data_3OVB
# 
_entry.id   3OVB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OVB         
NDB   NA0761       
RCSB  RCSB061618   
WWPDB D_1000061618 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3OUY . unspecified 
PDB 3OV7 . unspecified 
PDB 3OVA . unspecified 
PDB 3OVS . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3OVB 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pan, B.C.'    1 
'Xiong, Y.'    2 
'Steitz, T.A.' 3 
# 
_citation.id                        primary 
_citation.title                     'How the CCA-Adding Enzyme Selects Adenine over Cytosine at Position 76 of tRNA.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            330 
_citation.page_first                937 
_citation.page_last                 940 
_citation.year                      2010 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21071662 
_citation.pdbx_database_id_DOI      10.1126/science.1194985 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pan, B.'      1 
primary 'Xiong, Y.'    2 
primary 'Steitz, T.A.' 3 
# 
_cell.entry_id           3OVB 
_cell.length_a           110.978 
_cell.length_b           215.826 
_cell.length_c           58.390 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3OVB 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'CCA-Adding Enzyme'         51906.691 2   '2.7.7.25, 2.7.7.21' ? ? ? 
2 polymer     syn 'RNA (35-MER)'              11166.653 2   ?                    ? ? ? 
3 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181   3   ?                    ? ? ? 
4 non-polymer syn 'SULFATE ION'               96.063    2   ?                    ? ? ? 
5 non-polymer syn 1,2-ETHANEDIOL              62.068    5   ?                    ? ? ? 
6 non-polymer syn 'MAGNESIUM ION'             24.305    2   ?                    ? ? ? 
7 non-polymer syn 'PYROPHOSPHATE 2-'          175.959   2   ?                    ? ? ? 
8 water       nat water                       18.015    475 ?                    ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
2 'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDCCCQ
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDCCCQ
;
A,B ? 
2 polyribonucleotide no no GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACCA GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACCA C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   GLU n 
1 5   GLU n 
1 6   ILE n 
1 7   LEU n 
1 8   GLU n 
1 9   LYS n 
1 10  ALA n 
1 11  LEU n 
1 12  GLU n 
1 13  LEU n 
1 14  VAL n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  GLU n 
1 19  GLU n 
1 20  GLU n 
1 21  VAL n 
1 22  ARG n 
1 23  LYS n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ALA n 
1 28  GLU n 
1 29  GLU n 
1 30  GLU n 
1 31  LEU n 
1 32  ARG n 
1 33  ARG n 
1 34  ARG n 
1 35  LEU n 
1 36  ASP n 
1 37  GLU n 
1 38  LEU n 
1 39  GLY n 
1 40  VAL n 
1 41  GLU n 
1 42  TYR n 
1 43  VAL n 
1 44  PHE n 
1 45  VAL n 
1 46  GLY n 
1 47  SER n 
1 48  TYR n 
1 49  ALA n 
1 50  ARG n 
1 51  ASN n 
1 52  THR n 
1 53  TRP n 
1 54  LEU n 
1 55  LYS n 
1 56  GLY n 
1 57  SER n 
1 58  LEU n 
1 59  GLU n 
1 60  ILE n 
1 61  ASP n 
1 62  VAL n 
1 63  PHE n 
1 64  LEU n 
1 65  LEU n 
1 66  PHE n 
1 67  PRO n 
1 68  GLU n 
1 69  GLU n 
1 70  PHE n 
1 71  SER n 
1 72  LYS n 
1 73  GLU n 
1 74  GLU n 
1 75  LEU n 
1 76  ARG n 
1 77  GLU n 
1 78  ARG n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ILE n 
1 83  GLY n 
1 84  LYS n 
1 85  ALA n 
1 86  VAL n 
1 87  LEU n 
1 88  ASP n 
1 89  SER n 
1 90  TYR n 
1 91  GLU n 
1 92  ILE n 
1 93  ARG n 
1 94  TYR n 
1 95  ALA n 
1 96  GLU n 
1 97  HIS n 
1 98  PRO n 
1 99  TYR n 
1 100 VAL n 
1 101 HIS n 
1 102 GLY n 
1 103 VAL n 
1 104 VAL n 
1 105 LYS n 
1 106 GLY n 
1 107 VAL n 
1 108 GLU n 
1 109 VAL n 
1 110 ASP n 
1 111 VAL n 
1 112 VAL n 
1 113 PRO n 
1 114 CYS n 
1 115 TYR n 
1 116 LYS n 
1 117 LEU n 
1 118 LYS n 
1 119 GLU n 
1 120 PRO n 
1 121 LYS n 
1 122 ASN n 
1 123 ILE n 
1 124 LYS n 
1 125 SER n 
1 126 ALA n 
1 127 VAL n 
1 128 ASP n 
1 129 ARG n 
1 130 THR n 
1 131 PRO n 
1 132 PHE n 
1 133 HIS n 
1 134 HIS n 
1 135 LYS n 
1 136 TRP n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 ARG n 
1 141 ILE n 
1 142 LYS n 
1 143 GLY n 
1 144 LYS n 
1 145 GLU n 
1 146 ASN n 
1 147 GLU n 
1 148 VAL n 
1 149 ARG n 
1 150 LEU n 
1 151 LEU n 
1 152 LYS n 
1 153 GLY n 
1 154 PHE n 
1 155 LEU n 
1 156 LYS n 
1 157 ALA n 
1 158 ASN n 
1 159 GLY n 
1 160 ILE n 
1 161 TYR n 
1 162 GLY n 
1 163 ALA n 
1 164 GLU n 
1 165 TYR n 
1 166 LYS n 
1 167 VAL n 
1 168 ARG n 
1 169 GLY n 
1 170 PHE n 
1 171 SER n 
1 172 GLY n 
1 173 TYR n 
1 174 LEU n 
1 175 CYS n 
1 176 GLU n 
1 177 LEU n 
1 178 LEU n 
1 179 ILE n 
1 180 VAL n 
1 181 PHE n 
1 182 TYR n 
1 183 GLY n 
1 184 SER n 
1 185 PHE n 
1 186 LEU n 
1 187 GLU n 
1 188 THR n 
1 189 VAL n 
1 190 LYS n 
1 191 ASN n 
1 192 ALA n 
1 193 ARG n 
1 194 ARG n 
1 195 TRP n 
1 196 THR n 
1 197 ARG n 
1 198 ARG n 
1 199 THR n 
1 200 VAL n 
1 201 ILE n 
1 202 ASP n 
1 203 VAL n 
1 204 ALA n 
1 205 LYS n 
1 206 GLY n 
1 207 GLU n 
1 208 VAL n 
1 209 ARG n 
1 210 LYS n 
1 211 GLY n 
1 212 GLU n 
1 213 GLU n 
1 214 PHE n 
1 215 PHE n 
1 216 VAL n 
1 217 VAL n 
1 218 ASP n 
1 219 PRO n 
1 220 VAL n 
1 221 ASP n 
1 222 GLU n 
1 223 LYS n 
1 224 ARG n 
1 225 ASN n 
1 226 VAL n 
1 227 ALA n 
1 228 ALA n 
1 229 ASN n 
1 230 LEU n 
1 231 SER n 
1 232 LEU n 
1 233 ASP n 
1 234 ASN n 
1 235 LEU n 
1 236 ALA n 
1 237 ARG n 
1 238 PHE n 
1 239 VAL n 
1 240 HIS n 
1 241 LEU n 
1 242 CYS n 
1 243 ARG n 
1 244 GLU n 
1 245 PHE n 
1 246 MET n 
1 247 GLU n 
1 248 ALA n 
1 249 PRO n 
1 250 SER n 
1 251 LEU n 
1 252 GLY n 
1 253 PHE n 
1 254 PHE n 
1 255 LYS n 
1 256 PRO n 
1 257 LYS n 
1 258 HIS n 
1 259 PRO n 
1 260 LEU n 
1 261 GLU n 
1 262 ILE n 
1 263 GLU n 
1 264 PRO n 
1 265 GLU n 
1 266 ARG n 
1 267 LEU n 
1 268 ARG n 
1 269 LYS n 
1 270 ILE n 
1 271 VAL n 
1 272 GLU n 
1 273 GLU n 
1 274 ARG n 
1 275 GLY n 
1 276 THR n 
1 277 ALA n 
1 278 VAL n 
1 279 PHE n 
1 280 ALA n 
1 281 VAL n 
1 282 LYS n 
1 283 PHE n 
1 284 ARG n 
1 285 LYS n 
1 286 PRO n 
1 287 ASP n 
1 288 ILE n 
1 289 VAL n 
1 290 ASP n 
1 291 ASP n 
1 292 ASN n 
1 293 LEU n 
1 294 TYR n 
1 295 PRO n 
1 296 GLN n 
1 297 LEU n 
1 298 GLU n 
1 299 ARG n 
1 300 ALA n 
1 301 SER n 
1 302 ARG n 
1 303 LYS n 
1 304 ILE n 
1 305 PHE n 
1 306 GLU n 
1 307 PHE n 
1 308 LEU n 
1 309 GLU n 
1 310 ARG n 
1 311 GLU n 
1 312 ASN n 
1 313 PHE n 
1 314 MET n 
1 315 PRO n 
1 316 LEU n 
1 317 ARG n 
1 318 SER n 
1 319 ALA n 
1 320 PHE n 
1 321 LYS n 
1 322 ALA n 
1 323 SER n 
1 324 GLU n 
1 325 GLU n 
1 326 PHE n 
1 327 CYS n 
1 328 TYR n 
1 329 LEU n 
1 330 LEU n 
1 331 PHE n 
1 332 GLU n 
1 333 CYS n 
1 334 GLN n 
1 335 ILE n 
1 336 LYS n 
1 337 GLU n 
1 338 ILE n 
1 339 SER n 
1 340 ARG n 
1 341 VAL n 
1 342 PHE n 
1 343 ARG n 
1 344 ARG n 
1 345 MET n 
1 346 GLY n 
1 347 PRO n 
1 348 GLN n 
1 349 PHE n 
1 350 GLU n 
1 351 ASP n 
1 352 GLU n 
1 353 ARG n 
1 354 ASN n 
1 355 VAL n 
1 356 LYS n 
1 357 LYS n 
1 358 PHE n 
1 359 LEU n 
1 360 SER n 
1 361 ARG n 
1 362 ASN n 
1 363 ARG n 
1 364 ALA n 
1 365 PHE n 
1 366 ARG n 
1 367 PRO n 
1 368 PHE n 
1 369 ILE n 
1 370 GLU n 
1 371 ASN n 
1 372 GLY n 
1 373 ARG n 
1 374 TRP n 
1 375 TRP n 
1 376 ALA n 
1 377 PHE n 
1 378 GLU n 
1 379 MET n 
1 380 ARG n 
1 381 LYS n 
1 382 PHE n 
1 383 THR n 
1 384 THR n 
1 385 PRO n 
1 386 GLU n 
1 387 GLU n 
1 388 GLY n 
1 389 VAL n 
1 390 ARG n 
1 391 SER n 
1 392 TYR n 
1 393 ALA n 
1 394 SER n 
1 395 THR n 
1 396 HIS n 
1 397 TRP n 
1 398 HIS n 
1 399 THR n 
1 400 LEU n 
1 401 GLY n 
1 402 LYS n 
1 403 ASN n 
1 404 VAL n 
1 405 GLY n 
1 406 GLU n 
1 407 SER n 
1 408 ILE n 
1 409 ARG n 
1 410 GLU n 
1 411 TYR n 
1 412 PHE n 
1 413 GLU n 
1 414 ILE n 
1 415 ILE n 
1 416 SER n 
1 417 GLY n 
1 418 GLU n 
1 419 LYS n 
1 420 LEU n 
1 421 PHE n 
1 422 LYS n 
1 423 GLU n 
1 424 PRO n 
1 425 VAL n 
1 426 THR n 
1 427 ALA n 
1 428 GLU n 
1 429 LEU n 
1 430 CYS n 
1 431 GLU n 
1 432 MET n 
1 433 MET n 
1 434 GLY n 
1 435 VAL n 
1 436 LYS n 
1 437 ASP n 
1 438 CYS n 
1 439 CYS n 
1 440 CYS n 
1 441 GLN n 
2 1   G   n 
2 2   G   n 
2 3   A   n 
2 4   A   n 
2 5   G   n 
2 6   U   n 
2 7   A   n 
2 8   G   n 
2 9   A   n 
2 10  U   n 
2 11  G   n 
2 12  G   n 
2 13  U   n 
2 14  U   n 
2 15  C   n 
2 16  A   n 
2 17  A   n 
2 18  G   n 
2 19  U   n 
2 20  C   n 
2 21  C   n 
2 22  A   n 
2 23  U   n 
2 24  U   n 
2 25  U   n 
2 26  A   n 
2 27  C   n 
2 28  U   n 
2 29  U   n 
2 30  C   n 
2 31  C   n 
2 32  A   n 
2 33  C   n 
2 34  C   n 
2 35  A   n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Archaeoglobus fulgidus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      2234 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'chemical synthesis' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CCA_ARCFU 1 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 O28126 ? 
2 PDB 3OVB      2 ? ? 3OVB   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3OVB A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 1 3OVB B 1 ? 437 ? O28126 1 ? 437 ? 1 437 
3 2 3OVB C 1 ? 35  ? 3OVB   1 ? 35  ? 1 35  
4 2 3OVB D 1 ? 35  ? 3OVB   1 ? 35  ? 1 35  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3OVB CYS A 438 ? UNP O28126 ? ? 'EXPRESSION TAG' 438 1 
1 3OVB CYS A 439 ? UNP O28126 ? ? 'EXPRESSION TAG' 439 2 
1 3OVB CYS A 440 ? UNP O28126 ? ? 'EXPRESSION TAG' 440 3 
1 3OVB GLN A 441 ? UNP O28126 ? ? 'EXPRESSION TAG' 441 4 
2 3OVB CYS B 438 ? UNP O28126 ? ? 'EXPRESSION TAG' 438 5 
2 3OVB CYS B 439 ? UNP O28126 ? ? 'EXPRESSION TAG' 439 6 
2 3OVB CYS B 440 ? UNP O28126 ? ? 'EXPRESSION TAG' 440 7 
2 3OVB GLN B 441 ? UNP O28126 ? ? 'EXPRESSION TAG' 441 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                      ?                 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                     ?                 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE"  ?                 'C10 H16 N5 O13 P3' 507.181 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                     ?                 'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL               'ETHYLENE GLYCOL' 'C2 H6 O2'          62.068  
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ?                 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                      ?                 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                    ?                 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                        ?                 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ?                 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                      ?                 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                       ?                 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                   ?                 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ?                 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ?                 'C9 H11 N O2'       165.189 
POP non-polymer         . 'PYROPHOSPHATE 2-'           ?                 'H2 O7 P2 -2'       175.959 
PRO 'L-peptide linking' y PROLINE                      ?                 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                       ?                 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                ?                 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                    ?                 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                     ?                 'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ?                 'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                       ?                 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3OVB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.77 
_exptl_crystal.density_percent_sol   55.62 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;20% PEG 4000, 0.2 M tri-lithium citrate, 80 mM ammonium sulfate, 50 mM HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 300K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2007-10-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     3OVB 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   100973 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.098 
_reflns.pdbx_netI_over_sigmaI        15.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
1.95 2.02 81.3 ? ? ? ? ? ? ? ? ? ? ? 1 
2.02 2.10 98.6 ? ? ? ? ? ? ? ? ? ? ? 2 
2.10 2.20 99.8 ? ? ? ? ? ? ? ? ? ? ? 3 
2.20 2.31 99.8 ? ? ? ? ? ? ? ? ? ? ? 4 
2.31 2.46 99.7 ? ? ? ? ? ? ? ? ? ? ? 5 
2.46 2.65 99.8 ? ? ? ? ? ? ? ? ? ? ? 6 
# 
_refine.entry_id                                 3OVB 
_refine.ls_number_reflns_obs                     95658 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.63 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.21309 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21126 
_refine.ls_R_factor_R_free                       0.24775 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  5031 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.930 
_refine.B_iso_mean                               50.329 
_refine.aniso_B[1][1]                            -0.05 
_refine.aniso_B[2][2]                            0.03 
_refine.aniso_B[3][3]                            0.02 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.154 
_refine.overall_SU_ML                            0.125 
_refine.overall_SU_B                             8.261 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7285 
_refine_hist.pdbx_number_atoms_nucleic_acid   1476 
_refine_hist.pdbx_number_atoms_ligand         143 
_refine_hist.number_atoms_solvent             475 
_refine_hist.number_atoms_total               9379 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        46.63 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.010  0.022  ? 9283  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.353  2.192  ? 12850 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   5.463  5.000  ? 880   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   32.286 22.813 ? 391   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   17.656 15.000 ? 1397  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   19.440 15.000 ? 80    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.090  0.200  ? 1408  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 6488  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.192  0.200  ? 4192  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.298  0.200  ? 6125  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.184  0.200  ? 520   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.265  0.200  ? 53    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.394  0.200  ? 22    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.634  1.500  ? 4547  'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.988  2.000  ? 7093  'X-RAY DIFFRACTION' ? 
r_scbond_it              1.542  3.000  ? 5812  'X-RAY DIFFRACTION' ? 
r_scangle_it             2.438  4.500  ? 5757  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.953 
_refine_ls_shell.d_res_low                        2.003 
_refine_ls_shell.number_reflns_R_work             5760 
_refine_ls_shell.R_factor_R_work                  0.304 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.353 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             304 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3OVB 
_struct.title                     'How the CCA-adding Enzyme Selects Adenine over Cytosine in Position 76 of tRNA' 
_struct.pdbx_descriptor           'Protein (E.C.2.7.7.25, 2.7.7.21)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OVB 
_struct_keywords.pdbx_keywords   Transferase/RNA 
_struct_keywords.text            'Protein-RNA, Rossmann Fold, CCA-adding, tRNA, nucleotidyltransfer, Transferase-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 3 ? 
M N N 7 ? 
N N N 4 ? 
O N N 5 ? 
P N N 6 ? 
Q N N 7 ? 
R N N 3 ? 
S N N 8 ? 
T N N 8 ? 
U N N 8 ? 
V N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 2   ? ILE A 15  ? LYS A 2   ILE A 15  1 ? 14 
HELX_P HELX_P2  2  ASP A 17  ? GLY A 39  ? ASP A 17  GLY A 39  1 ? 23 
HELX_P HELX_P3  3  GLY A 46  ? ARG A 50  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  4  SER A 71  ? LEU A 87  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  5  ARG A 129 ? GLY A 139 ? ARG A 129 GLY A 139 1 ? 11 
HELX_P HELX_P6  6  LYS A 144 ? ASN A 158 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P7  7  SER A 171 ? GLY A 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P8  8  SER A 184 ? ARG A 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P9  9  SER A 231 ? ALA A 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P10 10 SER A 250 ? LYS A 255 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P11 11 GLU A 263 ? GLY A 275 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P12 12 VAL A 289 ? GLU A 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P13 13 ASP A 351 ? ARG A 361 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P14 14 THR A 384 ? HIS A 396 ? THR A 384 HIS A 396 1 ? 13 
HELX_P HELX_P15 15 TRP A 397 ? LEU A 400 ? TRP A 397 LEU A 400 5 ? 4  
HELX_P HELX_P16 16 GLY A 401 ? TYR A 411 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P17 17 GLY A 417 ? LYS A 422 ? GLY A 417 LYS A 422 1 ? 6  
HELX_P HELX_P18 18 VAL A 425 ? GLY A 434 ? VAL A 425 GLY A 434 1 ? 10 
HELX_P HELX_P19 19 LYS B 2   ? ALA B 10  ? LYS B 2   ALA B 10  1 ? 9  
HELX_P HELX_P20 20 ALA B 10  ? ILE B 15  ? ALA B 10  ILE B 15  1 ? 6  
HELX_P HELX_P21 21 ASP B 17  ? ASP B 36  ? ASP B 17  ASP B 36  1 ? 20 
HELX_P HELX_P22 22 GLY B 46  ? ASN B 51  ? GLY B 46  ASN B 51  1 ? 6  
HELX_P HELX_P23 23 SER B 71  ? LEU B 87  ? SER B 71  LEU B 87  1 ? 17 
HELX_P HELX_P24 24 ARG B 129 ? ILE B 141 ? ARG B 129 ILE B 141 1 ? 13 
HELX_P HELX_P25 25 LYS B 144 ? ASN B 158 ? LYS B 144 ASN B 158 1 ? 15 
HELX_P HELX_P26 26 SER B 171 ? GLY B 183 ? SER B 171 GLY B 183 1 ? 13 
HELX_P HELX_P27 27 SER B 184 ? ARG B 193 ? SER B 184 ARG B 193 1 ? 10 
HELX_P HELX_P28 28 SER B 231 ? ALA B 248 ? SER B 231 ALA B 248 1 ? 18 
HELX_P HELX_P29 29 SER B 250 ? PHE B 254 ? SER B 250 PHE B 254 5 ? 5  
HELX_P HELX_P30 30 GLU B 263 ? GLY B 275 ? GLU B 263 GLY B 275 1 ? 13 
HELX_P HELX_P31 31 VAL B 289 ? GLU B 311 ? VAL B 289 GLU B 311 1 ? 23 
HELX_P HELX_P32 32 ASP B 351 ? ARG B 361 ? ASP B 351 ARG B 361 1 ? 11 
HELX_P HELX_P33 33 THR B 384 ? HIS B 396 ? THR B 384 HIS B 396 1 ? 13 
HELX_P HELX_P34 34 TRP B 397 ? LEU B 400 ? TRP B 397 LEU B 400 5 ? 4  
HELX_P HELX_P35 35 GLY B 401 ? TYR B 411 ? GLY B 401 TYR B 411 1 ? 11 
HELX_P HELX_P36 36 GLY B 417 ? GLU B 423 ? GLY B 417 GLU B 423 1 ? 7  
HELX_P HELX_P37 37 VAL B 425 ? GLY B 434 ? VAL B 425 GLY B 434 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D A   35 OP1 A ? ? 1_555 P MG .  MG ? ? D A   35  B MG 902 1_555 ? ? ? ? ? ? ?                    2.390 ? 
metalc2  metalc ? ? L ATP .  O2B B ? ? 1_555 P MG .  MG ? ? B ATP 502 B MG 902 1_555 ? ? ? ? ? ? ?                    2.466 ? 
metalc3  metalc ? ? L ATP .  O3G B ? ? 1_555 P MG .  MG ? ? B ATP 502 B MG 902 1_555 ? ? ? ? ? ? ?                    2.747 ? 
metalc4  metalc ? ? E ATP .  O3G A ? ? 1_555 K MG .  MG ? ? A ATP 501 A MG 901 1_555 ? ? ? ? ? ? ?                    2.750 ? 
metalc5  metalc ? ? B ASP 61 OD1 ? ? ? 1_555 P MG .  MG ? ? B ASP 61  B MG 902 1_555 ? ? ? ? ? ? ?                    2.761 ? 
metalc6  metalc ? ? C A   35 OP1 B ? ? 1_555 K MG .  MG ? ? C A   35  A MG 901 1_555 ? ? ? ? ? ? ?                    2.814 ? 
metalc7  metalc ? ? A GLU 59 OE1 ? ? ? 1_555 K MG .  MG ? ? A GLU 59  A MG 901 1_555 ? ? ? ? ? ? ?                    2.890 ? 
metalc8  metalc ? ? L ATP .  O1A B ? ? 1_555 P MG .  MG ? ? B ATP 502 B MG 902 1_555 ? ? ? ? ? ? ?                    2.899 ? 
hydrog1  hydrog ? ? C G   1  N1  ? ? ? 1_555 C C  31 N3 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog2  hydrog ? ? C G   1  N2  ? ? ? 1_555 C C  31 O2 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog3  hydrog ? ? C G   1  O6  ? ? ? 1_555 C C  31 N4 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog4  hydrog ? ? C G   2  N1  ? ? ? 1_555 C C  30 N3 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog5  hydrog ? ? C G   2  N2  ? ? ? 1_555 C C  30 O2 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog6  hydrog ? ? C G   2  O6  ? ? ? 1_555 C C  30 N4 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog7  hydrog ? ? C A   3  N1  ? ? ? 1_555 C U  29 N3 ? ? C A   3   C U  29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog8  hydrog ? ? C A   3  N6  ? ? ? 1_555 C U  29 O4 ? ? C A   3   C U  29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog9  hydrog ? ? C A   4  N1  ? ? ? 1_555 C U  28 N3 ? ? C A   4   C U  28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog10 hydrog ? ? C A   4  N6  ? ? ? 1_555 C U  28 O4 ? ? C A   4   C U  28  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog11 hydrog ? ? C G   5  N1  ? ? ? 1_555 C C  27 N3 ? ? C G   5   C C  27  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog12 hydrog ? ? C U   6  N3  ? ? ? 1_555 C A  26 N1 ? ? C U   6   C A  26  1_555 ? ? ? ? ? ? 'U-A PAIR'           ?     ? 
hydrog13 hydrog ? ? C A   7  N1  ? ? ? 1_555 C U  25 N3 ? ? C A   7   C U  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog14 hydrog ? ? C A   7  N6  ? ? ? 1_555 C U  25 O4 ? ? C A   7   C U  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog15 hydrog ? ? C G   8  N1  ? ? ? 1_555 C U  24 O2 ? ? C G   8   C U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog16 hydrog ? ? C G   8  O6  ? ? ? 1_555 C U  24 N3 ? ? C G   8   C U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog17 hydrog ? ? C A   9  N1  ? ? ? 1_555 C U  23 N3 ? ? C A   9   C U  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog18 hydrog ? ? C A   9  N6  ? ? ? 1_555 C U  23 O4 ? ? C A   9   C U  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog19 hydrog ? ? C U   10 N3  ? ? ? 1_555 C A  22 N1 ? ? C U   10  C A  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog20 hydrog ? ? C U   10 O4  ? ? ? 1_555 C A  22 N6 ? ? C U   10  C A  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog21 hydrog ? ? C G   11 N1  ? ? ? 1_555 C C  21 N3 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog22 hydrog ? ? C G   11 N2  ? ? ? 1_555 C C  21 O2 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog23 hydrog ? ? C G   11 O6  ? ? ? 1_555 C C  21 N4 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog24 hydrog ? ? C G   12 N1  ? ? ? 1_555 C C  20 N3 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog25 hydrog ? ? C G   12 N2  ? ? ? 1_555 C C  20 O2 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog26 hydrog ? ? C G   12 O6  ? ? ? 1_555 C C  20 N4 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog27 hydrog ? ? C U   13 N3  ? ? ? 1_555 C A  17 N7 ? ? C U   13  C A  17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog28 hydrog ? ? C U   13 O2  ? ? ? 1_555 C A  17 N6 ? ? C U   13  C A  17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog29 hydrog ? ? D G   1  N1  ? ? ? 1_555 D C  31 N3 ? ? D G   1   D C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog30 hydrog ? ? D G   1  N2  ? ? ? 1_555 D C  31 O2 ? ? D G   1   D C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog31 hydrog ? ? D G   1  O6  ? ? ? 1_555 D C  31 N4 ? ? D G   1   D C  31  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog32 hydrog ? ? D G   2  N1  ? ? ? 1_555 D C  30 N3 ? ? D G   2   D C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog33 hydrog ? ? D G   2  N2  ? ? ? 1_555 D C  30 O2 ? ? D G   2   D C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog34 hydrog ? ? D G   2  O6  ? ? ? 1_555 D C  30 N4 ? ? D G   2   D C  30  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog35 hydrog ? ? D A   3  N1  ? ? ? 1_555 D U  29 N3 ? ? D A   3   D U  29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog36 hydrog ? ? D A   3  N6  ? ? ? 1_555 D U  29 O4 ? ? D A   3   D U  29  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog37 hydrog ? ? D A   4  N1  ? ? ? 1_555 D U  28 N3 ? ? D A   4   D U  28  1_555 ? ? ? ? ? ? 'A-U PAIR'           ?     ? 
hydrog38 hydrog ? ? D G   5  N1  ? ? ? 1_555 D C  27 N3 ? ? D G   5   D C  27  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog39 hydrog ? ? D U   6  N3  ? ? ? 1_555 D A  26 N1 ? ? D U   6   D A  26  1_555 ? ? ? ? ? ? 'U-A PAIR'           ?     ? 
hydrog40 hydrog ? ? D A   7  N1  ? ? ? 1_555 D U  25 N3 ? ? D A   7   D U  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog41 hydrog ? ? D A   7  N6  ? ? ? 1_555 D U  25 O4 ? ? D A   7   D U  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog42 hydrog ? ? D G   8  N1  ? ? ? 1_555 D U  24 O2 ? ? D G   8   D U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog43 hydrog ? ? D G   8  O6  ? ? ? 1_555 D U  24 N3 ? ? D G   8   D U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR         ?     ? 
hydrog44 hydrog ? ? D A   9  N1  ? ? ? 1_555 D U  23 N3 ? ? D A   9   D U  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog45 hydrog ? ? D A   9  N6  ? ? ? 1_555 D U  23 O4 ? ? D A   9   D U  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog46 hydrog ? ? D U   10 N3  ? ? ? 1_555 D A  22 N1 ? ? D U   10  D A  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog47 hydrog ? ? D U   10 O4  ? ? ? 1_555 D A  22 N6 ? ? D U   10  D A  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog48 hydrog ? ? D G   11 N1  ? ? ? 1_555 D C  21 N3 ? ? D G   11  D C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog49 hydrog ? ? D G   11 N2  ? ? ? 1_555 D C  21 O2 ? ? D G   11  D C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog50 hydrog ? ? D G   11 O6  ? ? ? 1_555 D C  21 N4 ? ? D G   11  D C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog51 hydrog ? ? D G   12 N1  ? ? ? 1_555 D C  20 N3 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog52 hydrog ? ? D G   12 N2  ? ? ? 1_555 D C  20 O2 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog53 hydrog ? ? D G   12 O6  ? ? ? 1_555 D C  20 N4 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 2 ? 
D ? 4 ? 
E ? 3 ? 
F ? 5 ? 
G ? 4 ? 
H ? 4 ? 
I ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 42  ? VAL A 45  ? TYR A 42  VAL A 45  
A 2 GLU A 59  ? PHE A 66  ? GLU A 59  PHE A 66  
A 3 VAL A 107 ? TYR A 115 ? VAL A 107 TYR A 115 
A 4 VAL A 100 ? VAL A 104 ? VAL A 100 VAL A 104 
A 5 SER A 89  ? GLU A 91  ? SER A 89  GLU A 91  
B 1 GLU A 207 ? LYS A 210 ? GLU A 207 LYS A 210 
B 2 THR A 199 ? ASP A 202 ? THR A 199 ASP A 202 
B 3 PHE A 215 ? ASP A 218 ? PHE A 215 ASP A 218 
B 4 ASP A 221 ? ASN A 225 ? ASP A 221 ASN A 225 
C 1 HIS A 258 ? PRO A 259 ? HIS A 258 PRO A 259 
C 2 CYS A 439 ? CYS A 440 ? CYS A 439 CYS A 440 
D 1 PRO A 315 ? ALA A 322 ? PRO A 315 ALA A 322 
D 2 PHE A 326 ? CYS A 333 ? PHE A 326 CYS A 333 
D 3 ALA A 277 ? ARG A 284 ? ALA A 277 ARG A 284 
D 4 GLU A 413 ? SER A 416 ? GLU A 413 SER A 416 
E 1 VAL A 341 ? GLN A 348 ? VAL A 341 GLN A 348 
E 2 ARG A 373 ? MET A 379 ? ARG A 373 MET A 379 
E 3 PHE A 368 ? GLU A 370 ? PHE A 368 GLU A 370 
F 1 TYR B 42  ? VAL B 45  ? TYR B 42  VAL B 45  
F 2 GLU B 59  ? PHE B 66  ? GLU B 59  PHE B 66  
F 3 VAL B 107 ? TYR B 115 ? VAL B 107 TYR B 115 
F 4 VAL B 100 ? VAL B 104 ? VAL B 100 VAL B 104 
F 5 SER B 89  ? GLU B 91  ? SER B 89  GLU B 91  
G 1 GLU B 207 ? LYS B 210 ? GLU B 207 LYS B 210 
G 2 THR B 199 ? ASP B 202 ? THR B 199 ASP B 202 
G 3 PHE B 215 ? ASP B 218 ? PHE B 215 ASP B 218 
G 4 ASP B 221 ? ASN B 225 ? ASP B 221 ASN B 225 
H 1 PRO B 315 ? ALA B 322 ? PRO B 315 ALA B 322 
H 2 PHE B 326 ? CYS B 333 ? PHE B 326 CYS B 333 
H 3 ALA B 277 ? ARG B 284 ? ALA B 277 ARG B 284 
H 4 GLU B 413 ? SER B 416 ? GLU B 413 SER B 416 
I 1 VAL B 341 ? GLN B 348 ? VAL B 341 GLN B 348 
I 2 ARG B 373 ? MET B 379 ? ARG B 373 MET B 379 
I 3 PHE B 368 ? GLU B 370 ? PHE B 368 GLU B 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 43  ? N VAL A 43  O PHE A 63  ? O PHE A 63  
A 2 3 N PHE A 66  ? N PHE A 66  O CYS A 114 ? O CYS A 114 
A 3 4 O VAL A 111 ? O VAL A 111 N VAL A 100 ? N VAL A 100 
A 4 5 O HIS A 101 ? O HIS A 101 N GLU A 91  ? N GLU A 91  
B 1 2 O GLU A 207 ? O GLU A 207 N ASP A 202 ? N ASP A 202 
B 2 3 N ILE A 201 ? N ILE A 201 O PHE A 215 ? O PHE A 215 
B 3 4 N ASP A 218 ? N ASP A 218 O ARG A 224 ? O ARG A 224 
C 1 2 N HIS A 258 ? N HIS A 258 O CYS A 440 ? O CYS A 440 
D 1 2 N LEU A 316 ? N LEU A 316 O GLU A 332 ? O GLU A 332 
D 2 3 O CYS A 327 ? O CYS A 327 N PHE A 283 ? N PHE A 283 
D 3 4 N LYS A 282 ? N LYS A 282 O GLU A 413 ? O GLU A 413 
E 1 2 N GLY A 346 ? N GLY A 346 O TRP A 374 ? O TRP A 374 
E 2 3 O ARG A 373 ? O ARG A 373 N GLU A 370 ? N GLU A 370 
F 1 2 N VAL B 43  ? N VAL B 43  O PHE B 63  ? O PHE B 63  
F 2 3 N LEU B 64  ? N LEU B 64  O VAL B 112 ? O VAL B 112 
F 3 4 O VAL B 111 ? O VAL B 111 N VAL B 100 ? N VAL B 100 
F 4 5 O HIS B 101 ? O HIS B 101 N GLU B 91  ? N GLU B 91  
G 1 2 O ARG B 209 ? O ARG B 209 N VAL B 200 ? N VAL B 200 
G 2 3 N THR B 199 ? N THR B 199 O PHE B 215 ? O PHE B 215 
G 3 4 N ASP B 218 ? N ASP B 218 O ARG B 224 ? O ARG B 224 
H 1 2 N LEU B 316 ? N LEU B 316 O GLU B 332 ? O GLU B 332 
H 2 3 O CYS B 327 ? O CYS B 327 N PHE B 283 ? N PHE B 283 
H 3 4 N LYS B 282 ? N LYS B 282 O GLU B 413 ? O GLU B 413 
I 1 2 N ARG B 344 ? N ARG B 344 O ALA B 376 ? O ALA B 376 
I 2 3 O ARG B 373 ? O ARG B 373 N GLU B 370 ? N GLU B 370 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE ATP A 501' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 701' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 801' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE EDO A 803' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 804' 
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE EDO A 805' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 901'  
AC8 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE ATP B 502' 
AC9 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE POP B 602' 
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 702' 
BC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO B 802' 
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 902'  
BC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE POP C 601' 
BC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ATP C 851' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 23 GLY A 46  ? GLY A 46  . ? 1_555 ? 
2   AC1 23 SER A 47  ? SER A 47  . ? 1_555 ? 
3   AC1 23 ARG A 50  ? ARG A 50  . ? 1_555 ? 
4   AC1 23 GLU A 59  ? GLU A 59  . ? 1_555 ? 
5   AC1 23 ASP A 61  ? ASP A 61  . ? 1_555 ? 
6   AC1 23 THR A 130 ? THR A 130 . ? 1_555 ? 
7   AC1 23 HIS A 133 ? HIS A 133 . ? 1_555 ? 
8   AC1 23 LYS A 152 ? LYS A 152 . ? 1_555 ? 
9   AC1 23 TYR A 161 ? TYR A 161 . ? 1_555 ? 
10  AC1 23 ALA A 163 ? ALA A 163 . ? 1_555 ? 
11  AC1 23 TYR A 173 ? TYR A 173 . ? 1_555 ? 
12  AC1 23 ARG A 224 ? ARG A 224 . ? 1_555 ? 
13  AC1 23 HOH S .   ? HOH A 448 . ? 1_555 ? 
14  AC1 23 HOH S .   ? HOH A 449 . ? 1_555 ? 
15  AC1 23 HOH S .   ? HOH A 455 . ? 1_555 ? 
16  AC1 23 HOH S .   ? HOH A 462 . ? 1_555 ? 
17  AC1 23 HOH S .   ? HOH A 505 . ? 1_555 ? 
18  AC1 23 HOH S .   ? HOH A 554 . ? 1_555 ? 
19  AC1 23 HOH S .   ? HOH A 565 . ? 1_555 ? 
20  AC1 23 MG  K .   ? MG  A 901 . ? 1_555 ? 
21  AC1 23 A   C 32  ? A   C 32  . ? 1_555 ? 
22  AC1 23 C   C 33  ? C   C 33  . ? 1_555 ? 
23  AC1 23 C   C 34  ? C   C 34  . ? 1_555 ? 
24  AC2 3  ARG A 299 ? ARG A 299 . ? 1_555 ? 
25  AC2 3  ARG A 302 ? ARG A 302 . ? 1_555 ? 
26  AC2 3  LYS A 303 ? LYS A 303 . ? 1_555 ? 
27  AC3 4  TRP A 397 ? TRP A 397 . ? 1_555 ? 
28  AC3 4  GLU A 406 ? GLU A 406 . ? 1_555 ? 
29  AC3 4  ARG A 409 ? ARG A 409 . ? 1_555 ? 
30  AC3 4  GLU A 410 ? GLU A 410 . ? 1_555 ? 
31  AC4 9  VAL A 40  ? VAL A 40  . ? 1_555 ? 
32  AC4 9  GLU A 41  ? GLU A 41  . ? 1_555 ? 
33  AC4 9  LEU A 64  ? LEU A 64  . ? 1_555 ? 
34  AC4 9  LEU A 65  ? LEU A 65  . ? 1_555 ? 
35  AC4 9  PHE A 66  ? PHE A 66  . ? 1_555 ? 
36  AC4 9  ASP A 437 ? ASP A 437 . ? 4_444 ? 
37  AC4 9  HOH S .   ? HOH A 481 . ? 4_444 ? 
38  AC4 9  HOH S .   ? HOH A 729 . ? 4_444 ? 
39  AC4 9  HOH S .   ? HOH A 734 . ? 1_555 ? 
40  AC5 5  ARG A 78  ? ARG A 78  . ? 4_544 ? 
41  AC5 5  LYS A 436 ? LYS A 436 . ? 1_555 ? 
42  AC5 5  ASP A 437 ? ASP A 437 . ? 1_555 ? 
43  AC5 5  ARG B 366 ? ARG B 366 . ? 1_555 ? 
44  AC5 5  EDO O .   ? EDO B 802 . ? 1_555 ? 
45  AC6 3  HIS A 398 ? HIS A 398 . ? 1_555 ? 
46  AC6 3  U   C 23  ? U   C 23  . ? 1_555 ? 
47  AC6 3  U   C 24  ? U   C 24  . ? 1_555 ? 
48  AC7 5  GLU A 59  ? GLU A 59  . ? 1_555 ? 
49  AC7 5  ASP A 61  ? ASP A 61  . ? 1_555 ? 
50  AC7 5  ATP E .   ? ATP A 501 . ? 1_555 ? 
51  AC7 5  A   C 35  ? A   C 35  . ? 1_555 ? 
52  AC7 5  POP Q .   ? POP C 601 . ? 1_555 ? 
53  AC8 14 GLY B 46  ? GLY B 46  . ? 1_555 ? 
54  AC8 14 SER B 47  ? SER B 47  . ? 1_555 ? 
55  AC8 14 ARG B 50  ? ARG B 50  . ? 1_555 ? 
56  AC8 14 ASP B 61  ? ASP B 61  . ? 1_555 ? 
57  AC8 14 THR B 130 ? THR B 130 . ? 1_555 ? 
58  AC8 14 HIS B 133 ? HIS B 133 . ? 1_555 ? 
59  AC8 14 LYS B 152 ? LYS B 152 . ? 1_555 ? 
60  AC8 14 TYR B 161 ? TYR B 161 . ? 1_555 ? 
61  AC8 14 TYR B 173 ? TYR B 173 . ? 1_555 ? 
62  AC8 14 ARG B 224 ? ARG B 224 . ? 1_555 ? 
63  AC8 14 MG  P .   ? MG  B 902 . ? 1_555 ? 
64  AC8 14 A   D 32  ? A   D 32  . ? 1_555 ? 
65  AC8 14 C   D 33  ? C   D 33  . ? 1_555 ? 
66  AC8 14 C   D 34  ? C   D 34  . ? 1_555 ? 
67  AC9 10 GLY B 46  ? GLY B 46  . ? 1_555 ? 
68  AC9 10 SER B 47  ? SER B 47  . ? 1_555 ? 
69  AC9 10 LYS B 152 ? LYS B 152 . ? 1_555 ? 
70  AC9 10 TYR B 161 ? TYR B 161 . ? 1_555 ? 
71  AC9 10 GLY B 172 ? GLY B 172 . ? 1_555 ? 
72  AC9 10 TYR B 173 ? TYR B 173 . ? 1_555 ? 
73  AC9 10 GLU B 176 ? GLU B 176 . ? 1_555 ? 
74  AC9 10 HOH T .   ? HOH B 511 . ? 1_555 ? 
75  AC9 10 MG  P .   ? MG  B 902 . ? 1_555 ? 
76  AC9 10 A   D 35  ? A   D 35  . ? 1_555 ? 
77  BC1 3  ARG B 299 ? ARG B 299 . ? 1_555 ? 
78  BC1 3  ARG B 302 ? ARG B 302 . ? 1_555 ? 
79  BC1 3  LYS B 303 ? LYS B 303 . ? 1_555 ? 
80  BC2 7  LYS A 257 ? LYS A 257 . ? 1_555 ? 
81  BC2 7  VAL A 435 ? VAL A 435 . ? 1_555 ? 
82  BC2 7  ASP A 437 ? ASP A 437 . ? 1_555 ? 
83  BC2 7  CYS A 438 ? CYS A 438 . ? 1_555 ? 
84  BC2 7  CYS A 439 ? CYS A 439 . ? 1_555 ? 
85  BC2 7  EDO I .   ? EDO A 804 . ? 1_555 ? 
86  BC2 7  ARG B 366 ? ARG B 366 . ? 1_555 ? 
87  BC3 5  GLU B 59  ? GLU B 59  . ? 1_555 ? 
88  BC3 5  ASP B 61  ? ASP B 61  . ? 1_555 ? 
89  BC3 5  ATP L .   ? ATP B 502 . ? 1_555 ? 
90  BC3 5  POP M .   ? POP B 602 . ? 1_555 ? 
91  BC3 5  A   D 35  ? A   D 35  . ? 1_555 ? 
92  BC4 12 GLY A 46  ? GLY A 46  . ? 1_555 ? 
93  BC4 12 SER A 47  ? SER A 47  . ? 1_555 ? 
94  BC4 12 ASP A 61  ? ASP A 61  . ? 1_555 ? 
95  BC4 12 TYR A 161 ? TYR A 161 . ? 1_555 ? 
96  BC4 12 GLY A 172 ? GLY A 172 . ? 1_555 ? 
97  BC4 12 HOH S .   ? HOH A 448 . ? 1_555 ? 
98  BC4 12 HOH S .   ? HOH A 554 . ? 1_555 ? 
99  BC4 12 HOH S .   ? HOH A 565 . ? 1_555 ? 
100 BC4 12 MG  K .   ? MG  A 901 . ? 1_555 ? 
101 BC4 12 A   C 35  ? A   C 35  . ? 1_555 ? 
102 BC4 12 HOH U .   ? HOH C 478 . ? 1_555 ? 
103 BC4 12 HOH U .   ? HOH C 485 . ? 1_555 ? 
104 BC5 4  U   C 14  ? U   C 14  . ? 1_555 ? 
105 BC5 4  A   C 16  ? A   C 16  . ? 1_555 ? 
106 BC5 4  A   C 17  ? A   C 17  . ? 1_555 ? 
107 BC5 4  U   C 19  ? U   C 19  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3OVB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3OVB 
_atom_sites.fract_transf_matrix[1][1]   0.009011 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004633 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017126 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 37.880  -54.081 -45.233 1.00 69.73  ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 38.343  -52.802 -44.611 1.00 69.48  ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 37.660  -51.564 -45.204 1.00 67.56  ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 37.461  -50.572 -44.496 1.00 66.85  ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 39.868  -52.667 -44.697 1.00 71.01  ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 40.640  -53.697 -43.864 1.00 73.06  ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 42.443  -53.505 -43.913 1.00 75.76  ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 42.688  -52.142 -42.758 1.00 75.92  ? 1   MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? 37.313  -51.608 -46.491 1.00 66.66  ? 2   LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? 36.501  -50.536 -47.077 1.00 64.75  ? 2   LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? 35.013  -50.808 -46.831 1.00 62.01  ? 2   LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? 34.616  -51.969 -46.689 1.00 61.42  ? 2   LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? 36.790  -50.350 -48.572 1.00 66.06  ? 2   LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? 36.319  -48.991 -49.129 1.00 66.61  ? 2   LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? 36.689  -47.836 -48.187 1.00 67.48  ? 2   LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? 35.806  -46.617 -48.389 1.00 66.59  ? 2   LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? 35.629  -45.891 -47.100 1.00 65.01  ? 2   LYS A NZ    1 
ATOM   18   N  N     . VAL A 1 3   ? 34.207  -49.743 -46.786 1.00 59.78  ? 3   VAL A N     1 
ATOM   19   C  CA    . VAL A 1 3   ? 32.769  -49.842 -46.462 1.00 57.18  ? 3   VAL A CA    1 
ATOM   20   C  C     . VAL A 1 3   ? 32.072  -51.045 -47.079 1.00 56.48  ? 3   VAL A C     1 
ATOM   21   O  O     . VAL A 1 3   ? 31.362  -51.761 -46.388 1.00 55.70  ? 3   VAL A O     1 
ATOM   22   C  CB    . VAL A 1 3   ? 31.940  -48.575 -46.835 1.00 56.55  ? 3   VAL A CB    1 
ATOM   23   C  CG1   . VAL A 1 3   ? 31.568  -47.775 -45.600 1.00 55.60  ? 3   VAL A CG1   1 
ATOM   24   C  CG2   . VAL A 1 3   ? 32.630  -47.722 -47.874 1.00 56.99  ? 3   VAL A CG2   1 
ATOM   25   N  N     . GLU A 1 4   ? 32.283  -51.264 -48.374 1.00 56.46  ? 4   GLU A N     1 
ATOM   26   C  CA    . GLU A 1 4   ? 31.601  -52.333 -49.103 1.00 55.81  ? 4   GLU A CA    1 
ATOM   27   C  C     . GLU A 1 4   ? 31.818  -53.709 -48.465 1.00 54.76  ? 4   GLU A C     1 
ATOM   28   O  O     . GLU A 1 4   ? 30.871  -54.494 -48.357 1.00 53.91  ? 4   GLU A O     1 
ATOM   29   C  CB    . GLU A 1 4   ? 32.003  -52.342 -50.585 1.00 57.74  ? 4   GLU A CB    1 
ATOM   30   C  CG    . GLU A 1 4   ? 31.988  -50.953 -51.260 1.00 60.12  ? 4   GLU A CG    1 
ATOM   31   C  CD    . GLU A 1 4   ? 33.283  -50.147 -51.035 1.00 63.56  ? 4   GLU A CD    1 
ATOM   32   O  OE1   . GLU A 1 4   ? 34.392  -50.741 -51.066 1.00 66.73  ? 4   GLU A OE1   1 
ATOM   33   O  OE2   . GLU A 1 4   ? 33.188  -48.912 -50.839 1.00 64.61  ? 4   GLU A OE2   1 
ATOM   34   N  N     . GLU A 1 5   ? 33.050  -53.981 -48.025 1.00 53.94  ? 5   GLU A N     1 
ATOM   35   C  CA    . GLU A 1 5   ? 33.380  -55.241 -47.350 1.00 53.09  ? 5   GLU A CA    1 
ATOM   36   C  C     . GLU A 1 5   ? 32.874  -55.289 -45.903 1.00 50.19  ? 5   GLU A C     1 
ATOM   37   O  O     . GLU A 1 5   ? 32.566  -56.371 -45.392 1.00 49.71  ? 5   GLU A O     1 
ATOM   38   C  CB    . GLU A 1 5   ? 34.887  -55.499 -47.366 1.00 54.34  ? 5   GLU A CB    1 
ATOM   39   C  CG    . GLU A 1 5   ? 35.477  -55.830 -48.733 1.00 57.12  ? 5   GLU A CG    1 
ATOM   40   C  CD    . GLU A 1 5   ? 37.010  -55.777 -48.749 1.00 58.68  ? 5   GLU A CD    1 
ATOM   41   O  OE1   . GLU A 1 5   ? 37.615  -55.367 -47.724 1.00 59.02  ? 5   GLU A OE1   1 
ATOM   42   O  OE2   . GLU A 1 5   ? 37.609  -56.139 -49.796 1.00 61.76  ? 5   GLU A OE2   1 
ATOM   43   N  N     . ILE A 1 6   ? 32.841  -54.130 -45.243 1.00 47.49  ? 6   ILE A N     1 
ATOM   44   C  CA    . ILE A 1 6   ? 32.179  -53.986 -43.943 1.00 45.15  ? 6   ILE A CA    1 
ATOM   45   C  C     . ILE A 1 6   ? 30.697  -54.369 -44.094 1.00 43.23  ? 6   ILE A C     1 
ATOM   46   O  O     . ILE A 1 6   ? 30.185  -55.201 -43.352 1.00 42.65  ? 6   ILE A O     1 
ATOM   47   C  CB    . ILE A 1 6   ? 32.256  -52.522 -43.383 1.00 44.42  ? 6   ILE A CB    1 
ATOM   48   C  CG1   . ILE A 1 6   ? 33.693  -51.963 -43.379 1.00 45.42  ? 6   ILE A CG1   1 
ATOM   49   C  CG2   . ILE A 1 6   ? 31.550  -52.408 -42.016 1.00 42.81  ? 6   ILE A CG2   1 
ATOM   50   C  CD1   . ILE A 1 6   ? 34.581  -52.461 -42.291 1.00 45.82  ? 6   ILE A CD1   1 
ATOM   51   N  N     . LEU A 1 7   ? 30.026  -53.759 -45.068 1.00 41.85  ? 7   LEU A N     1 
ATOM   52   C  CA    . LEU A 1 7   ? 28.595  -53.980 -45.268 1.00 40.56  ? 7   LEU A CA    1 
ATOM   53   C  C     . LEU A 1 7   ? 28.256  -55.423 -45.650 1.00 41.32  ? 7   LEU A C     1 
ATOM   54   O  O     . LEU A 1 7   ? 27.214  -55.936 -45.249 1.00 40.95  ? 7   LEU A O     1 
ATOM   55   C  CB    . LEU A 1 7   ? 28.021  -52.982 -46.272 1.00 39.71  ? 7   LEU A CB    1 
ATOM   56   C  CG    . LEU A 1 7   ? 28.131  -51.500 -45.879 1.00 37.54  ? 7   LEU A CG    1 
ATOM   57   C  CD1   . LEU A 1 7   ? 27.557  -50.598 -46.952 1.00 35.77  ? 7   LEU A CD1   1 
ATOM   58   C  CD2   . LEU A 1 7   ? 27.499  -51.186 -44.536 1.00 35.36  ? 7   LEU A CD2   1 
ATOM   59   N  N     . GLU A 1 8   ? 29.146  -56.071 -46.403 1.00 42.75  ? 8   GLU A N     1 
ATOM   60   C  CA    . GLU A 1 8   ? 29.050  -57.499 -46.689 1.00 43.88  ? 8   GLU A CA    1 
ATOM   61   C  C     . GLU A 1 8   ? 29.025  -58.358 -45.430 1.00 43.18  ? 8   GLU A C     1 
ATOM   62   O  O     . GLU A 1 8   ? 28.195  -59.265 -45.315 1.00 42.92  ? 8   GLU A O     1 
ATOM   63   C  CB    . GLU A 1 8   ? 30.229  -57.949 -47.547 1.00 46.14  ? 8   GLU A CB    1 
ATOM   64   C  CG    . GLU A 1 8   ? 30.039  -57.748 -49.029 1.00 49.22  ? 8   GLU A CG    1 
ATOM   65   C  CD    . GLU A 1 8   ? 31.155  -58.388 -49.846 1.00 54.92  ? 8   GLU A CD    1 
ATOM   66   O  OE1   . GLU A 1 8   ? 32.047  -59.054 -49.250 1.00 57.21  ? 8   GLU A OE1   1 
ATOM   67   O  OE2   . GLU A 1 8   ? 31.132  -58.222 -51.087 1.00 57.03  ? 8   GLU A OE2   1 
ATOM   68   N  N     . LYS A 1 9   ? 29.940  -58.080 -44.503 1.00 42.62  ? 9   LYS A N     1 
ATOM   69   C  CA    . LYS A 1 9   ? 30.021  -58.824 -43.243 1.00 42.53  ? 9   LYS A CA    1 
ATOM   70   C  C     . LYS A 1 9   ? 28.887  -58.462 -42.270 1.00 40.89  ? 9   LYS A C     1 
ATOM   71   O  O     . LYS A 1 9   ? 28.427  -59.312 -41.503 1.00 40.74  ? 9   LYS A O     1 
ATOM   72   C  CB    . LYS A 1 9   ? 31.399  -58.668 -42.579 1.00 43.46  ? 9   LYS A CB    1 
ATOM   73   C  CG    . LYS A 1 9   ? 32.560  -59.228 -43.422 1.00 46.59  ? 9   LYS A CG    1 
ATOM   74   C  CD    . LYS A 1 9   ? 33.775  -59.610 -42.579 1.00 48.98  ? 9   LYS A CD    1 
ATOM   75   C  CE    . LYS A 1 9   ? 34.869  -60.266 -43.432 1.00 50.89  ? 9   LYS A CE    1 
ATOM   76   N  NZ    . LYS A 1 9   ? 34.443  -61.566 -44.064 1.00 53.38  ? 9   LYS A NZ    1 
ATOM   77   N  N     . ALA A 1 10  ? 28.445  -57.205 -42.307 1.00 39.52  ? 10  ALA A N     1 
ATOM   78   C  CA    . ALA A 1 10  ? 27.321  -56.745 -41.483 1.00 38.40  ? 10  ALA A CA    1 
ATOM   79   C  C     . ALA A 1 10  ? 26.016  -57.446 -41.871 1.00 37.81  ? 10  ALA A C     1 
ATOM   80   O  O     . ALA A 1 10  ? 25.162  -57.664 -41.018 1.00 37.19  ? 10  ALA A O     1 
ATOM   81   C  CB    . ALA A 1 10  ? 27.160  -55.227 -41.567 1.00 36.64  ? 10  ALA A CB    1 
ATOM   82   N  N     . LEU A 1 11  ? 25.882  -57.775 -43.159 1.00 38.36  ? 11  LEU A N     1 
ATOM   83   C  CA    . LEU A 1 11  ? 24.745  -58.533 -43.682 1.00 38.38  ? 11  LEU A CA    1 
ATOM   84   C  C     . LEU A 1 11  ? 24.582  -59.878 -43.000 1.00 38.35  ? 11  LEU A C     1 
ATOM   85   O  O     . LEU A 1 11  ? 23.461  -60.313 -42.748 1.00 37.95  ? 11  LEU A O     1 
ATOM   86   C  CB    . LEU A 1 11  ? 24.866  -58.739 -45.194 1.00 39.55  ? 11  LEU A CB    1 
ATOM   87   C  CG    . LEU A 1 11  ? 24.473  -57.580 -46.114 1.00 39.65  ? 11  LEU A CG    1 
ATOM   88   C  CD1   . LEU A 1 11  ? 24.589  -58.006 -47.568 1.00 40.77  ? 11  LEU A CD1   1 
ATOM   89   C  CD2   . LEU A 1 11  ? 23.075  -57.066 -45.838 1.00 38.81  ? 11  LEU A CD2   1 
ATOM   90   N  N     . GLU A 1 12  ? 25.704  -60.521 -42.689 1.00 38.76  ? 12  GLU A N     1 
ATOM   91   C  CA    . GLU A 1 12  ? 25.717  -61.772 -41.941 1.00 38.61  ? 12  GLU A CA    1 
ATOM   92   C  C     . GLU A 1 12  ? 25.121  -61.618 -40.537 1.00 37.85  ? 12  GLU A C     1 
ATOM   93   O  O     . GLU A 1 12  ? 24.643  -62.590 -39.947 1.00 38.53  ? 12  GLU A O     1 
ATOM   94   C  CB    . GLU A 1 12  ? 27.144  -62.345 -41.862 1.00 39.78  ? 12  GLU A CB    1 
ATOM   95   C  CG    . GLU A 1 12  ? 27.732  -62.793 -43.203 1.00 40.81  ? 12  GLU A CG    1 
ATOM   96   C  CD    . GLU A 1 12  ? 29.211  -63.172 -43.130 0.30 41.80  ? 12  GLU A CD    1 
ATOM   97   O  OE1   . GLU A 1 12  ? 29.702  -63.535 -42.039 0.30 41.33  ? 12  GLU A OE1   1 
ATOM   98   O  OE2   . GLU A 1 12  ? 29.883  -63.112 -44.180 0.30 42.00  ? 12  GLU A OE2   1 
ATOM   99   N  N     . LEU A 1 13  ? 25.151  -60.398 -40.000 1.00 36.90  ? 13  LEU A N     1 
ATOM   100  C  CA    . LEU A 1 13  ? 24.568  -60.131 -38.691 1.00 36.17  ? 13  LEU A CA    1 
ATOM   101  C  C     . LEU A 1 13  ? 23.066  -59.863 -38.745 1.00 35.08  ? 13  LEU A C     1 
ATOM   102  O  O     . LEU A 1 13  ? 22.357  -60.098 -37.762 1.00 35.32  ? 13  LEU A O     1 
ATOM   103  C  CB    . LEU A 1 13  ? 25.280  -58.949 -38.010 1.00 35.84  ? 13  LEU A CB    1 
ATOM   104  C  CG    . LEU A 1 13  ? 26.791  -59.120 -37.830 1.00 37.60  ? 13  LEU A CG    1 
ATOM   105  C  CD1   . LEU A 1 13  ? 27.388  -57.943 -37.078 1.00 37.89  ? 13  LEU A CD1   1 
ATOM   106  C  CD2   . LEU A 1 13  ? 27.085  -60.427 -37.112 1.00 40.03  ? 13  LEU A CD2   1 
ATOM   107  N  N     . VAL A 1 14  ? 22.583  -59.362 -39.879 1.00 34.86  ? 14  VAL A N     1 
ATOM   108  C  CA    . VAL A 1 14  ? 21.199  -58.835 -39.965 1.00 33.86  ? 14  VAL A CA    1 
ATOM   109  C  C     . VAL A 1 14  ? 20.215  -59.654 -40.809 1.00 34.21  ? 14  VAL A C     1 
ATOM   110  O  O     . VAL A 1 14  ? 19.005  -59.510 -40.652 1.00 33.76  ? 14  VAL A O     1 
ATOM   111  C  CB    . VAL A 1 14  ? 21.160  -57.344 -40.427 1.00 33.06  ? 14  VAL A CB    1 
ATOM   112  C  CG1   . VAL A 1 14  ? 21.868  -56.442 -39.428 1.00 31.92  ? 14  VAL A CG1   1 
ATOM   113  C  CG2   . VAL A 1 14  ? 21.747  -57.177 -41.841 1.00 33.37  ? 14  VAL A CG2   1 
ATOM   114  N  N     . ILE A 1 15  ? 20.726  -60.502 -41.701 1.00 35.01  ? 15  ILE A N     1 
ATOM   115  C  CA    . ILE A 1 15  ? 19.870  -61.326 -42.568 1.00 35.40  ? 15  ILE A CA    1 
ATOM   116  C  C     . ILE A 1 15  ? 19.487  -62.622 -41.847 1.00 35.55  ? 15  ILE A C     1 
ATOM   117  O  O     . ILE A 1 15  ? 20.362  -63.338 -41.382 1.00 36.59  ? 15  ILE A O     1 
ATOM   118  C  CB    . ILE A 1 15  ? 20.570  -61.653 -43.915 1.00 36.37  ? 15  ILE A CB    1 
ATOM   119  C  CG1   . ILE A 1 15  ? 20.789  -60.371 -44.734 1.00 36.27  ? 15  ILE A CG1   1 
ATOM   120  C  CG2   . ILE A 1 15  ? 19.779  -62.722 -44.735 1.00 36.15  ? 15  ILE A CG2   1 
ATOM   121  C  CD1   . ILE A 1 15  ? 21.611  -60.602 -46.027 1.00 37.24  ? 15  ILE A CD1   1 
ATOM   122  N  N     . PRO A 1 16  ? 18.176  -62.924 -41.737 1.00 37.82  ? 16  PRO A N     1 
ATOM   123  C  CA    . PRO A 1 16  ? 17.772  -64.179 -41.078 1.00 38.21  ? 16  PRO A CA    1 
ATOM   124  C  C     . PRO A 1 16  ? 18.332  -65.389 -41.830 1.00 40.11  ? 16  PRO A C     1 
ATOM   125  O  O     . PRO A 1 16  ? 18.327  -65.386 -43.070 1.00 39.61  ? 16  PRO A O     1 
ATOM   126  C  CB    . PRO A 1 16  ? 16.238  -64.157 -41.191 1.00 36.89  ? 16  PRO A CB    1 
ATOM   127  C  CG    . PRO A 1 16  ? 15.897  -62.734 -41.410 1.00 35.44  ? 16  PRO A CG    1 
ATOM   128  C  CD    . PRO A 1 16  ? 17.012  -62.159 -42.212 1.00 36.11  ? 16  PRO A CD    1 
ATOM   129  N  N     . ASP A 1 17  ? 18.818  -66.399 -41.106 1.00 42.06  ? 17  ASP A N     1 
ATOM   130  C  CA    . ASP A 1 17  ? 19.233  -67.639 -41.766 1.00 44.57  ? 17  ASP A CA    1 
ATOM   131  C  C     . ASP A 1 17  ? 18.022  -68.441 -42.225 1.00 44.47  ? 17  ASP A C     1 
ATOM   132  O  O     . ASP A 1 17  ? 16.898  -68.198 -41.759 1.00 42.83  ? 17  ASP A O     1 
ATOM   133  C  CB    . ASP A 1 17  ? 20.228  -68.479 -40.931 1.00 47.02  ? 17  ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 17  ? 19.679  -68.930 -39.569 1.00 48.99  ? 17  ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 17  ? 20.521  -69.093 -38.650 1.00 52.02  ? 17  ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 17  ? 18.450  -69.142 -39.399 1.00 49.94  ? 17  ASP A OD2   1 
ATOM   137  N  N     . GLU A 1 18  ? 18.241  -69.372 -43.149 1.00 45.63  ? 18  GLU A N     1 
ATOM   138  C  CA    . GLU A 1 18  ? 17.137  -70.130 -43.741 1.00 46.52  ? 18  GLU A CA    1 
ATOM   139  C  C     . GLU A 1 18  ? 16.225  -70.842 -42.736 1.00 45.98  ? 18  GLU A C     1 
ATOM   140  O  O     . GLU A 1 18  ? 15.014  -70.893 -42.937 1.00 45.17  ? 18  GLU A O     1 
ATOM   141  C  CB    . GLU A 1 18  ? 17.633  -71.113 -44.810 1.00 48.33  ? 18  GLU A CB    1 
ATOM   142  C  CG    . GLU A 1 18  ? 17.299  -70.689 -46.246 1.00 50.47  ? 18  GLU A CG    1 
ATOM   143  C  CD    . GLU A 1 18  ? 15.786  -70.636 -46.537 1.00 53.03  ? 18  GLU A CD    1 
ATOM   144  O  OE1   . GLU A 1 18  ? 15.008  -71.448 -45.975 1.00 53.13  ? 18  GLU A OE1   1 
ATOM   145  O  OE2   . GLU A 1 18  ? 15.375  -69.767 -47.342 1.00 54.59  ? 18  GLU A OE2   1 
ATOM   146  N  N     . GLU A 1 19  ? 16.810  -71.389 -41.674 1.00 46.74  ? 19  GLU A N     1 
ATOM   147  C  CA    . GLU A 1 19  ? 16.067  -72.106 -40.631 1.00 47.00  ? 19  GLU A CA    1 
ATOM   148  C  C     . GLU A 1 19  ? 14.997  -71.214 -39.996 1.00 44.19  ? 19  GLU A C     1 
ATOM   149  O  O     . GLU A 1 19  ? 13.851  -71.641 -39.801 1.00 42.82  ? 19  GLU A O     1 
ATOM   150  C  CB    . GLU A 1 19  ? 17.049  -72.645 -39.579 1.00 48.39  ? 19  GLU A CB    1 
ATOM   151  C  CG    . GLU A 1 19  ? 16.449  -73.182 -38.281 1.00 50.17  ? 19  GLU A CG    1 
ATOM   152  C  CD    . GLU A 1 19  ? 17.535  -73.538 -37.244 1.00 52.67  ? 19  GLU A CD    1 
ATOM   153  O  OE1   . GLU A 1 19  ? 18.594  -74.098 -37.633 1.00 56.86  ? 19  GLU A OE1   1 
ATOM   154  O  OE2   . GLU A 1 19  ? 17.331  -73.260 -36.037 1.00 56.08  ? 19  GLU A OE2   1 
ATOM   155  N  N     . GLU A 1 20  ? 15.377  -69.973 -39.695 1.00 42.35  ? 20  GLU A N     1 
ATOM   156  C  CA    . GLU A 1 20  ? 14.455  -68.996 -39.139 1.00 40.09  ? 20  GLU A CA    1 
ATOM   157  C  C     . GLU A 1 20  ? 13.382  -68.595 -40.172 1.00 38.34  ? 20  GLU A C     1 
ATOM   158  O  O     . GLU A 1 20  ? 12.200  -68.523 -39.840 1.00 36.87  ? 20  GLU A O     1 
ATOM   159  C  CB    . GLU A 1 20  ? 15.219  -67.780 -38.609 1.00 39.88  ? 20  GLU A CB    1 
ATOM   160  C  CG    . GLU A 1 20  ? 14.323  -66.742 -37.949 1.00 40.62  ? 20  GLU A CG    1 
ATOM   161  C  CD    . GLU A 1 20  ? 15.085  -65.736 -37.120 1.00 41.89  ? 20  GLU A CD    1 
ATOM   162  O  OE1   . GLU A 1 20  ? 14.616  -65.411 -36.005 1.00 45.29  ? 20  GLU A OE1   1 
ATOM   163  O  OE2   . GLU A 1 20  ? 16.146  -65.274 -37.572 1.00 43.22  ? 20  GLU A OE2   1 
ATOM   164  N  N     . VAL A 1 21  ? 13.805  -68.370 -41.418 1.00 37.62  ? 21  VAL A N     1 
ATOM   165  C  CA    . VAL A 1 21  ? 12.887  -68.135 -42.540 1.00 36.78  ? 21  VAL A CA    1 
ATOM   166  C  C     . VAL A 1 21  ? 11.844  -69.259 -42.674 1.00 36.70  ? 21  VAL A C     1 
ATOM   167  O  O     . VAL A 1 21  ? 10.647  -68.985 -42.814 1.00 35.38  ? 21  VAL A O     1 
ATOM   168  C  CB    . VAL A 1 21  ? 13.657  -67.941 -43.887 1.00 37.04  ? 21  VAL A CB    1 
ATOM   169  C  CG1   . VAL A 1 21  ? 12.684  -67.759 -45.053 1.00 36.72  ? 21  VAL A CG1   1 
ATOM   170  C  CG2   . VAL A 1 21  ? 14.604  -66.750 -43.797 1.00 36.98  ? 21  VAL A CG2   1 
ATOM   171  N  N     . ARG A 1 22  ? 12.305  -70.509 -42.597 1.00 37.95  ? 22  ARG A N     1 
ATOM   172  C  CA    . ARG A 1 22  ? 11.435  -71.694 -42.699 1.00 39.28  ? 22  ARG A CA    1 
ATOM   173  C  C     . ARG A 1 22  ? 10.411  -71.722 -41.565 1.00 37.55  ? 22  ARG A C     1 
ATOM   174  O  O     . ARG A 1 22  ? 9.220   -71.938 -41.794 1.00 35.56  ? 22  ARG A O     1 
ATOM   175  C  CB    . ARG A 1 22  ? 12.251  -72.988 -42.638 1.00 40.73  ? 22  ARG A CB    1 
ATOM   176  C  CG    . ARG A 1 22  ? 13.014  -73.369 -43.905 1.00 45.10  ? 22  ARG A CG    1 
ATOM   177  C  CD    . ARG A 1 22  ? 13.713  -74.730 -43.731 1.00 47.16  ? 22  ARG A CD    1 
ATOM   178  N  NE    . ARG A 1 22  ? 14.999  -74.786 -44.435 1.00 54.71  ? 22  ARG A NE    1 
ATOM   179  C  CZ    . ARG A 1 22  ? 15.450  -75.852 -45.099 1.00 59.41  ? 22  ARG A CZ    1 
ATOM   180  N  NH1   . ARG A 1 22  ? 14.718  -76.960 -45.168 1.00 61.94  ? 22  ARG A NH1   1 
ATOM   181  N  NH2   . ARG A 1 22  ? 16.633  -75.814 -45.709 1.00 61.72  ? 22  ARG A NH2   1 
ATOM   182  N  N     . LYS A 1 23  ? 10.912  -71.529 -40.345 1.00 37.45  ? 23  LYS A N     1 
ATOM   183  C  CA    . LYS A 1 23  ? 10.100  -71.462 -39.130 1.00 37.27  ? 23  LYS A CA    1 
ATOM   184  C  C     . LYS A 1 23  ? 9.016   -70.388 -39.248 1.00 34.96  ? 23  LYS A C     1 
ATOM   185  O  O     . LYS A 1 23  ? 7.857   -70.633 -38.912 1.00 34.25  ? 23  LYS A O     1 
ATOM   186  C  CB    . LYS A 1 23  ? 11.002  -71.210 -37.920 1.00 37.79  ? 23  LYS A CB    1 
ATOM   187  C  CG    . LYS A 1 23  ? 10.395  -71.631 -36.596 1.00 40.75  ? 23  LYS A CG    1 
ATOM   188  C  CD    . LYS A 1 23  ? 11.247  -71.183 -35.414 1.00 44.83  ? 23  LYS A CD    1 
ATOM   189  C  CE    . LYS A 1 23  ? 10.521  -71.435 -34.089 1.00 46.26  ? 23  LYS A CE    1 
ATOM   190  N  NZ    . LYS A 1 23  ? 11.152  -70.682 -32.957 1.00 47.04  ? 23  LYS A NZ    1 
ATOM   191  N  N     . GLY A 1 24  ? 9.404   -69.211 -39.741 1.00 34.13  ? 24  GLY A N     1 
ATOM   192  C  CA    . GLY A 1 24  ? 8.465   -68.151 -40.134 1.00 32.56  ? 24  GLY A CA    1 
ATOM   193  C  C     . GLY A 1 24  ? 7.392   -68.570 -41.137 1.00 32.88  ? 24  GLY A C     1 
ATOM   194  O  O     . GLY A 1 24  ? 6.200   -68.344 -40.892 1.00 30.79  ? 24  GLY A O     1 
ATOM   195  N  N     . ARG A 1 25  ? 7.811   -69.177 -42.257 1.00 33.65  ? 25  ARG A N     1 
ATOM   196  C  CA    . ARG A 1 25  ? 6.890   -69.635 -43.313 1.00 34.64  ? 25  ARG A CA    1 
ATOM   197  C  C     . ARG A 1 25  ? 5.861   -70.644 -42.791 1.00 34.56  ? 25  ARG A C     1 
ATOM   198  O  O     . ARG A 1 25  ? 4.686   -70.555 -43.116 1.00 33.78  ? 25  ARG A O     1 
ATOM   199  C  CB    . ARG A 1 25  ? 7.638   -70.276 -44.500 1.00 36.28  ? 25  ARG A CB    1 
ATOM   200  C  CG    . ARG A 1 25  ? 8.711   -69.420 -45.165 1.00 40.22  ? 25  ARG A CG    1 
ATOM   201  C  CD    . ARG A 1 25  ? 8.153   -68.332 -46.062 1.00 44.80  ? 25  ARG A CD    1 
ATOM   202  N  NE    . ARG A 1 25  ? 8.994   -67.141 -45.965 1.00 50.37  ? 25  ARG A NE    1 
ATOM   203  C  CZ    . ARG A 1 25  ? 8.832   -66.032 -46.681 1.00 52.18  ? 25  ARG A CZ    1 
ATOM   204  N  NH1   . ARG A 1 25  ? 7.850   -65.950 -47.573 1.00 53.81  ? 25  ARG A NH1   1 
ATOM   205  N  NH2   . ARG A 1 25  ? 9.659   -65.004 -46.505 1.00 52.71  ? 25  ARG A NH2   1 
ATOM   206  N  N     . GLU A 1 26  ? 6.316   -71.615 -42.006 1.00 35.04  ? 26  GLU A N     1 
ATOM   207  C  CA    . GLU A 1 26  ? 5.432   -72.641 -41.463 1.00 35.74  ? 26  GLU A CA    1 
ATOM   208  C  C     . GLU A 1 26  ? 4.397   -72.062 -40.478 1.00 33.83  ? 26  GLU A C     1 
ATOM   209  O  O     . GLU A 1 26  ? 3.232   -72.484 -40.469 1.00 33.18  ? 26  GLU A O     1 
ATOM   210  C  CB    . GLU A 1 26  ? 6.252   -73.751 -40.811 1.00 36.61  ? 26  GLU A CB    1 
ATOM   211  C  CG    . GLU A 1 26  ? 7.123   -74.538 -41.797 1.00 40.01  ? 26  GLU A CG    1 
ATOM   212  C  CD    . GLU A 1 26  ? 8.160   -75.414 -41.110 1.00 42.73  ? 26  GLU A CD    1 
ATOM   213  O  OE1   . GLU A 1 26  ? 8.137   -75.511 -39.854 1.00 47.69  ? 26  GLU A OE1   1 
ATOM   214  O  OE2   . GLU A 1 26  ? 9.008   -76.010 -41.824 1.00 48.08  ? 26  GLU A OE2   1 
ATOM   215  N  N     . ALA A 1 27  ? 4.810   -71.082 -39.676 1.00 32.43  ? 27  ALA A N     1 
ATOM   216  C  CA    . ALA A 1 27  ? 3.890   -70.424 -38.736 1.00 31.00  ? 27  ALA A CA    1 
ATOM   217  C  C     . ALA A 1 27  ? 2.869   -69.588 -39.494 1.00 29.97  ? 27  ALA A C     1 
ATOM   218  O  O     . ALA A 1 27  ? 1.689   -69.597 -39.150 1.00 28.94  ? 27  ALA A O     1 
ATOM   219  C  CB    . ALA A 1 27  ? 4.642   -69.567 -37.723 1.00 30.32  ? 27  ALA A CB    1 
ATOM   220  N  N     . GLU A 1 28  ? 3.327   -68.881 -40.527 1.00 29.60  ? 28  GLU A N     1 
ATOM   221  C  CA    . GLU A 1 28  ? 2.439   -68.201 -41.459 1.00 29.86  ? 28  GLU A CA    1 
ATOM   222  C  C     . GLU A 1 28  ? 1.395   -69.142 -42.089 1.00 30.55  ? 28  GLU A C     1 
ATOM   223  O  O     . GLU A 1 28  ? 0.215   -68.802 -42.147 1.00 30.21  ? 28  GLU A O     1 
ATOM   224  C  CB    . GLU A 1 28  ? 3.249   -67.514 -42.571 1.00 30.16  ? 28  GLU A CB    1 
ATOM   225  C  CG    . GLU A 1 28  ? 2.359   -66.971 -43.693 1.00 30.54  ? 28  GLU A CG    1 
ATOM   226  C  CD    . GLU A 1 28  ? 3.127   -66.435 -44.889 1.00 30.99  ? 28  GLU A CD    1 
ATOM   227  O  OE1   . GLU A 1 28  ? 4.376   -66.506 -44.916 1.00 30.55  ? 28  GLU A OE1   1 
ATOM   228  O  OE2   . GLU A 1 28  ? 2.445   -65.943 -45.811 1.00 33.86  ? 28  GLU A OE2   1 
ATOM   229  N  N     . GLU A 1 29  ? 1.825   -70.311 -42.570 1.00 31.65  ? 29  GLU A N     1 
ATOM   230  C  CA    . GLU A 1 29  ? 0.888   -71.280 -43.139 1.00 32.75  ? 29  GLU A CA    1 
ATOM   231  C  C     . GLU A 1 29  ? -0.190  -71.704 -42.150 1.00 31.45  ? 29  GLU A C     1 
ATOM   232  O  O     . GLU A 1 29  ? -1.364  -71.733 -42.500 1.00 30.44  ? 29  GLU A O     1 
ATOM   233  C  CB    . GLU A 1 29  ? 1.605   -72.533 -43.694 1.00 34.75  ? 29  GLU A CB    1 
ATOM   234  C  CG    . GLU A 1 29  ? 1.790   -72.525 -45.209 1.00 40.74  ? 29  GLU A CG    1 
ATOM   235  C  CD    . GLU A 1 29  ? 0.456   -72.490 -45.986 1.00 47.95  ? 29  GLU A CD    1 
ATOM   236  O  OE1   . GLU A 1 29  ? -0.308  -73.486 -45.903 1.00 51.67  ? 29  GLU A OE1   1 
ATOM   237  O  OE2   . GLU A 1 29  ? 0.170   -71.470 -46.683 1.00 49.22  ? 29  GLU A OE2   1 
ATOM   238  N  N     . GLU A 1 30  ? 0.218   -72.041 -40.928 1.00 31.01  ? 30  GLU A N     1 
ATOM   239  C  CA    . GLU A 1 30  ? -0.706  -72.451 -39.873 1.00 30.91  ? 30  GLU A CA    1 
ATOM   240  C  C     . GLU A 1 30  ? -1.679  -71.332 -39.468 1.00 30.36  ? 30  GLU A C     1 
ATOM   241  O  O     . GLU A 1 30  ? -2.848  -71.583 -39.198 1.00 30.22  ? 30  GLU A O     1 
ATOM   242  C  CB    . GLU A 1 30  ? 0.085   -72.938 -38.652 1.00 31.32  ? 30  GLU A CB    1 
ATOM   243  C  CG    . GLU A 1 30  ? -0.755  -73.506 -37.507 1.00 31.36  ? 30  GLU A CG    1 
ATOM   244  C  CD    . GLU A 1 30  ? -1.652  -74.651 -37.943 1.00 34.18  ? 30  GLU A CD    1 
ATOM   245  O  OE1   . GLU A 1 30  ? -1.299  -75.357 -38.917 1.00 35.07  ? 30  GLU A OE1   1 
ATOM   246  O  OE2   . GLU A 1 30  ? -2.710  -74.852 -37.310 1.00 36.01  ? 30  GLU A OE2   1 
ATOM   247  N  N     . LEU A 1 31  ? -1.174  -70.108 -39.410 1.00 29.66  ? 31  LEU A N     1 
ATOM   248  C  CA    . LEU A 1 31  ? -1.977  -68.926 -39.089 1.00 29.71  ? 31  LEU A CA    1 
ATOM   249  C  C     . LEU A 1 31  ? -3.060  -68.680 -40.145 1.00 29.76  ? 31  LEU A C     1 
ATOM   250  O  O     . LEU A 1 31  ? -4.230  -68.484 -39.801 1.00 29.51  ? 31  LEU A O     1 
ATOM   251  C  CB    . LEU A 1 31  ? -1.063  -67.721 -39.019 1.00 28.96  ? 31  LEU A CB    1 
ATOM   252  C  CG    . LEU A 1 31  ? -1.124  -66.608 -37.973 1.00 29.76  ? 31  LEU A CG    1 
ATOM   253  C  CD1   . LEU A 1 31  ? -1.989  -66.864 -36.729 1.00 29.48  ? 31  LEU A CD1   1 
ATOM   254  C  CD2   . LEU A 1 31  ? 0.328   -66.317 -37.592 1.00 30.52  ? 31  LEU A CD2   1 
ATOM   255  N  N     . ARG A 1 32  ? -2.668  -68.695 -41.420 1.00 30.07  ? 32  ARG A N     1 
ATOM   256  C  CA    . ARG A 1 32  ? -3.619  -68.565 -42.533 1.00 30.86  ? 32  ARG A CA    1 
ATOM   257  C  C     . ARG A 1 32  ? -4.708  -69.616 -42.437 1.00 30.49  ? 32  ARG A C     1 
ATOM   258  O  O     . ARG A 1 32  ? -5.872  -69.287 -42.579 1.00 29.81  ? 32  ARG A O     1 
ATOM   259  C  CB    . ARG A 1 32  ? -2.935  -68.681 -43.908 1.00 31.80  ? 32  ARG A CB    1 
ATOM   260  C  CG    . ARG A 1 32  ? -1.805  -67.701 -44.125 1.00 32.61  ? 32  ARG A CG    1 
ATOM   261  C  CD    . ARG A 1 32  ? -1.390  -67.600 -45.596 1.00 35.05  ? 32  ARG A CD    1 
ATOM   262  N  NE    . ARG A 1 32  ? -1.962  -66.370 -46.139 1.00 43.25  ? 32  ARG A NE    1 
ATOM   263  C  CZ    . ARG A 1 32  ? -1.318  -65.208 -46.209 1.00 43.66  ? 32  ARG A CZ    1 
ATOM   264  N  NH1   . ARG A 1 32  ? -0.057  -65.115 -45.824 1.00 45.00  ? 32  ARG A NH1   1 
ATOM   265  N  NH2   . ARG A 1 32  ? -1.943  -64.139 -46.679 1.00 45.25  ? 32  ARG A NH2   1 
ATOM   266  N  N     . ARG A 1 33  ? -4.325  -70.875 -42.220 1.00 30.65  ? 33  ARG A N     1 
ATOM   267  C  CA    . ARG A 1 33  ? -5.292  -71.966 -42.038 1.00 31.57  ? 33  ARG A CA    1 
ATOM   268  C  C     . ARG A 1 33  ? -6.320  -71.699 -40.947 1.00 30.51  ? 33  ARG A C     1 
ATOM   269  O  O     . ARG A 1 33  ? -7.521  -71.905 -41.152 1.00 30.23  ? 33  ARG A O     1 
ATOM   270  C  CB    . ARG A 1 33  ? -4.599  -73.278 -41.683 1.00 32.70  ? 33  ARG A CB    1 
ATOM   271  C  CG    . ARG A 1 33  ? -3.840  -73.943 -42.800 1.00 37.86  ? 33  ARG A CG    1 
ATOM   272  C  CD    . ARG A 1 33  ? -3.438  -75.352 -42.370 1.00 43.43  ? 33  ARG A CD    1 
ATOM   273  N  NE    . ARG A 1 33  ? -2.396  -75.907 -43.229 1.00 48.80  ? 33  ARG A NE    1 
ATOM   274  C  CZ    . ARG A 1 33  ? -1.088  -75.867 -42.973 1.00 50.38  ? 33  ARG A CZ    1 
ATOM   275  N  NH1   . ARG A 1 33  ? -0.613  -75.302 -41.861 1.00 48.98  ? 33  ARG A NH1   1 
ATOM   276  N  NH2   . ARG A 1 33  ? -0.247  -76.414 -43.841 1.00 53.95  ? 33  ARG A NH2   1 
ATOM   277  N  N     . ARG A 1 34  ? -5.831  -71.292 -39.777 1.00 29.23  ? 34  ARG A N     1 
ATOM   278  C  CA    . ARG A 1 34  ? -6.677  -71.070 -38.613 1.00 28.40  ? 34  ARG A CA    1 
ATOM   279  C  C     . ARG A 1 34  ? -7.595  -69.889 -38.842 1.00 27.92  ? 34  ARG A C     1 
ATOM   280  O  O     . ARG A 1 34  ? -8.762  -69.927 -38.454 1.00 27.89  ? 34  ARG A O     1 
ATOM   281  C  CB    . ARG A 1 34  ? -5.824  -70.848 -37.359 1.00 27.96  ? 34  ARG A CB    1 
ATOM   282  C  CG    . ARG A 1 34  ? -5.132  -72.106 -36.888 1.00 28.90  ? 34  ARG A CG    1 
ATOM   283  C  CD    . ARG A 1 34  ? -4.332  -71.850 -35.640 1.00 29.67  ? 34  ARG A CD    1 
ATOM   284  N  NE    . ARG A 1 34  ? -3.407  -72.945 -35.366 1.00 30.63  ? 34  ARG A NE    1 
ATOM   285  C  CZ    . ARG A 1 34  ? -2.547  -72.971 -34.345 1.00 32.64  ? 34  ARG A CZ    1 
ATOM   286  N  NH1   . ARG A 1 34  ? -2.470  -71.952 -33.482 1.00 29.85  ? 34  ARG A NH1   1 
ATOM   287  N  NH2   . ARG A 1 34  ? -1.741  -74.013 -34.193 1.00 32.44  ? 34  ARG A NH2   1 
ATOM   288  N  N     . LEU A 1 35  ? -7.045  -68.837 -39.451 1.00 26.87  ? 35  LEU A N     1 
ATOM   289  C  CA    . LEU A 1 35  ? -7.819  -67.669 -39.840 1.00 26.97  ? 35  LEU A CA    1 
ATOM   290  C  C     . LEU A 1 35  ? -8.810  -67.940 -40.992 1.00 27.24  ? 35  LEU A C     1 
ATOM   291  O  O     . LEU A 1 35  ? -9.944  -67.463 -40.939 1.00 26.18  ? 35  LEU A O     1 
ATOM   292  C  CB    . LEU A 1 35  ? -6.878  -66.510 -40.192 1.00 25.94  ? 35  LEU A CB    1 
ATOM   293  C  CG    . LEU A 1 35  ? -6.156  -65.854 -39.010 1.00 26.42  ? 35  LEU A CG    1 
ATOM   294  C  CD1   . LEU A 1 35  ? -4.919  -65.071 -39.495 1.00 26.63  ? 35  LEU A CD1   1 
ATOM   295  C  CD2   . LEU A 1 35  ? -7.101  -64.966 -38.178 1.00 26.58  ? 35  LEU A CD2   1 
ATOM   296  N  N     . ASP A 1 36  ? -8.393  -68.686 -42.022 1.00 27.94  ? 36  ASP A N     1 
ATOM   297  C  CA    . ASP A 1 36  ? -9.331  -69.074 -43.103 1.00 29.35  ? 36  ASP A CA    1 
ATOM   298  C  C     . ASP A 1 36  ? -10.496 -69.880 -42.531 1.00 29.37  ? 36  ASP A C     1 
ATOM   299  O  O     . ASP A 1 36  ? -11.647 -69.703 -42.942 1.00 29.38  ? 36  ASP A O     1 
ATOM   300  C  CB    . ASP A 1 36  ? -8.661  -69.901 -44.198 1.00 30.75  ? 36  ASP A CB    1 
ATOM   301  C  CG    . ASP A 1 36  ? -7.624  -69.122 -44.978 1.00 32.09  ? 36  ASP A CG    1 
ATOM   302  O  OD1   . ASP A 1 36  ? -7.593  -67.875 -44.913 1.00 34.16  ? 36  ASP A OD1   1 
ATOM   303  O  OD2   . ASP A 1 36  ? -6.817  -69.770 -45.652 1.00 35.38  ? 36  ASP A OD2   1 
ATOM   304  N  N     . GLU A 1 37  ? -10.193 -70.760 -41.579 1.00 29.70  ? 37  GLU A N     1 
ATOM   305  C  CA    . GLU A 1 37  ? -11.213 -71.616 -40.968 1.00 29.60  ? 37  GLU A CA    1 
ATOM   306  C  C     . GLU A 1 37  ? -12.279 -70.789 -40.254 1.00 29.16  ? 37  GLU A C     1 
ATOM   307  O  O     . GLU A 1 37  ? -13.463 -71.172 -40.247 1.00 29.50  ? 37  GLU A O     1 
ATOM   308  C  CB    . GLU A 1 37  ? -10.564 -72.609 -40.006 1.00 30.09  ? 37  GLU A CB    1 
ATOM   309  C  CG    . GLU A 1 37  ? -11.534 -73.514 -39.295 1.00 31.57  ? 37  GLU A CG    1 
ATOM   310  C  CD    . GLU A 1 37  ? -10.844 -74.469 -38.348 1.00 33.74  ? 37  GLU A CD    1 
ATOM   311  O  OE1   . GLU A 1 37  ? -11.067 -75.680 -38.494 1.00 34.09  ? 37  GLU A OE1   1 
ATOM   312  O  OE2   . GLU A 1 37  ? -10.076 -74.022 -37.469 1.00 34.55  ? 37  GLU A OE2   1 
ATOM   313  N  N     . LEU A 1 38  ? -11.862 -69.655 -39.683 1.00 27.40  ? 38  LEU A N     1 
ATOM   314  C  CA    . LEU A 1 38  ? -12.772 -68.700 -39.006 1.00 27.42  ? 38  LEU A CA    1 
ATOM   315  C  C     . LEU A 1 38  ? -13.602 -67.795 -39.926 1.00 27.32  ? 38  LEU A C     1 
ATOM   316  O  O     . LEU A 1 38  ? -14.556 -67.182 -39.465 1.00 27.11  ? 38  LEU A O     1 
ATOM   317  C  CB    . LEU A 1 38  ? -12.004 -67.804 -38.019 1.00 26.08  ? 38  LEU A CB    1 
ATOM   318  C  CG    . LEU A 1 38  ? -11.572 -68.445 -36.699 1.00 26.36  ? 38  LEU A CG    1 
ATOM   319  C  CD1   . LEU A 1 38  ? -10.559 -67.568 -35.936 1.00 24.48  ? 38  LEU A CD1   1 
ATOM   320  C  CD2   . LEU A 1 38  ? -12.766 -68.828 -35.808 1.00 25.42  ? 38  LEU A CD2   1 
ATOM   321  N  N     . GLY A 1 39  ? -13.249 -67.702 -41.206 1.00 28.20  ? 39  GLY A N     1 
ATOM   322  C  CA    . GLY A 1 39  ? -14.068 -66.953 -42.190 1.00 29.22  ? 39  GLY A CA    1 
ATOM   323  C  C     . GLY A 1 39  ? -13.935 -65.455 -41.972 1.00 29.28  ? 39  GLY A C     1 
ATOM   324  O  O     . GLY A 1 39  ? -14.744 -64.643 -42.423 1.00 30.03  ? 39  GLY A O     1 
ATOM   325  N  N     . VAL A 1 40  ? -12.857 -65.101 -41.300 1.00 28.58  ? 40  VAL A N     1 
ATOM   326  C  CA    . VAL A 1 40  ? -12.586 -63.757 -40.839 1.00 28.25  ? 40  VAL A CA    1 
ATOM   327  C  C     . VAL A 1 40  ? -11.714 -62.967 -41.835 1.00 28.14  ? 40  VAL A C     1 
ATOM   328  O  O     . VAL A 1 40  ? -10.994 -63.576 -42.633 1.00 28.47  ? 40  VAL A O     1 
ATOM   329  C  CB    . VAL A 1 40  ? -11.975 -63.945 -39.425 1.00 27.59  ? 40  VAL A CB    1 
ATOM   330  C  CG1   . VAL A 1 40  ? -10.589 -63.407 -39.279 1.00 26.94  ? 40  VAL A CG1   1 
ATOM   331  C  CG2   . VAL A 1 40  ? -12.998 -63.594 -38.331 1.00 27.67  ? 40  VAL A CG2   1 
ATOM   332  N  N     . GLU A 1 41  ? -11.808 -61.631 -41.820 1.00 28.30  ? 41  GLU A N     1 
ATOM   333  C  CA    . GLU A 1 41  ? -11.048 -60.782 -42.767 1.00 29.36  ? 41  GLU A CA    1 
ATOM   334  C  C     . GLU A 1 41  ? -9.745  -60.266 -42.144 1.00 28.00  ? 41  GLU A C     1 
ATOM   335  O  O     . GLU A 1 41  ? -9.757  -59.600 -41.121 1.00 26.37  ? 41  GLU A O     1 
ATOM   336  C  CB    . GLU A 1 41  ? -11.901 -59.630 -43.315 1.00 29.66  ? 41  GLU A CB    1 
ATOM   337  C  CG    . GLU A 1 41  ? -11.221 -58.833 -44.398 1.00 32.00  ? 41  GLU A CG    1 
ATOM   338  C  CD    . GLU A 1 41  ? -12.088 -57.748 -45.027 1.00 33.87  ? 41  GLU A CD    1 
ATOM   339  O  OE1   . GLU A 1 41  ? -13.255 -57.541 -44.601 1.00 38.50  ? 41  GLU A OE1   1 
ATOM   340  O  OE2   . GLU A 1 41  ? -11.586 -57.096 -45.970 1.00 38.95  ? 41  GLU A OE2   1 
ATOM   341  N  N     . TYR A 1 42  ? -8.624  -60.608 -42.771 1.00 27.74  ? 42  TYR A N     1 
ATOM   342  C  CA    . TYR A 1 42  ? -7.315  -60.322 -42.188 1.00 27.39  ? 42  TYR A CA    1 
ATOM   343  C  C     . TYR A 1 42  ? -6.285  -60.033 -43.280 1.00 27.33  ? 42  TYR A C     1 
ATOM   344  O  O     . TYR A 1 42  ? -6.485  -60.396 -44.453 1.00 27.61  ? 42  TYR A O     1 
ATOM   345  C  CB    . TYR A 1 42  ? -6.848  -61.511 -41.329 1.00 27.74  ? 42  TYR A CB    1 
ATOM   346  C  CG    . TYR A 1 42  ? -6.544  -62.750 -42.139 1.00 28.09  ? 42  TYR A CG    1 
ATOM   347  C  CD1   . TYR A 1 42  ? -5.251  -62.992 -42.618 1.00 30.18  ? 42  TYR A CD1   1 
ATOM   348  C  CD2   . TYR A 1 42  ? -7.544  -63.688 -42.433 1.00 29.31  ? 42  TYR A CD2   1 
ATOM   349  C  CE1   . TYR A 1 42  ? -4.964  -64.130 -43.378 1.00 29.38  ? 42  TYR A CE1   1 
ATOM   350  C  CE2   . TYR A 1 42  ? -7.269  -64.830 -43.197 1.00 29.02  ? 42  TYR A CE2   1 
ATOM   351  C  CZ    . TYR A 1 42  ? -5.968  -65.048 -43.653 1.00 31.50  ? 42  TYR A CZ    1 
ATOM   352  O  OH    . TYR A 1 42  ? -5.659  -66.163 -44.412 1.00 30.29  ? 42  TYR A OH    1 
ATOM   353  N  N     . VAL A 1 43  ? -5.182  -59.409 -42.872 1.00 26.05  ? 43  VAL A N     1 
ATOM   354  C  CA    . VAL A 1 43  ? -4.068  -59.103 -43.754 1.00 25.50  ? 43  VAL A CA    1 
ATOM   355  C  C     . VAL A 1 43  ? -2.775  -59.236 -42.953 1.00 25.00  ? 43  VAL A C     1 
ATOM   356  O  O     . VAL A 1 43  ? -2.715  -58.801 -41.793 1.00 24.87  ? 43  VAL A O     1 
ATOM   357  C  CB    . VAL A 1 43  ? -4.218  -57.680 -44.401 1.00 25.47  ? 43  VAL A CB    1 
ATOM   358  C  CG1   . VAL A 1 43  ? -4.446  -56.579 -43.338 1.00 23.80  ? 43  VAL A CG1   1 
ATOM   359  C  CG2   . VAL A 1 43  ? -3.035  -57.344 -45.281 1.00 27.05  ? 43  VAL A CG2   1 
ATOM   360  N  N     . PHE A 1 44  ? -1.773  -59.892 -43.543 1.00 25.00  ? 44  PHE A N     1 
ATOM   361  C  CA    . PHE A 1 44  ? -0.410  -59.915 -42.987 1.00 24.80  ? 44  PHE A CA    1 
ATOM   362  C  C     . PHE A 1 44  ? 0.292   -58.604 -43.334 1.00 24.08  ? 44  PHE A C     1 
ATOM   363  O  O     . PHE A 1 44  ? 0.358   -58.196 -44.504 1.00 23.59  ? 44  PHE A O     1 
ATOM   364  C  CB    . PHE A 1 44  ? 0.392   -61.107 -43.525 1.00 24.99  ? 44  PHE A CB    1 
ATOM   365  C  CG    . PHE A 1 44  ? 0.033   -62.428 -42.891 1.00 27.09  ? 44  PHE A CG    1 
ATOM   366  C  CD1   . PHE A 1 44  ? -1.172  -63.060 -43.194 1.00 31.78  ? 44  PHE A CD1   1 
ATOM   367  C  CD2   . PHE A 1 44  ? 0.914   -63.068 -42.032 1.00 27.95  ? 44  PHE A CD2   1 
ATOM   368  C  CE1   . PHE A 1 44  ? -1.504  -64.306 -42.617 1.00 31.67  ? 44  PHE A CE1   1 
ATOM   369  C  CE2   . PHE A 1 44  ? 0.588   -64.304 -41.445 1.00 29.60  ? 44  PHE A CE2   1 
ATOM   370  C  CZ    . PHE A 1 44  ? -0.621  -64.918 -41.733 1.00 28.33  ? 44  PHE A CZ    1 
ATOM   371  N  N     . VAL A 1 45  ? 0.801   -57.938 -42.308 1.00 23.35  ? 45  VAL A N     1 
ATOM   372  C  CA    . VAL A 1 45  ? 1.488   -56.671 -42.479 1.00 23.01  ? 45  VAL A CA    1 
ATOM   373  C  C     . VAL A 1 45  ? 2.846   -56.668 -41.747 1.00 23.29  ? 45  VAL A C     1 
ATOM   374  O  O     . VAL A 1 45  ? 3.361   -57.721 -41.331 1.00 22.81  ? 45  VAL A O     1 
ATOM   375  C  CB    . VAL A 1 45  ? 0.600   -55.468 -42.028 1.00 23.36  ? 45  VAL A CB    1 
ATOM   376  C  CG1   . VAL A 1 45  ? -0.642  -55.365 -42.909 1.00 22.26  ? 45  VAL A CG1   1 
ATOM   377  C  CG2   . VAL A 1 45  ? 0.242   -55.580 -40.540 1.00 22.32  ? 45  VAL A CG2   1 
ATOM   378  N  N     . GLY A 1 46  ? 3.419   -55.477 -41.590 1.00 22.45  ? 46  GLY A N     1 
ATOM   379  C  CA    . GLY A 1 46  ? 4.680   -55.316 -40.895 1.00 22.29  ? 46  GLY A CA    1 
ATOM   380  C  C     . GLY A 1 46  ? 5.867   -55.962 -41.578 1.00 23.36  ? 46  GLY A C     1 
ATOM   381  O  O     . GLY A 1 46  ? 5.793   -56.346 -42.774 1.00 23.26  ? 46  GLY A O     1 
ATOM   382  N  N     . SER A 1 47  ? 6.964   -56.091 -40.826 1.00 23.26  ? 47  SER A N     1 
ATOM   383  C  CA    . SER A 1 47  ? 8.252   -56.509 -41.408 1.00 24.55  ? 47  SER A CA    1 
ATOM   384  C  C     . SER A 1 47  ? 8.269   -57.961 -41.885 1.00 24.47  ? 47  SER A C     1 
ATOM   385  O  O     . SER A 1 47  ? 8.996   -58.297 -42.821 1.00 25.20  ? 47  SER A O     1 
ATOM   386  C  CB    . SER A 1 47  ? 9.397   -56.263 -40.431 1.00 25.43  ? 47  SER A CB    1 
ATOM   387  O  OG    . SER A 1 47  ? 9.301   -57.133 -39.308 1.00 26.50  ? 47  SER A OG    1 
ATOM   388  N  N     . TYR A 1 48  ? 7.478   -58.823 -41.250 1.00 24.53  ? 48  TYR A N     1 
ATOM   389  C  CA    . TYR A 1 48  ? 7.374   -60.184 -41.753 1.00 24.70  ? 48  TYR A CA    1 
ATOM   390  C  C     . TYR A 1 48  ? 6.783   -60.182 -43.164 1.00 24.76  ? 48  TYR A C     1 
ATOM   391  O  O     . TYR A 1 48  ? 7.317   -60.826 -44.062 1.00 24.98  ? 48  TYR A O     1 
ATOM   392  C  CB    . TYR A 1 48  ? 6.589   -61.139 -40.830 1.00 24.69  ? 48  TYR A CB    1 
ATOM   393  C  CG    . TYR A 1 48  ? 6.522   -62.515 -41.453 1.00 25.00  ? 48  TYR A CG    1 
ATOM   394  C  CD1   . TYR A 1 48  ? 7.656   -63.327 -41.503 1.00 25.25  ? 48  TYR A CD1   1 
ATOM   395  C  CD2   . TYR A 1 48  ? 5.337   -62.986 -42.044 1.00 24.65  ? 48  TYR A CD2   1 
ATOM   396  C  CE1   . TYR A 1 48  ? 7.619   -64.606 -42.132 1.00 26.23  ? 48  TYR A CE1   1 
ATOM   397  C  CE2   . TYR A 1 48  ? 5.292   -64.256 -42.664 1.00 24.84  ? 48  TYR A CE2   1 
ATOM   398  C  CZ    . TYR A 1 48  ? 6.440   -65.050 -42.703 1.00 26.19  ? 48  TYR A CZ    1 
ATOM   399  O  OH    . TYR A 1 48  ? 6.404   -66.294 -43.315 1.00 27.90  ? 48  TYR A OH    1 
ATOM   400  N  N     . ALA A 1 49  ? 5.685   -59.452 -43.362 1.00 24.61  ? 49  ALA A N     1 
ATOM   401  C  CA    . ALA A 1 49  ? 5.035   -59.430 -44.675 1.00 25.40  ? 49  ALA A CA    1 
ATOM   402  C  C     . ALA A 1 49  ? 5.924   -58.856 -45.782 1.00 26.49  ? 49  ALA A C     1 
ATOM   403  O  O     . ALA A 1 49  ? 5.738   -59.179 -46.960 1.00 27.05  ? 49  ALA A O     1 
ATOM   404  C  CB    . ALA A 1 49  ? 3.698   -58.682 -44.615 1.00 24.56  ? 49  ALA A CB    1 
ATOM   405  N  N     . ARG A 1 50  ? 6.901   -58.033 -45.401 1.00 26.85  ? 50  ARG A N     1 
ATOM   406  C  CA    . ARG A 1 50  ? 7.754   -57.331 -46.356 1.00 27.67  ? 50  ARG A CA    1 
ATOM   407  C  C     . ARG A 1 50  ? 9.207   -57.848 -46.419 1.00 28.81  ? 50  ARG A C     1 
ATOM   408  O  O     . ARG A 1 50  ? 10.033  -57.277 -47.139 1.00 29.04  ? 50  ARG A O     1 
ATOM   409  C  CB    . ARG A 1 50  ? 7.761   -55.837 -46.046 1.00 27.64  ? 50  ARG A CB    1 
ATOM   410  C  CG    . ARG A 1 50  ? 6.414   -55.160 -46.221 1.00 28.14  ? 50  ARG A CG    1 
ATOM   411  C  CD    . ARG A 1 50  ? 6.525   -53.646 -46.095 1.00 27.35  ? 50  ARG A CD    1 
ATOM   412  N  NE    . ARG A 1 50  ? 6.795   -53.134 -44.745 1.00 25.71  ? 50  ARG A NE    1 
ATOM   413  C  CZ    . ARG A 1 50  ? 5.880   -52.816 -43.826 1.00 25.88  ? 50  ARG A CZ    1 
ATOM   414  N  NH1   . ARG A 1 50  ? 4.570   -53.020 -44.046 1.00 25.09  ? 50  ARG A NH1   1 
ATOM   415  N  NH2   . ARG A 1 50  ? 6.287   -52.306 -42.662 1.00 22.64  ? 50  ARG A NH2   1 
ATOM   416  N  N     . ASN A 1 51  ? 9.490   -58.933 -45.689 1.00 29.36  ? 51  ASN A N     1 
ATOM   417  C  CA    . ASN A 1 51  ? 10.836  -59.505 -45.547 1.00 30.47  ? 51  ASN A CA    1 
ATOM   418  C  C     . ASN A 1 51  ? 11.914  -58.493 -45.181 1.00 29.94  ? 51  ASN A C     1 
ATOM   419  O  O     . ASN A 1 51  ? 13.000  -58.487 -45.785 1.00 29.29  ? 51  ASN A O     1 
ATOM   420  C  CB    . ASN A 1 51  ? 11.263  -60.263 -46.815 1.00 32.36  ? 51  ASN A CB    1 
ATOM   421  C  CG    . ASN A 1 51  ? 10.438  -61.499 -47.064 1.00 36.38  ? 51  ASN A CG    1 
ATOM   422  O  OD1   . ASN A 1 51  ? 10.168  -62.289 -46.148 1.00 43.54  ? 51  ASN A OD1   1 
ATOM   423  N  ND2   . ASN A 1 51  ? 10.028  -61.684 -48.315 1.00 40.72  ? 51  ASN A ND2   1 
ATOM   424  N  N     . THR A 1 52  ? 11.614  -57.641 -44.193 1.00 28.95  ? 52  THR A N     1 
ATOM   425  C  CA    . THR A 1 52  ? 12.558  -56.628 -43.737 1.00 28.27  ? 52  THR A CA    1 
ATOM   426  C  C     . THR A 1 52  ? 12.883  -56.796 -42.261 1.00 28.19  ? 52  THR A C     1 
ATOM   427  O  O     . THR A 1 52  ? 13.427  -55.896 -41.643 1.00 28.42  ? 52  THR A O     1 
ATOM   428  C  CB    . THR A 1 52  ? 12.049  -55.191 -44.012 1.00 27.93  ? 52  THR A CB    1 
ATOM   429  O  OG1   . THR A 1 52  ? 10.772  -55.001 -43.394 1.00 26.51  ? 52  THR A OG1   1 
ATOM   430  C  CG2   . THR A 1 52  ? 11.942  -54.912 -45.534 1.00 27.56  ? 52  THR A CG2   1 
ATOM   431  N  N     . TRP A 1 53  ? 12.559  -57.961 -41.701 1.00 28.39  ? 53  TRP A N     1 
ATOM   432  C  CA    . TRP A 1 53  ? 12.821  -58.211 -40.284 1.00 28.76  ? 53  TRP A CA    1 
ATOM   433  C  C     . TRP A 1 53  ? 14.255  -58.666 -40.031 1.00 30.06  ? 53  TRP A C     1 
ATOM   434  O  O     . TRP A 1 53  ? 14.894  -59.242 -40.898 1.00 31.15  ? 53  TRP A O     1 
ATOM   435  C  CB    . TRP A 1 53  ? 11.807  -59.198 -39.693 1.00 28.50  ? 53  TRP A CB    1 
ATOM   436  C  CG    . TRP A 1 53  ? 12.184  -60.654 -39.845 1.00 29.27  ? 53  TRP A CG    1 
ATOM   437  C  CD1   . TRP A 1 53  ? 12.951  -61.413 -38.982 1.00 31.09  ? 53  TRP A CD1   1 
ATOM   438  C  CD2   . TRP A 1 53  ? 11.798  -61.521 -40.897 1.00 28.20  ? 53  TRP A CD2   1 
ATOM   439  N  NE1   . TRP A 1 53  ? 13.077  -62.699 -39.457 1.00 29.99  ? 53  TRP A NE1   1 
ATOM   440  C  CE2   . TRP A 1 53  ? 12.367  -62.794 -40.625 1.00 30.69  ? 53  TRP A CE2   1 
ATOM   441  C  CE3   . TRP A 1 53  ? 11.026  -61.355 -42.047 1.00 26.73  ? 53  TRP A CE3   1 
ATOM   442  C  CZ2   . TRP A 1 53  ? 12.190  -63.879 -41.466 1.00 30.80  ? 53  TRP A CZ2   1 
ATOM   443  C  CZ3   . TRP A 1 53  ? 10.858  -62.418 -42.873 1.00 29.82  ? 53  TRP A CZ3   1 
ATOM   444  C  CH2   . TRP A 1 53  ? 11.434  -63.674 -42.582 1.00 31.73  ? 53  TRP A CH2   1 
ATOM   445  N  N     . LEU A 1 54  ? 14.729  -58.403 -38.822 1.00 30.11  ? 54  LEU A N     1 
ATOM   446  C  CA    . LEU A 1 54  ? 16.089  -58.685 -38.411 1.00 31.40  ? 54  LEU A CA    1 
ATOM   447  C  C     . LEU A 1 54  ? 16.263  -60.137 -38.003 1.00 32.04  ? 54  LEU A C     1 
ATOM   448  O  O     . LEU A 1 54  ? 15.367  -60.738 -37.391 1.00 31.42  ? 54  LEU A O     1 
ATOM   449  C  CB    . LEU A 1 54  ? 16.409  -57.783 -37.226 1.00 31.24  ? 54  LEU A CB    1 
ATOM   450  C  CG    . LEU A 1 54  ? 17.586  -56.833 -37.200 1.00 33.28  ? 54  LEU A CG    1 
ATOM   451  C  CD1   . LEU A 1 54  ? 18.068  -56.440 -38.614 1.00 32.82  ? 54  LEU A CD1   1 
ATOM   452  C  CD2   . LEU A 1 54  ? 17.208  -55.616 -36.340 1.00 34.15  ? 54  LEU A CD2   1 
ATOM   453  N  N     . LYS A 1 55  ? 17.420  -60.698 -38.349 1.00 33.33  ? 55  LYS A N     1 
ATOM   454  C  CA    . LYS A 1 55  ? 17.839  -62.006 -37.863 1.00 34.38  ? 55  LYS A CA    1 
ATOM   455  C  C     . LYS A 1 55  ? 17.664  -62.057 -36.337 1.00 34.80  ? 55  LYS A C     1 
ATOM   456  O  O     . LYS A 1 55  ? 18.080  -61.129 -35.617 1.00 34.24  ? 55  LYS A O     1 
ATOM   457  C  CB    . LYS A 1 55  ? 19.300  -62.245 -38.250 1.00 35.69  ? 55  LYS A CB    1 
ATOM   458  C  CG    . LYS A 1 55  ? 19.970  -63.434 -37.602 1.00 37.51  ? 55  LYS A CG    1 
ATOM   459  C  CD    . LYS A 1 55  ? 21.460  -63.481 -37.952 1.00 38.40  ? 55  LYS A CD    1 
ATOM   460  C  CE    . LYS A 1 55  ? 22.099  -64.739 -37.419 1.00 40.76  ? 55  LYS A CE    1 
ATOM   461  N  NZ    . LYS A 1 55  ? 21.361  -65.963 -37.874 1.00 43.31  ? 55  LYS A NZ    1 
ATOM   462  N  N     . GLY A 1 56  ? 17.033  -63.129 -35.861 1.00 34.85  ? 56  GLY A N     1 
ATOM   463  C  CA    . GLY A 1 56  ? 16.814  -63.343 -34.439 1.00 35.52  ? 56  GLY A CA    1 
ATOM   464  C  C     . GLY A 1 56  ? 15.591  -62.656 -33.856 1.00 34.58  ? 56  GLY A C     1 
ATOM   465  O  O     . GLY A 1 56  ? 15.260  -62.885 -32.692 1.00 34.54  ? 56  GLY A O     1 
ATOM   466  N  N     . SER A 1 57  ? 14.918  -61.829 -34.659 1.00 33.79  ? 57  SER A N     1 
ATOM   467  C  CA    . SER A 1 57  ? 13.737  -61.077 -34.210 1.00 33.86  ? 57  SER A CA    1 
ATOM   468  C  C     . SER A 1 57  ? 12.461  -61.328 -35.026 1.00 33.15  ? 57  SER A C     1 
ATOM   469  O  O     . SER A 1 57  ? 11.683  -60.404 -35.267 1.00 32.59  ? 57  SER A O     1 
ATOM   470  C  CB    . SER A 1 57  ? 14.037  -59.576 -34.186 1.00 32.89  ? 57  SER A CB    1 
ATOM   471  O  OG    . SER A 1 57  ? 15.076  -59.301 -33.266 1.00 36.84  ? 57  SER A OG    1 
ATOM   472  N  N     . LEU A 1 58  ? 12.241  -62.569 -35.446 1.00 34.03  ? 58  LEU A N     1 
ATOM   473  C  CA    . LEU A 1 58  ? 11.036  -62.910 -36.193 1.00 33.53  ? 58  LEU A CA    1 
ATOM   474  C  C     . LEU A 1 58  ? 9.767   -62.673 -35.357 1.00 33.09  ? 58  LEU A C     1 
ATOM   475  O  O     . LEU A 1 58  ? 9.643   -63.168 -34.225 1.00 32.86  ? 58  LEU A O     1 
ATOM   476  C  CB    . LEU A 1 58  ? 11.105  -64.354 -36.695 1.00 34.51  ? 58  LEU A CB    1 
ATOM   477  C  CG    . LEU A 1 58  ? 9.856   -65.001 -37.317 1.00 34.79  ? 58  LEU A CG    1 
ATOM   478  C  CD1   . LEU A 1 58  ? 9.303   -64.224 -38.503 1.00 33.64  ? 58  LEU A CD1   1 
ATOM   479  C  CD2   . LEU A 1 58  ? 10.183  -66.413 -37.731 1.00 35.11  ? 58  LEU A CD2   1 
ATOM   480  N  N     . GLU A 1 59  ? 8.843   -61.890 -35.924 1.00 32.30  ? 59  GLU A N     1 
ATOM   481  C  CA    . GLU A 1 59  ? 7.515   -61.658 -35.334 1.00 31.78  ? 59  GLU A CA    1 
ATOM   482  C  C     . GLU A 1 59  ? 6.527   -61.323 -36.438 1.00 30.09  ? 59  GLU A C     1 
ATOM   483  O  O     . GLU A 1 59  ? 6.740   -60.394 -37.229 1.00 30.01  ? 59  GLU A O     1 
ATOM   484  C  CB    . GLU A 1 59  ? 7.518   -60.527 -34.296 1.00 31.80  ? 59  GLU A CB    1 
ATOM   485  C  CG    . GLU A 1 59  ? 6.125   -60.279 -33.710 1.00 36.22  ? 59  GLU A CG    1 
ATOM   486  C  CD    . GLU A 1 59  ? 5.928   -58.904 -33.113 1.00 40.93  ? 59  GLU A CD    1 
ATOM   487  O  OE1   . GLU A 1 59  ? 5.374   -58.020 -33.823 1.00 41.20  ? 59  GLU A OE1   1 
ATOM   488  O  OE2   . GLU A 1 59  ? 6.315   -58.720 -31.934 1.00 43.21  ? 59  GLU A OE2   1 
ATOM   489  N  N     . ILE A 1 60  ? 5.437   -62.073 -36.478 1.00 28.83  ? 60  ILE A N     1 
ATOM   490  C  CA    . ILE A 1 60  ? 4.418   -61.892 -37.487 1.00 27.64  ? 60  ILE A CA    1 
ATOM   491  C  C     . ILE A 1 60  ? 3.281   -60.981 -37.010 1.00 26.75  ? 60  ILE A C     1 
ATOM   492  O  O     . ILE A 1 60  ? 2.736   -61.186 -35.923 1.00 26.11  ? 60  ILE A O     1 
ATOM   493  C  CB    . ILE A 1 60  ? 3.826   -63.250 -37.881 1.00 28.34  ? 60  ILE A CB    1 
ATOM   494  C  CG1   . ILE A 1 60  ? 4.920   -64.170 -38.442 1.00 27.96  ? 60  ILE A CG1   1 
ATOM   495  C  CG2   . ILE A 1 60  ? 2.624   -63.067 -38.833 1.00 25.53  ? 60  ILE A CG2   1 
ATOM   496  C  CD1   . ILE A 1 60  ? 4.436   -65.583 -38.700 1.00 28.61  ? 60  ILE A CD1   1 
ATOM   497  N  N     . ASP A 1 61  ? 2.922   -60.003 -37.848 1.00 26.10  ? 61  ASP A N     1 
ATOM   498  C  CA    . ASP A 1 61  ? 1.773   -59.127 -37.621 1.00 25.69  ? 61  ASP A CA    1 
ATOM   499  C  C     . ASP A 1 61  ? 0.590   -59.560 -38.481 1.00 25.20  ? 61  ASP A C     1 
ATOM   500  O  O     . ASP A 1 61  ? 0.700   -59.602 -39.715 1.00 25.55  ? 61  ASP A O     1 
ATOM   501  C  CB    . ASP A 1 61  ? 2.126   -57.669 -37.957 1.00 25.53  ? 61  ASP A CB    1 
ATOM   502  C  CG    . ASP A 1 61  ? 3.230   -57.119 -37.083 1.00 26.70  ? 61  ASP A CG    1 
ATOM   503  O  OD1   . ASP A 1 61  ? 4.317   -56.810 -37.634 1.00 25.18  ? 61  ASP A OD1   1 
ATOM   504  O  OD2   . ASP A 1 61  ? 3.024   -57.028 -35.848 1.00 26.53  ? 61  ASP A OD2   1 
ATOM   505  N  N     . VAL A 1 62  ? -0.523  -59.890 -37.829 1.00 25.02  ? 62  VAL A N     1 
ATOM   506  C  CA    . VAL A 1 62  ? -1.796  -60.113 -38.508 1.00 25.15  ? 62  VAL A CA    1 
ATOM   507  C  C     . VAL A 1 62  ? -2.819  -59.071 -38.075 1.00 24.39  ? 62  VAL A C     1 
ATOM   508  O  O     . VAL A 1 62  ? -3.107  -58.915 -36.880 1.00 24.31  ? 62  VAL A O     1 
ATOM   509  C  CB    . VAL A 1 62  ? -2.388  -61.498 -38.213 1.00 25.72  ? 62  VAL A CB    1 
ATOM   510  C  CG1   . VAL A 1 62  ? -3.708  -61.698 -39.009 1.00 27.07  ? 62  VAL A CG1   1 
ATOM   511  C  CG2   . VAL A 1 62  ? -1.401  -62.596 -38.561 1.00 28.33  ? 62  VAL A CG2   1 
ATOM   512  N  N     . PHE A 1 63  ? -3.381  -58.382 -39.058 1.00 23.75  ? 63  PHE A N     1 
ATOM   513  C  CA    . PHE A 1 63  ? -4.394  -57.366 -38.801 1.00 23.18  ? 63  PHE A CA    1 
ATOM   514  C  C     . PHE A 1 63  ? -5.759  -57.900 -39.158 1.00 23.16  ? 63  PHE A C     1 
ATOM   515  O  O     . PHE A 1 63  ? -5.911  -58.589 -40.160 1.00 23.13  ? 63  PHE A O     1 
ATOM   516  C  CB    . PHE A 1 63  ? -4.085  -56.074 -39.559 1.00 23.31  ? 63  PHE A CB    1 
ATOM   517  C  CG    . PHE A 1 63  ? -3.354  -55.070 -38.730 1.00 22.86  ? 63  PHE A CG    1 
ATOM   518  C  CD1   . PHE A 1 63  ? -2.152  -55.408 -38.116 1.00 24.35  ? 63  PHE A CD1   1 
ATOM   519  C  CD2   . PHE A 1 63  ? -3.855  -53.791 -38.557 1.00 23.33  ? 63  PHE A CD2   1 
ATOM   520  C  CE1   . PHE A 1 63  ? -1.469  -54.493 -37.330 1.00 21.45  ? 63  PHE A CE1   1 
ATOM   521  C  CE2   . PHE A 1 63  ? -3.169  -52.859 -37.769 1.00 23.38  ? 63  PHE A CE2   1 
ATOM   522  C  CZ    . PHE A 1 63  ? -1.976  -53.212 -37.166 1.00 22.45  ? 63  PHE A CZ    1 
ATOM   523  N  N     . LEU A 1 64  ? -6.732  -57.617 -38.294 1.00 22.75  ? 64  LEU A N     1 
ATOM   524  C  CA    . LEU A 1 64  ? -8.122  -58.015 -38.510 1.00 23.23  ? 64  LEU A CA    1 
ATOM   525  C  C     . LEU A 1 64  ? -8.932  -56.799 -38.901 1.00 23.09  ? 64  LEU A C     1 
ATOM   526  O  O     . LEU A 1 64  ? -8.985  -55.823 -38.149 1.00 24.02  ? 64  LEU A O     1 
ATOM   527  C  CB    . LEU A 1 64  ? -8.681  -58.623 -37.220 1.00 23.24  ? 64  LEU A CB    1 
ATOM   528  C  CG    . LEU A 1 64  ? -7.863  -59.714 -36.515 1.00 23.88  ? 64  LEU A CG    1 
ATOM   529  C  CD1   . LEU A 1 64  ? -8.456  -60.040 -35.113 1.00 24.27  ? 64  LEU A CD1   1 
ATOM   530  C  CD2   . LEU A 1 64  ? -7.749  -60.963 -37.389 1.00 23.85  ? 64  LEU A CD2   1 
ATOM   531  N  N     . LEU A 1 65  ? -9.568  -56.862 -40.069 1.00 23.54  ? 65  LEU A N     1 
ATOM   532  C  CA    . LEU A 1 65  ? -10.196 -55.697 -40.681 1.00 22.88  ? 65  LEU A CA    1 
ATOM   533  C  C     . LEU A 1 65  ? -11.704 -55.651 -40.342 1.00 22.91  ? 65  LEU A C     1 
ATOM   534  O  O     . LEU A 1 65  ? -12.503 -56.321 -40.997 1.00 22.46  ? 65  LEU A O     1 
ATOM   535  C  CB    . LEU A 1 65  ? -9.954  -55.714 -42.208 1.00 23.86  ? 65  LEU A CB    1 
ATOM   536  C  CG    . LEU A 1 65  ? -8.474  -55.750 -42.654 1.00 25.66  ? 65  LEU A CG    1 
ATOM   537  C  CD1   . LEU A 1 65  ? -8.330  -55.969 -44.143 1.00 26.78  ? 65  LEU A CD1   1 
ATOM   538  C  CD2   . LEU A 1 65  ? -7.704  -54.470 -42.197 1.00 25.49  ? 65  LEU A CD2   1 
ATOM   539  N  N     . PHE A 1 66  ? -12.069 -54.850 -39.332 1.00 22.33  ? 66  PHE A N     1 
ATOM   540  C  CA    . PHE A 1 66  ? -13.461 -54.746 -38.840 1.00 23.04  ? 66  PHE A CA    1 
ATOM   541  C  C     . PHE A 1 66  ? -14.240 -53.571 -39.463 1.00 23.95  ? 66  PHE A C     1 
ATOM   542  O  O     . PHE A 1 66  ? -13.638 -52.587 -39.883 1.00 23.74  ? 66  PHE A O     1 
ATOM   543  C  CB    . PHE A 1 66  ? -13.486 -54.620 -37.304 1.00 23.00  ? 66  PHE A CB    1 
ATOM   544  C  CG    . PHE A 1 66  ? -13.167 -55.892 -36.577 1.00 24.24  ? 66  PHE A CG    1 
ATOM   545  C  CD1   . PHE A 1 66  ? -14.145 -56.871 -36.404 1.00 25.03  ? 66  PHE A CD1   1 
ATOM   546  C  CD2   . PHE A 1 66  ? -11.890 -56.101 -36.027 1.00 24.83  ? 66  PHE A CD2   1 
ATOM   547  C  CE1   . PHE A 1 66  ? -13.864 -58.043 -35.712 1.00 26.03  ? 66  PHE A CE1   1 
ATOM   548  C  CE2   . PHE A 1 66  ? -11.587 -57.291 -35.352 1.00 24.91  ? 66  PHE A CE2   1 
ATOM   549  C  CZ    . PHE A 1 66  ? -12.576 -58.264 -35.196 1.00 26.26  ? 66  PHE A CZ    1 
ATOM   550  N  N     . PRO A 1 67  ? -15.587 -53.667 -39.511 1.00 24.89  ? 67  PRO A N     1 
ATOM   551  C  CA    . PRO A 1 67  ? -16.409 -52.571 -39.989 1.00 26.23  ? 67  PRO A CA    1 
ATOM   552  C  C     . PRO A 1 67  ? -16.118 -51.285 -39.234 1.00 26.86  ? 67  PRO A C     1 
ATOM   553  O  O     . PRO A 1 67  ? -16.020 -51.293 -38.000 1.00 25.89  ? 67  PRO A O     1 
ATOM   554  C  CB    . PRO A 1 67  ? -17.835 -53.043 -39.683 1.00 26.94  ? 67  PRO A CB    1 
ATOM   555  C  CG    . PRO A 1 67  ? -17.742 -54.516 -39.729 1.00 25.99  ? 67  PRO A CG    1 
ATOM   556  C  CD    . PRO A 1 67  ? -16.407 -54.831 -39.123 1.00 25.20  ? 67  PRO A CD    1 
ATOM   557  N  N     . GLU A 1 68  ? -15.995 -50.194 -39.980 1.00 28.36  ? 68  GLU A N     1 
ATOM   558  C  CA    . GLU A 1 68  ? -15.738 -48.883 -39.403 1.00 30.47  ? 68  GLU A CA    1 
ATOM   559  C  C     . GLU A 1 68  ? -16.793 -48.522 -38.353 1.00 29.87  ? 68  GLU A C     1 
ATOM   560  O  O     . GLU A 1 68  ? -16.494 -47.822 -37.405 1.00 29.84  ? 68  GLU A O     1 
ATOM   561  C  CB    . GLU A 1 68  ? -15.687 -47.821 -40.504 1.00 30.88  ? 68  GLU A CB    1 
ATOM   562  C  CG    . GLU A 1 68  ? -15.167 -46.457 -40.061 1.00 33.78  ? 68  GLU A CG    1 
ATOM   563  C  CD    . GLU A 1 68  ? -15.108 -45.455 -41.205 1.00 36.77  ? 68  GLU A CD    1 
ATOM   564  O  OE1   . GLU A 1 68  ? -15.286 -45.862 -42.389 1.00 41.37  ? 68  GLU A OE1   1 
ATOM   565  O  OE2   . GLU A 1 68  ? -14.883 -44.250 -40.924 1.00 43.49  ? 68  GLU A OE2   1 
ATOM   566  N  N     . GLU A 1 69  ? -18.019 -49.014 -38.536 1.00 30.19  ? 69  GLU A N     1 
ATOM   567  C  CA    . GLU A 1 69  ? -19.126 -48.742 -37.604 1.00 30.56  ? 69  GLU A CA    1 
ATOM   568  C  C     . GLU A 1 69  ? -18.976 -49.326 -36.189 1.00 28.93  ? 69  GLU A C     1 
ATOM   569  O  O     . GLU A 1 69  ? -19.649 -48.876 -35.264 1.00 29.26  ? 69  GLU A O     1 
ATOM   570  C  CB    . GLU A 1 69  ? -20.471 -49.193 -38.194 1.00 31.56  ? 69  GLU A CB    1 
ATOM   571  C  CG    . GLU A 1 69  ? -20.797 -48.667 -39.587 1.00 35.24  ? 69  GLU A CG    1 
ATOM   572  C  CD    . GLU A 1 69  ? -20.483 -49.675 -40.701 1.00 38.67  ? 69  GLU A CD    1 
ATOM   573  O  OE1   . GLU A 1 69  ? -21.435 -50.075 -41.417 1.00 42.40  ? 69  GLU A OE1   1 
ATOM   574  O  OE2   . GLU A 1 69  ? -19.305 -50.078 -40.857 1.00 37.12  ? 69  GLU A OE2   1 
ATOM   575  N  N     . PHE A 1 70  ? -18.145 -50.349 -36.021 1.00 26.86  ? 70  PHE A N     1 
ATOM   576  C  CA    . PHE A 1 70  ? -17.962 -50.967 -34.713 1.00 25.96  ? 70  PHE A CA    1 
ATOM   577  C  C     . PHE A 1 70  ? -17.509 -49.963 -33.649 1.00 26.33  ? 70  PHE A C     1 
ATOM   578  O  O     . PHE A 1 70  ? -16.631 -49.132 -33.899 1.00 25.02  ? 70  PHE A O     1 
ATOM   579  C  CB    . PHE A 1 70  ? -16.933 -52.098 -34.797 1.00 24.64  ? 70  PHE A CB    1 
ATOM   580  C  CG    . PHE A 1 70  ? -17.515 -53.437 -35.162 1.00 22.93  ? 70  PHE A CG    1 
ATOM   581  C  CD1   . PHE A 1 70  ? -18.718 -53.542 -35.832 1.00 24.92  ? 70  PHE A CD1   1 
ATOM   582  C  CD2   . PHE A 1 70  ? -16.817 -54.602 -34.853 1.00 24.21  ? 70  PHE A CD2   1 
ATOM   583  C  CE1   . PHE A 1 70  ? -19.250 -54.814 -36.178 1.00 25.72  ? 70  PHE A CE1   1 
ATOM   584  C  CE2   . PHE A 1 70  ? -17.328 -55.848 -35.181 1.00 22.05  ? 70  PHE A CE2   1 
ATOM   585  C  CZ    . PHE A 1 70  ? -18.548 -55.954 -35.828 1.00 22.95  ? 70  PHE A CZ    1 
ATOM   586  N  N     . SER A 1 71  ? -18.097 -50.062 -32.459 1.00 27.03  ? 71  SER A N     1 
ATOM   587  C  CA    . SER A 1 71  ? -17.604 -49.314 -31.291 1.00 28.14  ? 71  SER A CA    1 
ATOM   588  C  C     . SER A 1 71  ? -16.193 -49.763 -30.901 1.00 27.80  ? 71  SER A C     1 
ATOM   589  O  O     . SER A 1 71  ? -15.766 -50.851 -31.254 1.00 26.21  ? 71  SER A O     1 
ATOM   590  C  CB    . SER A 1 71  ? -18.541 -49.500 -30.092 1.00 28.78  ? 71  SER A CB    1 
ATOM   591  O  OG    . SER A 1 71  ? -18.369 -50.801 -29.561 1.00 28.18  ? 71  SER A OG    1 
ATOM   592  N  N     . LYS A 1 72  ? -15.460 -48.921 -30.170 1.00 28.95  ? 72  LYS A N     1 
ATOM   593  C  CA    . LYS A 1 72  ? -14.147 -49.335 -29.697 1.00 29.78  ? 72  LYS A CA    1 
ATOM   594  C  C     . LYS A 1 72  ? -14.236 -50.618 -28.851 1.00 29.21  ? 72  LYS A C     1 
ATOM   595  O  O     . LYS A 1 72  ? -13.373 -51.482 -28.933 1.00 27.98  ? 72  LYS A O     1 
ATOM   596  C  CB    . LYS A 1 72  ? -13.454 -48.195 -28.937 1.00 31.71  ? 72  LYS A CB    1 
ATOM   597  C  CG    . LYS A 1 72  ? -12.944 -47.073 -29.860 1.00 36.01  ? 72  LYS A CG    1 
ATOM   598  C  CD    . LYS A 1 72  ? -11.968 -46.161 -29.112 1.00 42.59  ? 72  LYS A CD    1 
ATOM   599  C  CE    . LYS A 1 72  ? -12.077 -44.696 -29.557 1.00 46.23  ? 72  LYS A CE    1 
ATOM   600  N  NZ    . LYS A 1 72  ? -11.110 -43.836 -28.792 1.00 48.34  ? 72  LYS A NZ    1 
ATOM   601  N  N     . GLU A 1 73  ? -15.312 -50.762 -28.085 1.00 29.94  ? 73  GLU A N     1 
ATOM   602  C  CA    . GLU A 1 73  ? -15.490 -51.954 -27.244 1.00 30.62  ? 73  GLU A CA    1 
ATOM   603  C  C     . GLU A 1 73  ? -15.752 -53.227 -28.062 1.00 29.42  ? 73  GLU A C     1 
ATOM   604  O  O     . GLU A 1 73  ? -15.265 -54.315 -27.731 1.00 28.84  ? 73  GLU A O     1 
ATOM   605  C  CB    . GLU A 1 73  ? -16.594 -51.709 -26.209 1.00 31.54  ? 73  GLU A CB    1 
ATOM   606  C  CG    . GLU A 1 73  ? -17.021 -52.933 -25.400 1.00 36.27  ? 73  GLU A CG    1 
ATOM   607  C  CD    . GLU A 1 73  ? -15.946 -53.528 -24.456 1.00 42.22  ? 73  GLU A CD    1 
ATOM   608  O  OE1   . GLU A 1 73  ? -14.950 -52.853 -24.055 1.00 42.89  ? 73  GLU A OE1   1 
ATOM   609  O  OE2   . GLU A 1 73  ? -16.130 -54.714 -24.089 1.00 45.55  ? 73  GLU A OE2   1 
ATOM   610  N  N     . GLU A 1 74  ? -16.500 -53.085 -29.147 1.00 29.23  ? 74  GLU A N     1 
ATOM   611  C  CA    . GLU A 1 74  ? -16.694 -54.206 -30.061 1.00 28.81  ? 74  GLU A CA    1 
ATOM   612  C  C     . GLU A 1 74  ? -15.370 -54.576 -30.718 1.00 27.84  ? 74  GLU A C     1 
ATOM   613  O  O     . GLU A 1 74  ? -15.080 -55.761 -30.890 1.00 27.56  ? 74  GLU A O     1 
ATOM   614  C  CB    . GLU A 1 74  ? -17.771 -53.900 -31.110 1.00 28.70  ? 74  GLU A CB    1 
ATOM   615  C  CG    . GLU A 1 74  ? -19.179 -53.824 -30.543 1.00 30.25  ? 74  GLU A CG    1 
ATOM   616  C  CD    . GLU A 1 74  ? -20.185 -53.284 -31.533 1.00 32.51  ? 74  GLU A CD    1 
ATOM   617  O  OE1   . GLU A 1 74  ? -19.846 -52.327 -32.265 1.00 32.08  ? 74  GLU A OE1   1 
ATOM   618  O  OE2   . GLU A 1 74  ? -21.313 -53.822 -31.572 1.00 34.26  ? 74  GLU A OE2   1 
ATOM   619  N  N     . LEU A 1 75  ? -14.561 -53.572 -31.064 1.00 27.27  ? 75  LEU A N     1 
ATOM   620  C  CA    . LEU A 1 75  ? -13.254 -53.833 -31.661 1.00 26.59  ? 75  LEU A CA    1 
ATOM   621  C  C     . LEU A 1 75  ? -12.379 -54.665 -30.708 1.00 26.08  ? 75  LEU A C     1 
ATOM   622  O  O     . LEU A 1 75  ? -11.784 -55.668 -31.116 1.00 24.73  ? 75  LEU A O     1 
ATOM   623  C  CB    . LEU A 1 75  ? -12.558 -52.516 -32.050 1.00 26.75  ? 75  LEU A CB    1 
ATOM   624  C  CG    . LEU A 1 75  ? -11.324 -52.545 -32.966 1.00 27.56  ? 75  LEU A CG    1 
ATOM   625  C  CD1   . LEU A 1 75  ? -11.711 -52.855 -34.401 1.00 25.99  ? 75  LEU A CD1   1 
ATOM   626  C  CD2   . LEU A 1 75  ? -10.496 -51.238 -32.905 1.00 25.68  ? 75  LEU A CD2   1 
ATOM   627  N  N     . ARG A 1 76  ? -12.320 -54.237 -29.442 1.00 26.31  ? 76  ARG A N     1 
ATOM   628  C  CA    . ARG A 1 76  ? -11.633 -54.979 -28.361 1.00 26.98  ? 76  ARG A CA    1 
ATOM   629  C  C     . ARG A 1 76  ? -12.158 -56.422 -28.201 1.00 27.49  ? 76  ARG A C     1 
ATOM   630  O  O     . ARG A 1 76  ? -11.359 -57.377 -28.209 1.00 27.11  ? 76  ARG A O     1 
ATOM   631  C  CB    . ARG A 1 76  ? -11.734 -54.197 -27.021 1.00 27.26  ? 76  ARG A CB    1 
ATOM   632  C  CG    . ARG A 1 76  ? -10.904 -54.768 -25.843 1.00 27.60  ? 76  ARG A CG    1 
ATOM   633  C  CD    . ARG A 1 76  ? -11.450 -54.350 -24.482 1.00 31.32  ? 76  ARG A CD    1 
ATOM   634  N  NE    . ARG A 1 76  ? -11.901 -55.537 -23.743 1.00 41.51  ? 76  ARG A NE    1 
ATOM   635  C  CZ    . ARG A 1 76  ? -13.131 -56.041 -23.794 1.00 45.09  ? 76  ARG A CZ    1 
ATOM   636  N  NH1   . ARG A 1 76  ? -14.053 -55.466 -24.539 1.00 49.24  ? 76  ARG A NH1   1 
ATOM   637  N  NH2   . ARG A 1 76  ? -13.449 -57.129 -23.104 1.00 49.20  ? 76  ARG A NH2   1 
ATOM   638  N  N     . GLU A 1 77  ? -13.483 -56.586 -28.062 1.00 27.54  ? 77  GLU A N     1 
ATOM   639  C  CA    . GLU A 1 77  ? -14.071 -57.901 -27.791 1.00 28.94  ? 77  GLU A CA    1 
ATOM   640  C  C     . GLU A 1 77  ? -13.725 -58.925 -28.870 1.00 27.60  ? 77  GLU A C     1 
ATOM   641  O  O     . GLU A 1 77  ? -13.239 -60.023 -28.558 1.00 27.11  ? 77  GLU A O     1 
ATOM   642  C  CB    . GLU A 1 77  ? -15.604 -57.832 -27.726 1.00 29.37  ? 77  GLU A CB    1 
ATOM   643  C  CG    . GLU A 1 77  ? -16.193 -57.292 -26.473 1.00 34.11  ? 77  GLU A CG    1 
ATOM   644  C  CD    . GLU A 1 77  ? -17.728 -57.164 -26.571 1.00 35.19  ? 77  GLU A CD    1 
ATOM   645  O  OE1   . GLU A 1 77  ? -18.301 -56.334 -25.818 1.00 42.22  ? 77  GLU A OE1   1 
ATOM   646  O  OE2   . GLU A 1 77  ? -18.342 -57.867 -27.414 1.00 39.81  ? 77  GLU A OE2   1 
ATOM   647  N  N     . ARG A 1 78  ? -14.024 -58.566 -30.126 1.00 26.32  ? 78  ARG A N     1 
ATOM   648  C  CA    . ARG A 1 78  ? -13.876 -59.473 -31.266 1.00 25.53  ? 78  ARG A CA    1 
ATOM   649  C  C     . ARG A 1 78  ? -12.406 -59.738 -31.573 1.00 25.02  ? 78  ARG A C     1 
ATOM   650  O  O     . ARG A 1 78  ? -12.005 -60.884 -31.812 1.00 24.19  ? 78  ARG A O     1 
ATOM   651  C  CB    . ARG A 1 78  ? -14.607 -58.902 -32.493 1.00 25.50  ? 78  ARG A CB    1 
ATOM   652  C  CG    . ARG A 1 78  ? -16.123 -58.897 -32.398 1.00 27.14  ? 78  ARG A CG    1 
ATOM   653  C  CD    . ARG A 1 78  ? -16.741 -59.911 -33.362 1.00 32.88  ? 78  ARG A CD    1 
ATOM   654  N  NE    . ARG A 1 78  ? -16.298 -61.241 -33.003 1.00 32.84  ? 78  ARG A NE    1 
ATOM   655  C  CZ    . ARG A 1 78  ? -15.813 -62.174 -33.809 1.00 30.81  ? 78  ARG A CZ    1 
ATOM   656  N  NH1   . ARG A 1 78  ? -15.775 -62.043 -35.140 1.00 30.23  ? 78  ARG A NH1   1 
ATOM   657  N  NH2   . ARG A 1 78  ? -15.431 -63.309 -33.240 1.00 28.84  ? 78  ARG A NH2   1 
ATOM   658  N  N     . GLY A 1 79  ? -11.597 -58.676 -31.551 1.00 24.54  ? 79  GLY A N     1 
ATOM   659  C  CA    . GLY A 1 79  ? -10.167 -58.794 -31.777 1.00 24.76  ? 79  GLY A CA    1 
ATOM   660  C  C     . GLY A 1 79  ? -9.523  -59.764 -30.818 1.00 26.08  ? 79  GLY A C     1 
ATOM   661  O  O     . GLY A 1 79  ? -8.741  -60.626 -31.232 1.00 25.96  ? 79  GLY A O     1 
ATOM   662  N  N     . LEU A 1 80  ? -9.867  -59.634 -29.541 1.00 26.35  ? 80  LEU A N     1 
ATOM   663  C  CA    . LEU A 1 80  ? -9.278  -60.459 -28.487 1.00 27.83  ? 80  LEU A CA    1 
ATOM   664  C  C     . LEU A 1 80  ? -9.749  -61.910 -28.618 1.00 27.74  ? 80  LEU A C     1 
ATOM   665  O  O     . LEU A 1 80  ? -8.952  -62.837 -28.505 1.00 27.39  ? 80  LEU A O     1 
ATOM   666  C  CB    . LEU A 1 80  ? -9.596  -59.882 -27.103 1.00 28.05  ? 80  LEU A CB    1 
ATOM   667  C  CG    . LEU A 1 80  ? -8.524  -59.019 -26.409 1.00 30.11  ? 80  LEU A CG    1 
ATOM   668  C  CD1   . LEU A 1 80  ? -8.000  -57.899 -27.261 1.00 31.95  ? 80  LEU A CD1   1 
ATOM   669  C  CD2   . LEU A 1 80  ? -9.023  -58.485 -25.048 1.00 30.30  ? 80  LEU A CD2   1 
ATOM   670  N  N     . GLU A 1 81  ? -11.040 -62.071 -28.914 1.00 27.77  ? 81  GLU A N     1 
ATOM   671  C  CA    . GLU A 1 81  ? -11.665 -63.347 -29.226 1.00 29.12  ? 81  GLU A CA    1 
ATOM   672  C  C     . GLU A 1 81  ? -10.921 -64.119 -30.329 1.00 27.73  ? 81  GLU A C     1 
ATOM   673  O  O     . GLU A 1 81  ? -10.532 -65.270 -30.133 1.00 27.60  ? 81  GLU A O     1 
ATOM   674  C  CB    . GLU A 1 81  ? -13.098 -63.073 -29.700 1.00 29.18  ? 81  GLU A CB    1 
ATOM   675  C  CG    . GLU A 1 81  ? -14.152 -64.027 -29.220 1.00 32.92  ? 81  GLU A CG    1 
ATOM   676  C  CD    . GLU A 1 81  ? -15.497 -63.801 -29.915 1.00 34.02  ? 81  GLU A CD    1 
ATOM   677  O  OE1   . GLU A 1 81  ? -15.885 -62.626 -30.140 1.00 37.22  ? 81  GLU A OE1   1 
ATOM   678  O  OE2   . GLU A 1 81  ? -16.163 -64.811 -30.259 1.00 40.62  ? 81  GLU A OE2   1 
ATOM   679  N  N     . ILE A 1 82  ? -10.779 -63.495 -31.498 1.00 26.66  ? 82  ILE A N     1 
ATOM   680  C  CA    . ILE A 1 82  ? -10.071 -64.096 -32.646 1.00 26.64  ? 82  ILE A CA    1 
ATOM   681  C  C     . ILE A 1 82  ? -8.607  -64.376 -32.287 1.00 27.04  ? 82  ILE A C     1 
ATOM   682  O  O     . ILE A 1 82  ? -8.105  -65.463 -32.541 1.00 27.80  ? 82  ILE A O     1 
ATOM   683  C  CB    . ILE A 1 82  ? -10.191 -63.208 -33.925 1.00 25.58  ? 82  ILE A CB    1 
ATOM   684  C  CG1   . ILE A 1 82  ? -11.631 -63.222 -34.444 1.00 25.82  ? 82  ILE A CG1   1 
ATOM   685  C  CG2   . ILE A 1 82  ? -9.219  -63.664 -35.026 1.00 25.29  ? 82  ILE A CG2   1 
ATOM   686  C  CD1   . ILE A 1 82  ? -12.050 -61.953 -35.133 1.00 28.43  ? 82  ILE A CD1   1 
ATOM   687  N  N     . GLY A 1 83  ? -7.941  -63.398 -31.676 1.00 27.27  ? 83  GLY A N     1 
ATOM   688  C  CA    . GLY A 1 83  ? -6.543  -63.554 -31.242 1.00 27.92  ? 83  GLY A CA    1 
ATOM   689  C  C     . GLY A 1 83  ? -6.296  -64.805 -30.416 1.00 29.27  ? 83  GLY A C     1 
ATOM   690  O  O     . GLY A 1 83  ? -5.390  -65.585 -30.729 1.00 29.38  ? 83  GLY A O     1 
ATOM   691  N  N     . LYS A 1 84  ? -7.107  -64.987 -29.368 1.00 30.15  ? 84  LYS A N     1 
ATOM   692  C  CA    . LYS A 1 84  ? -7.040  -66.156 -28.485 1.00 31.79  ? 84  LYS A CA    1 
ATOM   693  C  C     . LYS A 1 84  ? -7.386  -67.460 -29.191 1.00 32.08  ? 84  LYS A C     1 
ATOM   694  O  O     . LYS A 1 84  ? -6.838  -68.517 -28.854 1.00 33.31  ? 84  LYS A O     1 
ATOM   695  C  CB    . LYS A 1 84  ? -7.983  -65.994 -27.290 1.00 32.23  ? 84  LYS A CB    1 
ATOM   696  C  CG    . LYS A 1 84  ? -7.679  -64.812 -26.370 1.00 32.81  ? 84  LYS A CG    1 
ATOM   697  C  CD    . LYS A 1 84  ? -8.695  -64.764 -25.234 1.00 34.22  ? 84  LYS A CD    1 
ATOM   698  C  CE    . LYS A 1 84  ? -8.392  -63.607 -24.293 1.00 37.54  ? 84  LYS A CE    1 
ATOM   699  N  NZ    . LYS A 1 84  ? -9.516  -63.315 -23.344 1.00 42.01  ? 84  LYS A NZ    1 
ATOM   700  N  N     . ALA A 1 85  ? -8.312  -67.393 -30.143 1.00 30.67  ? 85  ALA A N     1 
ATOM   701  C  CA    . ALA A 1 85  ? -8.710  -68.567 -30.901 1.00 31.12  ? 85  ALA A CA    1 
ATOM   702  C  C     . ALA A 1 85  ? -7.610  -69.110 -31.846 1.00 30.73  ? 85  ALA A C     1 
ATOM   703  O  O     . ALA A 1 85  ? -7.549  -70.317 -32.093 1.00 31.06  ? 85  ALA A O     1 
ATOM   704  C  CB    . ALA A 1 85  ? -10.003 -68.296 -31.680 1.00 31.03  ? 85  ALA A CB    1 
ATOM   705  N  N     . VAL A 1 86  ? -6.751  -68.228 -32.355 1.00 29.70  ? 86  VAL A N     1 
ATOM   706  C  CA    . VAL A 1 86  ? -5.776  -68.612 -33.403 1.00 29.14  ? 86  VAL A CA    1 
ATOM   707  C  C     . VAL A 1 86  ? -4.330  -68.811 -32.926 1.00 30.45  ? 86  VAL A C     1 
ATOM   708  O  O     . VAL A 1 86  ? -3.480  -69.258 -33.703 1.00 30.64  ? 86  VAL A O     1 
ATOM   709  C  CB    . VAL A 1 86  ? -5.812  -67.662 -34.652 1.00 28.27  ? 86  VAL A CB    1 
ATOM   710  C  CG1   . VAL A 1 86  ? -7.213  -67.592 -35.255 1.00 26.99  ? 86  VAL A CG1   1 
ATOM   711  C  CG2   . VAL A 1 86  ? -5.277  -66.247 -34.334 1.00 24.95  ? 86  VAL A CG2   1 
ATOM   712  N  N     . LEU A 1 87  ? -4.053  -68.485 -31.660 1.00 31.14  ? 87  LEU A N     1 
ATOM   713  C  CA    . LEU A 1 87  ? -2.694  -68.606 -31.112 1.00 32.21  ? 87  LEU A CA    1 
ATOM   714  C  C     . LEU A 1 87  ? -2.518  -69.855 -30.244 1.00 34.44  ? 87  LEU A C     1 
ATOM   715  O  O     . LEU A 1 87  ? -3.476  -70.299 -29.604 1.00 35.29  ? 87  LEU A O     1 
ATOM   716  C  CB    . LEU A 1 87  ? -2.314  -67.337 -30.344 1.00 31.66  ? 87  LEU A CB    1 
ATOM   717  C  CG    . LEU A 1 87  ? -2.297  -66.054 -31.198 1.00 29.25  ? 87  LEU A CG    1 
ATOM   718  C  CD1   . LEU A 1 87  ? -2.003  -64.798 -30.343 1.00 27.91  ? 87  LEU A CD1   1 
ATOM   719  C  CD2   . LEU A 1 87  ? -1.356  -66.160 -32.380 1.00 26.49  ? 87  LEU A CD2   1 
ATOM   720  N  N     . ASP A 1 88  ? -1.310  -70.427 -30.226 1.00 35.73  ? 88  ASP A N     1 
ATOM   721  C  CA    . ASP A 1 88  ? -1.057  -71.649 -29.445 1.00 38.03  ? 88  ASP A CA    1 
ATOM   722  C  C     . ASP A 1 88  ? -1.085  -71.335 -27.957 1.00 38.99  ? 88  ASP A C     1 
ATOM   723  O  O     . ASP A 1 88  ? -1.564  -72.135 -27.144 1.00 40.40  ? 88  ASP A O     1 
ATOM   724  C  CB    . ASP A 1 88  ? 0.290   -72.266 -29.797 1.00 38.94  ? 88  ASP A CB    1 
ATOM   725  C  CG    . ASP A 1 88  ? 0.282   -72.983 -31.120 1.00 39.57  ? 88  ASP A CG    1 
ATOM   726  O  OD1   . ASP A 1 88  ? -0.803  -73.203 -31.683 1.00 40.01  ? 88  ASP A OD1   1 
ATOM   727  O  OD2   . ASP A 1 88  ? 1.377   -73.353 -31.593 1.00 41.60  ? 88  ASP A OD2   1 
ATOM   728  N  N     . SER A 1 89  ? -0.519  -70.181 -27.618 1.00 38.50  ? 89  SER A N     1 
ATOM   729  C  CA    . SER A 1 89  ? -0.538  -69.634 -26.266 1.00 39.15  ? 89  SER A CA    1 
ATOM   730  C  C     . SER A 1 89  ? -0.545  -68.131 -26.492 1.00 37.92  ? 89  SER A C     1 
ATOM   731  O  O     . SER A 1 89  ? -0.257  -67.680 -27.607 1.00 36.52  ? 89  SER A O     1 
ATOM   732  C  CB    . SER A 1 89  ? 0.693   -70.064 -25.463 1.00 40.12  ? 89  SER A CB    1 
ATOM   733  O  OG    . SER A 1 89  ? 1.884   -69.531 -26.012 1.00 40.59  ? 89  SER A OG    1 
ATOM   734  N  N     . TYR A 1 90  ? -0.881  -67.367 -25.459 1.00 37.89  ? 90  TYR A N     1 
ATOM   735  C  CA    . TYR A 1 90  ? -1.086  -65.932 -25.618 1.00 37.19  ? 90  TYR A CA    1 
ATOM   736  C  C     . TYR A 1 90  ? -0.947  -65.138 -24.319 1.00 37.98  ? 90  TYR A C     1 
ATOM   737  O  O     . TYR A 1 90  ? -1.114  -65.668 -23.218 1.00 38.14  ? 90  TYR A O     1 
ATOM   738  C  CB    . TYR A 1 90  ? -2.455  -65.631 -26.273 1.00 36.52  ? 90  TYR A CB    1 
ATOM   739  C  CG    . TYR A 1 90  ? -3.659  -65.963 -25.411 1.00 37.37  ? 90  TYR A CG    1 
ATOM   740  C  CD1   . TYR A 1 90  ? -4.079  -65.100 -24.396 1.00 36.76  ? 90  TYR A CD1   1 
ATOM   741  C  CD2   . TYR A 1 90  ? -4.388  -67.144 -25.620 1.00 38.55  ? 90  TYR A CD2   1 
ATOM   742  C  CE1   . TYR A 1 90  ? -5.182  -65.415 -23.590 1.00 38.29  ? 90  TYR A CE1   1 
ATOM   743  C  CE2   . TYR A 1 90  ? -5.496  -67.468 -24.816 1.00 38.77  ? 90  TYR A CE2   1 
ATOM   744  C  CZ    . TYR A 1 90  ? -5.878  -66.597 -23.805 1.00 39.08  ? 90  TYR A CZ    1 
ATOM   745  O  OH    . TYR A 1 90  ? -6.970  -66.887 -23.020 1.00 40.00  ? 90  TYR A OH    1 
ATOM   746  N  N     . GLU A 1 91  ? -0.664  -63.853 -24.489 1.00 37.55  ? 91  GLU A N     1 
ATOM   747  C  CA    . GLU A 1 91  ? -0.606  -62.878 -23.421 1.00 39.57  ? 91  GLU A CA    1 
ATOM   748  C  C     . GLU A 1 91  ? -1.387  -61.660 -23.900 1.00 37.37  ? 91  GLU A C     1 
ATOM   749  O  O     . GLU A 1 91  ? -1.350  -61.312 -25.089 1.00 36.79  ? 91  GLU A O     1 
ATOM   750  C  CB    . GLU A 1 91  ? 0.846   -62.475 -23.148 1.00 40.08  ? 91  GLU A CB    1 
ATOM   751  C  CG    . GLU A 1 91  ? 1.733   -63.615 -22.656 1.00 43.95  ? 91  GLU A CG    1 
ATOM   752  C  CD    . GLU A 1 91  ? 3.181   -63.195 -22.355 1.00 45.79  ? 91  GLU A CD    1 
ATOM   753  O  OE1   . GLU A 1 91  ? 3.774   -62.416 -23.156 1.00 49.53  ? 91  GLU A OE1   1 
ATOM   754  O  OE2   . GLU A 1 91  ? 3.722   -63.670 -21.318 1.00 51.12  ? 91  GLU A OE2   1 
ATOM   755  N  N     . ILE A 1 92  ? -2.121  -61.028 -22.998 1.00 36.66  ? 92  ILE A N     1 
ATOM   756  C  CA    . ILE A 1 92  ? -2.801  -59.782 -23.342 1.00 35.22  ? 92  ILE A CA    1 
ATOM   757  C  C     . ILE A 1 92  ? -2.283  -58.680 -22.418 1.00 35.37  ? 92  ILE A C     1 
ATOM   758  O  O     . ILE A 1 92  ? -2.537  -58.693 -21.215 1.00 35.64  ? 92  ILE A O     1 
ATOM   759  C  CB    . ILE A 1 92  ? -4.339  -59.925 -23.324 1.00 35.25  ? 92  ILE A CB    1 
ATOM   760  C  CG1   . ILE A 1 92  ? -4.776  -60.791 -24.513 1.00 35.10  ? 92  ILE A CG1   1 
ATOM   761  C  CG2   . ILE A 1 92  ? -5.017  -58.558 -23.431 1.00 34.55  ? 92  ILE A CG2   1 
ATOM   762  C  CD1   . ILE A 1 92  ? -6.098  -61.505 -24.318 1.00 37.82  ? 92  ILE A CD1   1 
ATOM   763  N  N     . ARG A 1 93  ? -1.534  -57.751 -23.005 1.00 34.03  ? 93  ARG A N     1 
ATOM   764  C  CA    . ARG A 1 93  ? -0.878  -56.659 -22.278 1.00 33.92  ? 93  ARG A CA    1 
ATOM   765  C  C     . ARG A 1 93  ? -0.739  -55.463 -23.196 1.00 31.59  ? 93  ARG A C     1 
ATOM   766  O  O     . ARG A 1 93  ? 0.006   -55.518 -24.162 1.00 31.56  ? 93  ARG A O     1 
ATOM   767  C  CB    . ARG A 1 93  ? 0.525   -57.087 -21.824 1.00 35.37  ? 93  ARG A CB    1 
ATOM   768  C  CG    . ARG A 1 93  ? 0.666   -57.454 -20.375 1.00 40.11  ? 93  ARG A CG    1 
ATOM   769  C  CD    . ARG A 1 93  ? 2.151   -57.579 -20.037 1.00 47.42  ? 93  ARG A CD    1 
ATOM   770  N  NE    . ARG A 1 93  ? 2.409   -57.467 -18.598 1.00 54.15  ? 93  ARG A NE    1 
ATOM   771  C  CZ    . ARG A 1 93  ? 3.579   -57.727 -18.013 1.00 57.75  ? 93  ARG A CZ    1 
ATOM   772  N  NH1   . ARG A 1 93  ? 4.628   -58.124 -18.734 1.00 57.74  ? 93  ARG A NH1   1 
ATOM   773  N  NH2   . ARG A 1 93  ? 3.699   -57.599 -16.692 1.00 59.72  ? 93  ARG A NH2   1 
ATOM   774  N  N     . TYR A 1 94  ? -1.459  -54.382 -22.920 1.00 29.84  ? 94  TYR A N     1 
ATOM   775  C  CA    . TYR A 1 94  ? -1.419  -53.252 -23.832 1.00 27.58  ? 94  TYR A CA    1 
ATOM   776  C  C     . TYR A 1 94  ? -1.717  -51.979 -23.079 1.00 27.54  ? 94  TYR A C     1 
ATOM   777  O  O     . TYR A 1 94  ? -2.292  -52.027 -21.992 1.00 28.02  ? 94  TYR A O     1 
ATOM   778  C  CB    . TYR A 1 94  ? -2.368  -53.460 -25.031 1.00 26.09  ? 94  TYR A CB    1 
ATOM   779  C  CG    . TYR A 1 94  ? -3.824  -53.685 -24.684 1.00 26.83  ? 94  TYR A CG    1 
ATOM   780  C  CD1   . TYR A 1 94  ? -4.694  -52.607 -24.550 1.00 24.92  ? 94  TYR A CD1   1 
ATOM   781  C  CD2   . TYR A 1 94  ? -4.340  -54.982 -24.514 1.00 24.78  ? 94  TYR A CD2   1 
ATOM   782  C  CE1   . TYR A 1 94  ? -6.038  -52.794 -24.253 1.00 26.85  ? 94  TYR A CE1   1 
ATOM   783  C  CE2   . TYR A 1 94  ? -5.685  -55.173 -24.193 1.00 25.71  ? 94  TYR A CE2   1 
ATOM   784  C  CZ    . TYR A 1 94  ? -6.523  -54.069 -24.054 1.00 27.63  ? 94  TYR A CZ    1 
ATOM   785  O  OH    . TYR A 1 94  ? -7.865  -54.218 -23.757 1.00 27.96  ? 94  TYR A OH    1 
ATOM   786  N  N     . ALA A 1 95  ? -1.306  -50.842 -23.634 1.00 26.42  ? 95  ALA A N     1 
ATOM   787  C  CA    . ALA A 1 95  ? -1.553  -49.556 -22.962 1.00 27.31  ? 95  ALA A CA    1 
ATOM   788  C  C     . ALA A 1 95  ? -2.889  -48.942 -23.344 1.00 26.79  ? 95  ALA A C     1 
ATOM   789  O  O     . ALA A 1 95  ? -3.589  -48.434 -22.482 1.00 27.02  ? 95  ALA A O     1 
ATOM   790  C  CB    . ALA A 1 95  ? -0.405  -48.550 -23.234 1.00 26.42  ? 95  ALA A CB    1 
ATOM   791  N  N     . GLU A 1 96  ? -3.222  -48.943 -24.638 1.00 26.10  ? 96  GLU A N     1 
ATOM   792  C  CA    . GLU A 1 96  ? -4.459  -48.287 -25.083 1.00 26.55  ? 96  GLU A CA    1 
ATOM   793  C  C     . GLU A 1 96  ? -5.157  -49.129 -26.162 1.00 25.65  ? 96  GLU A C     1 
ATOM   794  O  O     . GLU A 1 96  ? -6.293  -49.571 -25.980 1.00 25.46  ? 96  GLU A O     1 
ATOM   795  C  CB    . GLU A 1 96  ? -4.178  -46.836 -25.545 1.00 26.77  ? 96  GLU A CB    1 
ATOM   796  C  CG    . GLU A 1 96  ? -5.422  -46.030 -26.042 1.00 27.42  ? 96  GLU A CG    1 
ATOM   797  C  CD    . GLU A 1 96  ? -5.783  -46.303 -27.537 1.00 29.20  ? 96  GLU A CD    1 
ATOM   798  O  OE1   . GLU A 1 96  ? -4.920  -46.202 -28.420 1.00 30.99  ? 96  GLU A OE1   1 
ATOM   799  O  OE2   . GLU A 1 96  ? -6.947  -46.608 -27.834 1.00 32.01  ? 96  GLU A OE2   1 
ATOM   800  N  N     . HIS A 1 97  ? -4.459  -49.381 -27.259 1.00 24.45  ? 97  HIS A N     1 
ATOM   801  C  CA    . HIS A 1 97  ? -5.039  -50.168 -28.324 1.00 23.67  ? 97  HIS A CA    1 
ATOM   802  C  C     . HIS A 1 97  ? -4.961  -51.667 -28.019 1.00 24.19  ? 97  HIS A C     1 
ATOM   803  O  O     . HIS A 1 97  ? -3.870  -52.197 -27.831 1.00 25.15  ? 97  HIS A O     1 
ATOM   804  C  CB    . HIS A 1 97  ? -4.395  -49.867 -29.683 1.00 21.93  ? 97  HIS A CB    1 
ATOM   805  C  CG    . HIS A 1 97  ? -5.173  -50.440 -30.813 1.00 22.38  ? 97  HIS A CG    1 
ATOM   806  N  ND1   . HIS A 1 97  ? -4.946  -51.711 -31.302 1.00 23.67  ? 97  HIS A ND1   1 
ATOM   807  C  CD2   . HIS A 1 97  ? -6.253  -49.970 -31.466 1.00 17.51  ? 97  HIS A CD2   1 
ATOM   808  C  CE1   . HIS A 1 97  ? -5.824  -51.970 -32.255 1.00 22.43  ? 97  HIS A CE1   1 
ATOM   809  N  NE2   . HIS A 1 97  ? -6.641  -50.938 -32.357 1.00 22.09  ? 97  HIS A NE2   1 
ATOM   810  N  N     . PRO A 1 98  ? -6.120  -52.354 -28.023 1.00 24.61  ? 98  PRO A N     1 
ATOM   811  C  CA    . PRO A 1 98  ? -6.197  -53.777 -27.656 1.00 24.84  ? 98  PRO A CA    1 
ATOM   812  C  C     . PRO A 1 98  ? -5.619  -54.668 -28.758 1.00 24.37  ? 98  PRO A C     1 
ATOM   813  O  O     . PRO A 1 98  ? -5.799  -54.378 -29.949 1.00 23.31  ? 98  PRO A O     1 
ATOM   814  C  CB    . PRO A 1 98  ? -7.709  -54.007 -27.510 1.00 25.30  ? 98  PRO A CB    1 
ATOM   815  C  CG    . PRO A 1 98  ? -8.316  -53.060 -28.516 1.00 25.10  ? 98  PRO A CG    1 
ATOM   816  C  CD    . PRO A 1 98  ? -7.435  -51.824 -28.450 1.00 24.53  ? 98  PRO A CD    1 
ATOM   817  N  N     . TYR A 1 99  ? -4.914  -55.726 -28.353 1.00 23.75  ? 99  TYR A N     1 
ATOM   818  C  CA    . TYR A 1 99  ? -4.400  -56.720 -29.279 1.00 23.92  ? 99  TYR A CA    1 
ATOM   819  C  C     . TYR A 1 99  ? -3.976  -57.950 -28.511 1.00 24.51  ? 99  TYR A C     1 
ATOM   820  O  O     . TYR A 1 99  ? -3.866  -57.915 -27.289 1.00 25.56  ? 99  TYR A O     1 
ATOM   821  C  CB    . TYR A 1 99  ? -3.219  -56.186 -30.114 1.00 23.50  ? 99  TYR A CB    1 
ATOM   822  C  CG    . TYR A 1 99  ? -1.953  -55.851 -29.352 1.00 23.89  ? 99  TYR A CG    1 
ATOM   823  C  CD1   . TYR A 1 99  ? -0.854  -56.723 -29.336 1.00 23.71  ? 99  TYR A CD1   1 
ATOM   824  C  CD2   . TYR A 1 99  ? -1.841  -54.647 -28.658 1.00 24.07  ? 99  TYR A CD2   1 
ATOM   825  C  CE1   . TYR A 1 99  ? 0.323   -56.397 -28.618 1.00 24.82  ? 99  TYR A CE1   1 
ATOM   826  C  CE2   . TYR A 1 99  ? -0.679  -54.313 -27.978 1.00 24.35  ? 99  TYR A CE2   1 
ATOM   827  C  CZ    . TYR A 1 99  ? 0.398   -55.181 -27.968 1.00 25.01  ? 99  TYR A CZ    1 
ATOM   828  O  OH    . TYR A 1 99  ? 1.529   -54.796 -27.268 1.00 27.30  ? 99  TYR A OH    1 
ATOM   829  N  N     . VAL A 1 100 ? -3.749  -59.044 -29.222 1.00 24.48  ? 100 VAL A N     1 
ATOM   830  C  CA    . VAL A 1 100 ? -3.265  -60.244 -28.565 1.00 24.97  ? 100 VAL A CA    1 
ATOM   831  C  C     . VAL A 1 100 ? -1.856  -60.559 -29.041 1.00 25.81  ? 100 VAL A C     1 
ATOM   832  O  O     . VAL A 1 100 ? -1.598  -60.648 -30.255 1.00 24.76  ? 100 VAL A O     1 
ATOM   833  C  CB    . VAL A 1 100 ? -4.208  -61.458 -28.790 1.00 25.64  ? 100 VAL A CB    1 
ATOM   834  C  CG1   . VAL A 1 100 ? -3.804  -62.625 -27.894 1.00 24.99  ? 100 VAL A CG1   1 
ATOM   835  C  CG2   . VAL A 1 100 ? -5.646  -61.068 -28.491 1.00 24.36  ? 100 VAL A CG2   1 
ATOM   836  N  N     . HIS A 1 101 ? -0.939  -60.693 -28.088 1.00 26.42  ? 101 HIS A N     1 
ATOM   837  C  CA    . HIS A 1 101 ? 0.380   -61.212 -28.415 1.00 28.17  ? 101 HIS A CA    1 
ATOM   838  C  C     . HIS A 1 101 ? 0.439   -62.698 -28.088 1.00 29.26  ? 101 HIS A C     1 
ATOM   839  O  O     . HIS A 1 101 ? -0.081  -63.120 -27.072 1.00 30.88  ? 101 HIS A O     1 
ATOM   840  C  CB    . HIS A 1 101 ? 1.486   -60.478 -27.683 1.00 28.48  ? 101 HIS A CB    1 
ATOM   841  C  CG    . HIS A 1 101 ? 2.852   -60.991 -28.027 1.00 30.42  ? 101 HIS A CG    1 
ATOM   842  N  ND1   . HIS A 1 101 ? 3.542   -60.580 -29.147 1.00 30.24  ? 101 HIS A ND1   1 
ATOM   843  C  CD2   . HIS A 1 101 ? 3.642   -61.901 -27.410 1.00 33.25  ? 101 HIS A CD2   1 
ATOM   844  C  CE1   . HIS A 1 101 ? 4.708   -61.199 -29.196 1.00 31.19  ? 101 HIS A CE1   1 
ATOM   845  N  NE2   . HIS A 1 101 ? 4.789   -62.013 -28.159 1.00 35.13  ? 101 HIS A NE2   1 
ATOM   846  N  N     . GLY A 1 102 ? 1.085   -63.484 -28.941 1.00 29.65  ? 102 GLY A N     1 
ATOM   847  C  CA    . GLY A 1 102 ? 1.202   -64.909 -28.684 1.00 30.43  ? 102 GLY A CA    1 
ATOM   848  C  C     . GLY A 1 102 ? 2.141   -65.657 -29.603 1.00 30.13  ? 102 GLY A C     1 
ATOM   849  O  O     . GLY A 1 102 ? 3.054   -65.087 -30.185 1.00 29.94  ? 102 GLY A O     1 
ATOM   850  N  N     . VAL A 1 103 ? 1.922   -66.956 -29.708 1.00 30.78  ? 103 VAL A N     1 
ATOM   851  C  CA    . VAL A 1 103 ? 2.864   -67.829 -30.392 1.00 31.62  ? 103 VAL A CA    1 
ATOM   852  C  C     . VAL A 1 103 ? 2.121   -68.812 -31.290 1.00 31.69  ? 103 VAL A C     1 
ATOM   853  O  O     . VAL A 1 103 ? 1.099   -69.367 -30.891 1.00 32.11  ? 103 VAL A O     1 
ATOM   854  C  CB    . VAL A 1 103 ? 3.746   -68.601 -29.366 1.00 32.33  ? 103 VAL A CB    1 
ATOM   855  C  CG1   . VAL A 1 103 ? 4.674   -69.579 -30.057 1.00 34.26  ? 103 VAL A CG1   1 
ATOM   856  C  CG2   . VAL A 1 103 ? 4.546   -67.643 -28.521 1.00 32.51  ? 103 VAL A CG2   1 
ATOM   857  N  N     . VAL A 1 104 ? 2.610   -68.979 -32.517 1.00 31.74  ? 104 VAL A N     1 
ATOM   858  C  CA    . VAL A 1 104 ? 2.174   -70.078 -33.377 1.00 32.33  ? 104 VAL A CA    1 
ATOM   859  C  C     . VAL A 1 104 ? 3.392   -70.886 -33.812 1.00 33.13  ? 104 VAL A C     1 
ATOM   860  O  O     . VAL A 1 104 ? 4.300   -70.343 -34.443 1.00 33.51  ? 104 VAL A O     1 
ATOM   861  C  CB    . VAL A 1 104 ? 1.392   -69.588 -34.622 1.00 31.75  ? 104 VAL A CB    1 
ATOM   862  C  CG1   . VAL A 1 104 ? 1.136   -70.753 -35.585 1.00 32.56  ? 104 VAL A CG1   1 
ATOM   863  C  CG2   . VAL A 1 104 ? 0.084   -68.939 -34.206 1.00 31.22  ? 104 VAL A CG2   1 
ATOM   864  N  N     . LYS A 1 105 ? 3.400   -72.175 -33.483 1.00 34.29  ? 105 LYS A N     1 
ATOM   865  C  CA    . LYS A 1 105 ? 4.510   -73.091 -33.836 1.00 35.97  ? 105 LYS A CA    1 
ATOM   866  C  C     . LYS A 1 105 ? 5.891   -72.487 -33.535 1.00 35.65  ? 105 LYS A C     1 
ATOM   867  O  O     . LYS A 1 105 ? 6.790   -72.465 -34.386 1.00 36.04  ? 105 LYS A O     1 
ATOM   868  C  CB    . LYS A 1 105 ? 4.415   -73.556 -35.298 1.00 35.50  ? 105 LYS A CB    1 
ATOM   869  C  CG    . LYS A 1 105 ? 3.077   -74.152 -35.674 1.00 36.27  ? 105 LYS A CG    1 
ATOM   870  C  CD    . LYS A 1 105 ? 3.043   -74.673 -37.096 1.00 37.93  ? 105 LYS A CD    1 
ATOM   871  C  CE    . LYS A 1 105 ? 3.434   -76.132 -37.142 1.00 43.20  ? 105 LYS A CE    1 
ATOM   872  N  NZ    . LYS A 1 105 ? 2.536   -76.925 -38.047 1.00 46.77  ? 105 LYS A NZ    1 
ATOM   873  N  N     . GLY A 1 106 ? 6.034   -71.979 -32.318 1.00 35.57  ? 106 GLY A N     1 
ATOM   874  C  CA    . GLY A 1 106 ? 7.290   -71.412 -31.844 1.00 35.40  ? 106 GLY A CA    1 
ATOM   875  C  C     . GLY A 1 106 ? 7.581   -69.984 -32.261 1.00 33.93  ? 106 GLY A C     1 
ATOM   876  O  O     . GLY A 1 106 ? 8.584   -69.415 -31.830 1.00 34.31  ? 106 GLY A O     1 
ATOM   877  N  N     . VAL A 1 107 ? 6.706   -69.396 -33.081 1.00 32.68  ? 107 VAL A N     1 
ATOM   878  C  CA    . VAL A 1 107 ? 6.929   -68.054 -33.648 1.00 31.09  ? 107 VAL A CA    1 
ATOM   879  C  C     . VAL A 1 107 ? 5.988   -67.018 -33.029 1.00 31.02  ? 107 VAL A C     1 
ATOM   880  O  O     . VAL A 1 107 ? 4.785   -67.235 -32.939 1.00 30.12  ? 107 VAL A O     1 
ATOM   881  C  CB    . VAL A 1 107 ? 6.758   -68.052 -35.207 1.00 30.93  ? 107 VAL A CB    1 
ATOM   882  C  CG1   . VAL A 1 107 ? 6.820   -66.609 -35.800 1.00 27.89  ? 107 VAL A CG1   1 
ATOM   883  C  CG2   . VAL A 1 107 ? 7.788   -68.976 -35.869 1.00 31.53  ? 107 VAL A CG2   1 
ATOM   884  N  N     . GLU A 1 108 ? 6.552   -65.879 -32.624 1.00 31.09  ? 108 GLU A N     1 
ATOM   885  C  CA    . GLU A 1 108 ? 5.772   -64.791 -32.038 1.00 30.11  ? 108 GLU A CA    1 
ATOM   886  C  C     . GLU A 1 108 ? 4.890   -64.089 -33.059 1.00 28.64  ? 108 GLU A C     1 
ATOM   887  O  O     . GLU A 1 108 ? 5.258   -63.955 -34.241 1.00 27.54  ? 108 GLU A O     1 
ATOM   888  C  CB    . GLU A 1 108 ? 6.697   -63.802 -31.324 1.00 30.82  ? 108 GLU A CB    1 
ATOM   889  C  CG    . GLU A 1 108 ? 7.284   -64.397 -30.060 1.00 35.61  ? 108 GLU A CG    1 
ATOM   890  C  CD    . GLU A 1 108 ? 7.918   -63.366 -29.157 1.00 41.06  ? 108 GLU A CD    1 
ATOM   891  O  OE1   . GLU A 1 108 ? 9.118   -63.077 -29.329 1.00 42.78  ? 108 GLU A OE1   1 
ATOM   892  O  OE2   . GLU A 1 108 ? 7.218   -62.862 -28.254 1.00 43.67  ? 108 GLU A OE2   1 
ATOM   893  N  N     . VAL A 1 109 ? 3.714   -63.660 -32.583 1.00 27.24  ? 109 VAL A N     1 
ATOM   894  C  CA    . VAL A 1 109 ? 2.638   -63.137 -33.417 1.00 25.46  ? 109 VAL A CA    1 
ATOM   895  C  C     . VAL A 1 109 ? 1.918   -62.009 -32.660 1.00 25.23  ? 109 VAL A C     1 
ATOM   896  O  O     . VAL A 1 109 ? 1.600   -62.144 -31.478 1.00 25.76  ? 109 VAL A O     1 
ATOM   897  C  CB    . VAL A 1 109 ? 1.605   -64.269 -33.773 1.00 25.52  ? 109 VAL A CB    1 
ATOM   898  C  CG1   . VAL A 1 109 ? 0.511   -63.758 -34.719 1.00 22.86  ? 109 VAL A CG1   1 
ATOM   899  C  CG2   . VAL A 1 109 ? 2.313   -65.464 -34.380 1.00 24.21  ? 109 VAL A CG2   1 
ATOM   900  N  N     . ASP A 1 110 ? 1.696   -60.886 -33.326 1.00 25.25  ? 110 ASP A N     1 
ATOM   901  C  CA    . ASP A 1 110 ? 0.723   -59.902 -32.848 1.00 25.08  ? 110 ASP A CA    1 
ATOM   902  C  C     . ASP A 1 110 ? -0.552  -60.007 -33.688 1.00 25.02  ? 110 ASP A C     1 
ATOM   903  O  O     . ASP A 1 110 ? -0.494  -59.901 -34.914 1.00 25.35  ? 110 ASP A O     1 
ATOM   904  C  CB    . ASP A 1 110 ? 1.290   -58.468 -32.920 1.00 25.26  ? 110 ASP A CB    1 
ATOM   905  C  CG    . ASP A 1 110 ? 2.280   -58.157 -31.801 1.00 27.65  ? 110 ASP A CG    1 
ATOM   906  O  OD1   . ASP A 1 110 ? 2.229   -58.801 -30.722 1.00 28.96  ? 110 ASP A OD1   1 
ATOM   907  O  OD2   . ASP A 1 110 ? 3.091   -57.221 -31.991 1.00 30.36  ? 110 ASP A OD2   1 
ATOM   908  N  N     . VAL A 1 111 ? -1.696  -60.245 -33.027 1.00 24.92  ? 111 VAL A N     1 
ATOM   909  C  CA    . VAL A 1 111 ? -3.017  -60.245 -33.687 1.00 23.63  ? 111 VAL A CA    1 
ATOM   910  C  C     . VAL A 1 111 ? -3.728  -58.970 -33.253 1.00 23.28  ? 111 VAL A C     1 
ATOM   911  O  O     . VAL A 1 111 ? -4.066  -58.795 -32.071 1.00 22.00  ? 111 VAL A O     1 
ATOM   912  C  CB    . VAL A 1 111 ? -3.863  -61.507 -33.357 1.00 24.34  ? 111 VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 111 ? -5.214  -61.463 -34.092 1.00 23.33  ? 111 VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 111 ? -3.122  -62.768 -33.753 1.00 24.94  ? 111 VAL A CG2   1 
ATOM   915  N  N     . VAL A 1 112 ? -3.890  -58.065 -34.214 1.00 22.82  ? 112 VAL A N     1 
ATOM   916  C  CA    . VAL A 1 112 ? -4.319  -56.697 -33.944 1.00 22.84  ? 112 VAL A CA    1 
ATOM   917  C  C     . VAL A 1 112 ? -5.620  -56.403 -34.699 1.00 23.18  ? 112 VAL A C     1 
ATOM   918  O  O     . VAL A 1 112 ? -5.666  -56.524 -35.918 1.00 22.97  ? 112 VAL A O     1 
ATOM   919  C  CB    . VAL A 1 112 ? -3.219  -55.686 -34.398 1.00 22.78  ? 112 VAL A CB    1 
ATOM   920  C  CG1   . VAL A 1 112 ? -3.543  -54.255 -33.981 1.00 22.73  ? 112 VAL A CG1   1 
ATOM   921  C  CG2   . VAL A 1 112 ? -1.825  -56.088 -33.855 1.00 21.14  ? 112 VAL A CG2   1 
ATOM   922  N  N     . PRO A 1 113 ? -6.668  -55.971 -33.977 1.00 23.85  ? 113 PRO A N     1 
ATOM   923  C  CA    . PRO A 1 113 ? -7.886  -55.493 -34.653 1.00 23.59  ? 113 PRO A CA    1 
ATOM   924  C  C     . PRO A 1 113 ? -7.729  -54.053 -35.124 1.00 23.92  ? 113 PRO A C     1 
ATOM   925  O  O     . PRO A 1 113 ? -7.082  -53.253 -34.455 1.00 24.13  ? 113 PRO A O     1 
ATOM   926  C  CB    . PRO A 1 113 ? -8.938  -55.537 -33.546 1.00 23.94  ? 113 PRO A CB    1 
ATOM   927  C  CG    . PRO A 1 113 ? -8.138  -55.269 -32.272 1.00 23.33  ? 113 PRO A CG    1 
ATOM   928  C  CD    . PRO A 1 113 ? -6.777  -55.910 -32.505 1.00 22.60  ? 113 PRO A CD    1 
ATOM   929  N  N     . CYS A 1 114 ? -8.319  -53.726 -36.265 1.00 24.15  ? 114 CYS A N     1 
ATOM   930  C  CA    . CYS A 1 114 ? -8.361  -52.334 -36.710 1.00 24.81  ? 114 CYS A CA    1 
ATOM   931  C  C     . CYS A 1 114 ? -9.629  -52.121 -37.520 1.00 24.82  ? 114 CYS A C     1 
ATOM   932  O  O     . CYS A 1 114 ? -10.354 -53.073 -37.830 1.00 24.95  ? 114 CYS A O     1 
ATOM   933  C  CB    . CYS A 1 114 ? -7.133  -52.001 -37.560 1.00 24.46  ? 114 CYS A CB    1 
ATOM   934  S  SG    . CYS A 1 114 ? -7.218  -52.681 -39.259 1.00 25.99  ? 114 CYS A SG    1 
ATOM   935  N  N     . TYR A 1 115 ? -9.866  -50.876 -37.895 1.00 25.07  ? 115 TYR A N     1 
ATOM   936  C  CA    . TYR A 1 115 ? -11.010 -50.524 -38.695 1.00 26.43  ? 115 TYR A CA    1 
ATOM   937  C  C     . TYR A 1 115 ? -10.624 -50.578 -40.171 1.00 27.39  ? 115 TYR A C     1 
ATOM   938  O  O     . TYR A 1 115 ? -9.576  -50.045 -40.565 1.00 27.14  ? 115 TYR A O     1 
ATOM   939  C  CB    . TYR A 1 115 ? -11.521 -49.124 -38.313 1.00 26.57  ? 115 TYR A CB    1 
ATOM   940  C  CG    . TYR A 1 115 ? -12.146 -49.078 -36.944 1.00 27.48  ? 115 TYR A CG    1 
ATOM   941  C  CD1   . TYR A 1 115 ? -11.515 -48.396 -35.888 1.00 26.45  ? 115 TYR A CD1   1 
ATOM   942  C  CD2   . TYR A 1 115 ? -13.353 -49.740 -36.681 1.00 26.71  ? 115 TYR A CD2   1 
ATOM   943  C  CE1   . TYR A 1 115 ? -12.071 -48.353 -34.629 1.00 26.90  ? 115 TYR A CE1   1 
ATOM   944  C  CE2   . TYR A 1 115 ? -13.926 -49.693 -35.414 1.00 26.76  ? 115 TYR A CE2   1 
ATOM   945  C  CZ    . TYR A 1 115 ? -13.271 -49.001 -34.389 1.00 27.36  ? 115 TYR A CZ    1 
ATOM   946  O  OH    . TYR A 1 115 ? -13.813 -48.936 -33.131 1.00 27.48  ? 115 TYR A OH    1 
ATOM   947  N  N     . LYS A 1 116 ? -11.461 -51.241 -40.967 1.00 28.02  ? 116 LYS A N     1 
ATOM   948  C  CA    . LYS A 1 116 ? -11.281 -51.295 -42.417 1.00 29.78  ? 116 LYS A CA    1 
ATOM   949  C  C     . LYS A 1 116 ? -11.728 -49.966 -43.006 1.00 31.44  ? 116 LYS A C     1 
ATOM   950  O  O     . LYS A 1 116 ? -12.910 -49.767 -43.289 1.00 32.48  ? 116 LYS A O     1 
ATOM   951  C  CB    . LYS A 1 116 ? -12.066 -52.454 -43.016 1.00 29.81  ? 116 LYS A CB    1 
ATOM   952  C  CG    . LYS A 1 116 ? -11.858 -52.650 -44.515 1.00 31.15  ? 116 LYS A CG    1 
ATOM   953  C  CD    . LYS A 1 116 ? -12.684 -53.805 -45.009 1.00 31.74  ? 116 LYS A CD    1 
ATOM   954  C  CE    . LYS A 1 116 ? -12.411 -54.086 -46.477 1.00 32.96  ? 116 LYS A CE    1 
ATOM   955  N  NZ    . LYS A 1 116 ? -13.256 -55.246 -46.896 1.00 36.97  ? 116 LYS A NZ    1 
ATOM   956  N  N     . LEU A 1 117 ? -10.786 -49.030 -43.128 1.00 32.71  ? 117 LEU A N     1 
ATOM   957  C  CA    . LEU A 1 117 ? -11.083 -47.716 -43.704 1.00 35.00  ? 117 LEU A CA    1 
ATOM   958  C  C     . LEU A 1 117 ? -10.807 -47.691 -45.211 1.00 37.18  ? 117 LEU A C     1 
ATOM   959  O  O     . LEU A 1 117 ? -10.031 -48.495 -45.727 1.00 37.09  ? 117 LEU A O     1 
ATOM   960  C  CB    . LEU A 1 117 ? -10.307 -46.588 -42.994 1.00 34.07  ? 117 LEU A CB    1 
ATOM   961  C  CG    . LEU A 1 117 ? -10.269 -46.475 -41.456 1.00 32.51  ? 117 LEU A CG    1 
ATOM   962  C  CD1   . LEU A 1 117 ? -9.271  -45.421 -41.025 1.00 30.74  ? 117 LEU A CD1   1 
ATOM   963  C  CD2   . LEU A 1 117 ? -11.627 -46.190 -40.837 1.00 30.64  ? 117 LEU A CD2   1 
ATOM   964  N  N     . LYS A 1 118 ? -11.453 -46.761 -45.908 1.00 40.17  ? 118 LYS A N     1 
ATOM   965  C  CA    . LYS A 1 118 ? -11.205 -46.537 -47.336 1.00 43.21  ? 118 LYS A CA    1 
ATOM   966  C  C     . LYS A 1 118 ? -9.975  -45.648 -47.523 1.00 43.27  ? 118 LYS A C     1 
ATOM   967  O  O     . LYS A 1 118 ? -9.214  -45.816 -48.472 1.00 43.52  ? 118 LYS A O     1 
ATOM   968  C  CB    . LYS A 1 118 ? -12.439 -45.908 -48.000 1.00 44.95  ? 118 LYS A CB    1 
ATOM   969  C  CG    . LYS A 1 118 ? -13.749 -46.645 -47.619 1.00 46.79  ? 118 LYS A CG    1 
ATOM   970  C  CD    . LYS A 1 118 ? -14.998 -46.008 -48.229 1.00 48.17  ? 118 LYS A CD    1 
ATOM   971  C  CE    . LYS A 1 118 ? -16.262 -46.708 -47.729 1.00 48.80  ? 118 LYS A CE    1 
ATOM   972  N  NZ    . LYS A 1 118 ? -17.435 -46.339 -48.571 1.00 52.36  ? 118 LYS A NZ    1 
ATOM   973  N  N     . GLU A 1 119 ? -9.802  -44.704 -46.602 1.00 43.82  ? 119 GLU A N     1 
ATOM   974  C  CA    . GLU A 1 119 ? -8.652  -43.805 -46.574 1.00 44.97  ? 119 GLU A CA    1 
ATOM   975  C  C     . GLU A 1 119 ? -8.189  -43.632 -45.129 1.00 43.74  ? 119 GLU A C     1 
ATOM   976  O  O     . GLU A 1 119 ? -9.019  -43.602 -44.223 1.00 43.38  ? 119 GLU A O     1 
ATOM   977  C  CB    . GLU A 1 119 ? -9.040  -42.447 -47.155 1.00 47.05  ? 119 GLU A CB    1 
ATOM   978  C  CG    . GLU A 1 119 ? -9.453  -42.479 -48.613 1.00 51.76  ? 119 GLU A CG    1 
ATOM   979  C  CD    . GLU A 1 119 ? -8.280  -42.278 -49.556 1.00 56.96  ? 119 GLU A CD    1 
ATOM   980  O  OE1   . GLU A 1 119 ? -8.274  -41.247 -50.270 1.00 59.12  ? 119 GLU A OE1   1 
ATOM   981  O  OE2   . GLU A 1 119 ? -7.359  -43.138 -49.576 1.00 57.96  ? 119 GLU A OE2   1 
ATOM   982  N  N     . PRO A 1 120 ? -6.867  -43.506 -44.902 1.00 43.30  ? 120 PRO A N     1 
ATOM   983  C  CA    . PRO A 1 120 ? -6.363  -43.376 -43.534 1.00 42.93  ? 120 PRO A CA    1 
ATOM   984  C  C     . PRO A 1 120 ? -6.350  -41.930 -43.028 1.00 43.98  ? 120 PRO A C     1 
ATOM   985  O  O     . PRO A 1 120 ? -5.438  -41.532 -42.301 1.00 43.83  ? 120 PRO A O     1 
ATOM   986  C  CB    . PRO A 1 120 ? -4.933  -43.922 -43.634 1.00 42.07  ? 120 PRO A CB    1 
