data_3OVS
# 
_entry.id   3OVS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OVS         
NDB   NA0762       
RCSB  RCSB061634   
WWPDB D_1000061634 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3OUY . unspecified 
PDB 3OV7 . unspecified 
PDB 3OVA . unspecified 
PDB 3OVB . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3OVS 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pan, B.C.'    1 
'Xiong, Y.'    2 
'Steitz, T.A.' 3 
# 
_citation.id                        primary 
_citation.title                     'How the CCA-Adding Enzyme Selects Adenine over Cytosine at Position 76 of tRNA.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            330 
_citation.page_first                937 
_citation.page_last                 940 
_citation.year                      2010 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21071662 
_citation.pdbx_database_id_DOI      10.1126/science.1194985 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pan, B.'      1 
primary 'Xiong, Y.'    2 
primary 'Steitz, T.A.' 3 
# 
_cell.entry_id           3OVS 
_cell.length_a           111.307 
_cell.length_b           218.216 
_cell.length_c           58.369 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3OVS 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'CCA-Adding Enzyme'        51905.746 2  '2.7.7.25, 2.7.7.21' ? ? ? 
2 polymer     syn 'RNA (34-MER)'             10837.447 2  ?                    ? ? ? 
3 non-polymer syn "CYTIDINE-5'-TRIPHOSPHATE" 483.156   2  ?                    ? ? ? 
4 non-polymer syn 'SULFATE ION'              96.063    6  ?                    ? ? ? 
5 non-polymer syn 1,2-ETHANEDIOL             62.068    3  ?                    ? ? ? 
6 non-polymer syn 'CALCIUM ION'              40.078    1  ?                    ? ? ? 
7 water       nat water                      18.015    96 ?                    ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
2 'tRNA nucleotidyltransferase, tRNA adenylyl-/cytidylyl- transferase, tRNA CCA-pyrophosphorylase, tRNA-NT' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDVCCM
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDVCCM
;
A,B ? 
2 polyribonucleotide no no GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACC GGAAGUAGAUGGUUCAAGUCCAUUUACUUCCACC C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   GLU n 
1 5   GLU n 
1 6   ILE n 
1 7   LEU n 
1 8   GLU n 
1 9   LYS n 
1 10  ALA n 
1 11  LEU n 
1 12  GLU n 
1 13  LEU n 
1 14  VAL n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  GLU n 
1 19  GLU n 
1 20  GLU n 
1 21  VAL n 
1 22  ARG n 
1 23  LYS n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ALA n 
1 28  GLU n 
1 29  GLU n 
1 30  GLU n 
1 31  LEU n 
1 32  ARG n 
1 33  ARG n 
1 34  ARG n 
1 35  LEU n 
1 36  ASP n 
1 37  GLU n 
1 38  LEU n 
1 39  GLY n 
1 40  VAL n 
1 41  GLU n 
1 42  TYR n 
1 43  VAL n 
1 44  PHE n 
1 45  VAL n 
1 46  GLY n 
1 47  SER n 
1 48  TYR n 
1 49  ALA n 
1 50  ARG n 
1 51  ASN n 
1 52  THR n 
1 53  TRP n 
1 54  LEU n 
1 55  LYS n 
1 56  GLY n 
1 57  SER n 
1 58  LEU n 
1 59  GLU n 
1 60  ILE n 
1 61  ASP n 
1 62  VAL n 
1 63  PHE n 
1 64  LEU n 
1 65  LEU n 
1 66  PHE n 
1 67  PRO n 
1 68  GLU n 
1 69  GLU n 
1 70  PHE n 
1 71  SER n 
1 72  LYS n 
1 73  GLU n 
1 74  GLU n 
1 75  LEU n 
1 76  ARG n 
1 77  GLU n 
1 78  ARG n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ILE n 
1 83  GLY n 
1 84  LYS n 
1 85  ALA n 
1 86  VAL n 
1 87  LEU n 
1 88  ASP n 
1 89  SER n 
1 90  TYR n 
1 91  GLU n 
1 92  ILE n 
1 93  ARG n 
1 94  TYR n 
1 95  ALA n 
1 96  GLU n 
1 97  HIS n 
1 98  PRO n 
1 99  TYR n 
1 100 VAL n 
1 101 HIS n 
1 102 GLY n 
1 103 VAL n 
1 104 VAL n 
1 105 LYS n 
1 106 GLY n 
1 107 VAL n 
1 108 GLU n 
1 109 VAL n 
1 110 ASP n 
1 111 VAL n 
1 112 VAL n 
1 113 PRO n 
1 114 CYS n 
1 115 TYR n 
1 116 LYS n 
1 117 LEU n 
1 118 LYS n 
1 119 GLU n 
1 120 PRO n 
1 121 LYS n 
1 122 ASN n 
1 123 ILE n 
1 124 LYS n 
1 125 SER n 
1 126 ALA n 
1 127 VAL n 
1 128 ASP n 
1 129 ARG n 
1 130 THR n 
1 131 PRO n 
1 132 PHE n 
1 133 HIS n 
1 134 HIS n 
1 135 LYS n 
1 136 TRP n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 ARG n 
1 141 ILE n 
1 142 LYS n 
1 143 GLY n 
1 144 LYS n 
1 145 GLU n 
1 146 ASN n 
1 147 GLU n 
1 148 VAL n 
1 149 ARG n 
1 150 LEU n 
1 151 LEU n 
1 152 LYS n 
1 153 GLY n 
1 154 PHE n 
1 155 LEU n 
1 156 LYS n 
1 157 ALA n 
1 158 ASN n 
1 159 GLY n 
1 160 ILE n 
1 161 TYR n 
1 162 GLY n 
1 163 ALA n 
1 164 GLU n 
1 165 TYR n 
1 166 LYS n 
1 167 VAL n 
1 168 ARG n 
1 169 GLY n 
1 170 PHE n 
1 171 SER n 
1 172 GLY n 
1 173 TYR n 
1 174 LEU n 
1 175 CYS n 
1 176 GLU n 
1 177 LEU n 
1 178 LEU n 
1 179 ILE n 
1 180 VAL n 
1 181 PHE n 
1 182 TYR n 
1 183 GLY n 
1 184 SER n 
1 185 PHE n 
1 186 LEU n 
1 187 GLU n 
1 188 THR n 
1 189 VAL n 
1 190 LYS n 
1 191 ASN n 
1 192 ALA n 
1 193 ARG n 
1 194 ARG n 
1 195 TRP n 
1 196 THR n 
1 197 ARG n 
1 198 ARG n 
1 199 THR n 
1 200 VAL n 
1 201 ILE n 
1 202 ASP n 
1 203 VAL n 
1 204 ALA n 
1 205 LYS n 
1 206 GLY n 
1 207 GLU n 
1 208 VAL n 
1 209 ARG n 
1 210 LYS n 
1 211 GLY n 
1 212 GLU n 
1 213 GLU n 
1 214 PHE n 
1 215 PHE n 
1 216 VAL n 
1 217 VAL n 
1 218 ASP n 
1 219 PRO n 
1 220 VAL n 
1 221 ASP n 
1 222 GLU n 
1 223 LYS n 
1 224 ARG n 
1 225 ASN n 
1 226 VAL n 
1 227 ALA n 
1 228 ALA n 
1 229 ASN n 
1 230 LEU n 
1 231 SER n 
1 232 LEU n 
1 233 ASP n 
1 234 ASN n 
1 235 LEU n 
1 236 ALA n 
1 237 ARG n 
1 238 PHE n 
1 239 VAL n 
1 240 HIS n 
1 241 LEU n 
1 242 CYS n 
1 243 ARG n 
1 244 GLU n 
1 245 PHE n 
1 246 MET n 
1 247 GLU n 
1 248 ALA n 
1 249 PRO n 
1 250 SER n 
1 251 LEU n 
1 252 GLY n 
1 253 PHE n 
1 254 PHE n 
1 255 LYS n 
1 256 PRO n 
1 257 LYS n 
1 258 HIS n 
1 259 PRO n 
1 260 LEU n 
1 261 GLU n 
1 262 ILE n 
1 263 GLU n 
1 264 PRO n 
1 265 GLU n 
1 266 ARG n 
1 267 LEU n 
1 268 ARG n 
1 269 LYS n 
1 270 ILE n 
1 271 VAL n 
1 272 GLU n 
1 273 GLU n 
1 274 ARG n 
1 275 GLY n 
1 276 THR n 
1 277 ALA n 
1 278 VAL n 
1 279 PHE n 
1 280 ALA n 
1 281 VAL n 
1 282 LYS n 
1 283 PHE n 
1 284 ARG n 
1 285 LYS n 
1 286 PRO n 
1 287 ASP n 
1 288 ILE n 
1 289 VAL n 
1 290 ASP n 
1 291 ASP n 
1 292 ASN n 
1 293 LEU n 
1 294 TYR n 
1 295 PRO n 
1 296 GLN n 
1 297 LEU n 
1 298 GLU n 
1 299 ARG n 
1 300 ALA n 
1 301 SER n 
1 302 ARG n 
1 303 LYS n 
1 304 ILE n 
1 305 PHE n 
1 306 GLU n 
1 307 PHE n 
1 308 LEU n 
1 309 GLU n 
1 310 ARG n 
1 311 GLU n 
1 312 ASN n 
1 313 PHE n 
1 314 MET n 
1 315 PRO n 
1 316 LEU n 
1 317 ARG n 
1 318 SER n 
1 319 ALA n 
1 320 PHE n 
1 321 LYS n 
1 322 ALA n 
1 323 SER n 
1 324 GLU n 
1 325 GLU n 
1 326 PHE n 
1 327 CYS n 
1 328 TYR n 
1 329 LEU n 
1 330 LEU n 
1 331 PHE n 
1 332 GLU n 
1 333 CYS n 
1 334 GLN n 
1 335 ILE n 
1 336 LYS n 
1 337 GLU n 
1 338 ILE n 
1 339 SER n 
1 340 ARG n 
1 341 VAL n 
1 342 PHE n 
1 343 ARG n 
1 344 ARG n 
1 345 MET n 
1 346 GLY n 
1 347 PRO n 
1 348 GLN n 
1 349 PHE n 
1 350 GLU n 
1 351 ASP n 
1 352 GLU n 
1 353 ARG n 
1 354 ASN n 
1 355 VAL n 
1 356 LYS n 
1 357 LYS n 
1 358 PHE n 
1 359 LEU n 
1 360 SER n 
1 361 ARG n 
1 362 ASN n 
1 363 ARG n 
1 364 ALA n 
1 365 PHE n 
1 366 ARG n 
1 367 PRO n 
1 368 PHE n 
1 369 ILE n 
1 370 GLU n 
1 371 ASN n 
1 372 GLY n 
1 373 ARG n 
1 374 TRP n 
1 375 TRP n 
1 376 ALA n 
1 377 PHE n 
1 378 GLU n 
1 379 MET n 
1 380 ARG n 
1 381 LYS n 
1 382 PHE n 
1 383 THR n 
1 384 THR n 
1 385 PRO n 
1 386 GLU n 
1 387 GLU n 
1 388 GLY n 
1 389 VAL n 
1 390 ARG n 
1 391 SER n 
1 392 TYR n 
1 393 ALA n 
1 394 SER n 
1 395 THR n 
1 396 HIS n 
1 397 TRP n 
1 398 HIS n 
1 399 THR n 
1 400 LEU n 
1 401 GLY n 
1 402 LYS n 
1 403 ASN n 
1 404 VAL n 
1 405 GLY n 
1 406 GLU n 
1 407 SER n 
1 408 ILE n 
1 409 ARG n 
1 410 GLU n 
1 411 TYR n 
1 412 PHE n 
1 413 GLU n 
1 414 ILE n 
1 415 ILE n 
1 416 SER n 
1 417 GLY n 
1 418 GLU n 
1 419 LYS n 
1 420 LEU n 
1 421 PHE n 
1 422 LYS n 
1 423 GLU n 
1 424 PRO n 
1 425 VAL n 
1 426 THR n 
1 427 ALA n 
1 428 GLU n 
1 429 LEU n 
1 430 CYS n 
1 431 GLU n 
1 432 MET n 
1 433 MET n 
1 434 GLY n 
1 435 VAL n 
1 436 LYS n 
1 437 ASP n 
1 438 VAL n 
1 439 CYS n 
1 440 CYS n 
1 441 MET n 
2 1   G   n 
2 2   G   n 
2 3   A   n 
2 4   A   n 
2 5   G   n 
2 6   U   n 
2 7   A   n 
2 8   G   n 
2 9   A   n 
2 10  U   n 
2 11  G   n 
2 12  G   n 
2 13  U   n 
2 14  U   n 
2 15  C   n 
2 16  A   n 
2 17  A   n 
2 18  G   n 
2 19  U   n 
2 20  C   n 
2 21  C   n 
2 22  A   n 
2 23  U   n 
2 24  U   n 
2 25  U   n 
2 26  A   n 
2 27  C   n 
2 28  U   n 
2 29  U   n 
2 30  C   n 
2 31  C   n 
2 32  A   n 
2 33  C   n 
2 34  C   n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Archaeoglobus fulgidus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      2234 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Chemistry Synthesis' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CCA_ARCFU 1 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 O28126 ? 
2 PDB 3OVS      2 ? ? 3OVS   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3OVS A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 1 3OVS B 1 ? 437 ? O28126 1 ? 437 ? 1 437 
3 2 3OVS C 1 ? 34  ? 3OVS   1 ? 34  ? 1 34  
4 2 3OVS D 1 ? 34  ? 3OVS   1 ? 34  ? 1 34  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3OVS VAL A 438 ? UNP O28126 ? ? 'EXPRESSION TAG' 438 1 
1 3OVS CYS A 439 ? UNP O28126 ? ? 'EXPRESSION TAG' 439 2 
1 3OVS CYS A 440 ? UNP O28126 ? ? 'EXPRESSION TAG' 440 3 
1 3OVS MET A 441 ? UNP O28126 ? ? 'EXPRESSION TAG' 441 4 
2 3OVS VAL B 438 ? UNP O28126 ? ? 'EXPRESSION TAG' 438 5 
2 3OVS CYS B 439 ? UNP O28126 ? ? 'EXPRESSION TAG' 439 6 
2 3OVS CYS B 440 ? UNP O28126 ? ? 'EXPRESSION TAG' 440 7 
2 3OVS MET B 441 ? UNP O28126 ? ? 'EXPRESSION TAG' 441 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P'  347.221 
ALA 'L-peptide linking' y ALANINE                      ?                 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                     ?                 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                 'C4 H7 N O4'       133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O8 P'   323.197 
CA  non-polymer         . 'CALCIUM ION'                ?                 'Ca 2'             40.078  
CTP non-polymer         . "CYTIDINE-5'-TRIPHOSPHATE"   ?                 'C9 H16 N3 O14 P3' 483.156 
CYS 'L-peptide linking' y CYSTEINE                     ?                 'C3 H7 N O2 S'     121.158 
EDO non-polymer         . 1,2-ETHANEDIOL               'ETHYLENE GLYCOL' 'C2 H6 O2'         62.068  
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O8 P'  363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ?                 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                      ?                 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                    ?                 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                        ?                 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ?                 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                      ?                 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                       ?                 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                   ?                 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ?                 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                      ?                 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                       ?                 'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                ?                 'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                    ?                 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                     ?                 'C9 H11 N O3'      181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ?                 'C9 H13 N2 O9 P'   324.181 
VAL 'L-peptide linking' y VALINE                       ?                 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3OVS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.82 
_exptl_crystal.density_percent_sol   56.45 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;20% PEG 4000, 0.2 M tri-lithium citrate, 80 mM ammonium sulfate, 50 mM HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 300K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2007-07-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             1.00 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3OVS 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.780 
_reflns.number_obs                   35291 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.14400 
_reflns.pdbx_netI_over_sigmaI        9.6000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.700 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.78 
_reflns_shell.d_res_low              2.88 
_reflns_shell.percent_possible_all   85.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3OVS 
_refine.ls_number_reflns_obs                     33457 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.80 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.214 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.211 
_refine.ls_R_factor_R_free                       0.268 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1767 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.926 
_refine.correlation_coeff_Fo_to_Fc_free          0.883 
_refine.B_iso_mean                               61.630 
_refine.aniso_B[1][1]                            -0.01000 
_refine.aniso_B[2][2]                            0.01000 
_refine.aniso_B[3][3]                            0.00000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.394 
_refine.overall_SU_ML                            0.301 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             31.094 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7285 
_refine_hist.pdbx_number_atoms_nucleic_acid   1440 
_refine_hist.pdbx_number_atoms_ligand         101 
_refine_hist.number_atoms_solvent             96 
_refine_hist.number_atoms_total               8922 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        37.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.022  ? 9143  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.265  2.181  ? 12632 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.999  5.000  ? 876   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.885 22.784 ? 388   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       20.638 15.000 ? 1396  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.705 15.000 ? 80    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.091  0.200  ? 1387  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 6400  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.200  0.200  ? 4155  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.304  0.200  ? 6103  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.155  0.200  ? 277   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.225  0.200  ? 65    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.394  0.200  ? 2     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.399  1.500  ? 4478  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.699  2.000  ? 7059  'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.992  3.000  ? 5630  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.765  4.500  ? 5573  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.87 
_refine_ls_shell.number_reflns_R_work             1958 
_refine_ls_shell.R_factor_R_work                  0.3430 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.3980 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             90 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3OVS 
_struct.title                     'How the CCA-adding Enzyme Selects Adenine over Cytosine in Position 76 of tRNA' 
_struct.pdbx_descriptor           'Protein (E.C.2.7.7.25, 2.7.7.21)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OVS 
_struct_keywords.pdbx_keywords   Transferase/RNA 
_struct_keywords.text            'Protein-RNA, Rossmann Fold, CCA-adding, tRNA, Nucleotidyltransfer, Transferase-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 6 ? 
N N N 3 ? 
O N N 4 ? 
P N N 5 ? 
Q N N 7 ? 
R N N 7 ? 
S N N 7 ? 
T N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 2   ? ILE A 15  ? LYS A 2   ILE A 15  1 ? 14 
HELX_P HELX_P2  2  ASP A 17  ? ASP A 36  ? ASP A 17  ASP A 36  1 ? 20 
HELX_P HELX_P3  3  GLY A 46  ? ARG A 50  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  4  SER A 71  ? LEU A 87  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  5  ARG A 129 ? GLY A 139 ? ARG A 129 GLY A 139 1 ? 11 
HELX_P HELX_P6  6  LYS A 144 ? ASN A 158 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P7  7  SER A 171 ? GLY A 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P8  8  SER A 184 ? ARG A 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P9  9  SER A 231 ? ALA A 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P10 10 SER A 250 ? LYS A 255 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P11 11 GLU A 263 ? GLY A 275 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P12 12 VAL A 289 ? GLU A 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P13 13 ASP A 351 ? SER A 360 ? ASP A 351 SER A 360 1 ? 10 
HELX_P HELX_P14 14 THR A 384 ? HIS A 396 ? THR A 384 HIS A 396 1 ? 13 
HELX_P HELX_P15 15 TRP A 397 ? LEU A 400 ? TRP A 397 LEU A 400 5 ? 4  
HELX_P HELX_P16 16 GLY A 401 ? TYR A 411 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P17 17 GLY A 417 ? LYS A 422 ? GLY A 417 LYS A 422 1 ? 6  
HELX_P HELX_P18 18 VAL A 425 ? GLY A 434 ? VAL A 425 GLY A 434 1 ? 10 
HELX_P HELX_P19 19 GLU B 4   ? ILE B 15  ? GLU B 4   ILE B 15  1 ? 12 
HELX_P HELX_P20 20 ASP B 17  ? LEU B 38  ? ASP B 17  LEU B 38  1 ? 22 
HELX_P HELX_P21 21 SER B 47  ? ASN B 51  ? SER B 47  ASN B 51  5 ? 5  
HELX_P HELX_P22 22 SER B 71  ? ALA B 85  ? SER B 71  ALA B 85  1 ? 15 
HELX_P HELX_P23 23 ASP B 128 ? GLU B 138 ? ASP B 128 GLU B 138 1 ? 11 
HELX_P HELX_P24 24 GLU B 145 ? ASN B 158 ? GLU B 145 ASN B 158 1 ? 14 
HELX_P HELX_P25 25 SER B 171 ? GLY B 183 ? SER B 171 GLY B 183 1 ? 13 
HELX_P HELX_P26 26 SER B 184 ? ARG B 193 ? SER B 184 ARG B 193 1 ? 10 
HELX_P HELX_P27 27 SER B 231 ? ALA B 248 ? SER B 231 ALA B 248 1 ? 18 
HELX_P HELX_P28 28 SER B 250 ? PHE B 254 ? SER B 250 PHE B 254 5 ? 5  
HELX_P HELX_P29 29 GLU B 263 ? GLY B 275 ? GLU B 263 GLY B 275 1 ? 13 
HELX_P HELX_P30 30 VAL B 289 ? GLU B 311 ? VAL B 289 GLU B 311 1 ? 23 
HELX_P HELX_P31 31 ASP B 351 ? SER B 360 ? ASP B 351 SER B 360 1 ? 10 
HELX_P HELX_P32 32 THR B 384 ? HIS B 396 ? THR B 384 HIS B 396 1 ? 13 
HELX_P HELX_P33 33 TRP B 397 ? LEU B 400 ? TRP B 397 LEU B 400 5 ? 4  
HELX_P HELX_P34 34 GLY B 401 ? TYR B 411 ? GLY B 401 TYR B 411 1 ? 11 
HELX_P HELX_P35 35 GLU B 418 ? GLU B 423 ? GLU B 418 GLU B 423 5 ? 6  
HELX_P HELX_P36 36 VAL B 425 ? GLY B 434 ? VAL B 425 GLY B 434 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 59 OE1 ? ? ? 1_555 M CA .  CA ? ? A GLU 59  A CA 801 1_555 ? ? ? ? ? ? ?            2.650 ? 
metalc2  metalc ? ? E CTP .  O1A ? ? ? 1_555 M CA .  CA ? ? A CTP 501 A CA 801 1_555 ? ? ? ? ? ? ?            2.661 ? 
metalc3  metalc ? ? A ASP 61 OD1 ? ? ? 1_555 M CA .  CA ? ? A ASP 61  A CA 801 1_555 ? ? ? ? ? ? ?            2.738 ? 
hydrog1  hydrog ? ? C G   1  N1  ? ? ? 1_555 C C  31 N3 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C G   1  N2  ? ? ? 1_555 C C  31 O2 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C G   1  O6  ? ? ? 1_555 C C  31 N4 ? ? C G   1   C C  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C G   2  N1  ? ? ? 1_555 C C  30 N3 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C G   2  N2  ? ? ? 1_555 C C  30 O2 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C G   2  O6  ? ? ? 1_555 C C  30 N4 ? ? C G   2   C C  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C A   3  N1  ? ? ? 1_555 C U  29 N3 ? ? C A   3   C U  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C A   3  N6  ? ? ? 1_555 C U  29 O4 ? ? C A   3   C U  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C A   4  N1  ? ? ? 1_555 C U  28 N3 ? ? C A   4   C U  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C A   4  N6  ? ? ? 1_555 C U  28 O4 ? ? C A   4   C U  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C G   5  N1  ? ? ? 1_555 C C  27 O2 ? ? C G   5   C C  27  1_555 ? ? ? ? ? ? 'G-C PAIR'   ?     ? 
hydrog12 hydrog ? ? C U   6  N3  ? ? ? 1_555 C A  26 N1 ? ? C U   6   C A  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C U   6  O4  ? ? ? 1_555 C A  26 N6 ? ? C U   6   C A  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C A   7  N1  ? ? ? 1_555 C U  25 N3 ? ? C A   7   C U  25  1_555 ? ? ? ? ? ? 'A-U PAIR'   ?     ? 
hydrog15 hydrog ? ? C G   8  N1  ? ? ? 1_555 C U  24 O2 ? ? C G   8   C U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog16 hydrog ? ? C G   8  O6  ? ? ? 1_555 C U  24 N3 ? ? C G   8   C U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog17 hydrog ? ? C A   9  N1  ? ? ? 1_555 C U  23 N3 ? ? C A   9   C U  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C A   9  N6  ? ? ? 1_555 C U  23 O4 ? ? C A   9   C U  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C U   10 N3  ? ? ? 1_555 C A  22 N1 ? ? C U   10  C A  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C U   10 O4  ? ? ? 1_555 C A  22 N6 ? ? C U   10  C A  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C G   11 N1  ? ? ? 1_555 C C  21 N3 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C G   11 N2  ? ? ? 1_555 C C  21 O2 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C G   11 O6  ? ? ? 1_555 C C  21 N4 ? ? C G   11  C C  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C G   12 N1  ? ? ? 1_555 C C  20 N3 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C G   12 N2  ? ? ? 1_555 C C  20 O2 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C G   12 O6  ? ? ? 1_555 C C  20 N4 ? ? C G   12  C C  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C U   13 N3  ? ? ? 1_555 C A  17 N7 ? ? C U   13  C A  17  1_555 ? ? ? ? ? ? 'U-A PAIR'   ?     ? 
hydrog28 hydrog ? ? D G   1  N1  ? ? ? 1_555 D C  31 N3 ? ? D G   1   D C  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? D G   1  N2  ? ? ? 1_555 D C  31 O2 ? ? D G   1   D C  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? D G   1  O6  ? ? ? 1_555 D C  31 N4 ? ? D G   1   D C  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? D G   2  N1  ? ? ? 1_555 D C  30 N3 ? ? D G   2   D C  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? D G   2  N2  ? ? ? 1_555 D C  30 O2 ? ? D G   2   D C  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? D G   2  O6  ? ? ? 1_555 D C  30 N4 ? ? D G   2   D C  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? D A   3  N1  ? ? ? 1_555 D U  29 N3 ? ? D A   3   D U  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? D A   3  N6  ? ? ? 1_555 D U  29 O4 ? ? D A   3   D U  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? D A   4  N1  ? ? ? 1_555 D U  28 N3 ? ? D A   4   D U  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? D A   4  N6  ? ? ? 1_555 D U  28 O4 ? ? D A   4   D U  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? D G   5  N1  ? ? ? 1_555 D C  27 N3 ? ? D G   5   D C  27  1_555 ? ? ? ? ? ? 'G-C PAIR'   ?     ? 
hydrog39 hydrog ? ? D U   6  N3  ? ? ? 1_555 D A  26 N1 ? ? D U   6   D A  26  1_555 ? ? ? ? ? ? 'U-A PAIR'   ?     ? 
hydrog40 hydrog ? ? D A   7  N1  ? ? ? 1_555 D U  25 N3 ? ? D A   7   D U  25  1_555 ? ? ? ? ? ? 'A-U PAIR'   ?     ? 
hydrog41 hydrog ? ? D G   8  N1  ? ? ? 1_555 D U  24 O2 ? ? D G   8   D U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog42 hydrog ? ? D G   8  O6  ? ? ? 1_555 D U  24 N3 ? ? D G   8   D U  24  1_555 ? ? ? ? ? ? TYPE_28_PAIR ?     ? 
hydrog43 hydrog ? ? D A   9  N1  ? ? ? 1_555 D U  23 N3 ? ? D A   9   D U  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? D A   9  N6  ? ? ? 1_555 D U  23 O4 ? ? D A   9   D U  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? D U   10 N3  ? ? ? 1_555 D A  22 N1 ? ? D U   10  D A  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? D U   10 O4  ? ? ? 1_555 D A  22 N6 ? ? D U   10  D A  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? D G   11 N1  ? ? ? 1_555 D C  21 N3 ? ? D G   11  D C  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? D G   11 N2  ? ? ? 1_555 D C  21 O2 ? ? D G   11  D C  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? D G   11 O6  ? ? ? 1_555 D C  21 N4 ? ? D G   11  D C  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? D G   12 N1  ? ? ? 1_555 D C  20 N3 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? D G   12 N2  ? ? ? 1_555 D C  20 O2 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? D G   12 O6  ? ? ? 1_555 D C  20 N4 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? D U   13 N3  ? ? ? 1_555 D A  17 N7 ? ? D U   13  D A  17  1_555 ? ? ? ? ? ? 'U-A PAIR'   ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           438 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            438 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   CYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    439 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    CYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     439 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -16.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
E ? 5 ? 
F ? 3 ? 
G ? 4 ? 
H ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 42  ? VAL A 45  ? TYR A 42  VAL A 45  
A 2 GLU A 59  ? PHE A 66  ? GLU A 59  PHE A 66  
A 3 VAL A 107 ? TYR A 115 ? VAL A 107 TYR A 115 
A 4 VAL A 100 ? VAL A 104 ? VAL A 100 VAL A 104 
A 5 SER A 89  ? GLU A 91  ? SER A 89  GLU A 91  
B 1 GLU A 207 ? LYS A 210 ? GLU A 207 LYS A 210 
B 2 THR A 199 ? ASP A 202 ? THR A 199 ASP A 202 
B 3 PHE A 215 ? ASP A 218 ? PHE A 215 ASP A 218 
B 4 ASP A 221 ? ASN A 225 ? ASP A 221 ASN A 225 
C 1 PRO A 315 ? ALA A 322 ? PRO A 315 ALA A 322 
C 2 PHE A 326 ? CYS A 333 ? PHE A 326 CYS A 333 
C 3 ALA A 277 ? ARG A 284 ? ALA A 277 ARG A 284 
C 4 GLU A 413 ? SER A 416 ? GLU A 413 SER A 416 
D 1 VAL A 341 ? GLN A 348 ? VAL A 341 GLN A 348 
D 2 ARG A 373 ? MET A 379 ? ARG A 373 MET A 379 
D 3 PHE A 368 ? GLU A 370 ? PHE A 368 GLU A 370 
E 1 TYR B 42  ? VAL B 45  ? TYR B 42  VAL B 45  
E 2 GLU B 59  ? PHE B 66  ? GLU B 59  PHE B 66  
E 3 VAL B 107 ? TYR B 115 ? VAL B 107 TYR B 115 
E 4 VAL B 100 ? VAL B 104 ? VAL B 100 VAL B 104 
E 5 SER B 89  ? ILE B 92  ? SER B 89  ILE B 92  
F 1 GLU B 207 ? LYS B 210 ? GLU B 207 LYS B 210 
F 2 THR B 199 ? ASP B 202 ? THR B 199 ASP B 202 
F 3 PHE B 215 ? VAL B 217 ? PHE B 215 VAL B 217 
G 1 PRO B 315 ? ALA B 322 ? PRO B 315 ALA B 322 
G 2 PHE B 326 ? CYS B 333 ? PHE B 326 CYS B 333 
G 3 ALA B 277 ? ARG B 284 ? ALA B 277 ARG B 284 
G 4 GLU B 413 ? SER B 416 ? GLU B 413 SER B 416 
H 1 VAL B 341 ? GLN B 348 ? VAL B 341 GLN B 348 
H 2 ARG B 373 ? MET B 379 ? ARG B 373 MET B 379 
H 3 PHE B 368 ? GLU B 370 ? PHE B 368 GLU B 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 43  ? N VAL A 43  O PHE A 63  ? O PHE A 63  
A 2 3 N VAL A 62  ? N VAL A 62  O VAL A 112 ? O VAL A 112 
A 3 4 O VAL A 109 ? O VAL A 109 N GLY A 102 ? N GLY A 102 
A 4 5 O HIS A 101 ? O HIS A 101 N GLU A 91  ? N GLU A 91  
B 1 2 O ARG A 209 ? O ARG A 209 N VAL A 200 ? N VAL A 200 
B 2 3 N ILE A 201 ? N ILE A 201 O VAL A 217 ? O VAL A 217 
B 3 4 N ASP A 218 ? N ASP A 218 O ARG A 224 ? O ARG A 224 
C 1 2 N LEU A 316 ? N LEU A 316 O GLU A 332 ? O GLU A 332 
C 2 3 O CYS A 327 ? O CYS A 327 N PHE A 283 ? N PHE A 283 
C 3 4 N ALA A 280 ? N ALA A 280 O ILE A 415 ? O ILE A 415 
D 1 2 N PRO A 347 ? N PRO A 347 O TRP A 374 ? O TRP A 374 
D 2 3 O ARG A 373 ? O ARG A 373 N GLU A 370 ? N GLU A 370 
E 1 2 N VAL B 43  ? N VAL B 43  O PHE B 63  ? O PHE B 63  
E 2 3 N ILE B 60  ? N ILE B 60  O ASP B 110 ? O ASP B 110 
E 3 4 O VAL B 109 ? O VAL B 109 N GLY B 102 ? N GLY B 102 
E 4 5 O HIS B 101 ? O HIS B 101 N GLU B 91  ? N GLU B 91  
F 1 2 O ARG B 209 ? O ARG B 209 N VAL B 200 ? N VAL B 200 
F 2 3 N THR B 199 ? N THR B 199 O PHE B 215 ? O PHE B 215 
G 1 2 N ALA B 319 ? N ALA B 319 O LEU B 330 ? O LEU B 330 
G 2 3 O CYS B 333 ? O CYS B 333 N ALA B 277 ? N ALA B 277 
G 3 4 N ALA B 280 ? N ALA B 280 O ILE B 415 ? O ILE B 415 
H 1 2 N ARG B 344 ? N ARG B 344 O ALA B 376 ? O ALA B 376 
H 2 3 O ARG B 373 ? O ARG B 373 N GLU B 370 ? N GLU B 370 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE CTP A 501' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 601' 
AC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE SO4 A 602' 
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 603' 
AC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 604' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 606' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE EDO A 701' 
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE EDO A 702' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A 801'  
BC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CTP B 502' 
BC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 B 605' 
BC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE EDO B 703' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 GLY A 46  ? GLY A 46  . ? 1_555 ? 
2  AC1 18 SER A 47  ? SER A 47  . ? 1_555 ? 
3  AC1 18 ARG A 50  ? ARG A 50  . ? 1_555 ? 
4  AC1 18 ASP A 61  ? ASP A 61  . ? 1_555 ? 
5  AC1 18 THR A 130 ? THR A 130 . ? 1_555 ? 
6  AC1 18 HIS A 133 ? HIS A 133 . ? 1_555 ? 
7  AC1 18 LYS A 152 ? LYS A 152 . ? 1_555 ? 
8  AC1 18 TYR A 161 ? TYR A 161 . ? 1_555 ? 
9  AC1 18 TYR A 173 ? TYR A 173 . ? 1_555 ? 
10 AC1 18 ARG A 224 ? ARG A 224 . ? 1_555 ? 
11 AC1 18 HOH Q .   ? HOH A 489 . ? 1_555 ? 
12 AC1 18 HOH Q .   ? HOH A 491 . ? 1_555 ? 
13 AC1 18 HOH Q .   ? HOH A 508 . ? 1_555 ? 
14 AC1 18 HOH Q .   ? HOH A 509 . ? 1_555 ? 
15 AC1 18 CA  M .   ? CA  A 801 . ? 1_555 ? 
16 AC1 18 A   C 32  ? A   C 32  . ? 1_555 ? 
17 AC1 18 C   C 33  ? C   C 33  . ? 1_555 ? 
18 AC1 18 C   C 34  ? C   C 34  . ? 1_555 ? 
19 AC2 3  ARG A 299 ? ARG A 299 . ? 1_555 ? 
20 AC2 3  ARG A 302 ? ARG A 302 . ? 1_555 ? 
21 AC2 3  LYS A 303 ? LYS A 303 . ? 1_555 ? 
22 AC3 1  ARG A 140 ? ARG A 140 . ? 1_555 ? 
23 AC4 5  VAL A 40  ? VAL A 40  . ? 1_555 ? 
24 AC4 5  GLU A 41  ? GLU A 41  . ? 1_555 ? 
25 AC4 5  LEU A 65  ? LEU A 65  . ? 1_555 ? 
26 AC4 5  PHE A 66  ? PHE A 66  . ? 1_555 ? 
27 AC4 5  ASP A 437 ? ASP A 437 . ? 4_554 ? 
28 AC5 3  ARG A 168 ? ARG A 168 . ? 1_555 ? 
29 AC5 3  SER A 231 ? SER A 231 . ? 1_555 ? 
30 AC5 3  LEU A 232 ? LEU A 232 . ? 1_555 ? 
31 AC6 5  ARG A 93  ? ARG A 93  . ? 1_555 ? 
32 AC6 5  TYR A 94  ? TYR A 94  . ? 1_555 ? 
33 AC6 5  ILE A 288 ? ILE A 288 . ? 1_555 ? 
34 AC6 5  VAL A 289 ? VAL A 289 . ? 1_555 ? 
35 AC6 5  ASN A 292 ? ASN A 292 . ? 1_555 ? 
36 AC7 4  ARG A 140 ? ARG A 140 . ? 1_555 ? 
37 AC7 4  ARG A 409 ? ARG A 409 . ? 1_554 ? 
38 AC7 4  TYR A 411 ? TYR A 411 . ? 1_554 ? 
39 AC7 4  PHE A 412 ? PHE A 412 . ? 1_554 ? 
40 AC8 5  ASN A 312 ? ASN A 312 . ? 1_555 ? 
41 AC8 5  PHE A 342 ? PHE A 342 . ? 1_555 ? 
42 AC8 5  ARG A 343 ? ARG A 343 . ? 1_555 ? 
43 AC8 5  MET B 314 ? MET B 314 . ? 1_555 ? 
44 AC8 5  GLN B 334 ? GLN B 334 . ? 1_555 ? 
45 AC9 3  GLU A 59  ? GLU A 59  . ? 1_555 ? 
46 AC9 3  ASP A 61  ? ASP A 61  . ? 1_555 ? 
47 AC9 3  CTP E .   ? CTP A 501 . ? 1_555 ? 
48 BC1 13 SER B 47  ? SER B 47  . ? 1_555 ? 
49 BC1 13 ARG B 50  ? ARG B 50  . ? 1_555 ? 
50 BC1 13 ASP B 61  ? ASP B 61  . ? 1_555 ? 
51 BC1 13 THR B 130 ? THR B 130 . ? 1_555 ? 
52 BC1 13 HIS B 133 ? HIS B 133 . ? 1_555 ? 
53 BC1 13 LYS B 152 ? LYS B 152 . ? 1_555 ? 
54 BC1 13 TYR B 161 ? TYR B 161 . ? 1_555 ? 
55 BC1 13 SER B 171 ? SER B 171 . ? 1_555 ? 
56 BC1 13 TYR B 173 ? TYR B 173 . ? 1_555 ? 
57 BC1 13 ARG B 224 ? ARG B 224 . ? 1_555 ? 
58 BC1 13 A   D 32  ? A   D 32  . ? 1_555 ? 
59 BC1 13 C   D 33  ? C   D 33  . ? 1_555 ? 
60 BC1 13 C   D 34  ? C   D 34  . ? 1_555 ? 
61 BC2 3  ARG B 299 ? ARG B 299 . ? 1_555 ? 
62 BC2 3  ARG B 302 ? ARG B 302 . ? 1_555 ? 
63 BC2 3  LYS B 303 ? LYS B 303 . ? 1_555 ? 
64 BC3 2  GLN B 348 ? GLN B 348 . ? 1_555 ? 
65 BC3 2  HOH R .   ? HOH B 460 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3OVS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3OVS 
_atom_sites.fract_transf_matrix[1][1]   0.008984 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004583 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017132 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -40.205 53.747  -45.140 1.00 82.77  ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -38.901 53.439  -44.480 1.00 79.04  ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -38.097 52.450  -45.348 1.00 76.58  ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -37.871 51.287  -44.982 1.00 74.83  ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -39.137 52.938  -43.040 1.00 78.09  ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? -37.863 52.615  -42.238 1.00 75.41  ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? -38.004 52.633  -40.425 1.00 74.96  ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? -39.589 51.803  -40.162 1.00 77.76  ? 1   MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? -37.687 52.930  -46.519 1.00 76.51  ? 2   LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? -36.901 52.129  -47.449 1.00 74.44  ? 2   LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? -35.446 52.070  -46.983 1.00 70.61  ? 2   LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? -34.907 53.044  -46.436 1.00 69.57  ? 2   LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? -36.980 52.715  -48.861 1.00 76.52  ? 2   LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? -37.325 51.709  -49.944 1.00 77.86  ? 2   LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? -36.725 52.105  -51.290 1.00 78.67  ? 2   LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? -35.569 51.183  -51.687 1.00 76.48  ? 2   LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? -34.614 50.859  -50.576 1.00 72.43  ? 2   LYS A NZ    1 
ATOM   18   N  N     . VAL A 1 3   ? -34.821 50.919  -47.211 1.00 68.16  ? 3   VAL A N     1 
ATOM   19   C  CA    . VAL A 1 3   ? -33.441 50.667  -46.795 1.00 64.54  ? 3   VAL A CA    1 
ATOM   20   C  C     . VAL A 1 3   ? -32.498 51.784  -47.250 1.00 63.76  ? 3   VAL A C     1 
ATOM   21   O  O     . VAL A 1 3   ? -31.739 52.334  -46.448 1.00 62.37  ? 3   VAL A O     1 
ATOM   22   C  CB    . VAL A 1 3   ? -32.924 49.305  -47.329 1.00 63.27  ? 3   VAL A CB    1 
ATOM   23   C  CG1   . VAL A 1 3   ? -31.596 48.964  -46.710 1.00 60.17  ? 3   VAL A CG1   1 
ATOM   24   C  CG2   . VAL A 1 3   ? -33.927 48.192  -47.051 1.00 64.61  ? 3   VAL A CG2   1 
ATOM   25   N  N     . GLU A 1 4   ? -32.558 52.118  -48.535 1.00 64.62  ? 4   GLU A N     1 
ATOM   26   C  CA    . GLU A 1 4   ? -31.685 53.141  -49.101 1.00 64.02  ? 4   GLU A CA    1 
ATOM   27   C  C     . GLU A 1 4   ? -31.950 54.541  -48.549 1.00 64.05  ? 4   GLU A C     1 
ATOM   28   O  O     . GLU A 1 4   ? -31.014 55.326  -48.406 1.00 63.18  ? 4   GLU A O     1 
ATOM   29   C  CB    . GLU A 1 4   ? -31.746 53.121  -50.628 1.00 66.13  ? 4   GLU A CB    1 
ATOM   30   C  CG    . GLU A 1 4   ? -30.845 52.052  -51.243 1.00 66.64  ? 4   GLU A CG    1 
ATOM   31   C  CD    . GLU A 1 4   ? -31.587 51.140  -52.213 1.00 71.53  ? 4   GLU A CD    1 
ATOM   32   O  OE1   . GLU A 1 4   ? -32.233 51.653  -53.164 1.00 74.75  ? 4   GLU A OE1   1 
ATOM   33   O  OE2   . GLU A 1 4   ? -31.517 49.901  -52.019 1.00 71.82  ? 4   GLU A OE2   1 
ATOM   34   N  N     . GLU A 1 5   ? -33.211 54.839  -48.229 1.00 64.79  ? 5   GLU A N     1 
ATOM   35   C  CA    . GLU A 1 5   ? -33.576 56.121  -47.619 1.00 64.88  ? 5   GLU A CA    1 
ATOM   36   C  C     . GLU A 1 5   ? -33.032 56.179  -46.195 1.00 61.54  ? 5   GLU A C     1 
ATOM   37   O  O     . GLU A 1 5   ? -32.651 57.245  -45.719 1.00 61.77  ? 5   GLU A O     1 
ATOM   38   C  CB    . GLU A 1 5   ? -35.096 56.325  -47.597 1.00 68.12  ? 5   GLU A CB    1 
ATOM   39   C  CG    . GLU A 1 5   ? -35.831 56.028  -48.912 1.00 71.66  ? 5   GLU A CG    1 
ATOM   40   C  CD    . GLU A 1 5   ? -36.111 57.266  -49.760 1.00 76.09  ? 5   GLU A CD    1 
ATOM   41   O  OE1   . GLU A 1 5   ? -35.146 57.942  -50.191 1.00 76.60  ? 5   GLU A OE1   1 
ATOM   42   O  OE2   . GLU A 1 5   ? -37.303 57.553  -50.014 1.00 78.74  ? 5   GLU A OE2   1 
ATOM   43   N  N     . ILE A 1 6   ? -33.004 55.030  -45.518 1.00 58.09  ? 6   ILE A N     1 