ATOM   987  C  CG    . PRO A 1 120 ? -4.521  -43.639 -45.046 1.00 42.85  ? 120 PRO A CG    1 
ATOM   988  C  CD    . PRO A 1 120 ? -5.771  -43.460 -45.890 1.00 43.69  ? 120 PRO A CD    1 
ATOM   989  N  N     . LYS A 1 121 ? -7.340  -41.153 -43.443 1.00 45.81  ? 121 LYS A N     1 
ATOM   990  C  CA    . LYS A 1 121 ? -7.587  -39.833 -42.880 1.00 47.18  ? 121 LYS A CA    1 
ATOM   991  C  C     . LYS A 1 121 ? -8.595  -40.025 -41.750 1.00 46.82  ? 121 LYS A C     1 
ATOM   992  O  O     . LYS A 1 121 ? -9.408  -40.964 -41.798 1.00 47.17  ? 121 LYS A O     1 
ATOM   993  C  CB    . LYS A 1 121 ? -8.159  -38.894 -43.948 1.00 48.79  ? 121 LYS A CB    1 
ATOM   994  C  CG    . LYS A 1 121 ? -7.373  -38.846 -45.267 1.00 51.12  ? 121 LYS A CG    1 
ATOM   995  C  CD    . LYS A 1 121 ? -6.079  -37.998 -45.189 1.00 54.36  ? 121 LYS A CD    1 
ATOM   996  C  CE    . LYS A 1 121 ? -4.851  -38.802 -44.720 1.00 52.94  ? 121 LYS A CE    1 
ATOM   997  N  NZ    . LYS A 1 121 ? -4.530  -39.961 -45.607 1.00 52.40  ? 121 LYS A NZ    1 
ATOM   998  N  N     . ASN A 1 122 ? -8.547  -39.148 -40.744 1.00 46.33  ? 122 ASN A N     1 
ATOM   999  C  CA    . ASN A 1 122 ? -9.450  -39.213 -39.584 1.00 45.33  ? 122 ASN A CA    1 
ATOM   1000 C  C     . ASN A 1 122 ? -9.590  -40.637 -39.056 1.00 43.26  ? 122 ASN A C     1 
ATOM   1001 O  O     . ASN A 1 122 ? -10.684 -41.222 -38.996 1.00 43.68  ? 122 ASN A O     1 
ATOM   1002 C  CB    . ASN A 1 122 ? -10.813 -38.599 -39.905 1.00 46.98  ? 122 ASN A CB    1 
ATOM   1003 C  CG    . ASN A 1 122 ? -10.699 -37.220 -40.516 1.00 49.27  ? 122 ASN A CG    1 
ATOM   1004 O  OD1   . ASN A 1 122 ? -9.847  -36.422 -40.125 1.00 48.90  ? 122 ASN A OD1   1 
ATOM   1005 N  ND2   . ASN A 1 122 ? -11.556 -36.938 -41.494 1.00 51.25  ? 122 ASN A ND2   1 
ATOM   1006 N  N     . ILE A 1 123 ? -8.440  -41.179 -38.688 1.00 40.84  ? 123 ILE A N     1 
ATOM   1007 C  CA    . ILE A 1 123 ? -8.275  -42.543 -38.225 1.00 38.08  ? 123 ILE A CA    1 
ATOM   1008 C  C     . ILE A 1 123 ? -9.157  -42.813 -36.993 1.00 35.99  ? 123 ILE A C     1 
ATOM   1009 O  O     . ILE A 1 123 ? -9.296  -41.948 -36.129 1.00 36.88  ? 123 ILE A O     1 
ATOM   1010 C  CB    . ILE A 1 123 ? -6.731  -42.779 -37.983 1.00 37.73  ? 123 ILE A CB    1 
ATOM   1011 C  CG1   . ILE A 1 123 ? -6.239  -43.995 -38.734 1.00 38.19  ? 123 ILE A CG1   1 
ATOM   1012 C  CG2   . ILE A 1 123 ? -6.300  -42.747 -36.513 1.00 38.13  ? 123 ILE A CG2   1 
ATOM   1013 C  CD1   . ILE A 1 123 ? -6.112  -43.729 -40.178 1.00 38.19  ? 123 ILE A CD1   1 
ATOM   1014 N  N     . LYS A 1 124 ? -9.774  -43.989 -36.914 1.00 32.97  ? 124 LYS A N     1 
ATOM   1015 C  CA    . LYS A 1 124 ? -10.670 -44.262 -35.786 1.00 30.94  ? 124 LYS A CA    1 
ATOM   1016 C  C     . LYS A 1 124 ? -9.946  -44.959 -34.620 1.00 28.88  ? 124 LYS A C     1 
ATOM   1017 O  O     . LYS A 1 124 ? -10.164 -44.611 -33.474 1.00 28.87  ? 124 LYS A O     1 
ATOM   1018 C  CB    . LYS A 1 124 ? -11.920 -45.032 -36.234 1.00 30.77  ? 124 LYS A CB    1 
ATOM   1019 C  CG    . LYS A 1 124 ? -13.040 -45.078 -35.183 1.00 31.21  ? 124 LYS A CG    1 
ATOM   1020 C  CD    . LYS A 1 124 ? -14.331 -45.760 -35.678 1.00 31.37  ? 124 LYS A CD    1 
ATOM   1021 C  CE    . LYS A 1 124 ? -15.429 -45.745 -34.573 1.00 32.84  ? 124 LYS A CE    1 
ATOM   1022 N  NZ    . LYS A 1 124 ? -16.670 -46.532 -34.910 1.00 30.07  ? 124 LYS A NZ    1 
ATOM   1023 N  N     . SER A 1 125 ? -9.106  -45.954 -34.920 1.00 27.19  ? 125 SER A N     1 
ATOM   1024 C  CA    . SER A 1 125 ? -8.229  -46.576 -33.920 1.00 25.49  ? 125 SER A CA    1 
ATOM   1025 C  C     . SER A 1 125 ? -6.779  -46.162 -34.191 1.00 24.85  ? 125 SER A C     1 
ATOM   1026 O  O     . SER A 1 125 ? -6.446  -45.732 -35.306 1.00 24.64  ? 125 SER A O     1 
ATOM   1027 C  CB    . SER A 1 125 ? -8.372  -48.101 -33.913 1.00 25.10  ? 125 SER A CB    1 
ATOM   1028 O  OG    . SER A 1 125 ? -7.360  -48.718 -34.686 1.00 26.41  ? 125 SER A OG    1 
ATOM   1029 N  N     . ALA A 1 126 ? -5.921  -46.280 -33.174 1.00 23.82  ? 126 ALA A N     1 
ATOM   1030 C  CA    . ALA A 1 126 ? -4.521  -45.794 -33.266 1.00 23.49  ? 126 ALA A CA    1 
ATOM   1031 C  C     . ALA A 1 126 ? -3.680  -46.460 -34.346 1.00 22.61  ? 126 ALA A C     1 
ATOM   1032 O  O     . ALA A 1 126 ? -2.678  -45.895 -34.769 1.00 22.71  ? 126 ALA A O     1 
ATOM   1033 C  CB    . ALA A 1 126 ? -3.809  -45.914 -31.898 1.00 22.57  ? 126 ALA A CB    1 
ATOM   1034 N  N     . VAL A 1 127 ? -4.095  -47.657 -34.764 1.00 21.57  ? 127 VAL A N     1 
ATOM   1035 C  CA    . VAL A 1 127 ? -3.325  -48.538 -35.645 1.00 22.31  ? 127 VAL A CA    1 
ATOM   1036 C  C     . VAL A 1 127 ? -3.842  -48.604 -37.112 1.00 22.39  ? 127 VAL A C     1 
ATOM   1037 O  O     . VAL A 1 127 ? -3.334  -49.390 -37.923 1.00 23.09  ? 127 VAL A O     1 
ATOM   1038 C  CB    . VAL A 1 127 ? -3.317  -50.010 -35.086 1.00 21.16  ? 127 VAL A CB    1 
ATOM   1039 C  CG1   . VAL A 1 127 ? -2.854  -50.058 -33.604 1.00 22.70  ? 127 VAL A CG1   1 
ATOM   1040 C  CG2   . VAL A 1 127 ? -4.698  -50.647 -35.227 1.00 22.08  ? 127 VAL A CG2   1 
ATOM   1041 N  N     . ASP A 1 128 ? -4.864  -47.811 -37.430 1.00 23.08  ? 128 ASP A N     1 
ATOM   1042 C  CA    . ASP A 1 128 ? -5.563  -47.894 -38.723 1.00 22.78  ? 128 ASP A CA    1 
ATOM   1043 C  C     . ASP A 1 128 ? -4.703  -47.558 -39.974 1.00 23.35  ? 128 ASP A C     1 
ATOM   1044 O  O     . ASP A 1 128 ? -5.055  -47.949 -41.088 1.00 23.80  ? 128 ASP A O     1 
ATOM   1045 C  CB    . ASP A 1 128 ? -6.817  -46.997 -38.719 1.00 24.02  ? 128 ASP A CB    1 
ATOM   1046 C  CG    . ASP A 1 128 ? -7.951  -47.514 -37.824 1.00 23.49  ? 128 ASP A CG    1 
ATOM   1047 O  OD1   . ASP A 1 128 ? -7.963  -48.691 -37.400 1.00 23.92  ? 128 ASP A OD1   1 
ATOM   1048 O  OD2   . ASP A 1 128 ? -8.880  -46.718 -37.594 1.00 23.38  ? 128 ASP A OD2   1 
ATOM   1049 N  N     . ARG A 1 129 ? -3.607  -46.811 -39.800 1.00 23.08  ? 129 ARG A N     1 
ATOM   1050 C  CA    . ARG A 1 129 ? -2.671  -46.543 -40.911 1.00 23.30  ? 129 ARG A CA    1 
ATOM   1051 C  C     . ARG A 1 129 ? -1.907  -47.777 -41.349 1.00 22.67  ? 129 ARG A C     1 
ATOM   1052 O  O     . ARG A 1 129 ? -1.467  -47.867 -42.476 1.00 22.94  ? 129 ARG A O     1 
ATOM   1053 C  CB    . ARG A 1 129 ? -1.640  -45.488 -40.531 1.00 22.65  ? 129 ARG A CB    1 
ATOM   1054 C  CG    . ARG A 1 129 ? -2.213  -44.135 -40.157 1.00 22.87  ? 129 ARG A CG    1 
ATOM   1055 C  CD    . ARG A 1 129 ? -1.058  -43.180 -39.948 1.00 21.32  ? 129 ARG A CD    1 
ATOM   1056 N  NE    . ARG A 1 129 ? -1.485  -41.974 -39.253 1.00 22.08  ? 129 ARG A NE    1 
ATOM   1057 C  CZ    . ARG A 1 129 ? -1.592  -41.871 -37.929 1.00 22.80  ? 129 ARG A CZ    1 
ATOM   1058 N  NH1   . ARG A 1 129 ? -1.294  -42.897 -37.132 1.00 21.27  ? 129 ARG A NH1   1 
ATOM   1059 N  NH2   . ARG A 1 129 ? -2.022  -40.753 -37.404 1.00 23.19  ? 129 ARG A NH2   1 
ATOM   1060 N  N     . THR A 1 130 ? -1.742  -48.728 -40.451 1.00 21.95  ? 130 THR A N     1 
ATOM   1061 C  CA    . THR A 1 130 ? -0.824  -49.840 -40.706 1.00 21.43  ? 130 THR A CA    1 
ATOM   1062 C  C     . THR A 1 130 ? -1.058  -50.690 -41.985 1.00 21.70  ? 130 THR A C     1 
ATOM   1063 O  O     . THR A 1 130 ? -0.086  -51.058 -42.639 1.00 21.24  ? 130 THR A O     1 
ATOM   1064 C  CB    . THR A 1 130 ? -0.666  -50.671 -39.426 1.00 20.30  ? 130 THR A CB    1 
ATOM   1065 O  OG1   . THR A 1 130 ? -0.121  -49.819 -38.409 1.00 20.68  ? 130 THR A OG1   1 
ATOM   1066 C  CG2   . THR A 1 130 ? 0.235   -51.874 -39.645 1.00 20.18  ? 130 THR A CG2   1 
ATOM   1067 N  N     . PRO A 1 131 ? -2.328  -51.046 -42.317 1.00 22.33  ? 131 PRO A N     1 
ATOM   1068 C  CA    . PRO A 1 131 ? -2.594  -51.663 -43.620 1.00 22.84  ? 131 PRO A CA    1 
ATOM   1069 C  C     . PRO A 1 131 ? -2.205  -50.777 -44.809 1.00 23.06  ? 131 PRO A C     1 
ATOM   1070 O  O     . PRO A 1 131 ? -1.769  -51.292 -45.834 1.00 23.34  ? 131 PRO A O     1 
ATOM   1071 C  CB    . PRO A 1 131 ? -4.118  -51.911 -43.595 1.00 23.38  ? 131 PRO A CB    1 
ATOM   1072 C  CG    . PRO A 1 131 ? -4.459  -51.973 -42.114 1.00 22.40  ? 131 PRO A CG    1 
ATOM   1073 C  CD    . PRO A 1 131 ? -3.563  -50.948 -41.504 1.00 22.79  ? 131 PRO A CD    1 
ATOM   1074 N  N     . PHE A 1 132 ? -2.345  -49.458 -44.667 1.00 23.00  ? 132 PHE A N     1 
ATOM   1075 C  CA    . PHE A 1 132 ? -1.967  -48.537 -45.739 1.00 23.29  ? 132 PHE A CA    1 
ATOM   1076 C  C     . PHE A 1 132 ? -0.432  -48.380 -45.877 1.00 22.95  ? 132 PHE A C     1 
ATOM   1077 O  O     . PHE A 1 132 ? 0.078   -48.256 -46.994 1.00 22.40  ? 132 PHE A O     1 
ATOM   1078 C  CB    . PHE A 1 132 ? -2.637  -47.180 -45.557 1.00 24.67  ? 132 PHE A CB    1 
ATOM   1079 C  CG    . PHE A 1 132 ? -4.146  -47.219 -45.635 1.00 25.66  ? 132 PHE A CG    1 
ATOM   1080 C  CD1   . PHE A 1 132 ? -4.909  -47.398 -44.486 1.00 26.44  ? 132 PHE A CD1   1 
ATOM   1081 C  CD2   . PHE A 1 132 ? -4.800  -47.041 -46.853 1.00 27.63  ? 132 PHE A CD2   1 
ATOM   1082 C  CE1   . PHE A 1 132 ? -6.302  -47.425 -44.553 1.00 26.50  ? 132 PHE A CE1   1 
ATOM   1083 C  CE2   . PHE A 1 132 ? -6.202  -47.069 -46.928 1.00 27.05  ? 132 PHE A CE2   1 
ATOM   1084 C  CZ    . PHE A 1 132 ? -6.944  -47.249 -45.773 1.00 27.20  ? 132 PHE A CZ    1 
ATOM   1085 N  N     . HIS A 1 133 ? 0.287   -48.366 -44.747 1.00 21.81  ? 133 HIS A N     1 
ATOM   1086 C  CA    . HIS A 1 133 ? 1.764   -48.478 -44.739 1.00 21.42  ? 133 HIS A CA    1 
ATOM   1087 C  C     . HIS A 1 133 ? 2.206   -49.671 -45.600 1.00 21.77  ? 133 HIS A C     1 
ATOM   1088 O  O     . HIS A 1 133 ? 3.122   -49.569 -46.428 1.00 22.65  ? 133 HIS A O     1 
ATOM   1089 C  CB    . HIS A 1 133 ? 2.296   -48.710 -43.306 1.00 20.49  ? 133 HIS A CB    1 
ATOM   1090 C  CG    . HIS A 1 133 ? 2.122   -47.538 -42.379 1.00 18.72  ? 133 HIS A CG    1 
ATOM   1091 N  ND1   . HIS A 1 133 ? 2.332   -47.632 -41.020 1.00 20.74  ? 133 HIS A ND1   1 
ATOM   1092 C  CD2   . HIS A 1 133 ? 1.768   -46.254 -42.616 1.00 19.78  ? 133 HIS A CD2   1 
ATOM   1093 C  CE1   . HIS A 1 133 ? 2.116   -46.457 -40.456 1.00 19.02  ? 133 HIS A CE1   1 
ATOM   1094 N  NE2   . HIS A 1 133 ? 1.776   -45.598 -41.403 1.00 18.62  ? 133 HIS A NE2   1 
ATOM   1095 N  N     . HIS A 1 134 ? 1.568   -50.811 -45.375 1.00 21.18  ? 134 HIS A N     1 
ATOM   1096 C  CA    . HIS A 1 134 ? 1.984   -52.024 -46.085 1.00 21.85  ? 134 HIS A CA    1 
ATOM   1097 C  C     . HIS A 1 134 ? 1.761   -51.930 -47.600 1.00 22.98  ? 134 HIS A C     1 
ATOM   1098 O  O     . HIS A 1 134 ? 2.656   -52.248 -48.380 1.00 23.56  ? 134 HIS A O     1 
ATOM   1099 C  CB    . HIS A 1 134 ? 1.323   -53.264 -45.518 1.00 21.82  ? 134 HIS A CB    1 
ATOM   1100 C  CG    . HIS A 1 134 ? 1.783   -54.520 -46.187 1.00 22.93  ? 134 HIS A CG    1 
ATOM   1101 N  ND1   . HIS A 1 134 ? 3.075   -54.981 -46.069 1.00 23.33  ? 134 HIS A ND1   1 
ATOM   1102 C  CD2   . HIS A 1 134 ? 1.148   -55.374 -47.032 1.00 25.55  ? 134 HIS A CD2   1 
ATOM   1103 C  CE1   . HIS A 1 134 ? 3.211   -56.088 -46.789 1.00 27.77  ? 134 HIS A CE1   1 
ATOM   1104 N  NE2   . HIS A 1 134 ? 2.054   -56.355 -47.374 1.00 25.41  ? 134 HIS A NE2   1 
ATOM   1105 N  N     . LYS A 1 135 ? 0.577   -51.474 -48.002 1.00 23.91  ? 135 LYS A N     1 
ATOM   1106 C  CA    . LYS A 1 135 ? 0.255   -51.274 -49.403 1.00 25.09  ? 135 LYS A CA    1 
ATOM   1107 C  C     . LYS A 1 135 ? 1.189   -50.233 -50.069 1.00 24.94  ? 135 LYS A C     1 
ATOM   1108 O  O     . LYS A 1 135 ? 1.577   -50.402 -51.231 1.00 24.41  ? 135 LYS A O     1 
ATOM   1109 C  CB    . LYS A 1 135 ? -1.218  -50.859 -49.551 1.00 27.34  ? 135 LYS A CB    1 
ATOM   1110 C  CG    . LYS A 1 135 ? -2.287  -51.933 -49.166 1.00 29.74  ? 135 LYS A CG    1 
ATOM   1111 C  CD    . LYS A 1 135 ? -2.382  -53.093 -50.174 1.00 36.82  ? 135 LYS A CD    1 
ATOM   1112 C  CE    . LYS A 1 135 ? -3.578  -54.050 -49.879 1.00 36.77  ? 135 LYS A CE    1 
ATOM   1113 N  NZ    . LYS A 1 135 ? -4.877  -53.605 -50.481 1.00 40.94  ? 135 LYS A NZ    1 
ATOM   1114 N  N     . TRP A 1 136 ? 1.520   -49.160 -49.349 1.00 23.77  ? 136 TRP A N     1 
ATOM   1115 C  CA    . TRP A 1 136 ? 2.429   -48.132 -49.872 1.00 24.80  ? 136 TRP A CA    1 
ATOM   1116 C  C     . TRP A 1 136 ? 3.846   -48.702 -50.076 1.00 25.71  ? 136 TRP A C     1 
ATOM   1117 O  O     . TRP A 1 136 ? 4.485   -48.480 -51.109 1.00 25.43  ? 136 TRP A O     1 
ATOM   1118 C  CB    . TRP A 1 136 ? 2.468   -46.888 -48.971 1.00 24.88  ? 136 TRP A CB    1 
ATOM   1119 C  CG    . TRP A 1 136 ? 3.093   -45.706 -49.694 1.00 25.47  ? 136 TRP A CG    1 
ATOM   1120 C  CD1   . TRP A 1 136 ? 2.456   -44.808 -50.503 1.00 25.71  ? 136 TRP A CD1   1 
ATOM   1121 C  CD2   . TRP A 1 136 ? 4.482   -45.341 -49.700 1.00 25.70  ? 136 TRP A CD2   1 
ATOM   1122 N  NE1   . TRP A 1 136 ? 3.356   -43.888 -50.991 1.00 26.27  ? 136 TRP A NE1   1 
ATOM   1123 C  CE2   . TRP A 1 136 ? 4.608   -44.194 -50.518 1.00 24.75  ? 136 TRP A CE2   1 
ATOM   1124 C  CE3   . TRP A 1 136 ? 5.628   -45.854 -49.053 1.00 24.97  ? 136 TRP A CE3   1 
ATOM   1125 C  CZ2   . TRP A 1 136 ? 5.833   -43.554 -50.732 1.00 26.48  ? 136 TRP A CZ2   1 
ATOM   1126 C  CZ3   . TRP A 1 136 ? 6.854   -45.228 -49.268 1.00 24.88  ? 136 TRP A CZ3   1 
ATOM   1127 C  CH2   . TRP A 1 136 ? 6.948   -44.085 -50.110 1.00 27.00  ? 136 TRP A CH2   1 
ATOM   1128 N  N     . LEU A 1 137 ? 4.318   -49.478 -49.107 1.00 24.95  ? 137 LEU A N     1 
ATOM   1129 C  CA    . LEU A 1 137 ? 5.681   -50.007 -49.168 1.00 26.54  ? 137 LEU A CA    1 
ATOM   1130 C  C     . LEU A 1 137 ? 5.874   -51.236 -50.043 1.00 27.69  ? 137 LEU A C     1 
ATOM   1131 O  O     . LEU A 1 137 ? 6.963   -51.422 -50.592 1.00 28.45  ? 137 LEU A O     1 
ATOM   1132 C  CB    . LEU A 1 137 ? 6.168   -50.316 -47.748 1.00 24.89  ? 137 LEU A CB    1 
ATOM   1133 C  CG    . LEU A 1 137 ? 7.310   -49.612 -47.009 1.00 27.86  ? 137 LEU A CG    1 
ATOM   1134 C  CD1   . LEU A 1 137 ? 7.882   -48.284 -47.585 1.00 27.60  ? 137 LEU A CD1   1 
ATOM   1135 C  CD2   . LEU A 1 137 ? 6.967   -49.520 -45.500 1.00 24.21  ? 137 LEU A CD2   1 
ATOM   1136 N  N     . GLU A 1 138 ? 4.837   -52.066 -50.183 1.00 29.29  ? 138 GLU A N     1 
ATOM   1137 C  CA    . GLU A 1 138 ? 5.008   -53.396 -50.786 1.00 32.15  ? 138 GLU A CA    1 
ATOM   1138 C  C     . GLU A 1 138 ? 5.692   -53.410 -52.167 1.00 33.28  ? 138 GLU A C     1 
ATOM   1139 O  O     . GLU A 1 138 ? 6.579   -54.221 -52.387 1.00 34.16  ? 138 GLU A O     1 
ATOM   1140 C  CB    . GLU A 1 138 ? 3.705   -54.231 -50.783 1.00 31.53  ? 138 GLU A CB    1 
ATOM   1141 C  CG    . GLU A 1 138 ? 2.625   -53.724 -51.716 1.00 35.42  ? 138 GLU A CG    1 
ATOM   1142 C  CD    . GLU A 1 138 ? 1.328   -54.529 -51.636 1.00 35.91  ? 138 GLU A CD    1 
ATOM   1143 O  OE1   . GLU A 1 138 ? 1.247   -55.476 -50.826 1.00 40.65  ? 138 GLU A OE1   1 
ATOM   1144 O  OE2   . GLU A 1 138 ? 0.386   -54.201 -52.390 1.00 41.84  ? 138 GLU A OE2   1 
ATOM   1145 N  N     . GLY A 1 139 ? 5.311   -52.503 -53.065 1.00 34.08  ? 139 GLY A N     1 
ATOM   1146 C  CA    . GLY A 1 139 ? 5.927   -52.444 -54.399 1.00 35.37  ? 139 GLY A CA    1 
ATOM   1147 C  C     . GLY A 1 139 ? 7.047   -51.421 -54.526 1.00 35.39  ? 139 GLY A C     1 
ATOM   1148 O  O     . GLY A 1 139 ? 7.539   -51.188 -55.622 1.00 37.51  ? 139 GLY A O     1 
ATOM   1149 N  N     . ARG A 1 140 ? 7.426   -50.785 -53.420 1.00 34.02  ? 140 ARG A N     1 
ATOM   1150 C  CA    . ARG A 1 140 ? 8.516   -49.788 -53.421 1.00 34.12  ? 140 ARG A CA    1 
ATOM   1151 C  C     . ARG A 1 140 ? 9.788   -50.266 -52.710 1.00 33.35  ? 140 ARG A C     1 
ATOM   1152 O  O     . ARG A 1 140 ? 10.852  -49.716 -52.937 1.00 33.81  ? 140 ARG A O     1 
ATOM   1153 C  CB    . ARG A 1 140 ? 8.054   -48.438 -52.833 1.00 33.32  ? 140 ARG A CB    1 
ATOM   1154 C  CG    . ARG A 1 140 ? 7.059   -47.705 -53.708 1.00 34.96  ? 140 ARG A CG    1 
ATOM   1155 C  CD    . ARG A 1 140 ? 6.465   -46.455 -53.081 1.00 34.17  ? 140 ARG A CD    1 
ATOM   1156 N  NE    . ARG A 1 140 ? 5.022   -46.418 -53.340 1.00 39.43  ? 140 ARG A NE    1 
ATOM   1157 C  CZ    . ARG A 1 140 ? 4.388   -45.434 -53.958 1.00 39.97  ? 140 ARG A CZ    1 
ATOM   1158 N  NH1   . ARG A 1 140 ? 5.041   -44.378 -54.370 1.00 43.12  ? 140 ARG A NH1   1 
ATOM   1159 N  NH2   . ARG A 1 140 ? 3.090   -45.504 -54.155 1.00 43.56  ? 140 ARG A NH2   1 
ATOM   1160 N  N     . ILE A 1 141 ? 9.660   -51.292 -51.870 1.00 32.64  ? 141 ILE A N     1 
ATOM   1161 C  CA    . ILE A 1 141 ? 10.743  -51.788 -51.004 1.00 32.85  ? 141 ILE A CA    1 
ATOM   1162 C  C     . ILE A 1 141 ? 11.441  -53.026 -51.587 1.00 33.73  ? 141 ILE A C     1 
ATOM   1163 O  O     . ILE A 1 141 ? 12.514  -53.418 -51.130 1.00 33.83  ? 141 ILE A O     1 
ATOM   1164 C  CB    . ILE A 1 141 ? 10.221  -52.076 -49.552 1.00 31.17  ? 141 ILE A CB    1 
ATOM   1165 C  CG1   . ILE A 1 141 ? 11.324  -51.937 -48.495 1.00 31.83  ? 141 ILE A CG1   1 
ATOM   1166 C  CG2   . ILE A 1 141 ? 9.548   -53.450 -49.462 1.00 32.07  ? 141 ILE A CG2   1 
ATOM   1167 C  CD1   . ILE A 1 141 ? 12.000  -50.567 -48.443 1.00 31.89  ? 141 ILE A CD1   1 
ATOM   1168 N  N     . LYS A 1 142 ? 10.832  -53.625 -52.604 1.00 35.23  ? 142 LYS A N     1 
ATOM   1169 C  CA    . LYS A 1 142 ? 11.413  -54.772 -53.324 1.00 36.71  ? 142 LYS A CA    1 
ATOM   1170 C  C     . LYS A 1 142 ? 12.864  -54.571 -53.739 1.00 37.44  ? 142 LYS A C     1 
ATOM   1171 O  O     . LYS A 1 142 ? 13.227  -53.538 -54.330 1.00 38.09  ? 142 LYS A O     1 
ATOM   1172 C  CB    . LYS A 1 142 ? 10.580  -55.096 -54.567 1.00 38.44  ? 142 LYS A CB    1 
ATOM   1173 C  CG    . LYS A 1 142 ? 9.121   -55.353 -54.274 1.00 40.23  ? 142 LYS A CG    1 
ATOM   1174 C  CD    . LYS A 1 142 ? 8.789   -56.833 -54.298 1.00 45.80  ? 142 LYS A CD    1 
ATOM   1175 C  CE    . LYS A 1 142 ? 7.280   -57.022 -54.461 1.00 47.05  ? 142 LYS A CE    1 
ATOM   1176 N  NZ    . LYS A 1 142 ? 6.768   -58.204 -53.720 1.00 48.51  ? 142 LYS A NZ    1 
ATOM   1177 N  N     . GLY A 1 143 ? 13.693  -55.569 -53.429 1.00 36.94  ? 143 GLY A N     1 
ATOM   1178 C  CA    . GLY A 1 143 ? 15.121  -55.510 -53.728 1.00 37.42  ? 143 GLY A CA    1 
ATOM   1179 C  C     . GLY A 1 143 ? 15.895  -54.554 -52.830 1.00 36.87  ? 143 GLY A C     1 
ATOM   1180 O  O     . GLY A 1 143 ? 17.090  -54.358 -53.027 1.00 38.07  ? 143 GLY A O     1 
ATOM   1181 N  N     . LYS A 1 144 ? 15.227  -53.943 -51.850 1.00 32.42  ? 144 LYS A N     1 
ATOM   1182 C  CA    . LYS A 1 144 ? 15.926  -53.127 -50.860 1.00 31.28  ? 144 LYS A CA    1 
ATOM   1183 C  C     . LYS A 1 144 ? 15.802  -53.665 -49.424 1.00 30.40  ? 144 LYS A C     1 
ATOM   1184 O  O     . LYS A 1 144 ? 16.146  -52.988 -48.458 1.00 29.09  ? 144 LYS A O     1 
ATOM   1185 C  CB    . LYS A 1 144 ? 15.487  -51.668 -50.960 1.00 31.13  ? 144 LYS A CB    1 
ATOM   1186 C  CG    . LYS A 1 144 ? 15.762  -51.080 -52.317 1.00 33.82  ? 144 LYS A CG    1 
ATOM   1187 C  CD    . LYS A 1 144 ? 15.508  -49.591 -52.368 1.00 35.57  ? 144 LYS A CD    1 
ATOM   1188 C  CE    . LYS A 1 144 ? 15.899  -49.090 -53.761 1.00 40.58  ? 144 LYS A CE    1 
ATOM   1189 N  NZ    . LYS A 1 144 ? 15.881  -47.601 -53.797 1.00 44.38  ? 144 LYS A NZ    1 
ATOM   1190 N  N     . GLU A 1 145 ? 15.355  -54.912 -49.306 1.00 30.50  ? 145 GLU A N     1 
ATOM   1191 C  CA    . GLU A 1 145 ? 15.140  -55.575 -48.010 1.00 30.02  ? 145 GLU A CA    1 
ATOM   1192 C  C     . GLU A 1 145 ? 16.397  -55.531 -47.159 1.00 29.24  ? 145 GLU A C     1 
ATOM   1193 O  O     . GLU A 1 145 ? 16.353  -55.218 -45.980 1.00 28.00  ? 145 GLU A O     1 
ATOM   1194 C  CB    . GLU A 1 145 ? 14.752  -57.043 -48.222 1.00 30.95  ? 145 GLU A CB    1 
ATOM   1195 C  CG    . GLU A 1 145 ? 14.283  -57.394 -49.675 1.00 36.62  ? 145 GLU A CG    1 
ATOM   1196 C  CD    . GLU A 1 145 ? 12.887  -56.939 -49.862 1.00 39.34  ? 145 GLU A CD    1 
ATOM   1197 O  OE1   . GLU A 1 145 ? 12.255  -57.302 -50.871 1.00 35.86  ? 145 GLU A OE1   1 
ATOM   1198 O  OE2   . GLU A 1 145 ? 12.424  -56.227 -48.933 1.00 37.98  ? 145 GLU A OE2   1 
ATOM   1199 N  N     . ASN A 1 146 ? 17.537  -55.853 -47.756 1.00 28.72  ? 146 ASN A N     1 
ATOM   1200 C  CA    . ASN A 1 146 ? 18.748  -55.938 -46.948 1.00 28.51  ? 146 ASN A CA    1 
ATOM   1201 C  C     . ASN A 1 146 ? 19.319  -54.572 -46.555 1.00 27.11  ? 146 ASN A C     1 
ATOM   1202 O  O     . ASN A 1 146 ? 19.988  -54.472 -45.539 1.00 26.46  ? 146 ASN A O     1 
ATOM   1203 C  CB    . ASN A 1 146 ? 19.763  -56.886 -47.577 1.00 30.19  ? 146 ASN A CB    1 
ATOM   1204 C  CG    . ASN A 1 146 ? 19.232  -58.319 -47.662 1.00 31.70  ? 146 ASN A CG    1 
ATOM   1205 O  OD1   . ASN A 1 146 ? 18.300  -58.713 -46.934 1.00 33.41  ? 146 ASN A OD1   1 
ATOM   1206 N  ND2   . ASN A 1 146 ? 19.805  -59.091 -48.551 1.00 33.50  ? 146 ASN A ND2   1 
ATOM   1207 N  N     . GLU A 1 147 ? 19.013  -53.530 -47.334 1.00 26.32  ? 147 GLU A N     1 
ATOM   1208 C  CA    . GLU A 1 147 ? 19.348  -52.151 -46.949 1.00 25.75  ? 147 GLU A CA    1 
ATOM   1209 C  C     . GLU A 1 147 ? 18.583  -51.765 -45.685 1.00 24.49  ? 147 GLU A C     1 
ATOM   1210 O  O     . GLU A 1 147 ? 19.134  -51.105 -44.808 1.00 23.98  ? 147 GLU A O     1 
ATOM   1211 C  CB    . GLU A 1 147 ? 19.012  -51.141 -48.053 1.00 25.96  ? 147 GLU A CB    1 
ATOM   1212 C  CG    . GLU A 1 147 ? 19.749  -51.316 -49.398 1.00 28.07  ? 147 GLU A CG    1 
ATOM   1213 C  CD    . GLU A 1 147 ? 21.267  -51.326 -49.279 1.00 32.05  ? 147 GLU A CD    1 
ATOM   1214 O  OE1   . GLU A 1 147 ? 21.821  -50.628 -48.395 1.00 33.64  ? 147 GLU A OE1   1 
ATOM   1215 O  OE2   . GLU A 1 147 ? 21.911  -52.032 -50.095 1.00 33.98  ? 147 GLU A OE2   1 
ATOM   1216 N  N     . VAL A 1 148 ? 17.303  -52.158 -45.621 1.00 24.04  ? 148 VAL A N     1 
ATOM   1217 C  CA    . VAL A 1 148 ? 16.478  -51.897 -44.450 1.00 23.58  ? 148 VAL A CA    1 
ATOM   1218 C  C     . VAL A 1 148 ? 17.064  -52.621 -43.248 1.00 23.61  ? 148 VAL A C     1 
ATOM   1219 O  O     . VAL A 1 148 ? 17.207  -52.027 -42.182 1.00 22.65  ? 148 VAL A O     1 
ATOM   1220 C  CB    . VAL A 1 148 ? 14.990  -52.278 -44.663 1.00 23.02  ? 148 VAL A CB    1 
ATOM   1221 C  CG1   . VAL A 1 148 ? 14.198  -52.083 -43.367 1.00 23.06  ? 148 VAL A CG1   1 
ATOM   1222 C  CG2   . VAL A 1 148 ? 14.371  -51.449 -45.802 1.00 23.64  ? 148 VAL A CG2   1 
ATOM   1223 N  N     . ARG A 1 149 ? 17.429  -53.889 -43.434 1.00 24.38  ? 149 ARG A N     1 
ATOM   1224 C  CA    . ARG A 1 149 ? 17.992  -54.700 -42.342 1.00 25.25  ? 149 ARG A CA    1 
ATOM   1225 C  C     . ARG A 1 149 ? 19.317  -54.151 -41.781 1.00 25.59  ? 149 ARG A C     1 
ATOM   1226 O  O     . ARG A 1 149 ? 19.559  -54.199 -40.572 1.00 25.37  ? 149 ARG A O     1 
ATOM   1227 C  CB    . ARG A 1 149 ? 18.133  -56.165 -42.781 1.00 26.00  ? 149 ARG A CB    1 
ATOM   1228 C  CG    . ARG A 1 149 ? 16.791  -56.864 -42.885 1.00 26.08  ? 149 ARG A CG    1 
ATOM   1229 C  CD    . ARG A 1 149 ? 16.894  -58.184 -43.608 1.00 29.81  ? 149 ARG A CD    1 
ATOM   1230 N  NE    . ARG A 1 149 ? 15.716  -59.031 -43.386 1.00 32.53  ? 149 ARG A NE    1 
ATOM   1231 C  CZ    . ARG A 1 149 ? 15.277  -59.971 -44.229 1.00 32.20  ? 149 ARG A CZ    1 
ATOM   1232 N  NH1   . ARG A 1 149 ? 15.895  -60.183 -45.389 1.00 31.51  ? 149 ARG A NH1   1 
ATOM   1233 N  NH2   . ARG A 1 149 ? 14.206  -60.698 -43.909 1.00 31.69  ? 149 ARG A NH2   1 
ATOM   1234 N  N     . LEU A 1 150 ? 20.164  -53.630 -42.662 1.00 26.15  ? 150 LEU A N     1 
ATOM   1235 C  CA    . LEU A 1 150 ? 21.388  -52.925 -42.245 1.00 25.89  ? 150 LEU A CA    1 
ATOM   1236 C  C     . LEU A 1 150 ? 21.099  -51.694 -41.384 1.00 25.28  ? 150 LEU A C     1 
ATOM   1237 O  O     . LEU A 1 150 ? 21.729  -51.511 -40.352 1.00 25.21  ? 150 LEU A O     1 
ATOM   1238 C  CB    . LEU A 1 150 ? 22.248  -52.544 -43.462 1.00 26.54  ? 150 LEU A CB    1 
ATOM   1239 C  CG    . LEU A 1 150 ? 22.990  -53.653 -44.230 1.00 26.86  ? 150 LEU A CG    1 
ATOM   1240 C  CD1   . LEU A 1 150 ? 23.632  -53.092 -45.494 1.00 30.13  ? 150 LEU A CD1   1 
ATOM   1241 C  CD2   . LEU A 1 150 ? 24.019  -54.447 -43.371 1.00 26.17  ? 150 LEU A CD2   1 
ATOM   1242 N  N     . LEU A 1 151 ? 20.152  -50.857 -41.811 1.00 24.70  ? 151 LEU A N     1 
ATOM   1243 C  CA    . LEU A 1 151 ? 19.782  -49.675 -41.048 1.00 24.37  ? 151 LEU A CA    1 
ATOM   1244 C  C     . LEU A 1 151 ? 19.212  -50.070 -39.678 1.00 24.44  ? 151 LEU A C     1 
ATOM   1245 O  O     . LEU A 1 151 ? 19.636  -49.523 -38.667 1.00 23.55  ? 151 LEU A O     1 
ATOM   1246 C  CB    . LEU A 1 151 ? 18.790  -48.781 -41.816 1.00 24.73  ? 151 LEU A CB    1 
ATOM   1247 C  CG    . LEU A 1 151 ? 18.342  -47.463 -41.150 1.00 23.29  ? 151 LEU A CG    1 
ATOM   1248 C  CD1   . LEU A 1 151 ? 19.529  -46.597 -40.728 1.00 25.06  ? 151 LEU A CD1   1 
ATOM   1249 C  CD2   . LEU A 1 151 ? 17.403  -46.697 -42.056 1.00 23.33  ? 151 LEU A CD2   1 
ATOM   1250 N  N     . LYS A 1 152 ? 18.259  -51.002 -39.658 1.00 24.03  ? 152 LYS A N     1 
ATOM   1251 C  CA    . LYS A 1 152 ? 17.724  -51.551 -38.394 1.00 24.68  ? 152 LYS A CA    1 
ATOM   1252 C  C     . LYS A 1 152 ? 18.817  -52.146 -37.477 1.00 24.82  ? 152 LYS A C     1 
ATOM   1253 O  O     . LYS A 1 152 ? 18.808  -51.911 -36.279 1.00 25.08  ? 152 LYS A O     1 
ATOM   1254 C  CB    . LYS A 1 152 ? 16.679  -52.631 -38.669 1.00 24.47  ? 152 LYS A CB    1 
ATOM   1255 C  CG    . LYS A 1 152 ? 15.454  -52.185 -39.463 1.00 24.11  ? 152 LYS A CG    1 
ATOM   1256 C  CD    . LYS A 1 152 ? 14.366  -53.251 -39.438 1.00 24.16  ? 152 LYS A CD    1 
ATOM   1257 C  CE    . LYS A 1 152 ? 13.085  -52.686 -40.106 1.00 21.69  ? 152 LYS A CE    1 
ATOM   1258 N  NZ    . LYS A 1 152 ? 11.975  -53.677 -40.213 1.00 22.48  ? 152 LYS A NZ    1 
ATOM   1259 N  N     . GLY A 1 153 ? 19.715  -52.954 -38.040 1.00 25.80  ? 153 GLY A N     1 
ATOM   1260 C  CA    . GLY A 1 153 ? 20.817  -53.567 -37.263 1.00 25.94  ? 153 GLY A CA    1 
ATOM   1261 C  C     . GLY A 1 153 ? 21.752  -52.527 -36.668 1.00 26.48  ? 153 GLY A C     1 
ATOM   1262 O  O     . GLY A 1 153 ? 22.152  -52.626 -35.494 1.00 27.24  ? 153 GLY A O     1 
ATOM   1263 N  N     . PHE A 1 154 ? 22.094  -51.536 -37.482 1.00 25.99  ? 154 PHE A N     1 
ATOM   1264 C  CA    . PHE A 1 154 ? 22.913  -50.390 -37.082 1.00 26.13  ? 154 PHE A CA    1 
ATOM   1265 C  C     . PHE A 1 154 ? 22.259  -49.610 -35.909 1.00 25.55  ? 154 PHE A C     1 
ATOM   1266 O  O     . PHE A 1 154 ? 22.918  -49.263 -34.904 1.00 25.06  ? 154 PHE A O     1 
ATOM   1267 C  CB    . PHE A 1 154 ? 23.099  -49.496 -38.320 1.00 25.91  ? 154 PHE A CB    1 
ATOM   1268 C  CG    . PHE A 1 154 ? 24.043  -48.324 -38.126 1.00 26.15  ? 154 PHE A CG    1 
ATOM   1269 C  CD1   . PHE A 1 154 ? 25.417  -48.491 -38.272 1.00 27.42  ? 154 PHE A CD1   1 
ATOM   1270 C  CD2   . PHE A 1 154 ? 23.551  -47.045 -37.845 1.00 27.72  ? 154 PHE A CD2   1 
ATOM   1271 C  CE1   . PHE A 1 154 ? 26.301  -47.411 -38.122 1.00 28.28  ? 154 PHE A CE1   1 
ATOM   1272 C  CE2   . PHE A 1 154 ? 24.430  -45.955 -37.681 1.00 28.78  ? 154 PHE A CE2   1 
ATOM   1273 C  CZ    . PHE A 1 154 ? 25.812  -46.152 -37.826 1.00 28.16  ? 154 PHE A CZ    1 
ATOM   1274 N  N     . LEU A 1 155 ? 20.961  -49.332 -36.035 1.00 25.25  ? 155 LEU A N     1 
ATOM   1275 C  CA    . LEU A 1 155 ? 20.223  -48.620 -34.988 1.00 24.42  ? 155 LEU A CA    1 
ATOM   1276 C  C     . LEU A 1 155 ? 20.130  -49.438 -33.711 1.00 24.82  ? 155 LEU A C     1 
ATOM   1277 O  O     . LEU A 1 155 ? 20.369  -48.942 -32.610 1.00 23.77  ? 155 LEU A O     1 
ATOM   1278 C  CB    . LEU A 1 155 ? 18.798  -48.258 -35.479 1.00 23.73  ? 155 LEU A CB    1 
ATOM   1279 C  CG    . LEU A 1 155 ? 18.843  -47.237 -36.609 1.00 22.60  ? 155 LEU A CG    1 
ATOM   1280 C  CD1   . LEU A 1 155 ? 17.560  -47.216 -37.416 1.00 22.06  ? 155 LEU A CD1   1 
ATOM   1281 C  CD2   . LEU A 1 155 ? 19.161  -45.869 -36.043 1.00 19.41  ? 155 LEU A CD2   1 
ATOM   1282 N  N     . LYS A 1 156 ? 19.762  -50.702 -33.877 1.00 24.84  ? 156 LYS A N     1 
ATOM   1283 C  CA    . LYS A 1 156 ? 19.588  -51.604 -32.759 1.00 25.71  ? 156 LYS A CA    1 
ATOM   1284 C  C     . LYS A 1 156 ? 20.882  -51.792 -31.963 1.00 25.69  ? 156 LYS A C     1 
ATOM   1285 O  O     . LYS A 1 156 ? 20.863  -51.767 -30.716 1.00 25.51  ? 156 LYS A O     1 
ATOM   1286 C  CB    . LYS A 1 156 ? 19.085  -52.945 -33.277 1.00 26.05  ? 156 LYS A CB    1 
ATOM   1287 C  CG    . LYS A 1 156 ? 18.496  -53.876 -32.240 1.00 30.37  ? 156 LYS A CG    1 
ATOM   1288 C  CD    . LYS A 1 156 ? 18.012  -55.126 -32.939 1.00 33.79  ? 156 LYS A CD    1 
ATOM   1289 C  CE    . LYS A 1 156 ? 17.001  -55.908 -32.110 1.00 37.90  ? 156 LYS A CE    1 
ATOM   1290 N  NZ    . LYS A 1 156 ? 17.646  -56.493 -30.901 1.00 40.80  ? 156 LYS A NZ    1 
ATOM   1291 N  N     . ALA A 1 157 ? 21.997  -51.978 -32.672 1.00 24.95  ? 157 ALA A N     1 
ATOM   1292 C  CA    . ALA A 1 157 ? 23.285  -52.173 -32.017 1.00 25.59  ? 157 ALA A CA    1 
ATOM   1293 C  C     . ALA A 1 157 ? 23.690  -50.937 -31.233 1.00 25.98  ? 157 ALA A C     1 
ATOM   1294 O  O     . ALA A 1 157 ? 24.524  -51.013 -30.323 1.00 27.17  ? 157 ALA A O     1 
ATOM   1295 C  CB    . ALA A 1 157 ? 24.352  -52.531 -33.024 1.00 25.81  ? 157 ALA A CB    1 
ATOM   1296 N  N     . ASN A 1 158 ? 23.111  -49.792 -31.586 1.00 24.92  ? 158 ASN A N     1 
ATOM   1297 C  CA    . ASN A 1 158 ? 23.431  -48.544 -30.908 1.00 25.14  ? 158 ASN A CA    1 
ATOM   1298 C  C     . ASN A 1 158 ? 22.313  -48.011 -30.022 1.00 24.72  ? 158 ASN A C     1 
ATOM   1299 O  O     . ASN A 1 158 ? 22.303  -46.825 -29.664 1.00 24.48  ? 158 ASN A O     1 
ATOM   1300 C  CB    . ASN A 1 158 ? 23.893  -47.511 -31.937 1.00 24.99  ? 158 ASN A CB    1 
ATOM   1301 C  CG    . ASN A 1 158 ? 25.256  -47.876 -32.508 1.00 25.52  ? 158 ASN A CG    1 
ATOM   1302 O  OD1   . ASN A 1 158 ? 26.285  -47.742 -31.834 1.00 26.89  ? 158 ASN A OD1   1 
ATOM   1303 N  ND2   . ASN A 1 158 ? 25.265  -48.389 -33.719 1.00 23.26  ? 158 ASN A ND2   1 
ATOM   1304 N  N     . GLY A 1 159 ? 21.386  -48.910 -29.680 1.00 24.20  ? 159 GLY A N     1 
ATOM   1305 C  CA    . GLY A 1 159 ? 20.328  -48.654 -28.702 1.00 24.93  ? 159 GLY A CA    1 
ATOM   1306 C  C     . GLY A 1 159 ? 19.276  -47.619 -29.065 1.00 24.35  ? 159 GLY A C     1 
ATOM   1307 O  O     . GLY A 1 159 ? 18.596  -47.122 -28.183 1.00 24.42  ? 159 GLY A O     1 
ATOM   1308 N  N     . ILE A 1 160 ? 19.134  -47.297 -30.348 1.00 23.90  ? 160 ILE A N     1 
ATOM   1309 C  CA    . ILE A 1 160 ? 18.168  -46.275 -30.783 1.00 24.12  ? 160 ILE A CA    1 
ATOM   1310 C  C     . ILE A 1 160 ? 17.151  -46.809 -31.809 1.00 24.19  ? 160 ILE A C     1 
ATOM   1311 O  O     . ILE A 1 160 ? 16.544  -46.044 -32.578 1.00 24.08  ? 160 ILE A O     1 
ATOM   1312 C  CB    . ILE A 1 160 ? 18.875  -44.952 -31.242 1.00 23.98  ? 160 ILE A CB    1 
ATOM   1313 C  CG1   . ILE A 1 160 ? 19.967  -45.226 -32.293 1.00 25.18  ? 160 ILE A CG1   1 
ATOM   1314 C  CG2   . ILE A 1 160 ? 19.490  -44.254 -30.045 1.00 23.77  ? 160 ILE A CG2   1 
ATOM   1315 C  CD1   . ILE A 1 160 ? 20.428  -43.964 -33.038 1.00 24.82  ? 160 ILE A CD1   1 
ATOM   1316 N  N     . TYR A 1 161 ? 16.970  -48.128 -31.791 1.00 23.84  ? 161 TYR A N     1 
ATOM   1317 C  CA    . TYR A 1 161 ? 15.966  -48.811 -32.599 1.00 24.05  ? 161 TYR A CA    1 
ATOM   1318 C  C     . TYR A 1 161 ? 14.660  -49.082 -31.813 1.00 23.57  ? 161 TYR A C     1 
ATOM   1319 O  O     . TYR A 1 161 ? 14.666  -49.798 -30.795 1.00 23.68  ? 161 TYR A O     1 
ATOM   1320 C  CB    . TYR A 1 161 ? 16.516  -50.133 -33.160 1.00 24.83  ? 161 TYR A CB    1 
ATOM   1321 C  CG    . TYR A 1 161 ? 15.533  -50.760 -34.123 1.00 26.55  ? 161 TYR A CG    1 
ATOM   1322 C  CD1   . TYR A 1 161 ? 15.153  -50.088 -35.290 1.00 26.98  ? 161 TYR A CD1   1 
ATOM   1323 C  CD2   . TYR A 1 161 ? 14.943  -51.991 -33.849 1.00 28.20  ? 161 TYR A CD2   1 
ATOM   1324 C  CE1   . TYR A 1 161 ? 14.226  -50.624 -36.161 1.00 26.76  ? 161 TYR A CE1   1 
ATOM   1325 C  CE2   . TYR A 1 161 ? 13.996  -52.546 -34.731 1.00 28.15  ? 161 TYR A CE2   1 
ATOM   1326 C  CZ    . TYR A 1 161 ? 13.656  -51.852 -35.873 1.00 26.71  ? 161 TYR A CZ    1 
ATOM   1327 O  OH    . TYR A 1 161 ? 12.751  -52.395 -36.740 1.00 27.64  ? 161 TYR A OH    1 
ATOM   1328 N  N     . GLY A 1 162 ? 13.556  -48.518 -32.311 1.00 23.07  ? 162 GLY A N     1 
ATOM   1329 C  CA    . GLY A 1 162 ? 12.227  -48.631 -31.705 1.00 21.54  ? 162 GLY A CA    1 
ATOM   1330 C  C     . GLY A 1 162 ? 11.702  -47.274 -31.271 1.00 21.98  ? 162 GLY A C     1 
ATOM   1331 O  O     . GLY A 1 162 ? 12.447  -46.467 -30.706 1.00 21.43  ? 162 GLY A O     1 
ATOM   1332 N  N     . ALA A 1 163 ? 10.415  -47.025 -31.513 1.00 21.33  ? 163 ALA A N     1 
ATOM   1333 C  CA    . ALA A 1 163 ? 9.784   -45.737 -31.180 1.00 21.26  ? 163 ALA A CA    1 
ATOM   1334 C  C     . ALA A 1 163 ? 9.085   -45.729 -29.808 1.00 21.13  ? 163 ALA A C     1 
ATOM   1335 O  O     . ALA A 1 163 ? 8.583   -44.694 -29.371 1.00 21.16  ? 163 ALA A O     1 
ATOM   1336 C  CB    . ALA A 1 163 ? 8.793   -45.328 -32.279 1.00 20.64  ? 163 ALA A CB    1 
ATOM   1337 N  N     . GLU A 1 164 ? 9.041   -46.891 -29.150 1.00 20.98  ? 164 GLU A N     1 
ATOM   1338 C  CA    . GLU A 1 164 ? 8.423   -47.024 -27.833 1.00 21.39  ? 164 GLU A CA    1 
ATOM   1339 C  C     . GLU A 1 164 ? 9.117   -46.129 -26.792 1.00 21.84  ? 164 GLU A C     1 
ATOM   1340 O  O     . GLU A 1 164 ? 10.314  -45.792 -26.953 1.00 21.18  ? 164 GLU A O     1 
ATOM   1341 C  CB    . GLU A 1 164 ? 8.377   -48.493 -27.386 1.00 22.12  ? 164 GLU A CB    1 
ATOM   1342 C  CG    . GLU A 1 164 ? 9.717   -49.162 -27.076 1.00 21.59  ? 164 GLU A CG    1 
ATOM   1343 C  CD    . GLU A 1 164 ? 10.380  -49.834 -28.271 1.00 25.43  ? 164 GLU A CD    1 
ATOM   1344 O  OE1   . GLU A 1 164 ? 11.164  -50.782 -28.037 1.00 25.31  ? 164 GLU A OE1   1 
ATOM   1345 O  OE2   . GLU A 1 164 ? 10.142  -49.424 -29.433 1.00 27.78  ? 164 GLU A OE2   1 
ATOM   1346 N  N     . TYR A 1 165 ? 8.362   -45.716 -25.761 1.00 21.81  ? 165 TYR A N     1 
ATOM   1347 C  CA    . TYR A 1 165 ? 8.888   -44.782 -24.744 1.00 22.97  ? 165 TYR A CA    1 
ATOM   1348 C  C     . TYR A 1 165 ? 10.202  -45.205 -24.100 1.00 22.53  ? 165 TYR A C     1 
ATOM   1349 O  O     . TYR A 1 165 ? 11.013  -44.351 -23.747 1.00 23.38  ? 165 TYR A O     1 
ATOM   1350 C  CB    . TYR A 1 165 ? 7.834   -44.379 -23.680 1.00 23.18  ? 165 TYR A CB    1 
ATOM   1351 C  CG    . TYR A 1 165 ? 6.911   -43.295 -24.214 1.00 23.70  ? 165 TYR A CG    1 
ATOM   1352 C  CD1   . TYR A 1 165 ? 5.538   -43.505 -24.348 1.00 24.23  ? 165 TYR A CD1   1 
ATOM   1353 C  CD2   . TYR A 1 165 ? 7.430   -42.070 -24.612 1.00 24.05  ? 165 TYR A CD2   1 
ATOM   1354 C  CE1   . TYR A 1 165 ? 4.712   -42.511 -24.859 1.00 25.30  ? 165 TYR A CE1   1 
ATOM   1355 C  CE2   . TYR A 1 165 ? 6.626   -41.082 -25.116 1.00 23.75  ? 165 TYR A CE2   1 
ATOM   1356 C  CZ    . TYR A 1 165 ? 5.265   -41.310 -25.277 1.00 25.11  ? 165 TYR A CZ    1 
ATOM   1357 O  OH    . TYR A 1 165 ? 4.501   -40.286 -25.802 1.00 25.78  ? 165 TYR A OH    1 
ATOM   1358 N  N     . LYS A 1 166 ? 10.410  -46.506 -23.964 1.00 22.38  ? 166 LYS A N     1 
ATOM   1359 C  CA    . LYS A 1 166 ? 11.635  -47.026 -23.361 1.00 24.18  ? 166 LYS A CA    1 
ATOM   1360 C  C     . LYS A 1 166 ? 12.876  -46.713 -24.188 1.00 23.25  ? 166 LYS A C     1 
ATOM   1361 O  O     . LYS A 1 166 ? 13.984  -46.633 -23.649 1.00 23.21  ? 166 LYS A O     1 
ATOM   1362 C  CB    . LYS A 1 166 ? 11.520  -48.534 -23.079 1.00 23.81  ? 166 LYS A CB    1 
ATOM   1363 C  CG    . LYS A 1 166 ? 12.731  -49.115 -22.353 1.00 26.70  ? 166 LYS A CG    1 
ATOM   1364 C  CD    . LYS A 1 166 ? 12.685  -50.646 -22.261 1.00 26.59  ? 166 LYS A CD    1 
ATOM   1365 C  CE    . LYS A 1 166 ? 13.659  -51.125 -21.197 1.00 31.03  ? 166 LYS A CE    1 
ATOM   1366 N  NZ    . LYS A 1 166 ? 13.731  -52.619 -21.148 1.00 32.10  ? 166 LYS A NZ    1 
ATOM   1367 N  N     . VAL A 1 167 ? 12.682  -46.521 -25.497 1.00 23.67  ? 167 VAL A N     1 
ATOM   1368 C  CA    . VAL A 1 167 ? 13.774  -46.225 -26.435 1.00 22.82  ? 167 VAL A CA    1 
ATOM   1369 C  C     . VAL A 1 167 ? 13.725  -44.794 -26.978 1.00 22.88  ? 167 VAL A C     1 
ATOM   1370 O  O     . VAL A 1 167 ? 14.762  -44.147 -27.052 1.00 22.48  ? 167 VAL A O     1 
ATOM   1371 C  CB    . VAL A 1 167 ? 13.834  -47.239 -27.604 1.00 22.38  ? 167 VAL A CB    1 
ATOM   1372 C  CG1   . VAL A 1 167 ? 14.985  -46.885 -28.600 1.00 20.79  ? 167 VAL A CG1   1 
ATOM   1373 C  CG2   . VAL A 1 167 ? 14.005  -48.657 -27.067 1.00 23.08  ? 167 VAL A CG2   1 
ATOM   1374 N  N     . ARG A 1 168 ? 12.538  -44.298 -27.351 1.00 22.56  ? 168 ARG A N     1 
ATOM   1375 C  CA    . ARG A 1 168 ? 12.425  -42.972 -28.028 1.00 21.95  ? 168 ARG A CA    1 
ATOM   1376 C  C     . ARG A 1 168 ? 13.373  -42.857 -29.254 1.00 21.74  ? 168 ARG A C     1 
ATOM   1377 O  O     . ARG A 1 168 ? 14.072  -41.833 -29.458 1.00 19.58  ? 168 ARG A O     1 
ATOM   1378 C  CB    . ARG A 1 168 ? 12.607  -41.792 -27.036 1.00 22.91  ? 168 ARG A CB    1 
ATOM   1379 C  CG    . ARG A 1 168 ? 11.474  -41.626 -25.946 1.00 22.57  ? 168 ARG A CG    1 
ATOM   1380 C  CD    . ARG A 1 168 ? 11.729  -40.375 -25.064 1.00 24.97  ? 168 ARG A CD    1 
ATOM   1381 N  NE    . ARG A 1 168 ? 10.739  -40.127 -23.990 1.00 26.18  ? 168 ARG A NE    1 
ATOM   1382 C  CZ    . ARG A 1 168 ? 9.666   -39.340 -24.101 1.00 25.80  ? 168 ARG A CZ    1 
ATOM   1383 N  NH1   . ARG A 1 168 ? 9.411   -38.716 -25.252 1.00 25.00  ? 168 ARG A NH1   1 
ATOM   1384 N  NH2   . ARG A 1 168 ? 8.844   -39.170 -23.058 1.00 23.64  ? 168 ARG A NH2   1 
ATOM   1385 N  N     . GLY A 1 169 ? 13.354  -43.910 -30.080 1.00 20.79  ? 169 GLY A N     1 
ATOM   1386 C  CA    . GLY A 1 169 ? 14.215  -44.016 -31.244 1.00 21.18  ? 169 GLY A CA    1 
ATOM   1387 C  C     . GLY A 1 169 ? 13.447  -44.132 -32.545 1.00 20.85  ? 169 GLY A C     1 
ATOM   1388 O  O     . GLY A 1 169 ? 12.364  -43.546 -32.689 1.00 20.68  ? 169 GLY A O     1 
ATOM   1389 N  N     . PHE A 1 170 ? 14.037  -44.864 -33.489 1.00 21.44  ? 170 PHE A N     1 
ATOM   1390 C  CA    . PHE A 1 170 ? 13.556  -45.049 -34.863 1.00 21.47  ? 170 PHE A CA    1 
ATOM   1391 C  C     . PHE A 1 170 ? 12.745  -46.334 -34.974 1.00 22.01  ? 170 PHE A C     1 
ATOM   1392 O  O     . PHE A 1 170 ? 13.280  -47.415 -34.679 1.00 22.17  ? 170 PHE A O     1 
ATOM   1393 C  CB    . PHE A 1 170 ? 14.752  -45.199 -35.840 1.00 22.23  ? 170 PHE A CB    1 
ATOM   1394 C  CG    . PHE A 1 170 ? 15.611  -43.960 -35.993 1.00 21.56  ? 170 PHE A CG    1 
ATOM   1395 C  CD1   . PHE A 1 170 ? 16.477  -43.565 -34.992 1.00 22.84  ? 170 PHE A CD1   1 
ATOM   1396 C  CD2   . PHE A 1 170 ? 15.600  -43.240 -37.184 1.00 23.79  ? 170 PHE A CD2   1 
ATOM   1397 C  CE1   . PHE A 1 170 ? 17.296  -42.421 -35.149 1.00 24.29  ? 170 PHE A CE1   1 
ATOM   1398 C  CE2   . PHE A 1 170 ? 16.410  -42.099 -37.353 1.00 24.86  ? 170 PHE A CE2   1 
ATOM   1399 C  CZ    . PHE A 1 170 ? 17.255  -41.689 -36.330 1.00 23.90  ? 170 PHE A CZ    1 
ATOM   1400 N  N     . SER A 1 171 ? 11.479  -46.230 -35.400 1.00 20.45  ? 171 SER A N     1 
ATOM   1401 C  CA    . SER A 1 171 ? 10.667  -47.418 -35.680 1.00 21.17  ? 171 SER A CA    1 
ATOM   1402 C  C     . SER A 1 171 ? 11.163  -48.165 -36.926 1.00 20.56  ? 171 SER A C     1 
ATOM   1403 O  O     . SER A 1 171 ? 11.809  -47.579 -37.770 1.00 19.69  ? 171 SER A O     1 
ATOM   1404 C  CB    . SER A 1 171 ? 9.194   -47.023 -35.887 1.00 21.20  ? 171 SER A CB    1 
ATOM   1405 O  OG    . SER A 1 171 ? 8.987   -46.193 -37.033 1.00 21.63  ? 171 SER A OG    1 
ATOM   1406 N  N     . GLY A 1 172 ? 10.826  -49.449 -37.036 1.00 21.40  ? 172 GLY A N     1 
ATOM   1407 C  CA    . GLY A 1 172 ? 10.977  -50.180 -38.302 1.00 21.77  ? 172 GLY A CA    1 
ATOM   1408 C  C     . GLY A 1 172 ? 10.415  -49.436 -39.502 1.00 21.94  ? 172 GLY A C     1 
ATOM   1409 O  O     . GLY A 1 172 ? 11.104  -49.266 -40.517 1.00 22.26  ? 172 GLY A O     1 
ATOM   1410 N  N     . TYR A 1 173 ? 9.168   -48.978 -39.402 1.00 21.86  ? 173 TYR A N     1 
ATOM   1411 C  CA    . TYR A 1 173 ? 8.529   -48.309 -40.528 1.00 22.22  ? 173 TYR A CA    1 
ATOM   1412 C  C     . TYR A 1 173 ? 9.330   -47.077 -40.964 1.00 22.34  ? 173 TYR A C     1 
ATOM   1413 O  O     . TYR A 1 173 ? 9.510   -46.843 -42.161 1.00 22.09  ? 173 TYR A O     1 
ATOM   1414 C  CB    . TYR A 1 173 ? 7.069   -47.954 -40.201 1.00 21.84  ? 173 TYR A CB    1 
ATOM   1415 C  CG    . TYR A 1 173 ? 6.317   -47.174 -41.284 1.00 22.64  ? 173 TYR A CG    1 
ATOM   1416 C  CD1   . TYR A 1 173 ? 6.143   -47.693 -42.572 1.00 21.72  ? 173 TYR A CD1   1 
ATOM   1417 C  CD2   . TYR A 1 173 ? 5.736   -45.931 -40.994 1.00 23.41  ? 173 TYR A CD2   1 
ATOM   1418 C  CE1   . TYR A 1 173 ? 5.443   -46.971 -43.559 1.00 21.53  ? 173 TYR A CE1   1 
ATOM   1419 C  CE2   . TYR A 1 173 ? 5.048   -45.199 -41.986 1.00 22.56  ? 173 TYR A CE2   1 
ATOM   1420 C  CZ    . TYR A 1 173 ? 4.904   -45.743 -43.266 1.00 21.81  ? 173 TYR A CZ    1 
ATOM   1421 O  OH    . TYR A 1 173 ? 4.190   -45.039 -44.226 1.00 22.16  ? 173 TYR A OH    1 
ATOM   1422 N  N     . LEU A 1 174 ? 9.798   -46.300 -39.990 1.00 22.11  ? 174 LEU A N     1 
ATOM   1423 C  CA    . LEU A 1 174 ? 10.660  -45.136 -40.283 1.00 22.19  ? 174 LEU A CA    1 
ATOM   1424 C  C     . LEU A 1 174 ? 11.894  -45.589 -41.071 1.00 22.56  ? 174 LEU A C     1 
ATOM   1425 O  O     . LEU A 1 174 ? 12.273  -44.950 -42.052 1.00 21.95  ? 174 LEU A O     1 
ATOM   1426 C  CB    . LEU A 1 174 ? 11.082  -44.412 -38.999 1.00 22.49  ? 174 LEU A CB    1 
ATOM   1427 C  CG    . LEU A 1 174 ? 12.062  -43.228 -39.108 1.00 22.87  ? 174 LEU A CG    1 
ATOM   1428 C  CD1   . LEU A 1 174 ? 11.555  -42.248 -40.112 1.00 21.09  ? 174 LEU A CD1   1 
ATOM   1429 C  CD2   . LEU A 1 174 ? 12.266  -42.560 -37.723 1.00 22.69  ? 174 LEU A CD2   1 
ATOM   1430 N  N     . CYS A 1 175 ? 12.495  -46.709 -40.664 1.00 22.00  ? 175 CYS A N     1 
ATOM   1431 C  CA    . CYS A 1 175 ? 13.648  -47.234 -41.402 1.00 22.82  ? 175 CYS A CA    1 
ATOM   1432 C  C     . CYS A 1 175 ? 13.326  -47.526 -42.861 1.00 22.59  ? 175 CYS A C     1 
ATOM   1433 O  O     . CYS A 1 175 ? 14.105  -47.181 -43.757 1.00 21.82  ? 175 CYS A O     1 
ATOM   1434 C  CB    . CYS A 1 175 ? 14.237  -48.470 -40.721 1.00 23.22  ? 175 CYS A CB    1 
ATOM   1435 S  SG    . CYS A 1 175 ? 14.961  -48.119 -39.108 1.00 24.63  ? 175 CYS A SG    1 
ATOM   1436 N  N     . GLU A 1 176 ? 12.181  -48.160 -43.095 1.00 23.15  ? 176 GLU A N     1 
ATOM   1437 C  CA    . GLU A 1 176 ? 11.738  -48.477 -44.445 1.00 23.49  ? 176 GLU A CA    1 
ATOM   1438 C  C     . GLU A 1 176 ? 11.538  -47.215 -45.264 1.00 23.76  ? 176 GLU A C     1 
ATOM   1439 O  O     . GLU A 1 176 ? 11.997  -47.135 -46.414 1.00 24.64  ? 176 GLU A O     1 
ATOM   1440 C  CB    . GLU A 1 176 ? 10.469  -49.330 -44.401 1.00 23.56  ? 176 GLU A CB    1 
ATOM   1441 C  CG    . GLU A 1 176 ? 10.795  -50.764 -44.011 1.00 23.70  ? 176 GLU A CG    1 
ATOM   1442 C  CD    . GLU A 1 176 ? 9.613   -51.596 -43.589 1.00 24.49  ? 176 GLU A CD    1 
ATOM   1443 O  OE1   . GLU A 1 176 ? 9.499   -52.740 -44.097 1.00 26.40  ? 176 GLU A OE1   1 
ATOM   1444 O  OE2   . GLU A 1 176 ? 8.810   -51.139 -42.750 1.00 23.54  ? 176 GLU A OE2   1 
ATOM   1445 N  N     . LEU A 1 177 ? 10.896  -46.221 -44.669 1.00 22.85  ? 177 LEU A N     1 
ATOM   1446 C  CA    . LEU A 1 177 ? 10.695  -44.953 -45.363 1.00 22.75  ? 177 LEU A CA    1 
ATOM   1447 C  C     . LEU A 1 177 ? 12.011  -44.298 -45.765 1.00 23.32  ? 177 LEU A C     1 
ATOM   1448 O  O     . LEU A 1 177 ? 12.124  -43.785 -46.876 1.00 24.13  ? 177 LEU A O     1 
ATOM   1449 C  CB    . LEU A 1 177 ? 9.873   -43.984 -44.522 1.00 22.22  ? 177 LEU A CB    1 
ATOM   1450 C  CG    . LEU A 1 177 ? 8.421   -44.365 -44.287 1.00 21.66  ? 177 LEU A CG    1 
ATOM   1451 C  CD1   . LEU A 1 177 ? 7.774   -43.214 -43.570 1.00 21.19  ? 177 LEU A CD1   1 
ATOM   1452 C  CD2   . LEU A 1 177 ? 7.699   -44.700 -45.662 1.00 20.22  ? 177 LEU A CD2   1 
ATOM   1453 N  N     . LEU A 1 178 ? 12.982  -44.291 -44.849 1.00 22.82  ? 178 LEU A N     1 
ATOM   1454 C  CA    . LEU A 1 178 ? 14.324  -43.719 -45.114 1.00 22.99  ? 178 LEU A CA    1 
ATOM   1455 C  C     . LEU A 1 178 ? 15.018  -44.402 -46.276 1.00 23.57  ? 178 LEU A C     1 
ATOM   1456 O  O     . LEU A 1 178 ? 15.653  -43.749 -47.107 1.00 22.77  ? 178 LEU A O     1 
ATOM   1457 C  CB    . LEU A 1 178 ? 15.211  -43.829 -43.868 1.00 22.67  ? 178 LEU A CB    1 
ATOM   1458 C  CG    . LEU A 1 178 ? 14.739  -43.006 -42.665 1.00 23.50  ? 178 LEU A CG    1 
ATOM   1459 C  CD1   . LEU A 1 178 ? 15.534  -43.343 -41.394 1.00 22.16  ? 178 LEU A CD1   1 
ATOM   1460 C  CD2   . LEU A 1 178 ? 14.771  -41.499 -43.016 1.00 24.43  ? 178 LEU A CD2   1 
ATOM   1461 N  N     . ILE A 1 179 ? 14.900  -45.728 -46.311 1.00 23.14  ? 179 ILE A N     1 
ATOM   1462 C  CA    . ILE A 1 179 ? 15.522  -46.530 -47.356 1.00 24.70  ? 179 ILE A CA    1 
ATOM   1463 C  C     . ILE A 1 179 ? 14.857  -46.264 -48.694 1.00 24.90  ? 179 ILE A C     1 
ATOM   1464 O  O     . ILE A 1 179 ? 15.540  -46.206 -49.725 1.00 26.45  ? 179 ILE A O     1 
ATOM   1465 C  CB    . ILE A 1 179 ? 15.520  -48.039 -47.014 1.00 23.98  ? 179 ILE A CB    1 
ATOM   1466 C  CG1   . ILE A 1 179 ? 16.480  -48.298 -45.835 1.00 25.11  ? 179 ILE A CG1   1 
ATOM   1467 C  CG2   . ILE A 1 179 ? 15.881  -48.917 -48.255 1.00 26.07  ? 179 ILE A CG2   1 
ATOM   1468 C  CD1   . ILE A 1 179 ? 17.862  -47.606 -45.969 1.00 24.48  ? 179 ILE A CD1   1 
ATOM   1469 N  N     . VAL A 1 180 ? 13.541  -46.086 -48.692 1.00 24.05  ? 180 VAL A N     1 
ATOM   1470 C  CA    . VAL A 1 180 ? 12.870  -45.698 -49.937 1.00 25.02  ? 180 VAL A CA    1 
ATOM   1471 C  C     . VAL A 1 180 ? 13.339  -44.311 -50.378 1.00 24.54  ? 180 VAL A C     1 
ATOM   1472 O  O     . VAL A 1 180 ? 13.614  -44.093 -51.553 1.00 25.31  ? 180 VAL A O     1 
ATOM   1473 C  CB    . VAL A 1 180 ? 11.336  -45.752 -49.824 1.00 23.89  ? 180 VAL A CB    1 
ATOM   1474 C  CG1   . VAL A 1 180 ? 10.686  -45.116 -51.081 1.00 26.22  ? 180 VAL A CG1   1 
ATOM   1475 C  CG2   . VAL A 1 180 ? 10.888  -47.209 -49.661 1.00 24.31  ? 180 VAL A CG2   1 
ATOM   1476 N  N     . PHE A 1 181 ? 13.441  -43.387 -49.430 1.00 24.12  ? 181 PHE A N     1 
ATOM   1477 C  CA    . PHE A 1 181 ? 13.821  -41.991 -49.732 1.00 24.27  ? 181 PHE A CA    1 
ATOM   1478 C  C     . PHE A 1 181 ? 15.264  -41.812 -50.277 1.00 25.51  ? 181 PHE A C     1 
ATOM   1479 O  O     . PHE A 1 181 ? 15.488  -41.044 -51.247 1.00 24.84  ? 181 PHE A O     1 
ATOM   1480 C  CB    . PHE A 1 181 ? 13.613  -41.115 -48.494 1.00 23.70  ? 181 PHE A CB    1 
ATOM   1481 C  CG    . PHE A 1 181 ? 13.705  -39.637 -48.773 1.00 24.13  ? 181 PHE A CG    1 
ATOM   1482 C  CD1   . PHE A 1 181 ? 12.635  -38.961 -49.341 1.00 24.59  ? 181 PHE A CD1   1 
ATOM   1483 C  CD2   . PHE A 1 181 ? 14.857  -38.930 -48.455 1.00 24.53  ? 181 PHE A CD2   1 
ATOM   1484 C  CE1   . PHE A 1 181 ? 12.707  -37.583 -49.618 1.00 26.00  ? 181 PHE A CE1   1 
ATOM   1485 C  CE2   . PHE A 1 181 ? 14.945  -37.552 -48.724 1.00 28.10  ? 181 PHE A CE2   1 
ATOM   1486 C  CZ    . PHE A 1 181 ? 13.860  -36.888 -49.328 1.00 26.16  ? 181 PHE A CZ    1 
ATOM   1487 N  N     . TYR A 1 182 ? 16.216  -42.519 -49.650 1.00 25.29  ? 182 TYR A N     1 
ATOM   1488 C  CA    . TYR A 1 182 ? 17.642  -42.388 -49.953 1.00 25.94  ? 182 TYR A CA    1 
ATOM   1489 C  C     . TYR A 1 182 ? 18.179  -43.493 -50.853 1.00 26.71  ? 182 TYR A C     1 
ATOM   1490 O  O     . TYR A 1 182 ? 19.209  -43.303 -51.496 1.00 28.00  ? 182 TYR A O     1 
ATOM   1491 C  CB    . TYR A 1 182 ? 18.488  -42.290 -48.669 1.00 25.41  ? 182 TYR A CB    1 
ATOM   1492 C  CG    . TYR A 1 182 ? 18.305  -40.998 -47.889 1.00 24.58  ? 182 TYR A CG    1 
ATOM   1493 C  CD1   . TYR A 1 182 ? 18.713  -39.768 -48.429 1.00 24.98  ? 182 TYR A CD1   1 
ATOM   1494 C  CD2   . TYR A 1 182 ? 17.746  -41.011 -46.599 1.00 24.92  ? 182 TYR A CD2   1 
ATOM   1495 C  CE1   . TYR A 1 182 ? 18.538  -38.594 -47.731 1.00 24.74  ? 182 TYR A CE1   1 
ATOM   1496 C  CE2   . TYR A 1 182 ? 17.573  -39.816 -45.870 1.00 23.25  ? 182 TYR A CE2   1 
ATOM   1497 C  CZ    . TYR A 1 182 ? 17.979  -38.627 -46.449 1.00 23.95  ? 182 TYR A CZ    1 
ATOM   1498 O  OH    . TYR A 1 182 ? 17.817  -37.458 -45.774 1.00 25.97  ? 182 TYR A OH    1 
ATOM   1499 N  N     . GLY A 1 183 ? 17.493  -44.636 -50.892 1.00 26.69  ? 183 GLY A N     1 
ATOM   1500 C  CA    . GLY A 1 183 ? 17.847  -45.726 -51.793 1.00 28.04  ? 183 GLY A CA    1 
ATOM   1501 C  C     . GLY A 1 183 ? 18.652  -46.860 -51.186 1.00 28.17  ? 183 GLY A C     1 
ATOM   1502 O  O     . GLY A 1 183 ? 18.627  -47.983 -51.687 1.00 28.92  ? 183 GLY A O     1 
ATOM   1503 N  N     . SER A 1 184 ? 19.387  -46.564 -50.121 1.00 28.10  ? 184 SER A N     1 
ATOM   1504 C  CA    . SER A 1 184 ? 20.322  -47.525 -49.530 1.00 28.01  ? 184 SER A CA    1 
ATOM   1505 C  C     . SER A 1 184 ? 20.682  -47.116 -48.106 1.00 27.15  ? 184 SER A C     1 
ATOM   1506 O  O     . SER A 1 184 ? 20.479  -45.958 -47.709 1.00 27.06  ? 184 SER A O     1 
ATOM   1507 C  CB    . SER A 1 184 ? 21.588  -47.690 -50.415 1.00 28.95  ? 184 SER A CB    1 
ATOM   1508 O  OG    . SER A 1 184 ? 22.422  -46.550 -50.321 1.00 28.35  ? 184 SER A OG    1 
ATOM   1509 N  N     . PHE A 1 185 ? 21.199  -48.073 -47.339 1.00 27.47  ? 185 PHE A N     1 
ATOM   1510 C  CA    . PHE A 1 185 ? 21.742  -47.808 -46.008 1.00 27.08  ? 185 PHE A CA    1 
ATOM   1511 C  C     . PHE A 1 185 ? 22.842  -46.749 -46.112 1.00 27.32  ? 185 PHE A C     1 
ATOM   1512 O  O     . PHE A 1 185 ? 22.812  -45.769 -45.392 1.00 26.11  ? 185 PHE A O     1 
ATOM   1513 C  CB    . PHE A 1 185 ? 22.314  -49.089 -45.370 1.00 27.26  ? 185 PHE A CB    1 
ATOM   1514 C  CG    . PHE A 1 185 ? 23.138  -48.837 -44.128 1.00 28.69  ? 185 PHE A CG    1 
ATOM   1515 C  CD1   . PHE A 1 185 ? 24.535  -48.985 -44.148 1.00 30.17  ? 185 PHE A CD1   1 
ATOM   1516 C  CD2   . PHE A 1 185 ? 22.526  -48.443 -42.934 1.00 28.43  ? 185 PHE A CD2   1 
ATOM   1517 C  CE1   . PHE A 1 185 ? 25.294  -48.742 -43.001 1.00 27.56  ? 185 PHE A CE1   1 
ATOM   1518 C  CE2   . PHE A 1 185 ? 23.284  -48.204 -41.776 1.00 25.60  ? 185 PHE A CE2   1 
ATOM   1519 C  CZ    . PHE A 1 185 ? 24.663  -48.338 -41.810 1.00 27.67  ? 185 PHE A CZ    1 
ATOM   1520 N  N     . LEU A 1 186 ? 23.791  -46.960 -47.029 1.00 28.59  ? 186 LEU A N     1 
ATOM   1521 C  CA    . LEU A 1 186 ? 24.966  -46.098 -47.156 1.00 29.40  ? 186 LEU A CA    1 
ATOM   1522 C  C     . LEU A 1 186 ? 24.575  -44.650 -47.458 1.00 29.22  ? 186 LEU A C     1 
ATOM   1523 O  O     . LEU A 1 186 ? 25.077  -43.716 -46.816 1.00 28.97  ? 186 LEU A O     1 
ATOM   1524 C  CB    . LEU A 1 186 ? 25.928  -46.657 -48.215 1.00 31.44  ? 186 LEU A CB    1 
ATOM   1525 C  CG    . LEU A 1 186 ? 27.339  -46.049 -48.253 1.00 32.84  ? 186 LEU A CG    1 
ATOM   1526 C  CD1   . LEU A 1 186 ? 28.010  -46.142 -46.870 1.00 35.07  ? 186 LEU A CD1   1 
ATOM   1527 C  CD2   . LEU A 1 186 ? 28.200  -46.713 -49.315 1.00 33.91  ? 186 LEU A CD2   1 
ATOM   1528 N  N     . GLU A 1 187 ? 23.662  -44.468 -48.416 1.00 29.13  ? 187 GLU A N     1 
ATOM   1529 C  CA    . GLU A 1 187 ? 23.119  -43.142 -48.731 1.00 29.04  ? 187 GLU A CA    1 
ATOM   1530 C  C     . GLU A 1 187 ? 22.365  -42.476 -47.571 1.00 27.65  ? 187 GLU A C     1 
ATOM   1531 O  O     . GLU A 1 187 ? 22.459  -41.258 -47.405 1.00 27.31  ? 187 GLU A O     1 
ATOM   1532 C  CB    . GLU A 1 187 ? 22.230  -43.192 -49.980 1.00 29.83  ? 187 GLU A CB    1 
ATOM   1533 C  CG    . GLU A 1 187 ? 23.009  -43.309 -51.286 1.00 33.54  ? 187 GLU A CG    1 
ATOM   1534 C  CD    . GLU A 1 187 ? 23.981  -42.156 -51.486 1.00 39.50  ? 187 GLU A CD    1 
ATOM   1535 O  OE1   . GLU A 1 187 ? 23.530  -40.981 -51.490 1.00 40.01  ? 187 GLU A OE1   1 
ATOM   1536 O  OE2   . GLU A 1 187 ? 25.195  -42.434 -51.637 1.00 42.05  ? 187 GLU A OE2   1 
ATOM   1537 N  N     . THR A 1 188 ? 21.612  -43.264 -46.796 1.00 26.20  ? 188 THR A N     1 
ATOM   1538 C  CA    . THR A 1 188 ? 20.880  -42.744 -45.636 1.00 25.52  ? 188 THR A CA    1 
ATOM   1539 C  C     . THR A 1 188 ? 21.897  -42.176 -44.629 1.00 25.25  ? 188 THR A C     1 
ATOM   1540 O  O     . THR A 1 188 ? 21.776  -41.039 -44.165 1.00 25.68  ? 188 THR A O     1 
ATOM   1541 C  CB    . THR A 1 188 ? 19.985  -43.838 -44.956 1.00 24.17  ? 188 THR A CB    1 
ATOM   1542 O  OG1   . THR A 1 188 ? 19.027  -44.358 -45.889 1.00 26.00  ? 188 THR A OG1   1 
ATOM   1543 C  CG2   . THR A 1 188 ? 19.223  -43.275 -43.747 1.00 24.44  ? 188 THR A CG2   1 
ATOM   1544 N  N     . VAL A 1 189 ? 22.908  -42.979 -44.328 1.00 25.67  ? 189 VAL A N     1 
ATOM   1545 C  CA    . VAL A 1 189 ? 23.945  -42.637 -43.362 1.00 26.82  ? 189 VAL A CA    1 
ATOM   1546 C  C     . VAL A 1 189 ? 24.704  -41.395 -43.810 1.00 27.01  ? 189 VAL A C     1 
ATOM   1547 O  O     . VAL A 1 189 ? 24.945  -40.508 -43.007 1.00 27.03  ? 189 VAL A O     1 
ATOM   1548 C  CB    . VAL A 1 189 ? 24.909  -43.843 -43.149 1.00 26.85  ? 189 VAL A CB    1 
ATOM   1549 C  CG1   . VAL A 1 189 ? 26.236  -43.403 -42.553 1.00 29.80  ? 189 VAL A CG1   1 
ATOM   1550 C  CG2   . VAL A 1 189 ? 24.244  -44.892 -42.266 1.00 27.16  ? 189 VAL A CG2   1 
ATOM   1551 N  N     . LYS A 1 190 ? 25.027  -41.323 -45.104 1.00 28.32  ? 190 LYS A N     1 
ATOM   1552 C  CA    . LYS A 1 190 ? 25.779  -40.198 -45.649 1.00 29.43  ? 190 LYS A CA    1 
ATOM   1553 C  C     . LYS A 1 190 ? 24.972  -38.915 -45.575 1.00 28.87  ? 190 LYS A C     1 
ATOM   1554 O  O     . LYS A 1 190 ? 25.516  -37.852 -45.267 1.00 29.87  ? 190 LYS A O     1 
ATOM   1555 C  CB    . LYS A 1 190 ? 26.204  -40.453 -47.090 1.00 30.15  ? 190 LYS A CB    1 
ATOM   1556 C  CG    . LYS A 1 190 ? 27.306  -41.477 -47.237 1.00 32.13  ? 190 LYS A CG    1 
ATOM   1557 C  CD    . LYS A 1 190 ? 27.403  -41.984 -48.668 1.00 36.32  ? 190 LYS A CD    1 
ATOM   1558 C  CE    . LYS A 1 190 ? 27.776  -40.872 -49.633 1.00 39.87  ? 190 LYS A CE    1 
ATOM   1559 N  NZ    . LYS A 1 190 ? 29.008  -40.145 -49.171 1.00 44.81  ? 190 LYS A NZ    1 
ATOM   1560 N  N     . ASN A 1 191 ? 23.684  -39.006 -45.878 1.00 27.76  ? 191 ASN A N     1 
ATOM   1561 C  CA    . ASN A 1 191 ? 22.834  -37.828 -45.820 1.00 28.08  ? 191 ASN A CA    1 
ATOM   1562 C  C     . ASN A 1 191 ? 22.447  -37.403 -44.379 1.00 27.42  ? 191 ASN A C     1 
ATOM   1563 O  O     . ASN A 1 191 ? 22.353  -36.205 -44.084 1.00 27.55  ? 191 ASN A O     1 
ATOM   1564 C  CB    . ASN A 1 191 ? 21.627  -38.007 -46.744 1.00 27.95  ? 191 ASN A CB    1 
ATOM   1565 C  CG    . ASN A 1 191 ? 21.988  -37.799 -48.208 1.00 29.92  ? 191 ASN A CG    1 
ATOM   1566 O  OD1   . ASN A 1 191 ? 22.145  -36.658 -48.660 1.00 32.18  ? 191 ASN A OD1   1 
ATOM   1567 N  ND2   . ASN A 1 191 ? 22.126  -38.896 -48.962 1.00 29.06  ? 191 ASN A ND2   1 
ATOM   1568 N  N     . ALA A 1 192 ? 22.280  -38.373 -43.483 1.00 26.41  ? 192 ALA A N     1 
ATOM   1569 C  CA    . ALA A 1 192 ? 21.904  -38.079 -42.073 1.00 26.27  ? 192 ALA A CA    1 
ATOM   1570 C  C     . ALA A 1 192 ? 22.973  -37.264 -41.347 1.00 27.12  ? 192 ALA A C     1 
ATOM   1571 O  O     . ALA A 1 192 ? 22.656  -36.524 -40.408 1.00 26.66  ? 192 ALA A O     1 
ATOM   1572 C  CB    . ALA A 1 192 ? 21.596  -39.347 -41.315 1.00 25.39  ? 192 ALA A CB    1 
ATOM   1573 N  N     . ARG A 1 193 ? 24.227  -37.353 -41.808 1.00 27.82  ? 193 ARG A N     1 
ATOM   1574 C  CA    . ARG A 1 193 ? 25.282  -36.455 -41.316 1.00 28.56  ? 193 ARG A CA    1 
ATOM   1575 C  C     . ARG A 1 193 ? 24.903  -34.974 -41.417 1.00 29.06  ? 193 ARG A C     1 
ATOM   1576 O  O     . ARG A 1 193 ? 25.448  -34.140 -40.677 1.00 28.54  ? 193 ARG A O     1 
ATOM   1577 C  CB    . ARG A 1 193 ? 26.604  -36.675 -42.067 1.00 29.75  ? 193 ARG A CB    1 
ATOM   1578 C  CG    . ARG A 1 193 ? 27.159  -38.093 -42.008 1.00 29.26  ? 193 ARG A CG    1 
ATOM   1579 C  CD    . ARG A 1 193 ? 28.489  -38.149 -42.753 1.00 30.29  ? 193 ARG A CD    1 
ATOM   1580 N  NE    . ARG A 1 193 ? 28.323  -38.107 -44.212 1.00 31.03  ? 193 ARG A NE    1 
ATOM   1581 C  CZ    . ARG A 1 193 ? 29.324  -38.012 -45.089 1.00 32.99  ? 193 ARG A CZ    1 
ATOM   1582 N  NH1   . ARG A 1 193 ? 30.593  -37.942 -44.680 1.00 32.83  ? 193 ARG A NH1   1 
ATOM   1583 N  NH2   . ARG A 1 193 ? 29.057  -37.987 -46.383 1.00 31.29  ? 193 ARG A NH2   1 
ATOM   1584 N  N     . ARG A 1 194 ? 23.981  -34.649 -42.326 1.00 28.67  ? 194 ARG A N     1 
ATOM   1585 C  CA    . ARG A 1 194 ? 23.571  -33.259 -42.542 1.00 29.20  ? 194 ARG A CA    1 
ATOM   1586 C  C     . ARG A 1 194 ? 22.165  -32.906 -42.018 1.00 28.25  ? 194 ARG A C     1 
ATOM   1587 O  O     . ARG A 1 194 ? 21.678  -31.784 -42.221 1.00 28.11  ? 194 ARG A O     1 
ATOM   1588 C  CB    . ARG A 1 194 ? 23.696  -32.904 -44.034 1.00 30.70  ? 194 ARG A CB    1 
ATOM   1589 C  CG    . ARG A 1 194 ? 25.099  -32.606 -44.495 1.00 34.20  ? 194 ARG A CG    1 
ATOM   1590 C  CD    . ARG A 1 194 ? 25.054  -32.143 -45.944 1.00 43.20  ? 194 ARG A CD    1 
ATOM   1591 N  NE    . ARG A 1 194 ? 26.371  -32.157 -46.587 1.00 49.79  ? 194 ARG A NE    1 
ATOM   1592 C  CZ    . ARG A 1 194 ? 26.618  -31.683 -47.814 1.00 53.17  ? 194 ARG A CZ    1 
ATOM   1593 N  NH1   . ARG A 1 194 ? 25.633  -31.145 -48.538 1.00 52.90  ? 194 ARG A NH1   1 
ATOM   1594 N  NH2   . ARG A 1 194 ? 27.854  -31.740 -48.315 1.00 54.80  ? 194 ARG A NH2   1 
ATOM   1595 N  N     . TRP A 1 195 ? 21.530  -33.845 -41.329 1.00 26.94  ? 195 TRP A N     1 
ATOM   1596 C  CA    . TRP A 1 195 ? 20.220  -33.613 -40.689 1.00 26.52  ? 195 TRP A CA    1 
ATOM   1597 C  C     . TRP A 1 195 ? 20.325  -32.654 -39.520 1.00 26.46  ? 195 TRP A C     1 
ATOM   1598 O  O     . TRP A 1 195 ? 21.304  -32.668 -38.780 1.00 26.47  ? 195 TRP A O     1 
ATOM   1599 C  CB    . TRP A 1 195 ? 19.643  -34.894 -40.120 1.00 25.58  ? 195 TRP A CB    1 
ATOM   1600 C  CG    . TRP A 1 195 ? 19.163  -35.923 -41.097 1.00 25.24  ? 195 TRP A CG    1 
ATOM   1601 C  CD1   . TRP A 1 195 ? 19.075  -35.815 -42.452 1.00 24.71  ? 195 TRP A CD1   1 
ATOM   1602 C  CD2   . TRP A 1 195 ? 18.642  -37.206 -40.755 1.00 23.58  ? 195 TRP A CD2   1 
ATOM   1603 N  NE1   . TRP A 1 195 ? 18.565  -36.975 -42.987 1.00 24.87  ? 195 TRP A NE1   1 
ATOM   1604 C  CE2   . TRP A 1 195 ? 18.278  -37.843 -41.961 1.00 25.19  ? 195 TRP A CE2   1 
ATOM   1605 C  CE3   . TRP A 1 195 ? 18.447  -37.885 -39.534 1.00 25.58  ? 195 TRP A CE3   1 
ATOM   1606 C  CZ2   . TRP A 1 195 ? 17.735  -39.129 -41.990 1.00 23.96  ? 195 TRP A CZ2   1 
ATOM   1607 C  CZ3   . TRP A 1 195 ? 17.910  -39.174 -39.564 1.00 24.02  ? 195 TRP A CZ3   1 
ATOM   1608 C  CH2   . TRP A 1 195 ? 17.547  -39.769 -40.779 1.00 23.26  ? 195 TRP A CH2   1 
ATOM   1609 N  N     . THR A 1 196 ? 19.294  -31.839 -39.342 1.00 26.57  ? 196 THR A N     1 
ATOM   1610 C  CA    . THR A 1 196 ? 19.249  -30.868 -38.247 1.00 26.81  ? 196 THR A CA    1 
ATOM   1611 C  C     . THR A 1 196 ? 17.960  -31.116 -37.480 1.00 26.76  ? 196 THR A C     1 
ATOM   1612 O  O     . THR A 1 196 ? 17.095  -31.839 -37.947 1.00 26.97  ? 196 THR A O     1 
ATOM   1613 C  CB    . THR A 1 196 ? 19.223  -29.421 -38.770 1.00 27.41  ? 196 THR A CB    1 
ATOM   1614 O  OG1   . THR A 1 196 ? 17.937  -29.143 -39.331 1.00 25.85  ? 196 THR A OG1   1 
ATOM   1615 C  CG2   . THR A 1 196 ? 20.317  -29.177 -39.843 1.00 28.03  ? 196 THR A CG2   1 
ATOM   1616 N  N     . ARG A 1 197 ? 17.822  -30.491 -36.317 1.00 27.23  ? 197 ARG A N     1 
ATOM   1617 C  CA    . ARG A 1 197 ? 16.572  -30.561 -35.552 1.00 26.77  ? 197 ARG A CA    1 
ATOM   1618 C  C     . ARG A 1 197 ? 15.393  -29.896 -36.273 1.00 27.29  ? 197 ARG A C     1 
ATOM   1619 O  O     . ARG A 1 197 ? 14.286  -29.877 -35.749 1.00 27.55  ? 197 ARG A O     1 
ATOM   1620 C  CB    . ARG A 1 197 ? 16.769  -29.948 -34.163 1.00 25.74  ? 197 ARG A CB    1 
ATOM   1621 C  CG    . ARG A 1 197 ? 16.894  -28.422 -34.147 1.00 25.22  ? 197 ARG A CG    1 
ATOM   1622 C  CD    . ARG A 1 197 ? 17.457  -27.955 -32.837 1.00 25.12  ? 197 ARG A CD    1 
ATOM   1623 N  NE    . ARG A 1 197 ? 18.844  -28.385 -32.654 1.00 26.20  ? 197 ARG A NE    1 
ATOM   1624 C  CZ    . ARG A 1 197 ? 19.487  -28.385 -31.488 1.00 26.72  ? 197 ARG A CZ    1 
ATOM   1625 N  NH1   . ARG A 1 197 ? 18.867  -27.978 -30.367 1.00 27.33  ? 197 ARG A NH1   1 
ATOM   1626 N  NH2   . ARG A 1 197 ? 20.748  -28.803 -31.434 1.00 25.18  ? 197 ARG A NH2   1 
ATOM   1627 N  N     . ARG A 1 198 ? 15.649  -29.319 -37.447 1.00 27.41  ? 198 ARG A N     1 
ATOM   1628 C  CA    . ARG A 1 198 ? 14.596  -28.695 -38.244 1.00 28.91  ? 198 ARG A CA    1 
ATOM   1629 C  C     . ARG A 1 198 ? 14.331  -29.427 -39.565 1.00 27.53  ? 198 ARG A C     1 
ATOM   1630 O  O     . ARG A 1 198 ? 13.552  -28.947 -40.380 1.00 27.82  ? 198 ARG A O     1 
ATOM   1631 C  CB    . ARG A 1 198 ? 14.950  -27.234 -38.568 1.00 30.22  ? 198 ARG A CB    1 
ATOM   1632 C  CG    . ARG A 1 198 ? 15.478  -26.434 -37.402 1.00 34.67  ? 198 ARG A CG    1 
ATOM   1633 C  CD    . ARG A 1 198 ? 14.409  -25.625 -36.736 1.00 40.51  ? 198 ARG A CD    1 
ATOM   1634 N  NE    . ARG A 1 198 ? 14.019  -24.475 -37.548 1.00 46.36  ? 198 ARG A NE    1 
ATOM   1635 C  CZ    . ARG A 1 198 ? 13.364  -23.406 -37.087 1.00 50.41  ? 198 ARG A CZ    1 
ATOM   1636 N  NH1   . ARG A 1 198 ? 13.041  -23.311 -35.796 1.00 51.61  ? 198 ARG A NH1   1 
ATOM   1637 N  NH2   . ARG A 1 198 ? 13.044  -22.418 -37.923 1.00 51.40  ? 198 ARG A NH2   1 
ATOM   1638 N  N     . THR A 1 199 ? 14.981  -30.568 -39.770 1.00 26.57  ? 199 THR A N     1 
ATOM   1639 C  CA    . THR A 1 199 ? 14.883  -31.322 -41.034 1.00 25.66  ? 199 THR A CA    1 
ATOM   1640 C  C     . THR A 1 199 ? 13.506  -31.969 -41.240 1.00 25.18  ? 199 THR A C     1 
ATOM   1641 O  O     . THR A 1 199 ? 13.002  -32.684 -40.374 1.00 24.29  ? 199 THR A O     1 
ATOM   1642 C  CB    . THR A 1 199 ? 15.993  -32.389 -41.134 1.00 25.29  ? 199 THR A CB    1 
ATOM   1643 O  OG1   . THR A 1 199 ? 17.262  -31.733 -41.181 1.00 25.64  ? 199 THR A OG1   1 
ATOM   1644 C  CG2   . THR A 1 199 ? 15.841  -33.268 -42.405 1.00 24.88  ? 199 THR A CG2   1 
ATOM   1645 N  N     . VAL A 1 200 ? 12.905  -31.707 -42.393 1.00 24.65  ? 200 VAL A N     1 
ATOM   1646 C  CA    . VAL A 1 200 ? 11.650  -32.365 -42.767 1.00 24.10  ? 200 VAL A CA    1 
ATOM   1647 C  C     . VAL A 1 200 ? 11.897  -33.288 -43.963 1.00 24.21  ? 200 VAL A C     1 
ATOM   1648 O  O     . VAL A 1 200 ? 12.357  -32.852 -45.013 1.00 24.46  ? 200 VAL A O     1 
ATOM   1649 C  CB    . VAL A 1 200 ? 10.550  -31.327 -43.101 1.00 24.97  ? 200 VAL A CB    1 
ATOM   1650 C  CG1   . VAL A 1 200 ? 9.269   -32.008 -43.682 1.00 23.85  ? 200 VAL A CG1   1 
ATOM   1651 C  CG2   . VAL A 1 200 ? 10.243  -30.464 -41.881 1.00 24.37  ? 200 VAL A CG2   1 
ATOM   1652 N  N     . ILE A 1 201 ? 11.595  -34.574 -43.796 1.00 24.40  ? 201 ILE A N     1 
ATOM   1653 C  CA    . ILE A 1 201 ? 11.707  -35.526 -44.893 1.00 24.43  ? 201 ILE A CA    1 
ATOM   1654 C  C     . ILE A 1 201 ? 10.306  -35.922 -45.373 1.00 24.93  ? 201 ILE A C     1 
ATOM   1655 O  O     . ILE A 1 201 ? 9.520   -36.493 -44.630 1.00 23.58  ? 201 ILE A O     1 
ATOM   1656 C  CB    . ILE A 1 201 ? 12.547  -36.777 -44.492 1.00 25.13  ? 201 ILE A CB    1 
ATOM   1657 C  CG1   . ILE A 1 201 ? 13.995  -36.366 -44.149 1.00 25.56  ? 201 ILE A CG1   1 
ATOM   1658 C  CG2   . ILE A 1 201 ? 12.558  -37.795 -45.635 1.00 23.29  ? 201 ILE A CG2   1 
ATOM   1659 C  CD1   . ILE A 1 201 ? 14.862  -37.475 -43.561 1.00 23.31  ? 201 ILE A CD1   1 
ATOM   1660 N  N     . ASP A 1 202 ? 9.994   -35.604 -46.629 1.00 25.48  ? 202 ASP A N     1 
ATOM   1661 C  CA    . ASP A 1 202 ? 8.670   -35.879 -47.170 1.00 25.45  ? 202 ASP A CA    1 
ATOM   1662 C  C     . ASP A 1 202 ? 8.817   -36.889 -48.316 1.00 25.50  ? 202 ASP A C     1 
ATOM   1663 O  O     . ASP A 1 202 ? 8.938   -36.507 -49.465 1.00 25.31  ? 202 ASP A O     1 
ATOM   1664 C  CB    . ASP A 1 202 ? 8.035   -34.550 -47.620 1.00 25.98  ? 202 ASP A CB    1 
ATOM   1665 C  CG    . ASP A 1 202 ? 6.562   -34.673 -48.002 1.00 27.25  ? 202 ASP A CG    1 
ATOM   1666 O  OD1   . ASP A 1 202 ? 6.024   -35.798 -48.161 1.00 24.37  ? 202 ASP A OD1   1 
ATOM   1667 O  OD2   . ASP A 1 202 ? 5.936   -33.596 -48.156 1.00 26.93  ? 202 ASP A OD2   1 
ATOM   1668 N  N     . VAL A 1 203 ? 8.813   -38.180 -47.988 1.00 25.52  ? 203 VAL A N     1 
ATOM   1669 C  CA    . VAL A 1 203 ? 9.058   -39.225 -49.000 1.00 26.06  ? 203 VAL A CA    1 
ATOM   1670 C  C     . VAL A 1 203 ? 8.045   -39.238 -50.159 1.00 26.68  ? 203 VAL A C     1 
ATOM   1671 O  O     . VAL A 1 203 ? 8.439   -39.429 -51.306 1.00 27.40  ? 203 VAL A O     1 
ATOM   1672 C  CB    . VAL A 1 203 ? 9.296   -40.663 -48.384 1.00 26.41  ? 203 VAL A CB    1 
ATOM   1673 C  CG1   . VAL A 1 203 ? 8.025   -41.270 -47.865 1.00 24.02  ? 203 VAL A CG1   1 
ATOM   1674 C  CG2   . VAL A 1 203 ? 9.932   -41.586 -49.443 1.00 26.53  ? 203 VAL A CG2   1 
ATOM   1675 N  N     . ALA A 1 204 ? 6.761   -38.994 -49.887 1.00 25.89  ? 204 ALA A N     1 
ATOM   1676 C  CA    . ALA A 1 204 ? 5.768   -38.961 -50.975 1.00 26.46  ? 204 ALA A CA    1 
ATOM   1677 C  C     . ALA A 1 204 ? 6.039   -37.824 -51.991 1.00 26.77  ? 204 ALA A C     1 
ATOM   1678 O  O     . ALA A 1 204 ? 5.791   -37.970 -53.188 1.00 27.20  ? 204 ALA A O     1 
ATOM   1679 C  CB    . ALA A 1 204 ? 4.333   -38.895 -50.413 1.00 25.70  ? 204 ALA A CB    1 
ATOM   1680 N  N     . LYS A 1 205 ? 6.569   -36.706 -51.508 1.00 26.87  ? 205 LYS A N     1 
ATOM   1681 C  CA    . LYS A 1 205 ? 6.898   -35.560 -52.364 1.00 28.71  ? 205 LYS A CA    1 
ATOM   1682 C  C     . LYS A 1 205 ? 8.345   -35.565 -52.900 1.00 27.93  ? 205 LYS A C     1 
ATOM   1683 O  O     . LYS A 1 205 ? 8.725   -34.683 -53.677 1.00 27.92  ? 205 LYS A O     1 
ATOM   1684 C  CB    . LYS A 1 205 ? 6.610   -34.247 -51.629 1.00 28.56  ? 205 LYS A CB    1 
ATOM   1685 C  CG    . LYS A 1 205 ? 5.127   -33.866 -51.566 1.00 31.32  ? 205 LYS A CG    1 
ATOM   1686 C  CD    . LYS A 1 205 ? 4.950   -32.541 -50.815 1.00 32.12  ? 205 LYS A CD    1 
ATOM   1687 C  CE    . LYS A 1 205 ? 3.560   -31.925 -51.009 1.00 39.34  ? 205 LYS A CE    1 
ATOM   1688 N  NZ    . LYS A 1 205 ? 2.442   -32.924 -51.063 1.00 40.83  ? 205 LYS A NZ    1 
ATOM   1689 N  N     . GLY A 1 206 ? 9.143   -36.542 -52.465 1.00 27.56  ? 206 GLY A N     1 
ATOM   1690 C  CA    . GLY A 1 206 ? 10.543  -36.670 -52.879 1.00 28.04  ? 206 GLY A CA    1 
ATOM   1691 C  C     . GLY A 1 206 ? 11.423  -35.538 -52.384 1.00 28.69  ? 206 GLY A C     1 
ATOM   1692 O  O     . GLY A 1 206 ? 12.430  -35.200 -53.010 1.00 29.30  ? 206 GLY A O     1 
ATOM   1693 N  N     . GLU A 1 207 ? 11.056  -34.970 -51.240 1.00 28.33  ? 207 GLU A N     1 
ATOM   1694 C  CA    . GLU A 1 207 ? 11.539  -33.645 -50.859 1.00 29.02  ? 207 GLU A CA    1 
ATOM   1695 C  C     . GLU A 1 207 ? 12.121  -33.577 -49.438 1.00 28.44  ? 207 GLU A C     1 
ATOM   1696 O  O     . GLU A 1 207 ? 11.561  -34.170 -48.505 1.00 26.73  ? 207 GLU A O     1 
ATOM   1697 C  CB    . GLU A 1 207 ? 10.375  -32.657 -50.974 1.00 29.91  ? 207 GLU A CB    1 
ATOM   1698 C  CG    . GLU A 1 207 ? 10.726  -31.238 -50.587 1.00 32.12  ? 207 GLU A CG    1 
ATOM   1699 C  CD    . GLU A 1 207 ? 9.628   -30.268 -50.913 1.00 36.67  ? 207 GLU A CD    1 
ATOM   1700 O  OE1   . GLU A 1 207 ? 8.681   -30.172 -50.112 1.00 37.30  ? 207 GLU A OE1   1 
ATOM   1701 O  OE2   . GLU A 1 207 ? 9.714   -29.602 -51.972 1.00 39.63  ? 207 GLU A OE2   1 
ATOM   1702 N  N     . VAL A 1 208 ? 13.234  -32.845 -49.286 1.00 28.51  ? 208 VAL A N     1 
ATOM   1703 C  CA    . VAL A 1 208 ? 13.730  -32.429 -47.966 1.00 29.52  ? 208 VAL A CA    1 
ATOM   1704 C  C     . VAL A 1 208 ? 13.539  -30.927 -47.853 1.00 30.36  ? 208 VAL A C     1 
ATOM   1705 O  O     . VAL A 1 208 ? 13.854  -30.193 -48.789 1.00 31.27  ? 208 VAL A O     1 
ATOM   1706 C  CB    . VAL A 1 208 ? 15.221  -32.770 -47.706 1.00 30.16  ? 208 VAL A CB    1 
ATOM   1707 C  CG1   . VAL A 1 208 ? 15.661  -32.213 -46.335 1.00 28.83  ? 208 VAL A CG1   1 
ATOM   1708 C  CG2   . VAL A 1 208 ? 15.438  -34.267 -47.714 1.00 30.27  ? 208 VAL A CG2   1 
ATOM   1709 N  N     . ARG A 1 209 ? 12.960  -30.498 -46.739 1.00 30.66  ? 209 ARG A N     1 
ATOM   1710 C  CA    . ARG A 1 209 ? 12.789  -29.083 -46.444 1.00 32.25  ? 209 ARG A CA    1 
ATOM   1711 C  C     . ARG A 1 209 ? 13.084  -28.757 -44.976 1.00 32.56  ? 209 ARG A C     1 
ATOM   1712 O  O     . ARG A 1 209 ? 13.603  -29.593 -44.238 1.00 31.74  ? 209 ARG A O     1 
ATOM   1713 C  CB    . ARG A 1 209 ? 11.412  -28.555 -46.910 1.00 33.22  ? 209 ARG A CB    1 
ATOM   1714 C  CG    . ARG A 1 209 ? 10.212  -29.212 -46.273 1.00 32.39  ? 209 ARG A CG    1 
ATOM   1715 C  CD    . ARG A 1 209 ? 8.892   -28.753 -46.906 1.00 33.28  ? 209 ARG A CD    1 
ATOM   1716 N  NE    . ARG A 1 209 ? 7.788   -29.412 -46.206 1.00 32.79  ? 209 ARG A NE    1 
ATOM   1717 C  CZ    . ARG A 1 209 ? 7.166   -30.516 -46.609 1.00 34.37  ? 209 ARG A CZ    1 
ATOM   1718 N  NH1   . ARG A 1 209 ? 7.469   -31.082 -47.778 1.00 34.19  ? 209 ARG A NH1   1 
ATOM   1719 N  NH2   . ARG A 1 209 ? 6.200   -31.040 -45.852 1.00 33.17  ? 209 ARG A NH2   1 
ATOM   1720 N  N     . LYS A 1 210 ? 12.815  -27.518 -44.590 1.00 34.11  ? 210 LYS A N     1 
ATOM   1721 C  CA    . LYS A 1 210 ? 13.087  -27.033 -43.250 1.00 35.59  ? 210 LYS A CA    1 
ATOM   1722 C  C     . LYS A 1 210 ? 11.746  -26.731 -42.612 1.00 35.63  ? 210 LYS A C     1 
ATOM   1723 O  O     . LYS A 1 210 ? 10.893  -26.106 -43.239 1.00 37.02  ? 210 LYS A O     1 
ATOM   1724 C  CB    . LYS A 1 210 ? 13.905  -25.747 -43.348 1.00 36.57  ? 210 LYS A CB    1 
ATOM   1725 C  CG    . LYS A 1 210 ? 14.702  -25.359 -42.132 1.00 39.16  ? 210 LYS A CG    1 
ATOM   1726 C  CD    . LYS A 1 210 ? 14.944  -23.847 -42.175 1.00 45.00  ? 210 LYS A CD    1 
ATOM   1727 C  CE    . LYS A 1 210 ? 16.158  -23.424 -41.360 1.00 47.77  ? 210 LYS A CE    1 
ATOM   1728 N  NZ    . LYS A 1 210 ? 15.825  -23.303 -39.919 1.00 49.51  ? 210 LYS A NZ    1 
ATOM   1729 N  N     . GLY A 1 211 ? 11.549  -27.181 -41.381 1.00 35.30  ? 211 GLY A N     1 
ATOM   1730 C  CA    . GLY A 1 211 ? 10.342  -26.849 -40.639 1.00 35.71  ? 211 GLY A CA    1 
ATOM   1731 C  C     . GLY A 1 211 ? 10.660  -26.474 -39.207 1.00 36.46  ? 211 GLY A C     1 
ATOM   1732 O  O     . GLY A 1 211 ? 11.774  -26.044 -38.899 1.00 36.17  ? 211 GLY A O     1 
ATOM   1733 N  N     . GLU A 1 212 ? 9.682   -26.667 -38.326 1.00 37.30  ? 212 GLU A N     1 
ATOM   1734 C  CA    . GLU A 1 212 ? 9.812   -26.261 -36.930 1.00 38.47  ? 212 GLU A CA    1 
ATOM   1735 C  C     . GLU A 1 212 ? 10.518  -27.317 -36.111 1.00 37.14  ? 212 GLU A C     1 
ATOM   1736 O  O     . GLU A 1 212 ? 11.144  -26.997 -35.104 1.00 37.79  ? 212 GLU A O     1 
ATOM   1737 C  CB    . GLU A 1 212 ? 8.441   -25.958 -36.318 1.00 39.60  ? 212 GLU A CB    1 
ATOM   1738 C  CG    . GLU A 1 212 ? 7.751   -24.743 -36.916 1.00 45.15  ? 212 GLU A CG    1 
ATOM   1739 C  CD    . GLU A 1 212 ? 8.543   -23.456 -36.708 1.00 51.41  ? 212 GLU A CD    1 
ATOM   1740 O  OE1   . GLU A 1 212 ? 9.406   -23.124 -37.558 1.00 54.38  ? 212 GLU A OE1   1 
ATOM   1741 O  OE2   . GLU A 1 212 ? 8.288   -22.770 -35.693 1.00 55.21  ? 212 GLU A OE2   1 
ATOM   1742 N  N     . GLU A 1 213 ? 10.379  -28.576 -36.523 1.00 35.37  ? 213 GLU A N     1 
ATOM   1743 C  CA    . GLU A 1 213 ? 11.128  -29.670 -35.915 1.00 34.17  ? 213 GLU A CA    1 
ATOM   1744 C  C     . GLU A 1 213 ? 11.365  -30.820 -36.876 1.00 31.70  ? 213 GLU A C     1 
ATOM   1745 O  O     . GLU A 1 213 ? 10.930  -30.769 -38.026 1.00 31.01  ? 213 GLU A O     1 
ATOM   1746 C  CB    . GLU A 1 213 ? 10.494  -30.159 -34.593 1.00 35.21  ? 213 GLU A CB    1 
ATOM   1747 C  CG    . GLU A 1 213 ? 8.984   -30.106 -34.488 1.00 39.65  ? 213 GLU A CG    1 
ATOM   1748 C  CD    . GLU A 1 213 ? 8.282   -30.949 -35.515 1.00 44.43  ? 213 GLU A CD    1 
ATOM   1749 O  OE1   . GLU A 1 213 ? 8.883   -31.945 -35.979 1.00 47.79  ? 213 GLU A OE1   1 
ATOM   1750 O  OE2   . GLU A 1 213 ? 7.123   -30.614 -35.861 1.00 46.18  ? 213 GLU A OE2   1 
ATOM   1751 N  N     . PHE A 1 214 ? 12.047  -31.857 -36.393 1.00 29.03  ? 214 PHE A N     1 
ATOM   1752 C  CA    . PHE A 1 214 ? 12.354  -33.015 -37.210 1.00 26.46  ? 214 PHE A CA    1 
ATOM   1753 C  C     . PHE A 1 214 ? 11.069  -33.789 -37.494 1.00 25.65  ? 214 PHE A C     1 
ATOM   1754 O  O     . PHE A 1 214 ? 10.373  -34.277 -36.567 1.00 25.16  ? 214 PHE A O     1 
ATOM   1755 C  CB    . PHE A 1 214 ? 13.413  -33.896 -36.541 1.00 25.81  ? 214 PHE A CB    1 
ATOM   1756 C  CG    . PHE A 1 214 ? 13.918  -35.003 -37.418 1.00 25.68  ? 214 PHE A CG    1 
ATOM   1757 C  CD1   . PHE A 1 214 ? 14.885  -34.749 -38.401 1.00 23.10  ? 214 PHE A CD1   1 
ATOM   1758 C  CD2   . PHE A 1 214 ? 13.429  -36.313 -37.275 1.00 24.57  ? 214 PHE A CD2   1 
ATOM   1759 C  CE1   . PHE A 1 214 ? 15.346  -35.771 -39.212 1.00 26.19  ? 214 PHE A CE1   1 
ATOM   1760 C  CE2   . PHE A 1 214 ? 13.885  -37.336 -38.089 1.00 22.54  ? 214 PHE A CE2   1 
ATOM   1761 C  CZ    . PHE A 1 214 ? 14.842  -37.073 -39.061 1.00 25.62  ? 214 PHE A CZ    1 
ATOM   1762 N  N     . PHE A 1 215 ? 10.747  -33.897 -38.783 1.00 24.31  ? 215 PHE A N     1 
ATOM   1763 C  CA    . PHE A 1 215 ? 9.453   -34.384 -39.205 1.00 22.66  ? 215 PHE A CA    1 
ATOM   1764 C  C     . PHE A 1 215 ? 9.661   -35.250 -40.437 1.00 22.49  ? 215 PHE A C     1 
ATOM   1765 O  O     . PHE A 1 215 ? 10.216  -34.801 -41.446 1.00 22.36  ? 215 PHE A O     1 
ATOM   1766 C  CB    . PHE A 1 215 ? 8.541   -33.197 -39.485 1.00 22.70  ? 215 PHE A CB    1 
ATOM   1767 C  CG    . PHE A 1 215 ? 7.049   -33.490 -39.441 1.00 22.94  ? 215 PHE A CG    1 
ATOM   1768 C  CD1   . PHE A 1 215 ? 6.246   -32.830 -38.510 1.00 22.59  ? 215 PHE A CD1   1 
ATOM   1769 C  CD2   . PHE A 1 215 ? 6.434   -34.340 -40.374 1.00 21.25  ? 215 PHE A CD2   1 
ATOM   1770 C  CE1   . PHE A 1 215 ? 4.854   -33.014 -38.470 1.00 23.07  ? 215 PHE A CE1   1 
ATOM   1771 C  CE2   . PHE A 1 215 ? 5.034   -34.551 -40.343 1.00 20.88  ? 215 PHE A CE2   1 
ATOM   1772 C  CZ    . PHE A 1 215 ? 4.242   -33.877 -39.396 1.00 22.78  ? 215 PHE A CZ    1 
ATOM   1773 N  N     . VAL A 1 216 ? 9.284   -36.518 -40.312 1.00 21.47  ? 216 VAL A N     1 
ATOM   1774 C  CA    . VAL A 1 216 ? 9.275   -37.429 -41.450 1.00 22.10  ? 216 VAL A CA    1 
ATOM   1775 C  C     . VAL A 1 216 ? 7.810   -37.661 -41.818 1.00 22.00  ? 216 VAL A C     1 
ATOM   1776 O  O     . VAL A 1 216 ? 7.080   -38.318 -41.066 1.00 22.28  ? 216 VAL A O     1 
ATOM   1777 C  CB    . VAL A 1 216 ? 10.003  -38.757 -41.145 1.00 21.95  ? 216 VAL A CB    1 
ATOM   1778 C  CG1   . VAL A 1 216 ? 9.883   -39.738 -42.343 1.00 20.60  ? 216 VAL A CG1   1 
ATOM   1779 C  CG2   . VAL A 1 216 ? 11.481  -38.478 -40.800 1.00 22.17  ? 216 VAL A CG2   1 
ATOM   1780 N  N     . VAL A 1 217 ? 7.378   -37.087 -42.945 1.00 21.94  ? 217 VAL A N     1 
ATOM   1781 C  CA    . VAL A 1 217 ? 5.951   -37.101 -43.315 1.00 22.22  ? 217 VAL A CA    1 
ATOM   1782 C  C     . VAL A 1 217 ? 5.571   -38.518 -43.737 1.00 22.03  ? 217 VAL A C     1 
ATOM   1783 O  O     . VAL A 1 217 ? 6.211   -39.100 -44.611 1.00 21.72  ? 217 VAL A O     1 
ATOM   1784 C  CB    . VAL A 1 217 ? 5.613   -36.075 -44.440 1.00 23.40  ? 217 VAL A CB    1 
ATOM   1785 C  CG1   . VAL A 1 217 ? 4.099   -35.998 -44.710 1.00 22.31  ? 217 VAL A CG1   1 
ATOM   1786 C  CG2   . VAL A 1 217 ? 6.177   -34.684 -44.103 1.00 22.42  ? 217 VAL A CG2   1 
ATOM   1787 N  N     . ASP A 1 218 ? 4.565   -39.079 -43.072 1.00 21.69  ? 218 ASP A N     1 
ATOM   1788 C  CA    . ASP A 1 218 ? 3.990   -40.372 -43.469 1.00 21.48  ? 218 ASP A CA    1 
ATOM   1789 C  C     . ASP A 1 218 ? 3.372   -40.217 -44.881 1.00 21.93  ? 218 ASP A C     1 
ATOM   1790 O  O     . ASP A 1 218 ? 2.554   -39.327 -45.099 1.00 22.98  ? 218 ASP A O     1 
ATOM   1791 C  CB    . ASP A 1 218 ? 2.919   -40.805 -42.457 1.00 21.57  ? 218 ASP A CB    1 
ATOM   1792 C  CG    . ASP A 1 218 ? 2.572   -42.281 -42.563 1.00 21.82  ? 218 ASP A CG    1 
ATOM   1793 O  OD1   . ASP A 1 218 ? 2.655   -42.880 -43.668 1.00 20.08  ? 218 ASP A OD1   1 
ATOM   1794 O  OD2   . ASP A 1 218 ? 2.203   -42.856 -41.538 1.00 19.00  ? 218 ASP A OD2   1 
ATOM   1795 N  N     . PRO A 1 219 ? 3.805   -41.044 -45.854 1.00 21.85  ? 219 PRO A N     1 
ATOM   1796 C  CA    . PRO A 1 219 ? 3.251   -40.930 -47.240 1.00 23.36  ? 219 PRO A CA    1 
ATOM   1797 C  C     . PRO A 1 219 ? 1.758   -41.288 -47.302 1.00 24.12  ? 219 PRO A C     1 
ATOM   1798 O  O     . PRO A 1 219 ? 1.089   -41.058 -48.295 1.00 24.32  ? 219 PRO A O     1 
ATOM   1799 C  CB    . PRO A 1 219 ? 4.096   -41.930 -48.046 1.00 22.75  ? 219 PRO A CB    1 
ATOM   1800 C  CG    . PRO A 1 219 ? 4.732   -42.819 -47.081 1.00 21.94  ? 219 PRO A CG    1 
ATOM   1801 C  CD    . PRO A 1 219 ? 4.847   -42.079 -45.753 1.00 21.29  ? 219 PRO A CD    1 
ATOM   1802 N  N     . VAL A 1 220 ? 1.257   -41.811 -46.194 1.00 24.38  ? 220 VAL A N     1 
ATOM   1803 C  CA    . VAL A 1 220 ? -0.098  -42.319 -46.074 1.00 26.12  ? 220 VAL A CA    1 
ATOM   1804 C  C     . VAL A 1 220 ? -0.999  -41.290 -45.339 1.00 26.10  ? 220 VAL A C     1 
ATOM   1805 O  O     . VAL A 1 220 ? -2.227  -41.375 -45.377 1.00 26.34  ? 220 VAL A O     1 
ATOM   1806 C  CB    . VAL A 1 220 ? 0.028   -43.720 -45.381 1.00 26.43  ? 220 VAL A CB    1 
ATOM   1807 C  CG1   . VAL A 1 220 ? -0.820  -43.912 -44.107 1.00 25.07  ? 220 VAL A CG1   1 
ATOM   1808 C  CG2   . VAL A 1 220 ? -0.002  -44.857 -46.381 1.00 26.94  ? 220 VAL A CG2   1 
ATOM   1809 N  N     . ASP A 1 221 ? -0.371  -40.297 -44.709 1.00 26.17  ? 221 ASP A N     1 
ATOM   1810 C  CA    . ASP A 1 221 ? -1.062  -39.323 -43.854 1.00 26.61  ? 221 ASP A CA    1 
ATOM   1811 C  C     . ASP A 1 221 ? -0.120  -38.153 -43.640 1.00 27.01  ? 221 ASP A C     1 
ATOM   1812 O  O     . ASP A 1 221 ? 0.821   -38.243 -42.834 1.00 26.44  ? 221 ASP A O     1 
ATOM   1813 C  CB    . ASP A 1 221 ? -1.450  -39.955 -42.504 1.00 25.43  ? 221 ASP A CB    1 
ATOM   1814 C  CG    . ASP A 1 221 ? -2.091  -38.963 -41.535 1.00 27.96  ? 221 ASP A CG    1 
ATOM   1815 O  OD1   . ASP A 1 221 ? -2.315  -37.780 -41.915 1.00 28.59  ? 221 ASP A OD1   1 
ATOM   1816 O  OD2   . ASP A 1 221 ? -2.408  -39.377 -40.392 1.00 24.44  ? 221 ASP A OD2   1 
ATOM   1817 N  N     . GLU A 1 222 ? -0.357  -37.076 -44.386 1.00 27.77  ? 222 GLU A N     1 
ATOM   1818 C  CA    . GLU A 1 222 ? 0.542   -35.920 -44.399 1.00 30.14  ? 222 GLU A CA    1 
ATOM   1819 C  C     . GLU A 1 222 ? 0.636   -35.210 -43.033 1.00 29.07  ? 222 GLU A C     1 
ATOM   1820 O  O     . GLU A 1 222 ? 1.590   -34.464 -42.772 1.00 29.88  ? 222 GLU A O     1 
ATOM   1821 C  CB    . GLU A 1 222 ? 0.159   -34.927 -45.510 1.00 30.13  ? 222 GLU A CB    1 
ATOM   1822 C  CG    . GLU A 1 222 ? -1.223  -34.326 -45.341 1.00 34.17  ? 222 GLU A CG    1 
ATOM   1823 C  CD    . GLU A 1 222 ? -1.561  -33.256 -46.366 1.00 36.76  ? 222 GLU A CD    1 
ATOM   1824 O  OE1   . GLU A 1 222 ? -0.797  -33.053 -47.342 1.00 43.25  ? 222 GLU A OE1   1 
ATOM   1825 O  OE2   . GLU A 1 222 ? -2.613  -32.607 -46.186 1.00 43.58  ? 222 GLU A OE2   1 
ATOM   1826 N  N     . LYS A 1 223 ? -0.345  -35.447 -42.173 1.00 28.29  ? 223 LYS A N     1 
ATOM   1827 C  CA    . LYS A 1 223 ? -0.344  -34.861 -40.844 1.00 28.30  ? 223 LYS A CA    1 
ATOM   1828 C  C     . LYS A 1 223 ? 0.511   -35.654 -39.844 1.00 26.21  ? 223 LYS A C     1 
ATOM   1829 O  O     . LYS A 1 223 ? 0.832   -35.154 -38.788 1.00 25.58  ? 223 LYS A O     1 
ATOM   1830 C  CB    . LYS A 1 223 ? -1.783  -34.708 -40.317 1.00 29.98  ? 223 LYS A CB    1 
ATOM   1831 C  CG    . LYS A 1 223 ? -2.715  -33.804 -41.169 1.00 33.11  ? 223 LYS A CG    1 
ATOM   1832 C  CD    . LYS A 1 223 ? -2.099  -32.433 -41.442 1.00 37.52  ? 223 LYS A CD    1 
ATOM   1833 C  CE    . LYS A 1 223 ? -2.946  -31.601 -42.419 1.00 39.77  ? 223 LYS A CE    1 
ATOM   1834 N  NZ    . LYS A 1 223 ? -2.036  -30.730 -43.250 1.00 43.33  ? 223 LYS A NZ    1 
ATOM   1835 N  N     . ARG A 1 224 ? 0.849   -36.899 -40.182 1.00 24.85  ? 224 ARG A N     1 
ATOM   1836 C  CA    . ARG A 1 224 ? 1.532   -37.830 -39.284 1.00 23.39  ? 224 ARG A CA    1 
ATOM   1837 C  C     . ARG A 1 224 ? 3.040   -37.611 -39.380 1.00 22.44  ? 224 ARG A C     1 
ATOM   1838 O  O     . ARG A 1 224 ? 3.600   -37.743 -40.469 1.00 21.59  ? 224 ARG A O     1 
ATOM   1839 C  CB    . ARG A 1 224 ? 1.244   -39.265 -39.759 1.00 23.45  ? 224 ARG A CB    1 
ATOM   1840 C  CG    . ARG A 1 224 ? 1.289   -40.362 -38.756 1.00 26.69  ? 224 ARG A CG    1 
ATOM   1841 C  CD    . ARG A 1 224 ? 2.622   -40.899 -38.299 1.00 30.76  ? 224 ARG A CD    1 
ATOM   1842 N  NE    . ARG A 1 224 ? 2.563   -40.752 -36.865 1.00 25.50  ? 224 ARG A NE    1 
ATOM   1843 C  CZ    . ARG A 1 224 ? 3.073   -41.496 -35.877 1.00 26.48  ? 224 ARG A CZ    1 
ATOM   1844 N  NH1   . ARG A 1 224 ? 3.749   -42.620 -36.030 1.00 29.90  ? 224 ARG A NH1   1 
ATOM   1845 N  NH2   . ARG A 1 224 ? 2.826   -41.071 -34.648 1.00 22.44  ? 224 ARG A NH2   1 
ATOM   1846 N  N     . ASN A 1 225 ? 3.697   -37.301 -38.253 1.00 21.58  ? 225 ASN A N     1 
ATOM   1847 C  CA    . ASN A 1 225 ? 5.168   -37.436 -38.145 1.00 22.07  ? 225 ASN A CA    1 
ATOM   1848 C  C     . ASN A 1 225 ? 5.569   -38.857 -37.726 1.00 21.22  ? 225 ASN A C     1 
ATOM   1849 O  O     . ASN A 1 225 ? 5.363   -39.260 -36.569 1.00 21.38  ? 225 ASN A O     1 
ATOM   1850 C  CB    . ASN A 1 225 ? 5.740   -36.426 -37.139 1.00 21.49  ? 225 ASN A CB    1 
ATOM   1851 C  CG    . ASN A 1 225 ? 7.286   -36.407 -37.111 1.00 23.08  ? 225 ASN A CG    1 
ATOM   1852 O  OD1   . ASN A 1 225 ? 7.950   -37.174 -37.823 1.00 19.79  ? 225 ASN A OD1   1 
ATOM   1853 N  ND2   . ASN A 1 225 ? 7.854   -35.528 -36.268 1.00 19.72  ? 225 ASN A ND2   1 
ATOM   1854 N  N     . VAL A 1 226 ? 6.187   -39.591 -38.649 1.00 21.72  ? 226 VAL A N     1 
ATOM   1855 C  CA    . VAL A 1 226 ? 6.632   -40.954 -38.381 1.00 20.64  ? 226 VAL A CA    1 
ATOM   1856 C  C     . VAL A 1 226 ? 7.718   -40.946 -37.281 1.00 21.26  ? 226 VAL A C     1 
ATOM   1857 O  O     . VAL A 1 226 ? 7.796   -41.875 -36.465 1.00 20.41  ? 226 VAL A O     1 
ATOM   1858 C  CB    . VAL A 1 226 ? 7.088   -41.678 -39.664 1.00 21.25  ? 226 VAL A CB    1 
ATOM   1859 C  CG1   . VAL A 1 226 ? 7.444   -43.140 -39.370 1.00 20.74  ? 226 VAL A CG1   1 
ATOM   1860 C  CG2   . VAL A 1 226 ? 5.962   -41.650 -40.721 1.00 20.52  ? 226 VAL A CG2   1 
ATOM   1861 N  N     . ALA A 1 227 ? 8.496   -39.862 -37.236 1.00 20.43  ? 227 ALA A N     1 
ATOM   1862 C  CA    . ALA A 1 227 ? 9.512   -39.664 -36.207 1.00 20.33  ? 227 ALA A CA    1 
ATOM   1863 C  C     . ALA A 1 227 ? 9.036   -38.844 -35.008 1.00 20.41  ? 227 ALA A C     1 
ATOM   1864 O  O     . ALA A 1 227 ? 9.861   -38.273 -34.304 1.00 21.43  ? 227 ALA A O     1 
ATOM   1865 C  CB    . ALA A 1 227 ? 10.771  -39.042 -36.819 1.00 20.05  ? 227 ALA A CB    1 
ATOM   1866 N  N     . ALA A 1 228 ? 7.722   -38.793 -34.752 1.00 19.78  ? 228 ALA A N     1 
ATOM   1867 C  CA    . ALA A 1 228 ? 7.184   -38.006 -33.630 1.00 20.42  ? 228 ALA A CA    1 
ATOM   1868 C  C     . ALA A 1 228 ? 7.853   -38.324 -32.292 1.00 20.16  ? 228 ALA A C     1 
ATOM   1869 O  O     . ALA A 1 228 ? 8.119   -37.418 -31.507 1.00 19.98  ? 228 ALA A O     1 
ATOM   1870 C  CB    . ALA A 1 228 ? 5.632   -38.168 -33.513 1.00 19.61  ? 228 ALA A CB    1 
ATOM   1871 N  N     . ASN A 1 229 ? 8.122   -39.608 -32.033 1.00 19.68  ? 229 ASN A N     1 
ATOM   1872 C  CA    . ASN A 1 229 ? 8.684   -40.006 -30.738 1.00 19.57  ? 229 ASN A CA    1 
ATOM   1873 C  C     . ASN A 1 229 ? 10.202  -40.246 -30.721 1.00 19.51  ? 229 ASN A C     1 
ATOM   1874 O  O     . ASN A 1 229 ? 10.749  -40.722 -29.717 1.00 18.62  ? 229 ASN A O     1 
ATOM   1875 C  CB    . ASN A 1 229 ? 7.935   -41.213 -30.137 1.00 19.47  ? 229 ASN A CB    1 
ATOM   1876 C  CG    . ASN A 1 229 ? 7.928   -41.201 -28.611 1.00 19.51  ? 229 ASN A CG    1 
ATOM   1877 O  OD1   . ASN A 1 229 ? 7.770   -40.154 -27.998 1.00 18.68  ? 229 ASN A OD1   1 
ATOM   1878 N  ND2   . ASN A 1 229 ? 8.048   -42.382 -27.993 1.00 15.07  ? 229 ASN A ND2   1 
ATOM   1879 N  N     . LEU A 1 230 ? 10.888  -39.913 -31.816 1.00 19.42  ? 230 LEU A N     1 
ATOM   1880 C  CA    . LEU A 1 230 ? 12.358  -39.871 -31.808 1.00 19.48  ? 230 LEU A CA    1 
ATOM   1881 C  C     . LEU A 1 230 ? 12.823  -38.644 -31.006 1.00 20.49  ? 230 LEU A C     1 
ATOM   1882 O  O     . LEU A 1 230 ? 12.515  -37.508 -31.376 1.00 20.23  ? 230 LEU A O     1 
ATOM   1883 C  CB    . LEU A 1 230 ? 12.900  -39.866 -33.245 1.00 19.33  ? 230 LEU A CB    1 
ATOM   1884 C  CG    . LEU A 1 230 ? 14.395  -39.556 -33.485 1.00 20.45  ? 230 LEU A CG    1 
ATOM   1885 C  CD1   . LEU A 1 230 ? 15.302  -40.642 -32.940 1.00 17.63  ? 230 LEU A CD1   1 
ATOM   1886 C  CD2   . LEU A 1 230 ? 14.660  -39.290 -34.985 1.00 19.07  ? 230 LEU A CD2   1 
ATOM   1887 N  N     . SER A 1 231 ? 13.525  -38.863 -29.888 1.00 19.83  ? 231 SER A N     1 
ATOM   1888 C  CA    . SER A 1 231 ? 13.948  -37.735 -29.047 1.00 20.71  ? 231 SER A CA    1 
ATOM   1889 C  C     . SER A 1 231 ? 14.993  -36.887 -29.774 1.00 20.75  ? 231 SER A C     1 
ATOM   1890 O  O     . SER A 1 231 ? 15.700  -37.367 -30.651 1.00 19.60  ? 231 SER A O     1 
ATOM   1891 C  CB    . SER A 1 231 ? 14.508  -38.219 -27.694 1.00 20.63  ? 231 SER A CB    1 
ATOM   1892 O  OG    . SER A 1 231 ? 15.637  -39.042 -27.912 1.00 21.03  ? 231 SER A OG    1 
ATOM   1893 N  N     . LEU A 1 232 ? 15.073  -35.614 -29.421 1.00 20.82  ? 232 LEU A N     1 
ATOM   1894 C  CA    . LEU A 1 232 ? 16.113  -34.764 -29.959 1.00 21.18  ? 232 LEU A CA    1 
ATOM   1895 C  C     . LEU A 1 232 ? 17.498  -35.384 -29.736 1.00 20.97  ? 232 LEU A C     1 
ATOM   1896 O  O     . LEU A 1 232 ? 18.364  -35.329 -30.613 1.00 20.55  ? 232 LEU A O     1 
ATOM   1897 C  CB    . LEU A 1 232 ? 16.034  -33.384 -29.296 1.00 22.41  ? 232 LEU A CB    1 
ATOM   1898 C  CG    . LEU A 1 232 ? 17.145  -32.383 -29.570 1.00 22.43  ? 232 LEU A CG    1 
ATOM   1899 C  CD1   . LEU A 1 232 ? 17.231  -32.057 -31.061 1.00 23.43  ? 232 LEU A CD1   1 
ATOM   1900 C  CD2   . LEU A 1 232 ? 16.880  -31.138 -28.726 1.00 22.75  ? 232 LEU A CD2   1 
ATOM   1901 N  N     . ASP A 1 233 ? 17.703  -35.979 -28.564 1.00 20.83  ? 233 ASP A N     1 
ATOM   1902 C  CA    . ASP A 1 233 ? 19.019  -36.481 -28.225 1.00 21.82  ? 233 ASP A CA    1 
ATOM   1903 C  C     . ASP A 1 233 ? 19.375  -37.739 -28.977 1.00 21.73  ? 233 ASP A C     1 
ATOM   1904 O  O     . ASP A 1 233 ? 20.539  -37.933 -29.295 1.00 22.46  ? 233 ASP A O     1 
ATOM   1905 C  CB    . ASP A 1 233 ? 19.199  -36.611 -26.718 1.00 21.77  ? 233 ASP A CB    1 
ATOM   1906 C  CG    . ASP A 1 233 ? 19.322  -35.254 -26.056 1.00 22.89  ? 233 ASP A CG    1 
ATOM   1907 O  OD1   . ASP A 1 233 ? 19.466  -34.256 -26.793 1.00 26.36  ? 233 ASP A OD1   1 
ATOM   1908 O  OD2   . ASP A 1 233 ? 19.256  -35.171 -24.827 1.00 27.11  ? 233 ASP A OD2   1 
ATOM   1909 N  N     . ASN A 1 234 ? 18.373  -38.562 -29.280 1.00 21.74  ? 234 ASN A N     1 
ATOM   1910 C  CA    . ASN A 1 234 ? 18.587  -39.762 -30.100 1.00 22.13  ? 234 ASN A CA    1 
ATOM   1911 C  C     . ASN A 1 234 ? 18.780  -39.445 -31.579 1.00 21.88  ? 234 ASN A C     1 
ATOM   1912 O  O     . ASN A 1 234 ? 19.553  -40.116 -32.259 1.00 21.88  ? 234 ASN A O     1 
ATOM   1913 C  CB    . ASN A 1 234 ? 17.487  -40.801 -29.872 1.00 21.33  ? 234 ASN A CB    1 
ATOM   1914 C  CG    . ASN A 1 234 ? 17.616  -41.479 -28.505 1.00 22.15  ? 234 ASN A CG    1 
ATOM   1915 O  OD1   . ASN A 1 234 ? 16.643  -42.025 -27.955 1.00 26.10  ? 234 ASN A OD1   1 
ATOM   1916 N  ND2   . ASN A 1 234 ? 18.812  -41.473 -27.970 1.00 18.36  ? 234 ASN A ND2   1 
ATOM   1917 N  N     . LEU A 1 235 ? 18.074  -38.424 -32.068 1.00 21.60  ? 235 LEU A N     1 
ATOM   1918 C  CA    . LEU A 1 235 ? 18.392  -37.835 -33.374 1.00 22.87  ? 235 LEU A CA    1 
ATOM   1919 C  C     . LEU A 1 235 ? 19.874  -37.412 -33.400 1.00 23.04  ? 235 LEU A C     1 
ATOM   1920 O  O     . LEU A 1 235 ? 20.605  -37.749 -34.340 1.00 22.91  ? 235 LEU A O     1 
ATOM   1921 C  CB    . LEU A 1 235 ? 17.501  -36.616 -33.659 1.00 22.14  ? 235 LEU A CB    1 
ATOM   1922 C  CG    . LEU A 1 235 ? 17.831  -35.806 -34.924 1.00 22.83  ? 235 LEU A CG    1 
ATOM   1923 C  CD1   . LEU A 1 235 ? 17.623  -36.633 -36.192 1.00 21.36  ? 235 LEU A CD1   1 
ATOM   1924 C  CD2   . LEU A 1 235 ? 17.018  -34.545 -34.976 1.00 23.83  ? 235 LEU A CD2   1 
ATOM   1925 N  N     . ALA A 1 236 ? 20.281  -36.659 -32.373 1.00 23.43  ? 236 ALA A N     1 
ATOM   1926 C  CA    . ALA A 1 236 ? 21.662  -36.189 -32.222 1.00 24.09  ? 236 ALA A CA    1 
ATOM   1927 C  C     . ALA A 1 236 ? 22.660  -37.349 -32.271 1.00 24.40  ? 236 ALA A C     1 
ATOM   1928 O  O     . ALA A 1 236 ? 23.648  -37.300 -33.010 1.00 25.42  ? 236 ALA A O     1 
ATOM   1929 C  CB    . ALA A 1 236 ? 21.823  -35.389 -30.915 1.00 23.93  ? 236 ALA A CB    1 
ATOM   1930 N  N     . ARG A 1 237 ? 22.380  -38.395 -31.503 1.00 24.44  ? 237 ARG A N     1 
ATOM   1931 C  CA    . ARG A 1 237 ? 23.240  -39.577 -31.463 1.00 24.82  ? 237 ARG A CA    1 
ATOM   1932 C  C     . ARG A 1 237 ? 23.374  -40.273 -32.810 1.00 24.50  ? 237 ARG A C     1 
ATOM   1933 O  O     . ARG A 1 237 ? 24.470  -40.687 -33.169 1.00 24.04  ? 237 ARG A O     1 
ATOM   1934 C  CB    . ARG A 1 237 ? 22.778  -40.544 -30.382 1.00 24.91  ? 237 ARG A CB    1 
ATOM   1935 C  CG    . ARG A 1 237 ? 22.885  -39.890 -29.012 1.00 28.17  ? 237 ARG A CG    1 
ATOM   1936 C  CD    . ARG A 1 237 ? 22.442  -40.768 -27.847 1.00 30.55  ? 237 ARG A CD    1 
ATOM   1937 N  NE    . ARG A 1 237 ? 22.585  -40.017 -26.596 1.00 33.68  ? 237 ARG A NE    1 
ATOM   1938 C  CZ    . ARG A 1 237 ? 21.588  -39.610 -25.804 1.00 35.75  ? 237 ARG A CZ    1 
ATOM   1939 N  NH1   . ARG A 1 237 ? 20.313  -39.878 -26.106 1.00 35.02  ? 237 ARG A NH1   1 
ATOM   1940 N  NH2   . ARG A 1 237 ? 21.879  -38.932 -24.688 1.00 34.48  ? 237 ARG A NH2   1 
ATOM   1941 N  N     . PHE A 1 238 ? 22.266  -40.414 -33.542 1.00 22.96  ? 238 PHE A N     1 
ATOM   1942 C  CA    . PHE A 1 238 ? 22.317  -40.998 -34.876 1.00 23.63  ? 238 PHE A CA    1 
ATOM   1943 C  C     . PHE A 1 238 ? 23.121  -40.115 -35.845 1.00 23.15  ? 238 PHE A C     1 
ATOM   1944 O  O     . PHE A 1 238 ? 23.989  -40.598 -36.551 1.00 24.21  ? 238 PHE A O     1 
ATOM   1945 C  CB    . PHE A 1 238 ? 20.906  -41.249 -35.424 1.00 22.33  ? 238 PHE A CB    1 
ATOM   1946 C  CG    . PHE A 1 238 ? 20.887  -41.859 -36.793 1.00 23.41  ? 238 PHE A CG    1 
ATOM   1947 C  CD1   . PHE A 1 238 ? 21.341  -43.158 -36.995 1.00 21.79  ? 238 PHE A CD1   1 
ATOM   1948 C  CD2   . PHE A 1 238 ? 20.387  -41.146 -37.875 1.00 21.79  ? 238 PHE A CD2   1 
ATOM   1949 C  CE1   . PHE A 1 238 ? 21.309  -43.720 -38.246 1.00 25.00  ? 238 PHE A CE1   1 
ATOM   1950 C  CE2   . PHE A 1 238 ? 20.339  -41.709 -39.130 1.00 22.93  ? 238 PHE A CE2   1 
ATOM   1951 C  CZ    . PHE A 1 238 ? 20.803  -43.000 -39.325 1.00 24.07  ? 238 PHE A CZ    1 
ATOM   1952 N  N     . VAL A 1 239 ? 22.858  -38.816 -35.860 1.00 22.93  ? 239 VAL A N     1 
ATOM   1953 C  CA    . VAL A 1 239 ? 23.648  -37.935 -36.722 1.00 22.87  ? 239 VAL A CA    1 
ATOM   1954 C  C     . VAL A 1 239 ? 25.161  -38.107 -36.444 1.00 24.18  ? 239 VAL A C     1 
ATOM   1955 O  O     . VAL A 1 239 ? 25.948  -38.320 -37.388 1.00 24.65  ? 239 VAL A O     1 
ATOM   1956 C  CB    . VAL A 1 239 ? 23.175  -36.457 -36.599 1.00 22.76  ? 239 VAL A CB    1 
ATOM   1957 C  CG1   . VAL A 1 239 ? 24.158  -35.504 -37.279 1.00 22.69  ? 239 VAL A CG1   1 
ATOM   1958 C  CG2   . VAL A 1 239 ? 21.769  -36.322 -37.183 1.00 20.37  ? 239 VAL A CG2   1 
ATOM   1959 N  N     . HIS A 1 240 ? 25.548  -38.062 -35.164 1.00 24.73  ? 240 HIS A N     1 
ATOM   1960 C  CA    . HIS A 1 240 ? 26.956  -38.194 -34.762 1.00 26.06  ? 240 HIS A CA    1 
ATOM   1961 C  C     . HIS A 1 240 ? 27.534  -39.569 -35.143 1.00 26.58  ? 240 HIS A C     1 
ATOM   1962 O  O     . HIS A 1 240 ? 28.668  -39.654 -35.637 1.00 27.34  ? 240 HIS A O     1 
ATOM   1963 C  CB    . HIS A 1 240 ? 27.138  -37.931 -33.254 1.00 25.87  ? 240 HIS A CB    1 
ATOM   1964 C  CG    . HIS A 1 240 ? 28.570  -37.951 -32.812 1.00 26.39  ? 240 HIS A CG    1 
ATOM   1965 N  ND1   . HIS A 1 240 ? 29.067  -38.895 -31.939 1.00 28.43  ? 240 HIS A ND1   1 
ATOM   1966 C  CD2   . HIS A 1 240 ? 29.610  -37.147 -33.127 1.00 25.55  ? 240 HIS A CD2   1 
ATOM   1967 C  CE1   . HIS A 1 240 ? 30.352  -38.670 -31.736 1.00 27.58  ? 240 HIS A CE1   1 
ATOM   1968 N  NE2   . HIS A 1 240 ? 30.709  -37.617 -32.450 1.00 28.35  ? 240 HIS A NE2   1 
ATOM   1969 N  N     . LEU A 1 241 ? 26.743  -40.621 -34.929 1.00 25.78  ? 241 LEU A N     1 
ATOM   1970 C  CA    . LEU A 1 241 ? 27.109  -41.986 -35.360 1.00 26.93  ? 241 LEU A CA    1 
ATOM   1971 C  C     . LEU A 1 241 ? 27.349  -42.113 -36.869 1.00 26.65  ? 241 LEU A C     1 
ATOM   1972 O  O     . LEU A 1 241 ? 28.260  -42.836 -37.297 1.00 26.26  ? 241 LEU A O     1 
ATOM   1973 C  CB    . LEU A 1 241 ? 26.013  -42.988 -35.001 1.00 26.65  ? 241 LEU A CB    1 
ATOM   1974 C  CG    . LEU A 1 241 ? 26.115  -44.079 -33.914 1.00 30.52  ? 241 LEU A CG    1 
ATOM   1975 C  CD1   . LEU A 1 241 ? 27.523  -44.393 -33.382 1.00 32.01  ? 241 LEU A CD1   1 
ATOM   1976 C  CD2   . LEU A 1 241 ? 25.182  -43.793 -32.761 1.00 32.29  ? 241 LEU A CD2   1 
ATOM   1977 N  N     . CYS A 1 242 ? 26.509  -41.452 -37.672 1.00 25.28  ? 242 CYS A N     1 
ATOM   1978 C  CA    . CYS A 1 242 ? 26.676  -41.499 -39.133 1.00 25.83  ? 242 CYS A CA    1 
ATOM   1979 C  C     . CYS A 1 242 ? 27.984  -40.798 -39.536 1.00 26.68  ? 242 CYS A C     1 
ATOM   1980 O  O     . CYS A 1 242 ? 28.697  -41.228 -40.456 1.00 27.18  ? 242 CYS A O     1 
ATOM   1981 C  CB    . CYS A 1 242 ? 25.451  -40.906 -39.847 1.00 24.70  ? 242 CYS A CB    1 
ATOM   1982 S  SG    . CYS A 1 242 ? 23.958  -41.939 -39.667 1.00 25.31  ? 242 CYS A SG    1 
ATOM   1983 N  N     . ARG A 1 243 ? 28.313  -39.730 -38.812 1.00 27.09  ? 243 ARG A N     1 
ATOM   1984 C  CA    . ARG A 1 243 ? 29.537  -38.983 -39.069 1.00 28.12  ? 243 ARG A CA    1 
ATOM   1985 C  C     . ARG A 1 243 ? 30.767  -39.805 -38.697 1.00 29.12  ? 243 ARG A C     1 
ATOM   1986 O  O     . ARG A 1 243 ? 31.745  -39.815 -39.433 1.00 29.85  ? 243 ARG A O     1 
ATOM   1987 C  CB    . ARG A 1 243 ? 29.523  -37.655 -38.323 1.00 27.95  ? 243 ARG A CB    1 
ATOM   1988 C  CG    . ARG A 1 243 ? 28.457  -36.697 -38.821 1.00 27.03  ? 243 ARG A CG    1 
ATOM   1989 C  CD    . ARG A 1 243 ? 28.561  -35.388 -38.075 1.00 27.03  ? 243 ARG A CD    1 
ATOM   1990 N  NE    . ARG A 1 243 ? 27.574  -34.431 -38.542 1.00 25.55  ? 243 ARG A NE    1 
ATOM   1991 C  CZ    . ARG A 1 243 ? 27.174  -33.371 -37.843 1.00 27.28  ? 243 ARG A CZ    1 
ATOM   1992 N  NH1   . ARG A 1 243 ? 27.660  -33.158 -36.616 1.00 25.82  ? 243 ARG A NH1   1 
ATOM   1993 N  NH2   . ARG A 1 243 ? 26.259  -32.542 -38.351 1.00 26.44  ? 243 ARG A NH2   1 
ATOM   1994 N  N     . GLU A 1 244 ? 30.691  -40.521 -37.576 1.00 29.38  ? 244 GLU A N     1 
ATOM   1995 C  CA    . GLU A 1 244 ? 31.764  -41.407 -37.124 1.00 30.62  ? 244 GLU A CA    1 
ATOM   1996 C  C     . GLU A 1 244 ? 31.973  -42.586 -38.056 1.00 30.97  ? 244 GLU A C     1 
ATOM   1997 O  O     . GLU A 1 244 ? 33.109  -42.925 -38.379 1.00 31.41  ? 244 GLU A O     1 
ATOM   1998 C  CB    . GLU A 1 244 ? 31.452  -41.954 -35.741 1.00 30.78  ? 244 GLU A CB    1 
ATOM   1999 C  CG    . GLU A 1 244 ? 31.649  -40.968 -34.639 1.00 33.56  ? 244 GLU A CG    1 
ATOM   2000 C  CD    . GLU A 1 244 ? 31.489  -41.603 -33.281 1.00 37.85  ? 244 GLU A CD    1 
ATOM   2001 O  OE1   . GLU A 1 244 ? 30.553  -42.433 -33.099 1.00 40.27  ? 244 GLU A OE1   1 
ATOM   2002 O  OE2   . GLU A 1 244 ? 32.311  -41.273 -32.404 1.00 40.08  ? 244 GLU A OE2   1 
ATOM   2003 N  N     . PHE A 1 245 ? 30.876  -43.217 -38.473 1.00 30.12  ? 245 PHE A N     1 
ATOM   2004 C  CA    . PHE A 1 245 ? 30.957  -44.364 -39.363 1.00 30.78  ? 245 PHE A CA    1 
ATOM   2005 C  C     . PHE A 1 245 ? 31.574  -43.970 -40.716 1.00 31.95  ? 245 PHE A C     1 
ATOM   2006 O  O     . PHE A 1 245 ? 32.374  -44.707 -41.244 1.00 32.03  ? 245 PHE A O     1 
ATOM   2007 C  CB    . PHE A 1 245 ? 29.589  -45.052 -39.528 1.00 30.21  ? 245 PHE A CB    1 
ATOM   2008 C  CG    . PHE A 1 245 ? 29.599  -46.221 -40.499 1.00 30.56  ? 245 PHE A CG    1 
ATOM   2009 C  CD1   . PHE A 1 245 ? 29.898  -47.515 -40.057 1.00 30.78  ? 245 PHE A CD1   1 
ATOM   2010 C  CD2   . PHE A 1 245 ? 29.312  -46.028 -41.852 1.00 30.76  ? 245 PHE A CD2   1 
ATOM   2011 C  CE1   . PHE A 1 245 ? 29.904  -48.595 -40.945 1.00 31.27  ? 245 PHE A CE1   1 
ATOM   2012 C  CE2   . PHE A 1 245 ? 29.323  -47.101 -42.750 1.00 32.29  ? 245 PHE A CE2   1 
ATOM   2013 C  CZ    . PHE A 1 245 ? 29.626  -48.390 -42.288 1.00 31.75  ? 245 PHE A CZ    1 
ATOM   2014 N  N     . MET A 1 246 ? 31.208  -42.813 -41.263 1.00 33.13  ? 246 MET A N     1 
ATOM   2015 C  CA    . MET A 1 246 ? 31.755  -42.390 -42.558 1.00 35.06  ? 246 MET A CA    1 
ATOM   2016 C  C     . MET A 1 246 ? 33.242  -42.055 -42.455 1.00 37.05  ? 246 MET A C     1 
ATOM   2017 O  O     . MET A 1 246 ? 34.025  -42.345 -43.382 1.00 38.19  ? 246 MET A O     1 
ATOM   2018 C  CB    . MET A 1 246 ? 30.967  -41.223 -43.168 1.00 34.76  ? 246 MET A CB    1 
ATOM   2019 C  CG    . MET A 1 246 ? 29.594  -41.582 -43.745 1.00 34.20  ? 246 MET A CG    1 
ATOM   2020 S  SD    . MET A 1 246 ? 29.509  -43.095 -44.732 1.00 35.75  ? 246 MET A SD    1 
ATOM   2021 C  CE    . MET A 1 246 ? 30.653  -42.750 -46.094 1.00 36.11  ? 246 MET A CE    1 
ATOM   2022 N  N     . GLU A 1 247 ? 33.631  -41.464 -41.326 1.00 37.41  ? 247 GLU A N     1 
ATOM   2023 C  CA    . GLU A 1 247 ? 35.036  -41.169 -41.029 1.00 40.10  ? 247 GLU A CA    1 
ATOM   2024 C  C     . GLU A 1 247 ? 35.892  -42.436 -40.859 1.00 40.01  ? 247 GLU A C     1 
ATOM   2025 O  O     . GLU A 1 247 ? 37.016  -42.504 -41.372 1.00 41.20  ? 247 GLU A O     1 
ATOM   2026 C  CB    . GLU A 1 247 ? 35.138  -40.273 -39.784 1.00 39.58  ? 247 GLU A CB    1 
ATOM   2027 C  CG    . GLU A 1 247 ? 36.560  -40.057 -39.225 1.00 43.01  ? 247 GLU A CG    1 
ATOM   2028 C  CD    . GLU A 1 247 ? 36.567  -39.290 -37.894 1.00 44.44  ? 247 GLU A CD    1 
ATOM   2029 O  OE1   . GLU A 1 247 ? 35.777  -38.318 -37.756 1.00 48.17  ? 247 GLU A OE1   1 
ATOM   2030 O  OE2   . GLU A 1 247 ? 37.367  -39.656 -36.985 1.00 50.40  ? 247 GLU A OE2   1 
ATOM   2031 N  N     . ALA A 1 248 ? 35.377  -43.421 -40.130 1.00 39.00  ? 248 ALA A N     1 
ATOM   2032 C  CA    . ALA A 1 248 ? 36.104  -44.677 -39.911 1.00 39.58  ? 248 ALA A CA    1 
ATOM   2033 C  C     . ALA A 1 248 ? 35.181  -45.896 -39.835 1.00 38.82  ? 248 ALA A C     1 
ATOM   2034 O  O     . ALA A 1 248 ? 34.862  -46.366 -38.732 1.00 38.11  ? 248 ALA A O     1 
ATOM   2035 C  CB    . ALA A 1 248 ? 36.993  -44.580 -38.656 1.00 40.07  ? 248 ALA A CB    1 
ATOM   2036 N  N     . PRO A 1 249 ? 34.768  -46.421 -41.011 1.00 38.68  ? 249 PRO A N     1 
ATOM   2037 C  CA    . PRO A 1 249 ? 33.824  -47.536 -41.124 1.00 38.21  ? 249 PRO A CA    1 
ATOM   2038 C  C     . PRO A 1 249 ? 34.374  -48.794 -40.475 1.00 38.55  ? 249 PRO A C     1 
ATOM   2039 O  O     . PRO A 1 249 ? 35.537  -49.146 -40.674 1.00 39.22  ? 249 PRO A O     1 
ATOM   2040 C  CB    . PRO A 1 249 ? 33.701  -47.743 -42.633 1.00 38.67  ? 249 PRO A CB    1 
ATOM   2041 C  CG    . PRO A 1 249 ? 34.152  -46.457 -43.239 1.00 39.37  ? 249 PRO A CG    1 
ATOM   2042 C  CD    . PRO A 1 249 ? 35.211  -45.955 -42.333 1.00 39.32  ? 249 PRO A CD    1 
ATOM   2043 N  N     . SER A 1 250 ? 33.525  -49.462 -39.711 1.00 37.56  ? 250 SER A N     1 
ATOM   2044 C  CA    . SER A 1 250 ? 33.924  -50.631 -38.963 1.00 37.87  ? 250 SER A CA    1 
ATOM   2045 C  C     . SER A 1 250 ? 32.717  -51.518 -38.723 1.00 36.88  ? 250 SER A C     1 
ATOM   2046 O  O     . SER A 1 250 ? 31.591  -51.033 -38.561 1.00 35.54  ? 250 SER A O     1 
ATOM   2047 C  CB    . SER A 1 250 ? 34.536  -50.192 -37.633 1.00 38.38  ? 250 SER A CB    1 
ATOM   2048 O  OG    . SER A 1 250 ? 34.744  -51.291 -36.776 1.00 39.88  ? 250 SER A OG    1 
ATOM   2049 N  N     . LEU A 1 251 ? 32.951  -52.823 -38.689 1.00 37.22  ? 251 LEU A N     1 
ATOM   2050 C  CA    . LEU A 1 251 ? 31.892  -53.777 -38.380 1.00 36.37  ? 251 LEU A CA    1 
ATOM   2051 C  C     . LEU A 1 251 ? 31.392  -53.578 -36.942 1.00 35.74  ? 251 LEU A C     1 
ATOM   2052 O  O     . LEU A 1 251 ? 30.253  -53.935 -36.614 1.00 34.84  ? 251 LEU A O     1 
ATOM   2053 C  CB    . LEU A 1 251 ? 32.384  -55.210 -38.615 1.00 36.96  ? 251 LEU A CB    1 
ATOM   2054 C  CG    . LEU A 1 251 ? 31.405  -56.382 -38.527 1.00 36.39  ? 251 LEU A CG    1 
ATOM   2055 C  CD1   . LEU A 1 251 ? 30.183  -56.183 -39.428 1.00 34.63  ? 251 LEU A CD1   1 
ATOM   2056 C  CD2   . LEU A 1 251 ? 32.132  -57.702 -38.861 1.00 37.56  ? 251 LEU A CD2   1 
ATOM   2057 N  N     . GLY A 1 252 ? 32.241  -52.974 -36.106 1.00 36.16  ? 252 GLY A N     1 
ATOM   2058 C  CA    . GLY A 1 252 ? 31.906  -52.678 -34.716 1.00 35.72  ? 252 GLY A CA    1 
ATOM   2059 C  C     . GLY A 1 252 ? 30.605  -51.917 -34.488 1.00 34.89  ? 252 GLY A C     1 
ATOM   2060 O  O     . GLY A 1 252 ? 29.958  -52.112 -33.466 1.00 34.39  ? 252 GLY A O     1 
ATOM   2061 N  N     . PHE A 1 253 ? 30.229  -51.060 -35.439 1.00 34.20  ? 253 PHE A N     1 
ATOM   2062 C  CA    . PHE A 1 253 ? 28.982  -50.281 -35.389 1.00 33.53  ? 253 PHE A CA    1 
ATOM   2063 C  C     . PHE A 1 253 ? 27.703  -51.110 -35.473 1.00 32.38  ? 253 PHE A C     1 
ATOM   2064 O  O     . PHE A 1 253 ? 26.622  -50.591 -35.228 1.00 32.06  ? 253 PHE A O     1 
ATOM   2065 C  CB    . PHE A 1 253 ? 28.941  -49.260 -36.533 1.00 33.24  ? 253 PHE A CB    1 
ATOM   2066 C  CG    . PHE A 1 253 ? 29.857  -48.084 -36.348 1.00 35.16  ? 253 PHE A CG    1 
ATOM   2067 C  CD1   . PHE A 1 253 ? 31.209  -48.165 -36.711 1.00 35.46  ? 253 PHE A CD1   1 
ATOM   2068 C  CD2   . PHE A 1 253 ? 29.370  -46.883 -35.856 1.00 33.79  ? 253 PHE A CD2   1 
ATOM   2069 C  CE1   . PHE A 1 253 ? 32.060  -47.073 -36.575 1.00 34.70  ? 253 PHE A CE1   1 
ATOM   2070 C  CE2   . PHE A 1 253 ? 30.226  -45.788 -35.702 1.00 35.05  ? 253 PHE A CE2   1 
ATOM   2071 C  CZ    . PHE A 1 253 ? 31.572  -45.889 -36.066 1.00 34.55  ? 253 PHE A CZ    1 
ATOM   2072 N  N     . PHE A 1 254 ? 27.832  -52.375 -35.860 1.00 32.91  ? 254 PHE A N     1 
ATOM   2073 C  CA    . PHE A 1 254 ? 26.718  -53.311 -35.939 1.00 32.31  ? 254 PHE A CA    1 
ATOM   2074 C  C     . PHE A 1 254 ? 26.794  -54.349 -34.821 1.00 32.55  ? 254 PHE A C     1 
ATOM   2075 O  O     . PHE A 1 254 ? 25.969  -55.259 -34.753 1.00 32.66  ? 254 PHE A O     1 
ATOM   2076 C  CB    . PHE A 1 254 ? 26.728  -54.044 -37.282 1.00 32.40  ? 254 PHE A CB    1 
ATOM   2077 C  CG    . PHE A 1 254 ? 26.569  -53.142 -38.471 1.00 32.65  ? 254 PHE A CG    1 
ATOM   2078 C  CD1   . PHE A 1 254 ? 27.679  -52.511 -39.044 1.00 32.57  ? 254 PHE A CD1   1 
ATOM   2079 C  CD2   . PHE A 1 254 ? 25.310  -52.924 -39.029 1.00 31.96  ? 254 PHE A CD2   1 
ATOM   2080 C  CE1   . PHE A 1 254 ? 27.530  -51.666 -40.149 1.00 32.77  ? 254 PHE A CE1   1 
ATOM   2081 C  CE2   . PHE A 1 254 ? 25.157  -52.081 -40.130 1.00 30.85  ? 254 PHE A CE2   1 
ATOM   2082 C  CZ    . PHE A 1 254 ? 26.270  -51.461 -40.696 1.00 31.10  ? 254 PHE A CZ    1 
ATOM   2083 N  N     . LYS A 1 255 ? 27.784  -54.211 -33.953 1.00 32.98  ? 255 LYS A N     1 
ATOM   2084 C  CA    . LYS A 1 255 ? 27.949  -55.129 -32.841 1.00 33.75  ? 255 LYS A CA    1 
ATOM   2085 C  C     . LYS A 1 255 ? 27.512  -54.449 -31.555 1.00 32.89  ? 255 LYS A C     1 
ATOM   2086 O  O     . LYS A 1 255 ? 28.128  -53.467 -31.144 1.00 32.88  ? 255 LYS A O     1 
ATOM   2087 C  CB    . LYS A 1 255 ? 29.401  -55.571 -32.717 1.00 34.54  ? 255 LYS A CB    1 
ATOM   2088 C  CG    . LYS A 1 255 ? 29.900  -56.486 -33.831 1.00 37.51  ? 255 LYS A CG    1 
ATOM   2089 C  CD    . LYS A 1 255 ? 31.400  -56.694 -33.675 1.00 39.93  ? 255 LYS A CD    1 
ATOM   2090 C  CE    . LYS A 1 255 ? 31.952  -57.691 -34.678 1.00 42.64  ? 255 LYS A CE    1 
ATOM   2091 N  NZ    . LYS A 1 255 ? 33.367  -58.014 -34.353 1.00 43.64  ? 255 LYS A NZ    1 
ATOM   2092 N  N     . PRO A 1 256 ? 26.465  -54.985 -30.901 1.00 32.58  ? 256 PRO A N     1 
ATOM   2093 C  CA    . PRO A 1 256 ? 25.995  -54.367 -29.667 1.00 31.91  ? 256 PRO A CA    1 
ATOM   2094 C  C     . PRO A 1 256 ? 27.007  -54.527 -28.533 1.00 32.67  ? 256 PRO A C     1 
ATOM   2095 O  O     . PRO A 1 256 ? 27.749  -55.525 -28.474 1.00 33.25  ? 256 PRO A O     1 
ATOM   2096 C  CB    . PRO A 1 256 ? 24.715  -55.137 -29.345 1.00 31.48  ? 256 PRO A CB    1 
ATOM   2097 C  CG    . PRO A 1 256 ? 24.889  -56.456 -30.017 1.00 32.98  ? 256 PRO A CG    1 
ATOM   2098 C  CD    . PRO A 1 256 ? 25.700  -56.198 -31.250 1.00 32.27  ? 256 PRO A CD    1 
ATOM   2099 N  N     . LYS A 1 257 ? 27.049  -53.524 -27.664 1.00 32.74  ? 257 LYS A N     1 
ATOM   2100 C  CA    . LYS A 1 257 ? 27.868  -53.569 -26.467 1.00 33.89  ? 257 LYS A CA    1 
ATOM   2101 C  C     . LYS A 1 257 ? 26.981  -53.887 -25.282 1.00 32.77  ? 257 LYS A C     1 
ATOM   2102 O  O     . LYS A 1 257 ? 25.789  -53.575 -25.282 1.00 33.21  ? 257 LYS A O     1 
ATOM   2103 C  CB    . LYS A 1 257 ? 28.620  -52.248 -26.254 1.00 34.44  ? 257 LYS A CB    1 
ATOM   2104 C  CG    . LYS A 1 257 ? 29.747  -52.038 -27.243 1.00 36.99  ? 257 LYS A CG    1 
ATOM   2105 C  CD    . LYS A 1 257 ? 30.619  -50.860 -26.863 1.00 41.81  ? 257 LYS A CD    1 
ATOM   2106 C  CE    . LYS A 1 257 ? 31.753  -50.690 -27.857 1.00 44.66  ? 257 LYS A CE    1 
ATOM   2107 N  NZ    . LYS A 1 257 ? 32.776  -49.720 -27.362 1.00 47.73  ? 257 LYS A NZ    1 
ATOM   2108 N  N     A HIS A 1 258 ? 27.560  -54.572 -24.303 0.50 32.73  ? 258 HIS A N     1 
ATOM   2109 N  N     B HIS A 1 258 ? 27.577  -54.506 -24.273 0.50 33.25  ? 258 HIS A N     1 
ATOM   2110 C  CA    A HIS A 1 258 ? 26.882  -54.910 -23.055 0.50 31.75  ? 258 HIS A CA    1 
ATOM   2111 C  CA    B HIS A 1 258 ? 26.878  -54.902 -23.059 0.50 32.74  ? 258 HIS A CA    1 
ATOM   2112 C  C     A HIS A 1 258 ? 27.687  -54.337 -21.893 0.50 32.14  ? 258 HIS A C     1 
ATOM   2113 C  C     B HIS A 1 258 ? 27.686  -54.376 -21.878 0.50 32.70  ? 258 HIS A C     1 
ATOM   2114 O  O     A HIS A 1 258 ? 28.910  -54.252 -21.990 0.50 32.21  ? 258 HIS A O     1 
ATOM   2115 O  O     B HIS A 1 258 ? 28.915  -54.367 -21.944 0.50 32.85  ? 258 HIS A O     1 
ATOM   2116 C  CB    A HIS A 1 258 ? 26.705  -56.430 -22.912 0.50 31.80  ? 258 HIS A CB    1 
ATOM   2117 C  CB    B HIS A 1 258 ? 26.743  -56.428 -23.014 0.50 33.40  ? 258 HIS A CB    1 
ATOM   2118 C  CG    A HIS A 1 258 ? 27.987  -57.209 -22.940 0.50 31.19  ? 258 HIS A CG    1 
ATOM   2119 C  CG    B HIS A 1 258 ? 26.298  -57.024 -24.316 0.50 33.98  ? 258 HIS A CG    1 
ATOM   2120 N  ND1   A HIS A 1 258 ? 28.422  -57.890 -24.057 0.50 29.45  ? 258 HIS A ND1   1 
ATOM   2121 N  ND1   B HIS A 1 258 ? 27.185  -57.416 -25.296 0.50 35.49  ? 258 HIS A ND1   1 
ATOM   2122 C  CD2   A HIS A 1 258 ? 28.912  -57.438 -21.977 0.50 30.28  ? 258 HIS A CD2   1 
ATOM   2123 C  CD2   B HIS A 1 258 ? 25.061  -57.253 -24.817 0.50 34.23  ? 258 HIS A CD2   1 
ATOM   2124 C  CE1   A HIS A 1 258 ? 29.565  -58.496 -23.782 0.50 29.99  ? 258 HIS A CE1   1 
ATOM   2125 C  CE1   B HIS A 1 258 ? 26.516  -57.874 -26.338 0.50 33.58  ? 258 HIS A CE1   1 
ATOM   2126 N  NE2   A HIS A 1 258 ? 29.886  -58.234 -22.529 0.50 29.35  ? 258 HIS A NE2   1 
ATOM   2127 N  NE2   B HIS A 1 258 ? 25.224  -57.787 -26.073 0.50 33.99  ? 258 HIS A NE2   1 
ATOM   2128 N  N     . PRO A 1 259 ? 27.005  -53.914 -20.807 1.00 32.24  ? 259 PRO A N     1 
ATOM   2129 C  CA    . PRO A 1 259 ? 27.716  -53.411 -19.613 1.00 32.80  ? 259 PRO A CA    1 
ATOM   2130 C  C     . PRO A 1 259 ? 28.572  -54.480 -18.940 1.00 34.00  ? 259 PRO A C     1 
ATOM   2131 O  O     . PRO A 1 259 ? 28.149  -55.623 -18.828 1.00 33.13  ? 259 PRO A O     1 
ATOM   2132 C  CB    . PRO A 1 259 ? 26.575  -53.007 -18.670 1.00 32.99  ? 259 PRO A CB    1 
ATOM   2133 C  CG    . PRO A 1 259 ? 25.381  -53.796 -19.142 1.00 32.37  ? 259 PRO A CG    1 
ATOM   2134 C  CD    . PRO A 1 259 ? 25.541  -53.831 -20.631 1.00 31.77  ? 259 PRO A CD    1 
ATOM   2135 N  N     . LEU A 1 260 ? 29.772  -54.111 -18.499 1.00 33.32  ? 260 LEU A N     1 
ATOM   2136 C  CA    . LEU A 1 260 ? 30.608  -55.051 -17.739 1.00 35.30  ? 260 LEU A CA    1 
ATOM   2137 C  C     . LEU A 1 260 ? 30.126  -55.121 -16.298 1.00 35.84  ? 260 LEU A C     1 
ATOM   2138 O  O     . LEU A 1 260 ? 29.525  -54.175 -15.802 1.00 34.12  ? 260 LEU A O     1 
ATOM   2139 C  CB    . LEU A 1 260 ? 32.074  -54.612 -17.757 1.00 35.30  ? 260 LEU A CB    1 
ATOM   2140 C  CG    . LEU A 1 260 ? 32.969  -55.013 -18.942 1.00 35.54  ? 260 LEU A CG    1 
ATOM   2141 C  CD1   . LEU A 1 260 ? 32.207  -55.203 -20.201 1.00 34.74  ? 260 LEU A CD1   1 
ATOM   2142 C  CD2   . LEU A 1 260 ? 34.084  -54.001 -19.140 1.00 34.22  ? 260 LEU A CD2   1 
ATOM   2143 N  N     . GLU A 1 261 ? 30.402  -56.234 -15.635 1.00 38.56  ? 261 GLU A N     1 
ATOM   2144 C  CA    . GLU A 1 261 ? 30.229  -56.311 -14.189 1.00 41.15  ? 261 GLU A CA    1 
ATOM   2145 C  C     . GLU A 1 261 ? 31.324  -55.453 -13.596 1.00 41.50  ? 261 GLU A C     1 
ATOM   2146 O  O     . GLU A 1 261 ? 32.507  -55.678 -13.848 1.00 42.64  ? 261 GLU A O     1 
ATOM   2147 C  CB    . GLU A 1 261 ? 30.344  -57.750 -13.673 1.00 42.55  ? 261 GLU A CB    1 
ATOM   2148 C  CG    . GLU A 1 261 ? 29.854  -57.914 -12.218 1.00 45.15  ? 261 GLU A CG    1 
ATOM   2149 C  CD    . GLU A 1 261 ? 30.110  -59.297 -11.627 1.00 46.74  ? 261 GLU A CD    1 
ATOM   2150 O  OE1   . GLU A 1 261 ? 29.632  -60.306 -12.208 1.00 52.23  ? 261 GLU A OE1   1 
ATOM   2151 O  OE2   . GLU A 1 261 ? 30.772  -59.376 -10.560 1.00 50.98  ? 261 GLU A OE2   1 
ATOM   2152 N  N     . ILE A 1 262 ? 30.928  -54.441 -12.845 1.00 41.54  ? 262 ILE A N     1 
ATOM   2153 C  CA    . ILE A 1 262 ? 31.894  -53.594 -12.191 1.00 43.17  ? 262 ILE A CA    1 
ATOM   2154 C  C     . ILE A 1 262 ? 31.813  -53.837 -10.693 1.00 44.04  ? 262 ILE A C     1 
ATOM   2155 O  O     . ILE A 1 262 ? 30.733  -53.798 -10.093 1.00 43.70  ? 262 ILE A O     1 
ATOM   2156 C  CB    . ILE A 1 262 ? 31.714  -52.097 -12.575 1.00 42.14  ? 262 ILE A CB    1 
ATOM   2157 C  CG1   . ILE A 1 262 ? 32.568  -51.196 -11.686 1.00 42.62  ? 262 ILE A CG1   1 
ATOM   2158 C  CG2   . ILE A 1 262 ? 30.265  -51.692 -12.500 1.00 42.01  ? 262 ILE A CG2   1 
ATOM   2159 C  CD1   . ILE A 1 262 ? 32.681  -49.781 -12.186 1.00 43.87  ? 262 ILE A CD1   1 
ATOM   2160 N  N     . GLU A 1 263 ? 32.966  -54.140 -10.116 1.00 45.93  ? 263 GLU A N     1 
ATOM   2161 C  CA    . GLU A 1 263 ? 33.112  -54.325 -8.682  1.00 47.44  ? 263 GLU A CA    1 
ATOM   2162 C  C     . GLU A 1 263 ? 32.728  -53.033 -7.942  1.00 46.06  ? 263 GLU A C     1 
ATOM   2163 O  O     . GLU A 1 263 ? 33.040  -51.927 -8.409  1.00 45.70  ? 263 GLU A O     1 
ATOM   2164 C  CB    . GLU A 1 263 ? 34.551  -54.760 -8.354  1.00 49.60  ? 263 GLU A CB    1 
ATOM   2165 C  CG    . GLU A 1 263 ? 35.655  -53.952 -9.063  1.00 52.83  ? 263 GLU A CG    1 
ATOM   2166 C  CD    . GLU A 1 263 ? 35.629  -54.094 -10.593 1.00 56.66  ? 263 GLU A CD    1 
ATOM   2167 O  OE1   . GLU A 1 263 ? 36.019  -55.167 -11.110 1.00 60.52  ? 263 GLU A OE1   1 
ATOM   2168 O  OE2   . GLU A 1 263 ? 35.231  -53.133 -11.291 1.00 56.74  ? 263 GLU A OE2   1 
ATOM   2169 N  N     . PRO A 1 264 ? 32.029  -53.162 -6.802  1.00 45.57  ? 264 PRO A N     1 
ATOM   2170 C  CA    . PRO A 1 264 ? 31.630  -51.974 -6.046  1.00 44.49  ? 264 PRO A CA    1 
ATOM   2171 C  C     . PRO A 1 264 ? 32.826  -51.095 -5.644  1.00 44.83  ? 264 PRO A C     1 
ATOM   2172 O  O     . PRO A 1 264 ? 32.640  -49.934 -5.279  1.00 43.71  ? 264 PRO A O     1 
ATOM   2173 C  CB    . PRO A 1 264 ? 30.939  -52.564 -4.812  1.00 44.62  ? 264 PRO A CB    1 
ATOM   2174 C  CG    . PRO A 1 264 ? 30.488  -53.922 -5.238  1.00 45.44  ? 264 PRO A CG    1 
ATOM   2175 C  CD    . PRO A 1 264 ? 31.559  -54.405 -6.159  1.00 46.59  ? 264 PRO A CD    1 
ATOM   2176 N  N     . GLU A 1 265 ? 34.030  -51.661 -5.741  1.00 45.99  ? 265 GLU A N     1 
ATOM   2177 C  CA    . GLU A 1 265 ? 35.275  -50.994 -5.384  1.00 46.52  ? 265 GLU A CA    1 
ATOM   2178 C  C     . GLU A 1 265 ? 35.777  -50.052 -6.475  1.00 45.18  ? 265 GLU A C     1 
ATOM   2179 O  O     . GLU A 1 265 ? 36.280  -48.972 -6.164  1.00 44.84  ? 265 GLU A O     1 
ATOM   2180 C  CB    . GLU A 1 265 ? 36.341  -52.041 -5.027  1.00 49.07  ? 265 GLU A CB    1 
ATOM   2181 C  CG    . GLU A 1 265 ? 37.691  -51.489 -4.549  1.00 51.96  ? 265 GLU A CG    1 
ATOM   2182 C  CD    . GLU A 1 265 ? 37.594  -50.502 -3.378  1.00 55.02  ? 265 GLU A CD    1 
ATOM   2183 O  OE1   . GLU A 1 265 ? 36.671  -50.612 -2.531  1.00 55.06  ? 265 GLU A OE1   1 
ATOM   2184 O  OE2   . GLU A 1 265 ? 38.475  -49.617 -3.301  1.00 56.50  ? 265 GLU A OE2   1 
ATOM   2185 N  N     . ARG A 1 266 ? 35.647  -50.453 -7.742  1.00 44.06  ? 266 ARG A N     1 
ATOM   2186 C  CA    . ARG A 1 266 ? 35.928  -49.546 -8.856  1.00 42.95  ? 266 ARG A CA    1 
ATOM   2187 C  C     . ARG A 1 266 ? 34.948  -48.365 -8.756  1.00 40.80  ? 266 ARG A C     1 
ATOM   2188 O  O     . ARG A 1 266 ? 35.362  -47.212 -8.880  1.00 39.55  ? 266 ARG A O     1 
ATOM   2189 C  CB    . ARG A 1 266 ? 35.851  -50.260 -10.226 1.00 43.10  ? 266 ARG A CB    1 
ATOM   2190 C  CG    . ARG A 1 266 ? 36.505  -49.502 -11.420 1.00 43.86  ? 266 ARG A CG    1 
ATOM   2191 C  CD    . ARG A 1 266 ? 36.199  -50.119 -12.842 1.00 44.16  ? 266 ARG A CD    1 
ATOM   2192 N  NE    . ARG A 1 266 ? 36.264  -49.104 -13.910 1.00 45.83  ? 266 ARG A NE    1 
ATOM   2193 C  CZ    . ARG A 1 266 ? 36.138  -49.311 -15.228 1.00 46.57  ? 266 ARG A CZ    1 
ATOM   2194 N  NH1   . ARG A 1 266 ? 35.928  -50.517 -15.751 1.00 46.87  ? 266 ARG A NH1   1 
ATOM   2195 N  NH2   . ARG A 1 266 ? 36.238  -48.274 -16.046 1.00 47.96  ? 266 ARG A NH2   1 
ATOM   2196 N  N     . LEU A 1 267 ? 33.671  -48.667 -8.474  1.00 39.07  ? 267 LEU A N     1 
ATOM   2197 C  CA    . LEU A 1 267 ? 32.637  -47.648 -8.278  1.00 37.47  ? 267 LEU A CA    1 
ATOM   2198 C  C     . LEU A 1 267 ? 32.969  -46.660 -7.169  1.00 36.69  ? 267 LEU A C     1 
ATOM   2199 O  O     . LEU A 1 267 ? 32.939  -45.449 -7.385  1.00 35.89  ? 267 LEU A O     1 
ATOM   2200 C  CB    . LEU A 1 267 ? 31.256  -48.293 -8.042  1.00 36.51  ? 267 LEU A CB    1 
ATOM   2201 C  CG    . LEU A 1 267 ? 30.190  -48.191 -9.146  1.00 36.73  ? 267 LEU A CG    1 
ATOM   2202 C  CD1   . LEU A 1 267 ? 30.667  -47.527 -10.434 1.00 36.46  ? 267 LEU A CD1   1 
ATOM   2203 C  CD2   . LEU A 1 267 ? 29.588  -49.555 -9.438  1.00 37.12  ? 267 LEU A CD2   1 
ATOM   2204 N  N     . ARG A 1 268 ? 33.295  -47.185 -5.989  1.00 37.67  ? 268 ARG A N     1 
ATOM   2205 C  CA    . ARG A 1 268 ? 33.700  -46.361 -4.844  1.00 37.72  ? 268 ARG A CA    1 
ATOM   2206 C  C     . ARG A 1 268 ? 34.837  -45.392 -5.194  1.00 37.52  ? 268 ARG A C     1 
ATOM   2207 O  O     . ARG A 1 268 ? 34.735  -44.179 -4.945  1.00 36.80  ? 268 ARG A O     1 
ATOM   2208 C  CB    . ARG A 1 268 ? 34.116  -47.254 -3.664  1.00 39.06  ? 268 ARG A CB    1 
ATOM   2209 C  CG    . ARG A 1 268 ? 34.374  -46.479 -2.380  1.00 40.62  ? 268 ARG A CG    1 
ATOM   2210 C  CD    . ARG A 1 268 ? 35.210  -47.266 -1.369  1.00 42.99  ? 268 ARG A CD    1 
ATOM   2211 N  NE    . ARG A 1 268 ? 36.549  -47.624 -1.848  1.00 46.16  ? 268 ARG A NE    1 
ATOM   2212 C  CZ    . ARG A 1 268 ? 37.599  -46.799 -1.901  1.00 47.74  ? 268 ARG A CZ    1 
ATOM   2213 N  NH1   . ARG A 1 268 ? 37.495  -45.521 -1.542  1.00 48.71  ? 268 ARG A NH1   1 
ATOM   2214 N  NH2   . ARG A 1 268 ? 38.763  -47.250 -2.338  1.00 48.07  ? 268 ARG A NH2   1 
ATOM   2215 N  N     . LYS A 1 269 ? 35.909  -45.935 -5.772  1.00 37.69  ? 269 LYS A N     1 
ATOM   2216 C  CA    . LYS A 1 269 ? 37.060  -45.143 -6.215  1.00 37.60  ? 269 LYS A CA    1 
ATOM   2217 C  C     . LYS A 1 269 ? 36.657  -44.044 -7.214  1.00 35.39  ? 269 LYS A C     1 
ATOM   2218 O  O     . LYS A 1 269 ? 37.122  -42.902 -7.129  1.00 34.61  ? 269 LYS A O     1 
ATOM   2219 C  CB    . LYS A 1 269 ? 38.133  -46.056 -6.821  1.00 38.83  ? 269 LYS A CB    1 
ATOM   2220 C  CG    . LYS A 1 269 ? 39.077  -46.684 -5.793  1.00 41.31  ? 269 LYS A CG    1 
ATOM   2221 C  CD    . LYS A 1 269 ? 39.920  -47.818 -6.407  1.00 43.43  ? 269 LYS A CD    1 
ATOM   2222 C  CE    . LYS A 1 269 ? 40.846  -48.445 -5.365  1.00 48.15  ? 269 LYS A CE    1 
ATOM   2223 N  NZ    . LYS A 1 269 ? 41.726  -49.533 -5.919  1.00 51.13  ? 269 LYS A NZ    1 
ATOM   2224 N  N     . ILE A 1 270 ? 35.767  -44.384 -8.145  1.00 33.89  ? 270 ILE A N     1 
ATOM   2225 C  CA    . ILE A 1 270 ? 35.330  -43.419 -9.153  1.00 31.70  ? 270 ILE A CA    1 
ATOM   2226 C  C     . ILE A 1 270 ? 34.531  -42.269 -8.519  1.00 30.23  ? 270 ILE A C     1 
ATOM   2227 O  O     . ILE A 1 270 ? 34.790  -41.087 -8.799  1.00 28.86  ? 270 ILE A O     1 
ATOM   2228 C  CB    . ILE A 1 270 ? 34.522  -44.106 -10.286 1.00 31.42  ? 270 ILE A CB    1 
ATOM   2229 C  CG1   . ILE A 1 270 ? 35.420  -45.054 -11.090 1.00 32.49  ? 270 ILE A CG1   1 
ATOM   2230 C  CG2   . ILE A 1 270 ? 33.851  -43.066 -11.176 1.00 29.91  ? 270 ILE A CG2   1 
ATOM   2231 C  CD1   . ILE A 1 270 ? 34.656  -46.103 -11.884 1.00 32.71  ? 270 ILE A CD1   1 
ATOM   2232 N  N     . VAL A 1 271 ? 33.589  -42.611 -7.642  1.00 29.42  ? 271 VAL A N     1 
ATOM   2233 C  CA    . VAL A 1 271 ? 32.748  -41.585 -6.998  1.00 28.56  ? 271 VAL A CA    1 
ATOM   2234 C  C     . VAL A 1 271 ? 33.601  -40.715 -6.082  1.00 29.41  ? 271 VAL A C     1 
ATOM   2235 O  O     . VAL A 1 271 ? 33.415  -39.496 -6.019  1.00 28.66  ? 271 VAL A O     1 
ATOM   2236 C  CB    . VAL A 1 271 ? 31.513  -42.198 -6.261  1.00 28.02  ? 271 VAL A CB    1 
ATOM   2237 C  CG1   . VAL A 1 271 ? 30.789  -41.155 -5.443  1.00 26.83  ? 271 VAL A CG1   1 
ATOM   2238 C  CG2   . VAL A 1 271 ? 30.536  -42.765 -7.293  1.00 26.60  ? 271 VAL A CG2   1 
ATOM   2239 N  N     . GLU A 1 272 ? 34.571  -41.345 -5.421  1.00 30.95  ? 272 GLU A N     1 
ATOM   2240 C  CA    . GLU A 1 272 ? 35.534  -40.638 -4.566  1.00 33.05  ? 272 GLU A CA    1 
ATOM   2241 C  C     . GLU A 1 272 ? 36.365  -39.638 -5.379  1.00 32.47  ? 272 GLU A C     1 
ATOM   2242 O  O     . GLU A 1 272 ? 36.499  -38.480 -4.992  1.00 32.20  ? 272 GLU A O     1 
ATOM   2243 C  CB    . GLU A 1 272 ? 36.431  -41.645 -3.830  1.00 34.08  ? 272 GLU A CB    1 
ATOM   2244 C  CG    . GLU A 1 272 ? 37.488  -41.019 -2.932  1.00 37.34  ? 272 GLU A CG    1 
ATOM   2245 C  CD    . GLU A 1 272 ? 38.443  -42.051 -2.338  1.00 39.82  ? 272 GLU A CD    1 
ATOM   2246 O  OE1   . GLU A 1 272 ? 39.058  -42.838 -3.097  1.00 44.55  ? 272 GLU A OE1   1 
ATOM   2247 O  OE2   . GLU A 1 272 ? 38.592  -42.063 -1.103  1.00 45.49  ? 272 GLU A OE2   1 
ATOM   2248 N  N     . GLU A 1 273 ? 36.899  -40.086 -6.514  1.00 32.13  ? 273 GLU A N     1 
ATOM   2249 C  CA    . GLU A 1 273 ? 37.644  -39.216 -7.419  1.00 32.52  ? 273 GLU A CA    1 
ATOM   2250 C  C     . GLU A 1 273 ? 36.785  -38.051 -7.953  1.00 30.84  ? 273 GLU A C     1 
ATOM   2251 O  O     . GLU A 1 273 ? 37.266  -36.919 -8.049  1.00 30.72  ? 273 GLU A O     1 
ATOM   2252 C  CB    . GLU A 1 273 ? 38.235  -40.035 -8.571  1.00 33.45  ? 273 GLU A CB    1 
ATOM   2253 C  CG    . GLU A 1 273 ? 38.965  -39.231 -9.654  1.00 37.08  ? 273 GLU A CG    1 
ATOM   2254 C  CD    . GLU A 1 273 ? 40.311  -38.670 -9.200  1.00 42.85  ? 273 GLU A CD    1 
ATOM   2255 O  OE1   . GLU A 1 273 ? 40.814  -39.059 -8.116  1.00 44.39  ? 273 GLU A OE1   1 
ATOM   2256 O  OE2   . GLU A 1 273 ? 40.880  -37.833 -9.938  1.00 45.41  ? 273 GLU A OE2   1 
ATOM   2257 N  N     . ARG A 1 274 ? 35.520  -38.330 -8.266  1.00 28.54  ? 274 ARG A N     1 
ATOM   2258 C  CA    . ARG A 1 274 ? 34.579  -37.303 -8.758  1.00 27.54  ? 274 ARG A CA    1 
ATOM   2259 C  C     . ARG A 1 274 ? 34.224  -36.267 -7.676  1.00 26.56  ? 274 ARG A C     1 
ATOM   2260 O  O     . ARG A 1 274 ? 33.994  -35.098 -7.988  1.00 26.54  ? 274 ARG A O     1 
ATOM   2261 C  CB    . ARG A 1 274 ? 33.281  -37.950 -9.245  1.00 25.87  ? 274 ARG A CB    1 
ATOM   2262 C  CG    . ARG A 1 274 ? 33.388  -38.773 -10.509 1.00 26.95  ? 274 ARG A CG    1 
ATOM   2263 C  CD    . ARG A 1 274 ? 31.963  -38.965 -11.126 1.00 27.42  ? 274 ARG A CD    1 
ATOM   2264 N  NE    . ARG A 1 274 ? 32.244  -38.818 -12.512 1.00 34.05  ? 274 ARG A NE    1 
ATOM   2265 C  CZ    . ARG A 1 274 ? 31.541  -38.210 -13.433 1.00 28.21  ? 274 ARG A CZ    1 
ATOM   2266 N  NH1   . ARG A 1 274 ? 30.336  -37.678 -13.233 1.00 25.94  ? 274 ARG A NH1   1 
ATOM   2267 N  NH2   . ARG A 1 274 ? 32.112  -38.196 -14.605 1.00 30.18  ? 274 ARG A NH2   1 
ATOM   2268 N  N     . GLY A 1 275 ? 34.149  -36.726 -6.428  1.00 26.28  ? 275 GLY A N     1 
ATOM   2269 C  CA    . GLY A 1 275 ? 33.872  -35.880 -5.247  1.00 26.83  ? 275 GLY A CA    1 
ATOM   2270 C  C     . GLY A 1 275 ? 32.412  -35.480 -5.108  1.00 25.70  ? 275 GLY A C     1 
ATOM   2271 O  O     . GLY A 1 275 ? 32.092  -34.465 -4.479  1.00 24.67  ? 275 GLY A O     1 
ATOM   2272 N  N     . THR A 1 276 ? 31.529  -36.289 -5.683  1.00 25.05  ? 276 THR A N     1 
ATOM   2273 C  CA    . THR A 1 276 ? 30.108  -35.958 -5.782  1.00 24.50  ? 276 THR A CA    1 
ATOM   2274 C  C     . THR A 1 276 ? 29.263  -36.761 -4.796  1.00 24.98  ? 276 THR A C     1 
ATOM   2275 O  O     . THR A 1 276 ? 29.719  -37.758 -4.225  1.00 25.56  ? 276 THR A O     1 
ATOM   2276 C  CB    . THR A 1 276 ? 29.541  -36.286 -7.192  1.00 24.27  ? 276 THR A CB    1 
ATOM   2277 O  OG1   . THR A 1 276 ? 29.838  -37.651 -7.510  1.00 22.57  ? 276 THR A OG1   1 
ATOM   2278 C  CG2   . THR A 1 276 ? 30.114  -35.391 -8.262  1.00 22.12  ? 276 THR A CG2   1 
ATOM   2279 N  N     . ALA A 1 277 ? 28.021  -36.316 -4.629  1.00 25.24  ? 277 ALA A N     1 
ATOM   2280 C  CA    . ALA A 1 277 ? 26.987  -37.094 -3.955  1.00 25.29  ? 277 ALA A CA    1 
ATOM   2281 C  C     . ALA A 1 277 ? 26.270  -37.904 -5.015  1.00 25.18  ? 277 ALA A C     1 
ATOM   2282 O  O     . ALA A 1 277 ? 25.683  -37.341 -5.930  1.00 25.41  ? 277 ALA A O     1 
ATOM   2283 C  CB    . ALA A 1 277 ? 26.004  -36.166 -3.237  1.00 25.45  ? 277 ALA A CB    1 
ATOM   2284 N  N     . VAL A 1 278 ? 26.320  -39.223 -4.880  1.00 25.47  ? 278 VAL A N     1 
ATOM   2285 C  CA    . VAL A 1 278 ? 25.615  -40.139 -5.772  1.00 25.01  ? 278 VAL A CA    1 
ATOM   2286 C  C     . VAL A 1 278 ? 24.616  -40.933 -4.923  1.00 24.94  ? 278 VAL A C     1 
ATOM   2287 O  O     . VAL A 1 278 ? 24.982  -41.551 -3.923  1.00 25.63  ? 278 VAL A O     1 
ATOM   2288 C  CB    . VAL A 1 278 ? 26.610  -41.079 -6.538  1.00 25.43  ? 278 VAL A CB    1 
ATOM   2289 C  CG1   . VAL A 1 278 ? 25.860  -42.050 -7.387  1.00 25.19  ? 278 VAL A CG1   1 
ATOM   2290 C  CG2   . VAL A 1 278 ? 27.582  -40.249 -7.420  1.00 24.71  ? 278 VAL A CG2   1 
ATOM   2291 N  N     . PHE A 1 279 ? 23.343  -40.877 -5.296  1.00 23.89  ? 279 PHE A N     1 
ATOM   2292 C  CA    . PHE A 1 279 ? 22.299  -41.514 -4.502  1.00 23.61  ? 279 PHE A CA    1 
ATOM   2293 C  C     . PHE A 1 279 ? 21.099  -41.873 -5.382  1.00 22.91  ? 279 PHE A C     1 
ATOM   2294 O  O     . PHE A 1 279 ? 20.935  -41.337 -6.490  1.00 21.64  ? 279 PHE A O     1 
ATOM   2295 C  CB    . PHE A 1 279 ? 21.884  -40.614 -3.311  1.00 24.19  ? 279 PHE A CB    1 
ATOM   2296 C  CG    . PHE A 1 279 ? 21.293  -39.297 -3.734  1.00 23.46  ? 279 PHE A CG    1 
ATOM   2297 C  CD1   . PHE A 1 279 ? 19.905  -39.161 -3.913  1.00 23.56  ? 279 PHE A CD1   1 
ATOM   2298 C  CD2   . PHE A 1 279 ? 22.123  -38.209 -3.991  1.00 23.61  ? 279 PHE A CD2   1 
ATOM   2299 C  CE1   . PHE A 1 279 ? 19.354  -37.952 -4.333  1.00 23.03  ? 279 PHE A CE1   1 
ATOM   2300 C  CE2   . PHE A 1 279 ? 21.593  -36.994 -4.428  1.00 23.47  ? 279 PHE A CE2   1 
ATOM   2301 C  CZ    . PHE A 1 279 ? 20.205  -36.857 -4.580  1.00 23.73  ? 279 PHE A CZ    1 
ATOM   2302 N  N     . ALA A 1 280 ? 20.282  -42.801 -4.896  1.00 22.50  ? 280 ALA A N     1 
ATOM   2303 C  CA    . ALA A 1 280 ? 19.081  -43.209 -5.604  1.00 22.91  ? 280 ALA A CA    1 
ATOM   2304 C  C     . ALA A 1 280 ? 17.863  -43.169 -4.712  1.00 22.64  ? 280 ALA A C     1 
ATOM   2305 O  O     . ALA A 1 280 ? 17.931  -43.438 -3.520  1.00 23.04  ? 280 ALA A O     1 
ATOM   2306 C  CB    . ALA A 1 280 ? 19.235  -44.622 -6.193  1.00 22.44  ? 280 ALA A CB    1 
ATOM   2307 N  N     . VAL A 1 281 ? 16.741  -42.842 -5.329  1.00 23.25  ? 281 VAL A N     1 
ATOM   2308 C  CA    . VAL A 1 281 ? 15.436  -43.053 -4.726  1.00 23.01  ? 281 VAL A CA    1 
ATOM   2309 C  C     . VAL A 1 281 ? 14.972  -44.426 -5.193  1.00 23.32  ? 281 VAL A C     1 
ATOM   2310 O  O     . VAL A 1 281 ? 14.831  -44.673 -6.392  1.00 22.31  ? 281 VAL A O     1 
ATOM   2311 C  CB    . VAL A 1 281 ? 14.449  -41.974 -5.184  1.00 23.42  ? 281 VAL A CB    1 
ATOM   2312 C  CG1   . VAL A 1 281 ? 13.029  -42.263 -4.642  1.00 21.68  ? 281 VAL A CG1   1 
ATOM   2313 C  CG2   . VAL A 1 281 ? 14.937  -40.623 -4.666  1.00 22.46  ? 281 VAL A CG2   1 
ATOM   2314 N  N     . LYS A 1 282 ? 14.755  -45.314 -4.238  1.00 23.45  ? 282 LYS A N     1 
ATOM   2315 C  CA    . LYS A 1 282 ? 14.292  -46.653 -4.531  1.00 23.90  ? 282 LYS A CA    1 
ATOM   2316 C  C     . LYS A 1 282 ? 12.846  -46.871 -4.041  1.00 24.44  ? 282 LYS A C     1 
ATOM   2317 O  O     . LYS A 1 282 ? 12.495  -46.432 -2.945  1.00 24.44  ? 282 LYS A O     1 
ATOM   2318 C  CB    . LYS A 1 282 ? 15.227  -47.653 -3.857  1.00 24.59  ? 282 LYS A CB    1 
ATOM   2319 C  CG    . LYS A 1 282 ? 14.928  -49.080 -4.211  1.00 24.94  ? 282 LYS A CG    1 
ATOM   2320 C  CD    . LYS A 1 282 ? 15.536  -50.008 -3.173  1.00 25.35  ? 282 LYS A CD    1 
ATOM   2321 C  CE    . LYS A 1 282 ? 15.312  -51.425 -3.572  1.00 26.06  ? 282 LYS A CE    1 
ATOM   2322 N  NZ    . LYS A 1 282 ? 15.914  -52.356 -2.630  1.00 31.19  ? 282 LYS A NZ    1 
ATOM   2323 N  N     . PHE A 1 283 ? 12.030  -47.548 -4.858  1.00 24.77  ? 283 PHE A N     1 
ATOM   2324 C  CA    . PHE A 1 283 ? 10.607  -47.836 -4.546  1.00 24.79  ? 283 PHE A CA    1 
ATOM   2325 C  C     . PHE A 1 283 ? 10.086  -49.013 -5.365  1.00 24.56  ? 283 PHE A C     1 
ATOM   2326 O  O     . PHE A 1 283 ? 10.709  -49.409 -6.357  1.00 23.38  ? 283 PHE A O     1 
ATOM   2327 C  CB    . PHE A 1 283 ? 9.725   -46.600 -4.805  1.00 24.62  ? 283 PHE A CB    1 
ATOM   2328 C  CG    . PHE A 1 283 ? 9.794   -46.089 -6.225  1.00 25.34  ? 283 PHE A CG    1 
ATOM   2329 C  CD1   . PHE A 1 283 ? 8.801   -46.413 -7.147  1.00 26.69  ? 283 PHE A CD1   1 
ATOM   2330 C  CD2   . PHE A 1 283 ? 10.870  -45.296 -6.640  1.00 24.37  ? 283 PHE A CD2   1 
ATOM   2331 C  CE1   . PHE A 1 283 ? 8.864   -45.953 -8.472  1.00 25.81  ? 283 PHE A CE1   1 
ATOM   2332 C  CE2   . PHE A 1 283 ? 10.950  -44.822 -7.966  1.00 24.59  ? 283 PHE A CE2   1 
ATOM   2333 C  CZ    . PHE A 1 283 ? 9.948   -45.159 -8.878  1.00 23.96  ? 283 PHE A CZ    1 
ATOM   2334 N  N     . ARG A 1 284 ? 8.931   -49.565 -4.974  1.00 24.85  ? 284 ARG A N     1 
ATOM   2335 C  CA    . ARG A 1 284 ? 8.400   -50.743 -5.656  1.00 25.78  ? 284 ARG A CA    1 
ATOM   2336 C  C     . ARG A 1 284 ? 7.795   -50.369 -7.012  1.00 25.33  ? 284 ARG A C     1 
ATOM   2337 O  O     . ARG A 1 284 ? 7.072   -49.372 -7.145  1.00 24.76  ? 284 ARG A O     1 
ATOM   2338 C  CB    . ARG A 1 284 ? 7.392   -51.508 -4.790  1.00 26.88  ? 284 ARG A CB    1 
ATOM   2339 C  CG    . ARG A 1 284 ? 8.028   -52.143 -3.567  1.00 31.78  ? 284 ARG A CG    1 
ATOM   2340 C  CD    . ARG A 1 284 ? 7.149   -53.202 -2.915  1.00 39.31  ? 284 ARG A CD    1 
ATOM   2341 N  NE    . ARG A 1 284 ? 7.919   -53.995 -1.940  1.00 44.36  ? 284 ARG A NE    1 
ATOM   2342 C  CZ    . ARG A 1 284 ? 8.564   -55.133 -2.225  1.00 46.03  ? 284 ARG A CZ    1 
ATOM   2343 N  NH1   . ARG A 1 284 ? 8.538   -55.650 -3.459  1.00 44.10  ? 284 ARG A NH1   1 
ATOM   2344 N  NH2   . ARG A 1 284 ? 9.235   -55.764 -1.263  1.00 47.43  ? 284 ARG A NH2   1 
ATOM   2345 N  N     . LYS A 1 285 ? 8.125   -51.174 -8.011  1.00 24.88  ? 285 LYS A N     1 
ATOM   2346 C  CA    . LYS A 1 285 ? 7.719   -50.935 -9.388  1.00 24.88  ? 285 LYS A CA    1 
ATOM   2347 C  C     . LYS A 1 285 ? 6.213   -51.142 -9.521  1.00 25.25  ? 285 LYS A C     1 
ATOM   2348 O  O     . LYS A 1 285 ? 5.696   -52.212 -9.156  1.00 25.54  ? 285 LYS A O     1 
ATOM   2349 C  CB    . LYS A 1 285 ? 8.490   -51.887 -10.317 1.00 24.74  ? 285 LYS A CB    1 
ATOM   2350 C  CG    . LYS A 1 285 ? 8.130   -51.769 -11.803 1.00 25.96  ? 285 LYS A CG    1 
ATOM   2351 C  CD    . LYS A 1 285 ? 9.117   -52.559 -12.631 1.00 29.79  ? 285 LYS A CD    1 
ATOM   2352 C  CE    . LYS A 1 285 ? 8.437   -53.631 -13.439 1.00 34.19  ? 285 LYS A CE    1 
ATOM   2353 N  NZ    . LYS A 1 285 ? 9.197   -53.916 -14.712 1.00 37.48  ? 285 LYS A NZ    1 
ATOM   2354 N  N     . PRO A 1 286 ? 5.490   -50.115 -10.028 1.00 25.85  ? 286 PRO A N     1 
ATOM   2355 C  CA    . PRO A 1 286 ? 4.054   -50.299 -10.343 1.00 27.13  ? 286 PRO A CA    1 
ATOM   2356 C  C     . PRO A 1 286 ? 3.845   -51.422 -11.379 1.00 27.42  ? 286 PRO A C     1 
ATOM   2357 O  O     . PRO A 1 286 ? 4.660   -51.590 -12.291 1.00 26.97  ? 286 PRO A O     1 
ATOM   2358 C  CB    . PRO A 1 286 ? 3.654   -48.955 -10.948 1.00 26.35  ? 286 PRO A CB    1 
ATOM   2359 C  CG    . PRO A 1 286 ? 4.655   -47.991 -10.420 1.00 26.18  ? 286 PRO A CG    1 
ATOM   2360 C  CD    . PRO A 1 286 ? 5.944   -48.747 -10.324 1.00 24.56  ? 286 PRO A CD    1 
ATOM   2361 N  N     . ASP A 1 287 ? 2.773   -52.186 -11.229 1.00 28.80  ? 287 ASP A N     1 
ATOM   2362 C  CA    . ASP A 1 287 ? 2.520   -53.306 -12.115 1.00 29.89  ? 287 ASP A CA    1 
ATOM   2363 C  C     . ASP A 1 287 ? 1.764   -52.790 -13.342 1.00 29.10  ? 287 ASP A C     1 
ATOM   2364 O  O     . ASP A 1 287 ? 0.551   -52.949 -13.455 1.00 29.79  ? 287 ASP A O     1 
ATOM   2365 C  CB    . ASP A 1 287 ? 1.743   -54.430 -11.399 1.00 31.74  ? 287 ASP A CB    1 
ATOM   2366 C  CG    . ASP A 1 287 ? 1.547   -55.671 -12.302 1.00 35.53  ? 287 ASP A CG    1 
ATOM   2367 O  OD1   . ASP A 1 287 ? 2.329   -55.841 -13.269 1.00 37.78  ? 287 ASP A OD1   1 
ATOM   2368 O  OD2   . ASP A 1 287 ? 0.613   -56.472 -12.048 1.00 41.53  ? 287 ASP A OD2   1 
ATOM   2369 N  N     . ILE A 1 288 ? 2.506   -52.129 -14.231 1.00 28.22  ? 288 ILE A N     1 
ATOM   2370 C  CA    . ILE A 1 288 ? 1.963   -51.465 -15.409 1.00 27.16  ? 288 ILE A CA    1 
ATOM   2371 C  C     . ILE A 1 288 ? 2.901   -51.730 -16.575 1.00 26.51  ? 288 ILE A C     1 
ATOM   2372 O  O     . ILE A 1 288 ? 4.061   -52.079 -16.385 1.00 26.30  ? 288 ILE A O     1 
ATOM   2373 C  CB    . ILE A 1 288 ? 1.763   -49.927 -15.167 1.00 26.64  ? 288 ILE A CB    1 
ATOM   2374 C  CG1   . ILE A 1 288 ? 3.105   -49.214 -14.941 1.00 25.21  ? 288 ILE A CG1   1 
ATOM   2375 C  CG2   . ILE A 1 288 ? 0.789   -49.702 -13.974 1.00 28.09  ? 288 ILE A CG2   1 
ATOM   2376 C  CD1   . ILE A 1 288 ? 3.024   -47.734 -14.638 1.00 23.83  ? 288 ILE A CD1   1 
ATOM   2377 N  N     . VAL A 1 289 ? 2.407   -51.547 -17.788 1.00 26.89  ? 289 VAL A N     1 
ATOM   2378 C  CA    . VAL A 1 289 ? 3.230   -51.758 -18.990 1.00 25.69  ? 289 VAL A CA    1 
ATOM   2379 C  C     . VAL A 1 289 ? 4.315   -50.696 -19.124 1.00 24.39  ? 289 VAL A C     1 
ATOM   2380 O  O     . VAL A 1 289 ? 4.203   -49.603 -18.561 1.00 22.79  ? 289 VAL A O     1 
ATOM   2381 C  CB    . VAL A 1 289 ? 2.361   -51.852 -20.297 1.00 26.34  ? 289 VAL A CB    1 
ATOM   2382 C  CG1   . VAL A 1 289 ? 1.319   -52.949 -20.158 1.00 28.41  ? 289 VAL A CG1   1 
ATOM   2383 C  CG2   . VAL A 1 289 ? 1.715   -50.509 -20.619 1.00 25.07  ? 289 VAL A CG2   1 
ATOM   2384 N  N     . ASP A 1 290 ? 5.369   -51.038 -19.867 1.00 24.69  ? 290 ASP A N     1 
ATOM   2385 C  CA    . ASP A 1 290 ? 6.514   -50.145 -20.117 1.00 25.17  ? 290 ASP A CA    1 
ATOM   2386 C  C     . ASP A 1 290 ? 6.110   -48.761 -20.643 1.00 24.43  ? 290 ASP A C     1 
ATOM   2387 O  O     . ASP A 1 290 ? 6.697   -47.736 -20.284 1.00 22.48  ? 290 ASP A O     1 
ATOM   2388 C  CB    . ASP A 1 290 ? 7.430   -50.773 -21.174 1.00 26.02  ? 290 ASP A CB    1 
ATOM   2389 C  CG    . ASP A 1 290 ? 8.285   -51.906 -20.635 1.00 27.36  ? 290 ASP A CG    1 
ATOM   2390 O  OD1   . ASP A 1 290 ? 8.161   -52.264 -19.442 1.00 27.47  ? 290 ASP A OD1   1 
ATOM   2391 O  OD2   . ASP A 1 290 ? 9.093   -52.433 -21.441 1.00 29.92  ? 290 ASP A OD2   1 
ATOM   2392 N  N     . ASP A 1 291 ? 5.102   -48.748 -21.503 1.00 25.13  ? 291 ASP A N     1 
ATOM   2393 C  CA    . ASP A 1 291 ? 4.721   -47.518 -22.187 1.00 25.54  ? 291 ASP A CA    1 
ATOM   2394 C  C     . ASP A 1 291 ? 4.008   -46.517 -21.286 1.00 25.26  ? 291 ASP A C     1 
ATOM   2395 O  O     . ASP A 1 291 ? 3.907   -45.327 -21.620 1.00 25.75  ? 291 ASP A O     1 
ATOM   2396 C  CB    . ASP A 1 291 ? 3.944   -47.878 -23.441 1.00 26.93  ? 291 ASP A CB    1 
ATOM   2397 C  CG    . ASP A 1 291 ? 4.684   -48.907 -24.264 1.00 27.89  ? 291 ASP A CG    1 
ATOM   2398 O  OD1   . ASP A 1 291 ? 4.428   -50.130 -24.063 1.00 28.30  ? 291 ASP A OD1   1 
ATOM   2399 O  OD2   . ASP A 1 291 ? 5.563   -48.488 -25.059 1.00 26.41  ? 291 ASP A OD2   1 
ATOM   2400 N  N     . ASN A 1 292 ? 3.569   -47.005 -20.124 1.00 24.80  ? 292 ASN A N     1 
ATOM   2401 C  CA    . ASN A 1 292 ? 3.021   -46.171 -19.045 1.00 24.81  ? 292 ASN A CA    1 
ATOM   2402 C  C     . ASN A 1 292 ? 4.108   -45.840 -18.022 1.00 23.70  ? 292 ASN A C     1 
ATOM   2403 O  O     . ASN A 1 292 ? 4.269   -44.689 -17.596 1.00 22.86  ? 292 ASN A O     1 
ATOM   2404 C  CB    . ASN A 1 292 ? 1.841   -46.898 -18.367 1.00 24.98  ? 292 ASN A CB    1 
ATOM   2405 C  CG    . ASN A 1 292 ? 0.595   -46.934 -19.234 1.00 26.61  ? 292 ASN A CG    1 
ATOM   2406 O  OD1   . ASN A 1 292 ? 0.430   -46.129 -20.154 1.00 26.11  ? 292 ASN A OD1   1 
ATOM   2407 N  ND2   . ASN A 1 292 ? -0.306  -47.877 -18.939 1.00 28.14  ? 292 ASN A ND2   1 
ATOM   2408 N  N     . LEU A 1 293 ? 4.882   -46.854 -17.648 1.00 23.69  ? 293 LEU A N     1 
ATOM   2409 C  CA    . LEU A 1 293 ? 5.931   -46.668 -16.645 1.00 22.73  ? 293 LEU A CA    1 
ATOM   2410 C  C     . LEU A 1 293 ? 7.060   -45.695 -17.028 1.00 22.39  ? 293 LEU A C     1 
ATOM   2411 O  O     . LEU A 1 293 ? 7.417   -44.807 -16.235 1.00 22.22  ? 293 LEU A O     1 
ATOM   2412 C  CB    . LEU A 1 293 ? 6.514   -48.027 -16.256 1.00 22.97  ? 293 LEU A CB    1 
ATOM   2413 C  CG    . LEU A 1 293 ? 7.625   -47.978 -15.200 1.00 22.73  ? 293 LEU A CG    1 
ATOM   2414 C  CD1   . LEU A 1 293 ? 7.113   -47.408 -13.841 1.00 21.45  ? 293 LEU A CD1   1 
ATOM   2415 C  CD2   . LEU A 1 293 ? 8.267   -49.355 -15.042 1.00 22.51  ? 293 LEU A CD2   1 
ATOM   2416 N  N     . TYR A 1 294 ? 7.614   -45.836 -18.234 1.00 22.51  ? 294 TYR A N     1 
ATOM   2417 C  CA    . TYR A 1 294 ? 8.799   -45.052 -18.615 1.00 22.16  ? 294 TYR A CA    1 
ATOM   2418 C  C     . TYR A 1 294 ? 8.610   -43.529 -18.600 1.00 21.58  ? 294 TYR A C     1 
ATOM   2419 O  O     . TYR A 1 294 ? 9.446   -42.835 -18.020 1.00 21.37  ? 294 TYR A O     1 
ATOM   2420 C  CB    . TYR A 1 294 ? 9.512   -45.603 -19.892 1.00 23.17  ? 294 TYR A CB    1 
ATOM   2421 C  CG    . TYR A 1 294 ? 10.318  -46.829 -19.517 1.00 23.11  ? 294 TYR A CG    1 
ATOM   2422 C  CD1   . TYR A 1 294 ? 9.755   -48.107 -19.564 1.00 27.83  ? 294 TYR A CD1   1 
ATOM   2423 C  CD2   . TYR A 1 294 ? 11.607  -46.706 -19.022 1.00 25.20  ? 294 TYR A CD2   1 
ATOM   2424 C  CE1   . TYR A 1 294 ? 10.470  -49.246 -19.148 1.00 25.63  ? 294 TYR A CE1   1 
ATOM   2425 C  CE2   . TYR A 1 294 ? 12.341  -47.831 -18.607 1.00 26.72  ? 294 TYR A CE2   1 
ATOM   2426 C  CZ    . TYR A 1 294 ? 11.763  -49.101 -18.670 1.00 27.12  ? 294 TYR A CZ    1 
ATOM   2427 O  OH    . TYR A 1 294 ? 12.498  -50.205 -18.265 1.00 26.41  ? 294 TYR A OH    1 
ATOM   2428 N  N     . PRO A 1 295 ? 7.510   -43.008 -19.194 1.00 21.03  ? 295 PRO A N     1 
ATOM   2429 C  CA    . PRO A 1 295 ? 7.318   -41.571 -19.087 1.00 21.13  ? 295 PRO A CA    1 
ATOM   2430 C  C     . PRO A 1 295 ? 7.117   -41.096 -17.644 1.00 20.73  ? 295 PRO A C     1 
ATOM   2431 O  O     . PRO A 1 295 ? 7.464   -39.960 -17.324 1.00 21.58  ? 295 PRO A O     1 
ATOM   2432 C  CB    . PRO A 1 295 ? 6.060   -41.331 -19.933 1.00 20.99  ? 295 PRO A CB    1 
ATOM   2433 C  CG    . PRO A 1 295 ? 6.045   -42.455 -20.882 1.00 22.24  ? 295 PRO A CG    1 
ATOM   2434 C  CD    . PRO A 1 295 ? 6.467   -43.609 -20.045 1.00 20.91  ? 295 PRO A CD    1 
ATOM   2435 N  N     . GLN A 1 296 ? 6.566   -41.963 -16.792 1.00 21.48  ? 296 GLN A N     1 
ATOM   2436 C  CA    . GLN A 1 296 ? 6.416   -41.663 -15.376 1.00 21.32  ? 296 GLN A CA    1 
ATOM   2437 C  C     . GLN A 1 296 ? 7.769   -41.667 -14.654 1.00 21.29  ? 296 GLN A C     1 
ATOM   2438 O  O     . GLN A 1 296 ? 8.024   -40.796 -13.822 1.00 22.00  ? 296 GLN A O     1 
ATOM   2439 C  CB    . GLN A 1 296 ? 5.432   -42.622 -14.697 1.00 21.65  ? 296 GLN A CB    1 
ATOM   2440 C  CG    . GLN A 1 296 ? 3.958   -42.432 -15.104 1.00 21.94  ? 296 GLN A CG    1 
ATOM   2441 C  CD    . GLN A 1 296 ? 3.066   -43.394 -14.356 1.00 23.30  ? 296 GLN A CD    1 
ATOM   2442 O  OE1   . GLN A 1 296 ? 3.186   -43.517 -13.143 1.00 22.68  ? 296 GLN A OE1   1 
ATOM   2443 N  NE2   . GLN A 1 296 ? 2.192   -44.098 -15.070 1.00 19.25  ? 296 GLN A NE2   1 
ATOM   2444 N  N     . LEU A 1 297 ? 8.641   -42.617 -14.977 1.00 20.73  ? 297 LEU A N     1 
ATOM   2445 C  CA    . LEU A 1 297 ? 10.008  -42.566 -14.442 1.00 20.46  ? 297 LEU A CA    1 
ATOM   2446 C  C     . LEU A 1 297 ? 10.745  -41.294 -14.895 1.00 20.25  ? 297 LEU A C     1 
ATOM   2447 O  O     . LEU A 1 297 ? 11.392  -40.620 -14.099 1.00 18.48  ? 297 LEU A O     1 
ATOM   2448 C  CB    . LEU A 1 297 ? 10.780  -43.838 -14.782 1.00 20.30  ? 297 LEU A CB    1 
ATOM   2449 C  CG    . LEU A 1 297 ? 10.316  -45.168 -14.178 1.00 20.79  ? 297 LEU A CG    1 
ATOM   2450 C  CD1   . LEU A 1 297 ? 11.179  -46.314 -14.728 1.00 21.82  ? 297 LEU A CD1   1 
ATOM   2451 C  CD2   . LEU A 1 297 ? 10.272  -45.177 -12.616 1.00 20.47  ? 297 LEU A CD2   1 
ATOM   2452 N  N     . GLU A 1 298 ? 10.587  -40.950 -16.166 1.00 20.56  ? 298 GLU A N     1 
ATOM   2453 C  CA    . GLU A 1 298 ? 11.126  -39.719 -16.726 1.00 21.01  ? 298 GLU A CA    1 
ATOM   2454 C  C     . GLU A 1 298 ? 10.589  -38.498 -16.007 1.00 20.25  ? 298 GLU A C     1 
ATOM   2455 O  O     . GLU A 1 298 ? 11.343  -37.597 -15.699 1.00 20.79  ? 298 GLU A O     1 
ATOM   2456 C  CB    . GLU A 1 298 ? 10.763  -39.599 -18.213 1.00 20.42  ? 298 GLU A CB    1 
ATOM   2457 C  CG    . GLU A 1 298 ? 11.497  -40.539 -19.125 1.00 24.20  ? 298 GLU A CG    1 
ATOM   2458 C  CD    . GLU A 1 298 ? 11.001  -40.477 -20.585 1.00 25.90  ? 298 GLU A CD    1 
ATOM   2459 O  OE1   . GLU A 1 298 ? 9.957   -39.826 -20.881 1.00 29.89  ? 298 GLU A OE1   1 
ATOM   2460 O  OE2   . GLU A 1 298 ? 11.675  -41.096 -21.429 1.00 30.26  ? 298 GLU A OE2   1 
ATOM   2461 N  N     . ARG A 1 299 ? 9.281   -38.439 -15.782 1.00 21.01  ? 299 ARG A N     1 
ATOM   2462 C  CA    . ARG A 1 299 ? 8.681   -37.322 -15.036 1.00 21.71  ? 299 ARG A CA    1 
ATOM   2463 C  C     . ARG A 1 299 ? 9.221   -37.188 -13.606 1.00 20.77  ? 299 ARG A C     1 
ATOM   2464 O  O     . ARG A 1 299 ? 9.600   -36.091 -13.181 1.00 19.48  ? 299 ARG A O     1 
ATOM   2465 C  CB    . ARG A 1 299 ? 7.140   -37.379 -15.008 1.00 21.12  ? 299 ARG A CB    1 
ATOM   2466 C  CG    . ARG A 1 299 ? 6.580   -36.552 -13.856 1.00 24.86  ? 299 ARG A CG    1 
ATOM   2467 C  CD    . ARG A 1 299 ? 5.038   -36.392 -13.788 1.00 26.21  ? 299 ARG A CD    1 
ATOM   2468 N  NE    . ARG A 1 299 ? 4.789   -35.229 -14.588 1.00 33.16  ? 299 ARG A NE    1 
ATOM   2469 C  CZ    . ARG A 1 299 ? 4.589   -34.004 -14.134 1.00 31.33  ? 299 ARG A CZ    1 
ATOM   2470 N  NH1   . ARG A 1 299 ? 4.517   -33.746 -12.841 1.00 28.59  ? 299 ARG A NH1   1 
ATOM   2471 N  NH2   . ARG A 1 299 ? 4.454   -33.045 -15.026 1.00 29.10  ? 299 ARG A NH2   1 
ATOM   2472 N  N     . ALA A 1 300 ? 9.224   -38.301 -12.871 1.00 20.45  ? 300 ALA A N     1 
ATOM   2473 C  CA    . ALA A 1 300 ? 9.606   -38.310 -11.451 1.00 20.01  ? 300 ALA A CA    1 
ATOM   2474 C  C     . ALA A 1 300 ? 11.064  -37.851 -11.314 1.00 20.02  ? 300 ALA A C     1 
ATOM   2475 O  O     . ALA A 1 300 ? 11.414  -37.040 -10.437 1.00 20.18  ? 300 ALA A O     1 
ATOM   2476 C  CB    . ALA A 1 300 ? 9.440   -39.735 -10.861 1.00 18.81  ? 300 ALA A CB    1 
ATOM   2477 N  N     . SER A 1 301 ? 11.913  -38.355 -12.204 1.00 20.12  ? 301 SER A N     1 
ATOM   2478 C  CA    . SER A 1 301 ? 13.325  -38.007 -12.100 1.00 21.37  ? 301 SER A CA    1 
ATOM   2479 C  C     . SER A 1 301 ? 13.607  -36.532 -12.466 1.00 20.39  ? 301 SER A C     1 
ATOM   2480 O  O     . SER A 1 301 ? 14.426  -35.873 -11.812 1.00 19.42  ? 301 SER A O     1 
ATOM   2481 C  CB    . SER A 1 301 ? 14.221  -39.027 -12.797 1.00 20.96  ? 301 SER A CB    1 
ATOM   2482 O  OG    . SER A 1 301 ? 14.162  -38.892 -14.184 1.00 27.93  ? 301 SER A OG    1 
ATOM   2483 N  N     . ARG A 1 302 ? 12.889  -35.997 -13.440 1.00 21.46  ? 302 ARG A N     1 
ATOM   2484 C  CA    . ARG A 1 302 ? 12.963  -34.547 -13.747 1.00 22.68  ? 302 ARG A CA    1 
ATOM   2485 C  C     . ARG A 1 302 ? 12.486  -33.639 -12.595 1.00 21.82  ? 302 ARG A C     1 
ATOM   2486 O  O     . ARG A 1 302 ? 13.112  -32.605 -12.293 1.00 21.64  ? 302 ARG A O     1 
ATOM   2487 C  CB    . ARG A 1 302 ? 12.128  -34.221 -14.983 1.00 23.23  ? 302 ARG A CB    1 
ATOM   2488 C  CG    . ARG A 1 302 ? 12.289  -32.763 -15.499 1.00 25.75  ? 302 ARG A CG    1 
ATOM   2489 C  CD    . ARG A 1 302 ? 11.449  -32.525 -16.760 1.00 28.05  ? 302 ARG A CD    1 
ATOM   2490 N  NE    . ARG A 1 302 ? 10.211  -31.807 -16.470 1.00 37.40  ? 302 ARG A NE    1 
ATOM   2491 C  CZ    . ARG A 1 302 ? 9.089   -32.372 -16.039 1.00 42.23  ? 302 ARG A CZ    1 
ATOM   2492 N  NH1   . ARG A 1 302 ? 9.024   -33.684 -15.848 1.00 45.58  ? 302 ARG A NH1   1 
ATOM   2493 N  NH2   . ARG A 1 302 ? 8.025   -31.627 -15.791 1.00 43.97  ? 302 ARG A NH2   1 
ATOM   2494 N  N     . LYS A 1 303 ? 11.344  -33.967 -11.999 1.00 20.96  ? 303 LYS A N     1 
ATOM   2495 C  CA    . LYS A 1 303 ? 10.810  -33.139 -10.911 1.00 21.27  ? 303 LYS A CA    1 
ATOM   2496 C  C     . LYS A 1 303 ? 11.786  -33.067 -9.731  1.00 21.19  ? 303 LYS A C     1 
ATOM   2497 O  O     . LYS A 1 303 ? 11.960  -32.008 -9.102  1.00 20.62  ? 303 LYS A O     1 
ATOM   2498 C  CB    . LYS A 1 303 ? 9.432   -33.645 -10.447 1.00 21.55  ? 303 LYS A CB    1 
ATOM   2499 C  CG    . LYS A 1 303 ? 8.312   -33.605 -11.541 1.00 22.05  ? 303 LYS A CG    1 
ATOM   2500 C  CD    . LYS A 1 303 ? 8.009   -32.182 -12.020 1.00 25.36  ? 303 LYS A CD    1 
ATOM   2501 C  CE    . LYS A 1 303 ? 7.469   -31.318 -10.880 1.00 27.08  ? 303 LYS A CE    1 
ATOM   2502 N  NZ    . LYS A 1 303 ? 7.233   -29.901 -11.293 1.00 27.82  ? 303 LYS A NZ    1 
ATOM   2503 N  N     . ILE A 1 304 ? 12.394  -34.205 -9.426  1.00 19.99  ? 304 ILE A N     1 
ATOM   2504 C  CA    . ILE A 1 304 ? 13.389  -34.277 -8.378  1.00 20.43  ? 304 ILE A CA    1 
ATOM   2505 C  C     . ILE A 1 304 ? 14.697  -33.561 -8.787  1.00 20.48  ? 304 ILE A C     1 
ATOM   2506 O  O     . ILE A 1 304 ? 15.254  -32.826 -7.980  1.00 20.70  ? 304 ILE A O     1 
ATOM   2507 C  CB    . ILE A 1 304 ? 13.695  -35.731 -7.954  1.00 19.42  ? 304 ILE A CB    1 
ATOM   2508 C  CG1   . ILE A 1 304 ? 12.442  -36.407 -7.388  1.00 20.50  ? 304 ILE A CG1   1 
ATOM   2509 C  CG2   . ILE A 1 304 ? 14.867  -35.765 -6.925  1.00 20.11  ? 304 ILE A CG2   1 
ATOM   2510 C  CD1   . ILE A 1 304 ? 12.657  -37.841 -6.971  1.00 19.85  ? 304 ILE A CD1   1 
ATOM   2511 N  N     . PHE A 1 305 ? 15.181  -33.790 -10.017 1.00 20.66  ? 305 PHE A N     1 
ATOM   2512 C  CA    . PHE A 1 305 ? 16.330  -33.031 -10.564 1.00 20.38  ? 305 PHE A CA    1 
ATOM   2513 C  C     . PHE A 1 305 ? 16.069  -31.531 -10.432 1.00 21.11  ? 305 PHE A C     1 
ATOM   2514 O  O     . PHE A 1 305 ? 16.944  -30.767 -9.988  1.00 20.67  ? 305 PHE A O     1 
ATOM   2515 C  CB    . PHE A 1 305 ? 16.550  -33.395 -12.046 1.00 20.77  ? 305 PHE A CB    1 
ATOM   2516 C  CG    . PHE A 1 305 ? 17.842  -32.870 -12.638 1.00 21.19  ? 305 PHE A CG    1 
ATOM   2517 C  CD1   . PHE A 1 305 ? 18.978  -33.674 -12.670 1.00 21.18  ? 305 PHE A CD1   1 
ATOM   2518 C  CD2   . PHE A 1 305 ? 17.916  -31.587 -13.183 1.00 20.80  ? 305 PHE A CD2   1 
ATOM   2519 C  CE1   . PHE A 1 305 ? 20.166  -33.219 -13.226 1.00 21.78  ? 305 PHE A CE1   1 
ATOM   2520 C  CE2   . PHE A 1 305 ? 19.114  -31.117 -13.734 1.00 23.56  ? 305 PHE A CE2   1 
ATOM   2521 C  CZ    . PHE A 1 305 ? 20.245  -31.941 -13.755 1.00 21.36  ? 305 PHE A CZ    1 
ATOM   2522 N  N     . GLU A 1 306 ? 14.877  -31.101 -10.849 1.00 20.32  ? 306 GLU A N     1 
ATOM   2523 C  CA    . GLU A 1 306 ? 14.512  -29.690 -10.777 1.00 22.42  ? 306 GLU A CA    1 
ATOM   2524 C  C     . GLU A 1 306 ? 14.484  -29.164 -9.344  1.00 22.04  ? 306 GLU A C     1 
ATOM   2525 O  O     . GLU A 1 306 ? 14.902  -28.027 -9.102  1.00 22.18  ? 306 GLU A O     1 
ATOM   2526 C  CB    . GLU A 1 306 ? 13.196  -29.425 -11.516 1.00 22.55  ? 306 GLU A CB    1 
ATOM   2527 C  CG    . GLU A 1 306 ? 13.392  -29.398 -13.067 1.00 26.49  ? 306 GLU A CG    1 
ATOM   2528 C  CD    . GLU A 1 306 ? 12.078  -29.442 -13.842 1.00 26.10  ? 306 GLU A CD    1 
ATOM   2529 O  OE1   . GLU A 1 306 ? 11.011  -29.374 -13.220 1.00 32.80  ? 306 GLU A OE1   1 
ATOM   2530 O  OE2   . GLU A 1 306 ? 12.110  -29.566 -15.076 1.00 32.83  ? 306 GLU A OE2   1 
ATOM   2531 N  N     . PHE A 1 307 ? 14.011  -29.993 -8.401  1.00 21.25  ? 307 PHE A N     1 
ATOM   2532 C  CA    . PHE A 1 307 ? 14.087  -29.657 -6.962  1.00 22.11  ? 307 PHE A CA    1 
ATOM   2533 C  C     . PHE A 1 307 ? 15.555  -29.445 -6.522  1.00 22.12  ? 307 PHE A C     1 
ATOM   2534 O  O     . PHE A 1 307 ? 15.890  -28.469 -5.869  1.00 22.99  ? 307 PHE A O     1 
ATOM   2535 C  CB    . PHE A 1 307 ? 13.407  -30.742 -6.112  1.00 21.93  ? 307 PHE A CB    1 
ATOM   2536 C  CG    . PHE A 1 307 ? 13.814  -30.728 -4.652  1.00 22.82  ? 307 PHE A CG    1 
ATOM   2537 C  CD1   . PHE A 1 307 ? 13.176  -29.889 -3.758  1.00 23.54  ? 307 PHE A CD1   1 
ATOM   2538 C  CD2   . PHE A 1 307 ? 14.863  -31.537 -4.192  1.00 22.99  ? 307 PHE A CD2   1 
ATOM   2539 C  CE1   . PHE A 1 307 ? 13.540  -29.874 -2.399  1.00 25.63  ? 307 PHE A CE1   1 
ATOM   2540 C  CE2   . PHE A 1 307 ? 15.258  -31.521 -2.859  1.00 23.26  ? 307 PHE A CE2   1 
ATOM   2541 C  CZ    . PHE A 1 307 ? 14.594  -30.691 -1.956  1.00 24.46  ? 307 PHE A CZ    1 
ATOM   2542 N  N     . LEU A 1 308 ? 16.417  -30.382 -6.896  1.00 21.97  ? 308 LEU A N     1 
ATOM   2543 C  CA    . LEU A 1 308 ? 17.843  -30.304 -6.580  1.00 22.16  ? 308 LEU A CA    1 
ATOM   2544 C  C     . LEU A 1 308 ? 18.505  -29.080 -7.207  1.00 22.71  ? 308 LEU A C     1 
ATOM   2545 O  O     . LEU A 1 308 ? 19.386  -28.472 -6.586  1.00 22.74  ? 308 LEU A O     1 
ATOM   2546 C  CB    . LEU A 1 308 ? 18.562  -31.596 -7.024  1.00 20.54  ? 308 LEU A CB    1 
ATOM   2547 C  CG    . LEU A 1 308 ? 18.198  -32.825 -6.184  1.00 21.93  ? 308 LEU A CG    1 
ATOM   2548 C  CD1   . LEU A 1 308 ? 18.696  -34.099 -6.876  1.00 18.73  ? 308 LEU A CD1   1 
ATOM   2549 C  CD2   . LEU A 1 308 ? 18.767  -32.743 -4.738  1.00 20.65  ? 308 LEU A CD2   1 
ATOM   2550 N  N     . GLU A 1 309 ? 18.088  -28.683 -8.416  1.00 23.28  ? 309 GLU A N     1 
ATOM   2551 C  CA    . GLU A 1 309 ? 18.679  -27.469 -8.968  1.00 25.41  ? 309 GLU A CA    1 
ATOM   2552 C  C     . GLU A 1 309 ? 18.264  -26.166 -8.244  1.00 24.98  ? 309 GLU A C     1 
ATOM   2553 O  O     . GLU A 1 309 ? 19.133  -25.319 -7.921  1.00 24.89  ? 309 GLU A O     1 
ATOM   2554 C  CB    . GLU A 1 309 ? 18.720  -27.419 -10.529 1.00 26.47  ? 309 GLU A CB    1 
ATOM   2555 C  CG    . GLU A 1 309 ? 17.456  -27.272 -11.274 1.00 29.53  ? 309 GLU A CG    1 
ATOM   2556 C  CD    . GLU A 1 309 ? 17.572  -27.583 -12.804 1.00 30.27  ? 309 GLU A CD    1 
ATOM   2557 O  OE1   . GLU A 1 309 ? 16.613  -28.193 -13.319 1.00 34.03  ? 309 GLU A OE1   1 
ATOM   2558 O  OE2   . GLU A 1 309 ? 18.599  -27.256 -13.485 1.00 33.58  ? 309 GLU A OE2   1 
ATOM   2559 N  N     . ARG A 1 310 ? 16.978  -26.018 -7.921  1.00 23.47  ? 310 ARG A N     1 
ATOM   2560 C  CA    . ARG A 1 310 ? 16.548  -24.812 -7.216  1.00 24.35  ? 310 ARG A CA    1 
ATOM   2561 C  C     . ARG A 1 310 ? 17.006  -24.763 -5.743  1.00 24.36  ? 310 ARG A C     1 
ATOM   2562 O  O     . ARG A 1 310 ? 17.124  -23.694 -5.175  1.00 25.48  ? 310 ARG A O     1 
ATOM   2563 C  CB    . ARG A 1 310 ? 15.043  -24.557 -7.362  1.00 24.46  ? 310 ARG A CB    1 
ATOM   2564 C  CG    . ARG A 1 310 ? 14.152  -25.600 -6.763  1.00 24.74  ? 310 ARG A CG    1 
ATOM   2565 C  CD    . ARG A 1 310 ? 12.663  -25.206 -6.872  1.00 25.98  ? 310 ARG A CD    1 
ATOM   2566 N  NE    . ARG A 1 310 ? 11.848  -26.267 -6.312  1.00 26.72  ? 310 ARG A NE    1 
ATOM   2567 C  CZ    . ARG A 1 310 ? 11.340  -27.269 -7.014  1.00 26.42  ? 310 ARG A CZ    1 
ATOM   2568 N  NH1   . ARG A 1 310 ? 11.510  -27.313 -8.328  1.00 26.56  ? 310 ARG A NH1   1 
ATOM   2569 N  NH2   . ARG A 1 310 ? 10.624  -28.202 -6.399  1.00 25.45  ? 310 ARG A NH2   1 
ATOM   2570 N  N     . GLU A 1 311 ? 17.281  -25.917 -5.146  1.00 23.30  ? 311 GLU A N     1 
ATOM   2571 C  CA    . GLU A 1 311 ? 17.843  -25.965 -3.799  1.00 24.16  ? 311 GLU A CA    1 
ATOM   2572 C  C     . GLU A 1 311 ? 19.383  -25.867 -3.774  1.00 24.66  ? 311 GLU A C     1 
ATOM   2573 O  O     . GLU A 1 311 ? 20.003  -26.037 -2.711  1.00 25.33  ? 311 GLU A O     1 
ATOM   2574 C  CB    . GLU A 1 311 ? 17.378  -27.212 -3.057  1.00 24.38  ? 311 GLU A CB    1 
ATOM   2575 C  CG    . GLU A 1 311 ? 15.883  -27.254 -2.706  1.00 25.55  ? 311 GLU A CG    1 
ATOM   2576 C  CD    . GLU A 1 311 ? 15.429  -26.155 -1.763  1.00 29.50  ? 311 GLU A CD    1 
ATOM   2577 O  OE1   . GLU A 1 311 ? 14.235  -25.808 -1.829  1.00 32.30  ? 311 GLU A OE1   1 
ATOM   2578 O  OE2   . GLU A 1 311 ? 16.246  -25.635 -0.970  1.00 30.10  ? 311 GLU A OE2   1 
ATOM   2579 N  N     . ASN A 1 312 ? 19.986  -25.590 -4.938  1.00 24.25  ? 312 ASN A N     1 
ATOM   2580 C  CA    . ASN A 1 312 ? 21.414  -25.267 -5.051  1.00 24.92  ? 312 ASN A CA    1 
ATOM   2581 C  C     . ASN A 1 312 ? 22.357  -26.432 -4.726  1.00 24.75  ? 312 ASN A C     1 
ATOM   2582 O  O     . ASN A 1 312 ? 23.473  -26.240 -4.216  1.00 25.40  ? 312 ASN A O     1 
ATOM   2583 C  CB    . ASN A 1 312 ? 21.758  -24.014 -4.222  1.00 25.82  ? 312 ASN A CB    1 
ATOM   2584 C  CG    . ASN A 1 312 ? 21.100  -22.768 -4.760  1.00 26.75  ? 312 ASN A CG    1 
ATOM   2585 O  OD1   . ASN A 1 312 ? 20.361  -22.074 -4.044  1.00 29.90  ? 312 ASN A OD1   1 
ATOM   2586 N  ND2   . ASN A 1 312 ? 21.370  -22.466 -6.020  1.00 25.38  ? 312 ASN A ND2   1 
ATOM   2587 N  N     . PHE A 1 313 ? 21.913  -27.636 -5.076  1.00 23.64  ? 313 PHE A N     1 
ATOM   2588 C  CA    . PHE A 1 313 ? 22.743  -28.826 -4.938  1.00 23.73  ? 313 PHE A CA    1 
ATOM   2589 C  C     . PHE A 1 313 ? 23.522  -29.185 -6.198  1.00 23.19  ? 313 PHE A C     1 
ATOM   2590 O  O     . PHE A 1 313 ? 24.341  -30.110 -6.177  1.00 22.69  ? 313 PHE A O     1 
ATOM   2591 C  CB    . PHE A 1 313 ? 21.912  -30.005 -4.453  1.00 22.14  ? 313 PHE A CB    1 
ATOM   2592 C  CG    . PHE A 1 313 ? 21.463  -29.866 -3.026  1.00 23.96  ? 313 PHE A CG    1 
ATOM   2593 C  CD1   . PHE A 1 313 ? 22.383  -29.922 -1.984  1.00 23.70  ? 313 PHE A CD1   1 
ATOM   2594 C  CD2   . PHE A 1 313 ? 20.108  -29.696 -2.727  1.00 23.65  ? 313 PHE A CD2   1 
ATOM   2595 C  CE1   . PHE A 1 313 ? 21.960  -29.799 -0.649  1.00 25.33  ? 313 PHE A CE1   1 
ATOM   2596 C  CE2   . PHE A 1 313 ? 19.680  -29.567 -1.406  1.00 23.52  ? 313 PHE A CE2   1 
ATOM   2597 C  CZ    . PHE A 1 313 ? 20.601  -29.617 -0.373  1.00 24.50  ? 313 PHE A CZ    1 
ATOM   2598 N  N     . MET A 1 314 ? 23.274  -28.429 -7.269  1.00 23.63  ? 314 MET A N     1 
ATOM   2599 C  CA    . MET A 1 314 ? 24.008  -28.546 -8.541  1.00 24.19  ? 314 MET A CA    1 
ATOM   2600 C  C     . MET A 1 314 ? 24.013  -29.984 -9.056  1.00 22.46  ? 314 MET A C     1 
ATOM   2601 O  O     . MET A 1 314 ? 25.091  -30.597 -9.184  1.00 21.97  ? 314 MET A O     1 
ATOM   2602 C  CB    . MET A 1 314 ? 25.448  -28.021 -8.368  1.00 24.53  ? 314 MET A CB    1 
ATOM   2603 C  CG    . MET A 1 314 ? 25.502  -26.582 -7.861  1.00 26.75  ? 314 MET A CG    1 
ATOM   2604 S  SD    . MET A 1 314 ? 27.158  -25.903 -7.670  1.00 30.53  ? 314 MET A SD    1 
ATOM   2605 C  CE    . MET A 1 314 ? 27.664  -25.847 -9.395  1.00 31.21  ? 314 MET A CE    1 
ATOM   2606 N  N     . PRO A 1 315 ? 22.813  -30.520 -9.381  1.00 21.26  ? 315 PRO A N     1 
ATOM   2607 C  CA    . PRO A 1 315 ? 22.764  -31.879 -9.893  1.00 21.14  ? 315 PRO A CA    1 
ATOM   2608 C  C     . PRO A 1 315 ? 23.466  -31.896 -11.256 1.00 21.23  ? 315 PRO A C     1 
ATOM   2609 O  O     . PRO A 1 315 ? 23.445  -30.902 -11.985 1.00 20.85  ? 315 PRO A O     1 
ATOM   2610 C  CB    . PRO A 1 315 ? 21.262  -32.139 -10.029 1.00 19.90  ? 315 PRO A CB    1 
ATOM   2611 C  CG    . PRO A 1 315 ? 20.675  -30.753 -10.267 1.00 20.17  ? 315 PRO A CG    1 
ATOM   2612 C  CD    . PRO A 1 315 ? 21.473  -29.913 -9.336  1.00 20.66  ? 315 PRO A CD    1 
ATOM   2613 N  N     . LEU A 1 316 ? 24.102  -33.006 -11.580 1.00 21.26  ? 316 LEU A N     1 
ATOM   2614 C  CA    . LEU A 1 316 ? 24.815  -33.101 -12.830 1.00 22.35  ? 316 LEU A CA    1 
ATOM   2615 C  C     . LEU A 1 316 ? 23.927  -33.729 -13.896 1.00 22.92  ? 316 LEU A C     1 
ATOM   2616 O  O     . LEU A 1 316 ? 23.575  -33.085 -14.872 1.00 24.02  ? 316 LEU A O     1 
ATOM   2617 C  CB    . LEU A 1 316 ? 26.141  -33.860 -12.632 1.00 22.52  ? 316 LEU A CB    1 
ATOM   2618 C  CG    . LEU A 1 316 ? 27.225  -33.074 -11.867 1.00 22.40  ? 316 LEU A CG    1 
ATOM   2619 C  CD1   . LEU A 1 316 ? 28.318  -33.959 -11.378 1.00 22.15  ? 316 LEU A CD1   1 
ATOM   2620 C  CD2   . LEU A 1 316 ? 27.825  -31.936 -12.681 1.00 24.83  ? 316 LEU A CD2   1 
ATOM   2621 N  N     . ARG A 1 317 ? 23.562  -34.983 -13.685 1.00 23.65  ? 317 ARG A N     1 
ATOM   2622 C  CA    . ARG A 1 317 ? 22.679  -35.727 -14.561 1.00 24.27  ? 317 ARG A CA    1 
ATOM   2623 C  C     . ARG A 1 317 ? 21.848  -36.640 -13.657 1.00 24.16  ? 317 ARG A C     1 
ATOM   2624 O  O     . ARG A 1 317 ? 22.130  -36.769 -12.450 1.00 24.42  ? 317 ARG A O     1 
ATOM   2625 C  CB    . ARG A 1 317 ? 23.479  -36.580 -15.555 1.00 23.78  ? 317 ARG A CB    1 
ATOM   2626 C  CG    . ARG A 1 317 ? 24.344  -35.828 -16.558 1.00 24.79  ? 317 ARG A CG    1 
ATOM   2627 C  CD    . ARG A 1 317 ? 24.993  -36.801 -17.489 1.00 22.80  ? 317 ARG A CD    1 
ATOM   2628 N  NE    . ARG A 1 317 ? 24.129  -37.209 -18.596 1.00 24.72  ? 317 ARG A NE    1 
ATOM   2629 C  CZ    . ARG A 1 317 ? 24.421  -38.208 -19.435 1.00 27.01  ? 317 ARG A CZ    1 
ATOM   2630 N  NH1   . ARG A 1 317 ? 25.545  -38.902 -19.276 1.00 27.04  ? 317 ARG A NH1   1 
ATOM   2631 N  NH2   . ARG A 1 317 ? 23.592  -38.517 -20.431 1.00 26.66  ? 317 ARG A NH2   1 
ATOM   2632 N  N     . SER A 1 318 ? 20.792  -37.220 -14.234 1.00 25.00  ? 318 SER A N     1 
ATOM   2633 C  CA    . SER A 1 318 ? 19.971  -38.224 -13.572 1.00 24.61  ? 318 SER A CA    1 
ATOM   2634 C  C     . SER A 1 318 ? 19.805  -39.426 -14.501 1.00 24.77  ? 318 SER A C     1 
ATOM   2635 O  O     . SER A 1 318 ? 20.106  -39.363 -15.706 1.00 25.49  ? 318 SER A O     1 
ATOM   2636 C  CB    . SER A 1 318 ? 18.607  -37.643 -13.140 1.00 24.65  ? 318 SER A CB    1 
ATOM   2637 O  OG    . SER A 1 318 ? 17.829  -37.214 -14.253 1.00 28.24  ? 318 SER A OG    1 
ATOM   2638 N  N     . ALA A 1 319 ? 19.340  -40.522 -13.935 1.00 23.49  ? 319 ALA A N     1 
ATOM   2639 C  CA    . ALA A 1 319 ? 19.099  -41.732 -14.683 1.00 23.04  ? 319 ALA A CA    1 
ATOM   2640 C  C     . ALA A 1 319 ? 18.007  -42.493 -13.953 1.00 22.71  ? 319 ALA A C     1 
ATOM   2641 O  O     . ALA A 1 319 ? 17.639  -42.140 -12.832 1.00 22.02  ? 319 ALA A O     1 
ATOM   2642 C  CB    . ALA A 1 319 ? 20.387  -42.578 -14.767 1.00 23.32  ? 319 ALA A CB    1 
ATOM   2643 N  N     . PHE A 1 320 ? 17.496  -43.548 -14.572 1.00 23.06  ? 320 PHE A N     1 
ATOM   2644 C  CA    . PHE A 1 320 ? 16.592  -44.440 -13.844 1.00 24.20  ? 320 PHE A CA    1 
ATOM   2645 C  C     . PHE A 1 320 ? 16.747  -45.858 -14.346 1.00 24.65  ? 320 PHE A C     1 
ATOM   2646 O  O     . PHE A 1 320 ? 17.251  -46.060 -15.457 1.00 24.40  ? 320 PHE A O     1 
ATOM   2647 C  CB    . PHE A 1 320 ? 15.130  -43.964 -13.974 1.00 24.18  ? 320 PHE A CB    1 
ATOM   2648 C  CG    . PHE A 1 320 ? 14.686  -43.717 -15.388 1.00 24.79  ? 320 PHE A CG    1 
ATOM   2649 C  CD1   . PHE A 1 320 ? 14.282  -44.780 -16.201 1.00 24.19  ? 320 PHE A CD1   1 
ATOM   2650 C  CD2   . PHE A 1 320 ? 14.659  -42.427 -15.911 1.00 24.59  ? 320 PHE A CD2   1 
ATOM   2651 C  CE1   . PHE A 1 320 ? 13.866  -44.551 -17.515 1.00 27.84  ? 320 PHE A CE1   1 
ATOM   2652 C  CE2   . PHE A 1 320 ? 14.246  -42.186 -17.219 1.00 27.11  ? 320 PHE A CE2   1 
ATOM   2653 C  CZ    . PHE A 1 320 ? 13.846  -43.251 -18.034 1.00 27.70  ? 320 PHE A CZ    1 
ATOM   2654 N  N     . LYS A 1 321 ? 16.295  -46.820 -13.533 1.00 25.01  ? 321 LYS A N     1 
ATOM   2655 C  CA    . LYS A 1 321 ? 16.272  -48.241 -13.866 1.00 26.89  ? 321 LYS A CA    1 
ATOM   2656 C  C     . LYS A 1 321 ? 15.009  -48.907 -13.323 1.00 26.96  ? 321 LYS A C     1 
ATOM   2657 O  O     . LYS A 1 321 ? 14.676  -48.757 -12.146 1.00 26.31  ? 321 LYS A O     1 
ATOM   2658 C  CB    . LYS A 1 321 ? 17.494  -48.958 -13.274 1.00 27.37  ? 321 LYS A CB    1 
ATOM   2659 C  CG    . LYS A 1 321 ? 17.920  -50.199 -14.064 1.00 30.99  ? 321 LYS A CG    1 
ATOM   2660 C  CD    . LYS A 1 321 ? 17.488  -51.491 -13.405 1.00 36.21  ? 321 LYS A CD    1 
ATOM   2661 C  CE    . LYS A 1 321 ? 18.246  -52.692 -13.986 1.00 37.20  ? 321 LYS A CE    1 
ATOM   2662 N  NZ    . LYS A 1 321 ? 18.098  -52.792 -15.460 1.00 41.50  ? 321 LYS A NZ    1 
ATOM   2663 N  N     . ALA A 1 322 ? 14.313  -49.649 -14.177 1.00 27.35  ? 322 ALA A N     1 
ATOM   2664 C  CA    . ALA A 1 322 ? 13.194  -50.468 -13.719 1.00 29.04  ? 322 ALA A CA    1 
ATOM   2665 C  C     . ALA A 1 322 ? 13.682  -51.908 -13.662 1.00 30.18  ? 322 ALA A C     1 
ATOM   2666 O  O     . ALA A 1 322 ? 14.089  -52.456 -14.686 1.00 30.12  ? 322 ALA A O     1 
ATOM   2667 C  CB    . ALA A 1 322 ? 11.993  -50.331 -14.660 1.00 28.34  ? 322 ALA A CB    1 
ATOM   2668 N  N     . SER A 1 323 ? 13.708  -52.497 -12.464 1.00 31.23  ? 323 SER A N     1 
ATOM   2669 C  CA    . SER A 1 323 ? 14.050  -53.915 -12.325 1.00 33.28  ? 323 SER A CA    1 
ATOM   2670 C  C     . SER A 1 323 ? 12.755  -54.722 -12.206 1.00 34.58  ? 323 SER A C     1 
ATOM   2671 O  O     . SER A 1 323 ? 11.680  -54.182 -12.407 1.00 33.60  ? 323 SER A O     1 
ATOM   2672 C  CB    . SER A 1 323 ? 14.977  -54.158 -11.123 1.00 33.73  ? 323 SER A CB    1 
ATOM   2673 O  OG    . SER A 1 323 ? 14.233  -54.241 -9.913  1.00 36.08  ? 323 SER A OG    1 
ATOM   2674 N  N     . GLU A 1 324 ? 12.853  -56.011 -11.888 1.00 36.29  ? 324 GLU A N     1 
ATOM   2675 C  CA    . GLU A 1 324 ? 11.666  -56.855 -11.819 1.00 38.69  ? 324 GLU A CA    1 
ATOM   2676 C  C     . GLU A 1 324 ? 10.673  -56.365 -10.760 1.00 37.54  ? 324 GLU A C     1 
ATOM   2677 O  O     . GLU A 1 324 ? 9.466   -56.289 -11.011 1.00 37.95  ? 324 GLU A O     1 
ATOM   2678 C  CB    . GLU A 1 324 ? 12.046  -58.331 -11.593 1.00 40.26  ? 324 GLU A CB    1 
ATOM   2679 C  CG    . GLU A 1 324 ? 12.812  -58.955 -12.793 1.00 42.92  ? 324 GLU A CG    1 
ATOM   2680 C  CD    . GLU A 1 324 ? 13.041  -60.478 -12.683 1.00 45.55  ? 324 GLU A CD    1 
ATOM   2681 O  OE1   . GLU A 1 324 ? 12.685  -61.084 -11.637 1.00 50.13  ? 324 GLU A OE1   1 
ATOM   2682 O  OE2   . GLU A 1 324 ? 13.587  -61.071 -13.659 1.00 51.83  ? 324 GLU A OE2   1 
ATOM   2683 N  N     . GLU A 1 325 ? 11.186  -56.008 -9.589  1.00 36.51  ? 325 GLU A N     1 
ATOM   2684 C  CA    . GLU A 1 325 ? 10.314  -55.621 -8.487  1.00 35.57  ? 325 GLU A CA    1 
ATOM   2685 C  C     . GLU A 1 325 ? 10.475  -54.166 -8.031  1.00 32.58  ? 325 GLU A C     1 
ATOM   2686 O  O     . GLU A 1 325 ? 9.572   -53.598 -7.403  1.00 31.47  ? 325 GLU A O     1 
ATOM   2687 C  CB    . GLU A 1 325 ? 10.431  -56.629 -7.332  1.00 37.82  ? 325 GLU A CB    1 
ATOM   2688 C  CG    . GLU A 1 325 ? 11.722  -56.598 -6.539  1.00 41.98  ? 325 GLU A CG    1 
ATOM   2689 C  CD    . GLU A 1 325 ? 12.865  -57.431 -7.139  1.00 48.00  ? 325 GLU A CD    1 
ATOM   2690 O  OE1   . GLU A 1 325 ? 13.557  -56.942 -8.079  1.00 49.51  ? 325 GLU A OE1   1 
ATOM   2691 O  OE2   . GLU A 1 325 ? 13.086  -58.567 -6.639  1.00 50.18  ? 325 GLU A OE2   1 
ATOM   2692 N  N     . PHE A 1 326 ? 11.610  -53.559 -8.367  1.00 30.39  ? 326 PHE A N     1 
ATOM   2693 C  CA    . PHE A 1 326 ? 11.906  -52.194 -7.919  1.00 28.15  ? 326 PHE A CA    1 
ATOM   2694 C  C     . PHE A 1 326 ? 12.220  -51.213 -9.052  1.00 26.92  ? 326 PHE A C     1 
ATOM   2695 O  O     . PHE A 1 326 ? 12.630  -51.606 -10.135 1.00 27.03  ? 326 PHE A O     1 
ATOM   2696 C  CB    . PHE A 1 326 ? 13.057  -52.174 -6.881  1.00 28.13  ? 326 PHE A CB    1 
ATOM   2697 C  CG    . PHE A 1 326 ? 12.756  -52.914 -5.581  1.00 28.41  ? 326 PHE A CG    1 
ATOM   2698 C  CD1   . PHE A 1 326 ? 13.239  -54.211 -5.373  1.00 27.22  ? 326 PHE A CD1   1 
ATOM   2699 C  CD2   . PHE A 1 326 ? 12.023  -52.309 -4.563  1.00 26.99  ? 326 PHE A CD2   1 
ATOM   2700 C  CE1   . PHE A 1 326 ? 12.967  -54.904 -4.190  1.00 29.17  ? 326 PHE A CE1   1 
ATOM   2701 C  CE2   . PHE A 1 326 ? 11.752  -52.975 -3.368  1.00 28.89  ? 326 PHE A CE2   1 
ATOM   2702 C  CZ    . PHE A 1 326 ? 12.218  -54.292 -3.177  1.00 31.35  ? 326 PHE A CZ    1 
ATOM   2703 N  N     . CYS A 1 327 ? 12.018  -49.928 -8.785  1.00 25.86  ? 327 CYS A N     1 
ATOM   2704 C  CA    . CYS A 1 327 ? 12.522  -48.860 -9.633  1.00 24.71  ? 327 CYS A CA    1 
ATOM   2705 C  C     . CYS A 1 327 ? 13.511  -48.021 -8.837  1.00 24.13  ? 327 CYS A C     1 
ATOM   2706 O  O     . CYS A 1 327 ? 13.468  -47.996 -7.597  1.00 23.59  ? 327 CYS A O     1 
ATOM   2707 C  CB    . CYS A 1 327 ? 11.394  -47.965 -10.149 1.00 24.96  ? 327 CYS A CB    1 
ATOM   2708 S  SG    . CYS A 1 327 ? 10.264  -48.753 -11.297 1.00 27.91  ? 327 CYS A SG    1 
ATOM   2709 N  N     . TYR A 1 328 ? 14.410  -47.357 -9.564  1.00 23.38  ? 328 TYR A N     1 
ATOM   2710 C  CA    . TYR A 1 328 ? 15.487  -46.567 -8.970  1.00 22.90  ? 328 TYR A CA    1 
ATOM   2711 C  C     . TYR A 1 328 ? 15.560  -45.277 -9.729  1.00 21.98  ? 328 TYR A C     1 
ATOM   2712 O  O     . TYR A 1 328 ? 15.697  -45.303 -10.951 1.00 20.99  ? 328 TYR A O     1 
ATOM   2713 C  CB    . TYR A 1 328 ? 16.843  -47.286 -9.110  1.00 23.30  ? 328 TYR A CB    1 
ATOM   2714 C  CG    . TYR A 1 328 ? 16.884  -48.635 -8.450  1.00 25.17  ? 328 TYR A CG    1 
ATOM   2715 C  CD1   . TYR A 1 328 ? 16.439  -49.780 -9.120  1.00 25.64  ? 328 TYR A CD1   1 
ATOM   2716 C  CD2   . TYR A 1 328 ? 17.354  -48.768 -7.140  1.00 26.31  ? 328 TYR A CD2   1 
ATOM   2717 C  CE1   . TYR A 1 328 ? 16.450  -51.031 -8.498  1.00 27.52  ? 328 TYR A CE1   1 
ATOM   2718 C  CE2   . TYR A 1 328 ? 17.391  -50.010 -6.515  1.00 27.21  ? 328 TYR A CE2   1 
ATOM   2719 C  CZ    . TYR A 1 328 ? 16.932  -51.144 -7.203  1.00 28.47  ? 328 TYR A CZ    1 
ATOM   2720 O  OH    . TYR A 1 328 ? 16.958  -52.378 -6.570  1.00 29.41  ? 328 TYR A OH    1 
ATOM   2721 N  N     . LEU A 1 329 ? 15.496  -44.151 -9.024  1.00 22.08  ? 329 LEU A N     1 
ATOM   2722 C  CA    . LEU A 1 329 ? 15.787  -42.867 -9.673  1.00 21.87  ? 329 LEU A CA    1 
ATOM   2723 C  C     . LEU A 1 329 ? 17.149  -42.391 -9.179  1.00 21.87  ? 329 LEU A C     1 
ATOM   2724 O  O     . LEU A 1 329 ? 17.335  -42.228 -7.993  1.00 22.24  ? 329 LEU A O     1 
ATOM   2725 C  CB    . LEU A 1 329 ? 14.694  -41.840 -9.350  1.00 22.45  ? 329 LEU A CB    1 
ATOM   2726 C  CG    . LEU A 1 329 ? 13.228  -42.264 -9.585  1.00 21.83  ? 329 LEU A CG    1 
ATOM   2727 C  CD1   . LEU A 1 329 ? 12.269  -41.302 -8.833  1.00 19.63  ? 329 LEU A CD1   1 
ATOM   2728 C  CD2   . LEU A 1 329 ? 12.842  -42.371 -11.081 1.00 21.89  ? 329 LEU A CD2   1 
ATOM   2729 N  N     . LEU A 1 330 ? 18.098  -42.208 -10.099 1.00 20.85  ? 330 LEU A N     1 
ATOM   2730 C  CA    . LEU A 1 330 ? 19.514  -42.005 -9.758  1.00 20.67  ? 330 LEU A CA    1 
ATOM   2731 C  C     . LEU A 1 330 ? 19.889  -40.557 -10.005 1.00 20.15  ? 330 LEU A C     1 
ATOM   2732 O  O     . LEU A 1 330 ? 19.450  -39.991 -11.009 1.00 19.03  ? 330 LEU A O     1 
ATOM   2733 C  CB    . LEU A 1 330 ? 20.388  -42.907 -10.636 1.00 21.71  ? 330 LEU A CB    1 
ATOM   2734 C  CG    . LEU A 1 330 ? 19.883  -44.363 -10.601 1.00 23.94  ? 330 LEU A CG    1 
ATOM   2735 C  CD1   . LEU A 1 330 ? 20.107  -45.070 -11.900 1.00 26.82  ? 330 LEU A CD1   1 
ATOM   2736 C  CD2   . LEU A 1 330 ? 20.573  -45.089 -9.475  1.00 26.95  ? 330 LEU A CD2   1 
ATOM   2737 N  N     . PHE A 1 331 ? 20.670  -39.984 -9.083  1.00 19.62  ? 331 PHE A N     1 
ATOM   2738 C  CA    . PHE A 1 331 ? 21.144  -38.588 -9.153  1.00 20.69  ? 331 PHE A CA    1 
ATOM   2739 C  C     . PHE A 1 331 ? 22.603  -38.443 -8.732  1.00 21.83  ? 331 PHE A C     1 
ATOM   2740 O  O     . PHE A 1 331 ? 23.101  -39.200 -7.886  1.00 22.51  ? 331 PHE A O     1 
ATOM   2741 C  CB    . PHE A 1 331 ? 20.285  -37.688 -8.263  1.00 20.73  ? 331 PHE A CB    1 
ATOM   2742 C  CG    . PHE A 1 331 ? 18.821  -37.859 -8.506  1.00 20.66  ? 331 PHE A CG    1 
ATOM   2743 C  CD1   . PHE A 1 331 ? 18.197  -37.154 -9.518  1.00 20.42  ? 331 PHE A CD1   1 
ATOM   2744 C  CD2   . PHE A 1 331 ? 18.081  -38.761 -7.749  1.00 20.88  ? 331 PHE A CD2   1 
ATOM   2745 C  CE1   . PHE A 1 331 ? 16.851  -37.339 -9.784  1.00 19.52  ? 331 PHE A CE1   1 
ATOM   2746 C  CE2   . PHE A 1 331 ? 16.719  -38.952 -8.021  1.00 20.43  ? 331 PHE A CE2   1 
ATOM   2747 C  CZ    . PHE A 1 331 ? 16.121  -38.251 -9.020  1.00 19.40  ? 331 PHE A CZ    1 
ATOM   2748 N  N     . GLU A 1 332 ? 23.284  -37.472 -9.348  1.00 21.42  ? 332 GLU A N     1 
ATOM   2749 C  CA    . GLU A 1 332 ? 24.645  -37.107 -8.970  1.00 22.19  ? 332 GLU A CA    1 
ATOM   2750 C  C     . GLU A 1 332 ? 24.661  -35.597 -8.837  1.00 22.00  ? 332 GLU A C     1 
ATOM   2751 O  O     . GLU A 1 332 ? 24.189  -34.903 -9.728  1.00 22.21  ? 332 GLU A O     1 
ATOM   2752 C  CB    . GLU A 1 332 ? 25.650  -37.543 -10.035 1.00 21.88  ? 332 GLU A CB    1 
ATOM   2753 C  CG    . GLU A 1 332 ? 27.105  -37.208 -9.642  1.00 23.47  ? 332 GLU A CG    1 
ATOM   2754 C  CD    . GLU A 1 332 ? 28.165  -37.801 -10.556 1.00 23.92  ? 332 GLU A CD    1 
ATOM   2755 O  OE1   . GLU A 1 332 ? 27.940  -37.847 -11.787 1.00 27.14  ? 332 GLU A OE1   1 
ATOM   2756 O  OE2   . GLU A 1 332 ? 29.258  -38.168 -10.037 1.00 22.35  ? 332 GLU A OE2   1 
ATOM   2757 N  N     . CYS A 1 333 ? 25.154  -35.114 -7.702  1.00 22.11  ? 333 CYS A N     1 
ATOM   2758 C  CA    . CYS A 1 333 ? 25.218  -33.691 -7.394  1.00 22.83  ? 333 CYS A CA    1 
ATOM   2759 C  C     . CYS A 1 333 ? 26.644  -33.266 -7.061  1.00 23.58  ? 333 CYS A C     1 
ATOM   2760 O  O     . CYS A 1 333 ? 27.410  -34.030 -6.507  1.00 24.46  ? 333 CYS A O     1 
ATOM   2761 C  CB    . CYS A 1 333 ? 24.315  -33.372 -6.202  1.00 23.04  ? 333 CYS A CB    1 
ATOM   2762 S  SG    . CYS A 1 333 ? 22.554  -33.690 -6.520  1.00 23.41  ? 333 CYS A SG    1 
ATOM   2763 N  N     . GLN A 1 334 ? 26.974  -32.032 -7.400  1.00 23.62  ? 334 GLN A N     1 
ATOM   2764 C  CA    . GLN A 1 334 ? 28.250  -31.440 -7.047  1.00 24.92  ? 334 GLN A CA    1 
ATOM   2765 C  C     . GLN A 1 334 ? 28.391  -31.085 -5.559  1.00 24.93  ? 334 GLN A C     1 
ATOM   2766 O  O     . GLN A 1 334 ? 29.499  -31.061 -5.035  1.00 25.53  ? 334 GLN A O     1 
ATOM   2767 C  CB    . GLN A 1 334 ? 28.494  -30.186 -7.902  1.00 24.61  ? 334 GLN A CB    1 
ATOM   2768 C  CG    . GLN A 1 334 ? 28.585  -30.515 -9.399  1.00 24.84  ? 334 GLN A CG    1 
ATOM   2769 C  CD    . GLN A 1 334 ? 28.989  -29.326 -10.272 1.00 26.51  ? 334 GLN A CD    1 
ATOM   2770 O  OE1   . GLN A 1 334 ? 28.294  -28.983 -11.215 1.00 30.58  ? 334 GLN A OE1   1 
ATOM   2771 N  NE2   . GLN A 1 334 ? 30.090  -28.703 -9.954  1.00 23.95  ? 334 GLN A NE2   1 
ATOM   2772 N  N     . ILE A 1 335 ? 27.268  -30.791 -4.908  1.00 24.78  ? 335 ILE A N     1 
ATOM   2773 C  CA    . ILE A 1 335 ? 27.237  -30.339 -3.524  1.00 25.59  ? 335 ILE A CA    1 
ATOM   2774 C  C     . ILE A 1 335 ? 26.768  -31.477 -2.624  1.00 26.72  ? 335 ILE A C     1 
ATOM   2775 O  O     . ILE A 1 335 ? 25.586  -31.849 -2.648  1.00 26.47  ? 335 ILE A O     1 
ATOM   2776 C  CB    . ILE A 1 335 ? 26.291  -29.106 -3.352  1.00 25.03  ? 335 ILE A CB    1 
ATOM   2777 C  CG1   . ILE A 1 335 ? 26.700  -27.951 -4.297  1.00 24.23  ? 335 ILE A CG1   1 
ATOM   2778 C  CG2   . ILE A 1 335 ? 26.154  -28.697 -1.853  1.00 25.04  ? 335 ILE A CG2   1 
ATOM   2779 C  CD1   . ILE A 1 335 ? 28.168  -27.558 -4.295  1.00 24.56  ? 335 ILE A CD1   1 
ATOM   2780 N  N     . LYS A 1 336 ? 27.694  -32.036 -1.850  1.00 27.43  ? 336 LYS A N     1 
ATOM   2781 C  CA    . LYS A 1 336 ? 27.353  -33.088 -0.872  1.00 28.19  ? 336 LYS A CA    1 
ATOM   2782 C  C     . LYS A 1 336 ? 26.718  -32.515 0.393   1.00 28.44  ? 336 LYS A C     1 
ATOM   2783 O  O     . LYS A 1 336 ? 25.887  -33.161 1.053   1.00 28.09  ? 336 LYS A O     1 
ATOM   2784 C  CB    . LYS A 1 336 ? 28.593  -33.910 -0.520  1.00 28.98  ? 336 LYS A CB    1 
ATOM   2785 C  CG    . LYS A 1 336 ? 28.928  -34.874 -1.608  1.00 30.79  ? 336 LYS A CG    1 
ATOM   2786 C  CD    . LYS A 1 336 ? 30.398  -35.042 -1.777  1.00 35.55  ? 336 LYS A CD    1 
ATOM   2787 C  CE    . LYS A 1 336 ? 30.993  -35.992 -0.797  1.00 37.73  ? 336 LYS A CE    1 
ATOM   2788 N  NZ    . LYS A 1 336 ? 32.295  -35.373 -0.419  1.00 42.14  ? 336 LYS A NZ    1 
ATOM   2789 N  N     . GLU A 1 337 ? 27.105  -31.287 0.713   1.00 28.30  ? 337 GLU A N     1 
ATOM   2790 C  CA    . GLU A 1 337 ? 26.628  -30.616 1.895   1.00 29.42  ? 337 GLU A CA    1 
ATOM   2791 C  C     . GLU A 1 337 ? 26.688  -29.123 1.647   1.00 28.49  ? 337 GLU A C     1 
ATOM   2792 O  O     . GLU A 1 337 ? 27.703  -28.602 1.188   1.00 28.13  ? 337 GLU A O     1 
ATOM   2793 C  CB    . GLU A 1 337 ? 27.466  -31.015 3.112   1.00 30.18  ? 337 GLU A CB    1 
ATOM   2794 C  CG    . GLU A 1 337 ? 27.088  -30.302 4.411   1.00 33.69  ? 337 GLU A CG    1 
ATOM   2795 C  CD    . GLU A 1 337 ? 28.096  -30.554 5.533   1.00 35.76  ? 337 GLU A CD    1 
ATOM   2796 O  OE1   . GLU A 1 337 ? 29.301  -30.222 5.372   1.00 40.82  ? 337 GLU A OE1   1 
ATOM   2797 O  OE2   . GLU A 1 337 ? 27.676  -31.096 6.577   1.00 41.19  ? 337 GLU A OE2   1 
ATOM   2798 N  N     . ILE A 1 338 ? 25.574  -28.455 1.911   1.00 27.66  ? 338 ILE A N     1 
ATOM   2799 C  CA    . ILE A 1 338 ? 25.492  -27.009 1.841   1.00 27.71  ? 338 ILE A CA    1 
ATOM   2800 C  C     . ILE A 1 338 ? 25.366  -26.496 3.281   1.00 29.87  ? 338 ILE A C     1 
ATOM   2801 O  O     . ILE A 1 338 ? 24.999  -27.260 4.190   1.00 30.03  ? 338 ILE A O     1 
ATOM   2802 C  CB    . ILE A 1 338 ? 24.297  -26.553 0.926   1.00 26.94  ? 338 ILE A CB    1 
ATOM   2803 C  CG1   . ILE A 1 338 ? 24.389  -25.062 0.575   1.00 26.14  ? 338 ILE A CG1   1 
ATOM   2804 C  CG2   . ILE A 1 338 ? 22.934  -26.906 1.559   1.00 25.78  ? 338 ILE A CG2   1 
ATOM   2805 C  CD1   . ILE A 1 338 ? 23.546  -24.689 -0.642  1.00 25.83  ? 338 ILE A CD1   1 
ATOM   2806 N  N     . SER A 1 339 ? 25.681  -25.216 3.487   1.00 30.82  ? 339 SER A N     1 
ATOM   2807 C  CA    . SER A 1 339 ? 25.508  -24.563 4.775   1.00 33.60  ? 339 SER A CA    1 
ATOM   2808 C  C     . SER A 1 339 ? 24.043  -24.515 5.220   1.00 34.16  ? 339 SER A C     1 
ATOM   2809 O  O     . SER A 1 339 ? 23.137  -24.680 4.417   1.00 33.21  ? 339 SER A O     1 
ATOM   2810 C  CB    . SER A 1 339 ? 26.067  -23.147 4.715   1.00 33.88  ? 339 SER A CB    1 
ATOM   2811 O  OG    . SER A 1 339 ? 25.289  -22.343 3.856   1.00 33.31  ? 339 SER A OG    1 
ATOM   2812 N  N     . ARG A 1 340 ? 23.826  -24.290 6.509   1.00 27.37  ? 340 ARG A N     1 
ATOM   2813 C  CA    . ARG A 1 340 ? 22.478  -24.152 7.056   1.00 30.09  ? 340 ARG A CA    1 
ATOM   2814 C  C     . ARG A 1 340 ? 21.964  -22.775 6.659   1.00 30.49  ? 340 ARG A C     1 
ATOM   2815 O  O     . ARG A 1 340 ? 20.811  -22.619 6.230   1.00 30.61  ? 340 ARG A O     1 
ATOM   2816 C  CB    . ARG A 1 340 ? 22.493  -24.300 8.583   1.00 31.46  ? 340 ARG A CB    1 
ATOM   2817 C  CG    . ARG A 1 340 ? 21.184  -24.844 9.192   1.00 37.46  ? 340 ARG A CG    1 
ATOM   2818 C  CD    . ARG A 1 340 ? 21.367  -26.269 9.742   1.00 44.43  ? 340 ARG A CD    1 
ATOM   2819 N  NE    . ARG A 1 340 ? 20.350  -27.194 9.245   1.00 47.65  ? 340 ARG A NE    1 
ATOM   2820 C  CZ    . ARG A 1 340 ? 20.407  -28.522 9.350   1.00 51.35  ? 340 ARG A CZ    1 
ATOM   2821 N  NH1   . ARG A 1 340 ? 21.439  -29.122 9.941   1.00 52.43  ? 340 ARG A NH1   1 
ATOM   2822 N  NH2   . ARG A 1 340 ? 19.426  -29.261 8.849   1.00 53.71  ? 340 ARG A NH2   1 
ATOM   2823 N  N     . VAL A 1 341 ? 22.840  -21.778 6.777   1.00 30.52  ? 341 VAL A N     1 
ATOM   2824 C  CA    . VAL A 1 341 ? 22.456  -20.381 6.537   1.00 31.92  ? 341 VAL A CA    1 
ATOM   2825 C  C     . VAL A 1 341 ? 22.409  -20.001 5.058   1.00 31.25  ? 341 VAL A C     1 
ATOM   2826 O  O     . VAL A 1 341 ? 23.269  -20.405 4.269   1.00 31.75  ? 341 VAL A O     1 
ATOM   2827 C  CB    . VAL A 1 341 ? 23.397  -19.399 7.267   1.00 31.88  ? 341 VAL A CB    1 
ATOM   2828 C  CG1   . VAL A 1 341 ? 22.981  -17.975 7.000   1.00 33.90  ? 341 VAL A CG1   1 
ATOM   2829 C  CG2   . VAL A 1 341 ? 23.323  -19.623 8.725   1.00 35.06  ? 341 VAL A CG2   1 
ATOM   2830 N  N     . PHE A 1 342 ? 21.403  -19.207 4.701   1.00 32.16  ? 342 PHE A N     1 
ATOM   2831 C  CA    . PHE A 1 342 ? 21.282  -18.623 3.368   1.00 32.72  ? 342 PHE A CA    1 
ATOM   2832 C  C     . PHE A 1 342 ? 20.727  -17.191 3.489   1.00 33.86  ? 342 PHE A C     1 
ATOM   2833 O  O     . PHE A 1 342 ? 20.364  -16.757 4.584   1.00 34.61  ? 342 PHE A O     1 
ATOM   2834 C  CB    . PHE A 1 342 ? 20.428  -19.515 2.439   1.00 33.31  ? 342 PHE A CB    1 
ATOM   2835 C  CG    . PHE A 1 342 ? 18.969  -19.590 2.808   1.00 34.09  ? 342 PHE A CG    1 
ATOM   2836 C  CD1   . PHE A 1 342 ? 18.029  -18.785 2.150   1.00 35.76  ? 342 PHE A CD1   1 
ATOM   2837 C  CD2   . PHE A 1 342 ? 18.520  -20.478 3.792   1.00 35.90  ? 342 PHE A CD2   1 
ATOM   2838 C  CE1   . PHE A 1 342 ? 16.658  -18.845 2.481   1.00 36.25  ? 342 PHE A CE1   1 
ATOM   2839 C  CE2   . PHE A 1 342 ? 17.148  -20.565 4.128   1.00 36.79  ? 342 PHE A CE2   1 
ATOM   2840 C  CZ    . PHE A 1 342 ? 16.213  -19.750 3.471   1.00 38.22  ? 342 PHE A CZ    1 
ATOM   2841 N  N     . ARG A 1 343 ? 20.695  -16.459 2.378   1.00 34.23  ? 343 ARG A N     1 
ATOM   2842 C  CA    . ARG A 1 343 ? 20.166  -15.101 2.354   1.00 35.30  ? 343 ARG A CA    1 
ATOM   2843 C  C     . ARG A 1 343 ? 18.760  -15.070 1.790   1.00 37.03  ? 343 ARG A C     1 
ATOM   2844 O  O     . ARG A 1 343 ? 18.441  -15.783 0.835   1.00 36.83  ? 343 ARG A O     1 
ATOM   2845 C  CB    . ARG A 1 343 ? 21.049  -14.194 1.497   1.00 35.59  ? 343 ARG A CB    1 
ATOM   2846 C  CG    . ARG A 1 343 ? 22.396  -13.845 2.106   1.00 34.75  ? 343 ARG A CG    1 
ATOM   2847 C  CD    . ARG A 1 343 ? 23.391  -13.416 1.017   1.00 35.80  ? 343 ARG A CD    1 
ATOM   2848 N  NE    . ARG A 1 343 ? 22.851  -12.342 0.179   1.00 37.92  ? 343 ARG A NE    1 
ATOM   2849 C  CZ    . ARG A 1 343 ? 23.351  -11.110 0.093   1.00 38.43  ? 343 ARG A CZ    1 
ATOM   2850 N  NH1   . ARG A 1 343 ? 24.433  -10.759 0.783   1.00 39.22  ? 343 ARG A NH1   1 
ATOM   2851 N  NH2   . ARG A 1 343 ? 22.761  -10.219 -0.689  1.00 39.87  ? 343 ARG A NH2   1 
ATOM   2852 N  N     . ARG A 1 344 ? 17.922  -14.241 2.402   1.00 38.52  ? 344 ARG A N     1 
ATOM   2853 C  CA    . ARG A 1 344 ? 16.592  -13.968 1.893   1.00 41.15  ? 344 ARG A CA    1 
ATOM   2854 C  C     . ARG A 1 344 ? 16.534  -12.473 1.614   1.00 41.57  ? 344 ARG A C     1 
ATOM   2855 O  O     . ARG A 1 344 ? 16.953  -11.667 2.444   1.00 41.08  ? 344 ARG A O     1 
ATOM   2856 C  CB    . ARG A 1 344 ? 15.535  -14.396 2.914   1.00 42.62  ? 344 ARG A CB    1 
ATOM   2857 C  CG    . ARG A 1 344 ? 14.089  -14.213 2.455   1.00 47.17  ? 344 ARG A CG    1 
ATOM   2858 C  CD    . ARG A 1 344 ? 13.172  -15.227 3.121   1.00 51.89  ? 344 ARG A CD    1 
ATOM   2859 N  NE    . ARG A 1 344 ? 13.214  -16.507 2.414   1.00 54.99  ? 344 ARG A NE    1 
ATOM   2860 C  CZ    . ARG A 1 344 ? 12.787  -17.667 2.908   1.00 56.37  ? 344 ARG A CZ    1 
ATOM   2861 N  NH1   . ARG A 1 344 ? 12.295  -17.734 4.139   1.00 58.47  ? 344 ARG A NH1   1 
ATOM   2862 N  NH2   . ARG A 1 344 ? 12.868  -18.766 2.171   1.00 56.66  ? 344 ARG A NH2   1 
ATOM   2863 N  N     . MET A 1 345 ? 16.049  -12.113 0.431   1.00 42.69  ? 345 MET A N     1 
ATOM   2864 C  CA    . MET A 1 345 ? 15.931  -10.711 0.043   1.00 43.82  ? 345 MET A CA    1 
ATOM   2865 C  C     . MET A 1 345 ? 14.716  -10.000 0.652   1.00 45.37  ? 345 MET A C     1 
ATOM   2866 O  O     . MET A 1 345 ? 13.574  -10.462 0.528   1.00 46.87  ? 345 MET A O     1 
ATOM   2867 C  CB    . MET A 1 345 ? 15.864  -10.589 -1.474  1.00 44.60  ? 345 MET A CB    1 
ATOM   2868 C  CG    . MET A 1 345 ? 16.023  -9.174  -1.952  1.00 45.82  ? 345 MET A CG    1 
ATOM   2869 S  SD    . MET A 1 345 ? 15.925  -9.083  -3.728  1.00 47.93  ? 345 MET A SD    1 
ATOM   2870 C  CE    . MET A 1 345 ? 14.159  -8.976  -3.982  1.00 50.76  ? 345 MET A CE    1 
ATOM   2871 N  N     . GLY A 1 346 ? 14.976  -8.866  1.291   1.00 45.11  ? 346 GLY A N     1 
ATOM   2872 C  CA    . GLY A 1 346 ? 13.924  -8.026  1.829   1.00 46.97  ? 346 GLY A CA    1 
ATOM   2873 C  C     . GLY A 1 346 ? 13.745  -6.807  0.949   1.00 48.13  ? 346 GLY A C     1 
ATOM   2874 O  O     . GLY A 1 346 ? 14.358  -6.720  -0.120  1.00 47.79  ? 346 GLY A O     1 
ATOM   2875 N  N     . PRO A 1 347 ? 12.912  -5.854  1.398   1.00 49.77  ? 347 PRO A N     1 
ATOM   2876 C  CA    . PRO A 1 347 ? 12.542  -4.684  0.603   1.00 51.00  ? 347 PRO A CA    1 
ATOM   2877 C  C     . PRO A 1 347 ? 13.592  -3.581  0.602   1.00 49.88  ? 347 PRO A C     1 
ATOM   2878 O  O     . PRO A 1 347 ? 14.560  -3.634  1.368   1.00 47.90  ? 347 PRO A O     1 
ATOM   2879 C  CB    . PRO A 1 347 ? 11.271  -4.188  1.295   1.00 53.66  ? 347 PRO A CB    1 
ATOM   2880 C  CG    . PRO A 1 347 ? 11.441  -4.584  2.717   1.00 52.94  ? 347 PRO A CG    1 
ATOM   2881 C  CD    . PRO A 1 347 ? 12.250  -5.861  2.717   1.00 50.70  ? 347 PRO A CD    1 
ATOM   2882 N  N     . GLN A 1 348 ? 13.384  -2.592  -0.264  1.00 51.03  ? 348 GLN A N     1 
ATOM   2883 C  CA    . GLN A 1 348 ? 14.214  -1.392  -0.303  1.00 50.69  ? 348 GLN A CA    1 
ATOM   2884 C  C     . GLN A 1 348 ? 14.019  -0.547  0.953   1.00 51.01  ? 348 GLN A C     1 
ATOM   2885 O  O     . GLN A 1 348 ? 12.933  -0.534  1.540   1.00 52.62  ? 348 GLN A O     1 
ATOM   2886 C  CB    . GLN A 1 348 ? 13.899  -0.578  -1.554  1.00 52.36  ? 348 GLN A CB    1 
ATOM   2887 C  CG    . GLN A 1 348 ? 14.324  -1.260  -2.845  1.00 52.33  ? 348 GLN A CG    1 
ATOM   2888 C  CD    . GLN A 1 348 ? 14.075  -0.398  -4.065  1.00 54.86  ? 348 GLN A CD    1 
ATOM   2889 O  OE1   . GLN A 1 348 ? 13.058  0.291   -4.156  1.00 57.13  ? 348 GLN A OE1   1 
ATOM   2890 N  NE2   . GLN A 1 348 ? 15.000  -0.440  -5.016  1.00 54.16  ? 348 GLN A NE2   1 
ATOM   2891 N  N     . PHE A 1 349 ? 15.079  0.155   1.349   1.00 50.04  ? 349 PHE A N     1 
ATOM   2892 C  CA    . PHE A 1 349 ? 15.122  0.883   2.618   1.00 50.52  ? 349 PHE A CA    1 
ATOM   2893 C  C     . PHE A 1 349 ? 14.058  1.962   2.752   1.00 53.58  ? 349 PHE A C     1 
ATOM   2894 O  O     . PHE A 1 349 ? 13.690  2.315   3.872   1.00 54.90  ? 349 PHE A O     1 
ATOM   2895 C  CB    . PHE A 1 349 ? 16.525  1.463   2.886   1.00 48.78  ? 349 PHE A CB    1 
ATOM   2896 C  CG    . PHE A 1 349 ? 16.811  2.787   2.195   1.00 49.33  ? 349 PHE A CG    1 
ATOM   2897 C  CD1   . PHE A 1 349 ? 16.387  3.997   2.760   1.00 50.55  ? 349 PHE A CD1   1 
ATOM   2898 C  CD2   . PHE A 1 349 ? 17.546  2.825   1.007   1.00 46.86  ? 349 PHE A CD2   1 
ATOM   2899 C  CE1   . PHE A 1 349 ? 16.671  5.221   2.138   1.00 51.47  ? 349 PHE A CE1   1 
ATOM   2900 C  CE2   . PHE A 1 349 ? 17.836  4.044   0.379   1.00 47.89  ? 349 PHE A CE2   1 
ATOM   2901 C  CZ    . PHE A 1 349 ? 17.404  5.239   0.943   1.00 50.30  ? 349 PHE A CZ    1 
ATOM   2902 N  N     . GLU A 1 350 ? 13.582  2.480   1.616   1.00 55.19  ? 350 GLU A N     1 
ATOM   2903 C  CA    . GLU A 1 350 ? 12.603  3.581   1.587   1.00 58.66  ? 350 GLU A CA    1 
ATOM   2904 C  C     . GLU A 1 350 ? 11.231  3.121   2.060   1.00 61.24  ? 350 GLU A C     1 
ATOM   2905 O  O     . GLU A 1 350 ? 10.512  3.865   2.738   1.00 63.56  ? 350 GLU A O     1 
ATOM   2906 C  CB    . GLU A 1 350 ? 12.472  4.158   0.170   1.00 59.65  ? 350 GLU A CB    1 
ATOM   2907 C  CG    . GLU A 1 350 ? 13.618  5.065   -0.283  1.00 58.95  ? 350 GLU A CG    1 
ATOM   2908 C  CD    . GLU A 1 350 ? 14.664  4.364   -1.151  1.00 58.07  ? 350 GLU A CD    1 
ATOM   2909 O  OE1   . GLU A 1 350 ? 15.511  5.076   -1.730  1.00 56.92  ? 350 GLU A OE1   1 
ATOM   2910 O  OE2   . GLU A 1 350 ? 14.652  3.116   -1.258  1.00 57.97  ? 350 GLU A OE2   1 
ATOM   2911 N  N     . ASP A 1 351 ? 10.883  1.890   1.690   1.00 61.45  ? 351 ASP A N     1 
ATOM   2912 C  CA    . ASP A 1 351 ? 9.556   1.315   1.924   1.00 64.53  ? 351 ASP A CA    1 
ATOM   2913 C  C     . ASP A 1 351 ? 9.367   0.912   3.391   1.00 65.01  ? 351 ASP A C     1 
ATOM   2914 O  O     . ASP A 1 351 ? 9.485   -0.264  3.737   1.00 64.12  ? 351 ASP A O     1 
ATOM   2915 C  CB    . ASP A 1 351 ? 9.368   0.104   1.002   1.00 64.04  ? 351 ASP A CB    1 
ATOM   2916 C  CG    . ASP A 1 351 ? 7.930   -0.368  0.926   1.00 68.49  ? 351 ASP A CG    1 
ATOM   2917 O  OD1   . ASP A 1 351 ? 7.108   -0.037  1.813   1.00 71.30  ? 351 ASP A OD1   1 
ATOM   2918 O  OD2   . ASP A 1 351 ? 7.622   -1.093  -0.039  1.00 70.96  ? 351 ASP A OD2   1 
ATOM   2919 N  N     . GLU A 1 352 ? 9.043   1.890   4.236   1.00 66.95  ? 352 GLU A N     1 
ATOM   2920 C  CA    . GLU A 1 352 ? 9.029   1.705   5.691   1.00 67.78  ? 352 GLU A CA    1 
ATOM   2921 C  C     . GLU A 1 352 ? 8.044   0.651   6.224   1.00 69.23  ? 352 GLU A C     1 
ATOM   2922 O  O     . GLU A 1 352 ? 8.388   -0.123  7.126   1.00 68.12  ? 352 GLU A O     1 
ATOM   2923 C  CB    . GLU A 1 352 ? 8.780   3.043   6.386   1.00 70.32  ? 352 GLU A CB    1 
ATOM   2924 C  CG    . GLU A 1 352 ? 9.004   3.000   7.886   1.00 72.52  ? 352 GLU A CG    1 
ATOM   2925 C  CD    . GLU A 1 352 ? 8.663   4.302   8.574   1.00 77.93  ? 352 GLU A CD    1 
ATOM   2926 O  OE1   . GLU A 1 352 ? 8.357   5.299   7.877   1.00 80.66  ? 352 GLU A OE1   1 
ATOM   2927 O  OE2   . GLU A 1 352 ? 8.704   4.327   9.825   1.00 80.59  ? 352 GLU A OE2   1 
ATOM   2928 N  N     . ARG A 1 353 ? 6.831   0.624   5.676   1.00 71.88  ? 353 ARG A N     1 
ATOM   2929 C  CA    . ARG A 1 353 ? 5.826   -0.355  6.099   1.00 74.04  ? 353 ARG A CA    1 
ATOM   2930 C  C     . ARG A 1 353 ? 6.324   -1.787  5.802   1.00 70.89  ? 353 ARG A C     1 
ATOM   2931 O  O     . ARG A 1 353 ? 6.310   -2.659  6.677   1.00 70.68  ? 353 ARG A O     1 
ATOM   2932 C  CB    . ARG A 1 353 ? 4.459   -0.059  5.447   1.00 77.81  ? 353 ARG A CB    1 
ATOM   2933 C  CG    . ARG A 1 353 ? 3.278   -0.002  6.441   1.00 82.97  ? 353 ARG A CG    1 
ATOM   2934 C  CD    . ARG A 1 353 ? 1.955   0.532   5.830   1.00 87.53  ? 353 ARG A CD    1 
ATOM   2935 N  NE    . ARG A 1 353 ? 1.862   1.998   5.796   1.00 91.08  ? 353 ARG A NE    1 
ATOM   2936 C  CZ    . ARG A 1 353 ? 0.724   2.701   5.746   1.00 96.20  ? 353 ARG A CZ    1 
ATOM   2937 N  NH1   . ARG A 1 353 ? -0.464  2.100   5.743   1.00 99.76  ? 353 ARG A NH1   1 
ATOM   2938 N  NH2   . ARG A 1 353 ? 0.768   4.028   5.712   1.00 97.84  ? 353 ARG A NH2   1 
ATOM   2939 N  N     . ASN A 1 354 ? 6.795   -2.014  4.579   1.00 68.40  ? 354 ASN A N     1 
ATOM   2940 C  CA    . ASN A 1 354 ? 7.328   -3.321  4.196   1.00 65.88  ? 354 ASN A CA    1 
ATOM   2941 C  C     . ASN A 1 354 ? 8.636   -3.726  4.895   1.00 62.43  ? 354 ASN A C     1 
ATOM   2942 O  O     . ASN A 1 354 ? 8.861   -4.919  5.116   1.00 61.07  ? 354 ASN A O     1 
ATOM   2943 C  CB    . ASN A 1 354 ? 7.470   -3.432  2.679   1.00 65.27  ? 354 ASN A CB    1 
ATOM   2944 C  CG    . ASN A 1 354 ? 6.135   -3.598  1.980   1.00 69.06  ? 354 ASN A CG    1 
ATOM   2945 O  OD1   . ASN A 1 354 ? 5.291   -4.408  2.385   1.00 72.04  ? 354 ASN A OD1   1 
ATOM   2946 N  ND2   . ASN A 1 354 ? 5.935   -2.835  0.918   1.00 71.26  ? 354 ASN A ND2   1 
ATOM   2947 N  N     . VAL A 1 355 ? 9.478   -2.748  5.244   1.00 60.80  ? 355 VAL A N     1 
ATOM   2948 C  CA    . VAL A 1 355 ? 10.679  -3.004  6.054   1.00 58.51  ? 355 VAL A CA    1 
ATOM   2949 C  C     . VAL A 1 355 ? 10.297  -3.492  7.461   1.00 60.02  ? 355 VAL A C     1 
ATOM   2950 O  O     . VAL A 1 355 ? 10.870  -4.471  7.951   1.00 58.45  ? 355 VAL A O     1 
ATOM   2951 C  CB    . VAL A 1 355 ? 11.675  -1.781  6.109   1.00 57.54  ? 355 VAL A CB    1 
ATOM   2952 C  CG1   . VAL A 1 355 ? 12.834  -2.054  7.062   1.00 55.23  ? 355 VAL A CG1   1 
ATOM   2953 C  CG2   . VAL A 1 355 ? 12.239  -1.456  4.736   1.00 55.65  ? 355 VAL A CG2   1 
ATOM   2954 N  N     . LYS A 1 356 ? 9.331   -2.817  8.089   1.00 63.39  ? 356 LYS A N     1 
ATOM   2955 C  CA    . LYS A 1 356 ? 8.765   -3.236  9.379   1.00 65.90  ? 356 LYS A CA    1 
ATOM   2956 C  C     . LYS A 1 356 ? 8.363   -4.711  9.358   1.00 65.85  ? 356 LYS A C     1 
ATOM   2957 O  O     . LYS A 1 356 ? 8.804   -5.494  10.204  1.00 64.98  ? 356 LYS A O     1 
ATOM   2958 C  CB    . LYS A 1 356 ? 7.540   -2.390  9.725   1.00 70.13  ? 356 LYS A CB    1 
ATOM   2959 C  CG    . LYS A 1 356 ? 7.738   -1.348  10.819  1.00 72.47  ? 356 LYS A CG    1 
ATOM   2960 C  CD    . LYS A 1 356 ? 6.637   -0.274  10.791  1.00 75.93  ? 356 LYS A CD    1 
ATOM   2961 C  CE    . LYS A 1 356 ? 5.228   -0.876  10.885  1.00 80.61  ? 356 LYS A CE    1 
ATOM   2962 N  NZ    . LYS A 1 356 ? 4.135   0.136   10.687  1.00 84.66  ? 356 LYS A NZ    1 
ATOM   2963 N  N     . LYS A 1 357 ? 7.529   -5.064  8.379   1.00 66.91  ? 357 LYS A N     1 
ATOM   2964 C  CA    . LYS A 1 357 ? 7.041   -6.427  8.172   1.00 67.45  ? 357 LYS A CA    1 
ATOM   2965 C  C     . LYS A 1 357 ? 8.192   -7.416  7.999   1.00 63.82  ? 357 LYS A C     1 
ATOM   2966 O  O     . LYS A 1 357 ? 8.158   -8.514  8.553   1.00 63.51  ? 357 LYS A O     1 
ATOM   2967 C  CB    . LYS A 1 357 ? 6.123   -6.479  6.946   1.00 68.99  ? 357 LYS A CB    1 
ATOM   2968 C  CG    . LYS A 1 357 ? 4.680   -6.042  7.194   1.00 74.64  ? 357 LYS A CG    1 
ATOM   2969 C  CD    . LYS A 1 357 ? 4.040   -5.554  5.905   1.00 77.11  ? 357 LYS A CD    1 
ATOM   2970 C  CE    . LYS A 1 357 ? 2.565   -5.884  5.849   1.00 83.83  ? 357 LYS A CE    1 
ATOM   2971 N  NZ    . LYS A 1 357 ? 2.339   -7.303  5.428   1.00 85.19  ? 357 LYS A NZ    1 
ATOM   2972 N  N     . PHE A 1 358 ? 9.208   -7.016  7.236   1.00 60.98  ? 358 PHE A N     1 
ATOM   2973 C  CA    . PHE A 1 358 ? 10.388  -7.854  7.019   1.00 58.19  ? 358 PHE A CA    1 
ATOM   2974 C  C     . PHE A 1 358 ? 11.179  -8.059  8.320   1.00 57.58  ? 358 PHE A C     1 
ATOM   2975 O  O     . PHE A 1 358 ? 11.607  -9.176  8.617   1.00 56.37  ? 358 PHE A O     1 
ATOM   2976 C  CB    . PHE A 1 358 ? 11.274  -7.280  5.905   1.00 55.62  ? 358 PHE A CB    1 
ATOM   2977 C  CG    . PHE A 1 358 ? 12.407  -8.188  5.499   1.00 53.12  ? 358 PHE A CG    1 
ATOM   2978 C  CD1   . PHE A 1 358 ? 12.152  -9.396  4.841   1.00 52.41  ? 358 PHE A CD1   1 
ATOM   2979 C  CD2   . PHE A 1 358 ? 13.729  -7.840  5.776   1.00 50.41  ? 358 PHE A CD2   1 
ATOM   2980 C  CE1   . PHE A 1 358 ? 13.199  -10.246 4.468   1.00 48.63  ? 358 PHE A CE1   1 
ATOM   2981 C  CE2   . PHE A 1 358 ? 14.789  -8.683  5.409   1.00 47.25  ? 358 PHE A CE2   1 
ATOM   2982 C  CZ    . PHE A 1 358 ? 14.524  -9.887  4.754   1.00 47.74  ? 358 PHE A CZ    1 
ATOM   2983 N  N     . LEU A 1 359 ? 11.318  -6.986  9.101   1.00 58.78  ? 359 LEU A N     1 
ATOM   2984 C  CA    . LEU A 1 359 ? 12.084  -7.002  10.354  1.00 58.93  ? 359 LEU A CA    1 
ATOM   2985 C  C     . LEU A 1 359 ? 11.362  -7.623  11.545  1.00 61.72  ? 359 LEU A C     1 
ATOM   2986 O  O     . LEU A 1 359 ? 12.000  -7.934  12.554  1.00 61.53  ? 359 LEU A O     1 
ATOM   2987 C  CB    . LEU A 1 359 ? 12.534  -5.582  10.730  1.00 59.31  ? 359 LEU A CB    1 
ATOM   2988 C  CG    . LEU A 1 359 ? 13.510  -4.859  9.797   1.00 57.45  ? 359 LEU A CG    1 
ATOM   2989 C  CD1   . LEU A 1 359 ? 14.066  -3.611  10.471  1.00 58.38  ? 359 LEU A CD1   1 
ATOM   2990 C  CD2   . LEU A 1 359 ? 14.645  -5.776  9.347   1.00 55.28  ? 359 LEU A CD2   1 
ATOM   2991 N  N     . SER A 1 360 ? 10.044  -7.802  11.427  1.00 64.61  ? 360 SER A N     1 
ATOM   2992 C  CA    . SER A 1 360 ? 9.207   -8.266  12.541  1.00 68.26  ? 360 SER A CA    1 
ATOM   2993 C  C     . SER A 1 360 ? 9.440   -9.721  12.940  1.00 67.87  ? 360 SER A C     1 
ATOM   2994 O  O     . SER A 1 360 ? 9.250   -10.080 14.103  1.00 69.81  ? 360 SER A O     1 
ATOM   2995 C  CB    . SER A 1 360 ? 7.721   -8.044  12.233  1.00 71.67  ? 360 SER A CB    1 
ATOM   2996 O  OG    . SER A 1 360 ? 7.293   -8.878  11.170  1.00 70.70  ? 360 SER A OG    1 
ATOM   2997 N  N     . ARG A 1 361 ? 9.836   -10.549 11.972  1.00 65.75  ? 361 ARG A N     1 
ATOM   2998 C  CA    . ARG A 1 361 ? 10.116  -11.965 12.210  1.00 65.58  ? 361 ARG A CA    1 
ATOM   2999 C  C     . ARG A 1 361 ? 11.363  -12.122 13.076  1.00 64.14  ? 361 ARG A C     1 
ATOM   3000 O  O     . ARG A 1 361 ? 12.396  -11.503 12.801  1.00 61.53  ? 361 ARG A O     1 
ATOM   3001 C  CB    . ARG A 1 361 ? 10.320  -12.697 10.877  1.00 63.51  ? 361 ARG A CB    1 
ATOM   3002 C  CG    . ARG A 1 361 ? 10.379  -14.228 10.977  1.00 64.93  ? 361 ARG A CG    1 
ATOM   3003 C  CD    . ARG A 1 361 ? 11.080  -14.813 9.753   1.00 65.36  ? 361 ARG A CD    1 
ATOM   3004 N  NE    . ARG A 1 361 ? 10.980  -16.271 9.661   1.00 68.64  ? 361 ARG A NE    1 
ATOM   3005 C  CZ    . ARG A 1 361 ? 11.194  -16.970 8.546   1.00 68.60  ? 361 ARG A CZ    1 
ATOM   3006 N  NH1   . ARG A 1 361 ? 11.521  -16.349 7.415   1.00 68.15  ? 361 ARG A NH1   1 
ATOM   3007 N  NH2   . ARG A 1 361 ? 11.076  -18.293 8.555   1.00 69.67  ? 361 ARG A NH2   1 
ATOM   3008 N  N     . ASN A 1 362 ? 11.271  -12.950 14.118  1.00 65.74  ? 362 ASN A N     1 
ATOM   3009 C  CA    . ASN A 1 362 ? 12.450  -13.262 14.926  1.00 64.76  ? 362 ASN A CA    1 
ATOM   3010 C  C     . ASN A 1 362 ? 13.380  -14.241 14.214  1.00 61.10  ? 362 ASN A C     1 
ATOM   3011 O  O     . ASN A 1 362 ? 12.939  -15.269 13.685  1.00 60.88  ? 362 ASN A O     1 
ATOM   3012 C  CB    . ASN A 1 362 ? 12.073  -13.787 16.318  1.00 68.17  ? 362 ASN A CB    1 
ATOM   3013 C  CG    . ASN A 1 362 ? 13.194  -13.588 17.344  1.00 69.33  ? 362 ASN A CG    1 
ATOM   3014 O  OD1   . ASN A 1 362 ? 14.256  -13.028 17.036  1.00 68.14  ? 362 ASN A OD1   1 
ATOM   3015 N  ND2   . ASN A 1 362 ? 12.956  -14.039 18.569  1.00 73.52  ? 362 ASN A ND2   1 
ATOM   3016 N  N     . ARG A 1 363 ? 14.665  -13.896 14.185  1.00 58.49  ? 363 ARG A N     1 
ATOM   3017 C  CA    . ARG A 1 363 ? 15.696  -14.730 13.570  1.00 55.23  ? 363 ARG A CA    1 
ATOM   3018 C  C     . ARG A 1 363 ? 16.884  -14.863 14.520  1.00 54.57  ? 363 ARG A C     1 
ATOM   3019 O  O     . ARG A 1 363 ? 17.064  -14.037 15.419  1.00 56.07  ? 363 ARG A O     1 
ATOM   3020 C  CB    . ARG A 1 363 ? 16.154  -14.122 12.244  1.00 52.69  ? 363 ARG A CB    1 
ATOM   3021 C  CG    . ARG A 1 363 ? 15.048  -13.910 11.220  1.00 53.45  ? 363 ARG A CG    1 
ATOM   3022 C  CD    . ARG A 1 363 ? 15.540  -13.125 10.006  1.00 51.89  ? 363 ARG A CD    1 
ATOM   3023 N  NE    . ARG A 1 363 ? 14.612  -12.044 9.663   1.00 56.32  ? 363 ARG A NE    1 
ATOM   3024 C  CZ    . ARG A 1 363 ? 13.664  -12.112 8.733   1.00 56.76  ? 363 ARG A CZ    1 
ATOM   3025 N  NH1   . ARG A 1 363 ? 13.497  -13.210 8.018   1.00 57.02  ? 363 ARG A NH1   1 
ATOM   3026 N  NH2   . ARG A 1 363 ? 12.881  -11.068 8.515   1.00 58.94  ? 363 ARG A NH2   1 
ATOM   3027 N  N     . ALA A 1 364 ? 17.690  -15.904 14.318  1.00 52.49  ? 364 ALA A N     1 
ATOM   3028 C  CA    . ALA A 1 364 ? 18.910  -16.110 15.106  1.00 51.74  ? 364 ALA A CA    1 
ATOM   3029 C  C     . ALA A 1 364 ? 19.936  -14.999 14.854  1.00 50.05  ? 364 ALA A C     1 
ATOM   3030 O  O     . ALA A 1 364 ? 20.699  -14.630 15.753  1.00 50.72  ? 364 ALA A O     1 
ATOM   3031 C  CB    . ALA A 1 364 ? 19.512  -17.469 14.808  1.00 50.38  ? 364 ALA A CB    1 
ATOM   3032 N  N     . PHE A 1 365 ? 19.939  -14.470 13.631  1.00 47.50  ? 365 PHE A N     1 
ATOM   3033 C  CA    . PHE A 1 365 ? 20.905  -13.442 13.226  1.00 45.63  ? 365 PHE A CA    1 
ATOM   3034 C  C     . PHE A 1 365 ? 20.207  -12.152 12.801  1.00 46.17  ? 365 PHE A C     1 
ATOM   3035 O  O     . PHE A 1 365 ? 19.033  -12.177 12.419  1.00 47.03  ? 365 PHE A O     1 
ATOM   3036 C  CB    . PHE A 1 365 ? 21.836  -13.995 12.131  1.00 42.49  ? 365 PHE A CB    1 
ATOM   3037 C  CG    . PHE A 1 365 ? 22.598  -15.223 12.561  1.00 40.11  ? 365 PHE A CG    1 
ATOM   3038 C  CD1   . PHE A 1 365 ? 22.195  -16.489 12.159  1.00 38.80  ? 365 PHE A CD1   1 
ATOM   3039 C  CD2   . PHE A 1 365 ? 23.701  -15.106 13.402  1.00 39.74  ? 365 PHE A CD2   1 
ATOM   3040 C  CE1   . PHE A 1 365 ? 22.893  -17.625 12.573  1.00 37.73  ? 365 PHE A CE1   1 
ATOM   3041 C  CE2   . PHE A 1 365 ? 24.398  -16.214 13.832  1.00 39.63  ? 365 PHE A CE2   1 
ATOM   3042 C  CZ    . PHE A 1 365 ? 23.992  -17.493 13.417  1.00 39.50  ? 365 PHE A CZ    1 
ATOM   3043 N  N     . ARG A 1 366 ? 20.912  -11.028 12.909  1.00 46.28  ? 366 ARG A N     1 
ATOM   3044 C  CA    . ARG A 1 366 ? 20.366  -9.728  12.515  1.00 47.31  ? 366 ARG A CA    1 
ATOM   3045 C  C     . ARG A 1 366 ? 20.255  -9.574  11.002  1.00 45.56  ? 366 ARG A C     1 
ATOM   3046 O  O     . ARG A 1 366 ? 21.200  -9.911  10.276  1.00 43.56  ? 366 ARG A O     1 
ATOM   3047 C  CB    . ARG A 1 366 ? 21.245  -8.586  13.024  1.00 48.10  ? 366 ARG A CB    1 
ATOM   3048 C  CG    . ARG A 1 366 ? 21.552  -8.653  14.482  1.00 52.48  ? 366 ARG A CG    1 
ATOM   3049 C  CD    . ARG A 1 366 ? 22.274  -7.418  14.975  1.00 57.66  ? 366 ARG A CD    1 
ATOM   3050 N  NE    . ARG A 1 366 ? 22.517  -7.556  16.408  1.00 63.89  ? 366 ARG A NE    1 
ATOM   3051 C  CZ    . ARG A 1 366 ? 22.602  -6.551  17.276  1.00 67.29  ? 366 ARG A CZ    1 
ATOM   3052 N  NH1   . ARG A 1 366 ? 22.469  -5.287  16.873  1.00 68.02  ? 366 ARG A NH1   1 
ATOM   3053 N  NH2   . ARG A 1 366 ? 22.819  -6.821  18.560  1.00 70.46  ? 366 ARG A NH2   1 
ATOM   3054 N  N     . PRO A 1 367 ? 19.101  -9.063  10.519  1.00 46.08  ? 367 PRO A N     1 
ATOM   3055 C  CA    . PRO A 1 367 ? 19.023  -8.584  9.137   1.00 44.80  ? 367 PRO A CA    1 
ATOM   3056 C  C     . PRO A 1 367 ? 20.059  -7.492  8.873   1.00 43.74  ? 367 PRO A C     1 
ATOM   3057 O  O     . PRO A 1 367 ? 20.533  -6.861  9.809   1.00 45.23  ? 367 PRO A O     1 
ATOM   3058 C  CB    . PRO A 1 367 ? 17.621  -7.992  9.051   1.00 46.54  ? 367 PRO A CB    1 
ATOM   3059 C  CG    . PRO A 1 367 ? 16.831  -8.717  10.108  1.00 48.55  ? 367 PRO A CG    1 
ATOM   3060 C  CD    . PRO A 1 367 ? 17.805  -8.954  11.220  1.00 48.71  ? 367 PRO A CD    1 
ATOM   3061 N  N     . PHE A 1 368 ? 20.410  -7.279  7.611   1.00 42.03  ? 368 PHE A N     1 
ATOM   3062 C  CA    . PHE A 1 368 ? 21.406  -6.269  7.251   1.00 41.35  ? 368 PHE A CA    1 
ATOM   3063 C  C     . PHE A 1 368 ? 21.005  -5.497  5.991   1.00 40.93  ? 368 PHE A C     1 
ATOM   3064 O  O     . PHE A 1 368 ? 20.161  -5.945  5.223   1.00 40.88  ? 368 PHE A O     1 
ATOM   3065 C  CB    . PHE A 1 368 ? 22.803  -6.909  7.088   1.00 39.92  ? 368 PHE A CB    1 
ATOM   3066 C  CG    . PHE A 1 368 ? 22.877  -7.982  6.020   1.00 39.03  ? 368 PHE A CG    1 
ATOM   3067 C  CD1   . PHE A 1 368 ? 22.472  -9.292  6.294   1.00 37.62  ? 368 PHE A CD1   1 
ATOM   3068 C  CD2   . PHE A 1 368 ? 23.356  -7.687  4.746   1.00 38.16  ? 368 PHE A CD2   1 
ATOM   3069 C  CE1   . PHE A 1 368 ? 22.535  -10.286 5.308   1.00 38.01  ? 368 PHE A CE1   1 
ATOM   3070 C  CE2   . PHE A 1 368 ? 23.430  -8.681  3.752   1.00 37.77  ? 368 PHE A CE2   1 
ATOM   3071 C  CZ    . PHE A 1 368 ? 23.029  -9.983  4.039   1.00 37.08  ? 368 PHE A CZ    1 
ATOM   3072 N  N     . ILE A 1 369 ? 21.629  -4.344  5.782   1.00 41.33  ? 369 ILE A N     1 
ATOM   3073 C  CA    . ILE A 1 369 ? 21.450  -3.572  4.555   1.00 41.19  ? 369 ILE A CA    1 
ATOM   3074 C  C     . ILE A 1 369 ? 22.601  -3.841  3.567   1.00 40.38  ? 369 ILE A C     1 
ATOM   3075 O  O     . ILE A 1 369 ? 23.784  -3.799  3.934   1.00 40.00  ? 369 ILE A O     1 
ATOM   3076 C  CB    . ILE A 1 369 ? 21.313  -2.049  4.862   1.00 42.52  ? 369 ILE A CB    1 
ATOM   3077 C  CG1   . ILE A 1 369 ? 20.009  -1.788  5.622   1.00 43.69  ? 369 ILE A CG1   1 
ATOM   3078 C  CG2   . ILE A 1 369 ? 21.420  -1.210  3.589   1.00 42.77  ? 369 ILE A CG2   1 
ATOM   3079 C  CD1   . ILE A 1 369 ? 19.647  -0.336  5.810   1.00 45.05  ? 369 ILE A CD1   1 
ATOM   3080 N  N     . GLU A 1 370 ? 22.243  -4.127  2.318   1.00 40.21  ? 370 GLU A N     1 
ATOM   3081 C  CA    . GLU A 1 370 ? 23.226  -4.323  1.255   1.00 40.36  ? 370 GLU A CA    1 
ATOM   3082 C  C     . GLU A 1 370 ? 22.707  -3.743  -0.065  1.00 41.18  ? 370 GLU A C     1 
ATOM   3083 O  O     . GLU A 1 370 ? 21.713  -4.211  -0.604  1.00 41.86  ? 370 GLU A O     1 
ATOM   3084 C  CB    . GLU A 1 370 ? 23.586  -5.804  1.115   1.00 39.47  ? 370 GLU A CB    1 
ATOM   3085 C  CG    . GLU A 1 370 ? 24.646  -6.094  0.062   1.00 40.28  ? 370 GLU A CG    1 
ATOM   3086 C  CD    . GLU A 1 370 ? 24.750  -7.565  -0.264  1.00 41.34  ? 370 GLU A CD    1 
ATOM   3087 O  OE1   . GLU A 1 370 ? 25.388  -8.310  0.510   1.00 39.97  ? 370 GLU A OE1   1 
ATOM   3088 O  OE2   . GLU A 1 370 ? 24.190  -7.982  -1.305  1.00 44.11  ? 370 GLU A OE2   1 
ATOM   3089 N  N     . ASN A 1 371 ? 23.386  -2.710  -0.559  1.00 41.60  ? 371 ASN A N     1 
ATOM   3090 C  CA    . ASN A 1 371 ? 23.028  -2.041  -1.816  1.00 42.97  ? 371 ASN A CA    1 
ATOM   3091 C  C     . ASN A 1 371 ? 21.577  -1.554  -1.817  1.00 43.42  ? 371 ASN A C     1 
ATOM   3092 O  O     . ASN A 1 371 ? 20.820  -1.801  -2.759  1.00 43.68  ? 371 ASN A O     1 
ATOM   3093 C  CB    . ASN A 1 371 ? 23.338  -2.924  -3.043  1.00 43.76  ? 371 ASN A CB    1 
ATOM   3094 C  CG    . ASN A 1 371 ? 24.813  -3.356  -3.115  1.00 44.97  ? 371 ASN A CG    1 
ATOM   3095 O  OD1   . ASN A 1 371 ? 25.729  -2.587  -2.785  1.00 47.80  ? 371 ASN A OD1   1 
ATOM   3096 N  ND2   . ASN A 1 371 ? 25.044  -4.593  -3.563  1.00 44.55  ? 371 ASN A ND2   1 
ATOM   3097 N  N     . GLY A 1 372 ? 21.206  -0.877  -0.731  1.00 43.46  ? 372 GLY A N     1 
ATOM   3098 C  CA    . GLY A 1 372 ? 19.913  -0.219  -0.607  1.00 45.07  ? 372 GLY A CA    1 
ATOM   3099 C  C     . GLY A 1 372 ? 18.728  -1.109  -0.303  1.00 45.45  ? 372 GLY A C     1 
ATOM   3100 O  O     . GLY A 1 372 ? 17.605  -0.620  -0.212  1.00 47.16  ? 372 GLY A O     1 
ATOM   3101 N  N     . ARG A 1 373 ? 18.979  -2.412  -0.171  1.00 44.54  ? 373 ARG A N     1 
ATOM   3102 C  CA    . ARG A 1 373 ? 17.955  -3.388  0.205   1.00 45.15  ? 373 ARG A CA    1 
ATOM   3103 C  C     . ARG A 1 373 ? 18.252  -4.037  1.553   1.00 44.15  ? 373 ARG A C     1 
ATOM   3104 O  O     . ARG A 1 373 ? 19.408  -4.258  1.905   1.00 42.55  ? 373 ARG A O     1 
ATOM   3105 C  CB    . ARG A 1 373 ? 17.818  -4.487  -0.860  1.00 44.90  ? 373 ARG A CB    1 
ATOM   3106 C  CG    . ARG A 1 373 ? 16.743  -4.208  -1.897  1.00 48.83  ? 373 ARG A CG    1 
ATOM   3107 C  CD    . ARG A 1 373 ? 16.287  -5.467  -2.620  1.00 50.53  ? 373 ARG A CD    1 
ATOM   3108 N  NE    . ARG A 1 373 ? 14.898  -5.332  -3.078  1.00 56.06  ? 373 ARG A NE    1 
ATOM   3109 C  CZ    . ARG A 1 373 ? 14.547  -4.817  -4.251  1.00 58.50  ? 373 ARG A CZ    1 
ATOM   3110 N  NH1   . ARG A 1 373 ? 15.471  -4.386  -5.102  1.00 60.91  ? 373 ARG A NH1   1 
ATOM   3111 N  NH2   . ARG A 1 373 ? 13.276  -4.726  -4.577  1.00 62.80  ? 373 ARG A NH2   1 
ATOM   3112 N  N     . TRP A 1 374 ? 17.193  -4.334  2.300   1.00 45.26  ? 374 TRP A N     1 
ATOM   3113 C  CA    . TRP A 1 374 ? 17.298  -5.218  3.450   1.00 44.91  ? 374 TRP A CA    1 
ATOM   3114 C  C     . TRP A 1 374 ? 17.455  -6.678  3.019   1.00 44.03  ? 374 TRP A C     1 
ATOM   3115 O  O     . TRP A 1 374 ? 16.864  -7.121  2.028   1.00 44.55  ? 374 TRP A O     1 
ATOM   3116 C  CB    . TRP A 1 374 ? 16.093  -5.050  4.373   1.00 46.69  ? 374 TRP A CB    1 
ATOM   3117 C  CG    . TRP A 1 374 ? 16.186  -3.800  5.178   1.00 48.21  ? 374 TRP A CG    1 
ATOM   3118 C  CD1   . TRP A 1 374 ? 15.693  -2.568  4.847   1.00 49.53  ? 374 TRP A CD1   1 
ATOM   3119 C  CD2   . TRP A 1 374 ? 16.845  -3.645  6.441   1.00 48.65  ? 374 TRP A CD2   1 
ATOM   3120 N  NE1   . TRP A 1 374 ? 15.997  -1.656  5.831   1.00 50.55  ? 374 TRP A NE1   1 
ATOM   3121 C  CE2   . TRP A 1 374 ? 16.702  -2.289  6.822   1.00 49.33  ? 374 TRP A CE2   1 
ATOM   3122 C  CE3   . TRP A 1 374 ? 17.549  -4.519  7.287   1.00 47.47  ? 374 TRP A CE3   1 
ATOM   3123 C  CZ2   . TRP A 1 374 ? 17.222  -1.788  8.020   1.00 50.03  ? 374 TRP A CZ2   1 
ATOM   3124 C  CZ3   . TRP A 1 374 ? 18.070  -4.018  8.478   1.00 48.01  ? 374 TRP A CZ3   1 
ATOM   3125 C  CH2   . TRP A 1 374 ? 17.905  -2.664  8.830   1.00 49.71  ? 374 TRP A CH2   1 
ATOM   3126 N  N     . TRP A 1 375 ? 18.278  -7.408  3.768   1.00 42.53  ? 375 TRP A N     1 
ATOM   3127 C  CA    . TRP A 1 375 ? 18.481  -8.841  3.569   1.00 41.33  ? 375 TRP A CA    1 
ATOM   3128 C  C     . TRP A 1 375 ? 18.442  -9.522  4.936   1.00 41.46  ? 375 TRP A C     1 
ATOM   3129 O  O     . TRP A 1 375 ? 18.745  -8.900  5.948   1.00 42.28  ? 375 TRP A O     1 
ATOM   3130 C  CB    . TRP A 1 375 ? 19.829  -9.108  2.892   1.00 39.73  ? 375 TRP A CB    1 
ATOM   3131 C  CG    . TRP A 1 375 ? 19.912  -8.652  1.445   1.00 39.60  ? 375 TRP A CG    1 
ATOM   3132 C  CD1   . TRP A 1 375 ? 20.192  -7.391  0.990   1.00 39.17  ? 375 TRP A CD1   1 
ATOM   3133 C  CD2   . TRP A 1 375 ? 19.713  -9.463  0.276   1.00 39.73  ? 375 TRP A CD2   1 
ATOM   3134 N  NE1   . TRP A 1 375 ? 20.180  -7.367  -0.385  1.00 38.89  ? 375 TRP A NE1   1 
ATOM   3135 C  CE2   . TRP A 1 375 ? 19.892  -8.624  -0.850  1.00 40.42  ? 375 TRP A CE2   1 
ATOM   3136 C  CE3   . TRP A 1 375 ? 19.425  -10.824 0.071   1.00 39.86  ? 375 TRP A CE3   1 
ATOM   3137 C  CZ2   . TRP A 1 375 ? 19.788  -9.100  -2.166  1.00 41.35  ? 375 TRP A CZ2   1 
ATOM   3138 C  CZ3   . TRP A 1 375 ? 19.313  -11.295 -1.236  1.00 40.19  ? 375 TRP A CZ3   1 
ATOM   3139 C  CH2   . TRP A 1 375 ? 19.495  -10.431 -2.337  1.00 41.20  ? 375 TRP A CH2   1 
ATOM   3140 N  N     . ALA A 1 376 ? 18.075  -10.795 4.973   1.00 40.94  ? 376 ALA A N     1 
ATOM   3141 C  CA    . ALA A 1 376 ? 18.091  -11.539 6.232   1.00 40.56  ? 376 ALA A CA    1 
ATOM   3142 C  C     . ALA A 1 376 ? 18.779  -12.883 6.051   1.00 38.90  ? 376 ALA A C     1 
ATOM   3143 O  O     . ALA A 1 376 ? 18.740  -13.451 4.966   1.00 38.90  ? 376 ALA A O     1 
ATOM   3144 C  CB    . ALA A 1 376 ? 16.679  -11.719 6.755   1.00 41.96  ? 376 ALA A CB    1 
ATOM   3145 N  N     . PHE A 1 377 ? 19.446  -13.362 7.100   1.00 38.31  ? 377 PHE A N     1 
ATOM   3146 C  CA    . PHE A 1 377 ? 19.926  -14.739 7.139   1.00 37.20  ? 377 PHE A CA    1 
ATOM   3147 C  C     . PHE A 1 377 ? 18.825  -15.639 7.675   1.00 38.12  ? 377 PHE A C     1 
ATOM   3148 O  O     . PHE A 1 377 ? 18.203  -15.327 8.696   1.00 39.38  ? 377 PHE A O     1 
ATOM   3149 C  CB    . PHE A 1 377 ? 21.160  -14.893 8.022   1.00 36.92  ? 377 PHE A CB    1 
ATOM   3150 C  CG    . PHE A 1 377 ? 22.386  -14.175 7.509   1.00 36.30  ? 377 PHE A CG    1 
ATOM   3151 C  CD1   . PHE A 1 377 ? 22.952  -13.139 8.250   1.00 36.43  ? 377 PHE A CD1   1 
ATOM   3152 C  CD2   . PHE A 1 377 ? 22.998  -14.554 6.308   1.00 35.39  ? 377 PHE A CD2   1 
ATOM   3153 C  CE1   . PHE A 1 377 ? 24.101  -12.470 7.800   1.00 35.23  ? 377 PHE A CE1   1 
ATOM   3154 C  CE2   . PHE A 1 377 ? 24.148  -13.893 5.848   1.00 34.04  ? 377 PHE A CE2   1 
ATOM   3155 C  CZ    . PHE A 1 377 ? 24.696  -12.848 6.599   1.00 35.09  ? 377 PHE A CZ    1 
ATOM   3156 N  N     . GLU A 1 378 ? 18.602  -16.754 6.979   1.00 37.42  ? 378 GLU A N     1 
ATOM   3157 C  CA    . GLU A 1 378 ? 17.627  -17.763 7.375   1.00 38.05  ? 378 GLU A CA    1 
ATOM   3158 C  C     . GLU A 1 378 ? 18.315  -19.130 7.411   1.00 36.08  ? 378 GLU A C     1 
ATOM   3159 O  O     . GLU A 1 378 ? 19.463  -19.256 6.993   1.00 33.75  ? 378 GLU A O     1 
ATOM   3160 C  CB    . GLU A 1 378 ? 16.443  -17.782 6.403   1.00 39.41  ? 378 GLU A CB    1 
ATOM   3161 C  CG    . GLU A 1 378 ? 15.780  -16.409 6.157   1.00 43.64  ? 378 GLU A CG    1 
ATOM   3162 C  CD    . GLU A 1 378 ? 14.737  -16.021 7.204   1.00 48.20  ? 378 GLU A CD    1 
ATOM   3163 O  OE1   . GLU A 1 378 ? 14.656  -16.644 8.287   1.00 52.03  ? 378 GLU A OE1   1 
ATOM   3164 O  OE2   . GLU A 1 378 ? 13.982  -15.069 6.937   1.00 51.06  ? 378 GLU A OE2   1 
ATOM   3165 N  N     . MET A 1 379 ? 17.611  -20.141 7.911   1.00 36.18  ? 379 MET A N     1 
ATOM   3166 C  CA    . MET A 1 379 ? 18.165  -21.494 8.047   1.00 35.11  ? 379 MET A CA    1 
ATOM   3167 C  C     . MET A 1 379 ? 17.391  -22.545 7.256   1.00 34.91  ? 379 MET A C     1 
ATOM   3168 O  O     . MET A 1 379 ? 16.163  -22.619 7.337   1.00 35.88  ? 379 MET A O     1 
ATOM   3169 C  CB    . MET A 1 379 ? 18.221  -21.914 9.520   1.00 36.46  ? 379 MET A CB    1 
ATOM   3170 C  CG    . MET A 1 379 ? 18.926  -20.910 10.424  1.00 37.48  ? 379 MET A CG    1 
ATOM   3171 S  SD    . MET A 1 379 ? 20.705  -20.865 10.150  1.00 41.08  ? 379 MET A SD    1 
ATOM   3172 C  CE    . MET A 1 379 ? 21.241  -22.075 11.366  1.00 42.79  ? 379 MET A CE    1 
ATOM   3173 N  N     . ARG A 1 380 ? 18.131  -23.363 6.510   1.00 32.76  ? 380 ARG A N     1 
ATOM   3174 C  CA    . ARG A 1 380 ? 17.560  -24.487 5.763   1.00 32.76  ? 380 ARG A CA    1 
ATOM   3175 C  C     . ARG A 1 380 ? 17.117  -25.590 6.704   1.00 33.28  ? 380 ARG A C     1 
ATOM   3176 O  O     . ARG A 1 380 ? 17.663  -25.734 7.806   1.00 33.18  ? 380 ARG A O     1 
ATOM   3177 C  CB    . ARG A 1 380 ? 18.590  -25.079 4.794   1.00 31.28  ? 380 ARG A CB    1 
ATOM   3178 C  CG    . ARG A 1 380 ? 19.100  -24.137 3.765   1.00 29.72  ? 380 ARG A CG    1 
ATOM   3179 C  CD    . ARG A 1 380 ? 20.109  -24.830 2.859   1.00 28.15  ? 380 ARG A CD    1 
ATOM   3180 N  NE    . ARG A 1 380 ? 20.306  -24.040 1.653   1.00 25.94  ? 380 ARG A NE    1 
ATOM   3181 C  CZ    . ARG A 1 380 ? 21.219  -23.092 1.511   1.00 23.83  ? 380 ARG A CZ    1 
ATOM   3182 N  NH1   . ARG A 1 380 ? 22.063  -22.813 2.504   1.00 24.86  ? 380 ARG A NH1   1 
ATOM   3183 N  NH2   . ARG A 1 380 ? 21.285  -22.420 0.363   1.00 26.45  ? 380 ARG A NH2   1 
ATOM   3184 N  N     . LYS A 1 381 ? 16.160  -26.394 6.252   1.00 34.15  ? 381 LYS A N     1 
ATOM   3185 C  CA    . LYS A 1 381 ? 15.722  -27.554 7.018   1.00 35.05  ? 381 LYS A CA    1 
ATOM   3186 C  C     . LYS A 1 381 ? 16.442  -28.827 6.596   1.00 34.55  ? 381 LYS A C     1 
ATOM   3187 O  O     . LYS A 1 381 ? 16.141  -29.899 7.111   1.00 35.72  ? 381 LYS A O     1 
ATOM   3188 C  CB    . LYS A 1 381 ? 14.200  -27.730 6.936   1.00 37.28  ? 381 LYS A CB    1 
ATOM   3189 C  CG    . LYS A 1 381 ? 13.435  -26.684 7.734   1.00 39.82  ? 381 LYS A CG    1 
ATOM   3190 C  CD    . LYS A 1 381 ? 11.978  -27.038 7.921   1.00 42.72  ? 381 LYS A CD    1 
ATOM   3191 C  CE    . LYS A 1 381 ? 11.062  -25.810 7.791   1.00 46.26  ? 381 LYS A CE    1 
ATOM   3192 N  NZ    . LYS A 1 381 ? 11.712  -24.487 8.070   1.00 44.02  ? 381 LYS A NZ    1 
ATOM   3193 N  N     . PHE A 1 382 ? 17.378  -28.705 5.654   1.00 33.15  ? 382 PHE A N     1 
ATOM   3194 C  CA    . PHE A 1 382 ? 18.206  -29.834 5.197   1.00 32.23  ? 382 PHE A CA    1 
ATOM   3195 C  C     . PHE A 1 382 ? 19.515  -29.305 4.610   1.00 30.91  ? 382 PHE A C     1 
ATOM   3196 O  O     . PHE A 1 382 ? 19.557  -28.194 4.087   1.00 31.42  ? 382 PHE A O     1 
ATOM   3197 C  CB    . PHE A 1 382 ? 17.468  -30.727 4.169   1.00 32.91  ? 382 PHE A CB    1 
ATOM   3198 C  CG    . PHE A 1 382 ? 16.696  -29.965 3.133   1.00 32.77  ? 382 PHE A CG    1 
ATOM   3199 C  CD1   . PHE A 1 382 ? 17.358  -29.282 2.105   1.00 33.21  ? 382 PHE A CD1   1 
ATOM   3200 C  CD2   . PHE A 1 382 ? 15.307  -29.937 3.170   1.00 33.56  ? 382 PHE A CD2   1 
ATOM   3201 C  CE1   . PHE A 1 382 ? 16.645  -28.571 1.139   1.00 34.24  ? 382 PHE A CE1   1 
ATOM   3202 C  CE2   . PHE A 1 382 ? 14.582  -29.238 2.206   1.00 34.28  ? 382 PHE A CE2   1 
ATOM   3203 C  CZ    . PHE A 1 382 ? 15.250  -28.551 1.194   1.00 35.29  ? 382 PHE A CZ    1 
ATOM   3204 N  N     . THR A 1 383 ? 20.589  -30.082 4.707   1.00 30.76  ? 383 THR A N     1 
ATOM   3205 C  CA    . THR A 1 383 ? 21.901  -29.601 4.231   1.00 29.29  ? 383 THR A CA    1 
ATOM   3206 C  C     . THR A 1 383 ? 22.588  -30.547 3.251   1.00 29.65  ? 383 THR A C     1 
ATOM   3207 O  O     . THR A 1 383 ? 23.676  -30.242 2.763   1.00 29.54  ? 383 THR A O     1 
ATOM   3208 C  CB    . THR A 1 383 ? 22.872  -29.309 5.392   1.00 29.58  ? 383 THR A CB    1 
ATOM   3209 O  OG1   . THR A 1 383 ? 23.033  -30.489 6.181   1.00 30.30  ? 383 THR A OG1   1 
ATOM   3210 C  CG2   . THR A 1 383 ? 22.363  -28.152 6.266   1.00 27.78  ? 383 THR A CG2   1 
ATOM   3211 N  N     . THR A 1 384 ? 21.962  -31.688 2.978   1.00 29.76  ? 384 THR A N     1 
ATOM   3212 C  CA    . THR A 1 384 ? 22.466  -32.617 1.983   1.00 28.85  ? 384 THR A CA    1 
ATOM   3213 C  C     . THR A 1 384 ? 21.392  -32.862 0.919   1.00 27.18  ? 384 THR A C     1 
ATOM   3214 O  O     . THR A 1 384 ? 20.200  -32.687 1.208   1.00 27.28  ? 384 THR A O     1 
ATOM   3215 C  CB    . THR A 1 384 ? 22.931  -33.971 2.595   1.00 28.81  ? 384 THR A CB    1 
ATOM   3216 O  OG1   . THR A 1 384 ? 21.797  -34.789 2.928   1.00 29.96  ? 384 THR A OG1   1 
ATOM   3217 C  CG2   . THR A 1 384 ? 23.849  -33.757 3.818   1.00 29.94  ? 384 THR A CG2   1 
ATOM   3218 N  N     . PRO A 1 385 ? 21.803  -33.230 -0.323  1.00 25.98  ? 385 PRO A N     1 
ATOM   3219 C  CA    . PRO A 1 385 ? 20.790  -33.507 -1.350  1.00 24.82  ? 385 PRO A CA    1 
ATOM   3220 C  C     . PRO A 1 385 ? 19.883  -34.660 -0.980  1.00 25.13  ? 385 PRO A C     1 
ATOM   3221 O  O     . PRO A 1 385 ? 18.706  -34.620 -1.317  1.00 24.28  ? 385 PRO A O     1 
ATOM   3222 C  CB    . PRO A 1 385 ? 21.607  -33.819 -2.621  1.00 23.86  ? 385 PRO A CB    1 
ATOM   3223 C  CG    . PRO A 1 385 ? 23.002  -34.129 -2.133  1.00 24.70  ? 385 PRO A CG    1 
ATOM   3224 C  CD    . PRO A 1 385 ? 23.175  -33.340 -0.853  1.00 25.65  ? 385 PRO A CD    1 
ATOM   3225 N  N     . GLU A 1 386 ? 20.419  -35.655 -0.270  1.00 25.86  ? 386 GLU A N     1 
ATOM   3226 C  CA    . GLU A 1 386 ? 19.612  -36.790 0.170   1.00 26.17  ? 386 GLU A CA    1 
ATOM   3227 C  C     . GLU A 1 386 ? 18.519  -36.399 1.165   1.00 25.98  ? 386 GLU A C     1 
ATOM   3228 O  O     . GLU A 1 386 ? 17.389  -36.886 1.070   1.00 25.97  ? 386 GLU A O     1 
ATOM   3229 C  CB    . GLU A 1 386 ? 20.491  -37.892 0.753   1.00 26.76  ? 386 GLU A CB    1 
ATOM   3230 C  CG    . GLU A 1 386 ? 21.480  -38.454 -0.253  1.00 27.51  ? 386 GLU A CG    1 
ATOM   3231 C  CD    . GLU A 1 386 ? 22.904  -37.925 -0.066  1.00 31.80  ? 386 GLU A CD    1 
ATOM   3232 O  OE1   . GLU A 1 386 ? 23.110  -36.694 0.172   1.00 28.14  ? 386 GLU A OE1   1 
ATOM   3233 O  OE2   . GLU A 1 386 ? 23.825  -38.772 -0.163  1.00 32.44  ? 386 GLU A OE2   1 
ATOM   3234 N  N     . GLU A 1 387 ? 18.864  -35.529 2.107   1.00 25.95  ? 387 GLU A N     1 
ATOM   3235 C  CA    . GLU A 1 387 ? 17.904  -34.996 3.064   1.00 26.14  ? 387 GLU A CA    1 
ATOM   3236 C  C     . GLU A 1 387 ? 16.849  -34.171 2.333   1.00 24.49  ? 387 GLU A C     1 
ATOM   3237 O  O     . GLU A 1 387 ? 15.678  -34.271 2.641   1.00 23.75  ? 387 GLU A O     1 
ATOM   3238 C  CB    . GLU A 1 387 ? 18.596  -34.142 4.134   1.00 26.82  ? 387 GLU A CB    1 
ATOM   3239 C  CG    . GLU A 1 387 ? 19.381  -34.932 5.173   1.00 27.54  ? 387 GLU A CG    1 
ATOM   3240 C  CD    . GLU A 1 387 ? 20.162  -34.035 6.153   1.00 30.23  ? 387 GLU A CD    1 
ATOM   3241 O  OE1   . GLU A 1 387 ? 20.206  -32.794 5.961   1.00 32.96  ? 387 GLU A OE1   1 
ATOM   3242 O  OE2   . GLU A 1 387 ? 20.719  -34.583 7.139   1.00 33.89  ? 387 GLU A OE2   1 
ATOM   3243 N  N     . GLY A 1 388 ? 17.278  -33.354 1.374   1.00 23.75  ? 388 GLY A N     1 
ATOM   3244 C  CA    . GLY A 1 388 ? 16.349  -32.601 0.530   1.00 23.10  ? 388 GLY A CA    1 
ATOM   3245 C  C     . GLY A 1 388 ? 15.329  -33.490 -0.171  1.00 22.85  ? 388 GLY A C     1 
ATOM   3246 O  O     . GLY A 1 388 ? 14.123  -33.235 -0.096  1.00 23.44  ? 388 GLY A O     1 
ATOM   3247 N  N     . VAL A 1 389 ? 15.809  -34.540 -0.846  1.00 22.04  ? 389 VAL A N     1 
ATOM   3248 C  CA    . VAL A 1 389 ? 14.924  -35.459 -1.597  1.00 21.71  ? 389 VAL A CA    1 
ATOM   3249 C  C     . VAL A 1 389 ? 13.996  -36.262 -0.670  1.00 21.74  ? 389 VAL A C     1 
ATOM   3250 O  O     . VAL A 1 389 ? 12.843  -36.552 -1.022  1.00 20.75  ? 389 VAL A O     1 
ATOM   3251 C  CB    . VAL A 1 389 ? 15.737  -36.411 -2.510  1.00 20.78  ? 389 VAL A CB    1 
ATOM   3252 C  CG1   . VAL A 1 389 ? 14.836  -37.422 -3.222  1.00 21.65  ? 389 VAL A CG1   1 
ATOM   3253 C  CG2   . VAL A 1 389 ? 16.532  -35.609 -3.551  1.00 22.39  ? 389 VAL A CG2   1 
ATOM   3254 N  N     . ARG A 1 390 ? 14.500  -36.642 0.507   1.00 22.00  ? 390 ARG A N     1 
ATOM   3255 C  CA    . ARG A 1 390 ? 13.634  -37.300 1.499   1.00 22.46  ? 390 ARG A CA    1 
ATOM   3256 C  C     . ARG A 1 390 ? 12.427  -36.412 1.784   1.00 22.44  ? 390 ARG A C     1 
ATOM   3257 O  O     . ARG A 1 390 ? 11.291  -36.873 1.785   1.00 22.06  ? 390 ARG A O     1 
ATOM   3258 C  CB    . ARG A 1 390 ? 14.382  -37.562 2.792   1.00 23.37  ? 390 ARG A CB    1 
ATOM   3259 C  CG    . ARG A 1 390 ? 13.514  -38.131 3.859   1.00 25.66  ? 390 ARG A CG    1 
ATOM   3260 C  CD    . ARG A 1 390 ? 13.955  -37.511 5.166   1.00 29.96  ? 390 ARG A CD    1 
ATOM   3261 N  NE    . ARG A 1 390 ? 15.081  -38.199 5.714   1.00 28.88  ? 390 ARG A NE    1 
ATOM   3262 C  CZ    . ARG A 1 390 ? 16.057  -37.672 6.449   1.00 29.55  ? 390 ARG A CZ    1 
ATOM   3263 N  NH1   . ARG A 1 390 ? 16.143  -36.365 6.747   1.00 30.82  ? 390 ARG A NH1   1 
ATOM   3264 N  NH2   . ARG A 1 390 ? 16.972  -38.500 6.896   1.00 29.32  ? 390 ARG A NH2   1 
ATOM   3265 N  N     . SER A 1 391 ? 12.693  -35.142 2.043   1.00 22.32  ? 391 SER A N     1 
ATOM   3266 C  CA    . SER A 1 391 ? 11.638  -34.164 2.265   1.00 23.86  ? 391 SER A CA    1 
ATOM   3267 C  C     . SER A 1 391 ? 10.745  -33.971 1.023   1.00 23.53  ? 391 SER A C     1 
ATOM   3268 O  O     . SER A 1 391 ? 9.512   -34.062 1.106   1.00 23.99  ? 391 SER A O     1 
ATOM   3269 C  CB    . SER A 1 391 ? 12.265  -32.838 2.690   1.00 24.32  ? 391 SER A CB    1 
ATOM   3270 O  OG    . SER A 1 391 ? 11.253  -31.886 2.914   1.00 27.85  ? 391 SER A OG    1 
ATOM   3271 N  N     . TYR A 1 392 ? 11.370  -33.731 -0.126  1.00 23.03  ? 392 TYR A N     1 
ATOM   3272 C  CA    . TYR A 1 392 ? 10.646  -33.493 -1.368  1.00 23.42  ? 392 TYR A CA    1 
ATOM   3273 C  C     . TYR A 1 392 ? 9.739   -34.686 -1.760  1.00 23.94  ? 392 TYR A C     1 
ATOM   3274 O  O     . TYR A 1 392 ? 8.552   -34.510 -2.026  1.00 24.38  ? 392 TYR A O     1 
ATOM   3275 C  CB    . TYR A 1 392 ? 11.617  -33.076 -2.505  1.00 22.36  ? 392 TYR A CB    1 
ATOM   3276 C  CG    . TYR A 1 392 ? 10.914  -32.828 -3.822  1.00 22.31  ? 392 TYR A CG    1 
ATOM   3277 C  CD1   . TYR A 1 392 ? 10.188  -31.647 -4.037  1.00 20.96  ? 392 TYR A CD1   1 
ATOM   3278 C  CD2   . TYR A 1 392 ? 10.891  -33.813 -4.823  1.00 20.06  ? 392 TYR A CD2   1 
ATOM   3279 C  CE1   . TYR A 1 392 ? 9.501   -31.430 -5.237  1.00 20.88  ? 392 TYR A CE1   1 
ATOM   3280 C  CE2   . TYR A 1 392 ? 10.221  -33.597 -6.015  1.00 19.94  ? 392 TYR A CE2   1 
ATOM   3281 C  CZ    . TYR A 1 392 ? 9.512   -32.414 -6.213  1.00 21.74  ? 392 TYR A CZ    1 
ATOM   3282 O  OH    . TYR A 1 392 ? 8.820   -32.191 -7.384  1.00 22.09  ? 392 TYR A OH    1 
ATOM   3283 N  N     . ALA A 1 393 ? 10.287  -35.893 -1.757  1.00 24.02  ? 393 ALA A N     1 
ATOM   3284 C  CA    . ALA A 1 393 ? 9.547   -37.074 -2.212  1.00 23.85  ? 393 ALA A CA    1 
ATOM   3285 C  C     . ALA A 1 393 ? 8.417   -37.492 -1.251  1.00 25.04  ? 393 ALA A C     1 
ATOM   3286 O  O     . ALA A 1 393 ? 7.391   -38.080 -1.679  1.00 25.17  ? 393 ALA A O     1 
ATOM   3287 C  CB    . ALA A 1 393 ? 10.495  -38.225 -2.465  1.00 23.11  ? 393 ALA A CB    1 
ATOM   3288 N  N     . SER A 1 394 ? 8.621   -37.222 0.035   1.00 25.70  ? 394 SER A N     1 
ATOM   3289 C  CA    . SER A 1 394 ? 7.608   -37.460 1.059   1.00 26.81  ? 394 SER A CA    1 
ATOM   3290 C  C     . SER A 1 394 ? 6.420   -36.539 0.902   1.00 27.72  ? 394 SER A C     1 
ATOM   3291 O  O     . SER A 1 394 ? 5.301   -36.971 1.118   1.00 29.53  ? 394 SER A O     1 
ATOM   3292 C  CB    . SER A 1 394 ? 8.174   -37.281 2.475   1.00 26.82  ? 394 SER A CB    1 
ATOM   3293 O  OG    . SER A 1 394 ? 9.241   -38.162 2.723   1.00 25.33  ? 394 SER A OG    1 
ATOM   3294 N  N     . THR A 1 395 ? 6.663   -35.270 0.577   1.00 27.82  ? 395 THR A N     1 
ATOM   3295 C  CA    . THR A 1 395 ? 5.583   -34.281 0.488   1.00 28.90  ? 395 THR A CA    1 
ATOM   3296 C  C     . THR A 1 395 ? 5.037   -34.077 -0.946  1.00 28.38  ? 395 THR A C     1 
ATOM   3297 O  O     . THR A 1 395 ? 3.882   -33.696 -1.116  1.00 28.37  ? 395 THR A O     1 
ATOM   3298 C  CB    . THR A 1 395 ? 5.993   -32.903 1.088   1.00 29.25  ? 395 THR A CB    1 
ATOM   3299 O  OG1   . THR A 1 395 ? 7.080   -32.360 0.342   1.00 31.24  ? 395 THR A OG1   1 
ATOM   3300 C  CG2   . THR A 1 395 ? 6.431   -33.026 2.532   1.00 29.35  ? 395 THR A CG2   1 
ATOM   3301 N  N     . HIS A 1 396 ? 5.854   -34.353 -1.960  1.00 27.68  ? 396 HIS A N     1 
ATOM   3302 C  CA    . HIS A 1 396 ? 5.474   -34.120 -3.365  1.00 28.10  ? 396 HIS A CA    1 
ATOM   3303 C  C     . HIS A 1 396 ? 5.297   -35.393 -4.204  1.00 27.46  ? 396 HIS A C     1 
ATOM   3304 O  O     . HIS A 1 396 ? 5.362   -35.340 -5.439  1.00 26.87  ? 396 HIS A O     1 
ATOM   3305 C  CB    . HIS A 1 396 ? 6.510   -33.233 -4.053  1.00 27.82  ? 396 HIS A CB    1 
ATOM   3306 C  CG    . HIS A 1 396 ? 6.506   -31.812 -3.585  1.00 29.90  ? 396 HIS A CG    1 
ATOM   3307 N  ND1   . HIS A 1 396 ? 6.138   -30.765 -4.404  1.00 32.17  ? 396 HIS A ND1   1 
ATOM   3308 C  CD2   . HIS A 1 396 ? 6.872   -31.259 -2.406  1.00 30.36  ? 396 HIS A CD2   1 
ATOM   3309 C  CE1   . HIS A 1 396 ? 6.236   -29.631 -3.732  1.00 32.26  ? 396 HIS A CE1   1 
ATOM   3310 N  NE2   . HIS A 1 396 ? 6.679   -29.905 -2.518  1.00 33.73  ? 396 HIS A NE2   1 
ATOM   3311 N  N     . TRP A 1 397 ? 5.110   -36.530 -3.531  1.00 27.35  ? 397 TRP A N     1 
ATOM   3312 C  CA    . TRP A 1 397 ? 4.869   -37.817 -4.183  1.00 26.77  ? 397 TRP A CA    1 
ATOM   3313 C  C     . TRP A 1 397 ? 3.856   -37.691 -5.338  1.00 27.37  ? 397 TRP A C     1 
ATOM   3314 O  O     . TRP A 1 397 ? 4.022   -38.296 -6.397  1.00 25.79  ? 397 TRP A O     1 
ATOM   3315 C  CB    . TRP A 1 397 ? 4.375   -38.845 -3.150  1.00 26.99  ? 397 TRP A CB    1 
ATOM   3316 C  CG    . TRP A 1 397 ? 3.078   -38.446 -2.468  1.00 28.55  ? 397 TRP A CG    1 
ATOM   3317 C  CD1   . TRP A 1 397 ? 2.945   -37.750 -1.303  1.00 27.83  ? 397 TRP A CD1   1 
ATOM   3318 C  CD2   . TRP A 1 397 ? 1.737   -38.714 -2.927  1.00 27.95  ? 397 TRP A CD2   1 
ATOM   3319 N  NE1   . TRP A 1 397 ? 1.613   -37.563 -1.006  1.00 28.20  ? 397 TRP A NE1   1 
ATOM   3320 C  CE2   . TRP A 1 397 ? 0.852   -38.144 -1.984  1.00 30.60  ? 397 TRP A CE2   1 
ATOM   3321 C  CE3   . TRP A 1 397 ? 1.204   -39.384 -4.034  1.00 29.05  ? 397 TRP A CE3   1 
ATOM   3322 C  CZ2   . TRP A 1 397 ? -0.540  -38.214 -2.123  1.00 31.59  ? 397 TRP A CZ2   1 
ATOM   3323 C  CZ3   . TRP A 1 397 ? -0.174  -39.457 -4.174  1.00 29.90  ? 397 TRP A CZ3   1 
ATOM   3324 C  CH2   . TRP A 1 397 ? -1.033  -38.875 -3.224  1.00 31.00  ? 397 TRP A CH2   1 
ATOM   3325 N  N     . HIS A 1 398 ? 2.830   -36.870 -5.116  1.00 28.16  ? 398 HIS A N     1 
ATOM   3326 C  CA    . HIS A 1 398 ? 1.703   -36.727 -6.041  1.00 29.92  ? 398 HIS A CA    1 
ATOM   3327 C  C     . HIS A 1 398 ? 2.085   -36.204 -7.435  1.00 28.88  ? 398 HIS A C     1 
ATOM   3328 O  O     . HIS A 1 398 ? 1.416   -36.499 -8.428  1.00 28.71  ? 398 HIS A O     1 
ATOM   3329 C  CB    . HIS A 1 398 ? 0.631   -35.838 -5.402  1.00 31.33  ? 398 HIS A CB    1 
ATOM   3330 C  CG    . HIS A 1 398 ? 1.181   -34.615 -4.730  1.00 35.61  ? 398 HIS A CG    1 
ATOM   3331 N  ND1   . HIS A 1 398 ? 1.431   -34.555 -3.371  1.00 35.75  ? 398 HIS A ND1   1 
ATOM   3332 C  CD2   . HIS A 1 398 ? 1.563   -33.417 -5.239  1.00 37.85  ? 398 HIS A CD2   1 
ATOM   3333 C  CE1   . HIS A 1 398 ? 1.905   -33.357 -3.073  1.00 40.39  ? 398 HIS A CE1   1 
ATOM   3334 N  NE2   . HIS A 1 398 ? 1.999   -32.649 -4.188  1.00 40.19  ? 398 HIS A NE2   1 
ATOM   3335 N  N     . THR A 1 399 ? 3.168   -35.438 -7.500  1.00 27.86  ? 399 THR A N     1 
ATOM   3336 C  CA    . THR A 1 399 ? 3.579   -34.807 -8.739  1.00 26.73  ? 399 THR A CA    1 
ATOM   3337 C  C     . THR A 1 399 ? 4.573   -35.683 -9.510  1.00 25.27  ? 399 THR A C     1 
ATOM   3338 O  O     . THR A 1 399 ? 5.069   -35.277 -10.564 1.00 24.62  ? 399 THR A O     1 
ATOM   3339 C  CB    . THR A 1 399 ? 4.166   -33.399 -8.474  1.00 27.18  ? 399 THR A CB    1 
ATOM   3340 O  OG1   . THR A 1 399 ? 3.955   -32.556 -9.619  1.00 27.68  ? 399 THR A OG1   1 
ATOM   3341 C  CG2   . THR A 1 399 ? 5.676   -33.467 -8.124  1.00 25.82  ? 399 THR A CG2   1 
ATOM   3342 N  N     . LEU A 1 400 ? 4.834   -36.884 -8.998  1.00 24.00  ? 400 LEU A N     1 
ATOM   3343 C  CA    . LEU A 1 400 ? 5.884   -37.753 -9.557  1.00 23.46  ? 400 LEU A CA    1 
ATOM   3344 C  C     . LEU A 1 400 ? 5.362   -38.838 -10.501 1.00 23.81  ? 400 LEU A C     1 
ATOM   3345 O  O     . LEU A 1 400 ? 5.971   -39.895 -10.628 1.00 23.87  ? 400 LEU A O     1 
ATOM   3346 C  CB    . LEU A 1 400 ? 6.728   -38.373 -8.424  1.00 22.59  ? 400 LEU A CB    1 
ATOM   3347 C  CG    . LEU A 1 400 ? 7.359   -37.340 -7.453  1.00 22.60  ? 400 LEU A CG    1 
ATOM   3348 C  CD1   . LEU A 1 400 ? 8.147   -38.014 -6.346  1.00 22.06  ? 400 LEU A CD1   1 
ATOM   3349 C  CD2   . LEU A 1 400 ? 8.259   -36.357 -8.213  1.00 18.39  ? 400 LEU A CD2   1 
ATOM   3350 N  N     . GLY A 1 401 ? 4.240   -38.571 -11.165 1.00 24.51  ? 401 GLY A N     1 
ATOM   3351 C  CA    . GLY A 1 401 ? 3.611   -39.569 -12.029 1.00 24.24  ? 401 GLY A CA    1 
ATOM   3352 C  C     . GLY A 1 401 ? 2.500   -40.283 -11.311 1.00 24.64  ? 401 GLY A C     1 
ATOM   3353 O  O     . GLY A 1 401 ? 2.567   -40.488 -10.089 1.00 24.07  ? 401 GLY A O     1 
ATOM   3354 N  N     . LYS A 1 402 ? 1.459   -40.671 -12.049 1.00 25.88  ? 402 LYS A N     1 
ATOM   3355 C  CA    . LYS A 1 402 ? 0.258   -41.234 -11.408 1.00 26.17  ? 402 LYS A CA    1 
ATOM   3356 C  C     . LYS A 1 402 ? 0.573   -42.479 -10.565 1.00 26.12  ? 402 LYS A C     1 
ATOM   3357 O  O     . LYS A 1 402 ? 0.220   -42.538 -9.385  1.00 26.82  ? 402 LYS A O     1 
ATOM   3358 C  CB    . LYS A 1 402 ? -0.839  -41.537 -12.446 1.00 27.65  ? 402 LYS A CB    1 
ATOM   3359 C  CG    . LYS A 1 402 ? -1.992  -42.435 -11.928 1.00 29.75  ? 402 LYS A CG    1 
ATOM   3360 C  CD    . LYS A 1 402 ? -2.875  -41.672 -10.977 1.00 36.30  ? 402 LYS A CD    1 
ATOM   3361 C  CE    . LYS A 1 402 ? -4.151  -42.452 -10.627 1.00 39.52  ? 402 LYS A CE    1 
ATOM   3362 N  NZ    . LYS A 1 402 ? -4.746  -41.773 -9.442  1.00 42.83  ? 402 LYS A NZ    1 
ATOM   3363 N  N     . ASN A 1 403 ? 1.235   -43.462 -11.174 1.00 25.17  ? 403 ASN A N     1 
ATOM   3364 C  CA    . ASN A 1 403 ? 1.482   -44.759 -10.539 1.00 25.21  ? 403 ASN A CA    1 
ATOM   3365 C  C     . ASN A 1 403 ? 2.806   -44.810 -9.759  1.00 24.90  ? 403 ASN A C     1 
ATOM   3366 O  O     . ASN A 1 403 ? 2.883   -45.411 -8.671  1.00 24.67  ? 403 ASN A O     1 
ATOM   3367 C  CB    . ASN A 1 403 ? 1.396   -45.871 -11.588 1.00 24.65  ? 403 ASN A CB    1 
ATOM   3368 C  CG    . ASN A 1 403 ? 0.090   -45.834 -12.365 1.00 25.57  ? 403 ASN A CG    1 
ATOM   3369 O  OD1   . ASN A 1 403 ? -0.977  -46.158 -11.837 1.00 27.70  ? 403 ASN A OD1   1 
ATOM   3370 N  ND2   . ASN A 1 403 ? 0.169   -45.471 -13.616 1.00 20.94  ? 403 ASN A ND2   1 
ATOM   3371 N  N     . VAL A 1 404 ? 3.835   -44.169 -10.318 1.00 24.44  ? 404 VAL A N     1 
ATOM   3372 C  CA    . VAL A 1 404 ? 5.124   -43.990 -9.655  1.00 22.97  ? 404 VAL A CA    1 
ATOM   3373 C  C     . VAL A 1 404 ? 4.959   -43.193 -8.342  1.00 23.39  ? 404 VAL A C     1 
ATOM   3374 O  O     . VAL A 1 404 ? 5.475   -43.603 -7.302  1.00 22.38  ? 404 VAL A O     1 
ATOM   3375 C  CB    . VAL A 1 404 ? 6.165   -43.318 -10.590 1.00 22.82  ? 404 VAL A CB    1 
ATOM   3376 C  CG1   . VAL A 1 404 ? 7.395   -42.822 -9.803  1.00 23.13  ? 404 VAL A CG1   1 
ATOM   3377 C  CG2   . VAL A 1 404 ? 6.596   -44.286 -11.673 1.00 21.69  ? 404 VAL A CG2   1 
ATOM   3378 N  N     . GLY A 1 405 ? 4.232   -42.080 -8.401  1.00 23.54  ? 405 GLY A N     1 
ATOM   3379 C  CA    . GLY A 1 405 ? 4.024   -41.230 -7.233  1.00 24.97  ? 405 GLY A CA    1 
ATOM   3380 C  C     . GLY A 1 405 ? 3.224   -41.905 -6.127  1.00 26.75  ? 405 GLY A C     1 
ATOM   3381 O  O     . GLY A 1 405 ? 3.539   -41.748 -4.942  1.00 26.85  ? 405 GLY A O     1 
ATOM   3382 N  N     . GLU A 1 406 ? 2.185   -42.640 -6.524  1.00 27.73  ? 406 GLU A N     1 
ATOM   3383 C  CA    . GLU A 1 406 ? 1.409   -43.464 -5.613  1.00 29.51  ? 406 GLU A CA    1 
ATOM   3384 C  C     . GLU A 1 406 ? 2.247   -44.571 -4.937  1.00 28.60  ? 406 GLU A C     1 
ATOM   3385 O  O     . GLU A 1 406 ? 2.087   -44.818 -3.742  1.00 28.43  ? 406 GLU A O     1 
ATOM   3386 C  CB    . GLU A 1 406 ? 0.154   -44.015 -6.300  1.00 30.63  ? 406 GLU A CB    1 
ATOM   3387 C  CG    . GLU A 1 406 ? -0.883  -42.908 -6.570  1.00 33.40  ? 406 GLU A CG    1 
ATOM   3388 C  CD    . GLU A 1 406 ? -2.146  -43.370 -7.308  1.00 35.72  ? 406 GLU A CD    1 
ATOM   3389 O  OE1   . GLU A 1 406 ? -3.038  -42.511 -7.479  1.00 42.19  ? 406 GLU A OE1   1 
ATOM   3390 O  OE2   . GLU A 1 406 ? -2.260  -44.551 -7.725  1.00 40.18  ? 406 GLU A OE2   1 
ATOM   3391 N  N     . SER A 1 407 ? 3.154   -45.204 -5.683  1.00 26.72  ? 407 SER A N     1 
ATOM   3392 C  CA    . SER A 1 407 ? 4.090   -46.160 -5.090  1.00 26.72  ? 407 SER A CA    1 
ATOM   3393 C  C     . SER A 1 407 ? 5.074   -45.487 -4.117  1.00 26.21  ? 407 SER A C     1 
ATOM   3394 O  O     . SER A 1 407 ? 5.296   -45.989 -3.017  1.00 27.18  ? 407 SER A O     1 
ATOM   3395 C  CB    . SER A 1 407 ? 4.857   -46.935 -6.174  1.00 26.48  ? 407 SER A CB    1 
ATOM   3396 O  OG    . SER A 1 407 ? 5.830   -47.770 -5.564  1.00 25.93  ? 407 SER A OG    1 
ATOM   3397 N  N     . ILE A 1 408 ? 5.638   -44.348 -4.516  1.00 24.59  ? 408 ILE A N     1 
ATOM   3398 C  CA    . ILE A 1 408 ? 6.528   -43.564 -3.645  1.00 24.25  ? 408 ILE A CA    1 
ATOM   3399 C  C     . ILE A 1 408 ? 5.850   -43.091 -2.327  1.00 24.69  ? 408 ILE A C     1 
ATOM   3400 O  O     . ILE A 1 408 ? 6.469   -43.083 -1.267  1.00 24.19  ? 408 ILE A O     1 
ATOM   3401 C  CB    . ILE A 1 408 ? 7.180   -42.406 -4.427  1.00 23.28  ? 408 ILE A CB    1 
ATOM   3402 C  CG1   . ILE A 1 408 ? 8.233   -42.962 -5.404  1.00 22.41  ? 408 ILE A CG1   1 
ATOM   3403 C  CG2   . ILE A 1 408 ? 7.779   -41.324 -3.481  1.00 21.81  ? 408 ILE A CG2   1 
ATOM   3404 C  CD1   . ILE A 1 408 ? 8.736   -41.925 -6.413  1.00 22.94  ? 408 ILE A CD1   1 
ATOM   3405 N  N     . ARG A 1 409 ? 4.569   -42.744 -2.411  1.00 25.65  ? 409 ARG A N     1 
ATOM   3406 C  CA    . ARG A 1 409 ? 3.736   -42.493 -1.253  1.00 26.76  ? 409 ARG A CA    1 
ATOM   3407 C  C     . ARG A 1 409 ? 3.714   -43.680 -0.265  1.00 27.76  ? 409 ARG A C     1 
ATOM   3408 O  O     . ARG A 1 409 ? 3.719   -43.486 0.939   1.00 27.85  ? 409 ARG A O     1 
ATOM   3409 C  CB    . ARG A 1 409 ? 2.295   -42.175 -1.694  1.00 27.21  ? 409 ARG A CB    1 
ATOM   3410 C  CG    . ARG A 1 409 ? 1.448   -41.594 -0.549  1.00 28.70  ? 409 ARG A CG    1 
ATOM   3411 C  CD    . ARG A 1 409 ? -0.043  -41.449 -0.879  1.00 30.12  ? 409 ARG A CD    1 
ATOM   3412 N  NE    . ARG A 1 409 ? -0.687  -40.618 0.161   1.00 35.16  ? 409 ARG A NE    1 
ATOM   3413 C  CZ    . ARG A 1 409 ? -1.986  -40.309 0.230   1.00 39.44  ? 409 ARG A CZ    1 
ATOM   3414 N  NH1   . ARG A 1 409 ? -2.853  -40.758 -0.675  1.00 37.84  ? 409 ARG A NH1   1 
ATOM   3415 N  NH2   . ARG A 1 409 ? -2.423  -39.541 1.231   1.00 40.99  ? 409 ARG A NH2   1 
ATOM   3416 N  N     . GLU A 1 410 ? 3.677   -44.900 -0.787  1.00 28.29  ? 410 GLU A N     1 
ATOM   3417 C  CA    . GLU A 1 410 ? 3.567   -46.092 0.049   1.00 30.15  ? 410 GLU A CA    1 
ATOM   3418 C  C     . GLU A 1 410 ? 4.892   -46.448 0.713   1.00 29.42  ? 410 GLU A C     1 
ATOM   3419 O  O     . GLU A 1 410 ? 4.922   -46.901 1.858   1.00 29.85  ? 410 GLU A O     1 
ATOM   3420 C  CB    . GLU A 1 410 ? 3.117   -47.275 -0.805  1.00 31.02  ? 410 GLU A CB    1 
ATOM   3421 C  CG    . GLU A 1 410 ? 1.726   -47.168 -1.342  1.00 36.00  ? 410 GLU A CG    1 
ATOM   3422 C  CD    . GLU A 1 410 ? 1.423   -48.240 -2.390  1.00 41.48  ? 410 GLU A CD    1 
ATOM   3423 O  OE1   . GLU A 1 410 ? 0.269   -48.260 -2.891  1.00 43.82  ? 410 GLU A OE1   1 
ATOM   3424 O  OE2   . GLU A 1 410 ? 2.333   -49.051 -2.710  1.00 42.27  ? 410 GLU A OE2   1 
ATOM   3425 N  N     . TYR A 1 411 ? 5.977   -46.285 -0.041  1.00 28.21  ? 411 TYR A N     1 
ATOM   3426 C  CA    . TYR A 1 411 ? 7.318   -46.631 0.411   1.00 27.55  ? 411 TYR A CA    1 
ATOM   3427 C  C     . TYR A 1 411 ? 8.341   -46.079 -0.563  1.00 26.32  ? 411 TYR A C     1 
ATOM   3428 O  O     . TYR A 1 411 ? 8.203   -46.223 -1.782  1.00 24.61  ? 411 TYR A O     1 
ATOM   3429 C  CB    . TYR A 1 411 ? 7.490   -48.163 0.555   1.00 28.59  ? 411 TYR A CB    1 
ATOM   3430 C  CG    . TYR A 1 411 ? 8.900   -48.654 0.256   1.00 28.00  ? 411 TYR A CG    1 
ATOM   3431 C  CD1   . TYR A 1 411 ? 9.184   -49.286 -0.951  1.00 28.39  ? 411 TYR A CD1   1 
ATOM   3432 C  CD2   . TYR A 1 411 ? 9.947   -48.478 1.169   1.00 28.90  ? 411 TYR A CD2   1 
ATOM   3433 C  CE1   . TYR A 1 411 ? 10.474  -49.715 -1.255  1.00 28.93  ? 411 TYR A CE1   1 
ATOM   3434 C  CE2   . TYR A 1 411 ? 11.251  -48.925 0.875   1.00 28.91  ? 411 TYR A CE2   1 
ATOM   3435 C  CZ    . TYR A 1 411 ? 11.497  -49.538 -0.345  1.00 29.59  ? 411 TYR A CZ    1 
ATOM   3436 O  OH    . TYR A 1 411 ? 12.769  -49.975 -0.680  1.00 30.40  ? 411 TYR A OH    1 
ATOM   3437 N  N     . PHE A 1 412 ? 9.371   -45.439 -0.016  1.00 25.78  ? 412 PHE A N     1 
ATOM   3438 C  CA    . PHE A 1 412 ? 10.588  -45.162 -0.781  1.00 24.87  ? 412 PHE A CA    1 
ATOM   3439 C  C     . PHE A 1 412 ? 11.762  -45.079 0.180   1.00 25.74  ? 412 PHE A C     1 
ATOM   3440 O  O     . PHE A 1 412 ? 11.579  -44.873 1.390   1.00 25.20  ? 412 PHE A O     1 
ATOM   3441 C  CB    . PHE A 1 412 ? 10.477  -43.887 -1.613  1.00 23.41  ? 412 PHE A CB    1 
ATOM   3442 C  CG    . PHE A 1 412 ? 10.660  -42.627 -0.825  1.00 24.25  ? 412 PHE A CG    1 
ATOM   3443 C  CD1   . PHE A 1 412 ? 11.945  -42.091 -0.623  1.00 24.79  ? 412 PHE A CD1   1 
ATOM   3444 C  CD2   . PHE A 1 412 ? 9.555   -41.963 -0.288  1.00 23.21  ? 412 PHE A CD2   1 
ATOM   3445 C  CE1   . PHE A 1 412 ? 12.120  -40.908 0.114   1.00 24.80  ? 412 PHE A CE1   1 
ATOM   3446 C  CE2   . PHE A 1 412 ? 9.731   -40.767 0.451   1.00 23.05  ? 412 PHE A CE2   1 
ATOM   3447 C  CZ    . PHE A 1 412 ? 11.014  -40.252 0.632   1.00 23.06  ? 412 PHE A CZ    1 
ATOM   3448 N  N     . GLU A 1 413 ? 12.956  -45.281 -0.360  1.00 25.26  ? 413 GLU A N     1 
ATOM   3449 C  CA    . GLU A 1 413 ? 14.165  -45.117 0.411   1.00 26.52  ? 413 GLU A CA    1 
ATOM   3450 C  C     . GLU A 1 413 ? 15.243  -44.517 -0.448  1.00 25.80  ? 413 GLU A C     1 
ATOM   3451 O  O     . GLU A 1 413 ? 15.247  -44.680 -1.687  1.00 25.91  ? 413 GLU A O     1 
ATOM   3452 C  CB    . GLU A 1 413 ? 14.643  -46.423 1.028   1.00 27.39  ? 413 GLU A CB    1 
ATOM   3453 C  CG    . GLU A 1 413 ? 15.020  -47.516 0.068   1.00 28.96  ? 413 GLU A CG    1 
ATOM   3454 C  CD    . GLU A 1 413 ? 15.475  -48.748 0.825   1.00 31.65  ? 413 GLU A CD    1 
ATOM   3455 O  OE1   . GLU A 1 413 ? 16.563  -48.718 1.428   1.00 31.74  ? 413 GLU A OE1   1 
ATOM   3456 O  OE2   . GLU A 1 413 ? 14.731  -49.746 0.843   1.00 35.72  ? 413 GLU A OE2   1 
ATOM   3457 N  N     . ILE A 1 414 ? 16.128  -43.805 0.220   1.00 25.19  ? 414 ILE A N     1 
ATOM   3458 C  CA    . ILE A 1 414 ? 17.275  -43.177 -0.408  1.00 25.53  ? 414 ILE A CA    1 
ATOM   3459 C  C     . ILE A 1 414 ? 18.487  -44.010 -0.038  1.00 26.82  ? 414 ILE A C     1 
ATOM   3460 O  O     . ILE A 1 414 ? 18.711  -44.311 1.139   1.00 26.97  ? 414 ILE A O     1 
ATOM   3461 C  CB    . ILE A 1 414 ? 17.397  -41.721 0.028   1.00 25.00  ? 414 ILE A CB    1 
ATOM   3462 C  CG1   . ILE A 1 414 ? 16.163  -40.966 -0.452  1.00 26.24  ? 414 ILE A CG1   1 
ATOM   3463 C  CG2   . ILE A 1 414 ? 18.715  -41.052 -0.491  1.00 24.16  ? 414 ILE A CG2   1 
ATOM   3464 C  CD1   . ILE A 1 414 ? 15.947  -39.704 0.219   1.00 28.05  ? 414 ILE A CD1   1 
ATOM   3465 N  N     . ILE A 1 415 ? 19.227  -44.412 -1.066  1.00 27.89  ? 415 ILE A N     1 
ATOM   3466 C  CA    . ILE A 1 415 ? 20.405  -45.265 -0.930  1.00 31.04  ? 415 ILE A CA    1 
ATOM   3467 C  C     . ILE A 1 415 ? 21.624  -44.595 -1.560  1.00 31.93  ? 415 ILE A C     1 
ATOM   3468 O  O     . ILE A 1 415 ? 21.513  -43.916 -2.583  1.00 30.28  ? 415 ILE A O     1 
ATOM   3469 C  CB    . ILE A 1 415 ? 20.242  -46.613 -1.659  1.00 31.48  ? 415 ILE A CB    1 
ATOM   3470 C  CG1   . ILE A 1 415 ? 18.888  -47.265 -1.395  1.00 33.62  ? 415 ILE A CG1   1 
ATOM   3471 C  CG2   . ILE A 1 415 ? 21.359  -47.542 -1.263  1.00 31.92  ? 415 ILE A CG2   1 
ATOM   3472 C  CD1   . ILE A 1 415 ? 18.877  -48.112 -0.200  1.00 37.46  ? 415 ILE A CD1   1 
ATOM   3473 N  N     . SER A 1 416 ? 22.785  -44.812 -0.948  1.00 34.60  ? 416 SER A N     1 
ATOM   3474 C  CA    . SER A 1 416 ? 24.060  -44.295 -1.456  1.00 36.99  ? 416 SER A CA    1 
ATOM   3475 C  C     . SER A 1 416 ? 25.207  -45.237 -1.085  1.00 38.86  ? 416 SER A C     1 
ATOM   3476 O  O     . SER A 1 416 ? 24.995  -46.210 -0.363  1.00 40.35  ? 416 SER A O     1 
ATOM   3477 C  CB    . SER A 1 416 ? 24.316  -42.897 -0.910  1.00 36.62  ? 416 SER A CB    1 
ATOM   3478 O  OG    . SER A 1 416 ? 24.430  -42.955 0.491   1.00 39.62  ? 416 SER A OG    1 
ATOM   3479 N  N     . GLY A 1 417 ? 26.404  -44.973 -1.609  1.00 40.67  ? 417 GLY A N     1 
ATOM   3480 C  CA    . GLY A 1 417 ? 27.605  -45.747 -1.259  1.00 42.53  ? 417 GLY A CA    1 
ATOM   3481 C  C     . GLY A 1 417 ? 27.501  -47.194 -1.700  1.00 44.27  ? 417 GLY A C     1 
ATOM   3482 O  O     . GLY A 1 417 ? 26.810  -47.495 -2.679  1.00 43.56  ? 417 GLY A O     1 
ATOM   3483 N  N     . GLU A 1 418 ? 28.171  -48.090 -0.972  1.00 45.98  ? 418 GLU A N     1 
ATOM   3484 C  CA    . GLU A 1 418 ? 28.223  -49.512 -1.324  1.00 48.02  ? 418 GLU A CA    1 
ATOM   3485 C  C     . GLU A 1 418 ? 26.839  -50.142 -1.352  1.00 47.35  ? 418 GLU A C     1 
ATOM   3486 O  O     . GLU A 1 418 ? 26.582  -51.068 -2.136  1.00 47.93  ? 418 GLU A O     1 
ATOM   3487 C  CB    . GLU A 1 418 ? 29.130  -50.300 -0.354  1.00 49.77  ? 418 GLU A CB    1 
ATOM   3488 C  CG    . GLU A 1 418 ? 29.478  -51.732 -0.833  1.00 52.21  ? 418 GLU A CG    1 
ATOM   3489 C  CD    . GLU A 1 418 ? 30.141  -52.609 0.238   1.00 54.65  ? 418 GLU A CD    1 
ATOM   3490 O  OE1   . GLU A 1 418 ? 30.407  -52.125 1.369   1.00 58.63  ? 418 GLU A OE1   1 
ATOM   3491 O  OE2   . GLU A 1 418 ? 30.403  -53.801 -0.055  1.00 59.56  ? 418 GLU A OE2   1 
ATOM   3492 N  N     . LYS A 1 419 ? 25.949  -49.652 -0.490  1.00 46.30  ? 419 LYS A N     1 
ATOM   3493 C  CA    . LYS A 1 419 ? 24.579  -50.115 -0.513  1.00 45.24  ? 419 LYS A CA    1 
ATOM   3494 C  C     . LYS A 1 419 ? 24.024  -49.901 -1.930  1.00 42.99  ? 419 LYS A C     1 
ATOM   3495 O  O     . LYS A 1 419 ? 23.378  -50.801 -2.489  1.00 43.34  ? 419 LYS A O     1 
ATOM   3496 C  CB    . LYS A 1 419 ? 23.758  -49.411 0.573   1.00 45.45  ? 419 LYS A CB    1 
ATOM   3497 C  CG    . LYS A 1 419 ? 22.228  -49.526 0.472   1.00 46.77  ? 419 LYS A CG    1 
ATOM   3498 C  CD    . LYS A 1 419 ? 21.614  -50.852 0.888   1.00 48.67  ? 419 LYS A CD    1 
ATOM   3499 C  CE    . LYS A 1 419 ? 20.305  -50.583 1.625   1.00 48.89  ? 419 LYS A CE    1 
ATOM   3500 N  NZ    . LYS A 1 419 ? 19.132  -51.424 1.204   1.00 47.97  ? 419 LYS A NZ    1 
ATOM   3501 N  N     . LEU A 1 420 ? 24.322  -48.743 -2.524  1.00 40.59  ? 420 LEU A N     1 
ATOM   3502 C  CA    . LEU A 1 420 ? 23.869  -48.446 -3.895  1.00 38.30  ? 420 LEU A CA    1 
ATOM   3503 C  C     . LEU A 1 420 ? 24.586  -49.314 -4.927  1.00 38.13  ? 420 LEU A C     1 
ATOM   3504 O  O     . LEU A 1 420 ? 23.947  -49.872 -5.818  1.00 38.14  ? 420 LEU A O     1 
ATOM   3505 C  CB    . LEU A 1 420 ? 24.008  -46.958 -4.243  1.00 37.20  ? 420 LEU A CB    1 
ATOM   3506 C  CG    . LEU A 1 420 ? 23.518  -46.508 -5.634  1.00 36.63  ? 420 LEU A CG    1 
ATOM   3507 C  CD1   . LEU A 1 420 ? 22.045  -46.805 -5.835  1.00 34.13  ? 420 LEU A CD1   1 
ATOM   3508 C  CD2   . LEU A 1 420 ? 23.791  -45.042 -5.875  1.00 35.11  ? 420 LEU A CD2   1 
ATOM   3509 N  N     . PHE A 1 421 ? 25.904  -49.441 -4.794  1.00 38.46  ? 421 PHE A N     1 
ATOM   3510 C  CA    . PHE A 1 421 ? 26.712  -50.203 -5.759  1.00 38.90  ? 421 PHE A CA    1 
ATOM   3511 C  C     . PHE A 1 421 ? 26.328  -51.682 -5.818  1.00 39.78  ? 421 PHE A C     1 
ATOM   3512 O  O     . PHE A 1 421 ? 26.654  -52.381 -6.783  1.00 40.25  ? 421 PHE A O     1 
ATOM   3513 C  CB    . PHE A 1 421 ? 28.209  -50.024 -5.487  1.00 39.28  ? 421 PHE A CB    1 
ATOM   3514 C  CG    . PHE A 1 421 ? 28.635  -48.584 -5.364  1.00 38.64  ? 421 PHE A CG    1 
ATOM   3515 C  CD1   . PHE A 1 421 ? 29.682  -48.226 -4.516  1.00 39.85  ? 421 PHE A CD1   1 
ATOM   3516 C  CD2   . PHE A 1 421 ? 27.975  -47.580 -6.071  1.00 36.81  ? 421 PHE A CD2   1 
ATOM   3517 C  CE1   . PHE A 1 421 ? 30.068  -46.887 -4.390  1.00 40.17  ? 421 PHE A CE1   1 
ATOM   3518 C  CE2   . PHE A 1 421 ? 28.357  -46.245 -5.942  1.00 37.10  ? 421 PHE A CE2   1 
ATOM   3519 C  CZ    . PHE A 1 421 ? 29.404  -45.901 -5.098  1.00 37.30  ? 421 PHE A CZ    1 
ATOM   3520 N  N     . LYS A 1 422 ? 25.611  -52.135 -4.791  1.00 40.16  ? 422 LYS A N     1 
ATOM   3521 C  CA    . LYS A 1 422 ? 25.118  -53.508 -4.715  1.00 40.83  ? 422 LYS A CA    1 
ATOM   3522 C  C     . LYS A 1 422 ? 23.751  -53.678 -5.391  1.00 39.63  ? 422 LYS A C     1 
ATOM   3523 O  O     . LYS A 1 422 ? 23.332  -54.804 -5.690  1.00 40.43  ? 422 LYS A O     1 
ATOM   3524 C  CB    . LYS A 1 422 ? 25.081  -53.968 -3.255  1.00 42.01  ? 422 LYS A CB    1 
ATOM   3525 C  CG    . LYS A 1 422 ? 26.461  -54.346 -2.695  1.00 44.72  ? 422 LYS A CG    1 
ATOM   3526 C  CD    . LYS A 1 422 ? 26.429  -54.519 -1.172  1.00 44.92  ? 422 LYS A CD    1 
ATOM   3527 C  CE    . LYS A 1 422 ? 27.536  -55.466 -0.718  1.00 49.29  ? 422 LYS A CE    1 
ATOM   3528 N  NZ    . LYS A 1 422 ? 27.505  -55.774 0.762   1.00 50.65  ? 422 LYS A NZ    1 
ATOM   3529 N  N     . GLU A 1 423 ? 23.070  -52.562 -5.661  1.00 37.60  ? 423 GLU A N     1 
ATOM   3530 C  CA    . GLU A 1 423 ? 21.807  -52.583 -6.415  1.00 36.17  ? 423 GLU A CA    1 
ATOM   3531 C  C     . GLU A 1 423 ? 22.077  -52.809 -7.908  1.00 34.51  ? 423 GLU A C     1 
ATOM   3532 O  O     . GLU A 1 423 ? 23.177  -52.510 -8.375  1.00 34.61  ? 423 GLU A O     1 
ATOM   3533 C  CB    . GLU A 1 423 ? 21.030  -51.278 -6.207  1.00 35.49  ? 423 GLU A CB    1 
ATOM   3534 C  CG    . GLU A 1 423 ? 20.732  -50.919 -4.746  1.00 37.28  ? 423 GLU A CG    1 
ATOM   3535 C  CD    . GLU A 1 423 ? 19.660  -51.787 -4.092  1.00 39.95  ? 423 GLU A CD    1 
ATOM   3536 O  OE1   . GLU A 1 423 ? 18.968  -52.565 -4.782  1.00 41.57  ? 423 GLU A OE1   1 
ATOM   3537 O  OE2   . GLU A 1 423 ? 19.525  -51.696 -2.855  1.00 43.50  ? 423 GLU A OE2   1 
ATOM   3538 N  N     . PRO A 1 424 ? 21.090  -53.344 -8.663  1.00 33.27  ? 424 PRO A N     1 
ATOM   3539 C  CA    . PRO A 1 424 ? 21.321  -53.588 -10.093 1.00 32.18  ? 424 PRO A CA    1 
ATOM   3540 C  C     . PRO A 1 424 ? 21.276  -52.308 -10.924 1.00 30.08  ? 424 PRO A C     1 
ATOM   3541 O  O     . PRO A 1 424 ? 20.459  -52.203 -11.841 1.00 29.63  ? 424 PRO A O     1 
ATOM   3542 C  CB    . PRO A 1 424 ? 20.150  -54.504 -10.480 1.00 32.68  ? 424 PRO A CB    1 
ATOM   3543 C  CG    . PRO A 1 424 ? 19.063  -54.125 -9.556  1.00 32.43  ? 424 PRO A CG    1 
ATOM   3544 C  CD    . PRO A 1 424 ? 19.727  -53.758 -8.257  1.00 33.44  ? 424 PRO A CD    1 
ATOM   3545 N  N     . VAL A 1 425 ? 22.151  -51.356 -10.609 1.00 28.56  ? 425 VAL A N     1 
ATOM   3546 C  CA    . VAL A 1 425 ? 22.151  -50.033 -11.263 1.00 27.43  ? 425 VAL A CA    1 
ATOM   3547 C  C     . VAL A 1 425 ? 23.534  -49.571 -11.760 1.00 27.16  ? 425 VAL A C     1 
ATOM   3548 O  O     . VAL A 1 425 ? 23.725  -48.379 -12.076 1.00 26.62  ? 425 VAL A O     1 
ATOM   3549 C  CB    . VAL A 1 425 ? 21.641  -48.933 -10.300 1.00 26.47  ? 425 VAL A CB    1 
ATOM   3550 C  CG1   . VAL A 1 425 ? 20.192  -49.207 -9.875  1.00 26.83  ? 425 VAL A CG1   1 
ATOM   3551 C  CG2   . VAL A 1 425 ? 22.562  -48.810 -9.082  1.00 27.47  ? 425 VAL A CG2   1 
ATOM   3552 N  N     . THR A 1 426 ? 24.488  -50.498 -11.814 1.00 27.22  ? 426 THR A N     1 
ATOM   3553 C  CA    . THR A 1 426 ? 25.874  -50.138 -12.112 1.00 27.81  ? 426 THR A CA    1 
ATOM   3554 C  C     . THR A 1 426 ? 26.036  -49.669 -13.564 1.00 27.34  ? 426 THR A C     1 
ATOM   3555 O  O     . THR A 1 426 ? 26.769  -48.711 -13.819 1.00 28.07  ? 426 THR A O     1 
ATOM   3556 C  CB    . THR A 1 426 ? 26.870  -51.269 -11.773 1.00 28.44  ? 426 THR A CB    1 
ATOM   3557 O  OG1   . THR A 1 426 ? 26.692  -52.351 -12.679 1.00 29.32  ? 426 THR A OG1   1 
ATOM   3558 C  CG2   . THR A 1 426 ? 26.695  -51.764 -10.336 1.00 29.99  ? 426 THR A CG2   1 
ATOM   3559 N  N     . ALA A 1 427 ? 25.320  -50.302 -14.495 1.00 27.11  ? 427 ALA A N     1 
ATOM   3560 C  CA    . ALA A 1 427 ? 25.308  -49.852 -15.892 1.00 27.30  ? 427 ALA A CA    1 
ATOM   3561 C  C     . ALA A 1 427 ? 24.827  -48.404 -16.003 1.00 26.52  ? 427 ALA A C     1 
ATOM   3562 O  O     . ALA A 1 427 ? 25.402  -47.598 -16.745 1.00 25.62  ? 427 ALA A O     1 
ATOM   3563 C  CB    . ALA A 1 427 ? 24.439  -50.747 -16.755 1.00 27.69  ? 427 ALA A CB    1 
ATOM   3564 N  N     . GLU A 1 428 ? 23.755  -48.093 -15.283 1.00 25.90  ? 428 GLU A N     1 
ATOM   3565 C  CA    . GLU A 1 428 ? 23.182  -46.742 -15.319 1.00 25.66  ? 428 GLU A CA    1 
ATOM   3566 C  C     . GLU A 1 428 ? 24.093  -45.712 -14.638 1.00 25.21  ? 428 GLU A C     1 
ATOM   3567 O  O     . GLU A 1 428 ? 24.199  -44.568 -15.114 1.00 24.97  ? 428 GLU A O     1 
ATOM   3568 C  CB    . GLU A 1 428 ? 21.766  -46.718 -14.710 1.00 25.12  ? 428 GLU A CB    1 
ATOM   3569 C  CG    . GLU A 1 428 ? 20.709  -47.349 -15.598 1.00 27.24  ? 428 GLU A CG    1 
ATOM   3570 C  CD    . GLU A 1 428 ? 20.708  -48.873 -15.536 1.00 29.50  ? 428 GLU A CD    1 
ATOM   3571 O  OE1   . GLU A 1 428 ? 21.299  -49.459 -14.597 1.00 30.90  ? 428 GLU A OE1   1 
ATOM   3572 O  OE2   . GLU A 1 428 ? 20.095  -49.488 -16.434 1.00 32.50  ? 428 GLU A OE2   1 
ATOM   3573 N  N     . LEU A 1 429 ? 24.737  -46.100 -13.535 1.00 24.96  ? 429 LEU A N     1 
ATOM   3574 C  CA    . LEU A 1 429 ? 25.716  -45.207 -12.873 1.00 25.25  ? 429 LEU A CA    1 
ATOM   3575 C  C     . LEU A 1 429 ? 26.910  -44.926 -13.795 1.00 25.55  ? 429 LEU A C     1 
ATOM   3576 O  O     . LEU A 1 429 ? 27.306  -43.782 -13.966 1.00 24.64  ? 429 LEU A O     1 
ATOM   3577 C  CB    . LEU A 1 429 ? 26.220  -45.792 -11.553 1.00 25.95  ? 429 LEU A CB    1 
ATOM   3578 C  CG    . LEU A 1 429 ? 25.205  -45.834 -10.413 1.00 26.86  ? 429 LEU A CG    1 
ATOM   3579 C  CD1   . LEU A 1 429 ? 25.859  -46.439 -9.200  1.00 27.73  ? 429 LEU A CD1   1 
ATOM   3580 C  CD2   . LEU A 1 429 ? 24.693  -44.439 -10.107 1.00 26.00  ? 429 LEU A CD2   1 
ATOM   3581 N  N     . CYS A 1 430 ? 27.443  -45.979 -14.407 1.00 24.85  ? 430 CYS A N     1 
ATOM   3582 C  CA    . CYS A 1 430 ? 28.536  -45.839 -15.374 1.00 26.19  ? 430 CYS A CA    1 
ATOM   3583 C  C     . CYS A 1 430 ? 28.195  -44.915 -16.559 1.00 25.72  ? 430 CYS A C     1 
ATOM   3584 O  O     . CYS A 1 430 ? 29.001  -44.069 -16.920 1.00 25.67  ? 430 CYS A O     1 
ATOM   3585 C  CB    . CYS A 1 430 ? 28.992  -47.226 -15.849 1.00 25.94  ? 430 CYS A CB    1 
ATOM   3586 S  SG    . CYS A 1 430 ? 29.916  -48.082 -14.575 1.00 29.14  ? 430 CYS A SG    1 
ATOM   3587 N  N     . GLU A 1 431 ? 26.988  -45.039 -17.118 1.00 25.52  ? 431 GLU A N     1 
ATOM   3588 C  CA    . GLU A 1 431 ? 26.568  -44.191 -18.251 1.00 26.59  ? 431 GLU A CA    1 
ATOM   3589 C  C     . GLU A 1 431 ? 26.335  -42.744 -17.813 1.00 25.97  ? 431 GLU A C     1 
ATOM   3590 O  O     . GLU A 1 431 ? 26.785  -41.802 -18.456 1.00 25.10  ? 431 GLU A O     1 
ATOM   3591 C  CB    . GLU A 1 431 ? 25.297  -44.758 -18.921 1.00 27.40  ? 431 GLU A CB    1 
ATOM   3592 C  CG    . GLU A 1 431 ? 24.616  -43.840 -19.959 1.00 31.25  ? 431 GLU A CG    1 
ATOM   3593 C  CD    . GLU A 1 431 ? 25.362  -43.723 -21.292 1.00 38.97  ? 431 GLU A CD    1 
ATOM   3594 O  OE1   . GLU A 1 431 ? 26.179  -44.623 -21.634 1.00 41.75  ? 431 GLU A OE1   1 
ATOM   3595 O  OE2   . GLU A 1 431 ? 25.124  -42.712 -22.010 1.00 41.51  ? 431 GLU A OE2   1 
ATOM   3596 N  N     . MET A 1 432 ? 25.637  -42.584 -16.700 1.00 25.03  ? 432 MET A N     1 
ATOM   3597 C  CA    . MET A 1 432 ? 25.380  -41.277 -16.112 1.00 27.38  ? 432 MET A CA    1 
ATOM   3598 C  C     . MET A 1 432 ? 26.670  -40.475 -15.895 1.00 25.52  ? 432 MET A C     1 
ATOM   3599 O  O     . MET A 1 432 ? 26.706  -39.278 -16.147 1.00 25.55  ? 432 MET A O     1 
ATOM   3600 C  CB    . MET A 1 432 ? 24.723  -41.505 -14.761 1.00 26.68  ? 432 MET A CB    1 
ATOM   3601 C  CG    . MET A 1 432 ? 23.858  -40.423 -14.223 1.00 31.41  ? 432 MET A CG    1 
ATOM   3602 S  SD    . MET A 1 432 ? 23.262  -41.149 -12.676 1.00 33.11  ? 432 MET A SD    1 
ATOM   3603 C  CE    . MET A 1 432 ? 24.050  -40.154 -11.437 1.00 34.06  ? 432 MET A CE    1 
ATOM   3604 N  N     . MET A 1 433 ? 27.704  -41.153 -15.397 1.00 25.08  ? 433 MET A N     1 
ATOM   3605 C  CA    . MET A 1 433 ? 28.990  -40.535 -15.040 1.00 25.09  ? 433 MET A CA    1 
ATOM   3606 C  C     . MET A 1 433 ? 30.000  -40.467 -16.186 1.00 24.59  ? 433 MET A C     1 
ATOM   3607 O  O     . MET A 1 433 ? 31.036  -39.804 -16.067 1.00 24.90  ? 433 MET A O     1 
ATOM   3608 C  CB    . MET A 1 433 ? 29.617  -41.289 -13.856 1.00 25.28  ? 433 MET A CB    1 
ATOM   3609 C  CG    . MET A 1 433 ? 28.738  -41.269 -12.575 1.00 26.31  ? 433 MET A CG    1 
ATOM   3610 S  SD    . MET A 1 433 ? 29.528  -41.739 -11.007 1.00 26.37  ? 433 MET A SD    1 
ATOM   3611 C  CE    . MET A 1 433 ? 29.836  -43.475 -11.283 1.00 26.67  ? 433 MET A CE    1 
ATOM   3612 N  N     . GLY A 1 434 ? 29.715  -41.149 -17.294 1.00 24.44  ? 434 GLY A N     1 
ATOM   3613 C  CA    . GLY A 1 434 ? 30.644  -41.168 -18.442 1.00 23.78  ? 434 GLY A CA    1 
ATOM   3614 C  C     . GLY A 1 434 ? 31.916  -41.947 -18.130 1.00 24.46  ? 434 GLY A C     1 
ATOM   3615 O  O     . GLY A 1 434 ? 33.014  -41.599 -18.586 1.00 24.75  ? 434 GLY A O     1 
ATOM   3616 N  N     . VAL A 1 435 ? 31.763  -43.011 -17.354 1.00 23.06  ? 435 VAL A N     1 
ATOM   3617 C  CA    . VAL A 1 435 ? 32.880  -43.900 -17.049 1.00 24.09  ? 435 VAL A CA    1 
ATOM   3618 C  C     . VAL A 1 435 ? 33.360  -44.538 -18.346 1.00 25.01  ? 435 VAL A C     1 
ATOM   3619 O  O     . VAL A 1 435 ? 32.569  -45.147 -19.077 1.00 24.90  ? 435 VAL A O     1 
ATOM   3620 C  CB    . VAL A 1 435 ? 32.463  -44.980 -16.015 1.00 24.32  ? 435 VAL A CB    1 
ATOM   3621 C  CG1   . VAL A 1 435 ? 33.596  -46.039 -15.777 1.00 25.82  ? 435 VAL A CG1   1 
ATOM   3622 C  CG2   . VAL A 1 435 ? 32.005  -44.296 -14.704 1.00 21.95  ? 435 VAL A CG2   1 
ATOM   3623 N  N     . LYS A 1 436 ? 34.653  -44.357 -18.628 1.00 25.48  ? 436 LYS A N     1 
ATOM   3624 C  CA    . LYS A 1 436 ? 35.317  -44.979 -19.762 1.00 26.38  ? 436 LYS A CA    1 
ATOM   3625 C  C     . LYS A 1 436 ? 35.439  -46.491 -19.542 1.00 27.17  ? 436 LYS A C     1 
ATOM   3626 O  O     . LYS A 1 436 ? 35.590  -46.957 -18.407 1.00 26.45  ? 436 LYS A O     1 
ATOM   3627 C  CB    . LYS A 1 436 ? 36.723  -44.379 -19.960 1.00 26.92  ? 436 LYS A CB    1 
ATOM   3628 C  CG    . LYS A 1 436 ? 36.767  -42.892 -20.330 1.00 26.59  ? 436 LYS A CG    1 
ATOM   3629 C  CD    . LYS A 1 436 ? 38.213  -42.420 -20.606 1.00 27.99  ? 436 LYS A CD    1 
ATOM   3630 C  CE    . LYS A 1 436 ? 38.253  -40.954 -21.017 1.00 28.36  ? 436 LYS A CE    1 
ATOM   3631 N  NZ    . LYS A 1 436 ? 39.638  -40.462 -21.337 1.00 27.76  ? 436 LYS A NZ    1 
ATOM   3632 N  N     . ASP A 1 437 ? 35.346  -47.253 -20.628 1.00 27.56  ? 437 ASP A N     1 
ATOM   3633 C  CA    . ASP A 1 437 ? 35.723  -48.670 -20.608 1.00 28.79  ? 437 ASP A CA    1 
ATOM   3634 C  C     . ASP A 1 437 ? 34.885  -49.529 -19.649 1.00 29.34  ? 437 ASP A C     1 
ATOM   3635 O  O     . ASP A 1 437 ? 35.415  -50.363 -18.918 1.00 29.75  ? 437 ASP A O     1 
ATOM   3636 C  CB    . ASP A 1 437 ? 37.225  -48.814 -20.316 1.00 29.12  ? 437 ASP A CB    1 
ATOM   3637 C  CG    . ASP A 1 437 ? 38.093  -48.128 -21.372 1.00 30.12  ? 437 ASP A CG    1 
ATOM   3638 O  OD1   . ASP A 1 437 ? 38.879  -47.206 -21.041 1.00 27.54  ? 437 ASP A OD1   1 
ATOM   3639 O  OD2   . ASP A 1 437 ? 37.960  -48.496 -22.555 1.00 28.48  ? 437 ASP A OD2   1 
ATOM   3640 N  N     . CYS A 1 438 ? 33.575  -49.341 -19.675 1.00 29.43  ? 438 CYS A N     1 
ATOM   3641 C  CA    . CYS A 1 438 ? 32.673  -50.134 -18.842 1.00 31.50  ? 438 CYS A CA    1 
ATOM   3642 C  C     . CYS A 1 438 ? 31.650  -50.936 -19.660 1.00 31.34  ? 438 CYS A C     1 
ATOM   3643 O  O     . CYS A 1 438 ? 30.680  -51.474 -19.115 1.00 29.83  ? 438 CYS A O     1 
ATOM   3644 C  CB    . CYS A 1 438 ? 31.961  -49.229 -17.862 1.00 30.63  ? 438 CYS A CB    1 
ATOM   3645 S  SG    . CYS A 1 438 ? 31.115  -47.905 -18.656 1.00 39.22  ? 438 CYS A SG    1 
ATOM   3646 N  N     . CYS A 1 439 ? 31.865  -50.990 -20.969 1.00 32.59  ? 439 CYS A N     1 
ATOM   3647 C  CA    . CYS A 1 439 ? 31.008  -51.753 -21.858 1.00 34.95  ? 439 CYS A CA    1 
ATOM   3648 C  C     . CYS A 1 439 ? 31.892  -52.560 -22.767 1.00 35.87  ? 439 CYS A C     1 
ATOM   3649 O  O     . CYS A 1 439 ? 33.040  -52.192 -23.017 1.00 35.89  ? 439 CYS A O     1 
ATOM   3650 C  CB    . CYS A 1 439 ? 30.132  -50.843 -22.714 1.00 33.91  ? 439 CYS A CB    1 
ATOM   3651 S  SG    . CYS A 1 439 ? 28.949  -49.905 -21.778 1.00 41.70  ? 439 CYS A SG    1 
ATOM   3652 N  N     . CYS A 1 440 ? 31.339  -53.641 -23.289 1.00 37.21  ? 440 CYS A N     1 
ATOM   3653 C  CA    . CYS A 1 440 ? 32.097  -54.475 -24.173 1.00 39.67  ? 440 CYS A CA    1 
ATOM   3654 C  C     . CYS A 1 440 ? 31.307  -55.174 -25.294 1.00 40.38  ? 440 CYS A C     1 
ATOM   3655 O  O     . CYS A 1 440 ? 30.152  -55.563 -25.131 1.00 38.81  ? 440 CYS A O     1 
ATOM   3656 C  CB    . CYS A 1 440 ? 32.857  -55.489 -23.342 1.00 40.08  ? 440 CYS A CB    1 
ATOM   3657 S  SG    . CYS A 1 440 ? 33.576  -56.682 -24.280 1.00 44.44  ? 440 CYS A SG    1 
ATOM   3658 N  N     . GLN A 1 441 ? 32.011  -55.295 -26.415 1.00 42.77  ? 441 GLN A N     1 
ATOM   3659 C  CA    . GLN A 1 441 ? 31.687  -56.040 -27.642 1.00 45.92  ? 441 GLN A CA    1 
ATOM   3660 C  C     . GLN A 1 441 ? 30.986  -55.236 -28.726 1.00 45.89  ? 441 GLN A C     1 
ATOM   3661 O  O     . GLN A 1 441 ? 31.670  -54.752 -29.629 1.00 47.28  ? 441 GLN A O     1 
ATOM   3662 C  CB    . GLN A 1 441 ? 31.089  -57.414 -27.385 1.00 46.54  ? 441 GLN A CB    1 
ATOM   3663 C  CG    . GLN A 1 441 ? 32.185  -58.405 -27.071 1.00 50.13  ? 441 GLN A CG    1 
ATOM   3664 C  CD    . GLN A 1 441 ? 31.670  -59.665 -26.437 1.00 54.29  ? 441 GLN A CD    1 
ATOM   3665 O  OE1   . GLN A 1 441 ? 30.494  -60.005 -26.556 1.00 55.15  ? 441 GLN A OE1   1 
ATOM   3666 N  NE2   . GLN A 1 441 ? 32.557  -60.373 -25.749 1.00 58.04  ? 441 GLN A NE2   1 
ATOM   3667 N  N     . MET B 1 1   ? 11.553  12.458  30.054  1.00 84.03  ? 1   MET B N     1 
ATOM   3668 C  CA    . MET B 1 1   ? 12.211  11.324  29.334  1.00 84.02  ? 1   MET B CA    1 
ATOM   3669 C  C     . MET B 1 1   ? 11.735  11.264  27.880  1.00 83.39  ? 1   MET B C     1 
ATOM   3670 O  O     . MET B 1 1   ? 12.106  10.359  27.125  1.00 83.41  ? 1   MET B O     1 
ATOM   3671 C  CB    . MET B 1 1   ? 11.919  10.003  30.055  1.00 84.07  ? 1   MET B CB    1 
ATOM   3672 C  CG    . MET B 1 1   ? 13.166  9.234   30.490  1.00 84.58  ? 1   MET B CG    1 
ATOM   3673 S  SD    . MET B 1 1   ? 12.833  7.949   31.728  1.00 85.05  ? 1   MET B SD    1 
ATOM   3674 C  CE    . MET B 1 1   ? 11.962  8.865   33.009  1.00 84.56  ? 1   MET B CE    1 
ATOM   3675 N  N     . LYS B 1 2   ? 10.912  12.242  27.501  1.00 140.75 ? 2   LYS B N     1 
ATOM   3676 C  CA    . LYS B 1 2   ? 10.423  12.384  26.133  1.00 137.25 ? 2   LYS B CA    1 
ATOM   3677 C  C     . LYS B 1 2   ? 11.536  12.953  25.245  1.00 132.60 ? 2   LYS B C     1 
ATOM   3678 O  O     . LYS B 1 2   ? 12.683  13.077  25.687  1.00 131.47 ? 2   LYS B O     1 
ATOM   3679 C  CB    . LYS B 1 2   ? 9.180   13.280  26.112  1.00 141.61 ? 2   LYS B CB    1 
ATOM   3680 C  CG    . LYS B 1 2   ? 8.127   12.873  25.095  1.00 140.68 ? 2   LYS B CG    1 
ATOM   3681 C  CD    . LYS B 1 2   ? 6.782   13.495  25.432  1.00 145.92 ? 2   LYS B CD    1 
ATOM   3682 C  CE    . LYS B 1 2   ? 5.670   12.913  24.576  1.00 145.54 ? 2   LYS B CE    1 
ATOM   3683 N  NZ    . LYS B 1 2   ? 4.333   13.402  25.012  1.00 151.49 ? 2   LYS B NZ    1 
ATOM   3684 N  N     . VAL B 1 3   ? 11.195  13.299  24.005  1.00 129.91 ? 3   VAL B N     1 
ATOM   3685 C  CA    . VAL B 1 3   ? 12.186  13.660  22.979  1.00 124.95 ? 3   VAL B CA    1 
ATOM   3686 C  C     . VAL B 1 3   ? 13.114  14.814  23.386  1.00 125.21 ? 3   VAL B C     1 
ATOM   3687 O  O     . VAL B 1 3   ? 14.337  14.667  23.356  1.00 122.25 ? 3   VAL B O     1 
ATOM   3688 C  CB    . VAL B 1 3   ? 11.521  13.952  21.601  1.00 123.92 ? 3   VAL B CB    1 
ATOM   3689 C  CG1   . VAL B 1 3   ? 12.574  14.007  20.499  1.00 119.31 ? 3   VAL B CG1   1 
ATOM   3690 C  CG2   . VAL B 1 3   ? 10.472  12.889  21.267  1.00 123.90 ? 3   VAL B CG2   1 
ATOM   3691 N  N     . GLU B 1 4   ? 12.529  15.945  23.778  1.00 128.64 ? 4   GLU B N     1 
ATOM   3692 C  CA    . GLU B 1 4   ? 13.298  17.146  24.127  1.00 129.42 ? 4   GLU B CA    1 
ATOM   3693 C  C     . GLU B 1 4   ? 14.153  17.010  25.396  1.00 129.90 ? 4   GLU B C     1 
ATOM   3694 O  O     . GLU B 1 4   ? 15.127  17.748  25.574  1.00 129.94 ? 4   GLU B O     1 
ATOM   3695 C  CB    . GLU B 1 4   ? 12.377  18.371  24.220  1.00 134.61 ? 4   GLU B CB    1 
ATOM   3696 C  CG    . GLU B 1 4   ? 11.992  18.979  22.865  1.00 133.69 ? 4   GLU B CG    1 
ATOM   3697 C  CD    . GLU B 1 4   ? 13.156  19.671  22.155  1.00 131.19 ? 4   GLU B CD    1 
ATOM   3698 O  OE1   . GLU B 1 4   ? 14.110  20.110  22.834  1.00 131.83 ? 4   GLU B OE1   1 
ATOM   3699 O  OE2   . GLU B 1 4   ? 13.113  19.782  20.912  1.00 128.96 ? 4   GLU B OE2   1 
ATOM   3700 N  N     . GLU B 1 5   ? 13.783  16.072  26.269  1.00 130.15 ? 5   GLU B N     1 
ATOM   3701 C  CA    . GLU B 1 5   ? 14.586  15.748  27.451  1.00 130.40 ? 5   GLU B CA    1 
ATOM   3702 C  C     . GLU B 1 5   ? 15.826  14.946  27.064  1.00 124.67 ? 5   GLU B C     1 
ATOM   3703 O  O     . GLU B 1 5   ? 16.917  15.204  27.579  1.00 124.72 ? 5   GLU B O     1 
ATOM   3704 C  CB    . GLU B 1 5   ? 13.766  14.973  28.488  1.00 133.85 ? 5   GLU B CB    1 
ATOM   3705 C  CG    . GLU B 1 5   ? 12.877  15.839  29.379  1.00 140.18 ? 5   GLU B CG    1 
ATOM   3706 C  CD    . GLU B 1 5   ? 11.523  16.149  28.759  1.00 141.77 ? 5   GLU B CD    1 
ATOM   3707 O  OE1   . GLU B 1 5   ? 10.898  15.233  28.179  1.00 139.58 ? 5   GLU B OE1   1 
ATOM   3708 O  OE2   . GLU B 1 5   ? 11.075  17.311  28.866  1.00 145.39 ? 5   GLU B OE2   1 
ATOM   3709 N  N     . ILE B 1 6   ? 15.644  13.978  26.162  1.00 119.59 ? 6   ILE B N     1 
ATOM   3710 C  CA    . ILE B 1 6   ? 16.740  13.162  25.625  1.00 113.84 ? 6   ILE B CA    1 
ATOM   3711 C  C     . ILE B 1 6   ? 17.784  14.048  24.941  1.00 110.84 ? 6   ILE B C     1 
ATOM   3712 O  O     . ILE B 1 6   ? 18.986  13.855  25.130  1.00 109.19 ? 6   ILE B O     1 
ATOM   3713 C  CB    . ILE B 1 6   ? 16.218  12.060  24.637  1.00 110.52 ? 6   ILE B CB    1 
ATOM   3714 C  CG1   . ILE B 1 6   ? 15.363  11.006  25.368  1.00 112.52 ? 6   ILE B CG1   1 
ATOM   3715 C  CG2   . ILE B 1 6   ? 17.370  11.406  23.847  1.00 105.34 ? 6   ILE B CG2   1 
ATOM   3716 C  CD1   . ILE B 1 6   ? 16.139  9.989   26.218  1.00 112.40 ? 6   ILE B CD1   1 
ATOM   3717 N  N     . LEU B 1 7   ? 17.308  15.026  24.169  1.00 110.22 ? 7   LEU B N     1 
ATOM   3718 C  CA    . LEU B 1 7   ? 18.162  15.978  23.451  1.00 107.78 ? 7   LEU B CA    1 