ATOM   44   C  CA    . ILE A 1 6   ? -32.462 54.933  -44.162 1.00 54.38  ? 6   ILE A CA    1 
ATOM   45   C  C     . ILE A 1 6   ? -30.975 55.269  -44.150 1.00 51.50  ? 6   ILE A C     1 
ATOM   46   O  O     . ILE A 1 6   ? -30.516 56.062  -43.329 1.00 50.92  ? 6   ILE A O     1 
ATOM   47   C  CB    . ILE A 1 6   ? -32.688 53.525  -43.550 1.00 52.87  ? 6   ILE A CB    1 
ATOM   48   C  CG1   . ILE A 1 6   ? -34.154 53.321  -43.155 1.00 54.50  ? 6   ILE A CG1   1 
ATOM   49   C  CG2   . ILE A 1 6   ? -31.767 53.285  -42.352 1.00 50.53  ? 6   ILE A CG2   1 
ATOM   50   C  CD1   . ILE A 1 6   ? -34.595 54.115  -41.934 1.00 55.97  ? 6   ILE A CD1   1 
ATOM   51   N  N     . LEU A 1 7   ? -30.236 54.668  -45.077 1.00 49.36  ? 7   LEU A N     1 
ATOM   52   C  CA    . LEU A 1 7   ? -28.795 54.848  -45.167 1.00 46.51  ? 7   LEU A CA    1 
ATOM   53   C  C     . LEU A 1 7   ? -28.407 56.253  -45.594 1.00 47.62  ? 7   LEU A C     1 
ATOM   54   O  O     . LEU A 1 7   ? -27.335 56.727  -45.245 1.00 46.57  ? 7   LEU A O     1 
ATOM   55   C  CB    . LEU A 1 7   ? -28.194 53.833  -46.134 1.00 45.30  ? 7   LEU A CB    1 
ATOM   56   C  CG    . LEU A 1 7   ? -28.367 52.359  -45.774 1.00 42.75  ? 7   LEU A CG    1 
ATOM   57   C  CD1   . LEU A 1 7   ? -27.979 51.473  -46.928 1.00 41.33  ? 7   LEU A CD1   1 
ATOM   58   C  CD2   . LEU A 1 7   ? -27.565 52.012  -44.554 1.00 38.85  ? 7   LEU A CD2   1 
ATOM   59   N  N     . GLU A 1 8   ? -29.273 56.919  -46.346 1.00 49.88  ? 8   GLU A N     1 
ATOM   60   C  CA    . GLU A 1 8   ? -29.020 58.299  -46.727 1.00 51.59  ? 8   GLU A CA    1 
ATOM   61   C  C     . GLU A 1 8   ? -29.102 59.232  -45.526 1.00 51.52  ? 8   GLU A C     1 
ATOM   62   O  O     . GLU A 1 8   ? -28.299 60.148  -45.405 1.00 51.81  ? 8   GLU A O     1 
ATOM   63   C  CB    . GLU A 1 8   ? -29.942 58.746  -47.865 1.00 54.85  ? 8   GLU A CB    1 
ATOM   64   C  CG    . GLU A 1 8   ? -29.613 58.057  -49.199 1.00 56.85  ? 8   GLU A CG    1 
ATOM   65   C  CD    . GLU A 1 8   ? -30.147 58.791  -50.436 1.00 62.59  ? 8   GLU A CD    1 
ATOM   66   O  OE1   . GLU A 1 8   ? -29.332 59.042  -51.358 1.00 64.21  ? 8   GLU A OE1   1 
ATOM   67   O  OE2   . GLU A 1 8   ? -31.366 59.105  -50.500 1.00 64.85  ? 8   GLU A OE2   1 
ATOM   68   N  N     . LYS A 1 9   ? -30.051 58.986  -44.630 1.00 51.47  ? 9   LYS A N     1 
ATOM   69   C  CA    . LYS A 1 9   ? -30.124 59.727  -43.370 1.00 51.63  ? 9   LYS A CA    1 
ATOM   70   C  C     . LYS A 1 9   ? -28.925 59.401  -42.459 1.00 48.84  ? 9   LYS A C     1 
ATOM   71   O  O     . LYS A 1 9   ? -28.373 60.280  -41.800 1.00 48.98  ? 9   LYS A O     1 
ATOM   72   C  CB    . LYS A 1 9   ? -31.438 59.422  -42.655 1.00 52.74  ? 9   LYS A CB    1 
ATOM   73   C  CG    . LYS A 1 9   ? -32.623 60.232  -43.134 1.00 56.74  ? 9   LYS A CG    1 
ATOM   74   C  CD    . LYS A 1 9   ? -33.797 59.308  -43.482 1.00 59.38  ? 9   LYS A CD    1 
ATOM   75   C  CE    . LYS A 1 9   ? -35.162 59.963  -43.260 1.00 62.81  ? 9   LYS A CE    1 
ATOM   76   N  NZ    . LYS A 1 9   ? -35.621 59.801  -41.843 1.00 62.72  ? 9   LYS A NZ    1 
ATOM   77   N  N     . ALA A 1 10  ? -28.525 58.133  -42.446 1.00 46.45  ? 10  ALA A N     1 
ATOM   78   C  CA    . ALA A 1 10  ? -27.409 57.663  -41.643 1.00 43.93  ? 10  ALA A CA    1 
ATOM   79   C  C     . ALA A 1 10  ? -26.120 58.395  -41.985 1.00 43.69  ? 10  ALA A C     1 
ATOM   80   O  O     . ALA A 1 10  ? -25.259 58.588  -41.121 1.00 42.82  ? 10  ALA A O     1 
ATOM   81   C  CB    . ALA A 1 10  ? -27.230 56.166  -41.821 1.00 41.92  ? 10  ALA A CB    1 
ATOM   82   N  N     . LEU A 1 11  ? -25.995 58.802  -43.245 1.00 44.71  ? 11  LEU A N     1 
ATOM   83   C  CA    . LEU A 1 11  ? -24.834 59.560  -43.702 1.00 44.76  ? 11  LEU A CA    1 
ATOM   84   C  C     . LEU A 1 11  ? -24.652 60.867  -42.922 1.00 46.16  ? 11  LEU A C     1 
ATOM   85   O  O     . LEU A 1 11  ? -23.527 61.237  -42.582 1.00 45.67  ? 11  LEU A O     1 
ATOM   86   C  CB    . LEU A 1 11  ? -24.914 59.832  -45.213 1.00 45.98  ? 11  LEU A CB    1 
ATOM   87   C  CG    . LEU A 1 11  ? -24.840 58.674  -46.229 1.00 44.85  ? 11  LEU A CG    1 
ATOM   88   C  CD1   . LEU A 1 11  ? -24.948 59.210  -47.645 1.00 47.07  ? 11  LEU A CD1   1 
ATOM   89   C  CD2   . LEU A 1 11  ? -23.587 57.802  -46.104 1.00 41.50  ? 11  LEU A CD2   1 
ATOM   90   N  N     . GLU A 1 12  ? -25.754 61.551  -42.620 1.00 48.22  ? 12  GLU A N     1 
ATOM   91   C  CA    . GLU A 1 12  ? -25.690 62.811  -41.877 1.00 50.05  ? 12  GLU A CA    1 
ATOM   92   C  C     . GLU A 1 12  ? -25.206 62.626  -40.436 1.00 48.25  ? 12  GLU A C     1 
ATOM   93   O  O     . GLU A 1 12  ? -24.766 63.583  -39.797 1.00 49.57  ? 12  GLU A O     1 
ATOM   94   C  CB    . GLU A 1 12  ? -27.035 63.541  -41.907 1.00 53.09  ? 12  GLU A CB    1 
ATOM   95   C  CG    . GLU A 1 12  ? -27.402 64.134  -43.270 1.00 57.17  ? 12  GLU A CG    1 
ATOM   96   C  CD    . GLU A 1 12  ? -28.913 64.286  -43.463 1.00 62.43  ? 12  GLU A CD    1 
ATOM   97   O  OE1   . GLU A 1 12  ? -29.683 63.561  -42.784 1.00 63.35  ? 12  GLU A OE1   1 
ATOM   98   O  OE2   . GLU A 1 12  ? -29.335 65.125  -44.296 1.00 65.43  ? 12  GLU A OE2   1 
ATOM   99   N  N     . LEU A 1 13  ? -25.279 61.396  -39.939 1.00 45.58  ? 13  LEU A N     1 
ATOM   100  C  CA    . LEU A 1 13  ? -24.748 61.057  -38.617 1.00 43.64  ? 13  LEU A CA    1 
ATOM   101  C  C     . LEU A 1 13  ? -23.282 60.627  -38.628 1.00 41.11  ? 13  LEU A C     1 
ATOM   102  O  O     . LEU A 1 13  ? -22.659 60.590  -37.580 1.00 40.54  ? 13  LEU A O     1 
ATOM   103  C  CB    . LEU A 1 13  ? -25.561 59.926  -37.977 1.00 42.77  ? 13  LEU A CB    1 
ATOM   104  C  CG    . LEU A 1 13  ? -27.055 60.085  -37.715 1.00 44.74  ? 13  LEU A CG    1 
ATOM   105  C  CD1   . LEU A 1 13  ? -27.618 58.752  -37.238 1.00 43.56  ? 13  LEU A CD1   1 
ATOM   106  C  CD2   . LEU A 1 13  ? -27.343 61.197  -36.710 1.00 46.83  ? 13  LEU A CD2   1 
ATOM   107  N  N     . VAL A 1 14  ? -22.740 60.272  -39.793 1.00 39.91  ? 14  VAL A N     1 
ATOM   108  C  CA    . VAL A 1 14  ? -21.396 59.669  -39.859 1.00 37.40  ? 14  VAL A CA    1 
ATOM   109  C  C     . VAL A 1 14  ? -20.374 60.399  -40.743 1.00 37.76  ? 14  VAL A C     1 
ATOM   110  O  O     . VAL A 1 14  ? -19.170 60.217  -40.572 1.00 36.65  ? 14  VAL A O     1 
ATOM   111  C  CB    . VAL A 1 14  ? -21.440 58.149  -40.206 1.00 35.32  ? 14  VAL A CB    1 
ATOM   112  C  CG1   . VAL A 1 14  ? -22.428 57.419  -39.310 1.00 34.60  ? 14  VAL A CG1   1 
ATOM   113  C  CG2   . VAL A 1 14  ? -21.789 57.928  -41.658 1.00 36.16  ? 14  VAL A CG2   1 
ATOM   114  N  N     . ILE A 1 15  ? -20.845 61.211  -41.684 1.00 39.47  ? 15  ILE A N     1 
ATOM   115  C  CA    . ILE A 1 15  ? -19.944 62.042  -42.482 1.00 40.41  ? 15  ILE A CA    1 
ATOM   116  C  C     . ILE A 1 15  ? -19.685 63.330  -41.729 1.00 42.13  ? 15  ILE A C     1 
ATOM   117  O  O     . ILE A 1 15  ? -20.622 63.984  -41.318 1.00 43.90  ? 15  ILE A O     1 
ATOM   118  C  CB    . ILE A 1 15  ? -20.522 62.343  -43.869 1.00 41.79  ? 15  ILE A CB    1 
ATOM   119  C  CG1   . ILE A 1 15  ? -20.490 61.071  -44.717 1.00 40.99  ? 15  ILE A CG1   1 
ATOM   120  C  CG2   . ILE A 1 15  ? -19.739 63.454  -44.552 1.00 42.64  ? 15  ILE A CG2   1 
ATOM   121  C  CD1   . ILE A 1 15  ? -21.426 61.081  -45.901 1.00 43.37  ? 15  ILE A CD1   1 
ATOM   122  N  N     . PRO A 1 16  ? -18.410 63.685  -41.513 1.00 44.88  ? 16  PRO A N     1 
ATOM   123  C  CA    . PRO A 1 16  ? -18.171 64.950  -40.826 1.00 46.45  ? 16  PRO A CA    1 
ATOM   124  C  C     . PRO A 1 16  ? -18.533 66.138  -41.713 1.00 48.97  ? 16  PRO A C     1 
ATOM   125  O  O     . PRO A 1 16  ? -18.463 66.039  -42.935 1.00 48.49  ? 16  PRO A O     1 
ATOM   126  C  CB    . PRO A 1 16  ? -16.666 64.912  -40.542 1.00 43.53  ? 16  PRO A CB    1 
ATOM   127  C  CG    . PRO A 1 16  ? -16.105 64.031  -41.594 1.00 40.98  ? 16  PRO A CG    1 
ATOM   128  C  CD    . PRO A 1 16  ? -17.153 62.986  -41.842 1.00 41.78  ? 16  PRO A CD    1 
ATOM   129  N  N     . ASP A 1 17  ? -18.930 67.246  -41.105 1.00 52.27  ? 17  ASP A N     1 
ATOM   130  C  CA    . ASP A 1 17  ? -19.290 68.424  -41.886 1.00 55.95  ? 17  ASP A CA    1 
ATOM   131  C  C     . ASP A 1 17  ? -18.063 69.230  -42.317 1.00 55.28  ? 17  ASP A C     1 
ATOM   132  O  O     . ASP A 1 17  ? -16.926 68.903  -41.946 1.00 52.69  ? 17  ASP A O     1 
ATOM   133  C  CB    . ASP A 1 17  ? -20.339 69.300  -41.167 1.00 60.12  ? 17  ASP A CB    1 
ATOM   134  C  CG    . ASP A 1 17  ? -20.114 69.395  -39.658 1.00 61.49  ? 17  ASP A CG    1 
ATOM   135  O  OD1   . ASP A 1 17  ? -21.122 69.580  -38.928 1.00 65.02  ? 17  ASP A OD1   1 
ATOM   136  O  OD2   . ASP A 1 17  ? -18.946 69.283  -39.204 1.00 59.96  ? 17  ASP A OD2   1 
ATOM   137  N  N     . GLU A 1 18  ? -18.323 70.276  -43.104 1.00 57.98  ? 18  GLU A N     1 
ATOM   138  C  CA    . GLU A 1 18  ? -17.303 71.139  -43.699 1.00 58.22  ? 18  GLU A CA    1 
ATOM   139  C  C     . GLU A 1 18  ? -16.357 71.756  -42.656 1.00 57.88  ? 18  GLU A C     1 
ATOM   140  O  O     . GLU A 1 18  ? -15.143 71.784  -42.859 1.00 55.90  ? 18  GLU A O     1 
ATOM   141  C  CB    . GLU A 1 18  ? -17.961 72.252  -44.542 1.00 61.90  ? 18  GLU A CB    1 
ATOM   142  C  CG    . GLU A 1 18  ? -19.067 71.801  -45.536 1.00 64.32  ? 18  GLU A CG    1 
ATOM   143  C  CD    . GLU A 1 18  ? -20.483 71.706  -44.913 1.00 68.21  ? 18  GLU A CD    1 
ATOM   144  O  OE1   . GLU A 1 18  ? -20.814 70.664  -44.293 1.00 66.65  ? 18  GLU A OE1   1 
ATOM   145  O  OE2   . GLU A 1 18  ? -21.278 72.667  -45.068 1.00 72.08  ? 18  GLU A OE2   1 
ATOM   146  N  N     . GLU A 1 19  ? -16.914 72.243  -41.547 1.00 60.23  ? 19  GLU A N     1 
ATOM   147  C  CA    . GLU A 1 19  ? -16.124 72.944  -40.529 1.00 60.79  ? 19  GLU A CA    1 
ATOM   148  C  C     . GLU A 1 19  ? -15.124 72.019  -39.861 1.00 57.08  ? 19  GLU A C     1 
ATOM   149  O  O     . GLU A 1 19  ? -13.979 72.403  -39.619 1.00 56.13  ? 19  GLU A O     1 
ATOM   150  C  CB    . GLU A 1 19  ? -17.002 73.664  -39.485 1.00 64.64  ? 19  GLU A CB    1 
ATOM   151  C  CG    . GLU A 1 19  ? -18.235 72.898  -38.981 1.00 67.48  ? 19  GLU A CG    1 
ATOM   152  C  CD    . GLU A 1 19  ? -19.563 73.366  -39.622 1.00 73.74  ? 19  GLU A CD    1 
ATOM   153  O  OE1   . GLU A 1 19  ? -19.966 72.809  -40.678 1.00 73.28  ? 19  GLU A OE1   1 
ATOM   154  O  OE2   . GLU A 1 19  ? -20.219 74.277  -39.051 1.00 78.34  ? 19  GLU A OE2   1 
ATOM   155  N  N     . GLU A 1 20  ? -15.549 70.791  -39.580 1.00 55.42  ? 20  GLU A N     1 
ATOM   156  C  CA    . GLU A 1 20  ? -14.651 69.796  -39.007 1.00 51.79  ? 20  GLU A CA    1 
ATOM   157  C  C     . GLU A 1 20  ? -13.567 69.417  -40.011 1.00 48.86  ? 20  GLU A C     1 
ATOM   158  O  O     . GLU A 1 20  ? -12.398 69.319  -39.649 1.00 47.19  ? 20  GLU A O     1 
ATOM   159  C  CB    . GLU A 1 20  ? -15.416 68.561  -38.533 1.00 50.95  ? 20  GLU A CB    1 
ATOM   160  C  CG    . GLU A 1 20  ? -14.533 67.544  -37.816 1.00 49.19  ? 20  GLU A CG    1 
ATOM   161  C  CD    . GLU A 1 20  ? -15.302 66.533  -36.976 1.00 50.88  ? 20  GLU A CD    1 
ATOM   162  O  OE1   . GLU A 1 20  ? -16.556 66.568  -36.968 1.00 53.75  ? 20  GLU A OE1   1 
ATOM   163  O  OE2   . GLU A 1 20  ? -14.640 65.698  -36.316 1.00 49.42  ? 20  GLU A OE2   1 
ATOM   164  N  N     . VAL A 1 21  ? -13.953 69.215  -41.269 1.00 48.60  ? 21  VAL A N     1 
ATOM   165  C  CA    . VAL A 1 21  ? -12.994 68.838  -42.308 1.00 46.30  ? 21  VAL A CA    1 
ATOM   166  C  C     . VAL A 1 21  ? -11.883 69.889  -42.421 1.00 46.52  ? 21  VAL A C     1 
ATOM   167  O  O     . VAL A 1 21  ? -10.697 69.556  -42.488 1.00 44.09  ? 21  VAL A O     1 
ATOM   168  C  CB    . VAL A 1 21  ? -13.682 68.624  -43.684 1.00 47.07  ? 21  VAL A CB    1 
ATOM   169  C  CG1   . VAL A 1 21  ? -12.663 68.240  -44.747 1.00 44.94  ? 21  VAL A CG1   1 
ATOM   170  C  CG2   . VAL A 1 21  ? -14.752 67.554  -43.588 1.00 46.96  ? 21  VAL A CG2   1 
ATOM   171  N  N     . ARG A 1 22  ? -12.288 71.155  -42.413 1.00 49.56  ? 22  ARG A N     1 
ATOM   172  C  CA    . ARG A 1 22  ? -11.377 72.273  -42.589 1.00 50.63  ? 22  ARG A CA    1 
ATOM   173  C  C     . ARG A 1 22  ? -10.468 72.408  -41.385 1.00 49.37  ? 22  ARG A C     1 
ATOM   174  O  O     . ARG A 1 22  ? -9.272  72.652  -41.533 1.00 48.27  ? 22  ARG A O     1 
ATOM   175  C  CB    . ARG A 1 22  ? -12.166 73.557  -42.817 1.00 54.63  ? 22  ARG A CB    1 
ATOM   176  C  CG    . ARG A 1 22  ? -11.386 74.659  -43.521 1.00 58.00  ? 22  ARG A CG    1 
ATOM   177  C  CD    . ARG A 1 22  ? -12.290 75.475  -44.460 1.00 64.68  ? 22  ARG A CD    1 
ATOM   178  N  NE    . ARG A 1 22  ? -13.653 75.622  -43.936 1.00 69.08  ? 22  ARG A NE    1 
ATOM   179  C  CZ    . ARG A 1 22  ? -14.042 76.555  -43.065 1.00 72.65  ? 22  ARG A CZ    1 
ATOM   180  N  NH1   . ARG A 1 22  ? -13.177 77.458  -42.603 1.00 73.53  ? 22  ARG A NH1   1 
ATOM   181  N  NH2   . ARG A 1 22  ? -15.306 76.580  -42.653 1.00 74.70  ? 22  ARG A NH2   1 
ATOM   182  N  N     . LYS A 1 23  ? -11.042 72.234  -40.196 1.00 49.77  ? 23  LYS A N     1 
ATOM   183  C  CA    . LYS A 1 23  ? -10.280 72.236  -38.948 1.00 49.07  ? 23  LYS A CA    1 
ATOM   184  C  C     . LYS A 1 23  ? -9.110  71.256  -39.053 1.00 45.44  ? 23  LYS A C     1 
ATOM   185  O  O     . LYS A 1 23  ? -7.991  71.582  -38.656 1.00 45.07  ? 23  LYS A O     1 
ATOM   186  C  CB    . LYS A 1 23  ? -11.191 71.877  -37.767 1.00 49.95  ? 23  LYS A CB    1 
ATOM   187  C  CG    . LYS A 1 23  ? -10.707 72.333  -36.391 1.00 51.36  ? 23  LYS A CG    1 
ATOM   188  C  CD    . LYS A 1 23  ? -11.633 71.840  -35.255 1.00 52.97  ? 23  LYS A CD    1 
ATOM   189  C  CE    . LYS A 1 23  ? -11.348 70.362  -34.854 1.00 51.73  ? 23  LYS A CE    1 
ATOM   190  N  NZ    . LYS A 1 23  ? -12.228 69.800  -33.761 1.00 51.66  ? 23  LYS A NZ    1 
ATOM   191  N  N     . GLY A 1 24  ? -9.373  70.075  -39.615 1.00 43.18  ? 24  GLY A N     1 
ATOM   192  C  CA    . GLY A 1 24  ? -8.364  69.038  -39.784 1.00 39.94  ? 24  GLY A CA    1 
ATOM   193  C  C     . GLY A 1 24  ? -7.390  69.306  -40.912 1.00 39.38  ? 24  GLY A C     1 
ATOM   194  O  O     . GLY A 1 24  ? -6.237  68.919  -40.836 1.00 37.41  ? 24  GLY A O     1 
ATOM   195  N  N     . ARG A 1 25  ? -7.861  69.945  -41.977 1.00 41.39  ? 25  ARG A N     1 
ATOM   196  C  CA    . ARG A 1 25  ? -6.989  70.367  -43.067 1.00 41.93  ? 25  ARG A CA    1 
ATOM   197  C  C     . ARG A 1 25  ? -5.974  71.397  -42.562 1.00 42.66  ? 25  ARG A C     1 
ATOM   198  O  O     . ARG A 1 25  ? -4.793  71.327  -42.890 1.00 41.28  ? 25  ARG A O     1 
ATOM   199  C  CB    . ARG A 1 25  ? -7.812  70.934  -44.232 1.00 44.31  ? 25  ARG A CB    1 
ATOM   200  C  CG    . ARG A 1 25  ? -7.919  70.041  -45.466 1.00 45.38  ? 25  ARG A CG    1 
ATOM   201  C  CD    . ARG A 1 25  ? -8.902  68.888  -45.299 1.00 49.07  ? 25  ARG A CD    1 
ATOM   202  N  NE    . ARG A 1 25  ? -8.588  67.760  -46.190 1.00 51.89  ? 25  ARG A NE    1 
ATOM   203  C  CZ    . ARG A 1 25  ? -8.951  66.487  -45.984 1.00 52.67  ? 25  ARG A CZ    1 
ATOM   204  N  NH1   . ARG A 1 25  ? -9.650  66.134  -44.909 1.00 53.49  ? 25  ARG A NH1   1 
ATOM   205  N  NH2   . ARG A 1 25  ? -8.604  65.548  -46.857 1.00 53.26  ? 25  ARG A NH2   1 
ATOM   206  N  N     . GLU A 1 26  ? -6.447  72.337  -41.744 1.00 45.15  ? 26  GLU A N     1 
ATOM   207  C  CA    . GLU A 1 26  ? -5.605  73.399  -41.185 1.00 46.96  ? 26  GLU A CA    1 
ATOM   208  C  C     . GLU A 1 26  ? -4.552  72.817  -40.244 1.00 44.40  ? 26  GLU A C     1 
ATOM   209  O  O     . GLU A 1 26  ? -3.397  73.243  -40.264 1.00 44.66  ? 26  GLU A O     1 
ATOM   210  C  CB    . GLU A 1 26  ? -6.454  74.476  -40.488 1.00 49.67  ? 26  GLU A CB    1 
ATOM   211  C  CG    . GLU A 1 26  ? -7.360  75.252  -41.448 1.00 53.60  ? 26  GLU A CG    1 
ATOM   212  C  CD    . GLU A 1 26  ? -8.127  76.418  -40.793 1.00 58.16  ? 26  GLU A CD    1 
ATOM   213  O  OE1   . GLU A 1 26  ? -7.815  77.595  -41.119 1.00 62.44  ? 26  GLU A OE1   1 
ATOM   214  O  OE2   . GLU A 1 26  ? -9.049  76.165  -39.971 1.00 60.34  ? 26  GLU A OE2   1 
ATOM   215  N  N     . ALA A 1 27  ? -4.952  71.829  -39.444 1.00 42.33  ? 27  ALA A N     1 
ATOM   216  C  CA    . ALA A 1 27  ? -4.036  71.119  -38.559 1.00 40.00  ? 27  ALA A CA    1 
ATOM   217  C  C     . ALA A 1 27  ? -2.996  70.358  -39.361 1.00 37.97  ? 27  ALA A C     1 
ATOM   218  O  O     . ALA A 1 27  ? -1.803  70.469  -39.097 1.00 37.45  ? 27  ALA A O     1 
ATOM   219  C  CB    . ALA A 1 27  ? -4.788  70.174  -37.681 1.00 38.90  ? 27  ALA A CB    1 
ATOM   220  N  N     . GLU A 1 28  ? -3.468  69.588  -40.340 1.00 37.31  ? 28  GLU A N     1 
ATOM   221  C  CA    . GLU A 1 28  ? -2.620  68.811  -41.240 1.00 35.85  ? 28  GLU A CA    1 
ATOM   222  C  C     . GLU A 1 28  ? -1.495  69.662  -41.829 1.00 36.88  ? 28  GLU A C     1 
ATOM   223  O  O     . GLU A 1 28  ? -0.332  69.258  -41.821 1.00 35.36  ? 28  GLU A O     1 
ATOM   224  C  CB    . GLU A 1 28  ? -3.468  68.213  -42.361 1.00 35.46  ? 28  GLU A CB    1 
ATOM   225  C  CG    . GLU A 1 28  ? -2.728  67.213  -43.239 1.00 34.80  ? 28  GLU A CG    1 
ATOM   226  C  CD    . GLU A 1 28  ? -3.441  66.941  -44.547 1.00 36.24  ? 28  GLU A CD    1 
ATOM   227  O  OE1   . GLU A 1 28  ? -4.658  67.210  -44.632 1.00 38.16  ? 28  GLU A OE1   1 
ATOM   228  O  OE2   . GLU A 1 28  ? -2.782  66.470  -45.500 1.00 36.52  ? 28  GLU A OE2   1 
ATOM   229  N  N     . GLU A 1 29  ? -1.863  70.847  -42.313 1.00 39.67  ? 29  GLU A N     1 
ATOM   230  C  CA    . GLU A 1 29  ? -0.924  71.794  -42.896 1.00 41.68  ? 29  GLU A CA    1 
ATOM   231  C  C     . GLU A 1 29  ? 0.149   72.183  -41.873 1.00 41.33  ? 29  GLU A C     1 
ATOM   232  O  O     . GLU A 1 29  ? 1.344   72.141  -42.167 1.00 40.90  ? 29  GLU A O     1 
ATOM   233  C  CB    . GLU A 1 29  ? -1.674  73.023  -43.424 1.00 44.60  ? 29  GLU A CB    1 
ATOM   234  C  CG    . GLU A 1 29  ? -0.853  73.960  -44.318 1.00 50.26  ? 29  GLU A CG    1 
ATOM   235  C  CD    . GLU A 1 29  ? -0.638  73.426  -45.750 1.00 55.16  ? 29  GLU A CD    1 
ATOM   236  O  OE1   . GLU A 1 29  ? 0.293   72.596  -45.955 1.00 54.38  ? 29  GLU A OE1   1 
ATOM   237  O  OE2   . GLU A 1 29  ? -1.385  73.859  -46.674 1.00 58.22  ? 29  GLU A OE2   1 
ATOM   238  N  N     . GLU A 1 30  ? -0.276  72.524  -40.661 1.00 41.74  ? 30  GLU A N     1 
ATOM   239  C  CA    . GLU A 1 30  ? 0.662   72.946  -39.627 1.00 42.12  ? 30  GLU A CA    1 
ATOM   240  C  C     . GLU A 1 30  ? 1.652   71.839  -39.263 1.00 39.71  ? 30  GLU A C     1 
ATOM   241  O  O     . GLU A 1 30  ? 2.848   72.080  -39.103 1.00 39.89  ? 30  GLU A O     1 
ATOM   242  C  CB    . GLU A 1 30  ? -0.093  73.417  -38.386 1.00 43.44  ? 30  GLU A CB    1 
ATOM   243  C  CG    . GLU A 1 30  ? 0.795   74.001  -37.300 1.00 45.33  ? 30  GLU A CG    1 
ATOM   244  C  CD    . GLU A 1 30  ? 1.669   75.134  -37.802 1.00 49.08  ? 30  GLU A CD    1 
ATOM   245  O  OE1   . GLU A 1 30  ? 1.262   75.821  -38.769 1.00 51.35  ? 30  GLU A OE1   1 
ATOM   246  O  OE2   . GLU A 1 30  ? 2.762   75.338  -37.224 1.00 50.12  ? 30  GLU A OE2   1 
ATOM   247  N  N     . LEU A 1 31  ? 1.129   70.627  -39.138 1.00 37.70  ? 31  LEU A N     1 
ATOM   248  C  CA    . LEU A 1 31  ? 1.906   69.467  -38.787 1.00 35.42  ? 31  LEU A CA    1 
ATOM   249  C  C     . LEU A 1 31  ? 2.987   69.239  -39.842 1.00 35.25  ? 31  LEU A C     1 
ATOM   250  O  O     . LEU A 1 31  ? 4.173   69.113  -39.502 1.00 34.91  ? 31  LEU A O     1 
ATOM   251  C  CB    . LEU A 1 31  ? 0.971   68.270  -38.682 1.00 33.93  ? 31  LEU A CB    1 
ATOM   252  C  CG    . LEU A 1 31  ? 1.322   67.064  -37.815 1.00 32.27  ? 31  LEU A CG    1 
ATOM   253  C  CD1   . LEU A 1 31  ? 2.002   67.482  -36.535 1.00 32.32  ? 31  LEU A CD1   1 
ATOM   254  C  CD2   . LEU A 1 31  ? 0.049   66.298  -37.518 1.00 30.25  ? 31  LEU A CD2   1 
ATOM   255  N  N     . ARG A 1 32  ? 2.583   69.215  -41.116 1.00 35.56  ? 32  ARG A N     1 
ATOM   256  C  CA    . ARG A 1 32  ? 3.531   69.073  -42.225 1.00 35.91  ? 32  ARG A CA    1 
ATOM   257  C  C     . ARG A 1 32  ? 4.638   70.117  -42.148 1.00 37.44  ? 32  ARG A C     1 
ATOM   258  O  O     . ARG A 1 32  ? 5.810   69.788  -42.307 1.00 37.41  ? 32  ARG A O     1 
ATOM   259  C  CB    . ARG A 1 32  ? 2.846   69.200  -43.583 1.00 36.75  ? 32  ARG A CB    1 
ATOM   260  C  CG    . ARG A 1 32  ? 1.801   68.182  -43.866 1.00 36.86  ? 32  ARG A CG    1 
ATOM   261  C  CD    . ARG A 1 32  ? 1.443   68.162  -45.339 1.00 40.29  ? 32  ARG A CD    1 
ATOM   262  N  NE    . ARG A 1 32  ? 1.735   66.846  -45.898 1.00 42.19  ? 32  ARG A NE    1 
ATOM   263  C  CZ    . ARG A 1 32  ? 0.894   65.816  -45.841 1.00 42.17  ? 32  ARG A CZ    1 
ATOM   264  N  NH1   . ARG A 1 32  ? -0.290  65.963  -45.262 1.00 43.42  ? 32  ARG A NH1   1 
ATOM   265  N  NH2   . ARG A 1 32  ? 1.234   64.641  -46.350 1.00 41.66  ? 32  ARG A NH2   1 
ATOM   266  N  N     . ARG A 1 33  ? 4.268   71.371  -41.904 1.00 39.10  ? 33  ARG A N     1 
ATOM   267  C  CA    . ARG A 1 33  ? 5.246   72.446  -41.848 1.00 41.27  ? 33  ARG A CA    1 
ATOM   268  C  C     . ARG A 1 33  ? 6.251   72.287  -40.712 1.00 40.23  ? 33  ARG A C     1 
ATOM   269  O  O     . ARG A 1 33  ? 7.403   72.691  -40.840 1.00 41.49  ? 33  ARG A O     1 
ATOM   270  C  CB    . ARG A 1 33  ? 4.558   73.804  -41.751 1.00 44.06  ? 33  ARG A CB    1 
ATOM   271  C  CG    . ARG A 1 33  ? 3.723   74.145  -42.971 1.00 47.61  ? 33  ARG A CG    1 
ATOM   272  C  CD    . ARG A 1 33  ? 3.800   75.623  -43.279 1.00 53.96  ? 33  ARG A CD    1 
ATOM   273  N  NE    . ARG A 1 33  ? 2.596   76.104  -43.948 1.00 57.80  ? 33  ARG A NE    1 
ATOM   274  C  CZ    . ARG A 1 33  ? 2.497   77.299  -44.522 1.00 62.53  ? 33  ARG A CZ    1 
ATOM   275  N  NH1   . ARG A 1 33  ? 3.536   78.132  -44.515 1.00 64.86  ? 33  ARG A NH1   1 
ATOM   276  N  NH2   . ARG A 1 33  ? 1.361   77.662  -45.110 1.00 64.56  ? 33  ARG A NH2   1 
ATOM   277  N  N     . ARG A 1 34  ? 5.806   71.702  -39.606 1.00 38.36  ? 34  ARG A N     1 
ATOM   278  C  CA    . ARG A 1 34  ? 6.658   71.487  -38.441 1.00 37.12  ? 34  ARG A CA    1 
ATOM   279  C  C     . ARG A 1 34  ? 7.580   70.299  -38.640 1.00 35.48  ? 34  ARG A C     1 
ATOM   280  O  O     . ARG A 1 34  ? 8.708   70.303  -38.161 1.00 35.46  ? 34  ARG A O     1 
ATOM   281  C  CB    . ARG A 1 34  ? 5.804   71.267  -37.196 1.00 36.22  ? 34  ARG A CB    1 
ATOM   282  C  CG    . ARG A 1 34  ? 5.060   72.486  -36.760 1.00 37.03  ? 34  ARG A CG    1 
ATOM   283  C  CD    . ARG A 1 34  ? 4.148   72.170  -35.624 1.00 34.63  ? 34  ARG A CD    1 
ATOM   284  N  NE    . ARG A 1 34  ? 3.389   73.340  -35.202 1.00 35.51  ? 34  ARG A NE    1 
ATOM   285  C  CZ    . ARG A 1 34  ? 2.705   73.417  -34.064 1.00 36.15  ? 34  ARG A CZ    1 
ATOM   286  N  NH1   . ARG A 1 34  ? 2.686   72.393  -33.228 1.00 34.58  ? 34  ARG A NH1   1 
ATOM   287  N  NH2   . ARG A 1 34  ? 2.041   74.520  -33.751 1.00 38.43  ? 34  ARG A NH2   1 
ATOM   288  N  N     . LEU A 1 35  ? 7.087   69.286  -39.345 1.00 34.24  ? 35  LEU A N     1 
ATOM   289  C  CA    . LEU A 1 35  ? 7.809   68.038  -39.538 1.00 33.12  ? 35  LEU A CA    1 
ATOM   290  C  C     . LEU A 1 35  ? 8.840   68.143  -40.634 1.00 34.57  ? 35  LEU A C     1 
ATOM   291  O  O     . LEU A 1 35  ? 9.901   67.551  -40.513 1.00 34.63  ? 35  LEU A O     1 
ATOM   292  C  CB    . LEU A 1 35  ? 6.843   66.899  -39.838 1.00 31.47  ? 35  LEU A CB    1 
ATOM   293  C  CG    . LEU A 1 35  ? 5.974   66.354  -38.711 1.00 30.02  ? 35  LEU A CG    1 
ATOM   294  C  CD1   . LEU A 1 35  ? 4.884   65.505  -39.317 1.00 28.90  ? 35  LEU A CD1   1 
ATOM   295  C  CD2   . LEU A 1 35  ? 6.785   65.534  -37.733 1.00 28.29  ? 35  LEU A CD2   1 
ATOM   296  N  N     . ASP A 1 36  ? 8.521   68.856  -41.719 1.00 36.90  ? 36  ASP A N     1 
ATOM   297  C  CA    . ASP A 1 36  ? 9.559   69.433  -42.592 1.00 39.81  ? 36  ASP A CA    1 
ATOM   298  C  C     . ASP A 1 36  ? 10.158  70.483  -41.696 1.00 41.97  ? 36  ASP A C     1 
ATOM   299  O  O     . ASP A 1 36  ? 9.547   70.838  -40.697 1.00 42.92  ? 36  ASP A O     1 
ATOM   300  C  CB    . ASP A 1 36  ? 8.964   70.142  -43.797 1.00 40.86  ? 36  ASP A CB    1 
ATOM   301  C  CG    . ASP A 1 36  ? 7.930   69.311  -44.528 1.00 40.65  ? 36  ASP A CG    1 
ATOM   302  O  OD1   . ASP A 1 36  ? 7.886   68.072  -44.370 1.00 39.17  ? 36  ASP A OD1   1 
ATOM   303  O  OD2   . ASP A 1 36  ? 7.145   69.916  -45.282 1.00 43.39  ? 36  ASP A OD2   1 
ATOM   304  N  N     . GLU A 1 37  ? 11.324  71.009  -42.006 1.00 44.12  ? 37  GLU A N     1 
ATOM   305  C  CA    . GLU A 1 37  ? 11.938  71.957  -41.063 1.00 46.18  ? 37  GLU A CA    1 
ATOM   306  C  C     . GLU A 1 37  ? 12.581  71.188  -39.917 1.00 45.01  ? 37  GLU A C     1 
ATOM   307  O  O     . GLU A 1 37  ? 13.609  71.617  -39.393 1.00 46.51  ? 37  GLU A O     1 
ATOM   308  C  CB    . GLU A 1 37  ? 10.940  73.018  -40.534 1.00 46.87  ? 37  GLU A CB    1 
ATOM   309  C  CG    . GLU A 1 37  ? 10.934  73.181  -39.004 1.00 47.75  ? 37  GLU A CG    1 
ATOM   310  C  CD    . GLU A 1 37  ? 10.639  74.604  -38.520 1.00 52.17  ? 37  GLU A CD    1 
ATOM   311  O  OE1   . GLU A 1 37  ? 9.671   74.784  -37.739 1.00 53.44  ? 37  GLU A OE1   1 
ATOM   312  O  OE2   . GLU A 1 37  ? 11.380  75.541  -38.896 1.00 53.30  ? 37  GLU A OE2   1 
ATOM   313  N  N     . LEU A 1 38  ? 11.986  70.058  -39.544 1.00 42.58  ? 38  LEU A N     1 
ATOM   314  C  CA    . LEU A 1 38  ? 12.640  69.141  -38.631 1.00 41.78  ? 38  LEU A CA    1 
ATOM   315  C  C     . LEU A 1 38  ? 13.478  68.089  -39.336 1.00 41.67  ? 38  LEU A C     1 
ATOM   316  O  O     . LEU A 1 38  ? 14.109  67.278  -38.661 1.00 41.67  ? 38  LEU A O     1 
ATOM   317  C  CB    . LEU A 1 38  ? 11.634  68.431  -37.741 1.00 40.03  ? 38  LEU A CB    1 
ATOM   318  C  CG    . LEU A 1 38  ? 11.501  68.929  -36.307 1.00 40.83  ? 38  LEU A CG    1 
ATOM   319  C  CD1   . LEU A 1 38  ? 10.483  68.062  -35.592 1.00 39.23  ? 38  LEU A CD1   1 
ATOM   320  C  CD2   . LEU A 1 38  ? 12.831  68.899  -35.587 1.00 41.52  ? 38  LEU A CD2   1 
ATOM   321  N  N     . GLY A 1 39  ? 13.493  68.093  -40.671 1.00 42.12  ? 39  GLY A N     1 
ATOM   322  C  CA    . GLY A 1 39  ? 14.175  67.037  -41.435 1.00 42.23  ? 39  GLY A CA    1 
ATOM   323  C  C     . GLY A 1 39  ? 13.239  65.852  -41.545 1.00 40.57  ? 39  GLY A C     1 
ATOM   324  O  O     . GLY A 1 39  ? 12.310  65.875  -42.350 1.00 41.64  ? 39  GLY A O     1 
ATOM   325  N  N     . VAL A 1 40  ? 13.491  64.813  -40.757 1.00 39.13  ? 40  VAL A N     1 
ATOM   326  C  CA    . VAL A 1 40  ? 12.475  63.802  -40.373 1.00 36.78  ? 40  VAL A CA    1 
ATOM   327  C  C     . VAL A 1 40  ? 11.541  63.198  -41.460 1.00 35.87  ? 40  VAL A C     1 
ATOM   328  O  O     . VAL A 1 40  ? 10.754  63.909  -42.099 1.00 35.69  ? 40  VAL A O     1 
ATOM   329  C  CB    . VAL A 1 40  ? 11.696  64.318  -39.126 1.00 36.21  ? 40  VAL A CB    1 
ATOM   330  C  CG1   . VAL A 1 40  ? 10.428  63.532  -38.851 1.00 34.83  ? 40  VAL A CG1   1 
ATOM   331  C  CG2   . VAL A 1 40  ? 12.617  64.298  -37.910 1.00 36.66  ? 40  VAL A CG2   1 
ATOM   332  N  N     . GLU A 1 41  ? 11.657  61.878  -41.648 1.00 35.26  ? 41  GLU A N     1 
ATOM   333  C  CA    . GLU A 1 41  ? 10.774  61.078  -42.519 1.00 35.18  ? 41  GLU A CA    1 
ATOM   334  C  C     . GLU A 1 41  ? 9.502   60.670  -41.799 1.00 33.22  ? 41  GLU A C     1 
ATOM   335  O  O     . GLU A 1 41  ? 9.559   60.058  -40.740 1.00 32.83  ? 41  GLU A O     1 
ATOM   336  C  CB    . GLU A 1 41  ? 11.460  59.784  -42.949 1.00 35.77  ? 41  GLU A CB    1 
ATOM   337  C  CG    . GLU A 1 41  ? 12.314  59.867  -44.174 1.00 40.60  ? 41  GLU A CG    1 
ATOM   338  C  CD    . GLU A 1 41  ? 12.591  58.486  -44.761 1.00 45.83  ? 41  GLU A CD    1 
ATOM   339  O  OE1   . GLU A 1 41  ? 11.615  57.739  -45.052 1.00 45.37  ? 41  GLU A OE1   1 
ATOM   340  O  OE2   . GLU A 1 41  ? 13.792  58.155  -44.949 1.00 49.80  ? 41  GLU A OE2   1 
ATOM   341  N  N     . TYR A 1 42  ? 8.353   60.975  -42.384 1.00 32.84  ? 42  TYR A N     1 
ATOM   342  C  CA    . TYR A 1 42  ? 7.069   60.656  -41.759 1.00 31.51  ? 42  TYR A CA    1 
ATOM   343  C  C     . TYR A 1 42  ? 6.043   60.251  -42.799 1.00 31.35  ? 42  TYR A C     1 
ATOM   344  O  O     . TYR A 1 42  ? 6.291   60.339  -43.996 1.00 32.62  ? 42  TYR A O     1 
ATOM   345  C  CB    . TYR A 1 42  ? 6.546   61.863  -40.979 1.00 31.49  ? 42  TYR A CB    1 
ATOM   346  C  CG    . TYR A 1 42  ? 6.354   63.085  -41.844 1.00 32.46  ? 42  TYR A CG    1 
ATOM   347  C  CD1   . TYR A 1 42  ? 5.143   63.318  -42.509 1.00 32.38  ? 42  TYR A CD1   1 
ATOM   348  C  CD2   . TYR A 1 42  ? 7.387   63.998  -42.015 1.00 33.13  ? 42  TYR A CD2   1 
ATOM   349  C  CE1   . TYR A 1 42  ? 4.972   64.440  -43.321 1.00 33.90  ? 42  TYR A CE1   1 
ATOM   350  C  CE2   . TYR A 1 42  ? 7.228   65.121  -42.821 1.00 34.81  ? 42  TYR A CE2   1 
ATOM   351  C  CZ    . TYR A 1 42  ? 6.027   65.336  -43.471 1.00 35.35  ? 42  TYR A CZ    1 
ATOM   352  O  OH    . TYR A 1 42  ? 5.887   66.460  -44.255 1.00 37.40  ? 42  TYR A OH    1 
ATOM   353  N  N     . VAL A 1 43  ? 4.875   59.831  -42.343 1.00 30.50  ? 43  VAL A N     1 
ATOM   354  C  CA    . VAL A 1 43  ? 3.783   59.511  -43.253 1.00 30.42  ? 43  VAL A CA    1 
ATOM   355  C  C     . VAL A 1 43  ? 2.457   59.574  -42.506 1.00 29.72  ? 43  VAL A C     1 
ATOM   356  O  O     . VAL A 1 43  ? 2.333   59.011  -41.421 1.00 29.22  ? 43  VAL A O     1 
ATOM   357  C  CB    . VAL A 1 43  ? 3.995   58.129  -43.951 1.00 30.55  ? 43  VAL A CB    1 
ATOM   358  C  CG1   . VAL A 1 43  ? 4.228   57.002  -42.934 1.00 29.44  ? 43  VAL A CG1   1 
ATOM   359  C  CG2   . VAL A 1 43  ? 2.825   57.806  -44.863 1.00 31.66  ? 43  VAL A CG2   1 
ATOM   360  N  N     . PHE A 1 44  ? 1.482   60.288  -43.062 1.00 30.27  ? 44  PHE A N     1 
ATOM   361  C  CA    . PHE A 1 44  ? 0.130   60.281  -42.493 1.00 30.17  ? 44  PHE A CA    1 
ATOM   362  C  C     . PHE A 1 44  ? -0.522  58.949  -42.808 1.00 29.88  ? 44  PHE A C     1 
ATOM   363  O  O     . PHE A 1 44  ? -0.524  58.494  -43.961 1.00 30.84  ? 44  PHE A O     1 
ATOM   364  C  CB    . PHE A 1 44  ? -0.718  61.418  -43.043 1.00 31.31  ? 44  PHE A CB    1 
ATOM   365  C  CG    . PHE A 1 44  ? -0.288  62.771  -42.568 1.00 33.00  ? 44  PHE A CG    1 
ATOM   366  C  CD1   . PHE A 1 44  ? 0.898   63.338  -43.016 1.00 34.66  ? 44  PHE A CD1   1 
ATOM   367  C  CD2   . PHE A 1 44  ? -1.074  63.489  -41.679 1.00 34.13  ? 44  PHE A CD2   1 
ATOM   368  C  CE1   . PHE A 1 44  ? 1.302   64.595  -42.563 1.00 36.25  ? 44  PHE A CE1   1 
ATOM   369  C  CE2   . PHE A 1 44  ? -0.680  64.746  -41.231 1.00 35.63  ? 44  PHE A CE2   1 
ATOM   370  C  CZ    . PHE A 1 44  ? 0.510   65.296  -41.670 1.00 35.61  ? 44  PHE A CZ    1 
ATOM   371  N  N     . VAL A 1 45  ? -1.051  58.304  -41.780 1.00 28.76  ? 45  VAL A N     1 
ATOM   372  C  CA    . VAL A 1 45  ? -1.723  57.031  -41.968 1.00 28.10  ? 45  VAL A CA    1 
ATOM   373  C  C     . VAL A 1 45  ? -3.083  57.028  -41.235 1.00 28.08  ? 45  VAL A C     1 
ATOM   374  O  O     . VAL A 1 45  ? -3.472  58.032  -40.622 1.00 28.63  ? 45  VAL A O     1 
ATOM   375  C  CB    . VAL A 1 45  ? -0.817  55.863  -41.512 1.00 27.89  ? 45  VAL A CB    1 
ATOM   376  C  CG1   . VAL A 1 45  ? 0.530   55.943  -42.207 1.00 28.27  ? 45  VAL A CG1   1 
ATOM   377  C  CG2   . VAL A 1 45  ? -0.631  55.863  -40.002 1.00 26.35  ? 45  VAL A CG2   1 
ATOM   378  N  N     . GLY A 1 46  ? -3.800  55.909  -41.291 1.00 27.19  ? 46  GLY A N     1 
ATOM   379  C  CA    . GLY A 1 46  ? -5.067  55.795  -40.582 1.00 26.48  ? 46  GLY A CA    1 
ATOM   380  C  C     . GLY A 1 46  ? -6.222  56.524  -41.247 1.00 26.32  ? 46  GLY A C     1 
ATOM   381  O  O     . GLY A 1 46  ? -6.113  56.995  -42.388 1.00 26.45  ? 46  GLY A O     1 
ATOM   382  N  N     . SER A 1 47  ? -7.322  56.623  -40.510 1.00 26.03  ? 47  SER A N     1 
ATOM   383  C  CA    . SER A 1 47  ? -8.573  57.134  -41.034 1.00 26.67  ? 47  SER A CA    1 
ATOM   384  C  C     . SER A 1 47  ? -8.515  58.569  -41.587 1.00 27.19  ? 47  SER A C     1 
ATOM   385  O  O     . SER A 1 47  ? -9.242  58.886  -42.535 1.00 28.03  ? 47  SER A O     1 
ATOM   386  C  CB    . SER A 1 47  ? -9.684  56.983  -39.995 1.00 27.46  ? 47  SER A CB    1 
ATOM   387  O  OG    . SER A 1 47  ? -9.449  57.797  -38.864 1.00 26.87  ? 47  SER A OG    1 
ATOM   388  N  N     . TYR A 1 48  ? -7.662  59.428  -41.024 1.00 26.63  ? 48  TYR A N     1 
ATOM   389  C  CA    . TYR A 1 48  ? -7.553  60.796  -41.545 1.00 27.41  ? 48  TYR A CA    1 
ATOM   390  C  C     . TYR A 1 48  ? -6.972  60.814  -42.936 1.00 27.55  ? 48  TYR A C     1 
ATOM   391  O  O     . TYR A 1 48  ? -7.460  61.503  -43.821 1.00 28.65  ? 48  TYR A O     1 
ATOM   392  C  CB    . TYR A 1 48  ? -6.697  61.714  -40.669 1.00 27.16  ? 48  TYR A CB    1 
ATOM   393  C  CG    . TYR A 1 48  ? -6.676  63.113  -41.245 1.00 28.03  ? 48  TYR A CG    1 
ATOM   394  C  CD1   . TYR A 1 48  ? -7.794  63.931  -41.155 1.00 29.54  ? 48  TYR A CD1   1 
ATOM   395  C  CD2   . TYR A 1 48  ? -5.563  63.599  -41.936 1.00 27.13  ? 48  TYR A CD2   1 
ATOM   396  C  CE1   . TYR A 1 48  ? -7.796  65.202  -41.719 1.00 31.46  ? 48  TYR A CE1   1 
ATOM   397  C  CE2   . TYR A 1 48  ? -5.560  64.872  -42.504 1.00 26.83  ? 48  TYR A CE2   1 
ATOM   398  C  CZ    . TYR A 1 48  ? -6.677  65.665  -42.387 1.00 30.07  ? 48  TYR A CZ    1 
ATOM   399  O  OH    . TYR A 1 48  ? -6.704  66.934  -42.929 1.00 32.65  ? 48  TYR A OH    1 
ATOM   400  N  N     . ALA A 1 49  ? -5.905  60.054  -43.108 1.00 27.27  ? 49  ALA A N     1 
ATOM   401  C  CA    . ALA A 1 49  ? -5.186  60.009  -44.359 1.00 27.97  ? 49  ALA A CA    1 
ATOM   402  C  C     . ALA A 1 49  ? -5.990  59.303  -45.444 1.00 29.03  ? 49  ALA A C     1 
ATOM   403  O  O     . ALA A 1 49  ? -5.649  59.401  -46.617 1.00 30.09  ? 49  ALA A O     1 
ATOM   404  C  CB    . ALA A 1 49  ? -3.847  59.320  -44.151 1.00 27.00  ? 49  ALA A CB    1 
ATOM   405  N  N     . ARG A 1 50  ? -7.041  58.586  -45.055 1.00 29.18  ? 50  ARG A N     1 
ATOM   406  C  CA    . ARG A 1 50  ? -7.886  57.887  -46.018 1.00 30.46  ? 50  ARG A CA    1 
ATOM   407  C  C     . ARG A 1 50  ? -9.307  58.463  -46.117 1.00 31.66  ? 50  ARG A C     1 
ATOM   408  O  O     . ARG A 1 50  ? -10.156 57.904  -46.810 1.00 32.65  ? 50  ARG A O     1 
ATOM   409  C  CB    . ARG A 1 50  ? -7.974  56.408  -45.649 1.00 30.35  ? 50  ARG A CB    1 
ATOM   410  C  CG    . ARG A 1 50  ? -6.853  55.547  -46.165 1.00 31.56  ? 50  ARG A CG    1 
ATOM   411  C  CD    . ARG A 1 50  ? -6.918  54.142  -45.548 1.00 33.09  ? 50  ARG A CD    1 
ATOM   412  N  NE    . ARG A 1 50  ? -5.799  53.905  -44.636 1.00 34.00  ? 50  ARG A NE    1 
ATOM   413  C  CZ    . ARG A 1 50  ? -5.891  53.446  -43.391 1.00 34.31  ? 50  ARG A CZ    1 
ATOM   414  N  NH1   . ARG A 1 50  ? -7.059  53.143  -42.836 1.00 34.85  ? 50  ARG A NH1   1 
ATOM   415  N  NH2   . ARG A 1 50  ? -4.784  53.274  -42.697 1.00 34.90  ? 50  ARG A NH2   1 
ATOM   416  N  N     . ASN A 1 51  ? -9.564  59.564  -45.415 1.00 31.67  ? 51  ASN A N     1 
ATOM   417  C  CA    . ASN A 1 51  ? -10.915 60.115  -45.269 1.00 33.08  ? 51  ASN A CA    1 
ATOM   418  C  C     . ASN A 1 51  ? -11.963 59.085  -44.901 1.00 32.90  ? 51  ASN A C     1 
ATOM   419  O  O     . ASN A 1 51  ? -13.041 59.066  -45.489 1.00 34.65  ? 51  ASN A O     1 
ATOM   420  C  CB    . ASN A 1 51  ? -11.343 60.889  -46.514 1.00 34.90  ? 51  ASN A CB    1 
ATOM   421  C  CG    . ASN A 1 51  ? -10.391 61.994  -46.835 1.00 37.11  ? 51  ASN A CG    1 
ATOM   422  O  OD1   . ASN A 1 51  ? -10.029 62.792  -45.961 1.00 40.02  ? 51  ASN A OD1   1 
ATOM   423  N  ND2   . ASN A 1 51  ? -9.933  62.036  -48.079 1.00 39.72  ? 51  ASN A ND2   1 
ATOM   424  N  N     . THR A 1 52  ? -11.641 58.236  -43.928 1.00 30.98  ? 52  THR A N     1 
ATOM   425  C  CA    . THR A 1 52  ? -12.598 57.264  -43.410 1.00 30.97  ? 52  THR A CA    1 
ATOM   426  C  C     . THR A 1 52  ? -12.944 57.503  -41.938 1.00 30.37  ? 52  THR A C     1 
ATOM   427  O  O     . THR A 1 52  ? -13.580 56.670  -41.307 1.00 30.86  ? 52  THR A O     1 
ATOM   428  C  CB    . THR A 1 52  ? -12.111 55.804  -43.616 1.00 30.48  ? 52  THR A CB    1 
ATOM   429  O  OG1   . THR A 1 52  ? -10.976 55.541  -42.772 1.00 30.41  ? 52  THR A OG1   1 
ATOM   430  C  CG2   . THR A 1 52  ? -11.730 55.559  -45.077 1.00 30.05  ? 52  THR A CG2   1 
ATOM   431  N  N     . TRP A 1 53  ? -12.532 58.642  -41.398 1.00 29.56  ? 53  TRP A N     1 