ATOM   3719 C  C     . LEU B 1 7   ? 19.000  16.869  24.370  1.00 110.04 ? 7   LEU B C     1 
ATOM   3720 O  O     . LEU B 1 7   ? 20.072  17.332  23.979  1.00 108.10 ? 7   LEU B O     1 
ATOM   3721 C  CB    . LEU B 1 7   ? 17.320  16.844  22.504  1.00 108.61 ? 7   LEU B CB    1 
ATOM   3722 C  CG    . LEU B 1 7   ? 17.156  16.452  21.028  1.00 104.76 ? 7   LEU B CG    1 
ATOM   3723 C  CD1   . LEU B 1 7   ? 16.646  15.027  20.834  1.00 102.83 ? 7   LEU B CD1   1 
ATOM   3724 C  CD2   . LEU B 1 7   ? 16.250  17.445  20.311  1.00 106.80 ? 7   LEU B CD2   1 
ATOM   3725 N  N     . GLU B 1 8   ? 18.506  17.107  25.585  1.00 114.02 ? 8   GLU B N     1 
ATOM   3726 C  CA    . GLU B 1 8   ? 19.204  17.961  26.550  1.00 116.86 ? 8   GLU B CA    1 
ATOM   3727 C  C     . GLU B 1 8   ? 20.275  17.237  27.367  1.00 115.83 ? 8   GLU B C     1 
ATOM   3728 O  O     . GLU B 1 8   ? 21.303  17.828  27.713  1.00 116.61 ? 8   GLU B O     1 
ATOM   3729 C  CB    . GLU B 1 8   ? 18.216  18.683  27.467  1.00 122.76 ? 8   GLU B CB    1 
ATOM   3730 C  CG    . GLU B 1 8   ? 17.572  19.889  26.812  1.00 124.56 ? 8   GLU B CG    1 
ATOM   3731 C  CD    . GLU B 1 8   ? 17.751  21.154  27.625  1.00 129.96 ? 8   GLU B CD    1 
ATOM   3732 O  OE1   . GLU B 1 8   ? 17.076  21.299  28.667  1.00 134.37 ? 8   GLU B OE1   1 
ATOM   3733 O  OE2   . GLU B 1 8   ? 18.569  22.006  27.213  1.00 129.48 ? 8   GLU B OE2   1 
ATOM   3734 N  N     . LYS B 1 9   ? 20.029  15.962  27.669  1.00 114.08 ? 9   LYS B N     1 
ATOM   3735 C  CA    . LYS B 1 9   ? 21.031  15.097  28.299  1.00 112.69 ? 9   LYS B CA    1 
ATOM   3736 C  C     . LYS B 1 9   ? 22.131  14.753  27.288  1.00 107.11 ? 9   LYS B C     1 
ATOM   3737 O  O     . LYS B 1 9   ? 23.255  14.408  27.666  1.00 106.53 ? 9   LYS B O     1 
ATOM   3738 C  CB    . LYS B 1 9   ? 20.386  13.821  28.860  1.00 113.32 ? 9   LYS B CB    1 
ATOM   3739 C  CG    . LYS B 1 9   ? 19.177  14.074  29.765  1.00 118.38 ? 9   LYS B CG    1 
ATOM   3740 C  CD    . LYS B 1 9   ? 18.504  12.778  30.220  1.00 119.15 ? 9   LYS B CD    1 
ATOM   3741 C  CE    . LYS B 1 9   ? 18.749  12.485  31.700  1.00 123.96 ? 9   LYS B CE    1 
ATOM   3742 N  NZ    . LYS B 1 9   ? 20.156  12.103  32.002  1.00 122.92 ? 9   LYS B NZ    1 
ATOM   3743 N  N     . ALA B 1 10  ? 21.791  14.870  26.005  1.00 103.09 ? 10  ALA B N     1 
ATOM   3744 C  CA    . ALA B 1 10  ? 22.713  14.610  24.901  1.00 97.79  ? 10  ALA B CA    1 
ATOM   3745 C  C     . ALA B 1 10  ? 23.774  15.700  24.751  1.00 97.63  ? 10  ALA B C     1 
ATOM   3746 O  O     . ALA B 1 10  ? 24.878  15.435  24.270  1.00 94.74  ? 10  ALA B O     1 
ATOM   3747 C  CB    . ALA B 1 10  ? 21.937  14.448  23.606  1.00 94.85  ? 10  ALA B CB    1 
ATOM   3748 N  N     . LEU B 1 11  ? 23.432  16.919  25.166  1.00 100.87 ? 11  LEU B N     1 
ATOM   3749 C  CA    . LEU B 1 11  ? 24.328  18.067  25.051  1.00 101.45 ? 11  LEU B CA    1 
ATOM   3750 C  C     . LEU B 1 11  ? 25.608  17.897  25.865  1.00 102.05 ? 11  LEU B C     1 
ATOM   3751 O  O     . LEU B 1 11  ? 26.675  18.318  25.426  1.00 100.67 ? 11  LEU B O     1 
ATOM   3752 C  CB    . LEU B 1 11  ? 23.615  19.365  25.448  1.00 106.15 ? 11  LEU B CB    1 
ATOM   3753 C  CG    . LEU B 1 11  ? 22.417  19.834  24.612  1.00 106.17 ? 11  LEU B CG    1 
ATOM   3754 C  CD1   . LEU B 1 11  ? 21.601  20.878  25.380  1.00 112.01 ? 11  LEU B CD1   1 
ATOM   3755 C  CD2   . LEU B 1 11  ? 22.846  20.371  23.247  1.00 102.78 ? 11  LEU B CD2   1 
ATOM   3756 N  N     . GLU B 1 12  ? 25.502  17.271  27.036  1.00 104.20 ? 12  GLU B N     1 
ATOM   3757 C  CA    . GLU B 1 12  ? 26.664  17.045  27.906  1.00 105.51 ? 12  GLU B CA    1 
ATOM   3758 C  C     . GLU B 1 12  ? 27.738  16.184  27.241  1.00 100.99 ? 12  GLU B C     1 
ATOM   3759 O  O     . GLU B 1 12  ? 28.879  16.133  27.703  1.00 101.80 ? 12  GLU B O     1 
ATOM   3760 C  CB    . GLU B 1 12  ? 26.243  16.413  29.238  1.00 109.12 ? 12  GLU B CB    1 
ATOM   3761 C  CG    . GLU B 1 12  ? 25.668  17.395  30.257  1.00 115.05 ? 12  GLU B CG    1 
ATOM   3762 C  CD    . GLU B 1 12  ? 24.176  17.638  30.079  1.00 116.20 ? 12  GLU B CD    1 
ATOM   3763 O  OE1   . GLU B 1 12  ? 23.506  16.819  29.412  1.00 112.83 ? 12  GLU B OE1   1 
ATOM   3764 O  OE2   . GLU B 1 12  ? 23.670  18.647  30.615  1.00 120.08 ? 12  GLU B OE2   1 
ATOM   3765 N  N     . LEU B 1 13  ? 27.360  15.518  26.153  1.00 96.57  ? 13  LEU B N     1 
ATOM   3766 C  CA    . LEU B 1 13  ? 28.257  14.621  25.430  1.00 92.36  ? 13  LEU B CA    1 
ATOM   3767 C  C     . LEU B 1 13  ? 28.846  15.261  24.167  1.00 89.32  ? 13  LEU B C     1 
ATOM   3768 O  O     . LEU B 1 13  ? 29.904  14.840  23.695  1.00 86.94  ? 13  LEU B O     1 
ATOM   3769 C  CB    . LEU B 1 13  ? 27.530  13.315  25.080  1.00 89.82  ? 13  LEU B CB    1 
ATOM   3770 C  CG    . LEU B 1 13  ? 26.896  12.527  26.235  1.00 92.40  ? 13  LEU B CG    1 
ATOM   3771 C  CD1   . LEU B 1 13  ? 25.816  11.596  25.712  1.00 90.14  ? 13  LEU B CD1   1 
ATOM   3772 C  CD2   . LEU B 1 13  ? 27.941  11.750  27.033  1.00 93.26  ? 13  LEU B CD2   1 
ATOM   3773 N  N     . VAL B 1 14  ? 28.168  16.277  23.634  1.00 89.77  ? 14  VAL B N     1 
ATOM   3774 C  CA    . VAL B 1 14  ? 28.591  16.928  22.385  1.00 87.20  ? 14  VAL B CA    1 
ATOM   3775 C  C     . VAL B 1 14  ? 29.225  18.309  22.574  1.00 90.07  ? 14  VAL B C     1 
ATOM   3776 O  O     . VAL B 1 14  ? 30.093  18.697  21.791  1.00 88.51  ? 14  VAL B O     1 
ATOM   3777 C  CB    . VAL B 1 14  ? 27.446  16.996  21.329  1.00 85.52  ? 14  VAL B CB    1 
ATOM   3778 C  CG1   . VAL B 1 14  ? 27.031  15.593  20.894  1.00 82.03  ? 14  VAL B CG1   1 
ATOM   3779 C  CG2   . VAL B 1 14  ? 26.242  17.777  21.853  1.00 88.80  ? 14  VAL B CG2   1 
ATOM   3780 N  N     . ILE B 1 15  ? 28.797  19.042  23.604  1.00 94.47  ? 15  ILE B N     1 
ATOM   3781 C  CA    . ILE B 1 15  ? 29.329  20.382  23.872  1.00 97.90  ? 15  ILE B CA    1 
ATOM   3782 C  C     . ILE B 1 15  ? 30.639  20.328  24.676  1.00 99.35  ? 15  ILE B C     1 
ATOM   3783 O  O     . ILE B 1 15  ? 30.677  19.745  25.764  1.00 101.12 ? 15  ILE B O     1 
ATOM   3784 C  CB    . ILE B 1 15  ? 28.272  21.338  24.527  1.00 102.64 ? 15  ILE B CB    1 
ATOM   3785 C  CG1   . ILE B 1 15  ? 28.768  22.788  24.544  1.00 106.40 ? 15  ILE B CG1   1 
ATOM   3786 C  CG2   . ILE B 1 15  ? 27.915  20.912  25.948  1.00 106.00 ? 15  ILE B CG2   1 
ATOM   3787 C  CD1   . ILE B 1 15  ? 28.734  23.483  23.201  1.00 104.99 ? 15  ILE B CD1   1 
ATOM   3788 N  N     . PRO B 1 16  ? 31.725  20.905  24.117  1.00 106.08 ? 16  PRO B N     1 
ATOM   3789 C  CA    . PRO B 1 16  ? 33.024  20.956  24.785  1.00 107.23 ? 16  PRO B CA    1 
ATOM   3790 C  C     . PRO B 1 16  ? 33.008  21.851  26.021  1.00 114.26 ? 16  PRO B C     1 
ATOM   3791 O  O     . PRO B 1 16  ? 32.538  22.991  25.956  1.00 115.85 ? 16  PRO B O     1 
ATOM   3792 C  CB    . PRO B 1 16  ? 33.948  21.539  23.710  1.00 101.47 ? 16  PRO B CB    1 
ATOM   3793 C  CG    . PRO B 1 16  ? 33.060  22.276  22.790  1.00 99.41  ? 16  PRO B CG    1 
ATOM   3794 C  CD    . PRO B 1 16  ? 31.778  21.518  22.775  1.00 100.68 ? 16  PRO B CD    1 
ATOM   3795 N  N     . ASP B 1 17  ? 33.511  21.325  27.136  1.00 119.07 ? 17  ASP B N     1 
ATOM   3796 C  CA    . ASP B 1 17  ? 33.594  22.084  28.383  1.00 126.67 ? 17  ASP B CA    1 
ATOM   3797 C  C     . ASP B 1 17  ? 34.602  23.230  28.266  1.00 126.36 ? 17  ASP B C     1 
ATOM   3798 O  O     . ASP B 1 17  ? 35.573  23.139  27.510  1.00 121.14 ? 17  ASP B O     1 
ATOM   3799 C  CB    . ASP B 1 17  ? 33.904  21.166  29.576  1.00 132.13 ? 17  ASP B CB    1 
ATOM   3800 C  CG    . ASP B 1 17  ? 35.223  20.415  29.430  1.00 129.29 ? 17  ASP B CG    1 
ATOM   3801 O  OD1   . ASP B 1 17  ? 35.794  20.366  28.319  1.00 122.84 ? 17  ASP B OD1   1 
ATOM   3802 O  OD2   . ASP B 1 17  ? 35.686  19.855  30.444  1.00 134.40 ? 17  ASP B OD2   1 
ATOM   3803 N  N     . GLU B 1 18  ? 34.358  24.300  29.020  1.00 132.61 ? 18  GLU B N     1 
ATOM   3804 C  CA    . GLU B 1 18  ? 35.072  25.572  28.865  1.00 133.26 ? 18  GLU B CA    1 
ATOM   3805 C  C     . GLU B 1 18  ? 36.601  25.480  28.960  1.00 132.32 ? 18  GLU B C     1 
ATOM   3806 O  O     . GLU B 1 18  ? 37.307  26.330  28.416  1.00 130.24 ? 18  GLU B O     1 
ATOM   3807 C  CB    . GLU B 1 18  ? 34.532  26.599  29.862  1.00 141.46 ? 18  GLU B CB    1 
ATOM   3808 C  CG    . GLU B 1 18  ? 34.633  28.042  29.389  1.00 142.03 ? 18  GLU B CG    1 
ATOM   3809 C  CD    . GLU B 1 18  ? 33.745  28.985  30.183  1.00 150.37 ? 18  GLU B CD    1 
ATOM   3810 O  OE1   . GLU B 1 18  ? 34.221  30.082  30.546  1.00 154.76 ? 18  GLU B OE1   1 
ATOM   3811 O  OE2   . GLU B 1 18  ? 32.573  28.634  30.445  1.00 153.07 ? 18  GLU B OE2   1 
ATOM   3812 N  N     . GLU B 1 19  ? 37.102  24.452  29.643  1.00 134.50 ? 19  GLU B N     1 
ATOM   3813 C  CA    . GLU B 1 19  ? 38.548  24.235  29.785  1.00 134.42 ? 19  GLU B CA    1 
ATOM   3814 C  C     . GLU B 1 19  ? 39.223  23.802  28.483  1.00 126.38 ? 19  GLU B C     1 
ATOM   3815 O  O     . GLU B 1 19  ? 40.366  24.181  28.221  1.00 125.17 ? 19  GLU B O     1 
ATOM   3816 C  CB    . GLU B 1 19  ? 38.878  23.252  30.921  1.00 139.88 ? 19  GLU B CB    1 
ATOM   3817 C  CG    . GLU B 1 19  ? 37.770  22.267  31.295  1.00 141.69 ? 19  GLU B CG    1 
ATOM   3818 C  CD    . GLU B 1 19  ? 36.774  22.841  32.295  1.00 149.07 ? 19  GLU B CD    1 
ATOM   3819 O  OE1   . GLU B 1 19  ? 35.554  22.691  32.077  1.00 148.40 ? 19  GLU B OE1   1 
ATOM   3820 O  OE2   . GLU B 1 19  ? 37.210  23.446  33.298  1.00 156.32 ? 19  GLU B OE2   1 
ATOM   3821 N  N     . GLU B 1 20  ? 38.519  23.013  27.674  1.00 121.55 ? 20  GLU B N     1 
ATOM   3822 C  CA    . GLU B 1 20  ? 39.030  22.627  26.359  1.00 114.19 ? 20  GLU B CA    1 
ATOM   3823 C  C     . GLU B 1 20  ? 38.723  23.714  25.319  1.00 110.52 ? 20  GLU B C     1 
ATOM   3824 O  O     . GLU B 1 20  ? 39.410  23.822  24.302  1.00 105.54 ? 20  GLU B O     1 
ATOM   3825 C  CB    . GLU B 1 20  ? 38.525  21.231  25.950  1.00 111.11 ? 20  GLU B CB    1 
ATOM   3826 C  CG    . GLU B 1 20  ? 37.150  21.168  25.299  1.00 109.18 ? 20  GLU B CG    1 
ATOM   3827 C  CD    . GLU B 1 20  ? 37.208  20.694  23.851  1.00 102.58 ? 20  GLU B CD    1 
ATOM   3828 O  OE1   . GLU B 1 20  ? 37.231  21.551  22.940  1.00 99.40  ? 20  GLU B OE1   1 
ATOM   3829 O  OE2   . GLU B 1 20  ? 37.231  19.464  23.627  1.00 100.77 ? 20  GLU B OE2   1 
ATOM   3830 N  N     . VAL B 1 21  ? 37.697  24.519  25.600  1.00 113.78 ? 21  VAL B N     1 
ATOM   3831 C  CA    . VAL B 1 21  ? 37.382  25.722  24.820  1.00 112.38 ? 21  VAL B CA    1 
ATOM   3832 C  C     . VAL B 1 21  ? 38.495  26.765  25.003  1.00 114.54 ? 21  VAL B C     1 
ATOM   3833 O  O     . VAL B 1 21  ? 38.902  27.432  24.047  1.00 111.24 ? 21  VAL B O     1 
ATOM   3834 C  CB    . VAL B 1 21  ? 35.997  26.325  25.225  1.00 116.67 ? 21  VAL B CB    1 
ATOM   3835 C  CG1   . VAL B 1 21  ? 35.716  27.633  24.483  1.00 116.11 ? 21  VAL B CG1   1 
ATOM   3836 C  CG2   . VAL B 1 21  ? 34.871  25.321  24.978  1.00 114.84 ? 21  VAL B CG2   1 
ATOM   3837 N  N     . ARG B 1 22  ? 38.980  26.880  26.240  1.00 120.60 ? 22  ARG B N     1 
ATOM   3838 C  CA    . ARG B 1 22  ? 40.102  27.752  26.588  1.00 123.84 ? 22  ARG B CA    1 
ATOM   3839 C  C     . ARG B 1 22  ? 41.419  27.227  26.007  1.00 119.59 ? 22  ARG B C     1 
ATOM   3840 O  O     . ARG B 1 22  ? 42.251  28.006  25.536  1.00 118.90 ? 22  ARG B O     1 
ATOM   3841 C  CB    . ARG B 1 22  ? 40.198  27.887  28.112  1.00 132.11 ? 22  ARG B CB    1 
ATOM   3842 C  CG    . ARG B 1 22  ? 41.375  28.704  28.632  1.00 136.58 ? 22  ARG B CG    1 
ATOM   3843 C  CD    . ARG B 1 22  ? 41.403  28.702  30.155  1.00 145.32 ? 22  ARG B CD    1 
ATOM   3844 N  NE    . ARG B 1 22  ? 41.456  27.347  30.708  1.00 145.74 ? 22  ARG B NE    1 
ATOM   3845 C  CZ    . ARG B 1 22  ? 41.241  27.040  31.986  1.00 153.03 ? 22  ARG B CZ    1 
ATOM   3846 N  NH1   . ARG B 1 22  ? 40.953  27.988  32.870  1.00 160.53 ? 22  ARG B NH1   1 
ATOM   3847 N  NH2   . ARG B 1 22  ? 41.313  25.776  32.381  1.00 153.32 ? 22  ARG B NH2   1 
ATOM   3848 N  N     . LYS B 1 23  ? 41.592  25.905  26.048  1.00 117.31 ? 23  LYS B N     1 
ATOM   3849 C  CA    . LYS B 1 23  ? 42.750  25.222  25.462  1.00 113.34 ? 23  LYS B CA    1 
ATOM   3850 C  C     . LYS B 1 23  ? 42.934  25.611  23.990  1.00 106.96 ? 23  LYS B C     1 
ATOM   3851 O  O     . LYS B 1 23  ? 44.059  25.824  23.528  1.00 105.31 ? 23  LYS B O     1 
ATOM   3852 C  CB    . LYS B 1 23  ? 42.575  23.703  25.603  1.00 111.91 ? 23  LYS B CB    1 
ATOM   3853 C  CG    . LYS B 1 23  ? 43.726  22.846  25.081  1.00 108.63 ? 23  LYS B CG    1 
ATOM   3854 C  CD    . LYS B 1 23  ? 44.717  22.474  26.179  1.00 114.47 ? 23  LYS B CD    1 
ATOM   3855 C  CE    . LYS B 1 23  ? 45.729  21.441  25.684  1.00 111.65 ? 23  LYS B CE    1 
ATOM   3856 N  NZ    . LYS B 1 23  ? 45.097  20.143  25.300  1.00 108.08 ? 23  LYS B NZ    1 
ATOM   3857 N  N     . GLY B 1 24  ? 41.815  25.710  23.274  1.00 103.93 ? 24  GLY B N     1 
ATOM   3858 C  CA    . GLY B 1 24  ? 41.804  26.087  21.868  1.00 98.72  ? 24  GLY B CA    1 
ATOM   3859 C  C     . GLY B 1 24  ? 42.121  27.547  21.611  1.00 100.77 ? 24  GLY B C     1 
ATOM   3860 O  O     . GLY B 1 24  ? 42.863  27.862  20.683  1.00 97.84  ? 24  GLY B O     1 
ATOM   3861 N  N     . ARG B 1 25  ? 41.563  28.439  22.428  1.00 106.36 ? 25  ARG B N     1 
ATOM   3862 C  CA    . ARG B 1 25  ? 41.743  29.882  22.234  1.00 109.45 ? 25  ARG B CA    1 
ATOM   3863 C  C     . ARG B 1 25  ? 43.195  30.335  22.370  1.00 111.13 ? 25  ARG B C     1 
ATOM   3864 O  O     . ARG B 1 25  ? 43.646  31.190  21.610  1.00 110.51 ? 25  ARG B O     1 
ATOM   3865 C  CB    . ARG B 1 25  ? 40.831  30.696  23.166  1.00 115.99 ? 25  ARG B CB    1 
ATOM   3866 C  CG    . ARG B 1 25  ? 39.337  30.598  22.841  1.00 115.61 ? 25  ARG B CG    1 
ATOM   3867 C  CD    . ARG B 1 25  ? 38.986  31.246  21.501  1.00 113.49 ? 25  ARG B CD    1 
ATOM   3868 N  NE    . ARG B 1 25  ? 37.948  30.491  20.797  1.00 110.46 ? 25  ARG B NE    1 
ATOM   3869 C  CZ    . ARG B 1 25  ? 36.672  30.861  20.691  1.00 112.94 ? 25  ARG B CZ    1 
ATOM   3870 N  NH1   . ARG B 1 25  ? 36.251  31.998  21.237  1.00 119.01 ? 25  ARG B NH1   1 
ATOM   3871 N  NH2   . ARG B 1 25  ? 35.814  30.090  20.030  1.00 109.60 ? 25  ARG B NH2   1 
ATOM   3872 N  N     . GLU B 1 26  ? 43.925  29.758  23.323  1.00 113.87 ? 26  GLU B N     1 
ATOM   3873 C  CA    . GLU B 1 26  ? 45.333  30.120  23.521  1.00 116.46 ? 26  GLU B CA    1 
ATOM   3874 C  C     . GLU B 1 26  ? 46.313  29.353  22.624  1.00 111.21 ? 26  GLU B C     1 
ATOM   3875 O  O     . GLU B 1 26  ? 47.506  29.659  22.593  1.00 112.65 ? 26  GLU B O     1 
ATOM   3876 C  CB    . GLU B 1 26  ? 45.740  30.081  25.004  1.00 123.50 ? 26  GLU B CB    1 
ATOM   3877 C  CG    . GLU B 1 26  ? 45.436  28.793  25.755  1.00 123.89 ? 26  GLU B CG    1 
ATOM   3878 C  CD    . GLU B 1 26  ? 45.406  29.006  27.261  1.00 132.12 ? 26  GLU B CD    1 
ATOM   3879 O  OE1   . GLU B 1 26  ? 46.309  28.494  27.954  1.00 135.54 ? 26  GLU B OE1   1 
ATOM   3880 O  OE2   . GLU B 1 26  ? 44.488  29.699  27.751  1.00 136.07 ? 26  GLU B OE2   1 
ATOM   3881 N  N     . ALA B 1 27  ? 45.801  28.362  21.896  1.00 105.75 ? 27  ALA B N     1 
ATOM   3882 C  CA    . ALA B 1 27  ? 46.541  27.752  20.798  1.00 100.59 ? 27  ALA B CA    1 
ATOM   3883 C  C     . ALA B 1 27  ? 46.309  28.585  19.542  1.00 97.85  ? 27  ALA B C     1 
ATOM   3884 O  O     . ALA B 1 27  ? 47.215  28.754  18.723  1.00 95.94  ? 27  ALA B O     1 
ATOM   3885 C  CB    . ALA B 1 27  ? 46.098  26.326  20.584  1.00 96.51  ? 27  ALA B CB    1 
ATOM   3886 N  N     . GLU B 1 28  ? 45.087  29.107  19.411  1.00 98.36  ? 28  GLU B N     1 
ATOM   3887 C  CA    . GLU B 1 28  ? 44.728  30.076  18.373  1.00 97.57  ? 28  GLU B CA    1 
ATOM   3888 C  C     . GLU B 1 28  ? 45.438  31.415  18.610  1.00 102.62 ? 28  GLU B C     1 
ATOM   3889 O  O     . GLU B 1 28  ? 45.696  32.166  17.667  1.00 102.19 ? 28  GLU B O     1 
ATOM   3890 C  CB    . GLU B 1 28  ? 43.209  30.295  18.349  1.00 97.95  ? 28  GLU B CB    1 
ATOM   3891 C  CG    . GLU B 1 28  ? 42.705  31.099  17.147  1.00 96.77  ? 28  GLU B CG    1 
ATOM   3892 C  CD    . GLU B 1 28  ? 41.391  31.833  17.401  1.00 99.79  ? 28  GLU B CD    1 
ATOM   3893 O  OE1   . GLU B 1 28  ? 40.665  31.497  18.362  1.00 102.10 ? 28  GLU B OE1   1 
ATOM   3894 O  OE2   . GLU B 1 28  ? 41.078  32.752  16.618  1.00 100.28 ? 28  GLU B OE2   1 
ATOM   3895 N  N     . GLU B 1 29  ? 45.733  31.708  19.875  1.00 108.05 ? 29  GLU B N     1 
ATOM   3896 C  CA    . GLU B 1 29  ? 46.505  32.886  20.249  1.00 113.71 ? 29  GLU B CA    1 
ATOM   3897 C  C     . GLU B 1 29  ? 47.927  32.730  19.724  1.00 112.33 ? 29  GLU B C     1 
ATOM   3898 O  O     . GLU B 1 29  ? 48.480  33.653  19.126  1.00 113.88 ? 29  GLU B O     1 
ATOM   3899 C  CB    . GLU B 1 29  ? 46.528  33.043  21.771  1.00 119.92 ? 29  GLU B CB    1 
ATOM   3900 C  CG    . GLU B 1 29  ? 46.877  34.434  22.260  1.00 127.20 ? 29  GLU B CG    1 
ATOM   3901 C  CD    . GLU B 1 29  ? 45.654  35.300  22.529  1.00 130.90 ? 29  GLU B CD    1 
ATOM   3902 O  OE1   . GLU B 1 29  ? 45.836  36.447  22.992  1.00 136.56 ? 29  GLU B OE1   1 
ATOM   3903 O  OE2   . GLU B 1 29  ? 44.517  34.837  22.286  1.00 127.65 ? 29  GLU B OE2   1 
ATOM   3904 N  N     . GLU B 1 30  ? 48.494  31.544  19.941  1.00 109.94 ? 30  GLU B N     1 
ATOM   3905 C  CA    . GLU B 1 30  ? 49.872  31.236  19.569  1.00 109.19 ? 30  GLU B CA    1 
ATOM   3906 C  C     . GLU B 1 30  ? 50.036  31.048  18.056  1.00 103.78 ? 30  GLU B C     1 
ATOM   3907 O  O     . GLU B 1 30  ? 51.117  31.279  17.509  1.00 103.96 ? 30  GLU B O     1 
ATOM   3908 C  CB    . GLU B 1 30  ? 50.345  29.992  20.330  1.00 109.08 ? 30  GLU B CB    1 
ATOM   3909 C  CG    . GLU B 1 30  ? 51.854  29.822  20.405  1.00 111.19 ? 30  GLU B CG    1 
ATOM   3910 C  CD    . GLU B 1 30  ? 52.561  31.059  20.926  1.00 118.25 ? 30  GLU B CD    1 
ATOM   3911 O  OE1   . GLU B 1 30  ? 52.176  31.575  22.001  1.00 123.63 ? 30  GLU B OE1   1 
ATOM   3912 O  OE2   . GLU B 1 30  ? 53.508  31.516  20.254  1.00 118.99 ? 30  GLU B OE2   1 
ATOM   3913 N  N     . LEU B 1 31  ? 48.956  30.627  17.397  1.00 99.49  ? 31  LEU B N     1 
ATOM   3914 C  CA    . LEU B 1 31  ? 48.909  30.492  15.940  1.00 94.97  ? 31  LEU B CA    1 
ATOM   3915 C  C     . LEU B 1 31  ? 48.920  31.841  15.228  1.00 96.97  ? 31  LEU B C     1 
ATOM   3916 O  O     . LEU B 1 31  ? 49.650  32.026  14.251  1.00 95.70  ? 31  LEU B O     1 
ATOM   3917 C  CB    . LEU B 1 31  ? 47.665  29.701  15.520  1.00 90.70  ? 31  LEU B CB    1 
ATOM   3918 C  CG    . LEU B 1 31  ? 47.760  28.240  15.077  1.00 86.59  ? 31  LEU B CG    1 
ATOM   3919 C  CD1   . LEU B 1 31  ? 49.006  27.538  15.589  1.00 88.28  ? 31  LEU B CD1   1 
ATOM   3920 C  CD2   . LEU B 1 31  ? 46.499  27.497  15.501  1.00 86.02  ? 31  LEU B CD2   1 
ATOM   3921 N  N     . ARG B 1 32  ? 48.102  32.771  15.721  1.00 100.70 ? 32  ARG B N     1 
ATOM   3922 C  CA    . ARG B 1 32  ? 47.977  34.102  15.135  1.00 103.67 ? 32  ARG B CA    1 
ATOM   3923 C  C     . ARG B 1 32  ? 49.227  34.952  15.367  1.00 108.08 ? 32  ARG B C     1 
ATOM   3924 O  O     . ARG B 1 32  ? 49.469  35.904  14.628  1.00 110.20 ? 32  ARG B O     1 
ATOM   3925 C  CB    . ARG B 1 32  ? 46.730  34.830  15.661  1.00 107.30 ? 32  ARG B CB    1 
ATOM   3926 C  CG    . ARG B 1 32  ? 45.384  34.308  15.101  1.00 104.67 ? 32  ARG B CG    1 
ATOM   3927 C  CD    . ARG B 1 32  ? 44.411  35.526  14.885  1.00 110.81 ? 32  ARG B CD    1 
ATOM   3928 N  NE    . ARG B 1 32  ? 43.035  35.165  15.292  1.00 112.02 ? 32  ARG B NE    1 
ATOM   3929 C  CZ    . ARG B 1 32  ? 42.006  34.874  14.440  1.00 110.24 ? 32  ARG B CZ    1 
ATOM   3930 N  NH1   . ARG B 1 32  ? 40.795  34.566  14.919  1.00 111.30 ? 32  ARG B NH1   1 
ATOM   3931 N  NH2   . ARG B 1 32  ? 42.183  34.885  13.111  1.00 107.63 ? 32  ARG B NH2   1 
ATOM   3932 N  N     . ARG B 1 33  ? 50.007  34.609  16.393  1.00 109.83 ? 33  ARG B N     1 
ATOM   3933 C  CA    . ARG B 1 33  ? 51.271  35.294  16.680  1.00 114.10 ? 33  ARG B CA    1 
ATOM   3934 C  C     . ARG B 1 33  ? 52.350  34.834  15.704  1.00 110.79 ? 33  ARG B C     1 
ATOM   3935 O  O     . ARG B 1 33  ? 53.059  35.653  15.118  1.00 113.17 ? 33  ARG B O     1 
ATOM   3936 C  CB    . ARG B 1 33  ? 51.723  35.041  18.126  1.00 118.08 ? 33  ARG B CB    1 
ATOM   3937 C  CG    . ARG B 1 33  ? 50.875  35.732  19.183  1.00 123.17 ? 33  ARG B CG    1 
ATOM   3938 C  CD    . ARG B 1 33  ? 51.045  35.094  20.560  1.00 125.78 ? 33  ARG B CD    1 
ATOM   3939 N  NE    . ARG B 1 33  ? 50.054  35.595  21.517  1.00 130.16 ? 33  ARG B NE    1 
ATOM   3940 C  CZ    . ARG B 1 33  ? 50.284  36.539  22.431  1.00 137.68 ? 33  ARG B CZ    1 
ATOM   3941 N  NH1   . ARG B 1 33  ? 51.483  37.099  22.539  1.00 141.60 ? 33  ARG B NH1   1 
ATOM   3942 N  NH2   . ARG B 1 33  ? 49.311  36.923  23.249  1.00 141.40 ? 33  ARG B NH2   1 
ATOM   3943 N  N     . ARG B 1 34  ? 52.451  33.518  15.528  1.00 105.37 ? 34  ARG B N     1 
ATOM   3944 C  CA    . ARG B 1 34  ? 53.458  32.905  14.658  1.00 102.38 ? 34  ARG B CA    1 
ATOM   3945 C  C     . ARG B 1 34  ? 53.228  33.206  13.175  1.00 99.45  ? 34  ARG B C     1 
ATOM   3946 O  O     . ARG B 1 34  ? 54.180  33.494  12.448  1.00 100.36 ? 34  ARG B O     1 
ATOM   3947 C  CB    . ARG B 1 34  ? 53.531  31.395  14.900  1.00 98.32  ? 34  ARG B CB    1 
ATOM   3948 C  CG    . ARG B 1 34  ? 54.131  31.018  16.245  1.00 101.97 ? 34  ARG B CG    1 
ATOM   3949 C  CD    . ARG B 1 34  ? 54.042  29.526  16.498  1.00 98.00  ? 34  ARG B CD    1 
ATOM   3950 N  NE    . ARG B 1 34  ? 54.320  29.194  17.894  1.00 102.25 ? 34  ARG B NE    1 
ATOM   3951 C  CZ    . ARG B 1 34  ? 54.477  27.958  18.363  1.00 101.21 ? 34  ARG B CZ    1 
ATOM   3952 N  NH1   . ARG B 1 34  ? 54.390  26.911  17.551  1.00 96.34  ? 34  ARG B NH1   1 
ATOM   3953 N  NH2   . ARG B 1 34  ? 54.727  27.769  19.652  1.00 106.07 ? 34  ARG B NH2   1 
ATOM   3954 N  N     . LEU B 1 35  ? 51.970  33.134  12.737  1.00 96.35  ? 35  LEU B N     1 
ATOM   3955 C  CA    . LEU B 1 35  ? 51.588  33.521  11.375  1.00 94.56  ? 35  LEU B CA    1 
ATOM   3956 C  C     . LEU B 1 35  ? 51.668  35.038  11.153  1.00 100.08 ? 35  LEU B C     1 
ATOM   3957 O  O     . LEU B 1 35  ? 52.103  35.486  10.092  1.00 100.73 ? 35  LEU B O     1 
ATOM   3958 C  CB    . LEU B 1 35  ? 50.193  32.997  11.030  1.00 90.40  ? 35  LEU B CB    1 
ATOM   3959 C  CG    . LEU B 1 35  ? 50.060  31.490  10.765  1.00 84.49  ? 35  LEU B CG    1 
ATOM   3960 C  CD1   . LEU B 1 35  ? 48.669  31.021  11.121  1.00 82.25  ? 35  LEU B CD1   1 
ATOM   3961 C  CD2   . LEU B 1 35  ? 50.403  31.133  9.320   1.00 80.37  ? 35  LEU B CD2   1 
ATOM   3962 N  N     . ASP B 1 36  ? 51.251  35.821  12.151  1.00 104.63 ? 36  ASP B N     1 
ATOM   3963 C  CA    . ASP B 1 36  ? 51.452  37.275  12.131  1.00 111.11 ? 36  ASP B CA    1 
ATOM   3964 C  C     . ASP B 1 36  ? 52.901  37.625  12.474  1.00 115.37 ? 36  ASP B C     1 
ATOM   3965 O  O     . ASP B 1 36  ? 53.168  38.454  13.347  1.00 121.12 ? 36  ASP B O     1 
ATOM   3966 C  CB    . ASP B 1 36  ? 50.497  37.985  13.101  1.00 114.95 ? 36  ASP B CB    1 
ATOM   3967 C  CG    . ASP B 1 36  ? 49.137  38.281  12.491  1.00 113.84 ? 36  ASP B CG    1 
ATOM   3968 O  OD1   . ASP B 1 36  ? 48.918  37.975  11.299  1.00 110.45 ? 36  ASP B OD1   1 
ATOM   3969 O  OD2   . ASP B 1 36  ? 48.281  38.830  13.217  1.00 116.79 ? 36  ASP B OD2   1 
ATOM   3970 N  N     . GLU B 1 37  ? 53.831  36.979  11.782  1.00 113.03 ? 37  GLU B N     1 
ATOM   3971 C  CA    . GLU B 1 37  ? 55.254  37.190  12.003  1.00 116.94 ? 37  GLU B CA    1 
ATOM   3972 C  C     . GLU B 1 37  ? 56.004  36.992  10.690  1.00 115.50 ? 37  GLU B C     1 
ATOM   3973 O  O     . GLU B 1 37  ? 56.989  37.686  10.421  1.00 120.13 ? 37  GLU B O     1 
ATOM   3974 C  CB    . GLU B 1 37  ? 55.774  36.231  13.075  1.00 116.08 ? 37  GLU B CB    1 
ATOM   3975 C  CG    . GLU B 1 37  ? 57.090  36.643  13.711  1.00 121.56 ? 37  GLU B CG    1 
ATOM   3976 C  CD    . GLU B 1 37  ? 57.408  35.851  14.966  1.00 121.98 ? 37  GLU B CD    1 
ATOM   3977 O  OE1   . GLU B 1 37  ? 57.137  34.632  14.996  1.00 116.99 ? 37  GLU B OE1   1 
ATOM   3978 O  OE2   . GLU B 1 37  ? 57.932  36.449  15.927  1.00 128.24 ? 37  GLU B OE2   1 
ATOM   3979 N  N     . LEU B 1 38  ? 55.529  36.046  9.879   1.00 109.68 ? 38  LEU B N     1 
ATOM   3980 C  CA    . LEU B 1 38  ? 56.046  35.855  8.522   1.00 108.36 ? 38  LEU B CA    1 
ATOM   3981 C  C     . LEU B 1 38  ? 55.217  36.654  7.509   1.00 109.23 ? 38  LEU B C     1 
ATOM   3982 O  O     . LEU B 1 38  ? 55.383  36.498  6.295   1.00 108.06 ? 38  LEU B O     1 
ATOM   3983 C  CB    . LEU B 1 38  ? 56.046  34.369  8.117   1.00 102.16 ? 38  LEU B CB    1 
ATOM   3984 C  CG    . LEU B 1 38  ? 56.536  33.173  8.954   1.00 100.04 ? 38  LEU B CG    1 
ATOM   3985 C  CD1   . LEU B 1 38  ? 57.694  33.498  9.898   1.00 104.99 ? 38  LEU B CD1   1 
ATOM   3986 C  CD2   . LEU B 1 38  ? 55.378  32.548  9.718   1.00 96.95  ? 38  LEU B CD2   1 
ATOM   3987 N  N     . GLY B 1 39  ? 54.331  37.512  8.012   1.00 111.83 ? 39  GLY B N     1 
ATOM   3988 C  CA    . GLY B 1 39  ? 53.323  38.153  7.179   1.00 112.65 ? 39  GLY B CA    1 
ATOM   3989 C  C     . GLY B 1 39  ? 52.207  37.157  6.938   1.00 106.86 ? 39  GLY B C     1 
ATOM   3990 O  O     . GLY B 1 39  ? 51.282  37.047  7.752   1.00 106.01 ? 39  GLY B O     1 
ATOM   3991 N  N     . VAL B 1 40  ? 52.321  36.417  5.832   1.00 103.18 ? 40  VAL B N     1 
ATOM   3992 C  CA    . VAL B 1 40  ? 51.386  35.342  5.441   1.00 97.28  ? 40  VAL B CA    1 
ATOM   3993 C  C     . VAL B 1 40  ? 49.909  35.756  5.452   1.00 97.53  ? 40  VAL B C     1 
ATOM   3994 O  O     . VAL B 1 40  ? 49.369  36.150  6.489   1.00 99.11  ? 40  VAL B O     1 
ATOM   3995 C  CB    . VAL B 1 40  ? 51.585  34.035  6.289   1.00 92.77  ? 40  VAL B CB    1 
ATOM   3996 C  CG1   . VAL B 1 40  ? 50.551  32.982  5.922   1.00 87.64  ? 40  VAL B CG1   1 
ATOM   3997 C  CG2   . VAL B 1 40  ? 52.980  33.473  6.104   1.00 92.39  ? 40  VAL B CG2   1 
ATOM   3998 N  N     . GLU B 1 41  ? 49.261  35.656  4.294   1.00 96.45  ? 41  GLU B N     1 
ATOM   3999 C  CA    . GLU B 1 41  ? 47.806  35.766  4.225   1.00 96.06  ? 41  GLU B CA    1 
ATOM   4000 C  C     . GLU B 1 41  ? 47.193  34.420  4.620   1.00 90.28  ? 41  GLU B C     1 
ATOM   4001 O  O     . GLU B 1 41  ? 47.473  33.388  3.998   1.00 86.38  ? 41  GLU B O     1 
ATOM   4002 C  CB    . GLU B 1 41  ? 47.350  36.194  2.829   1.00 97.87  ? 41  GLU B CB    1 
ATOM   4003 C  CG    . GLU B 1 41  ? 45.893  36.641  2.767   1.00 99.93  ? 41  GLU B CG    1 
ATOM   4004 C  CD    . GLU B 1 41  ? 45.515  37.292  1.445   1.00 103.82 ? 41  GLU B CD    1 
ATOM   4005 O  OE1   . GLU B 1 41  ? 46.379  37.400  0.548   1.00 105.39 ? 41  GLU B OE1   1 
ATOM   4006 O  OE2   . GLU B 1 41  ? 44.343  37.699  1.303   1.00 106.64 ? 41  GLU B OE2   1 
ATOM   4007 N  N     . TYR B 1 42  ? 46.374  34.435  5.668   1.00 90.24  ? 42  TYR B N     1 
ATOM   4008 C  CA    . TYR B 1 42  ? 45.781  33.208  6.202   1.00 85.83  ? 42  TYR B CA    1 
ATOM   4009 C  C     . TYR B 1 42  ? 44.394  33.468  6.772   1.00 86.84  ? 42  TYR B C     1 
ATOM   4010 O  O     . TYR B 1 42  ? 44.135  34.550  7.281   1.00 91.41  ? 42  TYR B O     1 
ATOM   4011 C  CB    . TYR B 1 42  ? 46.683  32.608  7.287   1.00 84.43  ? 42  TYR B CB    1 
ATOM   4012 C  CG    . TYR B 1 42  ? 46.729  33.412  8.573   1.00 88.72  ? 42  TYR B CG    1 
ATOM   4013 C  CD1   . TYR B 1 42  ? 45.897  33.090  9.643   1.00 88.62  ? 42  TYR B CD1   1 
ATOM   4014 C  CD2   . TYR B 1 42  ? 47.604  34.487  8.719   1.00 93.16  ? 42  TYR B CD2   1 
ATOM   4015 C  CE1   . TYR B 1 42  ? 45.931  33.811  10.820  1.00 92.08  ? 42  TYR B CE1   1 
ATOM   4016 C  CE2   . TYR B 1 42  ? 47.643  35.226  9.901   1.00 97.80  ? 42  TYR B CE2   1 
ATOM   4017 C  CZ    . TYR B 1 42  ? 46.803  34.876  10.947  1.00 97.27  ? 42  TYR B CZ    1 
ATOM   4018 O  OH    . TYR B 1 42  ? 46.824  35.581  12.123  1.00 101.64 ? 42  TYR B OH    1 
ATOM   4019 N  N     . VAL B 1 43  ? 43.512  32.475  6.700   1.00 83.14  ? 43  VAL B N     1 
ATOM   4020 C  CA    . VAL B 1 43  ? 42.188  32.620  7.306   1.00 84.18  ? 43  VAL B CA    1 
ATOM   4021 C  C     . VAL B 1 43  ? 41.732  31.362  8.052   1.00 80.16  ? 43  VAL B C     1 
ATOM   4022 O  O     . VAL B 1 43  ? 41.741  30.250  7.505   1.00 76.27  ? 43  VAL B O     1 
ATOM   4023 C  CB    . VAL B 1 43  ? 41.117  33.136  6.287   1.00 86.19  ? 43  VAL B CB    1 
ATOM   4024 C  CG1   . VAL B 1 43  ? 40.693  32.039  5.306   1.00 82.32  ? 43  VAL B CG1   1 
ATOM   4025 C  CG2   . VAL B 1 43  ? 39.906  33.735  7.018   1.00 89.61  ? 43  VAL B CG2   1 
ATOM   4026 N  N     . PHE B 1 44  ? 41.360  31.554  9.317   1.00 81.68  ? 44  PHE B N     1 
ATOM   4027 C  CA    . PHE B 1 44  ? 40.807  30.483  10.139  1.00 79.12  ? 44  PHE B CA    1 
ATOM   4028 C  C     . PHE B 1 44  ? 39.457  30.072  9.589   1.00 77.92  ? 44  PHE B C     1 
ATOM   4029 O  O     . PHE B 1 44  ? 38.558  30.909  9.442   1.00 80.99  ? 44  PHE B O     1 
ATOM   4030 C  CB    . PHE B 1 44  ? 40.679  30.923  11.598  1.00 82.44  ? 44  PHE B CB    1 
ATOM   4031 C  CG    . PHE B 1 44  ? 41.950  30.789  12.382  1.00 82.69  ? 44  PHE B CG    1 
ATOM   4032 C  CD1   . PHE B 1 44  ? 42.959  31.741  12.267  1.00 84.73  ? 44  PHE B CD1   1 
ATOM   4033 C  CD2   . PHE B 1 44  ? 42.147  29.702  13.229  1.00 81.32  ? 44  PHE B CD2   1 
ATOM   4034 C  CE1   . PHE B 1 44  ? 44.143  31.616  12.988  1.00 85.71  ? 44  PHE B CE1   1 
ATOM   4035 C  CE2   . PHE B 1 44  ? 43.329  29.572  13.959  1.00 82.24  ? 44  PHE B CE2   1 
ATOM   4036 C  CZ    . PHE B 1 44  ? 44.327  30.531  13.836  1.00 84.58  ? 44  PHE B CZ    1 
ATOM   4037 N  N     . VAL B 1 45  ? 39.341  28.784  9.270   1.00 73.43  ? 45  VAL B N     1 
ATOM   4038 C  CA    . VAL B 1 45  ? 38.110  28.193  8.738   1.00 72.28  ? 45  VAL B CA    1 
ATOM   4039 C  C     . VAL B 1 45  ? 37.725  26.930  9.519   1.00 69.90  ? 45  VAL B C     1 
ATOM   4040 O  O     . VAL B 1 45  ? 38.248  26.680  10.609  1.00 69.96  ? 45  VAL B O     1 
ATOM   4041 C  CB    . VAL B 1 45  ? 38.213  27.868  7.208   1.00 70.16  ? 45  VAL B CB    1 
ATOM   4042 C  CG1   . VAL B 1 45  ? 38.308  29.147  6.380   1.00 73.27  ? 45  VAL B CG1   1 
ATOM   4043 C  CG2   . VAL B 1 45  ? 39.382  26.939  6.918   1.00 66.37  ? 45  VAL B CG2   1 
ATOM   4044 N  N     . GLY B 1 46  ? 36.809  26.145  8.956   1.00 68.45  ? 46  GLY B N     1 
ATOM   4045 C  CA    . GLY B 1 46  ? 36.346  24.909  9.578   1.00 66.64  ? 46  GLY B CA    1 
ATOM   4046 C  C     . GLY B 1 46  ? 35.486  25.110  10.812  1.00 69.90  ? 46  GLY B C     1 
ATOM   4047 O  O     . GLY B 1 46  ? 35.014  26.226  11.095  1.00 73.16  ? 46  GLY B O     1 
ATOM   4048 N  N     . SER B 1 47  ? 35.317  24.024  11.561  1.00 69.21  ? 47  SER B N     1 
ATOM   4049 C  CA    . SER B 1 47  ? 34.401  23.961  12.694  1.00 72.39  ? 47  SER B CA    1 
ATOM   4050 C  C     . SER B 1 47  ? 34.850  24.774  13.903  1.00 75.81  ? 47  SER B C     1 
ATOM   4051 O  O     . SER B 1 47  ? 34.010  25.359  14.592  1.00 79.63  ? 47  SER B O     1 
ATOM   4052 C  CB    . SER B 1 47  ? 34.163  22.505  13.096  1.00 71.31  ? 47  SER B CB    1 
ATOM   4053 O  OG    . SER B 1 47  ? 35.368  21.894  13.517  1.00 69.40  ? 47  SER B OG    1 
ATOM   4054 N  N     . TYR B 1 48  ? 36.157  24.816  14.168  1.00 74.80  ? 48  TYR B N     1 
ATOM   4055 C  CA    . TYR B 1 48  ? 36.674  25.660  15.249  1.00 78.52  ? 48  TYR B CA    1 
ATOM   4056 C  C     . TYR B 1 48  ? 36.290  27.122  15.028  1.00 81.66  ? 48  TYR B C     1 
ATOM   4057 O  O     . TYR B 1 48  ? 35.891  27.819  15.964  1.00 85.83  ? 48  TYR B O     1 
ATOM   4058 C  CB    . TYR B 1 48  ? 38.196  25.539  15.412  1.00 77.27  ? 48  TYR B CB    1 
ATOM   4059 C  CG    . TYR B 1 48  ? 38.739  26.490  16.459  1.00 81.75  ? 48  TYR B CG    1 
ATOM   4060 C  CD1   . TYR B 1 48  ? 38.557  26.235  17.820  1.00 85.94  ? 48  TYR B CD1   1 
ATOM   4061 C  CD2   . TYR B 1 48  ? 39.396  27.666  16.093  1.00 82.49  ? 48  TYR B CD2   1 
ATOM   4062 C  CE1   . TYR B 1 48  ? 39.030  27.116  18.792  1.00 89.43  ? 48  TYR B CE1   1 
ATOM   4063 C  CE2   . TYR B 1 48  ? 39.874  28.549  17.057  1.00 87.03  ? 48  TYR B CE2   1 
ATOM   4064 C  CZ    . TYR B 1 48  ? 39.688  28.266  18.403  1.00 90.68  ? 48  TYR B CZ    1 
ATOM   4065 O  OH    . TYR B 1 48  ? 40.155  29.134  19.364  1.00 95.82  ? 48  TYR B OH    1 
ATOM   4066 N  N     . ALA B 1 49  ? 36.401  27.560  13.777  1.00 79.94  ? 49  ALA B N     1 
ATOM   4067 C  CA    . ALA B 1 49  ? 36.119  28.936  13.394  1.00 83.24  ? 49  ALA B CA    1 
ATOM   4068 C  C     . ALA B 1 49  ? 34.621  29.265  13.351  1.00 86.34  ? 49  ALA B C     1 
ATOM   4069 O  O     . ALA B 1 49  ? 34.244  30.439  13.321  1.00 90.08  ? 49  ALA B O     1 
ATOM   4070 C  CB    . ALA B 1 49  ? 36.786  29.253  12.065  1.00 80.89  ? 49  ALA B CB    1 
ATOM   4071 N  N     . ARG B 1 50  ? 33.777  28.234  13.343  1.00 84.96  ? 50  ARG B N     1 
ATOM   4072 C  CA    . ARG B 1 50  ? 32.323  28.421  13.422  1.00 88.30  ? 50  ARG B CA    1 
ATOM   4073 C  C     . ARG B 1 50  ? 31.787  28.084  14.817  1.00 91.47  ? 50  ARG B C     1 
ATOM   4074 O  O     . ARG B 1 50  ? 30.621  28.348  15.119  1.00 95.32  ? 50  ARG B O     1 
ATOM   4075 C  CB    . ARG B 1 50  ? 31.601  27.570  12.371  1.00 85.42  ? 50  ARG B CB    1 
ATOM   4076 C  CG    . ARG B 1 50  ? 31.942  27.886  10.924  1.00 83.14  ? 50  ARG B CG    1 
ATOM   4077 C  CD    . ARG B 1 50  ? 31.811  26.614  10.100  1.00 79.57  ? 50  ARG B CD    1 
ATOM   4078 N  NE    . ARG B 1 50  ? 32.465  26.664  8.792   1.00 76.79  ? 50  ARG B NE    1 
ATOM   4079 C  CZ    . ARG B 1 50  ? 32.667  25.593  8.022   1.00 74.91  ? 50  ARG B CZ    1 
ATOM   4080 N  NH1   . ARG B 1 50  ? 32.283  24.389  8.428   1.00 71.64  ? 50  ARG B NH1   1 
ATOM   4081 N  NH2   . ARG B 1 50  ? 33.263  25.720  6.842   1.00 74.56  ? 50  ARG B NH2   1 
ATOM   4082 N  N     . ASN B 1 51  ? 32.653  27.520  15.661  1.00 90.67  ? 51  ASN B N     1 
ATOM   4083 C  CA    . ASN B 1 51  ? 32.280  26.975  16.973  1.00 93.74  ? 51  ASN B CA    1 
ATOM   4084 C  C     . ASN B 1 51  ? 31.264  25.833  16.831  1.00 92.93  ? 51  ASN B C     1 
ATOM   4085 O  O     . ASN B 1 51  ? 30.176  25.890  17.403  1.00 96.70  ? 51  ASN B O     1 
ATOM   4086 C  CB    . ASN B 1 51  ? 31.773  28.089  17.913  1.00 100.27 ? 51  ASN B CB    1 
ATOM   4087 C  CG    . ASN B 1 51  ? 31.637  27.632  19.367  1.00 104.16 ? 51  ASN B CG    1 
ATOM   4088 O  OD1   . ASN B 1 51  ? 32.537  27.001  19.927  1.00 103.56 ? 51  ASN B OD1   1 
ATOM   4089 N  ND2   . ASN B 1 51  ? 30.510  27.971  19.988  1.00 109.17 ? 51  ASN B ND2   1 
ATOM   4090 N  N     . THR B 1 52  ? 31.623  24.802  16.055  1.00 88.28  ? 52  THR B N     1 
ATOM   4091 C  CA    . THR B 1 52  ? 30.718  23.663  15.809  1.00 87.63  ? 52  THR B CA    1 
ATOM   4092 C  C     . THR B 1 52  ? 31.350  22.271  15.977  1.00 84.72  ? 52  THR B C     1 
ATOM   4093 O  O     . THR B 1 52  ? 30.759  21.270  15.573  1.00 83.53  ? 52  THR B O     1 
ATOM   4094 C  CB    . THR B 1 52  ? 30.047  23.723  14.404  1.00 85.91  ? 52  THR B CB    1 
ATOM   4095 O  OG1   . THR B 1 52  ? 31.048  23.692  13.379  1.00 81.92  ? 52  THR B OG1   1 
ATOM   4096 C  CG2   . THR B 1 52  ? 29.181  24.961  14.246  1.00 90.04  ? 52  THR B CG2   1 
ATOM   4097 N  N     . TRP B 1 53  ? 32.538  22.207  16.572  1.00 84.09  ? 53  TRP B N     1 
ATOM   4098 C  CA    . TRP B 1 53  ? 33.215  20.930  16.800  1.00 82.17  ? 53  TRP B CA    1 
ATOM   4099 C  C     . TRP B 1 53  ? 32.655  20.199  18.027  1.00 85.97  ? 53  TRP B C     1 
ATOM   4100 O  O     . TRP B 1 53  ? 32.024  20.812  18.888  1.00 90.27  ? 53  TRP B O     1 
ATOM   4101 C  CB    . TRP B 1 53  ? 34.729  21.138  16.936  1.00 80.66  ? 53  TRP B CB    1 
ATOM   4102 C  CG    . TRP B 1 53  ? 35.164  21.608  18.297  1.00 84.93  ? 53  TRP B CG    1 
ATOM   4103 C  CD1   . TRP B 1 53  ? 35.537  20.826  19.354  1.00 87.41  ? 53  TRP B CD1   1 
ATOM   4104 C  CD2   . TRP B 1 53  ? 35.270  22.963  18.747  1.00 87.75  ? 53  TRP B CD2   1 
ATOM   4105 N  NE1   . TRP B 1 53  ? 35.865  21.607  20.434  1.00 91.58  ? 53  TRP B NE1   1 
ATOM   4106 C  CE2   . TRP B 1 53  ? 35.715  22.925  20.088  1.00 91.95  ? 53  TRP B CE2   1 
ATOM   4107 C  CE3   . TRP B 1 53  ? 35.035  24.207  18.148  1.00 88.02  ? 53  TRP B CE3   1 
ATOM   4108 C  CZ2   . TRP B 1 53  ? 35.932  24.081  20.840  1.00 95.87  ? 53  TRP B CZ2   1 
ATOM   4109 C  CZ3   . TRP B 1 53  ? 35.253  25.358  18.896  1.00 92.28  ? 53  TRP B CZ3   1 
ATOM   4110 C  CH2   . TRP B 1 53  ? 35.697  25.286  20.228  1.00 96.24  ? 53  TRP B CH2   1 
ATOM   4111 N  N     . LEU B 1 54  ? 32.904  18.892  18.103  1.00 84.76  ? 54  LEU B N     1 
ATOM   4112 C  CA    . LEU B 1 54  ? 32.428  18.062  19.213  1.00 88.69  ? 54  LEU B CA    1 
ATOM   4113 C  C     . LEU B 1 54  ? 33.367  18.095  20.407  1.00 91.31  ? 54  LEU B C     1 
ATOM   4114 O  O     . LEU B 1 54  ? 34.574  18.281  20.250  1.00 89.19  ? 54  LEU B O     1 
ATOM   4115 C  CB    . LEU B 1 54  ? 32.278  16.600  18.773  1.00 87.23  ? 54  LEU B CB    1 
ATOM   4116 C  CG    . LEU B 1 54  ? 31.189  16.123  17.807  1.00 86.27  ? 54  LEU B CG    1 
ATOM   4117 C  CD1   . LEU B 1 54  ? 29.784  16.364  18.352  1.00 90.16  ? 54  LEU B CD1   1 
ATOM   4118 C  CD2   . LEU B 1 54  ? 31.376  16.749  16.433  1.00 82.13  ? 54  LEU B CD2   1 
ATOM   4119 N  N     . LYS B 1 55  ? 32.803  17.887  21.595  1.00 96.39  ? 55  LYS B N     1 
ATOM   4120 C  CA    . LYS B 1 55  ? 33.581  17.710  22.818  1.00 100.07 ? 55  LYS B CA    1 
ATOM   4121 C  C     . LYS B 1 55  ? 34.680  16.666  22.609  1.00 97.53  ? 55  LYS B C     1 
ATOM   4122 O  O     . LYS B 1 55  ? 34.411  15.560  22.136  1.00 95.93  ? 55  LYS B O     1 
ATOM   4123 C  CB    . LYS B 1 55  ? 32.663  17.282  23.967  1.00 106.32 ? 55  LYS B CB    1 
ATOM   4124 C  CG    . LYS B 1 55  ? 33.349  17.160  25.320  1.00 111.69 ? 55  LYS B CG    1 
ATOM   4125 C  CD    . LYS B 1 55  ? 32.400  16.589  26.364  1.00 118.41 ? 55  LYS B CD    1 
ATOM   4126 C  CE    . LYS B 1 55  ? 33.041  16.548  27.744  1.00 124.80 ? 55  LYS B CE    1 
ATOM   4127 N  NZ    . LYS B 1 55  ? 34.228  15.646  27.794  1.00 123.89 ? 55  LYS B NZ    1 
ATOM   4128 N  N     . GLY B 1 56  ? 35.913  17.037  22.946  1.00 97.44  ? 56  GLY B N     1 
ATOM   4129 C  CA    . GLY B 1 56  ? 37.061  16.135  22.851  1.00 95.84  ? 56  GLY B CA    1 
ATOM   4130 C  C     . GLY B 1 56  ? 37.512  15.847  21.433  1.00 89.36  ? 56  GLY B C     1 
ATOM   4131 O  O     . GLY B 1 56  ? 38.341  14.969  21.210  1.00 88.19  ? 56  GLY B O     1 
ATOM   4132 N  N     . SER B 1 57  ? 36.964  16.597  20.481  1.00 85.80  ? 57  SER B N     1 
ATOM   4133 C  CA    . SER B 1 57  ? 37.258  16.429  19.061  1.00 80.27  ? 57  SER B CA    1 
ATOM   4134 C  C     . SER B 1 57  ? 37.757  17.750  18.449  1.00 77.82  ? 57  SER B C     1 
ATOM   4135 O  O     . SER B 1 57  ? 37.398  18.109  17.320  1.00 74.39  ? 57  SER B O     1 
ATOM   4136 C  CB    . SER B 1 57  ? 36.005  15.919  18.339  1.00 79.02  ? 57  SER B CB    1 
ATOM   4137 O  OG    . SER B 1 57  ? 36.270  15.594  16.991  1.00 74.43  ? 57  SER B OG    1 
ATOM   4138 N  N     . LEU B 1 58  ? 38.594  18.457  19.212  1.00 80.03  ? 58  LEU B N     1 
ATOM   4139 C  CA    . LEU B 1 58  ? 39.102  19.779  18.843  1.00 79.01  ? 58  LEU B CA    1 
ATOM   4140 C  C     . LEU B 1 58  ? 40.269  19.704  17.850  1.00 75.21  ? 58  LEU B C     1 
ATOM   4141 O  O     . LEU B 1 58  ? 41.343  19.192  18.175  1.00 75.76  ? 58  LEU B O     1 
ATOM   4142 C  CB    . LEU B 1 58  ? 39.552  20.538  20.099  1.00 83.74  ? 58  LEU B CB    1 
ATOM   4143 C  CG    . LEU B 1 58  ? 39.575  22.076  20.170  1.00 85.32  ? 58  LEU B CG    1 
ATOM   4144 C  CD1   . LEU B 1 58  ? 40.580  22.533  21.226  1.00 89.07  ? 58  LEU B CD1   1 
ATOM   4145 C  CD2   . LEU B 1 58  ? 39.868  22.766  18.837  1.00 81.04  ? 58  LEU B CD2   1 
ATOM   4146 N  N     . GLU B 1 59  ? 40.046  20.227  16.646  1.00 71.93  ? 59  GLU B N     1 
ATOM   4147 C  CA    . GLU B 1 59  ? 41.098  20.394  15.646  1.00 68.80  ? 59  GLU B CA    1 
ATOM   4148 C  C     . GLU B 1 59  ? 40.938  21.750  14.968  1.00 68.14  ? 59  GLU B C     1 
ATOM   4149 O  O     . GLU B 1 59  ? 39.838  22.110  14.547  1.00 68.21  ? 59  GLU B O     1 
ATOM   4150 C  CB    . GLU B 1 59  ? 41.048  19.272  14.605  1.00 65.32  ? 59  GLU B CB    1 
ATOM   4151 C  CG    . GLU B 1 59  ? 42.247  19.257  13.661  1.00 62.81  ? 59  GLU B CG    1 
ATOM   4152 C  CD    . GLU B 1 59  ? 42.096  18.261  12.522  1.00 60.45  ? 59  GLU B CD    1 
ATOM   4153 O  OE1   . GLU B 1 59  ? 42.059  17.026  12.776  1.00 60.61  ? 59  GLU B OE1   1 
ATOM   4154 O  OE2   . GLU B 1 59  ? 42.014  18.724  11.364  1.00 58.44  ? 59  GLU B OE2   1 
ATOM   4155 N  N     . ILE B 1 60  ? 42.031  22.502  14.869  1.00 68.21  ? 60  ILE B N     1 
ATOM   4156 C  CA    . ILE B 1 60  ? 41.986  23.818  14.233  1.00 68.20  ? 60  ILE B CA    1 
ATOM   4157 C  C     . ILE B 1 60  ? 42.377  23.761  12.752  1.00 64.79  ? 60  ILE B C     1 
ATOM   4158 O  O     . ILE B 1 60  ? 43.277  23.004  12.353  1.00 62.63  ? 60  ILE B O     1 
ATOM   4159 C  CB    . ILE B 1 60  ? 42.853  24.866  14.982  1.00 71.52  ? 60  ILE B CB    1 
ATOM   4160 C  CG1   . ILE B 1 60  ? 42.489  24.907  16.473  1.00 75.75  ? 60  ILE B CG1   1 
ATOM   4161 C  CG2   . ILE B 1 60  ? 42.665  26.238  14.367  1.00 72.78  ? 60  ILE B CG2   1 
ATOM   4162 C  CD1   . ILE B 1 60  ? 43.370  25.821  17.315  1.00 79.43  ? 60  ILE B CD1   1 
ATOM   4163 N  N     . ASP B 1 61  ? 41.685  24.569  11.948  1.00 64.61  ? 61  ASP B N     1 
ATOM   4164 C  CA    . ASP B 1 61  ? 41.945  24.664  10.514  1.00 62.10  ? 61  ASP B CA    1 
ATOM   4165 C  C     . ASP B 1 61  ? 42.483  26.035  10.155  1.00 63.75  ? 61  ASP B C     1 
ATOM   4166 O  O     . ASP B 1 61  ? 41.806  27.051  10.374  1.00 66.45  ? 61  ASP B O     1 
ATOM   4167 C  CB    . ASP B 1 61  ? 40.671  24.402  9.713   1.00 61.12  ? 61  ASP B CB    1 
ATOM   4168 C  CG    . ASP B 1 61  ? 40.242  22.963  9.764   1.00 58.83  ? 61  ASP B CG    1 
ATOM   4169 O  OD1   . ASP B 1 61  ? 39.185  22.692  10.369  1.00 58.63  ? 61  ASP B OD1   1 
ATOM   4170 O  OD2   . ASP B 1 61  ? 40.961  22.106  9.201   1.00 58.36  ? 61  ASP B OD2   1 
ATOM   4171 N  N     . VAL B 1 62  ? 43.703  26.062  9.617   1.00 62.51  ? 62  VAL B N     1 
ATOM   4172 C  CA    . VAL B 1 62  ? 44.302  27.313  9.126   1.00 63.93  ? 62  VAL B CA    1 
ATOM   4173 C  C     . VAL B 1 62  ? 44.609  27.178  7.634   1.00 62.01  ? 62  VAL B C     1 
ATOM   4174 O  O     . VAL B 1 62  ? 45.270  26.220  7.198   1.00 59.06  ? 62  VAL B O     1 
ATOM   4175 C  CB    . VAL B 1 62  ? 45.587  27.718  9.888   1.00 66.10  ? 62  VAL B CB    1 
ATOM   4176 C  CG1   . VAL B 1 62  ? 45.854  29.201  9.692   1.00 69.09  ? 62  VAL B CG1   1 
ATOM   4177 C  CG2   . VAL B 1 62  ? 45.466  27.411  11.375  1.00 67.84  ? 62  VAL B CG2   1 
ATOM   4178 N  N     . PHE B 1 63  ? 44.104  28.133  6.861   1.00 63.27  ? 63  PHE B N     1 
ATOM   4179 C  CA    . PHE B 1 63  ? 44.243  28.120  5.411   1.00 62.54  ? 63  PHE B CA    1 
ATOM   4180 C  C     . PHE B 1 63  ? 45.191  29.209  4.922   1.00 65.56  ? 63  PHE B C     1 
ATOM   4181 O  O     . PHE B 1 63  ? 45.025  30.378  5.258   1.00 68.89  ? 63  PHE B O     1 
ATOM   4182 C  CB    . PHE B 1 63  ? 42.870  28.251  4.746   1.00 62.74  ? 63  PHE B CB    1 
ATOM   4183 C  CG    . PHE B 1 63  ? 42.288  26.945  4.313   1.00 59.84  ? 63  PHE B CG    1 
ATOM   4184 C  CD1   . PHE B 1 63  ? 42.043  25.934  5.239   1.00 56.08  ? 63  PHE B CD1   1 
ATOM   4185 C  CD2   . PHE B 1 63  ? 41.987  26.716  2.975   1.00 59.81  ? 63  PHE B CD2   1 
ATOM   4186 C  CE1   . PHE B 1 63  ? 41.507  24.724  4.841   1.00 54.67  ? 63  PHE B CE1   1 
ATOM   4187 C  CE2   . PHE B 1 63  ? 41.445  25.495  2.570   1.00 56.60  ? 63  PHE B CE2   1 
ATOM   4188 C  CZ    . PHE B 1 63  ? 41.210  24.501  3.506   1.00 54.58  ? 63  PHE B CZ    1 
ATOM   4189 N  N     . LEU B 1 64  ? 46.196  28.815  4.143   1.00 64.47  ? 64  LEU B N     1 
ATOM   4190 C  CA    . LEU B 1 64  ? 47.139  29.778  3.575   1.00 67.56  ? 64  LEU B CA    1 
ATOM   4191 C  C     . LEU B 1 64  ? 46.658  30.188  2.191   1.00 68.89  ? 64  LEU B C     1 
ATOM   4192 O  O     . LEU B 1 64  ? 46.452  29.333  1.315   1.00 67.09  ? 64  LEU B O     1 
ATOM   4193 C  CB    . LEU B 1 64  ? 48.548  29.181  3.502   1.00 66.46  ? 64  LEU B CB    1 
ATOM   4194 C  CG    . LEU B 1 64  ? 48.973  28.360  4.722   1.00 64.94  ? 64  LEU B CG    1 
ATOM   4195 C  CD1   . LEU B 1 64  ? 49.921  27.214  4.335   1.00 63.00  ? 64  LEU B CD1   1 
ATOM   4196 C  CD2   . LEU B 1 64  ? 49.563  29.239  5.804   1.00 67.95  ? 64  LEU B CD2   1 
ATOM   4197 N  N     . LEU B 1 65  ? 46.471  31.493  2.008   1.00 72.66  ? 65  LEU B N     1 
ATOM   4198 C  CA    . LEU B 1 65  ? 45.936  32.046  0.767   1.00 74.94  ? 65  LEU B CA    1 
ATOM   4199 C  C     . LEU B 1 65  ? 47.067  32.487  -0.167  1.00 77.58  ? 65  LEU B C     1 
ATOM   4200 O  O     . LEU B 1 65  ? 47.834  33.401  0.149   1.00 80.33  ? 65  LEU B O     1 
ATOM   4201 C  CB    . LEU B 1 65  ? 44.980  33.211  1.060   1.00 78.90  ? 65  LEU B CB    1 
ATOM   4202 C  CG    . LEU B 1 65  ? 43.543  32.979  1.551   1.00 77.42  ? 65  LEU B CG    1 
ATOM   4203 C  CD1   . LEU B 1 65  ? 43.492  32.201  2.850   1.00 73.83  ? 65  LEU B CD1   1 
ATOM   4204 C  CD2   . LEU B 1 65  ? 42.827  34.320  1.726   1.00 83.33  ? 65  LEU B CD2   1 
ATOM   4205 N  N     . PHE B 1 66  ? 47.165  31.814  -1.311  1.00 76.53  ? 66  PHE B N     1 
ATOM   4206 C  CA    . PHE B 1 66  ? 48.218  32.069  -2.292  1.00 79.13  ? 66  PHE B CA    1 
ATOM   4207 C  C     . PHE B 1 66  ? 47.643  32.629  -3.596  1.00 83.17  ? 66  PHE B C     1 
ATOM   4208 O  O     . PHE B 1 66  ? 46.577  32.188  -4.037  1.00 82.18  ? 66  PHE B O     1 
ATOM   4209 C  CB    . PHE B 1 66  ? 48.995  30.779  -2.581  1.00 75.32  ? 66  PHE B CB    1 
ATOM   4210 C  CG    . PHE B 1 66  ? 49.965  30.393  -1.497  1.00 73.12  ? 66  PHE B CG    1 
ATOM   4211 C  CD1   . PHE B 1 66  ? 51.184  31.052  -1.370  1.00 75.61  ? 66  PHE B CD1   1 
ATOM   4212 C  CD2   . PHE B 1 66  ? 49.671  29.357  -0.615  1.00 68.31  ? 66  PHE B CD2   1 
ATOM   4213 C  CE1   . PHE B 1 66  ? 52.085  30.693  -0.372  1.00 74.49  ? 66  PHE B CE1   1 
ATOM   4214 C  CE2   . PHE B 1 66  ? 50.569  28.990  0.384   1.00 66.54  ? 66  PHE B CE2   1 
ATOM   4215 C  CZ    . PHE B 1 66  ? 51.777  29.654  0.506   1.00 69.49  ? 66  PHE B CZ    1 
ATOM   4216 N  N     . PRO B 1 67  ? 48.346  33.604  -4.214  1.00 88.38  ? 67  PRO B N     1 
ATOM   4217 C  CA    . PRO B 1 67  ? 47.934  34.136  -5.515  1.00 93.17  ? 67  PRO B CA    1 
ATOM   4218 C  C     . PRO B 1 67  ? 47.796  33.038  -6.572  1.00 91.36  ? 67  PRO B C     1 
ATOM   4219 O  O     . PRO B 1 67  ? 48.517  32.034  -6.526  1.00 87.71  ? 67  PRO B O     1 
ATOM   4220 C  CB    . PRO B 1 67  ? 49.079  35.082  -5.883  1.00 98.30  ? 67  PRO B CB    1 
ATOM   4221 C  CG    . PRO B 1 67  ? 49.662  35.482  -4.583  1.00 97.43  ? 67  PRO B CG    1 
ATOM   4222 C  CD    . PRO B 1 67  ? 49.564  34.273  -3.717  1.00 90.56  ? 67  PRO B CD    1 
ATOM   4223 N  N     . GLU B 1 68  ? 46.879  33.247  -7.515  1.00 94.68  ? 68  GLU B N     1 
ATOM   4224 C  CA    . GLU B 1 68  ? 46.538  32.247  -8.528  1.00 93.98  ? 68  GLU B CA    1 
ATOM   4225 C  C     . GLU B 1 68  ? 47.698  31.905  -9.474  1.00 95.98  ? 68  GLU B C     1 
ATOM   4226 O  O     . GLU B 1 68  ? 47.668  30.877  -10.156 1.00 94.61  ? 68  GLU B O     1 
ATOM   4227 C  CB    . GLU B 1 68  ? 45.307  32.691  -9.324  1.00 98.17  ? 68  GLU B CB    1 
ATOM   4228 C  CG    . GLU B 1 68  ? 44.362  31.546  -9.664  1.00 95.08  ? 68  GLU B CG    1 
ATOM   4229 C  CD    . GLU B 1 68  ? 43.275  31.931  -10.652 1.00 100.41 ? 68  GLU B CD    1 
ATOM   4230 O  OE1   . GLU B 1 68  ? 42.915  31.071  -11.484 1.00 100.26 ? 68  GLU B OE1   1 
ATOM   4231 O  OE2   . GLU B 1 68  ? 42.778  33.078  -10.599 1.00 103.61 ? 68  GLU B OE2   1 
ATOM   4232 N  N     . GLU B 1 69  ? 48.713  32.767  -9.497  1.00 99.82  ? 69  GLU B N     1 
ATOM   4233 C  CA    . GLU B 1 69  ? 49.899  32.576  -10.335 1.00 102.57 ? 69  GLU B CA    1 
ATOM   4234 C  C     . GLU B 1 69  ? 50.800  31.440  -9.843  1.00 97.44  ? 69  GLU B C     1 
ATOM   4235 O  O     . GLU B 1 69  ? 51.468  30.786  -10.648 1.00 98.44  ? 69  GLU B O     1 
ATOM   4236 C  CB    . GLU B 1 69  ? 50.693  33.879  -10.430 1.00 108.58 ? 69  GLU B CB    1 
ATOM   4237 C  CG    . GLU B 1 69  ? 50.010  34.958  -11.269 1.00 115.78 ? 69  GLU B CG    1 
ATOM   4238 C  CD    . GLU B 1 69  ? 50.209  36.354  -10.707 1.00 120.82 ? 69  GLU B CD    1 
ATOM   4239 O  OE1   . GLU B 1 69  ? 50.250  37.319  -11.502 1.00 127.81 ? 69  GLU B OE1   1 
ATOM   4240 O  OE2   . GLU B 1 69  ? 50.321  36.490  -9.469  1.00 118.08 ? 69  GLU B OE2   1 
ATOM   4241 N  N     . PHE B 1 70  ? 50.815  31.218  -8.528  1.00 92.64  ? 70  PHE B N     1 
ATOM   4242 C  CA    . PHE B 1 70  ? 51.617  30.163  -7.909  1.00 87.97  ? 70  PHE B CA    1 
ATOM   4243 C  C     . PHE B 1 70  ? 51.384  28.812  -8.575  1.00 85.21  ? 70  PHE B C     1 
ATOM   4244 O  O     . PHE B 1 70  ? 50.240  28.403  -8.780  1.00 83.67  ? 70  PHE B O     1 
ATOM   4245 C  CB    . PHE B 1 70  ? 51.312  30.078  -6.409  1.00 83.92  ? 70  PHE B CB    1 
ATOM   4246 C  CG    . PHE B 1 70  ? 52.262  30.863  -5.544  1.00 85.85  ? 70  PHE B CG    1 
ATOM   4247 C  CD1   . PHE B 1 70  ? 52.437  32.232  -5.730  1.00 91.68  ? 70  PHE B CD1   1 
ATOM   4248 C  CD2   . PHE B 1 70  ? 52.976  30.231  -4.529  1.00 83.38  ? 70  PHE B CD2   1 
ATOM   4249 C  CE1   . PHE B 1 70  ? 53.320  32.959  -4.928  1.00 93.86  ? 70  PHE B CE1   1 
ATOM   4250 C  CE2   . PHE B 1 70  ? 53.860  30.948  -3.722  1.00 85.23  ? 70  PHE B CE2   1 
ATOM   4251 C  CZ    . PHE B 1 70  ? 54.031  32.314  -3.921  1.00 90.32  ? 70  PHE B CZ    1 
ATOM   4252 N  N     . SER B 1 71  ? 52.469  28.128  -8.929  1.00 85.09  ? 71  SER B N     1 
ATOM   4253 C  CA    . SER B 1 71  ? 52.363  26.812  -9.556  1.00 83.21  ? 71  SER B CA    1 
ATOM   4254 C  C     . SER B 1 71  ? 51.844  25.786  -8.551  1.00 77.51  ? 71  SER B C     1 
ATOM   4255 O  O     . SER B 1 71  ? 51.768  26.068  -7.349  1.00 74.72  ? 71  SER B O     1 
ATOM   4256 C  CB    . SER B 1 71  ? 53.707  26.363  -10.145 1.00 85.31  ? 71  SER B CB    1 
ATOM   4257 O  OG    . SER B 1 71  ? 54.667  26.111  -9.135  1.00 82.61  ? 71  SER B OG    1 
ATOM   4258 N  N     . LYS B 1 72  ? 51.475  24.610  -9.057  1.00 76.23  ? 72  LYS B N     1 
ATOM   4259 C  CA    . LYS B 1 72  ? 51.085  23.476  -8.227  1.00 71.81  ? 72  LYS B CA    1 
ATOM   4260 C  C     . LYS B 1 72  ? 52.197  23.164  -7.212  1.00 69.77  ? 72  LYS B C     1 
ATOM   4261 O  O     . LYS B 1 72  ? 51.924  22.914  -6.032  1.00 66.28  ? 72  LYS B O     1 
ATOM   4262 C  CB    . LYS B 1 72  ? 50.809  22.258  -9.121  1.00 72.23  ? 72  LYS B CB    1 
ATOM   4263 C  CG    . LYS B 1 72  ? 50.346  20.992  -8.391  1.00 69.13  ? 72  LYS B CG    1 
ATOM   4264 C  CD    . LYS B 1 72  ? 51.047  19.740  -8.941  1.00 71.26  ? 72  LYS B CD    1 
ATOM   4265 C  CE    . LYS B 1 72  ? 52.418  19.535  -8.282  1.00 71.94  ? 72  LYS B CE    1 
ATOM   4266 N  NZ    . LYS B 1 72  ? 53.314  18.605  -9.032  1.00 74.67  ? 72  LYS B NZ    1 
ATOM   4267 N  N     . GLU B 1 73  ? 53.442  23.210  -7.690  1.00 72.26  ? 73  GLU B N     1 
ATOM   4268 C  CA    . GLU B 1 73  ? 54.633  22.875  -6.907  1.00 71.67  ? 73  GLU B CA    1 
ATOM   4269 C  C     . GLU B 1 73  ? 55.000  23.929  -5.850  1.00 71.54  ? 73  GLU B C     1 
ATOM   4270 O  O     . GLU B 1 73  ? 55.403  23.578  -4.740  1.00 69.41  ? 73  GLU B O     1 
ATOM   4271 C  CB    . GLU B 1 73  ? 55.813  22.635  -7.856  1.00 75.45  ? 73  GLU B CB    1 
ATOM   4272 C  CG    . GLU B 1 73  ? 57.052  22.017  -7.219  1.00 75.83  ? 73  GLU B CG    1 
ATOM   4273 C  CD    . GLU B 1 73  ? 58.229  21.934  -8.185  1.00 80.67  ? 73  GLU B CD    1 
ATOM   4274 O  OE1   . GLU B 1 73  ? 58.562  22.957  -8.831  1.00 85.04  ? 73  GLU B OE1   1 
ATOM   4275 O  OE2   . GLU B 1 73  ? 58.830  20.840  -8.292  1.00 82.48  ? 73  GLU B OE2   1 
ATOM   4276 N  N     . GLU B 1 74  ? 54.870  25.212  -6.191  1.00 74.39  ? 74  GLU B N     1 
ATOM   4277 C  CA    . GLU B 1 74  ? 55.209  26.286  -5.247  1.00 75.35  ? 74  GLU B CA    1 
ATOM   4278 C  C     . GLU B 1 74  ? 54.150  26.505  -4.173  1.00 71.67  ? 74  GLU B C     1 
ATOM   4279 O  O     . GLU B 1 74  ? 54.479  26.898  -3.059  1.00 71.29  ? 74  GLU B O     1 
ATOM   4280 C  CB    . GLU B 1 74  ? 55.562  27.598  -5.960  1.00 80.81  ? 74  GLU B CB    1 
ATOM   4281 C  CG    . GLU B 1 74  ? 57.076  27.853  -6.076  1.00 86.35  ? 74  GLU B CG    1 
ATOM   4282 C  CD    . GLU B 1 74  ? 57.690  28.472  -4.809  1.00 88.58  ? 74  GLU B CD    1 
ATOM   4283 O  OE1   . GLU B 1 74  ? 57.694  29.720  -4.692  1.00 92.03  ? 74  GLU B OE1   1 
ATOM   4284 O  OE2   . GLU B 1 74  ? 58.184  27.711  -3.942  1.00 86.83  ? 74  GLU B OE2   1 
ATOM   4285 N  N     . LEU B 1 75  ? 52.888  26.245  -4.508  1.00 69.48  ? 75  LEU B N     1 
ATOM   4286 C  CA    . LEU B 1 75  ? 51.825  26.147  -3.507  1.00 65.99  ? 75  LEU B CA    1 
ATOM   4287 C  C     . LEU B 1 75  ? 52.187  25.082  -2.465  1.00 62.37  ? 75  LEU B C     1 
ATOM   4288 O  O     . LEU B 1 75  ? 52.008  25.287  -1.261  1.00 61.23  ? 75  LEU B O     1 
ATOM   4289 C  CB    . LEU B 1 75  ? 50.496  25.771  -4.174  1.00 65.04  ? 75  LEU B CB    1 
ATOM   4290 C  CG    . LEU B 1 75  ? 49.244  25.625  -3.297  1.00 62.41  ? 75  LEU B CG    1 
ATOM   4291 C  CD1   . LEU B 1 75  ? 48.603  26.982  -3.007  1.00 64.62  ? 75  LEU B CD1   1 
ATOM   4292 C  CD2   . LEU B 1 75  ? 48.233  24.680  -3.945  1.00 60.97  ? 75  LEU B CD2   1 
ATOM   4293 N  N     . ARG B 1 76  ? 52.692  23.946  -2.948  1.00 61.08  ? 76  ARG B N     1 
ATOM   4294 C  CA    . ARG B 1 76  ? 53.128  22.847  -2.095  1.00 58.30  ? 76  ARG B CA    1 
ATOM   4295 C  C     . ARG B 1 76  ? 54.342  23.226  -1.238  1.00 59.40  ? 76  ARG B C     1 
ATOM   4296 O  O     . ARG B 1 76  ? 54.250  23.235  -0.007  1.00 57.83  ? 76  ARG B O     1 
ATOM   4297 C  CB    . ARG B 1 76  ? 53.426  21.596  -2.933  1.00 58.30  ? 76  ARG B CB    1 
ATOM   4298 C  CG    . ARG B 1 76  ? 53.720  20.353  -2.109  1.00 56.46  ? 76  ARG B CG    1 
ATOM   4299 C  CD    . ARG B 1 76  ? 54.333  19.249  -2.943  1.00 59.51  ? 76  ARG B CD    1 
ATOM   4300 N  NE    . ARG B 1 76  ? 55.756  19.472  -3.185  1.00 64.11  ? 76  ARG B NE    1 
ATOM   4301 C  CZ    . ARG B 1 76  ? 56.337  19.458  -4.384  1.00 67.70  ? 76  ARG B CZ    1 
ATOM   4302 N  NH1   . ARG B 1 76  ? 55.628  19.214  -5.481  1.00 69.07  ? 76  ARG B NH1   1 
ATOM   4303 N  NH2   . ARG B 1 76  ? 57.640  19.675  -4.487  1.00 71.14  ? 76  ARG B NH2   1 
ATOM   4304 N  N     . GLU B 1 77  ? 55.466  23.549  -1.882  1.00 62.09  ? 77  GLU B N     1 
ATOM   4305 C  CA    . GLU B 1 77  ? 56.710  23.792  -1.144  1.00 63.93  ? 77  GLU B CA    1 
ATOM   4306 C  C     . GLU B 1 77  ? 56.570  24.933  -0.140  1.00 64.62  ? 77  GLU B C     1 
ATOM   4307 O  O     . GLU B 1 77  ? 56.923  24.773  1.027   1.00 64.32  ? 77  GLU B O     1 
ATOM   4308 C  CB    . GLU B 1 77  ? 57.916  24.006  -2.078  1.00 67.72  ? 77  GLU B CB    1 
ATOM   4309 C  CG    . GLU B 1 77  ? 58.432  22.742  -2.797  1.00 68.54  ? 77  GLU B CG    1 
ATOM   4310 C  CD    . GLU B 1 77  ? 58.999  21.661  -1.858  1.00 68.54  ? 77  GLU B CD    1 
ATOM   4311 O  OE1   . GLU B 1 77  ? 58.268  21.171  -0.969  1.00 66.30  ? 77  GLU B OE1   1 
ATOM   4312 O  OE2   . GLU B 1 77  ? 60.176  21.271  -2.029  1.00 72.65  ? 77  GLU B OE2   1 
ATOM   4313 N  N     . ARG B 1 78  ? 56.027  26.062  -0.593  1.00 65.99  ? 78  ARG B N     1 
ATOM   4314 C  CA    . ARG B 1 78  ? 55.864  27.253  0.248   1.00 67.67  ? 78  ARG B CA    1 
ATOM   4315 C  C     . ARG B 1 78  ? 54.838  27.055  1.367   1.00 64.73  ? 78  ARG B C     1 
ATOM   4316 O  O     . ARG B 1 78  ? 55.018  27.553  2.483   1.00 65.64  ? 78  ARG B O     1 
ATOM   4317 C  CB    . ARG B 1 78  ? 55.489  28.464  -0.615  1.00 70.85  ? 78  ARG B CB    1 
ATOM   4318 C  CG    . ARG B 1 78  ? 55.576  29.811  0.091   1.00 74.90  ? 78  ARG B CG    1 
ATOM   4319 C  CD    . ARG B 1 78  ? 57.009  30.249  0.343   1.00 80.08  ? 78  ARG B CD    1 
ATOM   4320 N  NE    . ARG B 1 78  ? 57.054  31.508  1.092   1.00 84.87  ? 78  ARG B NE    1 
ATOM   4321 C  CZ    . ARG B 1 78  ? 57.170  31.596  2.417   1.00 85.34  ? 78  ARG B CZ    1 
ATOM   4322 N  NH1   . ARG B 1 78  ? 57.262  30.496  3.157   1.00 82.28  ? 78  ARG B NH1   1 
ATOM   4323 N  NH2   . ARG B 1 78  ? 57.201  32.787  3.006   1.00 88.88  ? 78  ARG B NH2   1 
ATOM   4324 N  N     . GLY B 1 79  ? 53.765  26.330  1.056   1.00 61.20  ? 79  GLY B N     1 
ATOM   4325 C  CA    . GLY B 1 79  ? 52.718  26.032  2.025   1.00 58.92  ? 79  GLY B CA    1 
ATOM   4326 C  C     . GLY B 1 79  ? 53.182  25.067  3.101   1.00 57.38  ? 79  GLY B C     1 
ATOM   4327 O  O     . GLY B 1 79  ? 52.887  25.260  4.282   1.00 57.55  ? 79  GLY B O     1 
ATOM   4328 N  N     . LEU B 1 80  ? 53.912  24.031  2.692   1.00 56.55  ? 80  LEU B N     1 
ATOM   4329 C  CA    . LEU B 1 80  ? 54.483  23.063  3.629   1.00 56.19  ? 80  LEU B CA    1 
ATOM   4330 C  C     . LEU B 1 80  ? 55.524  23.715  4.542   1.00 59.18  ? 80  LEU B C     1 
ATOM   4331 O  O     . LEU B 1 80  ? 55.580  23.416  5.737   1.00 59.37  ? 80  LEU B O     1 
ATOM   4332 C  CB    . LEU B 1 80  ? 55.099  21.878  2.871   1.00 55.89  ? 80  LEU B CB    1 
ATOM   4333 C  CG    . LEU B 1 80  ? 54.433  20.496  2.723   1.00 53.42  ? 80  LEU B CG    1 
ATOM   4334 C  CD1   . LEU B 1 80  ? 52.903  20.492  2.802   1.00 51.21  ? 80  LEU B CD1   1 
ATOM   4335 C  CD2   . LEU B 1 80  ? 54.910  19.831  1.436   1.00 53.72  ? 80  LEU B CD2   1 
ATOM   4336 N  N     . GLU B 1 81  ? 56.324  24.616  3.969   1.00 61.90  ? 81  GLU B N     1 
ATOM   4337 C  CA    . GLU B 1 81  ? 57.364  25.350  4.690   1.00 65.70  ? 81  GLU B CA    1 
ATOM   4338 C  C     . GLU B 1 81  ? 56.784  26.214  5.809   1.00 66.55  ? 81  GLU B C     1 
ATOM   4339 O  O     . GLU B 1 81  ? 57.360  26.292  6.899   1.00 68.75  ? 81  GLU B O     1 
ATOM   4340 C  CB    . GLU B 1 81  ? 58.174  26.214  3.711   1.00 68.86  ? 81  GLU B CB    1 
ATOM   4341 C  CG    . GLU B 1 81  ? 59.167  27.166  4.361   1.00 73.60  ? 81  GLU B CG    1 
ATOM   4342 C  CD    . GLU B 1 81  ? 59.642  28.269  3.420   1.00 77.50  ? 81  GLU B CD    1 
ATOM   4343 O  OE1   . GLU B 1 81  ? 59.742  28.020  2.193   1.00 77.64  ? 81  GLU B OE1   1 
ATOM   4344 O  OE2   . GLU B 1 81  ? 59.917  29.387  3.917   1.00 81.42  ? 81  GLU B OE2   1 
ATOM   4345 N  N     . ILE B 1 82  ? 55.652  26.863  5.531   1.00 65.36  ? 82  ILE B N     1 
ATOM   4346 C  CA    . ILE B 1 82  ? 54.993  27.718  6.520   1.00 66.69  ? 82  ILE B CA    1 
ATOM   4347 C  C     . ILE B 1 82  ? 54.390  26.870  7.634   1.00 64.77  ? 82  ILE B C     1 
ATOM   4348 O  O     . ILE B 1 82  ? 54.518  27.206  8.810   1.00 67.39  ? 82  ILE B O     1 
ATOM   4349 C  CB    . ILE B 1 82  ? 53.940  28.668  5.880   1.00 66.75  ? 82  ILE B CB    1 
ATOM   4350 C  CG1   . ILE B 1 82  ? 54.655  29.793  5.109   1.00 69.33  ? 82  ILE B CG1   1 
ATOM   4351 C  CG2   . ILE B 1 82  ? 53.043  29.292  6.955   1.00 68.16  ? 82  ILE B CG2   1 
ATOM   4352 C  CD1   . ILE B 1 82  ? 53.820  30.483  4.035   1.00 67.06  ? 82  ILE B CD1   1 
ATOM   4353 N  N     . GLY B 1 83  ? 53.766  25.759  7.255   1.00 60.83  ? 83  GLY B N     1 
ATOM   4354 C  CA    . GLY B 1 83  ? 53.183  24.833  8.213   1.00 59.41  ? 83  GLY B CA    1 
ATOM   4355 C  C     . GLY B 1 83  ? 54.193  24.242  9.180   1.00 61.22  ? 83  GLY B C     1 
ATOM   4356 O  O     . GLY B 1 83  ? 53.917  24.123  10.370  1.00 62.59  ? 83  GLY B O     1 
ATOM   4357 N  N     . LYS B 1 84  ? 55.363  23.873  8.672   1.00 61.86  ? 84  LYS B N     1 
ATOM   4358 C  CA    . LYS B 1 84  ? 56.404  23.272  9.500   1.00 64.51  ? 84  LYS B CA    1 
ATOM   4359 C  C     . LYS B 1 84  ? 56.966  24.269  10.516  1.00 68.79  ? 84  LYS B C     1 
ATOM   4360 O  O     . LYS B 1 84  ? 57.223  23.918  11.672  1.00 70.97  ? 84  LYS B O     1 
ATOM   4361 C  CB    . LYS B 1 84  ? 57.522  22.694  8.619   1.00 65.18  ? 84  LYS B CB    1 
ATOM   4362 C  CG    . LYS B 1 84  ? 57.172  21.338  8.012   1.00 62.40  ? 84  LYS B CG    1 
ATOM   4363 C  CD    . LYS B 1 84  ? 57.620  21.193  6.561   1.00 62.97  ? 84  LYS B CD    1 
ATOM   4364 C  CE    . LYS B 1 84  ? 58.990  20.563  6.420   1.00 66.61  ? 84  LYS B CE    1 
ATOM   4365 N  NZ    . LYS B 1 84  ? 60.054  21.586  6.201   1.00 71.60  ? 84  LYS B NZ    1 
ATOM   4366 N  N     . ALA B 1 85  ? 57.130  25.513  10.074  1.00 70.36  ? 85  ALA B N     1 
ATOM   4367 C  CA    . ALA B 1 85  ? 57.726  26.578  10.879  1.00 75.27  ? 85  ALA B CA    1 
ATOM   4368 C  C     . ALA B 1 85  ? 56.845  26.970  12.066  1.00 76.52  ? 85  ALA B C     1 
ATOM   4369 O  O     . ALA B 1 85  ? 57.345  27.343  13.129  1.00 80.61  ? 85  ALA B O     1 
ATOM   4370 C  CB    . ALA B 1 85  ? 57.995  27.788  10.005  1.00 76.82  ? 85  ALA B CB    1 
ATOM   4371 N  N     . VAL B 1 86  ? 55.537  26.841  11.869  1.00 73.28  ? 86  VAL B N     1 
ATOM   4372 C  CA    . VAL B 1 86  ? 54.517  27.378  12.760  1.00 74.60  ? 86  VAL B CA    1 
ATOM   4373 C  C     . VAL B 1 86  ? 53.989  26.360  13.791  1.00 74.24  ? 86  VAL B C     1 
ATOM   4374 O  O     . VAL B 1 86  ? 53.284  26.731  14.737  1.00 76.31  ? 86  VAL B O     1 
ATOM   4375 C  CB    . VAL B 1 86  ? 53.375  28.008  11.894  1.00 72.28  ? 86  VAL B CB    1 
ATOM   4376 C  CG1   . VAL B 1 86  ? 51.973  27.516  12.294  1.00 70.14  ? 86  VAL B CG1   1 
ATOM   4377 C  CG2   . VAL B 1 86  ? 53.480  29.521  11.878  1.00 75.59  ? 86  VAL B CG2   1 
ATOM   4378 N  N     . LEU B 1 87  ? 54.353  25.091  13.622  1.00 72.39  ? 87  LEU B N     1 
ATOM   4379 C  CA    . LEU B 1 87  ? 53.841  24.006  14.472  1.00 72.08  ? 87  LEU B CA    1 
ATOM   4380 C  C     . LEU B 1 87  ? 54.933  23.354  15.328  1.00 75.72  ? 87  LEU B C     1 
ATOM   4381 O  O     . LEU B 1 87  ? 56.036  23.088  14.834  1.00 76.42  ? 87  LEU B O     1 
ATOM   4382 C  CB    . LEU B 1 87  ? 53.129  22.950  13.618  1.00 67.16  ? 87  LEU B CB    1 
ATOM   4383 C  CG    . LEU B 1 87  ? 52.003  23.419  12.679  1.00 64.30  ? 87  LEU B CG    1 
ATOM   4384 C  CD1   . LEU B 1 87  ? 51.458  22.276  11.861  1.00 59.96  ? 87  LEU B CD1   1 
ATOM   4385 C  CD2   . LEU B 1 87  ? 50.859  24.126  13.413  1.00 66.43  ? 87  LEU B CD2   1 
ATOM   4386 N  N     . ASP B 1 88  ? 54.612  23.104  16.602  1.00 78.61  ? 88  ASP B N     1 
ATOM   4387 C  CA    . ASP B 1 88  ? 55.535  22.482  17.568  1.00 82.96  ? 88  ASP B CA    1 
ATOM   4388 C  C     . ASP B 1 88  ? 56.021  21.109  17.099  1.00 81.06  ? 88  ASP B C     1 
ATOM   4389 O  O     . ASP B 1 88  ? 57.227  20.851  17.035  1.00 83.51  ? 88  ASP B O     1 
ATOM   4390 C  CB    . ASP B 1 88  ? 54.879  22.348  18.950  1.00 86.52  ? 88  ASP B CB    1 
ATOM   4391 C  CG    . ASP B 1 88  ? 54.465  23.686  19.546  1.00 89.86  ? 88  ASP B CG    1 
ATOM   4392 O  OD1   . ASP B 1 88  ? 54.944  24.738  19.070  1.00 91.37  ? 88  ASP B OD1   1 
ATOM   4393 O  OD2   . ASP B 1 88  ? 53.658  23.684  20.502  1.00 92.29  ? 88  ASP B OD2   1 
ATOM   4394 N  N     . SER B 1 89  ? 55.068  20.235  16.792  1.00 77.12  ? 89  SER B N     1 
ATOM   4395 C  CA    . SER B 1 89  ? 55.345  18.950  16.177  1.00 74.83  ? 89  SER B CA    1 
ATOM   4396 C  C     . SER B 1 89  ? 54.605  18.950  14.852  1.00 69.15  ? 89  SER B C     1 
ATOM   4397 O  O     . SER B 1 89  ? 53.656  19.718  14.689  1.00 67.19  ? 89  SER B O     1 
ATOM   4398 C  CB    . SER B 1 89  ? 54.835  17.817  17.063  1.00 76.58  ? 89  SER B CB    1 
ATOM   4399 O  OG    . SER B 1 89  ? 55.288  17.970  18.398  1.00 82.62  ? 89  SER B OG    1 
ATOM   4400 N  N     . TYR B 1 90  ? 55.036  18.114  13.907  1.00 66.84  ? 90  TYR B N     1 
ATOM   4401 C  CA    . TYR B 1 90  ? 54.360  18.011  12.610  1.00 62.00  ? 90  TYR B CA    1 
ATOM   4402 C  C     . TYR B 1 90  ? 54.524  16.650  11.913  1.00 60.95  ? 90  TYR B C     1 
ATOM   4403 O  O     . TYR B 1 90  ? 55.537  15.957  12.075  1.00 63.22  ? 90  TYR B O     1 
ATOM   4404 C  CB    . TYR B 1 90  ? 54.772  19.158  11.667  1.00 60.70  ? 90  TYR B CB    1 
ATOM   4405 C  CG    . TYR B 1 90  ? 56.172  19.038  11.099  1.00 62.12  ? 90  TYR B CG    1 
ATOM   4406 C  CD1   . TYR B 1 90  ? 56.442  18.180  10.023  1.00 60.10  ? 90  TYR B CD1   1 
ATOM   4407 C  CD2   . TYR B 1 90  ? 57.226  19.777  11.631  1.00 65.29  ? 90  TYR B CD2   1 
ATOM   4408 C  CE1   . TYR B 1 90  ? 57.726  18.057  9.503   1.00 61.80  ? 90  TYR B CE1   1 
ATOM   4409 C  CE2   . TYR B 1 90  ? 58.516  19.663  11.112  1.00 67.31  ? 90  TYR B CE2   1 
ATOM   4410 C  CZ    . TYR B 1 90  ? 58.753  18.802  10.051  1.00 65.53  ? 90  TYR B CZ    1 
ATOM   4411 O  OH    . TYR B 1 90  ? 60.012  18.681  9.530   1.00 67.94  ? 90  TYR B OH    1 
ATOM   4412 N  N     . GLU B 1 91  ? 53.505  16.292  11.136  1.00 57.66  ? 91  GLU B N     1 
ATOM   4413 C  CA    . GLU B 1 91  ? 53.524  15.130  10.261  1.00 56.67  ? 91  GLU B CA    1 
ATOM   4414 C  C     . GLU B 1 91  ? 53.058  15.571  8.889   1.00 53.37  ? 91  GLU B C     1 
ATOM   4415 O  O     . GLU B 1 91  ? 52.169  16.420  8.771   1.00 51.90  ? 91  GLU B O     1 
ATOM   4416 C  CB    . GLU B 1 91  ? 52.563  14.066  10.763  1.00 56.58  ? 91  GLU B CB    1 
ATOM   4417 C  CG    . GLU B 1 91  ? 52.286  14.115  12.245  1.00 60.68  ? 91  GLU B CG    1 
ATOM   4418 C  CD    . GLU B 1 91  ? 51.312  13.051  12.672  1.00 62.72  ? 91  GLU B CD    1 
ATOM   4419 O  OE1   . GLU B 1 91  ? 50.367  12.777  11.896  1.00 60.68  ? 91  GLU B OE1   1 
ATOM   4420 O  OE2   . GLU B 1 91  ? 51.495  12.492  13.777  1.00 66.66  ? 91  GLU B OE2   1 
ATOM   4421 N  N     . ILE B 1 92  ? 53.651  15.005  7.847   1.00 53.22  ? 92  ILE B N     1 
ATOM   4422 C  CA    . ILE B 1 92  ? 53.231  15.318  6.486   1.00 50.67  ? 92  ILE B CA    1 
ATOM   4423 C  C     . ILE B 1 92  ? 52.835  14.018  5.809   1.00 50.12  ? 92  ILE B C     1 
ATOM   4424 O  O     . ILE B 1 92  ? 53.680  13.228  5.398   1.00 51.12  ? 92  ILE B O     1 
ATOM   4425 C  CB    . ILE B 1 92  ? 54.318  16.106  5.685   1.00 51.94  ? 92  ILE B CB    1 
ATOM   4426 C  CG1   . ILE B 1 92  ? 54.566  17.480  6.325   1.00 52.41  ? 92  ILE B CG1   1 
ATOM   4427 C  CG2   . ILE B 1 92  ? 53.920  16.256  4.202   1.00 49.67  ? 92  ILE B CG2   1 
ATOM   4428 C  CD1   . ILE B 1 92  ? 55.908  18.087  5.965   1.00 55.06  ? 92  ILE B CD1   1 
ATOM   4429 N  N     . ARG B 1 93  ? 51.529  13.798  5.728   1.00 48.43  ? 93  ARG B N     1 
ATOM   4430 C  CA    . ARG B 1 93  ? 50.995  12.573  5.141   1.00 48.50  ? 93  ARG B CA    1 
ATOM   4431 C  C     . ARG B 1 93  ? 49.648  12.915  4.507   1.00 45.87  ? 93  ARG B C     1 
ATOM   4432 O  O     . ARG B 1 93  ? 48.723  13.360  5.191   1.00 44.65  ? 93  ARG B O     1 
ATOM   4433 C  CB    . ARG B 1 93  ? 50.855  11.492  6.221   1.00 50.50  ? 93  ARG B CB    1 
ATOM   4434 C  CG    . ARG B 1 93  ? 50.837  10.068  5.730   1.00 52.79  ? 93  ARG B CG    1 
ATOM   4435 C  CD    . ARG B 1 93  ? 52.211  9.486   5.555   1.00 56.02  ? 93  ARG B CD    1 
ATOM   4436 N  NE    . ARG B 1 93  ? 52.193  8.036   5.773   1.00 60.16  ? 93  ARG B NE    1 
ATOM   4437 C  CZ    . ARG B 1 93  ? 52.289  7.107   4.818   1.00 61.58  ? 93  ARG B CZ    1 
ATOM   4438 N  NH1   . ARG B 1 93  ? 52.427  7.448   3.539   1.00 61.32  ? 93  ARG B NH1   1 
ATOM   4439 N  NH2   . ARG B 1 93  ? 52.256  5.823   5.146   1.00 63.09  ? 93  ARG B NH2   1 
ATOM   4440 N  N     . TYR B 1 94  ? 49.563  12.735  3.193   1.00 44.87  ? 94  TYR B N     1 
ATOM   4441 C  CA    . TYR B 1 94  ? 48.380  13.130  2.444   1.00 43.70  ? 94  TYR B CA    1 
ATOM   4442 C  C     . TYR B 1 94  ? 48.260  12.326  1.154   1.00 44.10  ? 94  TYR B C     1 
ATOM   4443 O  O     . TYR B 1 94  ? 49.213  11.664  0.736   1.00 45.00  ? 94  TYR B O     1 
ATOM   4444 C  CB    . TYR B 1 94  ? 48.382  14.641  2.171   1.00 42.78  ? 94  TYR B CB    1 
ATOM   4445 C  CG    . TYR B 1 94  ? 49.578  15.156  1.395   1.00 44.30  ? 94  TYR B CG    1 
ATOM   4446 C  CD1   . TYR B 1 94  ? 49.601  15.106  0.003   1.00 44.71  ? 94  TYR B CD1   1 
ATOM   4447 C  CD2   . TYR B 1 94  ? 50.673  15.728  2.052   1.00 45.92  ? 94  TYR B CD2   1 
ATOM   4448 C  CE1   . TYR B 1 94  ? 50.690  15.573  -0.722  1.00 46.78  ? 94  TYR B CE1   1 
ATOM   4449 C  CE2   . TYR B 1 94  ? 51.774  16.212  1.329   1.00 47.67  ? 94  TYR B CE2   1 
ATOM   4450 C  CZ    . TYR B 1 94  ? 51.770  16.129  -0.056  1.00 47.62  ? 94  TYR B CZ    1 
ATOM   4451 O  OH    . TYR B 1 94  ? 52.834  16.590  -0.786  1.00 49.07  ? 94  TYR B OH    1 
ATOM   4452 N  N     . ALA B 1 95  ? 47.075  12.384  0.542   1.00 43.34  ? 95  ALA B N     1 
ATOM   4453 C  CA    . ALA B 1 95  ? 46.743  11.537  -0.610  1.00 43.91  ? 95  ALA B CA    1 
ATOM   4454 C  C     . ALA B 1 95  ? 46.976  12.257  -1.935  1.00 44.21  ? 95  ALA B C     1 
ATOM   4455 O  O     . ALA B 1 95  ? 47.456  11.662  -2.899  1.00 45.70  ? 95  ALA B O     1 
ATOM   4456 C  CB    . ALA B 1 95  ? 45.295  11.052  -0.513  1.00 44.28  ? 95  ALA B CB    1 
ATOM   4457 N  N     . GLU B 1 96  ? 46.643  13.544  -1.959  1.00 42.74  ? 96  GLU B N     1 
ATOM   4458 C  CA    . GLU B 1 96  ? 46.779  14.363  -3.155  1.00 43.74  ? 96  GLU B CA    1 
ATOM   4459 C  C     . GLU B 1 96  ? 47.104  15.794  -2.767  1.00 42.59  ? 96  GLU B C     1 
ATOM   4460 O  O     . GLU B 1 96  ? 48.156  16.303  -3.143  1.00 43.41  ? 96  GLU B O     1 
ATOM   4461 C  CB    . GLU B 1 96  ? 45.519  14.293  -4.039  1.00 44.84  ? 96  GLU B CB    1 
ATOM   4462 C  CG    . GLU B 1 96  ? 45.578  15.133  -5.327  1.00 46.06  ? 96  GLU B CG    1 
ATOM   4463 C  CD    . GLU B 1 96  ? 45.132  16.570  -5.115  1.00 44.87  ? 96  GLU B CD    1 
ATOM   4464 O  OE1   . GLU B 1 96  ? 44.002  16.764  -4.626  1.00 43.49  ? 96  GLU B OE1   1 
ATOM   4465 O  OE2   . GLU B 1 96  ? 45.909  17.507  -5.432  1.00 44.91  ? 96  GLU B OE2   1 
ATOM   4466 N  N     . HIS B 1 97  ? 46.215  16.434  -2.012  1.00 41.44  ? 97  HIS B N     1 
ATOM   4467 C  CA    . HIS B 1 97  ? 46.412  17.834  -1.668  1.00 41.82  ? 97  HIS B CA    1 
ATOM   4468 C  C     . HIS B 1 97  ? 47.347  18.007  -0.476  1.00 41.69  ? 97  HIS B C     1 
ATOM   4469 O  O     . HIS B 1 97  ? 47.075  17.487  0.602   1.00 40.90  ? 97  HIS B O     1 
ATOM   4470 C  CB    . HIS B 1 97  ? 45.096  18.582  -1.423  1.00 41.61  ? 97  HIS B CB    1 
ATOM   4471 C  CG    . HIS B 1 97  ? 45.288  20.061  -1.294  1.00 42.55  ? 97  HIS B CG    1 
ATOM   4472 N  ND1   . HIS B 1 97  ? 45.536  20.673  -0.085  1.00 42.63  ? 97  HIS B ND1   1 
ATOM   4473 C  CD2   . HIS B 1 97  ? 45.332  21.042  -2.228  1.00 43.68  ? 97  HIS B CD2   1 
ATOM   4474 C  CE1   . HIS B 1 97  ? 45.708  21.970  -0.275  1.00 42.95  ? 97  HIS B CE1   1 
ATOM   4475 N  NE2   . HIS B 1 97  ? 45.589  22.221  -1.567  1.00 45.73  ? 97  HIS B NE2   1 
ATOM   4476 N  N     . PRO B 1 98  ? 48.438  18.777  -0.660  1.00 43.90  ? 98  PRO B N     1 
ATOM   4477 C  CA    . PRO B 1 98  ? 49.455  18.878  0.392   1.00 44.13  ? 98  PRO B CA    1 
ATOM   4478 C  C     . PRO B 1 98  ? 49.007  19.754  1.551   1.00 43.97  ? 98  PRO B C     1 
ATOM   4479 O  O     . PRO B 1 98  ? 48.455  20.831  1.328   1.00 44.60  ? 98  PRO B O     1 
ATOM   4480 C  CB    . PRO B 1 98  ? 50.649  19.509  -0.331  1.00 46.15  ? 98  PRO B CB    1 
ATOM   4481 C  CG    . PRO B 1 98  ? 50.033  20.331  -1.430  1.00 47.98  ? 98  PRO B CG    1 
ATOM   4482 C  CD    . PRO B 1 98  ? 48.767  19.604  -1.838  1.00 45.74  ? 98  PRO B CD    1 
ATOM   4483 N  N     . TYR B 1 99  ? 49.236  19.287  2.777   1.00 43.51  ? 99  TYR B N     1 
ATOM   4484 C  CA    . TYR B 1 99  ? 49.012  20.112  3.983   1.00 44.51  ? 99  TYR B CA    1 
ATOM   4485 C  C     . TYR B 1 99  ? 49.929  19.652  5.117   1.00 45.28  ? 99  TYR B C     1 
ATOM   4486 O  O     . TYR B 1 99  ? 50.671  18.683  4.967   1.00 45.94  ? 99  TYR B O     1 
ATOM   4487 C  CB    . TYR B 1 99  ? 47.531  20.092  4.417   1.00 43.06  ? 99  TYR B CB    1 
ATOM   4488 C  CG    . TYR B 1 99  ? 47.027  18.741  4.880   1.00 43.02  ? 99  TYR B CG    1 
ATOM   4489 C  CD1   . TYR B 1 99  ? 46.880  18.461  6.242   1.00 43.44  ? 99  TYR B CD1   1 
ATOM   4490 C  CD2   . TYR B 1 99  ? 46.676  17.751  3.959   1.00 40.00  ? 99  TYR B CD2   1 
ATOM   4491 C  CE1   . TYR B 1 99  ? 46.420  17.235  6.673   1.00 41.70  ? 99  TYR B CE1   1 
ATOM   4492 C  CE2   . TYR B 1 99  ? 46.219  16.498  4.388   1.00 41.13  ? 99  TYR B CE2   1 
ATOM   4493 C  CZ    . TYR B 1 99  ? 46.091  16.260  5.746   1.00 40.91  ? 99  TYR B CZ    1 
ATOM   4494 O  OH    . TYR B 1 99  ? 45.632  15.063  6.182   1.00 41.59  ? 99  TYR B OH    1 
ATOM   4495 N  N     . VAL B 1 100 ? 49.893  20.361  6.243   1.00 46.48  ? 100 VAL B N     1 
ATOM   4496 C  CA    . VAL B 1 100 ? 50.662  19.951  7.423   1.00 47.67  ? 100 VAL B CA    1 
ATOM   4497 C  C     . VAL B 1 100 ? 49.730  19.719  8.610   1.00 47.53  ? 100 VAL B C     1 
ATOM   4498 O  O     . VAL B 1 100 ? 48.979  20.606  8.993   1.00 47.43  ? 100 VAL B O     1 
ATOM   4499 C  CB    . VAL B 1 100 ? 51.784  20.971  7.805   1.00 49.96  ? 100 VAL B CB    1 
ATOM   4500 C  CG1   . VAL B 1 100 ? 52.649  20.419  8.921   1.00 52.17  ? 100 VAL B CG1   1 
ATOM   4501 C  CG2   . VAL B 1 100 ? 52.658  21.308  6.610   1.00 49.93  ? 100 VAL B CG2   1 
ATOM   4502 N  N     . HIS B 1 101 ? 49.768  18.510  9.167   1.00 47.63  ? 101 HIS B N     1 
ATOM   4503 C  CA    . HIS B 1 101 ? 49.118  18.256  10.449  1.00 48.94  ? 101 HIS B CA    1 
ATOM   4504 C  C     . HIS B 1 101 ? 50.152  18.416  11.555  1.00 52.11  ? 101 HIS B C     1 
ATOM   4505 O  O     . HIS B 1 101 ? 51.317  18.053  11.379  1.00 52.96  ? 101 HIS B O     1 
ATOM   4506 C  CB    . HIS B 1 101 ? 48.478  16.871  10.493  1.00 48.30  ? 101 HIS B CB    1 
ATOM   4507 C  CG    . HIS B 1 101 ? 47.665  16.622  11.728  1.00 50.46  ? 101 HIS B CG    1 
ATOM   4508 N  ND1   . HIS B 1 101 ? 46.444  17.221  11.950  1.00 51.25  ? 101 HIS B ND1   1 
ATOM   4509 C  CD2   . HIS B 1 101 ? 47.895  15.830  12.803  1.00 53.98  ? 101 HIS B CD2   1 
ATOM   4510 C  CE1   . HIS B 1 101 ? 45.958  16.814  13.109  1.00 53.16  ? 101 HIS B CE1   1 
ATOM   4511 N  NE2   . HIS B 1 101 ? 46.819  15.969  13.648  1.00 55.07  ? 101 HIS B NE2   1 
ATOM   4512 N  N     . GLY B 1 102 ? 49.733  18.984  12.682  1.00 54.30  ? 102 GLY B N     1 
ATOM   4513 C  CA    . GLY B 1 102 ? 50.641  19.199  13.800  1.00 58.09  ? 102 GLY B CA    1 
ATOM   4514 C  C     . GLY B 1 102 ? 49.990  19.534  15.126  1.00 61.14  ? 102 GLY B C     1 
ATOM   4515 O  O     . GLY B 1 102 ? 48.777  19.364  15.301  1.00 59.87  ? 102 GLY B O     1 
ATOM   4516 N  N     . VAL B 1 103 ? 50.817  20.015  16.057  1.00 65.37  ? 103 VAL B N     1 
ATOM   4517 C  CA    . VAL B 1 103 ? 50.399  20.327  17.425  1.00 69.54  ? 103 VAL B CA    1 
ATOM   4518 C  C     . VAL B 1 103 ? 50.928  21.704  17.821  1.00 72.84  ? 103 VAL B C     1 
ATOM   4519 O  O     . VAL B 1 103 ? 52.083  22.032  17.539  1.00 73.93  ? 103 VAL B O     1 
ATOM   4520 C  CB    . VAL B 1 103 ? 50.930  19.279  18.455  1.00 73.41  ? 103 VAL B CB    1 
ATOM   4521 C  CG1   . VAL B 1 103 ? 50.322  19.517  19.835  1.00 77.66  ? 103 VAL B CG1   1 
ATOM   4522 C  CG2   . VAL B 1 103 ? 50.660  17.844  17.996  1.00 70.72  ? 103 VAL B CG2   1 
ATOM   4523 N  N     . VAL B 1 104 ? 50.072  22.503  18.454  1.00 74.89  ? 104 VAL B N     1 
ATOM   4524 C  CA    . VAL B 1 104 ? 50.475  23.768  19.074  1.00 79.55  ? 104 VAL B CA    1 
ATOM   4525 C  C     . VAL B 1 104 ? 49.859  23.868  20.475  1.00 84.35  ? 104 VAL B C     1 
ATOM   4526 O  O     . VAL B 1 104 ? 48.632  23.874  20.629  1.00 83.72  ? 104 VAL B O     1 
ATOM   4527 C  CB    . VAL B 1 104 ? 50.122  25.003  18.191  1.00 77.85  ? 104 VAL B CB    1 
ATOM   4528 C  CG1   . VAL B 1 104 ? 50.032  26.282  19.026  1.00 82.45  ? 104 VAL B CG1   1 
ATOM   4529 C  CG2   . VAL B 1 104 ? 51.150  25.166  17.070  1.00 75.81  ? 104 VAL B CG2   1 
ATOM   4530 N  N     . LYS B 1 105 ? 50.734  23.917  21.481  1.00 89.77  ? 105 LYS B N     1 
ATOM   4531 C  CA    . LYS B 1 105 ? 50.366  23.931  22.908  1.00 95.49  ? 105 LYS B CA    1 
ATOM   4532 C  C     . LYS B 1 105 ? 49.321  22.874  23.295  1.00 94.75  ? 105 LYS B C     1 
ATOM   4533 O  O     . LYS B 1 105 ? 48.466  23.104  24.156  1.00 98.09  ? 105 LYS B O     1 
ATOM   4534 C  CB    . LYS B 1 105 ? 49.958  25.343  23.363  1.00 98.93  ? 105 LYS B CB    1 
ATOM   4535 C  CG    . LYS B 1 105 ? 51.070  26.380  23.194  1.00 101.32 ? 105 LYS B CG    1 
ATOM   4536 C  CD    . LYS B 1 105 ? 50.749  27.695  23.880  1.00 106.71 ? 105 LYS B CD    1 
ATOM   4537 C  CE    . LYS B 1 105 ? 51.138  27.665  25.354  1.00 114.45 ? 105 LYS B CE    1 
ATOM   4538 N  NZ    . LYS B 1 105 ? 50.980  28.993  26.010  1.00 120.37 ? 105 LYS B NZ    1 
ATOM   4539 N  N     . GLY B 1 106 ? 49.414  21.710  22.648  1.00 90.86  ? 106 GLY B N     1 
ATOM   4540 C  CA    . GLY B 1 106 ? 48.560  20.564  22.953  1.00 90.44  ? 106 GLY B CA    1 
ATOM   4541 C  C     . GLY B 1 106 ? 47.311  20.423  22.101  1.00 85.35  ? 106 GLY B C     1 
ATOM   4542 O  O     . GLY B 1 106 ? 46.483  19.552  22.366  1.00 85.44  ? 106 GLY B O     1 
ATOM   4543 N  N     . VAL B 1 107 ? 47.176  21.272  21.083  1.00 81.61  ? 107 VAL B N     1 
ATOM   4544 C  CA    . VAL B 1 107 ? 46.001  21.268  20.202  1.00 77.45  ? 107 VAL B CA    1 
ATOM   4545 C  C     . VAL B 1 107 ? 46.379  20.851  18.780  1.00 72.41  ? 107 VAL B C     1 
ATOM   4546 O  O     . VAL B 1 107 ? 47.349  21.370  18.214  1.00 71.56  ? 107 VAL B O     1 
ATOM   4547 C  CB    . VAL B 1 107 ? 45.292  22.654  20.171  1.00 78.32  ? 107 VAL B CB    1 
ATOM   4548 C  CG1   . VAL B 1 107 ? 44.185  22.684  19.125  1.00 73.97  ? 107 VAL B CG1   1 
ATOM   4549 C  CG2   . VAL B 1 107 ? 44.722  23.001  21.535  1.00 83.59  ? 107 VAL B CG2   1 
ATOM   4550 N  N     . GLU B 1 108 ? 45.611  19.910  18.223  1.00 69.47  ? 108 GLU B N     1 
ATOM   4551 C  CA    . GLU B 1 108 ? 45.770  19.463  16.833  1.00 65.21  ? 108 GLU B CA    1 
ATOM   4552 C  C     . GLU B 1 108 ? 45.501  20.605  15.854  1.00 62.97  ? 108 GLU B C     1 
ATOM   4553 O  O     . GLU B 1 108 ? 44.556  21.381  16.046  1.00 63.50  ? 108 GLU B O     1 
ATOM   4554 C  CB    . GLU B 1 108 ? 44.811  18.306  16.511  1.00 63.32  ? 108 GLU B CB    1 
ATOM   4555 C  CG    . GLU B 1 108 ? 44.783  17.158  17.518  1.00 67.24  ? 108 GLU B CG    1 
ATOM   4556 C  CD    . GLU B 1 108 ? 45.955  16.213  17.370  1.00 68.42  ? 108 GLU B CD    1 
ATOM   4557 O  OE1   . GLU B 1 108 ? 45.855  15.254  16.573  1.00 67.01  ? 108 GLU B OE1   1 
ATOM   4558 O  OE2   . GLU B 1 108 ? 46.973  16.424  18.063  1.00 71.51  ? 108 GLU B OE2   1 
ATOM   4559 N  N     . VAL B 1 109 ? 46.324  20.699  14.806  1.00 60.86  ? 109 VAL B N     1 
ATOM   4560 C  CA    . VAL B 1 109 ? 46.134  21.712  13.750  1.00 59.43  ? 109 VAL B CA    1 
ATOM   4561 C  C     . VAL B 1 109 ? 46.409  21.171  12.334  1.00 56.12  ? 109 VAL B C     1 
ATOM   4562 O  O     . VAL B 1 109 ? 47.329  20.372  12.131  1.00 55.51  ? 109 VAL B O     1 
ATOM   4563 C  CB    . VAL B 1 109 ? 47.009  22.986  13.973  1.00 61.78  ? 109 VAL B CB    1 
ATOM   4564 C  CG1   . VAL B 1 109 ? 46.528  24.125  13.082  1.00 61.61  ? 109 VAL B CG1   1 
ATOM   4565 C  CG2   . VAL B 1 109 ? 46.989  23.439  15.432  1.00 66.06  ? 109 VAL B CG2   1 
ATOM   4566 N  N     . ASP B 1 110 ? 45.597  21.620  11.373  1.00 54.44  ? 110 ASP B N     1 
ATOM   4567 C  CA    . ASP B 1 110 ? 45.873  21.469  9.946   1.00 52.08  ? 110 ASP B CA    1 
ATOM   4568 C  C     . ASP B 1 110 ? 46.256  22.822  9.354   1.00 52.70  ? 110 ASP B C     1 
ATOM   4569 O  O     . ASP B 1 110 ? 45.473  23.772  9.428   1.00 54.05  ? 110 ASP B O     1 
ATOM   4570 C  CB    . ASP B 1 110 ? 44.625  21.014  9.203   1.00 50.42  ? 110 ASP B CB    1 
ATOM   4571 C  CG    . ASP B 1 110 ? 44.334  19.559  9.378   1.00 50.48  ? 110 ASP B CG    1 
ATOM   4572 O  OD1   . ASP B 1 110 ? 45.259  18.783  9.715   1.00 51.60  ? 110 ASP B OD1   1 
ATOM   4573 O  OD2   . ASP B 1 110 ? 43.163  19.196  9.159   1.00 51.10  ? 110 ASP B OD2   1 
ATOM   4574 N  N     . VAL B 1 111 ? 47.434  22.901  8.743   1.00 52.35  ? 111 VAL B N     1 
ATOM   4575 C  CA    . VAL B 1 111 ? 47.812  24.082  7.958   1.00 53.14  ? 111 VAL B CA    1 
ATOM   4576 C  C     . VAL B 1 111 ? 47.737  23.716  6.467   1.00 51.36  ? 111 VAL B C     1 
ATOM   4577 O  O     . VAL B 1 111 ? 48.495  22.853  5.978   1.00 50.12  ? 111 VAL B O     1 
ATOM   4578 C  CB    . VAL B 1 111 ? 49.212  24.631  8.341   1.00 55.42  ? 111 VAL B CB    1 
ATOM   4579 C  CG1   . VAL B 1 111 ? 49.456  25.969  7.679   1.00 57.43  ? 111 VAL B CG1   1 
ATOM   4580 C  CG2   . VAL B 1 111 ? 49.352  24.759  9.856   1.00 57.31  ? 111 VAL B CG2   1 
ATOM   4581 N  N     . VAL B 1 112 ? 46.802  24.362  5.766   1.00 51.46  ? 112 VAL B N     1 
ATOM   4582 C  CA    . VAL B 1 112 ? 46.436  23.999  4.395   1.00 50.36  ? 112 VAL B CA    1 
ATOM   4583 C  C     . VAL B 1 112 ? 46.663  25.120  3.380   1.00 52.99  ? 112 VAL B C     1 
ATOM   4584 O  O     . VAL B 1 112 ? 46.072  26.205  3.488   1.00 54.90  ? 112 VAL B O     1 
ATOM   4585 C  CB    . VAL B 1 112 ? 44.963  23.485  4.304   1.00 49.49  ? 112 VAL B CB    1 
ATOM   4586 C  CG1   . VAL B 1 112 ? 44.704  22.848  2.948   1.00 48.79  ? 112 VAL B CG1   1 
ATOM   4587 C  CG2   . VAL B 1 112 ? 44.667  22.468  5.409   1.00 46.90  ? 112 VAL B CG2   1 
ATOM   4588 N  N     . PRO B 1 113 ? 47.539  24.876  2.393   1.00 53.23  ? 113 PRO B N     1 
ATOM   4589 C  CA    . PRO B 1 113 ? 47.698  25.876  1.335   1.00 55.99  ? 113 PRO B CA    1 
ATOM   4590 C  C     . PRO B 1 113 ? 46.506  25.861  0.374   1.00 56.29  ? 113 PRO B C     1 
ATOM   4591 O  O     . PRO B 1 113 ? 45.906  24.807  0.150   1.00 53.91  ? 113 PRO B O     1 
ATOM   4592 C  CB    . PRO B 1 113 ? 48.968  25.420  0.612   1.00 55.89  ? 113 PRO B CB    1 
ATOM   4593 C  CG    . PRO B 1 113 ? 49.046  23.958  0.856   1.00 53.39  ? 113 PRO B CG    1 
ATOM   4594 C  CD    . PRO B 1 113 ? 48.422  23.710  2.203   1.00 51.72  ? 113 PRO B CD    1 
ATOM   4595 N  N     . CYS B 1 114 ? 46.166  27.021  -0.179  1.00 59.51  ? 114 CYS B N     1 
ATOM   4596 C  CA    . CYS B 1 114 ? 45.128  27.100  -1.206  1.00 61.13  ? 114 CYS B CA    1 
ATOM   4597 C  C     . CYS B 1 114 ? 45.272  28.357  -2.051  1.00 65.35  ? 114 CYS B C     1 
ATOM   4598 O  O     . CYS B 1 114 ? 46.038  29.265  -1.712  1.00 67.26  ? 114 CYS B O     1 
ATOM   4599 C  CB    . CYS B 1 114 ? 43.727  27.019  -0.589  1.00 60.60  ? 114 CYS B CB    1 
ATOM   4600 S  SG    . CYS B 1 114 ? 43.106  28.567  0.050   1.00 65.79  ? 114 CYS B SG    1 
ATOM   4601 N  N     . TYR B 1 115 ? 44.527  28.402  -3.153  1.00 67.30  ? 115 TYR B N     1 
ATOM   4602 C  CA    . TYR B 1 115 ? 44.532  29.563  -4.037  1.00 72.17  ? 115 TYR B CA    1 
ATOM   4603 C  C     . TYR B 1 115 ? 43.440  30.564  -3.658  1.00 75.48  ? 115 TYR B C     1 
ATOM   4604 O  O     . TYR B 1 115 ? 42.267  30.198  -3.535  1.00 74.43  ? 115 TYR B O     1 
ATOM   4605 C  CB    . TYR B 1 115 ? 44.376  29.127  -5.497  1.00 73.55  ? 115 TYR B CB    1 
ATOM   4606 C  CG    . TYR B 1 115 ? 45.557  28.353  -6.040  1.00 72.11  ? 115 TYR B CG    1 
ATOM   4607 C  CD1   . TYR B 1 115 ? 45.480  26.970  -6.237  1.00 68.73  ? 115 TYR B CD1   1 
ATOM   4608 C  CD2   . TYR B 1 115 ? 46.757  28.998  -6.346  1.00 74.44  ? 115 TYR B CD2   1 
ATOM   4609 C  CE1   . TYR B 1 115 ? 46.569  26.252  -6.736  1.00 67.96  ? 115 TYR B CE1   1 
ATOM   4610 C  CE2   . TYR B 1 115 ? 47.848  28.294  -6.843  1.00 73.34  ? 115 TYR B CE2   1 
ATOM   4611 C  CZ    . TYR B 1 115 ? 47.749  26.924  -7.039  1.00 70.76  ? 115 TYR B CZ    1 
ATOM   4612 O  OH    . TYR B 1 115 ? 48.828  26.233  -7.533  1.00 70.19  ? 115 TYR B OH    1 
ATOM   4613 N  N     . LYS B 1 116 ? 43.836  31.825  -3.466  1.00 79.90  ? 116 LYS B N     1 
ATOM   4614 C  CA    . LYS B 1 116 ? 42.894  32.904  -3.150  1.00 84.32  ? 116 LYS B CA    1 
ATOM   4615 C  C     . LYS B 1 116 ? 42.259  33.408  -4.436  1.00 89.88  ? 116 LYS B C     1 
ATOM   4616 O  O     . LYS B 1 116 ? 42.700  34.407  -5.018  1.00 95.10  ? 116 LYS B O     1 
ATOM   4617 C  CB    . LYS B 1 116 ? 43.590  34.058  -2.412  1.00 87.08  ? 116 LYS B CB    1 
ATOM   4618 C  CG    . LYS B 1 116 ? 42.639  35.139  -1.892  1.00 90.77  ? 116 LYS B CG    1 
ATOM   4619 C  CD    . LYS B 1 116 ? 43.339  36.486  -1.753  1.00 95.15  ? 116 LYS B CD    1 
ATOM   4620 C  CE    . LYS B 1 116 ? 42.352  37.581  -1.385  1.00 100.21 ? 116 LYS B CE    1 
ATOM   4621 N  NZ    . LYS B 1 116 ? 42.969  38.949  -1.424  1.00 105.99 ? 116 LYS B NZ    1 
ATOM   4622 N  N     . LEU B 1 117 ? 41.222  32.710  -4.882  1.00 89.69  ? 117 LEU B N     1 
ATOM   4623 C  CA    . LEU B 1 117 ? 40.561  33.071  -6.129  1.00 95.54  ? 117 LEU B CA    1 
ATOM   4624 C  C     . LEU B 1 117 ? 39.270  33.866  -5.905  1.00 100.00 ? 117 LEU B C     1 
ATOM   4625 O  O     . LEU B 1 117 ? 38.771  33.963  -4.781  1.00 98.38  ? 117 LEU B O     1 
ATOM   4626 C  CB    . LEU B 1 117 ? 40.346  31.830  -7.016  1.00 93.36  ? 117 LEU B CB    1 
ATOM   4627 C  CG    . LEU B 1 117 ? 39.338  30.708  -6.746  1.00 89.81  ? 117 LEU B CG    1 
ATOM   4628 C  CD1   . LEU B 1 117 ? 39.434  29.689  -7.872  1.00 89.44  ? 117 LEU B CD1   1 
ATOM   4629 C  CD2   . LEU B 1 117 ? 39.532  30.019  -5.401  1.00 84.18  ? 117 LEU B CD2   1 
ATOM   4630 N  N     . LYS B 1 118 ? 38.771  34.471  -6.977  1.00 106.69 ? 118 LYS B N     1 
ATOM   4631 C  CA    . LYS B 1 118 ? 37.447  35.075  -6.986  1.00 111.87 ? 118 LYS B CA    1 
ATOM   4632 C  C     . LYS B 1 118 ? 36.512  34.060  -7.634  1.00 111.05 ? 118 LYS B C     1 
ATOM   4633 O  O     . LYS B 1 118 ? 36.796  33.571  -8.734  1.00 112.03 ? 118 LYS B O     1 
ATOM   4634 C  CB    . LYS B 1 118 ? 37.459  36.397  -7.762  1.00 120.27 ? 118 LYS B CB    1 
ATOM   4635 C  CG    . LYS B 1 118 ? 37.734  37.648  -6.911  1.00 124.29 ? 118 LYS B CG    1 
ATOM   4636 C  CD    . LYS B 1 118 ? 39.124  37.659  -6.250  1.00 121.77 ? 118 LYS B CD    1 
ATOM   4637 C  CE    . LYS B 1 118 ? 40.198  38.272  -7.150  1.00 126.42 ? 118 LYS B CE    1 
ATOM   4638 N  NZ    . LYS B 1 118 ? 40.791  37.276  -8.090  1.00 123.71 ? 118 LYS B NZ    1 
ATOM   4639 N  N     . GLU B 1 119 ? 35.422  33.728  -6.939  1.00 109.77 ? 119 GLU B N     1 
ATOM   4640 C  CA    . GLU B 1 119 ? 34.497  32.656  -7.342  1.00 108.30 ? 119 GLU B CA    1 
ATOM   4641 C  C     . GLU B 1 119 ? 35.105  31.258  -7.180  1.00 101.30 ? 119 GLU B C     1 
ATOM   4642 O  O     . GLU B 1 119 ? 36.147  30.962  -7.768  1.00 99.96  ? 119 GLU B O     1 
ATOM   4643 C  CB    . GLU B 1 119 ? 33.990  32.855  -8.778  1.00 114.69 ? 119 GLU B CB    1 
ATOM   4644 C  CG    . GLU B 1 119 ? 32.808  33.809  -8.904  1.00 122.09 ? 119 GLU B CG    1 
ATOM   4645 C  CD    . GLU B 1 119 ? 31.506  33.191  -8.416  1.00 121.74 ? 119 GLU B CD    1 
ATOM   4646 O  OE1   . GLU B 1 119 ? 31.299  31.972  -8.620  1.00 118.30 ? 119 GLU B OE1   1 
ATOM   4647 O  OE2   . GLU B 1 119 ? 30.690  33.925  -7.823  1.00 125.19 ? 119 GLU B OE2   1 
ATOM   4648 N  N     . PRO B 1 120 ? 34.452  30.393  -6.379  1.00 97.26  ? 120 PRO B N     1 
ATOM   4649 C  CA    . PRO B 1 120 ? 34.881  28.999  -6.196  1.00 91.49  ? 120 PRO B CA    1 
ATOM   4650 C  C     . PRO B 1 120 ? 34.395  28.063  -7.310  1.00 92.51  ? 120 PRO B C     1 
ATOM   4651 O  O     . PRO B 1 120 ? 34.245  26.861  -7.088  1.00 88.96  ? 120 PRO B O     1 
ATOM   4652 C  CB    . PRO B 1 120 ? 34.263  28.610  -4.841  1.00 88.05  ? 120 PRO B CB    1 
ATOM   4653 C  CG    . PRO B 1 120 ? 33.476  29.833  -4.377  1.00 92.61  ? 120 PRO B CG    1 
ATOM   4654 C  CD    . PRO B 1 120 ? 33.268  30.696  -5.563  1.00 98.67  ? 120 PRO B CD    1 
ATOM   4655 N  N     . LYS B 1 121 ? 34.152  28.625  -8.490  1.00 98.32  ? 121 LYS B N     1 
ATOM   4656 C  CA    . LYS B 1 121 ? 33.871  27.854  -9.696  1.00 100.48 ? 121 LYS B CA    1 
ATOM   4657 C  C     . LYS B 1 121 ? 35.162  27.671  -10.482 1.00 99.96  ? 121 LYS B C     1 
ATOM   4658 O  O     . LYS B 1 121 ? 36.093  28.473  -10.339 1.00 100.22 ? 121 LYS B O     1 
ATOM   4659 C  CB    . LYS B 1 121 ? 32.837  28.579  -10.562 1.00 108.04 ? 121 LYS B CB    1 
ATOM   4660 C  CG    . LYS B 1 121 ? 31.392  28.253  -10.227 1.00 109.82 ? 121 LYS B CG    1 
ATOM   4661 C  CD    . LYS B 1 121 ? 30.973  26.903  -10.813 1.00 109.64 ? 121 LYS B CD    1 
ATOM   4662 C  CE    . LYS B 1 121 ? 29.466  26.698  -10.727 1.00 113.06 ? 121 LYS B CE    1 
ATOM   4663 N  NZ    . LYS B 1 121 ? 28.997  26.519  -9.324  1.00 109.15 ? 121 LYS B NZ    1 
ATOM   4664 N  N     . ASN B 1 122 ? 35.213  26.621  -11.306 1.00 99.65  ? 122 ASN B N     1 
ATOM   4665 C  CA    . ASN B 1 122 ? 36.398  26.302  -12.113 1.00 99.49  ? 122 ASN B CA    1 
ATOM   4666 C  C     . ASN B 1 122 ? 37.640  26.111  -11.221 1.00 93.46  ? 122 ASN B C     1 
ATOM   4667 O  O     . ASN B 1 122 ? 38.743  26.569  -11.538 1.00 94.27  ? 122 ASN B O     1 
ATOM   4668 C  CB    . ASN B 1 122 ? 36.613  27.385  -13.186 1.00 106.63 ? 122 ASN B CB    1 
ATOM   4669 C  CG    . ASN B 1 122 ? 37.514  26.930  -14.326 1.00 108.98 ? 122 ASN B CG    1 
ATOM   4670 O  OD1   . ASN B 1 122 ? 38.005  25.797  -14.345 1.00 105.46 ? 122 ASN B OD1   1 
ATOM   4671 N  ND2   . ASN B 1 122 ? 37.735  27.822  -15.288 1.00 115.34 ? 122 ASN B ND2   1 
ATOM   4672 N  N     . ILE B 1 123 ? 37.429  25.418  -10.105 1.00 87.71  ? 123 ILE B N     1 
ATOM   4673 C  CA    . ILE B 1 123 ? 38.418  25.259  -9.032  1.00 82.23  ? 123 ILE B CA    1 
ATOM   4674 C  C     . ILE B 1 123 ? 39.819  24.795  -9.477  1.00 80.44  ? 123 ILE B C     1 
ATOM   4675 O  O     . ILE B 1 123 ? 39.957  23.939  -10.356 1.00 81.27  ? 123 ILE B O     1 
ATOM   4676 C  CB    . ILE B 1 123 ? 37.813  24.411  -7.866  1.00 77.81  ? 123 ILE B CB    1 
ATOM   4677 C  CG1   . ILE B 1 123 ? 37.463  25.333  -6.694  1.00 77.58  ? 123 ILE B CG1   1 
ATOM   4678 C  CG2   . ILE B 1 123 ? 38.720  23.239  -7.439  1.00 73.46  ? 123 ILE B CG2   1 
ATOM   4679 C  CD1   . ILE B 1 123 ? 36.495  24.736  -5.692  1.00 75.91  ? 123 ILE B CD1   1 
ATOM   4680 N  N     . LYS B 1 124 ? 40.840  25.397  -8.863  1.00 78.35  ? 124 LYS B N     1 
ATOM   4681 C  CA    . LYS B 1 124 ? 42.248  25.180  -9.211  1.00 77.27  ? 124 LYS B CA    1 
ATOM   4682 C  C     . LYS B 1 124 ? 42.854  24.047  -8.379  1.00 71.61  ? 124 LYS B C     1 
ATOM   4683 O  O     . LYS B 1 124 ? 43.410  23.083  -8.925  1.00 71.00  ? 124 LYS B O     1 
ATOM   4684 C  CB    . LYS B 1 124 ? 43.037  26.475  -8.978  1.00 79.15  ? 124 LYS B CB    1 
ATOM   4685 C  CG    . LYS B 1 124 ? 44.432  26.526  -9.589  1.00 80.91  ? 124 LYS B CG    1 
ATOM   4686 C  CD    . LYS B 1 124 ? 44.471  27.408  -10.832 1.00 87.22  ? 124 LYS B CD    1 
ATOM   4687 C  CE    . LYS B 1 124 ? 45.741  28.255  -10.885 1.00 89.72  ? 124 LYS B CE    1 
ATOM   4688 N  NZ    . LYS B 1 124 ? 46.993  27.472  -11.093 1.00 87.81  ? 124 LYS B NZ    1 
ATOM   4689 N  N     . SER B 1 125 ? 42.751  24.192  -7.058  1.00 67.82  ? 125 SER B N     1 
ATOM   4690 C  CA    . SER B 1 125 ? 43.210  23.193  -6.096  1.00 62.83  ? 125 SER B CA    1 
ATOM   4691 C  C     . SER B 1 125 ? 42.000  22.543  -5.424  1.00 60.86  ? 125 SER B C     1 
ATOM   4692 O  O     . SER B 1 125 ? 40.930  23.155  -5.347  1.00 62.57  ? 125 SER B O     1 
ATOM   4693 C  CB    . SER B 1 125 ? 44.154  23.842  -5.077  1.00 61.51  ? 125 SER B CB    1 
ATOM   4694 O  OG    . SER B 1 125 ? 43.778  23.599  -3.735  1.00 57.16  ? 125 SER B OG    1 
ATOM   4695 N  N     . ALA B 1 126 ? 42.172  21.312  -4.943  1.00 57.52  ? 126 ALA B N     1 
ATOM   4696 C  CA    . ALA B 1 126 ? 41.055  20.511  -4.426  1.00 55.79  ? 126 ALA B CA    1 
ATOM   4697 C  C     . ALA B 1 126 ? 40.309  21.130  -3.231  1.00 54.76  ? 126 ALA B C     1 
ATOM   4698 O  O     . ALA B 1 126 ? 39.170  20.758  -2.953  1.00 54.69  ? 126 ALA B O     1 
ATOM   4699 C  CB    . ALA B 1 126 ? 41.521  19.099  -4.096  1.00 53.42  ? 126 ALA B CB    1 
ATOM   4700 N  N     . VAL B 1 127 ? 40.941  22.092  -2.558  1.00 54.33  ? 127 VAL B N     1 
ATOM   4701 C  CA    . VAL B 1 127 ? 40.417  22.627  -1.297  1.00 53.56  ? 127 VAL B CA    1 
ATOM   4702 C  C     . VAL B 1 127 ? 39.890  24.056  -1.409  1.00 56.59  ? 127 VAL B C     1 
ATOM   4703 O  O     . VAL B 1 127 ? 39.539  24.671  -0.399  1.00 56.83  ? 127 VAL B O     1 
ATOM   4704 C  CB    . VAL B 1 127 ? 41.486  22.560  -0.150  1.00 51.65  ? 127 VAL B CB    1 
ATOM   4705 C  CG1   . VAL B 1 127 ? 41.985  21.152  0.051   1.00 48.88  ? 127 VAL B CG1   1 
ATOM   4706 C  CG2   . VAL B 1 127 ? 42.652  23.532  -0.408  1.00 52.42  ? 127 VAL B CG2   1 
ATOM   4707 N  N     . ASP B 1 128 ? 39.817  24.569  -2.635  1.00 59.25  ? 128 ASP B N     1 
ATOM   4708 C  CA    . ASP B 1 128 ? 39.558  25.997  -2.876  1.00 63.36  ? 128 ASP B CA    1 
ATOM   4709 C  C     . ASP B 1 128 ? 38.196  26.542  -2.427  1.00 65.52  ? 128 ASP B C     1 
ATOM   4710 O  O     . ASP B 1 128 ? 38.046  27.760  -2.267  1.00 68.67  ? 128 ASP B O     1 
ATOM   4711 C  CB    . ASP B 1 128 ? 39.796  26.351  -4.349  1.00 66.45  ? 128 ASP B CB    1 
ATOM   4712 C  CG    . ASP B 1 128 ? 41.257  26.335  -4.724  1.00 65.47  ? 128 ASP B CG    1 
ATOM   4713 O  OD1   . ASP B 1 128 ? 42.104  26.162  -3.822  1.00 62.55  ? 128 ASP B OD1   1 
ATOM   4714 O  OD2   . ASP B 1 128 ? 41.556  26.500  -5.924  1.00 67.48  ? 128 ASP B OD2   1 
ATOM   4715 N  N     . ARG B 1 129 ? 37.208  25.672  -2.228  1.00 64.57  ? 129 ARG B N     1 
ATOM   4716 C  CA    . ARG B 1 129 ? 35.891  26.174  -1.820  1.00 67.16  ? 129 ARG B CA    1 
ATOM   4717 C  C     . ARG B 1 129 ? 35.703  26.320  -0.304  1.00 65.93  ? 129 ARG B C     1 
ATOM   4718 O  O     . ARG B 1 129 ? 34.761  26.978  0.149   1.00 68.77  ? 129 ARG B O     1 
ATOM   4719 C  CB    . ARG B 1 129 ? 34.726  25.437  -2.507  1.00 68.35  ? 129 ARG B CB    1 
ATOM   4720 C  CG    . ARG B 1 129 ? 34.792  23.948  -2.521  1.00 64.98  ? 129 ARG B CG    1 
ATOM   4721 C  CD    . ARG B 1 129 ? 33.511  23.357  -3.119  1.00 67.25  ? 129 ARG B CD    1 
ATOM   4722 N  NE    . ARG B 1 129 ? 33.649  22.910  -4.508  1.00 68.44  ? 129 ARG B NE    1 
ATOM   4723 C  CZ    . ARG B 1 129 ? 34.172  21.739  -4.881  1.00 65.48  ? 129 ARG B CZ    1 
ATOM   4724 N  NH1   . ARG B 1 129 ? 34.643  20.890  -3.977  1.00 61.21  ? 129 ARG B NH1   1 
ATOM   4725 N  NH2   . ARG B 1 129 ? 34.241  21.419  -6.168  1.00 67.36  ? 129 ARG B NH2   1 
ATOM   4726 N  N     . THR B 1 130 ? 36.643  25.768  0.456   1.00 62.56  ? 130 THR B N     1 
ATOM   4727 C  CA    . THR B 1 130 ? 36.621  25.791  1.926   1.00 62.00  ? 130 THR B CA    1 
ATOM   4728 C  C     . THR B 1 130 ? 36.528  27.160  2.623   1.00 65.64  ? 130 THR B C     1 
ATOM   4729 O  O     . THR B 1 130 ? 35.748  27.296  3.570   1.00 67.37  ? 130 THR B O     1 
ATOM   4730 C  CB    . THR B 1 130 ? 37.806  24.998  2.498   1.00 58.23  ? 130 THR B CB    1 
ATOM   4731 O  OG1   . THR B 1 130 ? 37.707  23.636  2.062   1.00 56.40  ? 130 THR B OG1   1 
ATOM   4732 C  CG2   . THR B 1 130 ? 37.825  25.057  4.019   1.00 57.55  ? 130 THR B CG2   1 
ATOM   4733 N  N     . PRO B 1 131 ? 37.325  28.169  2.187   1.00 67.62  ? 131 PRO B N     1 
ATOM   4734 C  CA    . PRO B 1 131 ? 37.186  29.499  2.803   1.00 71.51  ? 131 PRO B CA    1 
ATOM   4735 C  C     . PRO B 1 131 ? 35.846  30.160  2.471   1.00 75.87  ? 131 PRO B C     1 
ATOM   4736 O  O     . PRO B 1 131 ? 35.331  30.960  3.262   1.00 78.57  ? 131 PRO B O     1 
ATOM   4737 C  CB    . PRO B 1 131 ? 38.343  30.306  2.196   1.00 72.78  ? 131 PRO B CB    1 
ATOM   4738 C  CG    . PRO B 1 131 ? 39.245  29.306  1.542   1.00 69.21  ? 131 PRO B CG    1 
ATOM   4739 C  CD    . PRO B 1 131 ? 38.375  28.161  1.150   1.00 67.22  ? 131 PRO B CD    1 
ATOM   4740 N  N     . PHE B 1 132 ? 35.297  29.816  1.309   1.00 76.78  ? 132 PHE B N     1 
ATOM   4741 C  CA    . PHE B 1 132 ? 33.979  30.282  0.890   1.00 81.48  ? 132 PHE B CA    1 
ATOM   4742 C  C     . PHE B 1 132 ? 32.856  29.527  1.607   1.00 80.93  ? 132 PHE B C     1 
ATOM   4743 O  O     . PHE B 1 132 ? 31.776  30.085  1.834   1.00 84.84  ? 132 PHE B O     1 
ATOM   4744 C  CB    . PHE B 1 132 ? 33.832  30.157  -0.625  1.00 83.01  ? 132 PHE B CB    1 
ATOM   4745 C  CG    . PHE B 1 132 ? 34.768  31.043  -1.398  1.00 85.59  ? 132 PHE B CG    1 
ATOM   4746 C  CD1   . PHE B 1 132 ? 36.017  30.576  -1.803  1.00 81.71  ? 132 PHE B CD1   1 
ATOM   4747 C  CD2   . PHE B 1 132 ? 34.401  32.347  -1.724  1.00 91.05  ? 132 PHE B CD2   1 
ATOM   4748 C  CE1   . PHE B 1 132 ? 36.884  31.395  -2.517  1.00 84.82  ? 132 PHE B CE1   1 
ATOM   4749 C  CE2   . PHE B 1 132 ? 35.266  33.175  -2.439  1.00 94.02  ? 132 PHE B CE2   1 
ATOM   4750 C  CZ    . PHE B 1 132 ? 36.507  32.698  -2.836  1.00 90.57  ? 132 PHE B CZ    1 
ATOM   4751 N  N     . HIS B 1 133 ? 33.120  28.264  1.956   1.00 76.61  ? 133 HIS B N     1 
ATOM   4752 C  CA    . HIS B 1 133 ? 32.227  27.474  2.808   1.00 76.07  ? 133 HIS B CA    1 
ATOM   4753 C  C     . HIS B 1 133 ? 32.012  28.201  4.125   1.00 78.58  ? 133 HIS B C     1 
ATOM   4754 O  O     . HIS B 1 133 ? 30.895  28.246  4.649   1.00 81.36  ? 133 HIS B O     1 
ATOM   4755 C  CB    . HIS B 1 133 ? 32.815  26.091  3.109   1.00 71.02  ? 133 HIS B CB    1 
ATOM   4756 C  CG    . HIS B 1 133 ? 32.714  25.115  1.979   1.00 68.90  ? 133 HIS B CG    1 
ATOM   4757 N  ND1   . HIS B 1 133 ? 33.297  23.867  2.029   1.00 64.45  ? 133 HIS B ND1   1 
ATOM   4758 C  CD2   . HIS B 1 133 ? 32.111  25.200  0.769   1.00 70.65  ? 133 HIS B CD2   1 
ATOM   4759 C  CE1   . HIS B 1 133 ? 33.051  23.221  0.903   1.00 64.75  ? 133 HIS B CE1   1 
ATOM   4760 N  NE2   . HIS B 1 133 ? 32.332  24.008  0.122   1.00 68.35  ? 133 HIS B NE2   1 
ATOM   4761 N  N     . HIS B 1 134 ? 33.094  28.775  4.645   1.00 78.20  ? 134 HIS B N     1 
ATOM   4762 C  CA    . HIS B 1 134 ? 33.071  29.450  5.930   1.00 80.51  ? 134 HIS B CA    1 
ATOM   4763 C  C     . HIS B 1 134 ? 32.368  30.802  5.866   1.00 86.80  ? 134 HIS B C     1 
ATOM   4764 O  O     . HIS B 1 134 ? 31.684  31.195  6.813   1.00 89.73  ? 134 HIS B O     1 
ATOM   4765 C  CB    . HIS B 1 134 ? 34.486  29.613  6.479   1.00 78.20  ? 134 HIS B CB    1 
ATOM   4766 C  CG    . HIS B 1 134 ? 34.521  30.210  7.847   1.00 80.38  ? 134 HIS B CG    1 
ATOM   4767 N  ND1   . HIS B 1 134 ? 34.323  29.463  8.988   1.00 77.30  ? 134 HIS B ND1   1 
ATOM   4768 C  CD2   . HIS B 1 134 ? 34.682  31.494  8.256   1.00 83.69  ? 134 HIS B CD2   1 
ATOM   4769 C  CE1   . HIS B 1 134 ? 34.383  30.258  10.042  1.00 83.27  ? 134 HIS B CE1   1 
ATOM   4770 N  NE2   . HIS B 1 134 ? 34.599  31.494  9.626   1.00 84.52  ? 134 HIS B NE2   1 
ATOM   4771 N  N     . LYS B 1 135 ? 32.544  31.505  4.749   1.00 89.49  ? 135 LYS B N     1 
ATOM   4772 C  CA    . LYS B 1 135 ? 31.930  32.817  4.540   1.00 96.11  ? 135 LYS B CA    1 
ATOM   4773 C  C     . LYS B 1 135 ? 30.413  32.720  4.382   1.00 99.50  ? 135 LYS B C     1 
ATOM   4774 O  O     . LYS B 1 135 ? 29.697  33.688  4.640   1.00 105.07 ? 135 LYS B O     1 
ATOM   4775 C  CB    . LYS B 1 135 ? 32.544  33.512  3.320   1.00 98.08  ? 135 LYS B CB    1 
ATOM   4776 C  CG    . LYS B 1 135 ? 34.031  33.829  3.443   1.00 96.98  ? 135 LYS B CG    1 
ATOM   4777 C  CD    . LYS B 1 135 ? 34.300  34.949  4.437   1.00 101.70 ? 135 LYS B CD    1 
ATOM   4778 C  CE    . LYS B 1 135 ? 35.770  34.991  4.812   1.00 99.97  ? 135 LYS B CE    1 
ATOM   4779 N  NZ    . LYS B 1 135 ? 35.989  35.769  6.059   1.00 103.78 ? 135 LYS B NZ    1 
ATOM   4780 N  N     . TRP B 1 136 ? 29.938  31.553  3.949   1.00 96.64  ? 136 TRP B N     1 
ATOM   4781 C  CA    . TRP B 1 136 ? 28.507  31.277  3.836   1.00 99.82  ? 136 TRP B CA    1 
ATOM   4782 C  C     . TRP B 1 136 ? 27.905  30.939  5.197   1.00 100.09 ? 136 TRP B C     1 
ATOM   4783 O  O     . TRP B 1 136 ? 26.805  31.386  5.519   1.00 104.65 ? 136 TRP B O     1 
ATOM   4784 C  CB    . TRP B 1 136 ? 28.248  30.130  2.849   1.00 97.11  ? 136 TRP B CB    1 
ATOM   4785 C  CG    . TRP B 1 136 ? 26.830  30.078  2.345   1.00 101.53 ? 136 TRP B CG    1 
ATOM   4786 C  CD1   . TRP B 1 136 ? 26.297  30.809  1.319   1.00 106.81 ? 136 TRP B CD1   1 
ATOM   4787 C  CD2   . TRP B 1 136 ? 25.764  29.258  2.846   1.00 101.87 ? 136 TRP B CD2   1 
ATOM   4788 N  NE1   . TRP B 1 136 ? 24.969  30.494  1.149   1.00 109.94 ? 136 TRP B NE1   1 
ATOM   4789 C  CE2   . TRP B 1 136 ? 24.615  29.547  2.074   1.00 107.25 ? 136 TRP B CE2   1 
ATOM   4790 C  CE3   . TRP B 1 136 ? 25.666  28.308  3.873   1.00 98.63  ? 136 TRP B CE3   1 
ATOM   4791 C  CZ2   . TRP B 1 136 ? 23.384  28.917  2.295   1.00 109.39 ? 136 TRP B CZ2   1 
ATOM   4792 C  CZ3   . TRP B 1 136 ? 24.443  27.683  4.094   1.00 100.83 ? 136 TRP B CZ3   1 
ATOM   4793 C  CH2   . TRP B 1 136 ? 23.318  27.993  3.308   1.00 106.20 ? 136 TRP B CH2   1 
ATOM   4794 N  N     . LEU B 1 137 ? 28.632  30.152  5.987   1.00 95.64  ? 137 LEU B N     1 
ATOM   4795 C  CA    . LEU B 1 137 ? 28.148  29.677  7.285   1.00 96.14  ? 137 LEU B CA    1 
ATOM   4796 C  C     . LEU B 1 137 ? 28.319  30.679  8.426   1.00 99.82  ? 137 LEU B C     1 
ATOM   4797 O  O     . LEU B 1 137 ? 27.677  30.542  9.467   1.00 101.95 ? 137 LEU B O     1 
ATOM   4798 C  CB    . LEU B 1 137 ? 28.818  28.349  7.656   1.00 90.65  ? 137 LEU B CB    1 
ATOM   4799 C  CG    . LEU B 1 137 ? 28.188  27.016  7.221   1.00 88.65  ? 137 LEU B CG    1 
ATOM   4800 C  CD1   . LEU B 1 137 ? 27.752  27.005  5.767   1.00 89.31  ? 137 LEU B CD1   1 
ATOM   4801 C  CD2   . LEU B 1 137 ? 29.162  25.875  7.465   1.00 83.03  ? 137 LEU B CD2   1 
ATOM   4802 N  N     . GLU B 1 138 ? 29.180  31.677  8.219   1.00 101.06 ? 138 GLU B N     1 
ATOM   4803 C  CA    . GLU B 1 138 ? 29.509  32.701  9.221   1.00 105.02 ? 138 GLU B CA    1 
ATOM   4804 C  C     . GLU B 1 138 ? 28.392  33.030  10.213  1.00 110.10 ? 138 GLU B C     1 
ATOM   4805 O  O     . GLU B 1 138 ? 28.482  32.703  11.398  1.00 110.08 ? 138 GLU B O     1 
ATOM   4806 C  CB    . GLU B 1 138 ? 29.909  34.000  8.525   1.00 108.78 ? 138 GLU B CB    1 
ATOM   4807 C  CG    . GLU B 1 138 ? 31.369  34.137  8.172   1.00 105.84 ? 138 GLU B CG    1 
ATOM   4808 C  CD    . GLU B 1 138 ? 31.654  35.472  7.518   1.00 110.59 ? 138 GLU B CD    1 
ATOM   4809 O  OE1   . GLU B 1 138 ? 32.707  36.070  7.821   1.00 111.45 ? 138 GLU B OE1   1 
ATOM   4810 O  OE2   . GLU B 1 138 ? 30.814  35.930  6.709   1.00 114.02 ? 138 GLU B OE2   1 
ATOM   4811 N  N     . GLY B 1 139 ? 27.353  33.693  9.716   1.00 114.97 ? 139 GLY B N     1 
ATOM   4812 C  CA    . GLY B 1 139 ? 26.254  34.148  10.556  1.00 120.89 ? 139 GLY B CA    1 
ATOM   4813 C  C     . GLY B 1 139 ? 25.103  33.167  10.587  1.00 120.54 ? 139 GLY B C     1 
ATOM   4814 O  O     . GLY B 1 139 ? 24.407  33.052  11.595  1.00 123.58 ? 139 GLY B O     1 
ATOM   4815 N  N     . ARG B 1 140 ? 24.913  32.452  9.479   1.00 117.34 ? 140 ARG B N     1 
ATOM   4816 C  CA    . ARG B 1 140 ? 23.795  31.516  9.319   1.00 117.43 ? 140 ARG B CA    1 
ATOM   4817 C  C     . ARG B 1 140 ? 23.810  30.370  10.329  1.00 114.14 ? 140 ARG B C     1 
ATOM   4818 O  O     . ARG B 1 140 ? 22.765  29.783  10.614  1.00 116.26 ? 140 ARG B O     1 
ATOM   4819 C  CB    . ARG B 1 140 ? 23.748  30.962  7.891   1.00 114.73 ? 140 ARG B CB    1 
ATOM   4820 C  CG    . ARG B 1 140 ? 23.771  32.039  6.825   1.00 118.35 ? 140 ARG B CG    1 
ATOM   4821 C  CD    . ARG B 1 140 ? 23.426  31.502  5.457   1.00 117.60 ? 140 ARG B CD    1 
ATOM   4822 N  NE    . ARG B 1 140 ? 23.993  32.354  4.414   1.00 119.75 ? 140 ARG B NE    1 
ATOM   4823 C  CZ    . ARG B 1 140 ? 23.469  32.517  3.203   1.00 123.32 ? 140 ARG B CZ    1 
ATOM   4824 N  NH1   . ARG B 1 140 ? 22.347  31.892  2.865   1.00 125.48 ? 140 ARG B NH1   1 
ATOM   4825 N  NH2   . ARG B 1 140 ? 24.066  33.314  2.326   1.00 124.94 ? 140 ARG B NH2   1 
ATOM   4826 N  N     . ILE B 1 141 ? 24.987  30.070  10.875  1.00 109.56 ? 141 ILE B N     1 
ATOM   4827 C  CA    . ILE B 1 141 ? 25.142  28.984  11.846  1.00 106.69 ? 141 ILE B CA    1 
ATOM   4828 C  C     . ILE B 1 141 ? 25.086  29.442  13.316  1.00 110.31 ? 141 ILE B C     1 
ATOM   4829 O  O     . ILE B 1 141 ? 24.995  28.615  14.228  1.00 109.84 ? 141 ILE B O     1 
ATOM   4830 C  CB    . ILE B 1 141 ? 26.432  28.147  11.567  1.00 100.02 ? 141 ILE B CB    1 
ATOM   4831 C  CG1   . ILE B 1 141 ? 26.251  26.693  12.017  1.00 97.32  ? 141 ILE B CG1   1 
ATOM   4832 C  CG2   . ILE B 1 141 ? 27.665  28.794  12.202  1.00 99.21  ? 141 ILE B CG2   1 
ATOM   4833 C  CD1   . ILE B 1 141 ? 25.334  25.876  11.123  1.00 96.89  ? 141 ILE B CD1   1 
ATOM   4834 N  N     . LYS B 1 142 ? 25.138  30.758  13.536  1.00 114.30 ? 142 LYS B N     1 
ATOM   4835 C  CA    . LYS B 1 142 ? 25.032  31.333  14.882  1.00 118.68 ? 142 LYS B CA    1 
ATOM   4836 C  C     . LYS B 1 142 ? 23.675  31.032  15.518  1.00 122.92 ? 142 LYS B C     1 
ATOM   4837 O  O     . LYS B 1 142 ? 22.633  31.156  14.872  1.00 125.32 ? 142 LYS B O     1 
ATOM   4838 C  CB    . LYS B 1 142 ? 25.279  32.846  14.851  1.00 123.31 ? 142 LYS B CB    1 
ATOM   4839 C  CG    . LYS B 1 142 ? 26.748  33.253  14.989  1.00 120.77 ? 142 LYS B CG    1 
ATOM   4840 C  CD    . LYS B 1 142 ? 27.008  34.646  14.410  1.00 124.68 ? 142 LYS B CD    1 
ATOM   4841 C  CE    . LYS B 1 142 ? 26.299  35.747  15.206  1.00 133.01 ? 142 LYS B CE    1 
ATOM   4842 N  NZ    . LYS B 1 142 ? 26.227  37.028  14.444  1.00 137.72 ? 142 LYS B NZ    1 
ATOM   4843 N  N     . GLY B 1 143 ? 23.703  30.622  16.784  1.00 123.92 ? 143 GLY B N     1 
ATOM   4844 C  CA    . GLY B 1 143 ? 22.499  30.200  17.496  1.00 128.01 ? 143 GLY B CA    1 
ATOM   4845 C  C     . GLY B 1 143 ? 21.986  28.837  17.064  1.00 124.32 ? 143 GLY B C     1 
ATOM   4846 O  O     . GLY B 1 143 ? 20.904  28.419  17.476  1.00 128.13 ? 143 GLY B O     1 
ATOM   4847 N  N     . LYS B 1 144 ? 22.766  28.145  16.234  1.00 114.72 ? 144 LYS B N     1 
ATOM   4848 C  CA    . LYS B 1 144 ? 22.409  26.821  15.716  1.00 109.27 ? 144 LYS B CA    1 
ATOM   4849 C  C     . LYS B 1 144 ? 23.558  25.824  15.846  1.00 103.99 ? 144 LYS B C     1 
ATOM   4850 O  O     . LYS B 1 144 ? 23.447  24.677  15.406  1.00 99.61  ? 144 LYS B O     1 
ATOM   4851 C  CB    . LYS B 1 144 ? 21.986  26.921  14.248  1.00 108.46 ? 144 LYS B CB    1 
ATOM   4852 C  CG    . LYS B 1 144 ? 20.499  27.115  14.036  1.00 111.94 ? 144 LYS B CG    1 
ATOM   4853 C  CD    . LYS B 1 144 ? 20.205  27.620  12.629  1.00 113.51 ? 144 LYS B CD    1 
ATOM   4854 C  CE    . LYS B 1 144 ? 18.719  27.544  12.294  1.00 115.84 ? 144 LYS B CE    1 
ATOM   4855 N  NZ    . LYS B 1 144 ? 17.860  28.271  13.269  1.00 121.53 ? 144 LYS B NZ    1 
ATOM   4856 N  N     . GLU B 1 145 ? 24.655  26.263  16.457  1.00 104.34 ? 145 GLU B N     1 
ATOM   4857 C  CA    . GLU B 1 145 ? 25.877  25.456  16.555  1.00 99.86  ? 145 GLU B CA    1 
ATOM   4858 C  C     . GLU B 1 145 ? 25.745  24.213  17.448  1.00 97.09  ? 145 GLU B C     1 
ATOM   4859 O  O     . GLU B 1 145 ? 26.444  23.217  17.236  1.00 93.06  ? 145 GLU B O     1 
ATOM   4860 C  CB    . GLU B 1 145 ? 27.079  26.322  16.972  1.00 102.10 ? 145 GLU B CB    1 
ATOM   4861 C  CG    . GLU B 1 145 ? 26.940  27.057  18.295  1.00 106.64 ? 145 GLU B CG    1 
ATOM   4862 C  CD    . GLU B 1 145 ? 26.146  28.349  18.176  1.00 111.33 ? 145 GLU B CD    1 
ATOM   4863 O  OE1   . GLU B 1 145 ? 26.611  29.279  17.482  1.00 112.79 ? 145 GLU B OE1   1 
ATOM   4864 O  OE2   . GLU B 1 145 ? 25.058  28.430  18.782  1.00 113.64 ? 145 GLU B OE2   1 
ATOM   4865 N  N     . ASN B 1 146 ? 24.850  24.269  18.432  1.00 99.33  ? 146 ASN B N     1 
ATOM   4866 C  CA    . ASN B 1 146 ? 24.582  23.112  19.289  1.00 97.14  ? 146 ASN B CA    1 
ATOM   4867 C  C     . ASN B 1 146 ? 23.700  22.071  18.616  1.00 93.52  ? 146 ASN B C     1 
ATOM   4868 O  O     . ASN B 1 146 ? 23.781  20.878  18.934  1.00 90.57  ? 146 ASN B O     1 
ATOM   4869 C  CB    . ASN B 1 146 ? 23.984  23.539  20.630  1.00 101.93 ? 146 ASN B CB    1 
ATOM   4870 C  CG    . ASN B 1 146 ? 25.042  23.975  21.627  1.00 104.26 ? 146 ASN B CG    1 
ATOM   4871 O  OD1   . ASN B 1 146 ? 26.231  24.032  21.307  1.00 102.42 ? 146 ASN B OD1   1 
ATOM   4872 N  ND2   . ASN B 1 146 ? 24.614  24.280  22.845  1.00 108.13 ? 146 ASN B ND2   1 
ATOM   4873 N  N     . GLU B 1 147 ? 22.866  22.529  17.684  1.00 93.54  ? 147 GLU B N     1 
ATOM   4874 C  CA    . GLU B 1 147 ? 22.066  21.636  16.850  1.00 90.12  ? 147 GLU B CA    1 
ATOM   4875 C  C     . GLU B 1 147 ? 22.966  20.866  15.879  1.00 85.00  ? 147 GLU B C     1 
ATOM   4876 O  O     . GLU B 1 147 ? 22.666  19.726  15.512  1.00 81.71  ? 147 GLU B O     1 
ATOM   4877 C  CB    . GLU B 1 147 ? 20.994  22.422  16.090  1.00 92.83  ? 147 GLU B CB    1 
ATOM   4878 C  CG    . GLU B 1 147 ? 20.009  23.196  16.985  1.00 98.13  ? 147 GLU B CG    1 
ATOM   4879 C  CD    . GLU B 1 147 ? 19.069  22.296  17.789  1.00 98.84  ? 147 GLU B CD    1 
ATOM   4880 O  OE1   . GLU B 1 147 ? 18.827  21.136  17.380  1.00 95.42  ? 147 GLU B OE1   1 
ATOM   4881 O  OE2   . GLU B 1 147 ? 18.558  22.759  18.834  1.00 103.24 ? 147 GLU B OE2   1 
ATOM   4882 N  N     . VAL B 1 148 ? 24.064  21.510  15.480  1.00 84.12  ? 148 VAL B N     1 
ATOM   4883 C  CA    . VAL B 1 148 ? 25.106  20.898  14.658  1.00 79.65  ? 148 VAL B CA    1 
ATOM   4884 C  C     . VAL B 1 148 ? 25.837  19.826  15.458  1.00 76.74  ? 148 VAL B C     1 
ATOM   4885 O  O     . VAL B 1 148 ? 26.017  18.706  14.982  1.00 73.13  ? 148 VAL B O     1 
ATOM   4886 C  CB    . VAL B 1 148 ? 26.111  21.960  14.150  1.00 80.81  ? 148 VAL B CB    1 
ATOM   4887 C  CG1   . VAL B 1 148 ? 27.272  21.306  13.410  1.00 76.64  ? 148 VAL B CG1   1 
ATOM   4888 C  CG2   . VAL B 1 148 ? 25.408  22.957  13.256  1.00 83.24  ? 148 VAL B CG2   1 
ATOM   4889 N  N     . ARG B 1 149 ? 26.238  20.181  16.678  1.00 78.60  ? 149 ARG B N     1 
ATOM   4890 C  CA    . ARG B 1 149 ? 26.882  19.242  17.595  1.00 76.96  ? 149 ARG B CA    1 
ATOM   4891 C  C     . ARG B 1 149 ? 26.022  17.997  17.864  1.00 75.15  ? 149 ARG B C     1 
ATOM   4892 O  O     . ARG B 1 149 ? 26.527  16.868  17.799  1.00 72.43  ? 149 ARG B O     1 
ATOM   4893 C  CB    . ARG B 1 149 ? 27.302  19.948  18.891  1.00 80.61  ? 149 ARG B CB    1 
ATOM   4894 C  CG    . ARG B 1 149 ? 28.705  20.540  18.817  1.00 81.07  ? 149 ARG B CG    1 
ATOM   4895 C  CD    . ARG B 1 149 ? 29.089  21.300  20.073  1.00 85.06  ? 149 ARG B CD    1 
ATOM   4896 N  NE    . ARG B 1 149 ? 28.980  22.744  19.891  1.00 89.32  ? 149 ARG B NE    1 
ATOM   4897 C  CZ    . ARG B 1 149 ? 30.008  23.588  19.813  1.00 90.42  ? 149 ARG B CZ    1 
ATOM   4898 N  NH1   . ARG B 1 149 ? 31.259  23.156  19.904  1.00 88.54  ? 149 ARG B NH1   1 
ATOM   4899 N  NH2   . ARG B 1 149 ? 29.779  24.880  19.650  1.00 93.56  ? 149 ARG B NH2   1 
ATOM   4900 N  N     . LEU B 1 150 ? 24.730  18.204  18.127  1.00 76.78  ? 150 LEU B N     1 
ATOM   4901 C  CA    . LEU B 1 150 ? 23.778  17.101  18.284  1.00 75.25  ? 150 LEU B CA    1 
ATOM   4902 C  C     . LEU B 1 150 ? 23.798  16.144  17.093  1.00 71.01  ? 150 LEU B C     1 
ATOM   4903 O  O     . LEU B 1 150 ? 23.864  14.924  17.277  1.00 69.02  ? 150 LEU B O     1 
ATOM   4904 C  CB    . LEU B 1 150 ? 22.352  17.624  18.502  1.00 78.48  ? 150 LEU B CB    1 
ATOM   4905 C  CG    . LEU B 1 150 ? 21.915  18.127  19.882  1.00 82.67  ? 150 LEU B CG    1 
ATOM   4906 C  CD1   . LEU B 1 150 ? 20.503  18.689  19.808  1.00 84.72  ? 150 LEU B CD1   1 
ATOM   4907 C  CD2   . LEU B 1 150 ? 21.991  17.018  20.929  1.00 82.20  ? 150 LEU B CD2   1 
ATOM   4908 N  N     . LEU B 1 151 ? 23.754  16.699  15.880  1.00 69.69  ? 151 LEU B N     1 
ATOM   4909 C  CA    . LEU B 1 151 ? 23.728  15.884  14.665  1.00 65.88  ? 151 LEU B CA    1 
ATOM   4910 C  C     . LEU B 1 151 ? 25.040  15.135  14.435  1.00 62.87  ? 151 LEU B C     1 
ATOM   4911 O  O     . LEU B 1 151 ? 25.017  13.967  14.056  1.00 60.30  ? 151 LEU B O     1 
ATOM   4912 C  CB    . LEU B 1 151 ? 23.327  16.707  13.433  1.00 66.12  ? 151 LEU B CB    1 
ATOM   4913 C  CG    . LEU B 1 151 ? 23.387  16.054  12.043  1.00 63.65  ? 151 LEU B CG    1 
ATOM   4914 C  CD1   . LEU B 1 151 ? 22.464  14.832  11.910  1.00 61.51  ? 151 LEU B CD1   1 
ATOM   4915 C  CD2   . LEU B 1 151 ? 23.094  17.070  10.955  1.00 64.90  ? 151 LEU B CD2   1 
ATOM   4916 N  N     . LYS B 1 152 ? 26.165  15.813  14.666  1.00 63.32  ? 152 LYS B N     1 
ATOM   4917 C  CA    . LYS B 1 152 ? 27.498  15.206  14.523  1.00 60.81  ? 152 LYS B CA    1 
ATOM   4918 C  C     . LYS B 1 152 ? 27.704  14.062  15.526  1.00 60.14  ? 152 LYS B C     1 
ATOM   4919 O  O     . LYS B 1 152 ? 28.235  13.007  15.171  1.00 57.34  ? 152 LYS B O     1 
ATOM   4920 C  CB    . LYS B 1 152 ? 28.604  16.260  14.684  1.00 61.89  ? 152 LYS B CB    1 
ATOM   4921 C  CG    . LYS B 1 152 ? 28.704  17.297  13.558  1.00 62.82  ? 152 LYS B CG    1 
ATOM   4922 C  CD    . LYS B 1 152 ? 29.831  18.305  13.817  1.00 64.38  ? 152 LYS B CD    1 
ATOM   4923 C  CE    . LYS B 1 152 ? 30.137  19.156  12.593  1.00 64.78  ? 152 LYS B CE    1 
ATOM   4924 N  NZ    . LYS B 1 152 ? 31.266  20.128  12.805  1.00 66.21  ? 152 LYS B NZ    1 
ATOM   4925 N  N     . GLY B 1 153 ? 27.269  14.280  16.768  1.00 62.87  ? 153 GLY B N     1 
ATOM   4926 C  CA    . GLY B 1 153 ? 27.369  13.282  17.834  1.00 63.54  ? 153 GLY B CA    1 
ATOM   4927 C  C     . GLY B 1 153 ? 26.512  12.056  17.567  1.00 62.15  ? 153 GLY B C     1 
ATOM   4928 O  O     . GLY B 1 153 ? 26.905  10.934  17.892  1.00 61.17  ? 153 GLY B O     1 
ATOM   4929 N  N     . PHE B 1 154 ? 25.342  12.291  16.974  1.00 62.29  ? 154 PHE B N     1 
ATOM   4930 C  CA    . PHE B 1 154 ? 24.415  11.247  16.542  1.00 61.19  ? 154 PHE B CA    1 
ATOM   4931 C  C     . PHE B 1 154 ? 25.049  10.375  15.455  1.00 57.78  ? 154 PHE B C     1 
ATOM   4932 O  O     . PHE B 1 154 ? 24.990  9.144   15.518  1.00 56.64  ? 154 PHE B O     1 
ATOM   4933 C  CB    . PHE B 1 154 ? 23.147  11.917  16.015  1.00 62.44  ? 154 PHE B CB    1 
ATOM   4934 C  CG    . PHE B 1 154 ? 22.010  10.973  15.723  1.00 62.26  ? 154 PHE B CG    1 
ATOM   4935 C  CD1   . PHE B 1 154 ? 21.152  10.552  16.742  1.00 64.64  ? 154 PHE B CD1   1 
ATOM   4936 C  CD2   . PHE B 1 154 ? 21.755  10.558  14.418  1.00 59.98  ? 154 PHE B CD2   1 
ATOM   4937 C  CE1   . PHE B 1 154 ? 20.079  9.712   16.471  1.00 65.08  ? 154 PHE B CE1   1 
ATOM   4938 C  CE2   . PHE B 1 154 ? 20.681  9.718   14.136  1.00 60.44  ? 154 PHE B CE2   1 
ATOM   4939 C  CZ    . PHE B 1 154 ? 19.844  9.292   15.166  1.00 62.78  ? 154 PHE B CZ    1 
ATOM   4940 N  N     . LEU B 1 155 ? 25.667  11.020  14.467  1.00 56.31  ? 155 LEU B N     1 
ATOM   4941 C  CA    . LEU B 1 155 ? 26.338  10.297  13.381  1.00 53.37  ? 155 LEU B CA    1 
ATOM   4942 C  C     . LEU B 1 155 ? 27.592  9.579   13.839  1.00 52.15  ? 155 LEU B C     1 
ATOM   4943 O  O     . LEU B 1 155 ? 27.839  8.443   13.426  1.00 50.29  ? 155 LEU B O     1 
ATOM   4944 C  CB    . LEU B 1 155 ? 26.672  11.237  12.225  1.00 52.78  ? 155 LEU B CB    1 
ATOM   4945 C  CG    . LEU B 1 155 ? 25.419  11.703  11.485  1.00 53.81  ? 155 LEU B CG    1 
ATOM   4946 C  CD1   . LEU B 1 155 ? 25.725  12.861  10.575  1.00 53.52  ? 155 LEU B CD1   1 
ATOM   4947 C  CD2   . LEU B 1 155 ? 24.807  10.535  10.718  1.00 50.35  ? 155 LEU B CD2   1 
ATOM   4948 N  N     . LYS B 1 156 ? 28.378  10.250  14.681  1.00 53.04  ? 156 LYS B N     1 
ATOM   4949 C  CA    . LYS B 1 156 ? 29.627  9.692   15.207  1.00 52.86  ? 156 LYS B CA    1 
ATOM   4950 C  C     . LYS B 1 156 ? 29.364  8.426   16.024  1.00 53.10  ? 156 LYS B C     1 
ATOM   4951 O  O     . LYS B 1 156 ? 30.089  7.439   15.894  1.00 52.03  ? 156 LYS B O     1 
ATOM   4952 C  CB    . LYS B 1 156 ? 30.375  10.738  16.042  1.00 55.00  ? 156 LYS B CB    1 
ATOM   4953 C  CG    . LYS B 1 156 ? 31.880  10.515  16.165  1.00 55.65  ? 156 LYS B CG    1 
ATOM   4954 C  CD    . LYS B 1 156 ? 32.550  11.778  16.713  1.00 59.22  ? 156 LYS B CD    1 
ATOM   4955 C  CE    . LYS B 1 156 ? 34.081  11.694  16.661  1.00 60.93  ? 156 LYS B CE    1 
ATOM   4956 N  NZ    . LYS B 1 156 ? 34.703  11.259  17.953  1.00 62.81  ? 156 LYS B NZ    1 
ATOM   4957 N  N     . ALA B 1 157 ? 28.314  8.457   16.842  1.00 54.92  ? 157 ALA B N     1 
ATOM   4958 C  CA    . ALA B 1 157 ? 27.919  7.299   17.656  1.00 56.08  ? 157 ALA B CA    1 
ATOM   4959 C  C     . ALA B 1 157 ? 27.486  6.086   16.824  1.00 54.31  ? 157 ALA B C     1 
ATOM   4960 O  O     . ALA B 1 157 ? 27.633  4.950   17.270  1.00 54.71  ? 157 ALA B O     1 
ATOM   4961 C  CB    . ALA B 1 157 ? 26.826  7.680   18.643  1.00 58.30  ? 157 ALA B CB    1 
ATOM   4962 N  N     . ASN B 1 158 ? 26.967  6.331   15.622  1.00 52.99  ? 158 ASN B N     1 
ATOM   4963 C  CA    . ASN B 1 158 ? 26.483  5.247   14.760  1.00 52.48  ? 158 ASN B CA    1 
ATOM   4964 C  C     . ASN B 1 158 ? 27.425  4.818   13.622  1.00 50.30  ? 158 ASN B C     1 
ATOM   4965 O  O     . ASN B 1 158 ? 27.016  4.106   12.704  1.00 49.09  ? 158 ASN B O     1 
ATOM   4966 C  CB    . ASN B 1 158 ? 25.065  5.556   14.256  1.00 52.92  ? 158 ASN B CB    1 
ATOM   4967 C  CG    . ASN B 1 158 ? 24.035  5.474   15.366  1.00 55.64  ? 158 ASN B CG    1 
ATOM   4968 O  OD1   . ASN B 1 158 ? 23.582  4.387   15.728  1.00 56.85  ? 158 ASN B OD1   1 
ATOM   4969 N  ND2   . ASN B 1 158 ? 23.680  6.623   15.931  1.00 58.39  ? 158 ASN B ND2   1 
ATOM   4970 N  N     . GLY B 1 159 ? 28.684  5.248   13.704  1.00 50.24  ? 159 GLY B N     1 
ATOM   4971 C  CA    . GLY B 1 159 ? 29.726  4.828   12.761  1.00 48.79  ? 159 GLY B CA    1 
ATOM   4972 C  C     . GLY B 1 159 ? 29.634  5.425   11.368  1.00 47.52  ? 159 GLY B C     1 
ATOM   4973 O  O     . GLY B 1 159 ? 30.208  4.876   10.411  1.00 46.04  ? 159 GLY B O     1 
ATOM   4974 N  N     . ILE B 1 160 ? 28.942  6.559   11.257  1.00 47.98  ? 160 ILE B N     1 
ATOM   4975 C  CA    . ILE B 1 160 ? 28.657  7.171   9.954   1.00 47.36  ? 160 ILE B CA    1 
ATOM   4976 C  C     . ILE B 1 160 ? 28.985  8.674   9.879   1.00 47.38  ? 160 ILE B C     1 
ATOM   4977 O  O     . ILE B 1 160 ? 28.481  9.400   9.022   1.00 47.49  ? 160 ILE B O     1 
ATOM   4978 C  CB    . ILE B 1 160 ? 27.204  6.810   9.489   1.00 48.26  ? 160 ILE B CB    1 
ATOM   4979 C  CG1   . ILE B 1 160 ? 27.177  5.374   8.961   1.00 47.71  ? 160 ILE B CG1   1 
ATOM   4980 C  CG2   . ILE B 1 160 ? 26.684  7.753   8.409   1.00 49.96  ? 160 ILE B CG2   1 
ATOM   4981 C  CD1   . ILE B 1 160 ? 25.782  4.787   8.838   1.00 51.45  ? 160 ILE B CD1   1 
ATOM   4982 N  N     . TYR B 1 161 ? 29.868  9.136   10.759  1.00 47.46  ? 161 TYR B N     1 
ATOM   4983 C  CA    . TYR B 1 161 ? 30.377  10.506  10.665  1.00 47.35  ? 161 TYR B CA    1 
ATOM   4984 C  C     . TYR B 1 161 ? 31.684  10.509  9.870   1.00 46.00  ? 161 TYR B C     1 
ATOM   4985 O  O     . TYR B 1 161 ? 32.556  9.676   10.113  1.00 45.88  ? 161 TYR B O     1 
ATOM   4986 C  CB    . TYR B 1 161 ? 30.585  11.113  12.055  1.00 48.87  ? 161 TYR B CB    1 
ATOM   4987 C  CG    . TYR B 1 161 ? 31.023  12.568  12.033  1.00 50.00  ? 161 TYR B CG    1 
ATOM   4988 C  CD1   . TYR B 1 161 ? 30.262  13.541  11.379  1.00 50.66  ? 161 TYR B CD1   1 
ATOM   4989 C  CD2   . TYR B 1 161 ? 32.193  12.970  12.677  1.00 50.00  ? 161 TYR B CD2   1 
ATOM   4990 C  CE1   . TYR B 1 161 ? 30.669  14.882  11.357  1.00 52.21  ? 161 TYR B CE1   1 
ATOM   4991 C  CE2   . TYR B 1 161 ? 32.606  14.305  12.671  1.00 52.40  ? 161 TYR B CE2   1 
ATOM   4992 C  CZ    . TYR B 1 161 ? 31.841  15.250  12.006  1.00 53.29  ? 161 TYR B CZ    1 
ATOM   4993 O  OH    . TYR B 1 161 ? 32.247  16.561  12.000  1.00 56.53  ? 161 TYR B OH    1 
ATOM   4994 N  N     . GLY B 1 162 ? 31.800  11.425  8.908   1.00 45.55  ? 162 GLY B N     1 
ATOM   4995 C  CA    . GLY B 1 162 ? 32.994  11.536  8.066   1.00 43.92  ? 162 GLY B CA    1 
ATOM   4996 C  C     . GLY B 1 162 ? 32.788  11.112  6.617   1.00 42.41  ? 162 GLY B C     1 
ATOM   4997 O  O     . GLY B 1 162 ? 32.268  10.027  6.342   1.00 41.01  ? 162 GLY B O     1 
ATOM   4998 N  N     . ALA B 1 163 ? 33.212  11.972  5.691   1.00 42.45  ? 163 ALA B N     1 
ATOM   4999 C  CA    . ALA B 1 163 ? 33.143  11.704  4.247   1.00 41.63  ? 163 ALA B CA    1 
ATOM   5000 C  C     . ALA B 1 163 ? 34.312  10.847  3.714   1.00 40.42  ? 163 ALA B C     1 
ATOM   5001 O  O     . ALA B 1 163 ? 34.272  10.374  2.566   1.00 39.70  ? 163 ALA B O     1 
ATOM   5002 C  CB    . ALA B 1 163 ? 33.049  13.028  3.467   1.00 43.53  ? 163 ALA B CB    1 
ATOM   5003 N  N     . GLU B 1 164 ? 35.341  10.638  4.537   1.00 40.11  ? 164 GLU B N     1 
ATOM   5004 C  CA    . GLU B 1 164 ? 36.524  9.861   4.115   1.00 39.19  ? 164 GLU B CA    1 
ATOM   5005 C  C     . GLU B 1 164 ? 36.205  8.400   3.774   1.00 38.35  ? 164 GLU B C     1 
ATOM   5006 O  O     . GLU B 1 164 ? 35.271  7.821   4.344   1.00 38.06  ? 164 GLU B O     1 
ATOM   5007 C  CB    . GLU B 1 164 ? 37.650  9.965   5.149   1.00 39.60  ? 164 GLU B CB    1 
ATOM   5008 C  CG    . GLU B 1 164 ? 37.438  9.202   6.440   1.00 39.58  ? 164 GLU B CG    1 
ATOM   5009 C  CD    . GLU B 1 164 ? 36.705  9.988   7.506   1.00 42.75  ? 164 GLU B CD    1 
ATOM   5010 O  OE1   . GLU B 1 164 ? 36.760  9.557   8.677   1.00 44.30  ? 164 GLU B OE1   1 
ATOM   5011 O  OE2   . GLU B 1 164 ? 36.068  11.022  7.195   1.00 42.97  ? 164 GLU B OE2   1 
ATOM   5012 N  N     . TYR B 1 165 ? 36.976  7.811   2.850   1.00 38.26  ? 165 TYR B N     1 
ATOM   5013 C  CA    . TYR B 1 165 ? 36.724  6.431   2.370   1.00 38.11  ? 165 TYR B CA    1 
ATOM   5014 C  C     . TYR B 1 165 ? 36.607  5.365   3.445   1.00 37.65  ? 165 TYR B C     1 
ATOM   5015 O  O     . TYR B 1 165 ? 35.937  4.348   3.241   1.00 37.46  ? 165 TYR B O     1 
ATOM   5016 C  CB    . TYR B 1 165 ? 37.734  5.992   1.305   1.00 38.58  ? 165 TYR B CB    1 
ATOM   5017 C  CG    . TYR B 1 165 ? 37.422  6.615   -0.023  1.00 40.59  ? 165 TYR B CG    1 
ATOM   5018 C  CD1   . TYR B 1 165 ? 38.342  7.446   -0.659  1.00 42.36  ? 165 TYR B CD1   1 
ATOM   5019 C  CD2   . TYR B 1 165 ? 36.175  6.421   -0.621  1.00 40.42  ? 165 TYR B CD2   1 
ATOM   5020 C  CE1   . TYR B 1 165 ? 38.034  8.046   -1.877  1.00 44.20  ? 165 TYR B CE1   1 
ATOM   5021 C  CE2   . TYR B 1 165 ? 35.857  7.015   -1.822  1.00 42.62  ? 165 TYR B CE2   1 
ATOM   5022 C  CZ    . TYR B 1 165 ? 36.784  7.839   -2.445  1.00 43.06  ? 165 TYR B CZ    1 
ATOM   5023 O  OH    . TYR B 1 165 ? 36.465  8.429   -3.640  1.00 44.16  ? 165 TYR B OH    1 
ATOM   5024 N  N     . LYS B 1 166 ? 37.262  5.585   4.579   1.00 37.82  ? 166 LYS B N     1 
ATOM   5025 C  CA    . LYS B 1 166 ? 37.175  4.639   5.682   1.00 37.65  ? 166 LYS B CA    1 
ATOM   5026 C  C     . LYS B 1 166 ? 35.734  4.589   6.199   1.00 37.34  ? 166 LYS B C     1 
ATOM   5027 O  O     . LYS B 1 166 ? 35.277  3.546   6.666   1.00 36.83  ? 166 LYS B O     1 
ATOM   5028 C  CB    . LYS B 1 166 ? 38.153  5.003   6.798   1.00 38.74  ? 166 LYS B CB    1 
ATOM   5029 C  CG    . LYS B 1 166 ? 38.055  4.116   8.014   1.00 39.92  ? 166 LYS B CG    1 
ATOM   5030 C  CD    . LYS B 1 166 ? 39.270  4.203   8.896   1.00 42.77  ? 166 LYS B CD    1 
ATOM   5031 C  CE    . LYS B 1 166 ? 39.072  3.293   10.099  1.00 45.52  ? 166 LYS B CE    1 
ATOM   5032 N  NZ    . LYS B 1 166 ? 40.247  3.269   11.003  1.00 49.21  ? 166 LYS B NZ    1 
ATOM   5033 N  N     . VAL B 1 167 ? 35.029  5.715   6.081   1.00 37.07  ? 167 VAL B N     1 
ATOM   5034 C  CA    . VAL B 1 167 ? 33.674  5.851   6.605   1.00 37.42  ? 167 VAL B CA    1 
ATOM   5035 C  C     . VAL B 1 167 ? 32.600  5.928   5.514   1.00 37.24  ? 167 VAL B C     1 
ATOM   5036 O  O     . VAL B 1 167 ? 31.607  5.200   5.590   1.00 37.38  ? 167 VAL B O     1 
ATOM   5037 C  CB    . VAL B 1 167 ? 33.534  7.081   7.561   1.00 38.64  ? 167 VAL B CB    1 
ATOM   5038 C  CG1   . VAL B 1 167 ? 32.127  7.138   8.158   1.00 39.01  ? 167 VAL B CG1   1 
ATOM   5039 C  CG2   . VAL B 1 167 ? 34.586  7.021   8.669   1.00 39.05  ? 167 VAL B CG2   1 
ATOM   5040 N  N     . ARG B 1 168 ? 32.784  6.818   4.528   1.00 37.09  ? 168 ARG B N     1 
ATOM   5041 C  CA    . ARG B 1 168 ? 31.765  7.089   3.496   1.00 37.47  ? 168 ARG B CA    1 
ATOM   5042 C  C     . ARG B 1 168 ? 30.433  7.522   4.119   1.00 37.99  ? 168 ARG B C     1 
ATOM   5043 O  O     . ARG B 1 168 ? 29.365  7.047   3.736   1.00 38.53  ? 168 ARG B O     1 
ATOM   5044 C  CB    . ARG B 1 168 ? 31.542  5.876   2.577   1.00 36.76  ? 168 ARG B CB    1 
ATOM   5045 C  CG    . ARG B 1 168 ? 32.663  5.622   1.572   1.00 38.01  ? 168 ARG B CG    1 
ATOM   5046 C  CD    . ARG B 1 168 ? 32.377  4.378   0.741   1.00 37.04  ? 168 ARG B CD    1 
ATOM   5047 N  NE    . ARG B 1 168 ? 33.523  3.976   -0.079  1.00 41.29  ? 168 ARG B NE    1 
ATOM   5048 C  CZ    . ARG B 1 168 ? 33.642  4.182   -1.392  1.00 42.21  ? 168 ARG B CZ    1 
ATOM   5049 N  NH1   . ARG B 1 168 ? 32.681  4.803   -2.071  1.00 43.34  ? 168 ARG B NH1   1 
ATOM   5050 N  NH2   . ARG B 1 168 ? 34.730  3.768   -2.029  1.00 42.79  ? 168 ARG B NH2   1 
ATOM   5051 N  N     . GLY B 1 169 ? 30.507  8.424   5.087   1.00 38.68  ? 169 GLY B N     1 
ATOM   5052 C  CA    . GLY B 1 169 ? 29.321  8.957   5.735   1.00 39.12  ? 169 GLY B CA    1 
ATOM   5053 C  C     . GLY B 1 169 ? 29.192  10.444  5.465   1.00 40.70  ? 169 GLY B C     1 
ATOM   5054 O  O     . GLY B 1 169 ? 29.505  10.912  4.371   1.00 40.25  ? 169 GLY B O     1 
ATOM   5055 N  N     . PHE B 1 170 ? 28.745  11.175  6.479   1.00 42.60  ? 170 PHE B N     1 
ATOM   5056 C  CA    . PHE B 1 170 ? 28.438  12.607  6.368   1.00 45.82  ? 170 PHE B CA    1 
ATOM   5057 C  C     . PHE B 1 170 ? 29.592  13.482  6.818   1.00 47.08  ? 170 PHE B C     1 
ATOM   5058 O  O     . PHE B 1 170 ? 30.108  13.293  7.922   1.00 47.83  ? 170 PHE B O     1 
ATOM   5059 C  CB    . PHE B 1 170 ? 27.256  12.949  7.270   1.00 47.72  ? 170 PHE B CB    1 
ATOM   5060 C  CG    . PHE B 1 170 ? 25.973  12.273  6.900   1.00 48.20  ? 170 PHE B CG    1 
ATOM   5061 C  CD1   . PHE B 1 170 ? 25.787  10.918  7.135   1.00 47.56  ? 170 PHE B CD1   1 
ATOM   5062 C  CD2   . PHE B 1 170 ? 24.918  13.011  6.371   1.00 51.79  ? 170 PHE B CD2   1 
ATOM   5063 C  CE1   . PHE B 1 170 ? 24.586  10.305  6.812   1.00 48.31  ? 170 PHE B CE1   1 
ATOM   5064 C  CE2   . PHE B 1 170 ? 23.716  12.402  6.046   1.00 53.02  ? 170 PHE B CE2   1 
ATOM   5065 C  CZ    . PHE B 1 170 ? 23.551  11.048  6.265   1.00 49.72  ? 170 PHE B CZ    1 
ATOM   5066 N  N     . SER B 1 171 ? 29.964  14.472  6.002   1.00 48.36  ? 171 SER B N     1 
ATOM   5067 C  CA    . SER B 1 171 ? 31.029  15.394  6.375   1.00 48.93  ? 171 SER B CA    1 
ATOM   5068 C  C     . SER B 1 171 ? 30.489  16.415  7.367   1.00 51.46  ? 171 SER B C     1 
ATOM   5069 O  O     . SER B 1 171 ? 29.284  16.714  7.374   1.00 53.25  ? 171 SER B O     1 
ATOM   5070 C  CB    . SER B 1 171 ? 31.639  16.095  5.150   1.00 49.93  ? 171 SER B CB    1 
ATOM   5071 O  OG    . SER B 1 171 ? 30.687  16.869  4.443   1.00 50.75  ? 171 SER B OG    1 
ATOM   5072 N  N     . GLY B 1 172 ? 31.373  16.928  8.216   1.00 51.67  ? 172 GLY B N     1 
ATOM   5073 C  CA    . GLY B 1 172 ? 31.023  17.988  9.162   1.00 54.15  ? 172 GLY B CA    1 
ATOM   5074 C  C     . GLY B 1 172 ? 30.352  19.173  8.488   1.00 56.33  ? 172 GLY B C     1 
ATOM   5075 O  O     . GLY B 1 172 ? 29.372  19.712  9.007   1.00 58.37  ? 172 GLY B O     1 
ATOM   5076 N  N     . TYR B 1 173 ? 30.876  19.564  7.326   1.00 56.17  ? 173 TYR B N     1 
ATOM   5077 C  CA    . TYR B 1 173 ? 30.308  20.661  6.530   1.00 58.97  ? 173 TYR B CA    1 
ATOM   5078 C  C     . TYR B 1 173 ? 28.862  20.361  6.125   1.00 59.31  ? 173 TYR B C     1 
ATOM   5079 O  O     . TYR B 1 173 ? 27.987  21.223  6.227   1.00 61.81  ? 173 TYR B O     1 
ATOM   5080 C  CB    . TYR B 1 173 ? 31.166  20.938  5.286   1.00 58.74  ? 173 TYR B CB    1 
ATOM   5081 C  CG    . TYR B 1 173 ? 30.595  21.983  4.349   1.00 61.75  ? 173 TYR B CG    1 
ATOM   5082 C  CD1   . TYR B 1 173 ? 30.200  23.234  4.830   1.00 65.26  ? 173 TYR B CD1   1 
ATOM   5083 C  CD2   . TYR B 1 173 ? 30.460  21.734  2.978   1.00 61.11  ? 173 TYR B CD2   1 