ATOM   432  C  CA    . TRP A 1 53  ? -12.797 58.959  -39.999 1.00 29.63  ? 53  TRP A CA    1 
ATOM   433  C  C     . TRP A 1 53  ? -14.245 59.370  -39.766 1.00 31.34  ? 53  TRP A C     1 
ATOM   434  O  O     . TRP A 1 53  ? -14.854 59.998  -40.608 1.00 32.54  ? 53  TRP A O     1 
ATOM   435  C  CB    . TRP A 1 53  ? -11.821 60.022  -39.467 1.00 28.96  ? 53  TRP A CB    1 
ATOM   436  C  CG    . TRP A 1 53  ? -12.241 61.431  -39.683 1.00 30.66  ? 53  TRP A CG    1 
ATOM   437  C  CD1   . TRP A 1 53  ? -13.023 62.210  -38.852 1.00 33.14  ? 53  TRP A CD1   1 
ATOM   438  C  CD2   . TRP A 1 53  ? -11.906 62.249  -40.795 1.00 29.63  ? 53  TRP A CD2   1 
ATOM   439  N  NE1   . TRP A 1 53  ? -13.189 63.466  -39.395 1.00 33.48  ? 53  TRP A NE1   1 
ATOM   440  C  CE2   . TRP A 1 53  ? -12.514 63.515  -40.587 1.00 31.89  ? 53  TRP A CE2   1 
ATOM   441  C  CE3   . TRP A 1 53  ? -11.147 62.042  -41.943 1.00 28.06  ? 53  TRP A CE3   1 
ATOM   442  C  CZ2   . TRP A 1 53  ? -12.379 64.558  -41.486 1.00 33.17  ? 53  TRP A CZ2   1 
ATOM   443  C  CZ3   . TRP A 1 53  ? -11.018 63.073  -42.840 1.00 30.63  ? 53  TRP A CZ3   1 
ATOM   444  C  CH2   . TRP A 1 53  ? -11.629 64.322  -42.608 1.00 32.98  ? 53  TRP A CH2   1 
ATOM   445  N  N     . LEU A 1 54  ? -14.763 59.025  -38.597 1.00 32.11  ? 54  LEU A N     1 
ATOM   446  C  CA    . LEU A 1 54  ? -16.151 59.260  -38.217 1.00 34.27  ? 54  LEU A CA    1 
ATOM   447  C  C     . LEU A 1 54  ? -16.401 60.699  -37.762 1.00 35.83  ? 54  LEU A C     1 
ATOM   448  O  O     . LEU A 1 54  ? -15.545 61.309  -37.124 1.00 35.43  ? 54  LEU A O     1 
ATOM   449  C  CB    . LEU A 1 54  ? -16.488 58.304  -37.083 1.00 34.68  ? 54  LEU A CB    1 
ATOM   450  C  CG    . LEU A 1 54  ? -17.805 57.548  -37.100 1.00 37.05  ? 54  LEU A CG    1 
ATOM   451  C  CD1   . LEU A 1 54  ? -18.174 57.069  -38.509 1.00 37.24  ? 54  LEU A CD1   1 
ATOM   452  C  CD2   . LEU A 1 54  ? -17.712 56.390  -36.122 1.00 36.21  ? 54  LEU A CD2   1 
ATOM   453  N  N     . LYS A 1 55  ? -17.570 61.235  -38.102 1.00 38.06  ? 55  LYS A N     1 
ATOM   454  C  CA    . LYS A 1 55  ? -18.006 62.560  -37.661 1.00 40.42  ? 55  LYS A CA    1 
ATOM   455  C  C     . LYS A 1 55  ? -17.813 62.714  -36.151 1.00 41.76  ? 55  LYS A C     1 
ATOM   456  O  O     . LYS A 1 55  ? -18.313 61.910  -35.367 1.00 42.77  ? 55  LYS A O     1 
ATOM   457  C  CB    . LYS A 1 55  ? -19.480 62.750  -38.024 1.00 43.07  ? 55  LYS A CB    1 
ATOM   458  C  CG    . LYS A 1 55  ? -20.101 64.071  -37.608 1.00 45.45  ? 55  LYS A CG    1 
ATOM   459  C  CD    . LYS A 1 55  ? -21.548 64.089  -38.014 1.00 47.65  ? 55  LYS A CD    1 
ATOM   460  C  CE    . LYS A 1 55  ? -22.070 65.490  -38.191 1.00 51.31  ? 55  LYS A CE    1 
ATOM   461  N  NZ    . LYS A 1 55  ? -22.916 65.890  -37.049 1.00 56.21  ? 55  LYS A NZ    1 
ATOM   462  N  N     . GLY A 1 56  ? -17.065 63.733  -35.746 1.00 42.14  ? 56  GLY A N     1 
ATOM   463  C  CA    . GLY A 1 56  ? -16.818 63.971  -34.330 1.00 43.82  ? 56  GLY A CA    1 
ATOM   464  C  C     . GLY A 1 56  ? -15.640 63.210  -33.746 1.00 42.00  ? 56  GLY A C     1 
ATOM   465  O  O     . GLY A 1 56  ? -15.312 63.393  -32.573 1.00 43.05  ? 56  GLY A O     1 
ATOM   466  N  N     . SER A 1 57  ? -15.001 62.367  -34.560 1.00 39.94  ? 57  SER A N     1 
ATOM   467  C  CA    . SER A 1 57  ? -13.871 61.531  -34.130 1.00 38.22  ? 57  SER A CA    1 
ATOM   468  C  C     . SER A 1 57  ? -12.567 61.868  -34.857 1.00 36.60  ? 57  SER A C     1 
ATOM   469  O  O     . SER A 1 57  ? -11.783 60.962  -35.182 1.00 34.97  ? 57  SER A O     1 
ATOM   470  C  CB    . SER A 1 57  ? -14.187 60.046  -34.354 1.00 37.39  ? 57  SER A CB    1 
ATOM   471  O  OG    . SER A 1 57  ? -14.848 59.456  -33.248 1.00 39.27  ? 57  SER A OG    1 
ATOM   472  N  N     . LEU A 1 58  ? -12.328 63.155  -35.109 1.00 37.80  ? 58  LEU A N     1 
ATOM   473  C  CA    . LEU A 1 58  ? -11.155 63.581  -35.862 1.00 36.49  ? 58  LEU A CA    1 
ATOM   474  C  C     . LEU A 1 58  ? -9.899  63.466  -35.026 1.00 36.23  ? 58  LEU A C     1 
ATOM   475  O  O     . LEU A 1 58  ? -9.793  64.063  -33.955 1.00 37.83  ? 58  LEU A O     1 
ATOM   476  C  CB    . LEU A 1 58  ? -11.318 65.015  -36.363 1.00 37.85  ? 58  LEU A CB    1 
ATOM   477  C  CG    . LEU A 1 58  ? -10.083 65.741  -36.911 1.00 35.70  ? 58  LEU A CG    1 
ATOM   478  C  CD1   . LEU A 1 58  ? -9.752  65.295  -38.317 1.00 31.41  ? 58  LEU A CD1   1 
ATOM   479  C  CD2   . LEU A 1 58  ? -10.313 67.247  -36.868 1.00 38.93  ? 58  LEU A CD2   1 
ATOM   480  N  N     . GLU A 1 59  ? -8.942  62.710  -35.548 1.00 35.25  ? 59  GLU A N     1 
ATOM   481  C  CA    . GLU A 1 59  ? -7.676  62.452  -34.889 1.00 35.50  ? 59  GLU A CA    1 
ATOM   482  C  C     . GLU A 1 59  ? -6.653  62.084  -35.964 1.00 33.98  ? 59  GLU A C     1 
ATOM   483  O  O     . GLU A 1 59  ? -6.875  61.139  -36.721 1.00 34.19  ? 59  GLU A O     1 
ATOM   484  C  CB    . GLU A 1 59  ? -7.866  61.290  -33.926 1.00 35.62  ? 59  GLU A CB    1 
ATOM   485  C  CG    . GLU A 1 59  ? -6.706  61.017  -33.036 1.00 38.15  ? 59  GLU A CG    1 
ATOM   486  C  CD    . GLU A 1 59  ? -6.751  59.612  -32.490 1.00 42.38  ? 59  GLU A CD    1 
ATOM   487  O  OE1   . GLU A 1 59  ? -6.096  58.732  -33.110 0.80 42.12  ? 59  GLU A OE1   1 
ATOM   488  O  OE2   . GLU A 1 59  ? -7.449  59.387  -31.465 0.80 43.83  ? 59  GLU A OE2   1 
ATOM   489  N  N     . ILE A 1 60  ? -5.540  62.808  -36.044 1.00 33.54  ? 60  ILE A N     1 
ATOM   490  C  CA    . ILE A 1 60  ? -4.548  62.552  -37.091 1.00 32.13  ? 60  ILE A CA    1 
ATOM   491  C  C     . ILE A 1 60  ? -3.417  61.646  -36.633 1.00 31.02  ? 60  ILE A C     1 
ATOM   492  O  O     . ILE A 1 60  ? -2.839  61.875  -35.588 1.00 31.40  ? 60  ILE A O     1 
ATOM   493  C  CB    . ILE A 1 60  ? -3.941  63.855  -37.608 1.00 32.68  ? 60  ILE A CB    1 
ATOM   494  C  CG1   . ILE A 1 60  ? -5.036  64.729  -38.204 1.00 34.60  ? 60  ILE A CG1   1 
ATOM   495  C  CG2   . ILE A 1 60  ? -2.847  63.579  -38.649 1.00 31.46  ? 60  ILE A CG2   1 
ATOM   496  C  CD1   . ILE A 1 60  ? -4.603  66.146  -38.450 1.00 37.28  ? 60  ILE A CD1   1 
ATOM   497  N  N     . ASP A 1 61  ? -3.095  60.638  -37.443 1.00 30.45  ? 61  ASP A N     1 
ATOM   498  C  CA    . ASP A 1 61  ? -1.994  59.704  -37.181 1.00 29.76  ? 61  ASP A CA    1 
ATOM   499  C  C     . ASP A 1 61  ? -0.760  59.992  -38.020 1.00 29.21  ? 61  ASP A C     1 
ATOM   500  O  O     . ASP A 1 61  ? -0.801  59.905  -39.251 1.00 29.26  ? 61  ASP A O     1 
ATOM   501  C  CB    . ASP A 1 61  ? -2.420  58.275  -37.496 1.00 29.68  ? 61  ASP A CB    1 
ATOM   502  C  CG    . ASP A 1 61  ? -3.504  57.778  -36.588 1.00 31.88  ? 61  ASP A CG    1 
ATOM   503  O  OD1   . ASP A 1 61  ? -4.495  57.211  -37.113 0.80 34.00  ? 61  ASP A OD1   1 
ATOM   504  O  OD2   . ASP A 1 61  ? -3.378  57.958  -35.356 0.80 33.41  ? 61  ASP A OD2   1 
ATOM   505  N  N     . VAL A 1 62  ? 0.343   60.293  -37.344 1.00 28.84  ? 62  VAL A N     1 
ATOM   506  C  CA    . VAL A 1 62  ? 1.623   60.485  -38.000 1.00 28.34  ? 62  VAL A CA    1 
ATOM   507  C  C     . VAL A 1 62  ? 2.578   59.372  -37.599 1.00 27.46  ? 62  VAL A C     1 
ATOM   508  O  O     . VAL A 1 62  ? 2.788   59.116  -36.406 1.00 27.56  ? 62  VAL A O     1 
ATOM   509  C  CB    . VAL A 1 62  ? 2.282   61.817  -37.597 1.00 29.32  ? 62  VAL A CB    1 
ATOM   510  C  CG1   . VAL A 1 62  ? 3.460   62.115  -38.525 1.00 29.92  ? 62  VAL A CG1   1 
ATOM   511  C  CG2   . VAL A 1 62  ? 1.276   62.956  -37.620 1.00 30.10  ? 62  VAL A CG2   1 
ATOM   512  N  N     . PHE A 1 63  ? 3.172   58.731  -38.598 1.00 26.46  ? 63  PHE A N     1 
ATOM   513  C  CA    . PHE A 1 63  ? 4.150   57.692  -38.362 1.00 25.42  ? 63  PHE A CA    1 
ATOM   514  C  C     . PHE A 1 63  ? 5.517   58.164  -38.796 1.00 25.49  ? 63  PHE A C     1 
ATOM   515  O  O     . PHE A 1 63  ? 5.707   58.570  -39.947 1.00 26.04  ? 63  PHE A O     1 
ATOM   516  C  CB    . PHE A 1 63  ? 3.754   56.424  -39.102 1.00 25.58  ? 63  PHE A CB    1 
ATOM   517  C  CG    . PHE A 1 63  ? 2.952   55.473  -38.270 1.00 25.73  ? 63  PHE A CG    1 
ATOM   518  C  CD1   . PHE A 1 63  ? 1.787   55.888  -37.644 1.00 25.82  ? 63  PHE A CD1   1 
ATOM   519  C  CD2   . PHE A 1 63  ? 3.375   54.161  -38.096 1.00 26.41  ? 63  PHE A CD2   1 
ATOM   520  C  CE1   . PHE A 1 63  ? 1.059   55.009  -36.869 1.00 26.98  ? 63  PHE A CE1   1 
ATOM   521  C  CE2   . PHE A 1 63  ? 2.654   53.273  -37.325 1.00 26.09  ? 63  PHE A CE2   1 
ATOM   522  C  CZ    . PHE A 1 63  ? 1.496   53.686  -36.715 1.00 26.78  ? 63  PHE A CZ    1 
ATOM   523  N  N     . LEU A 1 64  ? 6.453   58.135  -37.850 1.00 24.83  ? 64  LEU A N     1 
ATOM   524  C  CA    . LEU A 1 64  ? 7.838   58.497  -38.073 1.00 24.66  ? 64  LEU A CA    1 
ATOM   525  C  C     . LEU A 1 64  ? 8.612   57.255  -38.479 1.00 24.74  ? 64  LEU A C     1 
ATOM   526  O  O     . LEU A 1 64  ? 8.612   56.258  -37.741 1.00 24.53  ? 64  LEU A O     1 
ATOM   527  C  CB    . LEU A 1 64  ? 8.431   59.029  -36.775 1.00 25.25  ? 64  LEU A CB    1 
ATOM   528  C  CG    . LEU A 1 64  ? 7.774   60.205  -36.055 1.00 25.94  ? 64  LEU A CG    1 
ATOM   529  C  CD1   . LEU A 1 64  ? 8.479   60.429  -34.708 1.00 27.03  ? 64  LEU A CD1   1 
ATOM   530  C  CD2   . LEU A 1 64  ? 7.820   61.467  -36.914 1.00 25.66  ? 64  LEU A CD2   1 
ATOM   531  N  N     . LEU A 1 65  ? 9.295   57.321  -39.620 1.00 24.73  ? 65  LEU A N     1 
ATOM   532  C  CA    . LEU A 1 65  ? 9.985   56.152  -40.166 1.00 25.76  ? 65  LEU A CA    1 
ATOM   533  C  C     . LEU A 1 65  ? 11.500  56.097  -39.893 1.00 26.82  ? 65  LEU A C     1 
ATOM   534  O  O     . LEU A 1 65  ? 12.267  56.820  -40.512 1.00 27.62  ? 65  LEU A O     1 
ATOM   535  C  CB    . LEU A 1 65  ? 9.729   56.043  -41.667 1.00 26.28  ? 65  LEU A CB    1 
ATOM   536  C  CG    . LEU A 1 65  ? 8.286   56.112  -42.165 1.00 25.75  ? 65  LEU A CG    1 
ATOM   537  C  CD1   . LEU A 1 65  ? 8.289   56.245  -43.685 1.00 26.10  ? 65  LEU A CD1   1 
ATOM   538  C  CD2   . LEU A 1 65  ? 7.467   54.894  -41.719 1.00 25.35  ? 65  LEU A CD2   1 
ATOM   539  N  N     . PHE A 1 66  ? 11.926  55.206  -39.000 1.00 27.03  ? 66  PHE A N     1 
ATOM   540  C  CA    . PHE A 1 66  ? 13.332  55.126  -38.589 1.00 28.44  ? 66  PHE A CA    1 
ATOM   541  C  C     . PHE A 1 66  ? 14.101  53.974  -39.269 1.00 29.95  ? 66  PHE A C     1 
ATOM   542  O  O     . PHE A 1 66  ? 13.488  53.035  -39.788 1.00 29.82  ? 66  PHE A O     1 
ATOM   543  C  CB    . PHE A 1 66  ? 13.425  54.991  -37.063 1.00 28.43  ? 66  PHE A CB    1 
ATOM   544  C  CG    . PHE A 1 66  ? 12.988  56.226  -36.300 1.00 28.30  ? 66  PHE A CG    1 
ATOM   545  C  CD1   . PHE A 1 66  ? 13.903  57.231  -35.992 1.00 28.83  ? 66  PHE A CD1   1 
ATOM   546  C  CD2   . PHE A 1 66  ? 11.667  56.369  -35.863 1.00 28.22  ? 66  PHE A CD2   1 
ATOM   547  C  CE1   . PHE A 1 66  ? 13.514  58.363  -35.276 1.00 28.31  ? 66  PHE A CE1   1 
ATOM   548  C  CE2   . PHE A 1 66  ? 11.265  57.500  -35.139 1.00 27.34  ? 66  PHE A CE2   1 
ATOM   549  C  CZ    . PHE A 1 66  ? 12.192  58.498  -34.848 1.00 27.66  ? 66  PHE A CZ    1 
ATOM   550  N  N     . PRO A 1 67  ? 15.446  54.047  -39.282 1.00 31.43  ? 67  PRO A N     1 
ATOM   551  C  CA    . PRO A 1 67  ? 16.235  52.924  -39.761 1.00 33.75  ? 67  PRO A CA    1 
ATOM   552  C  C     . PRO A 1 67  ? 16.001  51.693  -38.911 1.00 34.68  ? 67  PRO A C     1 
ATOM   553  O  O     . PRO A 1 67  ? 16.008  51.789  -37.681 1.00 34.25  ? 67  PRO A O     1 
ATOM   554  C  CB    . PRO A 1 67  ? 17.674  53.410  -39.581 1.00 35.00  ? 67  PRO A CB    1 
ATOM   555  C  CG    . PRO A 1 67  ? 17.570  54.877  -39.642 1.00 33.83  ? 67  PRO A CG    1 
ATOM   556  C  CD    . PRO A 1 67  ? 16.310  55.175  -38.900 1.00 31.83  ? 67  PRO A CD    1 
ATOM   557  N  N     . GLU A 1 68  ? 15.795  50.547  -39.558 1.00 36.55  ? 68  GLU A N     1 
ATOM   558  C  CA    . GLU A 1 68  ? 15.564  49.296  -38.826 1.00 38.28  ? 68  GLU A CA    1 
ATOM   559  C  C     . GLU A 1 68  ? 16.751  48.900  -37.944 1.00 39.55  ? 68  GLU A C     1 
ATOM   560  O  O     . GLU A 1 68  ? 16.592  48.120  -37.011 1.00 40.22  ? 68  GLU A O     1 
ATOM   561  C  CB    . GLU A 1 68  ? 15.108  48.149  -39.751 1.00 39.10  ? 68  GLU A CB    1 
ATOM   562  C  CG    . GLU A 1 68  ? 16.189  47.406  -40.521 1.00 43.59  ? 68  GLU A CG    1 
ATOM   563  C  CD    . GLU A 1 68  ? 15.616  46.260  -41.381 1.00 46.35  ? 68  GLU A CD    1 
ATOM   564  O  OE1   . GLU A 1 68  ? 16.380  45.331  -41.761 1.00 51.74  ? 68  GLU A OE1   1 
ATOM   565  O  OE2   . GLU A 1 68  ? 14.394  46.282  -41.684 1.00 48.35  ? 68  GLU A OE2   1 
ATOM   566  N  N     . GLU A 1 69  ? 17.920  49.471  -38.231 1.00 40.45  ? 69  GLU A N     1 
ATOM   567  C  CA    . GLU A 1 69  ? 19.124  49.235  -37.447 1.00 42.44  ? 69  GLU A CA    1 
ATOM   568  C  C     . GLU A 1 69  ? 19.008  49.742  -36.009 1.00 41.00  ? 69  GLU A C     1 
ATOM   569  O  O     . GLU A 1 69  ? 19.716  49.256  -35.128 1.00 42.72  ? 69  GLU A O     1 
ATOM   570  C  CB    . GLU A 1 69  ? 20.341  49.882  -38.109 1.00 44.10  ? 69  GLU A CB    1 
ATOM   571  C  CG    . GLU A 1 69  ? 20.904  49.125  -39.305 1.00 48.73  ? 69  GLU A CG    1 
ATOM   572  C  CD    . GLU A 1 69  ? 20.750  49.865  -40.646 1.00 51.23  ? 69  GLU A CD    1 
ATOM   573  O  OE1   . GLU A 1 69  ? 21.729  49.812  -41.437 1.00 55.10  ? 69  GLU A OE1   1 
ATOM   574  O  OE2   . GLU A 1 69  ? 19.679  50.489  -40.912 1.00 48.02  ? 69  GLU A OE2   1 
ATOM   575  N  N     . PHE A 1 70  ? 18.128  50.716  -35.788 1.00 38.21  ? 70  PHE A N     1 
ATOM   576  C  CA    . PHE A 1 70  ? 17.934  51.336  -34.482 1.00 37.16  ? 70  PHE A CA    1 
ATOM   577  C  C     . PHE A 1 70  ? 17.486  50.328  -33.436 1.00 38.00  ? 70  PHE A C     1 
ATOM   578  O  O     . PHE A 1 70  ? 16.705  49.417  -33.723 1.00 37.50  ? 70  PHE A O     1 
ATOM   579  C  CB    . PHE A 1 70  ? 16.870  52.441  -34.565 1.00 34.50  ? 70  PHE A CB    1 
ATOM   580  C  CG    . PHE A 1 70  ? 17.406  53.808  -34.917 1.00 33.18  ? 70  PHE A CG    1 
ATOM   581  C  CD1   . PHE A 1 70  ? 18.587  53.963  -35.642 1.00 33.83  ? 70  PHE A CD1   1 
ATOM   582  C  CD2   . PHE A 1 70  ? 16.692  54.947  -34.556 1.00 30.56  ? 70  PHE A CD2   1 
ATOM   583  C  CE1   . PHE A 1 70  ? 19.062  55.234  -35.971 1.00 32.95  ? 70  PHE A CE1   1 
ATOM   584  C  CE2   . PHE A 1 70  ? 17.161  56.222  -34.887 1.00 30.53  ? 70  PHE A CE2   1 
ATOM   585  C  CZ    . PHE A 1 70  ? 18.345  56.363  -35.596 1.00 32.17  ? 70  PHE A CZ    1 
ATOM   586  N  N     . SER A 1 71  ? 17.979  50.513  -32.217 1.00 39.30  ? 71  SER A N     1 
ATOM   587  C  CA    . SER A 1 71  ? 17.475  49.784  -31.073 1.00 40.70  ? 71  SER A CA    1 
ATOM   588  C  C     . SER A 1 71  ? 16.081  50.308  -30.737 1.00 39.28  ? 71  SER A C     1 
ATOM   589  O  O     . SER A 1 71  ? 15.686  51.387  -31.193 1.00 37.73  ? 71  SER A O     1 
ATOM   590  C  CB    . SER A 1 71  ? 18.416  49.945  -29.878 1.00 42.42  ? 71  SER A CB    1 
ATOM   591  O  OG    . SER A 1 71  ? 18.371  51.262  -29.354 1.00 41.69  ? 71  SER A OG    1 
ATOM   592  N  N     . LYS A 1 72  ? 15.337  49.531  -29.954 1.00 40.59  ? 72  LYS A N     1 
ATOM   593  C  CA    . LYS A 1 72  ? 14.013  49.928  -29.484 1.00 39.86  ? 72  LYS A CA    1 
ATOM   594  C  C     . LYS A 1 72  ? 14.129  51.140  -28.545 1.00 39.67  ? 72  LYS A C     1 
ATOM   595  O  O     . LYS A 1 72  ? 13.259  52.022  -28.537 1.00 37.94  ? 72  LYS A O     1 
ATOM   596  C  CB    . LYS A 1 72  ? 13.329  48.735  -28.795 1.00 41.25  ? 72  LYS A CB    1 
ATOM   597  C  CG    . LYS A 1 72  ? 11.947  49.036  -28.170 1.00 43.00  ? 72  LYS A CG    1 
ATOM   598  C  CD    . LYS A 1 72  ? 12.052  49.242  -26.636 1.00 47.41  ? 72  LYS A CD    1 
ATOM   599  C  CE    . LYS A 1 72  ? 11.083  50.319  -26.119 1.00 46.87  ? 72  LYS A CE    1 
ATOM   600  N  NZ    . LYS A 1 72  ? 11.610  50.894  -24.847 1.00 48.86  ? 72  LYS A NZ    1 
ATOM   601  N  N     . GLU A 1 73  ? 15.213  51.160  -27.763 1.00 41.59  ? 73  GLU A N     1 
ATOM   602  C  CA    . GLU A 1 73  ? 15.559  52.273  -26.888 1.00 42.10  ? 73  GLU A CA    1 
ATOM   603  C  C     . GLU A 1 73  ? 15.684  53.547  -27.700 1.00 40.43  ? 73  GLU A C     1 
ATOM   604  O  O     . GLU A 1 73  ? 15.142  54.593  -27.326 1.00 39.27  ? 73  GLU A O     1 
ATOM   605  C  CB    . GLU A 1 73  ? 16.887  52.011  -26.168 1.00 44.63  ? 73  GLU A CB    1 
ATOM   606  C  CG    . GLU A 1 73  ? 16.948  50.720  -25.339 1.00 48.97  ? 73  GLU A CG    1 
ATOM   607  C  CD    . GLU A 1 73  ? 17.443  49.486  -26.121 1.00 51.38  ? 73  GLU A CD    1 
ATOM   608  O  OE1   . GLU A 1 73  ? 16.803  49.097  -27.132 1.00 49.34  ? 73  GLU A OE1   1 
ATOM   609  O  OE2   . GLU A 1 73  ? 18.468  48.896  -25.694 1.00 54.05  ? 73  GLU A OE2   1 
ATOM   610  N  N     . GLU A 1 74  ? 16.399  53.444  -28.820 1.00 40.55  ? 74  GLU A N     1 
ATOM   611  C  CA    . GLU A 1 74  ? 16.659  54.598  -29.685 1.00 39.89  ? 74  GLU A CA    1 
ATOM   612  C  C     . GLU A 1 74  ? 15.394  55.092  -30.370 1.00 38.03  ? 74  GLU A C     1 
ATOM   613  O  O     . GLU A 1 74  ? 15.194  56.294  -30.540 1.00 37.17  ? 74  GLU A O     1 
ATOM   614  C  CB    . GLU A 1 74  ? 17.739  54.279  -30.711 1.00 40.47  ? 74  GLU A CB    1 
ATOM   615  C  CG    . GLU A 1 74  ? 19.129  54.251  -30.123 1.00 41.76  ? 74  GLU A CG    1 
ATOM   616  C  CD    . GLU A 1 74  ? 20.182  53.857  -31.137 1.00 42.90  ? 74  GLU A CD    1 
ATOM   617  O  OE1   . GLU A 1 74  ? 19.859  53.056  -32.034 1.00 42.38  ? 74  GLU A OE1   1 
ATOM   618  O  OE2   . GLU A 1 74  ? 21.333  54.344  -31.040 1.00 44.62  ? 74  GLU A OE2   1 
ATOM   619  N  N     . LEU A 1 75  ? 14.543  54.145  -30.737 1.00 37.88  ? 75  LEU A N     1 
ATOM   620  C  CA    . LEU A 1 75  ? 13.231  54.437  -31.288 1.00 36.76  ? 75  LEU A CA    1 
ATOM   621  C  C     . LEU A 1 75  ? 12.388  55.284  -30.338 1.00 36.81  ? 75  LEU A C     1 
ATOM   622  O  O     . LEU A 1 75  ? 11.848  56.297  -30.748 1.00 36.23  ? 75  LEU A O     1 
ATOM   623  C  CB    . LEU A 1 75  ? 12.507  53.134  -31.627 1.00 36.56  ? 75  LEU A CB    1 
ATOM   624  C  CG    . LEU A 1 75  ? 11.385  53.202  -32.655 1.00 35.06  ? 75  LEU A CG    1 
ATOM   625  C  CD1   . LEU A 1 75  ? 11.968  53.286  -34.043 1.00 35.02  ? 75  LEU A CD1   1 
ATOM   626  C  CD2   . LEU A 1 75  ? 10.482  51.993  -32.524 1.00 34.89  ? 75  LEU A CD2   1 
ATOM   627  N  N     . ARG A 1 76  ? 12.278  54.890  -29.070 1.00 38.73  ? 76  ARG A N     1 
ATOM   628  C  CA    . ARG A 1 76  ? 11.425  55.645  -28.148 1.00 39.42  ? 76  ARG A CA    1 
ATOM   629  C  C     . ARG A 1 76  ? 11.994  57.009  -27.824 1.00 39.46  ? 76  ARG A C     1 
ATOM   630  O  O     . ARG A 1 76  ? 11.253  57.987  -27.849 1.00 39.22  ? 76  ARG A O     1 
ATOM   631  C  CB    . ARG A 1 76  ? 11.009  54.867  -26.880 1.00 40.54  ? 76  ARG A CB    1 
ATOM   632  C  CG    . ARG A 1 76  ? 12.109  54.215  -26.080 1.00 44.20  ? 76  ARG A CG    1 
ATOM   633  C  CD    . ARG A 1 76  ? 11.695  54.033  -24.605 1.00 45.93  ? 76  ARG A CD    1 
ATOM   634  N  NE    . ARG A 1 76  ? 11.529  55.312  -23.924 1.00 49.62  ? 76  ARG A NE    1 
ATOM   635  C  CZ    . ARG A 1 76  ? 12.533  56.085  -23.516 1.00 53.49  ? 76  ARG A CZ    1 
ATOM   636  N  NH1   . ARG A 1 76  ? 13.798  55.712  -23.710 1.00 56.05  ? 76  ARG A NH1   1 
ATOM   637  N  NH2   . ARG A 1 76  ? 12.275  57.240  -22.910 1.00 54.96  ? 76  ARG A NH2   1 
ATOM   638  N  N     . GLU A 1 77  ? 13.298  57.088  -27.555 1.00 40.38  ? 77  GLU A N     1 
ATOM   639  C  CA    . GLU A 1 77  ? 13.935  58.377  -27.255 1.00 40.86  ? 77  GLU A CA    1 
ATOM   640  C  C     . GLU A 1 77  ? 13.673  59.374  -28.355 1.00 38.99  ? 77  GLU A C     1 
ATOM   641  O  O     . GLU A 1 77  ? 13.356  60.524  -28.094 1.00 39.40  ? 77  GLU A O     1 
ATOM   642  C  CB    . GLU A 1 77  ? 15.439  58.233  -27.067 1.00 42.45  ? 77  GLU A CB    1 
ATOM   643  C  CG    . GLU A 1 77  ? 15.830  57.489  -25.810 1.00 46.88  ? 77  GLU A CG    1 
ATOM   644  C  CD    . GLU A 1 77  ? 17.303  57.655  -25.463 1.00 52.30  ? 77  GLU A CD    1 
ATOM   645  O  OE1   . GLU A 1 77  ? 17.865  56.753  -24.794 1.00 55.49  ? 77  GLU A OE1   1 
ATOM   646  O  OE2   . GLU A 1 77  ? 17.900  58.690  -25.846 1.00 53.38  ? 77  GLU A OE2   1 
ATOM   647  N  N     . ARG A 1 78  ? 13.771  58.909  -29.591 1.00 37.51  ? 78  ARG A N     1 
ATOM   648  C  CA    . ARG A 1 78  ? 13.683  59.782  -30.746 1.00 36.30  ? 78  ARG A CA    1 
ATOM   649  C  C     . ARG A 1 78  ? 12.245  60.102  -31.111 1.00 34.82  ? 78  ARG A C     1 
ATOM   650  O  O     . ARG A 1 78  ? 11.920  61.246  -31.418 1.00 34.60  ? 78  ARG A O     1 
ATOM   651  C  CB    . ARG A 1 78  ? 14.449  59.179  -31.928 1.00 36.29  ? 78  ARG A CB    1 
ATOM   652  C  CG    . ARG A 1 78  ? 15.958  59.348  -31.830 1.00 36.52  ? 78  ARG A CG    1 
ATOM   653  C  CD    . ARG A 1 78  ? 16.430  60.404  -32.792 1.00 37.63  ? 78  ARG A CD    1 
ATOM   654  N  NE    . ARG A 1 78  ? 15.989  61.755  -32.451 1.00 38.90  ? 78  ARG A NE    1 
ATOM   655  C  CZ    . ARG A 1 78  ? 15.743  62.722  -33.336 1.00 39.26  ? 78  ARG A CZ    1 
ATOM   656  N  NH1   . ARG A 1 78  ? 15.862  62.503  -34.643 1.00 38.74  ? 78  ARG A NH1   1 
ATOM   657  N  NH2   . ARG A 1 78  ? 15.357  63.914  -32.910 1.00 39.87  ? 78  ARG A NH2   1 
ATOM   658  N  N     . GLY A 1 79  ? 11.389  59.089  -31.074 1.00 33.96  ? 79  GLY A N     1 
ATOM   659  C  CA    . GLY A 1 79  ? 9.963   59.292  -31.266 1.00 33.18  ? 79  GLY A CA    1 
ATOM   660  C  C     . GLY A 1 79  ? 9.484   60.359  -30.305 1.00 34.07  ? 79  GLY A C     1 
ATOM   661  O  O     . GLY A 1 79  ? 8.930   61.376  -30.703 1.00 34.12  ? 79  GLY A O     1 
ATOM   662  N  N     . LEU A 1 80  ? 9.724   60.136  -29.026 1.00 35.60  ? 80  LEU A N     1 
ATOM   663  C  CA    . LEU A 1 80  ? 9.267   61.062  -27.999 1.00 36.99  ? 80  LEU A CA    1 
ATOM   664  C  C     . LEU A 1 80  ? 9.825   62.461  -28.235 1.00 37.45  ? 80  LEU A C     1 
ATOM   665  O  O     . LEU A 1 80  ? 9.077   63.424  -28.178 1.00 38.09  ? 80  LEU A O     1 
ATOM   666  C  CB    . LEU A 1 80  ? 9.571   60.521  -26.589 1.00 38.57  ? 80  LEU A CB    1 
ATOM   667  C  CG    . LEU A 1 80  ? 8.545   59.562  -25.928 1.00 39.28  ? 80  LEU A CG    1 
ATOM   668  C  CD1   . LEU A 1 80  ? 7.980   58.478  -26.853 1.00 37.12  ? 80  LEU A CD1   1 
ATOM   669  C  CD2   . LEU A 1 80  ? 9.111   58.926  -24.661 1.00 40.60  ? 80  LEU A CD2   1 
ATOM   670  N  N     . GLU A 1 81  ? 11.113  62.565  -28.549 1.00 37.43  ? 81  GLU A N     1 
ATOM   671  C  CA    . GLU A 1 81  ? 11.720  63.844  -28.920 1.00 38.43  ? 81  GLU A CA    1 
ATOM   672  C  C     . GLU A 1 81  ? 10.922  64.625  -29.963 1.00 37.24  ? 81  GLU A C     1 
ATOM   673  O  O     . GLU A 1 81  ? 10.480  65.738  -29.710 1.00 38.04  ? 81  GLU A O     1 
ATOM   674  C  CB    . GLU A 1 81  ? 13.122  63.621  -29.467 1.00 39.13  ? 81  GLU A CB    1 
ATOM   675  C  CG    . GLU A 1 81  ? 14.240  64.160  -28.628 1.00 43.32  ? 81  GLU A CG    1 
ATOM   676  C  CD    . GLU A 1 81  ? 15.501  64.321  -29.453 1.00 48.10  ? 81  GLU A CD    1 
ATOM   677  O  OE1   . GLU A 1 81  ? 15.840  63.365  -30.194 1.00 48.25  ? 81  GLU A OE1   1 
ATOM   678  O  OE2   . GLU A 1 81  ? 16.144  65.403  -29.379 1.00 51.24  ? 81  GLU A OE2   1 
ATOM   679  N  N     . ILE A 1 82  ? 10.761  64.026  -31.138 1.00 35.62  ? 82  ILE A N     1 
ATOM   680  C  CA    . ILE A 1 82  ? 10.059  64.635  -32.259 1.00 34.94  ? 82  ILE A CA    1 
ATOM   681  C  C     . ILE A 1 82  ? 8.588   64.917  -31.957 1.00 34.96  ? 82  ILE A C     1 
ATOM   682  O  O     . ILE A 1 82  ? 8.091   66.004  -32.252 1.00 35.46  ? 82  ILE A O     1 
ATOM   683  C  CB    . ILE A 1 82  ? 10.176  63.753  -33.513 1.00 33.81  ? 82  ILE A CB    1 
ATOM   684  C  CG1   . ILE A 1 82  ? 11.616  63.790  -34.033 1.00 34.91  ? 82  ILE A CG1   1 
ATOM   685  C  CG2   . ILE A 1 82  ? 9.188   64.209  -34.588 1.00 32.77  ? 82  ILE A CG2   1 
ATOM   686  C  CD1   . ILE A 1 82  ? 12.057  62.510  -34.706 1.00 36.70  ? 82  ILE A CD1   1 
ATOM   687  N  N     . GLY A 1 83  ? 7.896   63.937  -31.373 1.00 34.54  ? 83  GLY A N     1 
ATOM   688  C  CA    . GLY A 1 83  ? 6.502   64.109  -30.979 1.00 34.97  ? 83  GLY A CA    1 
ATOM   689  C  C     . GLY A 1 83  ? 6.337   65.339  -30.105 1.00 37.06  ? 83  GLY A C     1 
ATOM   690  O  O     . GLY A 1 83  ? 5.477   66.193  -30.363 1.00 37.93  ? 83  GLY A O     1 
ATOM   691  N  N     . LYS A 1 84  ? 7.181   65.428  -29.077 1.00 38.00  ? 84  LYS A N     1 
ATOM   692  C  CA    . LYS A 1 84  ? 7.241   66.593  -28.203 1.00 39.75  ? 84  LYS A CA    1 
ATOM   693  C  C     . LYS A 1 84  ? 7.583   67.865  -28.971 1.00 40.06  ? 84  LYS A C     1 
ATOM   694  O  O     . LYS A 1 84  ? 7.116   68.937  -28.622 1.00 42.03  ? 84  LYS A O     1 
ATOM   695  C  CB    . LYS A 1 84  ? 8.250   66.359  -27.069 1.00 40.97  ? 84  LYS A CB    1 
ATOM   696  C  CG    . LYS A 1 84  ? 7.648   65.626  -25.879 1.00 42.30  ? 84  LYS A CG    1 
ATOM   697  C  CD    . LYS A 1 84  ? 8.592   64.628  -25.189 1.00 43.72  ? 84  LYS A CD    1 
ATOM   698  C  CE    . LYS A 1 84  ? 9.541   65.272  -24.172 1.00 46.14  ? 84  LYS A CE    1 
ATOM   699  N  NZ    . LYS A 1 84  ? 10.954  65.258  -24.651 1.00 45.87  ? 84  LYS A NZ    1 
ATOM   700  N  N     . ALA A 1 85  ? 8.384   67.745  -30.023 1.00 38.64  ? 85  ALA A N     1 
ATOM   701  C  CA    . ALA A 1 85  ? 8.890   68.927  -30.740 1.00 39.36  ? 85  ALA A CA    1 
ATOM   702  C  C     . ALA A 1 85  ? 7.827   69.542  -31.617 1.00 39.05  ? 85  ALA A C     1 
ATOM   703  O  O     . ALA A 1 85  ? 7.932   70.687  -32.020 1.00 40.90  ? 85  ALA A O     1 
ATOM   704  C  CB    . ALA A 1 85  ? 10.111  68.567  -31.588 1.00 38.32  ? 85  ALA A CB    1 
ATOM   705  N  N     . VAL A 1 86  ? 6.790   68.774  -31.889 1.00 37.33  ? 86  VAL A N     1 
ATOM   706  C  CA    . VAL A 1 86  ? 5.911   69.061  -32.999 1.00 36.48  ? 86  VAL A CA    1 
ATOM   707  C  C     . VAL A 1 86  ? 4.474   69.367  -32.558 1.00 37.82  ? 86  VAL A C     1 
ATOM   708  O  O     . VAL A 1 86  ? 3.702   69.941  -33.320 1.00 38.38  ? 86  VAL A O     1 
ATOM   709  C  CB    . VAL A 1 86  ? 6.002   67.893  -34.006 1.00 33.97  ? 86  VAL A CB    1 
ATOM   710  C  CG1   . VAL A 1 86  ? 4.653   67.301  -34.340 1.00 31.81  ? 86  VAL A CG1   1 
ATOM   711  C  CG2   . VAL A 1 86  ? 6.773   68.311  -35.224 1.00 33.09  ? 86  VAL A CG2   1 
ATOM   712  N  N     . LEU A 1 87  ? 4.131   69.006  -31.323 1.00 38.54  ? 87  LEU A N     1 
ATOM   713  C  CA    . LEU A 1 87  ? 2.764   69.149  -30.827 1.00 39.61  ? 87  LEU A CA    1 
ATOM   714  C  C     . LEU A 1 87  ? 2.648   70.325  -29.862 1.00 42.71  ? 87  LEU A C     1 
ATOM   715  O  O     . LEU A 1 87  ? 3.518   70.510  -29.015 1.00 43.68  ? 87  LEU A O     1 
ATOM   716  C  CB    . LEU A 1 87  ? 2.309   67.854  -30.150 1.00 38.53  ? 87  LEU A CB    1 
ATOM   717  C  CG    . LEU A 1 87  ? 2.446   66.545  -30.933 1.00 34.95  ? 87  LEU A CG    1 
ATOM   718  C  CD1   . LEU A 1 87  ? 2.206   65.363  -30.033 1.00 34.38  ? 87  LEU A CD1   1 
ATOM   719  C  CD2   . LEU A 1 87  ? 1.487   66.505  -32.091 1.00 34.50  ? 87  LEU A CD2   1 
ATOM   720  N  N     . ASP A 1 88  ? 1.577   71.113  -30.007 1.00 44.91  ? 88  ASP A N     1 
ATOM   721  C  CA    . ASP A 1 88  ? 1.328   72.312  -29.189 1.00 48.29  ? 88  ASP A CA    1 
ATOM   722  C  C     . ASP A 1 88  ? 1.409   71.950  -27.716 1.00 49.59  ? 88  ASP A C     1 
ATOM   723  O  O     . ASP A 1 88  ? 2.231   72.491  -26.986 1.00 51.42  ? 88  ASP A O     1 
ATOM   724  C  CB    . ASP A 1 88  ? -0.041  72.921  -29.512 1.00 49.97  ? 88  ASP A CB    1 
ATOM   725  C  CG    . ASP A 1 88  ? -0.075  73.638  -30.860 1.00 50.81  ? 88  ASP A CG    1 
ATOM   726  O  OD1   . ASP A 1 88  ? 0.966   73.684  -31.547 1.00 49.89  ? 88  ASP A OD1   1 
ATOM   727  O  OD2   . ASP A 1 88  ? -1.151  74.165  -31.237 1.00 52.91  ? 88  ASP A OD2   1 
ATOM   728  N  N     . SER A 1 89  ? 0.548   71.032  -27.291 1.00 49.37  ? 89  SER A N     1 
ATOM   729  C  CA    . SER A 1 89  ? 0.705   70.348  -26.016 1.00 50.16  ? 89  SER A CA    1 
ATOM   730  C  C     . SER A 1 89  ? 0.612   68.846  -26.254 1.00 48.10  ? 89  SER A C     1 
ATOM   731  O  O     . SER A 1 89  ? 0.207   68.399  -27.345 1.00 46.19  ? 89  SER A O     1 
ATOM   732  C  CB    . SER A 1 89  ? -0.341  70.801  -25.017 1.00 52.96  ? 89  SER A CB    1 
ATOM   733  O  OG    . SER A 1 89  ? -1.625  70.643  -25.554 1.00 52.38  ? 89  SER A OG    1 
ATOM   734  N  N     . TYR A 1 90  ? 0.994   68.069  -25.241 1.00 48.55  ? 90  TYR A N     1 
ATOM   735  C  CA    . TYR A 1 90  ? 1.170   66.633  -25.423 1.00 46.60  ? 90  TYR A CA    1 
ATOM   736  C  C     . TYR A 1 90  ? 1.025   65.833  -24.137 1.00 48.05  ? 90  TYR A C     1 
ATOM   737  O  O     . TYR A 1 90  ? 1.127   66.380  -23.040 1.00 50.59  ? 90  TYR A O     1 
ATOM   738  C  CB    . TYR A 1 90  ? 2.537   66.340  -26.065 1.00 44.48  ? 90  TYR A CB    1 
ATOM   739  C  CG    . TYR A 1 90  ? 3.726   66.710  -25.204 1.00 45.41  ? 90  TYR A CG    1 
ATOM   740  C  CD1   . TYR A 1 90  ? 4.203   65.838  -24.223 1.00 45.14  ? 90  TYR A CD1   1 
ATOM   741  C  CD2   . TYR A 1 90  ? 4.379   67.931  -25.376 1.00 46.29  ? 90  TYR A CD2   1 
ATOM   742  C  CE1   . TYR A 1 90  ? 5.293   66.180  -23.425 1.00 46.32  ? 90  TYR A CE1   1 
ATOM   743  C  CE2   . TYR A 1 90  ? 5.473   68.277  -24.592 1.00 47.19  ? 90  TYR A CE2   1 
ATOM   744  C  CZ    . TYR A 1 90  ? 5.921   67.397  -23.620 1.00 47.89  ? 90  TYR A CZ    1 
ATOM   745  O  OH    . TYR A 1 90  ? 7.001   67.736  -22.840 1.00 50.52  ? 90  TYR A OH    1 
ATOM   746  N  N     . GLU A 1 91  ? 0.810   64.530  -24.303 1.00 46.93  ? 91  GLU A N     1 
ATOM   747  C  CA    . GLU A 1 91  ? 0.726   63.567  -23.215 1.00 48.39  ? 91  GLU A CA    1 
ATOM   748  C  C     . GLU A 1 91  ? 1.436   62.285  -23.646 1.00 46.29  ? 91  GLU A C     1 
ATOM   749  O  O     . GLU A 1 91  ? 1.366   61.881  -24.819 1.00 44.66  ? 91  GLU A O     1 
ATOM   750  C  CB    . GLU A 1 91  ? -0.736  63.271  -22.899 1.00 49.75  ? 91  GLU A CB    1 
ATOM   751  C  CG    . GLU A 1 91  ? -1.005  62.917  -21.440 1.00 54.67  ? 91  GLU A CG    1 
ATOM   752  C  CD    . GLU A 1 91  ? -2.471  63.114  -21.041 1.00 59.43  ? 91  GLU A CD    1 
ATOM   753  O  OE1   . GLU A 1 91  ? -2.727  63.426  -19.850 1.00 62.69  ? 91  GLU A OE1   1 
ATOM   754  O  OE2   . GLU A 1 91  ? -3.361  62.974  -21.920 1.00 58.93  ? 91  GLU A OE2   1 
ATOM   755  N  N     . ILE A 1 92  ? 2.139   61.655  -22.713 1.00 46.91  ? 92  ILE A N     1 
ATOM   756  C  CA    . ILE A 1 92  ? 2.821   60.392  -22.996 1.00 45.11  ? 92  ILE A CA    1 
ATOM   757  C  C     . ILE A 1 92  ? 2.239   59.338  -22.069 1.00 46.44  ? 92  ILE A C     1 
ATOM   758  O  O     . ILE A 1 92  ? 2.383   59.429  -20.849 1.00 48.85  ? 92  ILE A O     1 
ATOM   759  C  CB    . ILE A 1 92  ? 4.355   60.510  -22.802 1.00 44.92  ? 92  ILE A CB    1 
ATOM   760  C  CG1   . ILE A 1 92  ? 4.967   61.414  -23.870 1.00 43.61  ? 92  ILE A CG1   1 
ATOM   761  C  CG2   . ILE A 1 92  ? 5.021   59.144  -22.827 1.00 44.12  ? 92  ILE A CG2   1 
ATOM   762  C  CD1   . ILE A 1 92  ? 6.324   61.982  -23.494 1.00 45.10  ? 92  ILE A CD1   1 
ATOM   763  N  N     . ARG A 1 93  ? 1.558   58.356  -22.651 1.00 45.28  ? 93  ARG A N     1 
ATOM   764  C  CA    . ARG A 1 93  ? 0.935   57.273  -21.889 1.00 46.65  ? 93  ARG A CA    1 
ATOM   765  C  C     . ARG A 1 93  ? 0.629   56.121  -22.827 1.00 44.38  ? 93  ARG A C     1 
ATOM   766  O  O     . ARG A 1 93  ? -0.145  56.272  -23.774 1.00 43.13  ? 93  ARG A O     1 
ATOM   767  C  CB    . ARG A 1 93  ? -0.338  57.749  -21.168 1.00 49.07  ? 93  ARG A CB    1 
ATOM   768  C  CG    . ARG A 1 93  ? -0.789  56.816  -20.048 1.00 53.37  ? 93  ARG A CG    1 
ATOM   769  C  CD    . ARG A 1 93  ? -1.544  57.533  -18.916 1.00 59.21  ? 93  ARG A CD    1 
ATOM   770  N  NE    . ARG A 1 93  ? -1.698  56.697  -17.715 1.00 63.58  ? 93  ARG A NE    1 
ATOM   771  C  CZ    . ARG A 1 93  ? -0.696  56.336  -16.903 1.00 65.65  ? 93  ARG A CZ    1 
ATOM   772  N  NH1   . ARG A 1 93  ? 0.553   56.716  -17.158 1.00 64.56  ? 93  ARG A NH1   1 
ATOM   773  N  NH2   . ARG A 1 93  ? -0.935  55.581  -15.836 1.00 68.39  ? 93  ARG A NH2   1 
ATOM   774  N  N     . TYR A 1 94  ? 1.264   54.980  -22.570 1.00 44.15  ? 94  TYR A N     1 
ATOM   775  C  CA    . TYR A 1 94  ? 1.154   53.804  -23.439 1.00 42.23  ? 94  TYR A CA    1 
ATOM   776  C  C     . TYR A 1 94  ? 1.407   52.502  -22.679 1.00 43.74  ? 94  TYR A C     1 
ATOM   777  O  O     . TYR A 1 94  ? 1.969   52.513  -21.578 1.00 45.29  ? 94  TYR A O     1 
ATOM   778  C  CB    . TYR A 1 94  ? 2.118   53.921  -24.618 1.00 39.76  ? 94  TYR A CB    1 
ATOM   779  C  CG    . TYR A 1 94  ? 3.552   54.175  -24.223 1.00 39.86  ? 94  TYR A CG    1 
ATOM   780  C  CD1   . TYR A 1 94  ? 4.415   53.115  -23.973 1.00 41.16  ? 94  TYR A CD1   1 
ATOM   781  C  CD2   . TYR A 1 94  ? 4.052   55.482  -24.101 1.00 39.72  ? 94  TYR A CD2   1 
ATOM   782  C  CE1   . TYR A 1 94  ? 5.747   53.337  -23.606 1.00 41.98  ? 94  TYR A CE1   1 
ATOM   783  C  CE2   . TYR A 1 94  ? 5.381   55.716  -23.740 1.00 39.85  ? 94  TYR A CE2   1 
ATOM   784  C  CZ    . TYR A 1 94  ? 6.220   54.635  -23.494 1.00 41.05  ? 94  TYR A CZ    1 
ATOM   785  O  OH    . TYR A 1 94  ? 7.528   54.825  -23.134 1.00 40.99  ? 94  TYR A OH    1 
ATOM   786  N  N     . ALA A 1 95  ? 0.990   51.388  -23.281 1.00 43.17  ? 95  ALA A N     1 
ATOM   787  C  CA    . ALA A 1 95  ? 1.176   50.059  -22.704 1.00 44.59  ? 95  ALA A CA    1 
ATOM   788  C  C     . ALA A 1 95  ? 2.551   49.476  -23.052 1.00 44.18  ? 95  ALA A C     1 
ATOM   789  O  O     . ALA A 1 95  ? 3.358   49.235  -22.156 1.00 46.06  ? 95  ALA A O     1 
ATOM   790  C  CB    . ALA A 1 95  ? 0.074   49.136  -23.151 1.00 44.68  ? 95  ALA A CB    1 
ATOM   791  N  N     . GLU A 1 96  ? 2.824   49.257  -24.339 1.00 42.01  ? 96  GLU A N     1 
ATOM   792  C  CA    . GLU A 1 96  ? 4.119   48.720  -24.762 1.00 41.91  ? 96  GLU A CA    1 
ATOM   793  C  C     . GLU A 1 96  ? 4.841   49.643  -25.755 1.00 39.44  ? 96  GLU A C     1 
ATOM   794  O  O     . GLU A 1 96  ? 5.990   50.026  -25.554 1.00 39.49  ? 96  GLU A O     1 
ATOM   795  C  CB    . GLU A 1 96  ? 3.960   47.296  -25.321 1.00 42.46  ? 96  GLU A CB    1 
ATOM   796  C  CG    . GLU A 1 96  ? 5.238   46.680  -25.913 1.00 44.51  ? 96  GLU A CG    1 
ATOM   797  C  CD    . GLU A 1 96  ? 5.365   46.853  -27.438 1.00 45.75  ? 96  GLU A CD    1 
ATOM   798  O  OE1   . GLU A 1 96  ? 6.445   47.279  -27.917 1.00 46.01  ? 96  GLU A OE1   1 
ATOM   799  O  OE2   . GLU A 1 96  ? 4.388   46.557  -28.168 1.00 47.06  ? 96  GLU A OE2   1 
ATOM   800  N  N     . HIS A 1 97  ? 4.160   50.001  -26.826 1.00 37.59  ? 97  HIS A N     1 
ATOM   801  C  CA    . HIS A 1 97  ? 4.789   50.745  -27.883 1.00 36.03  ? 97  HIS A CA    1 
ATOM   802  C  C     . HIS A 1 97  ? 4.651   52.241  -27.629 1.00 35.20  ? 97  HIS A C     1 
ATOM   803  O  O     . HIS A 1 97  ? 3.546   52.762  -27.544 1.00 35.23  ? 97  HIS A O     1 
ATOM   804  C  CB    . HIS A 1 97  ? 4.188   50.344  -29.227 1.00 35.10  ? 97  HIS A CB    1 
ATOM   805  C  CG    . HIS A 1 97  ? 4.940   50.872  -30.405 1.00 34.72  ? 97  HIS A CG    1 
ATOM   806  N  ND1   . HIS A 1 97  ? 4.724   52.134  -30.919 1.00 34.72  ? 97  HIS A ND1   1 
ATOM   807  C  CD2   . HIS A 1 97  ? 5.905   50.312  -31.172 1.00 35.48  ? 97  HIS A CD2   1 
ATOM   808  C  CE1   . HIS A 1 97  ? 5.519   52.325  -31.956 1.00 34.30  ? 97  HIS A CE1   1 
ATOM   809  N  NE2   . HIS A 1 97  ? 6.244   51.234  -32.133 1.00 34.96  ? 97  HIS A NE2   1 
ATOM   810  N  N     . PRO A 1 98  ? 5.783   52.950  -27.540 1.00 35.03  ? 98  PRO A N     1 
ATOM   811  C  CA    . PRO A 1 98  ? 5.753   54.359  -27.133 1.00 34.42  ? 98  PRO A CA    1 
ATOM   812  C  C     . PRO A 1 98  ? 5.209   55.257  -28.246 1.00 32.54  ? 98  PRO A C     1 
ATOM   813  O  O     . PRO A 1 98  ? 5.279   54.905  -29.437 1.00 32.27  ? 98  PRO A O     1 
ATOM   814  C  CB    . PRO A 1 98  ? 7.222   54.667  -26.884 1.00 34.67  ? 98  PRO A CB    1 
ATOM   815  C  CG    . PRO A 1 98  ? 7.925   53.789  -27.881 1.00 34.76  ? 98  PRO A CG    1 
ATOM   816  C  CD    . PRO A 1 98  ? 7.147   52.505  -27.886 1.00 35.07  ? 98  PRO A CD    1 
ATOM   817  N  N     . TYR A 1 99  ? 4.652   56.394  -27.859 1.00 31.77  ? 99  TYR A N     1 
ATOM   818  C  CA    . TYR A 1 99  ? 4.164   57.376  -28.809 1.00 29.92  ? 99  TYR A CA    1 