ATOM   5084 C  CE1   . TYR B 1 173 ? 29.678  24.203  3.990   1.00 69.33  ? 173 TYR B CE1   1 
ATOM   5085 C  CE2   . TYR B 1 173 ? 29.932  22.724  2.115   1.00 64.81  ? 173 TYR B CE2   1 
ATOM   5086 C  CZ    . TYR B 1 173 ? 29.539  23.949  2.640   1.00 68.41  ? 173 TYR B CZ    1 
ATOM   5087 O  OH    . TYR B 1 173 ? 29.025  24.960  1.843   1.00 72.46  ? 173 TYR B OH    1 
ATOM   5088 N  N     . LEU B 1 174 ? 28.621  19.134  5.669   1.00 56.09  ? 174 LEU B N     1 
ATOM   5089 C  CA    . LEU B 1 174 ? 27.276  18.685  5.331   1.00 56.58  ? 174 LEU B CA    1 
ATOM   5090 C  C     . LEU B 1 174 ? 26.310  18.777  6.518   1.00 58.09  ? 174 LEU B C     1 
ATOM   5091 O  O     . LEU B 1 174 ? 25.142  19.123  6.343   1.00 59.91  ? 174 LEU B O     1 
ATOM   5092 C  CB    . LEU B 1 174 ? 27.310  17.246  4.808   1.00 52.83  ? 174 LEU B CB    1 
ATOM   5093 C  CG    . LEU B 1 174 ? 25.969  16.624  4.411   1.00 53.43  ? 174 LEU B CG    1 
ATOM   5094 C  CD1   . LEU B 1 174 ? 25.253  17.476  3.384   1.00 56.12  ? 174 LEU B CD1   1 
ATOM   5095 C  CD2   . LEU B 1 174 ? 26.175  15.210  3.887   1.00 50.31  ? 174 LEU B CD2   1 
ATOM   5096 N  N     . CYS B 1 175 ? 26.811  18.450  7.708   1.00 57.75  ? 175 CYS B N     1 
ATOM   5097 C  CA    . CYS B 1 175 ? 26.027  18.471  8.934   1.00 59.98  ? 175 CYS B CA    1 
ATOM   5098 C  C     . CYS B 1 175 ? 25.517  19.878  9.233   1.00 64.48  ? 175 CYS B C     1 
ATOM   5099 O  O     . CYS B 1 175 ? 24.394  20.042  9.708   1.00 66.71  ? 175 CYS B O     1 
ATOM   5100 C  CB    . CYS B 1 175 ? 26.852  17.954  10.114  1.00 58.69  ? 175 CYS B CB    1 
ATOM   5101 S  SG    . CYS B 1 175 ? 27.051  16.175  10.158  1.00 56.10  ? 175 CYS B SG    1 
ATOM   5102 N  N     . GLU B 1 176 ? 26.349  20.871  8.924   1.00 66.02  ? 176 GLU B N     1 
ATOM   5103 C  CA    . GLU B 1 176 ? 26.031  22.278  9.119   1.00 71.36  ? 176 GLU B CA    1 
ATOM   5104 C  C     . GLU B 1 176 ? 25.045  22.803  8.082   1.00 73.88  ? 176 GLU B C     1 
ATOM   5105 O  O     . GLU B 1 176 ? 24.185  23.613  8.403   1.00 77.64  ? 176 GLU B O     1 
ATOM   5106 C  CB    . GLU B 1 176 ? 27.313  23.103  9.091   1.00 71.98  ? 176 GLU B CB    1 
ATOM   5107 C  CG    . GLU B 1 176 ? 28.209  22.853  10.289  1.00 71.76  ? 176 GLU B CG    1 
ATOM   5108 C  CD    . GLU B 1 176 ? 29.537  23.568  10.183  1.00 74.06  ? 176 GLU B CD    1 
ATOM   5109 O  OE1   . GLU B 1 176 ? 29.790  24.485  10.990  1.00 75.67  ? 176 GLU B OE1   1 
ATOM   5110 O  OE2   . GLU B 1 176 ? 30.325  23.210  9.283   1.00 74.10  ? 176 GLU B OE2   1 
ATOM   5111 N  N     . LEU B 1 177 ? 25.179  22.341  6.842   1.00 72.60  ? 177 LEU B N     1 
ATOM   5112 C  CA    . LEU B 1 177 ? 24.228  22.663  5.783   1.00 75.11  ? 177 LEU B CA    1 
ATOM   5113 C  C     . LEU B 1 177 ? 22.846  22.072  6.062   1.00 75.59  ? 177 LEU B C     1 
ATOM   5114 O  O     . LEU B 1 177 ? 21.836  22.680  5.714   1.00 79.18  ? 177 LEU B O     1 
ATOM   5115 C  CB    . LEU B 1 177 ? 24.727  22.160  4.426   1.00 73.28  ? 177 LEU B CB    1 
ATOM   5116 C  CG    . LEU B 1 177 ? 25.973  22.768  3.773   1.00 73.71  ? 177 LEU B CG    1 
ATOM   5117 C  CD1   . LEU B 1 177 ? 26.276  21.966  2.517   1.00 71.33  ? 177 LEU B CD1   1 
ATOM   5118 C  CD2   . LEU B 1 177 ? 25.811  24.260  3.451   1.00 79.01  ? 177 LEU B CD2   1 
ATOM   5119 N  N     . LEU B 1 178 ? 22.804  20.886  6.674   1.00 72.42  ? 178 LEU B N     1 
ATOM   5120 C  CA    . LEU B 1 178 ? 21.535  20.260  7.049   1.00 72.73  ? 178 LEU B CA    1 
ATOM   5121 C  C     . LEU B 1 178 ? 20.824  21.019  8.168   1.00 76.48  ? 178 LEU B C     1 
ATOM   5122 O  O     . LEU B 1 178 ? 19.609  21.204  8.118   1.00 79.19  ? 178 LEU B O     1 
ATOM   5123 C  CB    . LEU B 1 178 ? 21.729  18.795  7.444   1.00 68.54  ? 178 LEU B CB    1 
ATOM   5124 C  CG    . LEU B 1 178 ? 22.014  17.810  6.301   1.00 65.19  ? 178 LEU B CG    1 
ATOM   5125 C  CD1   . LEU B 1 178 ? 22.413  16.445  6.849   1.00 61.29  ? 178 LEU B CD1   1 
ATOM   5126 C  CD2   . LEU B 1 178 ? 20.832  17.708  5.341   1.00 65.22  ? 178 LEU B CD2   1 
ATOM   5127 N  N     . ILE B 1 179 ? 21.588  21.447  9.172   1.00 77.07  ? 179 ILE B N     1 
ATOM   5128 C  CA    . ILE B 1 179 ? 21.052  22.241  10.278  1.00 81.14  ? 179 ILE B CA    1 
ATOM   5129 C  C     . ILE B 1 179 ? 20.625  23.621  9.790   1.00 85.94  ? 179 ILE B C     1 
ATOM   5130 O  O     . ILE B 1 179 ? 19.616  24.158  10.262  1.00 89.75  ? 179 ILE B O     1 
ATOM   5131 C  CB    . ILE B 1 179 ? 22.059  22.347  11.465  1.00 80.72  ? 179 ILE B CB    1 
ATOM   5132 C  CG1   . ILE B 1 179 ? 22.333  20.964  12.085  1.00 77.45  ? 179 ILE B CG1   1 
ATOM   5133 C  CG2   . ILE B 1 179 ? 21.587  23.341  12.529  1.00 85.86  ? 179 ILE B CG2   1 
ATOM   5134 C  CD1   . ILE B 1 179 ? 21.108  20.238  12.642  1.00 78.52  ? 179 ILE B CD1   1 
ATOM   5135 N  N     . VAL B 1 180 ? 21.374  24.194  8.845   1.00 86.21  ? 180 VAL B N     1 
ATOM   5136 C  CA    . VAL B 1 180 ? 20.977  25.482  8.251   1.00 91.16  ? 180 VAL B CA    1 
ATOM   5137 C  C     . VAL B 1 180 ? 19.672  25.296  7.471   1.00 92.90  ? 180 VAL B C     1 
ATOM   5138 O  O     . VAL B 1 180 ? 18.772  26.133  7.546   1.00 97.72  ? 180 VAL B O     1 
ATOM   5139 C  CB    . VAL B 1 180 ? 22.081  26.114  7.349   1.00 91.21  ? 180 VAL B CB    1 
ATOM   5140 C  CG1   . VAL B 1 180 ? 21.579  27.406  6.679   1.00 96.67  ? 180 VAL B CG1   1 
ATOM   5141 C  CG2   . VAL B 1 180 ? 23.327  26.424  8.156   1.00 90.16  ? 180 VAL B CG2   1 
ATOM   5142 N  N     . PHE B 1 181 ? 19.571  24.175  6.756   1.00 89.38  ? 181 PHE B N     1 
ATOM   5143 C  CA    . PHE B 1 181 ? 18.375  23.845  5.983   1.00 90.75  ? 181 PHE B CA    1 
ATOM   5144 C  C     . PHE B 1 181 ? 17.125  23.637  6.857   1.00 92.52  ? 181 PHE B C     1 
ATOM   5145 O  O     . PHE B 1 181 ? 16.113  24.322  6.681   1.00 96.88  ? 181 PHE B O     1 
ATOM   5146 C  CB    . PHE B 1 181 ? 18.624  22.607  5.102   1.00 86.47  ? 181 PHE B CB    1 
ATOM   5147 C  CG    . PHE B 1 181 ? 17.634  22.454  3.986   1.00 88.63  ? 181 PHE B CG    1 
ATOM   5148 C  CD1   . PHE B 1 181 ? 17.795  23.156  2.797   1.00 91.57  ? 181 PHE B CD1   1 
ATOM   5149 C  CD2   . PHE B 1 181 ? 16.529  21.625  4.128   1.00 89.02  ? 181 PHE B CD2   1 
ATOM   5150 C  CE1   . PHE B 1 181 ? 16.872  23.033  1.763   1.00 93.60  ? 181 PHE B CE1   1 
ATOM   5151 C  CE2   . PHE B 1 181 ? 15.601  21.498  3.102   1.00 91.18  ? 181 PHE B CE2   1 
ATOM   5152 C  CZ    . PHE B 1 181 ? 15.776  22.199  1.917   1.00 93.21  ? 181 PHE B CZ    1 
ATOM   5153 N  N     . TYR B 1 182 ? 17.219  22.700  7.800   1.00 89.28  ? 182 TYR B N     1 
ATOM   5154 C  CA    . TYR B 1 182 ? 16.062  22.218  8.556   1.00 90.10  ? 182 TYR B CA    1 
ATOM   5155 C  C     . TYR B 1 182 ? 15.819  22.937  9.876   1.00 93.18  ? 182 TYR B C     1 
ATOM   5156 O  O     . TYR B 1 182 ? 14.729  22.833  10.443  1.00 95.89  ? 182 TYR B O     1 
ATOM   5157 C  CB    . TYR B 1 182 ? 16.187  20.712  8.810   1.00 85.29  ? 182 TYR B CB    1 
ATOM   5158 C  CG    . TYR B 1 182 ? 15.993  19.847  7.587   1.00 82.93  ? 182 TYR B CG    1 
ATOM   5159 C  CD1   . TYR B 1 182 ? 14.798  19.870  6.870   1.00 85.70  ? 182 TYR B CD1   1 
ATOM   5160 C  CD2   . TYR B 1 182 ? 16.995  18.979  7.165   1.00 79.06  ? 182 TYR B CD2   1 
ATOM   5161 C  CE1   . TYR B 1 182 ? 14.615  19.064  5.750   1.00 83.73  ? 182 TYR B CE1   1 
ATOM   5162 C  CE2   . TYR B 1 182 ? 16.824  18.170  6.051   1.00 77.34  ? 182 TYR B CE2   1 
ATOM   5163 C  CZ    . TYR B 1 182 ? 15.634  18.216  5.347   1.00 79.60  ? 182 TYR B CZ    1 
ATOM   5164 O  OH    . TYR B 1 182 ? 15.470  17.405  4.244   1.00 77.60  ? 182 TYR B OH    1 
ATOM   5165 N  N     . GLY B 1 183 ? 16.828  23.652  10.371  1.00 93.38  ? 183 GLY B N     1 
ATOM   5166 C  CA    . GLY B 1 183 ? 16.660  24.514  11.546  1.00 96.92  ? 183 GLY B CA    1 
ATOM   5167 C  C     . GLY B 1 183 ? 17.128  23.928  12.867  1.00 94.85  ? 183 GLY B C     1 
ATOM   5168 O  O     . GLY B 1 183 ? 17.574  24.661  13.749  1.00 97.18  ? 183 GLY B O     1 
ATOM   5169 N  N     . SER B 1 184 ? 17.015  22.610  13.007  1.00 90.61  ? 184 SER B N     1 
ATOM   5170 C  CA    . SER B 1 184 ? 17.357  21.922  14.249  1.00 89.00  ? 184 SER B CA    1 
ATOM   5171 C  C     . SER B 1 184 ? 17.709  20.468  13.960  1.00 83.93  ? 184 SER B C     1 
ATOM   5172 O  O     . SER B 1 184 ? 17.354  19.942  12.903  1.00 82.22  ? 184 SER B O     1 
ATOM   5173 C  CB    . SER B 1 184 ? 16.176  21.963  15.224  1.00 92.48  ? 184 SER B CB    1 
ATOM   5174 O  OG    . SER B 1 184 ? 15.269  20.907  14.955  1.00 90.46  ? 184 SER B OG    1 
ATOM   5175 N  N     . PHE B 1 185 ? 18.399  19.829  14.905  1.00 82.10  ? 185 PHE B N     1 
ATOM   5176 C  CA    . PHE B 1 185 ? 18.675  18.390  14.853  1.00 77.83  ? 185 PHE B CA    1 
ATOM   5177 C  C     . PHE B 1 185 ? 17.368  17.605  14.689  1.00 78.12  ? 185 PHE B C     1 
ATOM   5178 O  O     . PHE B 1 185 ? 17.208  16.844  13.736  1.00 75.46  ? 185 PHE B O     1 
ATOM   5179 C  CB    . PHE B 1 185 ? 19.434  17.959  16.120  1.00 77.36  ? 185 PHE B CB    1 
ATOM   5180 C  CG    . PHE B 1 185 ? 19.537  16.463  16.308  1.00 74.26  ? 185 PHE B CG    1 
ATOM   5181 C  CD1   . PHE B 1 185 ? 18.799  15.823  17.304  1.00 76.22  ? 185 PHE B CD1   1 
ATOM   5182 C  CD2   . PHE B 1 185 ? 20.379  15.697  15.505  1.00 70.36  ? 185 PHE B CD2   1 
ATOM   5183 C  CE1   . PHE B 1 185 ? 18.893  14.441  17.492  1.00 72.72  ? 185 PHE B CE1   1 
ATOM   5184 C  CE2   . PHE B 1 185 ? 20.481  14.317  15.685  1.00 67.49  ? 185 PHE B CE2   1 
ATOM   5185 C  CZ    . PHE B 1 185 ? 19.732  13.689  16.683  1.00 69.07  ? 185 PHE B CZ    1 
ATOM   5186 N  N     . LEU B 1 186 ? 16.432  17.835  15.607  1.00 81.65  ? 186 LEU B N     1 
ATOM   5187 C  CA    . LEU B 1 186 ? 15.115  17.196  15.597  1.00 82.72  ? 186 LEU B CA    1 
ATOM   5188 C  C     . LEU B 1 186 ? 14.387  17.276  14.248  1.00 82.80  ? 186 LEU B C     1 
ATOM   5189 O  O     . LEU B 1 186 ? 13.875  16.262  13.768  1.00 81.09  ? 186 LEU B O     1 
ATOM   5190 C  CB    . LEU B 1 186 ? 14.240  17.758  16.728  1.00 87.32  ? 186 LEU B CB    1 
ATOM   5191 C  CG    . LEU B 1 186 ? 12.800  17.251  16.893  1.00 89.65  ? 186 LEU B CG    1 
ATOM   5192 C  CD1   . LEU B 1 186 ? 12.721  15.729  16.966  1.00 85.57  ? 186 LEU B CD1   1 
ATOM   5193 C  CD2   . LEU B 1 186 ? 12.164  17.868  18.125  1.00 94.21  ? 186 LEU B CD2   1 
ATOM   5194 N  N     . GLU B 1 187 ? 14.348  18.463  13.641  1.00 84.93  ? 187 GLU B N     1 
ATOM   5195 C  CA    . GLU B 1 187 ? 13.706  18.634  12.331  1.00 85.58  ? 187 GLU B CA    1 
ATOM   5196 C  C     . GLU B 1 187 ? 14.411  17.858  11.213  1.00 81.30  ? 187 GLU B C     1 
ATOM   5197 O  O     . GLU B 1 187 ? 13.760  17.329  10.308  1.00 80.87  ? 187 GLU B O     1 
ATOM   5198 C  CB    . GLU B 1 187 ? 13.571  20.115  11.969  1.00 89.57  ? 187 GLU B CB    1 
ATOM   5199 C  CG    . GLU B 1 187 ? 12.455  20.838  12.717  1.00 95.19  ? 187 GLU B CG    1 
ATOM   5200 C  CD    . GLU B 1 187 ? 11.104  20.128  12.623  1.00 97.45  ? 187 GLU B CD    1 
ATOM   5201 O  OE1   . GLU B 1 187 ? 10.718  19.684  11.511  1.00 96.06  ? 187 GLU B OE1   1 
ATOM   5202 O  OE2   . GLU B 1 187 ? 10.419  20.027  13.669  1.00 100.96 ? 187 GLU B OE2   1 
ATOM   5203 N  N     . THR B 1 188 ? 15.739  17.795  11.291  1.00 78.32  ? 188 THR B N     1 
ATOM   5204 C  CA    . THR B 1 188 ? 16.545  17.023  10.345  1.00 74.19  ? 188 THR B CA    1 
ATOM   5205 C  C     . THR B 1 188 ? 16.220  15.534  10.474  1.00 71.76  ? 188 THR B C     1 
ATOM   5206 O  O     . THR B 1 188 ? 15.886  14.881  9.487   1.00 70.41  ? 188 THR B O     1 
ATOM   5207 C  CB    . THR B 1 188 ? 18.056  17.262  10.565  1.00 71.84  ? 188 THR B CB    1 
ATOM   5208 O  OG1   . THR B 1 188 ? 18.319  18.670  10.644  1.00 74.77  ? 188 THR B OG1   1 
ATOM   5209 C  CG2   . THR B 1 188 ? 18.873  16.647  9.428   1.00 68.65  ? 188 THR B CG2   1 
ATOM   5210 N  N     . VAL B 1 189 ? 16.298  15.024  11.703  1.00 71.52  ? 189 VAL B N     1 
ATOM   5211 C  CA    . VAL B 1 189 ? 15.959  13.639  12.026  1.00 69.99  ? 189 VAL B CA    1 
ATOM   5212 C  C     . VAL B 1 189 ? 14.517  13.292  11.635  1.00 72.10  ? 189 VAL B C     1 
ATOM   5213 O  O     . VAL B 1 189 ? 14.272  12.232  11.065  1.00 70.70  ? 189 VAL B O     1 
ATOM   5214 C  CB    . VAL B 1 189 ? 16.241  13.336  13.528  1.00 70.37  ? 189 VAL B CB    1 
ATOM   5215 C  CG1   . VAL B 1 189 ? 15.512  12.087  14.005  1.00 70.79  ? 189 VAL B CG1   1 
ATOM   5216 C  CG2   . VAL B 1 189 ? 17.740  13.203  13.764  1.00 67.42  ? 189 VAL B CG2   1 
ATOM   5217 N  N     . LYS B 1 190 ? 13.581  14.199  11.922  1.00 76.04  ? 190 LYS B N     1 
ATOM   5218 C  CA    . LYS B 1 190 ? 12.169  14.015  11.577  1.00 78.65  ? 190 LYS B CA    1 
ATOM   5219 C  C     . LYS B 1 190 ? 11.969  13.910  10.063  1.00 77.74  ? 190 LYS B C     1 
ATOM   5220 O  O     . LYS B 1 190 ? 11.229  13.050  9.588   1.00 77.69  ? 190 LYS B O     1 
ATOM   5221 C  CB    . LYS B 1 190 ? 11.321  15.170  12.135  1.00 83.49  ? 190 LYS B CB    1 
ATOM   5222 C  CG    . LYS B 1 190 ? 9.913   14.767  12.584  1.00 86.96  ? 190 LYS B CG    1 
ATOM   5223 C  CD    . LYS B 1 190 ? 8.937   15.946  12.640  1.00 91.90  ? 190 LYS B CD    1 
ATOM   5224 C  CE    . LYS B 1 190 ? 9.163   16.825  13.868  1.00 95.15  ? 190 LYS B CE    1 
ATOM   5225 N  NZ    . LYS B 1 190 ? 8.042   17.794  14.091  1.00 101.12 ? 190 LYS B NZ    1 
ATOM   5226 N  N     . ASN B 1 191 ? 12.634  14.788  9.317   1.00 77.42  ? 191 ASN B N     1 
ATOM   5227 C  CA    . ASN B 1 191 ? 12.471  14.859  7.867   1.00 77.25  ? 191 ASN B CA    1 
ATOM   5228 C  C     . ASN B 1 191 ? 13.220  13.769  7.130   1.00 73.17  ? 191 ASN B C     1 
ATOM   5229 O  O     . ASN B 1 191 ? 12.734  13.246  6.127   1.00 73.09  ? 191 ASN B O     1 
ATOM   5230 C  CB    . ASN B 1 191 ? 12.894  16.229  7.339   1.00 79.07  ? 191 ASN B CB    1 
ATOM   5231 C  CG    . ASN B 1 191 ? 11.730  17.183  7.209   1.00 84.04  ? 191 ASN B CG    1 
ATOM   5232 O  OD1   . ASN B 1 191 ? 10.780  16.918  6.472   1.00 85.29  ? 191 ASN B OD1   1 
ATOM   5233 N  ND2   . ASN B 1 191 ? 11.798  18.307  7.917   1.00 87.13  ? 191 ASN B ND2   1 
ATOM   5234 N  N     . ALA B 1 192 ? 14.405  13.435  7.639   1.00 70.09  ? 192 ALA B N     1 
ATOM   5235 C  CA    . ALA B 1 192 ? 15.274  12.448  7.021   1.00 66.28  ? 192 ALA B CA    1 
ATOM   5236 C  C     . ALA B 1 192 ? 14.616  11.075  6.936   1.00 65.45  ? 192 ALA B C     1 
ATOM   5237 O  O     . ALA B 1 192 ? 15.000  10.259  6.105   1.00 63.34  ? 192 ALA B O     1 
ATOM   5238 C  CB    . ALA B 1 192 ? 16.598  12.365  7.767   1.00 63.98  ? 192 ALA B CB    1 
ATOM   5239 N  N     . ARG B 1 193 ? 13.621  10.834  7.790   1.00 67.36  ? 193 ARG B N     1 
ATOM   5240 C  CA    . ARG B 1 193 ? 12.824  9.607   7.738   1.00 67.56  ? 193 ARG B CA    1 
ATOM   5241 C  C     . ARG B 1 193 ? 12.158  9.405   6.371   1.00 68.75  ? 193 ARG B C     1 
ATOM   5242 O  O     . ARG B 1 193 ? 11.801  8.277   6.015   1.00 68.42  ? 193 ARG B O     1 
ATOM   5243 C  CB    . ARG B 1 193 ? 11.751  9.610   8.830   1.00 70.58  ? 193 ARG B CB    1 
ATOM   5244 C  CG    . ARG B 1 193 ? 12.267  9.626   10.261  1.00 69.92  ? 193 ARG B CG    1 
ATOM   5245 C  CD    . ARG B 1 193 ? 11.107  9.663   11.250  1.00 73.35  ? 193 ARG B CD    1 
ATOM   5246 N  NE    . ARG B 1 193 ? 10.241  10.829  11.056  1.00 77.68  ? 193 ARG B NE    1 
ATOM   5247 C  CZ    . ARG B 1 193 ? 9.137   11.078  11.756  1.00 81.69  ? 193 ARG B CZ    1 
ATOM   5248 N  NH1   . ARG B 1 193 ? 8.745   10.244  12.710  1.00 82.63  ? 193 ARG B NH1   1 
ATOM   5249 N  NH2   . ARG B 1 193 ? 8.416   12.162  11.499  1.00 85.79  ? 193 ARG B NH2   1 
ATOM   5250 N  N     . ARG B 1 194 ? 12.001  10.497  5.616   1.00 70.56  ? 194 ARG B N     1 
ATOM   5251 C  CA    . ARG B 1 194 ? 11.361  10.459  4.296   1.00 72.46  ? 194 ARG B CA    1 
ATOM   5252 C  C     . ARG B 1 194 ? 12.321  10.645  3.112   1.00 70.47  ? 194 ARG B C     1 
ATOM   5253 O  O     . ARG B 1 194 ? 11.876  10.742  1.964   1.00 72.18  ? 194 ARG B O     1 
ATOM   5254 C  CB    . ARG B 1 194 ? 10.222  11.482  4.209   1.00 76.87  ? 194 ARG B CB    1 
ATOM   5255 C  CG    . ARG B 1 194 ? 8.929   11.106  4.947   1.00 79.88  ? 194 ARG B CG    1 
ATOM   5256 C  CD    . ARG B 1 194 ? 7.778   12.025  4.511   1.00 85.61  ? 194 ARG B CD    1 
ATOM   5257 N  NE    . ARG B 1 194 ? 8.280   13.354  4.154   1.00 88.78  ? 194 ARG B NE    1 
ATOM   5258 C  CZ    . ARG B 1 194 ? 7.957   14.493  4.763   1.00 93.17  ? 194 ARG B CZ    1 
ATOM   5259 N  NH1   . ARG B 1 194 ? 7.086   14.512  5.766   1.00 95.76  ? 194 ARG B NH1   1 
ATOM   5260 N  NH2   . ARG B 1 194 ? 8.498   15.631  4.345   1.00 95.37  ? 194 ARG B NH2   1 
ATOM   5261 N  N     . TRP B 1 195 ? 13.625  10.707  3.389   1.00 67.40  ? 195 TRP B N     1 
ATOM   5262 C  CA    . TRP B 1 195 ? 14.638  10.757  2.327   1.00 65.52  ? 195 TRP B CA    1 
ATOM   5263 C  C     . TRP B 1 195 ? 14.647  9.477   1.492   1.00 63.78  ? 195 TRP B C     1 
ATOM   5264 O  O     . TRP B 1 195 ? 14.492  8.374   2.024   1.00 62.24  ? 195 TRP B O     1 
ATOM   5265 C  CB    . TRP B 1 195 ? 16.039  10.983  2.900   1.00 63.15  ? 195 TRP B CB    1 
ATOM   5266 C  CG    . TRP B 1 195 ? 16.298  12.358  3.459   1.00 65.25  ? 195 TRP B CG    1 
ATOM   5267 C  CD1   . TRP B 1 195 ? 15.495  13.459  3.354   1.00 70.09  ? 195 TRP B CD1   1 
ATOM   5268 C  CD2   . TRP B 1 195 ? 17.468  12.782  4.175   1.00 64.56  ? 195 TRP B CD2   1 
ATOM   5269 N  NE1   . TRP B 1 195 ? 16.082  14.540  3.981   1.00 71.29  ? 195 TRP B NE1   1 
ATOM   5270 C  CE2   . TRP B 1 195 ? 17.296  14.151  4.488   1.00 67.79  ? 195 TRP B CE2   1 
ATOM   5271 C  CE3   . TRP B 1 195 ? 18.641  12.136  4.590   1.00 61.14  ? 195 TRP B CE3   1 
ATOM   5272 C  CZ2   . TRP B 1 195 ? 18.252  14.882  5.200   1.00 66.21  ? 195 TRP B CZ2   1 
ATOM   5273 C  CZ3   . TRP B 1 195 ? 19.591  12.870  5.293   1.00 60.31  ? 195 TRP B CZ3   1 
ATOM   5274 C  CH2   . TRP B 1 195 ? 19.388  14.221  5.592   1.00 63.44  ? 195 TRP B CH2   1 
ATOM   5275 N  N     . THR B 1 196 ? 14.813  9.635   0.182   1.00 63.96  ? 196 THR B N     1 
ATOM   5276 C  CA    . THR B 1 196 ? 15.022  8.499   -0.709  1.00 62.07  ? 196 THR B CA    1 
ATOM   5277 C  C     . THR B 1 196 ? 16.431  8.579   -1.297  1.00 59.98  ? 196 THR B C     1 
ATOM   5278 O  O     . THR B 1 196 ? 17.145  9.569   -1.097  1.00 59.62  ? 196 THR B O     1 
ATOM   5279 C  CB    . THR B 1 196 ? 14.019  8.485   -1.875  1.00 65.14  ? 196 THR B CB    1 
ATOM   5280 O  OG1   . THR B 1 196 ? 14.360  9.519   -2.803  1.00 65.61  ? 196 THR B OG1   1 
ATOM   5281 C  CG2   . THR B 1 196 ? 12.575  8.676   -1.385  1.00 67.98  ? 196 THR B CG2   1 
ATOM   5282 N  N     . ARG B 1 197 ? 16.823  7.542   -2.036  1.00 58.68  ? 197 ARG B N     1 
ATOM   5283 C  CA    . ARG B 1 197 ? 18.091  7.545   -2.768  1.00 56.96  ? 197 ARG B CA    1 
ATOM   5284 C  C     . ARG B 1 197 ? 18.079  8.541   -3.933  1.00 59.54  ? 197 ARG B C     1 
ATOM   5285 O  O     . ARG B 1 197 ? 19.020  8.585   -4.727  1.00 58.79  ? 197 ARG B O     1 
ATOM   5286 C  CB    . ARG B 1 197 ? 18.403  6.138   -3.288  1.00 55.44  ? 197 ARG B CB    1 
ATOM   5287 C  CG    . ARG B 1 197 ? 17.450  5.619   -4.367  1.00 56.80  ? 197 ARG B CG    1 
ATOM   5288 C  CD    . ARG B 1 197 ? 17.636  4.131   -4.585  1.00 54.98  ? 197 ARG B CD    1 
ATOM   5289 N  NE    . ARG B 1 197 ? 17.192  3.343   -3.435  1.00 52.22  ? 197 ARG B NE    1 
ATOM   5290 C  CZ    . ARG B 1 197 ? 17.467  2.052   -3.247  1.00 50.73  ? 197 ARG B CZ    1 
ATOM   5291 N  NH1   . ARG B 1 197 ? 18.199  1.383   -4.128  1.00 50.25  ? 197 ARG B NH1   1 
ATOM   5292 N  NH2   . ARG B 1 197 ? 17.013  1.428   -2.167  1.00 48.72  ? 197 ARG B NH2   1 
ATOM   5293 N  N     . ARG B 1 198 ? 17.008  9.330   -4.019  1.00 62.95  ? 198 ARG B N     1 
ATOM   5294 C  CA    . ARG B 1 198 ? 16.766  10.236  -5.140  1.00 66.51  ? 198 ARG B CA    1 
ATOM   5295 C  C     . ARG B 1 198 ? 16.597  11.687  -4.677  1.00 68.39  ? 198 ARG B C     1 
ATOM   5296 O  O     . ARG B 1 198 ? 16.459  12.596  -5.496  1.00 71.48  ? 198 ARG B O     1 
ATOM   5297 C  CB    . ARG B 1 198 ? 15.513  9.787   -5.899  1.00 69.88  ? 198 ARG B CB    1 
ATOM   5298 C  CG    . ARG B 1 198 ? 15.604  8.388   -6.502  1.00 70.13  ? 198 ARG B CG    1 
ATOM   5299 C  CD    . ARG B 1 198 ? 15.945  8.442   -7.979  1.00 74.06  ? 198 ARG B CD    1 
ATOM   5300 N  NE    . ARG B 1 198 ? 14.857  9.042   -8.754  1.00 80.18  ? 198 ARG B NE    1 
ATOM   5301 C  CZ    . ARG B 1 198 ? 14.868  9.208   -10.076 1.00 83.55  ? 198 ARG B CZ    1 
ATOM   5302 N  NH1   . ARG B 1 198 ? 15.918  8.821   -10.798 1.00 82.66  ? 198 ARG B NH1   1 
ATOM   5303 N  NH2   . ARG B 1 198 ? 13.826  9.767   -10.677 1.00 87.34  ? 198 ARG B NH2   1 
ATOM   5304 N  N     . THR B 1 199 ? 16.615  11.888  -3.361  1.00 66.94  ? 199 THR B N     1 
ATOM   5305 C  CA    . THR B 1 199 ? 16.383  13.191  -2.738  1.00 69.00  ? 199 THR B CA    1 
ATOM   5306 C  C     . THR B 1 199 ? 17.486  14.193  -3.091  1.00 68.99  ? 199 THR B C     1 
ATOM   5307 O  O     . THR B 1 199 ? 18.673  13.872  -3.020  1.00 65.87  ? 199 THR B O     1 
ATOM   5308 C  CB    . THR B 1 199 ? 16.268  13.038  -1.192  1.00 67.46  ? 199 THR B CB    1 
ATOM   5309 O  OG1   . THR B 1 199 ? 15.176  12.167  -0.872  1.00 68.25  ? 199 THR B OG1   1 
ATOM   5310 C  CG2   . THR B 1 199 ? 16.048  14.380  -0.511  1.00 69.36  ? 199 THR B CG2   1 
ATOM   5311 N  N     . VAL B 1 200 ? 17.083  15.397  -3.484  1.00 72.69  ? 200 VAL B N     1 
ATOM   5312 C  CA    . VAL B 1 200 ? 18.014  16.496  -3.744  1.00 73.70  ? 200 VAL B CA    1 
ATOM   5313 C  C     . VAL B 1 200 ? 17.700  17.679  -2.816  1.00 76.27  ? 200 VAL B C     1 
ATOM   5314 O  O     . VAL B 1 200 ? 16.583  18.213  -2.828  1.00 79.97  ? 200 VAL B O     1 
ATOM   5315 C  CB    . VAL B 1 200 ? 17.995  16.931  -5.242  1.00 76.94  ? 200 VAL B CB    1 
ATOM   5316 C  CG1   . VAL B 1 200 ? 18.802  18.205  -5.461  1.00 78.56  ? 200 VAL B CG1   1 
ATOM   5317 C  CG2   . VAL B 1 200 ? 18.516  15.807  -6.137  1.00 73.90  ? 200 VAL B CG2   1 
ATOM   5318 N  N     . ILE B 1 201 ? 18.691  18.069  -2.014  1.00 74.58  ? 201 ILE B N     1 
ATOM   5319 C  CA    . ILE B 1 201 ? 18.551  19.154  -1.038  1.00 76.90  ? 201 ILE B CA    1 
ATOM   5320 C  C     . ILE B 1 201 ? 19.378  20.380  -1.452  1.00 79.62  ? 201 ILE B C     1 
ATOM   5321 O  O     . ILE B 1 201 ? 20.613  20.383  -1.344  1.00 77.17  ? 201 ILE B O     1 
ATOM   5322 C  CB    . ILE B 1 201 ? 18.932  18.689  0.398   1.00 73.65  ? 201 ILE B CB    1 
ATOM   5323 C  CG1   . ILE B 1 201 ? 18.076  17.489  0.816   1.00 72.04  ? 201 ILE B CG1   1 
ATOM   5324 C  CG2   . ILE B 1 201 ? 18.804  19.838  1.408   1.00 75.94  ? 201 ILE B CG2   1 
ATOM   5325 C  CD1   . ILE B 1 201 ? 18.496  16.829  2.117   1.00 68.83  ? 201 ILE B CD1   1 
ATOM   5326 N  N     . ASP B 1 202 ? 18.683  21.414  -1.927  1.00 84.77  ? 202 ASP B N     1 
ATOM   5327 C  CA    . ASP B 1 202 ? 19.319  22.649  -2.367  1.00 88.27  ? 202 ASP B CA    1 
ATOM   5328 C  C     . ASP B 1 202 ? 19.119  23.742  -1.327  1.00 91.64  ? 202 ASP B C     1 
ATOM   5329 O  O     . ASP B 1 202 ? 18.081  24.408  -1.289  1.00 96.04  ? 202 ASP B O     1 
ATOM   5330 C  CB    . ASP B 1 202 ? 18.782  23.080  -3.734  1.00 92.29  ? 202 ASP B CB    1 
ATOM   5331 C  CG    . ASP B 1 202 ? 19.593  24.211  -4.361  1.00 95.39  ? 202 ASP B CG    1 
ATOM   5332 O  OD1   . ASP B 1 202 ? 20.299  24.949  -3.638  1.00 94.99  ? 202 ASP B OD1   1 
ATOM   5333 O  OD2   . ASP B 1 202 ? 19.525  24.363  -5.597  1.00 98.01  ? 202 ASP B OD2   1 
ATOM   5334 N  N     . VAL B 1 203 ? 20.134  23.919  -0.489  1.00 90.08  ? 203 VAL B N     1 
ATOM   5335 C  CA    . VAL B 1 203 ? 20.103  24.890  0.605   1.00 93.33  ? 203 VAL B CA    1 
ATOM   5336 C  C     . VAL B 1 203 ? 20.017  26.329  0.094   1.00 99.30  ? 203 VAL B C     1 
ATOM   5337 O  O     . VAL B 1 203 ? 19.309  27.152  0.678   1.00 103.53 ? 203 VAL B O     1 
ATOM   5338 C  CB    . VAL B 1 203 ? 21.327  24.732  1.547   1.00 89.93  ? 203 VAL B CB    1 
ATOM   5339 C  CG1   . VAL B 1 203 ? 20.994  25.245  2.941   1.00 91.83  ? 203 VAL B CG1   1 
ATOM   5340 C  CG2   . VAL B 1 203 ? 21.771  23.267  1.616   1.00 84.96  ? 203 VAL B CG2   1 
ATOM   5341 N  N     . ALA B 1 204 ? 20.722  26.617  -1.001  1.00 100.40 ? 204 ALA B N     1 
ATOM   5342 C  CA    . ALA B 1 204 ? 20.741  27.959  -1.604  1.00 106.32 ? 204 ALA B CA    1 
ATOM   5343 C  C     . ALA B 1 204 ? 19.363  28.411  -2.097  1.00 111.74 ? 204 ALA B C     1 
ATOM   5344 O  O     . ALA B 1 204 ? 19.046  29.605  -2.071  1.00 117.18 ? 204 ALA B O     1 
ATOM   5345 C  CB    . ALA B 1 204 ? 21.754  28.021  -2.735  1.00 105.92 ? 204 ALA B CB    1 
ATOM   5346 N  N     . LYS B 1 205 ? 18.559  27.453  -2.551  1.00 110.40 ? 205 LYS B N     1 
ATOM   5347 C  CA    . LYS B 1 205 ? 17.184  27.721  -2.968  1.00 115.30 ? 205 LYS B CA    1 
ATOM   5348 C  C     . LYS B 1 205 ? 16.201  27.500  -1.819  1.00 115.36 ? 205 LYS B C     1 
ATOM   5349 O  O     . LYS B 1 205 ? 15.101  28.056  -1.818  1.00 120.56 ? 205 LYS B O     1 
ATOM   5350 C  CB    . LYS B 1 205 ? 16.798  26.851  -4.169  1.00 114.43 ? 205 LYS B CB    1 
ATOM   5351 C  CG    . LYS B 1 205 ? 17.550  27.184  -5.452  1.00 116.16 ? 205 LYS B CG    1 
ATOM   5352 C  CD    . LYS B 1 205 ? 17.154  26.247  -6.588  1.00 115.33 ? 205 LYS B CD    1 
ATOM   5353 C  CE    . LYS B 1 205 ? 18.040  26.448  -7.811  1.00 116.18 ? 205 LYS B CE    1 
ATOM   5354 N  NZ    . LYS B 1 205 ? 17.859  27.800  -8.419  1.00 122.17 ? 205 LYS B NZ    1 
ATOM   5355 N  N     . GLY B 1 206 ? 16.613  26.701  -0.839  1.00 110.22 ? 206 GLY B N     1 
ATOM   5356 C  CA    . GLY B 1 206 ? 15.765  26.340  0.294   1.00 109.83 ? 206 GLY B CA    1 
ATOM   5357 C  C     . GLY B 1 206 ? 14.646  25.387  -0.090  1.00 109.40 ? 206 GLY B C     1 
ATOM   5358 O  O     . GLY B 1 206 ? 13.477  25.655  0.187   1.00 113.06 ? 206 GLY B O     1 
ATOM   5359 N  N     . GLU B 1 207 ? 15.001  24.275  -0.733  1.00 105.19 ? 207 GLU B N     1 
ATOM   5360 C  CA    . GLU B 1 207 ? 14.012  23.279  -1.157  1.00 104.77 ? 207 GLU B CA    1 
ATOM   5361 C  C     . GLU B 1 207 ? 14.527  21.831  -1.164  1.00 98.33  ? 207 GLU B C     1 
ATOM   5362 O  O     . GLU B 1 207 ? 15.718  21.575  -1.363  1.00 94.78  ? 207 GLU B O     1 
ATOM   5363 C  CB    . GLU B 1 207 ? 13.420  23.644  -2.531  1.00 109.32 ? 207 GLU B CB    1 
ATOM   5364 C  CG    . GLU B 1 207 ? 14.352  23.393  -3.721  1.00 108.17 ? 207 GLU B CG    1 
ATOM   5365 C  CD    . GLU B 1 207 ? 13.614  23.241  -5.045  1.00 111.63 ? 207 GLU B CD    1 
ATOM   5366 O  OE1   . GLU B 1 207 ? 14.117  23.778  -6.058  1.00 114.88 ? 207 GLU B OE1   1 
ATOM   5367 O  OE2   . GLU B 1 207 ? 12.540  22.590  -5.077  1.00 112.70 ? 207 GLU B OE2   1 
ATOM   5368 N  N     . VAL B 1 208 ? 13.609  20.899  -0.916  1.00 97.07  ? 208 VAL B N     1 
ATOM   5369 C  CA    . VAL B 1 208 ? 13.846  19.474  -1.110  1.00 92.29  ? 208 VAL B CA    1 
ATOM   5370 C  C     . VAL B 1 208 ? 13.113  19.057  -2.377  1.00 94.06  ? 208 VAL B C     1 
ATOM   5371 O  O     . VAL B 1 208 ? 11.903  19.263  -2.494  1.00 97.99  ? 208 VAL B O     1 
ATOM   5372 C  CB    . VAL B 1 208 ? 13.316  18.621  0.075   1.00 90.18  ? 208 VAL B CB    1 
ATOM   5373 C  CG1   . VAL B 1 208 ? 13.649  17.152  -0.123  1.00 85.76  ? 208 VAL B CG1   1 
ATOM   5374 C  CG2   . VAL B 1 208 ? 13.866  19.112  1.401   1.00 89.31  ? 208 VAL B CG2   1 
ATOM   5375 N  N     . ARG B 1 209 ? 13.843  18.481  -3.325  1.00 91.37  ? 209 ARG B N     1 
ATOM   5376 C  CA    . ARG B 1 209 ? 13.244  17.991  -4.561  1.00 93.20  ? 209 ARG B CA    1 
ATOM   5377 C  C     . ARG B 1 209 ? 13.704  16.572  -4.881  1.00 88.78  ? 209 ARG B C     1 
ATOM   5378 O  O     . ARG B 1 209 ? 14.594  16.042  -4.217  1.00 84.25  ? 209 ARG B O     1 
ATOM   5379 C  CB    . ARG B 1 209 ? 13.516  18.951  -5.729  1.00 97.07  ? 209 ARG B CB    1 
ATOM   5380 C  CG    . ARG B 1 209 ? 14.968  19.054  -6.145  1.00 94.59  ? 209 ARG B CG    1 
ATOM   5381 C  CD    . ARG B 1 209 ? 15.186  20.133  -7.198  1.00 99.23  ? 209 ARG B CD    1 
ATOM   5382 N  NE    . ARG B 1 209 ? 16.616  20.383  -7.371  1.00 96.96  ? 209 ARG B NE    1 
ATOM   5383 C  CZ    . ARG B 1 209 ? 17.221  21.548  -7.155  1.00 98.56  ? 209 ARG B CZ    1 
ATOM   5384 N  NH1   . ARG B 1 209 ? 16.529  22.623  -6.784  1.00 102.98 ? 209 ARG B NH1   1 
ATOM   5385 N  NH2   . ARG B 1 209 ? 18.531  21.641  -7.335  1.00 96.08  ? 209 ARG B NH2   1 
ATOM   5386 N  N     . LYS B 1 210 ? 13.092  15.958  -5.890  1.00 90.37  ? 210 LYS B N     1 
ATOM   5387 C  CA    . LYS B 1 210 ? 13.462  14.611  -6.312  1.00 87.18  ? 210 LYS B CA    1 
ATOM   5388 C  C     . LYS B 1 210 ? 14.257  14.657  -7.614  1.00 87.57  ? 210 LYS B C     1 
ATOM   5389 O  O     . LYS B 1 210 ? 13.756  15.116  -8.641  1.00 91.80  ? 210 LYS B O     1 
ATOM   5390 C  CB    . LYS B 1 210 ? 12.225  13.720  -6.460  1.00 88.42  ? 210 LYS B CB    1 
ATOM   5391 C  CG    . LYS B 1 210 ? 12.529  12.223  -6.390  1.00 85.11  ? 210 LYS B CG    1 
ATOM   5392 C  CD    . LYS B 1 210 ? 11.257  11.363  -6.430  1.00 87.18  ? 210 LYS B CD    1 
ATOM   5393 C  CE    . LYS B 1 210 ? 10.906  10.885  -7.842  1.00 90.43  ? 210 LYS B CE    1 
ATOM   5394 N  NZ    . LYS B 1 210 ? 10.467  11.983  -8.750  1.00 94.89  ? 210 LYS B NZ    1 
ATOM   5395 N  N     . GLY B 1 211 ? 15.500  14.186  -7.553  1.00 83.46  ? 211 GLY B N     1 
ATOM   5396 C  CA    . GLY B 1 211 ? 16.391  14.176  -8.709  1.00 83.91  ? 211 GLY B CA    1 
ATOM   5397 C  C     . GLY B 1 211 ? 16.839  12.779  -9.085  1.00 81.05  ? 211 GLY B C     1 
ATOM   5398 O  O     . GLY B 1 211 ? 16.096  11.818  -8.906  1.00 80.47  ? 211 GLY B O     1 
ATOM   5399 N  N     . GLU B 1 212 ? 18.064  12.670  -9.596  1.00 79.54  ? 212 GLU B N     1 
ATOM   5400 C  CA    . GLU B 1 212 ? 18.611  11.403  -10.083 1.00 77.36  ? 212 GLU B CA    1 
ATOM   5401 C  C     . GLU B 1 212 ? 19.305  10.566  -9.007  1.00 72.46  ? 212 GLU B C     1 
ATOM   5402 O  O     . GLU B 1 212 ? 19.359  9.334   -9.098  1.00 70.95  ? 212 GLU B O     1 
ATOM   5403 C  CB    . GLU B 1 212 ? 19.591  11.656  -11.225 1.00 78.56  ? 212 GLU B CB    1 
ATOM   5404 C  CG    . GLU B 1 212 ? 18.994  11.475  -12.608 1.00 83.72  ? 212 GLU B CG    1 
ATOM   5405 C  CD    . GLU B 1 212 ? 20.022  11.000  -13.629 1.00 84.58  ? 212 GLU B CD    1 
ATOM   5406 O  OE1   . GLU B 1 212 ? 19.809  11.251  -14.838 1.00 88.77  ? 212 GLU B OE1   1 
ATOM   5407 O  OE2   . GLU B 1 212 ? 21.034  10.375  -13.225 1.00 79.87  ? 212 GLU B OE2   1 
ATOM   5408 N  N     . GLU B 1 213 ? 19.856  11.244  -8.005  1.00 70.25  ? 213 GLU B N     1 
ATOM   5409 C  CA    . GLU B 1 213 ? 20.556  10.590  -6.905  1.00 66.03  ? 213 GLU B CA    1 
ATOM   5410 C  C     . GLU B 1 213 ? 20.490  11.475  -5.669  1.00 64.75  ? 213 GLU B C     1 
ATOM   5411 O  O     . GLU B 1 213 ? 19.978  12.600  -5.729  1.00 67.38  ? 213 GLU B O     1 
ATOM   5412 C  CB    . GLU B 1 213 ? 22.015  10.306  -7.288  1.00 63.91  ? 213 GLU B CB    1 
ATOM   5413 C  CG    . GLU B 1 213 ? 22.752  11.493  -7.913  1.00 66.39  ? 213 GLU B CG    1 
ATOM   5414 C  CD    . GLU B 1 213 ? 24.021  11.082  -8.647  1.00 66.15  ? 213 GLU B CD    1 
ATOM   5415 O  OE1   . GLU B 1 213 ? 23.979  10.101  -9.431  1.00 68.32  ? 213 GLU B OE1   1 
ATOM   5416 O  OE2   . GLU B 1 213 ? 25.061  11.750  -8.449  1.00 67.22  ? 213 GLU B OE2   1 
ATOM   5417 N  N     . PHE B 1 214 ? 20.998  10.967  -4.551  1.00 60.73  ? 214 PHE B N     1 
ATOM   5418 C  CA    . PHE B 1 214 ? 21.132  11.781  -3.355  1.00 59.68  ? 214 PHE B CA    1 
ATOM   5419 C  C     . PHE B 1 214 ? 22.213  12.842  -3.588  1.00 59.93  ? 214 PHE B C     1 
ATOM   5420 O  O     . PHE B 1 214 ? 23.397  12.523  -3.724  1.00 57.59  ? 214 PHE B O     1 
ATOM   5421 C  CB    . PHE B 1 214 ? 21.430  10.926  -2.120  1.00 56.20  ? 214 PHE B CB    1 
ATOM   5422 C  CG    . PHE B 1 214 ? 21.168  11.636  -0.824  1.00 55.95  ? 214 PHE B CG    1 
ATOM   5423 C  CD1   . PHE B 1 214 ? 19.883  11.714  -0.309  1.00 56.48  ? 214 PHE B CD1   1 
ATOM   5424 C  CD2   . PHE B 1 214 ? 22.207  12.240  -0.123  1.00 54.71  ? 214 PHE B CD2   1 
ATOM   5425 C  CE1   . PHE B 1 214 ? 19.631  12.374  0.889   1.00 57.22  ? 214 PHE B CE1   1 
ATOM   5426 C  CE2   . PHE B 1 214 ? 21.964  12.904  1.077   1.00 55.24  ? 214 PHE B CE2   1 
ATOM   5427 C  CZ    . PHE B 1 214 ? 20.669  12.973  1.582   1.00 56.80  ? 214 PHE B CZ    1 
ATOM   5428 N  N     . PHE B 1 215 ? 21.782  14.100  -3.638  1.00 62.41  ? 215 PHE B N     1 
ATOM   5429 C  CA    . PHE B 1 215 ? 22.624  15.210  -4.072  1.00 63.77  ? 215 PHE B CA    1 
ATOM   5430 C  C     . PHE B 1 215 ? 22.356  16.442  -3.210  1.00 65.73  ? 215 PHE B C     1 
ATOM   5431 O  O     . PHE B 1 215 ? 21.396  17.175  -3.447  1.00 69.72  ? 215 PHE B O     1 
ATOM   5432 C  CB    . PHE B 1 215 ? 22.331  15.517  -5.550  1.00 66.56  ? 215 PHE B CB    1 
ATOM   5433 C  CG    . PHE B 1 215 ? 23.418  16.288  -6.269  1.00 67.18  ? 215 PHE B CG    1 
ATOM   5434 C  CD1   . PHE B 1 215 ? 24.107  15.704  -7.331  1.00 66.38  ? 215 PHE B CD1   1 
ATOM   5435 C  CD2   . PHE B 1 215 ? 23.723  17.606  -5.923  1.00 68.97  ? 215 PHE B CD2   1 
ATOM   5436 C  CE1   . PHE B 1 215 ? 25.097  16.411  -8.022  1.00 67.70  ? 215 PHE B CE1   1 
ATOM   5437 C  CE2   . PHE B 1 215 ? 24.707  18.322  -6.609  1.00 70.28  ? 215 PHE B CE2   1 
ATOM   5438 C  CZ    . PHE B 1 215 ? 25.394  17.724  -7.659  1.00 70.03  ? 215 PHE B CZ    1 
ATOM   5439 N  N     . VAL B 1 216 ? 23.198  16.666  -2.205  1.00 63.75  ? 216 VAL B N     1 
ATOM   5440 C  CA    . VAL B 1 216 ? 23.092  17.872  -1.388  1.00 65.87  ? 216 VAL B CA    1 
ATOM   5441 C  C     . VAL B 1 216 ? 23.966  18.959  -2.003  1.00 68.08  ? 216 VAL B C     1 
ATOM   5442 O  O     . VAL B 1 216 ? 25.190  18.946  -1.847  1.00 65.96  ? 216 VAL B O     1 
ATOM   5443 C  CB    . VAL B 1 216 ? 23.474  17.637  0.090   1.00 63.16  ? 216 VAL B CB    1 
ATOM   5444 C  CG1   . VAL B 1 216 ? 23.245  18.911  0.900   1.00 66.88  ? 216 VAL B CG1   1 
ATOM   5445 C  CG2   . VAL B 1 216 ? 22.669  16.498  0.675   1.00 61.21  ? 216 VAL B CG2   1 
ATOM   5446 N  N     . VAL B 1 217 ? 23.325  19.895  -2.700  1.00 72.47  ? 217 VAL B N     1 
ATOM   5447 C  CA    . VAL B 1 217 ? 24.049  20.874  -3.508  1.00 75.48  ? 217 VAL B CA    1 
ATOM   5448 C  C     . VAL B 1 217 ? 24.741  21.936  -2.649  1.00 77.04  ? 217 VAL B C     1 
ATOM   5449 O  O     . VAL B 1 217 ? 24.121  22.570  -1.784  1.00 78.88  ? 217 VAL B O     1 
ATOM   5450 C  CB    . VAL B 1 217 ? 23.173  21.508  -4.658  1.00 80.23  ? 217 VAL B CB    1 
ATOM   5451 C  CG1   . VAL B 1 217 ? 21.923  20.666  -4.942  1.00 79.85  ? 217 VAL B CG1   1 
ATOM   5452 C  CG2   . VAL B 1 217 ? 22.799  22.955  -4.366  1.00 84.68  ? 217 VAL B CG2   1 
ATOM   5453 N  N     . ASP B 1 218 ? 26.039  22.095  -2.896  1.00 76.38  ? 218 ASP B N     1 
ATOM   5454 C  CA    . ASP B 1 218 ? 26.853  23.138  -2.281  1.00 78.01  ? 218 ASP B CA    1 
ATOM   5455 C  C     . ASP B 1 218 ? 26.336  24.515  -2.703  1.00 83.61  ? 218 ASP B C     1 
ATOM   5456 O  O     . ASP B 1 218 ? 26.273  24.806  -3.898  1.00 86.27  ? 218 ASP B O     1 
ATOM   5457 C  CB    . ASP B 1 218 ? 28.306  22.955  -2.735  1.00 76.38  ? 218 ASP B CB    1 
ATOM   5458 C  CG    . ASP B 1 218 ? 29.317  23.549  -1.770  1.00 76.09  ? 218 ASP B CG    1 
ATOM   5459 O  OD1   . ASP B 1 218 ? 28.991  24.505  -1.040  1.00 76.39  ? 218 ASP B OD1   1 
ATOM   5460 O  OD2   . ASP B 1 218 ? 30.460  23.041  -1.751  1.00 73.68  ? 218 ASP B OD2   1 
ATOM   5461 N  N     . PRO B 1 219 ? 25.959  25.371  -1.729  1.00 85.88  ? 219 PRO B N     1 
ATOM   5462 C  CA    . PRO B 1 219 ? 25.469  26.707  -2.082  1.00 91.76  ? 219 PRO B CA    1 
ATOM   5463 C  C     . PRO B 1 219 ? 26.530  27.550  -2.791  1.00 94.23  ? 219 PRO B C     1 
ATOM   5464 O  O     . PRO B 1 219 ? 26.186  28.420  -3.588  1.00 99.21  ? 219 PRO B O     1 
ATOM   5465 C  CB    . PRO B 1 219 ? 25.127  27.332  -0.726  1.00 93.07  ? 219 PRO B CB    1 
ATOM   5466 C  CG    . PRO B 1 219 ? 25.008  26.189  0.215   1.00 88.28  ? 219 PRO B CG    1 
ATOM   5467 C  CD    . PRO B 1 219 ? 25.956  25.158  -0.271  1.00 83.84  ? 219 PRO B CD    1 
ATOM   5468 N  N     . VAL B 1 220 ? 27.807  27.285  -2.514  1.00 91.23  ? 220 VAL B N     1 
ATOM   5469 C  CA    . VAL B 1 220 ? 28.888  28.064  -3.124  1.00 93.11  ? 220 VAL B CA    1 
ATOM   5470 C  C     . VAL B 1 220 ? 29.371  27.439  -4.446  1.00 91.72  ? 220 VAL B C     1 
ATOM   5471 O  O     . VAL B 1 220 ? 30.177  28.033  -5.169  1.00 94.12  ? 220 VAL B O     1 
ATOM   5472 C  CB    . VAL B 1 220 ? 30.046  28.336  -2.117  1.00 91.67  ? 220 VAL B CB    1 
ATOM   5473 C  CG1   . VAL B 1 220 ? 31.138  27.274  -2.204  1.00 86.94  ? 220 VAL B CG1   1 
ATOM   5474 C  CG2   . VAL B 1 220 ? 30.626  29.718  -2.341  1.00 97.12  ? 220 VAL B CG2   1 
ATOM   5475 N  N     . ASP B 1 221 ? 28.847  26.250  -4.756  1.00 88.17  ? 221 ASP B N     1 
ATOM   5476 C  CA    . ASP B 1 221 ? 29.188  25.510  -5.976  1.00 86.72  ? 221 ASP B CA    1 
ATOM   5477 C  C     . ASP B 1 221 ? 28.087  24.501  -6.309  1.00 84.74  ? 221 ASP B C     1 
ATOM   5478 O  O     . ASP B 1 221 ? 28.101  23.374  -5.816  1.00 80.03  ? 221 ASP B O     1 
ATOM   5479 C  CB    . ASP B 1 221 ? 30.536  24.789  -5.810  1.00 82.65  ? 221 ASP B CB    1 
ATOM   5480 C  CG    . ASP B 1 221 ? 31.080  24.233  -7.121  1.00 82.57  ? 221 ASP B CG    1 
ATOM   5481 O  OD1   . ASP B 1 221 ? 30.722  24.740  -8.203  1.00 86.79  ? 221 ASP B OD1   1 
ATOM   5482 O  OD2   . ASP B 1 221 ? 31.887  23.285  -7.066  1.00 79.66  ? 221 ASP B OD2   1 
ATOM   5483 N  N     . GLU B 1 222 ? 27.138  24.908  -7.148  1.00 88.47  ? 222 GLU B N     1 
ATOM   5484 C  CA    . GLU B 1 222 ? 25.968  24.075  -7.452  1.00 87.56  ? 222 GLU B CA    1 
ATOM   5485 C  C     . GLU B 1 222 ? 26.278  22.826  -8.301  1.00 84.21  ? 222 GLU B C     1 
ATOM   5486 O  O     . GLU B 1 222 ? 25.421  21.949  -8.460  1.00 82.78  ? 222 GLU B O     1 
ATOM   5487 C  CB    . GLU B 1 222 ? 24.840  24.911  -8.071  1.00 93.26  ? 222 GLU B CB    1 
ATOM   5488 C  CG    . GLU B 1 222 ? 24.284  25.991  -7.136  1.00 96.98  ? 222 GLU B CG    1 
ATOM   5489 C  CD    . GLU B 1 222 ? 22.819  26.328  -7.409  1.00 101.78 ? 222 GLU B CD    1 
ATOM   5490 O  OE1   . GLU B 1 222 ? 21.936  25.523  -7.031  1.00 99.60  ? 222 GLU B OE1   1 
ATOM   5491 O  OE2   . GLU B 1 222 ? 22.549  27.406  -7.982  1.00 107.36 ? 222 GLU B OE2   1 
ATOM   5492 N  N     . LYS B 1 223 ? 27.503  22.753  -8.828  1.00 82.91  ? 223 LYS B N     1 
ATOM   5493 C  CA    . LYS B 1 223 ? 27.996  21.566  -9.539  1.00 79.69  ? 223 LYS B CA    1 
ATOM   5494 C  C     . LYS B 1 223 ? 28.367  20.447  -8.553  1.00 73.57  ? 223 LYS B C     1 
ATOM   5495 O  O     . LYS B 1 223 ? 28.311  19.260  -8.889  1.00 70.94  ? 223 LYS B O     1 
ATOM   5496 C  CB    . LYS B 1 223 ? 29.227  21.913  -10.386 1.00 81.15  ? 223 LYS B CB    1 
ATOM   5497 C  CG    . LYS B 1 223 ? 29.036  23.021  -11.428 1.00 87.95  ? 223 LYS B CG    1 
ATOM   5498 C  CD    . LYS B 1 223 ? 28.913  22.484  -12.855 1.00 90.99  ? 223 LYS B CD    1 
ATOM   5499 C  CE    . LYS B 1 223 ? 27.464  22.207  -13.260 1.00 93.78  ? 223 LYS B CE    1 
ATOM   5500 N  NZ    . LYS B 1 223 ? 26.962  20.907  -12.722 1.00 89.25  ? 223 LYS B NZ    1 
ATOM   5501 N  N     . ARG B 1 224 ? 28.738  20.852  -7.340  1.00 71.46  ? 224 ARG B N     1 
ATOM   5502 C  CA    . ARG B 1 224 ? 29.312  19.971  -6.329  1.00 66.36  ? 224 ARG B CA    1 
ATOM   5503 C  C     . ARG B 1 224 ? 28.256  19.368  -5.401  1.00 64.16  ? 224 ARG B C     1 
ATOM   5504 O  O     . ARG B 1 224 ? 27.428  20.089  -4.836  1.00 66.71  ? 224 ARG B O     1 
ATOM   5505 C  CB    . ARG B 1 224 ? 30.373  20.747  -5.533  1.00 66.07  ? 224 ARG B CB    1 
ATOM   5506 C  CG    . ARG B 1 224 ? 30.677  20.250  -4.122  1.00 62.22  ? 224 ARG B CG    1 
ATOM   5507 C  CD    . ARG B 1 224 ? 31.644  19.078  -4.125  1.00 57.62  ? 224 ARG B CD    1 
ATOM   5508 N  NE    . ARG B 1 224 ? 32.005  18.657  -2.773  1.00 53.41  ? 224 ARG B NE    1 
ATOM   5509 C  CZ    . ARG B 1 224 ? 32.650  17.527  -2.488  1.00 50.16  ? 224 ARG B CZ    1 
ATOM   5510 N  NH1   . ARG B 1 224 ? 33.005  16.702  -3.463  1.00 48.16  ? 224 ARG B NH1   1 
ATOM   5511 N  NH2   . ARG B 1 224 ? 32.941  17.224  -1.231  1.00 46.22  ? 224 ARG B NH2   1 
ATOM   5512 N  N     . ASN B 1 225 ? 28.298  18.042  -5.267  1.00 60.29  ? 225 ASN B N     1 
ATOM   5513 C  CA    . ASN B 1 225 ? 27.472  17.304  -4.314  1.00 57.16  ? 225 ASN B CA    1 
ATOM   5514 C  C     . ASN B 1 225 ? 28.252  17.024  -3.036  1.00 54.09  ? 225 ASN B C     1 
ATOM   5515 O  O     . ASN B 1 225 ? 29.139  16.152  -3.001  1.00 51.50  ? 225 ASN B O     1 
ATOM   5516 C  CB    . ASN B 1 225 ? 26.956  16.004  -4.937  1.00 55.87  ? 225 ASN B CB    1 
ATOM   5517 C  CG    . ASN B 1 225 ? 26.176  15.131  -3.946  1.00 53.31  ? 225 ASN B CG    1 
ATOM   5518 O  OD1   . ASN B 1 225 ? 25.749  15.591  -2.888  1.00 53.72  ? 225 ASN B OD1   1 
ATOM   5519 N  ND2   . ASN B 1 225 ? 25.983  13.866  -4.301  1.00 50.29  ? 225 ASN B ND2   1 
ATOM   5520 N  N     . VAL B 1 226 ? 27.890  17.745  -1.978  1.00 54.51  ? 226 VAL B N     1 
ATOM   5521 C  CA    . VAL B 1 226 ? 28.535  17.635  -0.667  1.00 52.34  ? 226 VAL B CA    1 
ATOM   5522 C  C     . VAL B 1 226 ? 28.446  16.203  -0.126  1.00 49.02  ? 226 VAL B C     1 
ATOM   5523 O  O     . VAL B 1 226 ? 29.345  15.733  0.574   1.00 47.12  ? 226 VAL B O     1 
ATOM   5524 C  CB    . VAL B 1 226 ? 27.924  18.645  0.332   1.00 54.49  ? 226 VAL B CB    1 
ATOM   5525 C  CG1   . VAL B 1 226 ? 28.664  18.639  1.660   1.00 53.59  ? 226 VAL B CG1   1 
ATOM   5526 C  CG2   . VAL B 1 226 ? 27.969  20.032  -0.253  1.00 57.71  ? 226 VAL B CG2   1 
ATOM   5527 N  N     . ALA B 1 227 ? 27.360  15.523  -0.486  1.00 48.69  ? 227 ALA B N     1 
ATOM   5528 C  CA    . ALA B 1 227 ? 27.114  14.140  -0.113  1.00 46.18  ? 227 ALA B CA    1 
ATOM   5529 C  C     . ALA B 1 227 ? 27.614  13.175  -1.190  1.00 44.96  ? 227 ALA B C     1 
ATOM   5530 O  O     . ALA B 1 227 ? 27.115  12.044  -1.310  1.00 44.17  ? 227 ALA B O     1 
ATOM   5531 C  CB    . ALA B 1 227 ? 25.623  13.932  0.138   1.00 46.68  ? 227 ALA B CB    1 
ATOM   5532 N  N     . ALA B 1 228 ? 28.600  13.617  -1.965  1.00 45.38  ? 228 ALA B N     1 
ATOM   5533 C  CA    . ALA B 1 228 ? 29.150  12.822  -3.054  1.00 44.55  ? 228 ALA B CA    1 
ATOM   5534 C  C     . ALA B 1 228 ? 29.622  11.477  -2.546  1.00 41.92  ? 228 ALA B C     1 
ATOM   5535 O  O     . ALA B 1 228 ? 29.341  10.450  -3.169  1.00 41.88  ? 228 ALA B O     1 
ATOM   5536 C  CB    . ALA B 1 228 ? 30.289  13.559  -3.736  1.00 45.76  ? 228 ALA B CB    1 
ATOM   5537 N  N     . ASN B 1 229 ? 30.310  11.474  -1.404  1.00 40.20  ? 229 ASN B N     1 
ATOM   5538 C  CA    . ASN B 1 229 ? 30.911  10.235  -0.897  1.00 37.80  ? 229 ASN B CA    1 
ATOM   5539 C  C     . ASN B 1 229 ? 30.115  9.439   0.143   1.00 36.97  ? 229 ASN B C     1 
ATOM   5540 O  O     . ASN B 1 229 ? 30.603  8.430   0.664   1.00 36.35  ? 229 ASN B O     1 
ATOM   5541 C  CB    . ASN B 1 229 ? 32.356  10.448  -0.419  1.00 36.31  ? 229 ASN B CB    1 
ATOM   5542 C  CG    . ASN B 1 229 ? 33.202  9.180   -0.584  1.00 34.47  ? 229 ASN B CG    1 
ATOM   5543 O  OD1   . ASN B 1 229 ? 32.961  8.403   -1.502  1.00 31.49  ? 229 ASN B OD1   1 
ATOM   5544 N  ND2   . ASN B 1 229 ? 34.181  8.973   0.300   1.00 31.68  ? 229 ASN B ND2   1 
ATOM   5545 N  N     . LEU B 1 230 ? 28.888  9.871   0.424   1.00 38.49  ? 230 LEU B N     1 
ATOM   5546 C  CA    . LEU B 1 230 ? 27.975  9.132   1.295   1.00 37.98  ? 230 LEU B CA    1 
ATOM   5547 C  C     . LEU B 1 230 ? 27.508  7.893   0.553   1.00 38.11  ? 230 LEU B C     1 
ATOM   5548 O  O     . LEU B 1 230 ? 26.891  7.991   -0.514  1.00 39.58  ? 230 LEU B O     1 
ATOM   5549 C  CB    . LEU B 1 230 ? 26.770  10.004  1.694   1.00 39.62  ? 230 LEU B CB    1 
ATOM   5550 C  CG    . LEU B 1 230 ? 25.586  9.477   2.525   1.00 40.09  ? 230 LEU B CG    1 
ATOM   5551 C  CD1   . LEU B 1 230 ? 26.023  8.791   3.815   1.00 37.00  ? 230 LEU B CD1   1 
ATOM   5552 C  CD2   . LEU B 1 230 ? 24.613  10.648  2.822   1.00 42.15  ? 230 LEU B CD2   1 
ATOM   5553 N  N     . SER B 1 231 ? 27.819  6.727   1.099   1.00 37.15  ? 231 SER B N     1 
ATOM   5554 C  CA    . SER B 1 231 ? 27.406  5.490   0.455   1.00 37.30  ? 231 SER B CA    1 
ATOM   5555 C  C     . SER B 1 231 ? 25.898  5.341   0.578   1.00 38.72  ? 231 SER B C     1 
ATOM   5556 O  O     . SER B 1 231 ? 25.306  5.706   1.599   1.00 39.37  ? 231 SER B O     1 
ATOM   5557 C  CB    . SER B 1 231 ? 28.111  4.288   1.067   1.00 36.41  ? 231 SER B CB    1 
ATOM   5558 O  OG    . SER B 1 231 ? 27.529  3.935   2.309   1.00 37.28  ? 231 SER B OG    1 
ATOM   5559 N  N     . LEU B 1 232 ? 25.280  4.826   -0.476  1.00 40.12  ? 232 LEU B N     1 
ATOM   5560 C  CA    . LEU B 1 232 ? 23.865  4.501   -0.451  1.00 41.84  ? 232 LEU B CA    1 
ATOM   5561 C  C     . LEU B 1 232 ? 23.510  3.761   0.847   1.00 41.40  ? 232 LEU B C     1 
ATOM   5562 O  O     . LEU B 1 232 ? 22.537  4.111   1.521   1.00 42.46  ? 232 LEU B O     1 
ATOM   5563 C  CB    . LEU B 1 232 ? 23.488  3.681   -1.695  1.00 43.07  ? 232 LEU B CB    1 
ATOM   5564 C  CG    . LEU B 1 232 ? 22.079  3.108   -1.849  1.00 44.72  ? 232 LEU B CG    1 
ATOM   5565 C  CD1   . LEU B 1 232 ? 21.075  4.208   -2.153  1.00 47.56  ? 232 LEU B CD1   1 
ATOM   5566 C  CD2   . LEU B 1 232 ? 22.068  2.064   -2.954  1.00 45.39  ? 232 LEU B CD2   1 
ATOM   5567 N  N     . ASP B 1 233 ? 24.318  2.765   1.214   1.00 40.35  ? 233 ASP B N     1 
ATOM   5568 C  CA    . ASP B 1 233 ? 24.017  1.939   2.383   1.00 40.07  ? 233 ASP B CA    1 
ATOM   5569 C  C     . ASP B 1 233 ? 24.051  2.707   3.699   1.00 40.30  ? 233 ASP B C     1 
ATOM   5570 O  O     . ASP B 1 233 ? 23.259  2.425   4.603   1.00 41.34  ? 233 ASP B O     1 
ATOM   5571 C  CB    . ASP B 1 233 ? 24.927  0.717   2.441   1.00 39.24  ? 233 ASP B CB    1 
ATOM   5572 C  CG    . ASP B 1 233 ? 24.523  -0.361  1.444   1.00 39.56  ? 233 ASP B CG    1 
ATOM   5573 O  OD1   . ASP B 1 233 ? 23.471  -0.214  0.784   1.00 39.78  ? 233 ASP B OD1   1 
ATOM   5574 O  OD2   . ASP B 1 233 ? 25.256  -1.367  1.318   1.00 39.62  ? 233 ASP B OD2   1 
ATOM   5575 N  N     . ASN B 1 234 ? 24.934  3.697   3.788   1.00 39.30  ? 234 ASN B N     1 
ATOM   5576 C  CA    . ASN B 1 234 ? 25.017  4.540   4.973   1.00 39.81  ? 234 ASN B CA    1 
ATOM   5577 C  C     . ASN B 1 234 ? 23.910  5.596   5.019   1.00 41.73  ? 234 ASN B C     1 
ATOM   5578 O  O     . ASN B 1 234 ? 23.460  5.978   6.100   1.00 43.00  ? 234 ASN B O     1 
ATOM   5579 C  CB    . ASN B 1 234 ? 26.394  5.197   5.097   1.00 38.51  ? 234 ASN B CB    1 
ATOM   5580 C  CG    . ASN B 1 234 ? 27.467  4.249   5.623   1.00 37.91  ? 234 ASN B CG    1 
ATOM   5581 O  OD1   . ASN B 1 234 ? 28.662  4.481   5.411   1.00 37.83  ? 234 ASN B OD1   1 
ATOM   5582 N  ND2   . ASN B 1 234 ? 27.057  3.187   6.305   1.00 39.42  ? 234 ASN B ND2   1 
ATOM   5583 N  N     . LEU B 1 235 ? 23.502  6.093   3.852   1.00 42.58  ? 235 LEU B N     1 
ATOM   5584 C  CA    . LEU B 1 235 ? 22.273  6.867   3.761   1.00 44.55  ? 235 LEU B CA    1 
ATOM   5585 C  C     . LEU B 1 235 ? 21.112  6.001   4.260   1.00 45.57  ? 235 LEU B C     1 
ATOM   5586 O  O     . LEU B 1 235 ? 20.387  6.402   5.159   1.00 46.90  ? 235 LEU B O     1 
ATOM   5587 C  CB    . LEU B 1 235 ? 22.022  7.366   2.327   1.00 46.14  ? 235 LEU B CB    1 
ATOM   5588 C  CG    . LEU B 1 235 ? 20.627  7.929   1.994   1.00 47.28  ? 235 LEU B CG    1 
ATOM   5589 C  CD1   . LEU B 1 235 ? 20.438  9.356   2.511   1.00 50.06  ? 235 LEU B CD1   1 
ATOM   5590 C  CD2   . LEU B 1 235 ? 20.363  7.863   0.498   1.00 48.65  ? 235 LEU B CD2   1 
ATOM   5591 N  N     . ALA B 1 236 ? 20.985  4.793   3.709   1.00 45.41  ? 236 ALA B N     1 
ATOM   5592 C  CA    . ALA B 1 236 ? 19.962  3.835   4.134   1.00 46.80  ? 236 ALA B CA    1 
ATOM   5593 C  C     . ALA B 1 236 ? 19.946  3.590   5.653   1.00 47.06  ? 236 ALA B C     1 
ATOM   5594 O  O     . ALA B 1 236 ? 18.875  3.513   6.264   1.00 48.98  ? 236 ALA B O     1 
ATOM   5595 C  CB    . ALA B 1 236 ? 20.122  2.520   3.377   1.00 46.16  ? 236 ALA B CB    1 
ATOM   5596 N  N     . ARG B 1 237 ? 21.135  3.507   6.250   1.00 45.76  ? 237 ARG B N     1 
ATOM   5597 C  CA    . ARG B 1 237 ? 21.287  3.240   7.681   1.00 46.43  ? 237 ARG B CA    1 
ATOM   5598 C  C     . ARG B 1 237 ? 20.878  4.444   8.540   1.00 47.68  ? 237 ARG B C     1 
ATOM   5599 O  O     . ARG B 1 237 ? 20.256  4.275   9.590   1.00 49.45  ? 237 ARG B O     1 
ATOM   5600 C  CB    . ARG B 1 237 ? 22.722  2.769   7.994   1.00 44.54  ? 237 ARG B CB    1 
ATOM   5601 C  CG    . ARG B 1 237 ? 23.016  1.337   7.491   1.00 44.81  ? 237 ARG B CG    1 
ATOM   5602 C  CD    . ARG B 1 237 ? 24.454  0.898   7.785   1.00 44.08  ? 237 ARG B CD    1 
ATOM   5603 N  NE    . ARG B 1 237 ? 24.767  -0.419  7.225   1.00 47.94  ? 237 ARG B NE    1 
ATOM   5604 C  CZ    . ARG B 1 237 ? 25.602  -0.638  6.210   1.00 47.07  ? 237 ARG B CZ    1 
ATOM   5605 N  NH1   . ARG B 1 237 ? 26.250  0.372   5.628   1.00 46.44  ? 237 ARG B NH1   1 
ATOM   5606 N  NH2   . ARG B 1 237 ? 25.808  -1.876  5.787   1.00 47.43  ? 237 ARG B NH2   1 
ATOM   5607 N  N     . PHE B 1 238 ? 21.208  5.648   8.071   1.00 47.08  ? 238 PHE B N     1 
ATOM   5608 C  CA    . PHE B 1 238 ? 20.803  6.905   8.716   1.00 48.65  ? 238 PHE B CA    1 
ATOM   5609 C  C     . PHE B 1 238 ? 19.287  7.097   8.687   1.00 51.13  ? 238 PHE B C     1 
ATOM   5610 O  O     . PHE B 1 238 ? 18.676  7.417   9.717   1.00 52.98  ? 238 PHE B O     1 
ATOM   5611 C  CB    . PHE B 1 238 ? 21.501  8.090   8.044   1.00 47.87  ? 238 PHE B CB    1 
ATOM   5612 C  CG    . PHE B 1 238 ? 21.110  9.434   8.600   1.00 50.48  ? 238 PHE B CG    1 
ATOM   5613 C  CD1   . PHE B 1 238 ? 21.531  9.834   9.866   1.00 51.03  ? 238 PHE B CD1   1 
ATOM   5614 C  CD2   . PHE B 1 238 ? 20.330  10.310  7.852   1.00 51.76  ? 238 PHE B CD2   1 
ATOM   5615 C  CE1   . PHE B 1 238 ? 21.164  11.081  10.383  1.00 52.09  ? 238 PHE B CE1   1 
ATOM   5616 C  CE2   . PHE B 1 238 ? 19.966  11.559  8.364   1.00 53.18  ? 238 PHE B CE2   1 
ATOM   5617 C  CZ    . PHE B 1 238 ? 20.391  11.940  9.625   1.00 53.95  ? 238 PHE B CZ    1 
ATOM   5618 N  N     . VAL B 1 239 ? 18.690  6.910   7.507   1.00 51.51  ? 239 VAL B N     1 
ATOM   5619 C  CA    . VAL B 1 239 ? 17.233  7.038   7.329   1.00 54.22  ? 239 VAL B CA    1 
ATOM   5620 C  C     . VAL B 1 239 ? 16.482  6.109   8.283   1.00 55.15  ? 239 VAL B C     1 
ATOM   5621 O  O     . VAL B 1 239 ? 15.526  6.525   8.956   1.00 57.66  ? 239 VAL B O     1 
ATOM   5622 C  CB    . VAL B 1 239 ? 16.804  6.786   5.852   1.00 54.41  ? 239 VAL B CB    1 
ATOM   5623 C  CG1   . VAL B 1 239 ? 15.291  6.525   5.739   1.00 57.31  ? 239 VAL B CG1   1 
ATOM   5624 C  CG2   . VAL B 1 239 ? 17.204  7.965   4.974   1.00 55.05  ? 239 VAL B CG2   1 
ATOM   5625 N  N     . HIS B 1 240 ? 16.920  4.857   8.340   1.00 53.74  ? 240 HIS B N     1 
ATOM   5626 C  CA    . HIS B 1 240 ? 16.349  3.876   9.251   1.00 55.09  ? 240 HIS B CA    1 
ATOM   5627 C  C     . HIS B 1 240 ? 16.591  4.299   10.709  1.00 56.64  ? 240 HIS B C     1 
ATOM   5628 O  O     . HIS B 1 240 ? 15.682  4.221   11.549  1.00 58.72  ? 240 HIS B O     1 
ATOM   5629 C  CB    . HIS B 1 240 ? 16.922  2.486   8.965   1.00 53.21  ? 240 HIS B CB    1 
ATOM   5630 C  CG    . HIS B 1 240 ? 16.310  1.396   9.788   1.00 54.62  ? 240 HIS B CG    1 
ATOM   5631 N  ND1   . HIS B 1 240 ? 17.034  0.647   10.690  1.00 52.38  ? 240 HIS B ND1   1 
ATOM   5632 C  CD2   . HIS B 1 240 ? 15.038  0.938   9.856   1.00 56.40  ? 240 HIS B CD2   1 
ATOM   5633 C  CE1   . HIS B 1 240 ? 16.236  -0.223  11.279  1.00 54.75  ? 240 HIS B CE1   1 
ATOM   5634 N  NE2   . HIS B 1 240 ? 15.018  -0.067  10.792  1.00 56.73  ? 240 HIS B NE2   1 
ATOM   5635 N  N     . LEU B 1 241 ? 17.806  4.776   10.990  1.00 55.71  ? 241 LEU B N     1 
ATOM   5636 C  CA    . LEU B 1 241 ? 18.185  5.236   12.330  1.00 57.52  ? 241 LEU B CA    1 
ATOM   5637 C  C     . LEU B 1 241 ? 17.243  6.342   12.812  1.00 60.38  ? 241 LEU B C     1 
ATOM   5638 O  O     . LEU B 1 241 ? 16.777  6.331   13.958  1.00 62.57  ? 241 LEU B O     1 
ATOM   5639 C  CB    . LEU B 1 241 ? 19.636  5.737   12.324  1.00 55.68  ? 241 LEU B CB    1 
ATOM   5640 C  CG    . LEU B 1 241 ? 20.587  5.410   13.481  1.00 56.48  ? 241 LEU B CG    1 
ATOM   5641 C  CD1   . LEU B 1 241 ? 20.137  6.090   14.757  1.00 59.84  ? 241 LEU B CD1   1 
ATOM   5642 C  CD2   . LEU B 1 241 ? 20.729  3.906   13.702  1.00 57.10  ? 241 LEU B CD2   1 
ATOM   5643 N  N     . CYS B 1 242 ? 16.962  7.284   11.916  1.00 60.92  ? 242 CYS B N     1 
ATOM   5644 C  CA    . CYS B 1 242 ? 16.034  8.372   12.179  1.00 63.79  ? 242 CYS B CA    1 
ATOM   5645 C  C     . CYS B 1 242 ? 14.628  7.866   12.511  1.00 66.64  ? 242 CYS B C     1 
ATOM   5646 O  O     . CYS B 1 242 ? 13.981  8.386   13.426  1.00 69.11  ? 242 CYS B O     1 
ATOM   5647 C  CB    . CYS B 1 242 ? 16.003  9.329   10.990  1.00 63.77  ? 242 CYS B CB    1 
ATOM   5648 S  SG    . CYS B 1 242 ? 17.544  10.275  10.780  1.00 62.03  ? 242 CYS B SG    1 
ATOM   5649 N  N     . ARG B 1 243 ? 14.172  6.850   11.775  1.00 66.26  ? 243 ARG B N     1 
ATOM   5650 C  CA    . ARG B 1 243 ? 12.863  6.229   12.005  1.00 69.30  ? 243 ARG B CA    1 
ATOM   5651 C  C     . ARG B 1 243 ? 12.816  5.514   13.349  1.00 70.86  ? 243 ARG B C     1 
ATOM   5652 O  O     . ARG B 1 243 ? 11.798  5.553   14.044  1.00 73.72  ? 243 ARG B O     1 
ATOM   5653 C  CB    . ARG B 1 243 ? 12.514  5.243   10.884  1.00 68.31  ? 243 ARG B CB    1 
ATOM   5654 C  CG    . ARG B 1 243 ? 12.235  5.896   9.538   1.00 68.14  ? 243 ARG B CG    1 
ATOM   5655 C  CD    . ARG B 1 243 ? 12.158  4.862   8.426   1.00 65.97  ? 243 ARG B CD    1 
ATOM   5656 N  NE    . ARG B 1 243 ? 11.950  5.487   7.121   1.00 66.45  ? 243 ARG B NE    1 
ATOM   5657 C  CZ    . ARG B 1 243 ? 11.967  4.842   5.956   1.00 66.23  ? 243 ARG B CZ    1 
ATOM   5658 N  NH1   . ARG B 1 243 ? 12.193  3.533   5.906   1.00 64.65  ? 243 ARG B NH1   1 
ATOM   5659 N  NH2   . ARG B 1 243 ? 11.763  5.516   4.832   1.00 67.53  ? 243 ARG B NH2   1 
ATOM   5660 N  N     . GLU B 1 244 ? 13.924  4.867   13.703  1.00 69.44  ? 244 GLU B N     1 
ATOM   5661 C  CA    . GLU B 1 244 ? 14.056  4.175   14.980  1.00 71.44  ? 244 GLU B CA    1 
ATOM   5662 C  C     . GLU B 1 244 ? 14.060  5.136   16.167  1.00 73.94  ? 244 GLU B C     1 
ATOM   5663 O  O     . GLU B 1 244 ? 13.423  4.860   17.186  1.00 76.81  ? 244 GLU B O     1 
ATOM   5664 C  CB    . GLU B 1 244 ? 15.326  3.331   15.008  1.00 69.01  ? 244 GLU B CB    1 
ATOM   5665 C  CG    . GLU B 1 244 ? 15.216  1.999   14.312  1.00 69.08  ? 244 GLU B CG    1 
ATOM   5666 C  CD    . GLU B 1 244 ? 16.461  1.147   14.513  1.00 68.99  ? 244 GLU B CD    1 
ATOM   5667 O  OE1   . GLU B 1 244 ? 17.565  1.715   14.686  1.00 67.86  ? 244 GLU B OE1   1 
ATOM   5668 O  OE2   . GLU B 1 244 ? 16.336  -0.096  14.496  1.00 70.29  ? 244 GLU B OE2   1 
ATOM   5669 N  N     . PHE B 1 245 ? 14.777  6.253   16.027  1.00 73.41  ? 245 PHE B N     1 
ATOM   5670 C  CA    . PHE B 1 245 ? 14.875  7.263   17.086  1.00 76.21  ? 245 PHE B CA    1 
ATOM   5671 C  C     . PHE B 1 245 ? 13.539  7.968   17.353  1.00 80.37  ? 245 PHE B C     1 
ATOM   5672 O  O     . PHE B 1 245 ? 13.168  8.186   18.502  1.00 83.25  ? 245 PHE B O     1 
ATOM   5673 C  CB    . PHE B 1 245 ? 15.974  8.284   16.767  1.00 74.31  ? 245 PHE B CB    1 
ATOM   5674 C  CG    . PHE B 1 245 ? 16.216  9.287   17.870  1.00 76.86  ? 245 PHE B CG    1 
ATOM   5675 C  CD1   . PHE B 1 245 ? 16.963  8.944   18.995  1.00 77.29  ? 245 PHE B CD1   1 
ATOM   5676 C  CD2   . PHE B 1 245 ? 15.702  10.581  17.780  1.00 79.21  ? 245 PHE B CD2   1 
ATOM   5677 C  CE1   . PHE B 1 245 ? 17.186  9.873   20.020  1.00 79.95  ? 245 PHE B CE1   1 
ATOM   5678 C  CE2   . PHE B 1 245 ? 15.917  11.515  18.796  1.00 81.64  ? 245 PHE B CE2   1 
ATOM   5679 C  CZ    . PHE B 1 245 ? 16.661  11.160  19.918  1.00 82.17  ? 245 PHE B CZ    1 
ATOM   5680 N  N     . MET B 1 246 ? 12.821  8.312   16.288  1.00 81.30  ? 246 MET B N     1 
ATOM   5681 C  CA    . MET B 1 246 ? 11.525  8.987   16.407  1.00 85.72  ? 246 MET B CA    1 
ATOM   5682 C  C     . MET B 1 246 ? 10.429  8.062   16.921  1.00 88.48  ? 246 MET B C     1 
ATOM   5683 O  O     . MET B 1 246 ? 9.478   8.515   17.560  1.00 92.40  ? 246 MET B O     1 
ATOM   5684 C  CB    . MET B 1 246 ? 11.109  9.589   15.066  1.00 85.54  ? 246 MET B CB    1 
ATOM   5685 C  CG    . MET B 1 246 ? 12.037  10.679  14.550  1.00 85.01  ? 246 MET B CG    1 
ATOM   5686 S  SD    . MET B 1 246 ? 11.787  12.283  15.324  1.00 90.89  ? 246 MET B SD    1 
ATOM   5687 C  CE    . MET B 1 246 ? 12.808  12.139  16.788  1.00 90.16  ? 246 MET B CE    1 
ATOM   5688 N  N     . GLU B 1 247 ? 10.558  6.773   16.626  1.00 87.06  ? 247 GLU B N     1 
ATOM   5689 C  CA    . GLU B 1 247 ? 9.627   5.768   17.117  1.00 89.95  ? 247 GLU B CA    1 
ATOM   5690 C  C     . GLU B 1 247 ? 9.831   5.552   18.616  1.00 92.15  ? 247 GLU B C     1 
ATOM   5691 O  O     . GLU B 1 247 ? 8.863   5.351   19.356  1.00 95.79  ? 247 GLU B O     1 
ATOM   5692 C  CB    . GLU B 1 247 ? 9.816   4.455   16.357  1.00 87.56  ? 247 GLU B CB    1 
ATOM   5693 C  CG    . GLU B 1 247 ? 8.642   3.487   16.432  1.00 90.49  ? 247 GLU B CG    1 
ATOM   5694 C  CD    . GLU B 1 247 ? 8.927   2.147   15.750  1.00 88.66  ? 247 GLU B CD    1 
ATOM   5695 O  OE1   . GLU B 1 247 ? 10.038  1.961   15.206  1.00 86.57  ? 247 GLU B OE1   1 
ATOM   5696 O  OE2   . GLU B 1 247 ? 8.033   1.270   15.760  1.00 92.03  ? 247 GLU B OE2   1 
ATOM   5697 N  N     . ALA B 1 248 ? 11.092  5.600   19.052  1.00 90.46  ? 248 ALA B N     1 
ATOM   5698 C  CA    . ALA B 1 248 ? 11.453  5.445   20.465  1.00 92.79  ? 248 ALA B CA    1 
ATOM   5699 C  C     . ALA B 1 248 ? 12.804  6.101   20.782  1.00 91.30  ? 248 ALA B C     1 
ATOM   5700 O  O     . ALA B 1 248 ? 13.846  5.450   20.676  1.00 88.73  ? 248 ALA B O     1 
ATOM   5701 C  CB    . ALA B 1 248 ? 11.460  3.963   20.863  1.00 92.91  ? 248 ALA B CB    1 
ATOM   5702 N  N     . PRO B 1 249 ? 12.787  7.391   21.180  1.00 93.44  ? 249 PRO B N     1 
ATOM   5703 C  CA    . PRO B 1 249 ? 14.024  8.136   21.437  1.00 92.47  ? 249 PRO B CA    1 
ATOM   5704 C  C     . PRO B 1 249 ? 14.785  7.629   22.658  1.00 93.81  ? 249 PRO B C     1 
ATOM   5705 O  O     . PRO B 1 249 ? 14.178  7.286   23.677  1.00 97.38  ? 249 PRO B O     1 
ATOM   5706 C  CB    . PRO B 1 249 ? 13.533  9.571   21.668  1.00 95.37  ? 249 PRO B CB    1 
ATOM   5707 C  CG    . PRO B 1 249 ? 12.127  9.428   22.120  1.00 98.90  ? 249 PRO B CG    1 
ATOM   5708 C  CD    . PRO B 1 249 ? 11.588  8.220   21.417  1.00 97.20  ? 249 PRO B CD    1 
ATOM   5709 N  N     . SER B 1 250 ? 16.107  7.582   22.540  1.00 91.36  ? 250 SER B N     1 
ATOM   5710 C  CA    . SER B 1 250 ? 16.974  7.137   23.624  1.00 92.77  ? 250 SER B CA    1 
ATOM   5711 C  C     . SER B 1 250 ? 18.316  7.872   23.594  1.00 91.36  ? 250 SER B C     1 
ATOM   5712 O  O     . SER B 1 250 ? 18.780  8.305   22.533  1.00 88.28  ? 250 SER B O     1 
ATOM   5713 C  CB    . SER B 1 250 ? 17.187  5.619   23.548  1.00 91.56  ? 250 SER B CB    1 
ATOM   5714 O  OG    . SER B 1 250 ? 18.226  5.188   24.413  1.00 92.58  ? 250 SER B OG    1 
ATOM   5715 N  N     . LEU B 1 251 ? 18.926  8.009   24.770  1.00 93.92  ? 251 LEU B N     1 
ATOM   5716 C  CA    . LEU B 1 251 ? 20.268  8.575   24.901  1.00 93.03  ? 251 LEU B CA    1 
ATOM   5717 C  C     . LEU B 1 251 ? 21.321  7.611   24.339  1.00 89.69  ? 251 LEU B C     1 
ATOM   5718 O  O     . LEU B 1 251 ? 22.439  8.018   24.017  1.00 87.83  ? 251 LEU B O     1 
ATOM   5719 C  CB    . LEU B 1 251 ? 20.559  8.910   26.369  1.00 97.26  ? 251 LEU B CB    1 
ATOM   5720 C  CG    . LEU B 1 251 ? 21.752  9.794   26.756  1.00 97.77  ? 251 LEU B CG    1 
ATOM   5721 C  CD1   . LEU B 1 251 ? 21.732  11.137  26.033  1.00 96.77  ? 251 LEU B CD1   1 
ATOM   5722 C  CD2   . LEU B 1 251 ? 21.774  10.003  28.266  1.00 102.92 ? 251 LEU B CD2   1 
ATOM   5723 N  N     . GLY B 1 252 ? 20.941  6.338   24.213  1.00 89.19  ? 252 GLY B N     1 
ATOM   5724 C  CA    . GLY B 1 252 ? 21.801  5.295   23.657  1.00 86.52  ? 252 GLY B CA    1 
ATOM   5725 C  C     . GLY B 1 252 ? 22.197  5.536   22.212  1.00 82.54  ? 252 GLY B C     1 
ATOM   5726 O  O     . GLY B 1 252 ? 23.203  5.003   21.747  1.00 80.36  ? 252 GLY B O     1 
ATOM   5727 N  N     . PHE B 1 253 ? 21.406  6.344   21.507  1.00 82.01  ? 253 PHE B N     1 
ATOM   5728 C  CA    . PHE B 1 253 ? 21.695  6.722   20.125  1.00 78.81  ? 253 PHE B CA    1 
ATOM   5729 C  C     . PHE B 1 253 ? 22.887  7.672   20.017  1.00 78.01  ? 253 PHE B C     1 
ATOM   5730 O  O     . PHE B 1 253 ? 23.401  7.900   18.919  1.00 75.39  ? 253 PHE B O     1 
ATOM   5731 C  CB    . PHE B 1 253 ? 20.463  7.360   19.479  1.00 79.10  ? 253 PHE B CB    1 
ATOM   5732 C  CG    . PHE B 1 253 ? 19.348  6.391   19.206  1.00 79.44  ? 253 PHE B CG    1 
ATOM   5733 C  CD1   . PHE B 1 253 ? 18.438  6.052   20.201  1.00 82.42  ? 253 PHE B CD1   1 
ATOM   5734 C  CD2   . PHE B 1 253 ? 19.202  5.822   17.948  1.00 76.99  ? 253 PHE B CD2   1 
ATOM   5735 C  CE1   . PHE B 1 253 ? 17.401  5.161   19.948  1.00 83.01  ? 253 PHE B CE1   1 
ATOM   5736 C  CE2   . PHE B 1 253 ? 18.169  4.925   17.683  1.00 77.54  ? 253 PHE B CE2   1 
ATOM   5737 C  CZ    . PHE B 1 253 ? 17.266  4.595   18.685  1.00 80.69  ? 253 PHE B CZ    1 
ATOM   5738 N  N     . PHE B 1 254 ? 23.320  8.211   21.159  1.00 80.73  ? 254 PHE B N     1 
ATOM   5739 C  CA    . PHE B 1 254 ? 24.425  9.177   21.222  1.00 80.83  ? 254 PHE B CA    1 
ATOM   5740 C  C     . PHE B 1 254 ? 25.703  8.610   21.851  1.00 81.54  ? 254 PHE B C     1 
ATOM   5741 O  O     . PHE B 1 254 ? 26.754  9.251   21.806  1.00 81.13  ? 254 PHE B O     1 
ATOM   5742 C  CB    . PHE B 1 254 ? 23.991  10.451  21.962  1.00 83.76  ? 254 PHE B CB    1 
ATOM   5743 C  CG    . PHE B 1 254 ? 22.869  11.192  21.289  1.00 83.09  ? 254 PHE B CG    1 
ATOM   5744 C  CD1   . PHE B 1 254 ? 21.542  10.926  21.623  1.00 84.56  ? 254 PHE B CD1   1 
ATOM   5745 C  CD2   . PHE B 1 254 ? 23.138  12.157  20.324  1.00 80.77  ? 254 PHE B CD2   1 
ATOM   5746 C  CE1   . PHE B 1 254 ? 20.500  11.606  21.000  1.00 84.96  ? 254 PHE B CE1   1 
ATOM   5747 C  CE2   . PHE B 1 254 ? 22.106  12.845  19.695  1.00 81.58  ? 254 PHE B CE2   1 
ATOM   5748 C  CZ    . PHE B 1 254 ? 20.782  12.569  20.034  1.00 84.18  ? 254 PHE B CZ    1 
ATOM   5749 N  N     . LYS B 1 255 ? 25.606  7.418   22.436  1.00 83.32  ? 255 LYS B N     1 
ATOM   5750 C  CA    . LYS B 1 255 ? 26.775  6.709   22.959  1.00 84.66  ? 255 LYS B CA    1 
ATOM   5751 C  C     . LYS B 1 255 ? 27.276  5.677   21.953  1.00 82.14  ? 255 LYS B C     1 
ATOM   5752 O  O     . LYS B 1 255 ? 26.465  4.973   21.341  1.00 80.80  ? 255 LYS B O     1 
ATOM   5753 C  CB    . LYS B 1 255 ? 26.459  6.006   24.284  1.00 88.38  ? 255 LYS B CB    1 
ATOM   5754 C  CG    . LYS B 1 255 ? 26.469  6.904   25.523  1.00 92.77  ? 255 LYS B CG    1 
ATOM   5755 C  CD    . LYS B 1 255 ? 25.064  7.363   25.910  1.00 95.59  ? 255 LYS B CD    1 
ATOM   5756 C  CE    . LYS B 1 255 ? 24.198  6.208   26.421  1.00 97.77  ? 255 LYS B CE    1 
ATOM   5757 N  NZ    . LYS B 1 255 ? 24.521  5.804   27.822  1.00 102.45 ? 255 LYS B NZ    1 
ATOM   5758 N  N     . PRO B 1 256 ? 28.614  5.576   21.786  1.00 81.93  ? 256 PRO B N     1 
ATOM   5759 C  CA    . PRO B 1 256 ? 29.214  4.583   20.889  1.00 80.00  ? 256 PRO B CA    1 
ATOM   5760 C  C     . PRO B 1 256 ? 28.920  3.165   21.373  1.00 82.04  ? 256 PRO B C     1 
ATOM   5761 O  O     . PRO B 1 256 ? 29.138  2.857   22.550  1.00 85.15  ? 256 PRO B O     1 
ATOM   5762 C  CB    . PRO B 1 256 ? 30.719  4.872   20.990  1.00 79.91  ? 256 PRO B CB    1 
ATOM   5763 C  CG    . PRO B 1 256 ? 30.826  6.238   21.563  1.00 81.22  ? 256 PRO B CG    1 
ATOM   5764 C  CD    . PRO B 1 256 ? 29.642  6.400   22.450  1.00 83.62  ? 256 PRO B CD    1 
ATOM   5765 N  N     . LYS B 1 257 ? 28.415  2.322   20.472  1.00 80.96  ? 257 LYS B N     1 
ATOM   5766 C  CA    . LYS B 1 257 ? 28.068  0.937   20.803  1.00 83.18  ? 257 LYS B CA    1 
ATOM   5767 C  C     . LYS B 1 257 ? 29.295  0.214   21.349  1.00 85.05  ? 257 LYS B C     1 
ATOM   5768 O  O     . LYS B 1 257 ? 30.397  0.345   20.796  1.00 83.36  ? 257 LYS B O     1 
ATOM   5769 C  CB    . LYS B 1 257 ? 27.510  0.185   19.578  1.00 80.99  ? 257 LYS B CB    1 
ATOM   5770 C  CG    . LYS B 1 257 ? 26.469  0.936   18.722  1.00 79.45  ? 257 LYS B CG    1 
ATOM   5771 C  CD    . LYS B 1 257 ? 25.056  0.930   19.327  1.00 82.29  ? 257 LYS B CD    1 
ATOM   5772 C  CE    . LYS B 1 257 ? 24.765  2.178   20.177  1.00 84.27  ? 257 LYS B CE    1 
ATOM   5773 N  NZ    . LYS B 1 257 ? 24.838  3.467   19.416  1.00 81.88  ? 257 LYS B NZ    1 
ATOM   5774 N  N     . HIS B 1 258 ? 29.094  -0.532  22.438  1.00 88.95  ? 258 HIS B N     1 
ATOM   5775 C  CA    . HIS B 1 258 ? 30.167  -1.276  23.109  1.00 91.81  ? 258 HIS B CA    1 
ATOM   5776 C  C     . HIS B 1 258 ? 30.992  -2.117  22.124  1.00 89.97  ? 258 HIS B C     1 
ATOM   5777 O  O     . HIS B 1 258 ? 30.463  -2.573  21.102  1.00 87.77  ? 258 HIS B O     1 
ATOM   5778 C  CB    . HIS B 1 258 ? 29.592  -2.186  24.203  1.00 96.03  ? 258 HIS B CB    1 
ATOM   5779 C  CG    . HIS B 1 258 ? 28.959  -1.451  25.345  1.00 99.53  ? 258 HIS B CG    1 
ATOM   5780 N  ND1   . HIS B 1 258 ? 27.597  -1.256  25.441  1.00 100.48 ? 258 HIS B ND1   1 
ATOM   5781 C  CD2   . HIS B 1 258 ? 29.499  -0.881  26.449  1.00 103.12 ? 258 HIS B CD2   1 
ATOM   5782 C  CE1   . HIS B 1 258 ? 27.326  -0.593  26.552  1.00 103.78 ? 258 HIS B CE1   1 
ATOM   5783 N  NE2   . HIS B 1 258 ? 28.463  -0.353  27.182  1.00 105.48 ? 258 HIS B NE2   1 
ATOM   5784 N  N     . PRO B 1 259 ? 32.294  -2.315  22.419  1.00 91.24  ? 259 PRO B N     1 
ATOM   5785 C  CA    . PRO B 1 259 ? 33.119  -3.196  21.579  1.00 90.10  ? 259 PRO B CA    1 
ATOM   5786 C  C     . PRO B 1 259 ? 32.611  -4.646  21.583  1.00 91.70  ? 259 PRO B C     1 
ATOM   5787 O  O     . PRO B 1 259 ? 32.766  -5.352  20.581  1.00 90.13  ? 259 PRO B O     1 
ATOM   5788 C  CB    . PRO B 1 259 ? 34.507  -3.112  22.232  1.00 92.41  ? 259 PRO B CB    1 
ATOM   5789 C  CG    . PRO B 1 259 ? 34.482  -1.853  23.048  1.00 93.37  ? 259 PRO B CG    1 
ATOM   5790 C  CD    . PRO B 1 259 ? 33.072  -1.726  23.526  1.00 94.04  ? 259 PRO B CD    1 
ATOM   5791 N  N     . LEU B 1 260 ? 32.001  -5.053  22.703  1.00 92.00  ? 260 LEU B N     1 
ATOM   5792 C  CA    . LEU B 1 260 ? 31.445  -6.404  22.925  1.00 91.79  ? 260 LEU B CA    1 
ATOM   5793 C  C     . LEU B 1 260 ? 32.372  -7.559  22.495  1.00 89.70  ? 260 LEU B C     1 
ATOM   5794 O  O     . LEU B 1 260 ? 32.255  -8.092  21.379  1.00 87.34  ? 260 LEU B O     1 
ATOM   5795 C  CB    . LEU B 1 260 ? 30.036  -6.553  22.312  1.00 91.39  ? 260 LEU B CB    1 
ATOM   5796 C  CG    . LEU B 1 260 ? 28.865  -5.784  22.946  1.00 93.98  ? 260 LEU B CG    1 
ATOM   5797 C  CD1   . LEU B 1 260 ? 28.347  -4.702  22.009  1.00 92.99  ? 260 LEU B CD1   1 
ATOM   5798 C  CD2   . LEU B 1 260 ? 27.734  -6.738  23.286  1.00 95.24  ? 260 LEU B CD2   1 
ATOM   5799 N  N     . GLU B 1 261 ? 33.278  -7.939  23.400  1.00 90.40  ? 261 GLU B N     1 
ATOM   5800 C  CA    . GLU B 1 261 ? 34.296  -8.963  23.123  1.00 88.40  ? 261 GLU B CA    1 
ATOM   5801 C  C     . GLU B 1 261 ? 33.730  -10.373 23.019  1.00 87.03  ? 261 GLU B C     1 
ATOM   5802 O  O     . GLU B 1 261 ? 33.035  -10.849 23.924  1.00 88.99  ? 261 GLU B O     1 
ATOM   5803 C  CB    . GLU B 1 261 ? 35.415  -8.940  24.171  1.00 90.77  ? 261 GLU B CB    1 
ATOM   5804 C  CG    . GLU B 1 261 ? 36.535  -7.944  23.888  1.00 90.76  ? 261 GLU B CG    1 
ATOM   5805 C  CD    . GLU B 1 261 ? 36.344  -6.614  24.597  1.00 93.36  ? 261 GLU B CD    1 
ATOM   5806 O  OE1   . GLU B 1 261 ? 35.721  -6.593  25.684  1.00 95.93  ? 261 GLU B OE1   1 
ATOM   5807 O  OE2   . GLU B 1 261 ? 36.834  -5.589  24.070  1.00 93.03  ? 261 GLU B OE2   1 
ATOM   5808 N  N     . ILE B 1 262 ? 34.044  -11.029 21.902  1.00 83.27  ? 262 ILE B N     1 
ATOM   5809 C  CA    . ILE B 1 262 ? 33.691  -12.430 21.683  1.00 81.41  ? 262 ILE B CA    1 
ATOM   5810 C  C     . ILE B 1 262 ? 34.959  -13.287 21.570  1.00 80.09  ? 262 ILE B C     1 
ATOM   5811 O  O     . ILE B 1 262 ? 35.837  -13.020 20.739  1.00 78.35  ? 262 ILE B O     1 
ATOM   5812 C  CB    . ILE B 1 262 ? 32.759  -12.614 20.446  1.00 79.23  ? 262 ILE B CB    1 
ATOM   5813 C  CG1   . ILE B 1 262 ? 32.385  -14.093 20.260  1.00 78.87  ? 262 ILE B CG1   1 
ATOM   5814 C  CG2   . ILE B 1 262 ? 33.395  -12.010 19.184  1.00 76.73  ? 262 ILE B CG2   1 
ATOM   5815 C  CD1   . ILE B 1 262 ? 31.205  -14.337 19.345  1.00 77.42  ? 262 ILE B CD1   1 
ATOM   5816 N  N     . GLU B 1 263 ? 35.050  -14.303 22.426  1.00 80.48  ? 263 GLU B N     1 
ATOM   5817 C  CA    . GLU B 1 263 ? 36.202  -15.198 22.435  1.00 79.37  ? 263 GLU B CA    1 
ATOM   5818 C  C     . GLU B 1 263 ? 36.155  -16.166 21.249  1.00 75.90  ? 263 GLU B C     1 
ATOM   5819 O  O     . GLU B 1 263 ? 35.070  -16.532 20.788  1.00 74.70  ? 263 GLU B O     1 
ATOM   5820 C  CB    . GLU B 1 263 ? 36.309  -15.956 23.772  1.00 82.84  ? 263 GLU B CB    1 
ATOM   5821 C  CG    . GLU B 1 263 ? 35.360  -17.153 23.945  1.00 83.85  ? 263 GLU B CG    1 
ATOM   5822 C  CD    . GLU B 1 263 ? 33.969  -16.761 24.428  1.00 85.73  ? 263 GLU B CD    1 
ATOM   5823 O  OE1   . GLU B 1 263 ? 33.279  -17.636 24.993  1.00 87.35  ? 263 GLU B OE1   1 
ATOM   5824 O  OE2   . GLU B 1 263 ? 33.559  -15.590 24.251  1.00 85.60  ? 263 GLU B OE2   1 
ATOM   5825 N  N     . PRO B 1 264 ? 37.337  -16.558 20.738  1.00 73.99  ? 264 PRO B N     1 
ATOM   5826 C  CA    . PRO B 1 264 ? 37.487  -17.543 19.671  1.00 71.21  ? 264 PRO B CA    1 
ATOM   5827 C  C     . PRO B 1 264 ? 36.474  -18.689 19.708  1.00 70.34  ? 264 PRO B C     1 
ATOM   5828 O  O     . PRO B 1 264 ? 35.977  -19.080 18.656  1.00 68.08  ? 264 PRO B O     1 
ATOM   5829 C  CB    . PRO B 1 264 ? 38.901  -18.090 19.891  1.00 72.55  ? 264 PRO B CB    1 
ATOM   5830 C  CG    . PRO B 1 264 ? 39.633  -17.028 20.680  1.00 74.55  ? 264 PRO B CG    1 
ATOM   5831 C  CD    . PRO B 1 264 ? 38.641  -15.999 21.148  1.00 75.04  ? 264 PRO B CD    1 
ATOM   5832 N  N     . GLU B 1 265 ? 36.170  -19.218 20.896  1.00 71.47  ? 265 GLU B N     1 
ATOM   5833 C  CA    . GLU B 1 265 ? 35.327  -20.418 21.000  1.00 70.94  ? 265 GLU B CA    1 
ATOM   5834 C  C     . GLU B 1 265 ? 33.837  -20.188 20.696  1.00 68.69  ? 265 GLU B C     1 
ATOM   5835 O  O     . GLU B 1 265 ? 33.203  -21.045 20.074  1.00 67.46  ? 265 GLU B O     1 
ATOM   5836 C  CB    . GLU B 1 265 ? 35.529  -21.156 22.338  1.00 74.22  ? 265 GLU B CB    1 
ATOM   5837 C  CG    . GLU B 1 265 ? 35.240  -22.673 22.258  1.00 75.29  ? 265 GLU B CG    1 
ATOM   5838 C  CD    . GLU B 1 265 ? 35.959  -23.509 23.335  1.00 79.04  ? 265 GLU B CD    1 
ATOM   5839 O  OE1   . GLU B 1 265 ? 36.148  -24.735 23.120  1.00 80.11  ? 265 GLU B OE1   1 
ATOM   5840 O  OE2   . GLU B 1 265 ? 36.327  -22.957 24.398  1.00 82.11  ? 265 GLU B OE2   1 
ATOM   5841 N  N     . ARG B 1 266 ? 33.281  -19.052 21.124  1.00 67.63  ? 266 ARG B N     1 
ATOM   5842 C  CA    . ARG B 1 266 ? 31.873  -18.740 20.826  1.00 65.96  ? 266 ARG B CA    1 
ATOM   5843 C  C     . ARG B 1 266 ? 31.672  -18.458 19.335  1.00 61.64  ? 266 ARG B C     1 
ATOM   5844 O  O     . ARG B 1 266 ? 30.702  -18.916 18.729  1.00 60.53  ? 266 ARG B O     1 
ATOM   5845 C  CB    . ARG B 1 266 ? 31.340  -17.575 21.672  1.00 67.48  ? 266 ARG B CB    1 
ATOM   5846 C  CG    . ARG B 1 266 ? 29.855  -17.289 21.420  1.00 67.79  ? 266 ARG B CG    1 
ATOM   5847 C  CD    . ARG B 1 266 ? 29.243  -16.268 22.377  1.00 70.48  ? 266 ARG B CD    1 
ATOM   5848 N  NE    . ARG B 1 266 ? 27.934  -15.814 21.892  1.00 71.95  ? 266 ARG B NE    1 
ATOM   5849 C  CZ    . ARG B 1 266 ? 27.667  -14.577 21.469  1.00 72.02  ? 266 ARG B CZ    1 
ATOM   5850 N  NH1   . ARG B 1 266 ? 28.608  -13.638 21.492  1.00 71.90  ? 266 ARG B NH1   1 
ATOM   5851 N  NH2   . ARG B 1 266 ? 26.449  -14.272 21.034  1.00 71.89  ? 266 ARG B NH2   1 
ATOM   5852 N  N     . LEU B 1 267 ? 32.604  -17.703 18.769  1.00 58.71  ? 267 LEU B N     1 
ATOM   5853 C  CA    . LEU B 1 267 ? 32.673  -17.442 17.340  1.00 55.01  ? 267 LEU B CA    1 
ATOM   5854 C  C     . LEU B 1 267 ? 32.752  -18.754 16.553  1.00 53.00  ? 267 LEU B C     1 
ATOM   5855 O  O     . LEU B 1 267 ? 32.006  -18.951 15.593  1.00 50.98  ? 267 LEU B O     1 
ATOM   5856 C  CB    . LEU B 1 267 ? 33.895  -16.567 17.066  1.00 54.37  ? 267 LEU B CB    1 
ATOM   5857 C  CG    . LEU B 1 267 ? 34.154  -15.792 15.779  1.00 52.56  ? 267 LEU B CG    1 
ATOM   5858 C  CD1   . LEU B 1 267 ? 32.931  -15.079 15.255  1.00 51.42  ? 267 LEU B CD1   1 
ATOM   5859 C  CD2   . LEU B 1 267 ? 35.251  -14.792 16.088  1.00 53.48  ? 267 LEU B CD2   1 
ATOM   5860 N  N     . ARG B 1 268 ? 33.639  -19.650 16.991  1.00 52.77  ? 268 ARG B N     1 
ATOM   5861 C  CA    . ARG B 1 268 ? 33.792  -20.983 16.402  1.00 51.66  ? 268 ARG B CA    1 
ATOM   5862 C  C     . ARG B 1 268 ? 32.481  -21.763 16.378  1.00 50.46  ? 268 ARG B C     1 
ATOM   5863 O  O     . ARG B 1 268 ? 32.114  -22.354 15.356  1.00 48.69  ? 268 ARG B O     1 
ATOM   5864 C  CB    . ARG B 1 268 ? 34.866  -21.774 17.155  1.00 53.81  ? 268 ARG B CB    1 
ATOM   5865 C  CG    . ARG B 1 268 ? 35.178  -23.128 16.535  1.00 56.64  ? 268 ARG B CG    1 
ATOM   5866 C  CD    . ARG B 1 268 ? 36.653  -23.449 16.654  1.00 62.44  ? 268 ARG B CD    1 
ATOM   5867 N  NE    . ARG B 1 268 ? 36.919  -24.874 16.461  1.00 67.26  ? 268 ARG B NE    1 
ATOM   5868 C  CZ    . ARG B 1 268 ? 37.934  -25.370 15.752  1.00 69.23  ? 268 ARG B CZ    1 
ATOM   5869 N  NH1   . ARG B 1 268 ? 38.790  -24.565 15.125  1.00 69.01  ? 268 ARG B NH1   1 
ATOM   5870 N  NH2   . ARG B 1 268 ? 38.081  -26.684 15.651  1.00 71.37  ? 268 ARG B NH2   1 
ATOM   5871 N  N     . LYS B 1 269 ? 31.788  -21.745 17.513  1.00 50.86  ? 269 LYS B N     1 
ATOM   5872 C  CA    . LYS B 1 269 ? 30.476  -22.372 17.692  1.00 50.36  ? 269 LYS B CA    1 
ATOM   5873 C  C     . LYS B 1 269 ? 29.442  -21.852 16.682  1.00 47.62  ? 269 LYS B C     1 
ATOM   5874 O  O     . LYS B 1 269 ? 28.720  -22.638 16.059  1.00 46.38  ? 269 LYS B O     1 
ATOM   5875 C  CB    . LYS B 1 269 ? 30.006  -22.107 19.120  1.00 53.10  ? 269 LYS B CB    1 
ATOM   5876 C  CG    . LYS B 1 269 ? 28.857  -22.944 19.627  1.00 55.92  ? 269 LYS B CG    1 
ATOM   5877 C  CD    . LYS B 1 269 ? 28.550  -22.538 21.059  1.00 60.46  ? 269 LYS B CD    1 
ATOM   5878 C  CE    . LYS B 1 269 ? 27.202  -23.068 21.520  1.00 65.05  ? 269 LYS B CE    1 
ATOM   5879 N  NZ    . LYS B 1 269 ? 26.868  -22.617 22.921  1.00 69.39  ? 269 LYS B NZ    1 
ATOM   5880 N  N     . ILE B 1 270 ? 29.393  -20.528 16.523  1.00 45.84  ? 270 ILE B N     1 
ATOM   5881 C  CA    . ILE B 1 270 ? 28.454  -19.858 15.612  1.00 43.69  ? 270 ILE B CA    1 
ATOM   5882 C  C     . ILE B 1 270 ? 28.694  -20.221 14.147  1.00 41.08  ? 270 ILE B C     1 
ATOM   5883 O  O     . ILE B 1 270 ? 27.746  -20.490 13.411  1.00 39.49  ? 270 ILE B O     1 
ATOM   5884 C  CB    . ILE B 1 270 ? 28.506  -18.321 15.792  1.00 43.74  ? 270 ILE B CB    1 
ATOM   5885 C  CG1   . ILE B 1 270 ? 27.913  -17.931 17.154  1.00 46.04  ? 270 ILE B CG1   1 
ATOM   5886 C  CG2   . ILE B 1 270 ? 27.783  -17.598 14.660  1.00 41.66  ? 270 ILE B CG2   1 
ATOM   5887 C  CD1   . ILE B 1 270 ? 28.242  -16.520 17.604  1.00 46.42  ? 270 ILE B CD1   1 
ATOM   5888 N  N     . VAL B 1 271 ? 29.960  -20.221 13.740  1.00 39.77  ? 271 VAL B N     1 
ATOM   5889 C  CA    . VAL B 1 271 ? 30.349  -20.612 12.391  1.00 38.24  ? 271 VAL B CA    1 
ATOM   5890 C  C     . VAL B 1 271 ? 29.930  -22.057 12.126  1.00 38.75  ? 271 VAL B C     1 
ATOM   5891 O  O     . VAL B 1 271 ? 29.381  -22.374 11.073  1.00 38.16  ? 271 VAL B O     1 
ATOM   5892 C  CB    . VAL B 1 271 ? 31.866  -20.417 12.174  1.00 37.31  ? 271 VAL B CB    1 
ATOM   5893 C  CG1   . VAL B 1 271 ? 32.338  -21.083 10.881  1.00 35.26  ? 271 VAL B CG1   1 
ATOM   5894 C  CG2   . VAL B 1 271 ? 32.192  -18.923 12.151  1.00 36.82  ? 271 VAL B CG2   1 
ATOM   5895 N  N     . GLU B 1 272 ? 30.172  -22.921 13.106  1.00 41.11  ? 272 GLU B N     1 
ATOM   5896 C  CA    . GLU B 1 272 ? 29.769  -24.319 13.034  1.00 42.36  ? 272 GLU B CA    1 
ATOM   5897 C  C     . GLU B 1 272 ? 28.242  -24.450 12.912  1.00 42.13  ? 272 GLU B C     1 
ATOM   5898 O  O     . GLU B 1 272 ? 27.757  -25.255 12.125  1.00 41.62  ? 272 GLU B O     1 
ATOM   5899 C  CB    . GLU B 1 272 ? 30.316  -25.084 14.238  1.00 44.99  ? 272 GLU B CB    1 
ATOM   5900 C  CG    . GLU B 1 272 ? 30.095  -26.587 14.193  1.00 49.62  ? 272 GLU B CG    1 
ATOM   5901 C  CD    . GLU B 1 272 ? 30.335  -27.245 15.544  1.00 55.88  ? 272 GLU B CD    1 
ATOM   5902 O  OE1   . GLU B 1 272 ? 31.085  -26.672 16.372  1.00 58.91  ? 272 GLU B OE1   1 
ATOM   5903 O  OE2   . GLU B 1 272 ? 29.771  -28.336 15.780  1.00 59.31  ? 272 GLU B OE2   1 
ATOM   5904 N  N     . GLU B 1 273 ? 27.504  -23.624 13.652  1.00 42.77  ? 273 GLU B N     1 
ATOM   5905 C  CA    . GLU B 1 273 ? 26.033  -23.599 13.582  1.00 43.28  ? 273 GLU B CA    1 
ATOM   5906 C  C     . GLU B 1 273 ? 25.522  -23.119 12.219  1.00 40.20  ? 273 GLU B C     1 
ATOM   5907 O  O     . GLU B 1 273 ? 24.566  -23.678 11.666  1.00 39.85  ? 273 GLU B O     1 
ATOM   5908 C  CB    . GLU B 1 273 ? 25.438  -22.765 14.736  1.00 44.65  ? 273 GLU B CB    1 
ATOM   5909 C  CG    . GLU B 1 273 ? 25.366  -23.545 16.080  1.00 49.29  ? 273 GLU B CG    1 
ATOM   5910 C  CD    . GLU B 1 273 ? 25.096  -22.677 17.320  1.00 50.65  ? 273 GLU B CD    1 
ATOM   5911 O  OE1   . GLU B 1 273 ? 25.281  -21.441 17.258  1.00 52.94  ? 273 GLU B OE1   1 
ATOM   5912 O  OE2   . GLU B 1 273 ? 24.710  -23.243 18.378  1.00 55.17  ? 273 GLU B OE2   1 
ATOM   5913 N  N     . ARG B 1 274 ? 26.170  -22.093 11.678  1.00 37.65  ? 274 ARG B N     1 
ATOM   5914 C  CA    . ARG B 1 274 ? 25.866  -21.608 10.332  1.00 35.52  ? 274 ARG B CA    1 
ATOM   5915 C  C     . ARG B 1 274 ? 26.192  -22.640 9.232   1.00 34.31  ? 274 ARG B C     1 
ATOM   5916 O  O     . ARG B 1 274 ? 25.512  -22.700 8.203   1.00 33.02  ? 274 ARG B O     1 
ATOM   5917 C  CB    . ARG B 1 274 ? 26.559  -20.271 10.086  1.00 34.42  ? 274 ARG B CB    1 
ATOM   5918 C  CG    . ARG B 1 274 ? 25.976  -19.190 10.977  1.00 35.30  ? 274 ARG B CG    1 
ATOM   5919 C  CD    . ARG B 1 274 ? 26.768  -17.903 10.983  1.00 38.00  ? 274 ARG B CD    1 
ATOM   5920 N  NE    . ARG B 1 274 ? 26.065  -16.782 10.351  1.00 38.18  ? 274 ARG B NE    1 
ATOM   5921 C  CZ    . ARG B 1 274 ? 26.320  -16.395 9.118   1.00 37.42  ? 274 ARG B CZ    1 
ATOM   5922 N  NH1   . ARG B 1 274 ? 27.221  -17.064 8.445   1.00 42.33  ? 274 ARG B NH1   1 
ATOM   5923 N  NH2   . ARG B 1 274 ? 25.705  -15.371 8.552   1.00 36.34  ? 274 ARG B NH2   1 
ATOM   5924 N  N     . GLY B 1 275 ? 27.212  -23.459 9.477   1.00 34.07  ? 275 GLY B N     1 
ATOM   5925 C  CA    . GLY B 1 275 ? 27.625  -24.498 8.539   1.00 33.30  ? 275 GLY B CA    1 
ATOM   5926 C  C     . GLY B 1 275 ? 28.374  -23.981 7.326   1.00 31.97  ? 275 GLY B C     1 
ATOM   5927 O  O     . GLY B 1 275 ? 28.490  -24.693 6.341   1.00 31.44  ? 275 GLY B O     1 
ATOM   5928 N  N     . THR B 1 276 ? 28.881  -22.746 7.411   1.00 31.48  ? 276 THR B N     1 
ATOM   5929 C  CA    . THR B 1 276 ? 29.579  -22.055 6.313   1.00 30.72  ? 276 THR B CA    1 
ATOM   5930 C  C     . THR B 1 276 ? 31.113  -22.208 6.334   1.00 30.46  ? 276 THR B C     1 
ATOM   5931 O  O     . THR B 1 276 ? 31.686  -22.580 7.351   1.00 31.57  ? 276 THR B O     1 
ATOM   5932 C  CB    . THR B 1 276 ? 29.302  -20.543 6.386   1.00 30.22  ? 276 THR B CB    1 
ATOM   5933 O  OG1   . THR B 1 276 ? 29.512  -20.091 7.733   1.00 31.42  ? 276 THR B OG1   1 
ATOM   5934 C  CG2   . THR B 1 276 ? 27.861  -20.222 5.962   1.00 29.81  ? 276 THR B CG2   1 
ATOM   5935 N  N     . ALA B 1 277 ? 31.758  -21.920 5.205   1.00 29.58  ? 277 ALA B N     1 
ATOM   5936 C  CA    . ALA B 1 277 ? 33.208  -21.795 5.134   1.00 29.58  ? 277 ALA B CA    1 
ATOM   5937 C  C     . ALA B 1 277 ? 33.529  -20.334 5.420   1.00 29.38  ? 277 ALA B C     1 
ATOM   5938 O  O     . ALA B 1 277 ? 33.090  -19.456 4.681   1.00 29.24  ? 277 ALA B O     1 
ATOM   5939 C  CB    . ALA B 1 277 ? 33.704  -22.150 3.759   1.00 28.94  ? 277 ALA B CB    1 
ATOM   5940 N  N     . VAL B 1 278 ? 34.274  -20.091 6.492   1.00 29.27  ? 278 VAL B N     1 
ATOM   5941 C  CA    . VAL B 1 278 ? 34.664  -18.735 6.900   1.00 28.94  ? 278 VAL B CA    1 
ATOM   5942 C  C     . VAL B 1 278 ? 36.183  -18.688 6.904   1.00 29.19  ? 278 VAL B C     1 
ATOM   5943 O  O     . VAL B 1 278 ? 36.835  -19.482 7.576   1.00 30.46  ? 278 VAL B O     1 
ATOM   5944 C  CB    . VAL B 1 278 ? 34.081  -18.338 8.285   1.00 29.78  ? 278 VAL B CB    1 
ATOM   5945 C  CG1   . VAL B 1 278 ? 34.600  -16.955 8.740   1.00 28.17  ? 278 VAL B CG1   1 
ATOM   5946 C  CG2   . VAL B 1 278 ? 32.571  -18.307 8.224   1.00 28.79  ? 278 VAL B CG2   1 
ATOM   5947 N  N     . PHE B 1 279 ? 36.742  -17.778 6.119   1.00 28.54  ? 279 PHE B N     1 
ATOM   5948 C  CA    . PHE B 1 279 ? 38.190  -17.677 5.997   1.00 29.48  ? 279 PHE B CA    1 
ATOM   5949 C  C     . PHE B 1 279 ? 38.605  -16.275 5.635   1.00 28.58  ? 279 PHE B C     1 
ATOM   5950 O  O     . PHE B 1 279 ? 37.774  -15.474 5.192   1.00 28.52  ? 279 PHE B O     1 
ATOM   5951 C  CB    . PHE B 1 279 ? 38.725  -18.664 4.950   1.00 29.49  ? 279 PHE B CB    1 
ATOM   5952 C  CG    . PHE B 1 279 ? 38.160  -18.458 3.559   1.00 29.30  ? 279 PHE B CG    1 
ATOM   5953 C  CD1   . PHE B 1 279 ? 38.861  -17.710 2.619   1.00 27.00  ? 279 PHE B CD1   1 
ATOM   5954 C  CD2   . PHE B 1 279 ? 36.942  -19.045 3.183   1.00 28.48  ? 279 PHE B CD2   1 
ATOM   5955 C  CE1   . PHE B 1 279 ? 38.362  -17.540 1.322   1.00 26.34  ? 279 PHE B CE1   1 
ATOM   5956 C  CE2   . PHE B 1 279 ? 36.434  -18.871 1.895   1.00 29.79  ? 279 PHE B CE2   1 
ATOM   5957 C  CZ    . PHE B 1 279 ? 37.153  -18.102 0.964   1.00 26.60  ? 279 PHE B CZ    1 
ATOM   5958 N  N     . ALA B 1 280 ? 39.900  -15.996 5.795   1.00 29.08  ? 280 ALA B N     1 
ATOM   5959 C  CA    . ALA B 1 280 ? 40.482  -14.688 5.441   1.00 28.99  ? 280 ALA B CA    1 
ATOM   5960 C  C     . ALA B 1 280 ? 41.738  -14.803 4.584   1.00 29.11  ? 280 ALA B C     1 
ATOM   5961 O  O     . ALA B 1 280 ? 42.479  -15.785 4.682   1.00 29.59  ? 280 ALA B O     1 
ATOM   5962 C  CB    . ALA B 1 280 ? 40.812  -13.883 6.701   1.00 29.42  ? 280 ALA B CB    1 
ATOM   5963 N  N     . VAL B 1 281 ? 41.962  -13.788 3.748   1.00 28.04  ? 281 VAL B N     1 
ATOM   5964 C  CA    . VAL B 1 281 ? 43.250  -13.574 3.098   1.00 29.00  ? 281 VAL B CA    1 
ATOM   5965 C  C     . VAL B 1 281 ? 43.979  -12.530 3.934   1.00 29.59  ? 281 VAL B C     1 
ATOM   5966 O  O     . VAL B 1 281 ? 43.509  -11.397 4.043   1.00 30.43  ? 281 VAL B O     1 
ATOM   5967 C  CB    . VAL B 1 281 ? 43.106  -13.004 1.658   1.00 28.34  ? 281 VAL B CB    1 
ATOM   5968 C  CG1   . VAL B 1 281 ? 44.478  -12.868 0.999   1.00 28.38  ? 281 VAL B CG1   1 
ATOM   5969 C  CG2   . VAL B 1 281 ? 42.138  -13.862 0.804   1.00 28.79  ? 281 VAL B CG2   1 
ATOM   5970 N  N     . LYS B 1 282 ? 45.117  -12.916 4.510   1.00 30.67  ? 282 LYS B N     1 
ATOM   5971 C  CA    . LYS B 1 282 ? 45.913  -12.044 5.365   1.00 30.95  ? 282 LYS B CA    1 
ATOM   5972 C  C     . LYS B 1 282 ? 47.186  -11.662 4.632   1.00 31.26  ? 282 LYS B C     1 
ATOM   5973 O  O     . LYS B 1 282 ? 47.855  -12.523 4.072   1.00 31.60  ? 282 LYS B O     1 
ATOM   5974 C  CB    . LYS B 1 282 ? 46.262  -12.768 6.674   1.00 32.38  ? 282 LYS B CB    1 
ATOM   5975 C  CG    . LYS B 1 282 ? 47.295  -12.063 7.567   1.00 34.25  ? 282 LYS B CG    1 
ATOM   5976 C  CD    . LYS B 1 282 ? 47.613  -12.930 8.783   1.00 35.03  ? 282 LYS B CD    1 
ATOM   5977 C  CE    . LYS B 1 282 ? 48.627  -12.259 9.713   1.00 36.42  ? 282 LYS B CE    1 
ATOM   5978 N  NZ    . LYS B 1 282 ? 48.943  -13.182 10.850  1.00 37.58  ? 282 LYS B NZ    1 
ATOM   5979 N  N     . PHE B 1 283 ? 47.532  -10.373 4.649   1.00 30.95  ? 283 PHE B N     1 
ATOM   5980 C  CA    . PHE B 1 283 ? 48.777  -9.931  4.037   1.00 31.00  ? 283 PHE B CA    1 
ATOM   5981 C  C     . PHE B 1 283 ? 49.293  -8.677  4.749   1.00 32.12  ? 283 PHE B C     1 
ATOM   5982 O  O     . PHE B 1 283 ? 48.561  -8.051  5.531   1.00 30.90  ? 283 PHE B O     1 
ATOM   5983 C  CB    . PHE B 1 283 ? 48.563  -9.709  2.529   1.00 30.29  ? 283 PHE B CB    1 
ATOM   5984 C  CG    . PHE B 1 283 ? 47.425  -8.784  2.214   1.00 30.11  ? 283 PHE B CG    1 
ATOM   5985 C  CD1   . PHE B 1 283 ? 47.663  -7.427  1.979   1.00 28.90  ? 283 PHE B CD1   1 
ATOM   5986 C  CD2   . PHE B 1 283 ? 46.106  -9.252  2.180   1.00 28.41  ? 283 PHE B CD2   1 
ATOM   5987 C  CE1   . PHE B 1 283 ? 46.612  -6.562  1.699   1.00 28.44  ? 283 PHE B CE1   1 
ATOM   5988 C  CE2   . PHE B 1 283 ? 45.040  -8.378  1.893   1.00 28.83  ? 283 PHE B CE2   1 
ATOM   5989 C  CZ    . PHE B 1 283 ? 45.294  -7.037  1.656   1.00 27.15  ? 283 PHE B CZ    1 
ATOM   5990 N  N     . ARG B 1 284 ? 50.553  -8.310  4.502   1.00 33.36  ? 284 ARG B N     1 
ATOM   5991 C  CA    . ARG B 1 284 ? 51.113  -7.102  5.114   1.00 34.60  ? 284 ARG B CA    1 
ATOM   5992 C  C     . ARG B 1 284 ? 50.420  -5.873  4.581   1.00 33.43  ? 284 ARG B C     1 
ATOM   5993 O  O     . ARG B 1 284 ? 50.200  -5.744  3.377   1.00 32.30  ? 284 ARG B O     1 
ATOM   5994 C  CB    . ARG B 1 284 ? 52.612  -6.954  4.848   1.00 36.67  ? 284 ARG B CB    1 
ATOM   5995 C  CG    . ARG B 1 284 ? 53.387  -8.215  5.020   1.00 39.93  ? 284 ARG B CG    1 
ATOM   5996 C  CD    . ARG B 1 284 ? 54.885  -7.943  5.101   1.00 45.58  ? 284 ARG B CD    1 
ATOM   5997 N  NE    . ARG B 1 284 ? 55.451  -8.928  6.013   1.00 50.49  ? 284 ARG B NE    1 
ATOM   5998 C  CZ    . ARG B 1 284 ? 55.572  -8.744  7.323   1.00 53.47  ? 284 ARG B CZ    1 
ATOM   5999 N  NH1   . ARG B 1 284 ? 55.217  -7.586  7.878   1.00 51.24  ? 284 ARG B NH1   1 
ATOM   6000 N  NH2   . ARG B 1 284 ? 56.081  -9.716  8.073   1.00 58.20  ? 284 ARG B NH2   1 
ATOM   6001 N  N     . LYS B 1 285 ? 50.118  -4.955  5.489   1.00 33.79  ? 285 LYS B N     1 
ATOM   6002 C  CA    . LYS B 1 285 ? 49.427  -3.724  5.140   1.00 33.86  ? 285 LYS B CA    1 
ATOM   6003 C  C     . LYS B 1 285 ? 50.370  -2.803  4.391   1.00 35.19  ? 285 LYS B C     1 
ATOM   6004 O  O     . LYS B 1 285 ? 51.460  -2.507  4.894   1.00 36.45  ? 285 LYS B O     1 
ATOM   6005 C  CB    . LYS B 1 285 ? 48.937  -3.043  6.412   1.00 34.14  ? 285 LYS B CB    1 
ATOM   6006 C  CG    . LYS B 1 285 ? 47.830  -2.059  6.186   1.00 35.62  ? 285 LYS B CG    1 
ATOM   6007 C  CD    . LYS B 1 285 ? 48.277  -0.672  6.466   1.00 38.22  ? 285 LYS B CD    1 
ATOM   6008 C  CE    . LYS B 1 285 ? 48.092  -0.326  7.924   1.00 41.28  ? 285 LYS B CE    1 
ATOM   6009 N  NZ    . LYS B 1 285 ? 48.499  1.088   8.131   1.00 44.49  ? 285 LYS B NZ    1 
ATOM   6010 N  N     . PRO B 1 286 ? 49.979  -2.372  3.171   1.00 34.93  ? 286 PRO B N     1 
ATOM   6011 C  CA    . PRO B 1 286 ? 50.748  -1.353  2.440   1.00 35.78  ? 286 PRO B CA    1 
ATOM   6012 C  C     . PRO B 1 286 ? 50.898  -0.064  3.240   1.00 36.76  ? 286 PRO B C     1 
ATOM   6013 O  O     . PRO B 1 286 ? 49.911  0.443   3.770   1.00 36.84  ? 286 PRO B O     1 
ATOM   6014 C  CB    . PRO B 1 286 ? 49.907  -1.110  1.192   1.00 35.05  ? 286 PRO B CB    1 
ATOM   6015 C  CG    . PRO B 1 286 ? 49.115  -2.401  1.014   1.00 33.89  ? 286 PRO B CG    1 
ATOM   6016 C  CD    . PRO B 1 286 ? 48.814  -2.854  2.403   1.00 33.27  ? 286 PRO B CD    1 
ATOM   6017 N  N     . ASP B 1 287 ? 52.121  0.454   3.334   1.00 38.06  ? 287 ASP B N     1 
ATOM   6018 C  CA    . ASP B 1 287 ? 52.384  1.690   4.073   1.00 38.76  ? 287 ASP B CA    1 
ATOM   6019 C  C     . ASP B 1 287 ? 51.861  2.892   3.280   1.00 38.65  ? 287 ASP B C     1 
ATOM   6020 O  O     . ASP B 1 287 ? 52.640  3.721   2.791   1.00 39.72  ? 287 ASP B O     1 
ATOM   6021 C  CB    . ASP B 1 287 ? 53.882  1.835   4.413   1.00 41.00  ? 287 ASP B CB    1 
ATOM   6022 C  CG    . ASP B 1 287 ? 54.172  3.003   5.379   1.00 42.35  ? 287 ASP B CG    1 
ATOM   6023 O  OD1   . ASP B 1 287 ? 53.239  3.559   6.009   1.00 41.57  ? 287 ASP B OD1   1 
ATOM   6024 O  OD2   . ASP B 1 287 ? 55.352  3.369   5.504   1.00 46.99  ? 287 ASP B OD2   1 
ATOM   6025 N  N     . ILE B 1 288 ? 50.533  2.959   3.150   1.00 37.00  ? 288 ILE B N     1 
ATOM   6026 C  CA    . ILE B 1 288 ? 49.841  4.061   2.462   1.00 37.38  ? 288 ILE B CA    1 
ATOM   6027 C  C     . ILE B 1 288 ? 48.744  4.686   3.344   1.00 36.79  ? 288 ILE B C     1 
ATOM   6028 O  O     . ILE B 1 288 ? 48.247  4.050   4.273   1.00 36.63  ? 288 ILE B O     1 
ATOM   6029 C  CB    . ILE B 1 288 ? 49.237  3.627   1.075   1.00 36.56  ? 288 ILE B CB    1 
ATOM   6030 C  CG1   . ILE B 1 288 ? 48.175  2.513   1.243   1.00 35.04  ? 288 ILE B CG1   1 
ATOM   6031 C  CG2   . ILE B 1 288 ? 50.354  3.253   0.097   1.00 36.99  ? 288 ILE B CG2   1 
ATOM   6032 C  CD1   . ILE B 1 288 ? 47.641  1.912   -0.069  1.00 34.01  ? 288 ILE B CD1   1 
ATOM   6033 N  N     . VAL B 1 289 ? 48.374  5.925   3.049   1.00 37.21  ? 289 VAL B N     1 
ATOM   6034 C  CA    . VAL B 1 289 ? 47.285  6.603   3.768   1.00 37.23  ? 289 VAL B CA    1 
ATOM   6035 C  C     . VAL B 1 289 ? 45.965  5.818   3.644   1.00 35.83  ? 289 VAL B C     1 
ATOM   6036 O  O     . VAL B 1 289 ? 45.802  5.038   2.695   1.00 34.40  ? 289 VAL B O     1 
ATOM   6037 C  CB    . VAL B 1 289 ? 47.099  8.052   3.279   1.00 38.45  ? 289 VAL B CB    1 
ATOM   6038 C  CG1   . VAL B 1 289 ? 48.300  8.898   3.660   1.00 39.26  ? 289 VAL B CG1   1 
ATOM   6039 C  CG2   . VAL B 1 289 ? 46.883  8.105   1.766   1.00 38.24  ? 289 VAL B CG2   1 
ATOM   6040 N  N     . ASP B 1 290 ? 45.049  6.024   4.599   1.00 35.61  ? 290 ASP B N     1 
ATOM   6041 C  CA    . ASP B 1 290 ? 43.743  5.351   4.622   1.00 35.20  ? 290 ASP B CA    1 
ATOM   6042 C  C     . ASP B 1 290 ? 42.933  5.572   3.348   1.00 34.64  ? 290 ASP B C     1 
ATOM   6043 O  O     . ASP B 1 290 ? 42.257  4.668   2.863   1.00 33.52  ? 290 ASP B O     1 
ATOM   6044 C  CB    . ASP B 1 290 ? 42.896  5.838   5.807   1.00 36.00  ? 290 ASP B CB    1 
ATOM   6045 C  CG    . ASP B 1 290 ? 43.341  5.262   7.148   1.00 37.47  ? 290 ASP B CG    1 
ATOM   6046 O  OD1   . ASP B 1 290 ? 44.270  4.414   7.185   1.00 36.01  ? 290 ASP B OD1   1 
ATOM   6047 O  OD2   . ASP B 1 290 ? 42.740  5.668   8.174   1.00 38.72  ? 290 ASP B OD2   1 
ATOM   6048 N  N     . ASP B 1 291 ? 42.989  6.789   2.821   1.00 35.71  ? 291 ASP B N     1 
ATOM   6049 C  CA    . ASP B 1 291 ? 42.148  7.176   1.695   1.00 35.98  ? 291 ASP B CA    1 
ATOM   6050 C  C     . ASP B 1 291 ? 42.618  6.571   0.378   1.00 35.56  ? 291 ASP B C     1 
ATOM   6051 O  O     . ASP B 1 291 ? 41.911  6.651   -0.633  1.00 35.45  ? 291 ASP B O     1 
ATOM   6052 C  CB    . ASP B 1 291 ? 42.120  8.687   1.618   1.00 38.00  ? 291 ASP B CB    1 
ATOM   6053 C  CG    . ASP B 1 291 ? 41.883  9.299   2.962   1.00 40.76  ? 291 ASP B CG    1 
ATOM   6054 O  OD1   . ASP B 1 291 ? 42.880  9.735   3.593   1.00 42.49  ? 291 ASP B OD1   1 
ATOM   6055 O  OD2   . ASP B 1 291 ? 40.720  9.271   3.412   1.00 42.34  ? 291 ASP B OD2   1 
ATOM   6056 N  N     . ASN B 1 292 ? 43.826  6.000   0.408   1.00 34.58  ? 292 ASN B N     1 
ATOM   6057 C  CA    . ASN B 1 292 ? 44.347  5.193   -0.675  1.00 34.38  ? 292 ASN B CA    1 
ATOM   6058 C  C     . ASN B 1 292 ? 44.079  3.720   -0.391  1.00 33.41  ? 292 ASN B C     1 
ATOM   6059 O  O     . ASN B 1 292 ? 43.694  2.969   -1.297  1.00 33.10  ? 292 ASN B O     1 
ATOM   6060 C  CB    . ASN B 1 292 ? 45.850  5.450   -0.877  1.00 34.56  ? 292 ASN B CB    1 
ATOM   6061 C  CG    . ASN B 1 292 ? 46.143  6.791   -1.570  1.00 35.49  ? 292 ASN B CG    1 
ATOM   6062 O  OD1   . ASN B 1 292 ? 45.256  7.430   -2.143  1.00 33.30  ? 292 ASN B OD1   1 
ATOM   6063 N  ND2   . ASN B 1 292 ? 47.403  7.199   -1.537  1.00 35.56  ? 292 ASN B ND2   1 
ATOM   6064 N  N     . LEU B 1 293 ? 44.252  3.319   0.872   1.00 33.48  ? 293 LEU B N     1 
ATOM   6065 C  CA    . LEU B 1 293 ? 44.119  1.917   1.271   1.00 32.88  ? 293 LEU B CA    1 
ATOM   6066 C  C     . LEU B 1 293 ? 42.691  1.372   1.147   1.00 32.13  ? 293 LEU B C     1 
ATOM   6067 O  O     . LEU B 1 293 ? 42.460  0.354   0.491   1.00 30.18  ? 293 LEU B O     1 
ATOM   6068 C  CB    . LEU B 1 293 ? 44.647  1.685   2.693   1.00 33.01  ? 293 LEU B CB    1 
ATOM   6069 C  CG    . LEU B 1 293 ? 44.569  0.239   3.231   1.00 32.54  ? 293 LEU B CG    1 
ATOM   6070 C  CD1   . LEU B 1 293 ? 45.283  -0.797  2.348   1.00 32.65  ? 293 LEU B CD1   1 
ATOM   6071 C  CD2   . LEU B 1 293 ? 45.084  0.155   4.671   1.00 33.83  ? 293 LEU B CD2   1 
ATOM   6072 N  N     . TYR B 1 294 ? 41.745  2.060   1.773   1.00 32.81  ? 294 TYR B N     1 
ATOM   6073 C  CA    . TYR B 1 294 ? 40.394  1.523   1.884   1.00 32.61  ? 294 TYR B CA    1 
ATOM   6074 C  C     . TYR B 1 294 ? 39.682  1.230   0.535   1.00 31.90  ? 294 TYR B C     1 
ATOM   6075 O  O     . TYR B 1 294 ? 39.083  0.160   0.393   1.00 31.32  ? 294 TYR B O     1 
ATOM   6076 C  CB    . TYR B 1 294 ? 39.562  2.352   2.876   1.00 34.33  ? 294 TYR B CB    1 
ATOM   6077 C  CG    . TYR B 1 294 ? 39.924  2.029   4.310   1.00 35.21  ? 294 TYR B CG    1 
ATOM   6078 C  CD1   . TYR B 1 294 ? 40.866  2.788   5.001   1.00 38.08  ? 294 TYR B CD1   1 
ATOM   6079 C  CD2   . TYR B 1 294 ? 39.357  0.927   4.962   1.00 37.24  ? 294 TYR B CD2   1 
ATOM   6080 C  CE1   . TYR B 1 294 ? 41.218  2.475   6.318   1.00 39.21  ? 294 TYR B CE1   1 
ATOM   6081 C  CE2   . TYR B 1 294 ? 39.700  0.609   6.271   1.00 37.27  ? 294 TYR B CE2   1 
ATOM   6082 C  CZ    . TYR B 1 294 ? 40.633  1.386   6.943   1.00 37.87  ? 294 TYR B CZ    1 
ATOM   6083 O  OH    . TYR B 1 294 ? 40.971  1.066   8.244   1.00 37.79  ? 294 TYR B OH    1 
ATOM   6084 N  N     . PRO B 1 295 ? 39.750  2.153   -0.453  1.00 32.27  ? 295 PRO B N     1 
ATOM   6085 C  CA    . PRO B 1 295 ? 39.216  1.794   -1.778  1.00 31.93  ? 295 PRO B CA    1 
ATOM   6086 C  C     . PRO B 1 295 ? 39.880  0.583   -2.443  1.00 30.83  ? 295 PRO B C     1 
ATOM   6087 O  O     . PRO B 1 295 ? 39.232  -0.109  -3.225  1.00 30.71  ? 295 PRO B O     1 
ATOM   6088 C  CB    . PRO B 1 295 ? 39.456  3.062   -2.606  1.00 33.06  ? 295 PRO B CB    1 
ATOM   6089 C  CG    . PRO B 1 295 ? 39.412  4.159   -1.592  1.00 32.98  ? 295 PRO B CG    1 
ATOM   6090 C  CD    . PRO B 1 295 ? 40.170  3.568   -0.426  1.00 33.75  ? 295 PRO B CD    1 
ATOM   6091 N  N     . GLN B 1 296 ? 41.153  0.337   -2.143  1.00 30.06  ? 296 GLN B N     1 
ATOM   6092 C  CA    . GLN B 1 296 ? 41.838  -0.847  -2.668  1.00 29.75  ? 296 GLN B CA    1 
ATOM   6093 C  C     . GLN B 1 296 ? 41.372  -2.135  -1.972  1.00 28.75  ? 296 GLN B C     1 
ATOM   6094 O  O     . GLN B 1 296 ? 41.229  -3.182  -2.630  1.00 29.14  ? 296 GLN B O     1 
ATOM   6095 C  CB    . GLN B 1 296 ? 43.351  -0.692  -2.564  1.00 29.43  ? 296 GLN B CB    1 
ATOM   6096 C  CG    . GLN B 1 296 ? 43.954  0.343   -3.494  1.00 30.52  ? 296 GLN B CG    1 
ATOM   6097 C  CD    . GLN B 1 296 ? 45.452  0.460   -3.311  1.00 30.74  ? 296 GLN B CD    1 
ATOM   6098 O  OE1   . GLN B 1 296 ? 46.142  -0.545  -3.227  1.00 31.83  ? 296 GLN B OE1   1 
ATOM   6099 N  NE2   . GLN B 1 296 ? 45.958  1.685   -3.266  1.00 29.01  ? 296 GLN B NE2   1 
ATOM   6100 N  N     . LEU B 1 297 ? 41.138  -2.063  -0.659  1.00 28.91  ? 297 LEU B N     1 
ATOM   6101 C  CA    . LEU B 1 297 ? 40.586  -3.209  0.113   1.00 28.52  ? 297 LEU B CA    1 
ATOM   6102 C  C     . LEU B 1 297 ? 39.186  -3.595  -0.359  1.00 29.02  ? 297 LEU B C     1 
ATOM   6103 O  O     . LEU B 1 297 ? 38.874  -4.787  -0.483  1.00 29.37  ? 297 LEU B O     1 
ATOM   6104 C  CB    . LEU B 1 297 ? 40.559  -2.926  1.634   1.00 28.77  ? 297 LEU B CB    1 
ATOM   6105 C  CG    . LEU B 1 297 ? 41.894  -2.708  2.388   1.00 29.62  ? 297 LEU B CG    1 
ATOM   6106 C  CD1   . LEU B 1 297 ? 41.708  -2.285  3.845   1.00 29.15  ? 297 LEU B CD1   1 
ATOM   6107 C  CD2   . LEU B 1 297 ? 42.783  -3.940  2.303   1.00 28.65  ? 297 LEU B CD2   1 
ATOM   6108 N  N     . GLU B 1 298 ? 38.344  -2.587  -0.577  1.00 30.21  ? 298 GLU B N     1 
ATOM   6109 C  CA    . GLU B 1 298 ? 37.034  -2.741  -1.225  1.00 31.85  ? 298 GLU B CA    1 
ATOM   6110 C  C     . GLU B 1 298 ? 37.130  -3.465  -2.576  1.00 31.24  ? 298 GLU B C     1 
ATOM   6111 O  O     . GLU B 1 298 ? 36.381  -4.414  -2.822  1.00 31.88  ? 298 GLU B O     1 
ATOM   6112 C  CB    . GLU B 1 298 ? 36.370  -1.360  -1.408  1.00 32.15  ? 298 GLU B CB    1 
ATOM   6113 C  CG    . GLU B 1 298 ? 35.711  -0.827  -0.142  1.00 34.90  ? 298 GLU B CG    1 
ATOM   6114 C  CD    . GLU B 1 298 ? 35.458  0.690   -0.160  1.00 37.07  ? 298 GLU B CD    1 
ATOM   6115 O  OE1   . GLU B 1 298 ? 35.123  1.241   0.911   1.00 41.82  ? 298 GLU B OE1   1 
ATOM   6116 O  OE2   . GLU B 1 298 ? 35.573  1.337   -1.228  1.00 41.97  ? 298 GLU B OE2   1 
ATOM   6117 N  N     . ARG B 1 299 ? 38.059  -3.020  -3.428  1.00 32.08  ? 299 ARG B N     1 
ATOM   6118 C  CA    . ARG B 1 299 ? 38.266  -3.606  -4.756  1.00 32.15  ? 299 ARG B CA    1 
ATOM   6119 C  C     . ARG B 1 299 ? 38.750  -5.044  -4.657  1.00 30.76  ? 299 ARG B C     1 
ATOM   6120 O  O     . ARG B 1 299 ? 38.171  -5.918  -5.292  1.00 30.07  ? 299 ARG B O     1 
ATOM   6121 C  CB    . ARG B 1 299 ? 39.222  -2.768  -5.634  1.00 33.29  ? 299 ARG B CB    1 
ATOM   6122 C  CG    . ARG B 1 299 ? 39.838  -3.604  -6.780  1.00 34.83  ? 299 ARG B CG    1 
ATOM   6123 C  CD    . ARG B 1 299 ? 40.788  -2.868  -7.746  1.00 35.75  ? 299 ARG B CD    1 
ATOM   6124 N  NE    . ARG B 1 299 ? 40.036  -2.479  -8.921  1.00 42.26  ? 299 ARG B NE    1 
ATOM   6125 C  CZ    . ARG B 1 299 ? 39.841  -3.224  -10.004 1.00 43.05  ? 299 ARG B CZ    1 
ATOM   6126 N  NH1   . ARG B 1 299 ? 40.397  -4.417  -10.140 1.00 43.39  ? 299 ARG B NH1   1 
ATOM   6127 N  NH2   . ARG B 1 299 ? 39.088  -2.748  -10.976 1.00 46.17  ? 299 ARG B NH2   1 
ATOM   6128 N  N     . ALA B 1 300 ? 39.810  -5.275  -3.875  1.00 30.03  ? 300 ALA B N     1 
ATOM   6129 C  CA    . ALA B 1 300 ? 40.336  -6.627  -3.632  1.00 29.41  ? 300 ALA B CA    1 
ATOM   6130 C  C     . ALA B 1 300 ? 39.231  -7.577  -3.151  1.00 29.12  ? 300 ALA B C     1 
ATOM   6131 O  O     . ALA B 1 300 ? 39.098  -8.672  -3.694  1.00 29.00  ? 300 ALA B O     1 
ATOM   6132 C  CB    . ALA B 1 300 ? 41.468  -6.601  -2.630  1.00 28.68  ? 300 ALA B CB    1 
ATOM   6133 N  N     . SER B 1 301 ? 38.462  -7.152  -2.139  1.00 29.22  ? 301 SER B N     1 
ATOM   6134 C  CA    . SER B 1 301 ? 37.302  -7.907  -1.625  1.00 29.47  ? 301 SER B CA    1 
ATOM   6135 C  C     . SER B 1 301 ? 36.290  -8.287  -2.701  1.00 29.23  ? 301 SER B C     1 
ATOM   6136 O  O     . SER B 1 301 ? 35.883  -9.451  -2.791  1.00 28.98  ? 301 SER B O     1 
ATOM   6137 C  CB    . SER B 1 301 ? 36.562  -7.118  -0.538  1.00 30.02  ? 301 SER B CB    1 
ATOM   6138 O  OG    . SER B 1 301 ? 37.399  -6.862  0.576   1.00 34.40  ? 301 SER B OG    1 
ATOM   6139 N  N     . ARG B 1 302 ? 35.889  -7.297  -3.497  1.00 29.37  ? 302 ARG B N     1 
ATOM   6140 C  CA    . ARG B 1 302 ? 34.901  -7.462  -4.550  1.00 29.62  ? 302 ARG B CA    1 
ATOM   6141 C  C     . ARG B 1 302 ? 35.390  -8.430  -5.624  1.00 29.21  ? 302 ARG B C     1 
ATOM   6142 O  O     . ARG B 1 302 ? 34.639  -9.316  -6.058  1.00 27.83  ? 302 ARG B O     1 
ATOM   6143 C  CB    . ARG B 1 302 ? 34.610  -6.107  -5.184  1.00 31.09  ? 302 ARG B CB    1 
ATOM   6144 C  CG    . ARG B 1 302 ? 33.393  -6.061  -6.070  1.00 34.25  ? 302 ARG B CG    1 
ATOM   6145 C  CD    . ARG B 1 302 ? 33.370  -4.766  -6.841  1.00 39.53  ? 302 ARG B CD    1 
ATOM   6146 N  NE    . ARG B 1 302 ? 33.807  -4.975  -8.217  1.00 45.43  ? 302 ARG B NE    1 
ATOM   6147 C  CZ    . ARG B 1 302 ? 34.799  -4.334  -8.823  1.00 48.31  ? 302 ARG B CZ    1 
ATOM   6148 N  NH1   . ARG B 1 302 ? 35.508  -3.400  -8.199  1.00 49.03  ? 302 ARG B NH1   1 
ATOM   6149 N  NH2   . ARG B 1 302 ? 35.073  -4.630  -10.081 1.00 51.74  ? 302 ARG B NH2   1 
ATOM   6150 N  N     . LYS B 1 303 ? 36.642  -8.246  -6.055  1.00 28.17  ? 303 LYS B N     1 
ATOM   6151 C  CA    . LYS B 1 303 ? 37.214  -9.081  -7.117  1.00 28.19  ? 303 LYS B CA    1 
ATOM   6152 C  C     . LYS B 1 303 ? 37.257  -10.546 -6.689  1.00 27.64  ? 303 LYS B C     1 
ATOM   6153 O  O     . LYS B 1 303 ? 36.952  -11.444 -7.484  1.00 27.60  ? 303 LYS B O     1 
ATOM   6154 C  CB    . LYS B 1 303 ? 38.607  -8.599  -7.531  1.00 28.42  ? 303 LYS B CB    1 
ATOM   6155 C  CG    . LYS B 1 303 ? 38.650  -7.260  -8.290  1.00 28.37  ? 303 LYS B CG    1 
ATOM   6156 C  CD    . LYS B 1 303 ? 37.707  -7.183  -9.480  1.00 30.14  ? 303 LYS B CD    1 
ATOM   6157 C  CE    . LYS B 1 303 ? 38.282  -7.835  -10.713 1.00 33.11  ? 303 LYS B CE    1 
ATOM   6158 N  NZ    . LYS B 1 303 ? 37.273  -7.865  -11.833 1.00 35.91  ? 303 LYS B NZ    1 
ATOM   6159 N  N     . ILE B 1 304 ? 37.624  -10.779 -5.431  1.00 26.95  ? 304 ILE B N     1 
ATOM   6160 C  CA    . ILE B 1 304 ? 37.624  -12.125 -4.878  1.00 26.84  ? 304 ILE B CA    1 
ATOM   6161 C  C     . ILE B 1 304 ? 36.200  -12.655 -4.638  1.00 26.69  ? 304 ILE B C     1 
ATOM   6162 O  O     . ILE B 1 304 ? 35.933  -13.837 -4.855  1.00 25.93  ? 304 ILE B O     1 
ATOM   6163 C  CB    . ILE B 1 304 ? 38.469  -12.214 -3.588  1.00 26.81  ? 304 ILE B CB    1 
ATOM   6164 C  CG1   . ILE B 1 304 ? 39.952  -11.947 -3.925  1.00 28.58  ? 304 ILE B CG1   1 
ATOM   6165 C  CG2   . ILE B 1 304 ? 38.306  -13.594 -2.918  1.00 24.80  ? 304 ILE B CG2   1 
ATOM   6166 C  CD1   . ILE B 1 304 ? 40.815  -11.543 -2.731  1.00 28.39  ? 304 ILE B CD1   1 
ATOM   6167 N  N     . PHE B 1 305 ? 35.307  -11.795 -4.162  1.00 26.28  ? 305 PHE B N     1 
ATOM   6168 C  CA    . PHE B 1 305 ? 33.899  -12.181 -3.991  1.00 26.87  ? 305 PHE B CA    1 
ATOM   6169 C  C     . PHE B 1 305 ? 33.308  -12.621 -5.344  1.00 27.58  ? 305 PHE B C     1 
ATOM   6170 O  O     . PHE B 1 305 ? 32.590  -13.620 -5.433  1.00 27.68  ? 305 PHE B O     1 
ATOM   6171 C  CB    . PHE B 1 305 ? 33.103  -11.017 -3.409  1.00 27.38  ? 305 PHE B CB    1 
ATOM   6172 C  CG    . PHE B 1 305 ? 31.705  -11.370 -2.992  1.00 27.03  ? 305 PHE B CG    1 
ATOM   6173 C  CD1   . PHE B 1 305 ? 31.427  -11.719 -1.666  1.00 29.20  ? 305 PHE B CD1   1 
ATOM   6174 C  CD2   . PHE B 1 305 ? 30.657  -11.324 -3.913  1.00 30.06  ? 305 PHE B CD2   1 
ATOM   6175 C  CE1   . PHE B 1 305 ? 30.109  -12.034 -1.261  1.00 29.35  ? 305 PHE B CE1   1 
ATOM   6176 C  CE2   . PHE B 1 305 ? 29.334  -11.646 -3.530  1.00 31.62  ? 305 PHE B CE2   1 
ATOM   6177 C  CZ    . PHE B 1 305 ? 29.065  -11.997 -2.200  1.00 30.15  ? 305 PHE B CZ    1 
ATOM   6178 N  N     . GLU B 1 306 ? 33.629  -11.878 -6.395  1.00 28.48  ? 306 GLU B N     1 
ATOM   6179 C  CA    . GLU B 1 306 ? 33.138  -12.210 -7.736  1.00 30.32  ? 306 GLU B CA    1 
ATOM   6180 C  C     . GLU B 1 306 ? 33.758  -13.509 -8.263  1.00 29.44  ? 306 GLU B C     1 
ATOM   6181 O  O     . GLU B 1 306 ? 33.078  -14.298 -8.924  1.00 30.12  ? 306 GLU B O     1 
ATOM   6182 C  CB    . GLU B 1 306 ? 33.326  -11.021 -8.694  1.00 30.92  ? 306 GLU B CB    1 
ATOM   6183 C  CG    . GLU B 1 306 ? 32.346  -9.884  -8.357  1.00 33.18  ? 306 GLU B CG    1 
ATOM   6184 C  CD    . GLU B 1 306 ? 32.648  -8.565  -9.045  1.00 35.08  ? 306 GLU B CD    1 
ATOM   6185 O  OE1   . GLU B 1 306 ? 33.700  -8.453  -9.710  1.00 38.95  ? 306 GLU B OE1   1 
ATOM   6186 O  OE2   . GLU B 1 306 ? 31.827  -7.628  -8.897  1.00 39.40  ? 306 GLU B OE2   1 
ATOM   6187 N  N     . PHE B 1 307 ? 35.030  -13.745 -7.947  1.00 28.55  ? 307 PHE B N     1 
ATOM   6188 C  CA    . PHE B 1 307 ? 35.641  -15.047 -8.225  1.00 28.32  ? 307 PHE B CA    1 
ATOM   6189 C  C     . PHE B 1 307 ? 34.848  -16.177 -7.535  1.00 27.61  ? 307 PHE B C     1 
ATOM   6190 O  O     . PHE B 1 307 ? 34.514  -17.189 -8.160  1.00 28.34  ? 307 PHE B O     1 
ATOM   6191 C  CB    . PHE B 1 307 ? 37.131  -15.060 -7.844  1.00 27.61  ? 307 PHE B CB    1 
ATOM   6192 C  CG    . PHE B 1 307 ? 37.724  -16.442 -7.750  1.00 27.75  ? 307 PHE B CG    1 
ATOM   6193 C  CD1   . PHE B 1 307 ? 38.170  -17.103 -8.885  1.00 29.46  ? 307 PHE B CD1   1 
ATOM   6194 C  CD2   . PHE B 1 307 ? 37.799  -17.099 -6.515  1.00 28.45  ? 307 PHE B CD2   1 
ATOM   6195 C  CE1   . PHE B 1 307 ? 38.718  -18.385 -8.791  1.00 29.37  ? 307 PHE B CE1   1 
ATOM   6196 C  CE2   . PHE B 1 307 ? 38.318  -18.375 -6.414  1.00 27.79  ? 307 PHE B CE2   1 
ATOM   6197 C  CZ    . PHE B 1 307 ? 38.776  -19.022 -7.550  1.00 28.54  ? 307 PHE B CZ    1 
ATOM   6198 N  N     . LEU B 1 308 ? 34.529  -15.989 -6.259  1.00 26.92  ? 308 LEU B N     1 
ATOM   6199 C  CA    . LEU B 1 308 ? 33.844  -17.035 -5.477  1.00 26.49  ? 308 LEU B CA    1 
ATOM   6200 C  C     . LEU B 1 308 ? 32.447  -17.317 -6.027  1.00 26.98  ? 308 LEU B C     1 
ATOM   6201 O  O     . LEU B 1 308 ? 32.003  -18.470 -6.055  1.00 26.88  ? 308 LEU B O     1 
ATOM   6202 C  CB    . LEU B 1 308 ? 33.773  -16.646 -3.989  1.00 25.83  ? 308 LEU B CB    1 
ATOM   6203 C  CG    . LEU B 1 308 ? 35.070  -16.730 -3.183  1.00 25.20  ? 308 LEU B CG    1 
ATOM   6204 C  CD1   . LEU B 1 308 ? 35.007  -15.857 -1.935  1.00 23.62  ? 308 LEU B CD1   1 
ATOM   6205 C  CD2   . LEU B 1 308 ? 35.390  -18.195 -2.859  1.00 22.49  ? 308 LEU B CD2   1 
ATOM   6206 N  N     . GLU B 1 309 ? 31.769  -16.259 -6.476  1.00 27.94  ? 309 GLU B N     1 
ATOM   6207 C  CA    . GLU B 1 309 ? 30.460  -16.377 -7.132  1.00 29.49  ? 309 GLU B CA    1 
ATOM   6208 C  C     . GLU B 1 309 ? 30.524  -17.257 -8.380  1.00 29.88  ? 309 GLU B C     1 
ATOM   6209 O  O     . GLU B 1 309 ? 29.793  -18.248 -8.489  1.00 29.29  ? 309 GLU B O     1 
ATOM   6210 C  CB    . GLU B 1 309 ? 29.918  -15.001 -7.527  1.00 30.51  ? 309 GLU B CB    1 
ATOM   6211 C  CG    . GLU B 1 309 ? 29.485  -14.137 -6.366  1.00 32.80  ? 309 GLU B CG    1 
ATOM   6212 C  CD    . GLU B 1 309 ? 28.746  -12.867 -6.791  1.00 34.44  ? 309 GLU B CD    1 
ATOM   6213 O  OE1   . GLU B 1 309 ? 29.349  -12.010 -7.494  1.00 38.20  ? 309 GLU B OE1   1 
ATOM   6214 O  OE2   . GLU B 1 309 ? 27.558  -12.735 -6.400  1.00 39.46  ? 309 GLU B OE2   1 
ATOM   6215 N  N     . ARG B 1 310 ? 31.396  -16.896 -9.321  1.00 29.91  ? 310 ARG B N     1 
ATOM   6216 C  CA    . ARG B 1 310 ? 31.445  -17.624 -10.583 1.00 30.89  ? 310 ARG B CA    1 
ATOM   6217 C  C     . ARG B 1 310 ? 32.051  -19.022 -10.412 1.00 30.29  ? 310 ARG B C     1 
ATOM   6218 O  O     . ARG B 1 310 ? 31.866  -19.876 -11.269 1.00 31.52  ? 310 ARG B O     1 
ATOM   6219 C  CB    . ARG B 1 310 ? 32.123  -16.820 -11.702 1.00 32.29  ? 310 ARG B CB    1 
ATOM   6220 C  CG    . ARG B 1 310 ? 33.589  -16.464 -11.462 1.00 32.03  ? 310 ARG B CG    1 
ATOM   6221 C  CD    . ARG B 1 310 ? 34.263  -15.829 -12.723 1.00 33.36  ? 310 ARG B CD    1 
ATOM   6222 N  NE    . ARG B 1 310 ? 35.664  -15.557 -12.408 1.00 32.12  ? 310 ARG B NE    1 
ATOM   6223 C  CZ    . ARG B 1 310 ? 36.091  -14.476 -11.759 1.00 32.43  ? 310 ARG B CZ    1 
ATOM   6224 N  NH1   . ARG B 1 310 ? 35.231  -13.526 -11.402 1.00 31.89  ? 310 ARG B NH1   1 
ATOM   6225 N  NH2   . ARG B 1 310 ? 37.387  -14.331 -11.485 1.00 32.11  ? 310 ARG B NH2   1 
ATOM   6226 N  N     . GLU B 1 311 ? 32.740  -19.265 -9.300  1.00 28.75  ? 311 GLU B N     1 
ATOM   6227 C  CA    . GLU B 1 311 ? 33.231  -20.620 -9.016  1.00 29.04  ? 311 GLU B CA    1 
ATOM   6228 C  C     . GLU B 1 311 ? 32.247  -21.469 -8.214  1.00 28.13  ? 311 GLU B C     1 
ATOM   6229 O  O     . GLU B 1 311 ? 32.587  -22.572 -7.789  1.00 27.45  ? 311 GLU B O     1 
ATOM   6230 C  CB    . GLU B 1 311 ? 34.600  -20.602 -8.333  1.00 28.67  ? 311 GLU B CB    1 
ATOM   6231 C  CG    . GLU B 1 311 ? 35.737  -20.055 -9.205  1.00 31.25  ? 311 GLU B CG    1 
ATOM   6232 C  CD    . GLU B 1 311 ? 36.099  -20.953 -10.369 1.00 35.01  ? 311 GLU B CD    1 
ATOM   6233 O  OE1   . GLU B 1 311 ? 36.630  -20.415 -11.366 1.00 38.55  ? 311 GLU B OE1   1 
ATOM   6234 O  OE2   . GLU B 1 311 ? 35.865  -22.181 -10.300 1.00 32.46  ? 311 GLU B OE2   1 
ATOM   6235 N  N     . ASN B 1 312 ? 31.032  -20.953 -8.024  1.00 27.73  ? 312 ASN B N     1 
ATOM   6236 C  CA    . ASN B 1 312 ? 29.943  -21.699 -7.376  1.00 28.20  ? 312 ASN B CA    1 
ATOM   6237 C  C     . ASN B 1 312 ? 30.182  -22.035 -5.893  1.00 27.30  ? 312 ASN B C     1 
ATOM   6238 O  O     . ASN B 1 312 ? 29.763  -23.094 -5.407  1.00 27.20  ? 312 ASN B O     1 
ATOM   6239 C  CB    . ASN B 1 312 ? 29.577  -22.961 -8.187  1.00 28.49  ? 312 ASN B CB    1 
ATOM   6240 C  CG    . ASN B 1 312 ? 29.065  -22.628 -9.586  1.00 30.79  ? 312 ASN B CG    1 
ATOM   6241 O  OD1   . ASN B 1 312 ? 29.692  -22.979 -10.589 1.00 32.77  ? 312 ASN B OD1   1 
ATOM   6242 N  ND2   . ASN B 1 312 ? 27.939  -21.937 -9.657  1.00 27.60  ? 312 ASN B ND2   1 
ATOM   6243 N  N     . PHE B 1 313 ? 30.885  -21.139 -5.200  1.00 26.85  ? 313 PHE B N     1 
ATOM   6244 C  CA    . PHE B 1 313 ? 31.112  -21.289 -3.760  1.00 26.46  ? 313 PHE B CA    1 
ATOM   6245 C  C     . PHE B 1 313 ? 30.052  -20.574 -2.945  1.00 26.42  ? 313 PHE B C     1 
ATOM   6246 O  O     . PHE B 1 313 ? 30.023  -20.680 -1.725  1.00 27.73  ? 313 PHE B O     1 
ATOM   6247 C  CB    . PHE B 1 313 ? 32.533  -20.871 -3.369  1.00 25.54  ? 313 PHE B CB    1 
ATOM   6248 C  CG    . PHE B 1 313 ? 33.571  -21.852 -3.810  1.00 25.23  ? 313 PHE B CG    1 
ATOM   6249 C  CD1   . PHE B 1 313 ? 33.553  -23.161 -3.322  1.00 27.06  ? 313 PHE B CD1   1 
ATOM   6250 C  CD2   . PHE B 1 313 ? 34.536  -21.495 -4.752  1.00 24.23  ? 313 PHE B CD2   1 
ATOM   6251 C  CE1   . PHE B 1 313 ? 34.499  -24.088 -3.741  1.00 25.68  ? 313 PHE B CE1   1 
ATOM   6252 C  CE2   . PHE B 1 313 ? 35.488  -22.406 -5.175  1.00 25.53  ? 313 PHE B CE2   1 
ATOM   6253 C  CZ    . PHE B 1 313 ? 35.464  -23.715 -4.678  1.00 26.71  ? 313 PHE B CZ    1 
ATOM   6254 N  N     . MET B 1 314 ? 29.177  -19.867 -3.646  1.00 27.28  ? 314 MET B N     1 
ATOM   6255 C  CA    . MET B 1 314 ? 28.006  -19.199 -3.077  1.00 27.99  ? 314 MET B CA    1 
ATOM   6256 C  C     . MET B 1 314 ? 28.390  -18.287 -1.910  1.00 27.76  ? 314 MET B C     1 
ATOM   6257 O  O     . MET B 1 314 ? 27.973  -18.486 -0.753  1.00 27.02  ? 314 MET B O     1 
ATOM   6258 C  CB    . MET B 1 314 ? 26.933  -20.225 -2.704  1.00 28.39  ? 314 MET B CB    1 
ATOM   6259 C  CG    . MET B 1 314 ? 26.508  -21.111 -3.873  1.00 29.04  ? 314 MET B CG    1 
ATOM   6260 S  SD    . MET B 1 314 ? 25.393  -22.418 -3.327  1.00 31.90  ? 314 MET B SD    1 
ATOM   6261 C  CE    . MET B 1 314 ? 23.934  -21.424 -2.964  1.00 34.71  ? 314 MET B CE    1 
ATOM   6262 N  N     . PRO B 1 315 ? 29.187  -17.256 -2.215  1.00 27.86  ? 315 PRO B N     1 
ATOM   6263 C  CA    . PRO B 1 315 ? 29.584  -16.395 -1.111  1.00 26.96  ? 315 PRO B CA    1 
ATOM   6264 C  C     . PRO B 1 315 ? 28.359  -15.625 -0.559  1.00 28.19  ? 315 PRO B C     1 
ATOM   6265 O  O     . PRO B 1 315 ? 27.461  -15.259 -1.328  1.00 27.78  ? 315 PRO B O     1 
ATOM   6266 C  CB    . PRO B 1 315 ? 30.626  -15.475 -1.761  1.00 27.64  ? 315 PRO B CB    1 
ATOM   6267 C  CG    . PRO B 1 315 ? 30.292  -15.468 -3.208  1.00 27.19  ? 315 PRO B CG    1 
ATOM   6268 C  CD    . PRO B 1 315 ? 29.703  -16.791 -3.523  1.00 27.68  ? 315 PRO B CD    1 
ATOM   6269 N  N     . LEU B 1 316 ? 28.315  -15.422 0.762   1.00 27.87  ? 316 LEU B N     1 
ATOM   6270 C  CA    . LEU B 1 316 ? 27.230  -14.675 1.395   1.00 29.02  ? 316 LEU B CA    1 
ATOM   6271 C  C     . LEU B 1 316 ? 27.567  -13.197 1.523   1.00 29.31  ? 316 LEU B C     1 
ATOM   6272 O  O     . LEU B 1 316 ? 26.843  -12.331 1.011   1.00 30.44  ? 316 LEU B O     1 
ATOM   6273 C  CB    . LEU B 1 316 ? 26.903  -15.259 2.778   1.00 29.19  ? 316 LEU B CB    1 
ATOM   6274 C  CG    . LEU B 1 316 ? 26.307  -16.669 2.724   1.00 29.24  ? 316 LEU B CG    1 
ATOM   6275 C  CD1   . LEU B 1 316 ? 26.450  -17.395 4.062   1.00 32.39  ? 316 LEU B CD1   1 
ATOM   6276 C  CD2   . LEU B 1 316 ? 24.862  -16.618 2.286   1.00 27.65  ? 316 LEU B CD2   1 
ATOM   6277 N  N     . ARG B 1 317 ? 28.655  -12.914 2.233   1.00 28.84  ? 317 ARG B N     1 
ATOM   6278 C  CA    . ARG B 1 317 ? 29.089  -11.541 2.490   1.00 29.14  ? 317 ARG B CA    1 
ATOM   6279 C  C     . ARG B 1 317 ? 30.606  -11.491 2.563   1.00 28.59  ? 317 ARG B C     1 
ATOM   6280 O  O     . ARG B 1 317 ? 31.278  -12.519 2.720   1.00 27.19  ? 317 ARG B O     1 
ATOM   6281 C  CB    . ARG B 1 317 ? 28.500  -10.990 3.800   1.00 29.85  ? 317 ARG B CB    1 
ATOM   6282 C  CG    . ARG B 1 317 ? 27.020  -10.548 3.757   1.00 31.56  ? 317 ARG B CG    1 
ATOM   6283 C  CD    . ARG B 1 317 ? 26.594  -9.876  5.060   1.00 31.77  ? 317 ARG B CD    1 
ATOM   6284 N  NE    . ARG B 1 317 ? 26.621  -8.408  4.982   1.00 31.97  ? 317 ARG B NE    1 
ATOM   6285 C  CZ    . ARG B 1 317 ? 26.485  -7.593  6.020   1.00 32.45  ? 317 ARG B CZ    1 
ATOM   6286 N  NH1   . ARG B 1 317 ? 26.346  -8.084  7.242   1.00 33.25  ? 317 ARG B NH1   1 
ATOM   6287 N  NH2   . ARG B 1 317 ? 26.499  -6.273  5.836   1.00 35.22  ? 317 ARG B NH2   1 
ATOM   6288 N  N     . SER B 1 318 ? 31.147  -10.281 2.447   1.00 28.57  ? 318 SER B N     1 
ATOM   6289 C  CA    . SER B 1 318 ? 32.558  -10.066 2.696   1.00 28.49  ? 318 SER B CA    1 
ATOM   6290 C  C     . SER B 1 318 ? 32.753  -8.873  3.624   1.00 29.12  ? 318 SER B C     1 
ATOM   6291 O  O     . SER B 1 318 ? 31.832  -8.066  3.836   1.00 29.05  ? 318 SER B O     1 
ATOM   6292 C  CB    . SER B 1 318 ? 33.348  -9.885  1.386   1.00 29.12  ? 318 SER B CB    1 
ATOM   6293 O  OG    . SER B 1 318 ? 33.000  -8.677  0.724   1.00 30.46  ? 318 SER B OG    1 
ATOM   6294 N  N     . ALA B 1 319 ? 33.952  -8.793  4.191   1.00 28.91  ? 319 ALA B N     1 
ATOM   6295 C  CA    . ALA B 1 319 ? 34.366  -7.656  4.983   1.00 29.71  ? 319 ALA B CA    1 
ATOM   6296 C  C     . ALA B 1 319 ? 35.885  -7.533  4.921   1.00 29.61  ? 319 ALA B C     1 
ATOM   6297 O  O     . ALA B 1 319 ? 36.565  -8.401  4.387   1.00 29.43  ? 319 ALA B O     1 
ATOM   6298 C  CB    . ALA B 1 319 ? 33.878  -7.808  6.435   1.00 30.10  ? 319 ALA B CB    1 
ATOM   6299 N  N     . PHE B 1 320 ? 36.425  -6.447  5.458   1.00 30.45  ? 320 PHE B N     1 
ATOM   6300 C  CA    . PHE B 1 320 ? 37.867  -6.313  5.521   1.00 30.98  ? 320 PHE B CA    1 
ATOM   6301 C  C     . PHE B 1 320 ? 38.277  -5.576  6.789   1.00 32.41  ? 320 PHE B C     1 
ATOM   6302 O  O     . PHE B 1 320 ? 37.475  -4.854  7.398   1.00 33.55  ? 320 PHE B O     1 
ATOM   6303 C  CB    . PHE B 1 320 ? 38.412  -5.632  4.256   1.00 30.97  ? 320 PHE B CB    1 
ATOM   6304 C  CG    . PHE B 1 320 ? 37.765  -4.314  3.963   1.00 32.00  ? 320 PHE B CG    1 
ATOM   6305 C  CD1   . PHE B 1 320 ? 38.129  -3.174  4.669   1.00 35.30  ? 320 PHE B CD1   1 
ATOM   6306 C  CD2   . PHE B 1 320 ? 36.770  -4.212  2.990   1.00 33.97  ? 320 PHE B CD2   1 
ATOM   6307 C  CE1   . PHE B 1 320 ? 37.514  -1.947  4.412   1.00 34.79  ? 320 PHE B CE1   1 
ATOM   6308 C  CE2   . PHE B 1 320 ? 36.149  -2.988  2.727   1.00 34.04  ? 320 PHE B CE2   1 
ATOM   6309 C  CZ    . PHE B 1 320 ? 36.531  -1.852  3.437   1.00 33.90  ? 320 PHE B CZ    1 
ATOM   6310 N  N     . LYS B 1 321 ? 39.530  -5.767  7.177   1.00 32.92  ? 321 LYS B N     1 
ATOM   6311 C  CA    . LYS B 1 321 ? 40.084  -5.131  8.359   1.00 34.25  ? 321 LYS B CA    1 
ATOM   6312 C  C     . LYS B 1 321 ? 41.524  -4.752  8.089   1.00 34.49  ? 321 LYS B C     1 
ATOM   6313 O  O     . LYS B 1 321 ? 42.303  -5.584  7.632   1.00 33.73  ? 321 LYS B O     1 
ATOM   6314 C  CB    . LYS B 1 321 ? 40.045  -6.100  9.545   1.00 34.91  ? 321 LYS B CB    1 
ATOM   6315 C  CG    . LYS B 1 321 ? 39.847  -5.440  10.886  1.00 38.66  ? 321 LYS B CG    1 
ATOM   6316 C  CD    . LYS B 1 321 ? 41.113  -4.960  11.499  1.00 42.94  ? 321 LYS B CD    1 
ATOM   6317 C  CE    . LYS B 1 321 ? 40.804  -4.081  12.688  1.00 45.30  ? 321 LYS B CE    1 
ATOM   6318 N  NZ    . LYS B 1 321 ? 41.879  -4.231  13.675  1.00 48.40  ? 321 LYS B NZ    1 
ATOM   6319 N  N     . ALA B 1 322 ? 41.864  -3.500  8.385   1.00 35.21  ? 322 ALA B N     1 
ATOM   6320 C  CA    . ALA B 1 322 ? 43.251  -3.050  8.402   1.00 36.62  ? 322 ALA B CA    1 
ATOM   6321 C  C     . ALA B 1 322 ? 43.751  -2.901  9.843   1.00 38.45  ? 322 ALA B C     1 
ATOM   6322 O  O     . ALA B 1 322 ? 43.228  -2.083  10.605  1.00 39.09  ? 322 ALA B O     1 
ATOM   6323 C  CB    . ALA B 1 322 ? 43.395  -1.734  7.636   1.00 36.30  ? 322 ALA B CB    1 
ATOM   6324 N  N     . SER B 1 323 ? 44.741  -3.716  10.209  1.00 39.62  ? 323 SER B N     1 
ATOM   6325 C  CA    . SER B 1 323 ? 45.492  -3.552  11.468  1.00 43.06  ? 323 SER B CA    1 
ATOM   6326 C  C     . SER B 1 323 ? 46.697  -2.648  11.272  1.00 44.03  ? 323 SER B C     1 
ATOM   6327 O  O     . SER B 1 323 ? 46.838  -2.029  10.225  1.00 43.58  ? 323 SER B O     1 
ATOM   6328 C  CB    . SER B 1 323 ? 45.982  -4.905  11.986  1.00 43.58  ? 323 SER B CB    1 
ATOM   6329 O  OG    . SER B 1 323 ? 45.176  -5.334  13.061  1.00 47.06  ? 323 SER B OG    1 
ATOM   6330 N  N     . GLU B 1 324 ? 47.563  -2.584  12.286  1.00 46.63  ? 324 GLU B N     1 
ATOM   6331 C  CA    . GLU B 1 324 ? 48.862  -1.911  12.179  1.00 48.07  ? 324 GLU B CA    1 
ATOM   6332 C  C     . GLU B 1 324 ? 49.792  -2.599  11.177  1.00 46.97  ? 324 GLU B C     1 
ATOM   6333 O  O     . GLU B 1 324 ? 50.412  -1.934  10.346  1.00 46.87  ? 324 GLU B O     1 
ATOM   6334 C  CB    . GLU B 1 324 ? 49.572  -1.842  13.546  1.00 51.11  ? 324 GLU B CB    1 
ATOM   6335 C  CG    . GLU B 1 324 ? 49.161  -0.685  14.462  1.00 54.77  ? 324 GLU B CG    1 
ATOM   6336 C  CD    . GLU B 1 324 ? 49.763  0.654   14.057  1.00 58.80  ? 324 GLU B CD    1 
ATOM   6337 O  OE1   . GLU B 1 324 ? 49.698  1.009   12.853  1.00 59.85  ? 324 GLU B OE1   1 
ATOM   6338 O  OE2   . GLU B 1 324 ? 50.287  1.361   14.951  1.00 61.10  ? 324 GLU B OE2   1 
ATOM   6339 N  N     . GLU B 1 325 ? 49.891  -3.924  11.260  1.00 46.22  ? 325 GLU B N     1 
ATOM   6340 C  CA    . GLU B 1 325 ? 50.827  -4.684  10.422  1.00 45.84  ? 325 GLU B CA    1 
ATOM   6341 C  C     . GLU B 1 325 ? 50.178  -5.373  9.217   1.00 43.32  ? 325 GLU B C     1 
ATOM   6342 O  O     . GLU B 1 325 ? 50.812  -5.528  8.170   1.00 42.74  ? 325 GLU B O     1 
ATOM   6343 C  CB    . GLU B 1 325 ? 51.576  -5.718  11.276  1.00 47.68  ? 325 GLU B CB    1 
ATOM   6344 C  CG    . GLU B 1 325 ? 52.718  -6.449  10.555  1.00 48.86  ? 325 GLU B CG    1 
ATOM   6345 C  CD    . GLU B 1 325 ? 53.645  -7.225  11.493  1.00 51.43  ? 325 GLU B CD    1 
ATOM   6346 O  OE1   . GLU B 1 325 ? 53.302  -7.423  12.683  1.00 54.46  ? 325 GLU B OE1   1 
ATOM   6347 O  OE2   . GLU B 1 325 ? 54.730  -7.637  11.027  1.00 51.94  ? 325 GLU B OE2   1 
ATOM   6348 N  N     . PHE B 1 326 ? 48.922  -5.786  9.375   1.00 41.40  ? 326 PHE B N     1 
ATOM   6349 C  CA    . PHE B 1 326 ? 48.264  -6.672  8.413   1.00 39.29  ? 326 PHE B CA    1 
ATOM   6350 C  C     . PHE B 1 326 ? 46.903  -6.175  7.960   1.00 37.32  ? 326 PHE B C     1 
ATOM   6351 O  O     . PHE B 1 326 ? 46.244  -5.399  8.646   1.00 37.48  ? 326 PHE B O     1 
ATOM   6352 C  CB    . PHE B 1 326 ? 48.095  -8.080  8.996   1.00 39.70  ? 326 PHE B CB    1 
ATOM   6353 C  CG    . PHE B 1 326 ? 49.391  -8.770  9.323   1.00 42.28  ? 326 PHE B CG    1 
ATOM   6354 C  CD1   . PHE B 1 326 ? 49.819  -8.877  10.644  1.00 43.76  ? 326 PHE B CD1   1 
ATOM   6355 C  CD2   . PHE B 1 326 ? 50.191  -9.302  8.314   1.00 42.44  ? 326 PHE B CD2   1 
ATOM   6356 C  CE1   . PHE B 1 326 ? 51.010  -9.520  10.961  1.00 45.82  ? 326 PHE B CE1   1 
ATOM   6357 C  CE2   . PHE B 1 326 ? 51.398  -9.937  8.618   1.00 43.97  ? 326 PHE B CE2   1 
ATOM   6358 C  CZ    . PHE B 1 326 ? 51.806  -10.044 9.945   1.00 46.16  ? 326 PHE B CZ    1 
ATOM   6359 N  N     . CYS B 1 327 ? 46.498  -6.653  6.788   1.00 35.50  ? 327 CYS B N     1 
ATOM   6360 C  CA    . CYS B 1 327 ? 45.173  -6.466  6.281   1.00 34.12  ? 327 CYS B CA    1 
ATOM   6361 C  C     . CYS B 1 327 ? 44.533  -7.835  6.170   1.00 33.45  ? 327 CYS B C     1 
ATOM   6362 O  O     . CYS B 1 327 ? 45.238  -8.834  5.999   1.00 33.17  ? 327 CYS B O     1 
ATOM   6363 C  CB    . CYS B 1 327 ? 45.223  -5.781  4.922   1.00 33.54  ? 327 CYS B CB    1 
ATOM   6364 S  SG    . CYS B 1 327 ? 45.607  -4.036  5.058   1.00 34.45  ? 327 CYS B SG    1 
ATOM   6365 N  N     . TYR B 1 328 ? 43.208  -7.868  6.309   1.00 32.43  ? 328 TYR B N     1 
ATOM   6366 C  CA    . TYR B 1 328 ? 42.438  -9.106  6.221   1.00 31.56  ? 328 TYR B CA    1 
ATOM   6367 C  C     . TYR B 1 328 ? 41.246  -8.908  5.297   1.00 30.72  ? 328 TYR B C     1 
ATOM   6368 O  O     . TYR B 1 328 ? 40.480  -7.954  5.450   1.00 29.95  ? 328 TYR B O     1 
ATOM   6369 C  CB    . TYR B 1 328 ? 41.932  -9.550  7.594   1.00 31.92  ? 328 TYR B CB    1 
ATOM   6370 C  CG    . TYR B 1 328 ? 43.010  -9.637  8.644   1.00 33.81  ? 328 TYR B CG    1 
ATOM   6371 C  CD1   . TYR B 1 328 ? 43.425  -8.491  9.339   1.00 34.84  ? 328 TYR B CD1   1 
ATOM   6372 C  CD2   . TYR B 1 328 ? 43.618  -10.852 8.943   1.00 34.31  ? 328 TYR B CD2   1 
ATOM   6373 C  CE1   . TYR B 1 328 ? 44.417  -8.557  10.294  1.00 36.68  ? 328 TYR B CE1   1 
ATOM   6374 C  CE2   . TYR B 1 328 ? 44.622  -10.926 9.904   1.00 36.85  ? 328 TYR B CE2   1 
ATOM   6375 C  CZ    . TYR B 1 328 ? 45.009  -9.771  10.579  1.00 36.93  ? 328 TYR B CZ    1 
ATOM   6376 O  OH    . TYR B 1 328 ? 45.987  -9.834  11.530  1.00 38.10  ? 328 TYR B OH    1 
ATOM   6377 N  N     . LEU B 1 329 ? 41.114  -9.815  4.338   1.00 30.17  ? 329 LEU B N     1 
ATOM   6378 C  CA    . LEU B 1 329 ? 39.955  -9.864  3.467   1.00 29.92  ? 329 LEU B CA    1 
ATOM   6379 C  C     . LEU B 1 329 ? 39.138  -11.073 3.920   1.00 29.80  ? 329 LEU B C     1 
ATOM   6380 O  O     . LEU B 1 329 ? 39.601  -12.208 3.846   1.00 30.02  ? 329 LEU B O     1 
ATOM   6381 C  CB    . LEU B 1 329 ? 40.383  -9.991  2.000   1.00 29.79  ? 329 LEU B CB    1 
ATOM   6382 C  CG    . LEU B 1 329 ? 41.496  -9.066  1.507   1.00 29.82  ? 329 LEU B CG    1 
ATOM   6383 C  CD1   . LEU B 1 329 ? 41.799  -9.346  0.057   1.00 29.25  ? 329 LEU B CD1   1 
ATOM   6384 C  CD2   . LEU B 1 329 ? 41.140  -7.581  1.699   1.00 29.14  ? 329 LEU B CD2   1 
ATOM   6385 N  N     . LEU B 1 330 ? 37.949  -10.806 4.448   1.00 29.16  ? 330 LEU B N     1 
ATOM   6386 C  CA    . LEU B 1 330 ? 37.145  -11.824 5.127   1.00 29.33  ? 330 LEU B CA    1 
ATOM   6387 C  C     . LEU B 1 330 ? 36.005  -12.308 4.239   1.00 28.37  ? 330 LEU B C     1 
ATOM   6388 O  O     . LEU B 1 330 ? 35.341  -11.508 3.582   1.00 27.99  ? 330 LEU B O     1 
ATOM   6389 C  CB    . LEU B 1 330 ? 36.601  -11.240 6.439   1.00 30.47  ? 330 LEU B CB    1 
ATOM   6390 C  CG    . LEU B 1 330 ? 37.687  -10.728 7.405   1.00 32.46  ? 330 LEU B CG    1 
ATOM   6391 C  CD1   . LEU B 1 330 ? 37.168  -9.617  8.319   1.00 35.57  ? 330 LEU B CD1   1 
ATOM   6392 C  CD2   . LEU B 1 330 ? 38.251  -11.886 8.221   1.00 34.13  ? 330 LEU B CD2   1 
ATOM   6393 N  N     . PHE B 1 331 ? 35.781  -13.620 4.218   1.00 28.85  ? 331 PHE B N     1 
ATOM   6394 C  CA    . PHE B 1 331 ? 34.731  -14.191 3.389   1.00 28.34  ? 331 PHE B CA    1 
ATOM   6395 C  C     . PHE B 1 331 ? 33.938  -15.276 4.109   1.00 28.62  ? 331 PHE B C     1 
ATOM   6396 O  O     . PHE B 1 331 ? 34.509  -16.070 4.872   1.00 28.81  ? 331 PHE B O     1 
ATOM   6397 C  CB    . PHE B 1 331 ? 35.332  -14.735 2.086   1.00 27.80  ? 331 PHE B CB    1 
ATOM   6398 C  CG    . PHE B 1 331 ? 36.104  -13.704 1.308   1.00 28.40  ? 331 PHE B CG    1 
ATOM   6399 C  CD1   . PHE B 1 331 ? 35.443  -12.798 0.475   1.00 28.46  ? 331 PHE B CD1   1 
ATOM   6400 C  CD2   . PHE B 1 331 ? 37.495  -13.617 1.435   1.00 25.54  ? 331 PHE B CD2   1 
ATOM   6401 C  CE1   . PHE B 1 331 ? 36.179  -11.814 -0.232  1.00 27.83  ? 331 PHE B CE1   1 
ATOM   6402 C  CE2   . PHE B 1 331 ? 38.215  -12.670 0.744   1.00 27.91  ? 331 PHE B CE2   1 
ATOM   6403 C  CZ    . PHE B 1 331 ? 37.562  -11.744 -0.079  1.00 25.36  ? 331 PHE B CZ    1 
ATOM   6404 N  N     . GLU B 1 332 ? 32.628  -15.300 3.853   1.00 28.22  ? 332 GLU B N     1 
ATOM   6405 C  CA    . GLU B 1 332 ? 31.772  -16.433 4.239   1.00 28.35  ? 332 GLU B CA    1 
ATOM   6406 C  C     . GLU B 1 332 ? 31.047  -17.057 3.045   1.00 27.39  ? 332 GLU B C     1 
ATOM   6407 O  O     . GLU B 1 332 ? 30.356  -16.358 2.306   1.00 27.14  ? 332 GLU B O     1 
ATOM   6408 C  CB    . GLU B 1 332 ? 30.752  -15.988 5.289   1.00 29.23  ? 332 GLU B CB    1 
ATOM   6409 C  CG    . GLU B 1 332 ? 29.903  -17.121 5.763   1.00 29.65  ? 332 GLU B CG    1 
ATOM   6410 C  CD    . GLU B 1 332 ? 29.031  -16.756 6.917   1.00 30.96  ? 332 GLU B CD    1 
ATOM   6411 O  OE1   . GLU B 1 332 ? 28.537  -15.612 6.967   1.00 32.73  ? 332 GLU B OE1   1 
ATOM   6412 O  OE2   . GLU B 1 332 ? 28.827  -17.639 7.773   1.00 28.73  ? 332 GLU B OE2   1 
ATOM   6413 N  N     . CYS B 1 333 ? 31.165  -18.379 2.884   1.00 27.06  ? 333 CYS B N     1 
ATOM   6414 C  CA    . CYS B 1 333 ? 30.602  -19.076 1.708   1.00 26.49  ? 333 CYS B CA    1 
ATOM   6415 C  C     . CYS B 1 333 ? 29.699  -20.216 2.140   1.00 25.68  ? 333 CYS B C     1 
ATOM   6416 O  O     . CYS B 1 333 ? 29.947  -20.864 3.158   1.00 25.59  ? 333 CYS B O     1 
ATOM   6417 C  CB    . CYS B 1 333 ? 31.709  -19.627 0.795   1.00 26.34  ? 333 CYS B CB    1 
ATOM   6418 S  SG    . CYS B 1 333 ? 32.736  -18.334 0.055   1.00 29.01  ? 333 CYS B SG    1 
ATOM   6419 N  N     . GLN B 1 334 ? 28.639  -20.445 1.370   1.00 24.84  ? 334 GLN B N     1 
ATOM   6420 C  CA    . GLN B 1 334 ? 27.692  -21.502 1.691   1.00 25.23  ? 334 GLN B CA    1 
ATOM   6421 C  C     . GLN B 1 334 ? 28.281  -22.880 1.413   1.00 24.83  ? 334 GLN B C     1 
ATOM   6422 O  O     . GLN B 1 334 ? 27.787  -23.894 1.935   1.00 25.76  ? 334 GLN B O     1 
ATOM   6423 C  CB    . GLN B 1 334 ? 26.400  -21.314 0.893   1.00 25.76  ? 334 GLN B CB    1 
ATOM   6424 C  CG    . GLN B 1 334 ? 25.677  -20.012 1.179   1.00 28.22  ? 334 GLN B CG    1 
ATOM   6425 C  CD    . GLN B 1 334 ? 24.246  -20.035 0.683   1.00 31.06  ? 334 GLN B CD    1 
ATOM   6426 O  OE1   . GLN B 1 334 ? 23.795  -19.127 -0.005  1.00 36.56  ? 334 GLN B OE1   1 
ATOM   6427 N  NE2   . GLN B 1 334 ? 23.535  -21.077 1.019   1.00 32.91  ? 334 GLN B NE2   1 
ATOM   6428 N  N     . ILE B 1 335 ? 29.319  -22.919 0.581   1.00 24.18  ? 335 ILE B N     1 
ATOM   6429 C  CA    . ILE B 1 335 ? 29.923  -24.195 0.137   1.00 24.48  ? 335 ILE B CA    1 
ATOM   6430 C  C     . ILE B 1 335 ? 31.331  -24.349 0.710   1.00 25.74  ? 335 ILE B C     1 
ATOM   6431 O  O     . ILE B 1 335 ? 32.250  -23.585 0.380   1.00 27.01  ? 335 ILE B O     1 
ATOM   6432 C  CB    . ILE B 1 335 ? 29.976  -24.311 -1.415  1.00 23.59  ? 335 ILE B CB    1 
ATOM   6433 C  CG1   . ILE B 1 335 ? 28.583  -24.121 -2.075  1.00 24.02  ? 335 ILE B CG1   1 
ATOM   6434 C  CG2   . ILE B 1 335 ? 30.691  -25.609 -1.881  1.00 23.05  ? 335 ILE B CG2   1 
ATOM   6435 C  CD1   . ILE B 1 335 ? 27.485  -25.026 -1.640  1.00 24.57  ? 335 ILE B CD1   1 
ATOM   6436 N  N     . LYS B 1 336 ? 31.496  -25.344 1.564   1.00 27.43  ? 336 LYS B N     1 
ATOM   6437 C  CA    . LYS B 1 336 ? 32.772  -25.617 2.205   1.00 28.20  ? 336 LYS B CA    1 
ATOM   6438 C  C     . LYS B 1 336 ? 33.638  -26.459 1.275   1.00 28.54  ? 336 LYS B C     1 
ATOM   6439 O  O     . LYS B 1 336 ? 34.864  -26.337 1.261   1.00 28.33  ? 336 LYS B O     1 
ATOM   6440 C  CB    . LYS B 1 336 ? 32.535  -26.363 3.508   1.00 29.49  ? 336 LYS B CB    1 
ATOM   6441 C  CG    . LYS B 1 336 ? 31.941  -25.510 4.602   1.00 31.18  ? 336 LYS B CG    1 
ATOM   6442 C  CD    . LYS B 1 336 ? 31.397  -26.373 5.718   1.00 34.78  ? 336 LYS B CD    1 
ATOM   6443 C  CE    . LYS B 1 336 ? 32.439  -26.627 6.762   1.00 39.75  ? 336 LYS B CE    1 
ATOM   6444 N  NZ    . LYS B 1 336 ? 31.892  -27.516 7.843   1.00 46.02  ? 336 LYS B NZ    1 
ATOM   6445 N  N     . GLU B 1 337 ? 32.968  -27.291 0.484   1.00 27.94  ? 337 GLU B N     1 
ATOM   6446 C  CA    . GLU B 1 337 ? 33.620  -28.191 -0.435  1.00 28.82  ? 337 GLU B CA    1 
ATOM   6447 C  C     . GLU B 1 337 ? 32.713  -28.469 -1.622  1.00 27.79  ? 337 GLU B C     1 
ATOM   6448 O  O     . GLU B 1 337 ? 31.537  -28.787 -1.453  1.00 27.77  ? 337 GLU B O     1 
ATOM   6449 C  CB    . GLU B 1 337 ? 33.946  -29.499 0.262   1.00 30.26  ? 337 GLU B CB    1 