ATOM   819  C  C     . TYR A 1 99  ? 3.707   58.586  -28.039 1.00 30.69  ? 99  TYR A C     1 
ATOM   820  O  O     . TYR A 1 99  ? 3.527   58.521  -26.832 1.00 32.28  ? 99  TYR A O     1 
ATOM   821  C  CB    . TYR A 1 99  ? 3.025   56.824  -29.684 1.00 28.72  ? 99  TYR A CB    1 
ATOM   822  C  CG    . TYR A 1 99  ? 1.706   56.604  -28.970 1.00 28.81  ? 99  TYR A CG    1 
ATOM   823  C  CD1   . TYR A 1 99  ? 0.638   57.489  -29.151 1.00 28.93  ? 99  TYR A CD1   1 
ATOM   824  C  CD2   . TYR A 1 99  ? 1.519   55.511  -28.131 1.00 28.21  ? 99  TYR A CD2   1 
ATOM   825  C  CE1   . TYR A 1 99  ? -0.580  57.293  -28.505 1.00 29.76  ? 99  TYR A CE1   1 
ATOM   826  C  CE2   . TYR A 1 99  ? 0.310   55.303  -27.490 1.00 30.53  ? 99  TYR A CE2   1 
ATOM   827  C  CZ    . TYR A 1 99  ? -0.735  56.192  -27.682 1.00 31.05  ? 99  TYR A CZ    1 
ATOM   828  O  OH    . TYR A 1 99  ? -1.927  55.983  -27.039 1.00 32.47  ? 99  TYR A OH    1 
ATOM   829  N  N     . VAL A 1 100 ? 3.524   59.687  -28.747 1.00 30.10  ? 100 VAL A N     1 
ATOM   830  C  CA    . VAL A 1 100 ? 3.137   60.930  -28.127 1.00 31.74  ? 100 VAL A CA    1 
ATOM   831  C  C     . VAL A 1 100 ? 1.712   61.273  -28.570 1.00 31.96  ? 100 VAL A C     1 
ATOM   832  O  O     . VAL A 1 100 ? 1.389   61.207  -29.763 1.00 30.88  ? 100 VAL A O     1 
ATOM   833  C  CB    . VAL A 1 100 ? 4.131   62.070  -28.484 1.00 31.52  ? 100 VAL A CB    1 
ATOM   834  C  CG1   . VAL A 1 100 ? 3.844   63.308  -27.664 1.00 33.29  ? 100 VAL A CG1   1 
ATOM   835  C  CG2   . VAL A 1 100 ? 5.545   61.622  -28.235 1.00 31.72  ? 100 VAL A CG2   1 
ATOM   836  N  N     . HIS A 1 101 ? 0.860   61.618  -27.611 1.00 33.45  ? 101 HIS A N     1 
ATOM   837  C  CA    . HIS A 1 101 ? -0.477  62.077  -27.946 1.00 34.16  ? 101 HIS A CA    1 
ATOM   838  C  C     . HIS A 1 101 ? -0.579  63.553  -27.664 1.00 35.78  ? 101 HIS A C     1 
ATOM   839  O  O     . HIS A 1 101 ? -0.239  64.008  -26.574 1.00 37.50  ? 101 HIS A O     1 
ATOM   840  C  CB    . HIS A 1 101 ? -1.546  61.341  -27.151 1.00 35.24  ? 101 HIS A CB    1 
ATOM   841  C  CG    . HIS A 1 101 ? -2.932  61.814  -27.444 1.00 36.28  ? 101 HIS A CG    1 
ATOM   842  N  ND1   . HIS A 1 101 ? -3.525  61.650  -28.679 1.00 34.88  ? 101 HIS A ND1   1 
ATOM   843  C  CD2   . HIS A 1 101 ? -3.843  62.447  -26.667 1.00 39.23  ? 101 HIS A CD2   1 
ATOM   844  C  CE1   . HIS A 1 101 ? -4.745  62.157  -28.648 1.00 37.07  ? 101 HIS A CE1   1 
ATOM   845  N  NE2   . HIS A 1 101 ? -4.964  62.644  -27.438 1.00 39.78  ? 101 HIS A NE2   1 
ATOM   846  N  N     . GLY A 1 102 ? -1.052  64.306  -28.644 1.00 35.27  ? 102 GLY A N     1 
ATOM   847  C  CA    . GLY A 1 102 ? -1.135  65.731  -28.466 1.00 36.77  ? 102 GLY A CA    1 
ATOM   848  C  C     . GLY A 1 102 ? -2.184  66.407  -29.302 1.00 37.20  ? 102 GLY A C     1 
ATOM   849  O  O     . GLY A 1 102 ? -3.125  65.789  -29.789 1.00 36.40  ? 102 GLY A O     1 
ATOM   850  N  N     . VAL A 1 103 ? -1.997  67.705  -29.455 1.00 38.70  ? 103 VAL A N     1 
ATOM   851  C  CA    . VAL A 1 103 ? -2.933  68.545  -30.155 1.00 39.80  ? 103 VAL A CA    1 
ATOM   852  C  C     . VAL A 1 103 ? -2.137  69.473  -31.062 1.00 39.67  ? 103 VAL A C     1 
ATOM   853  O  O     . VAL A 1 103 ? -1.083  69.987  -30.668 1.00 40.07  ? 103 VAL A O     1 
ATOM   854  C  CB    . VAL A 1 103 ? -3.811  69.326  -29.139 1.00 42.83  ? 103 VAL A CB    1 
ATOM   855  C  CG1   . VAL A 1 103 ? -4.317  70.630  -29.718 1.00 44.72  ? 103 VAL A CG1   1 
ATOM   856  C  CG2   . VAL A 1 103 ? -4.967  68.463  -28.680 1.00 43.04  ? 103 VAL A CG2   1 
ATOM   857  N  N     . VAL A 1 104 ? -2.621  69.632  -32.290 1.00 39.14  ? 104 VAL A N     1 
ATOM   858  C  CA    . VAL A 1 104 ? -2.120  70.659  -33.202 1.00 39.76  ? 104 VAL A CA    1 
ATOM   859  C  C     . VAL A 1 104 ? -3.310  71.480  -33.683 1.00 41.77  ? 104 VAL A C     1 
ATOM   860  O  O     . VAL A 1 104 ? -4.200  70.960  -34.376 1.00 41.19  ? 104 VAL A O     1 
ATOM   861  C  CB    . VAL A 1 104 ? -1.349  70.068  -34.403 1.00 37.31  ? 104 VAL A CB    1 
ATOM   862  C  CG1   . VAL A 1 104 ? -0.943  71.172  -35.367 1.00 38.01  ? 104 VAL A CG1   1 
ATOM   863  C  CG2   . VAL A 1 104 ? -0.114  69.333  -33.916 1.00 36.62  ? 104 VAL A CG2   1 
ATOM   864  N  N     . LYS A 1 105 ? -3.324  72.754  -33.294 1.00 44.02  ? 105 LYS A N     1 
ATOM   865  C  CA    . LYS A 1 105 ? -4.428  73.654  -33.606 1.00 46.39  ? 105 LYS A CA    1 
ATOM   866  C  C     . LYS A 1 105 ? -5.783  73.033  -33.265 1.00 46.48  ? 105 LYS A C     1 
ATOM   867  O  O     . LYS A 1 105 ? -6.671  72.957  -34.108 1.00 46.60  ? 105 LYS A O     1 
ATOM   868  C  CB    . LYS A 1 105 ? -4.368  74.100  -35.074 1.00 46.42  ? 105 LYS A CB    1 
ATOM   869  C  CG    . LYS A 1 105 ? -3.106  74.887  -35.448 1.00 46.84  ? 105 LYS A CG    1 
ATOM   870  C  CD    . LYS A 1 105 ? -3.051  75.198  -36.942 1.00 46.98  ? 105 LYS A CD    1 
ATOM   871  C  CE    . LYS A 1 105 ? -3.745  76.500  -37.281 1.00 51.19  ? 105 LYS A CE    1 
ATOM   872  N  NZ    . LYS A 1 105 ? -2.985  77.660  -36.746 1.00 54.67  ? 105 LYS A NZ    1 
ATOM   873  N  N     . GLY A 1 106 ? -5.916  72.573  -32.025 1.00 46.80  ? 106 GLY A N     1 
ATOM   874  C  CA    . GLY A 1 106 ? -7.181  72.080  -31.499 1.00 48.12  ? 106 GLY A CA    1 
ATOM   875  C  C     . GLY A 1 106 ? -7.675  70.737  -32.008 1.00 46.16  ? 106 GLY A C     1 
ATOM   876  O  O     . GLY A 1 106 ? -8.854  70.426  -31.856 1.00 47.85  ? 106 GLY A O     1 
ATOM   877  N  N     . VAL A 1 107 ? -6.802  69.934  -32.614 1.00 43.19  ? 107 VAL A N     1 
ATOM   878  C  CA    . VAL A 1 107 ? -7.197  68.601  -33.085 1.00 41.15  ? 107 VAL A CA    1 
ATOM   879  C  C     . VAL A 1 107 ? -6.235  67.523  -32.597 1.00 39.19  ? 107 VAL A C     1 
ATOM   880  O  O     . VAL A 1 107 ? -5.022  67.739  -32.586 1.00 38.16  ? 107 VAL A O     1 
ATOM   881  C  CB    . VAL A 1 107 ? -7.433  68.532  -34.649 1.00 40.26  ? 107 VAL A CB    1 
ATOM   882  C  CG1   . VAL A 1 107 ? -6.958  69.772  -35.350 1.00 41.14  ? 107 VAL A CG1   1 
ATOM   883  C  CG2   . VAL A 1 107 ? -6.818  67.268  -35.296 1.00 37.28  ? 107 VAL A CG2   1 
ATOM   884  N  N     . GLU A 1 108 ? -6.797  66.378  -32.188 1.00 38.87  ? 108 GLU A N     1 
ATOM   885  C  CA    . GLU A 1 108 ? -6.034  65.242  -31.667 1.00 37.44  ? 108 GLU A CA    1 
ATOM   886  C  C     . GLU A 1 108 ? -5.029  64.739  -32.676 1.00 34.85  ? 108 GLU A C     1 
ATOM   887  O  O     . GLU A 1 108 ? -5.370  64.516  -33.839 1.00 34.09  ? 108 GLU A O     1 
ATOM   888  C  CB    . GLU A 1 108 ? -6.939  64.063  -31.320 1.00 37.73  ? 108 GLU A CB    1 
ATOM   889  C  CG    . GLU A 1 108 ? -8.144  64.358  -30.463 1.00 42.29  ? 108 GLU A CG    1 
ATOM   890  C  CD    . GLU A 1 108 ? -7.794  65.037  -29.164 1.00 47.05  ? 108 GLU A CD    1 
ATOM   891  O  OE1   . GLU A 1 108 ? -6.583  65.242  -28.894 1.00 46.82  ? 108 GLU A OE1   1 
ATOM   892  O  OE2   . GLU A 1 108 ? -8.743  65.375  -28.418 1.00 51.00  ? 108 GLU A OE2   1 
ATOM   893  N  N     . VAL A 1 109 ? -3.796  64.546  -32.220 1.00 33.64  ? 109 VAL A N     1 
ATOM   894  C  CA    . VAL A 1 109 ? -2.760  63.966  -33.051 1.00 31.62  ? 109 VAL A CA    1 
ATOM   895  C  C     . VAL A 1 109 ? -2.030  62.867  -32.291 1.00 31.23  ? 109 VAL A C     1 
ATOM   896  O  O     . VAL A 1 109 ? -1.798  62.996  -31.092 1.00 32.51  ? 109 VAL A O     1 
ATOM   897  C  CB    . VAL A 1 109 ? -1.750  65.025  -33.528 1.00 31.39  ? 109 VAL A CB    1 
ATOM   898  C  CG1   . VAL A 1 109 ? -0.868  64.453  -34.623 1.00 29.15  ? 109 VAL A CG1   1 
ATOM   899  C  CG2   . VAL A 1 109 ? -2.462  66.270  -34.023 1.00 32.09  ? 109 VAL A CG2   1 
ATOM   900  N  N     . ASP A 1 110 ? -1.703  61.780  -32.982 1.00 30.32  ? 110 ASP A N     1 
ATOM   901  C  CA    . ASP A 1 110 ? -0.818  60.755  -32.449 1.00 30.77  ? 110 ASP A CA    1 
ATOM   902  C  C     . ASP A 1 110 ? 0.439   60.686  -33.288 1.00 29.72  ? 110 ASP A C     1 
ATOM   903  O  O     . ASP A 1 110 ? 0.366   60.355  -34.479 1.00 29.21  ? 110 ASP A O     1 
ATOM   904  C  CB    . ASP A 1 110 ? -1.471  59.374  -32.495 1.00 31.01  ? 110 ASP A CB    1 
ATOM   905  C  CG    . ASP A 1 110 ? -2.608  59.212  -31.507 1.00 35.06  ? 110 ASP A CG    1 
ATOM   906  O  OD1   . ASP A 1 110 ? -2.728  60.003  -30.538 1.00 39.53  ? 110 ASP A OD1   1 
ATOM   907  O  OD2   . ASP A 1 110 ? -3.391  58.256  -31.699 1.00 38.87  ? 110 ASP A OD2   1 
ATOM   908  N  N     . VAL A 1 111 ? 1.590   60.969  -32.677 1.00 29.99  ? 111 VAL A N     1 
ATOM   909  C  CA    . VAL A 1 111 ? 2.885   60.787  -33.355 1.00 29.03  ? 111 VAL A CA    1 
ATOM   910  C  C     . VAL A 1 111 ? 3.521   59.470  -32.923 1.00 28.59  ? 111 VAL A C     1 
ATOM   911  O  O     . VAL A 1 111 ? 3.904   59.306  -31.765 1.00 29.43  ? 111 VAL A O     1 
ATOM   912  C  CB    . VAL A 1 111 ? 3.846   61.967  -33.109 1.00 29.58  ? 111 VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 111 ? 5.162   61.730  -33.805 1.00 29.08  ? 111 VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 111 ? 3.236   63.249  -33.623 1.00 30.59  ? 111 VAL A CG2   1 
ATOM   915  N  N     . VAL A 1 112 ? 3.624   58.534  -33.859 1.00 27.75  ? 112 VAL A N     1 
ATOM   916  C  CA    . VAL A 1 112 ? 4.041   57.176  -33.533 1.00 28.05  ? 112 VAL A CA    1 
ATOM   917  C  C     . VAL A 1 112 ? 5.334   56.836  -34.231 1.00 27.97  ? 112 VAL A C     1 
ATOM   918  O  O     . VAL A 1 112 ? 5.400   56.957  -35.436 1.00 28.63  ? 112 VAL A O     1 
ATOM   919  C  CB    . VAL A 1 112 ? 2.968   56.151  -33.967 1.00 27.69  ? 112 VAL A CB    1 
ATOM   920  C  CG1   . VAL A 1 112 ? 3.456   54.735  -33.746 1.00 28.44  ? 112 VAL A CG1   1 
ATOM   921  C  CG2   . VAL A 1 112 ? 1.661   56.372  -33.202 1.00 28.59  ? 112 VAL A CG2   1 
ATOM   922  N  N     . PRO A 1 113 ? 6.365   56.401  -33.491 1.00 28.63  ? 113 PRO A N     1 
ATOM   923  C  CA    . PRO A 1 113 ? 7.581   55.989  -34.177 1.00 29.16  ? 113 PRO A CA    1 
ATOM   924  C  C     . PRO A 1 113 ? 7.490   54.549  -34.674 1.00 30.02  ? 113 PRO A C     1 
ATOM   925  O  O     . PRO A 1 113 ? 6.895   53.704  -34.004 1.00 30.54  ? 113 PRO A O     1 
ATOM   926  C  CB    . PRO A 1 113 ? 8.640   56.085  -33.082 1.00 29.89  ? 113 PRO A CB    1 
ATOM   927  C  CG    . PRO A 1 113 ? 7.890   55.771  -31.835 1.00 30.31  ? 113 PRO A CG    1 
ATOM   928  C  CD    . PRO A 1 113 ? 6.485   56.271  -32.029 1.00 29.51  ? 113 PRO A CD    1 
ATOM   929  N  N     . CYS A 1 114 ? 8.074   54.269  -35.839 1.00 30.73  ? 114 CYS A N     1 
ATOM   930  C  CA    . CYS A 1 114 ? 8.231   52.892  -36.293 1.00 31.70  ? 114 CYS A CA    1 
ATOM   931  C  C     . CYS A 1 114 ? 9.448   52.723  -37.190 1.00 32.73  ? 114 CYS A C     1 
ATOM   932  O  O     . CYS A 1 114 ? 10.280  53.631  -37.308 1.00 33.02  ? 114 CYS A O     1 
ATOM   933  C  CB    . CYS A 1 114 ? 6.972   52.410  -37.006 1.00 31.57  ? 114 CYS A CB    1 
ATOM   934  S  SG    . CYS A 1 114 ? 6.933   52.723  -38.762 1.00 33.10  ? 114 CYS A SG    1 
ATOM   935  N  N     . TYR A 1 115 ? 9.537   51.556  -37.826 1.00 33.68  ? 115 TYR A N     1 
ATOM   936  C  CA    . TYR A 1 115 ? 10.694  51.185  -38.620 1.00 35.05  ? 115 TYR A CA    1 
ATOM   937  C  C     . TYR A 1 115 ? 10.391  51.192  -40.112 1.00 35.52  ? 115 TYR A C     1 
ATOM   938  O  O     . TYR A 1 115 ? 9.438   50.556  -40.562 1.00 35.24  ? 115 TYR A O     1 
ATOM   939  C  CB    . TYR A 1 115 ? 11.179  49.798  -38.217 1.00 36.47  ? 115 TYR A CB    1 
ATOM   940  C  CG    . TYR A 1 115 ? 11.814  49.724  -36.860 1.00 37.27  ? 115 TYR A CG    1 
ATOM   941  C  CD1   . TYR A 1 115 ? 11.146  49.135  -35.790 1.00 37.55  ? 115 TYR A CD1   1 
ATOM   942  C  CD2   . TYR A 1 115 ? 13.092  50.227  -36.641 1.00 38.41  ? 115 TYR A CD2   1 
ATOM   943  C  CE1   . TYR A 1 115 ? 11.731  49.057  -34.537 1.00 37.61  ? 115 TYR A CE1   1 
ATOM   944  C  CE2   . TYR A 1 115 ? 13.686  50.150  -35.396 1.00 39.00  ? 115 TYR A CE2   1 
ATOM   945  C  CZ    . TYR A 1 115 ? 12.999  49.565  -34.348 1.00 38.75  ? 115 TYR A CZ    1 
ATOM   946  O  OH    . TYR A 1 115 ? 13.589  49.491  -33.105 1.00 40.38  ? 115 TYR A OH    1 
ATOM   947  N  N     . LYS A 1 116 ? 11.222  51.902  -40.868 1.00 36.52  ? 116 LYS A N     1 
ATOM   948  C  CA    . LYS A 1 116 ? 11.152  51.884  -42.314 1.00 37.98  ? 116 LYS A CA    1 
ATOM   949  C  C     . LYS A 1 116 ? 11.649  50.551  -42.848 1.00 40.56  ? 116 LYS A C     1 
ATOM   950  O  O     . LYS A 1 116 ? 12.840  50.367  -43.083 1.00 42.46  ? 116 LYS A O     1 
ATOM   951  C  CB    . LYS A 1 116 ? 11.951  53.036  -42.926 1.00 38.37  ? 116 LYS A CB    1 
ATOM   952  C  CG    . LYS A 1 116 ? 11.793  53.122  -44.437 1.00 39.45  ? 116 LYS A CG    1 
ATOM   953  C  CD    . LYS A 1 116 ? 12.413  54.380  -44.984 1.00 40.80  ? 116 LYS A CD    1 
ATOM   954  C  CE    . LYS A 1 116 ? 11.903  54.651  -46.381 1.00 42.14  ? 116 LYS A CE    1 
ATOM   955  N  NZ    . LYS A 1 116 ? 12.846  55.513  -47.131 1.00 45.05  ? 116 LYS A NZ    1 
ATOM   956  N  N     . LEU A 1 117 ? 10.714  49.625  -43.012 1.00 41.54  ? 117 LEU A N     1 
ATOM   957  C  CA    . LEU A 1 117 ? 10.964  48.334  -43.631 1.00 44.49  ? 117 LEU A CA    1 
ATOM   958  C  C     . LEU A 1 117 ? 10.567  48.389  -45.108 1.00 46.35  ? 117 LEU A C     1 
ATOM   959  O  O     . LEU A 1 117 ? 9.957   49.360  -45.562 1.00 45.01  ? 117 LEU A O     1 
ATOM   960  C  CB    . LEU A 1 117 ? 10.128  47.273  -42.915 1.00 44.15  ? 117 LEU A CB    1 
ATOM   961  C  CG    . LEU A 1 117 ? 10.590  46.549  -41.644 1.00 44.71  ? 117 LEU A CG    1 
ATOM   962  C  CD1   . LEU A 1 117 ? 11.611  47.312  -40.810 1.00 44.36  ? 117 LEU A CD1   1 
ATOM   963  C  CD2   . LEU A 1 117 ? 9.395   46.162  -40.792 1.00 43.57  ? 117 LEU A CD2   1 
ATOM   964  N  N     . LYS A 1 118 ? 10.937  47.359  -45.859 1.00 50.26  ? 118 LYS A N     1 
ATOM   965  C  CA    . LYS A 1 118 ? 10.350  47.090  -47.183 1.00 53.19  ? 118 LYS A CA    1 
ATOM   966  C  C     . LYS A 1 118 ? 10.015  45.612  -47.222 1.00 55.72  ? 118 LYS A C     1 
ATOM   967  O  O     . LYS A 1 118 ? 10.907  44.773  -47.097 1.00 58.64  ? 118 LYS A O     1 
ATOM   968  C  CB    . LYS A 1 118 ? 11.277  47.479  -48.352 1.00 55.40  ? 118 LYS A CB    1 
ATOM   969  C  CG    . LYS A 1 118 ? 12.752  47.778  -48.002 1.00 57.53  ? 118 LYS A CG    1 
ATOM   970  C  CD    . LYS A 1 118 ? 13.511  46.596  -47.365 1.00 60.80  ? 118 LYS A CD    1 
ATOM   971  C  CE    . LYS A 1 118 ? 13.839  45.497  -48.365 1.00 64.81  ? 118 LYS A CE    1 
ATOM   972  N  NZ    . LYS A 1 118 ? 14.560  44.391  -47.687 1.00 67.53  ? 118 LYS A NZ    1 
ATOM   973  N  N     . GLU A 1 119 ? 8.733   45.300  -47.387 1.00 55.82  ? 119 GLU A N     1 
ATOM   974  C  CA    . GLU A 1 119 ? 8.174   43.974  -47.071 1.00 57.77  ? 119 GLU A CA    1 
ATOM   975  C  C     . GLU A 1 119 ? 7.896   43.913  -45.561 1.00 56.25  ? 119 GLU A C     1 
ATOM   976  O  O     . GLU A 1 119 ? 8.816   44.067  -44.752 1.00 56.00  ? 119 GLU A O     1 
ATOM   977  C  CB    . GLU A 1 119 ? 9.086   42.805  -47.509 1.00 61.39  ? 119 GLU A CB    1 
ATOM   978  C  CG    . GLU A 1 119 ? 9.441   42.743  -49.014 1.00 65.25  ? 119 GLU A CG    1 
ATOM   979  C  CD    . GLU A 1 119 ? 8.349   42.111  -49.883 1.00 68.67  ? 119 GLU A CD    1 
ATOM   980  O  OE1   . GLU A 1 119 ? 8.653   41.123  -50.596 1.00 72.44  ? 119 GLU A OE1   1 
ATOM   981  O  OE2   . GLU A 1 119 ? 7.191   42.597  -49.859 1.00 67.28  ? 119 GLU A OE2   1 
ATOM   982  N  N     . PRO A 1 120 ? 6.617   43.710  -45.175 1.00 55.39  ? 120 PRO A N     1 
ATOM   983  C  CA    . PRO A 1 120 ? 6.242   43.561  -43.765 1.00 54.18  ? 120 PRO A CA    1 
ATOM   984  C  C     . PRO A 1 120 ? 6.508   42.155  -43.215 1.00 56.66  ? 120 PRO A C     1 
ATOM   985  O  O     . PRO A 1 120 ? 5.770   41.676  -42.356 1.00 56.74  ? 120 PRO A O     1 
ATOM   986  C  CB    . PRO A 1 120 ? 4.736   43.861  -43.764 1.00 52.51  ? 120 PRO A CB    1 
ATOM   987  C  CG    . PRO A 1 120 ? 4.373   44.188  -45.187 1.00 53.04  ? 120 PRO A CG    1 
ATOM   988  C  CD    . PRO A 1 120 ? 5.440   43.630  -46.051 1.00 55.35  ? 120 PRO A CD    1 
ATOM   989  N  N     . LYS A 1 121 ? 7.553   41.504  -43.717 1.00 59.20  ? 121 LYS A N     1 
ATOM   990  C  CA    . LYS A 1 121 ? 8.011   40.234  -43.179 1.00 61.74  ? 121 LYS A CA    1 
ATOM   991  C  C     . LYS A 1 121 ? 8.871   40.510  -41.942 1.00 61.04  ? 121 LYS A C     1 
ATOM   992  O  O     . LYS A 1 121 ? 9.511   41.568  -41.839 1.00 59.47  ? 121 LYS A O     1 
ATOM   993  C  CB    . LYS A 1 121 ? 8.832   39.479  -44.226 1.00 65.04  ? 121 LYS A CB    1 
ATOM   994  C  CG    . LYS A 1 121 ? 8.149   39.308  -45.573 1.00 66.81  ? 121 LYS A CG    1 
ATOM   995  C  CD    . LYS A 1 121 ? 7.628   37.890  -45.789 1.00 70.73  ? 121 LYS A CD    1 
ATOM   996  C  CE    . LYS A 1 121 ? 7.035   37.741  -47.193 1.00 71.77  ? 121 LYS A CE    1 
ATOM   997  N  NZ    . LYS A 1 121 ? 7.035   36.329  -47.662 1.00 75.87  ? 121 LYS A NZ    1 
ATOM   998  N  N     . ASN A 1 122 ? 8.863   39.557  -41.007 1.00 62.15  ? 122 ASN A N     1 
ATOM   999  C  CA    . ASN A 1 122 ? 9.734   39.555  -39.816 1.00 62.08  ? 122 ASN A CA    1 
ATOM   1000 C  C     . ASN A 1 122 ? 9.489   40.639  -38.744 1.00 58.53  ? 122 ASN A C     1 
ATOM   1001 O  O     . ASN A 1 122 ? 9.699   40.364  -37.561 1.00 59.65  ? 122 ASN A O     1 
ATOM   1002 C  CB    . ASN A 1 122 ? 11.225  39.483  -40.196 1.00 64.33  ? 122 ASN A CB    1 
ATOM   1003 C  CG    . ASN A 1 122 ? 11.526  38.371  -41.197 1.00 68.65  ? 122 ASN A CG    1 
ATOM   1004 O  OD1   . ASN A 1 122 ? 10.961  38.332  -42.291 1.00 68.91  ? 122 ASN A OD1   1 
ATOM   1005 N  ND2   . ASN A 1 122 ? 12.434  37.468  -40.827 1.00 73.09  ? 122 ASN A ND2   1 
ATOM   1006 N  N     . ILE A 1 123 ? 9.101   41.854  -39.156 1.00 54.33  ? 123 ILE A N     1 
ATOM   1007 C  CA    . ILE A 1 123 ? 8.558   42.902  -38.258 1.00 50.27  ? 123 ILE A CA    1 
ATOM   1008 C  C     . ILE A 1 123 ? 9.327   43.172  -36.958 1.00 48.92  ? 123 ILE A C     1 
ATOM   1009 O  O     . ILE A 1 123 ? 9.299   42.367  -36.045 1.00 50.11  ? 123 ILE A O     1 
ATOM   1010 C  CB    . ILE A 1 123 ? 7.049   42.621  -37.953 1.00 49.85  ? 123 ILE A CB    1 
ATOM   1011 C  CG1   . ILE A 1 123 ? 6.203   42.821  -39.216 1.00 50.15  ? 123 ILE A CG1   1 
ATOM   1012 C  CG2   . ILE A 1 123 ? 6.501   43.479  -36.816 1.00 47.86  ? 123 ILE A CG2   1 
ATOM   1013 C  CD1   . ILE A 1 123 ? 6.146   44.254  -39.728 1.00 48.76  ? 123 ILE A CD1   1 
ATOM   1014 N  N     . LYS A 1 124 ? 9.981   44.323  -36.863 1.00 46.25  ? 124 LYS A N     1 
ATOM   1015 C  CA    . LYS A 1 124 ? 10.763  44.649  -35.667 1.00 45.30  ? 124 LYS A CA    1 
ATOM   1016 C  C     . LYS A 1 124 ? 9.943   45.267  -34.524 1.00 43.20  ? 124 LYS A C     1 
ATOM   1017 O  O     . LYS A 1 124 ? 10.273  45.091  -33.357 1.00 43.91  ? 124 LYS A O     1 
ATOM   1018 C  CB    . LYS A 1 124 ? 11.967  45.527  -36.013 1.00 44.95  ? 124 LYS A CB    1 
ATOM   1019 C  CG    . LYS A 1 124 ? 12.992  45.635  -34.896 1.00 44.88  ? 124 LYS A CG    1 
ATOM   1020 C  CD    . LYS A 1 124 ? 14.231  46.382  -35.326 1.00 44.25  ? 124 LYS A CD    1 
ATOM   1021 C  CE    . LYS A 1 124 ? 15.217  46.470  -34.182 1.00 45.97  ? 124 LYS A CE    1 
ATOM   1022 N  NZ    . LYS A 1 124 ? 16.602  46.765  -34.634 1.00 47.37  ? 124 LYS A NZ    1 
ATOM   1023 N  N     . SER A 1 125 ? 8.885   45.996  -34.850 1.00 40.67  ? 125 SER A N     1 
ATOM   1024 C  CA    . SER A 1 125 ? 8.003   46.544  -33.811 1.00 39.00  ? 125 SER A CA    1 
ATOM   1025 C  C     . SER A 1 125 ? 6.535   46.269  -34.114 1.00 37.96  ? 125 SER A C     1 
ATOM   1026 O  O     . SER A 1 125 ? 6.149   46.040  -35.262 1.00 37.69  ? 125 SER A O     1 
ATOM   1027 C  CB    . SER A 1 125 ? 8.243   48.050  -33.578 1.00 37.38  ? 125 SER A CB    1 
ATOM   1028 O  OG    . SER A 1 125 ? 7.496   48.865  -34.475 1.00 35.52  ? 125 SER A OG    1 
ATOM   1029 N  N     . ALA A 1 126 ? 5.722   46.316  -33.069 1.00 37.36  ? 126 ALA A N     1 
ATOM   1030 C  CA    . ALA A 1 126 ? 4.307   45.986  -33.155 1.00 36.40  ? 126 ALA A CA    1 
ATOM   1031 C  C     . ALA A 1 126 ? 3.529   46.697  -34.281 1.00 34.14  ? 126 ALA A C     1 
ATOM   1032 O  O     . ALA A 1 126 ? 2.585   46.130  -34.828 1.00 33.99  ? 126 ALA A O     1 
ATOM   1033 C  CB    . ALA A 1 126 ? 3.653   46.238  -31.810 1.00 36.78  ? 126 ALA A CB    1 
ATOM   1034 N  N     . VAL A 1 127 ? 3.945   47.912  -34.635 1.00 31.96  ? 127 VAL A N     1 
ATOM   1035 C  CA    . VAL A 1 127 ? 3.144   48.786  -35.503 1.00 30.11  ? 127 VAL A CA    1 
ATOM   1036 C  C     . VAL A 1 127 ? 3.674   48.941  -36.938 1.00 29.43  ? 127 VAL A C     1 
ATOM   1037 O  O     . VAL A 1 127 ? 3.134   49.722  -37.734 1.00 28.47  ? 127 VAL A O     1 
ATOM   1038 C  CB    . VAL A 1 127 ? 2.974   50.178  -34.858 1.00 29.31  ? 127 VAL A CB    1 
ATOM   1039 C  CG1   . VAL A 1 127 ? 2.613   50.033  -33.367 1.00 29.72  ? 127 VAL A CG1   1 
ATOM   1040 C  CG2   . VAL A 1 127 ? 4.244   51.007  -35.014 1.00 28.84  ? 127 VAL A CG2   1 
ATOM   1041 N  N     . ASP A 1 128 ? 4.713   48.175  -37.268 1.00 29.92  ? 128 ASP A N     1 
ATOM   1042 C  CA    . ASP A 1 128 ? 5.433   48.307  -38.536 1.00 29.25  ? 128 ASP A CA    1 
ATOM   1043 C  C     . ASP A 1 128 ? 4.599   48.027  -39.797 1.00 29.02  ? 128 ASP A C     1 
ATOM   1044 O  O     . ASP A 1 128 ? 4.995   48.398  -40.900 1.00 28.94  ? 128 ASP A O     1 
ATOM   1045 C  CB    . ASP A 1 128 ? 6.685   47.423  -38.528 1.00 30.94  ? 128 ASP A CB    1 
ATOM   1046 C  CG    . ASP A 1 128 ? 7.783   47.944  -37.606 1.00 31.05  ? 128 ASP A CG    1 
ATOM   1047 O  OD1   . ASP A 1 128 ? 7.800   49.150  -37.272 1.00 29.51  ? 128 ASP A OD1   1 
ATOM   1048 O  OD2   . ASP A 1 128 ? 8.652   47.131  -37.223 1.00 32.69  ? 128 ASP A OD2   1 
ATOM   1049 N  N     . ARG A 1 129 ? 3.453   47.373  -39.640 1.00 28.91  ? 129 ARG A N     1 
ATOM   1050 C  CA    . ARG A 1 129 ? 2.609   47.039  -40.789 1.00 28.89  ? 129 ARG A CA    1 
ATOM   1051 C  C     . ARG A 1 129 ? 1.757   48.203  -41.226 1.00 27.39  ? 129 ARG A C     1 
ATOM   1052 O  O     . ARG A 1 129 ? 1.254   48.208  -42.344 1.00 27.79  ? 129 ARG A O     1 
ATOM   1053 C  CB    . ARG A 1 129 ? 1.654   45.902  -40.464 1.00 29.77  ? 129 ARG A CB    1 
ATOM   1054 C  CG    . ARG A 1 129 ? 2.277   44.580  -40.239 1.00 31.72  ? 129 ARG A CG    1 
ATOM   1055 C  CD    . ARG A 1 129 ? 1.171   43.561  -40.122 1.00 33.45  ? 129 ARG A CD    1 
ATOM   1056 N  NE    . ARG A 1 129 ? 1.676   42.316  -39.573 1.00 36.18  ? 129 ARG A NE    1 
ATOM   1057 C  CZ    . ARG A 1 129 ? 1.613   41.984  -38.289 1.00 35.96  ? 129 ARG A CZ    1 
ATOM   1058 N  NH1   . ARG A 1 129 ? 1.037   42.802  -37.416 1.00 33.73  ? 129 ARG A NH1   1 
ATOM   1059 N  NH2   . ARG A 1 129 ? 2.110   40.820  -37.888 1.00 38.92  ? 129 ARG A NH2   1 
ATOM   1060 N  N     . THR A 1 130 ? 1.565   49.166  -40.330 1.00 26.04  ? 130 THR A N     1 
ATOM   1061 C  CA    . THR A 1 130 ? 0.583   50.235  -40.538 1.00 25.07  ? 130 THR A CA    1 
ATOM   1062 C  C     . THR A 1 130 ? 0.820   51.056  -41.823 1.00 24.74  ? 130 THR A C     1 
ATOM   1063 O  O     . THR A 1 130 ? -0.137  51.315  -42.558 1.00 25.12  ? 130 THR A O     1 
ATOM   1064 C  CB    . THR A 1 130 ? 0.476   51.126  -39.282 1.00 24.43  ? 130 THR A CB    1 
ATOM   1065 O  OG1   . THR A 1 130 ? 0.084   50.317  -38.162 1.00 25.98  ? 130 THR A OG1   1 
ATOM   1066 C  CG2   . THR A 1 130 ? -0.530  52.227  -39.467 1.00 23.53  ? 130 THR A CG2   1 
ATOM   1067 N  N     . PRO A 1 131 ? 2.087   51.462  -42.103 1.00 24.29  ? 131 PRO A N     1 
ATOM   1068 C  CA    . PRO A 1 131 ? 2.389   52.124  -43.378 1.00 23.82  ? 131 PRO A CA    1 
ATOM   1069 C  C     . PRO A 1 131 ? 2.035   51.277  -44.582 1.00 24.48  ? 131 PRO A C     1 
ATOM   1070 O  O     . PRO A 1 131 ? 1.613   51.812  -45.610 1.00 25.12  ? 131 PRO A O     1 
ATOM   1071 C  CB    . PRO A 1 131 ? 3.907   52.312  -43.329 1.00 23.99  ? 131 PRO A CB    1 
ATOM   1072 C  CG    . PRO A 1 131 ? 4.249   52.321  -41.910 1.00 23.75  ? 131 PRO A CG    1 
ATOM   1073 C  CD    . PRO A 1 131 ? 3.290   51.378  -41.250 1.00 24.29  ? 131 PRO A CD    1 
ATOM   1074 N  N     . PHE A 1 132 ? 2.227   49.967  -44.471 1.00 24.77  ? 132 PHE A N     1 
ATOM   1075 C  CA    . PHE A 1 132 ? 1.884   49.064  -45.565 1.00 25.65  ? 132 PHE A CA    1 
ATOM   1076 C  C     . PHE A 1 132 ? 0.374   48.923  -45.737 1.00 25.28  ? 132 PHE A C     1 
ATOM   1077 O  O     . PHE A 1 132 ? -0.114  48.902  -46.863 1.00 26.17  ? 132 PHE A O     1 
ATOM   1078 C  CB    . PHE A 1 132 ? 2.527   47.703  -45.367 1.00 26.75  ? 132 PHE A CB    1 
ATOM   1079 C  CG    . PHE A 1 132 ? 4.018   47.726  -45.438 1.00 27.27  ? 132 PHE A CG    1 
ATOM   1080 C  CD1   . PHE A 1 132 ? 4.782   47.914  -44.289 1.00 25.89  ? 132 PHE A CD1   1 
ATOM   1081 C  CD2   . PHE A 1 132 ? 4.669   47.531  -46.650 1.00 28.20  ? 132 PHE A CD2   1 
ATOM   1082 C  CE1   . PHE A 1 132 ? 6.173   47.914  -44.350 1.00 26.23  ? 132 PHE A CE1   1 
ATOM   1083 C  CE2   . PHE A 1 132 ? 6.052   47.533  -46.719 1.00 28.61  ? 132 PHE A CE2   1 
ATOM   1084 C  CZ    . PHE A 1 132 ? 6.806   47.723  -45.566 1.00 28.27  ? 132 PHE A CZ    1 
ATOM   1085 N  N     . HIS A 1 133 ? -0.354  48.822  -44.624 1.00 24.25  ? 133 HIS A N     1 
ATOM   1086 C  CA    . HIS A 1 133 ? -1.808  48.807  -44.648 1.00 24.26  ? 133 HIS A CA    1 
ATOM   1087 C  C     . HIS A 1 133 ? -2.278  49.973  -45.472 1.00 24.14  ? 133 HIS A C     1 
ATOM   1088 O  O     . HIS A 1 133 ? -3.158  49.858  -46.325 1.00 25.15  ? 133 HIS A O     1 
ATOM   1089 C  CB    . HIS A 1 133 ? -2.387  48.951  -43.241 1.00 23.31  ? 133 HIS A CB    1 
ATOM   1090 C  CG    . HIS A 1 133 ? -2.145  47.769  -42.358 1.00 23.94  ? 133 HIS A CG    1 
ATOM   1091 N  ND1   . HIS A 1 133 ? -2.081  47.869  -40.985 1.00 22.44  ? 133 HIS A ND1   1 
ATOM   1092 C  CD2   . HIS A 1 133 ? -1.931  46.464  -42.650 1.00 24.98  ? 133 HIS A CD2   1 
ATOM   1093 C  CE1   . HIS A 1 133 ? -1.849  46.675  -40.470 1.00 22.89  ? 133 HIS A CE1   1 
ATOM   1094 N  NE2   . HIS A 1 133 ? -1.749  45.807  -41.459 1.00 23.69  ? 133 HIS A NE2   1 
ATOM   1095 N  N     . HIS A 1 134 ? -1.662  51.110  -45.212 1.00 23.59  ? 134 HIS A N     1 
ATOM   1096 C  CA    . HIS A 1 134 ? -2.014  52.317  -45.902 1.00 23.69  ? 134 HIS A CA    1 
ATOM   1097 C  C     . HIS A 1 134 ? -1.690  52.280  -47.390 1.00 24.99  ? 134 HIS A C     1 
ATOM   1098 O  O     . HIS A 1 134 ? -2.538  52.675  -48.176 1.00 25.79  ? 134 HIS A O     1 
ATOM   1099 C  CB    . HIS A 1 134 ? -1.363  53.518  -45.247 1.00 22.95  ? 134 HIS A CB    1 
ATOM   1100 C  CG    . HIS A 1 134 ? -1.848  54.811  -45.801 1.00 23.80  ? 134 HIS A CG    1 
ATOM   1101 N  ND1   . HIS A 1 134 ? -3.100  55.314  -45.515 1.00 25.35  ? 134 HIS A ND1   1 
ATOM   1102 C  CD2   . HIS A 1 134 ? -1.274  55.678  -46.662 1.00 23.81  ? 134 HIS A CD2   1 
ATOM   1103 C  CE1   . HIS A 1 134 ? -3.267  56.451  -46.164 1.00 26.19  ? 134 HIS A CE1   1 
ATOM   1104 N  NE2   . HIS A 1 134 ? -2.171  56.696  -46.862 1.00 26.73  ? 134 HIS A NE2   1 
ATOM   1105 N  N     . LYS A 1 135 ? -0.495  51.821  -47.786 1.00 25.56  ? 135 LYS A N     1 
ATOM   1106 C  CA    . LYS A 1 135 ? -0.191  51.703  -49.222 1.00 27.84  ? 135 LYS A CA    1 
ATOM   1107 C  C     . LYS A 1 135 ? -1.253  50.832  -49.881 1.00 28.09  ? 135 LYS A C     1 
ATOM   1108 O  O     . LYS A 1 135 ? -1.677  51.107  -51.013 1.00 29.67  ? 135 LYS A O     1 
ATOM   1109 C  CB    . LYS A 1 135 ? 1.182   51.079  -49.529 1.00 28.81  ? 135 LYS A CB    1 
ATOM   1110 C  CG    . LYS A 1 135 ? 2.430   51.783  -48.972 1.00 30.75  ? 135 LYS A CG    1 
ATOM   1111 C  CD    . LYS A 1 135 ? 3.736   51.350  -49.773 1.00 32.36  ? 135 LYS A CD    1 
ATOM   1112 C  CE    . LYS A 1 135 ? 5.011   51.052  -48.886 1.00 32.54  ? 135 LYS A CE    1 
ATOM   1113 N  NZ    . LYS A 1 135 ? 5.201   51.880  -47.650 1.00 29.22  ? 135 LYS A NZ    1 
ATOM   1114 N  N     . TRP A 1 136 ? -1.673  49.790  -49.168 1.00 27.01  ? 136 TRP A N     1 
ATOM   1115 C  CA    . TRP A 1 136 ? -2.543  48.784  -49.737 1.00 28.10  ? 136 TRP A CA    1 
ATOM   1116 C  C     . TRP A 1 136 ? -3.939  49.346  -49.959 1.00 28.59  ? 136 TRP A C     1 
ATOM   1117 O  O     . TRP A 1 136 ? -4.548  49.113  -51.011 1.00 30.31  ? 136 TRP A O     1 
ATOM   1118 C  CB    . TRP A 1 136 ? -2.597  47.532  -48.861 1.00 26.89  ? 136 TRP A CB    1 
ATOM   1119 C  CG    . TRP A 1 136 ? -3.150  46.346  -49.590 1.00 27.43  ? 136 TRP A CG    1 
ATOM   1120 C  CD1   . TRP A 1 136 ? -2.446  45.448  -50.327 1.00 28.49  ? 136 TRP A CD1   1 
ATOM   1121 C  CD2   . TRP A 1 136 ? -4.519  45.933  -49.660 1.00 26.95  ? 136 TRP A CD2   1 
ATOM   1122 N  NE1   . TRP A 1 136 ? -3.283  44.493  -50.852 1.00 29.52  ? 136 TRP A NE1   1 
ATOM   1123 C  CE2   . TRP A 1 136 ? -4.564  44.765  -50.459 1.00 28.91  ? 136 TRP A CE2   1 
ATOM   1124 C  CE3   . TRP A 1 136 ? -5.714  46.426  -49.120 1.00 25.65  ? 136 TRP A CE3   1 
ATOM   1125 C  CZ2   . TRP A 1 136 ? -5.753  44.084  -50.733 1.00 30.51  ? 136 TRP A CZ2   1 
ATOM   1126 C  CZ3   . TRP A 1 136 ? -6.905  45.747  -49.401 1.00 27.15  ? 136 TRP A CZ3   1 
ATOM   1127 C  CH2   . TRP A 1 136 ? -6.910  44.592  -50.202 1.00 29.80  ? 136 TRP A CH2   1 
ATOM   1128 N  N     . LEU A 1 137 ? -4.413  50.108  -48.981 1.00 27.48  ? 137 LEU A N     1 
ATOM   1129 C  CA    . LEU A 1 137 ? -5.777  50.596  -48.967 1.00 28.63  ? 137 LEU A CA    1 
ATOM   1130 C  C     . LEU A 1 137 ? -5.924  51.858  -49.824 1.00 30.06  ? 137 LEU A C     1 
ATOM   1131 O  O     . LEU A 1 137 ? -6.890  52.022  -50.581 1.00 30.83  ? 137 LEU A O     1 
ATOM   1132 C  CB    . LEU A 1 137 ? -6.168  50.883  -47.528 1.00 26.97  ? 137 LEU A CB    1 
ATOM   1133 C  CG    . LEU A 1 137 ? -7.368  50.163  -46.906 1.00 27.94  ? 137 LEU A CG    1 
ATOM   1134 C  CD1   . LEU A 1 137 ? -7.596  48.746  -47.447 1.00 27.82  ? 137 LEU A CD1   1 
ATOM   1135 C  CD2   . LEU A 1 137 ? -7.191  50.155  -45.385 1.00 26.44  ? 137 LEU A CD2   1 
ATOM   1136 N  N     . GLU A 1 138 ? -4.950  52.747  -49.677 1.00 30.75  ? 138 GLU A N     1 
ATOM   1137 C  CA    . GLU A 1 138 ? -4.814  53.957  -50.467 1.00 32.74  ? 138 GLU A CA    1 
ATOM   1138 C  C     . GLU A 1 138 ? -5.688  54.000  -51.729 1.00 35.05  ? 138 GLU A C     1 
ATOM   1139 O  O     . GLU A 1 138 ? -6.642  54.788  -51.790 1.00 36.04  ? 138 GLU A O     1 
ATOM   1140 C  CB    . GLU A 1 138 ? -3.355  54.092  -50.847 1.00 33.33  ? 138 GLU A CB    1 
ATOM   1141 C  CG    . GLU A 1 138 ? -2.852  55.478  -51.103 1.00 36.33  ? 138 GLU A CG    1 
ATOM   1142 C  CD    . GLU A 1 138 ? -1.400  55.426  -51.565 1.00 42.11  ? 138 GLU A CD    1 
ATOM   1143 O  OE1   . GLU A 1 138 ? -0.540  56.055  -50.902 1.00 43.16  ? 138 GLU A OE1   1 
ATOM   1144 O  OE2   . GLU A 1 138 ? -1.118  54.723  -52.575 1.00 44.94  ? 138 GLU A OE2   1 
ATOM   1145 N  N     . GLY A 1 139 ? -5.372  53.153  -52.719 1.00 36.50  ? 139 GLY A N     1 
ATOM   1146 C  CA    . GLY A 1 139 ? -6.003  53.223  -54.040 1.00 37.99  ? 139 GLY A CA    1 
ATOM   1147 C  C     . GLY A 1 139 ? -7.181  52.293  -54.221 1.00 38.94  ? 139 GLY A C     1 
ATOM   1148 O  O     . GLY A 1 139 ? -7.886  52.348  -55.226 1.00 40.83  ? 139 GLY A O     1 
ATOM   1149 N  N     . ARG A 1 140 ? -7.399  51.438  -53.231 1.00 37.98  ? 140 ARG A N     1 
ATOM   1150 C  CA    . ARG A 1 140 ? -8.467  50.445  -53.264 1.00 38.43  ? 140 ARG A CA    1 
ATOM   1151 C  C     . ARG A 1 140 ? -9.727  50.885  -52.513 1.00 37.95  ? 140 ARG A C     1 
ATOM   1152 O  O     . ARG A 1 140 ? -10.728 50.184  -52.519 1.00 39.14  ? 140 ARG A O     1 
ATOM   1153 C  CB    . ARG A 1 140 ? -7.937  49.133  -52.702 1.00 37.78  ? 140 ARG A CB    1 
ATOM   1154 C  CG    . ARG A 1 140 ? -7.312  48.268  -53.762 1.00 38.58  ? 140 ARG A CG    1 
ATOM   1155 C  CD    . ARG A 1 140 ? -6.888  46.935  -53.191 1.00 36.40  ? 140 ARG A CD    1 
ATOM   1156 N  NE    . ARG A 1 140 ? -5.451  46.890  -53.005 1.00 34.82  ? 140 ARG A NE    1 
ATOM   1157 C  CZ    . ARG A 1 140 ? -4.612  46.251  -53.811 1.00 35.85  ? 140 ARG A CZ    1 
ATOM   1158 N  NH1   . ARG A 1 140 ? -5.063  45.578  -54.858 1.00 37.92  ? 140 ARG A NH1   1 
ATOM   1159 N  NH2   . ARG A 1 140 ? -3.314  46.282  -53.557 1.00 35.48  ? 140 ARG A NH2   1 
ATOM   1160 N  N     . ILE A 1 141 ? -9.672  52.053  -51.883 1.00 36.79  ? 141 ILE A N     1 
ATOM   1161 C  CA    . ILE A 1 141 ? -10.752 52.542  -51.037 1.00 36.64  ? 141 ILE A CA    1 
ATOM   1162 C  C     . ILE A 1 141 ? -11.315 53.879  -51.524 1.00 37.33  ? 141 ILE A C     1 
ATOM   1163 O  O     . ILE A 1 141 ? -12.331 54.338  -51.018 1.00 37.78  ? 141 ILE A O     1 
ATOM   1164 C  CB    . ILE A 1 141 ? -10.300 52.639  -49.541 1.00 34.97  ? 141 ILE A CB    1 
ATOM   1165 C  CG1   . ILE A 1 141 ? -11.488 52.551  -48.586 1.00 35.34  ? 141 ILE A CG1   1 
ATOM   1166 C  CG2   . ILE A 1 141 ? -9.472  53.899  -49.271 1.00 34.44  ? 141 ILE A CG2   1 
ATOM   1167 C  CD1   . ILE A 1 141 ? -12.001 51.135  -48.361 1.00 36.77  ? 141 ILE A CD1   1 
ATOM   1168 N  N     . LYS A 1 142 ? -10.663 54.497  -52.503 1.00 38.12  ? 142 LYS A N     1 
ATOM   1169 C  CA    . LYS A 1 142 ? -11.161 55.744  -53.078 1.00 39.56  ? 142 LYS A CA    1 
ATOM   1170 C  C     . LYS A 1 142 ? -12.595 55.566  -53.577 1.00 41.37  ? 142 LYS A C     1 
ATOM   1171 O  O     . LYS A 1 142 ? -12.889 54.658  -54.360 1.00 42.75  ? 142 LYS A O     1 
ATOM   1172 C  CB    . LYS A 1 142 ? -10.264 56.238  -54.225 1.00 40.78  ? 142 LYS A CB    1 
ATOM   1173 C  CG    . LYS A 1 142 ? -8.982  56.957  -53.790 1.00 40.92  ? 142 LYS A CG    1 
ATOM   1174 C  CD    . LYS A 1 142 ? -8.473  57.857  -54.915 1.00 46.49  ? 142 LYS A CD    1 
ATOM   1175 C  CE    . LYS A 1 142 ? -6.932  57.886  -55.022 1.00 47.86  ? 142 LYS A CE    1 
ATOM   1176 N  NZ    . LYS A 1 142 ? -6.240  58.684  -53.960 1.00 45.98  ? 142 LYS A NZ    1 
ATOM   1177 N  N     . GLY A 1 143 ? -13.484 56.433  -53.104 1.00 41.55  ? 143 GLY A N     1 
ATOM   1178 C  CA    . GLY A 1 143 ? -14.875 56.428  -53.540 1.00 43.30  ? 143 GLY A CA    1 
ATOM   1179 C  C     . GLY A 1 143 ? -15.751 55.532  -52.694 1.00 42.90  ? 143 GLY A C     1 
ATOM   1180 O  O     . GLY A 1 143 ? -16.923 55.354  -52.985 1.00 44.43  ? 143 GLY A O     1 
ATOM   1181 N  N     . LYS A 1 144 ? -15.181 54.972  -51.636 1.00 38.53  ? 144 LYS A N     1 
ATOM   1182 C  CA    . LYS A 1 144 ? -15.912 54.027  -50.789 1.00 37.27  ? 144 LYS A CA    1 
ATOM   1183 C  C     . LYS A 1 144 ? -15.820 54.367  -49.305 1.00 35.78  ? 144 LYS A C     1 
ATOM   1184 O  O     . LYS A 1 144 ? -16.192 53.564  -48.445 1.00 33.95  ? 144 LYS A O     1 
ATOM   1185 C  CB    . LYS A 1 144 ? -15.439 52.601  -51.061 1.00 36.48  ? 144 LYS A CB    1 
ATOM   1186 C  CG    . LYS A 1 144 ? -16.116 51.995  -52.269 1.00 39.27  ? 144 LYS A CG    1 
ATOM   1187 C  CD    . LYS A 1 144 ? -15.402 50.767  -52.737 1.00 42.41  ? 144 LYS A CD    1 
ATOM   1188 C  CE    . LYS A 1 144 ? -16.305 49.950  -53.630 1.00 45.40  ? 144 LYS A CE    1 
ATOM   1189 N  NZ    . LYS A 1 144 ? -15.906 48.509  -53.547 1.00 47.36  ? 144 LYS A NZ    1 
ATOM   1190 N  N     . GLU A 1 145 ? -15.334 55.577  -49.032 1.00 36.37  ? 145 GLU A N     1 
ATOM   1191 C  CA    . GLU A 1 145 ? -15.133 56.068  -47.683 1.00 35.62  ? 145 GLU A CA    1 
ATOM   1192 C  C     . GLU A 1 145 ? -16.428 56.173  -46.893 1.00 35.07  ? 145 GLU A C     1 
ATOM   1193 O  O     . GLU A 1 145 ? -16.486 55.719  -45.749 1.00 33.71  ? 145 GLU A O     1 
ATOM   1194 C  CB    . GLU A 1 145 ? -14.414 57.408  -47.706 1.00 37.20  ? 145 GLU A CB    1 
ATOM   1195 C  CG    . GLU A 1 145 ? -14.422 58.091  -49.051 1.00 41.18  ? 145 GLU A CG    1 
ATOM   1196 C  CD    . GLU A 1 145 ? -13.249 57.664  -49.897 1.00 44.13  ? 145 GLU A CD    1 
ATOM   1197 O  OE1   . GLU A 1 145 ? -13.140 58.118  -51.062 1.00 46.66  ? 145 GLU A OE1   1 
ATOM   1198 O  OE2   . GLU A 1 145 ? -12.430 56.871  -49.382 1.00 44.20  ? 145 GLU A OE2   1 
ATOM   1199 N  N     . ASN A 1 146 ? -17.466 56.758  -47.492 1.00 36.07  ? 146 ASN A N     1 
ATOM   1200 C  CA    . ASN A 1 146 ? -18.756 56.883  -46.800 1.00 35.90  ? 146 ASN A CA    1 
ATOM   1201 C  C     . ASN A 1 146 ? -19.294 55.524  -46.392 1.00 33.93  ? 146 ASN A C     1 
ATOM   1202 O  O     . ASN A 1 146 ? -19.847 55.351  -45.308 1.00 33.18  ? 146 ASN A O     1 
ATOM   1203 C  CB    . ASN A 1 146 ? -19.773 57.628  -47.656 1.00 37.85  ? 146 ASN A CB    1 
ATOM   1204 C  CG    . ASN A 1 146 ? -19.293 59.007  -48.056 1.00 40.02  ? 146 ASN A CG    1 
ATOM   1205 O  OD1   . ASN A 1 146 ? -18.530 59.655  -47.334 1.00 39.96  ? 146 ASN A OD1   1 
ATOM   1206 N  ND2   . ASN A 1 146 ? -19.739 59.464  -49.217 1.00 42.91  ? 146 ASN A ND2   1 
ATOM   1207 N  N     . GLU A 1 147 ? -19.092 54.566  -47.283 1.00 33.30  ? 147 GLU A N     1 
ATOM   1208 C  CA    . GLU A 1 147 ? -19.398 53.167  -47.065 1.00 31.96  ? 147 GLU A CA    1 
ATOM   1209 C  C     . GLU A 1 147 ? -18.672 52.643  -45.804 1.00 30.02  ? 147 GLU A C     1 
ATOM   1210 O  O     . GLU A 1 147 ? -19.291 52.041  -44.920 1.00 29.00  ? 147 GLU A O     1 
ATOM   1211 C  CB    . GLU A 1 147 ? -18.974 52.408  -48.321 1.00 32.30  ? 147 GLU A CB    1 
ATOM   1212 C  CG    . GLU A 1 147 ? -19.981 51.445  -48.891 1.00 33.54  ? 147 GLU A CG    1 
ATOM   1213 C  CD    . GLU A 1 147 ? -21.382 52.020  -49.064 1.00 35.52  ? 147 GLU A CD    1 
ATOM   1214 O  OE1   . GLU A 1 147 ? -22.332 51.424  -48.498 1.00 36.87  ? 147 GLU A OE1   1 
ATOM   1215 O  OE2   . GLU A 1 147 ? -21.544 53.036  -49.770 1.00 35.92  ? 147 GLU A OE2   1 
ATOM   1216 N  N     . VAL A 1 148 ? -17.371 52.905  -45.706 1.00 29.29  ? 148 VAL A N     1 
ATOM   1217 C  CA    . VAL A 1 148 ? -16.612 52.561  -44.500 1.00 28.11  ? 148 VAL A CA    1 
ATOM   1218 C  C     . VAL A 1 148 ? -17.154 53.300  -43.273 1.00 28.14  ? 148 VAL A C     1 
ATOM   1219 O  O     . VAL A 1 148 ? -17.168 52.761  -42.174 1.00 27.49  ? 148 VAL A O     1 
ATOM   1220 C  CB    . VAL A 1 148 ? -15.104 52.889  -44.640 1.00 28.13  ? 148 VAL A CB    1 
ATOM   1221 C  CG1   . VAL A 1 148 ? -14.383 52.596  -43.344 1.00 27.71  ? 148 VAL A CG1   1 
ATOM   1222 C  CG2   . VAL A 1 148 ? -14.469 52.104  -45.773 1.00 27.73  ? 148 VAL A CG2   1 
ATOM   1223 N  N     . ARG A 1 149 ? -17.595 54.538  -43.468 1.00 29.32  ? 149 ARG A N     1 
ATOM   1224 C  CA    . ARG A 1 149 ? -18.119 55.342  -42.376 1.00 29.41  ? 149 ARG A CA    1 
ATOM   1225 C  C     . ARG A 1 149 ? -19.450 54.805  -41.865 1.00 29.38  ? 149 ARG A C     1 
ATOM   1226 O  O     . ARG A 1 149 ? -19.701 54.828  -40.676 1.00 29.40  ? 149 ARG A O     1 
ATOM   1227 C  CB    . ARG A 1 149 ? -18.239 56.803  -42.796 1.00 31.02  ? 149 ARG A CB    1 
ATOM   1228 C  CG    . ARG A 1 149 ? -16.917 57.533  -42.775 1.00 30.60  ? 149 ARG A CG    1 
ATOM   1229 C  CD    . ARG A 1 149 ? -17.006 58.859  -43.503 1.00 33.32  ? 149 ARG A CD    1 
ATOM   1230 N  NE    . ARG A 1 149 ? -15.863 59.733  -43.214 1.00 33.50  ? 149 ARG A NE    1 
ATOM   1231 C  CZ    . ARG A 1 149 ? -15.379 60.651  -44.046 1.00 34.22  ? 149 ARG A CZ    1 
ATOM   1232 N  NH1   . ARG A 1 149 ? -15.916 60.814  -45.254 1.00 34.40  ? 149 ARG A NH1   1 
ATOM   1233 N  NH2   . ARG A 1 149 ? -14.341 61.395  -43.676 1.00 34.46  ? 149 ARG A NH2   1 
ATOM   1234 N  N     . LEU A 1 150 ? -20.294 54.301  -42.756 1.00 29.83  ? 150 LEU A N     1 
ATOM   1235 C  CA    . LEU A 1 150 ? -21.536 53.661  -42.330 1.00 29.78  ? 150 LEU A CA    1 
ATOM   1236 C  C     . LEU A 1 150 ? -21.275 52.464  -41.399 1.00 28.63  ? 150 LEU A C     1 
ATOM   1237 O  O     . LEU A 1 150 ? -21.905 52.338  -40.354 1.00 28.82  ? 150 LEU A O     1 
ATOM   1238 C  CB    . LEU A 1 150 ? -22.391 53.243  -43.536 1.00 30.12  ? 150 LEU A CB    1 
ATOM   1239 C  CG    . LEU A 1 150 ? -23.169 54.321  -44.298 1.00 31.02  ? 150 LEU A CG    1 
ATOM   1240 C  CD1   . LEU A 1 150 ? -23.732 53.764  -45.583 1.00 29.41  ? 150 LEU A CD1   1 
ATOM   1241 C  CD2   . LEU A 1 150 ? -24.289 54.915  -43.458 1.00 30.98  ? 150 LEU A CD2   1 
ATOM   1242 N  N     . LEU A 1 151 ? -20.342 51.600  -41.782 1.00 27.95  ? 151 LEU A N     1 
ATOM   1243 C  CA    . LEU A 1 151 ? -20.017 50.420  -41.001 1.00 27.35  ? 151 LEU A CA    1 
ATOM   1244 C  C     . LEU A 1 151 ? -19.469 50.850  -39.654 1.00 27.66  ? 151 LEU A C     1 
ATOM   1245 O  O     . LEU A 1 151 ? -19.896 50.339  -38.617 1.00 27.53  ? 151 LEU A O     1 
ATOM   1246 C  CB    . LEU A 1 151 ? -18.954 49.594  -41.719 1.00 26.78  ? 151 LEU A CB    1 
ATOM   1247 C  CG    . LEU A 1 151 ? -19.011 48.064  -41.746 1.00 26.29  ? 151 LEU A CG    1 
ATOM   1248 C  CD1   . LEU A 1 151 ? -17.591 47.479  -41.749 1.00 24.76  ? 151 LEU A CD1   1 
ATOM   1249 C  CD2   . LEU A 1 151 ? -19.877 47.457  -40.645 1.00 25.62  ? 151 LEU A CD2   1 
ATOM   1250 N  N     . LYS A 1 152 ? -18.520 51.789  -39.674 1.00 28.30  ? 152 LYS A N     1 
ATOM   1251 C  CA    . LYS A 1 152 ? -17.931 52.293  -38.447 1.00 28.69  ? 152 LYS A CA    1 
ATOM   1252 C  C     . LYS A 1 152 ? -19.035 52.822  -37.550 1.00 29.47  ? 152 LYS A C     1 
ATOM   1253 O  O     . LYS A 1 152 ? -19.139 52.402  -36.398 1.00 29.89  ? 152 LYS A O     1 
ATOM   1254 C  CB    . LYS A 1 152 ? -16.887 53.376  -38.718 1.00 29.34  ? 152 LYS A CB    1 
ATOM   1255 C  CG    . LYS A 1 152 ? -15.585 52.868  -39.327 1.00 29.48  ? 152 LYS A CG    1 
ATOM   1256 C  CD    . LYS A 1 152 ? -14.537 53.977  -39.392 1.00 30.01  ? 152 LYS A CD    1 
ATOM   1257 C  CE    . LYS A 1 152 ? -13.207 53.445  -39.917 1.00 31.19  ? 152 LYS A CE    1 
ATOM   1258 N  NZ    . LYS A 1 152 ? -12.121 54.482  -39.907 1.00 32.82  ? 152 LYS A NZ    1 
ATOM   1259 N  N     . GLY A 1 153 ? -19.875 53.706  -38.087 1.00 30.22  ? 153 GLY A N     1 
ATOM   1260 C  CA    . GLY A 1 153 ? -20.981 54.286  -37.337 1.00 31.17  ? 153 GLY A CA    1 
ATOM   1261 C  C     . GLY A 1 153 ? -21.890 53.235  -36.725 1.00 30.89  ? 153 GLY A C     1 
ATOM   1262 O  O     . GLY A 1 153 ? -22.257 53.330  -35.555 1.00 31.15  ? 153 GLY A O     1 
ATOM   1263 N  N     . PHE A 1 154 ? -22.232 52.233  -37.532 1.00 30.45  ? 154 PHE A N     1 
ATOM   1264 C  CA    . PHE A 1 154 ? -23.111 51.121  -37.166 1.00 30.43  ? 154 PHE A CA    1 
ATOM   1265 C  C     . PHE A 1 154 ? -22.522 50.330  -36.008 1.00 29.63  ? 154 PHE A C     1 
ATOM   1266 O  O     . PHE A 1 154 ? -23.225 49.951  -35.073 1.00 30.37  ? 154 PHE A O     1 
ATOM   1267 C  CB    . PHE A 1 154 ? -23.266 50.228  -38.395 1.00 30.24  ? 154 PHE A CB    1 
ATOM   1268 C  CG    . PHE A 1 154 ? -24.296 49.135  -38.268 1.00 31.47  ? 154 PHE A CG    1 
ATOM   1269 C  CD1   . PHE A 1 154 ? -25.646 49.398  -38.453 1.00 33.95  ? 154 PHE A CD1   1 
ATOM   1270 C  CD2   . PHE A 1 154 ? -23.908 47.819  -38.050 1.00 31.79  ? 154 PHE A CD2   1 
ATOM   1271 C  CE1   . PHE A 1 154 ? -26.591 48.374  -38.376 1.00 33.52  ? 154 PHE A CE1   1 
ATOM   1272 C  CE2   . PHE A 1 154 ? -24.854 46.794  -37.970 1.00 31.02  ? 154 PHE A CE2   1 
ATOM   1273 C  CZ    . PHE A 1 154 ? -26.190 47.078  -38.137 1.00 31.91  ? 154 PHE A CZ    1 
ATOM   1274 N  N     . LEU A 1 155 ? -21.219 50.087  -36.067 1.00 28.67  ? 155 LEU A N     1 
ATOM   1275 C  CA    . LEU A 1 155 ? -20.539 49.331  -35.023 1.00 27.60  ? 155 LEU A CA    1 
ATOM   1276 C  C     . LEU A 1 155 ? -20.470 50.118  -33.737 1.00 28.09  ? 155 LEU A C     1 
ATOM   1277 O  O     . LEU A 1 155 ? -20.827 49.612  -32.680 1.00 28.48  ? 155 LEU A O     1 
ATOM   1278 C  CB    . LEU A 1 155 ? -19.139 48.932  -35.481 1.00 26.65  ? 155 LEU A CB    1 
ATOM   1279 C  CG    . LEU A 1 155 ? -19.163 47.876  -36.591 1.00 25.98  ? 155 LEU A CG    1 
ATOM   1280 C  CD1   . LEU A 1 155 ? -17.904 47.925  -37.425 1.00 25.74  ? 155 LEU A CD1   1 
ATOM   1281 C  CD2   . LEU A 1 155 ? -19.403 46.487  -36.032 1.00 25.55  ? 155 LEU A CD2   1 
ATOM   1282 N  N     . LYS A 1 156 ? -20.031 51.366  -33.840 1.00 28.50  ? 156 LYS A N     1 
ATOM   1283 C  CA    . LYS A 1 156 ? -19.830 52.210  -32.672 1.00 29.64  ? 156 LYS A CA    1 
ATOM   1284 C  C     . LYS A 1 156 ? -21.129 52.447  -31.909 1.00 30.70  ? 156 LYS A C     1 
ATOM   1285 O  O     . LYS A 1 156 ? -21.145 52.454  -30.677 1.00 31.56  ? 156 LYS A O     1 
ATOM   1286 C  CB    . LYS A 1 156 ? -19.211 53.546  -33.081 1.00 30.37  ? 156 LYS A CB    1 
ATOM   1287 C  CG    . LYS A 1 156 ? -18.817 54.409  -31.905 1.00 31.94  ? 156 LYS A CG    1 
ATOM   1288 C  CD    . LYS A 1 156 ? -18.442 55.792  -32.361 1.00 35.28  ? 156 LYS A CD    1 
ATOM   1289 C  CE    . LYS A 1 156 ? -17.555 56.487  -31.337 1.00 37.77  ? 156 LYS A CE    1 
ATOM   1290 N  NZ    . LYS A 1 156 ? -16.881 57.665  -31.965 1.00 40.34  ? 156 LYS A NZ    1 
ATOM   1291 N  N     . ALA A 1 157 ? -22.215 52.644  -32.643 1.00 30.93  ? 157 ALA A N     1 
ATOM   1292 C  CA    . ALA A 1 157 ? -23.492 52.903  -32.026 1.00 32.05  ? 157 ALA A CA    1 
ATOM   1293 C  C     . ALA A 1 157 ? -23.929 51.674  -31.244 1.00 31.89  ? 157 ALA A C     1 
ATOM   1294 O  O     . ALA A 1 157 ? -24.727 51.766  -30.319 1.00 33.34  ? 157 ALA A O     1 
ATOM   1295 C  CB    . ALA A 1 157 ? -24.515 53.270  -33.080 1.00 32.91  ? 157 ALA A CB    1 
ATOM   1296 N  N     . ASN A 1 158 ? -23.382 50.522  -31.606 1.00 30.62  ? 158 ASN A N     1 
ATOM   1297 C  CA    . ASN A 1 158 ? -23.723 49.277  -30.932 1.00 30.09  ? 158 ASN A CA    1 
ATOM   1298 C  C     . ASN A 1 158 ? -22.586 48.749  -30.059 1.00 29.47  ? 158 ASN A C     1 
ATOM   1299 O  O     . ASN A 1 158 ? -22.544 47.560  -29.731 1.00 29.67  ? 158 ASN A O     1 
ATOM   1300 C  CB    . ASN A 1 158 ? -24.180 48.247  -31.956 1.00 29.28  ? 158 ASN A CB    1 
ATOM   1301 C  CG    . ASN A 1 158 ? -25.433 48.679  -32.675 1.00 29.83  ? 158 ASN A CG    1 
ATOM   1302 O  OD1   . ASN A 1 158 ? -26.517 48.199  -32.377 1.00 31.54  ? 158 ASN A OD1   1 
ATOM   1303 N  ND2   . ASN A 1 158 ? -25.299 49.616  -33.601 1.00 29.09  ? 158 ASN A ND2   1 
ATOM   1304 N  N     . GLY A 1 159 ? -21.666 49.643  -29.707 1.00 28.97  ? 159 GLY A N     1 
ATOM   1305 C  CA    . GLY A 1 159 ? -20.669 49.399  -28.681 1.00 28.77  ? 159 GLY A CA    1 
ATOM   1306 C  C     . GLY A 1 159 ? -19.631 48.345  -28.984 1.00 27.86  ? 159 GLY A C     1 
ATOM   1307 O  O     . GLY A 1 159 ? -18.971 47.846  -28.073 1.00 27.94  ? 159 GLY A O     1 
ATOM   1308 N  N     . ILE A 1 160 ? -19.477 48.013  -30.264 1.00 27.10  ? 160 ILE A N     1 
ATOM   1309 C  CA    . ILE A 1 160 ? -18.504 47.009  -30.684 1.00 25.93  ? 160 ILE A CA    1 
ATOM   1310 C  C     . ILE A 1 160 ? -17.480 47.541  -31.701 1.00 25.25  ? 160 ILE A C     1 
ATOM   1311 O  O     . ILE A 1 160 ? -16.875 46.758  -32.443 1.00 24.44  ? 160 ILE A O     1 
ATOM   1312 C  CB    . ILE A 1 160 ? -19.196 45.729  -31.206 1.00 25.65  ? 160 ILE A CB    1 
ATOM   1313 C  CG1   . ILE A 1 160 ? -20.256 46.072  -32.257 1.00 25.89  ? 160 ILE A CG1   1 
ATOM   1314 C  CG2   . ILE A 1 160 ? -19.831 44.975  -30.059 1.00 26.26  ? 160 ILE A CG2   1 
ATOM   1315 C  CD1   . ILE A 1 160 ? -20.689 44.892  -33.114 1.00 25.84  ? 160 ILE A CD1   1 
ATOM   1316 N  N     . TYR A 1 161 ? -17.275 48.858  -31.716 1.00 25.43  ? 161 TYR A N     1 
ATOM   1317 C  CA    . TYR A 1 161 ? -16.218 49.456  -32.535 1.00 25.43  ? 161 TYR A CA    1 
ATOM   1318 C  C     . TYR A 1 161 ? -14.917 49.636  -31.757 1.00 25.74  ? 161 TYR A C     1 
ATOM   1319 O  O     . TYR A 1 161 ? -14.901 50.242  -30.680 1.00 26.19  ? 161 TYR A O     1 
ATOM   1320 C  CB    . TYR A 1 161 ? -16.650 50.802  -33.132 1.00 26.34  ? 161 TYR A CB    1 
ATOM   1321 C  CG    . TYR A 1 161 ? -15.650 51.408  -34.108 1.00 26.45  ? 161 TYR A CG    1 
ATOM   1322 C  CD1   . TYR A 1 161 ? -15.275 50.722  -35.263 1.00 26.08  ? 161 TYR A CD1   1 
ATOM   1323 C  CD2   . TYR A 1 161 ? -15.089 52.667  -33.880 1.00 27.65  ? 161 TYR A CD2   1 
ATOM   1324 C  CE1   . TYR A 1 161 ? -14.365 51.265  -36.166 1.00 26.82  ? 161 TYR A CE1   1 
ATOM   1325 C  CE2   . TYR A 1 161 ? -14.170 53.226  -34.777 1.00 28.02  ? 161 TYR A CE2   1 
ATOM   1326 C  CZ    . TYR A 1 161 ? -13.816 52.518  -35.924 1.00 27.85  ? 161 TYR A CZ    1 
ATOM   1327 O  OH    . TYR A 1 161 ? -12.910 53.037  -36.836 1.00 27.47  ? 161 TYR A OH    1 
ATOM   1328 N  N     . GLY A 1 162 ? -13.830 49.117  -32.329 1.00 25.42  ? 162 GLY A N     1 
ATOM   1329 C  CA    . GLY A 1 162 ? -12.489 49.242  -31.759 1.00 25.91  ? 162 GLY A CA    1 
ATOM   1330 C  C     . GLY A 1 162 ? -12.020 47.919  -31.196 1.00 25.70  ? 162 GLY A C     1 
ATOM   1331 O  O     . GLY A 1 162 ? -12.772 47.235  -30.523 1.00 26.29  ? 162 GLY A O     1 
ATOM   1332 N  N     . ALA A 1 163 ? -10.770 47.564  -31.462 1.00 25.98  ? 163 ALA A N     1 
ATOM   1333 C  CA    . ALA A 1 163 ? -10.208 46.290  -31.018 1.00 25.86  ? 163 ALA A CA    1 
ATOM   1334 C  C     . ALA A 1 163 ? -9.356  46.367  -29.734 1.00 26.74  ? 163 ALA A C     1 
ATOM   1335 O  O     . ALA A 1 163 ? -8.688  45.390  -29.385 1.00 27.62  ? 163 ALA A O     1 
ATOM   1336 C  CB    . ALA A 1 163 ? -9.409  45.645  -32.157 1.00 25.69  ? 163 ALA A CB    1 
ATOM   1337 N  N     . GLU A 1 164 ? -9.371  47.504  -29.037 1.00 26.72  ? 164 GLU A N     1 
ATOM   1338 C  CA    . GLU A 1 164 ? -8.694  47.623  -27.742 1.00 27.81  ? 164 GLU A CA    1 
ATOM   1339 C  C     . GLU A 1 164 ? -9.397  46.713  -26.713 1.00 28.22  ? 164 GLU A C     1 
ATOM   1340 O  O     . GLU A 1 164 ? -10.559 46.330  -26.910 1.00 27.43  ? 164 GLU A O     1 
ATOM   1341 C  CB    . GLU A 1 164 ? -8.675  49.081  -27.270 1.00 28.46  ? 164 GLU A CB    1 
ATOM   1342 C  CG    . GLU A 1 164 ? -10.036 49.673  -26.918 1.00 28.81  ? 164 GLU A CG    1 
ATOM   1343 C  CD    . GLU A 1 164 ? -10.654 50.505  -28.038 1.00 30.95  ? 164 GLU A CD    1 
ATOM   1344 O  OE1   . GLU A 1 164 ? -11.316 51.522  -27.720 1.00 32.84  ? 164 GLU A OE1   1 
ATOM   1345 O  OE2   . GLU A 1 164 ? -10.502 50.160  -29.236 1.00 31.66  ? 164 GLU A OE2   1 
ATOM   1346 N  N     . TYR A 1 165 ? -8.717  46.377  -25.615 1.00 29.22  ? 165 TYR A N     1 
ATOM   1347 C  CA    . TYR A 1 165 ? -9.267  45.399  -24.680 1.00 29.27  ? 165 TYR A CA    1 
ATOM   1348 C  C     . TYR A 1 165 ? -10.519 45.863  -23.986 1.00 29.34  ? 165 TYR A C     1 
ATOM   1349 O  O     . TYR A 1 165 ? -11.237 45.050  -23.418 1.00 29.95  ? 165 TYR A O     1 
ATOM   1350 C  CB    . TYR A 1 165 ? -8.230  44.908  -23.664 1.00 31.05  ? 165 TYR A CB    1 
ATOM   1351 C  CG    . TYR A 1 165 ? -7.279  43.920  -24.273 1.00 31.22  ? 165 TYR A CG    1 
ATOM   1352 C  CD1   . TYR A 1 165 ? -5.929  44.237  -24.447 1.00 33.54  ? 165 TYR A CD1   1 
ATOM   1353 C  CD2   . TYR A 1 165 ? -7.731  42.689  -24.727 1.00 29.69  ? 165 TYR A CD2   1 
ATOM   1354 C  CE1   . TYR A 1 165 ? -5.053  43.337  -25.039 1.00 33.25  ? 165 TYR A CE1   1 
ATOM   1355 C  CE2   . TYR A 1 165 ? -6.878  41.794  -25.326 1.00 30.89  ? 165 TYR A CE2   1 
ATOM   1356 C  CZ    . TYR A 1 165 ? -5.539  42.118  -25.480 1.00 32.61  ? 165 TYR A CZ    1 
ATOM   1357 O  OH    . TYR A 1 165 ? -4.687  41.220  -26.077 1.00 33.05  ? 165 TYR A OH    1 
ATOM   1358 N  N     . LYS A 1 166 ? -10.785 47.163  -24.035 1.00 29.21  ? 166 LYS A N     1 
ATOM   1359 C  CA    . LYS A 1 166 ? -11.970 47.710  -23.391 1.00 29.73  ? 166 LYS A CA    1 
ATOM   1360 C  C     . LYS A 1 166 ? -13.246 47.336  -24.145 1.00 28.83  ? 166 LYS A C     1 
ATOM   1361 O  O     . LYS A 1 166 ? -14.323 47.274  -23.565 1.00 28.94  ? 166 LYS A O     1 
ATOM   1362 C  CB    . LYS A 1 166 ? -11.859 49.229  -23.252 1.00 30.29  ? 166 LYS A CB    1 
ATOM   1363 C  CG    . LYS A 1 166 ? -12.880 49.801  -22.307 1.00 30.81  ? 166 LYS A CG    1 
ATOM   1364 C  CD    . LYS A 1 166 ? -12.937 51.306  -22.323 1.00 31.83  ? 166 LYS A CD    1 
ATOM   1365 C  CE    . LYS A 1 166 ? -14.023 51.751  -21.346 1.00 34.24  ? 166 LYS A CE    1 
ATOM   1366 N  NZ    . LYS A 1 166 ? -14.306 53.204  -21.383 1.00 36.37  ? 166 LYS A NZ    1 
ATOM   1367 N  N     . VAL A 1 167 ? -13.100 47.078  -25.441 1.00 28.28  ? 167 VAL A N     1 
ATOM   1368 C  CA    . VAL A 1 167 ? -14.232 46.858  -26.341 1.00 27.54  ? 167 VAL A CA    1 
ATOM   1369 C  C     . VAL A 1 167 ? -14.152 45.472  -26.971 1.00 27.13  ? 167 VAL A C     1 
ATOM   1370 O  O     . VAL A 1 167 ? -15.166 44.797  -27.127 1.00 27.10  ? 167 VAL A O     1 
ATOM   1371 C  CB    . VAL A 1 167 ? -14.266 47.933  -27.468 1.00 26.96  ? 167 VAL A CB    1 
ATOM   1372 C  CG1   . VAL A 1 167 ? -15.440 47.714  -28.415 1.00 25.83  ? 167 VAL A CG1   1 
ATOM   1373 C  CG2   . VAL A 1 167 ? -14.305 49.339  -26.877 1.00 27.54  ? 167 VAL A CG2   1 
ATOM   1374 N  N     . ARG A 1 168 ? -12.942 45.059  -27.341 1.00 27.34  ? 168 ARG A N     1 
ATOM   1375 C  CA    . ARG A 1 168 ? -12.707 43.760  -27.979 1.00 27.12  ? 168 ARG A CA    1 
ATOM   1376 C  C     . ARG A 1 168 ? -13.610 43.545  -29.193 1.00 26.26  ? 168 ARG A C     1 
ATOM   1377 O  O     . ARG A 1 168 ? -14.184 42.461  -29.369 1.00 26.38  ? 168 ARG A O     1 
ATOM   1378 C  CB    . ARG A 1 168 ? -12.870 42.621  -26.977 1.00 27.83  ? 168 ARG A CB    1 
ATOM   1379 C  CG    . ARG A 1 168 ? -11.671 42.384  -26.096 1.00 29.48  ? 168 ARG A CG    1 
ATOM   1380 C  CD    . ARG A 1 168 ? -11.995 41.230  -25.173 1.00 33.40  ? 168 ARG A CD    1 
ATOM   1381 N  NE    . ARG A 1 168 ? -11.002 40.157  -25.219 1.00 36.32  ? 168 ARG A NE    1 
ATOM   1382 C  CZ    . ARG A 1 168 ? -10.747 39.375  -26.274 1.00 36.91  ? 168 ARG A CZ    1 
ATOM   1383 N  NH1   . ARG A 1 168 ? -11.358 39.531  -27.441 1.00 33.31  ? 168 ARG A NH1   1 
ATOM   1384 N  NH2   . ARG A 1 168 ? -9.828  38.434  -26.162 1.00 41.58  ? 168 ARG A NH2   1 
ATOM   1385 N  N     . GLY A 1 169 ? -13.722 44.592  -30.014 1.00 25.61  ? 169 GLY A N     1 
ATOM   1386 C  CA    . GLY A 1 169 ? -14.536 44.581  -31.231 1.00 24.99  ? 169 GLY A CA    1 
ATOM   1387 C  C     . GLY A 1 169 ? -13.762 44.765  -32.529 1.00 24.43  ? 169 GLY A C     1 
ATOM   1388 O  O     . GLY A 1 169 ? -12.647 44.278  -32.663 1.00 25.29  ? 169 GLY A O     1 
ATOM   1389 N  N     . PHE A 1 170 ? -14.347 45.497  -33.471 1.00 23.99  ? 170 PHE A N     1 
ATOM   1390 C  CA    . PHE A 1 170 ? -13.833 45.598  -34.833 1.00 24.04  ? 170 PHE A CA    1 
ATOM   1391 C  C     . PHE A 1 170 ? -12.923 46.804  -35.004 1.00 24.62  ? 170 PHE A C     1 
ATOM   1392 O  O     . PHE A 1 170 ? -13.353 47.935  -34.765 1.00 24.99  ? 170 PHE A O     1 
ATOM   1393 C  CB    . PHE A 1 170 ? -15.000 45.759  -35.813 1.00 24.06  ? 170 PHE A CB    1 
ATOM   1394 C  CG    . PHE A 1 170 ? -15.889 44.556  -35.922 1.00 24.17  ? 170 PHE A CG    1 
ATOM   1395 C  CD1   . PHE A 1 170 ? -16.751 44.207  -34.887 1.00 24.34  ? 170 PHE A CD1   1 
ATOM   1396 C  CD2   . PHE A 1 170 ? -15.897 43.793  -37.086 1.00 24.29  ? 170 PHE A CD2   1 
ATOM   1397 C  CE1   . PHE A 1 170 ? -17.580 43.098  -34.998 1.00 24.97  ? 170 PHE A CE1   1 
ATOM   1398 C  CE2   . PHE A 1 170 ? -16.730 42.677  -37.211 1.00 24.19  ? 170 PHE A CE2   1 
ATOM   1399 C  CZ    . PHE A 1 170 ? -17.568 42.331  -36.173 1.00 24.76  ? 170 PHE A CZ    1 
ATOM   1400 N  N     . SER A 1 171 ? -11.684 46.590  -35.446 1.00 24.88  ? 171 SER A N     1 
ATOM   1401 C  CA    . SER A 1 171 ? -10.805 47.737  -35.704 1.00 25.44  ? 171 SER A CA    1 
ATOM   1402 C  C     . SER A 1 171 ? -11.280 48.545  -36.918 1.00 25.69  ? 171 SER A C     1 
ATOM   1403 O  O     . SER A 1 171 ? -12.100 48.070  -37.715 1.00 25.04  ? 171 SER A O     1 
ATOM   1404 C  CB    . SER A 1 171 ? -9.342  47.310  -35.853 1.00 25.66  ? 171 SER A CB    1 
ATOM   1405 O  OG    . SER A 1 171 ? -9.104  46.641  -37.071 1.00 25.63  ? 171 SER A OG    1 
ATOM   1406 N  N     . GLY A 1 172 ? -10.780 49.773  -37.047 1.00 26.76  ? 172 GLY A N     1 
ATOM   1407 C  CA    . GLY A 1 172 ? -11.129 50.631  -38.192 1.00 27.04  ? 172 GLY A CA    1 
ATOM   1408 C  C     . GLY A 1 172 ? -10.558 50.061  -39.477 1.00 26.87  ? 172 GLY A C     1 
ATOM   1409 O  O     . GLY A 1 172 ? -11.159 50.159  -40.539 1.00 26.80  ? 172 GLY A O     1 
ATOM   1410 N  N     . TYR A 1 173 ? -9.393  49.443  -39.362 1.00 27.07  ? 173 TYR A N     1 
ATOM   1411 C  CA    . TYR A 1 173 ? -8.739  48.836  -40.497 1.00 27.54  ? 173 TYR A CA    1 
ATOM   1412 C  C     . TYR A 1 173 ? -9.554  47.640  -40.958 1.00 27.15  ? 173 TYR A C     1 
ATOM   1413 O  O     . TYR A 1 173 ? -9.745  47.439  -42.162 1.00 27.35  ? 173 TYR A O     1 
ATOM   1414 C  CB    . TYR A 1 173 ? -7.303  48.448  -40.129 1.00 28.15  ? 173 TYR A CB    1 
ATOM   1415 C  CG    . TYR A 1 173 ? -6.568  47.629  -41.167 1.00 29.06  ? 173 TYR A CG    1 
ATOM   1416 C  CD1   . TYR A 1 173 ? -6.470  48.063  -42.491 1.00 29.93  ? 173 TYR A CD1   1 
ATOM   1417 C  CD2   . TYR A 1 173 ? -5.951  46.432  -40.818 1.00 29.01  ? 173 TYR A CD2   1 
ATOM   1418 C  CE1   . TYR A 1 173 ? -5.783  47.320  -43.445 1.00 30.79  ? 173 TYR A CE1   1 
ATOM   1419 C  CE2   . TYR A 1 173 ? -5.265  45.681  -41.762 1.00 30.59  ? 173 TYR A CE2   1 
ATOM   1420 C  CZ    . TYR A 1 173 ? -5.186  46.130  -43.076 1.00 30.81  ? 173 TYR A CZ    1 
ATOM   1421 O  OH    . TYR A 1 173 ? -4.507  45.388  -44.014 1.00 30.90  ? 173 TYR A OH    1 
ATOM   1422 N  N     . LEU A 1 174 ? -10.056 46.858  -40.002 1.00 26.75  ? 174 LEU A N     1 
ATOM   1423 C  CA    . LEU A 1 174 ? -10.969 45.758  -40.340 1.00 26.42  ? 174 LEU A CA    1 
ATOM   1424 C  C     . LEU A 1 174 ? -12.180 46.243  -41.144 1.00 26.18  ? 174 LEU A C     1 
ATOM   1425 O  O     . LEU A 1 174 ? -12.564 45.587  -42.107 1.00 26.25  ? 174 LEU A O     1 
ATOM   1426 C  CB    . LEU A 1 174 ? -11.402 44.956  -39.102 1.00 25.87  ? 174 LEU A CB    1 
ATOM   1427 C  CG    . LEU A 1 174 ? -12.443 43.830  -39.278 1.00 25.80  ? 174 LEU A CG    1 
ATOM   1428 C  CD1   . LEU A 1 174 ? -12.058 42.792  -40.321 1.00 25.73  ? 174 LEU A CD1   1 
ATOM   1429 C  CD2   . LEU A 1 174 ? -12.722 43.147  -37.956 1.00 25.80  ? 174 LEU A CD2   1 
ATOM   1430 N  N     . CYS A 1 175 ? -12.757 47.383  -40.755 1.00 26.21  ? 175 CYS A N     1 
ATOM   1431 C  CA    . CYS A 1 175 ? -13.891 47.967  -41.479 1.00 26.74  ? 175 CYS A CA    1 
ATOM   1432 C  C     . CYS A 1 175 ? -13.551 48.242  -42.932 1.00 27.57  ? 175 CYS A C     1 
ATOM   1433 O  O     . CYS A 1 175 ? -14.348 47.967  -43.835 1.00 28.39  ? 175 CYS A O     1 
ATOM   1434 C  CB    . CYS A 1 175 ? -14.364 49.246  -40.818 1.00 26.62  ? 175 CYS A CB    1 
ATOM   1435 S  SG    . CYS A 1 175 ? -15.150 48.952  -39.237 1.00 28.46  ? 175 CYS A SG    1 
ATOM   1436 N  N     . GLU A 1 176 ? -12.356 48.768  -43.161 1.00 27.77  ? 176 GLU A N     1 
ATOM   1437 C  CA    . GLU A 1 176 ? -11.926 49.062  -44.509 1.00 28.42  ? 176 GLU A CA    1 
ATOM   1438 C  C     . GLU A 1 176 ? -11.813 47.811  -45.353 1.00 27.52  ? 176 GLU A C     1 
ATOM   1439 O  O     . GLU A 1 176 ? -12.240 47.805  -46.500 1.00 28.47  ? 176 GLU A O     1 
ATOM   1440 C  CB    . GLU A 1 176 ? -10.607 49.832  -44.499 1.00 29.52  ? 176 GLU A CB    1 
ATOM   1441 C  CG    . GLU A 1 176 ? -10.798 51.317  -44.699 1.00 33.21  ? 176 GLU A CG    1 
ATOM   1442 C  CD    . GLU A 1 176 ? -10.028 52.146  -43.700 1.00 37.80  ? 176 GLU A CD    1 
ATOM   1443 O  OE1   . GLU A 1 176 ? -10.092 51.836  -42.489 1.00 39.49  ? 176 GLU A OE1   1 
ATOM   1444 O  OE2   . GLU A 1 176 ? -9.363  53.120  -44.121 1.00 41.12  ? 176 GLU A OE2   1 
ATOM   1445 N  N     . LEU A 1 177 ? -11.250 46.753  -44.784 1.00 26.18  ? 177 LEU A N     1 
ATOM   1446 C  CA    . LEU A 1 177 ? -11.039 45.519  -45.526 1.00 25.74  ? 177 LEU A CA    1 
ATOM   1447 C  C     . LEU A 1 177 ? -12.369 44.908  -45.926 1.00 25.67  ? 177 LEU A C     1 
ATOM   1448 O  O     . LEU A 1 177 ? -12.535 44.434  -47.055 1.00 26.32  ? 177 LEU A O     1 
ATOM   1449 C  CB    . LEU A 1 177 ? -10.204 44.522  -44.721 1.00 25.12  ? 177 LEU A CB    1 
ATOM   1450 C  CG    . LEU A 1 177 ? -8.765  44.956  -44.458 1.00 24.60  ? 177 LEU A CG    1 
ATOM   1451 C  CD1   . LEU A 1 177 ? -8.104  43.979  -43.541 1.00 24.09  ? 177 LEU A CD1   1 
ATOM   1452 C  CD2   . LEU A 1 177 ? -7.969  45.104  -45.744 1.00 24.77  ? 177 LEU A CD2   1 
ATOM   1453 N  N     . LEU A 1 178 ? -13.318 44.946  -44.997 1.00 24.99  ? 178 LEU A N     1 
ATOM   1454 C  CA    . LEU A 1 178 ? -14.667 44.464  -45.245 1.00 25.11  ? 178 LEU A CA    1 
ATOM   1455 C  C     . LEU A 1 178 ? -15.297 45.233  -46.387 1.00 25.72  ? 178 LEU A C     1 
ATOM   1456 O  O     . LEU A 1 178 ? -15.908 44.637  -47.284 1.00 26.84  ? 178 LEU A O     1 
ATOM   1457 C  CB    . LEU A 1 178 ? -15.526 44.596  -43.994 1.00 24.57  ? 178 LEU A CB    1 
ATOM   1458 C  CG    . LEU A 1 178 ? -15.139 43.670  -42.838 1.00 24.99  ? 178 LEU A CG    1 
ATOM   1459 C  CD1   . LEU A 1 178 ? -16.025 43.930  -41.598 1.00 23.13  ? 178 LEU A CD1   1 
ATOM   1460 C  CD2   . LEU A 1 178 ? -15.185 42.198  -43.283 1.00 24.50  ? 178 LEU A CD2   1 
ATOM   1461 N  N     . ILE A 1 179 ? -15.138 46.550  -46.373 1.00 25.20  ? 179 ILE A N     1 
ATOM   1462 C  CA    . ILE A 1 179 ? -15.708 47.336  -47.445 1.00 25.85  ? 179 ILE A CA    1 
ATOM   1463 C  C     . ILE A 1 179 ? -15.029 46.983  -48.760 1.00 26.84  ? 179 ILE A C     1 
ATOM   1464 O  O     . ILE A 1 179 ? -15.719 46.737  -49.745 1.00 28.14  ? 179 ILE A O     1 
ATOM   1465 C  CB    . ILE A 1 179 ? -15.708 48.846  -47.157 1.00 26.11  ? 179 ILE A CB    1 
ATOM   1466 C  CG1   . ILE A 1 179 ? -16.600 49.159  -45.939 1.00 24.27  ? 179 ILE A CG1   1 
ATOM   1467 C  CG2   . ILE A 1 179 ? -16.133 49.641  -48.418 1.00 27.24  ? 179 ILE A CG2   1 
ATOM   1468 C  CD1   . ILE A 1 179 ? -18.077 48.709  -46.055 1.00 21.87  ? 179 ILE A CD1   1 
ATOM   1469 N  N     . VAL A 1 180 ? -13.698 46.908  -48.774 1.00 26.56  ? 180 VAL A N     1 
ATOM   1470 C  CA    . VAL A 1 180 ? -12.986 46.434  -49.970 1.00 27.45  ? 180 VAL A CA    1 
ATOM   1471 C  C     . VAL A 1 180 ? -13.449 45.041  -50.377 1.00 27.69  ? 180 VAL A C     1 
ATOM   1472 O  O     . VAL A 1 180 ? -13.534 44.741  -51.557 1.00 29.00  ? 180 VAL A O     1 
ATOM   1473 C  CB    . VAL A 1 180 ? -11.452 46.431  -49.799 1.00 27.46  ? 180 VAL A CB    1 
ATOM   1474 C  CG1   . VAL A 1 180 ? -10.773 45.649  -50.933 1.00 28.46  ? 180 VAL A CG1   1 
ATOM   1475 C  CG2   . VAL A 1 180 ? -10.924 47.842  -49.769 1.00 27.92  ? 180 VAL A CG2   1 
ATOM   1476 N  N     . PHE A 1 181 ? -13.764 44.198  -49.402 1.00 26.94  ? 181 PHE A N     1 
ATOM   1477 C  CA    . PHE A 1 181 ? -14.123 42.811  -49.699 1.00 27.61  ? 181 PHE A CA    1 
ATOM   1478 C  C     . PHE A 1 181 ? -15.537 42.651  -50.251 1.00 28.45  ? 181 PHE A C     1 
ATOM   1479 O  O     . PHE A 1 181 ? -15.781 41.812  -51.120 1.00 29.19  ? 181 PHE A O     1 
ATOM   1480 C  CB    . PHE A 1 181 ? -13.942 41.928  -48.460 1.00 26.58  ? 181 PHE A CB    1 
ATOM   1481 C  CG    . PHE A 1 181 ? -13.985 40.461  -48.752 1.00 26.92  ? 181 PHE A CG    1 
ATOM   1482 C  CD1   . PHE A 1 181 ? -12.899 39.829  -49.365 1.00 28.29  ? 181 PHE A CD1   1 
ATOM   1483 C  CD2   . PHE A 1 181 ? -15.102 39.705  -48.405 1.00 26.52  ? 181 PHE A CD2   1 
ATOM   1484 C  CE1   . PHE A 1 181 ? -12.917 38.462  -49.633 1.00 28.99  ? 181 PHE A CE1   1 
ATOM   1485 C  CE2   . PHE A 1 181 ? -15.139 38.337  -48.663 1.00 28.27  ? 181 PHE A CE2   1 
ATOM   1486 C  CZ    . PHE A 1 181 ? -14.041 37.712  -49.288 1.00 29.68  ? 181 PHE A CZ    1 
ATOM   1487 N  N     . TYR A 1 182 ? -16.468 43.439  -49.723 1.00 28.32  ? 182 TYR A N     1 
ATOM   1488 C  CA    . TYR A 1 182 ? -17.880 43.278  -50.066 1.00 29.29  ? 182 TYR A CA    1 
ATOM   1489 C  C     . TYR A 1 182 ? -18.400 44.385  -50.968 1.00 30.31  ? 182 TYR A C     1 
ATOM   1490 O  O     . TYR A 1 182 ? -19.478 44.264  -51.531 1.00 31.67  ? 182 TYR A O     1 
ATOM   1491 C  CB    . TYR A 1 182 ? -18.742 43.173  -48.804 1.00 28.58  ? 182 TYR A CB    1 
ATOM   1492 C  CG    . TYR A 1 182 ? -18.584 41.869  -48.061 1.00 27.97  ? 182 TYR A CG    1 
ATOM   1493 C  CD1   . TYR A 1 182 ? -19.064 40.669  -48.607 1.00 28.72  ? 182 TYR A CD1   1 
ATOM   1494 C  CD2   . TYR A 1 182 ? -17.959 41.830  -46.816 1.00 26.16  ? 182 TYR A CD2   1 
ATOM   1495 C  CE1   . TYR A 1 182 ? -18.920 39.466  -47.938 1.00 28.14  ? 182 TYR A CE1   1 
ATOM   1496 C  CE2   . TYR A 1 182 ? -17.807 40.633  -46.130 1.00 26.11  ? 182 TYR A CE2   1 
ATOM   1497 C  CZ    . TYR A 1 182 ? -18.291 39.454  -46.698 1.00 28.01  ? 182 TYR A CZ    1 
ATOM   1498 O  OH    . TYR A 1 182 ? -18.152 38.267  -46.018 1.00 28.52  ? 182 TYR A OH    1 
ATOM   1499 N  N     . GLY A 1 183 ? -17.638 45.458  -51.105 1.00 29.98  ? 183 GLY A N     1 
ATOM   1500 C  CA    . GLY A 1 183 ? -18.027 46.535  -51.996 1.00 31.74  ? 183 GLY A CA    1 
ATOM   1501 C  C     . GLY A 1 183 ? -18.848 47.634  -51.351 1.00 31.89  ? 183 GLY A C     1 
ATOM   1502 O  O     . GLY A 1 183 ? -18.726 48.798  -51.727 1.00 32.57  ? 183 GLY A O     1 
ATOM   1503 N  N     . SER A 1 184 ? -19.684 47.269  -50.382 1.00 31.63  ? 184 SER A N     1 
ATOM   1504 C  CA    . SER A 1 184 ? -20.536 48.238  -49.699 1.00 32.15  ? 184 SER A CA    1 
ATOM   1505 C  C     . SER A 1 184 ? -20.887 47.829  -48.276 1.00 31.08  ? 184 SER A C     1 
ATOM   1506 O  O     . SER A 1 184 ? -20.781 46.651  -47.908 1.00 30.55  ? 184 SER A O     1 
ATOM   1507 C  CB    . SER A 1 184 ? -21.840 48.429  -50.472 1.00 34.08  ? 184 SER A CB    1 
ATOM   1508 O  OG    . SER A 1 184 ? -22.799 47.471  -50.060 1.00 34.50  ? 184 SER A OG    1 
ATOM   1509 N  N     . PHE A 1 185 ? -21.337 48.810  -47.497 1.00 31.14  ? 185 PHE A N     1 
ATOM   1510 C  CA    . PHE A 1 185 ? -21.934 48.561  -46.190 1.00 30.87  ? 185 PHE A CA    1 
ATOM   1511 C  C     . PHE A 1 185 ? -23.061 47.531  -46.276 1.00 31.92  ? 185 PHE A C     1 
ATOM   1512 O  O     . PHE A 1 185 ? -23.055 46.526  -45.562 1.00 31.17  ? 185 PHE A O     1 
ATOM   1513 C  CB    . PHE A 1 185 ? -22.490 49.858  -45.605 1.00 31.11  ? 185 PHE A CB    1 
ATOM   1514 C  CG    . PHE A 1 185 ? -23.302 49.655  -44.367 1.00 30.47  ? 185 PHE A CG    1 
ATOM   1515 C  CD1   . PHE A 1 185 ? -24.683 49.611  -44.428 1.00 31.25  ? 185 PHE A CD1   1 
ATOM   1516 C  CD2   . PHE A 1 185 ? -22.681 49.484  -43.136 1.00 29.50  ? 185 PHE A CD2   1 
ATOM   1517 C  CE1   . PHE A 1 185 ? -25.442 49.412  -43.273 1.00 32.13  ? 185 PHE A CE1   1 
ATOM   1518 C  CE2   . PHE A 1 185 ? -23.431 49.290  -41.977 1.00 29.78  ? 185 PHE A CE2   1 
ATOM   1519 C  CZ    . PHE A 1 185 ? -24.815 49.255  -42.047 1.00 30.61  ? 185 PHE A CZ    1 
ATOM   1520 N  N     . LEU A 1 186 ? -24.021 47.808  -47.163 1.00 34.06  ? 186 LEU A N     1 
ATOM   1521 C  CA    . LEU A 1 186 ? -25.182 46.958  -47.371 1.00 35.34  ? 186 LEU A CA    1 
ATOM   1522 C  C     . LEU A 1 186 ? -24.805 45.520  -47.729 1.00 35.32  ? 186 LEU A C     1 
ATOM   1523 O  O     . LEU A 1 186 ? -25.421 44.578  -47.222 1.00 35.49  ? 186 LEU A O     1 
ATOM   1524 C  CB    . LEU A 1 186 ? -26.120 47.560  -48.424 1.00 37.30  ? 186 LEU A CB    1 
ATOM   1525 C  CG    . LEU A 1 186 ? -27.511 46.906  -48.497 1.00 39.20  ? 186 LEU A CG    1 
ATOM   1526 C  CD1   . LEU A 1 186 ? -28.285 47.032  -47.176 1.00 38.42  ? 186 LEU A CD1   1 
ATOM   1527 C  CD2   . LEU A 1 186 ? -28.322 47.444  -49.655 1.00 41.19  ? 186 LEU A CD2   1 
ATOM   1528 N  N     . GLU A 1 187 ? -23.791 45.356  -48.580 1.00 35.39  ? 187 GLU A N     1 
ATOM   1529 C  CA    . GLU A 1 187 ? -23.283 44.021  -48.920 1.00 35.52  ? 187 GLU A CA    1 
ATOM   1530 C  C     . GLU A 1 187 ? -22.657 43.301  -47.723 1.00 33.52  ? 187 GLU A C     1 
ATOM   1531 O  O     . GLU A 1 187 ? -22.788 42.083  -47.589 1.00 33.78  ? 187 GLU A O     1 
ATOM   1532 C  CB    . GLU A 1 187 ? -22.279 44.095  -50.065 1.00 35.97  ? 187 GLU A CB    1 
ATOM   1533 C  CG    . GLU A 1 187 ? -22.915 44.162  -51.436 1.00 40.94  ? 187 GLU A CG    1 
ATOM   1534 C  CD    . GLU A 1 187 ? -23.853 42.982  -51.715 1.00 46.23  ? 187 GLU A CD    1 
ATOM   1535 O  OE1   . GLU A 1 187 ? -23.388 41.818  -51.607 1.00 47.67  ? 187 GLU A OE1   1 
ATOM   1536 O  OE2   . GLU A 1 187 ? -25.048 43.221  -52.043 1.00 47.86  ? 187 GLU A OE2   1 
ATOM   1537 N  N     . THR A 1 188 ? -21.978 44.054  -46.863 1.00 31.66  ? 188 THR A N     1 
ATOM   1538 C  CA    . THR A 1 188 ? -21.297 43.469  -45.715 1.00 29.97  ? 188 THR A CA    1 
ATOM   1539 C  C     . THR A 1 188 ? -22.339 42.916  -44.747 1.00 30.09  ? 188 THR A C     1 
ATOM   1540 O  O     . THR A 1 188 ? -22.404 41.708  -44.506 1.00 30.08  ? 188 THR A O     1 
ATOM   1541 C  CB    . THR A 1 188 ? -20.390 44.501  -45.021 1.00 28.62  ? 188 THR A CB    1 
ATOM   1542 O  OG1   . THR A 1 188 ? -19.380 44.920  -45.940 1.00 28.29  ? 188 THR A OG1   1 
ATOM   1543 C  CG2   . THR A 1 188 ? -19.726 43.904  -43.821 1.00 26.66  ? 188 THR A CG2   1 
ATOM   1544 N  N     . VAL A 1 189 ? -23.164 43.819  -44.225 1.00 30.11  ? 189 VAL A N     1 
ATOM   1545 C  CA    . VAL A 1 189 ? -24.292 43.477  -43.384 1.00 30.29  ? 189 VAL A CA    1 
ATOM   1546 C  C     . VAL A 1 189 ? -25.037 42.251  -43.927 1.00 31.51  ? 189 VAL A C     1 
ATOM   1547 O  O     . VAL A 1 189 ? -25.216 41.267  -43.198 1.00 31.81  ? 189 VAL A O     1 
ATOM   1548 C  CB    . VAL A 1 189 ? -25.222 44.687  -43.244 1.00 30.80  ? 189 VAL A CB    1 
ATOM   1549 C  CG1   . VAL A 1 189 ? -26.554 44.302  -42.639 1.00 32.49  ? 189 VAL A CG1   1 
ATOM   1550 C  CG2   . VAL A 1 189 ? -24.558 45.725  -42.400 1.00 29.86  ? 189 VAL A CG2   1 
ATOM   1551 N  N     . LYS A 1 190 ? -25.436 42.299  -45.202 1.00 32.39  ? 190 LYS A N     1 
ATOM   1552 C  CA    . LYS A 1 190 ? -26.159 41.195  -45.839 1.00 33.35  ? 190 LYS A CA    1 
ATOM   1553 C  C     . LYS A 1 190 ? -25.397 39.882  -45.722 1.00 32.57  ? 190 LYS A C     1 
ATOM   1554 O  O     . LYS A 1 190 ? -25.974 38.853  -45.381 1.00 32.87  ? 190 LYS A O     1 
ATOM   1555 C  CB    . LYS A 1 190 ? -26.482 41.513  -47.308 1.00 34.84  ? 190 LYS A CB    1 
ATOM   1556 C  CG    . LYS A 1 190 ? -27.825 42.221  -47.500 1.00 36.52  ? 190 LYS A CG    1 
ATOM   1557 C  CD    . LYS A 1 190 ? -28.068 42.748  -48.913 1.00 38.29  ? 190 LYS A CD    1 
ATOM   1558 C  CE    . LYS A 1 190 ? -28.472 41.651  -49.888 1.00 42.50  ? 190 LYS A CE    1 
ATOM   1559 N  NZ    . LYS A 1 190 ? -29.285 42.152  -51.067 1.00 46.27  ? 190 LYS A NZ    1 
ATOM   1560 N  N     . ASN A 1 191 ? -24.093 39.932  -45.970 1.00 31.45  ? 191 ASN A N     1 
ATOM   1561 C  CA    . ASN A 1 191 ? -23.266 38.734  -45.908 1.00 31.29  ? 191 ASN A CA    1 
ATOM   1562 C  C     . ASN A 1 191 ? -22.887 38.277  -44.514 1.00 30.15  ? 191 ASN A C     1 
ATOM   1563 O  O     . ASN A 1 191 ? -22.918 37.084  -44.230 1.00 30.72  ? 191 ASN A O     1 
ATOM   1564 C  CB    . ASN A 1 191 ? -22.025 38.893  -46.770 1.00 30.98  ? 191 ASN A CB    1 
ATOM   1565 C  CG    . ASN A 1 191 ? -22.294 38.548  -48.200 1.00 33.05  ? 191 ASN A CG    1 
ATOM   1566 O  OD1   . ASN A 1 191 ? -22.413 37.375  -48.551 1.00 34.69  ? 191 ASN A OD1   1 
ATOM   1567 N  ND2   . ASN A 1 191 ? -22.426 39.564  -49.037 1.00 34.29  ? 191 ASN A ND2   1 
ATOM   1568 N  N     . ALA A 1 192 ? -22.525 39.228  -43.656 1.00 28.75  ? 192 ALA A N     1 
ATOM   1569 C  CA    . ALA A 1 192 ? -22.161 38.947  -42.276 1.00 27.60  ? 192 ALA A CA    1 
ATOM   1570 C  C     . ALA A 1 192 ? -23.200 38.064  -41.607 1.00 28.55  ? 192 ALA A C     1 
ATOM   1571 O  O     . ALA A 1 192 ? -22.863 37.259  -40.742 1.00 28.74  ? 192 ALA A O     1 
ATOM   1572 C  CB    . ALA A 1 192 ? -22.011 40.227  -41.520 1.00 26.47  ? 192 ALA A CB    1 
ATOM   1573 N  N     . ARG A 1 193 ? -24.457 38.223  -42.019 1.00 29.44  ? 193 ARG A N     1 
ATOM   1574 C  CA    . ARG A 1 193 ? -25.569 37.396  -41.562 1.00 30.68  ? 193 ARG A CA    1 
ATOM   1575 C  C     . ARG A 1 193 ? -25.253 35.906  -41.504 1.00 31.51  ? 193 ARG A C     1 
ATOM   1576 O  O     . ARG A 1 193 ? -25.839 35.170  -40.711 1.00 32.38  ? 193 ARG A O     1 
ATOM   1577 C  CB    . ARG A 1 193 ? -26.764 37.603  -42.479 1.00 32.25  ? 193 ARG A CB    1 
ATOM   1578 C  CG    . ARG A 1 193 ? -27.939 38.283  -41.843 1.00 32.23  ? 193 ARG A CG    1 
ATOM   1579 C  CD    . ARG A 1 193 ? -28.503 39.371  -42.722 1.00 32.20  ? 193 ARG A CD    1 
ATOM   1580 N  NE    . ARG A 1 193 ? -28.437 39.061  -44.142 1.00 34.23  ? 193 ARG A NE    1 
ATOM   1581 C  CZ    . ARG A 1 193 ? -29.496 38.901  -44.926 1.00 37.05  ? 193 ARG A CZ    1 
ATOM   1582 N  NH1   . ARG A 1 193 ? -30.717 39.023  -44.429 1.00 39.16  ? 193 ARG A NH1   1 
ATOM   1583 N  NH2   . ARG A 1 193 ? -29.334 38.630  -46.213 1.00 38.08  ? 193 ARG A NH2   1 
ATOM   1584 N  N     . ARG A 1 194 ? -24.337 35.452  -42.345 1.00 31.64  ? 194 ARG A N     1 
ATOM   1585 C  CA    . ARG A 1 194 ? -23.986 34.038  -42.346 1.00 32.89  ? 194 ARG A CA    1 
ATOM   1586 C  C     . ARG A 1 194 ? -22.527 33.722  -42.003 1.00 31.17  ? 194 ARG A C     1 
ATOM   1587 O  O     . ARG A 1 194 ? -22.038 32.644  -42.323 1.00 32.14  ? 194 ARG A O     1 
ATOM   1588 C  CB    . ARG A 1 194 ? -24.457 33.326  -43.631 1.00 35.06  ? 194 ARG A CB    1 
ATOM   1589 C  CG    . ARG A 1 194 ? -24.506 34.184  -44.860 1.00 37.62  ? 194 ARG A CG    1 
ATOM   1590 C  CD    . ARG A 1 194 ? -24.410 33.314  -46.097 1.00 45.06  ? 194 ARG A CD    1 
ATOM   1591 N  NE    . ARG A 1 194 ? -23.452 33.853  -47.074 1.00 47.43  ? 194 ARG A NE    1 
ATOM   1592 C  CZ    . ARG A 1 194 ? -22.918 33.161  -48.081 1.00 50.11  ? 194 ARG A CZ    1 
ATOM   1593 N  NH1   . ARG A 1 194 ? -23.236 31.877  -48.267 1.00 52.05  ? 194 ARG A NH1   1 
ATOM   1594 N  NH2   . ARG A 1 194 ? -22.059 33.759  -48.908 1.00 50.03  ? 194 ARG A NH2   1 