ATOM   6450 C  CG    . GLU B 1 337 ? 34.873  -30.386 -0.530  1.00 34.28  ? 337 GLU B CG    1 
ATOM   6451 C  CD    . GLU B 1 337 ? 35.052  -31.730 0.114   1.00 40.02  ? 337 GLU B CD    1 
ATOM   6452 O  OE1   . GLU B 1 337 ? 34.134  -32.589 0.029   1.00 44.56  ? 337 GLU B OE1   1 
ATOM   6453 O  OE2   . GLU B 1 337 ? 36.123  -31.942 0.702   1.00 43.86  ? 337 GLU B OE2   1 
ATOM   6454 N  N     . ILE B 1 338 ? 33.269  -28.347 -2.822  1.00 27.21  ? 338 ILE B N     1 
ATOM   6455 C  CA    . ILE B 1 338 ? 32.553  -28.713 -4.056  1.00 26.11  ? 338 ILE B CA    1 
ATOM   6456 C  C     . ILE B 1 338 ? 33.175  -29.974 -4.683  1.00 27.13  ? 338 ILE B C     1 
ATOM   6457 O  O     . ILE B 1 338 ? 34.326  -30.330 -4.381  1.00 26.93  ? 338 ILE B O     1 
ATOM   6458 C  CB    . ILE B 1 338 ? 32.501  -27.474 -5.027  1.00 25.66  ? 338 ILE B CB    1 
ATOM   6459 C  CG1   . ILE B 1 338 ? 31.430  -27.632 -6.121  1.00 24.95  ? 338 ILE B CG1   1 
ATOM   6460 C  CG2   . ILE B 1 338 ? 33.892  -27.108 -5.589  1.00 25.09  ? 338 ILE B CG2   1 
ATOM   6461 C  CD1   . ILE B 1 338 ? 31.088  -26.322 -6.816  1.00 25.40  ? 338 ILE B CD1   1 
ATOM   6462 N  N     . SER B 1 339 ? 32.413  -30.660 -5.537  1.00 27.25  ? 339 SER B N     1 
ATOM   6463 C  CA    . SER B 1 339 ? 32.910  -31.825 -6.237  1.00 27.79  ? 339 SER B CA    1 
ATOM   6464 C  C     . SER B 1 339 ? 34.082  -31.445 -7.142  1.00 28.28  ? 339 SER B C     1 
ATOM   6465 O  O     . SER B 1 339 ? 34.254  -30.267 -7.523  1.00 26.16  ? 339 SER B O     1 
ATOM   6466 C  CB    . SER B 1 339 ? 31.791  -32.480 -7.060  1.00 28.83  ? 339 SER B CB    1 
ATOM   6467 O  OG    . SER B 1 339 ? 31.350  -31.608 -8.087  1.00 27.27  ? 339 SER B OG    1 
ATOM   6468 N  N     . ARG B 1 340 ? 34.915  -32.439 -7.450  1.00 24.36  ? 340 ARG B N     1 
ATOM   6469 C  CA    . ARG B 1 340 ? 35.987  -32.247 -8.414  1.00 24.46  ? 340 ARG B CA    1 
ATOM   6470 C  C     . ARG B 1 340 ? 35.381  -32.214 -9.826  1.00 23.94  ? 340 ARG B C     1 
ATOM   6471 O  O     . ARG B 1 340 ? 35.745  -31.374 -10.627 1.00 23.41  ? 340 ARG B O     1 
ATOM   6472 C  CB    . ARG B 1 340 ? 37.086  -33.322 -8.271  1.00 25.58  ? 340 ARG B CB    1 
ATOM   6473 C  CG    . ARG B 1 340 ? 38.451  -32.895 -8.845  1.00 29.39  ? 340 ARG B CG    1 
ATOM   6474 C  CD    . ARG B 1 340 ? 39.611  -33.173 -7.873  1.00 34.53  ? 340 ARG B CD    1 
ATOM   6475 N  NE    . ARG B 1 340 ? 40.366  -31.936 -7.664  1.00 42.01  ? 340 ARG B NE    1 
ATOM   6476 C  CZ    . ARG B 1 340 ? 41.062  -31.619 -6.577  1.00 42.55  ? 340 ARG B CZ    1 
ATOM   6477 N  NH1   . ARG B 1 340 ? 41.136  -32.439 -5.533  1.00 42.86  ? 340 ARG B NH1   1 
ATOM   6478 N  NH2   . ARG B 1 340 ? 41.677  -30.447 -6.530  1.00 47.51  ? 340 ARG B NH2   1 
ATOM   6479 N  N     . VAL B 1 341 ? 34.426  -33.100 -10.120 1.00 23.73  ? 341 VAL B N     1 
ATOM   6480 C  CA    . VAL B 1 341 ? 33.821  -33.095 -11.465 1.00 23.91  ? 341 VAL B CA    1 
ATOM   6481 C  C     . VAL B 1 341 ? 32.818  -31.939 -11.618 1.00 23.96  ? 341 VAL B C     1 
ATOM   6482 O  O     . VAL B 1 341 ? 32.119  -31.560 -10.665 1.00 24.27  ? 341 VAL B O     1 
ATOM   6483 C  CB    . VAL B 1 341 ? 33.237  -34.477 -11.880 1.00 24.02  ? 341 VAL B CB    1 
ATOM   6484 C  CG1   . VAL B 1 341 ? 31.948  -34.772 -11.111 1.00 22.92  ? 341 VAL B CG1   1 
ATOM   6485 C  CG2   . VAL B 1 341 ? 32.996  -34.557 -13.395 1.00 23.75  ? 341 VAL B CG2   1 
ATOM   6486 N  N     . PHE B 1 342 ? 32.796  -31.359 -12.814 1.00 24.31  ? 342 PHE B N     1 
ATOM   6487 C  CA    . PHE B 1 342 ? 31.775  -30.385 -13.176 1.00 25.24  ? 342 PHE B CA    1 
ATOM   6488 C  C     . PHE B 1 342 ? 31.368  -30.533 -14.647 1.00 24.99  ? 342 PHE B C     1 
ATOM   6489 O  O     . PHE B 1 342 ? 31.966  -31.309 -15.389 1.00 24.75  ? 342 PHE B O     1 
ATOM   6490 C  CB    . PHE B 1 342 ? 32.230  -28.960 -12.834 1.00 25.96  ? 342 PHE B CB    1 
ATOM   6491 C  CG    . PHE B 1 342 ? 33.364  -28.430 -13.690 1.00 27.17  ? 342 PHE B CG    1 
ATOM   6492 C  CD1   . PHE B 1 342 ? 33.093  -27.629 -14.796 1.00 28.02  ? 342 PHE B CD1   1 
ATOM   6493 C  CD2   . PHE B 1 342 ? 34.697  -28.677 -13.354 1.00 28.67  ? 342 PHE B CD2   1 
ATOM   6494 C  CE1   . PHE B 1 342 ? 34.118  -27.110 -15.573 1.00 29.51  ? 342 PHE B CE1   1 
ATOM   6495 C  CE2   . PHE B 1 342 ? 35.733  -28.150 -14.113 1.00 28.33  ? 342 PHE B CE2   1 
ATOM   6496 C  CZ    . PHE B 1 342 ? 35.441  -27.369 -15.233 1.00 29.84  ? 342 PHE B CZ    1 
ATOM   6497 N  N     . ARG B 1 343 ? 30.353  -29.788 -15.058 1.00 25.35  ? 343 ARG B N     1 
ATOM   6498 C  CA    . ARG B 1 343 ? 29.877  -29.818 -16.438 1.00 26.70  ? 343 ARG B CA    1 
ATOM   6499 C  C     . ARG B 1 343 ? 30.299  -28.575 -17.188 1.00 28.20  ? 343 ARG B C     1 
ATOM   6500 O  O     . ARG B 1 343 ? 30.173  -27.468 -16.672 1.00 29.28  ? 343 ARG B O     1 
ATOM   6501 C  CB    . ARG B 1 343 ? 28.355  -29.829 -16.465 1.00 26.52  ? 343 ARG B CB    1 
ATOM   6502 C  CG    . ARG B 1 343 ? 27.703  -31.151 -16.187 1.00 27.30  ? 343 ARG B CG    1 
ATOM   6503 C  CD    . ARG B 1 343 ? 26.246  -30.883 -15.813 1.00 27.04  ? 343 ARG B CD    1 
ATOM   6504 N  NE    . ARG B 1 343 ? 25.528  -30.131 -16.855 1.00 30.09  ? 343 ARG B NE    1 
ATOM   6505 C  CZ    . ARG B 1 343 ? 24.467  -30.584 -17.534 1.00 29.98  ? 343 ARG B CZ    1 
ATOM   6506 N  NH1   . ARG B 1 343 ? 23.976  -31.793 -17.295 1.00 27.44  ? 343 ARG B NH1   1 
ATOM   6507 N  NH2   . ARG B 1 343 ? 23.887  -29.819 -18.464 1.00 30.78  ? 343 ARG B NH2   1 
ATOM   6508 N  N     . ARG B 1 344 ? 30.730  -28.762 -18.427 1.00 28.36  ? 344 ARG B N     1 
ATOM   6509 C  CA    . ARG B 1 344 ? 31.087  -27.649 -19.300 1.00 29.84  ? 344 ARG B CA    1 
ATOM   6510 C  C     . ARG B 1 344 ? 30.304  -27.813 -20.607 1.00 28.88  ? 344 ARG B C     1 
ATOM   6511 O  O     . ARG B 1 344 ? 30.280  -28.895 -21.184 1.00 27.23  ? 344 ARG B O     1 
ATOM   6512 C  CB    . ARG B 1 344 ? 32.597  -27.679 -19.537 1.00 30.31  ? 344 ARG B CB    1 
ATOM   6513 C  CG    . ARG B 1 344 ? 33.106  -26.830 -20.700 1.00 35.02  ? 344 ARG B CG    1 
ATOM   6514 C  CD    . ARG B 1 344 ? 34.614  -26.628 -20.578 1.00 37.94  ? 344 ARG B CD    1 
ATOM   6515 N  NE    . ARG B 1 344 ? 34.920  -25.561 -19.630 1.00 43.11  ? 344 ARG B NE    1 
ATOM   6516 C  CZ    . ARG B 1 344 ? 36.059  -25.455 -18.942 1.00 45.96  ? 344 ARG B CZ    1 
ATOM   6517 N  NH1   . ARG B 1 344 ? 37.020  -26.370 -19.071 1.00 47.90  ? 344 ARG B NH1   1 
ATOM   6518 N  NH2   . ARG B 1 344 ? 36.235  -24.431 -18.113 1.00 45.56  ? 344 ARG B NH2   1 
ATOM   6519 N  N     . MET B 1 345 ? 29.636  -26.742 -21.034 1.00 29.64  ? 345 MET B N     1 
ATOM   6520 C  CA    . MET B 1 345 ? 28.756  -26.754 -22.212 1.00 29.95  ? 345 MET B CA    1 
ATOM   6521 C  C     . MET B 1 345 ? 29.568  -26.768 -23.507 1.00 29.13  ? 345 MET B C     1 
ATOM   6522 O  O     . MET B 1 345 ? 30.473  -25.963 -23.682 1.00 30.06  ? 345 MET B O     1 
ATOM   6523 C  CB    . MET B 1 345 ? 27.843  -25.515 -22.208 1.00 30.33  ? 345 MET B CB    1 
ATOM   6524 C  CG    . MET B 1 345 ? 26.758  -25.496 -23.301 1.00 30.18  ? 345 MET B CG    1 
ATOM   6525 S  SD    . MET B 1 345 ? 26.141  -23.801 -23.550 1.00 35.83  ? 345 MET B SD    1 
ATOM   6526 C  CE    . MET B 1 345 ? 24.950  -23.712 -22.228 1.00 38.63  ? 345 MET B CE    1 
ATOM   6527 N  N     . GLY B 1 346 ? 29.229  -27.689 -24.398 1.00 27.65  ? 346 GLY B N     1 
ATOM   6528 C  CA    . GLY B 1 346 ? 29.809  -27.733 -25.730 1.00 27.02  ? 346 GLY B CA    1 
ATOM   6529 C  C     . GLY B 1 346 ? 28.809  -27.321 -26.802 1.00 26.70  ? 346 GLY B C     1 
ATOM   6530 O  O     . GLY B 1 346 ? 27.760  -26.751 -26.494 1.00 26.30  ? 346 GLY B O     1 
ATOM   6531 N  N     . PRO B 1 347 ? 29.144  -27.587 -28.071 1.00 26.85  ? 347 PRO B N     1 
ATOM   6532 C  CA    . PRO B 1 347 ? 28.349  -27.080 -29.188 1.00 27.43  ? 347 PRO B CA    1 
ATOM   6533 C  C     . PRO B 1 347 ? 27.080  -27.888 -29.468 1.00 26.95  ? 347 PRO B C     1 
ATOM   6534 O  O     . PRO B 1 347 ? 26.973  -29.059 -29.052 1.00 26.91  ? 347 PRO B O     1 
ATOM   6535 C  CB    . PRO B 1 347 ? 29.320  -27.202 -30.368 1.00 27.82  ? 347 PRO B CB    1 
ATOM   6536 C  CG    . PRO B 1 347 ? 30.158  -28.401 -30.004 1.00 26.56  ? 347 PRO B CG    1 
ATOM   6537 C  CD    . PRO B 1 347 ? 30.333  -28.336 -28.531 1.00 26.61  ? 347 PRO B CD    1 
ATOM   6538 N  N     . GLN B 1 348 ? 26.138  -27.256 -30.168 1.00 27.69  ? 348 GLN B N     1 
ATOM   6539 C  CA    . GLN B 1 348 ? 24.987  -27.941 -30.753 1.00 28.07  ? 348 GLN B CA    1 
ATOM   6540 C  C     . GLN B 1 348 ? 25.440  -29.095 -31.642 1.00 27.06  ? 348 GLN B C     1 
ATOM   6541 O  O     . GLN B 1 348 ? 26.457  -28.990 -32.340 1.00 27.06  ? 348 GLN B O     1 
ATOM   6542 C  CB    . GLN B 1 348 ? 24.125  -26.954 -31.539 1.00 29.43  ? 348 GLN B CB    1 
ATOM   6543 C  CG    . GLN B 1 348 ? 23.558  -25.841 -30.655 1.00 33.59  ? 348 GLN B CG    1 
ATOM   6544 C  CD    . GLN B 1 348 ? 22.494  -25.024 -31.341 1.00 38.59  ? 348 GLN B CD    1 
ATOM   6545 O  OE1   . GLN B 1 348 ? 22.577  -24.757 -32.541 1.00 41.55  ? 348 GLN B OE1   1 
ATOM   6546 N  NE2   . GLN B 1 348 ? 21.470  -24.630 -30.585 1.00 39.85  ? 348 GLN B NE2   1 
ATOM   6547 N  N     . PHE B 1 349 ? 24.703  -30.201 -31.597 1.00 26.32  ? 349 PHE B N     1 
ATOM   6548 C  CA    . PHE B 1 349 ? 25.091  -31.417 -32.327 1.00 26.63  ? 349 PHE B CA    1 
ATOM   6549 C  C     . PHE B 1 349 ? 25.285  -31.252 -33.842 1.00 27.20  ? 349 PHE B C     1 
ATOM   6550 O  O     . PHE B 1 349 ? 26.051  -32.004 -34.445 1.00 27.08  ? 349 PHE B O     1 
ATOM   6551 C  CB    . PHE B 1 349 ? 24.132  -32.590 -32.025 1.00 25.44  ? 349 PHE B CB    1 
ATOM   6552 C  CG    . PHE B 1 349 ? 22.881  -32.617 -32.885 1.00 26.09  ? 349 PHE B CG    1 
ATOM   6553 C  CD1   . PHE B 1 349 ? 22.896  -33.257 -34.124 1.00 24.82  ? 349 PHE B CD1   1 
ATOM   6554 C  CD2   . PHE B 1 349 ? 21.689  -32.021 -32.442 1.00 26.91  ? 349 PHE B CD2   1 
ATOM   6555 C  CE1   . PHE B 1 349 ? 21.761  -33.297 -34.924 1.00 26.01  ? 349 PHE B CE1   1 
ATOM   6556 C  CE2   . PHE B 1 349 ? 20.523  -32.075 -33.227 1.00 26.45  ? 349 PHE B CE2   1 
ATOM   6557 C  CZ    . PHE B 1 349 ? 20.557  -32.703 -34.469 1.00 26.72  ? 349 PHE B CZ    1 
ATOM   6558 N  N     . GLU B 1 350 ? 24.606  -30.274 -34.443 1.00 28.32  ? 350 GLU B N     1 
ATOM   6559 C  CA    . GLU B 1 350 ? 24.684  -30.050 -35.903 1.00 29.27  ? 350 GLU B CA    1 
ATOM   6560 C  C     . GLU B 1 350 ? 26.064  -29.544 -36.366 1.00 31.12  ? 350 GLU B C     1 
ATOM   6561 O  O     . GLU B 1 350 ? 26.474  -29.800 -37.506 1.00 31.69  ? 350 GLU B O     1 
ATOM   6562 C  CB    . GLU B 1 350 ? 23.588  -29.078 -36.376 1.00 28.74  ? 350 GLU B CB    1 
ATOM   6563 C  CG    . GLU B 1 350 ? 22.163  -29.601 -36.279 1.00 26.63  ? 350 GLU B CG    1 
ATOM   6564 C  CD    . GLU B 1 350 ? 21.422  -29.157 -35.027 1.00 25.39  ? 350 GLU B CD    1 
ATOM   6565 O  OE1   . GLU B 1 350 ? 20.177  -29.069 -35.089 1.00 25.18  ? 350 GLU B OE1   1 
ATOM   6566 O  OE2   . GLU B 1 350 ? 22.068  -28.895 -33.979 1.00 26.77  ? 350 GLU B OE2   1 
ATOM   6567 N  N     A ASP B 1 351 ? 26.770  -28.834 -35.485 0.50 31.80  ? 351 ASP B N     1 
ATOM   6568 N  N     B ASP B 1 351 ? 26.765  -28.853 -35.467 0.50 31.55  ? 351 ASP B N     1 
ATOM   6569 C  CA    A ASP B 1 351 ? 28.019  -28.161 -35.849 0.50 33.47  ? 351 ASP B CA    1 
ATOM   6570 C  CA    B ASP B 1 351 ? 28.031  -28.195 -35.775 0.50 32.98  ? 351 ASP B CA    1 
ATOM   6571 C  C     A ASP B 1 351 ? 29.210  -29.121 -35.880 0.50 33.70  ? 351 ASP B C     1 
ATOM   6572 C  C     B ASP B 1 351 ? 29.179  -29.200 -35.828 0.50 33.38  ? 351 ASP B C     1 
ATOM   6573 O  O     A ASP B 1 351 ? 30.036  -29.119 -34.968 0.50 33.84  ? 351 ASP B O     1 
ATOM   6574 O  O     B ASP B 1 351 ? 29.953  -29.309 -34.876 0.50 33.37  ? 351 ASP B O     1 
ATOM   6575 C  CB    A ASP B 1 351 ? 28.302  -27.000 -34.886 0.50 34.22  ? 351 ASP B CB    1 
ATOM   6576 C  CB    B ASP B 1 351 ? 28.312  -27.126 -34.713 0.50 33.34  ? 351 ASP B CB    1 
ATOM   6577 C  CG    A ASP B 1 351 ? 27.161  -25.988 -34.815 0.50 35.43  ? 351 ASP B CG    1 
ATOM   6578 C  CG    B ASP B 1 351 ? 29.327  -26.083 -35.166 0.50 34.83  ? 351 ASP B CG    1 
ATOM   6579 O  OD1   A ASP B 1 351 ? 26.220  -26.050 -35.642 0.50 37.62  ? 351 ASP B OD1   1 
ATOM   6580 O  OD1   B ASP B 1 351 ? 30.110  -26.339 -36.105 0.50 36.22  ? 351 ASP B OD1   1 
ATOM   6581 O  OD2   A ASP B 1 351 ? 27.214  -25.119 -33.917 0.50 37.33  ? 351 ASP B OD2   1 
ATOM   6582 O  OD2   B ASP B 1 351 ? 29.345  -24.991 -34.556 0.50 35.23  ? 351 ASP B OD2   1 
ATOM   6583 N  N     . GLU B 1 352 ? 29.279  -29.926 -36.941 1.00 33.91  ? 352 GLU B N     1 
ATOM   6584 C  CA    . GLU B 1 352 ? 30.251  -31.027 -37.092 1.00 34.92  ? 352 GLU B CA    1 
ATOM   6585 C  C     . GLU B 1 352 ? 31.688  -30.676 -36.655 1.00 35.03  ? 352 GLU B C     1 
ATOM   6586 O  O     . GLU B 1 352 ? 32.278  -31.378 -35.829 1.00 34.13  ? 352 GLU B O     1 
ATOM   6587 C  CB    . GLU B 1 352 ? 30.212  -31.564 -38.537 1.00 35.26  ? 352 GLU B CB    1 
ATOM   6588 C  CG    . GLU B 1 352 ? 31.056  -32.817 -38.793 1.00 38.27  ? 352 GLU B CG    1 
ATOM   6589 C  CD    . GLU B 1 352 ? 30.711  -33.539 -40.114 1.00 40.15  ? 352 GLU B CD    1 
ATOM   6590 O  OE1   . GLU B 1 352 ? 29.724  -33.168 -40.802 1.00 45.99  ? 352 GLU B OE1   1 
ATOM   6591 O  OE2   . GLU B 1 352 ? 31.422  -34.516 -40.451 1.00 45.65  ? 352 GLU B OE2   1 
ATOM   6592 N  N     . ARG B 1 353 ? 32.211  -29.570 -37.184 1.00 35.59  ? 353 ARG B N     1 
ATOM   6593 C  CA    . ARG B 1 353 ? 33.588  -29.158 -36.946 1.00 36.69  ? 353 ARG B CA    1 
ATOM   6594 C  C     . ARG B 1 353 ? 33.845  -28.809 -35.472 1.00 35.25  ? 353 ARG B C     1 
ATOM   6595 O  O     . ARG B 1 353 ? 34.875  -29.184 -34.914 1.00 35.01  ? 353 ARG B O     1 
ATOM   6596 C  CB    . ARG B 1 353 ? 33.953  -27.998 -37.887 1.00 38.77  ? 353 ARG B CB    1 
ATOM   6597 C  CG    . ARG B 1 353 ? 35.405  -27.586 -37.863 1.00 43.83  ? 353 ARG B CG    1 
ATOM   6598 C  CD    . ARG B 1 353 ? 35.830  -26.955 -39.178 1.00 51.11  ? 353 ARG B CD    1 
ATOM   6599 N  NE    . ARG B 1 353 ? 36.304  -27.944 -40.150 1.00 57.22  ? 353 ARG B NE    1 
ATOM   6600 C  CZ    . ARG B 1 353 ? 35.678  -28.253 -41.288 1.00 59.68  ? 353 ARG B CZ    1 
ATOM   6601 N  NH1   . ARG B 1 353 ? 34.534  -27.652 -41.616 1.00 60.24  ? 353 ARG B NH1   1 
ATOM   6602 N  NH2   . ARG B 1 353 ? 36.199  -29.163 -42.107 1.00 60.88  ? 353 ARG B NH2   1 
ATOM   6603 N  N     . ASN B 1 354 ? 32.901  -28.119 -34.834 1.00 33.97  ? 354 ASN B N     1 
ATOM   6604 C  CA    . ASN B 1 354 ? 33.071  -27.746 -33.429 1.00 33.26  ? 354 ASN B CA    1 
ATOM   6605 C  C     . ASN B 1 354 ? 32.894  -28.887 -32.466 1.00 31.13  ? 354 ASN B C     1 
ATOM   6606 O  O     . ASN B 1 354 ? 33.591  -28.957 -31.460 1.00 30.57  ? 354 ASN B O     1 
ATOM   6607 C  CB    . ASN B 1 354 ? 32.189  -26.561 -33.055 1.00 33.85  ? 354 ASN B CB    1 
ATOM   6608 C  CG    . ASN B 1 354 ? 32.719  -25.283 -33.616 1.00 38.79  ? 354 ASN B CG    1 
ATOM   6609 O  OD1   . ASN B 1 354 ? 33.916  -25.006 -33.510 1.00 44.47  ? 354 ASN B OD1   1 
ATOM   6610 N  ND2   . ASN B 1 354 ? 31.858  -24.500 -34.245 1.00 42.04  ? 354 ASN B ND2   1 
ATOM   6611 N  N     . VAL B 1 355 ? 31.967  -29.787 -32.790 1.00 29.23  ? 355 VAL B N     1 
ATOM   6612 C  CA    . VAL B 1 355 ? 31.806  -31.031 -32.053 1.00 27.10  ? 355 VAL B CA    1 
ATOM   6613 C  C     . VAL B 1 355 ? 33.106  -31.837 -32.102 1.00 27.17  ? 355 VAL B C     1 
ATOM   6614 O  O     . VAL B 1 355 ? 33.595  -32.257 -31.070 1.00 25.89  ? 355 VAL B O     1 
ATOM   6615 C  CB    . VAL B 1 355 ? 30.618  -31.872 -32.583 1.00 26.38  ? 355 VAL B CB    1 
ATOM   6616 C  CG1   . VAL B 1 355 ? 30.575  -33.227 -31.930 1.00 25.33  ? 355 VAL B CG1   1 
ATOM   6617 C  CG2   . VAL B 1 355 ? 29.305  -31.158 -32.360 1.00 23.99  ? 355 VAL B CG2   1 
ATOM   6618 N  N     . LYS B 1 356 ? 33.650  -32.036 -33.305 1.00 27.99  ? 356 LYS B N     1 
ATOM   6619 C  CA    . LYS B 1 356 ? 34.923  -32.732 -33.482 1.00 29.39  ? 356 LYS B CA    1 
ATOM   6620 C  C     . LYS B 1 356 ? 36.030  -32.146 -32.605 1.00 29.66  ? 356 LYS B C     1 
ATOM   6621 O  O     . LYS B 1 356 ? 36.729  -32.887 -31.913 1.00 29.42  ? 356 LYS B O     1 
ATOM   6622 C  CB    . LYS B 1 356 ? 35.351  -32.753 -34.961 1.00 30.47  ? 356 LYS B CB    1 
ATOM   6623 C  CG    . LYS B 1 356 ? 36.689  -33.450 -35.207 1.00 34.27  ? 356 LYS B CG    1 
ATOM   6624 C  CD    . LYS B 1 356 ? 36.746  -34.115 -36.576 1.00 39.91  ? 356 LYS B CD    1 
ATOM   6625 C  CE    . LYS B 1 356 ? 38.102  -34.762 -36.829 1.00 44.75  ? 356 LYS B CE    1 
ATOM   6626 N  NZ    . LYS B 1 356 ? 38.678  -35.382 -35.584 1.00 47.90  ? 356 LYS B NZ    1 
ATOM   6627 N  N     . LYS B 1 357 ? 36.192  -30.826 -32.646 1.00 30.16  ? 357 LYS B N     1 
ATOM   6628 C  CA    . LYS B 1 357 ? 37.186  -30.155 -31.809 1.00 31.53  ? 357 LYS B CA    1 
ATOM   6629 C  C     . LYS B 1 357 ? 36.866  -30.287 -30.308 1.00 30.14  ? 357 LYS B C     1 
ATOM   6630 O  O     . LYS B 1 357 ? 37.775  -30.499 -29.496 1.00 30.50  ? 357 LYS B O     1 
ATOM   6631 C  CB    . LYS B 1 357 ? 37.328  -28.686 -32.203 1.00 32.56  ? 357 LYS B CB    1 
ATOM   6632 C  CG    . LYS B 1 357 ? 38.550  -28.000 -31.571 1.00 36.98  ? 357 LYS B CG    1 
ATOM   6633 C  CD    . LYS B 1 357 ? 38.930  -26.736 -32.291 1.00 41.03  ? 357 LYS B CD    1 
ATOM   6634 C  CE    . LYS B 1 357 ? 40.030  -26.017 -31.533 1.00 44.12  ? 357 LYS B CE    1 
ATOM   6635 N  NZ    . LYS B 1 357 ? 40.304  -24.693 -32.150 1.00 47.62  ? 357 LYS B NZ    1 
ATOM   6636 N  N     . PHE B 1 358 ? 35.583  -30.150 -29.948 1.00 28.51  ? 358 PHE B N     1 
ATOM   6637 C  CA    . PHE B 1 358 ? 35.136  -30.341 -28.562 1.00 27.51  ? 358 PHE B CA    1 
ATOM   6638 C  C     . PHE B 1 358 ? 35.470  -31.738 -28.070 1.00 27.37  ? 358 PHE B C     1 
ATOM   6639 O  O     . PHE B 1 358 ? 35.955  -31.901 -26.952 1.00 26.61  ? 358 PHE B O     1 
ATOM   6640 C  CB    . PHE B 1 358 ? 33.622  -30.128 -28.427 1.00 26.47  ? 358 PHE B CB    1 
ATOM   6641 C  CG    . PHE B 1 358 ? 33.134  -30.043 -26.990 1.00 26.26  ? 358 PHE B CG    1 
ATOM   6642 C  CD1   . PHE B 1 358 ? 33.554  -29.000 -26.157 1.00 27.13  ? 358 PHE B CD1   1 
ATOM   6643 C  CD2   . PHE B 1 358 ? 32.252  -31.002 -26.475 1.00 26.41  ? 358 PHE B CD2   1 
ATOM   6644 C  CE1   . PHE B 1 358 ? 33.093  -28.915 -24.818 1.00 26.20  ? 358 PHE B CE1   1 
ATOM   6645 C  CE2   . PHE B 1 358 ? 31.776  -30.928 -25.138 1.00 26.21  ? 358 PHE B CE2   1 
ATOM   6646 C  CZ    . PHE B 1 358 ? 32.201  -29.867 -24.314 1.00 25.30  ? 358 PHE B CZ    1 
ATOM   6647 N  N     . LEU B 1 359 ? 35.210  -32.737 -28.910 1.00 27.25  ? 359 LEU B N     1 
ATOM   6648 C  CA    . LEU B 1 359 ? 35.469  -34.135 -28.552 1.00 27.56  ? 359 LEU B CA    1 
ATOM   6649 C  C     . LEU B 1 359 ? 36.935  -34.568 -28.611 1.00 28.97  ? 359 LEU B C     1 
ATOM   6650 O  O     . LEU B 1 359 ? 37.277  -35.606 -28.049 1.00 29.59  ? 359 LEU B O     1 
ATOM   6651 C  CB    . LEU B 1 359 ? 34.581  -35.097 -29.368 1.00 26.93  ? 359 LEU B CB    1 
ATOM   6652 C  CG    . LEU B 1 359 ? 33.071  -34.916 -29.163 1.00 25.43  ? 359 LEU B CG    1 
ATOM   6653 C  CD1   . LEU B 1 359 ? 32.322  -35.975 -29.959 1.00 25.39  ? 359 LEU B CD1   1 
ATOM   6654 C  CD2   . LEU B 1 359 ? 32.633  -34.928 -27.674 1.00 23.05  ? 359 LEU B CD2   1 
ATOM   6655 N  N     . SER B 1 360 ? 37.788  -33.772 -29.258 1.00 30.11  ? 360 SER B N     1 
ATOM   6656 C  CA    . SER B 1 360 ? 39.213  -34.090 -29.408 1.00 31.50  ? 360 SER B CA    1 
ATOM   6657 C  C     . SER B 1 360 ? 39.992  -33.896 -28.107 1.00 32.18  ? 360 SER B C     1 
ATOM   6658 O  O     . SER B 1 360 ? 41.083  -34.442 -27.950 1.00 32.92  ? 360 SER B O     1 
ATOM   6659 C  CB    . SER B 1 360 ? 39.859  -33.272 -30.544 1.00 33.47  ? 360 SER B CB    1 
ATOM   6660 O  OG    . SER B 1 360 ? 40.033  -31.907 -30.178 1.00 32.71  ? 360 SER B OG    1 
ATOM   6661 N  N     . ARG B 1 361 ? 39.421  -33.127 -27.178 1.00 30.96  ? 361 ARG B N     1 
ATOM   6662 C  CA    . ARG B 1 361 ? 40.077  -32.829 -25.902 1.00 31.48  ? 361 ARG B CA    1 
ATOM   6663 C  C     . ARG B 1 361 ? 40.217  -34.087 -25.048 1.00 31.00  ? 361 ARG B C     1 
ATOM   6664 O  O     . ARG B 1 361 ? 39.343  -34.961 -25.057 1.00 29.72  ? 361 ARG B O     1 
ATOM   6665 C  CB    . ARG B 1 361 ? 39.304  -31.757 -25.136 1.00 31.51  ? 361 ARG B CB    1 
ATOM   6666 C  CG    . ARG B 1 361 ? 39.209  -30.425 -25.875 1.00 33.85  ? 361 ARG B CG    1 
ATOM   6667 C  CD    . ARG B 1 361 ? 40.600  -29.872 -26.225 1.00 39.91  ? 361 ARG B CD    1 
ATOM   6668 N  NE    . ARG B 1 361 ? 40.496  -28.555 -26.842 1.00 42.72  ? 361 ARG B NE    1 
ATOM   6669 C  CZ    . ARG B 1 361 ? 41.293  -28.087 -27.797 1.00 46.89  ? 361 ARG B CZ    1 
ATOM   6670 N  NH1   . ARG B 1 361 ? 42.289  -28.820 -28.289 1.00 49.82  ? 361 ARG B NH1   1 
ATOM   6671 N  NH2   . ARG B 1 361 ? 41.083  -26.870 -28.271 1.00 48.46  ? 361 ARG B NH2   1 
ATOM   6672 N  N     . ASN B 1 362 ? 41.340  -34.173 -24.353 1.00 30.78  ? 362 ASN B N     1 
ATOM   6673 C  CA    . ASN B 1 362 ? 41.611  -35.257 -23.435 1.00 30.95  ? 362 ASN B CA    1 
ATOM   6674 C  C     . ASN B 1 362 ? 40.981  -34.962 -22.080 1.00 29.15  ? 362 ASN B C     1 
ATOM   6675 O  O     . ASN B 1 362 ? 41.300  -33.947 -21.462 1.00 29.50  ? 362 ASN B O     1 
ATOM   6676 C  CB    . ASN B 1 362 ? 43.117  -35.467 -23.315 1.00 32.00  ? 362 ASN B CB    1 
ATOM   6677 C  CG    . ASN B 1 362 ? 43.762  -35.830 -24.646 1.00 34.08  ? 362 ASN B CG    1 
ATOM   6678 O  OD1   . ASN B 1 362 ? 43.318  -36.745 -25.342 1.00 31.90  ? 362 ASN B OD1   1 
ATOM   6679 N  ND2   . ASN B 1 362 ? 44.811  -35.100 -25.010 1.00 35.21  ? 362 ASN B ND2   1 
ATOM   6680 N  N     . ARG B 1 363 ? 40.056  -35.827 -21.652 1.00 27.88  ? 363 ARG B N     1 
ATOM   6681 C  CA    . ARG B 1 363 ? 39.330  -35.664 -20.377 1.00 26.68  ? 363 ARG B CA    1 
ATOM   6682 C  C     . ARG B 1 363 ? 39.246  -37.001 -19.639 1.00 26.73  ? 363 ARG B C     1 
ATOM   6683 O  O     . ARG B 1 363 ? 39.483  -38.064 -20.224 1.00 27.14  ? 363 ARG B O     1 
ATOM   6684 C  CB    . ARG B 1 363 ? 37.906  -35.090 -20.602 1.00 25.30  ? 363 ARG B CB    1 
ATOM   6685 C  CG    . ARG B 1 363 ? 37.857  -33.854 -21.528 1.00 26.42  ? 363 ARG B CG    1 
ATOM   6686 C  CD    . ARG B 1 363 ? 36.429  -33.317 -21.749 1.00 24.65  ? 363 ARG B CD    1 
ATOM   6687 N  NE    . ARG B 1 363 ? 36.190  -32.952 -23.158 1.00 34.61  ? 363 ARG B NE    1 
ATOM   6688 C  CZ    . ARG B 1 363 ? 36.085  -31.696 -23.570 1.00 35.08  ? 363 ARG B CZ    1 
ATOM   6689 N  NH1   . ARG B 1 363 ? 36.188  -30.716 -22.700 1.00 41.84  ? 363 ARG B NH1   1 
ATOM   6690 N  NH2   . ARG B 1 363 ? 35.859  -31.414 -24.817 1.00 37.19  ? 363 ARG B NH2   1 
ATOM   6691 N  N     . ALA B 1 364 ? 38.894  -36.949 -18.363 1.00 25.63  ? 364 ALA B N     1 
ATOM   6692 C  CA    . ALA B 1 364 ? 38.831  -38.154 -17.535 1.00 25.94  ? 364 ALA B CA    1 
ATOM   6693 C  C     . ALA B 1 364 ? 37.558  -38.986 -17.781 1.00 25.46  ? 364 ALA B C     1 
ATOM   6694 O  O     . ALA B 1 364 ? 37.531  -40.209 -17.565 1.00 24.77  ? 364 ALA B O     1 
ATOM   6695 C  CB    . ALA B 1 364 ? 38.974  -37.773 -16.058 1.00 25.53  ? 364 ALA B CB    1 
ATOM   6696 N  N     . PHE B 1 365 ? 36.511  -38.324 -18.263 1.00 24.94  ? 365 PHE B N     1 
ATOM   6697 C  CA    . PHE B 1 365 ? 35.222  -38.989 -18.462 1.00 24.96  ? 365 PHE B CA    1 
ATOM   6698 C  C     . PHE B 1 365 ? 34.661  -38.687 -19.849 1.00 25.41  ? 365 PHE B C     1 
ATOM   6699 O  O     . PHE B 1 365 ? 35.093  -37.727 -20.523 1.00 24.77  ? 365 PHE B O     1 
ATOM   6700 C  CB    . PHE B 1 365 ? 34.218  -38.648 -17.338 1.00 23.91  ? 365 PHE B CB    1 
ATOM   6701 C  CG    . PHE B 1 365 ? 34.715  -38.998 -15.938 1.00 23.67  ? 365 PHE B CG    1 
ATOM   6702 C  CD1   . PHE B 1 365 ? 35.322  -38.024 -15.141 1.00 21.95  ? 365 PHE B CD1   1 
ATOM   6703 C  CD2   . PHE B 1 365 ? 34.604  -40.297 -15.437 1.00 24.01  ? 365 PHE B CD2   1 
ATOM   6704 C  CE1   . PHE B 1 365 ? 35.808  -38.326 -13.877 1.00 22.58  ? 365 PHE B CE1   1 
ATOM   6705 C  CE2   . PHE B 1 365 ? 35.081  -40.628 -14.159 1.00 25.65  ? 365 PHE B CE2   1 
ATOM   6706 C  CZ    . PHE B 1 365 ? 35.690  -39.638 -13.368 1.00 25.24  ? 365 PHE B CZ    1 
ATOM   6707 N  N     . ARG B 1 366 ? 33.706  -39.512 -20.273 1.00 25.08  ? 366 ARG B N     1 
ATOM   6708 C  CA    . ARG B 1 366 ? 33.154  -39.384 -21.610 1.00 26.10  ? 366 ARG B CA    1 
ATOM   6709 C  C     . ARG B 1 366 ? 32.153  -38.237 -21.697 1.00 25.10  ? 366 ARG B C     1 
ATOM   6710 O  O     . ARG B 1 366 ? 31.272  -38.129 -20.846 1.00 25.07  ? 366 ARG B O     1 
ATOM   6711 C  CB    . ARG B 1 366 ? 32.497  -40.692 -22.050 1.00 26.69  ? 366 ARG B CB    1 
ATOM   6712 C  CG    . ARG B 1 366 ? 33.374  -41.915 -21.892 1.00 29.89  ? 366 ARG B CG    1 
ATOM   6713 C  CD    . ARG B 1 366 ? 32.626  -43.139 -22.348 1.00 36.06  ? 366 ARG B CD    1 
ATOM   6714 N  NE    . ARG B 1 366 ? 32.306  -43.005 -23.766 1.00 43.01  ? 366 ARG B NE    1 
ATOM   6715 C  CZ    . ARG B 1 366 ? 31.565  -43.858 -24.473 1.00 49.15  ? 366 ARG B CZ    1 
ATOM   6716 N  NH1   . ARG B 1 366 ? 31.048  -44.947 -23.900 1.00 52.19  ? 366 ARG B NH1   1 
ATOM   6717 N  NH2   . ARG B 1 366 ? 31.349  -43.622 -25.764 1.00 49.92  ? 366 ARG B NH2   1 
ATOM   6718 N  N     . PRO B 1 367 ? 32.307  -37.349 -22.702 1.00 25.24  ? 367 PRO B N     1 
ATOM   6719 C  CA    . PRO B 1 367 ? 31.274  -36.334 -22.963 1.00 24.55  ? 367 PRO B CA    1 
ATOM   6720 C  C     . PRO B 1 367 ? 29.924  -36.969 -23.358 1.00 24.46  ? 367 PRO B C     1 
ATOM   6721 O  O     . PRO B 1 367 ? 29.866  -38.139 -23.727 1.00 24.47  ? 367 PRO B O     1 
ATOM   6722 C  CB    . PRO B 1 367 ? 31.870  -35.525 -24.133 1.00 24.88  ? 367 PRO B CB    1 
ATOM   6723 C  CG    . PRO B 1 367 ? 33.363  -35.740 -24.015 1.00 24.78  ? 367 PRO B CG    1 
ATOM   6724 C  CD    . PRO B 1 367 ? 33.450  -37.201 -23.626 1.00 26.20  ? 367 PRO B CD    1 
ATOM   6725 N  N     . PHE B 1 368 ? 28.854  -36.187 -23.264 1.00 24.43  ? 368 PHE B N     1 
ATOM   6726 C  CA    . PHE B 1 368 ? 27.491  -36.688 -23.466 1.00 23.99  ? 368 PHE B CA    1 
ATOM   6727 C  C     . PHE B 1 368 ? 26.634  -35.643 -24.170 1.00 24.02  ? 368 PHE B C     1 
ATOM   6728 O  O     . PHE B 1 368 ? 26.971  -34.445 -24.199 1.00 25.44  ? 368 PHE B O     1 
ATOM   6729 C  CB    . PHE B 1 368 ? 26.870  -37.091 -22.109 1.00 24.16  ? 368 PHE B CB    1 
ATOM   6730 C  CG    . PHE B 1 368 ? 26.780  -35.952 -21.106 1.00 22.04  ? 368 PHE B CG    1 
ATOM   6731 C  CD1   . PHE B 1 368 ? 27.860  -35.649 -20.258 1.00 23.04  ? 368 PHE B CD1   1 
ATOM   6732 C  CD2   . PHE B 1 368 ? 25.604  -35.208 -20.984 1.00 22.36  ? 368 PHE B CD2   1 
ATOM   6733 C  CE1   . PHE B 1 368 ? 27.788  -34.602 -19.305 1.00 21.34  ? 368 PHE B CE1   1 
ATOM   6734 C  CE2   . PHE B 1 368 ? 25.514  -34.148 -20.023 1.00 24.88  ? 368 PHE B CE2   1 
ATOM   6735 C  CZ    . PHE B 1 368 ? 26.619  -33.855 -19.183 1.00 21.76  ? 368 PHE B CZ    1 
ATOM   6736 N  N     . ILE B 1 369 ? 25.544  -36.104 -24.756 1.00 24.41  ? 369 ILE B N     1 
ATOM   6737 C  CA    . ILE B 1 369 ? 24.553  -35.242 -25.390 1.00 24.39  ? 369 ILE B CA    1 
ATOM   6738 C  C     . ILE B 1 369 ? 23.397  -35.022 -24.411 1.00 24.59  ? 369 ILE B C     1 
ATOM   6739 O  O     . ILE B 1 369 ? 22.916  -35.968 -23.788 1.00 25.36  ? 369 ILE B O     1 
ATOM   6740 C  CB    . ILE B 1 369 ? 24.047  -35.840 -26.739 1.00 24.32  ? 369 ILE B CB    1 
ATOM   6741 C  CG1   . ILE B 1 369 ? 25.193  -35.867 -27.756 1.00 24.03  ? 369 ILE B CG1   1 
ATOM   6742 C  CG2   . ILE B 1 369 ? 22.887  -34.993 -27.348 1.00 23.80  ? 369 ILE B CG2   1 
ATOM   6743 C  CD1   . ILE B 1 369 ? 24.914  -36.715 -29.029 1.00 25.13  ? 369 ILE B CD1   1 
ATOM   6744 N  N     . GLU B 1 370 ? 22.965  -33.767 -24.295 1.00 25.07  ? 370 GLU B N     1 
ATOM   6745 C  CA    . GLU B 1 370 ? 21.814  -33.390 -23.487 1.00 25.04  ? 370 GLU B CA    1 
ATOM   6746 C  C     . GLU B 1 370 ? 21.084  -32.230 -24.141 1.00 26.04  ? 370 GLU B C     1 
ATOM   6747 O  O     . GLU B 1 370 ? 21.681  -31.168 -24.396 1.00 25.30  ? 370 GLU B O     1 
ATOM   6748 C  CB    . GLU B 1 370 ? 22.261  -32.983 -22.081 1.00 25.17  ? 370 GLU B CB    1 
ATOM   6749 C  CG    . GLU B 1 370 ? 21.091  -32.642 -21.161 1.00 26.00  ? 370 GLU B CG    1 
ATOM   6750 C  CD    . GLU B 1 370 ? 21.561  -32.122 -19.817 1.00 25.90  ? 370 GLU B CD    1 
ATOM   6751 O  OE1   . GLU B 1 370 ? 22.106  -32.933 -19.020 1.00 21.84  ? 370 GLU B OE1   1 
ATOM   6752 O  OE2   . GLU B 1 370 ? 21.406  -30.896 -19.585 1.00 22.26  ? 370 GLU B OE2   1 
ATOM   6753 N  N     . ASN B 1 371 ? 19.795  -32.439 -24.414 1.00 26.65  ? 371 ASN B N     1 
ATOM   6754 C  CA    . ASN B 1 371 ? 18.948  -31.446 -25.104 1.00 28.43  ? 371 ASN B CA    1 
ATOM   6755 C  C     . ASN B 1 371 ? 19.589  -30.827 -26.354 1.00 27.78  ? 371 ASN B C     1 
ATOM   6756 O  O     . ASN B 1 371 ? 19.617  -29.595 -26.529 1.00 28.38  ? 371 ASN B O     1 
ATOM   6757 C  CB    . ASN B 1 371 ? 18.430  -30.384 -24.122 1.00 29.24  ? 371 ASN B CB    1 
ATOM   6758 C  CG    . ASN B 1 371 ? 17.653  -30.988 -22.967 1.00 33.20  ? 371 ASN B CG    1 
ATOM   6759 O  OD1   . ASN B 1 371 ? 16.691  -31.729 -23.170 1.00 36.13  ? 371 ASN B OD1   1 
ATOM   6760 N  ND2   . ASN B 1 371 ? 18.053  -30.658 -21.744 1.00 34.01  ? 371 ASN B ND2   1 
ATOM   6761 N  N     . GLY B 1 372 ? 20.091  -31.701 -27.227 1.00 27.09  ? 372 GLY B N     1 
ATOM   6762 C  CA    . GLY B 1 372 ? 20.600  -31.284 -28.534 1.00 26.81  ? 372 GLY B CA    1 
ATOM   6763 C  C     . GLY B 1 372 ? 22.013  -30.716 -28.527 1.00 26.23  ? 372 GLY B C     1 
ATOM   6764 O  O     . GLY B 1 372 ? 22.532  -30.342 -29.578 1.00 25.85  ? 372 GLY B O     1 
ATOM   6765 N  N     . ARG B 1 373 ? 22.624  -30.606 -27.350 1.00 26.14  ? 373 ARG B N     1 
ATOM   6766 C  CA    . ARG B 1 373 ? 24.008  -30.193 -27.321 1.00 26.62  ? 373 ARG B CA    1 
ATOM   6767 C  C     . ARG B 1 373 ? 24.949  -31.103 -26.575 1.00 24.77  ? 373 ARG B C     1 
ATOM   6768 O  O     . ARG B 1 373 ? 24.544  -31.877 -25.728 1.00 24.74  ? 373 ARG B O     1 
ATOM   6769 C  CB    . ARG B 1 373 ? 24.209  -28.700 -27.005 1.00 27.48  ? 373 ARG B CB    1 
ATOM   6770 C  CG    . ARG B 1 373 ? 23.981  -28.220 -25.635 1.00 32.01  ? 373 ARG B CG    1 
ATOM   6771 C  CD    . ARG B 1 373 ? 23.789  -26.689 -25.694 1.00 36.32  ? 373 ARG B CD    1 
ATOM   6772 N  NE    . ARG B 1 373 ? 24.929  -26.064 -26.329 1.00 40.36  ? 373 ARG B NE    1 
ATOM   6773 C  CZ    . ARG B 1 373 ? 24.917  -24.934 -27.031 1.00 39.30  ? 373 ARG B CZ    1 
ATOM   6774 N  NH1   . ARG B 1 373 ? 23.806  -24.246 -27.225 1.00 38.53  ? 373 ARG B NH1   1 
ATOM   6775 N  NH2   . ARG B 1 373 ? 26.047  -24.504 -27.554 1.00 36.94  ? 373 ARG B NH2   1 
ATOM   6776 N  N     . TRP B 1 374 ? 26.213  -31.049 -26.973 1.00 24.64  ? 374 TRP B N     1 
ATOM   6777 C  CA    . TRP B 1 374 ? 27.258  -31.775 -26.288 1.00 24.46  ? 374 TRP B CA    1 
ATOM   6778 C  C     . TRP B 1 374 ? 27.636  -31.072 -24.980 1.00 24.55  ? 374 TRP B C     1 
ATOM   6779 O  O     . TRP B 1 374 ? 27.598  -29.832 -24.881 1.00 24.70  ? 374 TRP B O     1 
ATOM   6780 C  CB    . TRP B 1 374 ? 28.476  -31.906 -27.192 1.00 24.16  ? 374 TRP B CB    1 
ATOM   6781 C  CG    . TRP B 1 374 ? 28.269  -32.920 -28.255 1.00 25.83  ? 374 TRP B CG    1 
ATOM   6782 C  CD1   . TRP B 1 374 ? 27.784  -32.706 -29.519 1.00 25.48  ? 374 TRP B CD1   1 
ATOM   6783 C  CD2   . TRP B 1 374 ? 28.502  -34.329 -28.144 1.00 23.68  ? 374 TRP B CD2   1 
ATOM   6784 N  NE1   . TRP B 1 374 ? 27.732  -33.907 -30.211 1.00 25.07  ? 374 TRP B NE1   1 
ATOM   6785 C  CE2   . TRP B 1 374 ? 28.172  -34.910 -29.391 1.00 24.46  ? 374 TRP B CE2   1 
ATOM   6786 C  CE3   . TRP B 1 374 ? 28.986  -35.155 -27.120 1.00 26.51  ? 374 TRP B CE3   1 
ATOM   6787 C  CZ2   . TRP B 1 374 ? 28.296  -36.290 -29.637 1.00 23.84  ? 374 TRP B CZ2   1 
ATOM   6788 C  CZ3   . TRP B 1 374 ? 29.115  -36.515 -27.367 1.00 26.31  ? 374 TRP B CZ3   1 
ATOM   6789 C  CH2   . TRP B 1 374 ? 28.766  -37.068 -28.614 1.00 25.31  ? 374 TRP B CH2   1 
ATOM   6790 N  N     . TRP B 1 375 ? 27.970  -31.884 -23.987 1.00 24.14  ? 375 TRP B N     1 
ATOM   6791 C  CA    . TRP B 1 375 ? 28.479  -31.427 -22.696 1.00 24.34  ? 375 TRP B CA    1 
ATOM   6792 C  C     . TRP B 1 375 ? 29.700  -32.257 -22.301 1.00 24.43  ? 375 TRP B C     1 
ATOM   6793 O  O     . TRP B 1 375 ? 29.745  -33.456 -22.572 1.00 24.82  ? 375 TRP B O     1 
ATOM   6794 C  CB    . TRP B 1 375 ? 27.410  -31.582 -21.616 1.00 23.60  ? 375 TRP B CB    1 
ATOM   6795 C  CG    . TRP B 1 375 ? 26.246  -30.656 -21.810 1.00 24.04  ? 375 TRP B CG    1 
ATOM   6796 C  CD1   . TRP B 1 375 ? 25.210  -30.826 -22.671 1.00 23.35  ? 375 TRP B CD1   1 
ATOM   6797 C  CD2   . TRP B 1 375 ? 26.024  -29.406 -21.143 1.00 23.88  ? 375 TRP B CD2   1 
ATOM   6798 N  NE1   . TRP B 1 375 ? 24.348  -29.752 -22.587 1.00 25.77  ? 375 TRP B NE1   1 
ATOM   6799 C  CE2   . TRP B 1 375 ? 24.819  -28.871 -21.652 1.00 24.80  ? 375 TRP B CE2   1 
ATOM   6800 C  CE3   . TRP B 1 375 ? 26.717  -28.693 -20.152 1.00 25.71  ? 375 TRP B CE3   1 
ATOM   6801 C  CZ2   . TRP B 1 375 ? 24.285  -27.646 -21.211 1.00 27.30  ? 375 TRP B CZ2   1 
ATOM   6802 C  CZ3   . TRP B 1 375 ? 26.183  -27.455 -19.717 1.00 26.57  ? 375 TRP B CZ3   1 
ATOM   6803 C  CH2   . TRP B 1 375 ? 24.983  -26.954 -20.258 1.00 26.34  ? 375 TRP B CH2   1 
ATOM   6804 N  N     . ALA B 1 376 ? 30.678  -31.637 -21.639 1.00 24.71  ? 376 ALA B N     1 
ATOM   6805 C  CA    . ALA B 1 376 ? 31.776  -32.424 -21.053 1.00 24.17  ? 376 ALA B CA    1 
ATOM   6806 C  C     . ALA B 1 376 ? 31.796  -32.392 -19.528 1.00 23.79  ? 376 ALA B C     1 
ATOM   6807 O  O     . ALA B 1 376 ? 31.524  -31.373 -18.905 1.00 24.10  ? 376 ALA B O     1 
ATOM   6808 C  CB    . ALA B 1 376 ? 33.153  -31.989 -21.619 1.00 24.24  ? 376 ALA B CB    1 
ATOM   6809 N  N     . PHE B 1 377 ? 32.107  -33.536 -18.939 1.00 23.85  ? 377 PHE B N     1 
ATOM   6810 C  CA    . PHE B 1 377 ? 32.588  -33.593 -17.575 1.00 23.78  ? 377 PHE B CA    1 
ATOM   6811 C  C     . PHE B 1 377 ? 34.058  -33.161 -17.601 1.00 24.49  ? 377 PHE B C     1 
ATOM   6812 O  O     . PHE B 1 377 ? 34.862  -33.668 -18.396 1.00 24.98  ? 377 PHE B O     1 
ATOM   6813 C  CB    . PHE B 1 377 ? 32.487  -35.021 -17.019 1.00 23.01  ? 377 PHE B CB    1 
ATOM   6814 C  CG    . PHE B 1 377 ? 31.071  -35.484 -16.747 1.00 22.81  ? 377 PHE B CG    1 
ATOM   6815 C  CD1   . PHE B 1 377 ? 30.572  -36.628 -17.370 1.00 22.46  ? 377 PHE B CD1   1 
ATOM   6816 C  CD2   . PHE B 1 377 ? 30.248  -34.786 -15.870 1.00 21.57  ? 377 PHE B CD2   1 
ATOM   6817 C  CE1   . PHE B 1 377 ? 29.262  -37.090 -17.115 1.00 23.18  ? 377 PHE B CE1   1 
ATOM   6818 C  CE2   . PHE B 1 377 ? 28.935  -35.221 -15.613 1.00 22.27  ? 377 PHE B CE2   1 
ATOM   6819 C  CZ    . PHE B 1 377 ? 28.434  -36.378 -16.231 1.00 22.26  ? 377 PHE B CZ    1 
ATOM   6820 N  N     . GLU B 1 378 ? 34.397  -32.251 -16.704 1.00 25.35  ? 378 GLU B N     1 
ATOM   6821 C  CA    . GLU B 1 378 ? 35.723  -31.654 -16.609 1.00 26.79  ? 378 GLU B CA    1 
ATOM   6822 C  C     . GLU B 1 378 ? 36.108  -31.784 -15.129 1.00 26.02  ? 378 GLU B C     1 
ATOM   6823 O  O     . GLU B 1 378 ? 35.244  -32.054 -14.295 1.00 25.37  ? 378 GLU B O     1 
ATOM   6824 C  CB    . GLU B 1 378 ? 35.607  -30.185 -16.997 1.00 27.88  ? 378 GLU B CB    1 
ATOM   6825 C  CG    . GLU B 1 378 ? 36.661  -29.607 -17.944 1.00 33.69  ? 378 GLU B CG    1 
ATOM   6826 C  CD    . GLU B 1 378 ? 36.716  -30.298 -19.283 1.00 37.19  ? 378 GLU B CD    1 
ATOM   6827 O  OE1   . GLU B 1 378 ? 37.249  -31.428 -19.306 1.00 40.42  ? 378 GLU B OE1   1 
ATOM   6828 O  OE2   . GLU B 1 378 ? 36.266  -29.718 -20.306 1.00 37.82  ? 378 GLU B OE2   1 
ATOM   6829 N  N     . MET B 1 379 ? 37.376  -31.588 -14.808 1.00 25.67  ? 379 MET B N     1 
ATOM   6830 C  CA    . MET B 1 379 ? 37.839  -31.768 -13.426 1.00 26.50  ? 379 MET B CA    1 
ATOM   6831 C  C     . MET B 1 379 ? 38.443  -30.489 -12.877 1.00 26.77  ? 379 MET B C     1 
ATOM   6832 O  O     . MET B 1 379 ? 39.335  -29.892 -13.495 1.00 27.07  ? 379 MET B O     1 
ATOM   6833 C  CB    . MET B 1 379 ? 38.833  -32.929 -13.327 1.00 26.54  ? 379 MET B CB    1 
ATOM   6834 C  CG    . MET B 1 379 ? 38.217  -34.291 -13.659 1.00 28.97  ? 379 MET B CG    1 
ATOM   6835 S  SD    . MET B 1 379 ? 37.061  -34.963 -12.424 1.00 28.88  ? 379 MET B SD    1 
ATOM   6836 C  CE    . MET B 1 379 ? 38.191  -35.973 -11.464 1.00 24.27  ? 379 MET B CE    1 
ATOM   6837 N  N     . ARG B 1 380 ? 37.952  -30.070 -11.713 1.00 26.57  ? 380 ARG B N     1 
ATOM   6838 C  CA    . ARG B 1 380 ? 38.432  -28.842 -11.068 1.00 27.05  ? 380 ARG B CA    1 
ATOM   6839 C  C     . ARG B 1 380 ? 39.865  -28.985 -10.575 1.00 28.82  ? 380 ARG B C     1 
ATOM   6840 O  O     . ARG B 1 380 ? 40.302  -30.084 -10.228 1.00 28.60  ? 380 ARG B O     1 
ATOM   6841 C  CB    . ARG B 1 380 ? 37.569  -28.470 -9.858  1.00 26.82  ? 380 ARG B CB    1 
ATOM   6842 C  CG    . ARG B 1 380 ? 36.245  -27.834 -10.183 1.00 24.50  ? 380 ARG B CG    1 
ATOM   6843 C  CD    . ARG B 1 380 ? 35.429  -27.480 -8.945  1.00 25.17  ? 380 ARG B CD    1 
ATOM   6844 N  NE    . ARG B 1 380 ? 34.181  -26.821 -9.361  1.00 26.21  ? 380 ARG B NE    1 
ATOM   6845 C  CZ    . ARG B 1 380 ? 33.033  -27.446 -9.609  1.00 25.74  ? 380 ARG B CZ    1 
ATOM   6846 N  NH1   . ARG B 1 380 ? 32.932  -28.759 -9.444  1.00 23.30  ? 380 ARG B NH1   1 
ATOM   6847 N  NH2   . ARG B 1 380 ? 31.981  -26.749 -10.024 1.00 24.04  ? 380 ARG B NH2   1 
ATOM   6848 N  N     . LYS B 1 381 ? 40.564  -27.857 -10.497 1.00 30.27  ? 381 LYS B N     1 
ATOM   6849 C  CA    . LYS B 1 381 ? 41.897  -27.805 -9.886  1.00 32.82  ? 381 LYS B CA    1 
ATOM   6850 C  C     . LYS B 1 381 ? 41.857  -27.571 -8.370  1.00 32.33  ? 381 LYS B C     1 
ATOM   6851 O  O     . LYS B 1 381 ? 42.857  -27.760 -7.688  1.00 33.02  ? 381 LYS B O     1 
ATOM   6852 C  CB    . LYS B 1 381 ? 42.733  -26.712 -10.553 1.00 34.54  ? 381 LYS B CB    1 
ATOM   6853 C  CG    . LYS B 1 381 ? 43.007  -26.976 -12.027 1.00 38.26  ? 381 LYS B CG    1 
ATOM   6854 C  CD    . LYS B 1 381 ? 44.091  -28.030 -12.215 1.00 44.36  ? 381 LYS B CD    1 
ATOM   6855 C  CE    . LYS B 1 381 ? 44.058  -28.637 -13.622 1.00 47.30  ? 381 LYS B CE    1 
ATOM   6856 N  NZ    . LYS B 1 381 ? 44.039  -27.621 -14.732 1.00 50.71  ? 381 LYS B NZ    1 
ATOM   6857 N  N     . PHE B 1 382 ? 40.710  -27.138 -7.860  1.00 30.79  ? 382 PHE B N     1 
ATOM   6858 C  CA    . PHE B 1 382 ? 40.537  -26.885 -6.424  1.00 31.17  ? 382 PHE B CA    1 
ATOM   6859 C  C     . PHE B 1 382 ? 39.117  -27.256 -6.048  1.00 29.95  ? 382 PHE B C     1 
ATOM   6860 O  O     . PHE B 1 382 ? 38.219  -27.185 -6.895  1.00 30.17  ? 382 PHE B O     1 
ATOM   6861 C  CB    . PHE B 1 382 ? 40.831  -25.420 -6.061  1.00 31.99  ? 382 PHE B CB    1 
ATOM   6862 C  CG    . PHE B 1 382 ? 40.296  -24.426 -7.056  1.00 34.10  ? 382 PHE B CG    1 
ATOM   6863 C  CD1   . PHE B 1 382 ? 38.912  -24.193 -7.170  1.00 35.44  ? 382 PHE B CD1   1 
ATOM   6864 C  CD2   . PHE B 1 382 ? 41.173  -23.709 -7.874  1.00 35.29  ? 382 PHE B CD2   1 
ATOM   6865 C  CE1   . PHE B 1 382 ? 38.402  -23.284 -8.106  1.00 35.49  ? 382 PHE B CE1   1 
ATOM   6866 C  CE2   . PHE B 1 382 ? 40.687  -22.799 -8.803  1.00 36.25  ? 382 PHE B CE2   1 
ATOM   6867 C  CZ    . PHE B 1 382 ? 39.291  -22.576 -8.920  1.00 36.52  ? 382 PHE B CZ    1 
ATOM   6868 N  N     . THR B 1 383 ? 38.907  -27.675 -4.804  1.00 29.59  ? 383 THR B N     1 
ATOM   6869 C  CA    . THR B 1 383 ? 37.575  -28.147 -4.400  1.00 29.35  ? 383 THR B CA    1 
ATOM   6870 C  C     . THR B 1 383 ? 37.017  -27.396 -3.192  1.00 29.57  ? 383 THR B C     1 
ATOM   6871 O  O     . THR B 1 383 ? 35.892  -27.646 -2.752  1.00 29.06  ? 383 THR B O     1 
ATOM   6872 C  CB    . THR B 1 383 ? 37.543  -29.681 -4.157  1.00 28.57  ? 383 THR B CB    1 
ATOM   6873 O  OG1   . THR B 1 383 ? 38.523  -30.044 -3.175  1.00 29.94  ? 383 THR B OG1   1 
ATOM   6874 C  CG2   . THR B 1 383 ? 37.818  -30.438 -5.453  1.00 28.15  ? 383 THR B CG2   1 
ATOM   6875 N  N     . THR B 1 384 ? 37.802  -26.456 -2.678  1.00 27.37  ? 384 THR B N     1 
ATOM   6876 C  CA    . THR B 1 384 ? 37.396  -25.682 -1.537  1.00 26.73  ? 384 THR B CA    1 
ATOM   6877 C  C     . THR B 1 384 ? 37.568  -24.199 -1.875  1.00 26.06  ? 384 THR B C     1 
ATOM   6878 O  O     . THR B 1 384 ? 38.433  -23.820 -2.678  1.00 26.17  ? 384 THR B O     1 
ATOM   6879 C  CB    . THR B 1 384 ? 38.199  -26.050 -0.236  1.00 27.27  ? 384 THR B CB    1 
ATOM   6880 O  OG1   . THR B 1 384 ? 39.559  -25.628 -0.381  1.00 28.57  ? 384 THR B OG1   1 
ATOM   6881 C  CG2   . THR B 1 384 ? 38.157  -27.560 0.087   1.00 27.43  ? 384 THR B CG2   1 
ATOM   6882 N  N     . PRO B 1 385 ? 36.738  -23.352 -1.270  1.00 25.56  ? 385 PRO B N     1 
ATOM   6883 C  CA    . PRO B 1 385 ? 36.880  -21.911 -1.479  1.00 25.15  ? 385 PRO B CA    1 
ATOM   6884 C  C     . PRO B 1 385 ? 38.235  -21.322 -1.024  1.00 25.98  ? 385 PRO B C     1 
ATOM   6885 O  O     . PRO B 1 385 ? 38.738  -20.356 -1.633  1.00 25.58  ? 385 PRO B O     1 
ATOM   6886 C  CB    . PRO B 1 385 ? 35.689  -21.337 -0.690  1.00 24.72  ? 385 PRO B CB    1 
ATOM   6887 C  CG    . PRO B 1 385 ? 35.368  -22.373 0.325   1.00 24.91  ? 385 PRO B CG    1 
ATOM   6888 C  CD    . PRO B 1 385 ? 35.603  -23.668 -0.381  1.00 25.26  ? 385 PRO B CD    1 
ATOM   6889 N  N     . GLU B 1 386 ? 38.822  -21.879 0.031   1.00 26.13  ? 386 GLU B N     1 
ATOM   6890 C  CA    . GLU B 1 386 ? 40.168  -21.478 0.447   1.00 27.39  ? 386 GLU B CA    1 
ATOM   6891 C  C     . GLU B 1 386 ? 41.241  -21.754 -0.625  1.00 28.31  ? 386 GLU B C     1 
ATOM   6892 O  O     . GLU B 1 386 ? 42.105  -20.904 -0.895  1.00 27.38  ? 386 GLU B O     1 
ATOM   6893 C  CB    . GLU B 1 386 ? 40.572  -22.168 1.756   1.00 28.34  ? 386 GLU B CB    1 
ATOM   6894 C  CG    . GLU B 1 386 ? 39.736  -21.771 2.966   1.00 30.60  ? 386 GLU B CG    1 
ATOM   6895 C  CD    . GLU B 1 386 ? 38.526  -22.675 3.197   1.00 35.02  ? 386 GLU B CD    1 
ATOM   6896 O  OE1   . GLU B 1 386 ? 38.063  -23.377 2.250   1.00 34.29  ? 386 GLU B OE1   1 
ATOM   6897 O  OE2   . GLU B 1 386 ? 38.054  -22.705 4.361   1.00 36.41  ? 386 GLU B OE2   1 
ATOM   6898 N  N     . GLU B 1 387 ? 41.234  -22.963 -1.189  1.00 28.92  ? 387 GLU B N     1 
ATOM   6899 C  CA    . GLU B 1 387 ? 42.208  -23.273 -2.220  1.00 30.35  ? 387 GLU B CA    1 
ATOM   6900 C  C     . GLU B 1 387 ? 41.906  -22.530 -3.520  1.00 29.65  ? 387 GLU B C     1 
ATOM   6901 O  O     . GLU B 1 387 ? 42.822  -22.164 -4.240  1.00 29.68  ? 387 GLU B O     1 
ATOM   6902 C  CB    . GLU B 1 387 ? 42.353  -24.784 -2.431  1.00 32.00  ? 387 GLU B CB    1 
ATOM   6903 C  CG    . GLU B 1 387 ? 42.917  -25.517 -1.216  1.00 35.14  ? 387 GLU B CG    1 
ATOM   6904 C  CD    . GLU B 1 387 ? 44.244  -24.931 -0.711  1.00 40.00  ? 387 GLU B CD    1 
ATOM   6905 O  OE1   . GLU B 1 387 ? 45.194  -24.802 -1.528  1.00 41.62  ? 387 GLU B OE1   1 
ATOM   6906 O  OE2   . GLU B 1 387 ? 44.331  -24.606 0.504   1.00 39.46  ? 387 GLU B OE2   1 
ATOM   6907 N  N     . GLY B 1 388 ? 40.620  -22.293 -3.803  1.00 29.36  ? 388 GLY B N     1 
ATOM   6908 C  CA    . GLY B 1 388 ? 40.215  -21.507 -4.969  1.00 29.26  ? 388 GLY B CA    1 
ATOM   6909 C  C     . GLY B 1 388 ? 40.758  -20.086 -4.899  1.00 29.60  ? 388 GLY B C     1 
ATOM   6910 O  O     . GLY B 1 388 ? 41.349  -19.578 -5.871  1.00 30.24  ? 388 GLY B O     1 
ATOM   6911 N  N     . VAL B 1 389 ? 40.561  -19.446 -3.745  1.00 28.87  ? 389 VAL B N     1 
ATOM   6912 C  CA    . VAL B 1 389 ? 41.081  -18.086 -3.491  1.00 28.46  ? 389 VAL B CA    1 
ATOM   6913 C  C     . VAL B 1 389 ? 42.628  -18.035 -3.468  1.00 30.19  ? 389 VAL B C     1 
ATOM   6914 O  O     . VAL B 1 389 ? 43.233  -17.111 -4.020  1.00 30.23  ? 389 VAL B O     1 
ATOM   6915 C  CB    . VAL B 1 389 ? 40.488  -17.489 -2.201  1.00 28.22  ? 389 VAL B CB    1 
ATOM   6916 C  CG1   . VAL B 1 389 ? 41.140  -16.145 -1.849  1.00 26.76  ? 389 VAL B CG1   1 
ATOM   6917 C  CG2   . VAL B 1 389 ? 38.996  -17.321 -2.345  1.00 25.52  ? 389 VAL B CG2   1 
ATOM   6918 N  N     . ARG B 1 390 ? 43.265  -19.041 -2.873  1.00 30.77  ? 390 ARG B N     1 
ATOM   6919 C  CA    . ARG B 1 390 ? 44.728  -19.151 -2.955  1.00 32.67  ? 390 ARG B CA    1 
ATOM   6920 C  C     . ARG B 1 390 ? 45.222  -19.049 -4.408  1.00 32.93  ? 390 ARG B C     1 
ATOM   6921 O  O     . ARG B 1 390 ? 46.174  -18.322 -4.695  1.00 33.58  ? 390 ARG B O     1 
ATOM   6922 C  CB    . ARG B 1 390 ? 45.205  -20.459 -2.319  1.00 32.68  ? 390 ARG B CB    1 
ATOM   6923 C  CG    . ARG B 1 390 ? 46.712  -20.705 -2.416  1.00 36.26  ? 390 ARG B CG    1 
ATOM   6924 C  CD    . ARG B 1 390 ? 47.147  -21.880 -1.547  1.00 38.19  ? 390 ARG B CD    1 
ATOM   6925 N  NE    . ARG B 1 390 ? 47.387  -21.391 -0.193  1.00 46.48  ? 390 ARG B NE    1 
ATOM   6926 C  CZ    . ARG B 1 390 ? 46.735  -21.764 0.907   1.00 47.55  ? 390 ARG B CZ    1 
ATOM   6927 N  NH1   . ARG B 1 390 ? 45.792  -22.687 0.873   1.00 48.88  ? 390 ARG B NH1   1 
ATOM   6928 N  NH2   . ARG B 1 390 ? 47.062  -21.211 2.067   1.00 50.11  ? 390 ARG B NH2   1 
ATOM   6929 N  N     . SER B 1 391 ? 44.562  -19.777 -5.306  1.00 32.69  ? 391 SER B N     1 
ATOM   6930 C  CA    . SER B 1 391 ? 44.905  -19.803 -6.725  1.00 33.81  ? 391 SER B CA    1 
ATOM   6931 C  C     . SER B 1 391 ? 44.598  -18.458 -7.370  1.00 33.37  ? 391 SER B C     1 
ATOM   6932 O  O     . SER B 1 391 ? 45.441  -17.883 -8.068  1.00 34.13  ? 391 SER B O     1 
ATOM   6933 C  CB    . SER B 1 391 ? 44.132  -20.925 -7.421  1.00 34.49  ? 391 SER B CB    1 
ATOM   6934 O  OG    . SER B 1 391 ? 44.320  -20.894 -8.821  1.00 37.14  ? 391 SER B OG    1 
ATOM   6935 N  N     . TYR B 1 392 ? 43.404  -17.938 -7.097  1.00 31.68  ? 392 TYR B N     1 
ATOM   6936 C  CA    . TYR B 1 392 ? 42.992  -16.669 -7.658  1.00 31.39  ? 392 TYR B CA    1 
ATOM   6937 C  C     . TYR B 1 392 ? 43.930  -15.500 -7.261  1.00 31.72  ? 392 TYR B C     1 
ATOM   6938 O  O     . TYR B 1 392 ? 44.372  -14.742 -8.126  1.00 32.36  ? 392 TYR B O     1 
ATOM   6939 C  CB    . TYR B 1 392 ? 41.515  -16.363 -7.337  1.00 29.64  ? 392 TYR B CB    1 
ATOM   6940 C  CG    . TYR B 1 392 ? 41.088  -15.009 -7.882  1.00 29.17  ? 392 TYR B CG    1 
ATOM   6941 C  CD1   . TYR B 1 392 ? 40.787  -14.842 -9.237  1.00 28.60  ? 392 TYR B CD1   1 
ATOM   6942 C  CD2   . TYR B 1 392 ? 41.028  -13.894 -7.049  1.00 28.21  ? 392 TYR B CD2   1 
ATOM   6943 C  CE1   . TYR B 1 392 ? 40.431  -13.589 -9.745  1.00 28.49  ? 392 TYR B CE1   1 
ATOM   6944 C  CE2   . TYR B 1 392 ? 40.673  -12.628 -7.544  1.00 28.42  ? 392 TYR B CE2   1 
ATOM   6945 C  CZ    . TYR B 1 392 ? 40.373  -12.490 -8.890  1.00 28.62  ? 392 TYR B CZ    1 
ATOM   6946 O  OH    . TYR B 1 392 ? 40.021  -11.251 -9.381  1.00 29.81  ? 392 TYR B OH    1 
ATOM   6947 N  N     . ALA B 1 393 ? 44.215  -15.356 -5.964  1.00 31.37  ? 393 ALA B N     1 
ATOM   6948 C  CA    . ALA B 1 393 ? 45.094  -14.293 -5.460  1.00 32.06  ? 393 ALA B CA    1 
ATOM   6949 C  C     . ALA B 1 393 ? 46.544  -14.390 -5.951  1.00 34.13  ? 393 ALA B C     1 
ATOM   6950 O  O     . ALA B 1 393 ? 47.227  -13.377 -6.063  1.00 34.30  ? 393 ALA B O     1 
ATOM   6951 C  CB    . ALA B 1 393 ? 45.064  -14.248 -3.935  1.00 31.58  ? 393 ALA B CB    1 
ATOM   6952 N  N     . SER B 1 394 ? 47.025  -15.607 -6.204  1.00 34.94  ? 394 SER B N     1 
ATOM   6953 C  CA    . SER B 1 394 ? 48.373  -15.803 -6.739  1.00 37.60  ? 394 SER B CA    1 
ATOM   6954 C  C     . SER B 1 394 ? 48.459  -15.356 -8.193  1.00 38.48  ? 394 SER B C     1 
ATOM   6955 O  O     . SER B 1 394 ? 49.485  -14.866 -8.654  1.00 39.72  ? 394 SER B O     1 
ATOM   6956 C  CB    . SER B 1 394 ? 48.766  -17.283 -6.678  1.00 38.28  ? 394 SER B CB    1 
ATOM   6957 O  OG    . SER B 1 394 ? 48.687  -17.778 -5.355  1.00 39.83  ? 394 SER B OG    1 
ATOM   6958 N  N     . THR B 1 395 ? 47.354  -15.540 -8.900  1.00 37.84  ? 395 THR B N     1 
ATOM   6959 C  CA    . THR B 1 395 ? 47.320  -15.432 -10.339 1.00 38.86  ? 395 THR B CA    1 
ATOM   6960 C  C     . THR B 1 395 ? 46.825  -14.024 -10.746 1.00 38.22  ? 395 THR B C     1 
ATOM   6961 O  O     . THR B 1 395 ? 47.279  -13.462 -11.743 1.00 39.28  ? 395 THR B O     1 
ATOM   6962 C  CB    . THR B 1 395 ? 46.476  -16.638 -10.882 1.00 39.40  ? 395 THR B CB    1 
ATOM   6963 O  OG1   . THR B 1 395 ? 46.984  -17.113 -12.128 1.00 43.30  ? 395 THR B OG1   1 
ATOM   6964 C  CG2   . THR B 1 395 ? 45.011  -16.338 -10.977 1.00 37.33  ? 395 THR B CG2   1 
ATOM   6965 N  N     . HIS B 1 396 ? 45.954  -13.435 -9.922  1.00 35.70  ? 396 HIS B N     1 
ATOM   6966 C  CA    . HIS B 1 396 ? 45.319  -12.158 -10.235 1.00 35.06  ? 396 HIS B CA    1 
ATOM   6967 C  C     . HIS B 1 396 ? 45.647  -11.055 -9.239  1.00 34.27  ? 396 HIS B C     1 
ATOM   6968 O  O     . HIS B 1 396 ? 44.896  -10.087 -9.122  1.00 33.05  ? 396 HIS B O     1 
ATOM   6969 C  CB    . HIS B 1 396 ? 43.797  -12.310 -10.306 1.00 34.19  ? 396 HIS B CB    1 
ATOM   6970 C  CG    . HIS B 1 396 ? 43.321  -13.132 -11.457 1.00 34.45  ? 396 HIS B CG    1 
ATOM   6971 N  ND1   . HIS B 1 396 ? 42.656  -12.588 -12.531 1.00 35.92  ? 396 HIS B ND1   1 
ATOM   6972 C  CD2   . HIS B 1 396 ? 43.392  -14.463 -11.694 1.00 34.05  ? 396 HIS B CD2   1 
ATOM   6973 C  CE1   . HIS B 1 396 ? 42.337  -13.549 -13.382 1.00 37.06  ? 396 HIS B CE1   1 
ATOM   6974 N  NE2   . HIS B 1 396 ? 42.772  -14.697 -12.896 1.00 35.53  ? 396 HIS B NE2   1 
ATOM   6975 N  N     . TRP B 1 397 ? 46.771  -11.200 -8.536  1.00 34.89  ? 397 TRP B N     1 
ATOM   6976 C  CA    . TRP B 1 397 ? 47.255  -10.171 -7.594  1.00 34.75  ? 397 TRP B CA    1 
ATOM   6977 C  C     . TRP B 1 397 ? 47.181  -8.753  -8.197  1.00 35.53  ? 397 TRP B C     1 
ATOM   6978 O  O     . TRP B 1 397 ? 46.836  -7.784  -7.511  1.00 34.65  ? 397 TRP B O     1 
ATOM   6979 C  CB    . TRP B 1 397 ? 48.691  -10.502 -7.135  1.00 35.56  ? 397 TRP B CB    1 
ATOM   6980 C  CG    . TRP B 1 397 ? 49.692  -10.507 -8.270  1.00 37.84  ? 397 TRP B CG    1 
ATOM   6981 C  CD1   . TRP B 1 397 ? 50.070  -11.583 -9.026  1.00 38.76  ? 397 TRP B CD1   1 
ATOM   6982 C  CD2   . TRP B 1 397 ? 50.397  -9.375  -8.804  1.00 38.35  ? 397 TRP B CD2   1 
ATOM   6983 N  NE1   . TRP B 1 397 ? 50.977  -11.193 -9.982  1.00 40.05  ? 397 TRP B NE1   1 
ATOM   6984 C  CE2   . TRP B 1 397 ? 51.190  -9.846  -9.876  1.00 40.46  ? 397 TRP B CE2   1 
ATOM   6985 C  CE3   . TRP B 1 397 ? 50.435  -8.010  -8.478  1.00 37.56  ? 397 TRP B CE3   1 
ATOM   6986 C  CZ2   . TRP B 1 397 ? 52.026  -9.002  -10.622 1.00 42.59  ? 397 TRP B CZ2   1 
ATOM   6987 C  CZ3   . TRP B 1 397 ? 51.263  -7.166  -9.226  1.00 39.86  ? 397 TRP B CZ3   1 
ATOM   6988 C  CH2   . TRP B 1 397 ? 52.044  -7.667  -10.284 1.00 41.75  ? 397 TRP B CH2   1 
ATOM   6989 N  N     . HIS B 1 398 ? 47.481  -8.656  -9.493  1.00 37.19  ? 398 HIS B N     1 
ATOM   6990 C  CA    . HIS B 1 398 ? 47.572  -7.377  -10.203 1.00 38.69  ? 398 HIS B CA    1 
ATOM   6991 C  C     . HIS B 1 398 ? 46.241  -6.631  -10.300 1.00 37.57  ? 398 HIS B C     1 
ATOM   6992 O  O     . HIS B 1 398 ? 46.223  -5.400  -10.427 1.00 37.79  ? 398 HIS B O     1 
ATOM   6993 C  CB    . HIS B 1 398 ? 48.144  -7.603  -11.605 1.00 41.09  ? 398 HIS B CB    1 
ATOM   6994 C  CG    . HIS B 1 398 ? 47.437  -8.678  -12.370 1.00 42.66  ? 398 HIS B CG    1 
ATOM   6995 N  ND1   . HIS B 1 398 ? 47.950  -9.952  -12.513 1.00 45.41  ? 398 HIS B ND1   1 
ATOM   6996 C  CD2   . HIS B 1 398 ? 46.247  -8.677  -13.016 1.00 43.56  ? 398 HIS B CD2   1 
ATOM   6997 C  CE1   . HIS B 1 398 ? 47.109  -10.682 -13.226 1.00 47.04  ? 398 HIS B CE1   1 
ATOM   6998 N  NE2   . HIS B 1 398 ? 46.067  -9.933  -13.539 1.00 46.08  ? 398 HIS B NE2   1 
ATOM   6999 N  N     . THR B 1 399 ? 45.131  -7.367  -10.238 1.00 35.64  ? 399 THR B N     1 
ATOM   7000 C  CA    . THR B 1 399 ? 43.811  -6.736  -10.329 1.00 34.89  ? 399 THR B CA    1 
ATOM   7001 C  C     . THR B 1 399 ? 43.217  -6.333  -8.957  1.00 33.37  ? 399 THR B C     1 
ATOM   7002 O  O     . THR B 1 399 ? 42.074  -5.871  -8.888  1.00 33.25  ? 399 THR B O     1 
ATOM   7003 C  CB    . THR B 1 399 ? 42.811  -7.596  -11.187 1.00 34.95  ? 399 THR B CB    1 
ATOM   7004 O  OG1   . THR B 1 399 ? 41.705  -6.783  -11.613 1.00 35.26  ? 399 THR B OG1   1 
ATOM   7005 C  CG2   . THR B 1 399 ? 42.290  -8.785  -10.410 1.00 30.72  ? 399 THR B CG2   1 
ATOM   7006 N  N     . LEU B 1 400 ? 44.002  -6.472  -7.884  1.00 32.60  ? 400 LEU B N     1 
ATOM   7007 C  CA    . LEU B 1 400 ? 43.484  -6.281  -6.513  1.00 31.84  ? 400 LEU B CA    1 
ATOM   7008 C  C     . LEU B 1 400 ? 43.845  -4.954  -5.854  1.00 32.50  ? 400 LEU B C     1 
ATOM   7009 O  O     . LEU B 1 400 ? 43.956  -4.890  -4.626  1.00 32.90  ? 400 LEU B O     1 
ATOM   7010 C  CB    . LEU B 1 400 ? 43.911  -7.430  -5.590  1.00 30.79  ? 400 LEU B CB    1 
ATOM   7011 C  CG    . LEU B 1 400 ? 43.573  -8.857  -6.036  1.00 29.05  ? 400 LEU B CG    1 
ATOM   7012 C  CD1   . LEU B 1 400 ? 44.072  -9.819  -5.006  1.00 29.17  ? 400 LEU B CD1   1 
ATOM   7013 C  CD2   . LEU B 1 400 ? 42.067  -9.050  -6.291  1.00 24.90  ? 400 LEU B CD2   1 
ATOM   7014 N  N     . GLY B 1 401 ? 43.990  -3.897  -6.652  1.00 33.28  ? 401 GLY B N     1 
ATOM   7015 C  CA    . GLY B 1 401 ? 44.465  -2.614  -6.150  1.00 33.65  ? 401 GLY B CA    1 
ATOM   7016 C  C     . GLY B 1 401 ? 45.965  -2.497  -6.357  1.00 34.90  ? 401 GLY B C     1 
ATOM   7017 O  O     . GLY B 1 401 ? 46.683  -3.490  -6.306  1.00 34.60  ? 401 GLY B O     1 
ATOM   7018 N  N     . LYS B 1 402 ? 46.440  -1.278  -6.605  1.00 36.06  ? 402 LYS B N     1 
ATOM   7019 C  CA    . LYS B 1 402 ? 47.856  -1.030  -6.871  1.00 37.28  ? 402 LYS B CA    1 
ATOM   7020 C  C     . LYS B 1 402 ? 48.767  -1.549  -5.754  1.00 36.60  ? 402 LYS B C     1 
ATOM   7021 O  O     . LYS B 1 402 ? 49.654  -2.368  -5.997  1.00 37.34  ? 402 LYS B O     1 
ATOM   7022 C  CB    . LYS B 1 402 ? 48.105  0.458   -7.117  1.00 38.70  ? 402 LYS B CB    1 
ATOM   7023 C  CG    . LYS B 1 402 ? 49.572  0.840   -7.229  1.00 42.12  ? 402 LYS B CG    1 
ATOM   7024 C  CD    . LYS B 1 402 ? 50.056  0.804   -8.671  1.00 47.40  ? 402 LYS B CD    1 
ATOM   7025 C  CE    . LYS B 1 402 ? 51.530  1.180   -8.765  1.00 50.80  ? 402 LYS B CE    1 
ATOM   7026 N  NZ    . LYS B 1 402 ? 51.776  2.542   -8.196  1.00 54.30  ? 402 LYS B NZ    1 
ATOM   7027 N  N     . ASN B 1 403 ? 48.549  -1.084  -4.530  1.00 35.42  ? 403 ASN B N     1 
ATOM   7028 C  CA    . ASN B 1 403 ? 49.453  -1.445  -3.449  1.00 35.49  ? 403 ASN B CA    1 
ATOM   7029 C  C     . ASN B 1 403 ? 49.032  -2.711  -2.748  1.00 34.12  ? 403 ASN B C     1 
ATOM   7030 O  O     . ASN B 1 403 ? 49.876  -3.526  -2.375  1.00 35.40  ? 403 ASN B O     1 
ATOM   7031 C  CB    . ASN B 1 403 ? 49.598  -0.299  -2.466  1.00 35.37  ? 403 ASN B CB    1 
ATOM   7032 C  CG    . ASN B 1 403 ? 49.906  0.993   -3.157  1.00 36.49  ? 403 ASN B CG    1 
ATOM   7033 O  OD1   . ASN B 1 403 ? 51.043  1.233   -3.575  1.00 37.66  ? 403 ASN B OD1   1 
ATOM   7034 N  ND2   . ASN B 1 403 ? 48.890  1.825   -3.321  1.00 32.27  ? 403 ASN B ND2   1 
ATOM   7035 N  N     . VAL B 1 404 ? 47.726  -2.875  -2.571  1.00 32.86  ? 404 VAL B N     1 
ATOM   7036 C  CA    . VAL B 1 404 ? 47.181  -4.099  -1.986  1.00 31.21  ? 404 VAL B CA    1 
ATOM   7037 C  C     . VAL B 1 404 ? 47.580  -5.310  -2.819  1.00 31.49  ? 404 VAL B C     1 
ATOM   7038 O  O     . VAL B 1 404 ? 47.981  -6.341  -2.262  1.00 31.16  ? 404 VAL B O     1 
ATOM   7039 C  CB    . VAL B 1 404 ? 45.640  -4.029  -1.808  1.00 29.81  ? 404 VAL B CB    1 
ATOM   7040 C  CG1   . VAL B 1 404 ? 45.043  -5.427  -1.580  1.00 29.21  ? 404 VAL B CG1   1 
ATOM   7041 C  CG2   . VAL B 1 404 ? 45.292  -3.085  -0.652  1.00 29.21  ? 404 VAL B CG2   1 
ATOM   7042 N  N     . GLY B 1 405 ? 47.459  -5.182  -4.142  1.00 31.86  ? 405 GLY B N     1 
ATOM   7043 C  CA    . GLY B 1 405 ? 47.853  -6.236  -5.068  1.00 33.04  ? 405 GLY B CA    1 
ATOM   7044 C  C     . GLY B 1 405 ? 49.338  -6.535  -4.995  1.00 35.34  ? 405 GLY B C     1 
ATOM   7045 O  O     . GLY B 1 405 ? 49.748  -7.703  -4.966  1.00 35.50  ? 405 GLY B O     1 
ATOM   7046 N  N     . GLU B 1 406 ? 50.154  -5.479  -4.955  1.00 37.13  ? 406 GLU B N     1 
ATOM   7047 C  CA    . GLU B 1 406 ? 51.604  -5.651  -4.836  1.00 39.65  ? 406 GLU B CA    1 
ATOM   7048 C  C     . GLU B 1 406 ? 51.987  -6.401  -3.557  1.00 38.46  ? 406 GLU B C     1 
ATOM   7049 O  O     . GLU B 1 406 ? 52.872  -7.252  -3.578  1.00 38.99  ? 406 GLU B O     1 
ATOM   7050 C  CB    . GLU B 1 406 ? 52.332  -4.303  -4.922  1.00 40.79  ? 406 GLU B CB    1 
ATOM   7051 C  CG    . GLU B 1 406 ? 52.592  -3.835  -6.360  1.00 44.53  ? 406 GLU B CG    1 
ATOM   7052 C  CD    . GLU B 1 406 ? 52.959  -2.346  -6.478  1.00 46.15  ? 406 GLU B CD    1 
ATOM   7053 O  OE1   . GLU B 1 406 ? 53.175  -1.662  -5.440  1.00 50.41  ? 406 GLU B OE1   1 
ATOM   7054 O  OE2   . GLU B 1 406 ? 53.027  -1.856  -7.630  1.00 51.88  ? 406 GLU B OE2   1 
ATOM   7055 N  N     . SER B 1 407 ? 51.315  -6.092  -2.449  1.00 37.00  ? 407 SER B N     1 
ATOM   7056 C  CA    . SER B 1 407 ? 51.595  -6.775  -1.186  1.00 36.76  ? 407 SER B CA    1 
ATOM   7057 C  C     . SER B 1 407 ? 51.220  -8.252  -1.232  1.00 36.31  ? 407 SER B C     1 
ATOM   7058 O  O     . SER B 1 407 ? 51.930  -9.091  -0.666  1.00 36.33  ? 407 SER B O     1 
ATOM   7059 C  CB    . SER B 1 407 ? 50.873  -6.114  -0.015  1.00 35.93  ? 407 SER B CB    1 
ATOM   7060 O  OG    . SER B 1 407 ? 51.164  -6.826  1.174   1.00 36.14  ? 407 SER B OG    1 
ATOM   7061 N  N     . ILE B 1 408 ? 50.082  -8.547  -1.868  1.00 35.29  ? 408 ILE B N     1 
ATOM   7062 C  CA    . ILE B 1 408 ? 49.593  -9.918  -2.016  1.00 35.10  ? 408 ILE B CA    1 
ATOM   7063 C  C     . ILE B 1 408 ? 50.558  -10.733 -2.884  1.00 36.55  ? 408 ILE B C     1 
ATOM   7064 O  O     . ILE B 1 408 ? 50.814  -11.902 -2.600  1.00 36.94  ? 408 ILE B O     1 
ATOM   7065 C  CB    . ILE B 1 408 ? 48.108  -9.950  -2.539  1.00 33.67  ? 408 ILE B CB    1 
ATOM   7066 C  CG1   . ILE B 1 408 ? 47.157  -9.529  -1.405  1.00 33.01  ? 408 ILE B CG1   1 
ATOM   7067 C  CG2   . ILE B 1 408 ? 47.724  -11.328 -3.063  1.00 33.42  ? 408 ILE B CG2   1 
ATOM   7068 C  CD1   . ILE B 1 408 ? 45.734  -9.131  -1.834  1.00 32.22  ? 408 ILE B CD1   1 
ATOM   7069 N  N     . ARG B 1 409 ? 51.095  -10.098 -3.926  1.00 38.33  ? 409 ARG B N     1 
ATOM   7070 C  CA    . ARG B 1 409 ? 52.096  -10.712 -4.800  1.00 40.94  ? 409 ARG B CA    1 
ATOM   7071 C  C     . ARG B 1 409 ? 53.280  -11.284 -4.015  1.00 42.72  ? 409 ARG B C     1 
ATOM   7072 O  O     . ARG B 1 409 ? 53.686  -12.425 -4.254  1.00 43.52  ? 409 ARG B O     1 
ATOM   7073 C  CB    . ARG B 1 409 ? 52.617  -9.705  -5.834  1.00 42.10  ? 409 ARG B CB    1 
ATOM   7074 C  CG    . ARG B 1 409 ? 53.301  -10.382 -7.009  1.00 44.44  ? 409 ARG B CG    1 
ATOM   7075 C  CD    . ARG B 1 409 ? 54.168  -9.436  -7.808  1.00 47.38  ? 409 ARG B CD    1 
ATOM   7076 N  NE    . ARG B 1 409 ? 54.765  -10.134 -8.952  1.00 50.71  ? 409 ARG B NE    1 
ATOM   7077 C  CZ    . ARG B 1 409 ? 55.466  -9.551  -9.924  1.00 52.88  ? 409 ARG B CZ    1 
ATOM   7078 N  NH1   . ARG B 1 409 ? 55.673  -8.243  -9.919  1.00 51.99  ? 409 ARG B NH1   1 
ATOM   7079 N  NH2   . ARG B 1 409 ? 55.957  -10.284 -10.913 1.00 54.54  ? 409 ARG B NH2   1 
ATOM   7080 N  N     . GLU B 1 410 ? 53.827  -10.500 -3.086  1.00 43.59  ? 410 GLU B N     1 
ATOM   7081 C  CA    . GLU B 1 410 ? 54.986  -10.958 -2.312  1.00 46.71  ? 410 GLU B CA    1 
ATOM   7082 C  C     . GLU B 1 410 ? 54.659  -12.023 -1.267  1.00 45.99  ? 410 GLU B C     1 
ATOM   7083 O  O     . GLU B 1 410 ? 55.444  -12.946 -1.072  1.00 47.48  ? 410 GLU B O     1 
ATOM   7084 C  CB    . GLU B 1 410 ? 55.780  -9.798  -1.702  1.00 47.38  ? 410 GLU B CB    1 
ATOM   7085 C  CG    . GLU B 1 410 ? 55.009  -8.827  -0.832  1.00 48.06  ? 410 GLU B CG    1 
ATOM   7086 C  CD    . GLU B 1 410 ? 55.726  -7.475  -0.697  1.00 50.01  ? 410 GLU B CD    1 
ATOM   7087 O  OE1   . GLU B 1 410 ? 56.792  -7.303  -1.336  1.00 55.46  ? 410 GLU B OE1   1 
ATOM   7088 O  OE2   . GLU B 1 410 ? 55.215  -6.576  0.029   1.00 53.51  ? 410 GLU B OE2   1 
ATOM   7089 N  N     . TYR B 1 411 ? 53.510  -11.895 -0.604  1.00 44.03  ? 411 TYR B N     1 
ATOM   7090 C  CA    . TYR B 1 411 ? 53.065  -12.892 0.378   1.00 43.74  ? 411 TYR B CA    1 
ATOM   7091 C  C     . TYR B 1 411 ? 51.620  -12.666 0.821   1.00 40.98  ? 411 TYR B C     1 
ATOM   7092 O  O     . TYR B 1 411 ? 51.152  -11.538 0.986   1.00 39.05  ? 411 TYR B O     1 
ATOM   7093 C  CB    . TYR B 1 411 ? 54.014  -12.952 1.605   1.00 46.67  ? 411 TYR B CB    1 
ATOM   7094 C  CG    . TYR B 1 411 ? 53.310  -13.119 2.945   1.00 47.43  ? 411 TYR B CG    1 
ATOM   7095 C  CD1   . TYR B 1 411 ? 52.724  -12.010 3.581   1.00 47.97  ? 411 TYR B CD1   1 
ATOM   7096 C  CD2   . TYR B 1 411 ? 53.217  -14.371 3.567   1.00 47.49  ? 411 TYR B CD2   1 
ATOM   7097 C  CE1   . TYR B 1 411 ? 52.047  -12.133 4.792   1.00 48.17  ? 411 TYR B CE1   1 
ATOM   7098 C  CE2   . TYR B 1 411 ? 52.548  -14.511 4.793   1.00 48.85  ? 411 TYR B CE2   1 
ATOM   7099 C  CZ    . TYR B 1 411 ? 51.961  -13.376 5.398   1.00 48.94  ? 411 TYR B CZ    1 
ATOM   7100 O  OH    . TYR B 1 411 ? 51.287  -13.461 6.606   1.00 48.75  ? 411 TYR B OH    1 
ATOM   7101 N  N     . PHE B 1 412 ? 50.913  -13.763 1.011   1.00 40.01  ? 412 PHE B N     1 
ATOM   7102 C  CA    . PHE B 1 412 ? 49.633  -13.729 1.690   1.00 38.48  ? 412 PHE B CA    1 
ATOM   7103 C  C     . PHE B 1 412 ? 49.447  -15.102 2.275   1.00 39.32  ? 412 PHE B C     1 
ATOM   7104 O  O     . PHE B 1 412 ? 50.156  -16.041 1.901   1.00 40.56  ? 412 PHE B O     1 
ATOM   7105 C  CB    . PHE B 1 412 ? 48.479  -13.369 0.724   1.00 36.53  ? 412 PHE B CB    1 
ATOM   7106 C  CG    . PHE B 1 412 ? 48.186  -14.435 -0.310  1.00 35.74  ? 412 PHE B CG    1 
ATOM   7107 C  CD1   . PHE B 1 412 ? 47.256  -15.428 -0.055  1.00 34.54  ? 412 PHE B CD1   1 
ATOM   7108 C  CD2   . PHE B 1 412 ? 48.837  -14.430 -1.538  1.00 34.89  ? 412 PHE B CD2   1 
ATOM   7109 C  CE1   . PHE B 1 412 ? 46.985  -16.420 -1.006  1.00 33.90  ? 412 PHE B CE1   1 
ATOM   7110 C  CE2   . PHE B 1 412 ? 48.573  -15.405 -2.487  1.00 37.68  ? 412 PHE B CE2   1 
ATOM   7111 C  CZ    . PHE B 1 412 ? 47.643  -16.410 -2.220  1.00 34.99  ? 412 PHE B CZ    1 
ATOM   7112 N  N     . GLU B 1 413 ? 48.515  -15.218 3.208   1.00 39.16  ? 413 GLU B N     1 
ATOM   7113 C  CA    . GLU B 1 413 ? 48.034  -16.531 3.603   1.00 39.61  ? 413 GLU B CA    1 
ATOM   7114 C  C     . GLU B 1 413 ? 46.516  -16.624 3.656   1.00 37.78  ? 413 GLU B C     1 
ATOM   7115 O  O     . GLU B 1 413 ? 45.829  -15.627 3.826   1.00 36.46  ? 413 GLU B O     1 
ATOM   7116 C  CB    . GLU B 1 413 ? 48.667  -17.034 4.904   1.00 40.98  ? 413 GLU B CB    1 
ATOM   7117 C  CG    . GLU B 1 413 ? 49.137  -15.999 5.904   1.00 43.08  ? 413 GLU B CG    1 
ATOM   7118 C  CD    . GLU B 1 413 ? 49.956  -16.635 7.029   1.00 45.82  ? 413 GLU B CD    1 
ATOM   7119 O  OE1   . GLU B 1 413 ? 50.046  -17.884 7.065   1.00 49.75  ? 413 GLU B OE1   1 
ATOM   7120 O  OE2   . GLU B 1 413 ? 50.522  -15.903 7.872   1.00 48.84  ? 413 GLU B OE2   1 
ATOM   7121 N  N     . ILE B 1 414 ? 46.009  -17.837 3.476   1.00 37.70  ? 414 ILE B N     1 
ATOM   7122 C  CA    . ILE B 1 414 ? 44.598  -18.113 3.700   1.00 37.32  ? 414 ILE B CA    1 
ATOM   7123 C  C     . ILE B 1 414 ? 44.489  -18.719 5.099   1.00 38.16  ? 414 ILE B C     1 
ATOM   7124 O  O     . ILE B 1 414 ? 45.179  -19.684 5.420   1.00 39.12  ? 414 ILE B O     1 
ATOM   7125 C  CB    . ILE B 1 414 ? 43.989  -19.021 2.591   1.00 36.78  ? 414 ILE B CB    1 
ATOM   7126 C  CG1   . ILE B 1 414 ? 43.392  -18.180 1.461   1.00 37.23  ? 414 ILE B CG1   1 
ATOM   7127 C  CG2   . ILE B 1 414 ? 42.787  -19.801 3.119   1.00 36.49  ? 414 ILE B CG2   1 
ATOM   7128 C  CD1   . ILE B 1 414 ? 44.324  -17.321 0.725   1.00 35.79  ? 414 ILE B CD1   1 
ATOM   7129 N  N     . ILE B 1 415 ? 43.640  -18.127 5.933   1.00 37.87  ? 415 ILE B N     1 
ATOM   7130 C  CA    . ILE B 1 415 ? 43.493  -18.561 7.320   1.00 39.21  ? 415 ILE B CA    1 
ATOM   7131 C  C     . ILE B 1 415 ? 42.020  -18.815 7.686   1.00 39.13  ? 415 ILE B C     1 
ATOM   7132 O  O     . ILE B 1 415 ? 41.135  -18.051 7.307   1.00 36.76  ? 415 ILE B O     1 
ATOM   7133 C  CB    . ILE B 1 415 ? 44.146  -17.545 8.314   1.00 39.77  ? 415 ILE B CB    1 
ATOM   7134 C  CG1   . ILE B 1 415 ? 43.509  -16.156 8.199   1.00 38.62  ? 415 ILE B CG1   1 
ATOM   7135 C  CG2   . ILE B 1 415 ? 45.656  -17.446 8.075   1.00 41.33  ? 415 ILE B CG2   1 
ATOM   7136 C  CD1   . ILE B 1 415 ? 44.030  -15.136 9.219   1.00 39.92  ? 415 ILE B CD1   1 
ATOM   7137 N  N     . SER B 1 416 ? 41.782  -19.901 8.422   1.00 41.43  ? 416 SER B N     1 
ATOM   7138 C  CA    . SER B 1 416 ? 40.447  -20.265 8.907   1.00 42.75  ? 416 SER B CA    1 
ATOM   7139 C  C     . SER B 1 416 ? 40.536  -20.950 10.279  1.00 45.55  ? 416 SER B C     1 
ATOM   7140 O  O     . SER B 1 416 ? 41.626  -21.340 10.713  1.00 47.21  ? 416 SER B O     1 
ATOM   7141 C  CB    . SER B 1 416 ? 39.754  -21.192 7.906   1.00 42.20  ? 416 SER B CB    1 
ATOM   7142 O  OG    . SER B 1 416 ? 40.451  -22.420 7.811   1.00 42.54  ? 416 SER B OG    1 
ATOM   7143 N  N     . GLY B 1 417 ? 39.395  -21.077 10.961  1.00 46.48  ? 417 GLY B N     1 
ATOM   7144 C  CA    . GLY B 1 417 ? 39.319  -21.789 12.237  1.00 49.42  ? 417 GLY B CA    1 
ATOM   7145 C  C     . GLY B 1 417 ? 39.948  -21.037 13.400  1.00 51.82  ? 417 GLY B C     1 
ATOM   7146 O  O     . GLY B 1 417 ? 40.039  -19.804 13.382  1.00 51.33  ? 417 GLY B O     1 
ATOM   7147 N  N     . GLU B 1 418 ? 40.399  -21.782 14.408  1.00 54.68  ? 418 GLU B N     1 
ATOM   7148 C  CA    . GLU B 1 418 ? 40.974  -21.192 15.620  1.00 57.28  ? 418 GLU B CA    1 
ATOM   7149 C  C     . GLU B 1 418 ? 41.982  -20.101 15.288  1.00 56.64  ? 418 GLU B C     1 
ATOM   7150 O  O     . GLU B 1 418 ? 42.059  -19.089 15.985  1.00 57.28  ? 418 GLU B O     1 
ATOM   7151 C  CB    . GLU B 1 418 ? 41.655  -22.260 16.490  1.00 60.50  ? 418 GLU B CB    1 
ATOM   7152 C  CG    . GLU B 1 418 ? 40.733  -23.382 17.001  1.00 63.49  ? 418 GLU B CG    1 
ATOM   7153 C  CD    . GLU B 1 418 ? 40.098  -23.097 18.367  1.00 68.12  ? 418 GLU B CD    1 
ATOM   7154 O  OE1   . GLU B 1 418 ? 39.749  -24.075 19.067  1.00 70.64  ? 418 GLU B OE1   1 
ATOM   7155 O  OE2   . GLU B 1 418 ? 39.942  -21.910 18.746  1.00 69.14  ? 418 GLU B OE2   1 
ATOM   7156 N  N     . LYS B 1 419 ? 42.751  -20.317 14.221  1.00 55.63  ? 419 LYS B N     1 
ATOM   7157 C  CA    . LYS B 1 419 ? 43.818  -19.401 13.830  1.00 55.23  ? 419 LYS B CA    1 
ATOM   7158 C  C     . LYS B 1 419 ? 43.261  -18.046 13.391  1.00 52.66  ? 419 LYS B C     1 
ATOM   7159 O  O     . LYS B 1 419 ? 43.792  -16.993 13.765  1.00 53.20  ? 419 LYS B O     1 
ATOM   7160 C  CB    . LYS B 1 419 ? 44.673  -20.017 12.720  1.00 55.16  ? 419 LYS B CB    1 
ATOM   7161 C  CG    . LYS B 1 419 ? 45.833  -19.125 12.288  1.00 57.19  ? 419 LYS B CG    1 
ATOM   7162 C  CD    . LYS B 1 419 ? 46.771  -19.848 11.345  1.00 59.94  ? 419 LYS B CD    1 
ATOM   7163 C  CE    . LYS B 1 419 ? 47.934  -18.953 10.950  1.00 61.42  ? 419 LYS B CE    1 
ATOM   7164 N  NZ    . LYS B 1 419 ? 48.838  -19.682 10.022  1.00 62.59  ? 419 LYS B NZ    1 
ATOM   7165 N  N     . LEU B 1 420 ? 42.192  -18.091 12.601  1.00 50.02  ? 420 LEU B N     1 
ATOM   7166 C  CA    . LEU B 1 420 ? 41.491  -16.892 12.156  1.00 47.88  ? 420 LEU B CA    1 
ATOM   7167 C  C     . LEU B 1 420 ? 40.845  -16.155 13.331  1.00 48.39  ? 420 LEU B C     1 
ATOM   7168 O  O     . LEU B 1 420 ? 40.877  -14.932 13.391  1.00 47.15  ? 420 LEU B O     1 
ATOM   7169 C  CB    . LEU B 1 420 ? 40.434  -17.250 11.102  1.00 45.93  ? 420 LEU B CB    1 
ATOM   7170 C  CG    . LEU B 1 420 ? 39.458  -16.157 10.667  1.00 44.41  ? 420 LEU B CG    1 
ATOM   7171 C  CD1   . LEU B 1 420 ? 40.180  -14.986 10.004  1.00 44.51  ? 420 LEU B CD1   1 
ATOM   7172 C  CD2   . LEU B 1 420 ? 38.383  -16.717 9.752   1.00 43.75  ? 420 LEU B CD2   1 
ATOM   7173 N  N     . PHE B 1 421 ? 40.267  -16.922 14.254  1.00 49.91  ? 421 PHE B N     1 
ATOM   7174 C  CA    . PHE B 1 421 ? 39.579  -16.371 15.421  1.00 51.40  ? 421 PHE B CA    1 
ATOM   7175 C  C     . PHE B 1 421 ? 40.543  -15.713 16.425  1.00 53.17  ? 421 PHE B C     1 
ATOM   7176 O  O     . PHE B 1 421 ? 40.111  -14.913 17.265  1.00 54.12  ? 421 PHE B O     1 
ATOM   7177 C  CB    . PHE B 1 421 ? 38.709  -17.441 16.108  1.00 52.60  ? 421 PHE B CB    1 
ATOM   7178 C  CG    . PHE B 1 421 ? 37.739  -18.147 15.181  1.00 52.01  ? 421 PHE B CG    1 
ATOM   7179 C  CD1   . PHE B 1 421 ? 37.516  -19.516 15.308  1.00 53.45  ? 421 PHE B CD1   1 
ATOM   7180 C  CD2   . PHE B 1 421 ? 37.046  -17.450 14.186  1.00 51.30  ? 421 PHE B CD2   1 
ATOM   7181 C  CE1   . PHE B 1 421 ? 36.628  -20.183 14.460  1.00 53.02  ? 421 PHE B CE1   1 
ATOM   7182 C  CE2   . PHE B 1 421 ? 36.152  -18.109 13.334  1.00 49.91  ? 421 PHE B CE2   1 
ATOM   7183 C  CZ    . PHE B 1 421 ? 35.942  -19.477 13.474  1.00 50.63  ? 421 PHE B CZ    1 
ATOM   7184 N  N     . LYS B 1 422 ? 41.836  -16.040 16.329  1.00 53.63  ? 422 LYS B N     1 
ATOM   7185 C  CA    . LYS B 1 422 ? 42.872  -15.367 17.134  1.00 55.49  ? 422 LYS B CA    1 
ATOM   7186 C  C     . LYS B 1 422 ? 43.173  -13.962 16.594  1.00 53.78  ? 422 LYS B C     1 
ATOM   7187 O  O     . LYS B 1 422 ? 43.639  -13.087 17.332  1.00 54.97  ? 422 LYS B O     1 
ATOM   7188 C  CB    . LYS B 1 422 ? 44.179  -16.168 17.150  1.00 57.04  ? 422 LYS B CB    1 
ATOM   7189 C  CG    . LYS B 1 422 ? 44.166  -17.513 17.878  1.00 59.05  ? 422 LYS B CG    1 
ATOM   7190 C  CD    . LYS B 1 422 ? 45.609  -18.019 18.001  1.00 61.28  ? 422 LYS B CD    1 
ATOM   7191 C  CE    . LYS B 1 422 ? 45.723  -19.535 17.811  1.00 64.05  ? 422 LYS B CE    1 
ATOM   7192 N  NZ    . LYS B 1 422 ? 45.566  -20.284 19.093  1.00 66.37  ? 422 LYS B NZ    1 
ATOM   7193 N  N     . GLU B 1 423 ? 42.919  -13.756 15.301  1.00 50.59  ? 423 GLU B N     1 
ATOM   7194 C  CA    . GLU B 1 423 ? 43.241  -12.488 14.647  1.00 48.51  ? 423 GLU B CA    1 
ATOM   7195 C  C     . GLU B 1 423 ? 42.284  -11.384 15.097  1.00 47.56  ? 423 GLU B C     1 
ATOM   7196 O  O     . GLU B 1 423 ? 41.191  -11.681 15.577  1.00 47.40  ? 423 GLU B O     1 
ATOM   7197 C  CB    . GLU B 1 423 ? 43.220  -12.655 13.123  1.00 46.79  ? 423 GLU B CB    1 
ATOM   7198 C  CG    . GLU B 1 423 ? 44.173  -13.733 12.591  1.00 47.13  ? 423 GLU B CG    1 
ATOM   7199 C  CD    . GLU B 1 423 ? 45.648  -13.331 12.611  1.00 50.36  ? 423 GLU B CD    1 
ATOM   7200 O  OE1   . GLU B 1 423 ? 45.986  -12.160 12.882  1.00 51.28  ? 423 GLU B OE1   1 
ATOM   7201 O  OE2   . GLU B 1 423 ? 46.488  -14.207 12.345  1.00 53.88  ? 423 GLU B OE2   1 
ATOM   7202 N  N     . PRO B 1 424 ? 42.694  -10.107 14.964  1.00 46.94  ? 424 PRO B N     1 
ATOM   7203 C  CA    . PRO B 1 424 ? 41.835  -9.010  15.418  1.00 46.70  ? 424 PRO B CA    1 
ATOM   7204 C  C     . PRO B 1 424 ? 40.735  -8.659  14.405  1.00 44.56  ? 424 PRO B C     1 
ATOM   7205 O  O     . PRO B 1 424 ? 40.606  -7.500  13.980  1.00 44.28  ? 424 PRO B O     1 
ATOM   7206 C  CB    . PRO B 1 424 ? 42.825  -7.856  15.589  1.00 47.19  ? 424 PRO B CB    1 
ATOM   7207 C  CG    . PRO B 1 424 ? 43.864  -8.114  14.560  1.00 46.26  ? 424 PRO B CG    1 
ATOM   7208 C  CD    . PRO B 1 424 ? 43.976  -9.605  14.421  1.00 47.06  ? 424 PRO B CD    1 
ATOM   7209 N  N     . VAL B 1 425 ? 39.939  -9.660  14.047  1.00 42.95  ? 425 VAL B N     1 
ATOM   7210 C  CA    . VAL B 1 425 ? 38.910  -9.512  13.029  1.00 40.90  ? 425 VAL B CA    1 
ATOM   7211 C  C     . VAL B 1 425 ? 37.521  -9.849  13.571  1.00 41.47  ? 425 VAL B C     1 
ATOM   7212 O  O     . VAL B 1 425 ? 36.547  -9.906  12.810  1.00 40.03  ? 425 VAL B O     1 
ATOM   7213 C  CB    . VAL B 1 425 ? 39.217  -10.402 11.805  1.00 39.33  ? 425 VAL B CB    1 
ATOM   7214 C  CG1   . VAL B 1 425 ? 40.525  -9.993  11.168  1.00 37.81  ? 425 VAL B CG1   1 
ATOM   7215 C  CG2   . VAL B 1 425 ? 39.247  -11.901 12.196  1.00 39.44  ? 425 VAL B CG2   1 
ATOM   7216 N  N     . THR B 1 426 ? 37.442  -10.079 14.884  1.00 43.07  ? 426 THR B N     1 
ATOM   7217 C  CA    . THR B 1 426 ? 36.221  -10.599 15.505  1.00 44.02  ? 426 THR B CA    1 
ATOM   7218 C  C     . THR B 1 426 ? 35.023  -9.648  15.348  1.00 43.61  ? 426 THR B C     1 
ATOM   7219 O  O     . THR B 1 426 ? 33.917  -10.093 15.043  1.00 42.78  ? 426 THR B O     1 
ATOM   7220 C  CB    . THR B 1 426 ? 36.432  -11.055 16.978  1.00 46.38  ? 426 THR B CB    1 
ATOM   7221 O  OG1   . THR B 1 426 ? 36.991  -9.991  17.739  1.00 48.64  ? 426 THR B OG1   1 
ATOM   7222 C  CG2   . THR B 1 426 ? 37.383  -12.253 17.044  1.00 46.90  ? 426 THR B CG2   1 
ATOM   7223 N  N     . ALA B 1 427 ? 35.264  -8.347  15.509  1.00 43.82  ? 427 ALA B N     1 
ATOM   7224 C  CA    . ALA B 1 427 ? 34.248  -7.323  15.255  1.00 43.79  ? 427 ALA B CA    1 
ATOM   7225 C  C     . ALA B 1 427 ? 33.627  -7.468  13.861  1.00 42.26  ? 427 ALA B C     1 
ATOM   7226 O  O     . ALA B 1 427 ? 32.406  -7.497  13.712  1.00 42.09  ? 427 ALA B O     1 
ATOM   7227 C  CB    . ALA B 1 427 ? 34.855  -5.948  15.418  1.00 44.61  ? 427 ALA B CB    1 
ATOM   7228 N  N     . GLU B 1 428 ? 34.490  -7.586  12.852  1.00 40.78  ? 428 GLU B N     1 
ATOM   7229 C  CA    . GLU B 1 428 ? 34.085  -7.649  11.452  1.00 38.97  ? 428 GLU B CA    1 
ATOM   7230 C  C     . GLU B 1 428 ? 33.357  -8.942  11.115  1.00 37.93  ? 428 GLU B C     1 
ATOM   7231 O  O     . GLU B 1 428 ? 32.409  -8.925  10.340  1.00 36.84  ? 428 GLU B O     1 
ATOM   7232 C  CB    . GLU B 1 428 ? 35.295  -7.447  10.535  1.00 38.39  ? 428 GLU B CB    1 
ATOM   7233 C  CG    . GLU B 1 428 ? 35.766  -5.985  10.432  1.00 40.09  ? 428 GLU B CG    1 
ATOM   7234 C  CD    . GLU B 1 428 ? 36.568  -5.496  11.629  1.00 43.78  ? 428 GLU B CD    1 
ATOM   7235 O  OE1   . GLU B 1 428 ? 37.000  -6.319  12.481  1.00 43.37  ? 428 GLU B OE1   1 
ATOM   7236 O  OE2   . GLU B 1 428 ? 36.780  -4.260  11.712  1.00 47.45  ? 428 GLU B OE2   1 
ATOM   7237 N  N     . LEU B 1 429 ? 33.791  -10.055 11.702  1.00 37.90  ? 429 LEU B N     1 
ATOM   7238 C  CA    . LEU B 1 429 ? 33.101  -11.331 11.510  1.00 37.75  ? 429 LEU B CA    1 
ATOM   7239 C  C     . LEU B 1 429 ? 31.698  -11.311 12.123  1.00 38.96  ? 429 LEU B C     1 
ATOM   7240 O  O     . LEU B 1 429 ? 30.753  -11.786 11.506  1.00 38.00  ? 429 LEU B O     1 
ATOM   7241 C  CB    . LEU B 1 429 ? 33.922  -12.492 12.072  1.00 38.27  ? 429 LEU B CB    1 
ATOM   7242 C  CG    . LEU B 1 429 ? 35.219  -12.825 11.327  1.00 37.28  ? 429 LEU B CG    1 
ATOM   7243 C  CD1   . LEU B 1 429 ? 35.978  -13.941 12.060  1.00 39.54  ? 429 LEU B CD1   1 
ATOM   7244 C  CD2   . LEU B 1 429 ? 34.945  -13.188 9.856   1.00 37.92  ? 429 LEU B CD2   1 
ATOM   7245 N  N     . CYS B 1 430 ? 31.572  -10.730 13.319  1.00 41.05  ? 430 CYS B N     1 
ATOM   7246 C  CA    . CYS B 1 430 ? 30.279  -10.586 13.994  1.00 42.86  ? 430 CYS B CA    1 
ATOM   7247 C  C     . CYS B 1 430 ? 29.322  -9.723  13.199  1.00 42.95  ? 430 CYS B C     1 
ATOM   7248 O  O     . CYS B 1 430 ? 28.155  -10.074 13.050  1.00 43.52  ? 430 CYS B O     1 
ATOM   7249 C  CB    . CYS B 1 430 ? 30.457  -10.007 15.394  1.00 44.99  ? 430 CYS B CB    1 
ATOM   7250 S  SG    . CYS B 1 430 ? 31.248  -11.155 16.506  1.00 45.64  ? 430 CYS B SG    1 
ATOM   7251 N  N     . GLU B 1 431 ? 29.822  -8.598  12.695  1.00 43.05  ? 431 GLU B N     1 
ATOM   7252 C  CA    . GLU B 1 431 ? 29.048  -7.709  11.832  1.00 44.14  ? 431 GLU B CA    1 
ATOM   7253 C  C     . GLU B 1 431 ? 28.610  -8.417  10.541  1.00 42.57  ? 431 GLU B C     1 
ATOM   7254 O  O     . GLU B 1 431 ? 27.441  -8.353  10.145  1.00 43.18  ? 431 GLU B O     1 
ATOM   7255 C  CB    . GLU B 1 431 ? 29.857  -6.446  11.520  1.00 44.23  ? 431 GLU B CB    1 
ATOM   7256 C  CG    . GLU B 1 431 ? 29.222  -5.457  10.526  1.00 47.78  ? 431 GLU B CG    1 
ATOM   7257 C  CD    . GLU B 1 431 ? 27.945  -4.791  11.040  1.00 54.52  ? 431 GLU B CD    1 
ATOM   7258 O  OE1   . GLU B 1 431 ? 27.132  -4.350  10.191  1.00 56.86  ? 431 GLU B OE1   1 
ATOM   7259 O  OE2   . GLU B 1 431 ? 27.745  -4.704  12.279  1.00 57.95  ? 431 GLU B OE2   1 
ATOM   7260 N  N     . MET B 1 432 ? 29.562  -9.097  9.911   1.00 41.05  ? 432 MET B N     1 
ATOM   7261 C  CA    . MET B 1 432 ? 29.351  -9.840  8.681   1.00 40.61  ? 432 MET B CA    1 
ATOM   7262 C  C     . MET B 1 432 ? 28.250  -10.891 8.860   1.00 40.25  ? 432 MET B C     1 
ATOM   7263 O  O     . MET B 1 432 ? 27.354  -11.026 8.018   1.00 40.34  ? 432 MET B O     1 
ATOM   7264 C  CB    . MET B 1 432 ? 30.670  -10.530 8.306   1.00 39.42  ? 432 MET B CB    1 
ATOM   7265 C  CG    . MET B 1 432 ? 30.983  -10.656 6.838   1.00 39.65  ? 432 MET B CG    1 
ATOM   7266 S  SD    . MET B 1 432 ? 32.618  -11.409 6.648   1.00 40.21  ? 432 MET B SD    1 
ATOM   7267 C  CE    . MET B 1 432 ? 32.185  -13.129 6.504   1.00 38.95  ? 432 MET B CE    1 
ATOM   7268 N  N     . MET B 1 433 ? 28.312  -11.622 9.970   1.00 40.08  ? 433 MET B N     1 
ATOM   7269 C  CA    . MET B 1 433 ? 27.396  -12.731 10.208  1.00 40.20  ? 433 MET B CA    1 
ATOM   7270 C  C     . MET B 1 433 ? 26.080  -12.329 10.877  1.00 41.87  ? 433 MET B C     1 
ATOM   7271 O  O     . MET B 1 433 ? 25.181  -13.152 11.026  1.00 42.45  ? 433 MET B O     1 
ATOM   7272 C  CB    . MET B 1 433 ? 28.100  -13.834 10.995  1.00 40.26  ? 433 MET B CB    1 
ATOM   7273 C  CG    . MET B 1 433 ? 29.367  -14.335 10.302  1.00 38.28  ? 433 MET B CG    1 
ATOM   7274 S  SD    . MET B 1 433 ? 29.938  -15.931 10.920  1.00 39.20  ? 433 MET B SD    1 
ATOM   7275 C  CE    . MET B 1 433 ? 30.540  -15.475 12.542  1.00 39.19  ? 433 MET B CE    1 
ATOM   7276 N  N     . GLY B 1 434 ? 25.963  -11.058 11.244  1.00 42.90  ? 434 GLY B N     1 
ATOM   7277 C  CA    . GLY B 1 434 ? 24.789  -10.560 11.963  1.00 45.50  ? 434 GLY B CA    1 
ATOM   7278 C  C     . GLY B 1 434 ? 24.637  -11.178 13.342  1.00 47.43  ? 434 GLY B C     1 
ATOM   7279 O  O     . GLY B 1 434 ? 23.521  -11.482 13.774  1.00 48.83  ? 434 GLY B O     1 
ATOM   7280 N  N     . VAL B 1 435 ? 25.764  -11.373 14.026  1.00 47.80  ? 435 VAL B N     1 
ATOM   7281 C  CA    . VAL B 1 435 ? 25.779  -11.965 15.361  1.00 50.10  ? 435 VAL B CA    1 
ATOM   7282 C  C     . VAL B 1 435 ? 25.165  -10.997 16.379  1.00 53.07  ? 435 VAL B C     1 
ATOM   7283 O  O     . VAL B 1 435 ? 25.454  -9.800  16.372  1.00 52.86  ? 435 VAL B O     1 
ATOM   7284 C  CB    . VAL B 1 435 ? 27.215  -12.404 15.791  1.00 49.75  ? 435 VAL B CB    1 
ATOM   7285 C  CG1   . VAL B 1 435 ? 27.238  -12.873 17.259  1.00 51.71  ? 435 VAL B CG1   1 
ATOM   7286 C  CG2   . VAL B 1 435 ? 27.749  -13.500 14.871  1.00 47.08  ? 435 VAL B CG2   1 
ATOM   7287 N  N     . LYS B 1 436 ? 24.301  -11.532 17.235  1.00 55.91  ? 436 LYS B N     1 
ATOM   7288 C  CA    . LYS B 1 436 ? 23.604  -10.749 18.251  1.00 59.62  ? 436 LYS B CA    1 
ATOM   7289 C  C     . LYS B 1 436 ? 24.232  -10.885 19.635  1.00 62.39  ? 436 LYS B C     1 
ATOM   7290 O  O     . LYS B 1 436 ? 25.121  -11.715 19.847  1.00 61.90  ? 436 LYS B O     1 
ATOM   7291 C  CB    . LYS B 1 436 ? 22.130  -11.171 18.319  1.00 60.98  ? 436 LYS B CB    1 
ATOM   7292 C  CG    . LYS B 1 436 ? 21.306  -10.733 17.126  1.00 59.77  ? 436 LYS B CG    1 
ATOM   7293 C  CD    . LYS B 1 436 ? 19.824  -10.766 17.428  1.00 62.36  ? 436 LYS B CD    1 
ATOM   7294 C  CE    . LYS B 1 436 ? 19.200  -12.045 16.937  1.00 61.47  ? 436 LYS B CE    1 
ATOM   7295 N  NZ    . LYS B 1 436 ? 17.718  -11.996 17.034  1.00 65.01  ? 436 LYS B NZ    1 
ATOM   7296 N  N     . ASP B 1 437 ? 23.741  -10.052 20.559  1.00 66.13  ? 437 ASP B N     1 
ATOM   7297 C  CA    . ASP B 1 437 ? 24.006  -10.109 22.012  1.00 69.69  ? 437 ASP B CA    1 
ATOM   7298 C  C     . ASP B 1 437 ? 24.810  -8.883  22.418  1.00 70.49  ? 437 ASP B C     1 
ATOM   7299 O  O     . ASP B 1 437 ? 24.519  -8.213  23.412  1.00 73.62  ? 437 ASP B O     1 
ATOM   7300 C  CB    . ASP B 1 437 ? 24.734  -11.395 22.436  1.00 69.74  ? 437 ASP B CB    1 
ATOM   7301 C  CG    . ASP B 1 437 ? 24.040  -12.124 23.584  1.00 73.21  ? 437 ASP B CG    1 
ATOM   7302 O  OD1   . ASP B 1 437 ? 23.699  -13.313 23.398  1.00 73.54  ? 437 ASP B OD1   1 
ATOM   7303 O  OD2   . ASP B 1 437 ? 23.838  -11.529 24.666  1.00 76.80  ? 437 ASP B OD2   1 
ATOM   7304 O  "O5'" . G   C 2 1   ? -3.114  -42.276 -16.381 1.00 31.27  ? 1   G   C "O5'" 1 
ATOM   7305 C  "C5'" . G   C 2 1   ? -2.143  -43.085 -15.787 1.00 29.70  ? 1   G   C "C5'" 1 
ATOM   7306 C  "C4'" . G   C 2 1   ? -0.907  -43.136 -16.672 1.00 25.38  ? 1   G   C "C4'" 1 
ATOM   7307 O  "O4'" . G   C 2 1   ? -1.163  -43.841 -17.918 1.00 30.88  ? 1   G   C "O4'" 1 
ATOM   7308 C  "C3'" . G   C 2 1   ? -0.312  -41.798 -17.088 1.00 25.59  ? 1   G   C "C3'" 1 
ATOM   7309 O  "O3'" . G   C 2 1   ? 0.478   -41.192 -16.058 1.00 23.34  ? 1   G   C "O3'" 1 
ATOM   7310 C  "C2'" . G   C 2 1   ? 0.572   -42.223 -18.253 1.00 23.81  ? 1   G   C "C2'" 1 
ATOM   7311 O  "O2'" . G   C 2 1   ? 1.723   -42.969 -17.877 1.00 21.90  ? 1   G   C "O2'" 1 
ATOM   7312 C  "C1'" . G   C 2 1   ? -0.411  -43.166 -18.926 1.00 26.31  ? 1   G   C "C1'" 1 
ATOM   7313 N  N9    . G   C 2 1   ? -1.319  -42.595 -19.929 1.00 25.86  ? 1   G   C N9    1 
ATOM   7314 C  C8    . G   C 2 1   ? -2.694  -42.422 -19.873 1.00 28.31  ? 1   G   C C8    1 
ATOM   7315 N  N7    . G   C 2 1   ? -3.190  -41.928 -20.991 1.00 29.48  ? 1   G   C N7    1 
ATOM   7316 C  C5    . G   C 2 1   ? -2.080  -41.784 -21.836 1.00 27.80  ? 1   G   C C5    1 
ATOM   7317 C  C6    . G   C 2 1   ? -1.956  -41.325 -23.184 1.00 25.69  ? 1   G   C C6    1 
ATOM   7318 O  O6    . G   C 2 1   ? -2.850  -40.929 -23.935 1.00 26.20  ? 1   G   C O6    1 
ATOM   7319 N  N1    . G   C 2 1   ? -0.629  -41.346 -23.638 1.00 24.22  ? 1   G   C N1    1 
ATOM   7320 C  C2    . G   C 2 1   ? 0.458   -41.809 -22.899 1.00 25.32  ? 1   G   C C2    1 
ATOM   7321 N  N2    . G   C 2 1   ? 1.701   -41.798 -23.444 1.00 23.66  ? 1   G   C N2    1 
ATOM   7322 N  N3    . G   C 2 1   ? 0.355   -42.239 -21.654 1.00 23.19  ? 1   G   C N3    1 
ATOM   7323 C  C4    . G   C 2 1   ? -0.927  -42.207 -21.188 1.00 26.42  ? 1   G   C C4    1 
ATOM   7324 P  P     . G   C 2 2   ? 0.603   -39.600 -15.839 1.00 24.61  ? 2   G   C P     1 
ATOM   7325 O  OP1   . G   C 2 2   ? 1.296   -39.480 -14.542 1.00 27.48  ? 2   G   C OP1   1 
ATOM   7326 O  OP2   . G   C 2 2   ? -0.712  -38.930 -15.982 1.00 23.56  ? 2   G   C OP2   1 
ATOM   7327 O  "O5'" . G   C 2 2   ? 1.528   -39.025 -17.001 1.00 24.96  ? 2   G   C "O5'" 1 
ATOM   7328 C  "C5'" . G   C 2 2   ? 2.921   -39.384 -17.042 1.00 24.36  ? 2   G   C "C5'" 1 
ATOM   7329 C  "C4'" . G   C 2 2   ? 3.553   -38.988 -18.370 1.00 21.83  ? 2   G   C "C4'" 1 
ATOM   7330 O  "O4'" . G   C 2 2   ? 2.963   -39.763 -19.411 1.00 24.44  ? 2   G   C "O4'" 1 
ATOM   7331 C  "C3'" . G   C 2 2   ? 3.332   -37.566 -18.884 1.00 22.51  ? 2   G   C "C3'" 1 
ATOM   7332 O  "O3'" . G   C 2 2   ? 4.242   -36.715 -18.260 1.00 21.52  ? 2   G   C "O3'" 1 
ATOM   7333 C  "C2'" . G   C 2 2   ? 3.648   -37.743 -20.384 1.00 22.25  ? 2   G   C "C2'" 1 
ATOM   7334 O  "O2'" . G   C 2 2   ? 5.006   -37.995 -20.635 1.00 22.96  ? 2   G   C "O2'" 1 
ATOM   7335 C  "C1'" . G   C 2 2   ? 2.938   -39.050 -20.633 1.00 23.88  ? 2   G   C "C1'" 1 
ATOM   7336 N  N9    . G   C 2 2   ? 1.544   -38.857 -20.993 1.00 24.73  ? 2   G   C N9    1 
ATOM   7337 C  C8    . G   C 2 2   ? 0.429   -38.932 -20.189 1.00 25.69  ? 2   G   C C8    1 
ATOM   7338 N  N7    . G   C 2 2   ? -0.683  -38.688 -20.817 1.00 26.98  ? 2   G   C N7    1 
ATOM   7339 C  C5    . G   C 2 2   ? -0.272  -38.439 -22.129 1.00 27.21  ? 2   G   C C5    1 
ATOM   7340 C  C6    . G   C 2 2   ? -1.023  -38.132 -23.295 1.00 28.75  ? 2   G   C C6    1 
ATOM   7341 O  O6    . G   C 2 2   ? -2.253  -37.992 -23.394 1.00 30.25  ? 2   G   C O6    1 
ATOM   7342 N  N1    . G   C 2 2   ? -0.204  -37.953 -24.416 1.00 25.61  ? 2   G   C N1    1 
ATOM   7343 C  C2    . G   C 2 2   ? 1.170   -38.064 -24.411 1.00 25.34  ? 2   G   C C2    1 
ATOM   7344 N  N2    . G   C 2 2   ? 1.812   -37.864 -25.572 1.00 26.66  ? 2   G   C N2    1 
ATOM   7345 N  N3    . G   C 2 2   ? 1.886   -38.362 -23.336 1.00 23.72  ? 2   G   C N3    1 
ATOM   7346 C  C4    . G   C 2 2   ? 1.098   -38.527 -22.244 1.00 26.37  ? 2   G   C C4    1 
ATOM   7347 P  P     . A   C 2 3   ? 3.898   -35.148 -18.200 1.00 26.78  ? 3   A   C P     1 
ATOM   7348 O  OP1   . A   C 2 3   ? 4.992   -34.493 -17.450 1.00 29.81  ? 3   A   C OP1   1 
ATOM   7349 O  OP2   . A   C 2 3   ? 2.474   -34.961 -17.887 1.00 25.86  ? 3   A   C OP2   1 
ATOM   7350 O  "O5'" . A   C 2 3   ? 4.008   -34.762 -19.776 1.00 26.61  ? 3   A   C "O5'" 1 
ATOM   7351 C  "C5'" . A   C 2 3   ? 5.282   -34.524 -20.460 1.00 27.83  ? 3   A   C "C5'" 1 
ATOM   7352 C  "C4'" . A   C 2 3   ? 5.068   -34.090 -21.912 1.00 28.41  ? 3   A   C "C4'" 1 
ATOM   7353 O  "O4'" . A   C 2 3   ? 4.159   -35.017 -22.540 1.00 28.54  ? 3   A   C "O4'" 1 
ATOM   7354 C  "C3'" . A   C 2 3   ? 4.299   -32.801 -22.069 1.00 30.93  ? 3   A   C "C3'" 1 
ATOM   7355 O  "O3'" . A   C 2 3   ? 5.172   -31.731 -21.903 1.00 34.14  ? 3   A   C "O3'" 1 
ATOM   7356 C  "C2'" . A   C 2 3   ? 3.754   -32.929 -23.495 1.00 31.53  ? 3   A   C "C2'" 1 
ATOM   7357 O  "O2'" . A   C 2 3   ? 4.759   -32.854 -24.489 1.00 30.43  ? 3   A   C "O2'" 1 
ATOM   7358 C  "C1'" . A   C 2 3   ? 3.279   -34.360 -23.425 1.00 26.74  ? 3   A   C "C1'" 1 
ATOM   7359 N  N9    . A   C 2 3   ? 1.899   -34.529 -22.990 1.00 24.73  ? 3   A   C N9    1 
ATOM   7360 C  C8    . A   C 2 3   ? 1.425   -34.878 -21.749 1.00 25.18  ? 3   A   C C8    1 
ATOM   7361 N  N7    . A   C 2 3   ? 0.116   -34.967 -21.690 1.00 26.49  ? 3   A   C N7    1 
ATOM   7362 C  C5    . A   C 2 3   ? -0.289  -34.655 -22.979 1.00 26.45  ? 3   A   C C5    1 
ATOM   7363 C  C6    . A   C 2 3   ? -1.563  -34.565 -23.583 1.00 29.79  ? 3   A   C C6    1 
ATOM   7364 N  N6    . A   C 2 3   ? -2.712  -34.780 -22.919 1.00 31.06  ? 3   A   C N6    1 
ATOM   7365 N  N1    . A   C 2 3   ? -1.612  -34.225 -24.883 1.00 29.14  ? 3   A   C N1    1 
ATOM   7366 C  C2    . A   C 2 3   ? -0.462  -34.001 -25.549 1.00 29.64  ? 3   A   C C2    1 
ATOM   7367 N  N3    . A   C 2 3   ? 0.795   -34.043 -25.091 1.00 24.62  ? 3   A   C N3    1 
ATOM   7368 C  C4    . A   C 2 3   ? 0.800   -34.377 -23.788 1.00 24.93  ? 3   A   C C4    1 
ATOM   7369 P  P     . A   C 2 4   ? 4.548   -30.317 -21.494 1.00 38.53  ? 4   A   C P     1 
ATOM   7370 O  OP1   . A   C 2 4   ? 5.741   -29.498 -21.187 1.00 38.87  ? 4   A   C OP1   1 
ATOM   7371 O  OP2   . A   C 2 4   ? 3.484   -30.481 -20.460 1.00 36.86  ? 4   A   C OP2   1 
ATOM   7372 O  "O5'" . A   C 2 4   ? 3.849   -29.797 -22.824 1.00 42.24  ? 4   A   C "O5'" 1 
ATOM   7373 C  "C5'" . A   C 2 4   ? 4.645   -29.458 -23.964 1.00 45.05  ? 4   A   C "C5'" 1 
ATOM   7374 C  "C4'" . A   C 2 4   ? 3.733   -29.122 -25.115 1.00 46.23  ? 4   A   C "C4'" 1 
ATOM   7375 O  "O4'" . A   C 2 4   ? 2.892   -30.272 -25.386 1.00 42.80  ? 4   A   C "O4'" 1 
ATOM   7376 C  "C3'" . A   C 2 4   ? 2.729   -28.025 -24.811 1.00 48.27  ? 4   A   C "C3'" 1 
ATOM   7377 O  "O3'" . A   C 2 4   ? 3.292   -26.712 -24.901 1.00 54.73  ? 4   A   C "O3'" 1 
ATOM   7378 C  "C2'" . A   C 2 4   ? 1.669   -28.294 -25.872 1.00 46.91  ? 4   A   C "C2'" 1 
ATOM   7379 O  "O2'" . A   C 2 4   ? 2.032   -27.850 -27.166 1.00 48.87  ? 4   A   C "O2'" 1 
ATOM   7380 C  "C1'" . A   C 2 4   ? 1.607   -29.815 -25.792 1.00 44.02  ? 4   A   C "C1'" 1 
ATOM   7381 N  N9    . A   C 2 4   ? 0.559   -30.264 -24.862 1.00 42.21  ? 4   A   C N9    1 
ATOM   7382 C  C8    . A   C 2 4   ? 0.682   -30.717 -23.577 1.00 40.56  ? 4   A   C C8    1 
ATOM   7383 N  N7    . A   C 2 4   ? -0.461  -31.046 -23.010 1.00 40.39  ? 4   A   C N7    1 
ATOM   7384 C  C5    . A   C 2 4   ? -1.402  -30.789 -23.994 1.00 42.39  ? 4   A   C C5    1 
ATOM   7385 C  C6    . A   C 2 4   ? -2.805  -30.921 -24.045 1.00 43.49  ? 4   A   C C6    1 
ATOM   7386 N  N6    . A   C 2 4   ? -3.556  -31.370 -23.035 1.00 44.35  ? 4   A   C N6    1 
ATOM   7387 N  N1    . A   C 2 4   ? -3.425  -30.562 -25.180 1.00 46.46  ? 4   A   C N1    1 
ATOM   7388 C  C2    . A   C 2 4   ? -2.704  -30.105 -26.210 1.00 47.98  ? 4   A   C C2    1 
ATOM   7389 N  N3    . A   C 2 4   ? -1.386  -29.952 -26.288 1.00 45.86  ? 4   A   C N3    1 
ATOM   7390 C  C4    . A   C 2 4   ? -0.792  -30.299 -25.136 1.00 43.26  ? 4   A   C C4    1 
ATOM   7391 P  P     . G   C 2 5   ? 2.613   -25.554 -24.051 1.00 60.19  ? 5   G   C P     1 
ATOM   7392 O  OP1   . G   C 2 5   ? 3.421   -24.330 -24.272 1.00 62.43  ? 5   G   C OP1   1 
ATOM   7393 O  OP2   . G   C 2 5   ? 2.420   -26.049 -22.667 1.00 57.09  ? 5   G   C OP2   1 
ATOM   7394 O  "O5'" . G   C 2 5   ? 1.159   -25.385 -24.720 1.00 63.43  ? 5   G   C "O5'" 1 
ATOM   7395 C  "C5'" . G   C 2 5   ? 0.944   -24.639 -25.934 1.00 68.16  ? 5   G   C "C5'" 1 
ATOM   7396 C  "C4'" . G   C 2 5   ? -0.513  -24.699 -26.372 1.00 70.65  ? 5   G   C "C4'" 1 
ATOM   7397 O  "O4'" . G   C 2 5   ? -1.041  -26.043 -26.268 1.00 67.93  ? 5   G   C "O4'" 1 
ATOM   7398 C  "C3'" . G   C 2 5   ? -1.476  -23.929 -25.487 1.00 72.73  ? 5   G   C "C3'" 1 
ATOM   7399 O  "O3'" . G   C 2 5   ? -1.425  -22.550 -25.784 1.00 78.65  ? 5   G   C "O3'" 1 
ATOM   7400 C  "C2'" . G   C 2 5   ? -2.826  -24.570 -25.812 1.00 72.54  ? 5   G   C "C2'" 1 
ATOM   7401 O  "O2'" . G   C 2 5   ? -3.351  -24.248 -27.085 1.00 75.98  ? 5   G   C "O2'" 1 
ATOM   7402 C  "C1'" . G   C 2 5   ? -2.398  -26.019 -25.832 1.00 67.92  ? 5   G   C "C1'" 1 
ATOM   7403 N  N9    . G   C 2 5   ? -2.548  -26.727 -24.557 1.00 64.43  ? 5   G   C N9    1 
ATOM   7404 C  C8    . G   C 2 5   ? -1.558  -27.086 -23.676 1.00 61.67  ? 5   G   C C8    1 
ATOM   7405 N  N7    . G   C 2 5   ? -1.993  -27.739 -22.630 1.00 60.70  ? 5   G   C N7    1 
ATOM   7406 C  C5    . G   C 2 5   ? -3.368  -27.821 -22.829 1.00 62.38  ? 5   G   C C5    1 
ATOM   7407 C  C6    . G   C 2 5   ? -4.375  -28.421 -22.019 1.00 62.31  ? 5   G   C C6    1 
ATOM   7408 O  O6    . G   C 2 5   ? -4.229  -29.018 -20.930 1.00 59.98  ? 5   G   C O6    1 
ATOM   7409 N  N1    . G   C 2 5   ? -5.642  -28.281 -22.589 1.00 64.15  ? 5   G   C N1    1 
ATOM   7410 C  C2    . G   C 2 5   ? -5.888  -27.641 -23.788 1.00 67.41  ? 5   G   C C2    1 
ATOM   7411 N  N2    . G   C 2 5   ? -7.157  -27.591 -24.205 1.00 70.39  ? 5   G   C N2    1 
ATOM   7412 N  N3    . G   C 2 5   ? -4.956  -27.080 -24.550 1.00 67.49  ? 5   G   C N3    1 
ATOM   7413 C  C4    . G   C 2 5   ? -3.720  -27.206 -24.012 1.00 64.60  ? 5   G   C C4    1 
ATOM   7414 P  P     . U   C 2 6   ? -1.602  -21.515 -24.585 1.00 80.90  ? 6   U   C P     1 
ATOM   7415 O  OP1   . U   C 2 6   ? -0.896  -20.280 -24.998 1.00 83.66  ? 6   U   C OP1   1 
ATOM   7416 O  OP2   . U   C 2 6   ? -1.272  -22.180 -23.300 1.00 76.23  ? 6   U   C OP2   1 
ATOM   7417 O  "O5'" . U   C 2 6   ? -3.182  -21.259 -24.602 1.00 84.30  ? 6   U   C "O5'" 1 
ATOM   7418 C  "C5'" . U   C 2 6   ? -3.889  -20.985 -25.818 1.00 88.16  ? 6   U   C "C5'" 1 
ATOM   7419 C  "C4'" . U   C 2 6   ? -5.375  -21.244 -25.633 1.00 89.80  ? 6   U   C "C4'" 1 
ATOM   7420 O  "O4'" . U   C 2 6   ? -5.623  -22.662 -25.462 1.00 85.93  ? 6   U   C "O4'" 1 
ATOM   7421 C  "C3'" . U   C 2 6   ? -5.978  -20.645 -24.368 1.00 90.29  ? 6   U   C "C3'" 1 
ATOM   7422 O  "O3'" . U   C 2 6   ? -6.229  -19.260 -24.513 1.00 95.33  ? 6   U   C "O3'" 1 
ATOM   7423 C  "C2'" . U   C 2 6   ? -7.241  -21.482 -24.199 1.00 89.96  ? 6   U   C "C2'" 1 
ATOM   7424 O  "O2'" . U   C 2 6   ? -8.273  -21.115 -25.100 1.00 95.18  ? 6   U   C "O2'" 1 
ATOM   7425 C  "C1'" . U   C 2 6   ? -6.682  -22.860 -24.539 1.00 85.29  ? 6   U   C "C1'" 1 
ATOM   7426 N  N1    . U   C 2 6   ? -6.192  -23.643 -23.345 1.00 80.53  ? 6   U   C N1    1 
ATOM   7427 C  C2    . U   C 2 6   ? -7.089  -24.458 -22.676 1.00 79.83  ? 6   U   C C2    1 
ATOM   7428 O  O2    . U   C 2 6   ? -8.261  -24.563 -23.004 1.00 82.60  ? 6   U   C O2    1 
ATOM   7429 N  N3    . U   C 2 6   ? -6.563  -25.144 -21.599 1.00 75.64  ? 6   U   C N3    1 
ATOM   7430 C  C4    . U   C 2 6   ? -5.260  -25.095 -21.131 1.00 72.71  ? 6   U   C C4    1 
ATOM   7431 O  O4    . U   C 2 6   ? -4.931  -25.761 -20.154 1.00 70.47  ? 6   U   C O4    1 
ATOM   7432 C  C5    . U   C 2 6   ? -4.385  -24.224 -21.874 1.00 73.79  ? 6   U   C C5    1 
ATOM   7433 C  C6    . U   C 2 6   ? -4.871  -23.549 -22.924 1.00 77.36  ? 6   U   C C6    1 
ATOM   7434 P  P     . A   C 2 7   ? -6.026  -18.310 -23.236 1.00 95.89  ? 7   A   C P     1 
ATOM   7435 O  OP1   . A   C 2 7   ? -6.057  -16.910 -23.722 1.00 100.25 ? 7   A   C OP1   1 
ATOM   7436 O  OP2   . A   C 2 7   ? -4.870  -18.805 -22.441 1.00 90.56  ? 7   A   C OP2   1 
ATOM   7437 O  "O5'" . A   C 2 7   ? -7.350  -18.583 -22.379 1.00 95.47  ? 7   A   C "O5'" 1 
ATOM   7438 C  "C5'" . A   C 2 7   ? -8.652  -18.291 -22.904 1.00 98.73  ? 7   A   C "C5'" 1 
ATOM   7439 C  "C4'" . A   C 2 7   ? -9.718  -18.839 -21.970 1.00 97.29  ? 7   A   C "C4'" 1 
ATOM   7440 O  "O4'" . A   C 2 7   ? -9.692  -20.294 -21.979 1.00 93.01  ? 7   A   C "O4'" 1 
ATOM   7441 C  "C3'" . A   C 2 7   ? -9.518  -18.485 -20.499 1.00 94.37  ? 7   A   C "C3'" 1 
ATOM   7442 O  "O3'" . A   C 2 7   ? -9.953  -17.166 -20.183 1.00 97.31  ? 7   A   C "O3'" 1 
ATOM   7443 C  "C2'" . A   C 2 7   ? -10.355 -19.558 -19.810 1.00 92.59  ? 7   A   C "C2'" 1 
ATOM   7444 O  "O2'" . A   C 2 7   ? -11.739 -19.253 -19.773 1.00 97.06  ? 7   A   C "O2'" 1 
ATOM   7445 C  "C1'" . A   C 2 7   ? -10.036 -20.774 -20.686 1.00 90.00  ? 7   A   C "C1'" 1 
ATOM   7446 N  N9    . A   C 2 7   ? -8.930  -21.547 -20.117 1.00 84.58  ? 7   A   C N9    1 
ATOM   7447 C  C8    . A   C 2 7   ? -7.585  -21.413 -20.351 1.00 82.17  ? 7   A   C C8    1 
ATOM   7448 N  N7    . A   C 2 7   ? -6.833  -22.253 -19.672 1.00 77.71  ? 7   A   C N7    1 
ATOM   7449 C  C5    . A   C 2 7   ? -7.749  -22.985 -18.937 1.00 77.50  ? 7   A   C C5    1 
ATOM   7450 C  C6    . A   C 2 7   ? -7.606  -24.037 -18.011 1.00 74.87  ? 7   A   C C6    1 
ATOM   7451 N  N6    . A   C 2 7   ? -6.423  -24.549 -17.660 1.00 71.77  ? 7   A   C N6    1 
ATOM   7452 N  N1    . A   C 2 7   ? -8.727  -24.544 -17.452 1.00 76.01  ? 7   A   C N1    1 
ATOM   7453 C  C2    . A   C 2 7   ? -9.918  -24.030 -17.791 1.00 80.01  ? 7   A   C C2    1 
ATOM   7454 N  N3    . A   C 2 7   ? -10.180 -23.046 -18.652 1.00 83.15  ? 7   A   C N3    1 
ATOM   7455 C  C4    . A   C 2 7   ? -9.044  -22.560 -19.192 1.00 81.85  ? 7   A   C C4    1 
ATOM   7456 P  P     . G   C 2 8   ? -9.204  -16.354 -19.016 1.00 96.17  ? 8   G   C P     1 
ATOM   7457 O  OP1   . G   C 2 8   ? -10.157 -15.328 -18.520 1.00 100.19 ? 8   G   C OP1   1 
ATOM   7458 O  OP2   . G   C 2 8   ? -7.883  -15.923 -19.530 1.00 95.19  ? 8   G   C OP2   1 
ATOM   7459 O  "O5'" . G   C 2 8   ? -8.908  -17.475 -17.904 1.00 90.16  ? 8   G   C "O5'" 1 
ATOM   7460 C  "C5'" . G   C 2 8   ? -9.204  -17.306 -16.531 1.00 87.65  ? 8   G   C "C5'" 1 
ATOM   7461 C  "C4'" . G   C 2 8   ? -10.232 -18.315 -16.042 1.00 86.59  ? 8   G   C "C4'" 1 
ATOM   7462 O  "O4'" . G   C 2 8   ? -10.126 -19.615 -16.690 1.00 84.92  ? 8   G   C "O4'" 1 
ATOM   7463 C  "C3'" . G   C 2 8   ? -10.094 -18.672 -14.575 1.00 83.55  ? 8   G   C "C3'" 1 
ATOM   7464 O  "O3'" . G   C 2 8   ? -10.583 -17.620 -13.775 1.00 85.96  ? 8   G   C "O3'" 1 
ATOM   7465 C  "C2'" . G   C 2 8   ? -10.964 -19.919 -14.511 1.00 83.15  ? 8   G   C "C2'" 1 
ATOM   7466 O  "O2'" . G   C 2 8   ? -12.354 -19.659 -14.595 1.00 87.60  ? 8   G   C "O2'" 1 
ATOM   7467 C  "C1'" . G   C 2 8   ? -10.453 -20.637 -15.759 1.00 81.22  ? 8   G   C "C1'" 1 
ATOM   7468 N  N9    . G   C 2 8   ? -9.255  -21.415 -15.446 1.00 76.10  ? 8   G   C N9    1 
ATOM   7469 C  C8    . G   C 2 8   ? -7.989  -21.226 -15.953 1.00 74.03  ? 8   G   C C8    1 
ATOM   7470 N  N7    . G   C 2 8   ? -7.100  -22.056 -15.481 1.00 70.43  ? 8   G   C N7    1 
ATOM   7471 C  C5    . G   C 2 8   ? -7.825  -22.847 -14.598 1.00 70.02  ? 8   G   C C5    1 
ATOM   7472 C  C6    . G   C 2 8   ? -7.397  -23.922 -13.784 1.00 66.83  ? 8   G   C C6    1 
ATOM   7473 O  O6    . G   C 2 8   ? -6.255  -24.388 -13.701 1.00 64.56  ? 8   G   C O6    1 
ATOM   7474 N  N1    . G   C 2 8   ? -8.439  -24.462 -13.025 1.00 67.97  ? 8   G   C N1    1 
ATOM   7475 C  C2    . G   C 2 8   ? -9.744  -24.013 -13.049 1.00 71.84  ? 8   G   C C2    1 
ATOM   7476 N  N2    . G   C 2 8   ? -10.616 -24.652 -12.253 1.00 72.88  ? 8   G   C N2    1 
ATOM   7477 N  N3    . G   C 2 8   ? -10.157 -23.001 -13.807 1.00 74.44  ? 8   G   C N3    1 
ATOM   7478 C  C4    . G   C 2 8   ? -9.153  -22.464 -14.556 1.00 73.45  ? 8   G   C C4    1 
ATOM   7479 P  P     . A   C 2 9   ? -9.751  -17.156 -12.491 1.00 83.57  ? 9   A   C P     1 
ATOM   7480 O  OP1   . A   C 2 9   ? -10.369 -15.897 -12.017 1.00 87.29  ? 9   A   C OP1   1 
ATOM   7481 O  OP2   . A   C 2 9   ? -8.299  -17.184 -12.790 1.00 80.51  ? 9   A   C OP2   1 
ATOM   7482 O  "O5'" . A   C 2 9   ? -10.062 -18.327 -11.447 1.00 80.56  ? 9   A   C "O5'" 1 
ATOM   7483 C  "C5'" . A   C 2 9   ? -11.397 -18.565 -11.000 1.00 81.72  ? 9   A   C "C5'" 1 
ATOM   7484 C  "C4'" . A   C 2 9   ? -11.439 -19.750 -10.056 1.00 78.08  ? 9   A   C "C4'" 1 
ATOM   7485 O  "O4'" . A   C 2 9   ? -11.117 -20.969 -10.780 1.00 75.66  ? 9   A   C "O4'" 1 
ATOM   7486 C  "C3'" . A   C 2 9   ? -10.431 -19.716 -8.915  1.00 73.55  ? 9   A   C "C3'" 1 
ATOM   7487 O  "O3'" . A   C 2 9   ? -10.876 -18.889 -7.841  1.00 74.13  ? 9   A   C "O3'" 1 
ATOM   7488 C  "C2'" . A   C 2 9   ? -10.383 -21.196 -8.552  1.00 71.25  ? 9   A   C "C2'" 1 
ATOM   7489 O  "O2'" . A   C 2 9   ? -11.488 -21.625 -7.775  1.00 73.07  ? 9   A   C "O2'" 1 
ATOM   7490 C  "C1'" . A   C 2 9   ? -10.368 -21.828 -9.944  1.00 71.44  ? 9   A   C "C1'" 1 
ATOM   7491 N  N9    . A   C 2 9   ? -9.005  -21.908 -10.464 1.00 68.41  ? 9   A   C N9    1 
ATOM   7492 C  C8    . A   C 2 9   ? -8.443  -21.133 -11.444 1.00 68.71  ? 9   A   C C8    1 
ATOM   7493 N  N7    . A   C 2 9   ? -7.190  -21.411 -11.697 1.00 65.71  ? 9   A   C N7    1 
ATOM   7494 C  C5    . A   C 2 9   ? -6.905  -22.439 -10.812 1.00 63.72  ? 9   A   C C5    1 
ATOM   7495 C  C6    . A   C 2 9   ? -5.731  -23.187 -10.573 1.00 60.54  ? 9   A   C C6    1 
ATOM   7496 N  N6    . A   C 2 9   ? -4.584  -22.993 -11.244 1.00 58.67  ? 9   A   C N6    1 
ATOM   7497 N  N1    . A   C 2 9   ? -5.790  -24.142 -9.612  1.00 59.32  ? 9   A   C N1    1 
ATOM   7498 C  C2    . A   C 2 9   ? -6.934  -24.338 -8.939  1.00 60.86  ? 9   A   C C2    1 
ATOM   7499 N  N3    . A   C 2 9   ? -8.095  -23.701 -9.082  1.00 63.44  ? 9   A   C N3    1 
ATOM   7500 C  C4    . A   C 2 9   ? -8.012  -22.758 -10.041 1.00 64.79  ? 9   A   C C4    1 
ATOM   7501 P  P     . U   C 2 10  ? -9.854  -18.041 -6.946  1.00 71.28  ? 10  U   C P     1 
ATOM   7502 O  OP1   . U   C 2 10  ? -10.633 -17.167 -6.057  1.00 74.84  ? 10  U   C OP1   1 
ATOM   7503 O  OP2   . U   C 2 10  ? -8.867  -17.381 -7.819  1.00 71.26  ? 10  U   C OP2   1 
ATOM   7504 O  "O5'" . U   C 2 10  ? -9.127  -19.154 -6.046  1.00 68.43  ? 10  U   C "O5'" 1 
ATOM   7505 C  "C5'" . U   C 2 10  ? -9.881  -19.924 -5.099  1.00 68.45  ? 10  U   C "C5'" 1 
ATOM   7506 C  "C4'" . U   C 2 10  ? -9.166  -21.179 -4.638  1.00 64.73  ? 10  U   C "C4'" 1 
ATOM   7507 O  "O4'" . U   C 2 10  ? -8.700  -21.930 -5.786  1.00 63.23  ? 10  U   C "O4'" 1 
ATOM   7508 C  "C3'" . U   C 2 10  ? -7.882  -20.944 -3.870  1.00 62.21  ? 10  U   C "C3'" 1 
ATOM   7509 O  "O3'" . U   C 2 10  ? -8.103  -20.551 -2.528  1.00 64.78  ? 10  U   C "O3'" 1 
ATOM   7510 C  "C2'" . U   C 2 10  ? -7.222  -22.313 -3.976  1.00 59.54  ? 10  U   C "C2'" 1 
ATOM   7511 O  "O2'" . U   C 2 10  ? -7.787  -23.332 -3.170  1.00 59.56  ? 10  U   C "O2'" 1 
ATOM   7512 C  "C1'" . U   C 2 10  ? -7.485  -22.588 -5.452  1.00 59.16  ? 10  U   C "C1'" 1 
ATOM   7513 N  N1    . U   C 2 10  ? -6.338  -22.167 -6.345  1.00 56.25  ? 10  U   C N1    1 
ATOM   7514 C  C2    . U   C 2 10  ? -5.141  -22.875 -6.259  1.00 53.94  ? 10  U   C C2    1 
ATOM   7515 O  O2    . U   C 2 10  ? -4.966  -23.810 -5.494  1.00 51.90  ? 10  U   C O2    1 
ATOM   7516 N  N3    . U   C 2 10  ? -4.141  -22.444 -7.108  1.00 52.65  ? 10  U   C N3    1 
ATOM   7517 C  C4    . U   C 2 10  ? -4.226  -21.401 -8.018  1.00 54.14  ? 10  U   C C4    1 
ATOM   7518 O  O4    . U   C 2 10  ? -3.255  -21.134 -8.711  1.00 52.43  ? 10  U   C O4    1 
ATOM   7519 C  C5    . U   C 2 10  ? -5.501  -20.707 -8.054  1.00 56.14  ? 10  U   C C5    1 
ATOM   7520 C  C6    . U   C 2 10  ? -6.485  -21.112 -7.236  1.00 57.20  ? 10  U   C C6    1 
ATOM   7521 P  P     . G   C 2 11  ? -7.011  -19.644 -1.785  1.00 63.73  ? 11  G   C P     1 
ATOM   7522 O  OP1   . G   C 2 11  ? -7.716  -18.961 -0.670  1.00 65.90  ? 11  G   C OP1   1 
ATOM   7523 O  OP2   . G   C 2 11  ? -6.269  -18.849 -2.789  1.00 62.80  ? 11  G   C OP2   1 
ATOM   7524 O  "O5'" . G   C 2 11  ? -5.964  -20.697 -1.190  1.00 61.12  ? 11  G   C "O5'" 1 
ATOM   7525 C  "C5'" . G   C 2 11  ? -6.376  -21.747 -0.313  1.00 61.09  ? 11  G   C "C5'" 1 
ATOM   7526 C  "C4'" . G   C 2 11  ? -5.259  -22.761 -0.165  1.00 57.94  ? 11  G   C "C4'" 1 
ATOM   7527 O  "O4'" . G   C 2 11  ? -4.953  -23.331 -1.464  1.00 56.50  ? 11  G   C "O4'" 1 
ATOM   7528 C  "C3'" . G   C 2 11  ? -3.924  -22.190 0.291   1.00 56.34  ? 11  G   C "C3'" 1 
ATOM   7529 O  "O3'" . G   C 2 11  ? -3.881  -21.943 1.700   1.00 59.43  ? 11  G   C "O3'" 1 
ATOM   7530 C  "C2'" . G   C 2 11  ? -2.966  -23.288 -0.173  1.00 53.06  ? 11  G   C "C2'" 1 
ATOM   7531 O  "O2'" . G   C 2 11  ? -2.957  -24.457 0.630   1.00 52.03  ? 11  G   C "O2'" 1 
ATOM   7532 C  "C1'" . G   C 2 11  ? -3.550  -23.567 -1.556  1.00 51.88  ? 11  G   C "C1'" 1 
ATOM   7533 N  N9    . G   C 2 11  ? -2.930  -22.729 -2.591  1.00 50.36  ? 11  G   C N9    1 
ATOM   7534 C  C8    . G   C 2 11  ? -3.463  -21.633 -3.233  1.00 50.86  ? 11  G   C C8    1 
ATOM   7535 N  N7    . G   C 2 11  ? -2.660  -21.093 -4.109  1.00 49.86  ? 11  G   C N7    1 
ATOM   7536 C  C5    . G   C 2 11  ? -1.511  -21.877 -4.055  1.00 49.11  ? 11  G   C C5    1 
ATOM   7537 C  C6    . G   C 2 11  ? -0.287  -21.784 -4.786  1.00 47.86  ? 11  G   C C6    1 
ATOM   7538 O  O6    . G   C 2 11  ? 0.026   -20.948 -5.650  1.00 47.04  ? 11  G   C O6    1 
ATOM   7539 N  N1    . G   C 2 11  ? 0.619   -22.795 -4.424  1.00 46.18  ? 11  G   C N1    1 
ATOM   7540 C  C2    . G   C 2 11  ? 0.369   -23.766 -3.470  1.00 45.90  ? 11  G   C C2    1 
ATOM   7541 N  N2    . G   C 2 11  ? 1.348   -24.653 -3.234  1.00 44.49  ? 11  G   C N2    1 
ATOM   7542 N  N3    . G   C 2 11  ? -0.772  -23.858 -2.787  1.00 46.10  ? 11  G   C N3    1 
ATOM   7543 C  C4    . G   C 2 11  ? -1.665  -22.894 -3.126  1.00 48.49  ? 11  G   C C4    1 
ATOM   7544 P  P     . G   C 2 12  ? -2.917  -20.808 2.295   1.00 61.85  ? 12  G   C P     1 
ATOM   7545 O  OP1   . G   C 2 12  ? -3.246  -20.675 3.730   1.00 63.51  ? 12  G   C OP1   1 
ATOM   7546 O  OP2   . G   C 2 12  ? -2.963  -19.627 1.409   1.00 63.07  ? 12  G   C OP2   1 
ATOM   7547 O  "O5'" . G   C 2 12  ? -1.433  -21.388 2.155   1.00 58.15  ? 12  G   C "O5'" 1 
ATOM   7548 C  "C5'" . G   C 2 12  ? -1.029  -22.605 2.769   1.00 57.29  ? 12  G   C "C5'" 1 
ATOM   7549 C  "C4'" . G   C 2 12  ? 0.295   -23.049 2.177   1.00 54.23  ? 12  G   C "C4'" 1 
ATOM   7550 O  "O4'" . G   C 2 12  ? 0.178   -23.245 0.742   1.00 52.80  ? 12  G   C "O4'" 1 
ATOM   7551 C  "C3'" . G   C 2 12  ? 1.407   -22.017 2.280   1.00 53.61  ? 12  G   C "C3'" 1 
ATOM   7552 O  "O3'" . G   C 2 12  ? 1.975   -21.996 3.586   1.00 56.25  ? 12  G   C "O3'" 1 
ATOM   7553 C  "C2'" . G   C 2 12  ? 2.366   -22.524 1.208   1.00 50.85  ? 12  G   C "C2'" 1 
ATOM   7554 O  "O2'" . G   C 2 12  ? 3.109   -23.660 1.603   1.00 50.86  ? 12  G   C "O2'" 1 
ATOM   7555 C  "C1'" . G   C 2 12  ? 1.392   -22.892 0.092   1.00 49.29  ? 12  G   C "C1'" 1 
ATOM   7556 N  N9    . G   C 2 12  ? 1.181   -21.796 -0.864  1.00 48.90  ? 12  G   C N9    1 
ATOM   7557 C  C8    . G   C 2 12  ? 0.069   -20.995 -0.996  1.00 49.49  ? 12  G   C C8    1 
ATOM   7558 N  N7    . G   C 2 12  ? 0.168   -20.095 -1.938  1.00 49.48  ? 12  G   C N7    1 
ATOM   7559 C  C5    . G   C 2 12  ? 1.436   -20.295 -2.467  1.00 49.20  ? 12  G   C C5    1 
ATOM   7560 C  C6    . G   C 2 12  ? 2.117   -19.620 -3.518  1.00 49.23  ? 12  G   C C6    1 
ATOM   7561 O  O6    . G   C 2 12  ? 1.713   -18.675 -4.209  1.00 50.41  ? 12  G   C O6    1 
ATOM   7562 N  N1    . G   C 2 12  ? 3.395   -20.137 -3.746  1.00 47.95  ? 12  G   C N1    1 
ATOM   7563 C  C2    . G   C 2 12  ? 3.952   -21.179 -3.044  1.00 46.78  ? 12  G   C C2    1 
ATOM   7564 N  N2    . G   C 2 12  ? 5.194   -21.540 -3.394  1.00 46.90  ? 12  G   C N2    1 
ATOM   7565 N  N3    . G   C 2 12  ? 3.328   -21.826 -2.065  1.00 47.24  ? 12  G   C N3    1 
ATOM   7566 C  C4    . G   C 2 12  ? 2.077   -21.337 -1.817  1.00 49.03  ? 12  G   C C4    1 
ATOM   7567 P  P     . U   C 2 13  ? 2.692   -20.673 4.157   1.00 57.04  ? 13  U   C P     1 
ATOM   7568 O  OP1   . U   C 2 13  ? 3.213   -20.989 5.506   1.00 58.79  ? 13  U   C OP1   1 
ATOM   7569 O  OP2   . U   C 2 13  ? 1.767   -19.533 3.965   1.00 57.29  ? 13  U   C OP2   1 
ATOM   7570 O  "O5'" . U   C 2 13  ? 3.952   -20.467 3.199   1.00 55.25  ? 13  U   C "O5'" 1 
ATOM   7571 C  "C5'" . U   C 2 13  ? 5.053   -21.370 3.257   1.00 54.93  ? 13  U   C "C5'" 1 
ATOM   7572 C  "C4'" . U   C 2 13  ? 6.136   -20.926 2.300   1.00 54.56  ? 13  U   C "C4'" 1 
ATOM   7573 O  "O4'" . U   C 2 13  ? 5.636   -21.012 0.942   1.00 53.99  ? 13  U   C "O4'" 1 
ATOM   7574 C  "C3'" . U   C 2 13  ? 6.552   -19.467 2.442   1.00 55.53  ? 13  U   C "C3'" 1 
ATOM   7575 O  "O3'" . U   C 2 13  ? 7.533   -19.275 3.467   1.00 57.70  ? 13  U   C "O3'" 1 
ATOM   7576 C  "C2'" . U   C 2 13  ? 7.102   -19.152 1.059   1.00 54.25  ? 13  U   C "C2'" 1 
ATOM   7577 O  "O2'" . U   C 2 13  ? 8.410   -19.648 0.875   1.00 55.24  ? 13  U   C "O2'" 1 
ATOM   7578 C  "C1'" . U   C 2 13  ? 6.105   -19.905 0.181   1.00 53.22  ? 13  U   C "C1'" 1 
ATOM   7579 N  N1    . U   C 2 13  ? 4.974   -19.020 -0.311  1.00 52.46  ? 13  U   C N1    1 
ATOM   7580 C  C2    . U   C 2 13  ? 5.208   -18.203 -1.410  1.00 52.70  ? 13  U   C C2    1 
ATOM   7581 O  O2    . U   C 2 13  ? 6.271   -18.154 -2.005  1.00 52.72  ? 13  U   C O2    1 
ATOM   7582 N  N3    . U   C 2 13  ? 4.142   -17.426 -1.795  1.00 53.09  ? 13  U   C N3    1 
ATOM   7583 C  C4    . U   C 2 13  ? 2.891   -17.384 -1.198  1.00 54.15  ? 13  U   C C4    1 
ATOM   7584 O  O4    . U   C 2 13  ? 2.034   -16.632 -1.652  1.00 55.84  ? 13  U   C O4    1 
ATOM   7585 C  C5    . U   C 2 13  ? 2.717   -18.256 -0.058  1.00 52.60  ? 13  U   C C5    1 
ATOM   7586 C  C6    . U   C 2 13  ? 3.744   -19.024 0.328   1.00 51.97  ? 13  U   C C6    1 
ATOM   7587 P  P     . U   C 2 14  ? 7.360   -18.023 4.448   1.00 59.31  ? 14  U   C P     1 
ATOM   7588 O  OP1   . U   C 2 14  ? 8.404   -18.151 5.494   1.00 61.49  ? 14  U   C OP1   1 
ATOM   7589 O  OP2   . U   C 2 14  ? 5.939   -17.893 4.838   1.00 57.61  ? 14  U   C OP2   1 
ATOM   7590 O  "O5'" . U   C 2 14  ? 7.688   -16.782 3.492   1.00 59.21  ? 14  U   C "O5'" 1 
ATOM   7591 C  "C5'" . U   C 2 14  ? 8.963   -16.604 2.885   1.00 59.23  ? 14  U   C "C5'" 1 
ATOM   7592 C  "C4'" . U   C 2 14  ? 8.916   -15.382 1.991   1.00 59.78  ? 14  U   C "C4'" 1 
ATOM   7593 O  "O4'" . U   C 2 14  ? 8.012   -15.639 0.884   1.00 59.29  ? 14  U   C "O4'" 1 
ATOM   7594 C  "C3'" . U   C 2 14  ? 8.342   -14.119 2.627   1.00 60.20  ? 14  U   C "C3'" 1 
ATOM   7595 O  "O3'" . U   C 2 14  ? 9.277   -13.447 3.471   1.00 61.43  ? 14  U   C "O3'" 1 
ATOM   7596 C  "C2'" . U   C 2 14  ? 7.966   -13.316 1.387   1.00 60.71  ? 14  U   C "C2'" 1 
ATOM   7597 O  "O2'" . U   C 2 14  ? 9.070   -12.689 0.760   1.00 61.27  ? 14  U   C "O2'" 1 
ATOM   7598 C  "C1'" . U   C 2 14  ? 7.382   -14.425 0.502   1.00 59.14  ? 14  U   C "C1'" 1 
ATOM   7599 N  N1    . U   C 2 14  ? 5.869   -14.518 0.602   1.00 58.16  ? 14  U   C N1    1 
ATOM   7600 C  C2    . U   C 2 14  ? 5.111   -13.805 -0.309  1.00 59.11  ? 14  U   C C2    1 
ATOM   7601 O  O2    . U   C 2 14  ? 5.592   -13.119 -1.196  1.00 60.59  ? 14  U   C O2    1 
ATOM   7602 N  N3    . U   C 2 14  ? 3.749   -13.924 -0.157  1.00 58.86  ? 14  U   C N3    1 
ATOM   7603 C  C4    . U   C 2 14  ? 3.075   -14.663 0.803   1.00 58.49  ? 14  U   C C4    1 
ATOM   7604 O  O4    . U   C 2 14  ? 1.843   -14.668 0.805   1.00 59.01  ? 14  U   C O4    1 
ATOM   7605 C  C5    . U   C 2 14  ? 3.928   -15.383 1.725   1.00 56.92  ? 14  U   C C5    1 
ATOM   7606 C  C6    . U   C 2 14  ? 5.261   -15.281 1.595   1.00 56.67  ? 14  U   C C6    1 
ATOM   7607 P  P     . C   C 2 15  ? 8.786   -12.754 4.826   1.00 62.26  ? 15  C   C P     1 
ATOM   7608 O  OP1   . C   C 2 15  ? 9.998   -12.304 5.548   1.00 65.23  ? 15  C   C OP1   1 
ATOM   7609 O  OP2   . C   C 2 15  ? 7.805   -13.635 5.511   1.00 62.42  ? 15  C   C OP2   1 
ATOM   7610 O  "O5'" . C   C 2 15  ? 7.974   -11.478 4.297   1.00 62.80  ? 15  C   C "O5'" 1 
ATOM   7611 C  "C5'" . C   C 2 15  ? 7.572   -10.442 5.190   1.00 61.98  ? 15  C   C "C5'" 1 
ATOM   7612 C  "C4'" . C   C 2 15  ? 7.094   -9.199  4.451   1.00 62.96  ? 15  C   C "C4'" 1 
ATOM   7613 O  "O4'" . C   C 2 15  ? 8.222   -8.412  3.978   1.00 63.93  ? 15  C   C "O4'" 1 
ATOM   7614 C  "C3'" . C   C 2 15  ? 6.289   -9.404  3.172   1.00 62.15  ? 15  C   C "C3'" 1 
ATOM   7615 O  "O3'" . C   C 2 15  ? 4.958   -9.835  3.451   1.00 61.19  ? 15  C   C "O3'" 1 
ATOM   7616 C  "C2'" . C   C 2 15  ? 6.322   -7.983  2.623   1.00 64.57  ? 15  C   C "C2'" 1 
ATOM   7617 O  "O2'" . C   C 2 15  ? 5.400   -7.133  3.287   1.00 63.52  ? 15  C   C "O2'" 1 
ATOM   7618 C  "C1'" . C   C 2 15  ? 7.777   -7.576  2.919   1.00 66.06  ? 15  C   C "C1'" 1 
ATOM   7619 N  N1    . C   C 2 15  ? 8.703   -7.645  1.712   1.00 67.76  ? 15  C   C N1    1 
ATOM   7620 C  C2    . C   C 2 15  ? 9.730   -8.612  1.568   1.00 67.07  ? 15  C   C C2    1 
ATOM   7621 O  O2    . C   C 2 15  ? 9.936   -9.467  2.435   1.00 66.02  ? 15  C   C O2    1 
ATOM   7622 N  N3    . C   C 2 15  ? 10.508  -8.604  0.455   1.00 68.21  ? 15  C   C N3    1 
ATOM   7623 C  C4    . C   C 2 15  ? 10.312  -7.695  -0.501  1.00 70.88  ? 15  C   C C4    1 
ATOM   7624 N  N4    . C   C 2 15  ? 11.111  -7.743  -1.577  1.00 72.94  ? 15  C   C N4    1 
ATOM   7625 C  C5    . C   C 2 15  ? 9.281   -6.707  -0.388  1.00 72.35  ? 15  C   C C5    1 
ATOM   7626 C  C6    . C   C 2 15  ? 8.517   -6.718  0.717   1.00 70.44  ? 15  C   C C6    1 
ATOM   7627 P  P     . A   C 2 16  ? 4.249   -10.979 2.578   1.00 59.93  ? 16  A   C P     1 
ATOM   7628 O  OP1   . A   C 2 16  ? 2.862   -11.084 3.084   1.00 60.95  ? 16  A   C OP1   1 
ATOM   7629 O  OP2   . A   C 2 16  ? 5.092   -12.200 2.573   1.00 58.43  ? 16  A   C OP2   1 
ATOM   7630 O  "O5'" . A   C 2 16  ? 4.231   -10.397 1.078   1.00 61.00  ? 16  A   C "O5'" 1 
ATOM   7631 C  "C5'" . A   C 2 16  ? 3.407   -9.284  0.707   1.00 63.30  ? 16  A   C "C5'" 1 
ATOM   7632 C  "C4'" . A   C 2 16  ? 3.749   -8.745  -0.675  1.00 65.66  ? 16  A   C "C4'" 1 
ATOM   7633 O  "O4'" . A   C 2 16  ? 5.103   -8.226  -0.701  1.00 65.83  ? 16  A   C "O4'" 1 
ATOM   7634 C  "C3'" . A   C 2 16  ? 3.704   -9.772  -1.798  1.00 65.82  ? 16  A   C "C3'" 1 
ATOM   7635 O  "O3'" . A   C 2 16  ? 2.374   -9.868  -2.310  1.00 69.10  ? 16  A   C "O3'" 1 
ATOM   7636 C  "C2'" . A   C 2 16  ? 4.684   -9.208  -2.828  1.00 66.80  ? 16  A   C "C2'" 1 
ATOM   7637 O  "O2'" . A   C 2 16  ? 4.126   -8.296  -3.753  1.00 69.48  ? 16  A   C "O2'" 1 
ATOM   7638 C  "C1'" . A   C 2 16  ? 5.708   -8.497  -1.953  1.00 66.57  ? 16  A   C "C1'" 1 
ATOM   7639 N  N9    . A   C 2 16  ? 6.905   -9.325  -1.800  1.00 64.64  ? 16  A   C N9    1 
ATOM   7640 C  C8    . A   C 2 16  ? 7.240   -10.132 -0.748  1.00 62.24  ? 16  A   C C8    1 
ATOM   7641 N  N7    . A   C 2 16  ? 8.381   -10.756 -0.911  1.00 61.77  ? 16  A   C N7    1 
ATOM   7642 C  C5    . A   C 2 16  ? 8.827   -10.339 -2.158  1.00 64.06  ? 16  A   C C5    1 
ATOM   7643 C  C6    . A   C 2 16  ? 9.983   -10.638 -2.925  1.00 64.98  ? 16  A   C C6    1 
ATOM   7644 N  N6    . A   C 2 16  ? 10.953  -11.473 -2.524  1.00 64.06  ? 16  A   C N6    1 
ATOM   7645 N  N1    . A   C 2 16  ? 10.107  -10.047 -4.137  1.00 67.20  ? 16  A   C N1    1 
ATOM   7646 C  C2    . A   C 2 16  ? 9.144   -9.210  -4.551  1.00 68.52  ? 16  A   C C2    1 
ATOM   7647 N  N3    . A   C 2 16  ? 8.022   -8.855  -3.922  1.00 67.84  ? 16  A   C N3    1 
ATOM   7648 C  C4    . A   C 2 16  ? 7.922   -9.456  -2.721  1.00 65.50  ? 16  A   C C4    1 
ATOM   7649 P  P     . A   C 2 17  ? 1.745   -11.258 -2.786  1.00 68.79  ? 17  A   C P     1 
ATOM   7650 O  OP1   . A   C 2 17  ? 0.360   -10.970 -3.222  1.00 71.36  ? 17  A   C OP1   1 
ATOM   7651 O  OP2   . A   C 2 17  ? 1.985   -12.268 -1.725  1.00 66.27  ? 17  A   C OP2   1 
ATOM   7652 O  "O5'" . A   C 2 17  ? 2.632   -11.642 -4.064  1.00 69.66  ? 17  A   C "O5'" 1 
ATOM   7653 C  "C5'" . A   C 2 17  ? 2.569   -10.867 -5.261  1.00 74.18  ? 17  A   C "C5'" 1 
ATOM   7654 C  "C4'" . A   C 2 17  ? 2.514   -11.789 -6.463  1.00 75.12  ? 17  A   C "C4'" 1 
ATOM   7655 O  "O4'" . A   C 2 17  ? 3.638   -12.698 -6.412  1.00 72.87  ? 17  A   C "O4'" 1 
ATOM   7656 C  "C3'" . A   C 2 17  ? 1.271   -12.669 -6.559  1.00 75.76  ? 17  A   C "C3'" 1 
ATOM   7657 O  "O3'" . A   C 2 17  ? 0.844   -12.716 -7.912  1.00 80.70  ? 17  A   C "O3'" 1 
ATOM   7658 C  "C2'" . A   C 2 17  ? 1.727   -14.047 -6.081  1.00 71.85  ? 17  A   C "C2'" 1 
ATOM   7659 O  "O2'" . A   C 2 17  ? 1.006   -15.101 -6.697  1.00 70.40  ? 17  A   C "O2'" 1 
ATOM   7660 C  "C1'" . A   C 2 17  ? 3.193   -14.042 -6.522  1.00 70.76  ? 17  A   C "C1'" 1 
ATOM   7661 N  N9    . A   C 2 17  ? 4.119   -14.855 -5.730  1.00 68.14  ? 17  A   C N9    1 
ATOM   7662 C  C8    . A   C 2 17  ? 3.903   -15.434 -4.508  1.00 66.40  ? 17  A   C C8    1 
ATOM   7663 N  N7    . A   C 2 17  ? 4.934   -16.092 -4.039  1.00 64.74  ? 17  A   C N7    1 
ATOM   7664 C  C5    . A   C 2 17  ? 5.899   -15.933 -5.017  1.00 65.85  ? 17  A   C C5    1 
ATOM   7665 C  C6    . A   C 2 17  ? 7.233   -16.396 -5.126  1.00 65.71  ? 17  A   C C6    1 
ATOM   7666 N  N6    . A   C 2 17  ? 7.827   -17.143 -4.186  1.00 64.30  ? 17  A   C N6    1 
ATOM   7667 N  N1    . A   C 2 17  ? 7.929   -16.055 -6.239  1.00 67.27  ? 17  A   C N1    1 
ATOM   7668 C  C2    . A   C 2 17  ? 7.330   -15.307 -7.184  1.00 68.87  ? 17  A   C C2    1 
ATOM   7669 N  N3    . A   C 2 17  ? 6.087   -14.816 -7.189  1.00 69.31  ? 17  A   C N3    1 
ATOM   7670 C  C4    . A   C 2 17  ? 5.417   -15.169 -6.069  1.00 67.68  ? 17  A   C C4    1 
ATOM   7671 P  P     . G   C 2 18  ? -0.383  -11.817 -8.405  1.00 86.60  ? 18  G   C P     1 
ATOM   7672 O  OP1   . G   C 2 18  ? 0.180   -10.563 -8.965  1.00 89.05  ? 18  G   C OP1   1 
ATOM   7673 O  OP2   . G   C 2 18  ? -1.374  -11.752 -7.304  1.00 86.30  ? 18  G   C OP2   1 
ATOM   7674 O  "O5'" . G   C 2 18  ? -1.000  -12.724 -9.577  1.00 88.20  ? 18  G   C "O5'" 1 
ATOM   7675 C  "C5'" . G   C 2 18  ? -0.690  -12.419 -10.920 1.00 93.05  ? 18  G   C "C5'" 1 
ATOM   7676 C  "C4'" . G   C 2 18  ? -0.449  -13.671 -11.736 1.00 93.50  ? 18  G   C "C4'" 1 
ATOM   7677 O  "O4'" . G   C 2 18  ? -0.499  -13.272 -13.127 1.00 97.81  ? 18  G   C "O4'" 1 
ATOM   7678 C  "C3'" . G   C 2 18  ? 0.896   -14.366 -11.514 1.00 91.64  ? 18  G   C "C3'" 1 
ATOM   7679 O  "O3'" . G   C 2 18  ? 0.705   -15.628 -10.819 1.00 88.27  ? 18  G   C "O3'" 1 
ATOM   7680 C  "C2'" . G   C 2 18  ? 1.477   -14.534 -12.928 1.00 93.78  ? 18  G   C "C2'" 1 
ATOM   7681 O  "O2'" . G   C 2 18  ? 1.247   -15.819 -13.482 1.00 92.38  ? 18  G   C "O2'" 1 
ATOM   7682 C  "C1'" . G   C 2 18  ? 0.743   -13.492 -13.769 1.00 98.81  ? 18  G   C "C1'" 1 
ATOM   7683 N  N9    . G   C 2 18  ? 1.424   -12.207 -13.987 1.00 102.17 ? 18  G   C N9    1 
ATOM   7684 C  C8    . G   C 2 18  ? 2.019   -11.389 -13.050 1.00 102.53 ? 18  G   C C8    1 
ATOM   7685 N  N7    . G   C 2 18  ? 2.537   -10.300 -13.550 1.00 105.98 ? 18  G   C N7    1 
ATOM   7686 C  C5    . G   C 2 18  ? 2.268   -10.391 -14.913 1.00 108.55 ? 18  G   C C5    1 
ATOM   7687 C  C6    . G   C 2 18  ? 2.586   -9.499  -15.976 1.00 112.79 ? 18  G   C C6    1 
ATOM   7688 O  O6    . G   C 2 18  ? 3.189   -8.417  -15.913 1.00 115.59 ? 18  G   C O6    1 
ATOM   7689 N  N1    . G   C 2 18  ? 2.131   -9.961  -17.214 1.00 114.12 ? 18  G   C N1    1 
ATOM   7690 C  C2    . G   C 2 18  ? 1.450   -11.144 -17.405 1.00 111.45 ? 18  G   C C2    1 
ATOM   7691 N  N2    . G   C 2 18  ? 1.094   -11.422 -18.669 1.00 113.51 ? 18  G   C N2    1 
ATOM   7692 N  N3    . G   C 2 18  ? 1.146   -11.991 -16.420 1.00 107.56 ? 18  G   C N3    1 
ATOM   7693 C  C4    . G   C 2 18  ? 1.582   -11.558 -15.200 1.00 106.24 ? 18  G   C C4    1 
ATOM   7694 P  P     . U   C 2 19  ? 1.924   -16.497 -10.211 1.00 84.66  ? 19  U   C P     1 
ATOM   7695 O  OP1   . U   C 2 19  ? 1.381   -17.748 -9.633  1.00 82.08  ? 19  U   C OP1   1 
ATOM   7696 O  OP2   . U   C 2 19  ? 2.735   -15.588 -9.363  1.00 84.99  ? 19  U   C OP2   1 
ATOM   7697 O  "O5'" . U   C 2 19  ? 2.751   -16.901 -11.526 1.00 83.84  ? 19  U   C "O5'" 1 
ATOM   7698 C  "C5'" . U   C 2 19  ? 4.107   -17.309 -11.456 1.00 80.93  ? 19  U   C "C5'" 1 
ATOM   7699 C  "C4'" . U   C 2 19  ? 5.034   -16.406 -12.255 1.00 81.61  ? 19  U   C "C4'" 1 
ATOM   7700 O  "O4'" . U   C 2 19  ? 4.636   -15.014 -12.152 1.00 84.50  ? 19  U   C "O4'" 1 
ATOM   7701 C  "C3'" . U   C 2 19  ? 6.475   -16.497 -11.766 1.00 79.42  ? 19  U   C "C3'" 1 
ATOM   7702 O  "O3'" . U   C 2 19  ? 7.288   -17.161 -12.749 1.00 76.23  ? 19  U   C "O3'" 1 
ATOM   7703 C  "C2'" . U   C 2 19  ? 6.896   -15.051 -11.480 1.00 83.00  ? 19  U   C "C2'" 1 
ATOM   7704 O  "O2'" . U   C 2 19  ? 8.148   -14.708 -12.043 1.00 85.52  ? 19  U   C "O2'" 1 
ATOM   7705 C  "C1'" . U   C 2 19  ? 5.782   -14.196 -12.091 1.00 86.56  ? 19  U   C "C1'" 1 
ATOM   7706 N  N1    . U   C 2 19  ? 5.453   -12.979 -11.274 1.00 88.73  ? 19  U   C N1    1 
ATOM   7707 C  C2    . U   C 2 19  ? 5.410   -11.713 -11.853 1.00 92.77  ? 19  U   C C2    1 
ATOM   7708 O  O2    . U   C 2 19  ? 5.622   -11.493 -13.035 1.00 95.23  ? 19  U   C O2    1 
ATOM   7709 N  N3    . U   C 2 19  ? 5.099   -10.685 -10.982 1.00 93.97  ? 19  U   C N3    1 
ATOM   7710 C  C4    . U   C 2 19  ? 4.836   -10.793 -9.619  1.00 91.63  ? 19  U   C C4    1 
ATOM   7711 O  O4    . U   C 2 19  ? 4.573   -9.796  -8.947  1.00 92.79  ? 19  U   C O4    1 
ATOM   7712 C  C5    . U   C 2 19  ? 4.906   -12.136 -9.100  1.00 88.06  ? 19  U   C C5    1 
ATOM   7713 C  C6    . U   C 2 19  ? 5.200   -13.149 -9.922  1.00 86.98  ? 19  U   C C6    1 
ATOM   7714 P  P     . C   C 2 20  ? 7.438   -18.766 -12.792 1.00 71.01  ? 20  C   C P     1 
ATOM   7715 O  OP1   . C   C 2 20  ? 8.542   -19.068 -13.736 1.00 71.94  ? 20  C   C OP1   1 
ATOM   7716 O  OP2   . C   C 2 20  ? 6.111   -19.384 -13.028 1.00 69.70  ? 20  C   C OP2   1 
ATOM   7717 O  "O5'" . C   C 2 20  ? 7.881   -19.150 -11.293 1.00 65.92  ? 20  C   C "O5'" 1 
ATOM   7718 C  "C5'" . C   C 2 20  ? 9.261   -19.274 -10.923 1.00 61.43  ? 20  C   C "C5'" 1 
ATOM   7719 C  "C4'" . C   C 2 20  ? 9.450   -19.877 -9.541  1.00 56.37  ? 20  C   C "C4'" 1 
ATOM   7720 O  "O4'" . C   C 2 20  ? 9.004   -18.932 -8.536  1.00 55.08  ? 20  C   C "O4'" 1 
ATOM   7721 C  "C3'" . C   C 2 20  ? 8.649   -21.141 -9.227  1.00 52.46  ? 20  C   C "C3'" 1 
ATOM   7722 O  "O3'" . C   C 2 20  ? 9.273   -22.303 -9.720  1.00 50.05  ? 20  C   C "O3'" 1 
ATOM   7723 C  "C2'" . C   C 2 20  ? 8.635   -21.123 -7.702  1.00 51.70  ? 20  C   C "C2'" 1 
ATOM   7724 O  "O2'" . C   C 2 20  ? 9.844   -21.578 -7.121  1.00 50.53  ? 20  C   C "O2'" 1 
ATOM   7725 C  "C1'" . C   C 2 20  ? 8.430   -19.633 -7.441  1.00 52.17  ? 20  C   C "C1'" 1 
ATOM   7726 N  N1    . C   C 2 20  ? 6.978   -19.209 -7.247  1.00 52.07  ? 20  C   C N1    1 
ATOM   7727 C  C2    . C   C 2 20  ? 6.278   -19.574 -6.076  1.00 49.86  ? 20  C   C C2    1 
ATOM   7728 O  O2    . C   C 2 20  ? 6.836   -20.248 -5.205  1.00 47.83  ? 20  C   C O2    1 
ATOM   7729 N  N3    . C   C 2 20  ? 4.988   -19.162 -5.924  1.00 50.42  ? 20  C   C N3    1 
ATOM   7730 C  C4    . C   C 2 20  ? 4.393   -18.420 -6.869  1.00 51.64  ? 20  C   C C4    1 
ATOM   7731 N  N4    . C   C 2 20  ? 3.124   -18.051 -6.668  1.00 52.37  ? 20  C   C N4    1 
ATOM   7732 C  C5    . C   C 2 20  ? 5.077   -18.036 -8.063  1.00 52.69  ? 20  C   C C5    1 
ATOM   7733 C  C6    . C   C 2 20  ? 6.350   -18.442 -8.204  1.00 52.92  ? 20  C   C C6    1 
ATOM   7734 P  P     . C   C 2 21  ? 8.379   -23.567 -10.129 1.00 48.41  ? 21  C   C P     1 
ATOM   7735 O  OP1   . C   C 2 21  ? 9.224   -24.541 -10.849 1.00 49.63  ? 21  C   C OP1   1 
ATOM   7736 O  OP2   . C   C 2 21  ? 7.143   -23.078 -10.778 1.00 49.10  ? 21  C   C OP2   1 
ATOM   7737 O  "O5'" . C   C 2 21  ? 7.983   -24.175 -8.704  1.00 44.06  ? 21  C   C "O5'" 1 
ATOM   7738 C  "C5'" . C   C 2 21  ? 8.969   -24.696 -7.816  1.00 41.42  ? 21  C   C "C5'" 1 
ATOM   7739 C  "C4'" . C   C 2 21  ? 8.272   -25.242 -6.590  1.00 38.96  ? 21  C   C "C4'" 1 
ATOM   7740 O  "O4'" . C   C 2 21  ? 7.571   -24.161 -5.923  1.00 38.13  ? 21  C   C "O4'" 1 
ATOM   7741 C  "C3'" . C   C 2 21  ? 7.183   -26.257 -6.898  1.00 36.09  ? 21  C   C "C3'" 1 
ATOM   7742 O  "O3'" . C   C 2 21  ? 7.740   -27.562 -7.002  1.00 36.02  ? 21  C   C "O3'" 1 
ATOM   7743 C  "C2'" . C   C 2 21  ? 6.229   -26.115 -5.714  1.00 36.53  ? 21  C   C "C2'" 1 
ATOM   7744 O  "O2'" . C   C 2 21  ? 6.674   -26.734 -4.528  1.00 34.38  ? 21  C   C "O2'" 1 
ATOM   7745 C  "C1'" . C   C 2 21  ? 6.297   -24.620 -5.476  1.00 36.10  ? 21  C   C "C1'" 1 
ATOM   7746 N  N1    . C   C 2 21  ? 5.192   -23.791 -6.065  1.00 36.86  ? 21  C   C N1    1 
ATOM   7747 C  C2    . C   C 2 21  ? 3.969   -23.718 -5.371  1.00 37.91  ? 21  C   C C2    1 
ATOM   7748 O  O2    . C   C 2 21  ? 3.815   -24.372 -4.325  1.00 38.70  ? 21  C   C O2    1 
ATOM   7749 N  N3    . C   C 2 21  ? 2.976   -22.933 -5.868  1.00 37.76  ? 21  C   C N3    1 
ATOM   7750 C  C4    . C   C 2 21  ? 3.161   -22.236 -6.992  1.00 38.42  ? 21  C   C C4    1 
ATOM   7751 N  N4    . C   C 2 21  ? 2.138   -21.490 -7.417  1.00 39.34  ? 21  C   C N4    1 
ATOM   7752 C  C5    . C   C 2 21  ? 4.402   -22.285 -7.723  1.00 39.18  ? 21  C   C C5    1 
ATOM   7753 C  C6    . C   C 2 21  ? 5.376   -23.063 -7.220  1.00 36.91  ? 21  C   C C6    1 
ATOM   7754 P  P     . A   C 2 22  ? 7.012   -28.675 -7.882  1.00 34.10  ? 22  A   C P     1 
ATOM   7755 O  OP1   . A   C 2 22  ? 7.842   -29.903 -7.845  1.00 31.32  ? 22  A   C OP1   1 
ATOM   7756 O  OP2   . A   C 2 22  ? 6.664   -28.086 -9.206  1.00 35.08  ? 22  A   C OP2   1 
ATOM   7757 O  "O5'" . A   C 2 22  ? 5.678   -28.966 -7.063  1.00 34.17  ? 22  A   C "O5'" 1 
ATOM   7758 C  "C5'" . A   C 2 22  ? 4.405   -29.147 -7.673  1.00 33.49  ? 22  A   C "C5'" 1 
ATOM   7759 C  "C4'" . A   C 2 22  ? 3.353   -28.979 -6.596  1.00 33.82  ? 22  A   C "C4'" 1 
ATOM   7760 O  "O4'" . A   C 2 22  ? 3.245   -27.583 -6.222  1.00 33.13  ? 22  A   C "O4'" 1 
ATOM   7761 C  "C3'" . A   C 2 22  ? 1.932   -29.312 -7.021  1.00 34.09  ? 22  A   C "C3'" 1 
ATOM   7762 O  "O3'" . A   C 2 22  ? 1.744   -30.701 -6.998  1.00 34.69  ? 22  A   C "O3'" 1 
ATOM   7763 C  "C2'" . A   C 2 22  ? 1.122   -28.585 -5.951  1.00 35.66  ? 22  A   C "C2'" 1 
ATOM   7764 O  "O2'" . A   C 2 22  ? 1.135   -29.247 -4.693  1.00 36.12  ? 22  A   C "O2'" 1 
ATOM   7765 C  "C1'" . A   C 2 22  ? 1.903   -27.281 -5.880  1.00 34.92  ? 22  A   C "C1'" 1 
ATOM   7766 N  N9    . A   C 2 22  ? 1.457   -26.212 -6.777  1.00 36.22  ? 22  A   C N9    1 
ATOM   7767 C  C8    . A   C 2 22  ? 2.157   -25.698 -7.843  1.00 36.29  ? 22  A   C C8    1 
ATOM   7768 N  N7    . A   C 2 22  ? 1.535   -24.729 -8.476  1.00 37.63  ? 22  A   C N7    1 
ATOM   7769 C  C5    . A   C 2 22  ? 0.340   -24.580 -7.765  1.00 38.79  ? 22  A   C C5    1 
ATOM   7770 C  C6    . A   C 2 22  ? -0.782  -23.708 -7.901  1.00 39.78  ? 22  A   C C6    1 
ATOM   7771 N  N6    . A   C 2 22  ? -0.919  -22.770 -8.847  1.00 39.53  ? 22  A   C N6    1 
ATOM   7772 N  N1    . A   C 2 22  ? -1.804  -23.851 -7.025  1.00 40.27  ? 22  A   C N1    1 
ATOM   7773 C  C2    . A   C 2 22  ? -1.713  -24.782 -6.066  1.00 39.34  ? 22  A   C C2    1 
ATOM   7774 N  N3    . A   C 2 22  ? -0.713  -25.631 -5.830  1.00 38.10  ? 22  A   C N3    1 
ATOM   7775 C  C4    . A   C 2 22  ? 0.286   -25.489 -6.717  1.00 37.08  ? 22  A   C C4    1 
ATOM   7776 P  P     . U   C 2 23  ? 0.674   -31.384 -7.966  1.00 37.36  ? 23  U   C P     1 
ATOM   7777 O  OP1   . U   C 2 23  ? 0.765   -32.856 -7.781  1.00 35.45  ? 23  U   C OP1   1 
ATOM   7778 O  OP2   . U   C 2 23  ? 0.801   -30.771 -9.302  1.00 36.81  ? 23  U   C OP2   1 
ATOM   7779 O  "O5'" . U   C 2 23  ? -0.746  -30.906 -7.413  1.00 39.45  ? 23  U   C "O5'" 1 
ATOM   7780 C  "C5'" . U   C 2 23  ? -1.187  -31.217 -6.093  1.00 44.16  ? 23  U   C "C5'" 1 
ATOM   7781 C  "C4'" . U   C 2 23  ? -2.542  -30.588 -5.843  1.00 47.38  ? 23  U   C "C4'" 1 
ATOM   7782 O  "O4'" . U   C 2 23  ? -2.412  -29.149 -5.711  1.00 47.92  ? 23  U   C "O4'" 1 
ATOM   7783 C  "C3'" . U   C 2 23  ? -3.529  -30.715 -6.998  1.00 49.40  ? 23  U   C "C3'" 1 
ATOM   7784 O  "O3'" . U   C 2 23  ? -4.051  -32.037 -7.109  1.00 51.45  ? 23  U   C "O3'" 1 
ATOM   7785 C  "C2'" . U   C 2 23  ? -4.548  -29.656 -6.581  1.00 50.63  ? 23  U   C "C2'" 1 
ATOM   7786 O  "O2'" . U   C 2 23  ? -5.293  -29.988 -5.424  1.00 51.78  ? 23  U   C "O2'" 1 
ATOM   7787 C  "C1'" . U   C 2 23  ? -3.574  -28.531 -6.254  1.00 49.47  ? 23  U   C "C1'" 1 
ATOM   7788 N  N1    . U   C 2 23  ? -3.255  -27.636 -7.433  1.00 48.80  ? 23  U   C N1    1 
ATOM   7789 C  C2    . U   C 2 23  ? -4.166  -26.634 -7.751  1.00 49.99  ? 23  U   C C2    1 
ATOM   7790 O  O2    . U   C 2 23  ? -5.202  -26.452 -7.138  1.00 51.72  ? 23  U   C O2    1 
ATOM   7791 N  N3    . U   C 2 23  ? -3.821  -25.845 -8.825  1.00 49.79  ? 23  U   C N3    1 
ATOM   7792 C  C4    . U   C 2 23  ? -2.675  -25.949 -9.597  1.00 48.81  ? 23  U   C C4    1 
ATOM   7793 O  O4    . U   C 2 23  ? -2.508  -25.169 -10.531 1.00 49.09  ? 23  U   C O4    1 
ATOM   7794 C  C5    . U   C 2 23  ? -1.774  -27.018 -9.214  1.00 46.58  ? 23  U   C C5    1 
ATOM   7795 C  C6    . U   C 2 23  ? -2.092  -27.804 -8.173  1.00 46.78  ? 23  U   C C6    1 
ATOM   7796 P  P     . U   C 2 24  ? -4.725  -32.545 -8.472  1.00 53.61  ? 24  U   C P     1 
ATOM   7797 O  OP1   . U   C 2 24  ? -5.260  -33.887 -8.171  1.00 55.39  ? 24  U   C OP1   1 
ATOM   7798 O  OP2   . U   C 2 24  ? -3.794  -32.380 -9.606  1.00 50.45  ? 24  U   C OP2   1 
ATOM   7799 O  "O5'" . U   C 2 24  ? -5.922  -31.504 -8.719  1.00 55.15  ? 24  U   C "O5'" 1 
ATOM   7800 C  "C5'" . U   C 2 24  ? -7.100  -31.497 -7.937  1.00 58.29  ? 24  U   C "C5'" 1 
ATOM   7801 C  "C4'" . U   C 2 24  ? -8.021  -30.404 -8.442  1.00 60.86  ? 24  U   C "C4'" 1 
ATOM   7802 O  "O4'" . U   C 2 24  ? -7.353  -29.118 -8.364  1.00 58.43  ? 24  U   C "O4'" 1 
ATOM   7803 C  "C3'" . U   C 2 24  ? -8.403  -30.505 -9.914  1.00 61.70  ? 24  U   C "C3'" 1 
ATOM   7804 O  "O3'" . U   C 2 24  ? -9.407  -31.481 -10.097 1.00 65.74  ? 24  U   C "O3'" 1 
ATOM   7805 C  "C2'" . U   C 2 24  ? -8.891  -29.080 -10.147 1.00 62.96  ? 24  U   C "C2'" 1 
ATOM   7806 O  "O2'" . U   C 2 24  ? -10.126 -28.787 -9.516  1.00 66.79  ? 24  U   C "O2'" 1 
ATOM   7807 C  "C1'" . U   C 2 24  ? -7.765  -28.317 -9.461  1.00 59.60  ? 24  U   C "C1'" 1 
ATOM   7808 N  N1    . U   C 2 24  ? -6.634  -27.940 -10.410 1.00 57.58  ? 24  U   C N1    1 
ATOM   7809 C  C2    . U   C 2 24  ? -6.847  -26.856 -11.256 1.00 58.33  ? 24  U   C C2    1 
ATOM   7810 O  O2    . U   C 2 24  ? -7.875  -26.203 -11.267 1.00 61.56  ? 24  U   C O2    1 
ATOM   7811 N  N3    . U   C 2 24  ? -5.808  -26.547 -12.099 1.00 56.24  ? 24  U   C N3    1 
ATOM   7812 C  C4    . U   C 2 24  ? -4.595  -27.204 -12.187 1.00 53.90  ? 24  U   C C4    1 
ATOM   7813 O  O4    . U   C 2 24  ? -3.779  -26.793 -12.995 1.00 53.15  ? 24  U   C O4    1 
ATOM   7814 C  C5    . U   C 2 24  ? -4.430  -28.328 -11.289 1.00 53.16  ? 24  U   C C5    1 
ATOM   7815 C  C6    . U   C 2 24  ? -5.434  -28.648 -10.450 1.00 54.96  ? 24  U   C C6    1 