ATOM   1595 N  N     . TRP A 1 195 ? -21.848 34.647  -41.327 1.00 28.96  ? 195 TRP A N     1 
ATOM   1596 C  CA    . TRP A 1 195 ? -20.523 34.370  -40.775 1.00 27.55  ? 195 TRP A CA    1 
ATOM   1597 C  C     . TRP A 1 195 ? -20.680 33.363  -39.650 1.00 28.08  ? 195 TRP A C     1 
ATOM   1598 O  O     . TRP A 1 195 ? -21.714 33.335  -38.983 1.00 29.12  ? 195 TRP A O     1 
ATOM   1599 C  CB    . TRP A 1 195 ? -19.899 35.618  -40.168 1.00 25.62  ? 195 TRP A CB    1 
ATOM   1600 C  CG    . TRP A 1 195 ? -19.430 36.639  -41.115 1.00 25.21  ? 195 TRP A CG    1 
ATOM   1601 C  CD1   . TRP A 1 195 ? -19.373 36.551  -42.481 1.00 26.18  ? 195 TRP A CD1   1 
ATOM   1602 C  CD2   . TRP A 1 195 ? -18.894 37.919  -40.772 1.00 23.50  ? 195 TRP A CD2   1 
ATOM   1603 N  NE1   . TRP A 1 195 ? -18.850 37.715  -43.011 1.00 24.88  ? 195 TRP A NE1   1 
ATOM   1604 C  CE2   . TRP A 1 195 ? -18.551 38.569  -41.984 1.00 23.31  ? 195 TRP A CE2   1 
ATOM   1605 C  CE3   . TRP A 1 195 ? -18.684 38.586  -39.559 1.00 21.79  ? 195 TRP A CE3   1 
ATOM   1606 C  CZ2   . TRP A 1 195 ? -18.015 39.855  -42.018 1.00 22.95  ? 195 TRP A CZ2   1 
ATOM   1607 C  CZ3   . TRP A 1 195 ? -18.148 39.861  -39.587 1.00 22.51  ? 195 TRP A CZ3   1 
ATOM   1608 C  CH2   . TRP A 1 195 ? -17.823 40.490  -40.816 1.00 22.93  ? 195 TRP A CH2   1 
ATOM   1609 N  N     . THR A 1 196 ? -19.656 32.552  -39.425 1.00 27.63  ? 196 THR A N     1 
ATOM   1610 C  CA    . THR A 1 196 ? -19.651 31.623  -38.323 1.00 27.67  ? 196 THR A CA    1 
ATOM   1611 C  C     . THR A 1 196 ? -18.385 31.850  -37.530 1.00 27.22  ? 196 THR A C     1 
ATOM   1612 O  O     . THR A 1 196 ? -17.537 32.632  -37.940 1.00 26.40  ? 196 THR A O     1 
ATOM   1613 C  CB    . THR A 1 196 ? -19.689 30.155  -38.800 1.00 29.31  ? 196 THR A CB    1 
ATOM   1614 O  OG1   . THR A 1 196 ? -18.403 29.784  -39.304 1.00 29.96  ? 196 THR A OG1   1 
ATOM   1615 C  CG2   . THR A 1 196 ? -20.756 29.935  -39.859 1.00 27.92  ? 196 THR A CG2   1 
ATOM   1616 N  N     . ARG A 1 197 ? -18.257 31.165  -36.398 1.00 28.19  ? 197 ARG A N     1 
ATOM   1617 C  CA    . ARG A 1 197 ? -17.048 31.232  -35.583 1.00 28.25  ? 197 ARG A CA    1 
ATOM   1618 C  C     . ARG A 1 197 ? -15.838 30.600  -36.281 1.00 29.69  ? 197 ARG A C     1 
ATOM   1619 O  O     . ARG A 1 197 ? -14.699 30.764  -35.832 1.00 29.98  ? 197 ARG A O     1 
ATOM   1620 C  CB    . ARG A 1 197 ? -17.281 30.576  -34.214 1.00 29.19  ? 197 ARG A CB    1 
ATOM   1621 C  CG    . ARG A 1 197 ? -17.351 29.045  -34.197 1.00 30.06  ? 197 ARG A CG    1 
ATOM   1622 C  CD    . ARG A 1 197 ? -17.918 28.557  -32.874 1.00 31.83  ? 197 ARG A CD    1 
ATOM   1623 N  NE    . ARG A 1 197 ? -19.214 29.176  -32.594 1.00 32.03  ? 197 ARG A NE    1 
ATOM   1624 C  CZ    . ARG A 1 197 ? -19.933 29.002  -31.487 1.00 33.57  ? 197 ARG A CZ    1 
ATOM   1625 N  NH1   . ARG A 1 197 ? -19.495 28.230  -30.509 1.00 35.93  ? 197 ARG A NH1   1 
ATOM   1626 N  NH2   . ARG A 1 197 ? -21.096 29.620  -31.351 1.00 33.93  ? 197 ARG A NH2   1 
ATOM   1627 N  N     . ARG A 1 198 ? -16.090 29.874  -37.368 1.00 31.00  ? 198 ARG A N     1 
ATOM   1628 C  CA    . ARG A 1 198 ? -15.030 29.204  -38.111 1.00 32.35  ? 198 ARG A CA    1 
ATOM   1629 C  C     . ARG A 1 198 ? -14.772 29.875  -39.466 1.00 31.36  ? 198 ARG A C     1 
ATOM   1630 O  O     . ARG A 1 198 ? -14.146 29.286  -40.351 1.00 32.67  ? 198 ARG A O     1 
ATOM   1631 C  CB    . ARG A 1 198 ? -15.365 27.719  -38.290 1.00 34.90  ? 198 ARG A CB    1 
ATOM   1632 C  CG    . ARG A 1 198 ? -14.632 26.786  -37.333 1.00 38.56  ? 198 ARG A CG    1 
ATOM   1633 C  CD    . ARG A 1 198 ? -15.446 26.373  -36.128 1.00 44.11  ? 198 ARG A CD    1 
ATOM   1634 N  NE    . ARG A 1 198 ? -14.583 26.156  -34.957 1.00 49.05  ? 198 ARG A NE    1 
ATOM   1635 C  CZ    . ARG A 1 198 ? -14.910 25.449  -33.869 1.00 51.25  ? 198 ARG A CZ    1 
ATOM   1636 N  NH1   . ARG A 1 198 ? -16.092 24.844  -33.777 1.00 52.33  ? 198 ARG A NH1   1 
ATOM   1637 N  NH2   . ARG A 1 198 ? -14.037 25.341  -32.867 1.00 52.34  ? 198 ARG A NH2   1 
ATOM   1638 N  N     . THR A 1 199 ? -15.235 31.116  -39.616 1.00 29.36  ? 199 THR A N     1 
ATOM   1639 C  CA    . THR A 1 199 ? -15.203 31.800  -40.915 1.00 28.16  ? 199 THR A CA    1 
ATOM   1640 C  C     . THR A 1 199 ? -13.872 32.476  -41.173 1.00 27.51  ? 199 THR A C     1 
ATOM   1641 O  O     . THR A 1 199 ? -13.400 33.266  -40.362 1.00 26.81  ? 199 THR A O     1 
ATOM   1642 C  CB    . THR A 1 199 ? -16.350 32.827  -41.047 1.00 26.81  ? 199 THR A CB    1 
ATOM   1643 O  OG1   . THR A 1 199 ? -17.600 32.135  -40.993 1.00 27.03  ? 199 THR A OG1   1 
ATOM   1644 C  CG2   . THR A 1 199 ? -16.269 33.569  -42.363 1.00 25.70  ? 199 THR A CG2   1 
ATOM   1645 N  N     . VAL A 1 200 ? -13.274 32.163  -42.313 1.00 27.87  ? 200 VAL A N     1 
ATOM   1646 C  CA    . VAL A 1 200 ? -12.046 32.821  -42.741 1.00 26.92  ? 200 VAL A CA    1 
ATOM   1647 C  C     . VAL A 1 200 ? -12.327 33.688  -43.960 1.00 26.31  ? 200 VAL A C     1 
ATOM   1648 O  O     . VAL A 1 200 ? -12.758 33.194  -44.997 1.00 26.96  ? 200 VAL A O     1 
ATOM   1649 C  CB    . VAL A 1 200 ? -10.937 31.786  -43.064 1.00 28.53  ? 200 VAL A CB    1 
ATOM   1650 C  CG1   . VAL A 1 200 ? -9.776  32.434  -43.806 1.00 28.30  ? 200 VAL A CG1   1 
ATOM   1651 C  CG2   . VAL A 1 200 ? -10.461 31.093  -41.788 1.00 29.06  ? 200 VAL A CG2   1 
ATOM   1652 N  N     . ILE A 1 201 ? -12.095 34.983  -43.817 1.00 25.26  ? 201 ILE A N     1 
ATOM   1653 C  CA    . ILE A 1 201 ? -12.108 35.898  -44.946 1.00 25.21  ? 201 ILE A CA    1 
ATOM   1654 C  C     . ILE A 1 201 ? -10.675 36.229  -45.363 1.00 25.99  ? 201 ILE A C     1 
ATOM   1655 O  O     . ILE A 1 201 ? -9.928  36.845  -44.614 1.00 25.42  ? 201 ILE A O     1 
ATOM   1656 C  CB    . ILE A 1 201 ? -12.825 37.216  -44.592 1.00 23.98  ? 201 ILE A CB    1 
ATOM   1657 C  CG1   . ILE A 1 201 ? -14.208 36.935  -44.004 1.00 22.66  ? 201 ILE A CG1   1 
ATOM   1658 C  CG2   . ILE A 1 201 ? -12.874 38.152  -45.815 1.00 23.57  ? 201 ILE A CG2   1 
ATOM   1659 C  CD1   . ILE A 1 201 ? -14.866 38.146  -43.412 1.00 19.42  ? 201 ILE A CD1   1 
ATOM   1660 N  N     . ASP A 1 202 ? -10.299 35.818  -46.564 1.00 27.94  ? 202 ASP A N     1 
ATOM   1661 C  CA    . ASP A 1 202 ? -8.986  36.143  -47.120 1.00 29.30  ? 202 ASP A CA    1 
ATOM   1662 C  C     . ASP A 1 202 ? -9.109  37.234  -48.204 1.00 29.26  ? 202 ASP A C     1 
ATOM   1663 O  O     . ASP A 1 202 ? -9.310  36.941  -49.390 1.00 30.05  ? 202 ASP A O     1 
ATOM   1664 C  CB    . ASP A 1 202 ? -8.339  34.875  -47.685 1.00 31.53  ? 202 ASP A CB    1 
ATOM   1665 C  CG    . ASP A 1 202 ? -6.879  35.063  -48.024 1.00 33.13  ? 202 ASP A CG    1 
ATOM   1666 O  OD1   . ASP A 1 202 ? -6.376  36.202  -47.910 1.00 33.08  ? 202 ASP A OD1   1 
ATOM   1667 O  OD2   . ASP A 1 202 ? -6.239  34.061  -48.415 1.00 36.49  ? 202 ASP A OD2   1 
ATOM   1668 N  N     . VAL A 1 203 ? -8.977  38.488  -47.775 1.00 28.05  ? 203 VAL A N     1 
ATOM   1669 C  CA    . VAL A 1 203 ? -9.230  39.646  -48.628 1.00 27.89  ? 203 VAL A CA    1 
ATOM   1670 C  C     . VAL A 1 203 ? -8.390  39.612  -49.886 1.00 29.21  ? 203 VAL A C     1 
ATOM   1671 O  O     . VAL A 1 203 ? -8.900  39.829  -50.980 1.00 30.41  ? 203 VAL A O     1 
ATOM   1672 C  CB    . VAL A 1 203 ? -8.935  40.968  -47.897 1.00 27.04  ? 203 VAL A CB    1 
ATOM   1673 C  CG1   . VAL A 1 203 ? -9.545  42.128  -48.649 1.00 26.70  ? 203 VAL A CG1   1 
ATOM   1674 C  CG2   . VAL A 1 203 ? -9.463  40.925  -46.448 1.00 26.95  ? 203 VAL A CG2   1 
ATOM   1675 N  N     . ALA A 1 204 ? -7.102  39.328  -49.732 1.00 29.51  ? 204 ALA A N     1 
ATOM   1676 C  CA    . ALA A 1 204 ? -6.183  39.377  -50.851 1.00 30.44  ? 204 ALA A CA    1 
ATOM   1677 C  C     . ALA A 1 204 ? -6.562  38.358  -51.900 1.00 31.54  ? 204 ALA A C     1 
ATOM   1678 O  O     . ALA A 1 204 ? -6.389  38.601  -53.082 1.00 32.83  ? 204 ALA A O     1 
ATOM   1679 C  CB    . ALA A 1 204 ? -4.761  39.162  -50.385 1.00 31.28  ? 204 ALA A CB    1 
ATOM   1680 N  N     . LYS A 1 205 ? -7.095  37.223  -51.472 1.00 31.34  ? 205 LYS A N     1 
ATOM   1681 C  CA    . LYS A 1 205 ? -7.462  36.181  -52.421 1.00 32.89  ? 205 LYS A CA    1 
ATOM   1682 C  C     . LYS A 1 205 ? -8.922  36.233  -52.847 1.00 32.14  ? 205 LYS A C     1 
ATOM   1683 O  O     . LYS A 1 205 ? -9.317  35.497  -53.738 1.00 33.68  ? 205 LYS A O     1 
ATOM   1684 C  CB    . LYS A 1 205 ? -7.103  34.800  -51.891 1.00 33.91  ? 205 LYS A CB    1 
ATOM   1685 C  CG    . LYS A 1 205 ? -5.644  34.471  -52.009 1.00 36.96  ? 205 LYS A CG    1 
ATOM   1686 C  CD    . LYS A 1 205 ? -5.400  33.056  -51.557 1.00 42.12  ? 205 LYS A CD    1 
ATOM   1687 C  CE    . LYS A 1 205 ? -3.917  32.799  -51.313 1.00 46.39  ? 205 LYS A CE    1 
ATOM   1688 N  NZ    . LYS A 1 205 ? -3.753  31.795  -50.204 1.00 49.03  ? 205 LYS A NZ    1 
ATOM   1689 N  N     . GLY A 1 206 ? -9.708  37.111  -52.235 1.00 30.17  ? 206 GLY A N     1 
ATOM   1690 C  CA    . GLY A 1 206 ? -11.115 37.272  -52.595 1.00 30.40  ? 206 GLY A CA    1 
ATOM   1691 C  C     . GLY A 1 206 ? -11.933 36.036  -52.271 1.00 31.10  ? 206 GLY A C     1 
ATOM   1692 O  O     . GLY A 1 206 ? -12.825 35.630  -53.026 1.00 32.31  ? 206 GLY A O     1 
ATOM   1693 N  N     . GLU A 1 207 ? -11.636 35.453  -51.122 1.00 30.90  ? 207 GLU A N     1 
ATOM   1694 C  CA    . GLU A 1 207 ? -12.047 34.102  -50.801 1.00 32.23  ? 207 GLU A CA    1 
ATOM   1695 C  C     . GLU A 1 207 ? -12.602 34.000  -49.384 1.00 30.83  ? 207 GLU A C     1 
ATOM   1696 O  O     . GLU A 1 207 ? -12.107 34.648  -48.464 1.00 29.50  ? 207 GLU A O     1 
ATOM   1697 C  CB    . GLU A 1 207 ? -10.838 33.187  -50.938 1.00 33.69  ? 207 GLU A CB    1 
ATOM   1698 C  CG    . GLU A 1 207 ? -11.172 31.729  -50.927 1.00 37.59  ? 207 GLU A CG    1 
ATOM   1699 C  CD    . GLU A 1 207 ? -9.936  30.872  -50.915 1.00 42.57  ? 207 GLU A CD    1 
ATOM   1700 O  OE1   . GLU A 1 207 ? -9.359  30.673  -49.823 1.00 43.15  ? 207 GLU A OE1   1 
ATOM   1701 O  OE2   . GLU A 1 207 ? -9.540  30.395  -52.002 1.00 47.15  ? 207 GLU A OE2   1 
ATOM   1702 N  N     . VAL A 1 208 ? -13.625 33.171  -49.222 1.00 31.50  ? 208 VAL A N     1 
ATOM   1703 C  CA    . VAL A 1 208 ? -14.187 32.869  -47.916 1.00 30.95  ? 208 VAL A CA    1 
ATOM   1704 C  C     . VAL A 1 208 ? -14.081 31.365  -47.687 1.00 32.75  ? 208 VAL A C     1 
ATOM   1705 O  O     . VAL A 1 208 ? -14.461 30.579  -48.552 1.00 34.17  ? 208 VAL A O     1 
ATOM   1706 C  CB    . VAL A 1 208 ? -15.658 33.344  -47.809 1.00 30.41  ? 208 VAL A CB    1 
ATOM   1707 C  CG1   . VAL A 1 208 ? -16.214 33.086  -46.409 1.00 29.53  ? 208 VAL A CG1   1 
ATOM   1708 C  CG2   . VAL A 1 208 ? -15.748 34.819  -48.128 1.00 29.46  ? 208 VAL A CG2   1 
ATOM   1709 N  N     . ARG A 1 209 ? -13.553 30.960  -46.535 1.00 33.03  ? 209 ARG A N     1 
ATOM   1710 C  CA    . ARG A 1 209 ? -13.382 29.526  -46.262 1.00 35.44  ? 209 ARG A CA    1 
ATOM   1711 C  C     . ARG A 1 209 ? -13.522 29.161  -44.789 1.00 35.50  ? 209 ARG A C     1 
ATOM   1712 O  O     . ARG A 1 209 ? -13.637 30.037  -43.932 1.00 34.21  ? 209 ARG A O     1 
ATOM   1713 C  CB    . ARG A 1 209 ? -12.066 28.988  -46.857 1.00 36.74  ? 209 ARG A CB    1 
ATOM   1714 C  CG    . ARG A 1 209 ? -10.797 29.650  -46.354 1.00 35.75  ? 209 ARG A CG    1 
ATOM   1715 C  CD    . ARG A 1 209 ? -9.565  29.150  -47.111 1.00 37.74  ? 209 ARG A CD    1 
ATOM   1716 N  NE    . ARG A 1 209 ? -8.339  29.604  -46.461 1.00 39.14  ? 209 ARG A NE    1 
ATOM   1717 C  CZ    . ARG A 1 209 ? -7.643  30.694  -46.792 1.00 39.39  ? 209 ARG A CZ    1 
ATOM   1718 N  NH1   . ARG A 1 209 ? -8.016  31.470  -47.808 1.00 38.87  ? 209 ARG A NH1   1 
ATOM   1719 N  NH2   . ARG A 1 209 ? -6.550  31.007  -46.101 1.00 39.16  ? 209 ARG A NH2   1 
ATOM   1720 N  N     . LYS A 1 210 ? -13.542 27.859  -44.515 1.00 37.82  ? 210 LYS A N     1 
ATOM   1721 C  CA    . LYS A 1 210 ? -13.673 27.337  -43.159 1.00 38.35  ? 210 LYS A CA    1 
ATOM   1722 C  C     . LYS A 1 210 ? -12.314 27.154  -42.503 1.00 38.87  ? 210 LYS A C     1 
ATOM   1723 O  O     . LYS A 1 210 ? -11.432 26.519  -43.068 1.00 40.70  ? 210 LYS A O     1 
ATOM   1724 C  CB    . LYS A 1 210 ? -14.419 26.010  -43.194 1.00 40.40  ? 210 LYS A CB    1 
ATOM   1725 C  CG    . LYS A 1 210 ? -15.869 26.111  -42.775 1.00 41.04  ? 210 LYS A CG    1 
ATOM   1726 C  CD    . LYS A 1 210 ? -16.094 25.503  -41.382 1.00 43.10  ? 210 LYS A CD    1 
ATOM   1727 C  CE    . LYS A 1 210 ? -16.440 24.008  -41.473 1.00 45.92  ? 210 LYS A CE    1 
ATOM   1728 N  NZ    . LYS A 1 210 ? -16.977 23.498  -40.178 1.00 47.19  ? 210 LYS A NZ    1 
ATOM   1729 N  N     . GLY A 1 211 ? -12.141 27.714  -41.315 1.00 37.98  ? 211 GLY A N     1 
ATOM   1730 C  CA    . GLY A 1 211 ? -10.883 27.583  -40.586 1.00 39.04  ? 211 GLY A CA    1 
ATOM   1731 C  C     . GLY A 1 211 ? -11.115 27.088  -39.175 1.00 40.02  ? 211 GLY A C     1 
ATOM   1732 O  O     . GLY A 1 211 ? -12.149 26.488  -38.890 1.00 40.54  ? 211 GLY A O     1 
ATOM   1733 N  N     . GLU A 1 212 ? -10.151 27.335  -38.294 1.00 40.50  ? 212 GLU A N     1 
ATOM   1734 C  CA    . GLU A 1 212 ? -10.246 26.905  -36.900 1.00 41.75  ? 212 GLU A CA    1 
ATOM   1735 C  C     . GLU A 1 212 ? -10.931 27.971  -36.058 1.00 39.62  ? 212 GLU A C     1 
ATOM   1736 O  O     . GLU A 1 212 ? -11.498 27.679  -35.004 1.00 40.09  ? 212 GLU A O     1 
ATOM   1737 C  CB    . GLU A 1 212 ? -8.859  26.627  -36.328 1.00 43.36  ? 212 GLU A CB    1 
ATOM   1738 C  CG    . GLU A 1 212 ? -8.301  25.258  -36.647 1.00 48.43  ? 212 GLU A CG    1 
ATOM   1739 C  CD    . GLU A 1 212 ? -7.226  24.841  -35.647 1.00 54.16  ? 212 GLU A CD    1 
ATOM   1740 O  OE1   . GLU A 1 212 ? -7.568  24.594  -34.463 1.00 55.30  ? 212 GLU A OE1   1 
ATOM   1741 O  OE2   . GLU A 1 212 ? -6.037  24.764  -36.042 1.00 57.03  ? 212 GLU A OE2   1 
ATOM   1742 N  N     . GLU A 1 213 ? -10.865 29.208  -36.534 1.00 37.52  ? 213 GLU A N     1 
ATOM   1743 C  CA    . GLU A 1 213 ? -11.465 30.339  -35.852 1.00 35.68  ? 213 GLU A CA    1 
ATOM   1744 C  C     . GLU A 1 213 ? -11.793 31.423  -36.862 1.00 33.10  ? 213 GLU A C     1 
ATOM   1745 O  O     . GLU A 1 213 ? -11.379 31.337  -38.013 1.00 33.42  ? 213 GLU A O     1 
ATOM   1746 C  CB    . GLU A 1 213 ? -10.494 30.887  -34.801 1.00 36.31  ? 213 GLU A CB    1 
ATOM   1747 C  CG    . GLU A 1 213 ? -9.319  31.698  -35.374 1.00 37.69  ? 213 GLU A CG    1 
ATOM   1748 C  CD    . GLU A 1 213 ? -8.000  31.344  -34.722 1.00 41.71  ? 213 GLU A CD    1 
ATOM   1749 O  OE1   . GLU A 1 213 ? -7.989  31.023  -33.508 1.00 44.13  ? 213 GLU A OE1   1 
ATOM   1750 O  OE2   . GLU A 1 213 ? -6.969  31.373  -35.428 1.00 43.59  ? 213 GLU A OE2   1 
ATOM   1751 N  N     . PHE A 1 214 ? -12.526 32.442  -36.424 1.00 30.71  ? 214 PHE A N     1 
ATOM   1752 C  CA    . PHE A 1 214 ? -12.780 33.623  -37.238 1.00 28.36  ? 214 PHE A CA    1 
ATOM   1753 C  C     . PHE A 1 214 ? -11.447 34.305  -37.539 1.00 27.81  ? 214 PHE A C     1 
ATOM   1754 O  O     . PHE A 1 214 ? -10.647 34.540  -36.639 1.00 28.19  ? 214 PHE A O     1 
ATOM   1755 C  CB    . PHE A 1 214 ? -13.730 34.571  -36.515 1.00 27.07  ? 214 PHE A CB    1 
ATOM   1756 C  CG    . PHE A 1 214 ? -14.255 35.676  -37.375 1.00 25.86  ? 214 PHE A CG    1 
ATOM   1757 C  CD1   . PHE A 1 214 ? -15.298 35.449  -38.265 1.00 26.19  ? 214 PHE A CD1   1 
ATOM   1758 C  CD2   . PHE A 1 214 ? -13.719 36.951  -37.289 1.00 24.84  ? 214 PHE A CD2   1 
ATOM   1759 C  CE1   . PHE A 1 214 ? -15.783 36.475  -39.067 1.00 25.42  ? 214 PHE A CE1   1 
ATOM   1760 C  CE2   . PHE A 1 214 ? -14.203 37.976  -38.084 1.00 23.85  ? 214 PHE A CE2   1 
ATOM   1761 C  CZ    . PHE A 1 214 ? -15.233 37.737  -38.975 1.00 23.70  ? 214 PHE A CZ    1 
ATOM   1762 N  N     . PHE A 1 215 ? -11.191 34.579  -38.815 1.00 27.07  ? 215 PHE A N     1 
ATOM   1763 C  CA    . PHE A 1 215 ? -9.871  35.007  -39.251 1.00 26.29  ? 215 PHE A CA    1 
ATOM   1764 C  C     . PHE A 1 215 ? -10.008 35.828  -40.510 1.00 26.00  ? 215 PHE A C     1 
ATOM   1765 O  O     . PHE A 1 215 ? -10.469 35.332  -41.546 1.00 26.59  ? 215 PHE A O     1 
ATOM   1766 C  CB    . PHE A 1 215 ? -9.001  33.783  -39.522 1.00 27.16  ? 215 PHE A CB    1 
ATOM   1767 C  CG    . PHE A 1 215 ? -7.516  34.036  -39.465 1.00 25.73  ? 215 PHE A CG    1 
ATOM   1768 C  CD1   . PHE A 1 215 ? -6.738  33.414  -38.495 1.00 24.97  ? 215 PHE A CD1   1 
ATOM   1769 C  CD2   . PHE A 1 215 ? -6.887  34.838  -40.409 1.00 24.19  ? 215 PHE A CD2   1 
ATOM   1770 C  CE1   . PHE A 1 215 ? -5.365  33.610  -38.440 1.00 25.16  ? 215 PHE A CE1   1 
ATOM   1771 C  CE2   . PHE A 1 215 ? -5.505  35.037  -40.372 1.00 24.57  ? 215 PHE A CE2   1 
ATOM   1772 C  CZ    . PHE A 1 215 ? -4.746  34.423  -39.382 1.00 26.32  ? 215 PHE A CZ    1 
ATOM   1773 N  N     . VAL A 1 216 ? -9.615  37.093  -40.409 1.00 25.16  ? 216 VAL A N     1 
ATOM   1774 C  CA    . VAL A 1 216 ? -9.599  37.991  -41.550 1.00 24.60  ? 216 VAL A CA    1 
ATOM   1775 C  C     . VAL A 1 216 ? -8.149  38.193  -41.911 1.00 25.04  ? 216 VAL A C     1 
ATOM   1776 O  O     . VAL A 1 216 ? -7.426  38.875  -41.199 1.00 25.48  ? 216 VAL A O     1 
ATOM   1777 C  CB    . VAL A 1 216 ? -10.250 39.342  -41.200 1.00 23.57  ? 216 VAL A CB    1 
ATOM   1778 C  CG1   . VAL A 1 216 ? -10.114 40.335  -42.351 1.00 23.38  ? 216 VAL A CG1   1 
ATOM   1779 C  CG2   . VAL A 1 216 ? -11.707 39.133  -40.829 1.00 22.99  ? 216 VAL A CG2   1 
ATOM   1780 N  N     . VAL A 1 217 ? -7.726  37.573  -43.005 1.00 25.80  ? 217 VAL A N     1 
ATOM   1781 C  CA    . VAL A 1 217 ? -6.324  37.540  -43.400 1.00 26.68  ? 217 VAL A CA    1 
ATOM   1782 C  C     . VAL A 1 217 ? -5.832  38.904  -43.873 1.00 26.66  ? 217 VAL A C     1 
ATOM   1783 O  O     . VAL A 1 217 ? -6.360  39.463  -44.834 1.00 26.51  ? 217 VAL A O     1 
ATOM   1784 C  CB    . VAL A 1 217 ? -6.089  36.506  -44.514 1.00 28.02  ? 217 VAL A CB    1 
ATOM   1785 C  CG1   . VAL A 1 217 ? -4.645  36.557  -44.983 1.00 29.07  ? 217 VAL A CG1   1 
ATOM   1786 C  CG2   . VAL A 1 217 ? -6.455  35.107  -44.032 1.00 27.77  ? 217 VAL A CG2   1 
ATOM   1787 N  N     . ASP A 1 218 ? -4.820  39.434  -43.192 1.00 27.08  ? 218 ASP A N     1 
ATOM   1788 C  CA    . ASP A 1 218 ? -4.192  40.685  -43.609 1.00 27.65  ? 218 ASP A CA    1 
ATOM   1789 C  C     . ASP A 1 218 ? -3.554  40.587  -45.005 1.00 28.62  ? 218 ASP A C     1 
ATOM   1790 O  O     . ASP A 1 218 ? -2.700  39.728  -45.243 1.00 30.16  ? 218 ASP A O     1 
ATOM   1791 C  CB    . ASP A 1 218 ? -3.142  41.108  -42.588 1.00 28.37  ? 218 ASP A CB    1 
ATOM   1792 C  CG    . ASP A 1 218 ? -2.833  42.599  -42.639 1.00 29.56  ? 218 ASP A CG    1 
ATOM   1793 O  OD1   . ASP A 1 218 ? -3.097  43.267  -43.662 1.00 30.73  ? 218 ASP A OD1   1 
ATOM   1794 O  OD2   . ASP A 1 218 ? -2.304  43.112  -41.638 1.00 31.50  ? 218 ASP A OD2   1 
ATOM   1795 N  N     . PRO A 1 219 ? -3.978  41.462  -45.935 1.00 28.20  ? 219 PRO A N     1 
ATOM   1796 C  CA    . PRO A 1 219 ? -3.397  41.547  -47.289 1.00 29.45  ? 219 PRO A CA    1 
ATOM   1797 C  C     . PRO A 1 219 ? -1.873  41.708  -47.299 1.00 30.79  ? 219 PRO A C     1 
ATOM   1798 O  O     . PRO A 1 219 ? -1.212  41.178  -48.182 1.00 32.37  ? 219 PRO A O     1 
ATOM   1799 C  CB    . PRO A 1 219 ? -4.019  42.818  -47.879 1.00 28.73  ? 219 PRO A CB    1 
ATOM   1800 C  CG    . PRO A 1 219 ? -5.094  43.232  -46.982 1.00 27.23  ? 219 PRO A CG    1 
ATOM   1801 C  CD    . PRO A 1 219 ? -5.083  42.415  -45.733 1.00 26.77  ? 219 PRO A CD    1 
ATOM   1802 N  N     . VAL A 1 220 ? -1.331  42.433  -46.328 1.00 30.51  ? 220 VAL A N     1 
ATOM   1803 C  CA    . VAL A 1 220 ? 0.103   42.689  -46.269 1.00 32.20  ? 220 VAL A CA    1 
ATOM   1804 C  C     . VAL A 1 220 ? 0.917   41.611  -45.532 1.00 33.67  ? 220 VAL A C     1 
ATOM   1805 O  O     . VAL A 1 220 ? 2.147   41.604  -45.612 1.00 35.52  ? 220 VAL A O     1 
ATOM   1806 C  CB    . VAL A 1 220 ? 0.417   44.100  -45.678 1.00 31.86  ? 220 VAL A CB    1 
ATOM   1807 C  CG1   . VAL A 1 220 ? -0.580  45.126  -46.176 1.00 30.26  ? 220 VAL A CG1   1 
ATOM   1808 C  CG2   . VAL A 1 220 ? 0.451   44.075  -44.159 1.00 30.66  ? 220 VAL A CG2   1 
ATOM   1809 N  N     . ASP A 1 221 ? 0.238   40.716  -44.821 1.00 33.44  ? 221 ASP A N     1 
ATOM   1810 C  CA    . ASP A 1 221 ? 0.894   39.668  -44.042 1.00 35.45  ? 221 ASP A CA    1 
ATOM   1811 C  C     . ASP A 1 221 ? -0.126  38.588  -43.690 1.00 35.42  ? 221 ASP A C     1 
ATOM   1812 O  O     . ASP A 1 221 ? -1.025  38.809  -42.867 1.00 34.09  ? 221 ASP A O     1 
ATOM   1813 C  CB    . ASP A 1 221 ? 1.540   40.254  -42.777 1.00 35.75  ? 221 ASP A CB    1 
ATOM   1814 C  CG    . ASP A 1 221 ? 2.063   39.185  -41.812 1.00 37.49  ? 221 ASP A CG    1 
ATOM   1815 O  OD1   . ASP A 1 221 ? 2.576   38.127  -42.257 1.00 39.74  ? 221 ASP A OD1   1 
ATOM   1816 O  OD2   . ASP A 1 221 ? 1.972   39.419  -40.588 1.00 37.95  ? 221 ASP A OD2   1 
ATOM   1817 N  N     . GLU A 1 222 ? 0.030   37.422  -44.317 1.00 37.25  ? 222 GLU A N     1 
ATOM   1818 C  CA    . GLU A 1 222 ? -0.979  36.361  -44.279 1.00 37.56  ? 222 GLU A CA    1 
ATOM   1819 C  C     . GLU A 1 222 ? -1.065  35.621  -42.952 1.00 37.24  ? 222 GLU A C     1 
ATOM   1820 O  O     . GLU A 1 222 ? -2.076  34.980  -42.671 1.00 36.93  ? 222 GLU A O     1 
ATOM   1821 C  CB    . GLU A 1 222 ? -0.766  35.365  -45.417 1.00 38.78  ? 222 GLU A CB    1 
ATOM   1822 C  CG    . GLU A 1 222 ? 0.552   34.614  -45.355 1.00 42.79  ? 222 GLU A CG    1 
ATOM   1823 C  CD    . GLU A 1 222 ? 0.643   33.496  -46.386 1.00 45.61  ? 222 GLU A CD    1 
ATOM   1824 O  OE1   . GLU A 1 222 ? -0.324  33.334  -47.176 1.00 48.09  ? 222 GLU A OE1   1 
ATOM   1825 O  OE2   . GLU A 1 222 ? 1.684   32.778  -46.411 1.00 50.73  ? 222 GLU A OE2   1 
ATOM   1826 N  N     . LYS A 1 223 ? -0.018  35.700  -42.138 1.00 38.12  ? 223 LYS A N     1 
ATOM   1827 C  CA    . LYS A 1 223 ? -0.055  35.085  -40.810 1.00 38.37  ? 223 LYS A CA    1 
ATOM   1828 C  C     . LYS A 1 223 ? -0.822  35.948  -39.799 1.00 36.07  ? 223 LYS A C     1 
ATOM   1829 O  O     . LYS A 1 223 ? -0.984  35.556  -38.650 1.00 36.12  ? 223 LYS A O     1 
ATOM   1830 C  CB    . LYS A 1 223 ? 1.358   34.804  -40.295 1.00 40.59  ? 223 LYS A CB    1 
ATOM   1831 C  CG    . LYS A 1 223 ? 2.275   34.104  -41.287 1.00 44.72  ? 223 LYS A CG    1 
ATOM   1832 C  CD    . LYS A 1 223 ? 1.808   32.681  -41.622 1.00 48.95  ? 223 LYS A CD    1 
ATOM   1833 C  CE    . LYS A 1 223 ? 2.666   32.070  -42.733 1.00 52.04  ? 223 LYS A CE    1 
ATOM   1834 N  NZ    . LYS A 1 223 ? 2.199   30.714  -43.117 1.00 54.05  ? 223 LYS A NZ    1 
ATOM   1835 N  N     . ARG A 1 224 ? -1.311  37.105  -40.238 1.00 34.12  ? 224 ARG A N     1 
ATOM   1836 C  CA    . ARG A 1 224 ? -1.930  38.065  -39.339 1.00 32.40  ? 224 ARG A CA    1 
ATOM   1837 C  C     . ARG A 1 224 ? -3.442  38.046  -39.414 1.00 30.57  ? 224 ARG A C     1 
ATOM   1838 O  O     . ARG A 1 224 ? -4.026  38.136  -40.500 1.00 30.19  ? 224 ARG A O     1 
ATOM   1839 C  CB    . ARG A 1 224 ? -1.432  39.469  -39.652 1.00 32.41  ? 224 ARG A CB    1 
ATOM   1840 C  CG    . ARG A 1 224 ? -1.352  40.365  -38.452 1.00 32.92  ? 224 ARG A CG    1 
ATOM   1841 C  CD    . ARG A 1 224 ? -2.521  41.297  -38.322 1.00 32.84  ? 224 ARG A CD    1 
ATOM   1842 N  NE    . ARG A 1 224 ? -2.699  41.697  -36.925 1.00 35.02  ? 224 ARG A NE    1 
ATOM   1843 C  CZ    . ARG A 1 224 ? -3.282  42.828  -36.530 1.00 35.34  ? 224 ARG A CZ    1 
ATOM   1844 N  NH1   . ARG A 1 224 ? -3.726  43.709  -37.438 1.00 33.60  ? 224 ARG A NH1   1 
ATOM   1845 N  NH2   . ARG A 1 224 ? -3.395  43.086  -35.224 1.00 34.10  ? 224 ARG A NH2   1 
ATOM   1846 N  N     . ASN A 1 225 ? -4.075  37.932  -38.251 1.00 29.51  ? 225 ASN A N     1 
ATOM   1847 C  CA    . ASN A 1 225 ? -5.521  38.018  -38.169 1.00 27.60  ? 225 ASN A CA    1 
ATOM   1848 C  C     . ASN A 1 225 ? -5.967  39.441  -37.819 1.00 26.47  ? 225 ASN A C     1 
ATOM   1849 O  O     . ASN A 1 225 ? -5.827  39.915  -36.681 1.00 26.25  ? 225 ASN A O     1 
ATOM   1850 C  CB    . ASN A 1 225 ? -6.066  37.007  -37.165 1.00 27.61  ? 225 ASN A CB    1 
ATOM   1851 C  CG    . ASN A 1 225 ? -7.587  36.893  -37.212 1.00 27.10  ? 225 ASN A CG    1 
ATOM   1852 O  OD1   . ASN A 1 225 ? -8.262  37.527  -38.039 1.00 26.94  ? 225 ASN A OD1   1 
ATOM   1853 N  ND2   . ASN A 1 225 ? -8.134  36.076  -36.326 1.00 25.92  ? 225 ASN A ND2   1 
ATOM   1854 N  N     . VAL A 1 226 ? -6.512  40.129  -38.805 1.00 25.40  ? 226 VAL A N     1 
ATOM   1855 C  CA    . VAL A 1 226 ? -6.935  41.491  -38.584 1.00 24.70  ? 226 VAL A CA    1 
ATOM   1856 C  C     . VAL A 1 226 ? -7.976  41.515  -37.450 1.00 24.25  ? 226 VAL A C     1 
ATOM   1857 O  O     . VAL A 1 226 ? -8.114  42.519  -36.749 1.00 24.50  ? 226 VAL A O     1 
ATOM   1858 C  CB    . VAL A 1 226 ? -7.466  42.134  -39.876 1.00 24.12  ? 226 VAL A CB    1 
ATOM   1859 C  CG1   . VAL A 1 226 ? -7.767  43.586  -39.659 1.00 24.31  ? 226 VAL A CG1   1 
ATOM   1860 C  CG2   . VAL A 1 226 ? -6.442  42.013  -40.987 1.00 25.39  ? 226 VAL A CG2   1 
ATOM   1861 N  N     . ALA A 1 227 ? -8.666  40.394  -37.241 1.00 23.82  ? 227 ALA A N     1 
ATOM   1862 C  CA    . ALA A 1 227 ? -9.717  40.320  -36.235 1.00 22.82  ? 227 ALA A CA    1 
ATOM   1863 C  C     . ALA A 1 227 ? -9.261  39.542  -35.013 1.00 23.58  ? 227 ALA A C     1 
ATOM   1864 O  O     . ALA A 1 227 ? -10.088 39.008  -34.271 1.00 24.21  ? 227 ALA A O     1 
ATOM   1865 C  CB    . ALA A 1 227 ? -10.971 39.701  -36.819 1.00 22.23  ? 227 ALA A CB    1 
ATOM   1866 N  N     . ALA A 1 228 ? -7.950  39.497  -34.784 1.00 24.04  ? 228 ALA A N     1 
ATOM   1867 C  CA    . ALA A 1 228 ? -7.384  38.740  -33.657 1.00 24.41  ? 228 ALA A CA    1 
ATOM   1868 C  C     . ALA A 1 228 ? -8.109  38.980  -32.329 1.00 24.29  ? 228 ALA A C     1 
ATOM   1869 O  O     . ALA A 1 228 ? -8.401  38.043  -31.604 1.00 25.43  ? 228 ALA A O     1 
ATOM   1870 C  CB    . ALA A 1 228 ? -5.915  39.028  -33.518 1.00 24.65  ? 228 ALA A CB    1 
ATOM   1871 N  N     . ASN A 1 229 ? -8.430  40.230  -32.028 1.00 23.89  ? 229 ASN A N     1 
ATOM   1872 C  CA    . ASN A 1 229 ? -8.954  40.592  -30.707 1.00 24.11  ? 229 ASN A CA    1 
ATOM   1873 C  C     . ASN A 1 229 ? -10.455 40.898  -30.688 1.00 23.16  ? 229 ASN A C     1 
ATOM   1874 O  O     . ASN A 1 229 ? -10.968 41.439  -29.706 1.00 23.49  ? 229 ASN A O     1 
ATOM   1875 C  CB    . ASN A 1 229 ? -8.150  41.757  -30.125 1.00 24.50  ? 229 ASN A CB    1 
ATOM   1876 C  CG    . ASN A 1 229 ? -8.259  41.868  -28.619 1.00 26.42  ? 229 ASN A CG    1 
ATOM   1877 O  OD1   . ASN A 1 229 ? -8.417  40.874  -27.906 1.00 28.86  ? 229 ASN A OD1   1 
ATOM   1878 N  ND2   . ASN A 1 229 ? -8.149  43.095  -28.119 1.00 27.68  ? 229 ASN A ND2   1 
ATOM   1879 N  N     . LEU A 1 230 ? -11.159 40.547  -31.764 1.00 22.06  ? 230 LEU A N     1 
ATOM   1880 C  CA    . LEU A 1 230 ? -12.616 40.534  -31.727 1.00 21.61  ? 230 LEU A CA    1 
ATOM   1881 C  C     . LEU A 1 230 ? -13.068 39.276  -30.965 1.00 21.83  ? 230 LEU A C     1 
ATOM   1882 O  O     . LEU A 1 230 ? -12.725 38.160  -31.338 1.00 22.42  ? 230 LEU A O     1 
ATOM   1883 C  CB    . LEU A 1 230 ? -13.192 40.569  -33.145 1.00 21.08  ? 230 LEU A CB    1 
ATOM   1884 C  CG    . LEU A 1 230 ? -14.666 40.172  -33.339 1.00 21.99  ? 230 LEU A CG    1 
ATOM   1885 C  CD1   . LEU A 1 230 ? -15.600 41.244  -32.778 1.00 22.12  ? 230 LEU A CD1   1 
ATOM   1886 C  CD2   . LEU A 1 230 ? -14.990 39.903  -34.823 1.00 21.08  ? 230 LEU A CD2   1 
ATOM   1887 N  N     . SER A 1 231 ? -13.817 39.459  -29.889 1.00 21.49  ? 231 SER A N     1 
ATOM   1888 C  CA    . SER A 1 231 ? -14.238 38.334  -29.074 1.00 22.17  ? 231 SER A CA    1 
ATOM   1889 C  C     . SER A 1 231 ? -15.356 37.576  -29.752 1.00 22.04  ? 231 SER A C     1 
ATOM   1890 O  O     . SER A 1 231 ? -16.128 38.145  -30.532 1.00 21.79  ? 231 SER A O     1 
ATOM   1891 C  CB    . SER A 1 231 ? -14.706 38.814  -27.708 1.00 22.89  ? 231 SER A CB    1 
ATOM   1892 O  OG    . SER A 1 231 ? -15.906 39.557  -27.825 1.00 24.11  ? 231 SER A OG    1 
ATOM   1893 N  N     . LEU A 1 232 ? -15.440 36.285  -29.450 1.00 22.91  ? 232 LEU A N     1 
ATOM   1894 C  CA    . LEU A 1 232 ? -16.489 35.425  -29.964 1.00 23.03  ? 232 LEU A CA    1 
ATOM   1895 C  C     . LEU A 1 232 ? -17.843 36.091  -29.741 1.00 23.84  ? 232 LEU A C     1 
ATOM   1896 O  O     . LEU A 1 232 ? -18.663 36.173  -30.661 1.00 23.45  ? 232 LEU A O     1 
ATOM   1897 C  CB    . LEU A 1 232 ? -16.426 34.051  -29.299 1.00 24.00  ? 232 LEU A CB    1 
ATOM   1898 C  CG    . LEU A 1 232 ? -17.496 33.007  -29.598 1.00 24.15  ? 232 LEU A CG    1 
ATOM   1899 C  CD1   . LEU A 1 232 ? -17.555 32.694  -31.082 1.00 23.36  ? 232 LEU A CD1   1 
ATOM   1900 C  CD2   . LEU A 1 232 ? -17.240 31.743  -28.801 1.00 26.13  ? 232 LEU A CD2   1 
ATOM   1901 N  N     . ASP A 1 233 ? -18.055 36.618  -28.536 1.00 25.13  ? 233 ASP A N     1 
ATOM   1902 C  CA    . ASP A 1 233 ? -19.325 37.261  -28.219 1.00 25.99  ? 233 ASP A CA    1 
ATOM   1903 C  C     . ASP A 1 233 ? -19.631 38.508  -29.041 1.00 25.00  ? 233 ASP A C     1 
ATOM   1904 O  O     . ASP A 1 233 ? -20.774 38.729  -29.441 1.00 24.95  ? 233 ASP A O     1 
ATOM   1905 C  CB    . ASP A 1 233 ? -19.442 37.500  -26.727 1.00 26.98  ? 233 ASP A CB    1 
ATOM   1906 C  CG    . ASP A 1 233 ? -19.647 36.208  -25.973 1.00 30.76  ? 233 ASP A CG    1 
ATOM   1907 O  OD1   . ASP A 1 233 ? -19.939 35.189  -26.649 1.00 32.59  ? 233 ASP A OD1   1 
ATOM   1908 O  OD2   . ASP A 1 233 ? -19.510 36.193  -24.724 1.00 34.36  ? 233 ASP A OD2   1 
ATOM   1909 N  N     . ASN A 1 234 ? -18.611 39.305  -29.327 1.00 24.43  ? 234 ASN A N     1 
ATOM   1910 C  CA    . ASN A 1 234 ? -18.847 40.492  -30.120 1.00 23.80  ? 234 ASN A CA    1 
ATOM   1911 C  C     . ASN A 1 234 ? -19.115 40.154  -31.576 1.00 23.37  ? 234 ASN A C     1 
ATOM   1912 O  O     . ASN A 1 234 ? -19.891 40.849  -32.245 1.00 23.23  ? 234 ASN A O     1 
ATOM   1913 C  CB    . ASN A 1 234 ? -17.710 41.490  -29.958 1.00 23.35  ? 234 ASN A CB    1 
ATOM   1914 C  CG    . ASN A 1 234 ? -17.845 42.325  -28.691 1.00 25.14  ? 234 ASN A CG    1 
ATOM   1915 O  OD1   . ASN A 1 234 ? -16.903 43.016  -28.301 1.00 27.31  ? 234 ASN A OD1   1 
ATOM   1916 N  ND2   . ASN A 1 234 ? -19.017 42.280  -28.050 1.00 24.04  ? 234 ASN A ND2   1 
ATOM   1917 N  N     . LEU A 1 235 ? -18.488 39.078  -32.060 1.00 23.52  ? 235 LEU A N     1 
ATOM   1918 C  CA    . LEU A 1 235 ? -18.780 38.566  -33.395 1.00 23.17  ? 235 LEU A CA    1 
ATOM   1919 C  C     . LEU A 1 235 ? -20.250 38.177  -33.455 1.00 23.95  ? 235 LEU A C     1 
ATOM   1920 O  O     . LEU A 1 235 ? -20.963 38.532  -34.394 1.00 23.86  ? 235 LEU A O     1 
ATOM   1921 C  CB    . LEU A 1 235 ? -17.921 37.344  -33.717 1.00 23.69  ? 235 LEU A CB    1 
ATOM   1922 C  CG    . LEU A 1 235 ? -18.296 36.559  -34.989 1.00 23.45  ? 235 LEU A CG    1 
ATOM   1923 C  CD1   . LEU A 1 235 ? -17.881 37.311  -36.234 1.00 22.99  ? 235 LEU A CD1   1 
ATOM   1924 C  CD2   . LEU A 1 235 ? -17.645 35.211  -34.979 1.00 24.40  ? 235 LEU A CD2   1 
ATOM   1925 N  N     . ALA A 1 236 ? -20.689 37.467  -32.421 1.00 24.81  ? 236 ALA A N     1 
ATOM   1926 C  CA    . ALA A 1 236 ? -22.056 37.008  -32.309 1.00 25.91  ? 236 ALA A CA    1 
ATOM   1927 C  C     . ALA A 1 236 ? -23.041 38.172  -32.341 1.00 25.99  ? 236 ALA A C     1 
ATOM   1928 O  O     . ALA A 1 236 ? -24.061 38.106  -33.018 1.00 26.66  ? 236 ALA A O     1 
ATOM   1929 C  CB    . ALA A 1 236 ? -22.224 36.195  -31.034 1.00 27.08  ? 236 ALA A CB    1 
ATOM   1930 N  N     . ARG A 1 237 ? -22.729 39.241  -31.621 1.00 25.78  ? 237 ARG A N     1 
ATOM   1931 C  CA    . ARG A 1 237 ? -23.621 40.377  -31.556 1.00 26.47  ? 237 ARG A CA    1 
ATOM   1932 C  C     . ARG A 1 237 ? -23.716 41.034  -32.925 1.00 26.13  ? 237 ARG A C     1 
ATOM   1933 O  O     . ARG A 1 237 ? -24.824 41.365  -33.407 1.00 26.62  ? 237 ARG A O     1 
ATOM   1934 C  CB    . ARG A 1 237 ? -23.181 41.353  -30.463 1.00 26.41  ? 237 ARG A CB    1 
ATOM   1935 C  CG    . ARG A 1 237 ? -23.280 40.724  -29.082 1.00 29.59  ? 237 ARG A CG    1 
ATOM   1936 C  CD    . ARG A 1 237 ? -23.149 41.725  -27.937 1.00 34.63  ? 237 ARG A CD    1 
ATOM   1937 N  NE    . ARG A 1 237 ? -23.095 41.036  -26.637 1.00 38.58  ? 237 ARG A NE    1 
ATOM   1938 C  CZ    . ARG A 1 237 ? -21.982 40.542  -26.087 1.00 39.41  ? 237 ARG A CZ    1 
ATOM   1939 N  NH1   . ARG A 1 237 ? -20.823 40.671  -26.721 1.00 40.04  ? 237 ARG A NH1   1 
ATOM   1940 N  NH2   . ARG A 1 237 ? -22.019 39.915  -24.910 1.00 39.35  ? 237 ARG A NH2   1 
ATOM   1941 N  N     . PHE A 1 238 ? -22.564 41.183  -33.575 1.00 25.24  ? 238 PHE A N     1 
ATOM   1942 C  CA    . PHE A 1 238 ? -22.556 41.760  -34.895 1.00 25.07  ? 238 PHE A CA    1 
ATOM   1943 C  C     . PHE A 1 238 ? -23.412 40.936  -35.856 1.00 25.96  ? 238 PHE A C     1 
ATOM   1944 O  O     . PHE A 1 238 ? -24.297 41.493  -36.521 1.00 27.23  ? 238 PHE A O     1 
ATOM   1945 C  CB    . PHE A 1 238 ? -21.142 41.920  -35.440 1.00 24.55  ? 238 PHE A CB    1 
ATOM   1946 C  CG    . PHE A 1 238 ? -21.106 42.511  -36.822 1.00 24.77  ? 238 PHE A CG    1 
ATOM   1947 C  CD1   . PHE A 1 238 ? -21.537 43.824  -37.043 1.00 25.29  ? 238 PHE A CD1   1 
ATOM   1948 C  CD2   . PHE A 1 238 ? -20.675 41.760  -37.902 1.00 24.22  ? 238 PHE A CD2   1 
ATOM   1949 C  CE1   . PHE A 1 238 ? -21.528 44.379  -38.326 1.00 25.59  ? 238 PHE A CE1   1 
ATOM   1950 C  CE2   . PHE A 1 238 ? -20.654 42.313  -39.196 1.00 24.84  ? 238 PHE A CE2   1 
ATOM   1951 C  CZ    . PHE A 1 238 ? -21.083 43.618  -39.408 1.00 24.58  ? 238 PHE A CZ    1 
ATOM   1952 N  N     . VAL A 1 239 ? -23.167 39.620  -35.924 1.00 25.60  ? 239 VAL A N     1 
ATOM   1953 C  CA    . VAL A 1 239 ? -23.943 38.743  -36.803 1.00 25.59  ? 239 VAL A CA    1 
ATOM   1954 C  C     . VAL A 1 239 ? -25.422 38.924  -36.493 1.00 26.54  ? 239 VAL A C     1 
ATOM   1955 O  O     . VAL A 1 239 ? -26.229 39.123  -37.391 1.00 27.64  ? 239 VAL A O     1 
ATOM   1956 C  CB    . VAL A 1 239 ? -23.540 37.262  -36.676 1.00 26.15  ? 239 VAL A CB    1 
ATOM   1957 C  CG1   . VAL A 1 239 ? -24.623 36.340  -37.269 1.00 27.58  ? 239 VAL A CG1   1 
ATOM   1958 C  CG2   . VAL A 1 239 ? -22.193 37.000  -37.345 1.00 25.02  ? 239 VAL A CG2   1 
ATOM   1959 N  N     . HIS A 1 240 ? -25.774 38.898  -35.219 1.00 26.43  ? 240 HIS A N     1 
ATOM   1960 C  CA    . HIS A 1 240 ? -27.159 39.106  -34.835 1.00 27.44  ? 240 HIS A CA    1 
ATOM   1961 C  C     . HIS A 1 240 ? -27.720 40.469  -35.250 1.00 28.13  ? 240 HIS A C     1 
ATOM   1962 O  O     . HIS A 1 240 ? -28.844 40.532  -35.749 1.00 29.13  ? 240 HIS A O     1 
ATOM   1963 C  CB    . HIS A 1 240 ? -27.348 38.891  -33.342 1.00 27.35  ? 240 HIS A CB    1 
ATOM   1964 C  CG    . HIS A 1 240 ? -28.778 38.803  -32.935 1.00 27.45  ? 240 HIS A CG    1 
ATOM   1965 N  ND1   . HIS A 1 240 ? -29.402 39.784  -32.195 1.00 26.95  ? 240 HIS A ND1   1 
ATOM   1966 C  CD2   . HIS A 1 240 ? -29.714 37.855  -33.175 1.00 28.13  ? 240 HIS A CD2   1 
ATOM   1967 C  CE1   . HIS A 1 240 ? -30.659 39.442  -31.986 1.00 28.38  ? 240 HIS A CE1   1 
ATOM   1968 N  NE2   . HIS A 1 240 ? -30.873 38.275  -32.570 1.00 29.95  ? 240 HIS A NE2   1 
ATOM   1969 N  N     . LEU A 1 241 ? -26.955 41.550  -35.053 1.00 27.71  ? 241 LEU A N     1 
ATOM   1970 C  CA    . LEU A 1 241 ? -27.436 42.876  -35.464 1.00 28.84  ? 241 LEU A CA    1 
ATOM   1971 C  C     . LEU A 1 241 ? -27.732 42.935  -36.960 1.00 29.22  ? 241 LEU A C     1 
ATOM   1972 O  O     . LEU A 1 241 ? -28.737 43.512  -37.366 1.00 30.12  ? 241 LEU A O     1 
ATOM   1973 C  CB    . LEU A 1 241 ? -26.480 44.003  -35.057 1.00 28.11  ? 241 LEU A CB    1 
ATOM   1974 C  CG    . LEU A 1 241 ? -26.443 44.365  -33.565 1.00 30.12  ? 241 LEU A CG    1 
ATOM   1975 C  CD1   . LEU A 1 241 ? -25.162 45.112  -33.235 1.00 29.33  ? 241 LEU A CD1   1 
ATOM   1976 C  CD2   . LEU A 1 241 ? -27.690 45.152  -33.098 1.00 32.54  ? 241 LEU A CD2   1 
ATOM   1977 N  N     . CYS A 1 242 ? -26.868 42.324  -37.768 1.00 28.77  ? 242 CYS A N     1 
ATOM   1978 C  CA    . CYS A 1 242 ? -27.082 42.288  -39.211 1.00 30.27  ? 242 CYS A CA    1 
ATOM   1979 C  C     . CYS A 1 242 ? -28.400 41.587  -39.557 1.00 31.93  ? 242 CYS A C     1 
ATOM   1980 O  O     . CYS A 1 242 ? -29.188 42.083  -40.369 1.00 33.12  ? 242 CYS A O     1 
ATOM   1981 C  CB    . CYS A 1 242 ? -25.898 41.641  -39.921 1.00 29.31  ? 242 CYS A CB    1 
ATOM   1982 S  SG    . CYS A 1 242 ? -24.352 42.608  -39.772 1.00 30.94  ? 242 CYS A SG    1 
ATOM   1983 N  N     . ARG A 1 243 ? -28.643 40.450  -38.915 1.00 32.19  ? 243 ARG A N     1 
ATOM   1984 C  CA    . ARG A 1 243 ? -29.882 39.743  -39.090 1.00 34.12  ? 243 ARG A CA    1 
ATOM   1985 C  C     . ARG A 1 243 ? -31.042 40.682  -38.779 1.00 36.29  ? 243 ARG A C     1 
ATOM   1986 O  O     . ARG A 1 243 ? -31.968 40.827  -39.586 1.00 38.14  ? 243 ARG A O     1 
ATOM   1987 C  CB    . ARG A 1 243 ? -29.914 38.484  -38.215 1.00 34.12  ? 243 ARG A CB    1 
ATOM   1988 C  CG    . ARG A 1 243 ? -29.129 37.332  -38.825 1.00 32.52  ? 243 ARG A CG    1 
ATOM   1989 C  CD    . ARG A 1 243 ? -28.923 36.154  -37.899 1.00 29.86  ? 243 ARG A CD    1 
ATOM   1990 N  NE    . ARG A 1 243 ? -27.988 35.208  -38.499 1.00 27.77  ? 243 ARG A NE    1 
ATOM   1991 C  CZ    . ARG A 1 243 ? -27.426 34.181  -37.868 1.00 27.19  ? 243 ARG A CZ    1 
ATOM   1992 N  NH1   . ARG A 1 243 ? -27.708 33.937  -36.601 1.00 27.62  ? 243 ARG A NH1   1 
ATOM   1993 N  NH2   . ARG A 1 243 ? -26.580 33.386  -38.508 1.00 26.20  ? 243 ARG A NH2   1 
ATOM   1994 N  N     . GLU A 1 244 ? -30.976 41.344  -37.627 1.00 36.45  ? 244 GLU A N     1 
ATOM   1995 C  CA    . GLU A 1 244 ? -32.053 42.220  -37.199 1.00 38.43  ? 244 GLU A CA    1 
ATOM   1996 C  C     . GLU A 1 244 ? -32.217 43.409  -38.126 1.00 39.12  ? 244 GLU A C     1 
ATOM   1997 O  O     . GLU A 1 244 ? -33.349 43.826  -38.414 1.00 41.15  ? 244 GLU A O     1 
ATOM   1998 C  CB    . GLU A 1 244 ? -31.809 42.712  -35.790 1.00 38.01  ? 244 GLU A CB    1 
ATOM   1999 C  CG    . GLU A 1 244 ? -32.075 41.673  -34.740 1.00 40.48  ? 244 GLU A CG    1 
ATOM   2000 C  CD    . GLU A 1 244 ? -31.995 42.262  -33.350 1.00 43.68  ? 244 GLU A CD    1 
ATOM   2001 O  OE1   . GLU A 1 244 ? -30.904 42.768  -32.976 1.00 42.68  ? 244 GLU A OE1   1 
ATOM   2002 O  OE2   . GLU A 1 244 ? -33.030 42.228  -32.642 1.00 46.52  ? 244 GLU A OE2   1 
ATOM   2003 N  N     . PHE A 1 245 ? -31.095 43.945  -38.600 1.00 37.71  ? 245 PHE A N     1 
ATOM   2004 C  CA    . PHE A 1 245 ? -31.140 45.114  -39.459 1.00 38.50  ? 245 PHE A CA    1 
ATOM   2005 C  C     . PHE A 1 245 ? -31.852 44.822  -40.769 1.00 40.41  ? 245 PHE A C     1 
ATOM   2006 O  O     . PHE A 1 245 ? -32.578 45.669  -41.275 1.00 42.33  ? 245 PHE A O     1 
ATOM   2007 C  CB    . PHE A 1 245 ? -29.747 45.692  -39.729 1.00 36.53  ? 245 PHE A CB    1 
ATOM   2008 C  CG    . PHE A 1 245 ? -29.771 46.965  -40.540 1.00 37.02  ? 245 PHE A CG    1 
ATOM   2009 C  CD1   . PHE A 1 245 ? -30.005 48.194  -39.928 1.00 37.66  ? 245 PHE A CD1   1 
ATOM   2010 C  CD2   . PHE A 1 245 ? -29.576 46.936  -41.917 1.00 36.83  ? 245 PHE A CD2   1 
ATOM   2011 C  CE1   . PHE A 1 245 ? -30.035 49.372  -40.674 1.00 37.79  ? 245 PHE A CE1   1 
ATOM   2012 C  CE2   . PHE A 1 245 ? -29.602 48.110  -42.666 1.00 36.85  ? 245 PHE A CE2   1 
ATOM   2013 C  CZ    . PHE A 1 245 ? -29.832 49.325  -42.045 1.00 37.46  ? 245 PHE A CZ    1 
ATOM   2014 N  N     . MET A 1 246 ? -31.653 43.626  -41.316 1.00 40.66  ? 246 MET A N     1 
ATOM   2015 C  CA    . MET A 1 246 ? -32.257 43.283  -42.606 1.00 42.15  ? 246 MET A CA    1 
ATOM   2016 C  C     . MET A 1 246 ? -33.710 42.860  -42.499 1.00 44.09  ? 246 MET A C     1 
ATOM   2017 O  O     . MET A 1 246 ? -34.433 42.950  -43.477 1.00 45.89  ? 246 MET A O     1 
ATOM   2018 C  CB    . MET A 1 246 ? -31.417 42.246  -43.357 1.00 41.51  ? 246 MET A CB    1 
ATOM   2019 C  CG    . MET A 1 246 ? -29.992 42.726  -43.637 1.00 40.82  ? 246 MET A CG    1 
ATOM   2020 S  SD    . MET A 1 246 ? -29.706 43.858  -45.038 1.00 45.73  ? 246 MET A SD    1 
ATOM   2021 C  CE    . MET A 1 246 ? -31.323 44.169  -45.784 1.00 45.18  ? 246 MET A CE    1 
ATOM   2022 N  N     . GLU A 1 247 ? -34.121 42.385  -41.323 1.00 44.24  ? 247 GLU A N     1 
ATOM   2023 C  CA    . GLU A 1 247 ? -35.528 42.062  -41.052 1.00 46.90  ? 247 GLU A CA    1 
ATOM   2024 C  C     . GLU A 1 247 ? -36.327 43.344  -40.944 1.00 47.44  ? 247 GLU A C     1 
ATOM   2025 O  O     . GLU A 1 247 ? -37.440 43.426  -41.443 1.00 50.06  ? 247 GLU A O     1 
ATOM   2026 C  CB    . GLU A 1 247 ? -35.703 41.315  -39.726 1.00 46.81  ? 247 GLU A CB    1 
ATOM   2027 C  CG    . GLU A 1 247 ? -35.524 39.804  -39.739 1.00 47.90  ? 247 GLU A CG    1 
ATOM   2028 C  CD    . GLU A 1 247 ? -35.438 39.230  -38.309 1.00 48.16  ? 247 GLU A CD    1 
ATOM   2029 O  OE1   . GLU A 1 247 ? -34.299 39.058  -37.780 1.00 46.97  ? 247 GLU A OE1   1 
ATOM   2030 O  OE2   . GLU A 1 247 ? -36.513 38.975  -37.705 1.00 52.17  ? 247 GLU A OE2   1 
ATOM   2031 N  N     . ALA A 1 248 ? -35.752 44.333  -40.266 1.00 45.47  ? 248 ALA A N     1 
ATOM   2032 C  CA    . ALA A 1 248 ? -36.431 45.588  -39.977 1.00 45.94  ? 248 ALA A CA    1 
ATOM   2033 C  C     . ALA A 1 248 ? -35.424 46.738  -39.952 1.00 43.75  ? 248 ALA A C     1 
ATOM   2034 O  O     . ALA A 1 248 ? -34.906 47.085  -38.896 1.00 42.56  ? 248 ALA A O     1 
ATOM   2035 C  CB    . ALA A 1 248 ? -37.178 45.489  -38.649 1.00 46.87  ? 248 ALA A CB    1 
ATOM   2036 N  N     . PRO A 1 249 ? -35.126 47.316  -41.127 1.00 43.37  ? 249 PRO A N     1 
ATOM   2037 C  CA    . PRO A 1 249 ? -34.145 48.395  -41.222 1.00 41.84  ? 249 PRO A CA    1 
ATOM   2038 C  C     . PRO A 1 249 ? -34.630 49.674  -40.550 1.00 42.91  ? 249 PRO A C     1 
ATOM   2039 O  O     . PRO A 1 249 ? -35.777 50.083  -40.745 1.00 45.35  ? 249 PRO A O     1 
ATOM   2040 C  CB    . PRO A 1 249 ? -33.986 48.600  -42.735 1.00 42.31  ? 249 PRO A CB    1 
ATOM   2041 C  CG    . PRO A 1 249 ? -34.572 47.374  -43.365 1.00 43.23  ? 249 PRO A CG    1 
ATOM   2042 C  CD    . PRO A 1 249 ? -35.675 46.970  -42.448 1.00 44.86  ? 249 PRO A CD    1 
ATOM   2043 N  N     . SER A 1 250 ? -33.750 50.290  -39.762 1.00 41.11  ? 250 SER A N     1 
ATOM   2044 C  CA    . SER A 1 250 ? -34.099 51.442  -38.952 1.00 41.71  ? 250 SER A CA    1 
ATOM   2045 C  C     . SER A 1 250 ? -32.880 52.289  -38.642 1.00 40.19  ? 250 SER A C     1 
ATOM   2046 O  O     . SER A 1 250 ? -31.790 51.760  -38.447 1.00 38.02  ? 250 SER A O     1 
ATOM   2047 C  CB    . SER A 1 250 ? -34.718 50.978  -37.646 1.00 42.00  ? 250 SER A CB    1 
ATOM   2048 O  OG    . SER A 1 250 ? -34.868 52.069  -36.769 1.00 43.20  ? 250 SER A OG    1 
ATOM   2049 N  N     . LEU A 1 251 ? -33.086 53.605  -38.579 1.00 41.72  ? 251 LEU A N     1 
ATOM   2050 C  CA    . LEU A 1 251 ? -32.061 54.579  -38.179 1.00 40.72  ? 251 LEU A CA    1 
ATOM   2051 C  C     . LEU A 1 251 ? -31.637 54.391  -36.716 1.00 39.89  ? 251 LEU A C     1 
ATOM   2052 O  O     . LEU A 1 251 ? -30.598 54.897  -36.288 1.00 39.06  ? 251 LEU A O     1 
ATOM   2053 C  CB    . LEU A 1 251 ? -32.572 56.007  -38.408 1.00 42.83  ? 251 LEU A CB    1 
ATOM   2054 C  CG    . LEU A 1 251 ? -31.568 57.137  -38.640 1.00 42.68  ? 251 LEU A CG    1 
ATOM   2055 C  CD1   . LEU A 1 251 ? -30.730 56.888  -39.892 1.00 41.50  ? 251 LEU A CD1   1 
ATOM   2056 C  CD2   . LEU A 1 251 ? -32.279 58.475  -38.744 1.00 45.55  ? 251 LEU A CD2   1 
ATOM   2057 N  N     . GLY A 1 252 ? -32.440 53.651  -35.957 1.00 40.33  ? 252 GLY A N     1 
ATOM   2058 C  CA    . GLY A 1 252 ? -32.098 53.296  -34.591 1.00 39.82  ? 252 GLY A CA    1 
ATOM   2059 C  C     . GLY A 1 252 ? -30.751 52.606  -34.494 1.00 37.69  ? 252 GLY A C     1 
ATOM   2060 O  O     . GLY A 1 252 ? -30.013 52.814  -33.532 1.00 37.69  ? 252 GLY A O     1 
ATOM   2061 N  N     . PHE A 1 253 ? -30.411 51.801  -35.494 1.00 36.46  ? 253 PHE A N     1 
ATOM   2062 C  CA    . PHE A 1 253 ? -29.162 51.050  -35.467 1.00 34.45  ? 253 PHE A CA    1 
ATOM   2063 C  C     . PHE A 1 253 ? -27.915 51.931  -35.567 1.00 33.81  ? 253 PHE A C     1 
ATOM   2064 O  O     . PHE A 1 253 ? -26.807 51.450  -35.352 1.00 32.69  ? 253 PHE A O     1 
ATOM   2065 C  CB    . PHE A 1 253 ? -29.147 49.996  -36.576 1.00 33.86  ? 253 PHE A CB    1 
ATOM   2066 C  CG    . PHE A 1 253 ? -30.109 48.852  -36.357 1.00 34.60  ? 253 PHE A CG    1 
ATOM   2067 C  CD1   . PHE A 1 253 ? -31.390 48.885  -36.898 1.00 36.77  ? 253 PHE A CD1   1 
ATOM   2068 C  CD2   . PHE A 1 253 ? -29.726 47.731  -35.627 1.00 33.76  ? 253 PHE A CD2   1 
ATOM   2069 C  CE1   . PHE A 1 253 ? -32.282 47.821  -36.707 1.00 37.70  ? 253 PHE A CE1   1 
ATOM   2070 C  CE2   . PHE A 1 253 ? -30.607 46.667  -35.428 1.00 35.00  ? 253 PHE A CE2   1 
ATOM   2071 C  CZ    . PHE A 1 253 ? -31.891 46.711  -35.971 1.00 36.42  ? 253 PHE A CZ    1 
ATOM   2072 N  N     . PHE A 1 254 ? -28.090 53.210  -35.892 1.00 35.13  ? 254 PHE A N     1 
ATOM   2073 C  CA    . PHE A 1 254 ? -26.965 54.147  -36.008 1.00 34.72  ? 254 PHE A CA    1 
ATOM   2074 C  C     . PHE A 1 254 ? -26.973 55.191  -34.900 1.00 35.86  ? 254 PHE A C     1 
ATOM   2075 O  O     . PHE A 1 254 ? -26.122 56.078  -34.866 1.00 36.34  ? 254 PHE A O     1 
ATOM   2076 C  CB    . PHE A 1 254 ? -26.968 54.850  -37.371 1.00 35.43  ? 254 PHE A CB    1 
ATOM   2077 C  CG    . PHE A 1 254 ? -26.781 53.920  -38.528 1.00 34.88  ? 254 PHE A CG    1 
ATOM   2078 C  CD1   . PHE A 1 254 ? -27.876 53.296  -39.118 1.00 35.15  ? 254 PHE A CD1   1 
ATOM   2079 C  CD2   . PHE A 1 254 ? -25.509 53.656  -39.025 1.00 33.69  ? 254 PHE A CD2   1 
ATOM   2080 C  CE1   . PHE A 1 254 ? -27.706 52.418  -40.178 1.00 34.26  ? 254 PHE A CE1   1 
ATOM   2081 C  CE2   . PHE A 1 254 ? -25.331 52.779  -40.087 1.00 32.65  ? 254 PHE A CE2   1 
ATOM   2082 C  CZ    . PHE A 1 254 ? -26.434 52.158  -40.664 1.00 32.72  ? 254 PHE A CZ    1 
ATOM   2083 N  N     . LYS A 1 255 ? -27.938 55.102  -33.996 1.00 36.79  ? 255 LYS A N     1 
ATOM   2084 C  CA    . LYS A 1 255 ? -27.976 56.026  -32.870 1.00 37.95  ? 255 LYS A CA    1 
ATOM   2085 C  C     . LYS A 1 255 ? -27.549 55.292  -31.607 1.00 36.66  ? 255 LYS A C     1 
ATOM   2086 O  O     . LYS A 1 255 ? -28.028 54.188  -31.358 1.00 36.07  ? 255 LYS A O     1 
ATOM   2087 C  CB    . LYS A 1 255 ? -29.364 56.661  -32.713 1.00 40.57  ? 255 LYS A CB    1 
ATOM   2088 C  CG    . LYS A 1 255 ? -29.870 57.330  -33.984 1.00 42.77  ? 255 LYS A CG    1 
ATOM   2089 C  CD    . LYS A 1 255 ? -30.617 58.623  -33.726 1.00 47.81  ? 255 LYS A CD    1 
ATOM   2090 C  CE    . LYS A 1 255 ? -31.119 59.215  -35.053 1.00 51.27  ? 255 LYS A CE    1 
ATOM   2091 N  NZ    . LYS A 1 255 ? -31.294 60.716  -35.055 1.00 54.39  ? 255 LYS A NZ    1 
ATOM   2092 N  N     . PRO A 1 256 ? -26.615 55.883  -30.833 1.00 36.35  ? 256 PRO A N     1 
ATOM   2093 C  CA    . PRO A 1 256 ? -26.138 55.358  -29.550 1.00 35.96  ? 256 PRO A CA    1 
ATOM   2094 C  C     . PRO A 1 256 ? -27.240 55.299  -28.472 1.00 37.64  ? 256 PRO A C     1 
ATOM   2095 O  O     . PRO A 1 256 ? -28.162 56.118  -28.490 1.00 39.08  ? 256 PRO A O     1 
ATOM   2096 C  CB    . PRO A 1 256 ? -25.062 56.368  -29.138 1.00 35.86  ? 256 PRO A CB    1 
ATOM   2097 C  CG    . PRO A 1 256 ? -24.678 57.035  -30.380 1.00 35.82  ? 256 PRO A CG    1 
ATOM   2098 C  CD    . PRO A 1 256 ? -25.924 57.132  -31.177 1.00 36.95  ? 256 PRO A CD    1 
ATOM   2099 N  N     . LYS A 1 257 ? -27.139 54.317  -27.572 1.00 37.13  ? 257 LYS A N     1 
ATOM   2100 C  CA    . LYS A 1 257 ? -28.055 54.178  -26.447 1.00 39.18  ? 257 LYS A CA    1 
ATOM   2101 C  C     . LYS A 1 257 ? -27.329 54.452  -25.146 1.00 39.83  ? 257 LYS A C     1 
ATOM   2102 O  O     . LYS A 1 257 ? -26.209 53.992  -24.944 1.00 38.88  ? 257 LYS A O     1 
ATOM   2103 C  CB    . LYS A 1 257 ? -28.690 52.788  -26.413 1.00 38.74  ? 257 LYS A CB    1 
ATOM   2104 C  CG    . LYS A 1 257 ? -29.855 52.639  -27.362 1.00 40.64  ? 257 LYS A CG    1 
ATOM   2105 C  CD    . LYS A 1 257 ? -30.803 51.526  -26.955 1.00 42.69  ? 257 LYS A CD    1 
ATOM   2106 C  CE    . LYS A 1 257 ? -32.177 51.739  -27.604 1.00 45.00  ? 257 LYS A CE    1 
ATOM   2107 N  NZ    . LYS A 1 257 ? -33.060 50.539  -27.523 1.00 45.66  ? 257 LYS A NZ    1 
ATOM   2108 N  N     . HIS A 1 258 ? -27.958 55.209  -24.261 1.00 42.37  ? 258 HIS A N     1 
ATOM   2109 C  CA    . HIS A 1 258 ? -27.301 55.571  -23.023 1.00 43.64  ? 258 HIS A CA    1 
ATOM   2110 C  C     . HIS A 1 258 ? -28.014 54.979  -21.811 1.00 44.98  ? 258 HIS A C     1 
ATOM   2111 O  O     . HIS A 1 258 ? -29.245 54.916  -21.788 1.00 46.23  ? 258 HIS A O     1 
ATOM   2112 C  CB    . HIS A 1 258 ? -27.105 57.091  -22.928 1.00 45.58  ? 258 HIS A CB    1 
ATOM   2113 C  CG    . HIS A 1 258 ? -28.377 57.869  -22.799 1.00 50.16  ? 258 HIS A CG    1 
ATOM   2114 N  ND1   . HIS A 1 258 ? -28.962 58.148  -21.578 1.00 55.16  ? 258 HIS A ND1   1 
ATOM   2115 C  CD2   . HIS A 1 258 ? -29.166 58.447  -23.734 1.00 52.27  ? 258 HIS A CD2   1 
ATOM   2116 C  CE1   . HIS A 1 258 ? -30.062 58.856  -21.767 1.00 57.14  ? 258 HIS A CE1   1 
ATOM   2117 N  NE2   . HIS A 1 258 ? -30.208 59.052  -23.067 1.00 56.67  ? 258 HIS A NE2   1 
ATOM   2118 N  N     . PRO A 1 259 ? -27.227 54.494  -20.828 1.00 44.91  ? 259 PRO A N     1 
ATOM   2119 C  CA    . PRO A 1 259 ? -27.579 53.801  -19.595 1.00 46.08  ? 259 PRO A CA    1 
ATOM   2120 C  C     . PRO A 1 259 ? -28.883 54.107  -18.896 1.00 48.73  ? 259 PRO A C     1 
ATOM   2121 O  O     . PRO A 1 259 ? -29.463 53.174  -18.353 1.00 49.85  ? 259 PRO A O     1 
ATOM   2122 C  CB    . PRO A 1 259 ? -26.418 54.137  -18.680 1.00 46.21  ? 259 PRO A CB    1 
ATOM   2123 C  CG    . PRO A 1 259 ? -25.273 54.049  -19.590 1.00 44.47  ? 259 PRO A CG    1 
ATOM   2124 C  CD    . PRO A 1 259 ? -25.760 54.575  -20.939 1.00 43.64  ? 259 PRO A CD    1 
ATOM   2125 N  N     . LEU A 1 260 ? -29.329 55.364  -18.877 1.00 45.53  ? 260 LEU A N     1 
ATOM   2126 C  CA    . LEU A 1 260 ? -30.545 55.762  -18.127 1.00 47.27  ? 260 LEU A CA    1 
ATOM   2127 C  C     . LEU A 1 260 ? -30.425 55.642  -16.605 1.00 47.06  ? 260 LEU A C     1 
ATOM   2128 O  O     . LEU A 1 260 ? -30.066 54.604  -16.067 1.00 44.61  ? 260 LEU A O     1 
ATOM   2129 C  CB    . LEU A 1 260 ? -31.779 54.999  -18.599 1.00 46.60  ? 260 LEU A CB    1 
ATOM   2130 C  CG    . LEU A 1 260 ? -33.082 55.747  -18.838 1.00 48.65  ? 260 LEU A CG    1 
ATOM   2131 C  CD1   . LEU A 1 260 ? -32.959 56.662  -20.038 1.00 49.44  ? 260 LEU A CD1   1 
ATOM   2132 C  CD2   . LEU A 1 260 ? -34.181 54.749  -19.071 1.00 47.06  ? 260 LEU A CD2   1 
ATOM   2133 N  N     . GLU A 1 261 ? -30.744 56.728  -15.918 1.00 50.39  ? 261 GLU A N     1 
ATOM   2134 C  CA    . GLU A 1 261 ? -30.596 56.805  -14.474 1.00 51.28  ? 261 GLU A CA    1 
ATOM   2135 C  C     . GLU A 1 261 ? -31.777 56.097  -13.809 1.00 51.24  ? 261 GLU A C     1 
ATOM   2136 O  O     . GLU A 1 261 ? -32.920 56.533  -13.912 1.00 53.24  ? 261 GLU A O     1 
ATOM   2137 C  CB    . GLU A 1 261 ? -30.468 58.276  -14.058 1.00 54.44  ? 261 GLU A CB    1 
ATOM   2138 C  CG    . GLU A 1 261 ? -30.254 58.536  -12.574 1.00 56.96  ? 261 GLU A CG    1 
ATOM   2139 C  CD    . GLU A 1 261 ? -31.531 58.979  -11.851 1.00 61.94  ? 261 GLU A CD    1 
ATOM   2140 O  OE1   . GLU A 1 261 ? -32.407 59.629  -12.481 1.00 64.42  ? 261 GLU A OE1   1 
ATOM   2141 O  OE2   . GLU A 1 261 ? -31.650 58.680  -10.639 1.00 62.83  ? 261 GLU A OE2   1 
ATOM   2142 N  N     . ILE A 1 262 ? -31.490 54.975  -13.163 1.00 49.54  ? 262 ILE A N     1 
ATOM   2143 C  CA    . ILE A 1 262 ? -32.522 54.141  -12.548 1.00 49.69  ? 262 ILE A CA    1 
ATOM   2144 C  C     . ILE A 1 262 ? -32.409 54.196  -11.022 1.00 50.46  ? 262 ILE A C     1 
ATOM   2145 O  O     . ILE A 1 262 ? -31.339 53.975  -10.458 1.00 49.41  ? 262 ILE A O     1 
ATOM   2146 C  CB    . ILE A 1 262 ? -32.525 52.685  -13.138 1.00 47.01  ? 262 ILE A CB    1 
ATOM   2147 C  CG1   . ILE A 1 262 ? -33.560 51.783  -12.449 1.00 46.35  ? 262 ILE A CG1   1 
ATOM   2148 C  CG2   . ILE A 1 262 ? -31.118 52.078  -13.154 1.00 45.06  ? 262 ILE A CG2   1 
ATOM   2149 C  CD1   . ILE A 1 262 ? -32.997 50.836  -11.406 1.00 44.18  ? 262 ILE A CD1   1 
ATOM   2150 N  N     . GLU A 1 263 ? -33.526 54.520  -10.379 1.00 52.97  ? 263 GLU A N     1 
ATOM   2151 C  CA    . GLU A 1 263 ? -33.584 54.796  -8.948  1.00 54.72  ? 263 GLU A CA    1 
ATOM   2152 C  C     . GLU A 1 263 ? -33.330 53.547  -8.095  1.00 52.71  ? 263 GLU A C     1 
ATOM   2153 O  O     . GLU A 1 263 ? -33.776 52.464  -8.456  1.00 51.11  ? 263 GLU A O     1 
ATOM   2154 C  CB    . GLU A 1 263 ? -34.936 55.451  -8.600  1.00 57.95  ? 263 GLU A CB    1 
ATOM   2155 C  CG    . GLU A 1 263 ? -36.190 54.610  -8.906  1.00 59.14  ? 263 GLU A CG    1 
ATOM   2156 C  CD    . GLU A 1 263 ? -36.653 54.661  -10.376 1.00 61.51  ? 263 GLU A CD    1 
ATOM   2157 O  OE1   . GLU A 1 263 ? -37.808 55.100  -10.606 1.00 63.59  ? 263 GLU A OE1   1 
ATOM   2158 O  OE2   . GLU A 1 263 ? -35.884 54.252  -11.291 1.00 59.34  ? 263 GLU A OE2   1 
ATOM   2159 N  N     . PRO A 1 264 ? -32.606 53.694  -6.961  1.00 53.09  ? 264 PRO A N     1 
ATOM   2160 C  CA    . PRO A 1 264 ? -32.255 52.571  -6.068  1.00 51.54  ? 264 PRO A CA    1 
ATOM   2161 C  C     . PRO A 1 264 ? -33.455 51.742  -5.613  1.00 52.10  ? 264 PRO A C     1 
ATOM   2162 O  O     . PRO A 1 264 ? -33.344 50.527  -5.428  1.00 49.86  ? 264 PRO A O     1 
ATOM   2163 C  CB    . PRO A 1 264 ? -31.634 53.268  -4.853  1.00 52.51  ? 264 PRO A CB    1 
ATOM   2164 C  CG    . PRO A 1 264 ? -31.132 54.548  -5.372  1.00 53.97  ? 264 PRO A CG    1 
ATOM   2165 C  CD    . PRO A 1 264 ? -32.067 54.970  -6.461  1.00 55.04  ? 264 PRO A CD    1 
ATOM   2166 N  N     . GLU A 1 265 ? -34.587 52.411  -5.433  1.00 55.38  ? 265 GLU A N     1 
ATOM   2167 C  CA    . GLU A 1 265 ? -35.802 51.767  -4.988  1.00 56.62  ? 265 GLU A CA    1 
ATOM   2168 C  C     . GLU A 1 265 ? -36.293 50.726  -5.990  1.00 54.99  ? 265 GLU A C     1 
ATOM   2169 O  O     . GLU A 1 265 ? -36.669 49.627  -5.598  1.00 54.23  ? 265 GLU A O     1 
ATOM   2170 C  CB    . GLU A 1 265 ? -36.874 52.818  -4.692  1.00 60.34  ? 265 GLU A CB    1 
ATOM   2171 C  CG    . GLU A 1 265 ? -38.158 52.280  -4.057  1.00 63.69  ? 265 GLU A CG    1 
ATOM   2172 C  CD    . GLU A 1 265 ? -37.926 51.122  -3.084  1.00 65.17  ? 265 GLU A CD    1 
ATOM   2173 O  OE1   . GLU A 1 265 ? -36.909 51.129  -2.344  1.00 65.98  ? 265 GLU A OE1   1 
ATOM   2174 O  OE2   . GLU A 1 265 ? -38.770 50.197  -3.066  1.00 65.80  ? 265 GLU A OE2   1 
ATOM   2175 N  N     . ARG A 1 266 ? -36.264 51.057  -7.277  1.00 55.05  ? 266 ARG A N     1 
ATOM   2176 C  CA    . ARG A 1 266 ? -36.713 50.124  -8.316  1.00 53.80  ? 266 ARG A CA    1 
ATOM   2177 C  C     . ARG A 1 266 ? -35.740 48.960  -8.476  1.00 50.16  ? 266 ARG A C     1 
ATOM   2178 O  O     . ARG A 1 266 ? -36.135 47.854  -8.832  1.00 49.09  ? 266 ARG A O     1 
ATOM   2179 C  CB    . ARG A 1 266 ? -36.927 50.842  -9.657  1.00 55.12  ? 266 ARG A CB    1 
ATOM   2180 C  CG    . ARG A 1 266 ? -37.866 50.112  -10.608 1.00 57.32  ? 266 ARG A CG    1 
ATOM   2181 C  CD    . ARG A 1 266 ? -37.580 50.471  -12.064 1.00 62.20  ? 266 ARG A CD    1 
ATOM   2182 N  NE    . ARG A 1 266 ? -38.012 49.414  -12.985 1.00 64.72  ? 266 ARG A NE    1 
ATOM   2183 C  CZ    . ARG A 1 266 ? -37.541 49.236  -14.222 1.00 65.42  ? 266 ARG A CZ    1 
ATOM   2184 N  NH1   . ARG A 1 266 ? -36.605 50.047  -14.715 1.00 65.65  ? 266 ARG A NH1   1 
ATOM   2185 N  NH2   . ARG A 1 266 ? -38.001 48.237  -14.974 1.00 64.72  ? 266 ARG A NH2   1 
ATOM   2186 N  N     . LEU A 1 267 ? -34.470 49.221  -8.202  1.00 48.66  ? 267 LEU A N     1 
ATOM   2187 C  CA    . LEU A 1 267 ? -33.420 48.216  -8.301  1.00 45.76  ? 267 LEU A CA    1 
ATOM   2188 C  C     . LEU A 1 267 ? -33.566 47.191  -7.174  1.00 44.60  ? 267 LEU A C     1 
ATOM   2189 O  O     . LEU A 1 267 ? -33.404 45.984  -7.382  1.00 42.60  ? 267 LEU A O     1 
ATOM   2190 C  CB    . LEU A 1 267 ? -32.062 48.911  -8.240  1.00 45.41  ? 267 LEU A CB    1 
ATOM   2191 C  CG    . LEU A 1 267 ? -30.864 48.414  -9.046  1.00 43.89  ? 267 LEU A CG    1 
ATOM   2192 C  CD1   . LEU A 1 267 ? -31.260 47.689  -10.341 1.00 43.41  ? 267 LEU A CD1   1 
ATOM   2193 C  CD2   . LEU A 1 267 ? -29.944 49.598  -9.336  1.00 44.13  ? 267 LEU A CD2   1 
ATOM   2194 N  N     . ARG A 1 268 ? -33.897 47.692  -5.985  1.00 45.74  ? 268 ARG A N     1 
ATOM   2195 C  CA    . ARG A 1 268 ? -34.211 46.864  -4.823  1.00 45.30  ? 268 ARG A CA    1 
ATOM   2196 C  C     . ARG A 1 268 ? -35.351 45.893  -5.138  1.00 44.38  ? 268 ARG A C     1 
ATOM   2197 O  O     . ARG A 1 268 ? -35.288 44.726  -4.757  1.00 43.01  ? 268 ARG A O     1 
ATOM   2198 C  CB    . ARG A 1 268 ? -34.591 47.758  -3.639  1.00 47.41  ? 268 ARG A CB    1 
ATOM   2199 C  CG    . ARG A 1 268 ? -34.537 47.070  -2.279  1.00 48.09  ? 268 ARG A CG    1 
ATOM   2200 C  CD    . ARG A 1 268 ? -35.196 47.911  -1.177  1.00 51.07  ? 268 ARG A CD    1 
ATOM   2201 N  NE    . ARG A 1 268 ? -36.572 48.311  -1.499  1.00 56.51  ? 268 ARG A NE    1 
ATOM   2202 C  CZ    . ARG A 1 268 ? -37.604 47.470  -1.640  1.00 57.46  ? 268 ARG A CZ    1 
ATOM   2203 N  NH1   . ARG A 1 268 ? -37.439 46.157  -1.499  1.00 54.93  ? 268 ARG A NH1   1 
ATOM   2204 N  NH2   . ARG A 1 268 ? -38.812 47.943  -1.933  1.00 59.54  ? 268 ARG A NH2   1 
ATOM   2205 N  N     . LYS A 1 269 ? -36.373 46.390  -5.841  1.00 44.96  ? 269 LYS A N     1 
ATOM   2206 C  CA    . LYS A 1 269 ? -37.529 45.593  -6.270  1.00 44.61  ? 269 LYS A CA    1 
ATOM   2207 C  C     . LYS A 1 269 ? -37.160 44.471  -7.242  1.00 42.07  ? 269 LYS A C     1 
ATOM   2208 O  O     . LYS A 1 269 ? -37.619 43.341  -7.096  1.00 41.27  ? 269 LYS A O     1 
ATOM   2209 C  CB    . LYS A 1 269 ? -38.608 46.479  -6.915  1.00 46.69  ? 269 LYS A CB    1 
ATOM   2210 C  CG    . LYS A 1 269 ? -39.292 47.445  -5.976  1.00 49.88  ? 269 LYS A CG    1 
ATOM   2211 C  CD    . LYS A 1 269 ? -40.759 47.617  -6.348  1.00 54.01  ? 269 LYS A CD    1 
ATOM   2212 C  CE    . LYS A 1 269 ? -41.406 48.842  -5.678  1.00 57.47  ? 269 LYS A CE    1 
ATOM   2213 N  NZ    . LYS A 1 269 ? -41.161 50.095  -6.450  1.00 58.95  ? 269 LYS A NZ    1 
ATOM   2214 N  N     . ILE A 1 270 ? -36.350 44.796  -8.243  1.00 40.90  ? 270 ILE A N     1 
ATOM   2215 C  CA    . ILE A 1 270 ? -35.913 43.826  -9.249  1.00 38.97  ? 270 ILE A CA    1 
ATOM   2216 C  C     . ILE A 1 270 ? -35.089 42.723  -8.610  1.00 37.08  ? 270 ILE A C     1 
ATOM   2217 O  O     . ILE A 1 270 ? -35.307 41.550  -8.882  1.00 35.82  ? 270 ILE A O     1 
ATOM   2218 C  CB    . ILE A 1 270 ? -35.076 44.512  -10.349 1.00 38.65  ? 270 ILE A CB    1 
ATOM   2219 C  CG1   . ILE A 1 270 ? -35.974 45.372  -11.224 1.00 40.05  ? 270 ILE A CG1   1 
ATOM   2220 C  CG2   . ILE A 1 270 ? -34.290 43.497  -11.185 1.00 36.63  ? 270 ILE A CG2   1 
ATOM   2221 C  CD1   . ILE A 1 270 ? -35.227 46.474  -11.921 1.00 42.18  ? 270 ILE A CD1   1 
ATOM   2222 N  N     . VAL A 1 271 ? -34.145 43.108  -7.758  1.00 36.86  ? 271 VAL A N     1 
ATOM   2223 C  CA    . VAL A 1 271 ? -33.270 42.133  -7.122  1.00 35.95  ? 271 VAL A CA    1 
ATOM   2224 C  C     . VAL A 1 271 ? -34.065 41.188  -6.230  1.00 36.50  ? 271 VAL A C     1 
ATOM   2225 O  O     . VAL A 1 271 ? -33.802 39.986  -6.206  1.00 36.07  ? 271 VAL A O     1 
ATOM   2226 C  CB    . VAL A 1 271 ? -32.107 42.796  -6.336  1.00 35.77  ? 271 VAL A CB    1 
ATOM   2227 C  CG1   . VAL A 1 271 ? -31.345 41.760  -5.493  1.00 33.32  ? 271 VAL A CG1   1 
ATOM   2228 C  CG2   . VAL A 1 271 ? -31.166 43.503  -7.302  1.00 35.18  ? 271 VAL A CG2   1 
ATOM   2229 N  N     . GLU A 1 272 ? -35.047 41.717  -5.517  1.00 38.03  ? 272 GLU A N     1 
ATOM   2230 C  CA    . GLU A 1 272 ? -35.821 40.858  -4.654  1.00 38.98  ? 272 GLU A CA    1 
ATOM   2231 C  C     . GLU A 1 272 ? -36.836 40.030  -5.432  1.00 39.03  ? 272 GLU A C     1 
ATOM   2232 O  O     . GLU A 1 272 ? -37.184 38.930  -5.016  1.00 39.23  ? 272 GLU A O     1 
ATOM   2233 C  CB    . GLU A 1 272 ? -36.429 41.623  -3.478  1.00 40.77  ? 272 GLU A CB    1 
ATOM   2234 C  CG    . GLU A 1 272 ? -37.555 42.559  -3.809  1.00 44.62  ? 272 GLU A CG    1 
ATOM   2235 C  CD    . GLU A 1 272 ? -38.045 43.295  -2.579  1.00 49.70  ? 272 GLU A CD    1 
ATOM   2236 O  OE1   . GLU A 1 272 ? -37.188 43.653  -1.733  1.00 51.34  ? 272 GLU A OE1   1 
ATOM   2237 O  OE2   . GLU A 1 272 ? -39.274 43.520  -2.450  1.00 52.16  ? 272 GLU A OE2   1 
ATOM   2238 N  N     . GLU A 1 273 ? -37.289 40.538  -6.571  1.00 39.56  ? 273 GLU A N     1 
ATOM   2239 C  CA    . GLU A 1 273 ? -38.098 39.742  -7.484  1.00 39.66  ? 273 GLU A CA    1 
ATOM   2240 C  C     . GLU A 1 273 ? -37.291 38.519  -7.943  1.00 37.61  ? 273 GLU A C     1 
ATOM   2241 O  O     . GLU A 1 273 ? -37.770 37.394  -7.865  1.00 37.54  ? 273 GLU A O     1 
ATOM   2242 C  CB    . GLU A 1 273 ? -38.529 40.595  -8.671  1.00 40.70  ? 273 GLU A CB    1 
ATOM   2243 C  CG    . GLU A 1 273 ? -39.165 39.828  -9.811  1.00 43.35  ? 273 GLU A CG    1 
ATOM   2244 C  CD    . GLU A 1 273 ? -40.684 39.756  -9.708  1.00 49.21  ? 273 GLU A CD    1 
ATOM   2245 O  OE1   . GLU A 1 273 ? -41.267 40.454  -8.836  1.00 51.81  ? 273 GLU A OE1   1 
ATOM   2246 O  OE2   . GLU A 1 273 ? -41.295 39.006  -10.516 1.00 50.43  ? 273 GLU A OE2   1 
ATOM   2247 N  N     . ARG A 1 274 ? -36.056 38.744  -8.387  1.00 36.10  ? 274 ARG A N     1 
ATOM   2248 C  CA    . ARG A 1 274 ? -35.191 37.666  -8.852  1.00 34.49  ? 274 ARG A CA    1 
ATOM   2249 C  C     . ARG A 1 274 ? -34.750 36.765  -7.699  1.00 33.80  ? 274 ARG A C     1 
ATOM   2250 O  O     . ARG A 1 274 ? -34.397 35.598  -7.904  1.00 32.74  ? 274 ARG A O     1 
ATOM   2251 C  CB    . ARG A 1 274 ? -33.953 38.231  -9.532  1.00 33.97  ? 274 ARG A CB    1 
ATOM   2252 C  CG    . ARG A 1 274 ? -34.184 39.337  -10.550 1.00 34.30  ? 274 ARG A CG    1 
ATOM   2253 C  CD    . ARG A 1 274 ? -32.859 39.674  -11.226 1.00 33.51  ? 274 ARG A CD    1 
ATOM   2254 N  NE    . ARG A 1 274 ? -32.899 39.235  -12.612 1.00 34.31  ? 274 ARG A NE    1 
ATOM   2255 C  CZ    . ARG A 1 274 ? -31.890 38.702  -13.292 1.00 33.05  ? 274 ARG A CZ    1 
ATOM   2256 N  NH1   . ARG A 1 274 ? -30.701 38.501  -12.738 1.00 30.44  ? 274 ARG A NH1   1 
ATOM   2257 N  NH2   . ARG A 1 274 ? -32.096 38.360  -14.550 1.00 34.25  ? 274 ARG A NH2   1 
ATOM   2258 N  N     . GLY A 1 275 ? -34.764 37.332  -6.492  1.00 34.15  ? 275 GLY A N     1 
ATOM   2259 C  CA    . GLY A 1 275 ? -34.409 36.624  -5.255  1.00 33.48  ? 275 GLY A CA    1 
ATOM   2260 C  C     . GLY A 1 275 ? -32.966 36.157  -5.204  1.00 31.98  ? 275 GLY A C     1 
ATOM   2261 O  O     . GLY A 1 275 ? -32.667 35.137  -4.580  1.00 31.93  ? 275 GLY A O     1 
ATOM   2262 N  N     . THR A 1 276 ? -32.078 36.908  -5.857  1.00 30.77  ? 276 THR A N     1 
ATOM   2263 C  CA    . THR A 1 276 ? -30.670 36.550  -5.992  1.00 29.06  ? 276 THR A CA    1 
ATOM   2264 C  C     . THR A 1 276 ? -29.785 37.259  -4.972  1.00 28.88  ? 276 THR A C     1 
ATOM   2265 O  O     . THR A 1 276 ? -30.239 38.136  -4.221  1.00 29.94  ? 276 THR A O     1 
ATOM   2266 C  CB    . THR A 1 276 ? -30.133 36.938  -7.377  1.00 28.62  ? 276 THR A CB    1 
ATOM   2267 O  OG1   . THR A 1 276 ? -30.521 38.284  -7.677  1.00 28.81  ? 276 THR A OG1   1 
ATOM   2268 C  CG2   . THR A 1 276 ? -30.664 36.009  -8.452  1.00 28.44  ? 276 THR A CG2   1 
ATOM   2269 N  N     . ALA A 1 277 ? -28.516 36.867  -4.951  1.00 27.34  ? 277 ALA A N     1 
ATOM   2270 C  CA    . ALA A 1 277 ? -27.511 37.573  -4.193  1.00 26.56  ? 277 ALA A CA    1 
ATOM   2271 C  C     . ALA A 1 277 ? -26.794 38.466  -5.181  1.00 26.04  ? 277 ALA A C     1 
ATOM   2272 O  O     . ALA A 1 277 ? -26.188 37.966  -6.138  1.00 25.57  ? 277 ALA A O     1 
ATOM   2273 C  CB    . ALA A 1 277 ? -26.544 36.600  -3.555  1.00 25.84  ? 277 ALA A CB    1 
ATOM   2274 N  N     . VAL A 1 278 ? -26.884 39.781  -4.970  1.00 26.17  ? 278 VAL A N     1 
ATOM   2275 C  CA    . VAL A 1 278 ? -26.162 40.759  -5.788  1.00 25.51  ? 278 VAL A CA    1 
ATOM   2276 C  C     . VAL A 1 278 ? -25.180 41.583  -4.947  1.00 25.82  ? 278 VAL A C     1 
ATOM   2277 O  O     . VAL A 1 278 ? -25.566 42.216  -3.964  1.00 27.02  ? 278 VAL A O     1 
ATOM   2278 C  CB    . VAL A 1 278 ? -27.135 41.682  -6.566  1.00 26.11  ? 278 VAL A CB    1 
ATOM   2279 C  CG1   . VAL A 1 278 ? -26.366 42.727  -7.375  1.00 25.62  ? 278 VAL A CG1   1 
ATOM   2280 C  CG2   . VAL A 1 278 ? -28.007 40.864  -7.490  1.00 25.42  ? 278 VAL A CG2   1 
ATOM   2281 N  N     . PHE A 1 279 ? -23.914 41.588  -5.350  1.00 25.21  ? 279 PHE A N     1 
ATOM   2282 C  CA    . PHE A 1 279 ? -22.867 42.278  -4.591  1.00 25.53  ? 279 PHE A CA    1 
ATOM   2283 C  C     . PHE A 1 279 ? -21.638 42.574  -5.454  1.00 25.15  ? 279 PHE A C     1 
ATOM   2284 O  O     . PHE A 1 279 ? -21.392 41.895  -6.468  1.00 24.33  ? 279 PHE A O     1 
ATOM   2285 C  CB    . PHE A 1 279 ? -22.451 41.441  -3.372  1.00 25.53  ? 279 PHE A CB    1 
ATOM   2286 C  CG    . PHE A 1 279 ? -21.786 40.127  -3.728  1.00 24.83  ? 279 PHE A CG    1 
ATOM   2287 C  CD1   . PHE A 1 279 ? -20.403 40.033  -3.828  1.00 24.76  ? 279 PHE A CD1   1 
ATOM   2288 C  CD2   . PHE A 1 279 ? -22.544 38.987  -3.962  1.00 24.63  ? 279 PHE A CD2   1 
ATOM   2289 C  CE1   . PHE A 1 279 ? -19.786 38.825  -4.157  1.00 24.64  ? 279 PHE A CE1   1 
ATOM   2290 C  CE2   . PHE A 1 279 ? -21.933 37.778  -4.300  1.00 24.42  ? 279 PHE A CE2   1 
ATOM   2291 C  CZ    . PHE A 1 279 ? -20.552 37.698  -4.390  1.00 23.93  ? 279 PHE A CZ    1 
ATOM   2292 N  N     . ALA A 1 280 ? -20.859 43.569  -5.030  1.00 25.66  ? 280 ALA A N     1 
ATOM   2293 C  CA    . ALA A 1 280 ? -19.623 43.930  -5.722  1.00 25.54  ? 280 ALA A CA    1 
ATOM   2294 C  C     . ALA A 1 280 ? -18.390 43.904  -4.831  1.00 25.91  ? 280 ALA A C     1 
ATOM   2295 O  O     . ALA A 1 280 ? -18.479 44.082  -3.615  1.00 26.40  ? 280 ALA A O     1 
ATOM   2296 C  CB    . ALA A 1 280 ? -19.753 45.288  -6.364  1.00 26.33  ? 280 ALA A CB    1 
ATOM   2297 N  N     . VAL A 1 281 ? -17.237 43.695  -5.459  1.00 25.72  ? 281 VAL A N     1 
ATOM   2298 C  CA    . VAL A 1 281 ? -15.958 43.896  -4.802  1.00 26.21  ? 281 VAL A CA    1 
ATOM   2299 C  C     . VAL A 1 281 ? -15.498 45.285  -5.228  1.00 27.49  ? 281 VAL A C     1 
ATOM   2300 O  O     . VAL A 1 281 ? -15.332 45.545  -6.426  1.00 27.66  ? 281 VAL A O     1 
ATOM   2301 C  CB    . VAL A 1 281 ? -14.929 42.827  -5.216  1.00 25.28  ? 281 VAL A CB    1 
ATOM   2302 C  CG1   . VAL A 1 281 ? -13.640 42.985  -4.447  1.00 24.89  ? 281 VAL A CG1   1 
ATOM   2303 C  CG2   . VAL A 1 281 ? -15.494 41.445  -4.983  1.00 25.07  ? 281 VAL A CG2   1 
ATOM   2304 N  N     . LYS A 1 282 ? -15.321 46.166  -4.246  1.00 28.61  ? 282 LYS A N     1 
ATOM   2305 C  CA    . LYS A 1 282 ? -14.920 47.547  -4.470  1.00 29.96  ? 282 LYS A CA    1 
ATOM   2306 C  C     . LYS A 1 282 ? -13.470 47.750  -4.037  1.00 30.51  ? 282 LYS A C     1 
ATOM   2307 O  O     . LYS A 1 282 ? -13.083 47.262  -2.981  1.00 31.15  ? 282 LYS A O     1 
ATOM   2308 C  CB    . LYS A 1 282 ? -15.816 48.459  -3.644  1.00 31.35  ? 282 LYS A CB    1 
ATOM   2309 C  CG    . LYS A 1 282 ? -15.743 49.910  -4.020  1.00 33.28  ? 282 LYS A CG    1 
ATOM   2310 C  CD    . LYS A 1 282 ? -15.743 50.752  -2.769  1.00 37.41  ? 282 LYS A CD    1 
ATOM   2311 C  CE    . LYS A 1 282 ? -15.968 52.218  -3.073  1.00 40.09  ? 282 LYS A CE    1 
ATOM   2312 N  NZ    . LYS A 1 282 ? -17.359 52.424  -3.557  1.00 41.98  ? 282 LYS A NZ    1 
ATOM   2313 N  N     . PHE A 1 283 ? -12.683 48.478  -4.839  1.00 30.67  ? 283 PHE A N     1 
ATOM   2314 C  CA    . PHE A 1 283 ? -11.260 48.740  -4.549  1.00 30.79  ? 283 PHE A CA    1 
ATOM   2315 C  C     . PHE A 1 283 ? -10.677 49.872  -5.386  1.00 31.79  ? 283 PHE A C     1 
ATOM   2316 O  O     . PHE A 1 283 ? -11.263 50.268  -6.387  1.00 31.94  ? 283 PHE A O     1 
ATOM   2317 C  CB    . PHE A 1 283 ? -10.414 47.484  -4.744  1.00 29.50  ? 283 PHE A CB    1 
ATOM   2318 C  CG    . PHE A 1 283 ? -10.464 46.932  -6.121  1.00 28.24  ? 283 PHE A CG    1 
ATOM   2319 C  CD1   . PHE A 1 283 ? -9.427  47.163  -7.009  1.00 28.63  ? 283 PHE A CD1   1 
ATOM   2320 C  CD2   . PHE A 1 283 ? -11.548 46.165  -6.542  1.00 27.24  ? 283 PHE A CD2   1 
ATOM   2321 C  CE1   . PHE A 1 283 ? -9.470  46.637  -8.306  1.00 26.26  ? 283 PHE A CE1   1 
ATOM   2322 C  CE2   . PHE A 1 283 ? -11.591 45.636  -7.831  1.00 25.05  ? 283 PHE A CE2   1 
ATOM   2323 C  CZ    . PHE A 1 283 ? -10.555 45.878  -8.705  1.00 25.25  ? 283 PHE A CZ    1 
ATOM   2324 N  N     . ARG A 1 284 ? -9.518  50.384  -4.967  1.00 33.00  ? 284 ARG A N     1 
ATOM   2325 C  CA    . ARG A 1 284 ? -8.873  51.526  -5.620  1.00 34.39  ? 284 ARG A CA    1 
ATOM   2326 C  C     . ARG A 1 284 ? -8.419  51.171  -7.021  1.00 33.63  ? 284 ARG A C     1 
ATOM   2327 O  O     . ARG A 1 284 ? -7.804  50.124  -7.241  1.00 32.92  ? 284 ARG A O     1 
ATOM   2328 C  CB    . ARG A 1 284 ? -7.665  51.976  -4.821  1.00 35.48  ? 284 ARG A CB    1 
ATOM   2329 C  CG    . ARG A 1 284 ? -7.988  52.429  -3.428  1.00 38.93  ? 284 ARG A CG    1 
ATOM   2330 C  CD    . ARG A 1 284 ? -7.742  53.919  -3.261  1.00 44.24  ? 284 ARG A CD    1 
ATOM   2331 N  NE    . ARG A 1 284 ? -8.433  54.451  -2.088  1.00 47.86  ? 284 ARG A NE    1 
ATOM   2332 C  CZ    . ARG A 1 284 ? -8.849  55.711  -1.968  1.00 51.18  ? 284 ARG A CZ    1 
ATOM   2333 N  NH1   . ARG A 1 284 ? -8.639  56.589  -2.947  1.00 52.16  ? 284 ARG A NH1   1 
ATOM   2334 N  NH2   . ARG A 1 284 ? -9.480  56.093  -0.863  1.00 53.19  ? 284 ARG A NH2   1 
ATOM   2335 N  N     . LYS A 1 285 ? -8.724  52.041  -7.975  1.00 34.14  ? 285 LYS A N     1 
ATOM   2336 C  CA    . LYS A 1 285 ? -8.264  51.847  -9.337  1.00 33.79  ? 285 LYS A CA    1 
ATOM   2337 C  C     . LYS A 1 285 ? -6.741  51.993  -9.405  1.00 34.41  ? 285 LYS A C     1 
ATOM   2338 O  O     . LYS A 1 285 ? -6.196  53.022  -9.003  1.00 36.18  ? 285 LYS A O     1 
ATOM   2339 C  CB    . LYS A 1 285 ? -8.938  52.851  -10.270 1.00 34.83  ? 285 LYS A CB    1 
ATOM   2340 C  CG    . LYS A 1 285 ? -8.633  52.642  -11.746 1.00 34.80  ? 285 LYS A CG    1 
ATOM   2341 C  CD    . LYS A 1 285 ? -9.192  53.774  -12.567 1.00 36.17  ? 285 LYS A CD    1 
ATOM   2342 C  CE    . LYS A 1 285 ? -8.423  53.942  -13.845 1.00 37.61  ? 285 LYS A CE    1 
ATOM   2343 N  NZ    . LYS A 1 285 ? -9.350  54.291  -14.957 1.00 39.16  ? 285 LYS A NZ    1 
ATOM   2344 N  N     . PRO A 1 286 ? -6.044  50.958  -9.908  1.00 33.34  ? 286 PRO A N     1 
ATOM   2345 C  CA    . PRO A 1 286 ? -4.597  51.082  -10.123 1.00 33.96  ? 286 PRO A CA    1 
ATOM   2346 C  C     . PRO A 1 286 ? -4.295  52.061  -11.270 1.00 34.92  ? 286 PRO A C     1 
ATOM   2347 O  O     . PRO A 1 286 ? -4.878  51.935  -12.349 1.00 34.30  ? 286 PRO A O     1 
ATOM   2348 C  CB    . PRO A 1 286 ? -4.171  49.657  -10.503 1.00 32.85  ? 286 PRO A CB    1 
ATOM   2349 C  CG    . PRO A 1 286 ? -5.349  48.776  -10.178 1.00 31.62  ? 286 PRO A CG    1 
ATOM   2350 C  CD    . PRO A 1 286 ? -6.556  49.637  -10.307 1.00 31.50  ? 286 PRO A CD    1 
ATOM   2351 N  N     . ASP A 1 287 ? -3.405  53.026  -11.035 1.00 36.42  ? 287 ASP A N     1 
ATOM   2352 C  CA    . ASP A 1 287 ? -3.101  54.061  -12.032 1.00 37.96  ? 287 ASP A CA    1 
ATOM   2353 C  C     . ASP A 1 287 ? -2.316  53.519  -13.227 1.00 37.58  ? 287 ASP A C     1 
ATOM   2354 O  O     . ASP A 1 287 ? -1.109  53.721  -13.337 1.00 38.83  ? 287 ASP A O     1 
ATOM   2355 C  CB    . ASP A 1 287 ? -2.368  55.254  -11.405 1.00 40.04  ? 287 ASP A CB    1 
ATOM   2356 C  CG    . ASP A 1 287 ? -2.181  56.408  -12.392 1.00 42.90  ? 287 ASP A CG    1 
ATOM   2357 O  OD1   . ASP A 1 287 ? -2.946  56.486  -13.380 1.00 42.10  ? 287 ASP A OD1   1 
ATOM   2358 O  OD2   . ASP A 1 287 ? -1.264  57.238  -12.182 1.00 46.64  ? 287 ASP A OD2   1 
ATOM   2359 N  N     . ILE A 1 288 ? -3.021  52.834  -14.121 1.00 36.19  ? 288 ILE A N     1 
ATOM   2360 C  CA    . ILE A 1 288 ? -2.414  52.189  -15.287 1.00 35.68  ? 288 ILE A CA    1 
ATOM   2361 C  C     . ILE A 1 288 ? -3.325  52.353  -16.506 1.00 35.20  ? 288 ILE A C     1 
ATOM   2362 O  O     . ILE A 1 288 ? -4.493  52.694  -16.366 1.00 35.11  ? 288 ILE A O     1 
ATOM   2363 C  CB    . ILE A 1 288 ? -2.123  50.678  -15.014 1.00 34.57  ? 288 ILE A CB    1 
ATOM   2364 C  CG1   . ILE A 1 288 ? -3.425  49.873  -14.928 1.00 32.98  ? 288 ILE A CG1   1 
ATOM   2365 C  CG2   . ILE A 1 288 ? -1.257  50.493  -13.741 1.00 33.72  ? 288 ILE A CG2   1 
ATOM   2366 C  CD1   . ILE A 1 288 ? -3.233  48.391  -14.651 1.00 31.95  ? 288 ILE A CD1   1 
ATOM   2367 N  N     . VAL A 1 289 ? -2.802  52.110  -17.699 1.00 35.57  ? 289 VAL A N     1 
ATOM   2368 C  CA    . VAL A 1 289 ? -3.583  52.316  -18.929 1.00 35.49  ? 289 VAL A CA    1 
ATOM   2369 C  C     . VAL A 1 289 ? -4.710  51.299  -19.099 1.00 34.51  ? 289 VAL A C     1 
ATOM   2370 O  O     . VAL A 1 289 ? -4.682  50.207  -18.519 1.00 33.20  ? 289 VAL A O     1 