ATOM   7816 P  P     . U   C 2 25  ? -9.889  -31.981 -11.542 1.00 66.59  ? 25  U   C P     1 
ATOM   7817 O  OP1   . U   C 2 25  ? -10.757 -33.144 -11.253 1.00 71.08  ? 25  U   C OP1   1 
ATOM   7818 O  OP2   . U   C 2 25  ? -8.765  -32.117 -12.497 1.00 63.45  ? 25  U   C OP2   1 
ATOM   7819 O  "O5'" . U   C 2 25  ? -10.801 -30.778 -12.066 1.00 69.68  ? 25  U   C "O5'" 1 
ATOM   7820 C  "C5'" . U   C 2 25  ? -12.182 -30.701 -11.703 1.00 73.41  ? 25  U   C "C5'" 1 
ATOM   7821 C  "C4'" . U   C 2 25  ? -12.893 -29.640 -12.520 1.00 75.77  ? 25  U   C "C4'" 1 
ATOM   7822 O  "O4'" . U   C 2 25  ? -12.211 -28.363 -12.358 1.00 73.76  ? 25  U   C "O4'" 1 
ATOM   7823 C  "C3'" . U   C 2 25  ? -12.891 -29.853 -14.028 1.00 76.48  ? 25  U   C "C3'" 1 
ATOM   7824 O  "O3'" . U   C 2 25  ? -13.881 -30.782 -14.449 1.00 80.86  ? 25  U   C "O3'" 1 
ATOM   7825 C  "C2'" . U   C 2 25  ? -13.184 -28.436 -14.504 1.00 77.34  ? 25  U   C "C2'" 1 
ATOM   7826 O  "O2'" . U   C 2 25  ? -14.533 -28.041 -14.295 1.00 81.91  ? 25  U   C "O2'" 1 
ATOM   7827 C  "C1'" . U   C 2 25  ? -12.241 -27.655 -13.590 1.00 73.56  ? 25  U   C "C1'" 1 
ATOM   7828 N  N1    . U   C 2 25  ? -10.849 -27.456 -14.160 1.00 69.52  ? 25  U   C N1    1 
ATOM   7829 C  C2    . U   C 2 25  ? -10.664 -26.489 -15.139 1.00 69.77  ? 25  U   C C2    1 
ATOM   7830 O  O2    . U   C 2 25  ? -11.559 -25.780 -15.569 1.00 73.09  ? 25  U   C O2    1 
ATOM   7831 N  N3    . U   C 2 25  ? -9.371  -26.368 -15.603 1.00 66.76  ? 25  U   C N3    1 
ATOM   7832 C  C4    . U   C 2 25  ? -8.260  -27.096 -15.205 1.00 63.38  ? 25  U   C C4    1 
ATOM   7833 O  O4    . U   C 2 25  ? -7.172  -26.860 -15.721 1.00 61.78  ? 25  U   C O4    1 
ATOM   7834 C  C5    . U   C 2 25  ? -8.522  -28.088 -14.187 1.00 62.43  ? 25  U   C C5    1 
ATOM   7835 C  C6    . U   C 2 25  ? -9.775  -28.225 -13.716 1.00 65.25  ? 25  U   C C6    1 
ATOM   7836 P  P     . A   C 2 26  ? -13.590 -31.787 -15.672 1.00 82.09  ? 26  A   C P     1 
ATOM   7837 O  OP1   . A   C 2 26  ? -14.600 -32.861 -15.548 1.00 84.58  ? 26  A   C OP1   1 
ATOM   7838 O  OP2   . A   C 2 26  ? -12.144 -32.126 -15.710 1.00 77.37  ? 26  A   C OP2   1 
ATOM   7839 O  "O5'" . A   C 2 26  ? -13.913 -30.917 -16.981 1.00 83.47  ? 26  A   C "O5'" 1 
ATOM   7840 C  "C5'" . A   C 2 26  ? -15.163 -30.217 -17.082 1.00 87.86  ? 26  A   C "C5'" 1 
ATOM   7841 C  "C4'" . A   C 2 26  ? -15.124 -29.104 -18.117 1.00 88.09  ? 26  A   C "C4'" 1 
ATOM   7842 O  "O4'" . A   C 2 26  ? -14.250 -28.026 -17.692 1.00 85.33  ? 26  A   C "O4'" 1 
ATOM   7843 C  "C3'" . A   C 2 26  ? -14.560 -29.512 -19.465 1.00 86.88  ? 26  A   C "C3'" 1 
ATOM   7844 O  "O3'" . A   C 2 26  ? -15.544 -30.196 -20.215 1.00 91.23  ? 26  A   C "O3'" 1 
ATOM   7845 C  "C2'" . A   C 2 26  ? -14.151 -28.160 -20.044 1.00 86.01  ? 26  A   C "C2'" 1 
ATOM   7846 O  "O2'" . A   C 2 26  ? -15.237 -27.391 -20.526 1.00 89.87  ? 26  A   C "O2'" 1 
ATOM   7847 C  "C1'" . A   C 2 26  ? -13.526 -27.523 -18.805 1.00 82.51  ? 26  A   C "C1'" 1 
ATOM   7848 N  N9    . A   C 2 26  ? -12.096 -27.824 -18.636 1.00 77.31  ? 26  A   C N9    1 
ATOM   7849 C  C8    . A   C 2 26  ? -11.531 -28.787 -17.834 1.00 73.82  ? 26  A   C C8    1 
ATOM   7850 N  N7    . A   C 2 26  ? -10.222 -28.827 -17.879 1.00 69.64  ? 26  A   C N7    1 
ATOM   7851 C  C5    . A   C 2 26  ? -9.895  -27.821 -18.775 1.00 70.55  ? 26  A   C C5    1 
ATOM   7852 C  C6    . A   C 2 26  ? -8.656  -27.352 -19.262 1.00 68.89  ? 26  A   C C6    1 
ATOM   7853 N  N6    . A   C 2 26  ? -7.475  -27.864 -18.892 1.00 65.34  ? 26  A   C N6    1 
ATOM   7854 N  N1    . A   C 2 26  ? -8.681  -26.329 -20.149 1.00 71.21  ? 26  A   C N1    1 
ATOM   7855 C  C2    . A   C 2 26  ? -9.863  -25.811 -20.523 1.00 75.15  ? 26  A   C C2    1 
ATOM   7856 N  N3    . A   C 2 26  ? -11.091 -26.167 -20.134 1.00 77.40  ? 26  A   C N3    1 
ATOM   7857 C  C4    . A   C 2 26  ? -11.037 -27.188 -19.251 1.00 75.27  ? 26  A   C C4    1 
ATOM   7858 P  P     . C   C 2 27  ? -15.122 -31.434 -21.142 1.00 91.08  ? 27  C   C P     1 
ATOM   7859 O  OP1   . C   C 2 27  ? -16.376 -32.151 -21.479 1.00 95.20  ? 27  C   C OP1   1 
ATOM   7860 O  OP2   . C   C 2 27  ? -13.977 -32.178 -20.551 1.00 85.97  ? 27  C   C OP2   1 
ATOM   7861 O  "O5'" . C   C 2 27  ? -14.591 -30.689 -22.454 1.00 91.13  ? 27  C   C "O5'" 1 
ATOM   7862 C  "C5'" . C   C 2 27  ? -15.457 -29.839 -23.211 1.00 95.83  ? 27  C   C "C5'" 1 
ATOM   7863 C  "C4'" . C   C 2 27  ? -14.646 -28.929 -24.113 1.00 94.97  ? 27  C   C "C4'" 1 
ATOM   7864 O  "O4'" . C   C 2 27  ? -13.744 -28.112 -23.319 1.00 91.24  ? 27  C   C "O4'" 1 
ATOM   7865 C  "C3'" . C   C 2 27  ? -13.721 -29.668 -25.071 1.00 92.07  ? 27  C   C "C3'" 1 
ATOM   7866 O  "O3'" . C   C 2 27  ? -14.427 -30.135 -26.210 1.00 96.37  ? 27  C   C "O3'" 1 
ATOM   7867 C  "C2'" . C   C 2 27  ? -12.682 -28.596 -25.386 1.00 89.78  ? 27  C   C "C2'" 1 
ATOM   7868 O  "O2'" . C   C 2 27  ? -13.137 -27.619 -26.311 1.00 93.78  ? 27  C   C "O2'" 1 
ATOM   7869 C  "C1'" . C   C 2 27  ? -12.496 -28.004 -23.990 1.00 86.99  ? 27  C   C "C1'" 1 
ATOM   7870 N  N1    . C   C 2 27  ? -11.389 -28.638 -23.176 1.00 81.19  ? 27  C   C N1    1 
ATOM   7871 C  C2    . C   C 2 27  ? -10.091 -28.126 -23.319 1.00 78.54  ? 27  C   C C2    1 
ATOM   7872 O  O2    . C   C 2 27  ? -9.909  -27.181 -24.110 1.00 79.89  ? 27  C   C O2    1 
ATOM   7873 N  N3    . C   C 2 27  ? -9.080  -28.682 -22.583 1.00 73.77  ? 27  C   C N3    1 
ATOM   7874 C  C4    . C   C 2 27  ? -9.319  -29.694 -21.739 1.00 72.51  ? 27  C   C C4    1 
ATOM   7875 N  N4    . C   C 2 27  ? -8.291  -30.196 -21.042 1.00 68.86  ? 27  C   C N4    1 
ATOM   7876 C  C5    . C   C 2 27  ? -10.632 -30.231 -21.579 1.00 74.68  ? 27  C   C C5    1 
ATOM   7877 C  C6    . C   C 2 27  ? -11.617 -29.677 -22.306 1.00 79.34  ? 27  C   C C6    1 
ATOM   7878 P  P     . U   C 2 28  ? -13.874 -31.399 -27.033 1.00 95.97  ? 28  U   C P     1 
ATOM   7879 O  OP1   . U   C 2 28  ? -14.992 -31.886 -27.878 1.00 99.50  ? 28  U   C OP1   1 
ATOM   7880 O  OP2   . U   C 2 28  ? -13.160 -32.345 -26.124 1.00 91.34  ? 28  U   C OP2   1 
ATOM   7881 O  "O5'" . U   C 2 28  ? -12.783 -30.718 -27.982 1.00 93.54  ? 28  U   C "O5'" 1 
ATOM   7882 C  "C5'" . U   C 2 28  ? -11.422 -31.031 -27.781 1.00 87.28  ? 28  U   C "C5'" 1 
ATOM   7883 C  "C4'" . U   C 2 28  ? -10.546 -29.983 -28.429 1.00 86.07  ? 28  U   C "C4'" 1 
ATOM   7884 O  "O4'" . U   C 2 28  ? -9.967  -29.110 -27.425 1.00 83.14  ? 28  U   C "O4'" 1 
ATOM   7885 C  "C3'" . U   C 2 28  ? -9.374  -30.603 -29.171 1.00 81.32  ? 28  U   C "C3'" 1 
ATOM   7886 O  "O3'" . U   C 2 28  ? -9.765  -30.758 -30.519 1.00 83.42  ? 28  U   C "O3'" 1 
ATOM   7887 C  "C2'" . U   C 2 28  ? -8.252  -29.593 -28.979 1.00 80.00  ? 28  U   C "C2'" 1 
ATOM   7888 O  "O2'" . U   C 2 28  ? -8.318  -28.508 -29.894 1.00 83.32  ? 28  U   C "O2'" 1 
ATOM   7889 C  "C1'" . U   C 2 28  ? -8.555  -29.133 -27.552 1.00 79.17  ? 28  U   C "C1'" 1 
ATOM   7890 N  N1    . U   C 2 28  ? -7.952  -29.965 -26.437 1.00 74.29  ? 28  U   C N1    1 
ATOM   7891 C  C2    . U   C 2 28  ? -6.589  -29.895 -26.226 1.00 70.99  ? 28  U   C C2    1 
ATOM   7892 O  O2    . U   C 2 28  ? -5.838  -29.208 -26.899 1.00 71.40  ? 28  U   C O2    1 
ATOM   7893 N  N3    . U   C 2 28  ? -6.139  -30.668 -25.179 1.00 68.56  ? 28  U   C N3    1 
ATOM   7894 C  C4    . U   C 2 28  ? -6.881  -31.491 -24.339 1.00 68.34  ? 28  U   C C4    1 
ATOM   7895 O  O4    . U   C 2 28  ? -6.321  -32.130 -23.445 1.00 65.57  ? 28  U   C O4    1 
ATOM   7896 C  C5    . U   C 2 28  ? -8.295  -31.513 -24.620 1.00 70.88  ? 28  U   C C5    1 
ATOM   7897 C  C6    . U   C 2 28  ? -8.757  -30.761 -25.628 1.00 73.73  ? 28  U   C C6    1 
ATOM   7898 P  P     . U   C 2 29  ? -9.993  -32.244 -31.064 1.00 81.19  ? 29  U   C P     1 
ATOM   7899 O  OP1   . U   C 2 29  ? -11.170 -32.237 -31.964 1.00 85.45  ? 29  U   C OP1   1 
ATOM   7900 O  OP2   . U   C 2 29  ? -9.887  -33.216 -29.934 1.00 78.72  ? 29  U   C OP2   1 
ATOM   7901 O  "O5'" . U   C 2 29  ? -8.678  -32.445 -31.935 1.00 76.99  ? 29  U   C "O5'" 1 
ATOM   7902 C  "C5'" . U   C 2 29  ? -7.670  -33.226 -31.376 1.00 66.93  ? 29  U   C "C5'" 1 
ATOM   7903 C  "C4'" . U   C 2 29  ? -6.343  -32.528 -31.491 1.00 61.98  ? 29  U   C "C4'" 1 
ATOM   7904 O  "O4'" . U   C 2 29  ? -6.115  -31.729 -30.304 1.00 59.72  ? 29  U   C "O4'" 1 
ATOM   7905 C  "C3'" . U   C 2 29  ? -5.212  -33.547 -31.487 1.00 55.60  ? 29  U   C "C3'" 1 
ATOM   7906 O  "O3'" . U   C 2 29  ? -5.005  -34.073 -32.789 1.00 52.77  ? 29  U   C "O3'" 1 
ATOM   7907 C  "C2'" . U   C 2 29  ? -4.051  -32.748 -30.899 1.00 53.60  ? 29  U   C "C2'" 1 
ATOM   7908 O  "O2'" . U   C 2 29  ? -3.453  -31.804 -31.774 1.00 55.23  ? 29  U   C "O2'" 1 
ATOM   7909 C  "C1'" . U   C 2 29  ? -4.814  -32.013 -29.796 1.00 55.41  ? 29  U   C "C1'" 1 
ATOM   7910 N  N1    . U   C 2 29  ? -4.889  -32.711 -28.454 1.00 52.58  ? 29  U   C N1    1 
ATOM   7911 C  C2    . U   C 2 29  ? -3.728  -32.871 -27.703 1.00 49.21  ? 29  U   C C2    1 
ATOM   7912 O  O2    . U   C 2 29  ? -2.619  -32.495 -28.064 1.00 46.20  ? 29  U   C O2    1 
ATOM   7913 N  N3    . U   C 2 29  ? -3.923  -33.488 -26.482 1.00 48.05  ? 29  U   C N3    1 
ATOM   7914 C  C4    . U   C 2 29  ? -5.117  -33.961 -25.954 1.00 48.45  ? 29  U   C C4    1 
ATOM   7915 O  O4    . U   C 2 29  ? -5.119  -34.507 -24.857 1.00 47.22  ? 29  U   C O4    1 
ATOM   7916 C  C5    . U   C 2 29  ? -6.276  -33.767 -26.792 1.00 51.29  ? 29  U   C C5    1 
ATOM   7917 C  C6    . U   C 2 29  ? -6.118  -33.157 -27.977 1.00 53.81  ? 29  U   C C6    1 
ATOM   7918 P  P     . C   C 2 30  ? -4.828  -35.651 -32.921 1.00 50.67  ? 30  C   C P     1 
ATOM   7919 O  OP1   . C   C 2 30  ? -5.004  -35.971 -34.347 1.00 52.43  ? 30  C   C OP1   1 
ATOM   7920 O  OP2   . C   C 2 30  ? -5.640  -36.365 -31.912 1.00 49.61  ? 30  C   C OP2   1 
ATOM   7921 O  "O5'" . C   C 2 30  ? -3.295  -35.871 -32.501 1.00 44.99  ? 30  C   C "O5'" 1 
ATOM   7922 C  "C5'" . C   C 2 30  ? -2.266  -35.034 -33.018 1.00 41.26  ? 30  C   C "C5'" 1 
ATOM   7923 C  "C4'" . C   C 2 30  ? -1.014  -35.152 -32.173 1.00 34.62  ? 30  C   C "C4'" 1 
ATOM   7924 O  "O4'" . C   C 2 30  ? -1.275  -34.621 -30.848 1.00 35.14  ? 30  C   C "O4'" 1 
ATOM   7925 C  "C3'" . C   C 2 30  ? -0.488  -36.559 -31.894 1.00 31.66  ? 30  C   C "C3'" 1 
ATOM   7926 O  "O3'" . C   C 2 30  ? 0.136   -37.165 -33.062 1.00 26.71  ? 30  C   C "O3'" 1 
ATOM   7927 C  "C2'" . C   C 2 30  ? 0.451   -36.217 -30.733 1.00 28.50  ? 30  C   C "C2'" 1 
ATOM   7928 O  "O2'" . C   C 2 30  ? 1.503   -35.287 -31.024 1.00 29.65  ? 30  C   C "O2'" 1 
ATOM   7929 C  "C1'" . C   C 2 30  ? -0.523  -35.393 -29.921 1.00 30.70  ? 30  C   C "C1'" 1 
ATOM   7930 N  N1    . C   C 2 30  ? -1.426  -36.014 -28.868 1.00 29.02  ? 30  C   C N1    1 
ATOM   7931 C  C2    . C   C 2 30  ? -0.834  -36.376 -27.638 1.00 23.65  ? 30  C   C C2    1 
ATOM   7932 O  O2    . C   C 2 30  ? 0.406   -36.250 -27.523 1.00 20.17  ? 30  C   C O2    1 
ATOM   7933 N  N3    . C   C 2 30  ? -1.655  -36.852 -26.645 1.00 22.26  ? 30  C   C N3    1 
ATOM   7934 C  C4    . C   C 2 30  ? -2.980  -37.016 -26.872 1.00 26.93  ? 30  C   C C4    1 
ATOM   7935 N  N4    . C   C 2 30  ? -3.749  -37.519 -25.888 1.00 27.39  ? 30  C   C N4    1 
ATOM   7936 C  C5    . C   C 2 30  ? -3.591  -36.637 -28.117 1.00 27.99  ? 30  C   C C5    1 
ATOM   7937 C  C6    . C   C 2 30  ? -2.788  -36.129 -29.065 1.00 30.49  ? 30  C   C C6    1 
ATOM   7938 P  P     . C   C 2 31  ? 0.266   -38.705 -33.250 1.00 27.68  ? 31  C   C P     1 
ATOM   7939 O  OP1   . C   C 2 31  ? 0.890   -38.993 -34.570 1.00 30.74  ? 31  C   C OP1   1 
ATOM   7940 O  OP2   . C   C 2 31  ? -1.015  -39.383 -32.973 1.00 31.10  ? 31  C   C OP2   1 
ATOM   7941 O  "O5'" . C   C 2 31  ? 1.258   -39.189 -32.081 1.00 23.06  ? 31  C   C "O5'" 1 
ATOM   7942 C  "C5'" . C   C 2 31  ? 2.635   -38.810 -32.055 1.00 17.33  ? 31  C   C "C5'" 1 
ATOM   7943 C  "C4'" . C   C 2 31  ? 3.316   -39.340 -30.809 1.00 15.74  ? 31  C   C "C4'" 1 
ATOM   7944 O  "O4'" . C   C 2 31  ? 2.685   -38.791 -29.623 1.00 21.14  ? 31  C   C "O4'" 1 
ATOM   7945 C  "C3'" . C   C 2 31  ? 3.237   -40.840 -30.604 1.00 19.26  ? 31  C   C "C3'" 1 
ATOM   7946 O  "O3'" . C   C 2 31  ? 4.131   -41.445 -31.527 1.00 16.02  ? 31  C   C "O3'" 1 
ATOM   7947 C  "C2'" . C   C 2 31  ? 3.578   -40.872 -29.110 1.00 18.66  ? 31  C   C "C2'" 1 
ATOM   7948 O  "O2'" . C   C 2 31  ? 4.828   -40.251 -28.781 1.00 17.56  ? 31  C   C "O2'" 1 
ATOM   7949 C  "C1'" . C   C 2 31  ? 2.603   -39.821 -28.645 1.00 17.70  ? 31  C   C "C1'" 1 
ATOM   7950 N  N1    . C   C 2 31  ? 1.139   -40.090 -28.209 1.00 15.32  ? 31  C   C N1    1 
ATOM   7951 C  C2    . C   C 2 31  ? 0.924   -40.427 -26.869 1.00 14.32  ? 31  C   C C2    1 
ATOM   7952 O  O2    . C   C 2 31  ? 1.883   -40.534 -26.119 1.00 17.29  ? 31  C   C O2    1 
ATOM   7953 N  N3    . C   C 2 31  ? -0.341  -40.610 -26.397 1.00 16.13  ? 31  C   C N3    1 
ATOM   7954 C  C4    . C   C 2 31  ? -1.363  -40.503 -27.259 1.00 16.68  ? 31  C   C C4    1 
ATOM   7955 N  N4    . C   C 2 31  ? -2.574  -40.711 -26.752 1.00 20.63  ? 31  C   C N4    1 
ATOM   7956 C  C5    . C   C 2 31  ? -1.194  -40.162 -28.656 1.00 18.71  ? 31  C   C C5    1 
ATOM   7957 C  C6    . C   C 2 31  ? 0.075   -39.937 -29.074 1.00 17.81  ? 31  C   C C6    1 
ATOM   7958 P  P     . A   C 2 32  ? 3.985   -42.991 -31.925 1.00 19.35  ? 32  A   C P     1 
ATOM   7959 O  OP1   . A   C 2 32  ? 5.079   -43.308 -32.855 1.00 20.01  ? 32  A   C OP1   1 
ATOM   7960 O  OP2   . A   C 2 32  ? 2.571   -43.105 -32.400 1.00 19.73  ? 32  A   C OP2   1 
ATOM   7961 O  "O5'" . A   C 2 32  ? 4.139   -43.683 -30.526 1.00 18.17  ? 32  A   C "O5'" 1 
ATOM   7962 C  "C5'" . A   C 2 32  ? 5.440   -44.009 -29.987 1.00 19.42  ? 32  A   C "C5'" 1 
ATOM   7963 C  "C4'" . A   C 2 32  ? 5.257   -44.651 -28.621 1.00 17.93  ? 32  A   C "C4'" 1 
ATOM   7964 O  "O4'" . A   C 2 32  ? 4.434   -43.885 -27.700 1.00 20.14  ? 32  A   C "O4'" 1 
ATOM   7965 C  "C3'" . A   C 2 32  ? 4.548   -45.981 -28.665 1.00 19.64  ? 32  A   C "C3'" 1 
ATOM   7966 O  "O3'" . A   C 2 32  ? 5.476   -46.852 -29.255 1.00 19.48  ? 32  A   C "O3'" 1 
ATOM   7967 C  "C2'" . A   C 2 32  ? 4.233   -46.131 -27.170 1.00 17.14  ? 32  A   C "C2'" 1 
ATOM   7968 O  "O2'" . A   C 2 32  ? 5.373   -46.373 -26.352 1.00 21.80  ? 32  A   C "O2'" 1 
ATOM   7969 C  "C1'" . A   C 2 32  ? 3.718   -44.741 -26.876 1.00 17.43  ? 32  A   C "C1'" 1 
ATOM   7970 N  N9    . A   C 2 32  ? 2.260   -44.549 -27.016 1.00 16.17  ? 32  A   C N9    1 
ATOM   7971 C  C8    . A   C 2 32  ? 1.476   -44.272 -28.105 1.00 14.52  ? 32  A   C C8    1 
ATOM   7972 N  N7    . A   C 2 32  ? 0.202   -44.189 -27.779 1.00 16.27  ? 32  A   C N7    1 
ATOM   7973 C  C5    . A   C 2 32  ? 0.162   -44.407 -26.405 1.00 17.09  ? 32  A   C C5    1 
ATOM   7974 C  C6    . A   C 2 32  ? -0.873  -44.431 -25.430 1.00 18.76  ? 32  A   C C6    1 
ATOM   7975 N  N6    . A   C 2 32  ? -2.174  -44.210 -25.713 1.00 19.57  ? 32  A   C N6    1 
ATOM   7976 N  N1    . A   C 2 32  ? -0.530  -44.678 -24.149 1.00 17.93  ? 32  A   C N1    1 
ATOM   7977 C  C2    . A   C 2 32  ? 0.754   -44.891 -23.842 1.00 18.45  ? 32  A   C C2    1 
ATOM   7978 N  N3    . A   C 2 32  ? 1.804   -44.863 -24.678 1.00 17.18  ? 32  A   C N3    1 
ATOM   7979 C  C4    . A   C 2 32  ? 1.430   -44.640 -25.943 1.00 16.46  ? 32  A   C C4    1 
ATOM   7980 P  P     . C   C 2 33  ? 5.107   -48.092 -30.206 1.00 21.90  ? 33  C   C P     1 
ATOM   7981 O  OP1   . C   C 2 33  ? 6.355   -48.768 -30.562 1.00 21.62  ? 33  C   C OP1   1 
ATOM   7982 O  OP2   . C   C 2 33  ? 4.227   -47.543 -31.304 1.00 21.23  ? 33  C   C OP2   1 
ATOM   7983 O  "O5'" . C   C 2 33  ? 4.243   -48.904 -29.152 1.00 23.94  ? 33  C   C "O5'" 1 
ATOM   7984 C  "C5'" . C   C 2 33  ? 4.833   -49.765 -28.127 1.00 23.61  ? 33  C   C "C5'" 1 
ATOM   7985 C  "C4'" . C   C 2 33  ? 3.730   -50.494 -27.390 1.00 21.66  ? 33  C   C "C4'" 1 
ATOM   7986 O  "O4'" . C   C 2 33  ? 2.800   -49.531 -26.844 1.00 25.20  ? 33  C   C "O4'" 1 
ATOM   7987 C  "C3'" . C   C 2 33  ? 2.839   -51.349 -28.265 1.00 24.30  ? 33  C   C "C3'" 1 
ATOM   7988 O  "O3'" . C   C 2 33  ? 3.400   -52.644 -28.466 1.00 22.62  ? 33  C   C "O3'" 1 
ATOM   7989 C  "C2'" . C   C 2 33  ? 1.572   -51.481 -27.439 1.00 26.35  ? 33  C   C "C2'" 1 
ATOM   7990 O  "O2'" . C   C 2 33  ? 1.691   -52.418 -26.376 1.00 28.12  ? 33  C   C "O2'" 1 
ATOM   7991 C  "C1'" . C   C 2 33  ? 1.493   -50.101 -26.843 1.00 24.65  ? 33  C   C "C1'" 1 
ATOM   7992 N  N1    . C   C 2 33  ? 0.526   -49.107 -27.489 1.00 24.47  ? 33  C   C N1    1 
ATOM   7993 C  C2    . C   C 2 33  ? -0.838  -49.177 -27.132 1.00 26.70  ? 33  C   C C2    1 
ATOM   7994 O  O2    . C   C 2 33  ? -1.199  -50.093 -26.361 1.00 25.47  ? 33  C   C O2    1 
ATOM   7995 N  N3    . C   C 2 33  ? -1.710  -48.292 -27.713 1.00 24.73  ? 33  C   C N3    1 
ATOM   7996 C  C4    . C   C 2 33  ? -1.271  -47.374 -28.586 1.00 25.05  ? 33  C   C C4    1 
ATOM   7997 N  N4    . C   C 2 33  ? -2.148  -46.524 -29.109 1.00 24.10  ? 33  C   C N4    1 
ATOM   7998 C  C5    . C   C 2 33  ? 0.117   -47.270 -28.937 1.00 24.56  ? 33  C   C C5    1 
ATOM   7999 C  C6    . C   C 2 33  ? 0.959   -48.181 -28.390 1.00 22.98  ? 33  C   C C6    1 
ATOM   8000 P  P     A C   C 2 34  ? 3.569   -53.159 -29.970 0.50 19.46  ? 34  C   C P     1 
ATOM   8001 P  P     B C   C 2 34  ? 4.268   -52.963 -29.809 0.50 18.92  ? 34  C   C P     1 
ATOM   8002 O  OP1   A C   C 2 34  ? 4.049   -54.566 -29.854 0.50 20.93  ? 34  C   C OP1   1 
ATOM   8003 O  OP1   B C   C 2 34  ? 4.827   -54.322 -29.683 0.50 20.15  ? 34  C   C OP1   1 
ATOM   8004 O  OP2   A C   C 2 34  ? 4.311   -52.136 -30.720 0.50 18.97  ? 34  C   C OP2   1 
ATOM   8005 O  OP2   B C   C 2 34  ? 5.190   -51.860 -30.125 0.50 21.97  ? 34  C   C OP2   1 
ATOM   8006 O  "O5'" A C   C 2 34  ? 2.061   -53.139 -30.546 0.50 21.36  ? 34  C   C "O5'" 1 
ATOM   8007 O  "O5'" B C   C 2 34  ? 3.073   -52.916 -30.864 0.50 20.84  ? 34  C   C "O5'" 1 
ATOM   8008 C  "C5'" A C   C 2 34  ? 1.507   -54.290 -31.203 0.50 21.98  ? 34  C   C "C5'" 1 
ATOM   8009 C  "C5'" B C   C 2 34  ? 2.258   -54.093 -31.056 0.50 21.24  ? 34  C   C "C5'" 1 
ATOM   8010 C  "C4'" A C   C 2 34  ? 1.326   -54.087 -32.704 0.50 22.28  ? 34  C   C "C4'" 1 
ATOM   8011 C  "C4'" B C   C 2 34  ? 1.664   -54.172 -32.462 0.50 21.98  ? 34  C   C "C4'" 1 
ATOM   8012 O  "O4'" A C   C 2 34  ? 0.342   -53.038 -32.899 0.50 23.39  ? 34  C   C "O4'" 1 
ATOM   8013 O  "O4'" B C   C 2 34  ? 0.509   -53.305 -32.567 0.50 22.08  ? 34  C   C "O4'" 1 
ATOM   8014 C  "C3'" A C   C 2 34  ? 2.501   -53.574 -33.550 0.50 22.66  ? 34  C   C "C3'" 1 
ATOM   8015 C  "C3'" B C   C 2 34  ? 2.546   -53.672 -33.601 0.50 21.59  ? 34  C   C "C3'" 1 
ATOM   8016 O  "O3'" A C   C 2 34  ? 3.442   -54.585 -33.948 0.50 25.93  ? 34  C   C "O3'" 1 
ATOM   8017 O  "O3'" B C   C 2 34  ? 3.453   -54.658 -34.013 0.50 25.56  ? 34  C   C "O3'" 1 
ATOM   8018 C  "C2'" A C   C 2 34  ? 1.733   -53.148 -34.793 0.50 22.42  ? 34  C   C "C2'" 1 
ATOM   8019 C  "C2'" B C   C 2 34  ? 1.508   -53.474 -34.693 0.50 20.87  ? 34  C   C "C2'" 1 
ATOM   8020 O  "O2'" A C   C 2 34  ? 1.288   -54.286 -35.508 0.50 25.10  ? 34  C   C "O2'" 1 
ATOM   8021 O  "O2'" B C   C 2 34  ? 1.006   -54.722 -35.167 0.50 20.18  ? 34  C   C "O2'" 1 
ATOM   8022 C  "C1'" A C   C 2 34  ? 0.541   -52.437 -34.170 0.50 22.10  ? 34  C   C "C1'" 1 
ATOM   8023 C  "C1'" B C   C 2 34  ? 0.473   -52.717 -33.867 0.50 20.53  ? 34  C   C "C1'" 1 
ATOM   8024 N  N1    A C   C 2 34  ? 0.728   -50.945 -34.017 0.50 21.64  ? 34  C   C N1    1 
ATOM   8025 N  N1    B C   C 2 34  ? 0.701   -51.211 -33.792 0.50 20.43  ? 34  C   C N1    1 
ATOM   8026 C  C2    A C   C 2 34  ? 0.335   -50.092 -35.068 0.50 21.06  ? 34  C   C C2    1 
ATOM   8027 C  C2    B C   C 2 34  ? 0.470   -50.417 -34.937 0.50 19.59  ? 34  C   C C2    1 
ATOM   8028 O  O2    A C   C 2 34  ? -0.154  -50.545 -36.105 0.50 20.61  ? 34  C   C O2    1 
ATOM   8029 O  O2    B C   C 2 34  ? 0.103   -50.945 -35.994 0.50 19.42  ? 34  C   C O2    1 
ATOM   8030 N  N3    A C   C 2 34  ? 0.498   -48.758 -34.933 0.50 20.72  ? 34  C   C N3    1 
ATOM   8031 N  N3    B C   C 2 34  ? 0.666   -49.075 -34.866 0.50 19.01  ? 34  C   C N3    1 
ATOM   8032 C  C4    A C   C 2 34  ? 1.015   -48.251 -33.814 0.50 21.62  ? 34  C   C C4    1 
ATOM   8033 C  C4    B C   C 2 34  ? 1.060   -48.510 -33.719 0.50 19.61  ? 34  C   C C4    1 
ATOM   8034 N  N4    A C   C 2 34  ? 1.130   -46.912 -33.784 0.50 21.05  ? 34  C   C N4    1 
ATOM   8035 N  N4    B C   C 2 34  ? 1.218   -47.172 -33.731 0.50 20.20  ? 34  C   C N4    1 
ATOM   8036 C  C5    A C   C 2 34  ? 1.420   -49.086 -32.719 0.50 20.49  ? 34  C   C C5    1 
ATOM   8037 C  C5    B C   C 2 34  ? 1.295   -49.285 -32.532 0.50 18.65  ? 34  C   C C5    1 
ATOM   8038 C  C6    A C   C 2 34  ? 1.264   -50.414 -32.867 0.50 21.95  ? 34  C   C C6    1 
ATOM   8039 C  C6    B C   C 2 34  ? 1.108   -50.617 -32.619 0.50 20.54  ? 34  C   C C6    1 
ATOM   8040 P  P     B A   C 2 35  ? 4.818   -54.181 -34.707 0.50 21.48  ? 35  A   C P     1 
ATOM   8041 O  OP1   B A   C 2 35  ? 5.481   -55.420 -35.153 0.50 22.05  ? 35  A   C OP1   1 
ATOM   8042 O  OP2   B A   C 2 35  ? 5.534   -53.294 -33.766 0.50 23.34  ? 35  A   C OP2   1 
ATOM   8043 O  "O5'" B A   C 2 35  ? 4.380   -53.291 -35.966 0.50 19.71  ? 35  A   C "O5'" 1 
ATOM   8044 C  "C5'" B A   C 2 35  ? 4.029   -53.820 -37.265 0.50 15.32  ? 35  A   C "C5'" 1 
ATOM   8045 C  "C4'" B A   C 2 35  ? 3.666   -52.687 -38.228 0.50 15.28  ? 35  A   C "C4'" 1 
ATOM   8046 O  "O4'" B A   C 2 35  ? 2.792   -51.781 -37.524 0.50 13.79  ? 35  A   C "O4'" 1 
ATOM   8047 C  "C3'" B A   C 2 35  ? 4.780   -51.757 -38.686 0.50 11.75  ? 35  A   C "C3'" 1 
ATOM   8048 O  "O3'" B A   C 2 35  ? 5.683   -52.284 -39.660 0.50 12.78  ? 35  A   C "O3'" 1 
ATOM   8049 C  "C2'" B A   C 2 35  ? 3.975   -50.544 -39.179 0.50 12.72  ? 35  A   C "C2'" 1 
ATOM   8050 O  "O2'" B A   C 2 35  ? 3.267   -50.680 -40.426 0.50 9.69   ? 35  A   C "O2'" 1 
ATOM   8051 C  "C1'" B A   C 2 35  ? 3.026   -50.443 -37.992 0.50 13.18  ? 35  A   C "C1'" 1 
ATOM   8052 N  N9    B A   C 2 35  ? 3.481   -49.679 -36.819 0.50 13.53  ? 35  A   C N9    1 
ATOM   8053 C  C8    B A   C 2 35  ? 3.654   -50.201 -35.563 0.50 13.34  ? 35  A   C C8    1 
ATOM   8054 N  N7    B A   C 2 35  ? 4.039   -49.317 -34.669 0.50 14.20  ? 35  A   C N7    1 
ATOM   8055 C  C5    B A   C 2 35  ? 4.129   -48.135 -35.395 0.50 13.60  ? 35  A   C C5    1 
ATOM   8056 C  C6    B A   C 2 35  ? 4.496   -46.833 -35.004 0.50 13.62  ? 35  A   C C6    1 
ATOM   8057 N  N6    B A   C 2 35  ? 4.833   -46.547 -33.734 0.50 13.22  ? 35  A   C N6    1 
ATOM   8058 N  N1    B A   C 2 35  ? 4.513   -45.860 -35.954 0.50 13.20  ? 35  A   C N1    1 
ATOM   8059 C  C2    B A   C 2 35  ? 4.175   -46.188 -37.225 0.50 14.88  ? 35  A   C C2    1 
ATOM   8060 N  N3    B A   C 2 35  ? 3.797   -47.400 -37.693 0.50 13.20  ? 35  A   C N3    1 
ATOM   8061 C  C4    B A   C 2 35  ? 3.797   -48.331 -36.720 0.50 12.52  ? 35  A   C C4    1 
ATOM   8062 O  "O5'" . G   D 2 1   ? 48.101  5.085   -7.255  1.00 51.88  ? 1   G   D "O5'" 1 
ATOM   8063 C  "C5'" . G   D 2 1   ? 47.858  4.048   -6.336  1.00 47.33  ? 1   G   D "C5'" 1 
ATOM   8064 C  "C4'" . G   D 2 1   ? 46.549  4.272   -5.604  1.00 41.53  ? 1   G   D "C4'" 1 
ATOM   8065 O  "O4'" . G   D 2 1   ? 46.372  5.663   -5.296  1.00 40.69  ? 1   G   D "O4'" 1 
ATOM   8066 C  "C3'" . G   D 2 1   ? 45.267  3.975   -6.357  1.00 39.73  ? 1   G   D "C3'" 1 
ATOM   8067 O  "O3'" . G   D 2 1   ? 45.051  2.594   -6.429  1.00 38.52  ? 1   G   D "O3'" 1 
ATOM   8068 C  "C2'" . G   D 2 1   ? 44.249  4.639   -5.444  1.00 36.73  ? 1   G   D "C2'" 1 
ATOM   8069 O  "O2'" . G   D 2 1   ? 44.053  3.932   -4.232  1.00 32.77  ? 1   G   D "O2'" 1 
ATOM   8070 C  "C1'" . G   D 2 1   ? 44.977  5.942   -5.175  1.00 37.37  ? 1   G   D "C1'" 1 
ATOM   8071 N  N9    . G   D 2 1   ? 44.605  7.095   -6.025  1.00 38.33  ? 1   G   D N9    1 
ATOM   8072 C  C8    . G   D 2 1   ? 45.374  7.707   -6.985  1.00 40.84  ? 1   G   D C8    1 
ATOM   8073 N  N7    . G   D 2 1   ? 44.803  8.740   -7.553  1.00 42.56  ? 1   G   D N7    1 
ATOM   8074 C  C5    . G   D 2 1   ? 43.562  8.830   -6.922  1.00 40.49  ? 1   G   D C5    1 
ATOM   8075 C  C6    . G   D 2 1   ? 42.490  9.751   -7.111  1.00 40.51  ? 1   G   D C6    1 
ATOM   8076 O  O6    . G   D 2 1   ? 42.447  10.692  -7.917  1.00 41.91  ? 1   G   D O6    1 
ATOM   8077 N  N1    . G   D 2 1   ? 41.396  9.491   -6.262  1.00 37.67  ? 1   G   D N1    1 
ATOM   8078 C  C2    . G   D 2 1   ? 41.359  8.459   -5.347  1.00 35.59  ? 1   G   D C2    1 
ATOM   8079 N  N2    . G   D 2 1   ? 40.250  8.326   -4.595  1.00 34.45  ? 1   G   D N2    1 
ATOM   8080 N  N3    . G   D 2 1   ? 42.364  7.599   -5.168  1.00 35.52  ? 1   G   D N3    1 
ATOM   8081 C  C4    . G   D 2 1   ? 43.430  7.830   -5.978  1.00 37.54  ? 1   G   D C4    1 
ATOM   8082 P  P     . G   D 2 2   ? 44.262  1.969   -7.660  1.00 39.59  ? 2   G   D P     1 
ATOM   8083 O  OP1   . G   D 2 2   ? 44.467  0.515   -7.631  1.00 36.86  ? 2   G   D OP1   1 
ATOM   8084 O  OP2   . G   D 2 2   ? 44.624  2.713   -8.883  1.00 40.77  ? 2   G   D OP2   1 
ATOM   8085 O  "O5'" . G   D 2 2   ? 42.736  2.346   -7.319  1.00 37.60  ? 2   G   D "O5'" 1 
ATOM   8086 C  "C5'" . G   D 2 2   ? 41.931  1.596   -6.414  1.00 37.21  ? 2   G   D "C5'" 1 
ATOM   8087 C  "C4'" . G   D 2 2   ? 40.633  2.343   -6.159  1.00 37.25  ? 2   G   D "C4'" 1 
ATOM   8088 O  "O4'" . G   D 2 2   ? 40.902  3.733   -5.858  1.00 38.00  ? 2   G   D "O4'" 1 
ATOM   8089 C  "C3'" . G   D 2 2   ? 39.697  2.472   -7.346  1.00 38.39  ? 2   G   D "C3'" 1 
ATOM   8090 O  "O3'" . G   D 2 2   ? 38.992  1.270   -7.577  1.00 38.59  ? 2   G   D "O3'" 1 
ATOM   8091 C  "C2'" . G   D 2 2   ? 38.789  3.606   -6.885  1.00 38.48  ? 2   G   D "C2'" 1 
ATOM   8092 O  "O2'" . G   D 2 2   ? 37.852  3.232   -5.893  1.00 36.69  ? 2   G   D "O2'" 1 
ATOM   8093 C  "C1'" . G   D 2 2   ? 39.842  4.553   -6.331  1.00 36.83  ? 2   G   D "C1'" 1 
ATOM   8094 N  N9    . G   D 2 2   ? 40.331  5.491   -7.346  1.00 37.80  ? 2   G   D N9    1 
ATOM   8095 C  C8    . G   D 2 2   ? 41.503  5.444   -8.067  1.00 38.28  ? 2   G   D C8    1 
ATOM   8096 N  N7    . G   D 2 2   ? 41.646  6.442   -8.902  1.00 40.98  ? 2   G   D N7    1 
ATOM   8097 C  C5    . G   D 2 2   ? 40.495  7.210   -8.723  1.00 41.75  ? 2   G   D C5    1 
ATOM   8098 C  C6    . G   D 2 2   ? 40.070  8.417   -9.344  1.00 44.70  ? 2   G   D C6    1 
ATOM   8099 O  O6    . G   D 2 2   ? 40.655  9.089   -10.213 1.00 47.06  ? 2   G   D O6    1 
ATOM   8100 N  N1    . G   D 2 2   ? 38.825  8.847   -8.863  1.00 44.18  ? 2   G   D N1    1 
ATOM   8101 C  C2    . G   D 2 2   ? 38.078  8.202   -7.905  1.00 42.02  ? 2   G   D C2    1 
ATOM   8102 N  N2    . G   D 2 2   ? 36.906  8.750   -7.560  1.00 42.65  ? 2   G   D N2    1 
ATOM   8103 N  N3    . G   D 2 2   ? 38.462  7.076   -7.322  1.00 39.84  ? 2   G   D N3    1 
ATOM   8104 C  C4    . G   D 2 2   ? 39.674  6.633   -7.773  1.00 40.14  ? 2   G   D C4    1 
ATOM   8105 P  P     . A   D 2 3   ? 38.474  0.957   -9.055  1.00 39.58  ? 3   A   D P     1 
ATOM   8106 O  OP1   . A   D 2 3   ? 37.952  -0.428  -8.994  1.00 39.87  ? 3   A   D OP1   1 
ATOM   8107 O  OP2   . A   D 2 3   ? 39.567  1.286   -9.995  1.00 40.55  ? 3   A   D OP2   1 
ATOM   8108 O  "O5'" . A   D 2 3   ? 37.303  2.037   -9.307  1.00 42.41  ? 3   A   D "O5'" 1 
ATOM   8109 C  "C5'" . A   D 2 3   ? 36.093  2.027   -8.549  1.00 42.94  ? 3   A   D "C5'" 1 
ATOM   8110 C  "C4'" . A   D 2 3   ? 35.271  3.269   -8.833  1.00 47.23  ? 3   A   D "C4'" 1 
ATOM   8111 O  "O4'" . A   D 2 3   ? 36.027  4.485   -8.586  1.00 45.93  ? 3   A   D "O4'" 1 
ATOM   8112 C  "C3'" . A   D 2 3   ? 34.838  3.449   -10.278 1.00 51.11  ? 3   A   D "C3'" 1 
ATOM   8113 O  "O3'" . A   D 2 3   ? 33.801  2.526   -10.610 1.00 56.07  ? 3   A   D "O3'" 1 
ATOM   8114 C  "C2'" . A   D 2 3   ? 34.386  4.908   -10.226 1.00 53.05  ? 3   A   D "C2'" 1 
ATOM   8115 O  "O2'" . A   D 2 3   ? 33.160  5.100   -9.546  1.00 54.11  ? 3   A   D "O2'" 1 
ATOM   8116 C  "C1'" . A   D 2 3   ? 35.535  5.526   -9.431  1.00 50.12  ? 3   A   D "C1'" 1 
ATOM   8117 N  N9    . A   D 2 3   ? 36.616  6.003   -10.293 1.00 50.34  ? 3   A   D N9    1 
ATOM   8118 C  C8    . A   D 2 3   ? 37.789  5.343   -10.539 1.00 49.19  ? 3   A   D C8    1 
ATOM   8119 N  N7    . A   D 2 3   ? 38.590  5.965   -11.360 1.00 51.05  ? 3   A   D N7    1 
ATOM   8120 C  C5    . A   D 2 3   ? 37.901  7.120   -11.684 1.00 53.83  ? 3   A   D C5    1 
ATOM   8121 C  C6    . A   D 2 3   ? 38.227  8.207   -12.522 1.00 58.07  ? 3   A   D C6    1 
ATOM   8122 N  N6    . A   D 2 3   ? 39.379  8.285   -13.200 1.00 59.42  ? 3   A   D N6    1 
ATOM   8123 N  N1    . A   D 2 3   ? 37.315  9.206   -12.636 1.00 61.16  ? 3   A   D N1    1 
ATOM   8124 C  C2    . A   D 2 3   ? 36.155  9.111   -11.961 1.00 60.11  ? 3   A   D C2    1 
ATOM   8125 N  N3    . A   D 2 3   ? 35.747  8.141   -11.138 1.00 56.10  ? 3   A   D N3    1 
ATOM   8126 C  C4    . A   D 2 3   ? 36.672  7.163   -11.042 1.00 53.53  ? 3   A   D C4    1 
ATOM   8127 P  P     . A   D 2 4   ? 33.505  2.098   -12.129 1.00 60.98  ? 4   A   D P     1 
ATOM   8128 O  OP1   . A   D 2 4   ? 32.406  1.112   -12.078 1.00 62.89  ? 4   A   D OP1   1 
ATOM   8129 O  OP2   . A   D 2 4   ? 34.781  1.718   -12.779 1.00 59.52  ? 4   A   D OP2   1 
ATOM   8130 O  "O5'" . A   D 2 4   ? 32.967  3.450   -12.795 1.00 66.11  ? 4   A   D "O5'" 1 
ATOM   8131 C  "C5'" . A   D 2 4   ? 31.624  3.836   -12.551 1.00 72.98  ? 4   A   D "C5'" 1 
ATOM   8132 C  "C4'" . A   D 2 4   ? 31.286  5.124   -13.269 1.00 79.98  ? 4   A   D "C4'" 1 
ATOM   8133 O  "O4'" . A   D 2 4   ? 32.211  6.164   -12.854 1.00 79.29  ? 4   A   D "O4'" 1 
ATOM   8134 C  "C3'" . A   D 2 4   ? 31.414  5.100   -14.786 1.00 85.33  ? 4   A   D "C3'" 1 
ATOM   8135 O  "O3'" . A   D 2 4   ? 30.271  4.523   -15.411 1.00 92.24  ? 4   A   D "O3'" 1 
ATOM   8136 C  "C2'" . A   D 2 4   ? 31.543  6.593   -15.074 1.00 88.34  ? 4   A   D "C2'" 1 
ATOM   8137 O  "O2'" . A   D 2 4   ? 30.313  7.292   -14.990 1.00 93.25  ? 4   A   D "O2'" 1 
ATOM   8138 C  "C1'" . A   D 2 4   ? 32.487  7.020   -13.952 1.00 82.80  ? 4   A   D "C1'" 1 
ATOM   8139 N  N9    . A   D 2 4   ? 33.907  6.914   -14.307 1.00 80.50  ? 4   A   D N9    1 
ATOM   8140 C  C8    . A   D 2 4   ? 34.778  5.914   -13.959 1.00 75.65  ? 4   A   D C8    1 
ATOM   8141 N  N7    . A   D 2 4   ? 35.994  6.075   -14.421 1.00 75.38  ? 4   A   D N7    1 
ATOM   8142 C  C5    . A   D 2 4   ? 35.922  7.267   -15.124 1.00 80.16  ? 4   A   D C5    1 
ATOM   8143 C  C6    . A   D 2 4   ? 36.881  8.005   -15.858 1.00 83.39  ? 4   A   D C6    1 
ATOM   8144 N  N6    . A   D 2 4   ? 38.152  7.621   -16.001 1.00 82.31  ? 4   A   D N6    1 
ATOM   8145 N  N1    . A   D 2 4   ? 36.485  9.158   -16.446 1.00 88.81  ? 4   A   D N1    1 
ATOM   8146 C  C2    . A   D 2 4   ? 35.208  9.546   -16.311 1.00 90.84  ? 4   A   D C2    1 
ATOM   8147 N  N3    . A   D 2 4   ? 34.221  8.941   -15.644 1.00 88.78  ? 4   A   D N3    1 
ATOM   8148 C  C4    . A   D 2 4   ? 34.643  7.797   -15.067 1.00 82.95  ? 4   A   D C4    1 
ATOM   8149 P  P     . G   D 2 5   ? 30.431  3.604   -16.722 1.00 96.70  ? 5   G   D P     1 
ATOM   8150 O  OP1   . G   D 2 5   ? 29.079  3.136   -17.116 1.00 100.67 ? 5   G   D OP1   1 
ATOM   8151 O  OP2   . G   D 2 5   ? 31.495  2.602   -16.454 1.00 90.92  ? 5   G   D OP2   1 
ATOM   8152 O  "O5'" . G   D 2 5   ? 30.983  4.629   -17.826 1.00 101.76 ? 5   G   D "O5'" 1 
ATOM   8153 C  "C5'" . G   D 2 5   ? 30.087  5.290   -18.708 1.00 110.77 ? 5   G   D "C5'" 1 
ATOM   8154 C  "C4'" . G   D 2 5   ? 30.632  6.637   -19.140 1.00 115.82 ? 5   G   D "C4'" 1 
ATOM   8155 O  "O4'" . G   D 2 5   ? 31.687  7.075   -18.249 1.00 110.81 ? 5   G   D "O4'" 1 
ATOM   8156 C  "C3'" . G   D 2 5   ? 31.331  6.670   -20.489 1.00 120.57 ? 5   G   D "C3'" 1 
ATOM   8157 O  "O3'" . G   D 2 5   ? 30.417  6.593   -21.579 1.00 129.26 ? 5   G   D "O3'" 1 
ATOM   8158 C  "C2'" . G   D 2 5   ? 32.036  8.019   -20.386 1.00 122.03 ? 5   G   D "C2'" 1 
ATOM   8159 O  "O2'" . G   D 2 5   ? 31.172  9.134   -20.506 1.00 127.92 ? 5   G   D "O2'" 1 
ATOM   8160 C  "C1'" . G   D 2 5   ? 32.587  7.909   -18.964 1.00 113.94 ? 5   G   D "C1'" 1 
ATOM   8161 N  N9    . G   D 2 5   ? 33.947  7.354   -18.906 1.00 109.39 ? 5   G   D N9    1 
ATOM   8162 C  C8    . G   D 2 5   ? 34.364  6.202   -18.275 1.00 103.06 ? 5   G   D C8    1 
ATOM   8163 N  N7    . G   D 2 5   ? 35.643  5.967   -18.401 1.00 101.00 ? 5   G   D N7    1 
ATOM   8164 C  C5    . G   D 2 5   ? 36.110  7.028   -19.167 1.00 106.17 ? 5   G   D C5    1 
ATOM   8165 C  C6    . G   D 2 5   ? 37.418  7.326   -19.633 1.00 107.68 ? 5   G   D C6    1 
ATOM   8166 O  O6    . G   D 2 5   ? 38.460  6.682   -19.453 1.00 104.70 ? 5   G   D O6    1 
ATOM   8167 N  N1    . G   D 2 5   ? 37.461  8.503   -20.380 1.00 114.32 ? 5   G   D N1    1 
ATOM   8168 C  C2    . G   D 2 5   ? 36.368  9.297   -20.650 1.00 119.15 ? 5   G   D C2    1 
ATOM   8169 N  N2    . G   D 2 5   ? 36.585  10.397  -21.386 1.00 126.02 ? 5   G   D N2    1 
ATOM   8170 N  N3    . G   D 2 5   ? 35.141  9.035   -20.217 1.00 117.87 ? 5   G   D N3    1 
ATOM   8171 C  C4    . G   D 2 5   ? 35.080  7.890   -19.485 1.00 111.32 ? 5   G   D C4    1 
ATOM   8172 P  P     . U   D 2 6   ? 30.748  5.625   -22.814 1.00 132.32 ? 6   U   D P     1 
ATOM   8173 O  OP1   . U   D 2 6   ? 29.485  5.416   -23.557 1.00 138.84 ? 6   U   D OP1   1 
ATOM   8174 O  OP2   . U   D 2 6   ? 31.498  4.448   -22.313 1.00 124.02 ? 6   U   D OP2   1 
ATOM   8175 O  "O5'" . U   D 2 6   ? 31.752  6.508   -23.701 1.00 137.81 ? 6   U   D "O5'" 1 
ATOM   8176 C  "C5'" . U   D 2 6   ? 31.286  7.655   -24.418 1.00 148.19 ? 6   U   D "C5'" 1 
ATOM   8177 C  "C4'" . U   D 2 6   ? 32.402  8.381   -25.156 1.00 153.34 ? 6   U   D "C4'" 1 
ATOM   8178 O  "O4'" . U   D 2 6   ? 33.390  8.869   -24.207 1.00 148.01 ? 6   U   D "O4'" 1 
ATOM   8179 C  "C3'" . U   D 2 6   ? 33.244  7.554   -26.124 1.00 154.53 ? 6   U   D "C3'" 1 
ATOM   8180 O  "O3'" . U   D 2 6   ? 32.595  7.296   -27.366 1.00 163.07 ? 6   U   D "O3'" 1 
ATOM   8181 C  "C2'" . U   D 2 6   ? 34.466  8.458   -26.259 1.00 156.39 ? 6   U   D "C2'" 1 
ATOM   8182 O  "O2'" . U   D 2 6   ? 34.219  9.640   -27.000 1.00 165.58 ? 6   U   D "O2'" 1 
ATOM   8183 C  "C1'" . U   D 2 6   ? 34.688  8.778   -24.781 1.00 148.62 ? 6   U   D "C1'" 1 
ATOM   8184 N  N1    . U   D 2 6   ? 35.537  7.746   -24.050 1.00 139.71 ? 6   U   D N1    1 
ATOM   8185 C  C2    . U   D 2 6   ? 36.921  7.774   -24.187 1.00 139.07 ? 6   U   D C2    1 
ATOM   8186 O  O2    . U   D 2 6   ? 37.526  8.591   -24.867 1.00 145.10 ? 6   U   D O2    1 
ATOM   8187 N  N3    . U   D 2 6   ? 37.589  6.793   -23.486 1.00 131.34 ? 6   U   D N3    1 
ATOM   8188 C  C4    . U   D 2 6   ? 37.036  5.809   -22.682 1.00 124.77 ? 6   U   D C4    1 
ATOM   8189 O  O4    . U   D 2 6   ? 37.767  5.004   -22.118 1.00 119.29 ? 6   U   D O4    1 
ATOM   8190 C  C5    . U   D 2 6   ? 35.599  5.837   -22.584 1.00 125.90 ? 6   U   D C5    1 
ATOM   8191 C  C6    . U   D 2 6   ? 34.928  6.782   -23.256 1.00 133.11 ? 6   U   D C6    1 
ATOM   8192 P  P     . A   D 2 7   ? 32.787  5.866   -28.072 1.00 162.09 ? 7   A   D P     1 
ATOM   8193 O  OP1   . A   D 2 7   ? 31.897  5.839   -29.254 1.00 171.34 ? 7   A   D OP1   1 
ATOM   8194 O  OP2   . A   D 2 7   ? 32.658  4.801   -27.051 1.00 152.38 ? 7   A   D OP2   1 
ATOM   8195 O  "O5'" . A   D 2 7   ? 34.316  5.896   -28.555 1.00 162.75 ? 7   A   D "O5'" 1 
ATOM   8196 C  "C5'" . A   D 2 7   ? 34.709  6.695   -29.677 1.00 173.02 ? 7   A   D "C5'" 1 
ATOM   8197 C  "C4'" . A   D 2 7   ? 36.196  6.592   -29.985 1.00 172.99 ? 7   A   D "C4'" 1 
ATOM   8198 O  "O4'" . A   D 2 7   ? 36.985  7.076   -28.864 1.00 167.38 ? 7   A   D "O4'" 1 
ATOM   8199 C  "C3'" . A   D 2 7   ? 36.763  5.198   -30.237 1.00 168.25 ? 7   A   D "C3'" 1 
ATOM   8200 O  "O3'" . A   D 2 7   ? 36.435  4.697   -31.535 1.00 174.23 ? 7   A   D "O3'" 1 
ATOM   8201 C  "C2'" . A   D 2 7   ? 38.253  5.499   -30.085 1.00 167.93 ? 7   A   D "C2'" 1 
ATOM   8202 O  "O2'" . A   D 2 7   ? 38.813  6.173   -31.198 1.00 178.14 ? 7   A   D "O2'" 1 
ATOM   8203 C  "C1'" . A   D 2 7   ? 38.236  6.404   -28.853 1.00 164.22 ? 7   A   D "C1'" 1 
ATOM   8204 N  N9    . A   D 2 7   ? 38.392  5.617   -27.626 1.00 153.93 ? 7   A   D N9    1 
ATOM   8205 C  C8    . A   D 2 7   ? 37.400  5.143   -26.807 1.00 148.15 ? 7   A   D C8    1 
ATOM   8206 N  N7    . A   D 2 7   ? 37.834  4.448   -25.783 1.00 140.00 ? 7   A   D N7    1 
ATOM   8207 C  C5    . A   D 2 7   ? 39.209  4.460   -25.941 1.00 140.34 ? 7   A   D C5    1 
ATOM   8208 C  C6    . A   D 2 7   ? 40.256  3.897   -25.180 1.00 134.42 ? 7   A   D C6    1 
ATOM   8209 N  N6    . A   D 2 7   ? 40.046  3.191   -24.066 1.00 126.87 ? 7   A   D N6    1 
ATOM   8210 N  N1    . A   D 2 7   ? 41.526  4.091   -25.607 1.00 137.74 ? 7   A   D N1    1 
ATOM   8211 C  C2    . A   D 2 7   ? 41.733  4.804   -26.727 1.00 146.35 ? 7   A   D C2    1 
ATOM   8212 N  N3    . A   D 2 7   ? 40.829  5.382   -27.525 1.00 152.49 ? 7   A   D N3    1 
ATOM   8213 C  C4    . A   D 2 7   ? 39.575  5.173   -27.073 1.00 148.97 ? 7   A   D C4    1 
ATOM   8214 P  P     . G   D 2 8   ? 36.404  3.125   -31.879 1.00 169.29 ? 8   G   D P     1 
ATOM   8215 O  OP1   . G   D 2 8   ? 37.284  2.934   -33.056 1.00 175.69 ? 8   G   D OP1   1 
ATOM   8216 O  OP2   . G   D 2 8   ? 34.987  2.712   -31.961 1.00 170.06 ? 8   G   D OP2   1 
ATOM   8217 O  "O5'" . G   D 2 8   ? 37.012  2.377   -30.598 1.00 156.94 ? 8   G   D "O5'" 1 
ATOM   8218 C  "C5'" . G   D 2 8   ? 37.798  1.190   -30.720 1.00 151.08 ? 8   G   D "C5'" 1 
ATOM   8219 C  "C4'" . G   D 2 8   ? 39.266  1.574   -30.722 1.00 150.79 ? 8   G   D "C4'" 1 
ATOM   8220 O  "O4'" . G   D 2 8   ? 39.533  2.433   -29.581 1.00 146.94 ? 8   G   D "O4'" 1 
ATOM   8221 C  "C3'" . G   D 2 8   ? 40.279  0.449   -30.567 1.00 144.91 ? 8   G   D "C3'" 1 
ATOM   8222 O  "O3'" . G   D 2 8   ? 40.510  -0.263  -31.791 1.00 148.14 ? 8   G   D "O3'" 1 
ATOM   8223 C  "C2'" . G   D 2 8   ? 41.487  1.271   -30.116 1.00 145.69 ? 8   G   D "C2'" 1 
ATOM   8224 O  "O2'" . G   D 2 8   ? 42.084  2.033   -31.151 1.00 154.72 ? 8   G   D "O2'" 1 
ATOM   8225 C  "C1'" . G   D 2 8   ? 40.831  2.176   -29.080 1.00 142.62 ? 8   G   D "C1'" 1 
ATOM   8226 N  N9    . G   D 2 8   ? 40.740  1.531   -27.769 1.00 133.01 ? 8   G   D N9    1 
ATOM   8227 C  C8    . G   D 2 8   ? 39.595  1.164   -27.099 1.00 128.18 ? 8   G   D C8    1 
ATOM   8228 N  N7    . G   D 2 8   ? 39.821  0.593   -25.948 1.00 120.70 ? 8   G   D N7    1 
ATOM   8229 C  C5    . G   D 2 8   ? 41.207  0.575   -25.846 1.00 120.55 ? 8   G   D C5    1 
ATOM   8230 C  C6    . G   D 2 8   ? 42.041  0.079   -24.813 1.00 114.95 ? 8   G   D C6    1 
ATOM   8231 O  O6    . G   D 2 8   ? 41.699  -0.461  -23.749 1.00 108.83 ? 8   G   D O6    1 
ATOM   8232 N  N1    . G   D 2 8   ? 43.397  0.255   -25.101 1.00 117.99 ? 8   G   D N1    1 
ATOM   8233 C  C2    . G   D 2 8   ? 43.892  0.838   -26.247 1.00 125.58 ? 8   G   D C2    1 
ATOM   8234 N  N2    . G   D 2 8   ? 45.227  0.920   -26.350 1.00 128.31 ? 8   G   D N2    1 
ATOM   8235 N  N3    . G   D 2 8   ? 43.120  1.308   -27.220 1.00 130.92 ? 8   G   D N3    1 
ATOM   8236 C  C4    . G   D 2 8   ? 41.792  1.146   -26.959 1.00 128.06 ? 8   G   D C4    1 
ATOM   8237 P  P     . A   D 2 9   ? 41.547  -1.491  -31.844 1.00 143.40 ? 9   A   D P     1 
ATOM   8238 O  OP1   . A   D 2 9   ? 41.602  -1.990  -33.239 1.00 150.01 ? 9   A   D OP1   1 
ATOM   8239 O  OP2   . A   D 2 9   ? 41.213  -2.435  -30.747 1.00 133.39 ? 9   A   D OP2   1 
ATOM   8240 O  "O5'" . A   D 2 9   ? 42.922  -0.744  -31.477 1.00 143.45 ? 9   A   D "O5'" 1 
ATOM   8241 C  "C5'" . A   D 2 9   ? 44.162  -0.991  -32.129 1.00 145.49 ? 9   A   D "C5'" 1 
ATOM   8242 C  "C4'" . A   D 2 9   ? 45.183  -1.538  -31.146 1.00 137.57 ? 9   A   D "C4'" 1 
ATOM   8243 O  "O4'" . A   D 2 9   ? 45.064  -0.924  -29.831 1.00 131.30 ? 9   A   D "O4'" 1 
ATOM   8244 C  "C3'" . A   D 2 9   ? 45.008  -3.006  -30.807 1.00 129.51 ? 9   A   D "C3'" 1 
ATOM   8245 O  "O3'" . A   D 2 9   ? 45.368  -3.873  -31.873 1.00 131.73 ? 9   A   D "O3'" 1 
ATOM   8246 C  "C2'" . A   D 2 9   ? 45.908  -3.118  -29.577 1.00 123.98 ? 9   A   D "C2'" 1 
ATOM   8247 O  "O2'" . A   D 2 9   ? 47.295  -3.096  -29.866 1.00 128.39 ? 9   A   D "O2'" 1 
ATOM   8248 C  "C1'" . A   D 2 9   ? 45.456  -1.862  -28.836 1.00 122.66 ? 9   A   D "C1'" 1 
ATOM   8249 N  N9    . A   D 2 9   ? 44.336  -2.160  -27.940 1.00 115.40 ? 9   A   D N9    1 
ATOM   8250 C  C8    . A   D 2 9   ? 43.011  -1.882  -28.140 1.00 115.31 ? 9   A   D C8    1 
ATOM   8251 N  N7    . A   D 2 9   ? 42.227  -2.279  -27.166 1.00 108.50 ? 9   A   D N7    1 
ATOM   8252 C  C5    . A   D 2 9   ? 43.095  -2.867  -26.264 1.00 103.75 ? 9   A   D C5    1 
ATOM   8253 C  C6    . A   D 2 9   ? 42.889  -3.486  -25.011 1.00 96.67  ? 9   A   D C6    1 
ATOM   8254 N  N6    . A   D 2 9   ? 41.684  -3.611  -24.451 1.00 93.18  ? 9   A   D N6    1 
ATOM   8255 N  N1    . A   D 2 9   ? 43.967  -3.977  -24.362 1.00 94.45  ? 9   A   D N1    1 
ATOM   8256 C  C2    . A   D 2 9   ? 45.177  -3.845  -24.928 1.00 98.85  ? 9   A   D C2    1 
ATOM   8257 N  N3    . A   D 2 9   ? 45.494  -3.286  -26.098 1.00 105.33 ? 9   A   D N3    1 
ATOM   8258 C  C4    . A   D 2 9   ? 44.400  -2.809  -26.723 1.00 107.62 ? 9   A   D C4    1 
ATOM   8259 P  P     . U   D 2 10  ? 44.830  -5.379  -31.812 1.00 124.89 ? 10  U   D P     1 
ATOM   8260 O  OP1   . U   D 2 10  ? 44.709  -5.879  -33.204 1.00 130.64 ? 10  U   D OP1   1 
ATOM   8261 O  OP2   . U   D 2 10  ? 43.668  -5.442  -30.889 1.00 117.72 ? 10  U   D OP2   1 
ATOM   8262 O  "O5'" . U   D 2 10  ? 46.065  -6.102  -31.104 1.00 119.41 ? 10  U   D "O5'" 1 
ATOM   8263 C  "C5'" . U   D 2 10  ? 45.831  -7.157  -30.217 1.00 108.61 ? 10  U   D "C5'" 1 
ATOM   8264 C  "C4'" . U   D 2 10  ? 46.845  -7.164  -29.098 1.00 103.39 ? 10  U   D "C4'" 1 
ATOM   8265 O  "O4'" . U   D 2 10  ? 46.541  -6.147  -28.107 1.00 99.80  ? 10  U   D "O4'" 1 
ATOM   8266 C  "C3'" . U   D 2 10  ? 46.762  -8.475  -28.350 1.00 95.79  ? 10  U   D "C3'" 1 
ATOM   8267 O  "O3'" . U   D 2 10  ? 47.625  -9.419  -28.958 1.00 97.12  ? 10  U   D "O3'" 1 
ATOM   8268 C  "C2'" . U   D 2 10  ? 47.115  -8.115  -26.914 1.00 91.20  ? 10  U   D "C2'" 1 
ATOM   8269 O  "O2'" . U   D 2 10  ? 48.505  -8.044  -26.663 1.00 94.31  ? 10  U   D "O2'" 1 
ATOM   8270 C  "C1'" . U   D 2 10  ? 46.454  -6.741  -26.816 1.00 92.06  ? 10  U   D "C1'" 1 
ATOM   8271 N  N1    . U   D 2 10  ? 45.014  -6.793  -26.344 1.00 86.79  ? 10  U   D N1    1 
ATOM   8272 C  C2    . U   D 2 10  ? 44.716  -7.282  -25.074 1.00 80.77  ? 10  U   D C2    1 
ATOM   8273 O  O2    . U   D 2 10  ? 45.548  -7.689  -24.275 1.00 78.79  ? 10  U   D O2    1 
ATOM   8274 N  N3    . U   D 2 10  ? 43.378  -7.280  -24.753 1.00 77.54  ? 10  U   D N3    1 
ATOM   8275 C  C4    . U   D 2 10  ? 42.323  -6.850  -25.540 1.00 80.15  ? 10  U   D C4    1 
ATOM   8276 O  O4    . U   D 2 10  ? 41.178  -6.914  -25.102 1.00 77.50  ? 10  U   D O4    1 
ATOM   8277 C  C5    . U   D 2 10  ? 42.702  -6.360  -26.842 1.00 86.47  ? 10  U   D C5    1 
ATOM   8278 C  C6    . U   D 2 10  ? 44.000  -6.347  -27.180 1.00 89.50  ? 10  U   D C6    1 
ATOM   8279 P  P     . G   D 2 11  ? 46.989  -10.833 -29.345 1.00 93.48  ? 11  G   D P     1 
ATOM   8280 O  OP1   . G   D 2 11  ? 47.865  -11.474 -30.355 1.00 98.57  ? 11  G   D OP1   1 
ATOM   8281 O  OP2   . G   D 2 11  ? 45.545  -10.643 -29.622 1.00 91.32  ? 11  G   D OP2   1 
ATOM   8282 O  "O5'" . G   D 2 11  ? 47.110  -11.634 -27.974 1.00 85.97  ? 11  G   D "O5'" 1 
ATOM   8283 C  "C5'" . G   D 2 11  ? 48.376  -11.791 -27.361 1.00 86.33  ? 11  G   D "C5'" 1 
ATOM   8284 C  "C4'" . G   D 2 11  ? 48.198  -12.038 -25.879 1.00 80.37  ? 11  G   D "C4'" 1 
ATOM   8285 O  "O4'" . G   D 2 11  ? 47.425  -10.974 -25.263 1.00 78.03  ? 11  G   D "O4'" 1 
ATOM   8286 C  "C3'" . G   D 2 11  ? 47.387  -13.272 -25.539 1.00 75.56  ? 11  G   D "C3'" 1 
ATOM   8287 O  "O3'" . G   D 2 11  ? 48.157  -14.444 -25.769 1.00 77.42  ? 11  G   D "O3'" 1 
ATOM   8288 C  "C2'" . G   D 2 11  ? 47.070  -12.984 -24.068 1.00 70.57  ? 11  G   D "C2'" 1 
ATOM   8289 O  "O2'" . G   D 2 11  ? 48.137  -13.197 -23.158 1.00 70.55  ? 11  G   D "O2'" 1 
ATOM   8290 C  "C1'" . G   D 2 11  ? 46.720  -11.499 -24.148 1.00 70.92  ? 11  G   D "C1'" 1 
ATOM   8291 N  N9    . G   D 2 11  ? 45.282  -11.300 -24.322 1.00 68.34  ? 11  G   D N9    1 
ATOM   8292 C  C8    . G   D 2 11  ? 44.629  -10.820 -25.435 1.00 71.13  ? 11  G   D C8    1 
ATOM   8293 N  N7    . G   D 2 11  ? 43.334  -10.760 -25.295 1.00 68.80  ? 11  G   D N7    1 
ATOM   8294 C  C5    . G   D 2 11  ? 43.108  -11.235 -24.005 1.00 64.46  ? 11  G   D C5    1 
ATOM   8295 C  C6    . G   D 2 11  ? 41.895  -11.412 -23.284 1.00 61.15  ? 11  G   D C6    1 
ATOM   8296 O  O6    . G   D 2 11  ? 40.741  -11.167 -23.667 1.00 61.36  ? 11  G   D O6    1 
ATOM   8297 N  N1    . G   D 2 11  ? 42.108  -11.928 -22.000 1.00 57.44  ? 11  G   D N1    1 
ATOM   8298 C  C2    . G   D 2 11  ? 43.342  -12.238 -21.474 1.00 57.30  ? 11  G   D C2    1 
ATOM   8299 N  N2    . G   D 2 11  ? 43.362  -12.724 -20.224 1.00 54.75  ? 11  G   D N2    1 
ATOM   8300 N  N3    . G   D 2 11  ? 44.482  -12.076 -22.139 1.00 60.23  ? 11  G   D N3    1 
ATOM   8301 C  C4    . G   D 2 11  ? 44.297  -11.575 -23.393 1.00 64.01  ? 11  G   D C4    1 
ATOM   8302 P  P     . G   D 2 12  ? 47.452  -15.836 -26.131 1.00 76.81  ? 12  G   D P     1 
ATOM   8303 O  OP1   . G   D 2 12  ? 48.546  -16.778 -26.468 1.00 79.71  ? 12  G   D OP1   1 
ATOM   8304 O  OP2   . G   D 2 12  ? 46.355  -15.616 -27.107 1.00 76.04  ? 12  G   D OP2   1 
ATOM   8305 O  "O5'" . G   D 2 12  ? 46.759  -16.263 -24.746 1.00 70.86  ? 12  G   D "O5'" 1 
ATOM   8306 C  "C5'" . G   D 2 12  ? 47.507  -16.580 -23.565 1.00 69.15  ? 12  G   D "C5'" 1 
ATOM   8307 C  "C4'" . G   D 2 12  ? 46.551  -16.732 -22.395 1.00 64.33  ? 12  G   D "C4'" 1 
ATOM   8308 O  "O4'" . G   D 2 12  ? 45.791  -15.506 -22.252 1.00 62.08  ? 12  G   D "O4'" 1 
ATOM   8309 C  "C3'" . G   D 2 12  ? 45.436  -17.757 -22.562 1.00 62.19  ? 12  G   D "C3'" 1 
ATOM   8310 O  "O3'" . G   D 2 12  ? 45.876  -19.084 -22.350 1.00 63.97  ? 12  G   D "O3'" 1 
ATOM   8311 C  "C2'" . G   D 2 12  ? 44.438  -17.302 -21.505 1.00 57.57  ? 12  G   D "C2'" 1 
ATOM   8312 O  "O2'" . G   D 2 12  ? 44.837  -17.558 -20.174 1.00 57.14  ? 12  G   D "O2'" 1 
ATOM   8313 C  "C1'" . G   D 2 12  ? 44.490  -15.809 -21.758 1.00 57.19  ? 12  G   D "C1'" 1 
ATOM   8314 N  N9    . G   D 2 12  ? 43.452  -15.337 -22.677 1.00 56.69  ? 12  G   D N9    1 
ATOM   8315 C  C8    . G   D 2 12  ? 43.614  -14.865 -23.958 1.00 59.56  ? 12  G   D C8    1 
ATOM   8316 N  N7    . G   D 2 12  ? 42.495  -14.503 -24.518 1.00 59.84  ? 12  G   D N7    1 
ATOM   8317 C  C5    . G   D 2 12  ? 41.530  -14.754 -23.551 1.00 56.60  ? 12  G   D C5    1 
ATOM   8318 C  C6    . G   D 2 12  ? 40.129  -14.553 -23.582 1.00 56.20  ? 12  G   D C6    1 
ATOM   8319 O  O6    . G   D 2 12  ? 39.458  -14.106 -24.520 1.00 58.40  ? 12  G   D O6    1 
ATOM   8320 N  N1    . G   D 2 12  ? 39.508  -14.932 -22.385 1.00 53.15  ? 12  G   D N1    1 
ATOM   8321 C  C2    . G   D 2 12  ? 40.170  -15.444 -21.290 1.00 51.58  ? 12  G   D C2    1 
ATOM   8322 N  N2    . G   D 2 12  ? 39.419  -15.760 -20.219 1.00 49.52  ? 12  G   D N2    1 
ATOM   8323 N  N3    . G   D 2 12  ? 41.487  -15.630 -21.248 1.00 51.50  ? 12  G   D N3    1 
ATOM   8324 C  C4    . G   D 2 12  ? 42.101  -15.265 -22.406 1.00 54.76  ? 12  G   D C4    1 
ATOM   8325 P  P     . U   D 2 13  ? 45.145  -20.264 -23.140 1.00 63.98  ? 13  U   D P     1 
ATOM   8326 O  OP1   . U   D 2 13  ? 45.939  -21.499 -22.964 1.00 66.23  ? 13  U   D OP1   1 
ATOM   8327 O  OP2   . U   D 2 13  ? 44.808  -19.774 -24.495 1.00 66.56  ? 13  U   D OP2   1 
ATOM   8328 O  "O5'" . U   D 2 13  ? 43.766  -20.446 -22.373 1.00 59.46  ? 13  U   D "O5'" 1 
ATOM   8329 C  "C5'" . U   D 2 13  ? 43.711  -20.700 -20.978 1.00 56.66  ? 13  U   D "C5'" 1 
ATOM   8330 C  "C4'" . U   D 2 13  ? 42.255  -20.670 -20.581 1.00 53.56  ? 13  U   D "C4'" 1 
ATOM   8331 O  "O4'" . U   D 2 13  ? 41.746  -19.330 -20.792 1.00 52.60  ? 13  U   D "O4'" 1 
ATOM   8332 C  "C3'" . U   D 2 13  ? 41.372  -21.517 -21.486 1.00 53.29  ? 13  U   D "C3'" 1 
ATOM   8333 O  "O3'" . U   D 2 13  ? 41.409  -22.892 -21.140 1.00 53.23  ? 13  U   D "O3'" 1 
ATOM   8334 C  "C2'" . U   D 2 13  ? 40.007  -20.887 -21.253 1.00 51.51  ? 13  U   D "C2'" 1 
ATOM   8335 O  "O2'" . U   D 2 13  ? 39.384  -21.331 -20.063 1.00 51.40  ? 13  U   D "O2'" 1 
ATOM   8336 C  "C1'" . U   D 2 13  ? 40.381  -19.405 -21.186 1.00 51.61  ? 13  U   D "C1'" 1 
ATOM   8337 N  N1    . U   D 2 13  ? 40.129  -18.700 -22.505 1.00 52.46  ? 13  U   D N1    1 
ATOM   8338 C  C2    . U   D 2 13  ? 38.838  -18.263 -22.795 1.00 52.69  ? 13  U   D C2    1 
ATOM   8339 O  O2    . U   D 2 13  ? 37.879  -18.401 -22.042 1.00 51.19  ? 13  U   D O2    1 
ATOM   8340 N  N3    . U   D 2 13  ? 38.705  -17.644 -24.017 1.00 54.58  ? 13  U   D N3    1 
ATOM   8341 C  C4    . U   D 2 13  ? 39.704  -17.429 -24.954 1.00 57.33  ? 13  U   D C4    1 
ATOM   8342 O  O4    . U   D 2 13  ? 39.429  -16.857 -26.007 1.00 60.49  ? 13  U   D O4    1 
ATOM   8343 C  C5    . U   D 2 13  ? 41.016  -17.914 -24.589 1.00 56.33  ? 13  U   D C5    1 
ATOM   8344 C  C6    . U   D 2 13  ? 41.170  -18.523 -23.407 1.00 54.10  ? 13  U   D C6    1 
ATOM   8345 P  P     . U   D 2 14  ? 41.282  -23.995 -22.297 1.00 53.98  ? 14  U   D P     1 
ATOM   8346 O  OP1   . U   D 2 14  ? 41.331  -25.332 -21.663 1.00 53.93  ? 14  U   D OP1   1 
ATOM   8347 O  OP2   . U   D 2 14  ? 42.230  -23.662 -23.380 1.00 55.49  ? 14  U   D OP2   1 
ATOM   8348 O  "O5'" . U   D 2 14  ? 39.805  -23.725 -22.869 1.00 51.32  ? 14  U   D "O5'" 1 
ATOM   8349 C  "C5'" . U   D 2 14  ? 38.630  -24.031 -22.117 1.00 48.13  ? 14  U   D "C5'" 1 
ATOM   8350 C  "C4'" . U   D 2 14  ? 37.386  -23.611 -22.882 1.00 46.07  ? 14  U   D "C4'" 1 
ATOM   8351 O  "O4'" . U   D 2 14  ? 37.403  -22.175 -23.104 1.00 44.25  ? 14  U   D "O4'" 1 
ATOM   8352 C  "C3'" . U   D 2 14  ? 37.274  -24.213 -24.280 1.00 45.65  ? 14  U   D "C3'" 1 
ATOM   8353 O  "O3'" . U   D 2 14  ? 36.701  -25.506 -24.222 1.00 45.11  ? 14  U   D "O3'" 1 
ATOM   8354 C  "C2'" . U   D 2 14  ? 36.378  -23.188 -24.983 1.00 46.72  ? 14  U   D "C2'" 1 
ATOM   8355 O  "O2'" . U   D 2 14  ? 34.996  -23.347 -24.740 1.00 48.11  ? 14  U   D "O2'" 1 
ATOM   8356 C  "C1'" . U   D 2 14  ? 36.875  -21.870 -24.383 1.00 46.30  ? 14  U   D "C1'" 1 
ATOM   8357 N  N1    . U   D 2 14  ? 37.890  -21.250 -25.302 1.00 46.68  ? 14  U   D N1    1 
ATOM   8358 C  C2    . U   D 2 14  ? 37.424  -20.503 -26.369 1.00 49.50  ? 14  U   D C2    1 
ATOM   8359 O  O2    . U   D 2 14  ? 36.239  -20.307 -26.585 1.00 50.44  ? 14  U   D O2    1 
ATOM   8360 N  N3    . U   D 2 14  ? 38.406  -19.975 -27.181 1.00 51.72  ? 14  U   D N3    1 
ATOM   8361 C  C4    . U   D 2 14  ? 39.778  -20.133 -27.047 1.00 50.54  ? 14  U   D C4    1 
ATOM   8362 O  O4    . U   D 2 14  ? 40.524  -19.601 -27.860 1.00 53.81  ? 14  U   D O4    1 
ATOM   8363 C  C5    . U   D 2 14  ? 40.198  -20.934 -25.922 1.00 47.67  ? 14  U   D C5    1 
ATOM   8364 C  C6    . U   D 2 14  ? 39.253  -21.448 -25.111 1.00 46.83  ? 14  U   D C6    1 
ATOM   8365 P  P     . C   D 2 15  ? 37.280  -26.728 -25.080 1.00 43.34  ? 15  C   D P     1 
ATOM   8366 O  OP1   . C   D 2 15  ? 36.629  -27.951 -24.558 1.00 44.46  ? 15  C   D OP1   1 
ATOM   8367 O  OP2   . C   D 2 15  ? 38.758  -26.631 -25.136 1.00 43.69  ? 15  C   D OP2   1 
ATOM   8368 O  "O5'" . C   D 2 15  ? 36.736  -26.408 -26.547 1.00 44.13  ? 15  C   D "O5'" 1 
ATOM   8369 C  "C5'" . C   D 2 15  ? 37.200  -27.103 -27.701 1.00 43.23  ? 15  C   D "C5'" 1 
ATOM   8370 C  "C4'" . C   D 2 15  ? 36.439  -26.632 -28.934 1.00 45.58  ? 15  C   D "C4'" 1 
ATOM   8371 O  "O4'" . C   D 2 15  ? 35.040  -27.000 -28.850 1.00 45.40  ? 15  C   D "O4'" 1 
ATOM   8372 C  "C3'" . C   D 2 15  ? 36.359  -25.125 -29.131 1.00 47.34  ? 15  C   D "C3'" 1 
ATOM   8373 O  "O3'" . C   D 2 15  ? 37.584  -24.624 -29.627 1.00 50.68  ? 15  C   D "O3'" 1 
ATOM   8374 C  "C2'" . C   D 2 15  ? 35.222  -25.016 -30.143 1.00 49.58  ? 15  C   D "C2'" 1 
ATOM   8375 O  "O2'" . C   D 2 15  ? 35.581  -25.317 -31.481 1.00 52.59  ? 15  C   D "O2'" 1 
ATOM   8376 C  "C1'" . C   D 2 15  ? 34.263  -26.085 -29.614 1.00 48.30  ? 15  C   D "C1'" 1 
ATOM   8377 N  N1    . C   D 2 15  ? 33.106  -25.503 -28.814 1.00 48.61  ? 15  C   D N1    1 
ATOM   8378 C  C2    . C   D 2 15  ? 33.070  -25.528 -27.405 1.00 46.35  ? 15  C   D C2    1 
ATOM   8379 O  O2    . C   D 2 15  ? 33.980  -26.038 -26.765 1.00 46.51  ? 15  C   D O2    1 
ATOM   8380 N  N3    . C   D 2 15  ? 32.032  -24.990 -26.724 1.00 46.95  ? 15  C   D N3    1 
ATOM   8381 C  C4    . C   D 2 15  ? 31.037  -24.444 -27.402 1.00 50.09  ? 15  C   D C4    1 
ATOM   8382 N  N4    . C   D 2 15  ? 30.034  -23.942 -26.679 1.00 52.79  ? 15  C   D N4    1 
ATOM   8383 C  C5    . C   D 2 15  ? 31.042  -24.394 -28.833 1.00 53.16  ? 15  C   D C5    1 
ATOM   8384 C  C6    . C   D 2 15  ? 32.072  -24.924 -29.504 1.00 50.73  ? 15  C   D C6    1 
ATOM   8385 P  P     . A   D 2 16  ? 38.193  -23.216 -29.168 1.00 51.08  ? 16  A   D P     1 
ATOM   8386 O  OP1   . A   D 2 16  ? 39.375  -22.993 -30.033 1.00 53.06  ? 16  A   D OP1   1 
ATOM   8387 O  OP2   . A   D 2 16  ? 38.336  -23.186 -27.701 1.00 47.28  ? 16  A   D OP2   1 
ATOM   8388 O  "O5'" . A   D 2 16  ? 37.076  -22.152 -29.584 1.00 57.57  ? 16  A   D "O5'" 1 
ATOM   8389 C  "C5'" . A   D 2 16  ? 36.833  -21.866 -30.954 1.00 65.98  ? 16  A   D "C5'" 1 
ATOM   8390 C  "C4'" . A   D 2 16  ? 35.570  -21.044 -31.122 1.00 72.67  ? 16  A   D "C4'" 1 
ATOM   8391 O  "O4'" . A   D 2 16  ? 34.420  -21.783 -30.637 1.00 71.39  ? 16  A   D "O4'" 1 
ATOM   8392 C  "C3'" . A   D 2 16  ? 35.558  -19.725 -30.358 1.00 74.74  ? 16  A   D "C3'" 1 
ATOM   8393 O  "O3'" . A   D 2 16  ? 36.170  -18.701 -31.141 1.00 83.94  ? 16  A   D "O3'" 1 
ATOM   8394 C  "C2'" . A   D 2 16  ? 34.065  -19.471 -30.156 1.00 75.51  ? 16  A   D "C2'" 1 
ATOM   8395 O  "O2'" . A   D 2 16  ? 33.436  -18.795 -31.227 1.00 81.67  ? 16  A   D "O2'" 1 
ATOM   8396 C  "C1'" . A   D 2 16  ? 33.497  -20.882 -30.051 1.00 72.53  ? 16  A   D "C1'" 1 
ATOM   8397 N  N9    . A   D 2 16  ? 33.261  -21.225 -28.655 1.00 68.29  ? 16  A   D N9    1 
ATOM   8398 C  C8    . A   D 2 16  ? 34.093  -21.906 -27.812 1.00 64.16  ? 16  A   D C8    1 
ATOM   8399 N  N7    . A   D 2 16  ? 33.604  -22.050 -26.605 1.00 62.17  ? 16  A   D N7    1 
ATOM   8400 C  C5    . A   D 2 16  ? 32.376  -21.418 -26.658 1.00 65.37  ? 16  A   D C5    1 
ATOM   8401 C  C6    . A   D 2 16  ? 31.356  -21.224 -25.700 1.00 66.37  ? 16  A   D C6    1 
ATOM   8402 N  N6    . A   D 2 16  ? 31.441  -21.668 -24.440 1.00 63.98  ? 16  A   D N6    1 
ATOM   8403 N  N1    . A   D 2 16  ? 30.246  -20.548 -26.086 1.00 69.97  ? 16  A   D N1    1 
ATOM   8404 C  C2    . A   D 2 16  ? 30.162  -20.100 -27.346 1.00 73.03  ? 16  A   D C2    1 
ATOM   8405 N  N3    . A   D 2 16  ? 31.054  -20.224 -28.332 1.00 72.99  ? 16  A   D N3    1 
ATOM   8406 C  C4    . A   D 2 16  ? 32.146  -20.899 -27.918 1.00 68.98  ? 16  A   D C4    1 
ATOM   8407 P  P     . A   D 2 17  ? 37.266  -17.687 -30.554 1.00 86.57  ? 17  A   D P     1 
ATOM   8408 O  OP1   . A   D 2 17  ? 37.763  -16.882 -31.694 1.00 92.12  ? 17  A   D OP1   1 
ATOM   8409 O  OP2   . A   D 2 17  ? 38.235  -18.449 -29.735 1.00 82.42  ? 17  A   D OP2   1 
ATOM   8410 O  "O5'" . A   D 2 17  ? 36.402  -16.728 -29.615 1.00 90.28  ? 17  A   D "O5'" 1 
ATOM   8411 C  "C5'" . A   D 2 17  ? 36.429  -16.827 -28.197 1.00 93.68  ? 17  A   D "C5'" 1 
ATOM   8412 C  "C4'" . A   D 2 17  ? 35.105  -16.293 -27.685 1.00 99.76  ? 17  A   D "C4'" 1 
ATOM   8413 O  "O4'" . A   D 2 17  ? 34.379  -17.286 -26.909 1.00 98.99  ? 17  A   D "O4'" 1 
ATOM   8414 C  "C3'" . A   D 2 17  ? 35.164  -15.015 -26.824 1.00 101.60 ? 17  A   D "C3'" 1 
ATOM   8415 O  "O3'" . A   D 2 17  ? 34.502  -13.867 -27.472 1.00 109.27 ? 17  A   D "O3'" 1 
ATOM   8416 C  "C2'" . A   D 2 17  ? 34.479  -15.486 -25.528 1.00 98.61  ? 17  A   D "C2'" 1 
ATOM   8417 O  "O2'" . A   D 2 17  ? 33.766  -14.486 -24.829 1.00 98.66  ? 17  A   D "O2'" 1 
ATOM   8418 C  "C1'" . A   D 2 17  ? 33.506  -16.450 -26.189 1.00 101.27 ? 17  A   D "C1'" 1 
ATOM   8419 N  N9    . A   D 2 17  ? 32.543  -17.179 -25.364 1.00 100.72 ? 17  A   D N9    1 
ATOM   8420 C  C8    . A   D 2 17  ? 32.754  -18.192 -24.470 1.00 97.75  ? 17  A   D C8    1 
ATOM   8421 N  N7    . A   D 2 17  ? 31.647  -18.617 -23.900 1.00 98.79  ? 17  A   D N7    1 
ATOM   8422 C  C5    . A   D 2 17  ? 30.644  -17.835 -24.461 1.00 102.85 ? 17  A   D C5    1 
ATOM   8423 C  C6    . A   D 2 17  ? 29.234  -17.780 -24.290 1.00 106.54 ? 17  A   D C6    1 
ATOM   8424 N  N6    . A   D 2 17  ? 28.550  -18.576 -23.455 1.00 106.51 ? 17  A   D N6    1 
ATOM   8425 N  N1    . A   D 2 17  ? 28.540  -16.868 -25.018 1.00 110.86 ? 17  A   D N1    1 
ATOM   8426 C  C2    . A   D 2 17  ? 29.206  -16.065 -25.862 1.00 111.51 ? 17  A   D C2    1 
ATOM   8427 N  N3    . A   D 2 17  ? 30.518  -16.026 -26.105 1.00 108.44 ? 17  A   D N3    1 
ATOM   8428 C  C4    . A   D 2 17  ? 31.185  -16.942 -25.370 1.00 104.14 ? 17  A   D C4    1 
ATOM   8429 P  P     . G   D 2 18  ? 34.051  -13.756 -29.032 1.00 117.78 ? 18  G   D P     1 
ATOM   8430 O  OP1   . G   D 2 18  ? 32.750  -14.445 -29.205 1.00 119.26 ? 18  G   D OP1   1 
ATOM   8431 O  OP2   . G   D 2 18  ? 35.188  -14.145 -29.896 1.00 118.69 ? 18  G   D OP2   1 
ATOM   8432 O  "O5'" . G   D 2 18  ? 33.827  -12.182 -29.245 1.00 122.85 ? 18  G   D "O5'" 1 
ATOM   8433 C  "C5'" . G   D 2 18  ? 34.953  -11.301 -29.244 1.00 124.84 ? 18  G   D "C5'" 1 
ATOM   8434 C  "C4'" . G   D 2 18  ? 34.567  -9.847  -29.033 1.00 129.19 ? 18  G   D "C4'" 1 
ATOM   8435 O  "O4'" . G   D 2 18  ? 33.925  -9.338  -30.227 1.00 137.12 ? 18  G   D "O4'" 1 
ATOM   8436 C  "C3'" . G   D 2 18  ? 33.562  -9.545  -27.926 1.00 127.71 ? 18  G   D "C3'" 1 
ATOM   8437 O  "O3'" . G   D 2 18  ? 34.198  -9.518  -26.640 1.00 122.20 ? 18  G   D "O3'" 1 
ATOM   8438 C  "C2'" . G   D 2 18  ? 33.051  -8.168  -28.351 1.00 133.71 ? 18  G   D "C2'" 1 
ATOM   8439 O  "O2'" . G   D 2 18  ? 33.909  -7.106  -27.977 1.00 132.99 ? 18  G   D "O2'" 1 
ATOM   8440 C  "C1'" . G   D 2 18  ? 33.033  -8.294  -29.872 1.00 140.60 ? 18  G   D "C1'" 1 
ATOM   8441 N  N9    . G   D 2 18  ? 31.709  -8.581  -30.424 1.00 145.50 ? 18  G   D N9    1 
ATOM   8442 C  C8    . G   D 2 18  ? 31.144  -9.823  -30.613 1.00 144.59 ? 18  G   D C8    1 
ATOM   8443 N  N7    . G   D 2 18  ? 29.948  -9.778  -31.129 1.00 150.26 ? 18  G   D N7    1 
ATOM   8444 C  C5    . G   D 2 18  ? 29.697  -8.421  -31.297 1.00 155.46 ? 18  G   D C5    1 
ATOM   8445 C  C6    . G   D 2 18  ? 28.553  -7.757  -31.817 1.00 163.36 ? 18  G   D C6    1 
ATOM   8446 O  O6    . G   D 2 18  ? 27.505  -8.265  -32.245 1.00 167.59 ? 18  G   D O6    1 
ATOM   8447 N  N1    . G   D 2 18  ? 28.699  -6.366  -31.816 1.00 166.98 ? 18  G   D N1    1 
ATOM   8448 C  C2    . G   D 2 18  ? 29.816  -5.697  -31.365 1.00 163.31 ? 18  G   D C2    1 
ATOM   8449 N  N2    . G   D 2 18  ? 29.782  -4.358  -31.438 1.00 167.99 ? 18  G   D N2    1 
ATOM   8450 N  N3    . G   D 2 18  ? 30.895  -6.308  -30.875 1.00 156.16 ? 18  G   D N3    1 
ATOM   8451 C  C4    . G   D 2 18  ? 30.772  -7.666  -30.868 1.00 152.57 ? 18  G   D C4    1 
ATOM   8452 P  P     . U   D 2 19  ? 33.478  -10.102 -25.324 1.00 117.78 ? 19  U   D P     1 
ATOM   8453 O  OP1   . U   D 2 19  ? 34.294  -9.682  -24.158 1.00 113.29 ? 19  U   D OP1   1 
ATOM   8454 O  OP2   . U   D 2 19  ? 33.209  -11.543 -25.555 1.00 116.38 ? 19  U   D OP2   1 
ATOM   8455 O  "O5'" . U   D 2 19  ? 32.060  -9.341  -25.303 1.00 120.86 ? 19  U   D "O5'" 1 
ATOM   8456 C  "C5'" . U   D 2 19  ? 31.463  -8.866  -24.089 1.00 117.15 ? 19  U   D "C5'" 1 
ATOM   8457 C  "C4'" . U   D 2 19  ? 30.356  -9.792  -23.598 1.00 115.23 ? 19  U   D "C4'" 1 
ATOM   8458 O  "O4'" . U   D 2 19  ? 29.525  -10.224 -24.705 1.00 120.26 ? 19  U   D "O4'" 1 
ATOM   8459 C  "C3'" . U   D 2 19  ? 30.837  -11.054 -22.880 1.00 108.43 ? 19  U   D "C3'" 1 
ATOM   8460 O  "O3'" . U   D 2 19  ? 30.239  -11.114 -21.581 1.00 103.58 ? 19  U   D "O3'" 1 
ATOM   8461 C  "C2'" . U   D 2 19  ? 30.425  -12.215 -23.793 1.00 111.00 ? 19  U   D "C2'" 1 
ATOM   8462 O  "O2'" . U   D 2 19  ? 29.999  -13.360 -23.077 1.00 108.81 ? 19  U   D "O2'" 1 
ATOM   8463 C  "C1'" . U   D 2 19  ? 29.277  -11.613 -24.607 1.00 118.51 ? 19  U   D "C1'" 1 
ATOM   8464 N  N1    . U   D 2 19  ? 29.122  -12.144 -26.010 1.00 122.73 ? 19  U   D N1    1 
ATOM   8465 C  C2    . U   D 2 19  ? 27.939  -12.777 -26.378 1.00 126.90 ? 19  U   D C2    1 
ATOM   8466 O  O2    . U   D 2 19  ? 26.991  -12.949 -25.627 1.00 127.82 ? 19  U   D O2    1 
ATOM   8467 N  N3    . U   D 2 19  ? 27.902  -13.219 -27.684 1.00 130.47 ? 19  U   D N3    1 
ATOM   8468 C  C4    . U   D 2 19  ? 28.901  -13.093 -28.640 1.00 130.42 ? 19  U   D C4    1 
ATOM   8469 O  O4    . U   D 2 19  ? 28.719  -13.541 -29.769 1.00 134.07 ? 19  U   D O4    1 
ATOM   8470 C  C5    . U   D 2 19  ? 30.098  -12.420 -28.187 1.00 126.60 ? 19  U   D C5    1 
ATOM   8471 C  C6    . U   D 2 19  ? 30.159  -11.980 -26.921 1.00 122.91 ? 19  U   D C6    1 
ATOM   8472 P  P     . C   D 2 20  ? 30.998  -10.531 -20.285 1.00 97.13  ? 20  C   D P     1 
ATOM   8473 O  OP1   . C   D 2 20  ? 29.963  -10.204 -19.277 1.00 98.33  ? 20  C   D OP1   1 
ATOM   8474 O  OP2   . C   D 2 20  ? 31.946  -9.466  -20.691 1.00 96.52  ? 20  C   D OP2   1 
ATOM   8475 O  "O5'" . C   D 2 20  ? 31.860  -11.794 -19.800 1.00 89.35  ? 20  C   D "O5'" 1 
ATOM   8476 C  "C5'" . C   D 2 20  ? 31.232  -12.950 -19.236 1.00 83.94  ? 20  C   D "C5'" 1 
ATOM   8477 C  "C4'" . C   D 2 20  ? 32.243  -13.980 -18.754 1.00 76.47  ? 20  C   D "C4'" 1 
ATOM   8478 O  "O4'" . C   D 2 20  ? 32.696  -14.781 -19.878 1.00 76.02  ? 20  C   D "O4'" 1 
ATOM   8479 C  "C3'" . C   D 2 20  ? 33.535  -13.426 -18.162 1.00 70.77  ? 20  C   D "C3'" 1 
ATOM   8480 O  "O3'" . C   D 2 20  ? 33.393  -13.056 -16.803 1.00 65.88  ? 20  C   D "O3'" 1 
ATOM   8481 C  "C2'" . C   D 2 20  ? 34.503  -14.588 -18.368 1.00 69.41  ? 20  C   D "C2'" 1 
ATOM   8482 O  "O2'" . C   D 2 20  ? 34.351  -15.647 -17.435 1.00 68.22  ? 20  C   D "O2'" 1 
ATOM   8483 C  "C1'" . C   D 2 20  ? 34.095  -15.016 -19.777 1.00 71.95  ? 20  C   D "C1'" 1 
ATOM   8484 N  N1    . C   D 2 20  ? 34.857  -14.310 -20.892 1.00 72.58  ? 20  C   D N1    1 
ATOM   8485 C  C2    . C   D 2 20  ? 36.139  -14.765 -21.264 1.00 70.95  ? 20  C   D C2    1 
ATOM   8486 O  O2    . C   D 2 20  ? 36.644  -15.732 -20.682 1.00 68.64  ? 20  C   D O2    1 
ATOM   8487 N  N3    . C   D 2 20  ? 36.802  -14.125 -22.266 1.00 72.51  ? 20  C   D N3    1 
ATOM   8488 C  C4    . C   D 2 20  ? 36.246  -13.080 -22.890 1.00 75.67  ? 20  C   D C4    1 
ATOM   8489 N  N4    . C   D 2 20  ? 36.940  -12.488 -23.869 1.00 77.78  ? 20  C   D N4    1 
ATOM   8490 C  C5    . C   D 2 20  ? 34.949  -12.596 -22.532 1.00 76.73  ? 20  C   D C5    1 
ATOM   8491 C  C6    . C   D 2 20  ? 34.303  -13.236 -21.546 1.00 75.34  ? 20  C   D C6    1 
ATOM   8492 P  P     . C   D 2 21  ? 34.074  -11.701 -16.296 1.00 61.94  ? 21  C   D P     1 
ATOM   8493 O  OP1   . C   D 2 21  ? 33.417  -11.287 -15.037 1.00 63.08  ? 21  C   D OP1   1 
ATOM   8494 O  OP2   . C   D 2 21  ? 34.137  -10.740 -17.418 1.00 64.24  ? 21  C   D OP2   1 
ATOM   8495 O  "O5'" . C   D 2 21  ? 35.576  -12.150 -15.976 1.00 56.73  ? 21  C   D "O5'" 1 
ATOM   8496 C  "C5'" . C   D 2 21  ? 35.852  -13.319 -15.209 1.00 50.60  ? 21  C   D "C5'" 1 
ATOM   8497 C  "C4'" . C   D 2 21  ? 37.312  -13.700 -15.371 1.00 45.99  ? 21  C   D "C4'" 1 
ATOM   8498 O  "O4'" . C   D 2 21  ? 37.572  -14.176 -16.716 1.00 43.82  ? 21  C   D "O4'" 1 
ATOM   8499 C  "C3'" . C   D 2 21  ? 38.286  -12.544 -15.183 1.00 43.52  ? 21  C   D "C3'" 1 
ATOM   8500 O  "O3'" . C   D 2 21  ? 38.549  -12.360 -13.800 1.00 40.69  ? 21  C   D "O3'" 1 
ATOM   8501 C  "C2'" . C   D 2 21  ? 39.511  -13.047 -15.945 1.00 42.80  ? 21  C   D "C2'" 1 
ATOM   8502 O  "O2'" . C   D 2 21  ? 40.264  -14.007 -15.227 1.00 40.01  ? 21  C   D "O2'" 1 
ATOM   8503 C  "C1'" . C   D 2 21  ? 38.849  -13.735 -17.134 1.00 42.34  ? 21  C   D "C1'" 1 
ATOM   8504 N  N1    . C   D 2 21  ? 38.729  -12.914 -18.401 1.00 42.83  ? 21  C   D N1    1 
ATOM   8505 C  C2    . C   D 2 21  ? 39.848  -12.773 -19.245 1.00 43.63  ? 21  C   D C2    1 
ATOM   8506 O  O2    . C   D 2 21  ? 40.922  -13.303 -18.933 1.00 42.86  ? 21  C   D O2    1 
ATOM   8507 N  N3    . C   D 2 21  ? 39.715  -12.062 -20.396 1.00 45.90  ? 21  C   D N3    1 
ATOM   8508 C  C4    . C   D 2 21  ? 38.536  -11.502 -20.700 1.00 47.56  ? 21  C   D C4    1 
ATOM   8509 N  N4    . C   D 2 21  ? 38.443  -10.811 -21.831 1.00 50.42  ? 21  C   D N4    1 
ATOM   8510 C  C5    . C   D 2 21  ? 37.384  -11.634 -19.862 1.00 46.49  ? 21  C   D C5    1 
ATOM   8511 C  C6    . C   D 2 21  ? 37.533  -12.346 -18.737 1.00 43.78  ? 21  C   D C6    1 
ATOM   8512 P  P     . A   D 2 22  ? 38.964  -10.949 -13.202 1.00 39.72  ? 22  A   D P     1 
ATOM   8513 O  OP1   . A   D 2 22  ? 39.130  -11.201 -11.750 1.00 41.07  ? 22  A   D OP1   1 
ATOM   8514 O  OP2   . A   D 2 22  ? 38.045  -9.889  -13.655 1.00 39.99  ? 22  A   D OP2   1 
ATOM   8515 O  "O5'" . A   D 2 22  ? 40.424  -10.729 -13.834 1.00 41.15  ? 22  A   D "O5'" 1 
ATOM   8516 C  "C5'" . A   D 2 22  ? 40.905  -9.490  -14.322 1.00 41.82  ? 22  A   D "C5'" 1 
ATOM   8517 C  "C4'" . A   D 2 22  ? 42.131  -9.795  -15.160 1.00 43.47  ? 22  A   D "C4'" 1 
ATOM   8518 O  "O4'" . A   D 2 22  ? 41.739  -10.522 -16.353 1.00 43.57  ? 22  A   D "O4'" 1 
ATOM   8519 C  "C3'" . A   D 2 22  ? 42.868  -8.584  -15.692 1.00 46.39  ? 22  A   D "C3'" 1 
ATOM   8520 O  "O3'" . A   D 2 22  ? 43.728  -8.049  -14.694 1.00 48.64  ? 22  A   D "O3'" 1 
ATOM   8521 C  "C2'" . A   D 2 22  ? 43.612  -9.201  -16.880 1.00 47.07  ? 22  A   D "C2'" 1 
ATOM   8522 O  "O2'" . A   D 2 22  ? 44.750  -9.947  -16.518 1.00 48.19  ? 22  A   D "O2'" 1 
ATOM   8523 C  "C1'" . A   D 2 22  ? 42.558  -10.146 -17.448 1.00 45.44  ? 22  A   D "C1'" 1 
ATOM   8524 N  N9    . A   D 2 22  ? 41.756  -9.536  -18.520 1.00 46.63  ? 22  A   D N9    1 
ATOM   8525 C  C8    . A   D 2 22  ? 40.422  -9.222  -18.485 1.00 45.91  ? 22  A   D C8    1 
ATOM   8526 N  N7    . A   D 2 22  ? 39.974  -8.676  -19.590 1.00 47.57  ? 22  A   D N7    1 
ATOM   8527 C  C5    . A   D 2 22  ? 41.085  -8.631  -20.417 1.00 50.16  ? 22  A   D C5    1 
ATOM   8528 C  C6    . A   D 2 22  ? 41.279  -8.158  -21.743 1.00 54.12  ? 22  A   D C6    1 
ATOM   8529 N  N6    . A   D 2 22  ? 40.307  -7.626  -22.488 1.00 56.17  ? 22  A   D N6    1 
ATOM   8530 N  N1    . A   D 2 22  ? 42.521  -8.247  -22.275 1.00 56.57  ? 22  A   D N1    1 
ATOM   8531 C  C2    . A   D 2 22  ? 43.507  -8.777  -21.531 1.00 54.88  ? 22  A   D C2    1 
ATOM   8532 N  N3    . A   D 2 22  ? 43.448  -9.249  -20.283 1.00 50.83  ? 22  A   D N3    1 
ATOM   8533 C  C4    . A   D 2 22  ? 42.198  -9.151  -19.773 1.00 48.93  ? 22  A   D C4    1 
ATOM   8534 P  P     . U   D 2 23  ? 44.055  -6.481  -14.677 1.00 51.61  ? 23  U   D P     1 
ATOM   8535 O  OP1   . U   D 2 23  ? 44.895  -6.169  -13.502 1.00 52.03  ? 23  U   D OP1   1 
ATOM   8536 O  OP2   . U   D 2 23  ? 42.807  -5.713  -14.892 1.00 50.70  ? 23  U   D OP2   1 
ATOM   8537 O  "O5'" . U   D 2 23  ? 44.971  -6.360  -15.977 1.00 56.48  ? 23  U   D "O5'" 1 
ATOM   8538 C  "C5'" . U   D 2 23  ? 46.299  -6.870  -15.969 1.00 59.88  ? 23  U   D "C5'" 1 
ATOM   8539 C  "C4'" . U   D 2 23  ? 46.954  -6.662  -17.321 1.00 64.66  ? 23  U   D "C4'" 1 
ATOM   8540 O  "O4'" . U   D 2 23  ? 46.174  -7.318  -18.358 1.00 63.42  ? 23  U   D "O4'" 1 
ATOM   8541 C  "C3'" . U   D 2 23  ? 47.016  -5.221  -17.813 1.00 67.31  ? 23  U   D "C3'" 1 
ATOM   8542 O  "O3'" . U   D 2 23  ? 48.018  -4.444  -17.156 1.00 70.99  ? 23  U   D "O3'" 1 
ATOM   8543 C  "C2'" . U   D 2 23  ? 47.325  -5.462  -19.286 1.00 70.75  ? 23  U   D "C2'" 1 
ATOM   8544 O  "O2'" . U   D 2 23  ? 48.656  -5.887  -19.516 1.00 74.13  ? 23  U   D "O2'" 1 
ATOM   8545 C  "C1'" . U   D 2 23  ? 46.339  -6.595  -19.580 1.00 67.43  ? 23  U   D "C1'" 1 
ATOM   8546 N  N1    . U   D 2 23  ? 45.011  -6.103  -20.109 1.00 66.03  ? 23  U   D N1    1 
ATOM   8547 C  C2    . U   D 2 23  ? 44.917  -5.614  -21.406 1.00 70.42  ? 23  U   D C2    1 
ATOM   8548 O  O2    . U   D 2 23  ? 45.853  -5.546  -22.189 1.00 74.08  ? 23  U   D O2    1 
ATOM   8549 N  N3    . U   D 2 23  ? 43.654  -5.195  -21.770 1.00 70.68  ? 23  U   D N3    1 
ATOM   8550 C  C4    . U   D 2 23  ? 42.505  -5.211  -20.990 1.00 67.10  ? 23  U   D C4    1 
ATOM   8551 O  O4    . U   D 2 23  ? 41.445  -4.804  -21.459 1.00 67.72  ? 23  U   D O4    1 
ATOM   8552 C  C5    . U   D 2 23  ? 42.679  -5.727  -19.650 1.00 62.83  ? 23  U   D C5    1 
ATOM   8553 C  C6    . U   D 2 23  ? 43.898  -6.138  -19.275 1.00 62.70  ? 23  U   D C6    1 
ATOM   8554 P  P     . U   D 2 24  ? 47.729  -2.909  -16.779 1.00 72.02  ? 24  U   D P     1 
ATOM   8555 O  OP1   . U   D 2 24  ? 48.767  -2.494  -15.812 1.00 73.31  ? 24  U   D OP1   1 
ATOM   8556 O  OP2   . U   D 2 24  ? 46.295  -2.776  -16.434 1.00 68.42  ? 24  U   D OP2   1 
ATOM   8557 O  "O5'" . U   D 2 24  ? 47.968  -2.097  -18.143 1.00 78.40  ? 24  U   D "O5'" 1 
ATOM   8558 C  "C5'" . U   D 2 24  ? 49.169  -2.246  -18.903 1.00 84.37  ? 24  U   D "C5'" 1 
ATOM   8559 C  "C4'" . U   D 2 24  ? 48.979  -1.789  -20.340 1.00 89.78  ? 24  U   D "C4'" 1 
ATOM   8560 O  "O4'" . U   D 2 24  ? 47.971  -2.592  -21.005 1.00 87.54  ? 24  U   D "O4'" 1 
ATOM   8561 C  "C3'" . U   D 2 24  ? 48.448  -0.374  -20.514 1.00 92.54  ? 24  U   D "C3'" 1 
ATOM   8562 O  "O3'" . U   D 2 24  ? 49.471  0.589   -20.347 1.00 98.47  ? 24  U   D "O3'" 1 
ATOM   8563 C  "C2'" . U   D 2 24  ? 47.929  -0.420  -21.948 1.00 95.56  ? 24  U   D "C2'" 1 
ATOM   8564 O  "O2'" . U   D 2 24  ? 48.950  -0.338  -22.935 1.00 102.59 ? 24  U   D "O2'" 1 
ATOM   8565 C  "C1'" . U   D 2 24  ? 47.256  -1.792  -21.937 1.00 90.00  ? 24  U   D "C1'" 1 
ATOM   8566 N  N1    . U   D 2 24  ? 45.789  -1.759  -21.567 1.00 85.09  ? 24  U   D N1    1 
ATOM   8567 C  C2    . U   D 2 24  ? 44.860  -1.190  -22.430 1.00 87.60  ? 24  U   D C2    1 
ATOM   8568 O  O2    . U   D 2 24  ? 45.149  -0.690  -23.506 1.00 93.29  ? 24  U   D O2    1 
ATOM   8569 N  N3    . U   D 2 24  ? 43.556  -1.226  -21.986 1.00 83.64  ? 24  U   D N3    1 
ATOM   8570 C  C4    . U   D 2 24  ? 43.093  -1.760  -20.792 1.00 78.19  ? 24  U   D C4    1 
ATOM   8571 O  O4    . U   D 2 24  ? 41.897  -1.723  -20.525 1.00 76.46  ? 24  U   D O4    1 
ATOM   8572 C  C5    . U   D 2 24  ? 44.108  -2.333  -19.945 1.00 75.61  ? 24  U   D C5    1 
ATOM   8573 C  C6    . U   D 2 24  ? 45.383  -2.312  -20.360 1.00 79.34  ? 24  U   D C6    1 
ATOM   8574 P  P     . U   D 2 25  ? 49.070  2.089   -19.961 1.00 100.68 ? 25  U   D P     1 
ATOM   8575 O  OP1   . U   D 2 25  ? 50.227  2.679   -19.249 1.00 102.65 ? 25  U   D OP1   1 
ATOM   8576 O  OP2   . U   D 2 25  ? 47.724  2.070   -19.337 1.00 94.62  ? 25  U   D OP2   1 
ATOM   8577 O  "O5'" . U   D 2 25  ? 48.918  2.804   -21.383 1.00 108.10 ? 25  U   D "O5'" 1 
ATOM   8578 C  "C5'" . U   D 2 25  ? 49.971  2.819   -22.335 1.00 116.44 ? 25  U   D "C5'" 1 
ATOM   8579 C  "C4'" . U   D 2 25  ? 49.479  3.502   -23.593 1.00 123.54 ? 25  U   D "C4'" 1 
ATOM   8580 O  "O4'" . U   D 2 25  ? 48.471  2.680   -24.239 1.00 121.36 ? 25  U   D "O4'" 1 
ATOM   8581 C  "C3'" . U   D 2 25  ? 48.753  4.821   -23.358 1.00 124.74 ? 25  U   D "C3'" 1 
ATOM   8582 O  "O3'" . U   D 2 25  ? 49.664  5.883   -23.116 1.00 130.46 ? 25  U   D "O3'" 1 
ATOM   8583 C  "C2'" . U   D 2 25  ? 47.973  4.953   -24.663 1.00 129.56 ? 25  U   D "C2'" 1 
ATOM   8584 O  "O2'" . U   D 2 25  ? 48.763  5.324   -25.783 1.00 138.46 ? 25  U   D "O2'" 1 
ATOM   8585 C  "C1'" . U   D 2 25  ? 47.469  3.515   -24.802 1.00 124.49 ? 25  U   D "C1'" 1 
ATOM   8586 N  N1    . U   D 2 25  ? 46.144  3.276   -24.120 1.00 117.60 ? 25  U   D N1    1 
ATOM   8587 C  C2    . U   D 2 25  ? 44.965  3.701   -24.718 1.00 119.65 ? 25  U   D C2    1 
ATOM   8588 O  O2    . U   D 2 25  ? 44.909  4.270   -25.794 1.00 127.13 ? 25  U   D O2    1 
ATOM   8589 N  N3    . U   D 2 25  ? 43.822  3.429   -24.001 1.00 113.87 ? 25  U   D N3    1 
ATOM   8590 C  C4    . U   D 2 25  ? 43.735  2.792   -22.773 1.00 106.51 ? 25  U   D C4    1 
ATOM   8591 O  O4    . U   D 2 25  ? 42.640  2.617   -22.249 1.00 102.94 ? 25  U   D O4    1 
ATOM   8592 C  C5    . U   D 2 25  ? 44.994  2.380   -22.209 1.00 104.93 ? 25  U   D C5    1 
ATOM   8593 C  C6    . U   D 2 25  ? 46.117  2.634   -22.891 1.00 110.39 ? 25  U   D C6    1 
ATOM   8594 P  P     . A   D 2 26  ? 49.313  7.038   -22.059 1.00 128.79 ? 26  A   D P     1 
ATOM   8595 O  OP1   . A   D 2 26  ? 50.548  7.833   -21.871 1.00 134.13 ? 26  A   D OP1   1 
ATOM   8596 O  OP2   . A   D 2 26  ? 48.635  6.454   -20.878 1.00 119.29 ? 26  A   D OP2   1 
ATOM   8597 O  "O5'" . A   D 2 26  ? 48.238  7.916   -22.856 1.00 133.27 ? 26  A   D "O5'" 1 
ATOM   8598 C  "C5'" . A   D 2 26  ? 48.655  8.796   -23.900 1.00 143.77 ? 26  A   D "C5'" 1 
ATOM   8599 C  "C4'" . A   D 2 26  ? 47.471  9.276   -24.718 1.00 147.90 ? 26  A   D "C4'" 1 
ATOM   8600 O  "O4'" . A   D 2 26  ? 46.695  8.141   -25.178 1.00 144.91 ? 26  A   D "O4'" 1 
ATOM   8601 C  "C3'" . A   D 2 26  ? 46.463  10.132  -23.964 1.00 145.24 ? 26  A   D "C3'" 1 
ATOM   8602 O  "O3'" . A   D 2 26  ? 46.894  11.491  -23.888 1.00 151.85 ? 26  A   D "O3'" 1 
ATOM   8603 C  "C2'" . A   D 2 26  ? 45.215  9.949   -24.824 1.00 146.95 ? 26  A   D "C2'" 1 
ATOM   8604 O  "O2'" . A   D 2 26  ? 45.200  10.753  -25.988 1.00 157.01 ? 26  A   D "O2'" 1 
ATOM   8605 C  "C1'" . A   D 2 26  ? 45.318  8.472   -25.193 1.00 143.69 ? 26  A   D "C1'" 1 
ATOM   8606 N  N9    . A   D 2 26  ? 44.593  7.625   -24.248 1.00 134.33 ? 26  A   D N9    1 
ATOM   8607 C  C8    . A   D 2 26  ? 45.117  6.884   -23.222 1.00 127.44 ? 26  A   D C8    1 
ATOM   8608 N  N7    . A   D 2 26  ? 44.219  6.225   -22.529 1.00 120.82 ? 26  A   D N7    1 
ATOM   8609 C  C5    . A   D 2 26  ? 43.020  6.558   -23.138 1.00 123.37 ? 26  A   D C5    1 
ATOM   8610 C  C6    . A   D 2 26  ? 41.680  6.188   -22.877 1.00 119.87 ? 26  A   D C6    1 
ATOM   8611 N  N6    . A   D 2 26  ? 41.326  5.361   -21.885 1.00 112.50 ? 26  A   D N6    1 
ATOM   8612 N  N1    . A   D 2 26  ? 40.717  6.703   -23.680 1.00 124.97 ? 26  A   D N1    1 
ATOM   8613 C  C2    . A   D 2 26  ? 41.072  7.533   -24.677 1.00 133.24 ? 26  A   D C2    1 
ATOM   8614 N  N3    . A   D 2 26  ? 42.294  7.952   -25.015 1.00 137.08 ? 26  A   D N3    1 
ATOM   8615 C  C4    . A   D 2 26  ? 43.231  7.425   -24.201 1.00 131.75 ? 26  A   D C4    1 
ATOM   8616 P  P     . C   D 2 27  ? 46.535  12.404  -22.618 1.00 148.14 ? 27  C   D P     1 
ATOM   8617 O  OP1   . C   D 2 27  ? 47.374  13.623  -22.708 1.00 155.00 ? 27  C   D OP1   1 
ATOM   8618 O  OP2   . C   D 2 27  ? 46.579  11.568  -21.393 1.00 138.49 ? 27  C   D OP2   1 
ATOM   8619 O  "O5'" . C   D 2 27  ? 45.006  12.808  -22.878 1.00 149.25 ? 27  C   D "O5'" 1 
ATOM   8620 C  "C5'" . C   D 2 27  ? 44.622  13.649  -23.978 1.00 159.53 ? 27  C   D "C5'" 1 
ATOM   8621 C  "C4'" . C   D 2 27  ? 43.133  13.534  -24.270 1.00 159.78 ? 27  C   D "C4'" 1 
ATOM   8622 O  "O4'" . C   D 2 27  ? 42.777  12.137  -24.444 1.00 155.28 ? 27  C   D "O4'" 1 
ATOM   8623 C  "C3'" . C   D 2 27  ? 42.203  14.026  -23.163 1.00 154.51 ? 27  C   D "C3'" 1 
ATOM   8624 O  "O3'" . C   D 2 27  ? 41.989  15.441  -23.238 1.00 160.46 ? 27  C   D "O3'" 1 
ATOM   8625 C  "C2'" . C   D 2 27  ? 40.933  13.212  -23.421 1.00 152.40 ? 27  C   D "C2'" 1 
ATOM   8626 O  "O2'" . C   D 2 27  ? 40.132  13.737  -24.465 1.00 160.81 ? 27  C   D "O2'" 1 
ATOM   8627 C  "C1'" . C   D 2 27  ? 41.520  11.866  -23.841 1.00 149.83 ? 27  C   D "C1'" 1 
ATOM   8628 N  N1    . C   D 2 27  ? 41.652  10.850  -22.719 1.00 139.86 ? 27  C   D N1    1 
ATOM   8629 C  C2    . C   D 2 27  ? 40.584  9.969   -22.463 1.00 135.19 ? 27  C   D C2    1 
ATOM   8630 O  O2    . C   D 2 27  ? 39.558  10.035  -23.154 1.00 139.13 ? 27  C   D O2    1 
ATOM   8631 N  N3    . C   D 2 27  ? 40.705  9.055   -21.459 1.00 126.91 ? 27  C   D N3    1 
ATOM   8632 C  C4    . C   D 2 27  ? 41.822  8.996   -20.724 1.00 123.73 ? 27  C   D C4    1 
ATOM   8633 N  N4    . C   D 2 27  ? 41.886  8.078   -19.750 1.00 116.40 ? 27  C   D N4    1 
ATOM   8634 C  C5    . C   D 2 27  ? 42.921  9.881   -20.963 1.00 128.47 ? 27  C   D C5    1 
ATOM   8635 C  C6    . C   D 2 27  ? 42.791  10.775  -21.954 1.00 136.27 ? 27  C   D C6    1 
ATOM   8636 P  P     . U   D 2 28  ? 41.914  16.328  -21.900 1.00 155.76 ? 28  U   D P     1 
ATOM   8637 O  OP1   . U   D 2 28  ? 41.783  17.743  -22.317 1.00 163.99 ? 28  U   D OP1   1 
ATOM   8638 O  OP2   . U   D 2 28  ? 43.020  15.931  -20.995 1.00 149.52 ? 28  U   D OP2   1 
ATOM   8639 O  "O5'" . U   D 2 28  ? 40.550  15.840  -21.216 1.00 148.73 ? 28  U   D "O5'" 1 
ATOM   8640 C  "C5'" . U   D 2 28  ? 39.283  16.212  -21.760 1.00 152.45 ? 28  U   D "C5'" 1 
ATOM   8641 C  "C4'" . U   D 2 28  ? 38.140  15.495  -21.058 1.00 145.23 ? 28  U   D "C4'" 1 
ATOM   8642 O  "O4'" . U   D 2 28  ? 38.248  14.054  -21.212 1.00 140.57 ? 28  U   D "O4'" 1 
ATOM   8643 C  "C3'" . U   D 2 28  ? 38.079  15.637  -19.544 1.00 136.64 ? 28  U   D "C3'" 1 
ATOM   8644 O  "O3'" . U   D 2 28  ? 37.667  16.932  -19.121 1.00 137.78 ? 28  U   D "O3'" 1 
ATOM   8645 C  "C2'" . U   D 2 28  ? 37.056  14.555  -19.226 1.00 132.19 ? 28  U   D "C2'" 1 
ATOM   8646 O  "O2'" . U   D 2 28  ? 35.728  14.910  -19.568 1.00 136.93 ? 28  U   D "O2'" 1 
ATOM   8647 C  "C1'" . U   D 2 28  ? 37.573  13.433  -20.126 1.00 132.76 ? 28  U   D "C1'" 1 
ATOM   8648 N  N1    . U   D 2 28  ? 38.473  12.481  -19.380 1.00 125.31 ? 28  U   D N1    1 
ATOM   8649 C  C2    . U   D 2 28  ? 37.886  11.496  -18.599 1.00 118.96 ? 28  U   D C2    1 
ATOM   8650 O  O2    . U   D 2 28  ? 36.678  11.359  -18.496 1.00 119.11 ? 28  U   D O2    1 
ATOM   8651 N  N3    . U   D 2 28  ? 38.765  10.664  -17.941 1.00 113.10 ? 28  U   D N3    1 
ATOM   8652 C  C4    . U   D 2 28  ? 40.150  10.723  -17.981 1.00 113.17 ? 28  U   D C4    1 
ATOM   8653 O  O4    . U   D 2 28  ? 40.806  9.911   -17.337 1.00 108.20 ? 28  U   D O4    1 
ATOM   8654 C  C5    . U   D 2 28  ? 40.694  11.777  -18.809 1.00 120.11 ? 28  U   D C5    1 
ATOM   8655 C  C6    . U   D 2 28  ? 39.855  12.597  -19.460 1.00 125.76 ? 28  U   D C6    1 
ATOM   8656 P  P     . U   D 2 29  ? 38.438  17.641  -17.903 1.00 131.84 ? 29  U   D P     1 
ATOM   8657 O  OP1   . U   D 2 29  ? 38.977  18.929  -18.403 1.00 138.93 ? 29  U   D OP1   1 
ATOM   8658 O  OP2   . U   D 2 29  ? 39.349  16.648  -17.276 1.00 124.77 ? 29  U   D OP2   1 
ATOM   8659 O  "O5'" . U   D 2 29  ? 37.255  17.959  -16.876 1.00 126.22 ? 29  U   D "O5'" 1 
ATOM   8660 C  "C5'" . U   D 2 29  ? 37.171  17.224  -15.673 1.00 114.57 ? 29  U   D "C5'" 1 
ATOM   8661 C  "C4'" . U   D 2 29  ? 35.862  16.470  -15.591 1.00 110.31 ? 29  U   D "C4'" 1 
ATOM   8662 O  "O4'" . U   D 2 29  ? 35.907  15.241  -16.362 1.00 109.05 ? 29  U   D "O4'" 1 
ATOM   8663 C  "C3'" . U   D 2 29  ? 35.550  16.014  -14.183 1.00 101.46 ? 29  U   D "C3'" 1 
ATOM   8664 O  "O3'" . U   D 2 29  ? 34.931  17.075  -13.484 1.00 100.52 ? 29  U   D "O3'" 1 
ATOM   8665 C  "C2'" . U   D 2 29  ? 34.636  14.823  -14.436 1.00 100.47 ? 29  U   D "C2'" 1 
ATOM   8666 O  "O2'" . U   D 2 29  ? 33.336  15.216  -14.839 1.00 106.29 ? 29  U   D "O2'" 1 
ATOM   8667 C  "C1'" . U   D 2 29  ? 35.398  14.166  -15.587 1.00 101.43 ? 29  U   D "C1'" 1 
ATOM   8668 N  N1    . U   D 2 29  ? 36.540  13.241  -15.187 1.00 95.05  ? 29  U   D N1    1 
ATOM   8669 C  C2    . U   D 2 29  ? 36.288  12.076  -14.471 1.00 88.86  ? 29  U   D C2    1 
ATOM   8670 O  O2    . U   D 2 29  ? 35.181  11.716  -14.107 1.00 87.60  ? 29  U   D O2    1 
ATOM   8671 N  N3    . U   D 2 29  ? 37.406  11.326  -14.185 1.00 84.87  ? 29  U   D N3    1 
ATOM   8672 C  C4    . U   D 2 29  ? 38.722  11.603  -14.527 1.00 86.26  ? 29  U   D C4    1 
ATOM   8673 O  O4    . U   D 2 29  ? 39.617  10.834  -14.194 1.00 82.71  ? 29  U   D O4    1 
ATOM   8674 C  C5    . U   D 2 29  ? 38.909  12.824  -15.267 1.00 91.64  ? 29  U   D C5    1 
ATOM   8675 C  C6    . U   D 2 29  ? 37.837  13.568  -15.561 1.00 95.94  ? 29  U   D C6    1 
ATOM   8676 P  P     . C   D 2 30  ? 35.623  17.585  -12.134 1.00 94.03  ? 30  C   D P     1 
ATOM   8677 O  OP1   . C   D 2 30  ? 35.116  18.936  -11.812 1.00 96.50  ? 30  C   D OP1   1 
ATOM   8678 O  OP2   . C   D 2 30  ? 37.083  17.341  -12.225 1.00 91.98  ? 30  C   D OP2   1 
ATOM   8679 O  "O5'" . C   D 2 30  ? 35.025  16.550  -11.075 1.00 84.56  ? 30  C   D "O5'" 1 
ATOM   8680 C  "C5'" . C   D 2 30  ? 33.647  16.196  -11.122 1.00 81.95  ? 30  C   D "C5'" 1 
ATOM   8681 C  "C4'" . C   D 2 30  ? 33.430  14.873  -10.426 1.00 73.82  ? 30  C   D "C4'" 1 
ATOM   8682 O  "O4'" . C   D 2 30  ? 34.031  13.796  -11.186 1.00 72.12  ? 30  C   D "O4'" 1 
ATOM   8683 C  "C3'" . C   D 2 30  ? 34.099  14.761  -9.069  1.00 66.16  ? 30  C   D "C3'" 1 
ATOM   8684 O  "O3'" . C   D 2 30  ? 33.309  15.411  -8.097  1.00 64.19  ? 30  C   D "O3'" 1 
ATOM   8685 C  "C2'" . C   D 2 30  ? 34.107  13.253  -8.880  1.00 63.07  ? 30  C   D "C2'" 1 
ATOM   8686 O  "O2'" . C   D 2 30  ? 32.845  12.742  -8.494  1.00 62.89  ? 30  C   D "O2'" 1 
ATOM   8687 C  "C1'" . C   D 2 30  ? 34.478  12.791  -10.287 1.00 65.99  ? 30  C   D "C1'" 1 
ATOM   8688 N  N1    . C   D 2 30  ? 35.953  12.537  -10.484 1.00 63.93  ? 30  C   D N1    1 
ATOM   8689 C  C2    . C   D 2 30  ? 36.557  11.404  -9.900  1.00 59.02  ? 30  C   D C2    1 
ATOM   8690 O  O2    . C   D 2 30  ? 35.877  10.624  -9.221  1.00 56.51  ? 30  C   D O2    1 
ATOM   8691 N  N3    . C   D 2 30  ? 37.887  11.195  -10.102 1.00 57.84  ? 30  C   D N3    1 
ATOM   8692 C  C4    . C   D 2 30  ? 38.600  12.062  -10.838 1.00 61.57  ? 30  C   D C4    1 
ATOM   8693 N  N4    . C   D 2 30  ? 39.904  11.819  -11.010 1.00 61.10  ? 30  C   D N4    1 
ATOM   8694 C  C5    . C   D 2 30  ? 38.010  13.218  -11.439 1.00 66.26  ? 30  C   D C5    1 
ATOM   8695 C  C6    . C   D 2 30  ? 36.700  13.412  -11.236 1.00 67.45  ? 30  C   D C6    1 
ATOM   8696 P  P     . C   D 2 31  ? 33.984  16.113  -6.836  1.00 59.01  ? 31  C   D P     1 
ATOM   8697 O  OP1   . C   D 2 31  ? 32.939  16.950  -6.210  1.00 62.20  ? 31  C   D OP1   1 
ATOM   8698 O  OP2   . C   D 2 31  ? 35.274  16.711  -7.233  1.00 58.86  ? 31  C   D OP2   1 
ATOM   8699 O  "O5'" . C   D 2 31  ? 34.311  14.870  -5.885  1.00 55.64  ? 31  C   D "O5'" 1 
ATOM   8700 C  "C5'" . C   D 2 31  ? 33.244  14.008  -5.488  1.00 55.21  ? 31  C   D "C5'" 1 
ATOM   8701 C  "C4'" . C   D 2 31  ? 33.776  12.768  -4.824  1.00 51.48  ? 31  C   D "C4'" 1 
ATOM   8702 O  "O4'" . C   D 2 31  ? 34.515  11.977  -5.785  1.00 51.51  ? 31  C   D "O4'" 1 
ATOM   8703 C  "C3'" . C   D 2 31  ? 34.773  13.051  -3.720  1.00 48.40  ? 31  C   D "C3'" 1 
ATOM   8704 O  "O3'" . C   D 2 31  ? 34.066  13.332  -2.530  1.00 48.52  ? 31  C   D "O3'" 1 
ATOM   8705 C  "C2'" . C   D 2 31  ? 35.542  11.736  -3.660  1.00 46.38  ? 31  C   D "C2'" 1 
ATOM   8706 O  "O2'" . C   D 2 31  ? 34.832  10.706  -2.991  1.00 44.33  ? 31  C   D "O2'" 1 
ATOM   8707 C  "C1'" . C   D 2 31  ? 35.642  11.404  -5.143  1.00 47.98  ? 31  C   D "C1'" 1 
ATOM   8708 N  N1    . C   D 2 31  ? 36.934  11.808  -5.836  1.00 48.64  ? 31  C   D N1    1 
ATOM   8709 C  C2    . C   D 2 31  ? 38.103  11.036  -5.631  1.00 45.75  ? 31  C   D C2    1 
ATOM   8710 O  O2    . C   D 2 31  ? 38.090  10.059  -4.876  1.00 43.23  ? 31  C   D O2    1 
ATOM   8711 N  N3    . C   D 2 31  ? 39.247  11.398  -6.274  1.00 47.12  ? 31  C   D N3    1 
ATOM   8712 C  C4    . C   D 2 31  ? 39.267  12.457  -7.091  1.00 49.66  ? 31  C   D C4    1 
ATOM   8713 N  N4    . C   D 2 31  ? 40.427  12.745  -7.686  1.00 50.91  ? 31  C   D N4    1 
ATOM   8714 C  C5    . C   D 2 31  ? 38.098  13.254  -7.318  1.00 51.94  ? 31  C   D C5    1 
ATOM   8715 C  C6    . C   D 2 31  ? 36.970  12.890  -6.679  1.00 50.32  ? 31  C   D C6    1 
ATOM   8716 P  P     . A   D 2 32  ? 34.735  14.276  -1.429  1.00 48.26  ? 32  A   D P     1 
ATOM   8717 O  OP1   . A   D 2 32  ? 33.705  14.638  -0.430  1.00 49.95  ? 32  A   D OP1   1 
ATOM   8718 O  OP2   . A   D 2 32  ? 35.449  15.365  -2.131  1.00 47.60  ? 32  A   D OP2   1 
ATOM   8719 O  "O5'" . A   D 2 32  ? 35.845  13.307  -0.804  1.00 43.82  ? 32  A   D "O5'" 1 
ATOM   8720 C  "C5'" . A   D 2 32  ? 35.506  12.219  0.018   1.00 43.02  ? 32  A   D "C5'" 1 
ATOM   8721 C  "C4'" . A   D 2 32  ? 36.740  11.412  0.373   1.00 39.61  ? 32  A   D "C4'" 1 
ATOM   8722 O  "O4'" . A   D 2 32  ? 37.402  10.930  -0.824  1.00 38.89  ? 32  A   D "O4'" 1 
ATOM   8723 C  "C3'" . A   D 2 32  ? 37.847  12.173  1.084   1.00 37.61  ? 32  A   D "C3'" 1 
ATOM   8724 O  "O3'" . A   D 2 32  ? 37.565  12.387  2.449   1.00 37.75  ? 32  A   D "O3'" 1 
ATOM   8725 C  "C2'" . A   D 2 32  ? 39.021  11.224  0.883   1.00 36.28  ? 32  A   D "C2'" 1 
ATOM   8726 O  "O2'" . A   D 2 32  ? 38.926  10.071  1.696   1.00 35.56  ? 32  A   D "O2'" 1 
ATOM   8727 C  "C1'" . A   D 2 32  ? 38.800  10.836  -0.567  1.00 36.04  ? 32  A   D "C1'" 1 
ATOM   8728 N  N9    . A   D 2 32  ? 39.559  11.538  -1.608  1.00 37.77  ? 32  A   D N9    1 
ATOM   8729 C  C8    . A   D 2 32  ? 39.206  12.681  -2.285  1.00 37.98  ? 32  A   D C8    1 
ATOM   8730 N  N7    . A   D 2 32  ? 40.080  13.051  -3.197  1.00 40.02  ? 32  A   D N7    1 
ATOM   8731 C  C5    . A   D 2 32  ? 41.064  12.066  -3.129  1.00 39.62  ? 32  A   D C5    1 
ATOM   8732 C  C6    . A   D 2 32  ? 42.280  11.851  -3.825  1.00 39.57  ? 32  A   D C6    1 
ATOM   8733 N  N6    . A   D 2 32  ? 42.729  12.650  -4.786  1.00 42.34  ? 32  A   D N6    1 
ATOM   8734 N  N1    . A   D 2 32  ? 43.027  10.762  -3.498  1.00 39.50  ? 32  A   D N1    1 
ATOM   8735 C  C2    . A   D 2 32  ? 42.588  9.937   -2.538  1.00 36.87  ? 32  A   D C2    1 
ATOM   8736 N  N3    . A   D 2 32  ? 41.470  10.033  -1.816  1.00 37.39  ? 32  A   D N3    1 
ATOM   8737 C  C4    . A   D 2 32  ? 40.744  11.118  -2.163  1.00 36.73  ? 32  A   D C4    1 
ATOM   8738 P  P     . C   D 2 33  ? 37.853  13.839  3.100   1.00 39.42  ? 33  C   D P     1 
ATOM   8739 O  OP1   . C   D 2 33  ? 37.219  13.847  4.433   1.00 38.77  ? 33  C   D OP1   1 
ATOM   8740 O  OP2   . C   D 2 33  ? 37.565  14.869  2.094   1.00 40.36  ? 33  C   D OP2   1 
ATOM   8741 O  "O5'" . C   D 2 33  ? 39.456  13.842  3.259   1.00 39.28  ? 33  C   D "O5'" 1 
ATOM   8742 C  "C5'" . C   D 2 33  ? 40.154  12.814  3.974   1.00 38.33  ? 33  C   D "C5'" 1 
ATOM   8743 C  "C4'" . C   D 2 33  ? 41.657  12.920  3.742   1.00 39.70  ? 33  C   D "C4'" 1 
ATOM   8744 O  "O4'" . C   D 2 33  ? 42.015  12.638  2.364   1.00 38.11  ? 33  C   D "O4'" 1 
ATOM   8745 C  "C3'" . C   D 2 33  ? 42.240  14.306  3.967   1.00 42.51  ? 33  C   D "C3'" 1 
ATOM   8746 O  "O3'" . C   D 2 33  ? 42.392  14.513  5.356   1.00 45.40  ? 33  C   D "O3'" 1 
ATOM   8747 C  "C2'" . C   D 2 33  ? 43.575  14.219  3.224   1.00 41.50  ? 33  C   D "C2'" 1 
ATOM   8748 O  "O2'" . C   D 2 33  ? 44.590  13.627  4.016   1.00 40.83  ? 33  C   D "O2'" 1 
ATOM   8749 C  "C1'" . C   D 2 33  ? 43.190  13.350  2.019   1.00 40.66  ? 33  C   D "C1'" 1 
ATOM   8750 N  N1    . C   D 2 33  ? 42.899  14.126  0.777   1.00 41.97  ? 33  C   D N1    1 
ATOM   8751 C  C2    . C   D 2 33  ? 43.953  14.604  -0.014  1.00 43.31  ? 33  C   D C2    1 
ATOM   8752 O  O2    . C   D 2 33  ? 45.119  14.368  0.314   1.00 44.52  ? 33  C   D O2    1 
ATOM   8753 N  N3    . C   D 2 33  ? 43.653  15.298  -1.140  1.00 44.21  ? 33  C   D N3    1 
ATOM   8754 C  C4    . C   D 2 33  ? 42.377  15.529  -1.477  1.00 44.52  ? 33  C   D C4    1 
ATOM   8755 N  N4    . C   D 2 33  ? 42.137  16.227  -2.593  1.00 46.61  ? 33  C   D N4    1 
ATOM   8756 C  C5    . C   D 2 33  ? 41.286  15.059  -0.681  1.00 42.71  ? 33  C   D C5    1 
ATOM   8757 C  C6    . C   D 2 33  ? 41.594  14.371  0.420   1.00 42.00  ? 33  C   D C6    1 
ATOM   8758 P  P     A C   D 2 34  ? 41.620  15.715  6.084   0.50 47.39  ? 34  C   D P     1 
ATOM   8759 P  P     B C   D 2 34  ? 41.623  15.718  6.083   0.50 47.39  ? 34  C   D P     1 
ATOM   8760 O  OP1   A C   D 2 34  ? 41.981  15.634  7.516   0.50 46.31  ? 34  C   D OP1   1 
ATOM   8761 O  OP1   B C   D 2 34  ? 41.986  15.638  7.515   0.50 46.32  ? 34  C   D OP1   1 
ATOM   8762 O  OP2   A C   D 2 34  ? 40.194  15.685  5.686   0.50 47.58  ? 34  C   D OP2   1 
ATOM   8763 O  OP2   B C   D 2 34  ? 40.197  15.690  5.686   0.50 47.58  ? 34  C   D OP2   1 
ATOM   8764 O  "O5'" A C   D 2 34  ? 42.277  17.006  5.396   0.50 48.82  ? 34  C   D "O5'" 1 
ATOM   8765 O  "O5'" B C   D 2 34  ? 42.283  17.006  5.392   0.50 48.83  ? 34  C   D "O5'" 1 
ATOM   8766 C  "C5'" A C   D 2 34  ? 42.859  18.040  6.181   0.50 51.01  ? 34  C   D "C5'" 1 
ATOM   8767 C  "C5'" B C   D 2 34  ? 42.858  18.046  6.175   0.50 51.01  ? 34  C   D "C5'" 1 
ATOM   8768 C  "C4'" A C   D 2 34  ? 42.185  19.374  5.916   0.50 52.57  ? 34  C   D "C4'" 1 
ATOM   8769 C  "C4'" B C   D 2 34  ? 42.178  19.375  5.906   0.50 52.57  ? 34  C   D "C4'" 1 
ATOM   8770 O  "O4'" A C   D 2 34  ? 42.172  19.630  4.487   0.50 52.98  ? 34  C   D "O4'" 1 
ATOM   8771 O  "O4'" B C   D 2 34  ? 42.154  19.623  4.476   0.50 52.98  ? 34  C   D "O4'" 1 
ATOM   8772 C  "C3'" A C   D 2 34  ? 40.711  19.484  6.298   0.50 53.71  ? 34  C   D "C3'" 1 
ATOM   8773 C  "C3'" B C   D 2 34  ? 40.705  19.481  6.295   0.50 53.71  ? 34  C   D "C3'" 1 
ATOM   8774 O  "O3'" A C   D 2 34  ? 40.484  19.690  7.692   0.50 54.72  ? 34  C   D "O3'" 1 
ATOM   8775 O  "O3'" B C   D 2 34  ? 40.483  19.690  7.690   0.50 54.72  ? 34  C   D "O3'" 1 
ATOM   8776 C  "C2'" A C   D 2 34  ? 40.298  20.702  5.483   0.50 53.43  ? 34  C   D "C2'" 1 
ATOM   8777 C  "C2'" B C   D 2 34  ? 40.284  20.696  5.478   0.50 53.43  ? 34  C   D "C2'" 1 
ATOM   8778 O  "O2'" A C   D 2 34  ? 40.755  21.908  6.055   0.50 53.62  ? 34  C   D "O2'" 1 
ATOM   8779 O  "O2'" B C   D 2 34  ? 40.737  21.906  6.044   0.50 53.63  ? 34  C   D "O2'" 1 
ATOM   8780 C  "C1'" A C   D 2 34  ? 41.042  20.438  4.178   0.50 53.45  ? 34  C   D "C1'" 1 
ATOM   8781 C  "C1'" B C   D 2 34  ? 41.023  20.431  4.171   0.50 53.43  ? 34  C   D "C1'" 1 
ATOM   8782 N  N1    A C   D 2 34  ? 40.182  19.825  3.095   0.50 53.70  ? 34  C   D N1    1 
ATOM   8783 N  N1    B C   D 2 34  ? 40.159  19.819  3.091   0.50 53.68  ? 34  C   D N1    1 
ATOM   8784 C  C2    A C   D 2 34  ? 39.385  20.674  2.301   0.50 53.60  ? 34  C   D C2    1 
ATOM   8785 C  C2    B C   D 2 34  ? 39.369  20.669  2.293   0.50 53.57  ? 34  C   D C2    1 
ATOM   8786 O  O2    A C   D 2 34  ? 39.403  21.894  2.498   0.50 53.40  ? 34  C   D O2    1 
ATOM   8787 O  O2    B C   D 2 34  ? 39.397  21.891  2.485   0.50 53.37  ? 34  C   D O2    1 
ATOM   8788 N  N3    A C   D 2 34  ? 38.615  20.132  1.320   0.50 53.66  ? 34  C   D N3    1 
ATOM   8789 N  N3    B C   D 2 34  ? 38.593  20.130  1.316   0.50 53.63  ? 34  C   D N3    1 
ATOM   8790 C  C4    A C   D 2 34  ? 38.612  18.809  1.121   0.50 53.61  ? 34  C   D C4    1 
ATOM   8791 C  C4    B C   D 2 34  ? 38.580  18.805  1.123   0.50 53.58  ? 34  C   D C4    1 
ATOM   8792 N  N4    A C   D 2 34  ? 37.831  18.334  0.145   0.50 53.46  ? 34  C   D N4    1 
ATOM   8793 N  N4    B C   D 2 34  ? 37.795  18.332  0.149   0.50 53.43  ? 34  C   D N4    1 
ATOM   8794 C  C5    A C   D 2 34  ? 39.410  17.923  1.915   0.50 53.40  ? 34  C   D C5    1 
ATOM   8795 C  C5    B C   D 2 34  ? 39.371  17.917  1.922   0.50 53.37  ? 34  C   D C5    1 
ATOM   8796 C  C6    A C   D 2 34  ? 40.169  18.467  2.879   0.50 53.51  ? 34  C   D C6    1 
ATOM   8797 C  C6    B C   D 2 34  ? 40.135  18.460  2.883   0.50 53.48  ? 34  C   D C6    1 
ATOM   8798 P  P     A A   D 2 35  ? 39.020  19.349  8.261   0.50 55.60  ? 35  A   D P     1 
ATOM   8799 O  OP1   A A   D 2 35  ? 38.950  19.831  9.659   0.50 55.44  ? 35  A   D OP1   1 
ATOM   8800 O  OP2   A A   D 2 35  ? 38.751  17.920  7.978   0.50 55.60  ? 35  A   D OP2   1 
ATOM   8801 O  "O5'" A A   D 2 35  ? 38.036  20.205  7.315   0.50 55.75  ? 35  A   D "O5'" 1 
ATOM   8802 C  "C5'" A A   D 2 35  ? 37.640  21.548  7.634   0.50 56.89  ? 35  A   D "C5'" 1 
ATOM   8803 C  "C4'" A A   D 2 35  ? 36.793  22.224  6.559   0.50 57.34  ? 35  A   D "C4'" 1 
ATOM   8804 O  "O4'" A A   D 2 35  ? 37.217  21.818  5.231   0.50 58.14  ? 35  A   D "O4'" 1 
ATOM   8805 C  "C3'" A A   D 2 35  ? 35.292  21.951  6.608   0.50 57.37  ? 35  A   D "C3'" 1 
ATOM   8806 O  "O3'" A A   D 2 35  ? 34.638  22.904  7.433   0.50 56.70  ? 35  A   D "O3'" 1 
ATOM   8807 C  "C2'" A A   D 2 35  ? 34.862  22.108  5.149   0.50 57.90  ? 35  A   D "C2'" 1 
ATOM   8808 O  "O2'" A A   D 2 35  ? 34.535  23.439  4.778   0.50 57.64  ? 35  A   D "O2'" 1 
ATOM   8809 C  "C1'" A A   D 2 35  ? 36.095  21.621  4.386   0.50 58.16  ? 35  A   D "C1'" 1 
ATOM   8810 N  N9    A A   D 2 35  ? 36.028  20.208  4.002   0.50 58.26  ? 35  A   D N9    1 
ATOM   8811 C  C8    A A   D 2 35  ? 36.799  19.188  4.494   0.50 58.35  ? 35  A   D C8    1 
ATOM   8812 N  N7    A A   D 2 35  ? 36.532  18.013  3.977   0.50 58.41  ? 35  A   D N7    1 
ATOM   8813 C  C5    A A   D 2 35  ? 35.509  18.273  3.079   0.50 58.30  ? 35  A   D C5    1 
ATOM   8814 C  C6    A A   D 2 35  ? 34.775  17.441  2.203   0.50 58.23  ? 35  A   D C6    1 
ATOM   8815 N  N6    A A   D 2 35  ? 34.985  16.123  2.099   0.50 58.24  ? 35  A   D N6    1 
ATOM   8816 N  N1    A A   D 2 35  ? 33.815  18.015  1.435   0.50 58.42  ? 35  A   D N1    1 
ATOM   8817 C  C2    A A   D 2 35  ? 33.607  19.338  1.541   0.50 58.29  ? 35  A   D C2    1 
ATOM   8818 N  N3    A A   D 2 35  ? 34.234  20.218  2.326   0.50 58.06  ? 35  A   D N3    1 
ATOM   8819 C  C4    A A   D 2 35  ? 35.183  19.623  3.079   0.50 58.37  ? 35  A   D C4    1 
HETATM 8820 P  PG    A ATP E 3 .   ? 10.245  -55.027 -36.802 0.50 25.19  ? 501 ATP A PG    1 
HETATM 8821 O  O1G   A ATP E 3 .   ? 11.477  -55.199 -37.674 0.50 24.71  ? 501 ATP A O1G   1 
HETATM 8822 O  O2G   A ATP E 3 .   ? 10.510  -54.253 -35.523 0.50 23.90  ? 501 ATP A O2G   1 
HETATM 8823 O  O3G   A ATP E 3 .   ? 9.433   -56.278 -36.593 0.50 23.91  ? 501 ATP A O3G   1 
HETATM 8824 P  PB    A ATP E 3 .   ? 7.728   -53.859 -37.806 0.50 14.06  ? 501 ATP A PB    1 
HETATM 8825 O  O1B   A ATP E 3 .   ? 7.612   -52.615 -38.661 0.50 12.35  ? 501 ATP A O1B   1 
HETATM 8826 O  O2B   A ATP E 3 .   ? 7.035   -55.129 -38.172 0.50 12.58  ? 501 ATP A O2B   1 
HETATM 8827 O  O3B   A ATP E 3 .   ? 9.338   -54.025 -37.694 0.50 19.78  ? 501 ATP A O3B   1 
HETATM 8828 P  PA    A ATP E 3 .   ? 5.876   -53.542 -35.562 0.50 18.07  ? 501 ATP A PA    1 
HETATM 8829 O  O1A   A ATP E 3 .   ? 5.409   -54.978 -35.569 0.50 19.65  ? 501 ATP A O1A   1 
HETATM 8830 O  O2A   A ATP E 3 .   ? 5.901   -52.830 -34.229 0.50 21.28  ? 501 ATP A O2A   1 
HETATM 8831 O  O3A   A ATP E 3 .   ? 7.346   -53.455 -36.253 0.50 17.37  ? 501 ATP A O3A   1 
HETATM 8832 O  "O5'" A ATP E 3 .   ? 4.963   -52.609 -36.500 0.50 19.83  ? 501 ATP A "O5'" 1 
HETATM 8833 C  "C5'" A ATP E 3 .   ? 4.008   -53.159 -37.406 0.50 22.56  ? 501 ATP A "C5'" 1 
HETATM 8834 C  "C4'" A ATP E 3 .   ? 3.597   -52.105 -38.432 0.50 22.00  ? 501 ATP A "C4'" 1 
HETATM 8835 O  "O4'" A ATP E 3 .   ? 2.766   -51.157 -37.760 0.50 23.75  ? 501 ATP A "O4'" 1 
HETATM 8836 C  "C3'" A ATP E 3 .   ? 4.743   -51.304 -39.037 0.50 23.45  ? 501 ATP A "C3'" 1 
HETATM 8837 O  "O3'" A ATP E 3 .   ? 5.176   -51.790 -40.314 0.50 25.05  ? 501 ATP A "O3'" 1 
HETATM 8838 C  "C2'" A ATP E 3 .   ? 4.218   -49.881 -39.130 0.50 23.04  ? 501 ATP A "C2'" 1 
HETATM 8839 O  "O2'" A ATP E 3 .   ? 3.474   -49.608 -40.330 0.50 24.52  ? 501 ATP A "O2'" 1 
HETATM 8840 C  "C1'" A ATP E 3 .   ? 3.204   -49.817 -38.020 0.50 21.76  ? 501 ATP A "C1'" 1 
HETATM 8841 N  N9    A ATP E 3 .   ? 3.753   -49.148 -36.803 0.50 22.17  ? 501 ATP A N9    1 
HETATM 8842 C  C8    A ATP E 3 .   ? 3.918   -49.681 -35.578 0.50 21.85  ? 501 ATP A C8    1 
HETATM 8843 N  N7    A ATP E 3 .   ? 4.420   -48.761 -34.706 0.50 21.83  ? 501 ATP A N7    1 
HETATM 8844 C  C5    A ATP E 3 .   ? 4.582   -47.604 -35.382 0.50 21.93  ? 501 ATP A C5    1 
HETATM 8845 C  C6    A ATP E 3 .   ? 5.076   -46.225 -35.093 0.50 22.38  ? 501 ATP A C6    1 
HETATM 8846 N  N6    A ATP E 3 .   ? 5.504   -45.847 -33.854 0.50 22.02  ? 501 ATP A N6    1 
HETATM 8847 N  N1    A ATP E 3 .   ? 5.080   -45.339 -36.123 0.50 21.45  ? 501 ATP A N1    1 
HETATM 8848 C  C2    A ATP E 3 .   ? 4.665   -45.663 -37.369 0.50 20.83  ? 501 ATP A C2    1 
HETATM 8849 N  N3    A ATP E 3 .   ? 4.212   -46.889 -37.691 0.50 22.51  ? 501 ATP A N3    1 
HETATM 8850 C  C4    A ATP E 3 .   ? 4.144   -47.877 -36.763 0.50 20.95  ? 501 ATP A C4    1 
HETATM 8851 S  S     . SO4 F 4 .   ? 5.412   -29.644 -14.426 1.00 55.81  ? 701 SO4 A S     1 
HETATM 8852 O  O1    . SO4 F 4 .   ? 4.747   -28.374 -14.762 1.00 53.96  ? 701 SO4 A O1    1 
HETATM 8853 O  O2    . SO4 F 4 .   ? 4.833   -30.168 -13.184 1.00 53.25  ? 701 SO4 A O2    1 
HETATM 8854 O  O3    . SO4 F 4 .   ? 5.221   -30.617 -15.503 1.00 53.31  ? 701 SO4 A O3    1 
HETATM 8855 O  O4    . SO4 F 4 .   ? 6.859   -29.412 -14.260 1.00 54.82  ? 701 SO4 A O4    1 
HETATM 8856 C  C1    . EDO G 5 .   ? -0.793  -43.931 -2.769  1.00 39.95  ? 801 EDO A C1    1 
HETATM 8857 O  O1    . EDO G 5 .   ? -0.580  -45.353 -2.771  1.00 41.10  ? 801 EDO A O1    1 
HETATM 8858 C  C2    . EDO G 5 .   ? -2.228  -43.624 -3.174  1.00 42.73  ? 801 EDO A C2    1 
HETATM 8859 O  O2    . EDO G 5 .   ? -2.531  -42.244 -2.932  1.00 44.88  ? 801 EDO A O2    1 
HETATM 8860 C  C1    . EDO H 5 .   ? -13.400 -59.132 -38.931 1.00 34.12  ? 803 EDO A C1    1 
HETATM 8861 O  O1    . EDO H 5 .   ? -13.740 -60.400 -39.502 1.00 33.27  ? 803 EDO A O1    1 
HETATM 8862 C  C2    . EDO H 5 .   ? -12.006 -59.181 -38.331 1.00 31.63  ? 803 EDO A C2    1 
HETATM 8863 O  O2    . EDO H 5 .   ? -11.103 -60.014 -39.037 1.00 29.19  ? 803 EDO A O2    1 
HETATM 8864 C  C1    . EDO I 5 .   ? 36.028  -45.511 -23.542 1.00 50.28  ? 804 EDO A C1    1 
HETATM 8865 O  O1    . EDO I 5 .   ? 34.698  -45.569 -23.018 1.00 50.07  ? 804 EDO A O1    1 
HETATM 8866 C  C2    . EDO I 5 .   ? 35.984  -44.963 -24.957 1.00 50.44  ? 804 EDO A C2    1 
HETATM 8867 O  O2    . EDO I 5 .   ? 35.768  -43.553 -24.869 1.00 51.74  ? 804 EDO A O2    1 
HETATM 8868 C  C1    . EDO J 5 .   ? -1.699  -35.717 -7.106  1.00 57.44  ? 805 EDO A C1    1 
HETATM 8869 O  O1    . EDO J 5 .   ? -2.130  -37.059 -6.851  1.00 56.93  ? 805 EDO A O1    1 
HETATM 8870 C  C2    . EDO J 5 .   ? -2.205  -35.289 -8.466  1.00 58.28  ? 805 EDO A C2    1 
HETATM 8871 O  O2    . EDO J 5 .   ? -1.463  -34.118 -8.820  1.00 60.50  ? 805 EDO A O2    1 
HETATM 8872 MG MG    . MG  K 6 .   ? 7.036   -57.547 -36.140 1.00 39.66  ? 901 MG  A MG    1 
HETATM 8873 P  PG    B ATP L 3 .   ? 35.205  18.571  12.607  0.50 55.63  ? 502 ATP B PG    1 
HETATM 8874 O  O1G   B ATP L 3 .   ? 34.159  18.567  13.702  0.50 55.37  ? 502 ATP B O1G   1 
HETATM 8875 O  O2G   B ATP L 3 .   ? 35.301  17.264  11.855  0.50 55.87  ? 502 ATP B O2G   1 
HETATM 8876 O  O3G   B ATP L 3 .   ? 36.536  19.139  13.039  0.50 55.92  ? 502 ATP B O3G   1 
HETATM 8877 P  PB    B ATP L 3 .   ? 35.545  20.224  10.270  0.50 53.49  ? 502 ATP B PB    1 
HETATM 8878 O  O1B   B ATP L 3 .   ? 34.576  20.730  9.231   0.50 53.28  ? 502 ATP B O1B   1 
HETATM 8879 O  O2B   B ATP L 3 .   ? 36.579  21.177  10.823  0.50 53.42  ? 502 ATP B O2B   1 
HETATM 8880 O  O3B   B ATP L 3 .   ? 34.665  19.616  11.491  0.50 54.41  ? 502 ATP B O3B   1 
HETATM 8881 P  PA    B ATP L 3 .   ? 37.443  19.120  8.464   0.50 52.73  ? 502 ATP B PA    1 
HETATM 8882 O  O1A   B ATP L 3 .   ? 38.647  19.730  9.142   0.50 52.98  ? 502 ATP B O1A   1 
HETATM 8883 O  O2A   B ATP L 3 .   ? 37.595  17.805  7.732   0.50 52.77  ? 502 ATP B O2A   1 
HETATM 8884 O  O3A   B ATP L 3 .   ? 36.300  18.959  9.598   0.50 53.60  ? 502 ATP B O3A   1 
HETATM 8885 O  "O5'" B ATP L 3 .   ? 36.826  20.166  7.401   0.50 52.69  ? 502 ATP B "O5'" 1 
HETATM 8886 C  "C5'" B ATP L 3 .   ? 37.342  21.495  7.282   0.50 52.14  ? 502 ATP B "C5'" 1 
HETATM 8887 C  "C4'" B ATP L 3 .   ? 36.562  22.340  6.275   0.50 51.82  ? 502 ATP B "C4'" 1 
HETATM 8888 O  "O4'" B ATP L 3 .   ? 37.003  22.056  4.941   0.50 52.11  ? 502 ATP B "O4'" 1 
HETATM 8889 C  "C3'" B ATP L 3 .   ? 35.055  22.118  6.304   0.50 51.29  ? 502 ATP B "C3'" 1 
HETATM 8890 O  "O3'" B ATP L 3 .   ? 34.386  23.164  7.009   0.50 49.85  ? 502 ATP B "O3'" 1 
HETATM 8891 C  "C2'" B ATP L 3 .   ? 34.643  22.101  4.847   0.50 51.67  ? 502 ATP B "C2'" 1 
HETATM 8892 O  "O2'" B ATP L 3 .   ? 34.188  23.395  4.434   0.50 50.95  ? 502 ATP B "O2'" 1 
HETATM 8893 C  "C1'" B ATP L 3 .   ? 35.904  21.743  4.079   0.50 51.88  ? 502 ATP B "C1'" 1 
HETATM 8894 N  N9    B ATP L 3 .   ? 35.897  20.286  3.770   0.50 51.90  ? 502 ATP B N9    1 
HETATM 8895 C  C8    B ATP L 3 .   ? 36.743  19.367  4.280   0.50 51.99  ? 502 ATP B C8    1 
HETATM 8896 N  N7    B ATP L 3 .   ? 36.476  18.123  3.807   0.50 52.08  ? 502 ATP B N7    1 
HETATM 8897 C  C5    B ATP L 3 .   ? 35.429  18.231  2.967   0.50 51.87  ? 502 ATP B C5    1 
HETATM 8898 C  C6    B ATP L 3 .   ? 34.633  17.305  2.120   0.50 51.86  ? 502 ATP B C6    1 
HETATM 8899 N  N6    B ATP L 3 .   ? 34.916  15.978  2.079   0.50 51.86  ? 502 ATP B N6    1 
HETATM 8900 N  N1    B ATP L 3 .   ? 33.615  17.830  1.390   0.50 51.98  ? 502 ATP B N1    1 
HETATM 8901 C  C2    B ATP L 3 .   ? 33.321  19.149  1.420   0.50 51.93  ? 502 ATP B C2    1 
HETATM 8902 N  N3    B ATP L 3 .   ? 34.004  20.043  2.164   0.50 51.54  ? 502 ATP B N3    1 
HETATM 8903 C  C4    B ATP L 3 .   ? 35.049  19.658  2.945   0.50 51.96  ? 502 ATP B C4    1 
HETATM 8904 P  P1    A POP M 7 .   ? 34.671  18.688  11.738  0.50 64.91  ? 602 POP B P1    1 
HETATM 8905 O  O1    A POP M 7 .   ? 33.485  18.967  12.627  0.50 64.83  ? 602 POP B O1    1 
HETATM 8906 O  O2    A POP M 7 .   ? 35.840  18.306  12.617  0.50 65.00  ? 602 POP B O2    1 
HETATM 8907 O  O3    A POP M 7 .   ? 34.355  17.548  10.799  0.50 64.83  ? 602 POP B O3    1 
HETATM 8908 O  O     A POP M 7 .   ? 35.033  20.019  10.898  0.50 64.87  ? 602 POP B O     1 
HETATM 8909 P  P2    A POP M 7 .   ? 34.315  20.416  9.506   0.50 64.90  ? 602 POP B P2    1 
HETATM 8910 O  O4    A POP M 7 .   ? 35.068  21.591  8.927   0.50 64.94  ? 602 POP B O4    1 
HETATM 8911 O  O5    A POP M 7 .   ? 34.358  19.274  8.513   0.50 65.10  ? 602 POP B O5    1 
HETATM 8912 O  O6    A POP M 7 .   ? 32.876  20.817  9.768   0.50 65.15  ? 602 POP B O6    1 
HETATM 8913 S  S     . SO4 N 4 .   ? 36.634  -4.525  -12.823 1.00 66.85  ? 702 SO4 B S     1 
HETATM 8914 O  O1    . SO4 N 4 .   ? 36.288  -4.227  -14.213 1.00 66.74  ? 702 SO4 B O1    1 
HETATM 8915 O  O2    . SO4 N 4 .   ? 37.963  -5.142  -12.787 1.00 66.02  ? 702 SO4 B O2    1 
HETATM 8916 O  O3    . SO4 N 4 .   ? 36.621  -3.293  -12.039 1.00 66.05  ? 702 SO4 B O3    1 
HETATM 8917 O  O4    . SO4 N 4 .   ? 35.637  -5.449  -12.278 1.00 66.77  ? 702 SO4 B O4    1 
HETATM 8918 C  C1    . EDO O 5 .   ? 32.738  -48.016 -23.234 1.00 59.77  ? 802 EDO B C1    1 
HETATM 8919 O  O1    . EDO O 5 .   ? 32.394  -47.138 -22.158 1.00 58.15  ? 802 EDO B O1    1 
HETATM 8920 C  C2    . EDO O 5 .   ? 31.578  -48.048 -24.227 1.00 61.52  ? 802 EDO B C2    1 
HETATM 8921 O  O2    . EDO O 5 .   ? 31.768  -47.083 -25.272 1.00 62.71  ? 802 EDO B O2    1 
HETATM 8922 MG MG    . MG  P 6 .   ? 38.665  20.483  11.941  1.00 62.14  ? 902 MG  B MG    1 
HETATM 8923 P  P1    B POP Q 7 .   ? 9.896   -54.418 -36.372 0.50 64.99  ? 601 POP C P1    1 
HETATM 8924 O  O1    B POP Q 7 .   ? 10.444  -53.108 -36.888 0.50 64.51  ? 601 POP C O1    1 
HETATM 8925 O  O2    B POP Q 7 .   ? 10.999  -55.451 -36.312 0.50 64.90  ? 601 POP C O2    1 
HETATM 8926 O  O3    B POP Q 7 .   ? 9.318   -54.208 -34.991 0.50 64.86  ? 601 POP C O3    1 
HETATM 8927 O  O     B POP Q 7 .   ? 8.767   -54.927 -37.404 0.50 64.64  ? 601 POP C O     1 
HETATM 8928 P  P2    B POP Q 7 .   ? 7.445   -54.066 -37.741 0.50 64.41  ? 601 POP C P2    1 
HETATM 8929 O  O4    B POP Q 7 .   ? 6.285   -55.031 -37.743 0.50 64.32  ? 601 POP C O4    1 
HETATM 8930 O  O5    B POP Q 7 .   ? 7.232   -52.996 -36.687 0.50 64.94  ? 601 POP C O5    1 
HETATM 8931 O  O6    B POP Q 7 .   ? 7.554   -53.406 -39.093 0.50 64.36  ? 601 POP C O6    1 
HETATM 8932 P  PG    . ATP R 3 .   ? 12.588  -7.094  -10.295 0.00 53.46  ? 851 ATP C PG    1 
HETATM 8933 O  O1G   . ATP R 3 .   ? 14.053  -7.465  -10.360 0.00 53.16  ? 851 ATP C O1G   1 
HETATM 8934 O  O2G   . ATP R 3 .   ? 12.208  -5.955  -11.213 0.00 53.67  ? 851 ATP C O2G   1 
HETATM 8935 O  O3G   . ATP R 3 .   ? 12.062  -6.951  -8.885  0.00 53.71  ? 851 ATP C O3G   1 
HETATM 8936 P  PB    . ATP R 3 .   ? 10.209  -8.685  -10.685 0.00 51.01  ? 851 ATP C PB    1 
HETATM 8937 O  O1B   . ATP R 3 .   ? 10.119  -9.826  -9.703  0.00 50.61  ? 851 ATP C O1B   1 
HETATM 8938 O  O2B   . ATP R 3 .   ? 9.480   -7.398  -10.377 0.00 51.30  ? 851 ATP C O2B   1 
HETATM 8939 O  O3B   . ATP R 3 .   ? 11.784  -8.362  -10.909 0.00 52.04  ? 851 ATP C O3B   1 
HETATM 8940 P  PA    . ATP R 3 .   ? 8.219   -9.987  -12.236 0.00 50.70  ? 851 ATP C PA    1 
HETATM 8941 O  O1A   . ATP R 3 .   ? 7.456   -9.665  -10.974 0.00 50.84  ? 851 ATP C O1A   1 
HETATM 8942 O  O2A   . ATP R 3 .   ? 7.622   -9.621  -13.579 0.00 50.73  ? 851 ATP C O2A   1 
HETATM 8943 O  O3A   . ATP R 3 .   ? 9.665   -9.276  -12.092 0.00 51.55  ? 851 ATP C O3A   1 
HETATM 8944 O  "O5'" . ATP R 3 .   ? 8.539   -11.570 -12.292 0.00 50.89  ? 851 ATP C "O5'" 1 
HETATM 8945 C  "C5'" . ATP R 3 .   ? 8.307   -12.408 -11.156 0.00 50.42  ? 851 ATP C "C5'" 1 
HETATM 8946 C  "C4'" . ATP R 3 .   ? 9.585   -12.765 -10.394 0.00 50.27  ? 851 ATP C "C4'" 1 
HETATM 8947 O  "O4'" . ATP R 3 .   ? 9.840   -11.797 -9.366  0.00 50.56  ? 851 ATP C "O4'" 1 
HETATM 8948 C  "C3'" . ATP R 3 .   ? 9.567   -14.134 -9.724  0.00 49.75  ? 851 ATP C "C3'" 1 
HETATM 8949 O  "O3'" . ATP R 3 .   ? 10.310  -15.094 -10.475 0.00 48.43  ? 851 ATP C "O3'" 1 
HETATM 8950 C  "C2'" . ATP R 3 .   ? 10.205  -13.905 -8.368  0.00 50.14  ? 851 ATP C "C2'" 1 
HETATM 8951 O  "O2'" . ATP R 3 .   ? 11.599  -14.229 -8.397  0.00 49.40  ? 851 ATP C "O2'" 1 
HETATM 8952 C  "C1'" . ATP R 3 .   ? 10.043  -12.419 -8.095  0.00 50.48  ? 851 ATP C "C1'" 1 
HETATM 8953 N  N9    . ATP R 3 .   ? 9.052   -12.097 -7.246  1.00 69.30  ? 851 ATP C N9    1 
HETATM 8954 C  C8    . ATP R 3 .   ? 7.977   -11.347 -7.570  1.00 69.02  ? 851 ATP C C8    1 
HETATM 8955 N  N7    . ATP R 3 .   ? 7.048   -11.375 -6.577  1.00 69.23  ? 851 ATP C N7    1 
HETATM 8956 C  C5    . ATP R 3 .   ? 7.528   -12.157 -5.589  1.00 68.93  ? 851 ATP C C5    1 
HETATM 8957 C  C6    . ATP R 3 .   ? 7.056   -12.611 -4.255  1.00 68.63  ? 851 ATP C C6    1 
HETATM 8958 N  N6    . ATP R 3 .   ? 5.849   -12.222 -3.774  1.00 68.50  ? 851 ATP C N6    1 
HETATM 8959 N  N1    . ATP R 3 .   ? 7.873   -13.427 -3.539  1.00 68.72  ? 851 ATP C N1    1 
HETATM 8960 C  C2    . ATP R 3 .   ? 9.078   -13.827 -4.008  1.00 69.07  ? 851 ATP C C2    1 
HETATM 8961 N  N3    . ATP R 3 .   ? 9.572   -13.453 -5.210  1.00 68.82  ? 851 ATP C N3    1 
HETATM 8962 C  C4    . ATP R 3 .   ? 8.857   -12.632 -6.032  1.00 69.23  ? 851 ATP C C4    1 
HETATM 8963 O  O     . HOH S 8 .   ? 7.312   -56.037 -50.510 1.00 41.62  ? 442 HOH A O     1 
HETATM 8964 O  O     . HOH S 8 .   ? 33.044  -49.486 -32.952 1.00 54.89  ? 443 HOH A O     1 
HETATM 8965 O  O     . HOH S 8 .   ? -14.604 -65.335 -34.913 1.00 12.97  ? 444 HOH A O     1 
HETATM 8966 O  O     . HOH S 8 .   ? 0.561   -39.189 -8.273  1.00 34.85  ? 445 HOH A O     1 
HETATM 8967 O  O     . HOH S 8 .   ? -1.944  -45.874 -37.318 1.00 19.36  ? 446 HOH A O     1 
HETATM 8968 O  O     . HOH S 8 .   ? -2.263  -61.282 -46.465 1.00 28.10  ? 447 HOH A O     1 
HETATM 8969 O  O     . HOH S 8 .   ? 9.622   -52.566 -40.470 1.00 19.95  ? 448 HOH A O     1 
HETATM 8970 O  O     . HOH S 8 .   ? 7.442   -49.957 -37.292 1.00 23.77  ? 449 HOH A O     1 
HETATM 8971 O  O     . HOH S 8 .   ? 7.879   -27.589 -43.673 1.00 46.41  ? 450 HOH A O     1 
HETATM 8972 O  O     . HOH S 8 .   ? -16.878 -48.523 -26.918 1.00 34.96  ? 451 HOH A O     1 
HETATM 8973 O  O     . HOH S 8 .   ? 9.474   -23.610 -40.267 1.00 52.07  ? 452 HOH A O     1 
HETATM 8974 O  O     . HOH S 8 .   ? 14.960  -25.427 -47.514 1.00 46.05  ? 453 HOH A O     1 
HETATM 8975 O  O     . HOH S 8 .   ? -13.375 -45.133 -44.527 1.00 44.79  ? 454 HOH A O     1 
HETATM 8976 O  O     . HOH S 8 .   ? 3.274   -43.572 -39.001 1.00 22.72  ? 455 HOH A O     1 
HETATM 8977 O  O     . HOH S 8 .   ? 14.101  -28.841 -30.855 1.00 42.41  ? 456 HOH A O     1 
HETATM 8978 O  O     . HOH S 8 .   ? 25.103  -44.011 -29.112 1.00 51.01  ? 457 HOH A O     1 
HETATM 8979 O  O     . HOH S 8 .   ? 25.898  -40.455 -21.802 1.00 41.23  ? 458 HOH A O     1 
HETATM 8980 O  O     . HOH S 8 .   ? 6.956   -48.091 -3.108  1.00 24.81  ? 459 HOH A O     1 
HETATM 8981 O  O     . HOH S 8 .   ? 12.842  -34.536 -27.588 1.00 26.72  ? 460 HOH A O     1 
HETATM 8982 O  O     . HOH S 8 .   ? 30.889  -47.840 -31.982 1.00 43.72  ? 461 HOH A O     1 
HETATM 8983 O  O     . HOH S 8 .   ? 7.285   -44.265 -36.029 1.00 18.88  ? 462 HOH A O     1 
HETATM 8984 O  O     . HOH S 8 .   ? 28.174  -46.572 -20.280 1.00 39.32  ? 463 HOH A O     1 
HETATM 8985 O  O     . HOH S 8 .   ? 35.803  -40.253 -24.166 1.00 35.74  ? 464 HOH A O     1 
HETATM 8986 O  O     . HOH S 8 .   ? 9.272   -68.003 -29.758 1.00 41.50  ? 465 HOH A O     1 
HETATM 8987 O  O     . HOH S 8 .   ? 8.148   -48.685 -23.830 1.00 18.29  ? 466 HOH A O     1 
HETATM 8988 O  O     . HOH S 8 .   ? 17.260  -20.822 13.644  1.00 53.66  ? 467 HOH A O     1 
HETATM 8989 O  O     . HOH S 8 .   ? 3.143   -62.668 -46.265 1.00 42.12  ? 468 HOH A O     1 
HETATM 8990 O  O     . HOH S 8 .   ? -9.373  -71.724 -36.448 1.00 21.70  ? 469 HOH A O     1 
HETATM 8991 O  O     . HOH S 8 .   ? 18.864  -31.510 -43.564 1.00 47.70  ? 470 HOH A O     1 
HETATM 8992 O  O     . HOH S 8 .   ? 19.717  -51.920 -17.277 1.00 47.90  ? 471 HOH A O     1 
HETATM 8993 O  O     . HOH S 8 .   ? 3.120   -60.364 -41.025 1.00 21.91  ? 472 HOH A O     1 
HETATM 8994 O  O     . HOH S 8 .   ? -1.807  -45.449 -21.702 1.00 20.50  ? 473 HOH A O     1 
HETATM 8995 O  O     . HOH S 8 .   ? 21.778  -19.433 -6.684  1.00 49.21  ? 474 HOH A O     1 
HETATM 8996 O  O     . HOH S 8 .   ? 23.476  -23.522 -7.841  1.00 45.63  ? 475 HOH A O     1 
HETATM 8997 O  O     . HOH S 8 .   ? 21.784  -26.024 -8.343  1.00 17.82  ? 476 HOH A O     1 
HETATM 8998 O  O     . HOH S 8 .   ? -1.472  -57.813 -25.929 1.00 28.99  ? 477 HOH A O     1 
HETATM 8999 O  O     . HOH S 8 .   ? 9.083   -50.971 -23.854 1.00 19.28  ? 478 HOH A O     1 
HETATM 9000 O  O     . HOH S 8 .   ? 1.671   -57.989 -25.360 1.00 44.41  ? 479 HOH A O     1 
HETATM 9001 O  O     . HOH S 8 .   ? 39.398  -38.273 -23.169 1.00 23.85  ? 480 HOH A O     1 
HETATM 9002 O  O     . HOH S 8 .   ? 41.462  -47.834 -17.384 1.00 44.18  ? 481 HOH A O     1 
HETATM 9003 O  O     . HOH S 8 .   ? -18.084 -45.615 -32.189 1.00 54.82  ? 482 HOH A O     1 
HETATM 9004 O  O     . HOH S 8 .   ? -20.041 -46.447 -30.475 1.00 54.64  ? 483 HOH A O     1 
HETATM 9005 O  O     . HOH S 8 .   ? 12.943  -51.627 -29.726 1.00 32.98  ? 484 HOH A O     1 
HETATM 9006 O  O     . HOH S 8 .   ? 5.543   -58.732 -39.006 1.00 19.95  ? 485 HOH A O     1 
HETATM 9007 O  O     . HOH S 8 .   ? -8.303  -61.856 -21.283 1.00 53.83  ? 486 HOH A O     1 
HETATM 9008 O  O     . HOH S 8 .   ? -5.566  -55.139 -20.438 1.00 50.73  ? 487 HOH A O     1 
HETATM 9009 O  O     . HOH S 8 .   ? -6.836  -47.252 -30.624 1.00 25.39  ? 488 HOH A O     1 
HETATM 9010 O  O     . HOH S 8 .   ? 15.004  -33.779 5.253   1.00 23.80  ? 489 HOH A O     1 
HETATM 9011 O  O     . HOH S 8 .   ? 9.755   -56.898 -49.789 1.00 29.68  ? 490 HOH A O     1 
HETATM 9012 O  O     . HOH S 8 .   ? -3.119  -48.001 -19.782 1.00 27.19  ? 491 HOH A O     1 
HETATM 9013 O  O     . HOH S 8 .   ? 15.917  -35.391 -25.948 1.00 20.01  ? 492 HOH A O     1 
HETATM 9014 O  O     . HOH S 8 .   ? 2.134   -36.445 -11.307 1.00 28.74  ? 493 HOH A O     1 
HETATM 9015 O  O     . HOH S 8 .   ? 14.532  -45.535 -53.503 1.00 30.97  ? 494 HOH A O     1 
HETATM 9016 O  O     . HOH S 8 .   ? -0.641  -50.879 -17.475 1.00 23.26  ? 495 HOH A O     1 
HETATM 9017 O  O     . HOH S 8 .   ? 22.367  -37.510 4.022   1.00 35.18  ? 496 HOH A O     1 
HETATM 9018 O  O     . HOH S 8 .   ? 0.209   -47.467 -37.302 1.00 17.15  ? 497 HOH A O     1 
HETATM 9019 O  O     . HOH S 8 .   ? 15.035  -49.705 -17.027 1.00 25.61  ? 498 HOH A O     1 
HETATM 9020 O  O     . HOH S 8 .   ? 10.437  -29.918 -8.882  1.00 23.01  ? 499 HOH A O     1 
HETATM 9021 O  O     . HOH S 8 .   ? 3.629   -50.446 -53.297 1.00 30.62  ? 500 HOH A O     1 
HETATM 9022 O  O     . HOH S 8 .   ? 19.836  -35.514 -16.733 1.00 28.73  ? 502 HOH A O     1 
HETATM 9023 O  O     . HOH S 8 .   ? 29.286  -34.926 -34.921 1.00 22.10  ? 503 HOH A O     1 
HETATM 9024 O  O     . HOH S 8 .   ? 5.133   -49.946 -2.074  1.00 26.58  ? 504 HOH A O     1 
HETATM 9025 O  O     . HOH S 8 .   ? 5.717   -50.513 -32.906 1.00 28.68  ? 505 HOH A O     1 
HETATM 9026 O  O     . HOH S 8 .   ? 18.731  -35.338 -46.976 1.00 28.68  ? 506 HOH A O     1 
HETATM 9027 O  O     . HOH S 8 .   ? 17.430  -50.299 -29.680 1.00 30.03  ? 507 HOH A O     1 
HETATM 9028 O  O     . HOH S 8 .   ? -3.911  -43.772 -28.159 1.00 26.32  ? 508 HOH A O     1 
HETATM 9029 O  O     . HOH S 8 .   ? 9.645   -27.545 -3.566  1.00 38.17  ? 509 HOH A O     1 
HETATM 9030 O  O     . HOH S 8 .   ? -7.487  -71.855 -34.545 1.00 29.32  ? 510 HOH A O     1 
HETATM 9031 O  O     . HOH S 8 .   ? 5.396   -53.834 -21.006 1.00 33.38  ? 511 HOH A O     1 
HETATM 9032 O  O     . HOH S 8 .   ? 12.319  -43.552 -21.449 1.00 28.39  ? 512 HOH A O     1 
HETATM 9033 O  O     . HOH S 8 .   ? 6.744   -52.274 -17.051 1.00 27.31  ? 513 HOH A O     1 
HETATM 9034 O  O     . HOH S 8 .   ? 28.449  -40.007 -2.777  1.00 32.45  ? 514 HOH A O     1 
HETATM 9035 O  O     . HOH S 8 .   ? 14.211  -31.757 6.622   1.00 28.64  ? 515 HOH A O     1 
HETATM 9036 O  O     . HOH S 8 .   ? 2.714   -43.206 -20.458 1.00 18.30  ? 516 HOH A O     1 
HETATM 9037 O  O     . HOH S 8 .   ? 4.390   -39.881 1.938   1.00 33.28  ? 517 HOH A O     1 
HETATM 9038 O  O     . HOH S 8 .   ? 11.034  -39.194 -27.484 1.00 46.86  ? 518 HOH A O     1 
HETATM 9039 O  O     . HOH S 8 .   ? 3.730   -49.325 2.683   1.00 36.76  ? 519 HOH A O     1 
HETATM 9040 O  O     . HOH S 8 .   ? -1.458  -46.975 -49.063 1.00 25.61  ? 520 HOH A O     1 
HETATM 9041 O  O     . HOH S 8 .   ? 18.924  -25.201 -0.509  1.00 26.43  ? 521 HOH A O     1 
HETATM 9042 O  O     . HOH S 8 .   ? 24.303  -49.615 -48.351 1.00 32.59  ? 522 HOH A O     1 
HETATM 9043 O  O     . HOH S 8 .   ? 30.750  -52.603 -31.035 1.00 32.95  ? 523 HOH A O     1 
HETATM 9044 O  O     . HOH S 8 .   ? 36.395  -42.880 -16.906 1.00 27.76  ? 524 HOH A O     1 
HETATM 9045 O  O     . HOH S 8 .   ? -9.130  -72.291 -30.954 1.00 30.31  ? 525 HOH A O     1 
HETATM 9046 O  O     . HOH S 8 .   ? 27.036  -36.939 -48.294 1.00 36.13  ? 526 HOH A O     1 
HETATM 9047 O  O     . HOH S 8 .   ? -12.284 -63.320 -25.367 1.00 41.02  ? 527 HOH A O     1 
HETATM 9048 O  O     . HOH S 8 .   ? 1.409   -47.507 -7.837  1.00 26.03  ? 528 HOH A O     1 
HETATM 9049 O  O     . HOH S 8 .   ? 12.799  -42.046 -53.746 1.00 43.66  ? 529 HOH A O     1 
HETATM 9050 O  O     . HOH S 8 .   ? 6.876   -43.075 -55.948 1.00 36.43  ? 530 HOH A O     1 
HETATM 9051 O  O     . HOH S 8 .   ? 2.805   -41.532 -52.676 1.00 30.43  ? 531 HOH A O     1 
HETATM 9052 O  O     . HOH S 8 .   ? -0.815  -46.771 -15.783 1.00 28.07  ? 532 HOH A O     1 
HETATM 9053 O  O     . HOH S 8 .   ? 25.623  -35.687 0.716   1.00 29.75  ? 533 HOH A O     1 
HETATM 9054 O  O     . HOH S 8 .   ? 21.722  -55.305 -34.261 1.00 34.33  ? 534 HOH A O     1 
HETATM 9055 O  O     . HOH S 8 .   ? 19.369  -37.457 -23.304 1.00 32.04  ? 535 HOH A O     1 
HETATM 9056 O  O     . HOH S 8 .   ? -1.590  -43.578 -34.319 1.00 22.63  ? 536 HOH A O     1 
HETATM 9057 O  O     . HOH S 8 .   ? -8.352  -73.655 -42.999 1.00 28.05  ? 537 HOH A O     1 
HETATM 9058 O  O     . HOH S 8 .   ? 29.052  -27.345 -13.553 1.00 26.58  ? 538 HOH A O     1 
HETATM 9059 O  O     . HOH S 8 .   ? -13.137 -60.989 -26.001 1.00 31.70  ? 539 HOH A O     1 
HETATM 9060 O  O     . HOH S 8 .   ? 9.053   -32.249 4.128   1.00 36.42  ? 540 HOH A O     1 
HETATM 9061 O  O     . HOH S 8 .   ? 26.100  -37.537 -13.688 1.00 25.15  ? 541 HOH A O     1 
HETATM 9062 O  O     . HOH S 8 .   ? 38.895  -35.745 -5.771  1.00 40.00  ? 542 HOH A O     1 
HETATM 9063 O  O     . HOH S 8 .   ? -10.859 -66.121 -43.619 1.00 27.56  ? 543 HOH A O     1 
HETATM 9064 O  O     . HOH S 8 .   ? -9.208  -61.968 -45.530 1.00 27.99  ? 544 HOH A O     1 
HETATM 9065 O  O     . HOH S 8 .   ? 11.994  -26.060 -3.135  1.00 29.09  ? 545 HOH A O     1 
HETATM 9066 O  O     . HOH S 8 .   ? 7.228   -52.567 0.424   1.00 54.42  ? 546 HOH A O     1 
HETATM 9067 O  O     . HOH S 8 .   ? -8.241  -50.578 -44.117 1.00 28.69  ? 547 HOH A O     1 
HETATM 9068 O  O     . HOH S 8 .   ? 6.530   -51.419 -25.323 1.00 31.01  ? 548 HOH A O     1 
HETATM 9069 O  O     . HOH S 8 .   ? 26.291  -4.768  3.213   1.00 36.71  ? 549 HOH A O     1 
HETATM 9070 O  O     . HOH S 8 .   ? 1.101   -51.961 -8.846  1.00 29.20  ? 550 HOH A O     1 
HETATM 9071 O  O     . HOH S 8 .   ? 16.023  -43.774 3.188   1.00 34.35  ? 551 HOH A O     1 
HETATM 9072 O  O     . HOH S 8 .   ? 18.555  -35.195 8.716   1.00 27.55  ? 552 HOH A O     1 
HETATM 9073 O  O     . HOH S 8 .   ? 21.893  -28.354 -13.130 1.00 35.31  ? 553 HOH A O     1 
HETATM 9074 O  O     . HOH S 8 .   ? 13.109  -57.004 -36.889 1.00 28.32  ? 554 HOH A O     1 
HETATM 9075 O  O     . HOH S 8 .   ? -16.496 -46.192 -29.867 1.00 40.24  ? 555 HOH A O     1 
HETATM 9076 O  O     . HOH S 8 .   ? 18.038  -43.480 -17.652 1.00 36.35  ? 556 HOH A O     1 
HETATM 9077 O  O     . HOH S 8 .   ? 16.476  -39.100 -15.755 1.00 28.21  ? 557 HOH A O     1 
HETATM 9078 O  O     . HOH S 8 .   ? 15.863  -35.716 -15.228 1.00 37.24  ? 558 HOH A O     1 
HETATM 9079 O  O     . HOH S 8 .   ? 34.933  -49.394 -34.553 1.00 58.60  ? 559 HOH A O     1 
HETATM 9080 O  O     . HOH S 8 .   ? -8.970  -56.345 -22.532 1.00 34.84  ? 560 HOH A O     1 
HETATM 9081 O  O     . HOH S 8 .   ? 5.696   -33.772 -34.499 1.00 25.93  ? 561 HOH A O     1 
HETATM 9082 O  O     . HOH S 8 .   ? 10.433  -43.545 -34.820 1.00 24.58  ? 562 HOH A O     1 
HETATM 9083 O  O     . HOH S 8 .   ? 18.696  -55.008 -50.363 1.00 31.93  ? 563 HOH A O     1 
HETATM 9084 O  O     . HOH S 8 .   ? 31.738  -38.009 -41.783 1.00 33.46  ? 564 HOH A O     1 
HETATM 9085 O  O     . HOH S 8 .   ? 10.881  -58.470 -36.247 1.00 35.52  ? 565 HOH A O     1 
HETATM 9086 O  O     . HOH S 8 .   ? 7.246   -26.740 -39.542 1.00 47.54  ? 566 HOH A O     1 
HETATM 9087 O  O     . HOH S 8 .   ? 16.651  -39.693 -25.524 1.00 30.32  ? 567 HOH A O     1 
HETATM 9088 O  O     . HOH S 8 .   ? 30.088  -44.775 -20.281 1.00 32.09  ? 568 HOH A O     1 
HETATM 9089 O  O     . HOH S 8 .   ? 26.366  -46.184 -29.654 1.00 39.03  ? 569 HOH A O     1 
HETATM 9090 O  O     . HOH S 8 .   ? 28.451  -48.894 -32.291 1.00 29.60  ? 570 HOH A O     1 
HETATM 9091 O  O     . HOH S 8 .   ? 35.579  -53.947 -39.447 1.00 42.60  ? 571 HOH A O     1 
HETATM 9092 O  O     . HOH S 8 .   ? -9.895  -75.323 -35.036 1.00 36.26  ? 572 HOH A O     1 
HETATM 9093 O  O     . HOH S 8 .   ? 14.349  -45.406 -21.192 1.00 32.73  ? 573 HOH A O     1 
HETATM 9094 O  O     . HOH S 8 .   ? 11.355  -53.687 -20.650 1.00 33.82  ? 574 HOH A O     1 
HETATM 9095 O  O     . HOH S 8 .   ? -2.356  -72.163 -45.009 1.00 38.18  ? 575 HOH A O     1 
HETATM 9096 O  O     . HOH S 8 .   ? 4.907   -40.671 -53.810 1.00 31.35  ? 576 HOH A O     1 
HETATM 9097 O  O     . HOH S 8 .   ? 27.786  -52.174 -15.228 1.00 37.87  ? 577 HOH A O     1 
HETATM 9098 O  O     . HOH S 8 .   ? -2.881  -40.334 -34.854 1.00 27.59  ? 578 HOH A O     1 
HETATM 9099 O  O     . HOH S 8 .   ? -15.559 -50.859 -42.844 1.00 31.27  ? 579 HOH A O     1 
HETATM 9100 O  O     . HOH S 8 .   ? -0.323  -59.057 -46.974 1.00 32.82  ? 580 HOH A O     1 
HETATM 9101 O  O     . HOH S 8 .   ? 28.519  -57.796 -29.690 1.00 35.51  ? 581 HOH A O     1 
HETATM 9102 O  O     . HOH S 8 .   ? 10.278  -36.373 -29.775 1.00 30.89  ? 582 HOH A O     1 
HETATM 9103 O  O     . HOH S 8 .   ? -14.283 -72.825 -42.192 1.00 28.48  ? 583 HOH A O     1 
HETATM 9104 O  O     . HOH S 8 .   ? 3.018   -32.545 -44.277 1.00 38.02  ? 584 HOH A O     1 
HETATM 9105 O  O     . HOH S 8 .   ? 13.858  -37.113 -16.740 1.00 31.20  ? 585 HOH A O     1 
HETATM 9106 O  O     . HOH S 8 .   ? 8.209   -29.256 -38.928 1.00 28.86  ? 586 HOH A O     1 
HETATM 9107 O  O     . HOH S 8 .   ? 11.129  -35.741 -33.927 1.00 33.14  ? 587 HOH A O     1 
HETATM 9108 O  O     . HOH S 8 .   ? -2.465  -37.243 -46.509 1.00 35.36  ? 588 HOH A O     1 
HETATM 9109 O  O     . HOH S 8 .   ? 16.465  -47.819 -17.539 1.00 32.78  ? 589 HOH A O     1 
HETATM 9110 O  O     . HOH S 8 .   ? 26.961  -48.469 -18.815 1.00 28.85  ? 590 HOH A O     1 
HETATM 9111 O  O     . HOH S 8 .   ? 3.887   -72.719 -30.097 1.00 39.35  ? 591 HOH A O     1 
HETATM 9112 O  O     . HOH S 8 .   ? 32.239  -38.602 -3.409  1.00 26.38  ? 592 HOH A O     1 
HETATM 9113 O  O     . HOH S 8 .   ? 12.015  -30.070 4.799   1.00 31.32  ? 593 HOH A O     1 
HETATM 9114 O  O     . HOH S 8 .   ? 35.329  -43.869 -0.592  1.00 38.52  ? 594 HOH A O     1 
HETATM 9115 O  O     . HOH S 8 .   ? 16.199  -27.430 -29.732 1.00 32.07  ? 595 HOH A O     1 
HETATM 9116 O  O     . HOH S 8 .   ? 9.406   -65.430 -33.272 1.00 28.90  ? 596 HOH A O     1 
HETATM 9117 O  O     . HOH S 8 .   ? -1.033  -38.503 -48.119 1.00 41.00  ? 597 HOH A O     1 
HETATM 9118 O  O     . HOH S 8 .   ? 1.055   -75.895 -32.433 1.00 43.63  ? 598 HOH A O     1 
HETATM 9119 O  O     . HOH S 8 .   ? 16.755  -21.381 -6.273  1.00 38.62  ? 599 HOH A O     1 
HETATM 9120 O  O     . HOH S 8 .   ? -9.210  -51.794 -23.539 1.00 33.25  ? 600 HOH A O     1 
HETATM 9121 O  O     . HOH S 8 .   ? 30.617  -31.318 -2.641  1.00 37.01  ? 601 HOH A O     1 
HETATM 9122 O  O     . HOH S 8 .   ? -3.691  -46.250 -12.904 1.00 41.12  ? 602 HOH A O     1 
HETATM 9123 O  O     . HOH S 8 .   ? -11.490 -66.880 -28.141 1.00 34.88  ? 603 HOH A O     1 
HETATM 9124 O  O     . HOH S 8 .   ? 21.539  -58.000 -50.322 1.00 54.23  ? 604 HOH A O     1 
HETATM 9125 O  O     . HOH S 8 .   ? 11.330  -39.900 -52.378 1.00 41.21  ? 605 HOH A O     1 
HETATM 9126 O  O     . HOH S 8 .   ? 2.266   -51.664 -23.768 1.00 27.98  ? 606 HOH A O     1 
HETATM 9127 O  O     . HOH S 8 .   ? 23.093  -61.010 -35.181 1.00 37.63  ? 607 HOH A O     1 
HETATM 9128 O  O     . HOH S 8 .   ? 35.404  -50.496 -25.990 1.00 51.64  ? 608 HOH A O     1 
HETATM 9129 O  O     . HOH S 8 .   ? 4.048   -57.307 -29.380 1.00 43.17  ? 609 HOH A O     1 
HETATM 9130 O  O     . HOH S 8 .   ? 28.177  -54.445 -11.966 1.00 36.32  ? 610 HOH A O     1 
HETATM 9131 O  O     . HOH S 8 .   ? 20.203  -43.445 -26.594 1.00 43.37  ? 611 HOH A O     1 
HETATM 9132 O  O     . HOH S 8 .   ? 8.384   -44.535 -55.380 1.00 38.11  ? 612 HOH A O     1 
HETATM 9133 O  O     . HOH S 8 .   ? 26.009  -27.583 6.802   1.00 39.45  ? 613 HOH A O     1 
HETATM 9134 O  O     . HOH S 8 .   ? -6.676  -72.715 -45.631 1.00 46.15  ? 614 HOH A O     1 
HETATM 9135 O  O     . HOH S 8 .   ? -2.699  -37.682 -38.365 1.00 32.21  ? 615 HOH A O     1 
HETATM 9136 O  O     . HOH S 8 .   ? -7.171  -49.490 -41.806 1.00 23.67  ? 616 HOH A O     1 
HETATM 9137 O  O     . HOH S 8 .   ? 8.075   -50.240 -34.732 1.00 35.04  ? 617 HOH A O     1 
HETATM 9138 O  O     . HOH S 8 .   ? 7.272   -72.720 -37.390 1.00 34.27  ? 618 HOH A O     1 
HETATM 9139 O  O     . HOH S 8 .   ? -13.383 -66.958 -32.348 1.00 37.88  ? 619 HOH A O     1 
HETATM 9140 O  O     . HOH S 8 .   ? -6.458  -75.369 -38.684 1.00 45.02  ? 620 HOH A O     1 
HETATM 9141 O  O     . HOH S 8 .   ? 1.274   -45.040 -37.404 1.00 20.87  ? 621 HOH A O     1 
HETATM 9142 O  O     . HOH S 8 .   ? -9.998  -65.983 -21.419 1.00 55.40  ? 622 HOH A O     1 
HETATM 9143 O  O     . HOH S 8 .   ? 25.167  -41.546 3.591   1.00 55.94  ? 623 HOH A O     1 
HETATM 9144 O  O     . HOH S 8 .   ? 20.345  -39.713 -18.414 1.00 39.49  ? 624 HOH A O     1 
HETATM 9145 O  O     . HOH S 8 .   ? 15.251  -42.606 -24.078 1.00 45.49  ? 625 HOH A O     1 
HETATM 9146 O  O     . HOH S 8 .   ? 1.856   -37.417 -47.141 1.00 24.43  ? 626 HOH A O     1 
HETATM 9147 O  O     . HOH S 8 .   ? -17.640 -44.550 -36.649 1.00 45.67  ? 627 HOH A O     1 
HETATM 9148 O  O     . HOH S 8 .   ? 17.643  -40.961 -18.082 1.00 39.22  ? 628 HOH A O     1 
HETATM 9149 O  O     . HOH S 8 .   ? 17.457  -57.357 -50.467 1.00 41.93  ? 629 HOH A O     1 
HETATM 9150 O  O     . HOH S 8 .   ? -0.734  -42.590 -49.972 1.00 43.26  ? 630 HOH A O     1 
HETATM 9151 O  O     . HOH S 8 .   ? -3.159  -62.374 -20.577 1.00 37.74  ? 631 HOH A O     1 
HETATM 9152 O  O     . HOH S 8 .   ? 5.233   -51.203 0.265   1.00 46.48  ? 632 HOH A O     1 
HETATM 9153 O  O     . HOH S 8 .   ? -6.936  -42.634 -32.719 1.00 40.79  ? 633 HOH A O     1 
HETATM 9154 O  O     . HOH S 8 .   ? 10.356  -52.813 -16.982 1.00 50.76  ? 634 HOH A O     1 
HETATM 9155 O  O     . HOH S 8 .   ? 2.987   -66.690 -25.209 1.00 53.93  ? 635 HOH A O     1 
HETATM 9156 O  O     . HOH S 8 .   ? -3.138  -54.890 -20.488 1.00 37.77  ? 636 HOH A O     1 
HETATM 9157 O  O     . HOH S 8 .   ? 4.827   -53.791 -7.202  1.00 60.86  ? 637 HOH A O     1 
HETATM 9158 O  O     . HOH S 8 .   ? -2.054  -49.144 -15.634 1.00 44.43  ? 638 HOH A O     1 
HETATM 9159 O  O     . HOH S 8 .   ? 26.040  -51.146 -23.131 1.00 41.49  ? 639 HOH A O     1 
HETATM 9160 O  O     . HOH S 8 .   ? 25.807  -39.512 -1.632  1.00 48.56  ? 640 HOH A O     1 
HETATM 9161 O  O     . HOH S 8 .   ? 28.762  -50.505 -17.080 1.00 37.25  ? 641 HOH A O     1 
HETATM 9162 O  O     . HOH S 8 .   ? 5.596   -38.194 -47.339 1.00 17.56  ? 642 HOH A O     1 
HETATM 9163 O  O     . HOH S 8 .   ? -18.912 -49.237 -25.829 1.00 65.22  ? 643 HOH A O     1 
HETATM 9164 O  O     . HOH S 8 .   ? 3.210   -50.816 -5.884  1.00 43.34  ? 644 HOH A O     1 
HETATM 9165 O  O     . HOH S 8 .   ? 24.503  -51.956 -27.533 1.00 53.15  ? 645 HOH A O     1 
HETATM 9166 O  O     . HOH S 8 .   ? -2.633  -54.083 -46.204 1.00 28.78  ? 646 HOH A O     1 
HETATM 9167 O  O     . HOH S 8 .   ? -2.445  -68.828 -22.962 1.00 41.30  ? 647 HOH A O     1 
HETATM 9168 O  O     . HOH S 8 .   ? 3.062   -54.417 -23.193 1.00 49.70  ? 648 HOH A O     1 
HETATM 9169 O  O     . HOH S 8 .   ? 13.418  -32.377 -33.179 1.00 41.01  ? 649 HOH A O     1 
HETATM 9170 O  O     . HOH S 8 .   ? -6.472  -50.713 -20.827 1.00 41.50  ? 650 HOH A O     1 
HETATM 9171 O  O     . HOH S 8 .   ? 26.291  -41.272 -30.821 1.00 34.95  ? 651 HOH A O     1 
HETATM 9172 O  O     . HOH S 8 .   ? 25.071  -38.872 3.236   1.00 50.89  ? 652 HOH A O     1 
HETATM 9173 O  O     . HOH S 8 .   ? 22.323  -41.303 -18.303 1.00 34.79  ? 653 HOH A O     1 
HETATM 9174 O  O     . HOH S 8 .   ? 23.145  -52.365 -14.228 1.00 46.59  ? 654 HOH A O     1 
HETATM 9175 O  O     . HOH S 8 .   ? 14.613  -30.297 -15.982 1.00 43.01  ? 655 HOH A O     1 
HETATM 9176 O  O     . HOH S 8 .   ? 7.367   -37.831 -18.894 1.00 30.26  ? 656 HOH A O     1 
HETATM 9177 O  O     . HOH S 8 .   ? 1.357   -39.102 2.456   1.00 43.99  ? 657 HOH A O     1 
HETATM 9178 O  O     . HOH S 8 .   ? 16.010  -54.998 -7.685  1.00 48.31  ? 658 HOH A O     1 
HETATM 9179 O  O     . HOH S 8 .   ? 15.075  -26.034 3.837   1.00 39.70  ? 659 HOH A O     1 
HETATM 9180 O  O     . HOH S 8 .   ? 19.100  -22.750 -1.644  1.00 32.32  ? 660 HOH A O     1 
HETATM 9181 O  O     . HOH S 8 .   ? 14.986  -25.932 -11.647 1.00 44.84  ? 661 HOH A O     1 
HETATM 9182 O  O     . HOH S 8 .   ? 25.007  -54.836 -9.040  1.00 46.86  ? 662 HOH A O     1 
HETATM 9183 O  O     . HOH S 8 .   ? 15.792  -24.604 1.619   1.00 37.08  ? 663 HOH A O     1 
HETATM 9184 O  O     . HOH S 8 .   ? 17.123  -2.665  -6.456  1.00 45.41  ? 664 HOH A O     1 
HETATM 9185 O  O     . HOH S 8 .   ? 18.167  -1.530  -3.399  1.00 45.40  ? 665 HOH A O     1 
HETATM 9186 O  O     . HOH S 8 .   ? 27.044  -7.328  2.388   1.00 36.37  ? 666 HOH A O     1 
HETATM 9187 O  O     . HOH S 8 .   ? 21.040  -34.260 -46.115 1.00 39.25  ? 667 HOH A O     1 
HETATM 9188 O  O     . HOH S 8 .   ? 8.750   -38.836 -45.439 1.00 24.84  ? 668 HOH A O     1 
HETATM 9189 O  O     . HOH S 8 .   ? 5.758   -30.485 -42.178 1.00 51.58  ? 669 HOH A O     1 
HETATM 9190 O  O     . HOH S 8 .   ? -16.124 -53.591 -43.589 1.00 42.73  ? 670 HOH A O     1 
HETATM 9191 O  O     . HOH S 8 .   ? 25.123  -53.237 -49.277 1.00 46.68  ? 671 HOH A O     1 
HETATM 9192 O  O     . HOH S 8 .   ? 13.064  -63.067 -45.402 1.00 47.80  ? 672 HOH A O     1 
HETATM 9193 O  O     . HOH S 8 .   ? 20.408  -40.880 -51.751 1.00 31.67  ? 673 HOH A O     1 
HETATM 9194 O  O     . HOH S 8 .   ? 24.033  -31.284 -39.483 1.00 42.58  ? 674 HOH A O     1 
HETATM 9195 O  O     . HOH S 8 .   ? -6.586  -51.337 -46.259 1.00 31.24  ? 675 HOH A O     1 
HETATM 9196 O  O     . HOH S 8 .   ? 16.482  -27.355 -26.917 1.00 47.20  ? 676 HOH A O     1 
HETATM 9197 O  O     . HOH S 8 .   ? -12.379 -65.743 -25.929 1.00 40.10  ? 677 HOH A O     1 
HETATM 9198 O  O     . HOH S 8 .   ? 19.803  -38.593 -51.399 1.00 37.58  ? 678 HOH A O     1 
HETATM 9199 O  O     . HOH S 8 .   ? 3.221   -35.810 -48.430 1.00 31.05  ? 679 HOH A O     1 
HETATM 9200 O  O     . HOH S 8 .   ? 16.878  -29.531 -44.039 1.00 42.14  ? 680 HOH A O     1 
HETATM 9201 O  O     . HOH S 8 .   ? 25.821  -49.550 -50.655 1.00 37.60  ? 681 HOH A O     1 
HETATM 9202 O  O     . HOH S 8 .   ? 16.374  -48.073 -23.799 1.00 46.27  ? 682 HOH A O     1 
HETATM 9203 O  O     . HOH S 8 .   ? -15.151 -55.603 -42.370 1.00 35.37  ? 683 HOH A O     1 
HETATM 9204 O  O     . HOH S 8 .   ? -11.193 -42.163 -42.795 1.00 49.30  ? 684 HOH A O     1 
HETATM 9205 O  O     . HOH S 8 .   ? 2.681   -75.120 -41.098 1.00 31.91  ? 685 HOH A O     1 
HETATM 9206 O  O     . HOH S 8 .   ? 12.402  -25.103 -46.680 1.00 41.62  ? 686 HOH A O     1 
HETATM 9207 O  O     . HOH S 8 .   ? 25.952  -40.007 -26.682 1.00 44.42  ? 687 HOH A O     1 
HETATM 9208 O  O     . HOH S 8 .   ? 6.562   -37.791 -28.022 1.00 39.62  ? 688 HOH A O     1 
HETATM 9209 O  O     . HOH S 8 .   ? -0.041  -49.747 -9.959  1.00 48.55  ? 689 HOH A O     1 
HETATM 9210 O  O     . HOH S 8 .   ? -0.085  -36.501 1.169   1.00 41.68  ? 690 HOH A O     1 
HETATM 9211 O  O     . HOH S 8 .   ? 29.114  -47.137 1.493   1.00 42.19  ? 691 HOH A O     1 
HETATM 9212 O  O     . HOH S 8 .   ? 24.281  -53.613 -12.109 1.00 42.05  ? 692 HOH A O     1 
HETATM 9213 O  O     . HOH S 8 .   ? 28.536  -41.090 -21.109 1.00 46.97  ? 693 HOH A O     1 
HETATM 9214 O  O     . HOH S 8 .   ? 19.005  -37.132 7.813   1.00 40.70  ? 694 HOH A O     1 
HETATM 9215 O  O     . HOH S 8 .   ? 23.484  -14.451 16.935  1.00 49.32  ? 695 HOH A O     1 
HETATM 9216 O  O     . HOH S 8 .   ? 21.183  -43.728 -18.328 1.00 51.93  ? 696 HOH A O     1 
HETATM 9217 O  O     . HOH S 8 .   ? -15.340 -57.861 -41.564 1.00 41.85  ? 697 HOH A O     1 
HETATM 9218 O  O     . HOH S 8 .   ? 11.312  -51.949 -25.452 1.00 32.69  ? 698 HOH A O     1 
HETATM 9219 O  O     . HOH S 8 .   ? 23.356  -56.287 -35.933 1.00 46.70  ? 699 HOH A O     1 
HETATM 9220 O  O     . HOH S 8 .   ? 10.231  -30.152 0.241   1.00 43.13  ? 700 HOH A O     1 
HETATM 9221 O  O     . HOH S 8 .   ? 16.552  -23.615 -10.575 1.00 47.99  ? 702 HOH A O     1 
HETATM 9222 O  O     . HOH S 8 .   ? 14.384  -55.851 -34.115 1.00 45.23  ? 703 HOH A O     1 
HETATM 9223 O  O     . HOH S 8 .   ? -18.887 -45.223 -39.479 1.00 52.53  ? 704 HOH A O     1 
HETATM 9224 O  O     . HOH S 8 .   ? 13.465  -51.017 -55.041 1.00 54.05  ? 705 HOH A O     1 
HETATM 9225 O  O     . HOH S 8 .   ? 15.080  -54.319 -16.299 1.00 53.95  ? 706 HOH A O     1 
HETATM 9226 O  O     . HOH S 8 .   ? 25.048  -27.327 9.741   1.00 54.06  ? 707 HOH A O     1 
HETATM 9227 O  O     . HOH S 8 .   ? 33.848  -30.101 4.437   1.00 43.82  ? 708 HOH A O     1 
HETATM 9228 O  O     . HOH S 8 .   ? 14.913  -10.726 12.666  1.00 45.55  ? 709 HOH A O     1 
HETATM 9229 O  O     . HOH S 8 .   ? 18.853  -16.178 11.029  1.00 41.85  ? 710 HOH A O     1 
HETATM 9230 O  O     . HOH S 8 .   ? 16.911  -18.023 11.550  1.00 47.42  ? 711 HOH A O     1 
HETATM 9231 O  O     . HOH S 8 .   ? 15.170  -14.207 -1.518  1.00 38.85  ? 712 HOH A O     1 
HETATM 9232 O  O     . HOH S 8 .   ? 18.259  -31.729 8.977   1.00 43.64  ? 713 HOH A O     1 
HETATM 9233 O  O     . HOH S 8 .   ? 17.880  -56.112 -13.142 1.00 50.83  ? 714 HOH A O     1 
HETATM 9234 O  O     . HOH S 8 .   ? 20.262  -59.124 -36.257 1.00 36.30  ? 715 HOH A O     1 
HETATM 9235 O  O     . HOH S 8 .   ? 1.018   -78.811 -38.735 1.00 44.33  ? 716 HOH A O     1 
HETATM 9236 O  O     . HOH S 8 .   ? 1.342   -40.106 -50.763 1.00 36.98  ? 717 HOH A O     1 
HETATM 9237 O  O     . HOH S 8 .   ? 31.502  -40.436 -29.529 1.00 56.96  ? 718 HOH A O     1 
HETATM 9238 O  O     . HOH S 8 .   ? 34.096  -38.184 -43.045 1.00 47.09  ? 719 HOH A O     1 
HETATM 9239 O  O     . HOH S 8 .   ? 31.120  -29.882 3.359   1.00 42.44  ? 720 HOH A O     1 
HETATM 9240 O  O     . HOH S 8 .   ? 22.710  -29.312 -42.509 1.00 39.72  ? 721 HOH A O     1 
HETATM 9241 O  O     . HOH S 8 .   ? 32.798  -38.715 -46.907 1.00 52.41  ? 722 HOH A O     1 
HETATM 9242 O  O     . HOH S 8 .   ? 38.077  -46.612 -13.345 1.00 46.93  ? 723 HOH A O     1 
HETATM 9243 O  O     . HOH S 8 .   ? 9.129   -59.201 -37.852 1.00 45.15  ? 724 HOH A O     1 
HETATM 9244 O  O     . HOH S 8 .   ? 0.972   -46.685 -53.324 1.00 50.01  ? 725 HOH A O     1 
HETATM 9245 O  O     . HOH S 8 .   ? -20.582 -51.382 -28.057 1.00 40.10  ? 726 HOH A O     1 
HETATM 9246 O  O     . HOH S 8 .   ? 9.819   -28.448 -11.277 1.00 45.35  ? 727 HOH A O     1 
HETATM 9247 O  O     . HOH S 8 .   ? 0.707   -32.721 -38.329 1.00 39.22  ? 728 HOH A O     1 
HETATM 9248 O  O     . HOH S 8 .   ? 39.034  -47.750 -17.987 1.00 52.42  ? 729 HOH A O     1 
HETATM 9249 O  O     . HOH S 8 .   ? 36.295  -56.461 -44.692 1.00 60.80  ? 730 HOH A O     1 
HETATM 9250 O  O     . HOH S 8 .   ? 12.704  -25.763 -10.261 1.00 48.02  ? 731 HOH A O     1 
HETATM 9251 O  O     . HOH S 8 .   ? 5.838   -28.836 -37.293 1.00 46.72  ? 732 HOH A O     1 
HETATM 9252 O  O     . HOH S 8 .   ? 5.099   -26.799 -35.400 1.00 57.13  ? 733 HOH A O     1 
HETATM 9253 O  O     . HOH S 8 .   ? -15.964 -61.870 -39.699 1.00 30.07  ? 734 HOH A O     1 
HETATM 9254 O  O     . HOH S 8 .   ? -9.656  -57.759 -47.274 1.00 48.57  ? 735 HOH A O     1 
HETATM 9255 O  O     . HOH S 8 .   ? 10.863  -38.153 -28.113 1.00 31.02  ? 736 HOH A O     1 
HETATM 9256 O  O     . HOH S 8 .   ? 5.570   -63.222 -46.422 1.00 50.43  ? 737 HOH A O     1 
HETATM 9257 O  O     . HOH S 8 .   ? 21.940  -55.669 -31.593 1.00 33.51  ? 738 HOH A O     1 
HETATM 9258 O  O     . HOH S 8 .   ? 8.445   -59.390 -50.021 1.00 43.87  ? 739 HOH A O     1 
HETATM 9259 O  O     . HOH T 8 .   ? 52.093  -9.342  2.256   1.00 30.94  ? 442 HOH B O     1 
HETATM 9260 O  O     . HOH T 8 .   ? 21.980  -35.454 -19.158 1.00 20.66  ? 443 HOH B O     1 
HETATM 9261 O  O     . HOH T 8 .   ? 21.465  -36.666 -21.510 1.00 28.02  ? 444 HOH B O     1 
HETATM 9262 O  O     . HOH T 8 .   ? 36.795  -38.000 -22.806 1.00 23.76  ? 445 HOH B O     1 
HETATM 9263 O  O     . HOH T 8 .   ? 35.763  -36.879 -26.307 1.00 34.02  ? 446 HOH B O     1 
HETATM 9264 O  O     . HOH T 8 .   ? 28.753  0.757   0.327   1.00 51.19  ? 447 HOH B O     1 
HETATM 9265 O  O     . HOH T 8 .   ? 21.224  -17.650 -0.425  1.00 38.71  ? 448 HOH B O     1 
HETATM 9266 O  O     . HOH T 8 .   ? 36.851  -35.860 -24.134 1.00 25.36  ? 449 HOH B O     1 
HETATM 9267 O  O     . HOH T 8 .   ? 26.947  -34.254 -33.048 1.00 26.38  ? 450 HOH B O     1 
HETATM 9268 O  O     . HOH T 8 .   ? 36.867  -11.615 -10.122 1.00 29.55  ? 451 HOH B O     1 
HETATM 9269 O  O     . HOH T 8 .   ? 35.293  -32.706 -3.941  1.00 26.85  ? 452 HOH B O     1 
HETATM 9270 O  O     . HOH T 8 .   ? 34.270  -4.122  5.860   1.00 35.68  ? 453 HOH B O     1 
HETATM 9271 O  O     . HOH T 8 .   ? 34.529  -22.578 8.312   1.00 33.07  ? 454 HOH B O     1 
HETATM 9272 O  O     . HOH T 8 .   ? 25.046  -39.135 -24.690 1.00 33.41  ? 455 HOH B O     1 
HETATM 9273 O  O     . HOH T 8 .   ? 32.188  -24.123 -10.918 1.00 35.89  ? 456 HOH B O     1 
HETATM 9274 O  O     . HOH T 8 .   ? 33.993  -5.024  -1.611  1.00 32.62  ? 457 HOH B O     1 
HETATM 9275 O  O     . HOH T 8 .   ? 35.821  1.823   3.043   1.00 34.03  ? 458 HOH B O     1 
HETATM 9276 O  O     . HOH T 8 .   ? 45.637  10.657  4.525   1.00 47.93  ? 459 HOH B O     1 
HETATM 9277 O  O     . HOH T 8 .   ? 32.257  1.738   3.805   1.00 53.41  ? 460 HOH B O     1 
HETATM 9278 O  O     . HOH T 8 .   ? 28.293  -19.218 -6.377  1.00 23.55  ? 461 HOH B O     1 
HETATM 9279 O  O     . HOH T 8 .   ? 39.405  -37.438 -27.111 1.00 38.96  ? 462 HOH B O     1 
HETATM 9280 O  O     . HOH T 8 .   ? 26.979  -24.905 -31.367 1.00 29.49  ? 463 HOH B O     1 
HETATM 9281 O  O     . HOH T 8 .   ? 37.115  -35.554 -31.994 1.00 30.44  ? 464 HOH B O     1 
HETATM 9282 O  O     . HOH T 8 .   ? 30.848  -24.215 9.448   1.00 31.15  ? 465 HOH B O     1 
HETATM 9283 O  O     . HOH T 8 .   ? 19.914  30.765  2.118   1.00 51.12  ? 466 HOH B O     1 
HETATM 9284 O  O     . HOH T 8 .   ? 34.335  -24.002 -9.190  1.00 30.68  ? 467 HOH B O     1 
HETATM 9285 O  O     . HOH T 8 .   ? 28.952  -26.409 2.910   1.00 37.62  ? 468 HOH B O     1 
HETATM 9286 O  O     . HOH T 8 .   ? 32.718  -7.469  -1.846  1.00 34.25  ? 469 HOH B O     1 
HETATM 9287 O  O     . HOH T 8 .   ? 33.852  -35.389 -20.359 1.00 26.15  ? 470 HOH B O     1 
HETATM 9288 O  O     . HOH T 8 .   ? 20.373  -29.008 -21.109 1.00 30.81  ? 471 HOH B O     1 
HETATM 9289 O  O     . HOH T 8 .   ? 25.668  -27.238 -16.518 1.00 31.16  ? 472 HOH B O     1 
HETATM 9290 O  O     . HOH T 8 .   ? 36.371  -1.251  -7.095  1.00 42.64  ? 473 HOH B O     1 
HETATM 9291 O  O     . HOH T 8 .   ? 42.939  -36.775 -28.117 1.00 37.91  ? 474 HOH B O     1 
HETATM 9292 O  O     . HOH T 8 .   ? 47.281  -21.383 -9.357  1.00 44.54  ? 475 HOH B O     1 
HETATM 9293 O  O     . HOH T 8 .   ? 26.008  -21.560 -7.699  1.00 53.31  ? 476 HOH B O     1 
HETATM 9294 O  O     . HOH T 8 .   ? 21.140  -19.566 -1.939  1.00 48.49  ? 477 HOH B O     1 
HETATM 9295 O  O     . HOH T 8 .   ? 30.839  -27.270 19.452  1.00 47.88  ? 478 HOH B O     1 
HETATM 9296 O  O     . HOH T 8 .   ? 20.492  -27.591 -28.186 1.00 26.41  ? 479 HOH B O     1 
HETATM 9297 O  O     . HOH T 8 .   ? 41.211  -38.431 -25.550 1.00 37.00  ? 480 HOH B O     1 
HETATM 9298 O  O     . HOH T 8 .   ? 37.461  -2.547  8.811   1.00 41.68  ? 481 HOH B O     1 
HETATM 9299 O  O     . HOH T 8 .   ? 35.220  10.473  10.651  1.00 54.00  ? 482 HOH B O     1 
HETATM 9300 O  O     . HOH T 8 .   ? 28.699  1.470   3.064   1.00 33.69  ? 483 HOH B O     1 
HETATM 9301 O  O     . HOH T 8 .   ? 21.613  -28.585 -23.563 1.00 28.00  ? 484 HOH B O     1 
HETATM 9302 O  O     . HOH T 8 .   ? 36.202  -24.157 -12.970 1.00 47.91  ? 485 HOH B O     1 
HETATM 9303 O  O     . HOH T 8 .   ? 48.369  -19.832 3.613   1.00 44.07  ? 486 HOH B O     1 
HETATM 9304 O  O     . HOH T 8 .   ? 46.379  3.358   6.322   1.00 35.92  ? 487 HOH B O     1 
HETATM 9305 O  O     . HOH T 8 .   ? 45.042  -23.522 -4.692  1.00 30.03  ? 488 HOH B O     1 
HETATM 9306 O  O     . HOH T 8 .   ? 49.824  6.858   0.591   1.00 36.02  ? 489 HOH B O     1 
HETATM 9307 O  O     . HOH T 8 .   ? 44.314  -3.452  -9.563  1.00 37.98  ? 490 HOH B O     1 
HETATM 9308 O  O     . HOH T 8 .   ? 39.307  -31.292 -17.013 1.00 46.15  ? 491 HOH B O     1 
HETATM 9309 O  O     . HOH T 8 .   ? 39.851  7.103   4.873   1.00 37.67  ? 492 HOH B O     1 
HETATM 9310 O  O     . HOH T 8 .   ? 20.505  -30.502 -17.059 1.00 32.02  ? 493 HOH B O     1 
HETATM 9311 O  O     . HOH T 8 .   ? 37.305  -29.564 -36.259 1.00 34.84  ? 494 HOH B O     1 
HETATM 9312 O  O     . HOH T 8 .   ? 31.756  -33.955 -35.443 1.00 28.89  ? 495 HOH B O     1 
HETATM 9313 O  O     . HOH T 8 .   ? 38.797  7.819   9.443   1.00 38.73  ? 496 HOH B O     1 
HETATM 9314 O  O     . HOH T 8 .   ? 40.102  -1.329  9.180   1.00 29.72  ? 497 HOH B O     1 
HETATM 9315 O  O     . HOH T 8 .   ? 31.326  -32.077 1.426   1.00 38.34  ? 498 HOH B O     1 
HETATM 9316 O  O     . HOH T 8 .   ? 35.645  1.039   5.687   1.00 36.03  ? 499 HOH B O     1 
HETATM 9317 O  O     . HOH T 8 .   ? 52.466  -2.883  -1.535  1.00 31.59  ? 500 HOH B O     1 
HETATM 9318 O  O     . HOH T 8 .   ? 32.384  -33.030 -2.021  1.00 45.98  ? 501 HOH B O     1 
HETATM 9319 O  O     . HOH T 8 .   ? 20.431  -24.332 -27.504 1.00 46.39  ? 503 HOH B O     1 
HETATM 9320 O  O     . HOH T 8 .   ? 27.379  -31.694 -41.623 1.00 63.23  ? 504 HOH B O     1 
HETATM 9321 O  O     . HOH T 8 .   ? 43.223  -22.883 12.215  1.00 47.32  ? 505 HOH B O     1 
HETATM 9322 O  O     . HOH T 8 .   ? 40.861  -40.664 -28.191 1.00 59.57  ? 506 HOH B O     1 
HETATM 9323 O  O     . HOH T 8 .   ? 11.250  22.099  0.917   1.00 55.92  ? 507 HOH B O     1 
HETATM 9324 O  O     . HOH T 8 .   ? 52.297  -14.931 -3.219  1.00 44.51  ? 508 HOH B O     1 
HETATM 9325 O  O     . HOH T 8 .   ? 27.123  3.678   -2.823  1.00 40.05  ? 509 HOH B O     1 
HETATM 9326 O  O     . HOH T 8 .   ? 42.322  5.069   10.698  1.00 56.51  ? 510 HOH B O     1 
HETATM 9327 O  O     . HOH T 8 .   ? 34.434  16.626  7.960   1.00 51.96  ? 511 HOH B O     1 
HETATM 9328 O  O     . HOH T 8 .   ? 42.787  -18.819 -10.725 1.00 46.82  ? 512 HOH B O     1 
HETATM 9329 O  O     . HOH T 8 .   ? 28.395  -13.215 5.963   1.00 42.22  ? 513 HOH B O     1 
HETATM 9330 O  O     . HOH T 8 .   ? 52.580  12.324  1.623   1.00 45.45  ? 514 HOH B O     1 
HETATM 9331 O  O     . HOH T 8 .   ? 53.896  -4.633  1.388   1.00 47.25  ? 515 HOH B O     1 
HETATM 9332 O  O     . HOH T 8 .   ? 20.997  -26.275 -24.715 1.00 38.93  ? 516 HOH B O     1 
HETATM 9333 O  O     . HOH T 8 .   ? 44.350  -21.435 8.933   1.00 37.51  ? 517 HOH B O     1 
HETATM 9334 O  O     . HOH T 8 .   ? 26.348  -17.220 -5.843  1.00 44.05  ? 518 HOH B O     1 
HETATM 9335 O  O     . HOH T 8 .   ? 37.357  -18.002 -12.275 1.00 43.83  ? 519 HOH B O     1 
HETATM 9336 O  O     . HOH T 8 .   ? 22.389  -20.828 15.502  1.00 53.05  ? 520 HOH B O     1 
HETATM 9337 O  O     . HOH T 8 .   ? 48.304  17.587  -6.630  1.00 47.29  ? 521 HOH B O     1 
HETATM 9338 O  O     . HOH T 8 .   ? 26.478  1.259   -0.754  1.00 33.18  ? 522 HOH B O     1 
HETATM 9339 O  O     . HOH T 8 .   ? 25.417  -16.947 -1.466  1.00 40.50  ? 523 HOH B O     1 
HETATM 9340 O  O     . HOH T 8 .   ? 40.589  7.640   7.398   1.00 36.08  ? 524 HOH B O     1 
HETATM 9341 O  O     . HOH T 8 .   ? 39.537  -25.423 -11.513 1.00 40.21  ? 525 HOH B O     1 
HETATM 9342 O  O     . HOH T 8 .   ? 47.349  -22.238 -5.748  1.00 40.15  ? 526 HOH B O     1 
HETATM 9343 O  O     . HOH T 8 .   ? 29.450  -8.142  1.235   1.00 39.18  ? 527 HOH B O     1 
HETATM 9344 O  O     . HOH T 8 .   ? 43.618  -31.795 -27.245 1.00 55.00  ? 528 HOH B O     1 
HETATM 9345 O  O     . HOH T 8 .   ? 41.365  -27.857 -3.122  1.00 38.05  ? 529 HOH B O     1 
HETATM 9346 O  O     . HOH T 8 .   ? 43.245  -31.944 -24.453 1.00 35.56  ? 530 HOH B O     1 
HETATM 9347 O  O     . HOH T 8 .   ? 29.274  13.396  3.206   1.00 39.97  ? 531 HOH B O     1 
HETATM 9348 O  O     . HOH T 8 .   ? 19.189  -26.438 -36.408 1.00 45.94  ? 532 HOH B O     1 
HETATM 9349 O  O     . HOH T 8 .   ? 17.177  -24.631 -35.014 1.00 38.25  ? 533 HOH B O     1 
HETATM 9350 O  O     . HOH T 8 .   ? 14.941  -25.353 -33.405 1.00 49.10  ? 534 HOH B O     1 
HETATM 9351 O  O     . HOH T 8 .   ? 25.549  -12.932 -2.156  1.00 45.88  ? 535 HOH B O     1 
HETATM 9352 O  O     . HOH T 8 .   ? 30.171  -6.049  5.224   1.00 50.07  ? 536 HOH B O     1 
HETATM 9353 O  O     . HOH T 8 .   ? 30.771  2.071   5.711   1.00 44.47  ? 537 HOH B O     1 
HETATM 9354 O  O     . HOH T 8 .   ? 45.903  7.821   6.839   1.00 48.32  ? 538 HOH B O     1 
HETATM 9355 O  O     . HOH T 8 .   ? 38.914  -33.971 -17.137 1.00 37.27  ? 539 HOH B O     1 
HETATM 9356 O  O     . HOH T 8 .   ? 39.340  -16.370 -12.485 1.00 39.41  ? 540 HOH B O     1 
HETATM 9357 O  O     . HOH T 8 .   ? 45.352  -13.739 -15.052 1.00 54.63  ? 541 HOH B O     1 
HETATM 9358 O  O     . HOH T 8 .   ? 40.964  -31.740 -20.131 1.00 51.79  ? 542 HOH B O     1 
HETATM 9359 O  O     . HOH T 8 .   ? 41.957  15.345  -6.420  1.00 58.62  ? 543 HOH B O     1 
HETATM 9360 O  O     . HOH T 8 .   ? 48.684  9.296   -3.114  1.00 43.07  ? 544 HOH B O     1 
HETATM 9361 O  O     . HOH T 8 .   ? 21.910  -24.517 -22.529 1.00 54.65  ? 545 HOH B O     1 
HETATM 9362 O  O     . HOH T 8 .   ? 19.585  -24.749 -33.514 1.00 46.67  ? 546 HOH B O     1 
HETATM 9363 O  O     . HOH T 8 .   ? 28.520  -28.896 -39.952 1.00 45.71  ? 547 HOH B O     1 
HETATM 9364 O  O     . HOH T 8 .   ? 28.819  -34.065 -44.032 1.00 47.94  ? 548 HOH B O     1 
HETATM 9365 O  O     . HOH T 8 .   ? 49.920  -19.050 -0.406  1.00 47.06  ? 549 HOH B O     1 
HETATM 9366 O  O     . HOH T 8 .   ? 49.727  15.891  6.221   1.00 53.25  ? 550 HOH B O     1 
HETATM 9367 O  O     . HOH T 8 .   ? 48.703  13.735  9.024   1.00 58.75  ? 551 HOH B O     1 
HETATM 9368 O  O     . HOH T 8 .   ? 34.124  -6.295  1.601   1.00 35.73  ? 552 HOH B O     1 
HETATM 9369 O  O     . HOH T 8 .   ? 22.423  -1.786  9.419   1.00 55.50  ? 553 HOH B O     1 
HETATM 9370 O  O     . HOH T 8 .   ? 46.987  11.057  -5.907  1.00 49.63  ? 554 HOH B O     1 
HETATM 9371 O  O     . HOH T 8 .   ? 39.503  -0.582  12.064  1.00 51.22  ? 555 HOH B O     1 
HETATM 9372 O  O     . HOH T 8 .   ? 51.289  12.512  -2.939  1.00 53.61  ? 556 HOH B O     1 
HETATM 9373 O  O     . HOH T 8 .   ? 50.453  23.974  -12.077 1.00 68.96  ? 557 HOH B O     1 
HETATM 9374 O  O     . HOH T 8 .   ? 30.977  -7.856  -3.723  1.00 43.01  ? 558 HOH B O     1 
HETATM 9375 O  O     . HOH T 8 .   ? 30.196  -7.989  -6.474  1.00 50.32  ? 559 HOH B O     1 
HETATM 9376 O  O     . HOH T 8 .   ? 30.427  5.960   -1.269  1.00 41.86  ? 560 HOH B O     1 
HETATM 9377 O  O     . HOH T 8 .   ? 26.504  -7.994  14.748  1.00 50.43  ? 561 HOH B O     1 
HETATM 9378 O  O     . HOH T 8 .   ? 32.000  -23.869 -22.839 1.00 40.60  ? 562 HOH B O     1 
HETATM 9379 O  O     . HOH T 8 .   ? 41.978  -30.817 -13.768 1.00 47.36  ? 563 HOH B O     1 
HETATM 9380 O  O     . HOH T 8 .   ? 36.193  -25.177 3.141   1.00 35.33  ? 564 HOH B O     1 
HETATM 9381 O  O     . HOH U 8 .   ? 7.459   -34.775 -17.453 1.00 33.14  ? 36  HOH C O     1 
HETATM 9382 O  O     . HOH U 8 .   ? 2.365   -36.889 -35.752 1.00 21.77  ? 37  HOH C O     1 
HETATM 9383 O  O     . HOH U 8 .   ? 7.440   -41.940 -33.570 1.00 21.22  ? 38  HOH C O     1 
HETATM 9384 O  O     . HOH U 8 .   ? 2.000   -45.710 -31.315 1.00 22.72  ? 39  HOH C O     1 
HETATM 9385 O  O     . HOH U 8 .   ? 8.461   -48.859 -32.377 1.00 27.38  ? 50  HOH C O     1 
HETATM 9386 O  O     . HOH U 8 .   ? -1.376  -43.995 -30.010 1.00 22.42  ? 64  HOH C O     1 
HETATM 9387 O  O     . HOH U 8 .   ? 4.611   -37.116 -26.015 1.00 29.20  ? 91  HOH C O     1 
HETATM 9388 O  O     . HOH U 8 .   ? -4.972  -40.450 -28.366 1.00 41.32  ? 130 HOH C O     1 
HETATM 9389 O  O     . HOH U 8 .   ? 1.180   -44.373 -34.735 1.00 22.14  ? 140 HOH C O     1 
HETATM 9390 O  O     . HOH U 8 .   ? -0.487  -42.451 -31.676 1.00 35.84  ? 157 HOH C O     1 
HETATM 9391 O  O     . HOH U 8 .   ? -3.241  -38.431 -19.443 1.00 48.32  ? 159 HOH C O     1 
HETATM 9392 O  O     . HOH U 8 .   ? -5.619  -41.316 -21.252 1.00 38.86  ? 167 HOH C O     1 
HETATM 9393 O  O     . HOH U 8 .   ? 0.622   -26.394 -1.185  1.00 59.44  ? 181 HOH C O     1 
HETATM 9394 O  O     . HOH U 8 .   ? 4.892   -26.064 -9.946  1.00 34.48  ? 194 HOH C O     1 
HETATM 9395 O  O     . HOH U 8 .   ? 6.085   -55.072 -31.815 1.00 45.03  ? 195 HOH C O     1 
HETATM 9396 O  O     . HOH U 8 .   ? 1.207   -35.148 -15.288 1.00 33.30  ? 196 HOH C O     1 
HETATM 9397 O  O     . HOH U 8 .   ? 2.973   -35.647 -28.701 1.00 29.30  ? 204 HOH C O     1 
HETATM 9398 O  O     . HOH U 8 .   ? -8.098  -26.577 -6.143  1.00 48.59  ? 210 HOH C O     1 
HETATM 9399 O  O     . HOH U 8 .   ? -3.409  -39.376 -31.215 1.00 30.53  ? 224 HOH C O     1 
HETATM 9400 O  O     . HOH U 8 .   ? 2.601   -52.410 -42.074 1.00 24.41  ? 233 HOH C O     1 
HETATM 9401 O  O     . HOH U 8 .   ? 7.559   -52.403 -27.671 1.00 37.23  ? 244 HOH C O     1 
HETATM 9402 O  O     . HOH U 8 .   ? 7.805   -51.215 -30.390 1.00 41.62  ? 265 HOH C O     1 
HETATM 9403 O  O     . HOH U 8 .   ? -0.980  -37.488 -36.607 1.00 33.78  ? 270 HOH C O     1 
HETATM 9404 O  O     . HOH U 8 .   ? 2.984   -29.581 -2.123  1.00 49.83  ? 277 HOH C O     1 
HETATM 9405 O  O     . HOH U 8 .   ? -1.653  -18.653 -6.870  1.00 45.87  ? 278 HOH C O     1 
HETATM 9406 O  O     . HOH U 8 .   ? 4.780   -23.559 -0.465  1.00 50.56  ? 283 HOH C O     1 
HETATM 9407 O  O     . HOH U 8 .   ? -9.184  -31.052 -16.288 1.00 44.34  ? 284 HOH C O     1 
HETATM 9408 O  O     . HOH U 8 .   ? -5.982  -25.808 -4.576  1.00 43.59  ? 301 HOH C O     1 
HETATM 9409 O  O     . HOH U 8 .   ? -1.920  -30.662 -10.556 1.00 50.67  ? 302 HOH C O     1 
HETATM 9410 O  O     . HOH U 8 .   ? -4.471  -43.499 -23.874 1.00 33.08  ? 305 HOH C O     1 
HETATM 9411 O  O     . HOH U 8 .   ? 7.249   -23.283 -2.070  1.00 44.82  ? 306 HOH C O     1 
HETATM 9412 O  O     . HOH U 8 .   ? -13.893 -24.322 -11.942 1.00 57.82  ? 308 HOH C O     1 
HETATM 9413 O  O     . HOH U 8 .   ? -1.352  -27.377 -3.580  1.00 48.33  ? 310 HOH C O     1 
HETATM 9414 O  O     . HOH U 8 .   ? -10.432 -21.764 -1.438  1.00 50.50  ? 311 HOH C O     1 
HETATM 9415 O  O     . HOH U 8 .   ? -3.721  -26.695 -17.576 1.00 53.67  ? 312 HOH C O     1 
HETATM 9416 O  O     . HOH U 8 .   ? 13.263  -12.429 -4.140  1.00 54.62  ? 359 HOH C O     1 
HETATM 9417 O  O     . HOH U 8 .   ? 10.750  -52.028 -32.276 1.00 39.12  ? 376 HOH C O     1 
HETATM 9418 O  O     . HOH U 8 .   ? 0.026   -35.506 -18.873 1.00 40.67  ? 438 HOH C O     1 
HETATM 9419 O  O     . HOH U 8 .   ? -4.869  -38.637 -22.720 1.00 52.47  ? 455 HOH C O     1 
HETATM 9420 O  O     . HOH U 8 .   ? -6.682  -38.187 -26.101 1.00 44.36  ? 469 HOH C O     1 
HETATM 9421 O  O     . HOH U 8 .   ? 8.222   -56.053 -33.519 1.00 40.38  ? 478 HOH C O     1 
HETATM 9422 O  O     . HOH U 8 .   ? -4.685  -44.952 -21.663 1.00 52.92  ? 480 HOH C O     1 
HETATM 9423 O  O     . HOH U 8 .   ? -5.180  -44.399 -18.463 1.00 58.93  ? 481 HOH C O     1 
HETATM 9424 O  O     . HOH U 8 .   ? 9.815   -51.195 -34.733 1.00 40.56  ? 485 HOH C O     1 
HETATM 9425 O  O     . HOH V 8 .   ? 45.439  9.510   -4.035  1.00 33.19  ? 45  HOH D O     1 
HETATM 9426 O  O     . HOH V 8 .   ? 42.023  5.931   -3.271  1.00 31.95  ? 78  HOH D O     1 
HETATM 9427 O  O     . HOH V 8 .   ? 37.997  15.600  -0.355  1.00 38.68  ? 93  HOH D O     1 
HETATM 9428 O  O     . HOH V 8 .   ? 45.780  -10.350 -19.393 1.00 42.87  ? 129 HOH D O     1 
HETATM 9429 O  O     . HOH V 8 .   ? 31.175  13.643  0.224   1.00 42.26  ? 215 HOH D O     1 
HETATM 9430 O  O     . HOH V 8 .   ? 45.119  11.188  3.011   1.00 46.96  ? 229 HOH D O     1 
HETATM 9431 O  O     . HOH V 8 .   ? 37.127  16.285  -4.735  1.00 49.18  ? 293 HOH D O     1 
HETATM 9432 O  O     . HOH V 8 .   ? 28.901  -23.385 -29.896 1.00 42.21  ? 298 HOH D O     1 
HETATM 9433 O  O     . HOH V 8 .   ? 30.059  16.224  -7.046  1.00 47.60  ? 315 HOH D O     1 
HETATM 9434 O  O     . HOH V 8 .   ? 41.028  14.961  -9.895  1.00 59.17  ? 363 HOH D O     1 
HETATM 9435 O  O     . HOH V 8 .   ? 39.709  15.646  -4.118  1.00 43.49  ? 373 HOH D O     1 
HETATM 9436 O  O     . HOH V 8 .   ? 40.363  -27.964 -23.024 1.00 42.45  ? 444 HOH D O     1 
HETATM 9437 O  O     . HOH V 8 .   ? 43.973  6.559   -10.364 1.00 46.48  ? 472 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.6997 1.0630 0.8867 0.0745  0.1016  -0.0741 1   MET A N     
2    C CA    . MET A 1   ? 0.6910 1.0654 0.8833 0.0629  0.0984  -0.0637 1   MET A CA    
3    C C     . MET A 1   ? 0.6761 1.0451 0.8458 0.0501  0.1021  -0.0592 1   MET A C     
4    O O     . MET A 1   ? 0.6702 1.0345 0.8353 0.0403  0.0956  -0.0506 1   MET A O     
5    C CB    . MET A 1   ? 0.6912 1.0967 0.9102 0.0645  0.1039  -0.0633 1   MET A CB    
6    C CG    . MET A 1   ? 0.7063 1.1184 0.9511 0.0760  0.0975  -0.0652 1   MET A CG    
7    S SD    . MET A 1   ? 0.7159 1.1670 0.9955 0.0779  0.1032  -0.0641 1   MET A SD    
8    C CE    . MET A 1   ? 0.7162 1.1701 0.9985 0.0628  0.0927  -0.0503 1   MET A CE    
9    N N     . LYS A 2   ? 0.6695 1.0384 0.8247 0.0502  0.1121  -0.0651 2   LYS A N     
10   C CA    . LYS A 2   ? 0.6562 1.0160 0.7878 0.0389  0.1141  -0.0608 2   LYS A CA    
11   C C     . LYS A 2   ? 0.6382 0.9689 0.7491 0.0393  0.1067  -0.0613 2   LYS A C     
12   O O     . LYS A 2   ? 0.6343 0.9536 0.7459 0.0489  0.1038  -0.0675 2   LYS A O     
13   C CB    . LYS A 2   ? 0.6711 1.0443 0.7947 0.0372  0.1277  -0.0656 2   LYS A CB    
14   C CG    . LYS A 2   ? 0.6856 1.0556 0.7897 0.0234  0.1298  -0.0585 2   LYS A CG    
15   C CD    . LYS A 2   ? 0.6926 1.0667 0.8044 0.0132  0.1229  -0.0476 2   LYS A CD    
16   C CE    . LYS A 2   ? 0.6937 1.0531 0.7833 0.0012  0.1199  -0.0405 2   LYS A CE    
17   N NZ    . LYS A 2   ? 0.6758 1.0256 0.7686 -0.0046 0.1084  -0.0325 2   LYS A NZ    
18   N N     . VAL A 3   ? 0.6196 0.9386 0.7131 0.0290  0.1034  -0.0548 3   VAL A N     
19   C CA    . VAL A 3   ? 0.6013 0.8946 0.6767 0.0283  0.0959  -0.0540 3   VAL A CA    
20   C C     . VAL A 3   ? 0.5993 0.8806 0.6663 0.0370  0.0976  -0.0628 3   VAL A C     
21   O O     . VAL A 3   ? 0.5952 0.8604 0.6608 0.0416  0.0900  -0.0637 3   VAL A O     
22   C CB    . VAL A 3   ? 0.6032 0.8870 0.6584 0.0172  0.0953  -0.0480 3   VAL A CB    
23   C CG1   . VAL A 3   ? 0.5947 0.8686 0.6494 0.0112  0.0856  -0.0399 3   VAL A CG1   
24   C CG2   . VAL A 3   ? 0.6042 0.9045 0.6568 0.0101  0.1045  -0.0463 3   VAL A CG2   
25   N N     . GLU A 4   ? 0.5986 0.8876 0.6592 0.0388  0.1073  -0.0692 4   GLU A N     
26   C CA    . GLU A 4   ? 0.5980 0.8747 0.6479 0.0461  0.1091  -0.0783 4   GLU A CA    
27   C C     . GLU A 4   ? 0.5814 0.8534 0.6459 0.0578  0.1048  -0.0841 4   GLU A C     
28   O O     . GLU A 4   ? 0.5800 0.8326 0.6358 0.0618  0.0993  -0.0874 4   GLU A O     
29   C CB    . GLU A 4   ? 0.6212 0.9097 0.6628 0.0464  0.1212  -0.0849 4   GLU A CB    
30   C CG    . GLU A 4   ? 0.6534 0.9490 0.6820 0.0342  0.1260  -0.0783 4   GLU A CG    
31   C CD    . GLU A 4   ? 0.6833 1.0030 0.7288 0.0293  0.1308  -0.0726 4   GLU A CD    
32   O OE1   . GLU A 4   ? 0.7110 1.0491 0.7753 0.0363  0.1366  -0.0774 4   GLU A OE1   
33   O OE2   . GLU A 4   ? 0.6981 1.0183 0.7384 0.0185  0.1284  -0.0634 4   GLU A OE2   
34   N N     . GLU A 5   ? 0.5576 0.8471 0.6447 0.0630  0.1066  -0.0847 5   GLU A N     
35   C CA    . GLU A 5   ? 0.5426 0.8285 0.6460 0.0744  0.1016  -0.0891 5   GLU A CA    
36   C C     . GLU A 5   ? 0.5095 0.7812 0.6163 0.0728  0.0888  -0.0816 5   GLU A C     
37   O O     . GLU A 5   ? 0.5065 0.7649 0.6172 0.0803  0.0824  -0.0845 5   GLU A O     
38   C CB    . GLU A 5   ? 0.5421 0.8528 0.6700 0.0809  0.1074  -0.0920 5   GLU A CB    
39   C CG    . GLU A 5   ? 0.5725 0.8977 0.7001 0.0861  0.1206  -0.1019 5   GLU A CG    
40   C CD    . GLU A 5   ? 0.5738 0.9285 0.7272 0.0902  0.1276  -0.1028 5   GLU A CD    
41   O OE1   . GLU A 5   ? 0.5693 0.9333 0.7400 0.0876  0.1216  -0.0950 5   GLU A OE1   
42   O OE2   . GLU A 5   ? 0.6071 0.9762 0.7632 0.0960  0.1392  -0.1116 5   GLU A OE2   
43   N N     . ILE A 6   ? 0.4748 0.7493 0.5801 0.0630  0.0852  -0.0722 6   ILE A N     
44   C CA    . ILE A 6   ? 0.4510 0.7106 0.5540 0.0597  0.0739  -0.0649 6   ILE A CA    
45   C C     . ILE A 6   ? 0.4409 0.6771 0.5244 0.0592  0.0703  -0.0665 6   ILE A C     
46   O O     . ILE A 6   ? 0.4379 0.6600 0.5226 0.0633  0.0628  -0.0663 6   ILE A O     
47   C CB    . ILE A 6   ? 0.4410 0.7056 0.5411 0.0483  0.0716  -0.0555 6   ILE A CB    
48   C CG1   . ILE A 6   ? 0.4396 0.7286 0.5577 0.0465  0.0758  -0.0532 6   ILE A CG1   
49   C CG2   . ILE A 6   ? 0.4271 0.6759 0.5234 0.0455  0.0606  -0.0490 6   ILE A CG2   
50   C CD1   . ILE A 6   ? 0.4348 0.7316 0.5744 0.0514  0.0693  -0.0511 6   ILE A CD1   
51   N N     . LEU A 7   ? 0.4304 0.6632 0.4965 0.0536  0.0753  -0.0675 7   LEU A N     
52   C CA    . LEU A 7   ? 0.4269 0.6393 0.4749 0.0519  0.0717  -0.0683 7   LEU A CA    
53   C C     . LEU A 7   ? 0.4404 0.6420 0.4878 0.0609  0.0709  -0.0766 7   LEU A C     
54   O O     . LEU A 7   ? 0.4439 0.6279 0.4840 0.0611  0.0642  -0.0759 7   LEU A O     
55   C CB    . LEU A 7   ? 0.4221 0.6341 0.4524 0.0441  0.0766  -0.0673 7   LEU A CB    
56   C CG    . LEU A 7   ? 0.3936 0.6114 0.4216 0.0344  0.0758  -0.0585 7   LEU A CG    
57   C CD1   . LEU A 7   ? 0.3777 0.5936 0.3879 0.0273  0.0802  -0.0575 7   LEU A CD1   
58   C CD2   . LEU A 7   ? 0.3696 0.5761 0.3977 0.0315  0.0665  -0.0517 7   LEU A CD2   
59   N N     . GLU A 8   ? 0.4522 0.6644 0.5078 0.0682  0.0776  -0.0846 8   GLU A N     
60   C CA    . GLU A 8   ? 0.4690 0.6714 0.5270 0.0781  0.0766  -0.0934 8   GLU A CA    
61   C C     . GLU A 8   ? 0.4593 0.6518 0.5297 0.0832  0.0667  -0.0906 8   GLU A C     
62   O O     . GLU A 8   ? 0.4641 0.6382 0.5285 0.0861  0.0610  -0.0931 8   GLU A O     
63   C CB    . GLU A 8   ? 0.4886 0.7075 0.5570 0.0861  0.0860  -0.1022 8   GLU A CB    
64   C CG    . GLU A 8   ? 0.5321 0.7537 0.5843 0.0845  0.0955  -0.1091 8   GLU A CG    
65   C CD    . GLU A 8   ? 0.5959 0.8326 0.6582 0.0939  0.1052  -0.1194 8   GLU A CD    
66   O OE1   . GLU A 8   ? 0.6152 0.8596 0.6989 0.1026  0.1038  -0.1214 8   GLU A OE1   
67   O OE2   . GLU A 8   ? 0.6257 0.8669 0.6744 0.0928  0.1141  -0.1254 8   GLU A OE2   
68   N N     . LYS A 9   ? 0.4425 0.6472 0.5298 0.0838  0.0643  -0.0853 9   LYS A N     
69   C CA    . LYS A 9   ? 0.4401 0.6366 0.5393 0.0880  0.0544  -0.0815 9   LYS A CA    
70   C C     . LYS A 9   ? 0.4283 0.6092 0.5162 0.0803  0.0460  -0.0729 9   LYS A C     
71   O O     . LYS A 9   ? 0.4307 0.5973 0.5200 0.0830  0.0379  -0.0711 9   LYS A O     
72   C CB    . LYS A 9   ? 0.4383 0.6534 0.5594 0.0911  0.0539  -0.0785 9   LYS A CB    
73   C CG    . LYS A 9   ? 0.4676 0.6989 0.6038 0.1008  0.0619  -0.0874 9   LYS A CG    
74   C CD    . LYS A 9   ? 0.4851 0.7293 0.6465 0.1074  0.0577  -0.0853 9   LYS A CD    
75   C CE    . LYS A 9   ? 0.4986 0.7589 0.6762 0.1184  0.0660  -0.0952 9   LYS A CE    
76   N NZ    . LYS A 9   ? 0.5369 0.7813 0.7098 0.1285  0.0664  -0.1055 9   LYS A NZ    
77   N N     . ALA A 10  ? 0.4136 0.5975 0.4905 0.0707  0.0480  -0.0676 10  ALA A N     
78   C CA    . ALA A 10  ? 0.4077 0.5784 0.4731 0.0636  0.0415  -0.0603 10  ALA A CA    
79   C C     . ALA A 10  ? 0.4108 0.5631 0.4628 0.0639  0.0392  -0.0633 10  ALA A C     
80   O O     . ALA A 10  ? 0.4086 0.5482 0.4562 0.0613  0.0323  -0.0584 10  ALA A O     
81   C CB    . ALA A 10  ? 0.3860 0.5635 0.4428 0.0542  0.0445  -0.0552 10  ALA A CB    
82   N N     . LEU A 11  ? 0.4202 0.5716 0.4655 0.0665  0.0450  -0.0711 11  LEU A N     
83   C CA    . LEU A 11  ? 0.4301 0.5647 0.4636 0.0672  0.0426  -0.0751 11  LEU A CA    
84   C C     . LEU A 11  ? 0.4318 0.5530 0.4723 0.0730  0.0351  -0.0760 11  LEU A C     
85   O O     . LEU A 11  ? 0.4345 0.5404 0.4670 0.0704  0.0295  -0.0741 11  LEU A O     
86   C CB    . LEU A 11  ? 0.4465 0.5836 0.4724 0.0700  0.0501  -0.0845 11  LEU A CB    
87   C CG    . LEU A 11  ? 0.4509 0.5935 0.4622 0.0626  0.0560  -0.0837 11  LEU A CG    
88   C CD1   . LEU A 11  ? 0.4678 0.6110 0.4704 0.0660  0.0627  -0.0935 11  LEU A CD1   
89   C CD2   . LEU A 11  ? 0.4485 0.5790 0.4470 0.0550  0.0508  -0.0777 11  LEU A CD2   
90   N N     . GLU A 12  ? 0.4296 0.5571 0.4860 0.0808  0.0346  -0.0785 12  GLU A N     
91   C CA    . GLU A 12  ? 0.4290 0.5442 0.4940 0.0867  0.0265  -0.0783 12  GLU A CA    
92   C C     . GLU A 12  ? 0.4221 0.5296 0.4865 0.0810  0.0181  -0.0678 12  GLU A C     
93   O O     . GLU A 12  ? 0.4354 0.5279 0.5006 0.0826  0.0106  -0.0659 12  GLU A O     
94   C CB    . GLU A 12  ? 0.4338 0.5597 0.5179 0.0965  0.0277  -0.0824 12  GLU A CB    
95   C CG    . GLU A 12  ? 0.4443 0.5762 0.5302 0.1042  0.0359  -0.0943 12  GLU A CG    
96   C CD    . GLU A 12  ? 0.4448 0.5918 0.5517 0.1139  0.0384  -0.0981 12  GLU A CD    
97   O OE1   . GLU A 12  ? 0.4341 0.5811 0.5552 0.1169  0.0311  -0.0928 12  GLU A OE1   
98   O OE2   . GLU A 12  ? 0.4423 0.6019 0.5517 0.1186  0.0479  -0.1065 12  GLU A OE2   
99   N N     . LEU A 13  ? 0.4076 0.5247 0.4697 0.0740  0.0193  -0.0609 13  LEU A N     
100  C CA    . LEU A 13  ? 0.4015 0.5123 0.4607 0.0682  0.0125  -0.0515 13  LEU A CA    
101  C C     . LEU A 13  ? 0.3966 0.4960 0.4402 0.0612  0.0115  -0.0488 13  LEU A C     
102  O O     . LEU A 13  ? 0.4038 0.4939 0.4444 0.0578  0.0054  -0.0425 13  LEU A O     
103  C CB    . LEU A 13  ? 0.3911 0.5161 0.4547 0.0641  0.0135  -0.0457 13  LEU A CB    
104  C CG    . LEU A 13  ? 0.4029 0.5417 0.4842 0.0701  0.0137  -0.0470 13  LEU A CG    
105  C CD1   . LEU A 13  ? 0.4014 0.5524 0.4858 0.0645  0.0132  -0.0406 13  LEU A CD1   
106  C CD2   . LEU A 13  ? 0.4331 0.5630 0.5248 0.0768  0.0058  -0.0462 13  LEU A CD2   
107  N N     . VAL A 14  ? 0.3966 0.4976 0.4304 0.0589  0.0174  -0.0532 14  VAL A N     
108  C CA    . VAL A 14  ? 0.3909 0.4845 0.4110 0.0517  0.0169  -0.0501 14  VAL A CA    
109  C C     . VAL A 14  ? 0.4022 0.4832 0.4144 0.0522  0.0157  -0.0549 14  VAL A C     
110  O O     . VAL A 14  ? 0.4018 0.4753 0.4057 0.0468  0.0132  -0.0514 14  VAL A O     
111  C CB    . VAL A 14  ? 0.3797 0.4838 0.3927 0.0463  0.0227  -0.0488 14  VAL A CB    
112  C CG1   . VAL A 14  ? 0.3602 0.4739 0.3788 0.0438  0.0221  -0.0428 14  VAL A CG1   
113  C CG2   . VAL A 14  ? 0.3816 0.4935 0.3927 0.0488  0.0298  -0.0562 14  VAL A CG2   
114  N N     . ILE A 15  ? 0.4121 0.4910 0.4270 0.0586  0.0175  -0.0632 15  ILE A N     
115  C CA    . ILE A 15  ? 0.4242 0.4900 0.4308 0.0591  0.0159  -0.0689 15  ILE A CA    
116  C C     . ILE A 15  ? 0.4296 0.4802 0.4410 0.0612  0.0076  -0.0672 15  ILE A C     
117  O O     . ILE A 15  ? 0.4394 0.4891 0.4617 0.0674  0.0052  -0.0682 15  ILE A O     
118  C CB    . ILE A 15  ? 0.4359 0.5050 0.4410 0.0651  0.0219  -0.0796 15  ILE A CB    
119  C CG1   . ILE A 15  ? 0.4324 0.5153 0.4302 0.0614  0.0299  -0.0804 15  ILE A CG1   
120  C CG2   . ILE A 15  ? 0.4413 0.4941 0.4381 0.0666  0.0187  -0.0865 15  ILE A CG2   
121  C CD1   . ILE A 15  ? 0.4433 0.5326 0.4392 0.0670  0.0373  -0.0906 15  ILE A CD1   
122  N N     . PRO A 16  ? 0.3638 0.5427 0.5306 0.0143  0.0400  -0.0899 16  PRO A N     
123  C CA    . PRO A 16  ? 0.3649 0.5403 0.5468 0.0228  0.0330  -0.0812 16  PRO A CA    
124  C C     . PRO A 16  ? 0.3814 0.5529 0.5898 0.0274  0.0424  -0.0893 16  PRO A C     
125  O O     . PRO A 16  ? 0.3801 0.5435 0.5813 0.0221  0.0546  -0.1022 16  PRO A O     
126  C CB    . PRO A 16  ? 0.3632 0.5222 0.5162 0.0196  0.0303  -0.0775 16  PRO A CB    
127  C CG    . PRO A 16  ? 0.3542 0.5128 0.4795 0.0115  0.0309  -0.0794 16  PRO A CG    
128  C CD    . PRO A 16  ? 0.3582 0.5237 0.4900 0.0073  0.0410  -0.0902 16  PRO A CD    
129  N N     . ASP A 17  ? 0.3939 0.5714 0.6329 0.0370  0.0372  -0.0820 17  ASP A N     
130  C CA    . ASP A 17  ? 0.4185 0.5898 0.6852 0.0422  0.0465  -0.0895 17  ASP A CA    
131  C C     . ASP A 17  ? 0.4284 0.5791 0.6822 0.0411  0.0497  -0.0909 17  ASP A C     
132  O O     . ASP A 17  ? 0.4182 0.5617 0.6473 0.0388  0.0417  -0.0824 17  ASP A O     
133  C CB    . ASP A 17  ? 0.4315 0.6156 0.7395 0.0536  0.0409  -0.0811 17  ASP A CB    
134  C CG    . ASP A 17  ? 0.4558 0.6407 0.7650 0.0603  0.0254  -0.0615 17  ASP A CG    
135  O OD1   . ASP A 17  ? 0.4803 0.6821 0.8140 0.0675  0.0164  -0.0513 17  ASP A OD1   
136  O OD2   . ASP A 17  ? 0.4801 0.6503 0.7671 0.0582  0.0222  -0.0560 17  ASP A OD2   
137  N N     . GLU A 18  ? 0.4402 0.5822 0.7112 0.0420  0.0619  -0.1027 18  GLU A N     
138  C CA    . GLU A 18  ? 0.4617 0.5850 0.7209 0.0391  0.0667  -0.1075 18  GLU A CA    
139  C C     . GLU A 18  ? 0.4572 0.5722 0.7175 0.0447  0.0559  -0.0923 18  GLU A C     
140  O O     . GLU A 18  ? 0.4589 0.5618 0.6954 0.0397  0.0548  -0.0923 18  GLU A O     
141  C CB    . GLU A 18  ? 0.4792 0.5954 0.7615 0.0393  0.0824  -0.1239 18  GLU A CB    
142  C CG    . GLU A 18  ? 0.5173 0.6270 0.7732 0.0273  0.0949  -0.1416 18  GLU A CG    
143  C CD    . GLU A 18  ? 0.5656 0.6620 0.7874 0.0204  0.0914  -0.1408 18  GLU A CD    
144  O OE1   . GLU A 18  ? 0.5682 0.6552 0.7955 0.0245  0.0858  -0.1331 18  GLU A OE1   
145  O OE2   . GLU A 18  ? 0.5961 0.6919 0.7861 0.0106  0.0944  -0.1474 18  GLU A OE2   
146  N N     . GLU A 19  ? 0.4551 0.5774 0.7432 0.0548  0.0480  -0.0791 19  GLU A N     
147  C CA    . GLU A 19  ? 0.4598 0.5751 0.7508 0.0604  0.0380  -0.0627 19  GLU A CA    
148  C C     . GLU A 19  ? 0.4363 0.5518 0.6909 0.0546  0.0275  -0.0535 19  GLU A C     
149  O O     . GLU A 19  ? 0.4276 0.5302 0.6691 0.0530  0.0252  -0.0488 19  GLU A O     
150  C CB    . GLU A 19  ? 0.4620 0.5892 0.7874 0.0718  0.0299  -0.0485 19  GLU A CB    
151  C CG    . GLU A 19  ? 0.4853 0.6096 0.8113 0.0774  0.0171  -0.0277 19  GLU A CG    
152  C CD    . GLU A 19  ? 0.5011 0.6415 0.8587 0.0883  0.0073  -0.0123 19  GLU A CD    
153  O OE1   . GLU A 19  ? 0.5407 0.6858 0.9341 0.0951  0.0135  -0.0175 19  GLU A OE1   
154  O OE2   . GLU A 19  ? 0.5447 0.6941 0.8920 0.0898  -0.0066 0.0049  19  GLU A OE2   
155  N N     . GLU A 20  ? 0.4132 0.5430 0.6529 0.0512  0.0223  -0.0521 20  GLU A N     
156  C CA    . GLU A 20  ? 0.3951 0.5260 0.6020 0.0455  0.0140  -0.0454 20  GLU A CA    
157  C C     . GLU A 20  ? 0.3869 0.5047 0.5652 0.0367  0.0207  -0.0561 20  GLU A C     
158  O O     . GLU A 20  ? 0.3772 0.4875 0.5360 0.0340  0.0159  -0.0505 20  GLU A O     
159  C CB    . GLU A 20  ? 0.3882 0.5374 0.5897 0.0436  0.0084  -0.0430 20  GLU A CB    
160  C CG    . GLU A 20  ? 0.4074 0.5580 0.5778 0.0378  0.0006  -0.0367 20  GLU A CG    
161  C CD    . GLU A 20  ? 0.4175 0.5870 0.5871 0.0367  -0.0064 -0.0324 20  GLU A CD    
162  O OE1   . GLU A 20  ? 0.4627 0.6374 0.6206 0.0359  -0.0162 -0.0217 20  GLU A OE1   
163  O OE2   . GLU A 20  ? 0.4274 0.6069 0.6079 0.0357  -0.0017 -0.0404 20  GLU A OE2   
164  N N     . VAL A 21  ? 0.3788 0.4950 0.5556 0.0322  0.0317  -0.0712 21  VAL A N     
165  C CA    . VAL A 21  ? 0.3802 0.4850 0.5321 0.0239  0.0383  -0.0817 21  VAL A CA    
166  C C     . VAL A 21  ? 0.3836 0.4739 0.5367 0.0243  0.0393  -0.0818 21  VAL A C     
167  O O     . VAL A 21  ? 0.3770 0.4607 0.5064 0.0192  0.0364  -0.0810 21  VAL A O     
168  C CB    . VAL A 21  ? 0.3827 0.4885 0.5361 0.0190  0.0514  -0.0982 21  VAL A CB    
169  C CG1   . VAL A 21  ? 0.3912 0.4867 0.5173 0.0100  0.0571  -0.1081 21  VAL A CG1   
170  C CG2   . VAL A 21  ? 0.3784 0.4978 0.5287 0.0171  0.0513  -0.0986 21  VAL A CG2   
171  N N     . ARG A 22  ? 0.3912 0.4769 0.5739 0.0305  0.0435  -0.0826 22  ARG A N     
172  C CA    . ARG A 22  ? 0.4108 0.4817 0.5998 0.0310  0.0460  -0.0834 22  ARG A CA    
173  C C     . ARG A 22  ? 0.3935 0.4615 0.5718 0.0325  0.0346  -0.0677 22  ARG A C     
174  O O     . ARG A 22  ? 0.3766 0.4350 0.5396 0.0276  0.0346  -0.0695 22  ARG A O     
175  C CB    . ARG A 22  ? 0.4178 0.4845 0.6454 0.0390  0.0522  -0.0847 22  ARG A CB    
176  C CG    . ARG A 22  ? 0.4690 0.5336 0.7110 0.0365  0.0671  -0.1038 22  ARG A CG    
177  C CD    . ARG A 22  ? 0.4830 0.5416 0.7673 0.0455  0.0733  -0.1040 22  ARG A CD    
178  N NE    . ARG A 22  ? 0.5686 0.6344 0.8757 0.0472  0.0843  -0.1168 22  ARG A NE    
179  C CZ    . ARG A 22  ? 0.6213 0.6787 0.9573 0.0493  0.0977  -0.1296 22  ARG A CZ    
180  N NH1   . ARG A 22  ? 0.6558 0.6965 1.0013 0.0496  0.1019  -0.1314 22  ARG A NH1   
181  N NH2   . ARG A 22  ? 0.6408 0.7064 0.9976 0.0504  0.1081  -0.1416 22  ARG A NH2   
182  N N     . LYS A 23  ? 0.3860 0.4635 0.5733 0.0389  0.0252  -0.0528 23  LYS A N     
183  C CA    . LYS A 23  ? 0.3873 0.4648 0.5640 0.0401  0.0144  -0.0369 23  LYS A CA    
184  C C     . LYS A 23  ? 0.3692 0.4470 0.5120 0.0320  0.0111  -0.0387 23  LYS A C     
185  O O     . LYS A 23  ? 0.3664 0.4367 0.4980 0.0296  0.0081  -0.0340 23  LYS A O     
186  C CB    . LYS A 23  ? 0.3851 0.4770 0.5737 0.0466  0.0051  -0.0227 23  LYS A CB    
187  C CG    . LYS A 23  ? 0.4235 0.5142 0.6107 0.0496  -0.0046 -0.0049 23  LYS A CG    
188  C CD    . LYS A 23  ? 0.4674 0.5758 0.6602 0.0540  -0.0151 0.0084  23  LYS A CD    
189  C CE    . LYS A 23  ? 0.4886 0.5967 0.6723 0.0546  -0.0246 0.0259  23  LYS A CE    
190  N NZ    . LYS A 23  ? 0.4936 0.6215 0.6724 0.0553  -0.0355 0.0367  23  LYS A NZ    
191  N N     . GLY A 24  ? 0.3607 0.4470 0.4890 0.0280  0.0122  -0.0454 24  GLY A N     
192  C CA    . GLY A 24  ? 0.3510 0.4365 0.4495 0.0206  0.0110  -0.0490 24  GLY A CA    
193  C C     . GLY A 24  ? 0.3627 0.4365 0.4501 0.0151  0.0161  -0.0582 24  GLY A C     
194  O O     . GLY A 24  ? 0.3426 0.4130 0.4140 0.0120  0.0116  -0.0544 24  GLY A O     
195  N N     . ARG A 25  ? 0.3711 0.4399 0.4675 0.0136  0.0256  -0.0709 25  ARG A N     
196  C CA    . ARG A 25  ? 0.3902 0.4497 0.4765 0.0072  0.0310  -0.0818 25  ARG A CA    
197  C C     . ARG A 25  ? 0.3902 0.4403 0.4828 0.0080  0.0285  -0.0769 25  ARG A C     
198  O O     . ARG A 25  ? 0.3868 0.4334 0.4632 0.0024  0.0268  -0.0794 25  ARG A O     
199  C CB    . ARG A 25  ? 0.4080 0.4642 0.5063 0.0051  0.0430  -0.0973 25  ARG A CB    
200  C CG    . ARG A 25  ? 0.4566 0.5213 0.5505 0.0032  0.0481  -0.1043 25  ARG A CG    
201  C CD    . ARG A 25  ? 0.5243 0.5911 0.5867 -0.0052 0.0481  -0.1094 25  ARG A CD    
202  N NE    . ARG A 25  ? 0.5940 0.6700 0.6499 -0.0051 0.0474  -0.1065 25  ARG A NE    
203  C CZ    . ARG A 25  ? 0.6242 0.7027 0.6556 -0.0114 0.0482  -0.1090 25  ARG A CZ    
204  N NH1   . ARG A 25  ? 0.6535 0.7275 0.6636 -0.0181 0.0487  -0.1139 25  ARG A NH1   
205  N NH2   . ARG A 25  ? 0.6293 0.7152 0.6581 -0.0112 0.0485  -0.1062 25  ARG A NH2   
206  N N     . GLU A 26  ? 0.3893 0.4356 0.5066 0.0148  0.0284  -0.0696 26  GLU A N     
207  C CA    . GLU A 26  ? 0.3988 0.4348 0.5244 0.0156  0.0272  -0.0639 26  GLU A CA    
208  C C     . GLU A 26  ? 0.3795 0.4183 0.4875 0.0143  0.0175  -0.0515 26  GLU A C     
209  O O     . GLU A 26  ? 0.3755 0.4073 0.4778 0.0103  0.0172  -0.0519 26  GLU A O     
210  C CB    . GLU A 26  ? 0.4010 0.4320 0.5580 0.0241  0.0291  -0.0566 26  GLU A CB    
211  C CG    . GLU A 26  ? 0.4383 0.4641 0.6176 0.0254  0.0408  -0.0705 26  GLU A CG    
212  C CD    . GLU A 26  ? 0.4620 0.4861 0.6753 0.0356  0.0416  -0.0616 26  GLU A CD    
213  O OE1   . GLU A 26  ? 0.5225 0.5488 0.7407 0.0414  0.0325  -0.0434 26  GLU A OE1   
214  O OE2   . GLU A 26  ? 0.5233 0.5444 0.7591 0.0379  0.0515  -0.0726 26  GLU A OE2   
215  N N     . ALA A 27  ? 0.3609 0.4106 0.4608 0.0169  0.0103  -0.0419 27  ALA A N     
216  C CA    . ALA A 27  ? 0.3472 0.4007 0.4302 0.0150  0.0023  -0.0317 27  ALA A CA    
217  C C     . ALA A 27  ? 0.3415 0.3957 0.4017 0.0080  0.0023  -0.0396 27  ALA A C     
218  O O     . ALA A 27  ? 0.3321 0.3840 0.3836 0.0049  -0.0007 -0.0364 27  ALA A O     
219  C CB    . ALA A 27  ? 0.3353 0.4010 0.4157 0.0185  -0.0044 -0.0215 27  ALA A CB    
220  N N     . GLU A 28  ? 0.3383 0.3963 0.3899 0.0054  0.0056  -0.0495 28  GLU A N     
221  C CA    . GLU A 28  ? 0.3483 0.4065 0.3797 -0.0010 0.0058  -0.0571 28  GLU A CA    
222  C C     . GLU A 28  ? 0.3594 0.4097 0.3918 -0.0055 0.0086  -0.0642 28  GLU A C     
223  O O     . GLU A 28  ? 0.3590 0.4103 0.3787 -0.0094 0.0047  -0.0637 28  GLU A O     
224  C CB    . GLU A 28  ? 0.3534 0.4154 0.3771 -0.0033 0.0105  -0.0664 28  GLU A CB    
225  C CG    . GLU A 28  ? 0.3651 0.4270 0.3684 -0.0101 0.0107  -0.0738 28  GLU A CG    
226  C CD    . GLU A 28  ? 0.3729 0.4373 0.3671 -0.0136 0.0165  -0.0830 28  GLU A CD    
227  O OE1   . GLU A 28  ? 0.3632 0.4293 0.3685 -0.0111 0.0216  -0.0855 28  GLU A OE1   
228  O OE2   . GLU A 28  ? 0.4150 0.4804 0.3909 -0.0193 0.0158  -0.0875 28  GLU A OE2   
229  N N     . GLU A 29  ? 0.3702 0.4132 0.4191 -0.0052 0.0156  -0.0717 29  GLU A N     
230  C CA    . GLU A 29  ? 0.3857 0.4210 0.4377 -0.0103 0.0192  -0.0799 29  GLU A CA    
231  C C     . GLU A 29  ? 0.3696 0.4011 0.4244 -0.0101 0.0146  -0.0706 29  GLU A C     
232  O O     . GLU A 29  ? 0.3597 0.3912 0.4055 -0.0159 0.0131  -0.0748 29  GLU A O     
233  C CB    . GLU A 29  ? 0.4068 0.4334 0.4801 -0.0096 0.0291  -0.0898 29  GLU A CB    
234  C CG    . GLU A 29  ? 0.4851 0.5125 0.5502 -0.0165 0.0364  -0.1073 29  GLU A CG    
235  C CD    . GLU A 29  ? 0.5818 0.6105 0.6295 -0.0257 0.0346  -0.1155 29  GLU A CD    
236  O OE1   . GLU A 29  ? 0.6281 0.6495 0.6858 -0.0285 0.0367  -0.1190 29  GLU A OE1   
237  O OE2   . GLU A 29  ? 0.6026 0.6399 0.6275 -0.0301 0.0310  -0.1182 29  GLU A OE2   
238  N N     . GLU A 30  ? 0.3604 0.3898 0.4280 -0.0039 0.0124  -0.0578 30  GLU A N     
239  C CA    . GLU A 30  ? 0.3596 0.3853 0.4295 -0.0040 0.0088  -0.0474 30  GLU A CA    
240  C C     . GLU A 30  ? 0.3564 0.3908 0.4063 -0.0070 0.0019  -0.0428 30  GLU A C     
241  O O     . GLU A 30  ? 0.3561 0.3885 0.4036 -0.0108 0.0007  -0.0416 30  GLU A O     
242  C CB    . GLU A 30  ? 0.3604 0.3840 0.4457 0.0033  0.0071  -0.0331 30  GLU A CB    
243  C CG    . GLU A 30  ? 0.3616 0.3801 0.4499 0.0030  0.0045  -0.0210 30  GLU A CG    
244  C CD    . GLU A 30  ? 0.3982 0.4044 0.4962 -0.0017 0.0106  -0.0276 30  GLU A CD    
245  O OE1   . GLU A 30  ? 0.4078 0.4069 0.5179 -0.0026 0.0177  -0.0393 30  GLU A OE1   
246  O OE2   . GLU A 30  ? 0.4234 0.4273 0.5177 -0.0053 0.0092  -0.0219 30  GLU A OE2   
247  N N     . LEU A 31  ? 0.3485 0.3922 0.3862 -0.0053 -0.0019 -0.0406 31  LEU A N     
248  C CA    . LEU A 31  ? 0.3522 0.4038 0.3730 -0.0075 -0.0074 -0.0372 31  LEU A CA    
249  C C     . LEU A 31  ? 0.3559 0.4086 0.3663 -0.0133 -0.0076 -0.0467 31  LEU A C     
250  O O     . LEU A 31  ? 0.3534 0.4085 0.3593 -0.0160 -0.0107 -0.0444 31  LEU A O     
251  C CB    . LEU A 31  ? 0.3429 0.4024 0.3551 -0.0049 -0.0096 -0.0352 31  LEU A CB    
252  C CG    . LEU A 31  ? 0.3535 0.4208 0.3565 -0.0038 -0.0145 -0.0266 31  LEU A CG    
253  C CD1   . LEU A 31  ? 0.3497 0.4170 0.3533 -0.0045 -0.0172 -0.0177 31  LEU A CD1   
254  C CD2   . LEU A 31  ? 0.3599 0.4318 0.3679 0.0003  -0.0146 -0.0234 31  LEU A CD2   
255  N N     . ARG A 32  ? 0.3610 0.4134 0.3680 -0.0156 -0.0043 -0.0573 32  ARG A N     
256  C CA    . ARG A 32  ? 0.3736 0.4286 0.3703 -0.0218 -0.0051 -0.0665 32  ARG A CA    
257  C C     . ARG A 32  ? 0.3674 0.4181 0.3729 -0.0258 -0.0042 -0.0695 32  ARG A C     
258  O O     . ARG A 32  ? 0.3592 0.4153 0.3580 -0.0294 -0.0084 -0.0703 32  ARG A O     
259  C CB    . ARG A 32  ? 0.3871 0.4417 0.3793 -0.0248 -0.0003 -0.0783 32  ARG A CB    
260  C CG    . ARG A 32  ? 0.3987 0.4571 0.3832 -0.0219 0.0004  -0.0766 32  ARG A CG    
261  C CD    . ARG A 32  ? 0.4325 0.4924 0.4068 -0.0269 0.0048  -0.0883 32  ARG A CD    
262  N NE    . ARG A 32  ? 0.5408 0.6077 0.4948 -0.0295 -0.0007 -0.0860 32  ARG A NE    
263  C CZ    . ARG A 32  ? 0.5483 0.6184 0.4922 -0.0276 -0.0014 -0.0815 32  ARG A CZ    
264  N NH1   . ARG A 32  ? 0.5632 0.6317 0.5149 -0.0238 0.0030  -0.0801 32  ARG A NH1   
265  N NH2   . ARG A 32  ? 0.5723 0.6474 0.4996 -0.0295 -0.0065 -0.0781 32  ARG A NH2   
266  N N     . ARG A 33  ? 0.3671 0.4083 0.3892 -0.0251 0.0015  -0.0713 33  ARG A N     
267  C CA    . ARG A 33  ? 0.3771 0.4122 0.4101 -0.0293 0.0038  -0.0738 33  ARG A CA    
268  C C     . ARG A 33  ? 0.3633 0.4012 0.3948 -0.0293 -0.0009 -0.0637 33  ARG A C     
269  O O     . ARG A 33  ? 0.3590 0.3995 0.3902 -0.0349 -0.0020 -0.0680 33  ARG A O     
270  C CB    . ARG A 33  ? 0.3889 0.4112 0.4425 -0.0267 0.0110  -0.0732 33  ARG A CB    
271  C CG    . ARG A 33  ? 0.4535 0.4705 0.5146 -0.0285 0.0186  -0.0867 33  ARG A CG    
272  C CD    . ARG A 33  ? 0.5206 0.5233 0.6063 -0.0260 0.0261  -0.0856 33  ARG A CD    
273  N NE    . ARG A 33  ? 0.5866 0.5840 0.6836 -0.0253 0.0344  -0.0969 33  ARG A NE    
274  C CZ    . ARG A 33  ? 0.6036 0.5999 0.7108 -0.0177 0.0363  -0.0921 33  ARG A CZ    
275  N NH1   . ARG A 33  ? 0.5847 0.5852 0.6913 -0.0103 0.0298  -0.0758 33  ARG A NH1   
276  N NH2   . ARG A 33  ? 0.6464 0.6382 0.7654 -0.0180 0.0453  -0.1046 33  ARG A NH2   
277  N N     . ARG A 34  ? 0.3468 0.3851 0.3786 -0.0237 -0.0031 -0.0509 34  ARG A N     
278  C CA    . ARG A 34  ? 0.3359 0.3768 0.3663 -0.0241 -0.0061 -0.0411 34  ARG A CA    
279  C C     . ARG A 34  ? 0.3306 0.3826 0.3477 -0.0264 -0.0113 -0.0430 34  ARG A C     
280  O O     . ARG A 34  ? 0.3288 0.3836 0.3471 -0.0299 -0.0124 -0.0420 34  ARG A O     
281  C CB    . ARG A 34  ? 0.3301 0.3707 0.3614 -0.0183 -0.0076 -0.0279 34  ARG A CB    
282  C CG    . ARG A 34  ? 0.3403 0.3700 0.3878 -0.0154 -0.0035 -0.0223 34  ARG A CG    
283  C CD    . ARG A 34  ? 0.3492 0.3816 0.3963 -0.0101 -0.0067 -0.0082 34  ARG A CD    
284  N NE    . ARG A 34  ? 0.3588 0.3821 0.4229 -0.0055 -0.0038 -0.0022 34  ARG A NE    
285  C CZ    . ARG A 34  ? 0.3823 0.4079 0.4498 -0.0002 -0.0071 0.0109  34  ARG A CZ    
286  N NH1   . ARG A 34  ? 0.3479 0.3848 0.4013 0.0000  -0.0127 0.0182  34  ARG A NH1   
287  N NH2   . ARG A 34  ? 0.3764 0.3937 0.4623 0.0048  -0.0047 0.0166  34  ARG A NH2   
288  N N     . LEU A 35  ? 0.3190 0.3770 0.3249 -0.0243 -0.0141 -0.0452 35  LEU A N     
289  C CA    . LEU A 35  ? 0.3208 0.3885 0.3153 -0.0257 -0.0189 -0.0467 35  LEU A CA    
290  C C     . LEU A 35  ? 0.3234 0.3949 0.3167 -0.0313 -0.0205 -0.0565 35  LEU A C     
291  O O     . LEU A 35  ? 0.3079 0.3869 0.2997 -0.0332 -0.0244 -0.0560 35  LEU A O     
292  C CB    . LEU A 35  ? 0.3102 0.3816 0.2938 -0.0221 -0.0206 -0.0455 35  LEU A CB    
293  C CG    . LEU A 35  ? 0.3164 0.3887 0.2988 -0.0177 -0.0210 -0.0362 35  LEU A CG    
294  C CD1   . LEU A 35  ? 0.3209 0.3945 0.2964 -0.0149 -0.0205 -0.0372 35  LEU A CD1   
295  C CD2   . LEU A 35  ? 0.3177 0.3960 0.2964 -0.0179 -0.0238 -0.0311 35  LEU A CD2   
296  N N     . ASP A 36  ? 0.3331 0.4008 0.3277 -0.0342 -0.0173 -0.0659 36  ASP A N     
297  C CA    . ASP A 36  ? 0.3498 0.4225 0.3430 -0.0411 -0.0188 -0.0765 36  ASP A CA    
298  C C     . ASP A 36  ? 0.3461 0.4181 0.3516 -0.0451 -0.0181 -0.0771 36  ASP A C     
299  O O     . ASP A 36  ? 0.3434 0.4249 0.3479 -0.0495 -0.0224 -0.0811 36  ASP A O     
300  C CB    . ASP A 36  ? 0.3689 0.4366 0.3627 -0.0450 -0.0136 -0.0883 36  ASP A CB    
301  C CG    . ASP A 36  ? 0.3897 0.4595 0.3701 -0.0430 -0.0136 -0.0898 36  ASP A CG    
302  O OD1   . ASP A 36  ? 0.4176 0.4938 0.3866 -0.0397 -0.0187 -0.0828 36  ASP A OD1   
303  O OD2   . ASP A 36  ? 0.4325 0.4970 0.4150 -0.0449 -0.0074 -0.0984 36  ASP A OD2   
304  N N     . GLU A 37  ? 0.3497 0.4112 0.3674 -0.0437 -0.0126 -0.0724 37  GLU A N     
305  C CA    . GLU A 37  ? 0.3454 0.4040 0.3753 -0.0480 -0.0102 -0.0722 37  GLU A CA    
306  C C     . GLU A 37  ? 0.3373 0.4059 0.3648 -0.0479 -0.0150 -0.0658 37  GLU A C     
307  O O     . GLU A 37  ? 0.3378 0.4107 0.3726 -0.0535 -0.0151 -0.0698 37  GLU A O     
308  C CB    . GLU A 37  ? 0.3522 0.3967 0.3943 -0.0455 -0.0037 -0.0652 37  GLU A CB    
309  C CG    . GLU A 37  ? 0.3686 0.4080 0.4229 -0.0502 0.0000  -0.0633 37  GLU A CG    
310  C CD    . GLU A 37  ? 0.3972 0.4219 0.4628 -0.0471 0.0059  -0.0538 37  GLU A CD    
311  O OE1   . GLU A 37  ? 0.4006 0.4146 0.4800 -0.0513 0.0123  -0.0584 37  GLU A OE1   
312  O OE2   . GLU A 37  ? 0.4092 0.4332 0.4703 -0.0408 0.0041  -0.0418 37  GLU A OE2   
313  N N     . LEU A 38  ? 0.3166 0.3891 0.3351 -0.0422 -0.0182 -0.0572 38  LEU A N     
314  C CA    . LEU A 38  ? 0.3144 0.3964 0.3309 -0.0414 -0.0218 -0.0519 38  LEU A CA    
315  C C     . LEU A 38  ? 0.3104 0.4055 0.3222 -0.0424 -0.0284 -0.0568 38  LEU A C     
316  O O     . LEU A 38  ? 0.3039 0.4073 0.3190 -0.0424 -0.0307 -0.0542 38  LEU A O     
317  C CB    . LEU A 38  ? 0.3000 0.3813 0.3096 -0.0355 -0.0219 -0.0419 38  LEU A CB    
318  C CG    . LEU A 38  ? 0.3048 0.3781 0.3187 -0.0347 -0.0173 -0.0333 38  LEU A CG    
319  C CD1   . LEU A 38  ? 0.2836 0.3578 0.2889 -0.0295 -0.0183 -0.0253 38  LEU A CD1   
320  C CD2   . LEU A 38  ? 0.2898 0.3648 0.3111 -0.0392 -0.0147 -0.0307 38  LEU A CD2   
321  N N     . GLY A 39  ? 0.3232 0.4206 0.3277 -0.0434 -0.0312 -0.0634 39  GLY A N     
322  C CA    . GLY A 39  ? 0.3334 0.4440 0.3329 -0.0449 -0.0387 -0.0671 39  GLY A CA    
323  C C     . GLY A 39  ? 0.3350 0.4506 0.3268 -0.0386 -0.0427 -0.0590 39  GLY A C     
324  O O     . GLY A 39  ? 0.3412 0.4676 0.3322 -0.0379 -0.0491 -0.0581 39  GLY A O     
325  N N     . VAL A 40  ? 0.3305 0.4379 0.3176 -0.0341 -0.0390 -0.0532 40  VAL A N     
326  C CA    . VAL A 40  ? 0.3275 0.4368 0.3091 -0.0287 -0.0405 -0.0460 40  VAL A CA    
327  C C     . VAL A 40  ? 0.3308 0.4396 0.2990 -0.0263 -0.0429 -0.0458 40  VAL A C     
328  O O     . VAL A 40  ? 0.3381 0.4429 0.3007 -0.0285 -0.0413 -0.0509 40  VAL A O     
329  C CB    . VAL A 40  ? 0.3204 0.4225 0.3052 -0.0267 -0.0349 -0.0404 40  VAL A CB    
330  C CG1   . VAL A 40  ? 0.3168 0.4137 0.2930 -0.0229 -0.0332 -0.0369 40  VAL A CG1   
331  C CG2   . VAL A 40  ? 0.3172 0.4243 0.3099 -0.0270 -0.0340 -0.0369 40  VAL A CG2   
332  N N     . GLU A 41  ? 0.3330 0.4455 0.2969 -0.0224 -0.0457 -0.0404 41  GLU A N     
333  C CA    . GLU A 41  ? 0.3510 0.4625 0.3019 -0.0206 -0.0475 -0.0389 41  GLU A CA    
334  C C     . GLU A 41  ? 0.3379 0.4417 0.2843 -0.0174 -0.0424 -0.0355 41  GLU A C     
335  O O     . GLU A 41  ? 0.3161 0.4193 0.2666 -0.0147 -0.0406 -0.0310 41  GLU A O     
336  C CB    . GLU A 41  ? 0.3528 0.4721 0.3021 -0.0183 -0.0539 -0.0344 41  GLU A CB    
337  C CG    . GLU A 41  ? 0.3878 0.5058 0.3225 -0.0174 -0.0560 -0.0319 41  GLU A CG    
338  C CD    . GLU A 41  ? 0.4092 0.5347 0.3429 -0.0147 -0.0632 -0.0255 41  GLU A CD    
339  O OE1   . GLU A 41  ? 0.4611 0.5938 0.4079 -0.0128 -0.0668 -0.0235 41  GLU A OE1   
340  O OE2   . GLU A 41  ? 0.4785 0.6027 0.3988 -0.0144 -0.0651 -0.0220 41  GLU A OE2   
341  N N     . TYR A 42  ? 0.3388 0.4378 0.2775 -0.0186 -0.0397 -0.0386 42  TYR A N     
342  C CA    . TYR A 42  ? 0.3368 0.4301 0.2738 -0.0162 -0.0348 -0.0366 42  TYR A CA    
343  C C     . TYR A 42  ? 0.3406 0.4313 0.2664 -0.0171 -0.0330 -0.0391 42  TYR A C     
344  O O     . TYR A 42  ? 0.3458 0.4383 0.2648 -0.0205 -0.0346 -0.0438 42  TYR A O     
345  C CB    . TYR A 42  ? 0.3395 0.4287 0.2857 -0.0165 -0.0310 -0.0380 42  TYR A CB    
346  C CG    . TYR A 42  ? 0.3445 0.4305 0.2924 -0.0196 -0.0290 -0.0451 42  TYR A CG    
347  C CD1   . TYR A 42  ? 0.3731 0.4550 0.3186 -0.0193 -0.0248 -0.0485 42  TYR A CD1   
348  C CD2   . TYR A 42  ? 0.3577 0.4450 0.3111 -0.0233 -0.0303 -0.0496 42  TYR A CD2   
349  C CE1   . TYR A 42  ? 0.3630 0.4416 0.3117 -0.0223 -0.0214 -0.0565 42  TYR A CE1   
350  C CE2   . TYR A 42  ? 0.3543 0.4380 0.3102 -0.0269 -0.0272 -0.0579 42  TYR A CE2   
351  C CZ    . TYR A 42  ? 0.3881 0.4670 0.3418 -0.0262 -0.0224 -0.0614 42  TYR A CZ    
352  O OH    . TYR A 42  ? 0.3728 0.4477 0.3305 -0.0300 -0.0179 -0.0710 42  TYR A OH    
353  N N     . VAL A 43  ? 0.3261 0.4137 0.2500 -0.0150 -0.0293 -0.0368 43  VAL A N     
354  C CA    . VAL A 43  ? 0.3229 0.4080 0.2378 -0.0161 -0.0260 -0.0392 43  VAL A CA    
355  C C     . VAL A 43  ? 0.3153 0.3981 0.2366 -0.0143 -0.0210 -0.0394 43  VAL A C     
356  O O     . VAL A 43  ? 0.3115 0.3953 0.2383 -0.0120 -0.0212 -0.0351 43  VAL A O     
357  C CB    . VAL A 43  ? 0.3262 0.4116 0.2298 -0.0157 -0.0277 -0.0345 43  VAL A CB    
358  C CG1   . VAL A 43  ? 0.3034 0.3885 0.2122 -0.0122 -0.0279 -0.0282 43  VAL A CG1   
359  C CG2   . VAL A 43  ? 0.3507 0.4331 0.2441 -0.0178 -0.0230 -0.0367 43  VAL A CG2   
360  N N     . PHE A 44  ? 0.3158 0.3966 0.2375 -0.0157 -0.0167 -0.0450 44  PHE A N     
361  C CA    . PHE A 44  ? 0.3110 0.3916 0.2396 -0.0138 -0.0124 -0.0453 44  PHE A CA    
362  C C     . PHE A 44  ? 0.3048 0.3856 0.2245 -0.0145 -0.0099 -0.0440 44  PHE A C     
363  O O     . PHE A 44  ? 0.3030 0.3822 0.2112 -0.0174 -0.0082 -0.0462 44  PHE A O     
364  C CB    . PHE A 44  ? 0.3117 0.3903 0.2474 -0.0147 -0.0077 -0.0525 44  PHE A CB    
365  C CG    . PHE A 44  ? 0.3344 0.4112 0.2837 -0.0132 -0.0086 -0.0527 44  PHE A CG    
366  C CD1   . PHE A 44  ? 0.3947 0.4700 0.3430 -0.0155 -0.0110 -0.0547 44  PHE A CD1   
367  C CD2   . PHE A 44  ? 0.3405 0.4173 0.3043 -0.0096 -0.0068 -0.0507 44  PHE A CD2   
368  C CE1   . PHE A 44  ? 0.3899 0.4619 0.3514 -0.0148 -0.0107 -0.0549 44  PHE A CE1   
369  C CE2   . PHE A 44  ? 0.3582 0.4316 0.3349 -0.0081 -0.0073 -0.0492 44  PHE A CE2   
370  C CZ    . PHE A 44  ? 0.3437 0.4138 0.3191 -0.0109 -0.0087 -0.0514 44  PHE A CZ    
371  N N     . VAL A 45  ? 0.2933 0.3761 0.2178 -0.0126 -0.0095 -0.0403 45  VAL A N     
372  C CA    . VAL A 45  ? 0.2911 0.3735 0.2096 -0.0137 -0.0063 -0.0393 45  VAL A CA    
373  C C     . VAL A 45  ? 0.2901 0.3767 0.2182 -0.0131 -0.0030 -0.0409 45  VAL A C     
374  O O     . VAL A 45  ? 0.2793 0.3690 0.2185 -0.0113 -0.0032 -0.0426 45  VAL A O     
375  C CB    . VAL A 45  ? 0.2975 0.3787 0.2116 -0.0131 -0.0088 -0.0337 45  VAL A CB    
376  C CG1   . VAL A 45  ? 0.2870 0.3658 0.1928 -0.0133 -0.0127 -0.0315 45  VAL A CG1   
377  C CG2   . VAL A 45  ? 0.2800 0.3650 0.2031 -0.0113 -0.0113 -0.0313 45  VAL A CG2   
378  N N     . GLY A 46  ? 0.2802 0.3674 0.2055 -0.0145 -0.0001 -0.0402 46  GLY A N     
379  C CA    . GLY A 46  ? 0.2730 0.3664 0.2074 -0.0148 0.0025  -0.0422 46  GLY A CA    
380  C C     . GLY A 46  ? 0.2839 0.3795 0.2244 -0.0153 0.0071  -0.0477 46  GLY A C     
381  O O     . GLY A 46  ? 0.2862 0.3772 0.2205 -0.0168 0.0101  -0.0512 46  GLY A O     
382  N N     . SER A 47  ? 0.2755 0.3794 0.2287 -0.0145 0.0077  -0.0491 47  SER A N     
383  C CA    . SER A 47  ? 0.2874 0.3953 0.2501 -0.0150 0.0132  -0.0550 47  SER A CA    
384  C C     . SER A 47  ? 0.2841 0.3904 0.2552 -0.0122 0.0137  -0.0578 47  SER A C     
385  O O     . SER A 47  ? 0.2924 0.3982 0.2669 -0.0136 0.0202  -0.0645 47  SER A O     
386  C CB    . SER A 47  ? 0.2901 0.4096 0.2666 -0.0146 0.0126  -0.0554 47  SER A CB    
387  O OG    . SER A 47  ? 0.2977 0.4237 0.2855 -0.0103 0.0057  -0.0506 47  SER A OG    
388  N N     . TYR A 48  ? 0.2838 0.3889 0.2592 -0.0088 0.0079  -0.0535 48  TYR A N     
389  C CA    . TYR A 48  ? 0.2845 0.3858 0.2681 -0.0067 0.0093  -0.0567 48  TYR A CA    
390  C C     . TYR A 48  ? 0.2926 0.3862 0.2619 -0.0108 0.0135  -0.0625 48  TYR A C     
391  O O     . TYR A 48  ? 0.2945 0.3865 0.2682 -0.0120 0.0197  -0.0702 48  TYR A O     
392  C CB    . TYR A 48  ? 0.2824 0.3824 0.2732 -0.0030 0.0030  -0.0505 48  TYR A CB    
393  C CG    . TYR A 48  ? 0.2849 0.3793 0.2857 -0.0015 0.0062  -0.0551 48  TYR A CG    
394  C CD1   . TYR A 48  ? 0.2806 0.3777 0.3011 0.0018  0.0100  -0.0584 48  TYR A CD1   
395  C CD2   . TYR A 48  ? 0.2859 0.3725 0.2780 -0.0038 0.0058  -0.0573 48  TYR A CD2   
396  C CE1   . TYR A 48  ? 0.2915 0.3820 0.3233 0.0028  0.0147  -0.0643 48  TYR A CE1   
397  C CE2   . TYR A 48  ? 0.2871 0.3681 0.2889 -0.0036 0.0100  -0.0635 48  TYR A CE2   
398  C CZ    . TYR A 48  ? 0.2971 0.3792 0.3188 -0.0003 0.0149  -0.0672 48  TYR A CZ    
399  O OH    . TYR A 48  ? 0.3172 0.3926 0.3505 -0.0004 0.0204  -0.0745 48  TYR A OH    
400  N N     . ALA A 49  ? 0.2976 0.3871 0.2502 -0.0130 0.0102  -0.0591 49  ALA A N     
401  C CA    . ALA A 49  ? 0.3145 0.3987 0.2520 -0.0171 0.0123  -0.0631 49  ALA A CA    
402  C C     . ALA A 49  ? 0.3312 0.4151 0.2603 -0.0216 0.0200  -0.0687 49  ALA A C     
403  O O     . ALA A 49  ? 0.3425 0.4237 0.2615 -0.0257 0.0235  -0.0744 49  ALA A O     
404  C CB    . ALA A 49  ? 0.3092 0.3909 0.2331 -0.0178 0.0063  -0.0568 49  ALA A CB    
405  N N     . ARG A 50  ? 0.3333 0.4207 0.2663 -0.0216 0.0230  -0.0677 50  ARG A N     
406  C CA    . ARG A 50  ? 0.3466 0.4335 0.2714 -0.0265 0.0310  -0.0720 50  ARG A CA    
407  C C     . ARG A 50  ? 0.3535 0.4462 0.2951 -0.0264 0.0385  -0.0798 50  ARG A C     
408  O O     . ARG A 50  ? 0.3577 0.4510 0.2947 -0.0309 0.0464  -0.0842 50  ARG A O     
409  C CB    . ARG A 50  ? 0.3495 0.4352 0.2656 -0.0280 0.0305  -0.0659 50  ARG A CB    
410  C CG    . ARG A 50  ? 0.3631 0.4428 0.2634 -0.0282 0.0248  -0.0584 50  ARG A CG    
411  C CD    . ARG A 50  ? 0.3566 0.4329 0.2497 -0.0300 0.0266  -0.0531 50  ARG A CD    
412  N NE    . ARG A 50  ? 0.3305 0.4107 0.2357 -0.0277 0.0248  -0.0511 50  ARG A NE    
413  C CZ    . ARG A 50  ? 0.3322 0.4119 0.2392 -0.0248 0.0187  -0.0459 50  ARG A CZ    
414  N NH1   . ARG A 50  ? 0.3258 0.4017 0.2257 -0.0228 0.0131  -0.0415 50  ARG A NH1   
415  N NH2   . ARG A 50  ? 0.2865 0.3707 0.2029 -0.0244 0.0185  -0.0458 50  ARG A NH2   
416  N N     . ASN A 51  ? 0.3523 0.4492 0.3142 -0.0213 0.0362  -0.0810 51  ASN A N     
417  C CA    . ASN A 51  ? 0.3566 0.4606 0.3404 -0.0192 0.0417  -0.0869 51  ASN A CA    
418  C C     . ASN A 51  ? 0.3456 0.4573 0.3346 -0.0207 0.0445  -0.0868 51  ASN A C     
419  O O     . ASN A 51  ? 0.3334 0.4492 0.3303 -0.0233 0.0533  -0.0945 51  ASN A O     
420  C CB    . ASN A 51  ? 0.3810 0.4824 0.3662 -0.0226 0.0515  -0.0982 51  ASN A CB    
421  C CG    . ASN A 51  ? 0.4332 0.5287 0.4206 -0.0210 0.0499  -0.1008 51  ASN A CG    
422  O OD1   . ASN A 51  ? 0.5186 0.6144 0.5212 -0.0151 0.0440  -0.0962 51  ASN A OD1   
423  N ND2   . ASN A 51  ? 0.4951 0.5854 0.4667 -0.0272 0.0554  -0.1083 51  ASN A ND2   
424  N N     . THR A 52  ? 0.3335 0.4477 0.3189 -0.0199 0.0379  -0.0792 52  THR A N     
425  C CA    . THR A 52  ? 0.3206 0.4425 0.3111 -0.0222 0.0401  -0.0795 52  THR A CA    
426  C C     . THR A 52  ? 0.3104 0.4434 0.3174 -0.0177 0.0322  -0.0748 52  THR A C     
427  O O     . THR A 52  ? 0.3099 0.4503 0.3195 -0.0201 0.0318  -0.0744 52  THR A O     
428  C CB    . THR A 52  ? 0.3255 0.4404 0.2954 -0.0274 0.0416  -0.0764 52  THR A CB    
429  O OG1   . THR A 52  ? 0.3125 0.4222 0.2726 -0.0252 0.0335  -0.0688 52  THR A OG1   
430  C CG2   . THR A 52  ? 0.3296 0.4353 0.2821 -0.0328 0.0498  -0.0800 52  THR A CG2   
431  N N     . TRP A 53  ? 0.3087 0.4432 0.3266 -0.0119 0.0262  -0.0712 53  TRP A N     
432  C CA    . TRP A 53  ? 0.3052 0.4508 0.3368 -0.0078 0.0177  -0.0650 53  TRP A CA    
433  C C     . TRP A 53  ? 0.3086 0.4681 0.3653 -0.0050 0.0189  -0.0680 53  TRP A C     
434  O O     . TRP A 53  ? 0.3190 0.4777 0.3868 -0.0042 0.0260  -0.0747 53  TRP A O     
435  C CB    . TRP A 53  ? 0.3034 0.4442 0.3351 -0.0030 0.0104  -0.0577 53  TRP A CB    
436  C CG    . TRP A 53  ? 0.3066 0.4475 0.3579 0.0026  0.0109  -0.0583 53  TRP A CG    
437  C CD1   . TRP A 53  ? 0.3188 0.4701 0.3925 0.0083  0.0062  -0.0535 53  TRP A CD1   
438  C CD2   . TRP A 53  ? 0.2967 0.4267 0.3479 0.0031  0.0166  -0.0637 53  TRP A CD2   
439  N NE1   . TRP A 53  ? 0.3013 0.4473 0.3908 0.0130  0.0093  -0.0555 53  TRP A NE1   
440  C CE2   . TRP A 53  ? 0.3193 0.4520 0.3950 0.0093  0.0161  -0.0627 53  TRP A CE2   
441  C CE3   . TRP A 53  ? 0.2880 0.4067 0.3210 -0.0015 0.0217  -0.0692 53  TRP A CE3   
442  C CZ2   . TRP A 53  ? 0.3211 0.4446 0.4044 0.0107  0.0221  -0.0687 53  TRP A CZ2   
443  C CZ3   . TRP A 53  ? 0.3277 0.4394 0.3661 -0.0009 0.0267  -0.0753 53  TRP A CZ3   
444  C CH2   . TRP A 53  ? 0.3429 0.4562 0.4066 0.0049  0.0275  -0.0758 53  TRP A CH2   
445  N N     . LEU A 54  ? 0.3018 0.4748 0.3675 -0.0039 0.0118  -0.0632 54  LEU A N     
446  C CA    . LEU A 54  ? 0.3042 0.4941 0.3946 -0.0014 0.0107  -0.0648 54  LEU A CA    
447  C C     . LEU A 54  ? 0.3042 0.4976 0.4156 0.0072  0.0054  -0.0590 54  LEU A C     
448  O O     . LEU A 54  ? 0.3000 0.4878 0.4060 0.0105  -0.0014 -0.0504 54  LEU A O     
449  C CB    . LEU A 54  ? 0.2978 0.5022 0.3870 -0.0046 0.0039  -0.0616 54  LEU A CB    
450  C CG    . LEU A 54  ? 0.3162 0.5345 0.4140 -0.0099 0.0077  -0.0687 54  LEU A CG    
451  C CD1   . LEU A 54  ? 0.3133 0.5238 0.4100 -0.0140 0.0210  -0.0790 54  LEU A CD1   
452  C CD2   . LEU A 54  ? 0.3313 0.5531 0.4133 -0.0165 0.0041  -0.0677 54  LEU A CD2   
453  N N     . LYS A 55  ? 0.3091 0.5114 0.4458 0.0107  0.0093  -0.0636 55  LYS A N     
454  C CA    . LYS A 55  ? 0.3117 0.5200 0.4747 0.0197  0.0041  -0.0573 55  LYS A CA    
455  C C     . LYS A 55  ? 0.3131 0.5327 0.4765 0.0224  -0.0099 -0.0440 55  LYS A C     
456  O O     . LYS A 55  ? 0.3026 0.5367 0.4619 0.0182  -0.0148 -0.0432 55  LYS A O     
457  C CB    . LYS A 55  ? 0.3138 0.5356 0.5065 0.0223  0.0095  -0.0644 55  LYS A CB    
458  C CG    . LYS A 55  ? 0.3225 0.5549 0.5479 0.0325  0.0029  -0.0567 55  LYS A CG    
459  C CD    . LYS A 55  ? 0.3178 0.5667 0.5745 0.0346  0.0082  -0.0646 55  LYS A CD    
460  C CE    . LYS A 55  ? 0.3327 0.5907 0.6254 0.0460  0.0022  -0.0564 55  LYS A CE    
461  N NZ    . LYS A 55  ? 0.3705 0.6082 0.6669 0.0516  0.0064  -0.0545 55  LYS A NZ    
462  N N     . GLY A 56  ? 0.3147 0.5275 0.4820 0.0285  -0.0156 -0.0340 56  GLY A N     
463  C CA    . GLY A 56  ? 0.3202 0.5426 0.4868 0.0311  -0.0285 -0.0200 56  GLY A CA    
464  C C     . GLY A 56  ? 0.3206 0.5364 0.4568 0.0250  -0.0323 -0.0161 56  GLY A C     
465  O O     . GLY A 56  ? 0.3194 0.5415 0.4516 0.0261  -0.0420 -0.0047 56  GLY A O     
466  N N     . SER A 57  ? 0.3216 0.5252 0.4370 0.0187  -0.0246 -0.0251 57  SER A N     
467  C CA    . SER A 57  ? 0.3337 0.5306 0.4224 0.0131  -0.0267 -0.0229 57  SER A CA    
468  C C     . SER A 57  ? 0.3366 0.5130 0.4102 0.0123  -0.0214 -0.0252 57  SER A C     
469  O O     . SER A 57  ? 0.3384 0.5079 0.3920 0.0069  -0.0187 -0.0288 57  SER A O     
470  C CB    . SER A 57  ? 0.3230 0.5268 0.3998 0.0054  -0.0240 -0.0303 57  SER A CB    
471  O OG    . SER A 57  ? 0.3621 0.5869 0.4507 0.0047  -0.0303 -0.0283 57  SER A OG    
472  N N     . LEU A 58  ? 0.3471 0.5143 0.4317 0.0176  -0.0199 -0.0232 58  LEU A N     
473  C CA    . LEU A 58  ? 0.3508 0.5006 0.4227 0.0163  -0.0156 -0.0258 58  LEU A CA    
474  C C     . LEU A 58  ? 0.3524 0.4983 0.4065 0.0138  -0.0211 -0.0185 58  LEU A C     
475  O O     . LEU A 58  ? 0.3465 0.4975 0.4044 0.0162  -0.0281 -0.0083 58  LEU A O     
476  C CB    . LEU A 58  ? 0.3600 0.5013 0.4497 0.0219  -0.0126 -0.0258 58  LEU A CB    
477  C CG    . LEU A 58  ? 0.3722 0.4970 0.4528 0.0207  -0.0092 -0.0278 58  LEU A CG    
478  C CD1   . LEU A 58  ? 0.3663 0.4838 0.4279 0.0145  -0.0028 -0.0382 58  LEU A CD1   
479  C CD2   . LEU A 58  ? 0.3710 0.4890 0.4739 0.0259  -0.0052 -0.0292 58  LEU A CD2   
480  N N     . GLU A 59  ? 0.3515 0.4891 0.3866 0.0090  -0.0177 -0.0235 59  GLU A N     
481  C CA    . GLU A 59  ? 0.3518 0.4844 0.3714 0.0065  -0.0210 -0.0188 59  GLU A CA    
482  C C     . GLU A 59  ? 0.3387 0.4593 0.3451 0.0036  -0.0162 -0.0250 59  GLU A C     
483  O O     . GLU A 59  ? 0.3408 0.4603 0.3393 0.0006  -0.0119 -0.0315 59  GLU A O     
484  C CB    . GLU A 59  ? 0.3520 0.4945 0.3617 0.0026  -0.0247 -0.0163 59  GLU A CB    
485  C CG    . GLU A 59  ? 0.4145 0.5520 0.4099 -0.0002 -0.0266 -0.0127 59  GLU A CG    
486  C CD    . GLU A 59  ? 0.4762 0.6194 0.4596 -0.0054 -0.0265 -0.0150 59  GLU A CD    
487  O OE1   . GLU A 59  ? 0.4851 0.6211 0.4593 -0.0078 -0.0220 -0.0205 59  GLU A OE1   
488  O OE2   . GLU A 59  ? 0.5011 0.6560 0.4846 -0.0072 -0.0307 -0.0111 59  GLU A OE2   
489  N N     . ILE A 60  ? 0.3264 0.4387 0.3304 0.0041  -0.0172 -0.0226 60  ILE A N     
490  C CA    . ILE A 60  ? 0.3182 0.4212 0.3109 0.0014  -0.0142 -0.0278 60  ILE A CA    
491  C C     . ILE A 60  ? 0.3116 0.4143 0.2904 -0.0015 -0.0167 -0.0251 60  ILE A C     
492  O O     . ILE A 60  ? 0.3027 0.4078 0.2815 -0.0014 -0.0204 -0.0190 60  ILE A O     
493  C CB    . ILE A 60  ? 0.3274 0.4220 0.3273 0.0029  -0.0133 -0.0283 60  ILE A CB    
494  C CG1   . ILE A 60  ? 0.3175 0.4111 0.3337 0.0060  -0.0091 -0.0324 60  ILE A CG1   
495  C CG2   . ILE A 60  ? 0.2983 0.3860 0.2857 -0.0007 -0.0118 -0.0333 60  ILE A CG2   
496  C CD1   . ILE A 60  ? 0.3252 0.4098 0.3519 0.0074  -0.0073 -0.0332 60  ILE A CD1   
497  N N     . ASP A 61  ? 0.3082 0.4079 0.2756 -0.0042 -0.0143 -0.0296 61  ASP A N     
498  C CA    . ASP A 61  ? 0.3070 0.4052 0.2639 -0.0062 -0.0159 -0.0279 61  ASP A CA    
499  C C     . ASP A 61  ? 0.3044 0.3962 0.2570 -0.0069 -0.0164 -0.0296 61  ASP A C     
500  O O     . ASP A 61  ? 0.3114 0.3996 0.2599 -0.0078 -0.0141 -0.0343 61  ASP A O     
501  C CB    . ASP A 61  ? 0.3074 0.4064 0.2564 -0.0083 -0.0132 -0.0303 61  ASP A CB    
502  C CG    . ASP A 61  ? 0.3182 0.4250 0.2714 -0.0090 -0.0126 -0.0300 61  ASP A CG    
503  O OD1   . ASP A 61  ? 0.2977 0.4061 0.2530 -0.0097 -0.0092 -0.0337 61  ASP A OD1   
504  O OD2   . ASP A 61  ? 0.3138 0.4262 0.2682 -0.0096 -0.0154 -0.0266 61  ASP A OD2   
505  N N     . VAL A 62  ? 0.3020 0.3934 0.2554 -0.0070 -0.0192 -0.0262 62  VAL A N     
506  C CA    . VAL A 62  ? 0.3060 0.3939 0.2559 -0.0083 -0.0205 -0.0279 62  VAL A CA    
507  C C     . VAL A 62  ? 0.2972 0.3872 0.2425 -0.0090 -0.0221 -0.0254 62  VAL A C     
508  O O     . VAL A 62  ? 0.2943 0.3874 0.2420 -0.0092 -0.0225 -0.0221 62  VAL A O     
509  C CB    . VAL A 62  ? 0.3112 0.3967 0.2693 -0.0083 -0.0214 -0.0270 62  VAL A CB    
510  C CG1   . VAL A 62  ? 0.3298 0.4137 0.2851 -0.0106 -0.0230 -0.0302 62  VAL A CG1   
511  C CG2   . VAL A 62  ? 0.3426 0.4250 0.3090 -0.0070 -0.0190 -0.0294 62  VAL A CG2   
512  N N     . PHE A 63  ? 0.2917 0.3802 0.2306 -0.0094 -0.0228 -0.0270 63  PHE A N     
513  C CA    . PHE A 63  ? 0.2844 0.3744 0.2219 -0.0091 -0.0241 -0.0247 63  PHE A CA    
514  C C     . PHE A 63  ? 0.2828 0.3741 0.2231 -0.0097 -0.0276 -0.0250 63  PHE A C     
515  O O     . PHE A 63  ? 0.2834 0.3738 0.2216 -0.0108 -0.0292 -0.0278 63  PHE A O     
516  C CB    . PHE A 63  ? 0.2892 0.3770 0.2195 -0.0086 -0.0230 -0.0242 63  PHE A CB    
517  C CG    . PHE A 63  ? 0.2832 0.3713 0.2140 -0.0087 -0.0194 -0.0235 63  PHE A CG    
518  C CD1   . PHE A 63  ? 0.3007 0.3910 0.2333 -0.0095 -0.0172 -0.0249 63  PHE A CD1   
519  C CD2   . PHE A 63  ? 0.2896 0.3763 0.2204 -0.0081 -0.0181 -0.0218 63  PHE A CD2   
520  C CE1   . PHE A 63  ? 0.2631 0.3555 0.1962 -0.0108 -0.0142 -0.0254 63  PHE A CE1   
521  C CE2   . PHE A 63  ? 0.2898 0.3767 0.2217 -0.0093 -0.0137 -0.0228 63  PHE A CE2   
522  C CZ    . PHE A 63  ? 0.2768 0.3671 0.2090 -0.0111 -0.0120 -0.0251 63  PHE A CZ    
523  N N     . LEU A 64  ? 0.2748 0.3691 0.2206 -0.0095 -0.0280 -0.0230 64  LEU A N     
524  C CA    . LEU A 64  ? 0.2780 0.3755 0.2292 -0.0102 -0.0311 -0.0235 64  LEU A CA    
525  C C     . LEU A 64  ? 0.2751 0.3751 0.2271 -0.0082 -0.0331 -0.0217 64  LEU A C     
526  O O     . LEU A 64  ? 0.2859 0.3860 0.2406 -0.0069 -0.0303 -0.0201 64  LEU A O     
527  C CB    . LEU A 64  ? 0.2749 0.3745 0.2336 -0.0118 -0.0292 -0.0227 64  LEU A CB    
528  C CG    . LEU A 64  ? 0.2836 0.3806 0.2431 -0.0131 -0.0272 -0.0216 64  LEU A CG    
529  C CD1   . LEU A 64  ? 0.2861 0.3857 0.2503 -0.0153 -0.0250 -0.0189 64  LEU A CD1   
530  C CD2   . LEU A 64  ? 0.2838 0.3772 0.2451 -0.0141 -0.0283 -0.0245 64  LEU A CD2   
531  N N     . LEU A 65  ? 0.2806 0.3829 0.2309 -0.0080 -0.0379 -0.0219 65  LEU A N     
532  C CA    . LEU A 65  ? 0.2714 0.3759 0.2219 -0.0052 -0.0411 -0.0182 65  LEU A CA    
533  C C     . LEU A 65  ? 0.2649 0.3769 0.2286 -0.0042 -0.0440 -0.0176 65  LEU A C     
534  O O     . LEU A 65  ? 0.2564 0.3745 0.2227 -0.0057 -0.0492 -0.0192 65  LEU A O     
535  C CB    . LEU A 65  ? 0.2876 0.3921 0.2269 -0.0059 -0.0455 -0.0175 65  LEU A CB    
536  C CG    . LEU A 65  ? 0.3167 0.4145 0.2438 -0.0074 -0.0416 -0.0190 65  LEU A CG    
537  C CD1   . LEU A 65  ? 0.3346 0.4334 0.2494 -0.0098 -0.0451 -0.0198 65  LEU A CD1   
538  C CD2   . LEU A 65  ? 0.3169 0.4090 0.2424 -0.0051 -0.0370 -0.0153 65  LEU A CD2   
539  N N     . PHE A 66  ? 0.2544 0.3667 0.2273 -0.0022 -0.0402 -0.0164 66  PHE A N     
540  C CA    . PHE A 66  ? 0.2558 0.3756 0.2439 -0.0013 -0.0410 -0.0169 66  PHE A CA    
541  C C     . PHE A 66  ? 0.2635 0.3866 0.2599 0.0037  -0.0449 -0.0123 66  PHE A C     
542  O O     . PHE A 66  ? 0.2647 0.3819 0.2555 0.0066  -0.0443 -0.0082 66  PHE A O     
543  C CB    . PHE A 66  ? 0.2535 0.3726 0.2479 -0.0029 -0.0333 -0.0194 66  PHE A CB    
544  C CG    . PHE A 66  ? 0.2705 0.3890 0.2614 -0.0076 -0.0308 -0.0221 66  PHE A CG    
545  C CD1   . PHE A 66  ? 0.2760 0.3999 0.2750 -0.0104 -0.0318 -0.0242 66  PHE A CD1   
546  C CD2   . PHE A 66  ? 0.2833 0.3961 0.2640 -0.0093 -0.0272 -0.0220 66  PHE A CD2   
547  C CE1   . PHE A 66  ? 0.2903 0.4120 0.2867 -0.0147 -0.0289 -0.0252 66  PHE A CE1   
548  C CE2   . PHE A 66  ? 0.2853 0.3972 0.2639 -0.0128 -0.0255 -0.0224 66  PHE A CE2   
549  C CZ    . PHE A 66  ? 0.2988 0.4142 0.2849 -0.0155 -0.0261 -0.0236 66  PHE A CZ    
550  N N     . PRO A 67  ? 0.2672 0.4001 0.2784 0.0049  -0.0486 -0.0125 67  PRO A N     
551  C CA    . PRO A 67  ? 0.2787 0.4160 0.3020 0.0107  -0.0526 -0.0071 67  PRO A CA    
552  C C     . PRO A 67  ? 0.2870 0.4169 0.3167 0.0142  -0.0450 -0.0057 67  PRO A C     
553  O O     . PRO A 67  ? 0.2738 0.4018 0.3079 0.0118  -0.0366 -0.0110 67  PRO A O     
554  C CB    . PRO A 67  ? 0.2771 0.4270 0.3193 0.0102  -0.0549 -0.0102 67  PRO A CB    
555  C CG    . PRO A 67  ? 0.2669 0.4192 0.3014 0.0038  -0.0561 -0.0155 67  PRO A CG    
556  C CD    . PRO A 67  ? 0.2659 0.4065 0.2851 0.0008  -0.0492 -0.0174 67  PRO A CD    
557  N N     . GLU A 68  ? 0.3073 0.4330 0.3371 0.0194  -0.0476 0.0014  68  GLU A N     
558  C CA    . GLU A 68  ? 0.3342 0.4515 0.3719 0.0228  -0.0400 0.0027  68  GLU A CA    
559  C C     . GLU A 68  ? 0.3170 0.4398 0.3779 0.0245  -0.0343 -0.0019 68  GLU A C     
560  O O     . GLU A 68  ? 0.3171 0.4338 0.3831 0.0239  -0.0245 -0.0061 68  GLU A O     
561  C CB    . GLU A 68  ? 0.3412 0.4537 0.3786 0.0287  -0.0448 0.0130  68  GLU A CB    
562  C CG    . GLU A 68  ? 0.3801 0.4803 0.4231 0.0315  -0.0360 0.0146  68  GLU A CG    
563  C CD    . GLU A 68  ? 0.4204 0.5143 0.4624 0.0372  -0.0407 0.0267  68  GLU A CD    
564  O OE1   . GLU A 68  ? 0.4801 0.5796 0.5120 0.0380  -0.0514 0.0340  68  GLU A OE1   
565  O OE2   . GLU A 68  ? 0.5060 0.5893 0.5572 0.0405  -0.0335 0.0290  68  GLU A OE2   
566  N N     . GLU A 69  ? 0.3123 0.4475 0.3873 0.0258  -0.0400 -0.0019 69  GLU A N     
567  C CA    . GLU A 69  ? 0.3065 0.4489 0.4058 0.0271  -0.0343 -0.0069 69  GLU A CA    
568  C C     . GLU A 69  ? 0.2866 0.4289 0.3838 0.0200  -0.0239 -0.0169 69  GLU A C     
569  O O     . GLU A 69  ? 0.2839 0.4293 0.3985 0.0201  -0.0158 -0.0223 69  GLU A O     
570  C CB    . GLU A 69  ? 0.3085 0.4663 0.4245 0.0297  -0.0434 -0.0048 69  GLU A CB    
571  C CG    . GLU A 69  ? 0.3528 0.5145 0.4717 0.0365  -0.0555 0.0062  69  GLU A CG    
572  C CD    . GLU A 69  ? 0.4015 0.5677 0.4999 0.0326  -0.0663 0.0088  69  GLU A CD    
573  O OE1   . GLU A 69  ? 0.4410 0.6217 0.5483 0.0336  -0.0765 0.0111  69  GLU A OE1   
574  O OE2   . GLU A 69  ? 0.3932 0.5496 0.4677 0.0281  -0.0644 0.0076  69  GLU A OE2   
575  N N     . PHE A 70  ? 0.2681 0.4074 0.3450 0.0139  -0.0241 -0.0192 70  PHE A N     
576  C CA    . PHE A 70  ? 0.2580 0.3976 0.3307 0.0070  -0.0156 -0.0264 70  PHE A CA    
577  C C     . PHE A 70  ? 0.2642 0.3978 0.3385 0.0058  -0.0045 -0.0310 70  PHE A C     
578  O O     . PHE A 70  ? 0.2529 0.3776 0.3202 0.0079  -0.0032 -0.0289 70  PHE A O     
579  C CB    . PHE A 70  ? 0.2499 0.3854 0.3009 0.0020  -0.0181 -0.0260 70  PHE A CB    
580  C CG    . PHE A 70  ? 0.2259 0.3681 0.2772 -0.0009 -0.0237 -0.0264 70  PHE A CG    
581  C CD1   . PHE A 70  ? 0.2428 0.3947 0.3093 0.0015  -0.0296 -0.0257 70  PHE A CD1   
582  C CD2   . PHE A 70  ? 0.2479 0.3867 0.2852 -0.0062 -0.0230 -0.0274 70  PHE A CD2   
583  C CE1   . PHE A 70  ? 0.2505 0.4091 0.3178 -0.0025 -0.0343 -0.0275 70  PHE A CE1   
584  C CE2   . PHE A 70  ? 0.2186 0.3619 0.2574 -0.0095 -0.0268 -0.0285 70  PHE A CE2   
585  C CZ    . PHE A 70  ? 0.2218 0.3749 0.2753 -0.0082 -0.0321 -0.0293 70  PHE A CZ    
586  N N     . SER A 71  ? 0.2686 0.4072 0.3514 0.0015  0.0040  -0.0380 71  SER A N     
587  C CA    . SER A 71  ? 0.2847 0.4192 0.3653 -0.0024 0.0154  -0.0445 71  SER A CA    
588  C C     . SER A 71  ? 0.2904 0.4194 0.3465 -0.0079 0.0158  -0.0444 71  SER A C     
589  O O     . SER A 71  ? 0.2745 0.4037 0.3177 -0.0095 0.0092  -0.0403 71  SER A O     
590  C CB    . SER A 71  ? 0.2864 0.4290 0.3782 -0.0077 0.0248  -0.0525 71  SER A CB    
591  O OG    . SER A 71  ? 0.2824 0.4285 0.3598 -0.0146 0.0239  -0.0525 71  SER A OG    
592  N N     . LYS A 72  ? 0.3080 0.4326 0.3592 -0.0108 0.0236  -0.0492 72  LYS A N     
593  C CA    . LYS A 72  ? 0.3264 0.4486 0.3564 -0.0163 0.0235  -0.0494 72  LYS A CA    
594  C C     . LYS A 72  ? 0.3203 0.4492 0.3405 -0.0228 0.0235  -0.0496 72  LYS A C     
595  O O     . LYS A 72  ? 0.3100 0.4378 0.3154 -0.0246 0.0183  -0.0452 72  LYS A O     
596  C CB    . LYS A 72  ? 0.3527 0.4715 0.3806 -0.0198 0.0325  -0.0563 72  LYS A CB    
597  C CG    . LYS A 72  ? 0.4088 0.5181 0.4414 -0.0141 0.0318  -0.0539 72  LYS A CG    
598  C CD    . LYS A 72  ? 0.4953 0.6011 0.5220 -0.0195 0.0402  -0.0613 72  LYS A CD    
599  C CE    . LYS A 72  ? 0.5395 0.6357 0.5813 -0.0150 0.0460  -0.0630 72  LYS A CE    
600  N NZ    . LYS A 72  ? 0.5690 0.6622 0.6056 -0.0217 0.0550  -0.0719 72  LYS A NZ    
601  N N     . GLU A 73  ? 0.3240 0.4594 0.3540 -0.0261 0.0296  -0.0541 73  GLU A N     
602  C CA    . GLU A 73  ? 0.3339 0.4748 0.3548 -0.0329 0.0306  -0.0534 73  GLU A CA    
603  C C     . GLU A 73  ? 0.3189 0.4596 0.3393 -0.0305 0.0217  -0.0464 73  GLU A C     
604  O O     . GLU A 73  ? 0.3160 0.4563 0.3236 -0.0344 0.0193  -0.0423 73  GLU A O     
605  C CB    . GLU A 73  ? 0.3395 0.4876 0.3712 -0.0380 0.0411  -0.0610 73  GLU A CB    
606  C CG    . GLU A 73  ? 0.4000 0.5536 0.4245 -0.0453 0.0431  -0.0595 73  GLU A CG    
607  C CD    . GLU A 73  ? 0.4832 0.6371 0.4840 -0.0526 0.0434  -0.0564 73  GLU A CD    
608  O OE1   . GLU A 73  ? 0.4956 0.6487 0.4855 -0.0546 0.0448  -0.0588 73  GLU A OE1   
609  O OE2   . GLU A 73  ? 0.5271 0.6827 0.5209 -0.0567 0.0420  -0.0512 73  GLU A OE2   
610  N N     . GLU A 74  ? 0.3117 0.4527 0.3463 -0.0243 0.0167  -0.0449 74  GLU A N     
611  C CA    . GLU A 74  ? 0.3065 0.4476 0.3404 -0.0225 0.0081  -0.0399 74  GLU A CA    
612  C C     . GLU A 74  ? 0.3020 0.4358 0.3198 -0.0208 0.0016  -0.0349 74  GLU A C     
613  O O     . GLU A 74  ? 0.3014 0.4337 0.3121 -0.0228 -0.0022 -0.0318 74  GLU A O     
614  C CB    . GLU A 74  ? 0.2977 0.4431 0.3497 -0.0167 0.0031  -0.0396 74  GLU A CB    
615  C CG    . GLU A 74  ? 0.3078 0.4624 0.3791 -0.0184 0.0087  -0.0445 74  GLU A CG    
616  C CD    . GLU A 74  ? 0.3276 0.4883 0.4194 -0.0116 0.0032  -0.0438 74  GLU A CD    
617  O OE1   . GLU A 74  ? 0.3229 0.4795 0.4165 -0.0051 -0.0005 -0.0406 74  GLU A OE1   
618  O OE2   . GLU A 74  ? 0.3416 0.5116 0.4483 -0.0129 0.0026  -0.0459 74  GLU A OE2   
619  N N     . LEU A 75  ? 0.2978 0.4268 0.3114 -0.0175 0.0013  -0.0347 75  LEU A N     
620  C CA    . LEU A 75  ? 0.2959 0.4188 0.2955 -0.0163 -0.0035 -0.0309 75  LEU A CA    
621  C C     . LEU A 75  ? 0.2938 0.4167 0.2806 -0.0216 -0.0019 -0.0299 75  LEU A C     
622  O O     . LEU A 75  ? 0.2798 0.4001 0.2599 -0.0214 -0.0066 -0.0261 75  LEU A O     
623  C CB    . LEU A 75  ? 0.3001 0.4180 0.2983 -0.0130 -0.0023 -0.0314 75  LEU A CB    
624  C CG    . LEU A 75  ? 0.3163 0.4280 0.3030 -0.0109 -0.0070 -0.0280 75  LEU A CG    
625  C CD1   . LEU A 75  ? 0.2961 0.4066 0.2847 -0.0066 -0.0144 -0.0241 75  LEU A CD1   
626  C CD2   . LEU A 75  ? 0.2948 0.4016 0.2792 -0.0102 -0.0027 -0.0296 75  LEU A CD2   
627  N N     . ARG A 76  ? 0.2963 0.4227 0.2806 -0.0263 0.0050  -0.0332 76  ARG A N     
628  C CA    . ARG A 76  ? 0.3080 0.4370 0.2801 -0.0320 0.0063  -0.0311 76  ARG A CA    
629  C C     . ARG A 76  ? 0.3143 0.4438 0.2864 -0.0342 0.0043  -0.0265 76  ARG A C     
630  O O     . ARG A 76  ? 0.3129 0.4399 0.2774 -0.0344 0.0002  -0.0210 76  ARG A O     
631  C CB    . ARG A 76  ? 0.3107 0.4452 0.2798 -0.0381 0.0146  -0.0368 76  ARG A CB    
632  C CG    . ARG A 76  ? 0.3186 0.4578 0.2723 -0.0447 0.0152  -0.0339 76  ARG A CG    
633  C CD    . ARG A 76  ? 0.3643 0.5110 0.3148 -0.0527 0.0241  -0.0396 76  ARG A CD    
634  N NE    . ARG A 76  ? 0.4942 0.6441 0.4388 -0.0577 0.0245  -0.0341 76  ARG A NE    
635  C CZ    . ARG A 76  ? 0.5365 0.6863 0.4906 -0.0583 0.0275  -0.0343 76  ARG A CZ    
636  N NH1   . ARG A 76  ? 0.5839 0.7323 0.5547 -0.0539 0.0293  -0.0397 76  ARG A NH1   
637  N NH2   . ARG A 76  ? 0.5900 0.7416 0.5379 -0.0635 0.0285  -0.0286 76  ARG A NH2   
638  N N     . GLU A 77  ? 0.3103 0.4431 0.2930 -0.0357 0.0075  -0.0290 77  GLU A N     
639  C CA    . GLU A 77  ? 0.3275 0.4607 0.3114 -0.0392 0.0075  -0.0255 77  GLU A CA    
640  C C     . GLU A 77  ? 0.3123 0.4396 0.2967 -0.0357 0.0002  -0.0212 77  GLU A C     
641  O O     . GLU A 77  ? 0.3092 0.4330 0.2876 -0.0378 -0.0010 -0.0157 77  GLU A O     
642  C CB    . GLU A 77  ? 0.3261 0.4646 0.3250 -0.0408 0.0118  -0.0301 77  GLU A CB    
643  C CG    . GLU A 77  ? 0.3838 0.5285 0.3836 -0.0466 0.0212  -0.0347 77  GLU A CG    
644  C CD    . GLU A 77  ? 0.3891 0.5400 0.4080 -0.0472 0.0255  -0.0402 77  GLU A CD    
645  O OE1   . GLU A 77  ? 0.4742 0.6306 0.4994 -0.0499 0.0340  -0.0467 77  GLU A OE1   
646  O OE2   . GLU A 77  ? 0.4442 0.5952 0.4730 -0.0450 0.0206  -0.0388 77  GLU A OE2   
647  N N     . ARG A 78  ? 0.2939 0.4203 0.2860 -0.0306 -0.0043 -0.0236 78  ARG A N     
648  C CA    . ARG A 78  ? 0.2848 0.4070 0.2782 -0.0283 -0.0103 -0.0220 78  ARG A CA    
649  C C     . ARG A 78  ? 0.2840 0.3999 0.2666 -0.0262 -0.0134 -0.0187 78  ARG A C     
650  O O     . ARG A 78  ? 0.2755 0.3868 0.2569 -0.0268 -0.0153 -0.0161 78  ARG A O     
651  C CB    . ARG A 78  ? 0.2804 0.4056 0.2830 -0.0243 -0.0147 -0.0254 78  ARG A CB    
652  C CG    . ARG A 78  ? 0.2936 0.4264 0.3110 -0.0259 -0.0131 -0.0287 78  ARG A CG    
653  C CD    . ARG A 78  ? 0.3637 0.4982 0.3876 -0.0269 -0.0182 -0.0300 78  ARG A CD    
654  N NE    . ARG A 78  ? 0.3670 0.4953 0.3856 -0.0311 -0.0164 -0.0281 78  ARG A NE    
655  C CZ    . ARG A 78  ? 0.3441 0.4670 0.3594 -0.0314 -0.0199 -0.0281 78  ARG A CZ    
656  N NH1   . ARG A 78  ? 0.3364 0.4607 0.3516 -0.0288 -0.0260 -0.0309 78  ARG A NH1   
657  N NH2   . ARG A 78  ? 0.3223 0.4384 0.3352 -0.0348 -0.0167 -0.0253 78  ARG A NH2   
658  N N     . GLY A 79  ? 0.2799 0.3958 0.2565 -0.0239 -0.0133 -0.0192 79  GLY A N     
659  C CA    . GLY A 79  ? 0.2869 0.3988 0.2550 -0.0221 -0.0156 -0.0168 79  GLY A CA    
660  C C     . GLY A 79  ? 0.3054 0.4168 0.2688 -0.0248 -0.0148 -0.0118 79  GLY A C     
661  O O     . GLY A 79  ? 0.3056 0.4126 0.2683 -0.0232 -0.0176 -0.0089 79  GLY A O     
662  N N     . LEU A 80  ? 0.3081 0.4241 0.2688 -0.0292 -0.0109 -0.0105 80  LEU A N     
663  C CA    . LEU A 80  ? 0.3288 0.4456 0.2831 -0.0323 -0.0107 -0.0038 80  LEU A CA    
664  C C     . LEU A 80  ? 0.3277 0.4390 0.2875 -0.0330 -0.0113 0.0008  80  LEU A C     
665  O O     . LEU A 80  ? 0.3248 0.4323 0.2836 -0.0319 -0.0137 0.0072  80  LEU A O     
666  C CB    . LEU A 80  ? 0.3313 0.4555 0.2790 -0.0381 -0.0058 -0.0042 80  LEU A CB    
667  C CG    . LEU A 80  ? 0.3586 0.4888 0.2965 -0.0397 -0.0059 -0.0049 80  LEU A CG    
668  C CD1   . LEU A 80  ? 0.3817 0.5106 0.3218 -0.0357 -0.0067 -0.0110 80  LEU A CD1   
669  C CD2   . LEU A 80  ? 0.3608 0.4990 0.2916 -0.0471 0.0002  -0.0073 80  LEU A CD2   
670  N N     . GLU A 81  ? 0.3254 0.4366 0.2931 -0.0348 -0.0090 -0.0029 81  GLU A N     
671  C CA    . GLU A 81  ? 0.3418 0.4477 0.3171 -0.0362 -0.0087 -0.0012 81  GLU A CA    
672  C C     . GLU A 81  ? 0.3255 0.4239 0.3043 -0.0322 -0.0128 -0.0009 81  GLU A C     
673  O O     . GLU A 81  ? 0.3252 0.4172 0.3062 -0.0326 -0.0126 0.0046  81  GLU A O     
674  C CB    . GLU A 81  ? 0.3379 0.4476 0.3232 -0.0378 -0.0069 -0.0080 81  GLU A CB    
675  C CG    . GLU A 81  ? 0.3831 0.4923 0.3753 -0.0432 -0.0028 -0.0069 81  GLU A CG    
676  C CD    . GLU A 81  ? 0.3910 0.5056 0.3961 -0.0441 -0.0025 -0.0146 81  GLU A CD    
677  O OE1   . GLU A 81  ? 0.4282 0.5497 0.4361 -0.0417 -0.0031 -0.0193 81  GLU A OE1   
678  O OE2   . GLU A 81  ? 0.4724 0.5847 0.4862 -0.0471 -0.0018 -0.0159 81  GLU A OE2   
679  N N     . ILE A 82  ? 0.3113 0.4103 0.2913 -0.0286 -0.0159 -0.0069 82  ILE A N     
680  C CA    . ILE A 82  ? 0.3124 0.4054 0.2945 -0.0255 -0.0188 -0.0088 82  ILE A CA    
681  C C     . ILE A 82  ? 0.3199 0.4096 0.2979 -0.0228 -0.0196 -0.0034 82  ILE A C     
682  O O     . ILE A 82  ? 0.3299 0.4130 0.3133 -0.0218 -0.0195 -0.0014 82  ILE A O     
683  C CB    . ILE A 82  ? 0.2985 0.3940 0.2793 -0.0230 -0.0218 -0.0155 82  ILE A CB    
684  C CG1   . ILE A 82  ? 0.2978 0.3975 0.2858 -0.0252 -0.0226 -0.0202 82  ILE A CG1   
685  C CG2   . ILE A 82  ? 0.2970 0.3873 0.2767 -0.0206 -0.0236 -0.0180 82  ILE A CG2   
686  C CD1   . ILE A 82  ? 0.3293 0.4349 0.3161 -0.0228 -0.0255 -0.0234 82  ILE A CD1   
687  N N     . GLY A 83  ? 0.3236 0.4186 0.2941 -0.0218 -0.0201 -0.0015 83  GLY A N     
688  C CA    . GLY A 83  ? 0.3326 0.4279 0.3003 -0.0195 -0.0217 0.0036  83  GLY A CA    
689  C C     . GLY A 83  ? 0.3496 0.4415 0.3209 -0.0202 -0.0217 0.0125  83  GLY A C     
690  O O     . GLY A 83  ? 0.3506 0.4379 0.3280 -0.0168 -0.0231 0.0155  83  GLY A O     
691  N N     . LYS A 84  ? 0.3611 0.4550 0.3294 -0.0247 -0.0195 0.0170  84  LYS A N     
692  C CA    . LYS A 84  ? 0.3825 0.4725 0.3527 -0.0262 -0.0190 0.0275  84  LYS A CA    
693  C C     . LYS A 84  ? 0.3858 0.4645 0.3684 -0.0253 -0.0173 0.0276  84  LYS A C     
694  O O     . LYS A 84  ? 0.4016 0.4740 0.3900 -0.0236 -0.0177 0.0362  84  LYS A O     
695  C CB    . LYS A 84  ? 0.3890 0.4837 0.3519 -0.0326 -0.0156 0.0310  84  LYS A CB    
696  C CG    . LYS A 84  ? 0.3967 0.5028 0.3470 -0.0353 -0.0159 0.0306  84  LYS A CG    
697  C CD    . LYS A 84  ? 0.4155 0.5258 0.3588 -0.0426 -0.0110 0.0328  84  LYS A CD    
698  C CE    . LYS A 84  ? 0.4579 0.5799 0.3885 -0.0465 -0.0102 0.0306  84  LYS A CE    
699  N NZ    . LYS A 84  ? 0.5149 0.6419 0.4394 -0.0544 -0.0033 0.0285  84  LYS A NZ    
700  N N     . ALA A 85  ? 0.3672 0.4437 0.3545 -0.0267 -0.0154 0.0181  85  ALA A N     
701  C CA    . ALA A 85  ? 0.3722 0.4390 0.3712 -0.0273 -0.0133 0.0153  85  ALA A CA    
702  C C     . ALA A 85  ? 0.3671 0.4274 0.3733 -0.0223 -0.0145 0.0129  85  ALA A C     
703  O O     . ALA A 85  ? 0.3708 0.4212 0.3881 -0.0222 -0.0118 0.0141  85  ALA A O     
704  C CB    . ALA A 85  ? 0.3692 0.4386 0.3712 -0.0308 -0.0120 0.0051  85  ALA A CB    
705  N N     . VAL A 86  ? 0.3540 0.4195 0.3550 -0.0186 -0.0174 0.0091  86  VAL A N     
706  C CA    . VAL A 86  ? 0.3463 0.4070 0.3540 -0.0147 -0.0173 0.0043  86  VAL A CA    
707  C C     . VAL A 86  ? 0.3616 0.4226 0.3729 -0.0096 -0.0190 0.0117  86  VAL A C     
708  O O     . VAL A 86  ? 0.3624 0.4192 0.3824 -0.0062 -0.0178 0.0079  86  VAL A O     
709  C CB    . VAL A 86  ? 0.3359 0.4009 0.3373 -0.0146 -0.0184 -0.0067 86  VAL A CB    
710  C CG1   . VAL A 86  ? 0.3196 0.3857 0.3201 -0.0191 -0.0179 -0.0138 86  VAL A CG1   
711  C CG2   . VAL A 86  ? 0.2945 0.3684 0.2850 -0.0129 -0.0211 -0.0055 86  VAL A CG2   
712  N N     . LEU A 87  ? 0.3702 0.4373 0.3756 -0.0094 -0.0217 0.0217  87  LEU A N     
713  C CA    . LEU A 87  ? 0.3813 0.4521 0.3904 -0.0048 -0.0249 0.0297  87  LEU A CA    
714  C C     . LEU A 87  ? 0.4084 0.4733 0.4268 -0.0032 -0.0253 0.0428  87  LEU A C     
715  O O     . LEU A 87  ? 0.4214 0.4824 0.4370 -0.0073 -0.0235 0.0481  87  LEU A O     
716  C CB    . LEU A 87  ? 0.3744 0.4583 0.3703 -0.0060 -0.0285 0.0316  87  LEU A CB    
717  C CG    . LEU A 87  ? 0.3448 0.4333 0.3334 -0.0067 -0.0279 0.0202  87  LEU A CG    
718  C CD1   . LEU A 87  ? 0.3278 0.4281 0.3046 -0.0088 -0.0301 0.0213  87  LEU A CD1   
719  C CD2   . LEU A 87  ? 0.3081 0.3938 0.3046 -0.0026 -0.0270 0.0137  87  LEU A CD2   
720  N N     . ASP A 88  ? 0.4210 0.4850 0.4515 0.0027  -0.0273 0.0486  88  ASP A N     
721  C CA    . ASP A 88  ? 0.4485 0.5059 0.4904 0.0055  -0.0281 0.0630  88  ASP A CA    
722  C C     . ASP A 88  ? 0.4618 0.5290 0.4906 0.0030  -0.0332 0.0767  88  ASP A C     
723  O O     . ASP A 88  ? 0.4814 0.5429 0.5106 0.0011  -0.0327 0.0886  88  ASP A O     
724  C CB    . ASP A 88  ? 0.4543 0.5099 0.5151 0.0134  -0.0293 0.0659  88  ASP A CB    
725  C CG    . ASP A 88  ? 0.4613 0.5042 0.5379 0.0152  -0.0225 0.0542  88  ASP A CG    
726  O OD1   . ASP A 88  ? 0.4705 0.5052 0.5443 0.0102  -0.0175 0.0458  88  ASP A OD1   
727  O OD2   . ASP A 88  ? 0.4818 0.5239 0.5748 0.0213  -0.0219 0.0528  88  ASP A OD2   
728  N N     . SER A 89  ? 0.4545 0.5364 0.4717 0.0023  -0.0377 0.0748  89  SER A N     
729  C CA    . SER A 89  ? 0.4639 0.5583 0.4653 -0.0018 -0.0423 0.0841  89  SER A CA    
730  C C     . SER A 89  ? 0.4489 0.5543 0.4374 -0.0052 -0.0423 0.0716  89  SER A C     
731  O O     . SER A 89  ? 0.4301 0.5335 0.4238 -0.0027 -0.0403 0.0600  89  SER A O     
732  C CB    . SER A 89  ? 0.4714 0.5742 0.4789 0.0029  -0.0498 0.0986  89  SER A CB    
733  O OG    . SER A 89  ? 0.4719 0.5832 0.4871 0.0077  -0.0530 0.0925  89  SER A OG    
734  N N     . TYR A 90  ? 0.4506 0.5666 0.4224 -0.0113 -0.0436 0.0738  90  TYR A N     
735  C CA    . TYR A 90  ? 0.4429 0.5669 0.4034 -0.0152 -0.0419 0.0615  90  TYR A CA    
736  C C     . TYR A 90  ? 0.4533 0.5923 0.3977 -0.0214 -0.0445 0.0647  90  TYR A C     
737  O O     . TYR A 90  ? 0.4564 0.5992 0.3936 -0.0248 -0.0465 0.0762  90  TYR A O     
738  C CB    . TYR A 90  ? 0.4379 0.5535 0.3962 -0.0184 -0.0353 0.0513  90  TYR A CB    
739  C CG    . TYR A 90  ? 0.4518 0.5656 0.4026 -0.0245 -0.0319 0.0560  90  TYR A CG    
740  C CD1   . TYR A 90  ? 0.4455 0.5695 0.3816 -0.0312 -0.0305 0.0550  90  TYR A CD1   
741  C CD2   . TYR A 90  ? 0.4679 0.5696 0.4270 -0.0243 -0.0290 0.0604  90  TYR A CD2   
742  C CE1   . TYR A 90  ? 0.4676 0.5905 0.3968 -0.0376 -0.0262 0.0587  90  TYR A CE1   
743  C CE2   . TYR A 90  ? 0.4733 0.5735 0.4261 -0.0306 -0.0250 0.0647  90  TYR A CE2   
744  C CZ    . TYR A 90  ? 0.4787 0.5898 0.4163 -0.0372 -0.0235 0.0640  90  TYR A CZ    
745  O OH    . TYR A 90  ? 0.4928 0.6030 0.4241 -0.0442 -0.0184 0.0672  90  TYR A OH    
746  N N     . GLU A 91  ? 0.4471 0.5942 0.3855 -0.0236 -0.0437 0.0540  91  GLU A N     
747  C CA    . GLU A 91  ? 0.4730 0.6341 0.3964 -0.0307 -0.0442 0.0521  91  GLU A CA    
748  C C     . GLU A 91  ? 0.4473 0.6061 0.3665 -0.0340 -0.0373 0.0376  91  GLU A C     
749  O O     . GLU A 91  ? 0.4396 0.5910 0.3671 -0.0297 -0.0353 0.0297  91  GLU A O     
750  C CB    . GLU A 91  ? 0.4745 0.6495 0.3989 -0.0295 -0.0506 0.0534  91  GLU A CB    
751  C CG    . GLU A 91  ? 0.5197 0.6993 0.4510 -0.0251 -0.0587 0.0688  91  GLU A CG    
752  C CD    . GLU A 91  ? 0.5363 0.7328 0.4706 -0.0240 -0.0660 0.0699  91  GLU A CD    
753  O OE1   . GLU A 91  ? 0.5810 0.7791 0.5219 -0.0223 -0.0643 0.0585  91  GLU A OE1   
754  O OE2   . GLU A 91  ? 0.6010 0.8098 0.5315 -0.0252 -0.0736 0.0826  91  GLU A OE2   
755  N N     . ILE A 92  ? 0.4404 0.6051 0.3473 -0.0416 -0.0334 0.0344  92  ILE A N     
756  C CA    . ILE A 92  ? 0.4232 0.5866 0.3285 -0.0444 -0.0267 0.0210  92  ILE A CA    
757  C C     . ILE A 92  ? 0.4241 0.6014 0.3185 -0.0514 -0.0259 0.0153  92  ILE A C     
758  O O     . ILE A 92  ? 0.4286 0.6148 0.3109 -0.0588 -0.0249 0.0179  92  ILE A O     
759  C CB    . ILE A 92  ? 0.4259 0.5821 0.3314 -0.0470 -0.0202 0.0186  92  ILE A CB    
760  C CG1   . ILE A 92  ? 0.4242 0.5671 0.3423 -0.0403 -0.0209 0.0204  92  ILE A CG1   
761  C CG2   . ILE A 92  ? 0.4170 0.5742 0.3218 -0.0501 -0.0133 0.0057  92  ILE A CG2   
762  C CD1   . ILE A 92  ? 0.4600 0.5972 0.3799 -0.0429 -0.0168 0.0229  92  ILE A CD1   
763  N N     . ARG A 93  ? 0.4051 0.5841 0.3036 -0.0497 -0.0258 0.0071  93  ARG A N     
764  C CA    . ARG A 93  ? 0.4021 0.5940 0.2928 -0.0564 -0.0248 -0.0002 93  ARG A CA    
765  C C     . ARG A 93  ? 0.3722 0.5584 0.2698 -0.0546 -0.0198 -0.0121 93  ARG A C     
766  O O     . ARG A 93  ? 0.3703 0.5522 0.2765 -0.0487 -0.0226 -0.0118 93  ARG A O     
767  C CB    . ARG A 93  ? 0.4166 0.6214 0.3060 -0.0561 -0.0336 0.0070  93  ARG A CB    
768  C CG    . ARG A 93  ? 0.4763 0.6959 0.3518 -0.0634 -0.0377 0.0144  93  ARG A CG    
769  C CD    . ARG A 93  ? 0.5632 0.7983 0.4400 -0.0630 -0.0471 0.0193  93  ARG A CD    
770  N NE    . ARG A 93  ? 0.6477 0.9017 0.5082 -0.0726 -0.0509 0.0225  93  ARG A NE    
771  C CZ    . ARG A 93  ? 0.6879 0.9595 0.5470 -0.0736 -0.0609 0.0298  93  ARG A CZ    
772  N NH1   . ARG A 93  ? 0.6821 0.9544 0.5574 -0.0650 -0.0674 0.0342  93  ARG A NH1   
773  N NH2   . ARG A 93  ? 0.7126 1.0022 0.5541 -0.0836 -0.0643 0.0324  93  ARG A NH2   
774  N N     . TYR A 94  ? 0.3511 0.5365 0.2459 -0.0598 -0.0118 -0.0223 94  TYR A N     
775  C CA    . TYR A 94  ? 0.3225 0.5001 0.2252 -0.0575 -0.0067 -0.0318 94  TYR A CA    
776  C C     . TYR A 94  ? 0.3218 0.5040 0.2204 -0.0656 0.0015  -0.0436 94  TYR A C     
777  O O     . TYR A 94  ? 0.3282 0.5176 0.2186 -0.0725 0.0046  -0.0451 94  TYR A O     
778  C CB    . TYR A 94  ? 0.3056 0.4681 0.2176 -0.0501 -0.0049 -0.0305 94  TYR A CB    
779  C CG    . TYR A 94  ? 0.3161 0.4752 0.2282 -0.0515 -0.0007 -0.0305 94  TYR A CG    
780  C CD1   . TYR A 94  ? 0.2915 0.4482 0.2072 -0.0541 0.0076  -0.0395 94  TYR A CD1   
781  C CD2   . TYR A 94  ? 0.2909 0.4489 0.2019 -0.0501 -0.0042 -0.0216 94  TYR A CD2   
782  C CE1   . TYR A 94  ? 0.3155 0.4704 0.2342 -0.0552 0.0120  -0.0403 94  TYR A CE1   
783  C CE2   . TYR A 94  ? 0.3029 0.4587 0.2153 -0.0521 0.0004  -0.0223 94  TYR A CE2   
784  C CZ    . TYR A 94  ? 0.3261 0.4812 0.2425 -0.0547 0.0085  -0.0320 94  TYR A CZ    
785  O OH    . TYR A 94  ? 0.3292 0.4833 0.2497 -0.0566 0.0137  -0.0337 94  TYR A OH    
786  N N     . ALA A 95  ? 0.3071 0.4852 0.2117 -0.0655 0.0060  -0.0521 95  ALA A N     
787  C CA    . ALA A 95  ? 0.3177 0.4986 0.2213 -0.0733 0.0153  -0.0648 95  ALA A CA    
788  C C     . ALA A 95  ? 0.3122 0.4810 0.2246 -0.0708 0.0237  -0.0696 95  ALA A C     
789  O O     . ALA A 95  ? 0.3145 0.4868 0.2252 -0.0772 0.0313  -0.0774 95  ALA A O     
790  C CB    . ALA A 95  ? 0.3048 0.4874 0.2116 -0.0759 0.0173  -0.0726 95  ALA A CB    
791  N N     . GLU A 96  ? 0.3045 0.4601 0.2269 -0.0618 0.0225  -0.0655 96  GLU A N     
792  C CA    . GLU A 96  ? 0.3100 0.4552 0.2434 -0.0584 0.0293  -0.0690 96  GLU A CA    
793  C C     . GLU A 96  ? 0.2995 0.4365 0.2385 -0.0494 0.0236  -0.0596 96  GLU A C     
794  O O     . GLU A 96  ? 0.2961 0.4329 0.2385 -0.0485 0.0246  -0.0580 96  GLU A O     
795  C CB    . GLU A 96  ? 0.3127 0.4499 0.2547 -0.0584 0.0366  -0.0771 96  GLU A CB    
796  C CG    . GLU A 96  ? 0.3197 0.4457 0.2764 -0.0537 0.0435  -0.0797 96  GLU A CG    
797  C CD    . GLU A 96  ? 0.3436 0.4588 0.3072 -0.0433 0.0375  -0.0700 96  GLU A CD    
798  O OE1   . GLU A 96  ? 0.3686 0.4787 0.3301 -0.0403 0.0339  -0.0662 96  GLU A OE1   
799  O OE2   . GLU A 96  ? 0.3774 0.4902 0.3485 -0.0387 0.0366  -0.0666 96  GLU A OE2   
800  N N     . HIS A 97  ? 0.2859 0.4174 0.2256 -0.0438 0.0179  -0.0541 97  HIS A N     
801  C CA    . HIS A 97  ? 0.2769 0.4017 0.2206 -0.0365 0.0125  -0.0466 97  HIS A CA    
802  C C     . HIS A 97  ? 0.2837 0.4138 0.2215 -0.0365 0.0060  -0.0396 97  HIS A C     
803  O O     . HIS A 97  ? 0.2962 0.4311 0.2283 -0.0376 0.0017  -0.0367 97  HIS A O     
804  C CB    . HIS A 97  ? 0.2570 0.3736 0.2027 -0.0312 0.0099  -0.0441 97  HIS A CB    
805  C CG    . HIS A 97  ? 0.2635 0.3737 0.2132 -0.0249 0.0055  -0.0383 97  HIS A CG    
806  N ND1   . HIS A 97  ? 0.2808 0.3916 0.2271 -0.0225 -0.0010 -0.0328 97  HIS A ND1   
807  C CD2   . HIS A 97  ? 0.2010 0.3055 0.1587 -0.0209 0.0064  -0.0375 97  HIS A CD2   
808  C CE1   . HIS A 97  ? 0.2652 0.3712 0.2158 -0.0182 -0.0036 -0.0299 97  HIS A CE1   
809  N NE2   . HIS A 97  ? 0.2596 0.3626 0.2170 -0.0170 0.0001  -0.0321 97  HIS A NE2   
810  N N     . PRO A 98  ? 0.2883 0.4172 0.2296 -0.0350 0.0053  -0.0367 98  PRO A N     
811  C CA    . PRO A 98  ? 0.2915 0.4236 0.2287 -0.0356 0.0007  -0.0300 98  PRO A CA    
812  C C     . PRO A 98  ? 0.2868 0.4137 0.2253 -0.0301 -0.0059 -0.0242 98  PRO A C     
813  O O     . PRO A 98  ? 0.2741 0.3943 0.2174 -0.0255 -0.0068 -0.0250 98  PRO A O     
814  C CB    . PRO A 98  ? 0.2955 0.4267 0.2390 -0.0359 0.0037  -0.0306 98  PRO A CB    
815  C CG    . PRO A 98  ? 0.2917 0.4167 0.2453 -0.0312 0.0055  -0.0343 98  PRO A CG    
816  C CD    . PRO A 98  ? 0.2854 0.4096 0.2370 -0.0323 0.0089  -0.0392 98  PRO A CD    
817  N N     . TYR A 99  ? 0.2792 0.4094 0.2136 -0.0307 -0.0101 -0.0185 99  TYR A N     
818  C CA    . TYR A 99  ? 0.2821 0.4073 0.2196 -0.0259 -0.0150 -0.0139 99  TYR A CA    
819  C C     . TYR A 99  ? 0.2889 0.4178 0.2247 -0.0269 -0.0184 -0.0063 99  TYR A C     
820  O O     . TYR A 99  ? 0.3018 0.4383 0.2313 -0.0315 -0.0180 -0.0041 99  TYR A O     
821  C CB    . TYR A 99  ? 0.2771 0.4008 0.2151 -0.0232 -0.0161 -0.0163 99  TYR A CB    
822  C CG    . TYR A 99  ? 0.2804 0.4126 0.2147 -0.0259 -0.0169 -0.0165 99  TYR A CG    
823  C CD1   . TYR A 99  ? 0.2763 0.4121 0.2127 -0.0239 -0.0214 -0.0117 99  TYR A CD1   
824  C CD2   . TYR A 99  ? 0.2823 0.4198 0.2127 -0.0306 -0.0129 -0.0222 99  TYR A CD2   
825  C CE1   . TYR A 99  ? 0.2874 0.4337 0.2219 -0.0265 -0.0233 -0.0119 99  TYR A CE1   
826  C CE2   . TYR A 99  ? 0.2836 0.4308 0.2108 -0.0341 -0.0140 -0.0236 99  TYR A CE2   
827  C CZ    . TYR A 99  ? 0.2895 0.4420 0.2188 -0.0320 -0.0197 -0.0181 99  TYR A CZ    
828  O OH    . TYR A 99  ? 0.3152 0.4797 0.2426 -0.0357 -0.0216 -0.0197 99  TYR A OH    
829  N N     . VAL A 100 ? 0.2886 0.4117 0.2297 -0.0229 -0.0216 -0.0023 100 VAL A N     
830  C CA    . VAL A 100 ? 0.2939 0.4188 0.2360 -0.0227 -0.0249 0.0062  100 VAL A CA    
831  C C     . VAL A 100 ? 0.3026 0.4284 0.2496 -0.0185 -0.0284 0.0080  100 VAL A C     
832  O O     . VAL A 100 ? 0.2895 0.4090 0.2422 -0.0148 -0.0279 0.0040  100 VAL A O     
833  C CB    . VAL A 100 ? 0.3032 0.4202 0.2509 -0.0220 -0.0244 0.0101  100 VAL A CB    
834  C CG1   . VAL A 100 ? 0.2944 0.4124 0.2428 -0.0223 -0.0270 0.0207  100 VAL A CG1   
835  C CG2   . VAL A 100 ? 0.2876 0.4047 0.2332 -0.0259 -0.0204 0.0067  100 VAL A CG2   
836  N N     . HIS A 101 ? 0.3080 0.4429 0.2529 -0.0196 -0.0318 0.0136  101 HIS A N     
837  C CA    . HIS A 101 ? 0.3266 0.4637 0.2800 -0.0151 -0.0356 0.0167  101 HIS A CA    
838  C C     . HIS A 101 ? 0.3391 0.4726 0.2999 -0.0121 -0.0386 0.0273  101 HIS A C     
839  O O     . HIS A 101 ? 0.3608 0.4965 0.3161 -0.0151 -0.0397 0.0349  101 HIS A O     
840  C CB    . HIS A 101 ? 0.3272 0.4780 0.2770 -0.0173 -0.0385 0.0166  101 HIS A CB    
841  C CG    . HIS A 101 ? 0.3465 0.5015 0.3080 -0.0124 -0.0424 0.0195  101 HIS A CG    
842  N ND1   . HIS A 101 ? 0.3427 0.4951 0.3110 -0.0096 -0.0400 0.0119  101 HIS A ND1   
843  C CD2   . HIS A 101 ? 0.3775 0.5392 0.3464 -0.0094 -0.0483 0.0296  101 HIS A CD2   
844  C CE1   . HIS A 101 ? 0.3489 0.5068 0.3294 -0.0054 -0.0435 0.0158  101 HIS A CE1   
845  N NE2   . HIS A 101 ? 0.3963 0.5600 0.3784 -0.0047 -0.0491 0.0269  101 HIS A NE2   
846  N N     . GLY A 102 ? 0.3418 0.4694 0.3154 -0.0064 -0.0392 0.0278  102 GLY A N     
847  C CA    . GLY A 102 ? 0.3499 0.4724 0.3340 -0.0029 -0.0412 0.0379  102 GLY A CA    
848  C C     . GLY A 102 ? 0.3421 0.4596 0.3431 0.0036  -0.0410 0.0368  102 GLY A C     
849  O O     . GLY A 102 ? 0.3368 0.4592 0.3415 0.0054  -0.0408 0.0304  102 GLY A O     
850  N N     . VAL A 103 ? 0.3499 0.4574 0.3623 0.0066  -0.0400 0.0426  103 VAL A N     
851  C CA    . VAL A 103 ? 0.3557 0.4584 0.3874 0.0130  -0.0392 0.0427  103 VAL A CA    
852  C C     . VAL A 103 ? 0.3591 0.4457 0.3995 0.0136  -0.0333 0.0380  103 VAL A C     
853  O O     . VAL A 103 ? 0.3678 0.4472 0.4052 0.0108  -0.0321 0.0425  103 VAL A O     
854  C CB    . VAL A 103 ? 0.3588 0.4676 0.4019 0.0177  -0.0453 0.0577  103 VAL A CB    
855  C CG1   . VAL A 103 ? 0.3770 0.4801 0.4445 0.0252  -0.0436 0.0579  103 VAL A CG1   
856  C CG2   . VAL A 103 ? 0.3577 0.4849 0.3926 0.0163  -0.0518 0.0610  103 VAL A CG2   
857  N N     . VAL A 104 ? 0.3579 0.4397 0.4083 0.0160  -0.0289 0.0277  104 VAL A N     
858  C CA    . VAL A 104 ? 0.3662 0.4337 0.4284 0.0166  -0.0229 0.0224  104 VAL A CA    
859  C C     . VAL A 104 ? 0.3698 0.4347 0.4544 0.0231  -0.0206 0.0220  104 VAL A C     
860  O O     . VAL A 104 ? 0.3715 0.4427 0.4589 0.0247  -0.0194 0.0144  104 VAL A O     
861  C CB    . VAL A 104 ? 0.3636 0.4269 0.4157 0.0117  -0.0183 0.0077  104 VAL A CB    
862  C CG1   . VAL A 104 ? 0.3738 0.4242 0.4392 0.0116  -0.0117 0.0001  104 VAL A CG1   
863  C CG2   . VAL A 104 ? 0.3621 0.4272 0.3970 0.0062  -0.0201 0.0085  104 VAL A CG2   
864  N N     . LYS A 105 ? 0.3819 0.4371 0.4838 0.0267  -0.0192 0.0299  105 LYS A N     
865  C CA    . LYS A 105 ? 0.3958 0.4469 0.5240 0.0339  -0.0162 0.0303  105 LYS A CA    
866  C C     . LYS A 105 ? 0.3845 0.4510 0.5191 0.0389  -0.0212 0.0336  105 LYS A C     
867  O O     . LYS A 105 ? 0.3845 0.4529 0.5320 0.0417  -0.0169 0.0240  105 LYS A O     
868  C CB    . LYS A 105 ? 0.3905 0.4309 0.5275 0.0322  -0.0064 0.0132  105 LYS A CB    
869  C CG    . LYS A 105 ? 0.4063 0.4334 0.5382 0.0263  -0.0016 0.0079  105 LYS A CG    
870  C CD    . LYS A 105 ? 0.4276 0.4455 0.5680 0.0237  0.0080  -0.0097 105 LYS A CD    
871  C CE    . LYS A 105 ? 0.4892 0.4935 0.6585 0.0284  0.0145  -0.0081 105 LYS A CE    
872  N NZ    . LYS A 105 ? 0.5378 0.5286 0.7105 0.0220  0.0233  -0.0216 105 LYS A NZ    
873  N N     . GLY A 106 ? 0.3826 0.4611 0.5078 0.0391  -0.0300 0.0465  106 GLY A N     
874  C CA    . GLY A 106 ? 0.3729 0.4685 0.5037 0.0429  -0.0363 0.0511  106 GLY A CA    
875  C C     . GLY A 106 ? 0.3557 0.4629 0.4708 0.0384  -0.0362 0.0396  106 GLY A C     
876  O O     . GLY A 106 ? 0.3541 0.4769 0.4728 0.0402  -0.0413 0.0423  106 GLY A O     
877  N N     . VAL A 107 ? 0.3477 0.4480 0.4461 0.0323  -0.0308 0.0275  107 VAL A N     
878  C CA    . VAL A 107 ? 0.3296 0.4377 0.4139 0.0280  -0.0292 0.0165  107 VAL A CA    
879  C C     . VAL A 107 ? 0.3356 0.4477 0.3955 0.0217  -0.0325 0.0180  107 VAL A C     
880  O O     . VAL A 107 ? 0.3302 0.4338 0.3805 0.0186  -0.0315 0.0191  107 VAL A O     
881  C CB    . VAL A 107 ? 0.3309 0.4292 0.4149 0.0259  -0.0202 0.0011  107 VAL A CB    
882  C CG1   . VAL A 107 ? 0.2963 0.4006 0.3626 0.0208  -0.0185 -0.0084 107 VAL A CG1   
883  C CG2   . VAL A 107 ? 0.3311 0.4266 0.4402 0.0314  -0.0151 -0.0031 107 VAL A CG2   
884  N N     . GLU A 108 ? 0.3348 0.4600 0.3864 0.0195  -0.0356 0.0169  108 GLU A N     
885  C CA    . GLU A 108 ? 0.3280 0.4574 0.3586 0.0134  -0.0375 0.0166  108 GLU A CA    
886  C C     . GLU A 108 ? 0.3165 0.4372 0.3344 0.0094  -0.0319 0.0060  108 GLU A C     
887  O O     . GLU A 108 ? 0.3028 0.4194 0.3240 0.0099  -0.0270 -0.0029 108 GLU A O     
888  C CB    . GLU A 108 ? 0.3325 0.4784 0.3600 0.0116  -0.0417 0.0173  108 GLU A CB    
889  C CG    . GLU A 108 ? 0.3869 0.5442 0.4219 0.0141  -0.0496 0.0303  108 GLU A CG    
890  C CD    . GLU A 108 ? 0.4525 0.6278 0.4798 0.0099  -0.0546 0.0307  108 GLU A CD    
891  O OE1   . GLU A 108 ? 0.4670 0.6533 0.5054 0.0116  -0.0559 0.0276  108 GLU A OE1   
892  O OE2   . GLU A 108 ? 0.4898 0.6690 0.5006 0.0043  -0.0566 0.0334  108 GLU A OE2   
893  N N     . VAL A 109 ? 0.3041 0.4227 0.3080 0.0053  -0.0325 0.0074  109 VAL A N     
894  C CA    . VAL A 109 ? 0.2878 0.3985 0.2812 0.0021  -0.0286 0.0000  109 VAL A CA    
895  C C     . VAL A 109 ? 0.2878 0.4035 0.2673 -0.0024 -0.0296 0.0004  109 VAL A C     
896  O O     . VAL A 109 ? 0.2940 0.4144 0.2703 -0.0041 -0.0325 0.0071  109 VAL A O     
897  C CB    . VAL A 109 ? 0.2910 0.3905 0.2882 0.0025  -0.0271 0.0009  109 VAL A CB    
898  C CG1   . VAL A 109 ? 0.2623 0.3561 0.2501 -0.0006 -0.0243 -0.0068 109 VAL A CG1   
899  C CG2   . VAL A 109 ? 0.2709 0.3647 0.2842 0.0067  -0.0250 0.0002  109 VAL A CG2   
900  N N     . ASP A 110 ? 0.2910 0.4056 0.2625 -0.0045 -0.0268 -0.0068 110 ASP A N     
901  C CA    . ASP A 110 ? 0.2920 0.4077 0.2531 -0.0083 -0.0261 -0.0079 110 ASP A CA    
902  C C     . ASP A 110 ? 0.2950 0.4021 0.2536 -0.0085 -0.0244 -0.0108 110 ASP A C     
903  O O     . ASP A 110 ? 0.3010 0.4030 0.2592 -0.0074 -0.0228 -0.0156 110 ASP A O     
904  C CB    . ASP A 110 ? 0.2946 0.4148 0.2503 -0.0105 -0.0240 -0.0130 110 ASP A CB    
905  C CG    . ASP A 110 ? 0.3207 0.4528 0.2771 -0.0124 -0.0262 -0.0109 110 ASP A CG    
906  O OD1   . ASP A 110 ? 0.3352 0.4731 0.2921 -0.0130 -0.0298 -0.0045 110 ASP A OD1   
907  O OD2   . ASP A 110 ? 0.3539 0.4900 0.3097 -0.0139 -0.0242 -0.0158 110 ASP A OD2   
908  N N     . VAL A 111 ? 0.2945 0.4010 0.2513 -0.0103 -0.0249 -0.0080 111 VAL A N     
909  C CA    . VAL A 111 ? 0.2803 0.3815 0.2362 -0.0110 -0.0239 -0.0109 111 VAL A CA    
910  C C     . VAL A 111 ? 0.2764 0.3810 0.2270 -0.0132 -0.0224 -0.0128 111 VAL A C     
911  O O     . VAL A 111 ? 0.2592 0.3685 0.2080 -0.0159 -0.0216 -0.0105 111 VAL A O     
912  C CB    . VAL A 111 ? 0.2885 0.3865 0.2497 -0.0118 -0.0244 -0.0074 111 VAL A CB    
913  C CG1   . VAL A 111 ? 0.2766 0.3716 0.2383 -0.0130 -0.0240 -0.0114 111 VAL A CG1   
914  C CG2   . VAL A 111 ? 0.2951 0.3883 0.2642 -0.0094 -0.0249 -0.0057 111 VAL A CG2   
915  N N     . VAL A 112 ? 0.2722 0.3743 0.2205 -0.0123 -0.0215 -0.0168 112 VAL A N     
916  C CA    . VAL A 112 ? 0.2728 0.3765 0.2184 -0.0134 -0.0192 -0.0189 112 VAL A CA    
917  C C     . VAL A 112 ? 0.2773 0.3783 0.2253 -0.0122 -0.0198 -0.0200 112 VAL A C     
918  O O     . VAL A 112 ? 0.2762 0.3737 0.2229 -0.0105 -0.0218 -0.0207 112 VAL A O     
919  C CB    . VAL A 112 ? 0.2735 0.3765 0.2157 -0.0130 -0.0173 -0.0213 112 VAL A CB    
920  C CG1   . VAL A 112 ? 0.2730 0.3764 0.2143 -0.0145 -0.0136 -0.0237 112 VAL A CG1   
921  C CG2   . VAL A 112 ? 0.2511 0.3587 0.1934 -0.0137 -0.0178 -0.0205 112 VAL A CG2   
922  N N     . PRO A 113 ? 0.2837 0.3874 0.2352 -0.0135 -0.0181 -0.0203 113 PRO A N     
923  C CA    . PRO A 113 ? 0.2789 0.3820 0.2354 -0.0116 -0.0191 -0.0211 113 PRO A CA    
924  C C     . PRO A 113 ? 0.2842 0.3846 0.2402 -0.0096 -0.0173 -0.0218 113 PRO A C     
925  O O     . PRO A 113 ? 0.2875 0.3877 0.2417 -0.0110 -0.0132 -0.0234 113 PRO A O     
926  C CB    . PRO A 113 ? 0.2797 0.3874 0.2424 -0.0140 -0.0163 -0.0219 113 PRO A CB    
927  C CG    . PRO A 113 ? 0.2728 0.3832 0.2306 -0.0174 -0.0124 -0.0225 113 PRO A CG    
928  C CD    . PRO A 113 ? 0.2662 0.3750 0.2176 -0.0169 -0.0150 -0.0202 113 PRO A CD    
929  N N     . CYS A 114 ? 0.2873 0.3857 0.2448 -0.0067 -0.0205 -0.0202 114 CYS A N     
930  C CA    . CYS A 114 ? 0.2964 0.3911 0.2553 -0.0042 -0.0188 -0.0189 114 CYS A CA    
931  C C     . CYS A 114 ? 0.2936 0.3901 0.2594 -0.0008 -0.0234 -0.0160 114 CYS A C     
932  O O     . CYS A 114 ? 0.2929 0.3941 0.2610 -0.0012 -0.0279 -0.0161 114 CYS A O     
933  C CB    . CYS A 114 ? 0.2971 0.3863 0.2462 -0.0040 -0.0186 -0.0178 114 CYS A CB    
934  S SG    . CYS A 114 ? 0.3193 0.4076 0.2606 -0.0029 -0.0251 -0.0151 114 CYS A SG    
935  N N     . TYR A 115 ? 0.2965 0.3895 0.2664 0.0024  -0.0223 -0.0131 115 TYR A N     
936  C CA    . TYR A 115 ? 0.3102 0.4059 0.2880 0.0065  -0.0276 -0.0086 115 TYR A CA    
937  C C     . TYR A 115 ? 0.3271 0.4205 0.2931 0.0075  -0.0335 -0.0036 115 TYR A C     
938  O O     . TYR A 115 ? 0.3296 0.4158 0.2858 0.0069  -0.0308 -0.0020 115 TYR A O     
939  C CB    . TYR A 115 ? 0.3087 0.4014 0.2996 0.0102  -0.0231 -0.0070 115 TYR A CB    
940  C CG    . TYR A 115 ? 0.3146 0.4114 0.3181 0.0086  -0.0170 -0.0130 115 TYR A CG    
941  C CD1   . TYR A 115 ? 0.3028 0.3955 0.3068 0.0058  -0.0080 -0.0181 115 TYR A CD1   
942  C CD2   . TYR A 115 ? 0.2982 0.4040 0.3125 0.0088  -0.0197 -0.0145 115 TYR A CD2   
943  C CE1   . TYR A 115 ? 0.3038 0.4012 0.3170 0.0031  -0.0017 -0.0245 115 TYR A CE1   
944  C CE2   . TYR A 115 ? 0.2939 0.4038 0.3189 0.0064  -0.0128 -0.0204 115 TYR A CE2   
945  C CZ    . TYR A 115 ? 0.3036 0.4092 0.3269 0.0034  -0.0037 -0.0254 115 TYR A CZ    
946  O OH    . TYR A 115 ? 0.3008 0.4110 0.3324 -0.0001 0.0038  -0.0320 115 TYR A OH    
947  N N     . LYS A 116 ? 0.3326 0.4330 0.2992 0.0080  -0.0412 -0.0018 116 LYS A N     
948  C CA    . LYS A 116 ? 0.3589 0.4593 0.3132 0.0080  -0.0475 0.0027  116 LYS A CA    
949  C C     . LYS A 116 ? 0.3793 0.4774 0.3378 0.0131  -0.0500 0.0117  116 LYS A C     
950  O O     . LYS A 116 ? 0.3864 0.4918 0.3559 0.0167  -0.0562 0.0159  116 LYS A O     
951  C CB    . LYS A 116 ? 0.3562 0.4664 0.3100 0.0057  -0.0548 0.0004  116 LYS A CB    
952  C CG    . LYS A 116 ? 0.3776 0.4897 0.3161 0.0039  -0.0612 0.0033  116 LYS A CG    
953  C CD    . LYS A 116 ? 0.3811 0.5041 0.3208 0.0005  -0.0678 -0.0011 116 LYS A CD    
954  C CE    . LYS A 116 ? 0.4015 0.5274 0.3235 -0.0032 -0.0733 -0.0003 116 LYS A CE    
955  N NZ    . LYS A 116 ? 0.4476 0.5849 0.3721 -0.0076 -0.0793 -0.0066 116 LYS A NZ    
956  N N     . LEU A 117 ? 0.4011 0.4888 0.3528 0.0137  -0.0447 0.0149  117 LEU A N     
957  C CA    . LEU A 117 ? 0.4305 0.5131 0.3861 0.0186  -0.0460 0.0248  117 LEU A CA    
958  C C     . LEU A 117 ? 0.4642 0.5464 0.4021 0.0177  -0.0524 0.0326  117 LEU A C     
959  O O     . LEU A 117 ? 0.4683 0.5511 0.3897 0.0124  -0.0525 0.0284  117 LEU A O     
960  C CB    . LEU A 117 ? 0.4214 0.4919 0.3812 0.0193  -0.0357 0.0243  117 LEU A CB    
961  C CG    . LEU A 117 ? 0.3976 0.4674 0.3703 0.0181  -0.0273 0.0153  117 LEU A CG    
962  C CD1   . LEU A 117 ? 0.3791 0.4375 0.3512 0.0168  -0.0176 0.0139  117 LEU A CD1   
963  C CD2   . LEU A 117 ? 0.3649 0.4405 0.3588 0.0225  -0.0280 0.0152  117 LEU A CD2   
964  N N     . LYS A 118 ? 0.5009 0.5824 0.4429 0.0227  -0.0576 0.0440  118 LYS A N     
965  C CA    . LYS A 118 ? 0.5458 0.6265 0.4693 0.0216  -0.0636 0.0537  118 LYS A CA    
966  C C     . LYS A 118 ? 0.5553 0.6209 0.4680 0.0200  -0.0548 0.0572  118 LYS A C     
967  O O     . LYS A 118 ? 0.5661 0.6294 0.4579 0.0154  -0.0550 0.0593  118 LYS A O     
968  C CB    . LYS A 118 ? 0.5625 0.6499 0.4955 0.0280  -0.0739 0.0666  118 LYS A CB    
969  C CG    . LYS A 118 ? 0.5748 0.6780 0.5249 0.0301  -0.0814 0.0621  118 LYS A CG    
970  C CD    . LYS A 118 ? 0.5849 0.6971 0.5483 0.0372  -0.0924 0.0750  118 LYS A CD    
971  C CE    . LYS A 118 ? 0.5807 0.7091 0.5643 0.0387  -0.0981 0.0689  118 LYS A CE    
972  N NZ    . LYS A 118 ? 0.6179 0.7599 0.6116 0.0443  -0.1118 0.0811  118 LYS A NZ    
973  N N     . GLU A 119 ? 0.5606 0.6163 0.4881 0.0232  -0.0464 0.0568  119 GLU A N     
974  C CA    . GLU A 119 ? 0.5821 0.6231 0.5036 0.0211  -0.0364 0.0583  119 GLU A CA    
975  C C     . GLU A 119 ? 0.5635 0.6003 0.4983 0.0199  -0.0260 0.0469  119 GLU A C     
976  O O     . GLU A 119 ? 0.5515 0.5925 0.5044 0.0232  -0.0258 0.0432  119 GLU A O     
977  C CB    . GLU A 119 ? 0.6097 0.6412 0.5369 0.0267  -0.0372 0.0732  119 GLU A CB    
978  C CG    . GLU A 119 ? 0.6729 0.7089 0.5849 0.0276  -0.0480 0.0868  119 GLU A CG    
979  C CD    . GLU A 119 ? 0.7499 0.7773 0.6371 0.0215  -0.0440 0.0909  119 GLU A CD    
980  O OE1   . GLU A 119 ? 0.7818 0.7996 0.6651 0.0240  -0.0441 0.1055  119 GLU A OE1   
981  O OE2   . GLU A 119 ? 0.7666 0.7965 0.6393 0.0143  -0.0400 0.0800  119 GLU A OE2   
982  N N     . PRO A 120 ? 0.5633 0.5929 0.4891 0.0145  -0.0173 0.0411  120 PRO A N     
983  C CA    . PRO A 120 ? 0.5556 0.5835 0.4920 0.0121  -0.0084 0.0299  120 PRO A CA    
984  C C     . PRO A 120 ? 0.5681 0.5841 0.5187 0.0142  0.0003  0.0319  120 PRO A C     
985  O O     . PRO A 120 ? 0.5673 0.5784 0.5196 0.0097  0.0096  0.0240  120 PRO A O     
986  C CB    . PRO A 120 ? 0.5498 0.5775 0.4713 0.0054  -0.0040 0.0232  120 PRO A CB    
987  C CG    . PRO A 120 ? 0.5669 0.5888 0.4724 0.0042  -0.0056 0.0322  120 PRO A CG    
988  C CD    . PRO A 120 ? 0.5767 0.6006 0.4827 0.0097  -0.0150 0.0440  120 PRO A CD    
989  N N     . LYS A 121 ? 0.5891 0.6008 0.5506 0.0207  -0.0027 0.0422  121 LYS A N     
990  C CA    . LYS A 121 ? 0.6039 0.6043 0.5843 0.0239  0.0057  0.0435  121 LYS A CA    
991  C C     . LYS A 121 ? 0.5901 0.5986 0.5903 0.0267  0.0061  0.0357  121 LYS A C     
992  O O     . LYS A 121 ? 0.5900 0.6113 0.5907 0.0287  -0.0026 0.0355  121 LYS A O     
993  C CB    . LYS A 121 ? 0.6261 0.6173 0.6104 0.0305  0.0019  0.0604  121 LYS A CB    
994  C CG    . LYS A 121 ? 0.6653 0.6507 0.6265 0.0276  -0.0007 0.0706  121 LYS A CG    
995  C CD    . LYS A 121 ? 0.7130 0.6832 0.6692 0.0220  0.0120  0.0683  121 LYS A CD    
996  C CE    . LYS A 121 ? 0.6974 0.6734 0.6407 0.0132  0.0168  0.0538  121 LYS A CE    
997  N NZ    . LYS A 121 ? 0.6945 0.6804 0.6159 0.0100  0.0088  0.0548  121 LYS A NZ    
998  N N     . ASN A 122 ? 0.5808 0.5822 0.5973 0.0261  0.0171  0.0284  122 ASN A N     
999  C CA    . ASN A 122 ? 0.5595 0.5680 0.5950 0.0275  0.0202  0.0194  122 ASN A CA    
1000 C C     . ASN A 122 ? 0.5309 0.5552 0.5577 0.0238  0.0146  0.0115  122 ASN A C     
1001 O O     . ASN A 122 ? 0.5301 0.5645 0.5651 0.0274  0.0082  0.0126  122 ASN A O     
1002 C CB    . ASN A 122 ? 0.5734 0.5809 0.6309 0.0369  0.0168  0.0285  122 ASN A CB    
1003 C CG    . ASN A 122 ? 0.6049 0.5954 0.6718 0.0415  0.0216  0.0391  122 ASN A CG    
1004 O OD1   . ASN A 122 ? 0.6041 0.5822 0.6719 0.0372  0.0331  0.0338  122 ASN A OD1   
1005 N ND2   . ASN A 122 ? 0.6276 0.6178 0.7019 0.0500  0.0127  0.0546  122 ASN A ND2   
1006 N N     . ILE A 123 ? 0.5049 0.5310 0.5159 0.0165  0.0173  0.0039  123 ILE A N     
1007 C CA    . ILE A 123 ? 0.4692 0.5079 0.4698 0.0124  0.0127  -0.0025 123 ILE A CA    
1008 C C     . ILE A 123 ? 0.4355 0.4826 0.4494 0.0118  0.0155  -0.0106 123 ILE A C     
1009 O O     . ILE A 123 ? 0.4438 0.4872 0.4704 0.0106  0.0248  -0.0171 123 ILE A O     
1010 C CB    . ILE A 123 ? 0.4702 0.5077 0.4557 0.0052  0.0169  -0.0086 123 ILE A CB    
1011 C CG1   . ILE A 123 ? 0.4795 0.5230 0.4485 0.0040  0.0088  -0.0058 123 ILE A CG1   
1012 C CG2   . ILE A 123 ? 0.4725 0.5147 0.4615 -0.0009 0.0244  -0.0208 123 ILE A CG2   
1013 C CD1   . ILE A 123 ? 0.4846 0.5215 0.4450 0.0067  0.0048  0.0042  123 ILE A CD1   
1014 N N     . LYS A 124 ? 0.3944 0.4525 0.4059 0.0120  0.0085  -0.0110 124 LYS A N     
1015 C CA    . LYS A 124 ? 0.3619 0.4281 0.3856 0.0108  0.0117  -0.0181 124 LYS A CA    
1016 C C     . LYS A 124 ? 0.3372 0.4093 0.3507 0.0030  0.0157  -0.0274 124 LYS A C     
1017 O O     . LYS A 124 ? 0.3338 0.4084 0.3545 -0.0006 0.0234  -0.0355 124 LYS A O     
1018 C CB    . LYS A 124 ? 0.3544 0.4296 0.3851 0.0150  0.0032  -0.0136 124 LYS A CB    
1019 C CG    . LYS A 124 ? 0.3518 0.4345 0.3996 0.0147  0.0078  -0.0202 124 LYS A CG    
1020 C CD    . LYS A 124 ? 0.3471 0.4397 0.4051 0.0188  -0.0005 -0.0159 124 LYS A CD    
1021 C CE    . LYS A 124 ? 0.3570 0.4572 0.4337 0.0178  0.0060  -0.0236 124 LYS A CE    
1022 N NZ    . LYS A 124 ? 0.3143 0.4262 0.4018 0.0203  -0.0012 -0.0213 124 LYS A NZ    
1023 N N     . SER A 125 ? 0.3202 0.3953 0.3175 0.0003  0.0103  -0.0259 125 SER A N     
1024 C CA    . SER A 125 ? 0.3002 0.3807 0.2876 -0.0063 0.0127  -0.0323 125 SER A CA    
1025 C C     . SER A 125 ? 0.2971 0.3725 0.2747 -0.0090 0.0148  -0.0330 125 SER A C     
1026 O O     . SER A 125 ? 0.2978 0.3657 0.2728 -0.0060 0.0131  -0.0276 125 SER A O     
1027 C CB    . SER A 125 ? 0.2952 0.3833 0.2753 -0.0072 0.0057  -0.0304 125 SER A CB    
1028 O OG    . SER A 125 ? 0.3163 0.4028 0.2845 -0.0073 0.0010  -0.0271 125 SER A OG    
1029 N N     . ALA A 126 ? 0.2842 0.3646 0.2562 -0.0152 0.0185  -0.0396 126 ALA A N     
1030 C CA    . ALA A 126 ? 0.2830 0.3608 0.2486 -0.0188 0.0215  -0.0421 126 ALA A CA    
1031 C C     . ALA A 126 ? 0.2755 0.3519 0.2317 -0.0170 0.0157  -0.0367 126 ALA A C     
1032 O O     . ALA A 126 ? 0.2793 0.3513 0.2324 -0.0188 0.0187  -0.0375 126 ALA A O     
1033 C CB    . ALA A 126 ? 0.2694 0.3568 0.2312 -0.0262 0.0249  -0.0502 126 ALA A CB    
1034 N N     . VAL A 127 ? 0.2622 0.3423 0.2148 -0.0142 0.0085  -0.0322 127 VAL A N     
1035 C CA    . VAL A 127 ? 0.2743 0.3547 0.2186 -0.0134 0.0036  -0.0290 127 VAL A CA    
1036 C C     . VAL A 127 ? 0.2782 0.3526 0.2197 -0.0090 -0.0005 -0.0227 127 VAL A C     
1037 O O     . VAL A 127 ? 0.2894 0.3642 0.2238 -0.0088 -0.0040 -0.0212 127 VAL A O     
1038 C CB    . VAL A 127 ? 0.2576 0.3465 0.1998 -0.0142 -0.0013 -0.0291 127 VAL A CB    
1039 C CG1   . VAL A 127 ? 0.2742 0.3713 0.2169 -0.0189 0.0012  -0.0336 127 VAL A CG1   
1040 C CG2   . VAL A 127 ? 0.2676 0.3575 0.2136 -0.0114 -0.0052 -0.0262 127 VAL A CG2   
1041 N N     . ASP A 128 ? 0.2865 0.3563 0.2342 -0.0057 -0.0003 -0.0194 128 ASP A N     
1042 C CA    . ASP A 128 ? 0.2845 0.3514 0.2298 -0.0016 -0.0059 -0.0124 128 ASP A CA    
1043 C C     . ASP A 128 ? 0.2975 0.3579 0.2319 -0.0020 -0.0058 -0.0084 128 ASP A C     
1044 O O     . ASP A 128 ? 0.3054 0.3659 0.2330 -0.0004 -0.0114 -0.0035 128 ASP A O     
1045 C CB    . ASP A 128 ? 0.2970 0.3614 0.2543 0.0027  -0.0058 -0.0086 128 ASP A CB    
1046 C CG    . ASP A 128 ? 0.2840 0.3563 0.2521 0.0034  -0.0072 -0.0117 128 ASP A CG    
1047 O OD1   . ASP A 128 ? 0.2883 0.3676 0.2531 0.0010  -0.0098 -0.0148 128 ASP A OD1   
1048 O OD2   . ASP A 128 ? 0.2786 0.3497 0.2598 0.0066  -0.0052 -0.0106 128 ASP A OD2   
1049 N N     . ARG A 129 ? 0.2965 0.3517 0.2288 -0.0050 0.0009  -0.0108 129 ARG A N     
1050 C CA    . ARG A 129 ? 0.3048 0.3542 0.2263 -0.0067 0.0026  -0.0079 129 ARG A CA    
1051 C C     . ARG A 129 ? 0.2980 0.3530 0.2105 -0.0090 0.0000  -0.0110 129 ARG A C     
1052 O O     . ARG A 129 ? 0.3058 0.3578 0.2080 -0.0101 -0.0002 -0.0085 129 ARG A O     
1053 C CB    . ARG A 129 ? 0.2979 0.3413 0.2214 -0.0102 0.0114  -0.0111 129 ARG A CB    
1054 C CG    . ARG A 129 ? 0.3000 0.3351 0.2337 -0.0086 0.0165  -0.0091 129 ARG A CG    
1055 C CD    . ARG A 129 ? 0.2823 0.3111 0.2168 -0.0135 0.0257  -0.0133 129 ARG A CD    
1056 N NE    . ARG A 129 ? 0.2900 0.3117 0.2372 -0.0132 0.0325  -0.0151 129 ARG A NE    
1057 C CZ    . ARG A 129 ? 0.2942 0.3216 0.2505 -0.0159 0.0361  -0.0242 129 ARG A CZ    
1058 N NH1   . ARG A 129 ? 0.2716 0.3119 0.2247 -0.0186 0.0326  -0.0305 129 ARG A NH1   
1059 N NH2   . ARG A 129 ? 0.2976 0.3176 0.2661 -0.0159 0.0433  -0.0267 129 ARG A NH2   
1060 N N     . THR A 130 ? 0.2847 0.3476 0.2015 -0.0100 -0.0014 -0.0164 130 THR A N     
1061 C CA    . THR A 130 ? 0.2781 0.3456 0.1904 -0.0119 -0.0022 -0.0201 130 THR A CA    
1062 C C     . THR A 130 ? 0.2844 0.3517 0.1881 -0.0115 -0.0062 -0.0184 130 THR A C     
1063 O O     . THR A 130 ? 0.2806 0.3478 0.1787 -0.0138 -0.0037 -0.0212 130 THR A O     
1064 C CB    . THR A 130 ? 0.2587 0.3342 0.1784 -0.0124 -0.0034 -0.0242 130 THR A CB    
1065 O OG1   . THR A 130 ? 0.2615 0.3385 0.1859 -0.0148 0.0012  -0.0273 130 THR A OG1   
1066 C CG2   . THR A 130 ? 0.2559 0.3359 0.1749 -0.0132 -0.0044 -0.0272 130 THR A CG2   
1067 N N     . PRO A 131 ? 0.2921 0.3607 0.1956 -0.0091 -0.0122 -0.0152 131 PRO A N     
1068 C CA    . PRO A 131 ? 0.3017 0.3709 0.1954 -0.0100 -0.0160 -0.0141 131 PRO A CA    
1069 C C     . PRO A 131 ? 0.3105 0.3738 0.1920 -0.0115 -0.0139 -0.0096 131 PRO A C     
1070 O O     . PRO A 131 ? 0.3175 0.3812 0.1881 -0.0146 -0.0135 -0.0115 131 PRO A O     
1071 C CB    . PRO A 131 ? 0.3056 0.3787 0.2039 -0.0073 -0.0229 -0.0110 131 PRO A CB    
1072 C CG    . PRO A 131 ? 0.2880 0.3636 0.1993 -0.0058 -0.0218 -0.0130 131 PRO A CG    
1073 C CD    . PRO A 131 ? 0.2938 0.3652 0.2067 -0.0064 -0.0154 -0.0134 131 PRO A CD    
1074 N N     . PHE A 132 ? 0.3111 0.3684 0.1944 -0.0099 -0.0116 -0.0039 132 PHE A N     
1075 C CA    . PHE A 132 ? 0.3211 0.3712 0.1928 -0.0114 -0.0090 0.0022  132 PHE A CA    
1076 C C     . PHE A 132 ? 0.3194 0.3662 0.1863 -0.0161 -0.0004 -0.0027 132 PHE A C     
1077 O O     . PHE A 132 ? 0.3180 0.3617 0.1714 -0.0195 0.0020  -0.0007 132 PHE A O     
1078 C CB    . PHE A 132 ? 0.3387 0.3819 0.2166 -0.0078 -0.0087 0.0106  132 PHE A CB    
1079 C CG    . PHE A 132 ? 0.3480 0.3953 0.2317 -0.0029 -0.0172 0.0164  132 PHE A CG    
1080 C CD1   . PHE A 132 ? 0.3512 0.4030 0.2506 0.0001  -0.0186 0.0130  132 PHE A CD1   
1081 C CD2   . PHE A 132 ? 0.3761 0.4238 0.2498 -0.0018 -0.0238 0.0255  132 PHE A CD2   
1082 C CE1   . PHE A 132 ? 0.3477 0.4044 0.2549 0.0044  -0.0259 0.0177  132 PHE A CE1   
1083 C CE2   . PHE A 132 ? 0.3641 0.4179 0.2457 0.0028  -0.0325 0.0309  132 PHE A CE2   
1084 C CZ    . PHE A 132 ? 0.3586 0.4167 0.2581 0.0061  -0.0331 0.0267  132 PHE A CZ    
1085 N N     . HIS A 133 ? 0.3008 0.3494 0.1786 -0.0167 0.0042  -0.0090 133 HIS A N     
1086 C CA    . HIS A 133 ? 0.2958 0.3452 0.1729 -0.0210 0.0113  -0.0154 133 HIS A CA    
1087 C C     . HIS A 133 ? 0.3012 0.3552 0.1708 -0.0232 0.0106  -0.0198 133 HIS A C     
1088 O O     . HIS A 133 ? 0.3156 0.3676 0.1772 -0.0273 0.0164  -0.0218 133 HIS A O     
1089 C CB    . HIS A 133 ? 0.2773 0.3331 0.1683 -0.0209 0.0128  -0.0220 133 HIS A CB    
1090 C CG    . HIS A 133 ? 0.2534 0.3057 0.1521 -0.0208 0.0158  -0.0211 133 HIS A CG    
1091 N ND1   . HIS A 133 ? 0.2734 0.3324 0.1825 -0.0213 0.0162  -0.0263 133 HIS A ND1   
1092 C CD2   . HIS A 133 ? 0.2703 0.3130 0.1682 -0.0206 0.0192  -0.0160 133 HIS A CD2   
1093 C CE1   . HIS A 133 ? 0.2515 0.3057 0.1657 -0.0221 0.0203  -0.0261 133 HIS A CE1   
1094 N NE2   . HIS A 133 ? 0.2518 0.2952 0.1607 -0.0213 0.0225  -0.0198 133 HIS A NE2   
1095 N N     . HIS A 134 ? 0.2905 0.3504 0.1638 -0.0210 0.0047  -0.0222 134 HIS A N     
1096 C CA    . HIS A 134 ? 0.2991 0.3627 0.1683 -0.0232 0.0051  -0.0282 134 HIS A CA    
1097 C C     . HIS A 134 ? 0.3203 0.3812 0.1719 -0.0267 0.0051  -0.0260 134 HIS A C     
1098 O O     . HIS A 134 ? 0.3298 0.3909 0.1746 -0.0310 0.0109  -0.0311 134 HIS A O     
1099 C CB    . HIS A 134 ? 0.2941 0.3631 0.1720 -0.0206 -0.0004 -0.0312 134 HIS A CB    
1100 C CG    . HIS A 134 ? 0.3076 0.3793 0.1845 -0.0229 0.0014  -0.0385 134 HIS A CG    
1101 N ND1   . HIS A 134 ? 0.3096 0.3832 0.1937 -0.0241 0.0075  -0.0448 134 HIS A ND1   
1102 C CD2   . HIS A 134 ? 0.3425 0.4154 0.2129 -0.0247 -0.0014 -0.0413 134 HIS A CD2   
1103 C CE1   . HIS A 134 ? 0.3657 0.4406 0.2490 -0.0260 0.0091  -0.0514 134 HIS A CE1   
1104 N NE2   . HIS A 134 ? 0.3389 0.4133 0.2133 -0.0269 0.0039  -0.0499 134 HIS A NE2   
1105 N N     . LYS A 135 ? 0.3348 0.3942 0.1794 -0.0250 -0.0012 -0.0182 135 LYS A N     
1106 C CA    . LYS A 135 ? 0.3562 0.4145 0.1824 -0.0284 -0.0030 -0.0139 135 LYS A CA    
1107 C C     . LYS A 135 ? 0.3606 0.4116 0.1755 -0.0323 0.0047  -0.0102 135 LYS A C     
1108 O O     . LYS A 135 ? 0.3593 0.4105 0.1579 -0.0378 0.0076  -0.0113 135 LYS A O     
1109 C CB    . LYS A 135 ? 0.3850 0.4444 0.2095 -0.0248 -0.0125 -0.0046 135 LYS A CB    
1110 C CG    . LYS A 135 ? 0.4098 0.4772 0.2429 -0.0225 -0.0203 -0.0083 135 LYS A CG    
1111 C CD    . LYS A 135 ? 0.5011 0.5747 0.3233 -0.0277 -0.0222 -0.0152 135 LYS A CD    
1112 C CE    . LYS A 135 ? 0.4950 0.5762 0.3258 -0.0262 -0.0300 -0.0182 135 LYS A CE    
1113 N NZ    . LYS A 135 ? 0.5479 0.6345 0.3730 -0.0251 -0.0398 -0.0099 135 LYS A NZ    
1114 N N     . TRP A 136 ? 0.3450 0.3899 0.1682 -0.0302 0.0086  -0.0061 136 TRP A N     
1115 C CA    . TRP A 136 ? 0.3634 0.4004 0.1783 -0.0343 0.0170  -0.0028 136 TRP A CA    
1116 C C     . TRP A 136 ? 0.3741 0.4141 0.1888 -0.0397 0.0261  -0.0135 136 TRP A C     
1117 O O     . TRP A 136 ? 0.3762 0.4134 0.1765 -0.0455 0.0323  -0.0133 136 TRP A O     
1118 C CB    . TRP A 136 ? 0.3631 0.3927 0.1897 -0.0315 0.0202  0.0020  136 TRP A CB    
1119 C CG    . TRP A 136 ? 0.3773 0.3964 0.1938 -0.0356 0.0279  0.0086  136 TRP A CG    
1120 C CD1   . TRP A 136 ? 0.3870 0.3977 0.1922 -0.0349 0.0259  0.0218  136 TRP A CD1   
1121 C CD2   . TRP A 136 ? 0.3809 0.3972 0.1983 -0.0413 0.0391  0.0028  136 TRP A CD2   
1122 N NE1   . TRP A 136 ? 0.3996 0.4007 0.1977 -0.0400 0.0356  0.0251  136 TRP A NE1   
1123 C CE2   . TRP A 136 ? 0.3767 0.3813 0.1823 -0.0444 0.0442  0.0129  136 TRP A CE2   
1124 C CE3   . TRP A 136 ? 0.3656 0.3887 0.1944 -0.0439 0.0450  -0.0095 136 TRP A CE3   
1125 C CZ2   . TRP A 136 ? 0.4011 0.4001 0.2051 -0.0508 0.0561  0.0101  136 TRP A CZ2   
1126 C CZ3   . TRP A 136 ? 0.3657 0.3852 0.1943 -0.0499 0.0560  -0.0127 136 TRP A CZ3   
1127 C CH2   . TRP A 136 ? 0.4009 0.4080 0.2168 -0.0537 0.0620  -0.0034 136 TRP A CH2   
1128 N N     . LEU A 137 ? 0.3568 0.4033 0.1878 -0.0378 0.0267  -0.0225 137 LEU A N     
1129 C CA    . LEU A 137 ? 0.3739 0.4246 0.2100 -0.0416 0.0349  -0.0326 137 LEU A CA    
1130 C C     . LEU A 137 ? 0.3888 0.4445 0.2186 -0.0446 0.0361  -0.0402 137 LEU A C     
1131 O O     . LEU A 137 ? 0.3986 0.4557 0.2269 -0.0494 0.0449  -0.0471 137 LEU A O     
1132 C CB    . LEU A 137 ? 0.3438 0.4006 0.2012 -0.0382 0.0345  -0.0380 137 LEU A CB    
1133 C CG    . LEU A 137 ? 0.3771 0.4354 0.2462 -0.0400 0.0412  -0.0414 137 LEU A CG    
1134 C CD1   . LEU A 137 ? 0.3793 0.4293 0.2401 -0.0452 0.0497  -0.0382 137 LEU A CD1   
1135 C CD2   . LEU A 137 ? 0.3245 0.3870 0.2084 -0.0357 0.0359  -0.0410 137 LEU A CD2   
1136 N N     . GLU A 138 ? 0.4090 0.4676 0.2362 -0.0423 0.0282  -0.0400 138 GLU A N     
1137 C CA    . GLU A 138 ? 0.4439 0.5075 0.2700 -0.0449 0.0298  -0.0497 138 GLU A CA    
1138 C C     . GLU A 138 ? 0.4641 0.5270 0.2732 -0.0529 0.0382  -0.0545 138 GLU A C     
1139 O O     . GLU A 138 ? 0.4718 0.5383 0.2878 -0.0555 0.0455  -0.0655 138 GLU A O     
1140 C CB    . GLU A 138 ? 0.4354 0.5019 0.2607 -0.0425 0.0203  -0.0491 138 GLU A CB    
1141 C CG    . GLU A 138 ? 0.4916 0.5571 0.2972 -0.0447 0.0141  -0.0412 138 GLU A CG    
1142 C CD    . GLU A 138 ? 0.4955 0.5659 0.3032 -0.0426 0.0045  -0.0414 138 GLU A CD    
1143 O OE1   . GLU A 138 ? 0.5492 0.6220 0.3732 -0.0395 0.0034  -0.0473 138 GLU A OE1   
1144 O OE2   . GLU A 138 ? 0.5748 0.6469 0.3681 -0.0442 -0.0021 -0.0351 138 GLU A OE2   
1145 N N     . GLY A 139 ? 0.4827 0.5412 0.2707 -0.0567 0.0376  -0.0461 139 GLY A N     
1146 C CA    . GLY A 139 ? 0.5058 0.5638 0.2741 -0.0655 0.0459  -0.0496 139 GLY A CA    
1147 C C     . GLY A 139 ? 0.5086 0.5613 0.2747 -0.0692 0.0563  -0.0476 139 GLY A C     
1148 O O     . GLY A 139 ? 0.5420 0.5932 0.2899 -0.0770 0.0640  -0.0487 139 GLY A O     
1149 N N     . ARG A 140 ? 0.4863 0.5364 0.2700 -0.0644 0.0570  -0.0449 140 ARG A N     
1150 C CA    . ARG A 140 ? 0.4886 0.5341 0.2736 -0.0683 0.0673  -0.0441 140 ARG A CA    
1151 C C     . ARG A 140 ? 0.4690 0.5213 0.2768 -0.0681 0.0748  -0.0562 140 ARG A C     
1152 O O     . ARG A 140 ? 0.4748 0.5262 0.2839 -0.0732 0.0852  -0.0593 140 ARG A O     
1153 C CB    . ARG A 140 ? 0.4810 0.5179 0.2673 -0.0649 0.0640  -0.0316 140 ARG A CB    
1154 C CG    . ARG A 140 ? 0.5116 0.5409 0.2759 -0.0659 0.0590  -0.0177 140 ARG A CG    
1155 C CD    . ARG A 140 ? 0.5028 0.5229 0.2725 -0.0610 0.0553  -0.0055 140 ARG A CD    
1156 N NE    . ARG A 140 ? 0.5724 0.5917 0.3338 -0.0563 0.0434  0.0051  140 ARG A NE    
1157 C CZ    . ARG A 140 ? 0.5864 0.5973 0.3348 -0.0560 0.0406  0.0199  140 ARG A CZ    
1158 N NH1   . ARG A 140 ? 0.6322 0.6327 0.3734 -0.0603 0.0494  0.0263  140 ARG A NH1   
1159 N NH2   . ARG A 140 ? 0.6326 0.6458 0.3768 -0.0512 0.0288  0.0287  140 ARG A NH2   
1160 N N     . ILE A 141 ? 0.4515 0.5111 0.2776 -0.0622 0.0693  -0.0622 141 ILE A N     
1161 C CA    . ILE A 141 ? 0.4432 0.5108 0.2941 -0.0600 0.0732  -0.0713 141 ILE A CA    
1162 C C     . ILE A 141 ? 0.4500 0.5241 0.3077 -0.0622 0.0797  -0.0837 141 ILE A C     
1163 O O     . ILE A 141 ? 0.4418 0.5233 0.3202 -0.0612 0.0849  -0.0916 141 ILE A O     
1164 C CB    . ILE A 141 ? 0.4147 0.4862 0.2834 -0.0518 0.0630  -0.0684 141 ILE A CB    
1165 C CG1   . ILE A 141 ? 0.4130 0.4923 0.3042 -0.0503 0.0658  -0.0729 141 ILE A CG1   
1166 C CG2   . ILE A 141 ? 0.4233 0.4983 0.2970 -0.0476 0.0565  -0.0716 141 ILE A CG2   
1167 C CD1   . ILE A 141 ? 0.4153 0.4916 0.3047 -0.0551 0.0726  -0.0710 141 ILE A CD1   
1168 N N     . LYS A 142 ? 0.4751 0.5472 0.3162 -0.0654 0.0795  -0.0858 142 LYS A N     
1169 C CA    . LYS A 142 ? 0.4909 0.5678 0.3362 -0.0689 0.0873  -0.0991 142 LYS A CA    
1170 C C     . LYS A 142 ? 0.4966 0.5771 0.3489 -0.0744 0.1014  -0.1079 142 LYS A C     
1171 O O     . LYS A 142 ? 0.5112 0.5877 0.3481 -0.0809 0.1080  -0.1043 142 LYS A O     
1172 C CB    . LYS A 142 ? 0.5224 0.5964 0.3417 -0.0749 0.0867  -0.1000