ATOM   2371 C  CB    . VAL A 1 289 ? -2.694  52.323  -20.190 1.00 36.36  ? 289 VAL A CB    1 
ATOM   2372 C  CG1   . VAL A 1 289 ? -1.745  53.508  -20.181 1.00 36.90  ? 289 VAL A CG1   1 
ATOM   2373 C  CG2   . VAL A 1 289 ? -1.931  51.010  -20.329 1.00 35.08  ? 289 VAL A CG2   1 
ATOM   2374 N  N     . ASP A 1 290 ? -5.696  51.663  -19.906 1.00 35.61  ? 290 ASP A N     1 
ATOM   2375 C  CA    . ASP A 1 290 ? -6.854  50.809  -20.161 1.00 35.49  ? 290 ASP A CA    1 
ATOM   2376 C  C     . ASP A 1 290 ? -6.490  49.393  -20.609 1.00 35.06  ? 290 ASP A C     1 
ATOM   2377 O  O     . ASP A 1 290 ? -7.080  48.423  -20.139 1.00 34.17  ? 290 ASP A O     1 
ATOM   2378 C  CB    . ASP A 1 290 ? -7.766  51.451  -21.203 1.00 36.72  ? 290 ASP A CB    1 
ATOM   2379 C  CG    . ASP A 1 290 ? -8.681  52.505  -20.615 1.00 38.86  ? 290 ASP A CG    1 
ATOM   2380 O  OD1   . ASP A 1 290 ? -8.363  53.066  -19.546 1.00 40.06  ? 290 ASP A OD1   1 
ATOM   2381 O  OD2   . ASP A 1 290 ? -9.737  52.773  -21.231 1.00 42.91  ? 290 ASP A OD2   1 
ATOM   2382 N  N     . ASP A 1 291 ? -5.509  49.274  -21.503 1.00 36.25  ? 291 ASP A N     1 
ATOM   2383 C  CA    . ASP A 1 291 ? -5.135  47.971  -22.055 1.00 36.05  ? 291 ASP A CA    1 
ATOM   2384 C  C     . ASP A 1 291 ? -4.357  47.087  -21.098 1.00 35.31  ? 291 ASP A C     1 
ATOM   2385 O  O     . ASP A 1 291 ? -4.177  45.897  -21.370 1.00 35.42  ? 291 ASP A O     1 
ATOM   2386 C  CB    . ASP A 1 291 ? -4.389  48.158  -23.352 1.00 37.71  ? 291 ASP A CB    1 
ATOM   2387 C  CG    . ASP A 1 291 ? -4.953  49.291  -24.150 1.00 40.51  ? 291 ASP A CG    1 
ATOM   2388 O  OD1   . ASP A 1 291 ? -4.675  50.455  -23.756 1.00 44.23  ? 291 ASP A OD1   1 
ATOM   2389 O  OD2   . ASP A 1 291 ? -5.694  49.026  -25.125 1.00 39.99  ? 291 ASP A OD2   1 
ATOM   2390 N  N     . ASN A 1 292 ? -3.913  47.654  -19.977 1.00 34.71  ? 292 ASN A N     1 
ATOM   2391 C  CA    . ASN A 1 292 ? -3.410  46.845  -18.881 1.00 33.43  ? 292 ASN A CA    1 
ATOM   2392 C  C     . ASN A 1 292 ? -4.521  46.546  -17.893 1.00 31.88  ? 292 ASN A C     1 
ATOM   2393 O  O     . ASN A 1 292 ? -4.632  45.423  -17.399 1.00 31.10  ? 292 ASN A O     1 
ATOM   2394 C  CB    . ASN A 1 292 ? -2.218  47.506  -18.189 1.00 34.24  ? 292 ASN A CB    1 
ATOM   2395 C  CG    . ASN A 1 292 ? -0.995  47.611  -19.095 1.00 35.44  ? 292 ASN A CG    1 
ATOM   2396 O  OD1   . ASN A 1 292 ? -0.872  46.899  -20.094 1.00 35.34  ? 292 ASN A OD1   1 
ATOM   2397 N  ND2   . ASN A 1 292 ? -0.085  48.509  -18.749 1.00 36.28  ? 292 ASN A ND2   1 
ATOM   2398 N  N     . LEU A 1 293 ? -5.363  47.541  -17.627 1.00 31.44  ? 293 LEU A N     1 
ATOM   2399 C  CA    . LEU A 1 293 ? -6.367  47.414  -16.570 1.00 29.89  ? 293 LEU A CA    1 
ATOM   2400 C  C     . LEU A 1 293 ? -7.496  46.443  -16.906 1.00 28.58  ? 293 LEU A C     1 
ATOM   2401 O  O     . LEU A 1 293 ? -7.886  45.633  -16.059 1.00 27.78  ? 293 LEU A O     1 
ATOM   2402 C  CB    . LEU A 1 293 ? -6.931  48.785  -16.173 1.00 30.49  ? 293 LEU A CB    1 
ATOM   2403 C  CG    . LEU A 1 293 ? -8.091  48.800  -15.167 1.00 29.61  ? 293 LEU A CG    1 
ATOM   2404 C  CD1   . LEU A 1 293 ? -7.648  48.288  -13.813 1.00 29.20  ? 293 LEU A CD1   1 
ATOM   2405 C  CD2   . LEU A 1 293 ? -8.698  50.181  -15.041 1.00 30.52  ? 293 LEU A CD2   1 
ATOM   2406 N  N     . TYR A 1 294 ? -8.011  46.519  -18.130 1.00 28.20  ? 294 TYR A N     1 
ATOM   2407 C  CA    . TYR A 1 294 ? -9.191  45.739  -18.517 1.00 27.14  ? 294 TYR A CA    1 
ATOM   2408 C  C     . TYR A 1 294 ? -9.015  44.223  -18.593 1.00 26.34  ? 294 TYR A C     1 
ATOM   2409 O  O     . TYR A 1 294 ? -9.885  43.491  -18.138 1.00 24.80  ? 294 TYR A O     1 
ATOM   2410 C  CB    . TYR A 1 294 ? -9.833  46.306  -19.782 1.00 28.07  ? 294 TYR A CB    1 
ATOM   2411 C  CG    . TYR A 1 294 ? -10.694 47.488  -19.444 1.00 28.86  ? 294 TYR A CG    1 
ATOM   2412 C  CD1   . TYR A 1 294 ? -10.155 48.772  -19.372 1.00 30.71  ? 294 TYR A CD1   1 
ATOM   2413 C  CD2   . TYR A 1 294 ? -12.037 47.322  -19.143 1.00 29.12  ? 294 TYR A CD2   1 
ATOM   2414 C  CE1   . TYR A 1 294 ? -10.941 49.863  -19.036 1.00 31.70  ? 294 TYR A CE1   1 
ATOM   2415 C  CE2   . TYR A 1 294 ? -12.838 48.411  -18.810 1.00 30.53  ? 294 TYR A CE2   1 
ATOM   2416 C  CZ    . TYR A 1 294 ? -12.283 49.672  -18.750 1.00 31.10  ? 294 TYR A CZ    1 
ATOM   2417 O  OH    . TYR A 1 294 ? -13.075 50.739  -18.412 1.00 32.22  ? 294 TYR A OH    1 
ATOM   2418 N  N     . PRO A 1 295 ? -7.891  43.743  -19.160 1.00 27.29  ? 295 PRO A N     1 
ATOM   2419 C  CA    . PRO A 1 295 ? -7.692  42.303  -19.110 1.00 27.23  ? 295 PRO A CA    1 
ATOM   2420 C  C     . PRO A 1 295 ? -7.526  41.841  -17.666 1.00 26.80  ? 295 PRO A C     1 
ATOM   2421 O  O     . PRO A 1 295 ? -7.980  40.751  -17.313 1.00 26.50  ? 295 PRO A O     1 
ATOM   2422 C  CB    . PRO A 1 295 ? -6.393  42.101  -19.898 1.00 28.07  ? 295 PRO A CB    1 
ATOM   2423 C  CG    . PRO A 1 295 ? -6.262  43.319  -20.722 1.00 28.58  ? 295 PRO A CG    1 
ATOM   2424 C  CD    . PRO A 1 295 ? -6.774  44.403  -19.858 1.00 28.40  ? 295 PRO A CD    1 
ATOM   2425 N  N     . GLN A 1 296 ? -6.902  42.683  -16.843 1.00 26.98  ? 296 GLN A N     1 
ATOM   2426 C  CA    . GLN A 1 296 ? -6.742  42.391  -15.425 1.00 26.58  ? 296 GLN A CA    1 
ATOM   2427 C  C     . GLN A 1 296 ? -8.075  42.320  -14.701 1.00 25.92  ? 296 GLN A C     1 
ATOM   2428 O  O     . GLN A 1 296 ? -8.277  41.440  -13.871 1.00 25.65  ? 296 GLN A O     1 
ATOM   2429 C  CB    . GLN A 1 296 ? -5.816  43.398  -14.762 1.00 26.95  ? 296 GLN A CB    1 
ATOM   2430 C  CG    . GLN A 1 296 ? -4.350  43.069  -14.955 1.00 27.73  ? 296 GLN A CG    1 
ATOM   2431 C  CD    . GLN A 1 296 ? -3.431  44.075  -14.300 1.00 28.88  ? 296 GLN A CD    1 
ATOM   2432 O  OE1   . GLN A 1 296 ? -3.487  44.300  -13.090 1.00 29.31  ? 296 GLN A OE1   1 
ATOM   2433 N  NE2   . GLN A 1 296 ? -2.570  44.680  -15.098 1.00 29.60  ? 296 GLN A NE2   1 
ATOM   2434 N  N     . LEU A 1 297 ? -8.989  43.229  -15.024 1.00 26.28  ? 297 LEU A N     1 
ATOM   2435 C  CA    . LEU A 1 297 ? -10.347 43.147  -14.491 1.00 25.96  ? 297 LEU A CA    1 
ATOM   2436 C  C     . LEU A 1 297 ? -11.069 41.926  -15.024 1.00 25.93  ? 297 LEU A C     1 
ATOM   2437 O  O     . LEU A 1 297 ? -11.836 41.313  -14.301 1.00 25.75  ? 297 LEU A O     1 
ATOM   2438 C  CB    . LEU A 1 297 ? -11.153 44.416  -14.773 1.00 25.90  ? 297 LEU A CB    1 
ATOM   2439 C  CG    . LEU A 1 297 ? -10.655 45.618  -13.979 1.00 26.72  ? 297 LEU A CG    1 
ATOM   2440 C  CD1   . LEU A 1 297 ? -11.202 46.939  -14.506 1.00 27.22  ? 297 LEU A CD1   1 
ATOM   2441 C  CD2   . LEU A 1 297 ? -10.978 45.439  -12.500 1.00 26.65  ? 297 LEU A CD2   1 
ATOM   2442 N  N     . GLU A 1 298 ? -10.815 41.564  -16.277 1.00 27.12  ? 298 GLU A N     1 
ATOM   2443 C  CA    . GLU A 1 298 ? -11.395 40.350  -16.830 1.00 27.91  ? 298 GLU A CA    1 
ATOM   2444 C  C     . GLU A 1 298 ? -10.934 39.125  -16.056 1.00 27.83  ? 298 GLU A C     1 
ATOM   2445 O  O     . GLU A 1 298 ? -11.757 38.304  -15.676 1.00 27.84  ? 298 GLU A O     1 
ATOM   2446 C  CB    . GLU A 1 298 ? -11.111 40.207  -18.319 1.00 28.84  ? 298 GLU A CB    1 
ATOM   2447 C  CG    . GLU A 1 298 ? -12.359 40.369  -19.178 1.00 32.45  ? 298 GLU A CG    1 
ATOM   2448 C  CD    . GLU A 1 298 ? -12.056 40.752  -20.643 1.00 39.55  ? 298 GLU A CD    1 
ATOM   2449 O  OE1   . GLU A 1 298 ? -11.139 41.591  -20.887 1.00 41.73  ? 298 GLU A OE1   1 
ATOM   2450 O  OE2   . GLU A 1 298 ? -12.752 40.219  -21.554 1.00 41.79  ? 298 GLU A OE2   1 
ATOM   2451 N  N     . ARG A 1 299 ? -9.637  39.021  -15.785 1.00 28.34  ? 299 ARG A N     1 
ATOM   2452 C  CA    . ARG A 1 299 ? -9.119  37.902  -15.012 1.00 28.39  ? 299 ARG A CA    1 
ATOM   2453 C  C     . ARG A 1 299 ? -9.702  37.870  -13.605 1.00 28.16  ? 299 ARG A C     1 
ATOM   2454 O  O     . ARG A 1 299 ? -10.200 36.827  -13.162 1.00 28.25  ? 299 ARG A O     1 
ATOM   2455 C  CB    . ARG A 1 299 ? -7.589  37.906  -14.963 1.00 29.11  ? 299 ARG A CB    1 
ATOM   2456 C  CG    . ARG A 1 299 ? -7.027  37.172  -13.753 1.00 29.39  ? 299 ARG A CG    1 
ATOM   2457 C  CD    . ARG A 1 299 ? -5.535  36.976  -13.807 1.00 29.21  ? 299 ARG A CD    1 
ATOM   2458 N  NE    . ARG A 1 299 ? -5.232  35.685  -14.387 1.00 29.41  ? 299 ARG A NE    1 
ATOM   2459 C  CZ    . ARG A 1 299 ? -4.994  34.582  -13.688 1.00 30.09  ? 299 ARG A CZ    1 
ATOM   2460 N  NH1   . ARG A 1 299 ? -4.995  34.594  -12.362 1.00 29.36  ? 299 ARG A NH1   1 
ATOM   2461 N  NH2   . ARG A 1 299 ? -4.742  33.455  -14.326 1.00 32.28  ? 299 ARG A NH2   1 
ATOM   2462 N  N     . ALA A 1 300 ? -9.647  39.001  -12.904 1.00 28.29  ? 300 ALA A N     1 
ATOM   2463 C  CA    . ALA A 1 300 ? -10.169 39.072  -11.535 1.00 28.38  ? 300 ALA A CA    1 
ATOM   2464 C  C     . ALA A 1 300 ? -11.633 38.617  -11.472 1.00 28.22  ? 300 ALA A C     1 
ATOM   2465 O  O     . ALA A 1 300 ? -12.025 37.812  -10.607 1.00 28.09  ? 300 ALA A O     1 
ATOM   2466 C  CB    . ALA A 1 300 ? -10.018 40.466  -10.980 1.00 28.45  ? 300 ALA A CB    1 
ATOM   2467 N  N     . SER A 1 301 ? -12.426 39.121  -12.413 1.00 28.24  ? 301 SER A N     1 
ATOM   2468 C  CA    . SER A 1 301 ? -13.823 38.753  -12.528 1.00 27.95  ? 301 SER A CA    1 
ATOM   2469 C  C     . SER A 1 301 ? -13.985 37.234  -12.673 1.00 28.08  ? 301 SER A C     1 
ATOM   2470 O  O     . SER A 1 301 ? -14.812 36.610  -11.999 1.00 28.25  ? 301 SER A O     1 
ATOM   2471 C  CB    . SER A 1 301 ? -14.414 39.447  -13.740 1.00 27.74  ? 301 SER A CB    1 
ATOM   2472 O  OG    . SER A 1 301 ? -15.735 39.815  -13.468 1.00 28.04  ? 301 SER A OG    1 
ATOM   2473 N  N     . ARG A 1 302 ? -13.169 36.652  -13.541 1.00 28.33  ? 302 ARG A N     1 
ATOM   2474 C  CA    . ARG A 1 302 ? -13.272 35.256  -13.898 1.00 28.62  ? 302 ARG A CA    1 
ATOM   2475 C  C     . ARG A 1 302 ? -12.908 34.371  -12.710 1.00 28.68  ? 302 ARG A C     1 
ATOM   2476 O  O     . ARG A 1 302 ? -13.695 33.505  -12.327 1.00 29.02  ? 302 ARG A O     1 
ATOM   2477 C  CB    . ARG A 1 302 ? -12.352 34.974  -15.076 1.00 29.62  ? 302 ARG A CB    1 
ATOM   2478 C  CG    . ARG A 1 302 ? -12.829 33.901  -16.017 1.00 31.83  ? 302 ARG A CG    1 
ATOM   2479 C  CD    . ARG A 1 302 ? -11.735 33.532  -17.010 1.00 34.13  ? 302 ARG A CD    1 
ATOM   2480 N  NE    . ARG A 1 302 ? -10.825 32.547  -16.431 1.00 36.68  ? 302 ARG A NE    1 
ATOM   2481 C  CZ    . ARG A 1 302 ? -9.530  32.743  -16.196 1.00 38.41  ? 302 ARG A CZ    1 
ATOM   2482 N  NH1   . ARG A 1 302 ? -8.955  33.897  -16.503 1.00 38.45  ? 302 ARG A NH1   1 
ATOM   2483 N  NH2   . ARG A 1 302 ? -8.801  31.768  -15.662 1.00 40.38  ? 302 ARG A NH2   1 
ATOM   2484 N  N     . LYS A 1 303 ? -11.737 34.599  -12.111 1.00 28.22  ? 303 LYS A N     1 
ATOM   2485 C  CA    . LYS A 1 303 ? -11.278 33.757  -11.011 1.00 27.94  ? 303 LYS A CA    1 
ATOM   2486 C  C     . LYS A 1 303 ? -12.245 33.723  -9.819  1.00 26.92  ? 303 LYS A C     1 
ATOM   2487 O  O     . LYS A 1 303 ? -12.390 32.697  -9.166  1.00 27.58  ? 303 LYS A O     1 
ATOM   2488 C  CB    . LYS A 1 303 ? -9.883  34.176  -10.532 1.00 28.84  ? 303 LYS A CB    1 
ATOM   2489 C  CG    . LYS A 1 303 ? -8.762  34.236  -11.594 1.00 29.71  ? 303 LYS A CG    1 
ATOM   2490 C  CD    . LYS A 1 303 ? -8.500  32.916  -12.322 1.00 31.12  ? 303 LYS A CD    1 
ATOM   2491 C  CE    . LYS A 1 303 ? -8.544  31.699  -11.406 1.00 32.36  ? 303 LYS A CE    1 
ATOM   2492 N  NZ    . LYS A 1 303 ? -7.257  31.002  -11.318 1.00 33.99  ? 303 LYS A NZ    1 
ATOM   2493 N  N     . ILE A 1 304 ? -12.890 34.844  -9.520  1.00 25.56  ? 304 ILE A N     1 
ATOM   2494 C  CA    . ILE A 1 304 ? -13.835 34.894  -8.404  1.00 24.47  ? 304 ILE A CA    1 
ATOM   2495 C  C     . ILE A 1 304 ? -15.132 34.184  -8.790  1.00 24.77  ? 304 ILE A C     1 
ATOM   2496 O  O     . ILE A 1 304 ? -15.719 33.446  -7.980  1.00 24.94  ? 304 ILE A O     1 
ATOM   2497 C  CB    . ILE A 1 304 ? -14.117 36.346  -7.935  1.00 24.12  ? 304 ILE A CB    1 
ATOM   2498 C  CG1   . ILE A 1 304 ? -12.838 36.983  -7.379  1.00 23.23  ? 304 ILE A CG1   1 
ATOM   2499 C  CG2   . ILE A 1 304 ? -15.247 36.380  -6.919  1.00 21.79  ? 304 ILE A CG2   1 
ATOM   2500 C  CD1   . ILE A 1 304 ? -12.898 38.496  -7.203  1.00 23.74  ? 304 ILE A CD1   1 
ATOM   2501 N  N     . PHE A 1 305 ? -15.564 34.386  -10.032 1.00 24.60  ? 305 PHE A N     1 
ATOM   2502 C  CA    . PHE A 1 305 ? -16.705 33.648  -10.578 1.00 24.98  ? 305 PHE A CA    1 
ATOM   2503 C  C     . PHE A 1 305 ? -16.464 32.126  -10.478 1.00 26.11  ? 305 PHE A C     1 
ATOM   2504 O  O     . PHE A 1 305 ? -17.352 31.359  -10.097 1.00 26.46  ? 305 PHE A O     1 
ATOM   2505 C  CB    . PHE A 1 305 ? -16.925 34.081  -12.022 1.00 24.57  ? 305 PHE A CB    1 
ATOM   2506 C  CG    . PHE A 1 305 ? -18.149 33.503  -12.669 1.00 24.86  ? 305 PHE A CG    1 
ATOM   2507 C  CD1   . PHE A 1 305 ? -19.335 34.233  -12.717 1.00 23.65  ? 305 PHE A CD1   1 
ATOM   2508 C  CD2   . PHE A 1 305 ? -18.104 32.244  -13.288 1.00 25.85  ? 305 PHE A CD2   1 
ATOM   2509 C  CE1   . PHE A 1 305 ? -20.462 33.709  -13.350 1.00 24.04  ? 305 PHE A CE1   1 
ATOM   2510 C  CE2   . PHE A 1 305 ? -19.235 31.707  -13.909 1.00 24.75  ? 305 PHE A CE2   1 
ATOM   2511 C  CZ    . PHE A 1 305 ? -20.412 32.439  -13.935 1.00 24.32  ? 305 PHE A CZ    1 
ATOM   2512 N  N     . GLU A 1 306 ? -15.250 31.700  -10.809 1.00 27.17  ? 306 GLU A N     1 
ATOM   2513 C  CA    . GLU A 1 306 ? -14.882 30.296  -10.737 1.00 28.58  ? 306 GLU A CA    1 
ATOM   2514 C  C     . GLU A 1 306 ? -14.858 29.788  -9.300  1.00 28.86  ? 306 GLU A C     1 
ATOM   2515 O  O     . GLU A 1 306 ? -15.334 28.684  -9.017  1.00 29.85  ? 306 GLU A O     1 
ATOM   2516 C  CB    . GLU A 1 306 ? -13.531 30.079  -11.390 1.00 29.47  ? 306 GLU A CB    1 
ATOM   2517 C  CG    . GLU A 1 306 ? -13.561 30.149  -12.890 1.00 31.54  ? 306 GLU A CG    1 
ATOM   2518 C  CD    . GLU A 1 306 ? -12.168 30.079  -13.473 1.00 37.86  ? 306 GLU A CD    1 
ATOM   2519 O  OE1   . GLU A 1 306 ? -11.186 29.960  -12.685 1.00 39.74  ? 306 GLU A OE1   1 
ATOM   2520 O  OE2   . GLU A 1 306 ? -12.051 30.144  -14.720 1.00 41.19  ? 306 GLU A OE2   1 
ATOM   2521 N  N     . PHE A 1 307 ? -14.299 30.590  -8.398  1.00 28.47  ? 307 PHE A N     1 
ATOM   2522 C  CA    . PHE A 1 307 ? -14.361 30.289  -6.979  1.00 28.65  ? 307 PHE A CA    1 
ATOM   2523 C  C     . PHE A 1 307 ? -15.820 30.092  -6.555  1.00 28.27  ? 307 PHE A C     1 
ATOM   2524 O  O     . PHE A 1 307 ? -16.163 29.087  -5.931  1.00 28.81  ? 307 PHE A O     1 
ATOM   2525 C  CB    . PHE A 1 307 ? -13.703 31.401  -6.152  1.00 28.33  ? 307 PHE A CB    1 
ATOM   2526 C  CG    . PHE A 1 307 ? -14.166 31.436  -4.725  1.00 28.24  ? 307 PHE A CG    1 
ATOM   2527 C  CD1   . PHE A 1 307 ? -13.675 30.521  -3.800  1.00 28.83  ? 307 PHE A CD1   1 
ATOM   2528 C  CD2   . PHE A 1 307 ? -15.128 32.357  -4.313  1.00 27.02  ? 307 PHE A CD2   1 
ATOM   2529 C  CE1   . PHE A 1 307 ? -14.117 30.533  -2.487  1.00 27.75  ? 307 PHE A CE1   1 
ATOM   2530 C  CE2   . PHE A 1 307 ? -15.575 32.366  -2.996  1.00 26.70  ? 307 PHE A CE2   1 
ATOM   2531 C  CZ    . PHE A 1 307 ? -15.062 31.456  -2.086  1.00 27.15  ? 307 PHE A CZ    1 
ATOM   2532 N  N     . LEU A 1 308 ? -16.677 31.046  -6.909  1.00 27.39  ? 308 LEU A N     1 
ATOM   2533 C  CA    . LEU A 1 308 ? -18.090 30.955  -6.551  1.00 27.15  ? 308 LEU A CA    1 
ATOM   2534 C  C     . LEU A 1 308 ? -18.736 29.706  -7.119  1.00 28.02  ? 308 LEU A C     1 
ATOM   2535 O  O     . LEU A 1 308 ? -19.601 29.124  -6.467  1.00 28.24  ? 308 LEU A O     1 
ATOM   2536 C  CB    . LEU A 1 308 ? -18.878 32.201  -6.984  1.00 26.25  ? 308 LEU A CB    1 
ATOM   2537 C  CG    . LEU A 1 308 ? -18.643 33.519  -6.225  1.00 25.58  ? 308 LEU A CG    1 
ATOM   2538 C  CD1   . LEU A 1 308 ? -19.275 34.685  -6.960  1.00 24.85  ? 308 LEU A CD1   1 
ATOM   2539 C  CD2   . LEU A 1 308 ? -19.132 33.483  -4.787  1.00 24.76  ? 308 LEU A CD2   1 
ATOM   2540 N  N     . GLU A 1 309 ? -18.326 29.278  -8.315  1.00 28.80  ? 309 GLU A N     1 
ATOM   2541 C  CA    . GLU A 1 309 ? -18.990 28.122  -8.911  1.00 30.70  ? 309 GLU A CA    1 
ATOM   2542 C  C     . GLU A 1 309 ? -18.554 26.780  -8.315  1.00 31.20  ? 309 GLU A C     1 
ATOM   2543 O  O     . GLU A 1 309 ? -19.403 25.915  -8.096  1.00 31.60  ? 309 GLU A O     1 
ATOM   2544 C  CB    . GLU A 1 309 ? -19.066 28.162  -10.459 1.00 30.44  ? 309 GLU A CB    1 
ATOM   2545 C  CG    . GLU A 1 309 ? -17.863 27.682  -11.257 1.00 33.79  ? 309 GLU A CG    1 
ATOM   2546 C  CD    . GLU A 1 309 ? -18.009 27.928  -12.792 1.00 34.58  ? 309 GLU A CD    1 
ATOM   2547 O  OE1   . GLU A 1 309 ? -16.955 28.001  -13.499 1.00 37.96  ? 309 GLU A OE1   1 
ATOM   2548 O  OE2   . GLU A 1 309 ? -19.164 28.049  -13.290 1.00 36.35  ? 309 GLU A OE2   1 
ATOM   2549 N  N     . ARG A 1 310 ? -17.266 26.622  -7.999  1.00 31.46  ? 310 ARG A N     1 
ATOM   2550 C  CA    . ARG A 1 310 ? -16.797 25.370  -7.372  1.00 32.73  ? 310 ARG A CA    1 
ATOM   2551 C  C     . ARG A 1 310 ? -17.262 25.258  -5.922  1.00 32.79  ? 310 ARG A C     1 
ATOM   2552 O  O     . ARG A 1 310 ? -17.340 24.175  -5.354  1.00 33.41  ? 310 ARG A O     1 
ATOM   2553 C  CB    . ARG A 1 310 ? -15.274 25.181  -7.491  1.00 33.32  ? 310 ARG A CB    1 
ATOM   2554 C  CG    . ARG A 1 310 ? -14.452 26.250  -6.843  1.00 32.08  ? 310 ARG A CG    1 
ATOM   2555 C  CD    . ARG A 1 310 ? -12.977 25.912  -6.837  1.00 32.80  ? 310 ARG A CD    1 
ATOM   2556 N  NE    . ARG A 1 310 ? -12.179 27.062  -6.399  1.00 31.66  ? 310 ARG A NE    1 
ATOM   2557 C  CZ    . ARG A 1 310 ? -11.692 27.988  -7.216  1.00 30.38  ? 310 ARG A CZ    1 
ATOM   2558 N  NH1   . ARG A 1 310 ? -11.911 27.902  -8.515  1.00 30.01  ? 310 ARG A NH1   1 
ATOM   2559 N  NH2   . ARG A 1 310 ? -10.985 29.000  -6.735  1.00 30.54  ? 310 ARG A NH2   1 
ATOM   2560 N  N     . GLU A 1 311 ? -17.591 26.408  -5.356  1.00 32.27  ? 311 GLU A N     1 
ATOM   2561 C  CA    . GLU A 1 311 ? -18.084 26.517  -3.995  1.00 33.11  ? 311 GLU A CA    1 
ATOM   2562 C  C     . GLU A 1 311 ? -19.627 26.510  -3.944  1.00 32.54  ? 311 GLU A C     1 
ATOM   2563 O  O     . GLU A 1 311 ? -20.237 26.883  -2.942  1.00 32.74  ? 311 GLU A O     1 
ATOM   2564 C  CB    . GLU A 1 311 ? -17.520 27.791  -3.378  1.00 32.19  ? 311 GLU A CB    1 
ATOM   2565 C  CG    . GLU A 1 311 ? -17.212 27.639  -1.930  1.00 36.20  ? 311 GLU A CG    1 
ATOM   2566 C  CD    . GLU A 1 311 ? -16.161 26.566  -1.645  1.00 40.35  ? 311 GLU A CD    1 
ATOM   2567 O  OE1   . GLU A 1 311 ? -15.060 26.636  -2.239  1.00 40.98  ? 311 GLU A OE1   1 
ATOM   2568 O  OE2   . GLU A 1 311 ? -16.437 25.669  -0.809  1.00 42.30  ? 311 GLU A OE2   1 
ATOM   2569 N  N     . ASN A 1 312 ? -20.240 26.104  -5.051  1.00 32.25  ? 312 ASN A N     1 
ATOM   2570 C  CA    . ASN A 1 312 ? -21.686 25.880  -5.153  1.00 31.94  ? 312 ASN A CA    1 
ATOM   2571 C  C     . ASN A 1 312 ? -22.630 27.057  -4.890  1.00 31.14  ? 312 ASN A C     1 
ATOM   2572 O  O     . ASN A 1 312 ? -23.788 26.865  -4.545  1.00 31.44  ? 312 ASN A O     1 
ATOM   2573 C  CB    . ASN A 1 312 ? -22.089 24.645  -4.351  1.00 32.98  ? 312 ASN A CB    1 
ATOM   2574 C  CG    . ASN A 1 312 ? -21.552 23.363  -4.962  1.00 33.52  ? 312 ASN A CG    1 
ATOM   2575 O  OD1   . ASN A 1 312 ? -20.833 22.605  -4.309  1.00 33.11  ? 312 ASN A OD1   1 
ATOM   2576 N  ND2   . ASN A 1 312 ? -21.891 23.122  -6.229  1.00 31.61  ? 312 ASN A ND2   1 
ATOM   2577 N  N     . PHE A 1 313 ? -22.150 28.277  -5.099  1.00 30.33  ? 313 PHE A N     1 
ATOM   2578 C  CA    . PHE A 1 313 ? -23.021 29.436  -4.966  1.00 29.55  ? 313 PHE A CA    1 
ATOM   2579 C  C     . PHE A 1 313 ? -23.811 29.739  -6.232  1.00 29.32  ? 313 PHE A C     1 
ATOM   2580 O  O     . PHE A 1 313 ? -24.614 30.671  -6.256  1.00 29.23  ? 313 PHE A O     1 
ATOM   2581 C  CB    . PHE A 1 313 ? -22.231 30.648  -4.475  1.00 28.69  ? 313 PHE A CB    1 
ATOM   2582 C  CG    . PHE A 1 313 ? -21.829 30.542  -3.035  1.00 29.33  ? 313 PHE A CG    1 
ATOM   2583 C  CD1   . PHE A 1 313 ? -22.798 30.551  -2.027  1.00 29.03  ? 313 PHE A CD1   1 
ATOM   2584 C  CD2   . PHE A 1 313 ? -20.496 30.392  -2.679  1.00 29.03  ? 313 PHE A CD2   1 
ATOM   2585 C  CE1   . PHE A 1 313 ? -22.446 30.431  -0.699  1.00 27.73  ? 313 PHE A CE1   1 
ATOM   2586 C  CE2   . PHE A 1 313 ? -20.139 30.279  -1.351  1.00 29.12  ? 313 PHE A CE2   1 
ATOM   2587 C  CZ    . PHE A 1 313 ? -21.125 30.296  -0.360  1.00 29.34  ? 313 PHE A CZ    1 
ATOM   2588 N  N     . MET A 1 314 ? -23.590 28.936  -7.270  1.00 29.58  ? 314 MET A N     1 
ATOM   2589 C  CA    . MET A 1 314 ? -24.322 29.047  -8.536  1.00 29.75  ? 314 MET A CA    1 
ATOM   2590 C  C     . MET A 1 314 ? -24.352 30.481  -9.092  1.00 28.62  ? 314 MET A C     1 
ATOM   2591 O  O     . MET A 1 314 ? -25.417 31.124  -9.151  1.00 28.39  ? 314 MET A O     1 
ATOM   2592 C  CB    . MET A 1 314 ? -25.741 28.465  -8.402  1.00 30.05  ? 314 MET A CB    1 
ATOM   2593 C  CG    . MET A 1 314 ? -25.764 27.025  -7.916  1.00 31.55  ? 314 MET A CG    1 
ATOM   2594 S  SD    . MET A 1 314 ? -27.415 26.303  -7.865  1.00 33.46  ? 314 MET A SD    1 
ATOM   2595 C  CE    . MET A 1 314 ? -27.893 26.351  -9.608  1.00 32.89  ? 314 MET A CE    1 
ATOM   2596 N  N     . PRO A 1 315 ? -23.178 30.988  -9.501  1.00 28.02  ? 315 PRO A N     1 
ATOM   2597 C  CA    . PRO A 1 315 ? -23.114 32.351  -10.042 1.00 27.34  ? 315 PRO A CA    1 
ATOM   2598 C  C     . PRO A 1 315 ? -23.846 32.450  -11.372 1.00 27.36  ? 315 PRO A C     1 
ATOM   2599 O  O     . PRO A 1 315 ? -23.744 31.547  -12.185 1.00 27.88  ? 315 PRO A O     1 
ATOM   2600 C  CB    . PRO A 1 315 ? -21.611 32.586  -10.227 1.00 27.02  ? 315 PRO A CB    1 
ATOM   2601 C  CG    . PRO A 1 315 ? -21.018 31.225  -10.329 1.00 27.45  ? 315 PRO A CG    1 
ATOM   2602 C  CD    . PRO A 1 315 ? -21.861 30.329  -9.483  1.00 27.89  ? 315 PRO A CD    1 
ATOM   2603 N  N     . LEU A 1 316 ? -24.588 33.530  -11.575 1.00 27.35  ? 316 LEU A N     1 
ATOM   2604 C  CA    . LEU A 1 316 ? -25.330 33.743  -12.812 1.00 27.82  ? 316 LEU A CA    1 
ATOM   2605 C  C     . LEU A 1 316 ? -24.494 34.424  -13.897 1.00 28.46  ? 316 LEU A C     1 
ATOM   2606 O  O     . LEU A 1 316 ? -24.135 33.798  -14.893 1.00 29.15  ? 316 LEU A O     1 
ATOM   2607 C  CB    . LEU A 1 316 ? -26.592 34.548  -12.545 1.00 27.52  ? 316 LEU A CB    1 
ATOM   2608 C  CG    . LEU A 1 316 ? -27.721 33.795  -11.872 1.00 27.66  ? 316 LEU A CG    1 
ATOM   2609 C  CD1   . LEU A 1 316 ? -28.692 34.786  -11.295 1.00 27.86  ? 316 LEU A CD1   1 
ATOM   2610 C  CD2   . LEU A 1 316 ? -28.417 32.869  -12.854 1.00 27.17  ? 316 LEU A CD2   1 
ATOM   2611 N  N     . ARG A 1 317 ? -24.231 35.713  -13.740 1.00 28.42  ? 317 ARG A N     1 
ATOM   2612 C  CA    . ARG A 1 317 ? -23.309 36.383  -14.634 1.00 29.20  ? 317 ARG A CA    1 
ATOM   2613 C  C     . ARG A 1 317 ? -22.399 37.222  -13.789 1.00 29.56  ? 317 ARG A C     1 
ATOM   2614 O  O     . ARG A 1 317 ? -22.468 37.189  -12.551 1.00 29.76  ? 317 ARG A O     1 
ATOM   2615 C  CB    . ARG A 1 317 ? -24.019 37.286  -15.645 1.00 29.71  ? 317 ARG A CB    1 
ATOM   2616 C  CG    . ARG A 1 317 ? -24.839 36.573  -16.697 1.00 30.70  ? 317 ARG A CG    1 
ATOM   2617 C  CD    . ARG A 1 317 ? -25.500 37.572  -17.624 1.00 30.98  ? 317 ARG A CD    1 
ATOM   2618 N  NE    . ARG A 1 317 ? -24.587 38.053  -18.654 1.00 32.41  ? 317 ARG A NE    1 
ATOM   2619 C  CZ    . ARG A 1 317 ? -24.859 39.050  -19.494 1.00 34.31  ? 317 ARG A CZ    1 
ATOM   2620 N  NH1   . ARG A 1 317 ? -26.023 39.687  -19.427 1.00 36.22  ? 317 ARG A NH1   1 
ATOM   2621 N  NH2   . ARG A 1 317 ? -23.965 39.421  -20.399 1.00 34.01  ? 317 ARG A NH2   1 
ATOM   2622 N  N     . SER A 1 318 ? -21.560 37.996  -14.463 1.00 30.02  ? 318 SER A N     1 
ATOM   2623 C  CA    . SER A 1 318 ? -20.553 38.800  -13.794 1.00 30.01  ? 318 SER A CA    1 
ATOM   2624 C  C     . SER A 1 318 ? -20.241 40.048  -14.618 1.00 30.07  ? 318 SER A C     1 
ATOM   2625 O  O     . SER A 1 318 ? -20.296 40.029  -15.852 1.00 30.40  ? 318 SER A O     1 
ATOM   2626 C  CB    . SER A 1 318 ? -19.320 37.941  -13.563 1.00 29.75  ? 318 SER A CB    1 
ATOM   2627 O  OG    . SER A 1 318 ? -18.155 38.640  -13.903 1.00 32.28  ? 318 SER A OG    1 
ATOM   2628 N  N     . ALA A 1 319 ? -19.943 41.140  -13.936 1.00 29.92  ? 319 ALA A N     1 
ATOM   2629 C  CA    . ALA A 1 319 ? -19.671 42.398  -14.620 1.00 30.43  ? 319 ALA A CA    1 
ATOM   2630 C  C     . ALA A 1 319 ? -18.545 43.150  -13.936 1.00 30.27  ? 319 ALA A C     1 
ATOM   2631 O  O     . ALA A 1 319 ? -18.154 42.805  -12.827 1.00 30.05  ? 319 ALA A O     1 
ATOM   2632 C  CB    . ALA A 1 319 ? -20.924 43.244  -14.658 1.00 31.05  ? 319 ALA A CB    1 
ATOM   2633 N  N     . PHE A 1 320 ? -18.020 44.171  -14.596 1.00 30.72  ? 320 PHE A N     1 
ATOM   2634 C  CA    . PHE A 1 320 ? -17.048 45.049  -13.949 1.00 31.36  ? 320 PHE A CA    1 
ATOM   2635 C  C     . PHE A 1 320 ? -17.167 46.497  -14.416 1.00 32.66  ? 320 PHE A C     1 
ATOM   2636 O  O     . PHE A 1 320 ? -17.638 46.760  -15.512 1.00 33.32  ? 320 PHE A O     1 
ATOM   2637 C  CB    . PHE A 1 320 ? -15.609 44.521  -14.086 1.00 30.67  ? 320 PHE A CB    1 
ATOM   2638 C  CG    . PHE A 1 320 ? -15.190 44.225  -15.497 1.00 31.02  ? 320 PHE A CG    1 
ATOM   2639 C  CD1   . PHE A 1 320 ? -14.763 45.246  -16.345 1.00 31.29  ? 320 PHE A CD1   1 
ATOM   2640 C  CD2   . PHE A 1 320 ? -15.195 42.915  -15.976 1.00 30.84  ? 320 PHE A CD2   1 
ATOM   2641 C  CE1   . PHE A 1 320 ? -14.365 44.969  -17.656 1.00 30.77  ? 320 PHE A CE1   1 
ATOM   2642 C  CE2   . PHE A 1 320 ? -14.801 42.627  -17.294 1.00 30.15  ? 320 PHE A CE2   1 
ATOM   2643 C  CZ    . PHE A 1 320 ? -14.385 43.651  -18.127 1.00 30.59  ? 320 PHE A CZ    1 
ATOM   2644 N  N     . LYS A 1 321 ? -16.757 47.429  -13.562 1.00 33.62  ? 321 LYS A N     1 
ATOM   2645 C  CA    . LYS A 1 321 ? -16.812 48.846  -13.872 1.00 35.38  ? 321 LYS A CA    1 
ATOM   2646 C  C     . LYS A 1 321 ? -15.592 49.520  -13.299 1.00 36.30  ? 321 LYS A C     1 
ATOM   2647 O  O     . LYS A 1 321 ? -15.115 49.121  -12.246 1.00 36.19  ? 321 LYS A O     1 
ATOM   2648 C  CB    . LYS A 1 321 ? -18.071 49.484  -13.282 1.00 36.14  ? 321 LYS A CB    1 
ATOM   2649 C  CG    . LYS A 1 321 ? -18.493 50.753  -13.983 1.00 37.51  ? 321 LYS A CG    1 
ATOM   2650 C  CD    . LYS A 1 321 ? -18.211 51.985  -13.163 1.00 40.31  ? 321 LYS A CD    1 
ATOM   2651 C  CE    . LYS A 1 321 ? -18.095 53.227  -14.043 1.00 43.20  ? 321 LYS A CE    1 
ATOM   2652 N  NZ    . LYS A 1 321 ? -19.004 53.237  -15.230 1.00 44.70  ? 321 LYS A NZ    1 
ATOM   2653 N  N     . ALA A 1 322 ? -15.096 50.540  -13.995 1.00 37.77  ? 322 ALA A N     1 
ATOM   2654 C  CA    . ALA A 1 322 ? -13.961 51.319  -13.541 1.00 38.92  ? 322 ALA A CA    1 
ATOM   2655 C  C     . ALA A 1 322 ? -14.357 52.779  -13.509 1.00 41.31  ? 322 ALA A C     1 
ATOM   2656 O  O     . ALA A 1 322 ? -14.811 53.323  -14.512 1.00 42.44  ? 322 ALA A O     1 
ATOM   2657 C  CB    . ALA A 1 322 ? -12.794 51.121  -14.467 1.00 38.69  ? 322 ALA A CB    1 
ATOM   2658 N  N     . SER A 1 323 ? -14.201 53.405  -12.352 1.00 42.82  ? 323 SER A N     1 
ATOM   2659 C  CA    . SER A 1 323 ? -14.412 54.835  -12.214 1.00 45.55  ? 323 SER A CA    1 
ATOM   2660 C  C     . SER A 1 323 ? -13.064 55.525  -12.277 1.00 47.04  ? 323 SER A C     1 
ATOM   2661 O  O     . SER A 1 323 ? -12.068 54.886  -12.615 1.00 46.34  ? 323 SER A O     1 
ATOM   2662 C  CB    . SER A 1 323 ? -15.074 55.126  -10.880 1.00 46.32  ? 323 SER A CB    1 
ATOM   2663 O  OG    . SER A 1 323 ? -16.454 54.838  -10.943 1.00 46.66  ? 323 SER A OG    1 
ATOM   2664 N  N     . GLU A 1 324 ? -13.023 56.818  -11.955 1.00 49.53  ? 324 GLU A N     1 
ATOM   2665 C  CA    . GLU A 1 324 ? -11.746 57.531  -11.866 1.00 51.24  ? 324 GLU A CA    1 
ATOM   2666 C  C     . GLU A 1 324 ? -10.885 56.929  -10.770 1.00 50.05  ? 324 GLU A C     1 
ATOM   2667 O  O     . GLU A 1 324 ? -9.676  56.778  -10.933 1.00 50.06  ? 324 GLU A O     1 
ATOM   2668 C  CB    . GLU A 1 324 ? -11.942 59.029  -11.599 1.00 54.19  ? 324 GLU A CB    1 
ATOM   2669 C  CG    . GLU A 1 324 ? -12.903 59.747  -12.566 1.00 57.98  ? 324 GLU A CG    1 
ATOM   2670 C  CD    . GLU A 1 324 ? -12.399 59.852  -14.024 1.00 60.45  ? 324 GLU A CD    1 
ATOM   2671 O  OE1   . GLU A 1 324 ? -11.586 59.010  -14.478 1.00 60.05  ? 324 GLU A OE1   1 
ATOM   2672 O  OE2   . GLU A 1 324 ? -12.842 60.790  -14.725 1.00 62.84  ? 324 GLU A OE2   1 
ATOM   2673 N  N     . GLU A 1 325 ? -11.532 56.541  -9.677  1.00 49.21  ? 325 GLU A N     1 
ATOM   2674 C  CA    . GLU A 1 325 ? -10.841 56.172  -8.446  1.00 48.75  ? 325 GLU A CA    1 
ATOM   2675 C  C     . GLU A 1 325 ? -11.104 54.738  -7.970  1.00 45.36  ? 325 GLU A C     1 
ATOM   2676 O  O     . GLU A 1 325 ? -10.257 54.134  -7.325  1.00 44.53  ? 325 GLU A O     1 
ATOM   2677 C  CB    . GLU A 1 325 ? -11.129 57.220  -7.345  1.00 51.40  ? 325 GLU A CB    1 
ATOM   2678 C  CG    . GLU A 1 325 ? -12.587 57.311  -6.811  1.00 54.90  ? 325 GLU A CG    1 
ATOM   2679 C  CD    . GLU A 1 325 ? -13.649 57.823  -7.824  1.00 59.61  ? 325 GLU A CD    1 
ATOM   2680 O  OE1   . GLU A 1 325 ? -13.782 57.244  -8.940  1.00 59.28  ? 325 GLU A OE1   1 
ATOM   2681 O  OE2   . GLU A 1 325 ? -14.386 58.785  -7.475  1.00 61.97  ? 325 GLU A OE2   1 
ATOM   2682 N  N     . PHE A 1 326 ? -12.261 54.182  -8.307  1.00 43.33  ? 326 PHE A N     1 
ATOM   2683 C  CA    . PHE A 1 326 ? -12.569 52.803  -7.907  1.00 40.27  ? 326 PHE A CA    1 
ATOM   2684 C  C     . PHE A 1 326 ? -12.850 51.851  -9.057  1.00 37.96  ? 326 PHE A C     1 
ATOM   2685 O  O     . PHE A 1 326 ? -13.258 52.260  -10.144 1.00 38.13  ? 326 PHE A O     1 
ATOM   2686 C  CB    . PHE A 1 326 ? -13.726 52.767  -6.900  1.00 40.32  ? 326 PHE A CB    1 
ATOM   2687 C  CG    . PHE A 1 326 ? -13.398 53.414  -5.595  1.00 41.10  ? 326 PHE A CG    1 
ATOM   2688 C  CD1   . PHE A 1 326 ? -13.876 54.677  -5.298  1.00 42.41  ? 326 PHE A CD1   1 
ATOM   2689 C  CD2   . PHE A 1 326 ? -12.588 52.770  -4.674  1.00 39.78  ? 326 PHE A CD2   1 
ATOM   2690 C  CE1   . PHE A 1 326 ? -13.563 55.287  -4.096  1.00 43.79  ? 326 PHE A CE1   1 
ATOM   2691 C  CE2   . PHE A 1 326 ? -12.271 53.371  -3.471  1.00 41.86  ? 326 PHE A CE2   1 
ATOM   2692 C  CZ    . PHE A 1 326 ? -12.758 54.637  -3.181  1.00 43.68  ? 326 PHE A CZ    1 
ATOM   2693 N  N     . CYS A 1 327 ? -12.607 50.574  -8.798  1.00 35.71  ? 327 CYS A N     1 
ATOM   2694 C  CA    . CYS A 1 327 ? -13.042 49.499  -9.676  1.00 33.78  ? 327 CYS A CA    1 
ATOM   2695 C  C     . CYS A 1 327 ? -14.053 48.653  -8.942  1.00 32.21  ? 327 CYS A C     1 
ATOM   2696 O  O     . CYS A 1 327 ? -14.047 48.603  -7.708  1.00 32.56  ? 327 CYS A O     1 
ATOM   2697 C  CB    . CYS A 1 327 ? -11.866 48.643  -10.092 1.00 32.93  ? 327 CYS A CB    1 
ATOM   2698 S  SG    . CYS A 1 327 ? -10.831 49.488  -11.261 1.00 36.04  ? 327 CYS A SG    1 
ATOM   2699 N  N     . TYR A 1 328 ? -14.924 47.996  -9.695  1.00 30.43  ? 328 TYR A N     1 
ATOM   2700 C  CA    . TYR A 1 328 ? -15.992 47.218  -9.105  1.00 29.18  ? 328 TYR A CA    1 
ATOM   2701 C  C     . TYR A 1 328 ? -16.115 45.887  -9.796  1.00 27.98  ? 328 TYR A C     1 
ATOM   2702 O  O     . TYR A 1 328 ? -16.219 45.821  -11.007 1.00 27.93  ? 328 TYR A O     1 
ATOM   2703 C  CB    . TYR A 1 328 ? -17.316 47.958  -9.241  1.00 29.69  ? 328 TYR A CB    1 
ATOM   2704 C  CG    . TYR A 1 328 ? -17.392 49.279  -8.522  1.00 30.69  ? 328 TYR A CG    1 
ATOM   2705 C  CD1   . TYR A 1 328 ? -16.925 50.458  -9.122  1.00 30.84  ? 328 TYR A CD1   1 
ATOM   2706 C  CD2   . TYR A 1 328 ? -17.955 49.359  -7.246  1.00 31.49  ? 328 TYR A CD2   1 
ATOM   2707 C  CE1   . TYR A 1 328 ? -17.007 51.673  -8.472  1.00 33.00  ? 328 TYR A CE1   1 
ATOM   2708 C  CE2   . TYR A 1 328 ? -18.046 50.577  -6.571  1.00 33.18  ? 328 TYR A CE2   1 
ATOM   2709 C  CZ    . TYR A 1 328 ? -17.571 51.728  -7.189  1.00 34.96  ? 328 TYR A CZ    1 
ATOM   2710 O  OH    . TYR A 1 328 ? -17.667 52.930  -6.521  1.00 37.40  ? 328 TYR A OH    1 
ATOM   2711 N  N     . LEU A 1 329 ? -16.118 44.812  -9.036  1.00 27.68  ? 329 LEU A N     1 
ATOM   2712 C  CA    . LEU A 1 329 ? -16.450 43.518  -9.629  1.00 27.35  ? 329 LEU A CA    1 
ATOM   2713 C  C     . LEU A 1 329 ? -17.869 43.116  -9.201  1.00 27.37  ? 329 LEU A C     1 
ATOM   2714 O  O     . LEU A 1 329 ? -18.128 42.907  -8.021  1.00 27.79  ? 329 LEU A O     1 
ATOM   2715 C  CB    . LEU A 1 329 ? -15.394 42.473  -9.258  1.00 26.59  ? 329 LEU A CB    1 
ATOM   2716 C  CG    . LEU A 1 329 ? -13.980 42.977  -9.572  1.00 27.22  ? 329 LEU A CG    1 
ATOM   2717 C  CD1   . LEU A 1 329 ? -12.910 42.279  -8.740  1.00 28.25  ? 329 LEU A CD1   1 
ATOM   2718 C  CD2   . LEU A 1 329 ? -13.671 42.855  -11.051 1.00 27.82  ? 329 LEU A CD2   1 
ATOM   2719 N  N     . LEU A 1 330 ? -18.791 43.054  -10.155 1.00 27.47  ? 330 LEU A N     1 
ATOM   2720 C  CA    . LEU A 1 330 ? -20.192 42.770  -9.845  1.00 28.14  ? 330 LEU A CA    1 
ATOM   2721 C  C     . LEU A 1 330 ? -20.517 41.293  -10.015 1.00 27.65  ? 330 LEU A C     1 
ATOM   2722 O  O     . LEU A 1 330 ? -20.033 40.649  -10.940 1.00 27.96  ? 330 LEU A O     1 
ATOM   2723 C  CB    . LEU A 1 330 ? -21.106 43.621  -10.720 1.00 28.79  ? 330 LEU A CB    1 
ATOM   2724 C  CG    . LEU A 1 330 ? -20.737 45.110  -10.725 1.00 30.65  ? 330 LEU A CG    1 
ATOM   2725 C  CD1   . LEU A 1 330 ? -21.326 45.798  -11.912 1.00 32.16  ? 330 LEU A CD1   1 
ATOM   2726 C  CD2   . LEU A 1 330 ? -21.177 45.814  -9.455  1.00 32.61  ? 330 LEU A CD2   1 
ATOM   2727 N  N     . PHE A 1 331 ? -21.321 40.751  -9.108  1.00 27.87  ? 331 PHE A N     1 
ATOM   2728 C  CA    . PHE A 1 331 ? -21.658 39.335  -9.134  1.00 27.58  ? 331 PHE A CA    1 
ATOM   2729 C  C     . PHE A 1 331 ? -23.106 39.107  -8.735  1.00 28.45  ? 331 PHE A C     1 
ATOM   2730 O  O     . PHE A 1 331 ? -23.673 39.860  -7.926  1.00 28.59  ? 331 PHE A O     1 
ATOM   2731 C  CB    . PHE A 1 331 ? -20.742 38.536  -8.206  1.00 27.44  ? 331 PHE A CB    1 
ATOM   2732 C  CG    . PHE A 1 331 ? -19.307 38.532  -8.626  1.00 26.50  ? 331 PHE A CG    1 
ATOM   2733 C  CD1   . PHE A 1 331 ? -18.836 37.576  -9.514  1.00 25.99  ? 331 PHE A CD1   1 
ATOM   2734 C  CD2   . PHE A 1 331 ? -18.426 39.489  -8.132  1.00 26.16  ? 331 PHE A CD2   1 
ATOM   2735 C  CE1   . PHE A 1 331 ? -17.510 37.579  -9.919  1.00 26.79  ? 331 PHE A CE1   1 
ATOM   2736 C  CE2   . PHE A 1 331 ? -17.098 39.501  -8.518  1.00 25.86  ? 331 PHE A CE2   1 
ATOM   2737 C  CZ    . PHE A 1 331 ? -16.635 38.546  -9.416  1.00 27.08  ? 331 PHE A CZ    1 
ATOM   2738 N  N     . GLU A 1 332 ? -23.691 38.064  -9.327  1.00 28.87  ? 332 GLU A N     1 
ATOM   2739 C  CA    . GLU A 1 332 ? -25.034 37.605  -8.989  1.00 29.84  ? 332 GLU A CA    1 
ATOM   2740 C  C     . GLU A 1 332 ? -25.055 36.090  -8.859  1.00 29.32  ? 332 GLU A C     1 
ATOM   2741 O  O     . GLU A 1 332 ? -24.573 35.381  -9.732  1.00 29.22  ? 332 GLU A O     1 
ATOM   2742 C  CB    . GLU A 1 332 ? -26.063 38.058  -10.020 1.00 30.01  ? 332 GLU A CB    1 
ATOM   2743 C  CG    . GLU A 1 332 ? -27.494 38.002  -9.482  1.00 31.93  ? 332 GLU A CG    1 
ATOM   2744 C  CD    . GLU A 1 332 ? -28.560 38.315  -10.524 1.00 33.24  ? 332 GLU A CD    1 
ATOM   2745 O  OE1   . GLU A 1 332 ? -28.291 38.156  -11.747 1.00 35.04  ? 332 GLU A OE1   1 
ATOM   2746 O  OE2   . GLU A 1 332 ? -29.690 38.697  -10.116 1.00 36.68  ? 332 GLU A OE2   1 
ATOM   2747 N  N     . CYS A 1 333 ? -25.605 35.605  -7.749  1.00 29.53  ? 333 CYS A N     1 
ATOM   2748 C  CA    . CYS A 1 333 ? -25.642 34.179  -7.451  1.00 29.34  ? 333 CYS A CA    1 
ATOM   2749 C  C     . CYS A 1 333 ? -27.055 33.724  -7.161  1.00 29.35  ? 333 CYS A C     1 
ATOM   2750 O  O     . CYS A 1 333 ? -27.865 34.483  -6.628  1.00 29.63  ? 333 CYS A O     1 
ATOM   2751 C  CB    . CYS A 1 333 ? -24.750 33.869  -6.259  1.00 29.21  ? 333 CYS A CB    1 
ATOM   2752 S  SG    . CYS A 1 333 ? -23.028 34.267  -6.567  1.00 31.65  ? 333 CYS A SG    1 
ATOM   2753 N  N     . GLN A 1 334 ? -27.350 32.479  -7.515  1.00 29.16  ? 334 GLN A N     1 
ATOM   2754 C  CA    . GLN A 1 334 ? -28.647 31.898  -7.196  1.00 29.46  ? 334 GLN A CA    1 
ATOM   2755 C  C     . GLN A 1 334 ? -28.775 31.569  -5.714  1.00 29.55  ? 334 GLN A C     1 
ATOM   2756 O  O     . GLN A 1 334 ? -29.878 31.515  -5.188  1.00 30.60  ? 334 GLN A O     1 
ATOM   2757 C  CB    . GLN A 1 334 ? -28.909 30.654  -8.041  1.00 29.67  ? 334 GLN A CB    1 
ATOM   2758 C  CG    . GLN A 1 334 ? -28.918 30.948  -9.526  1.00 29.62  ? 334 GLN A CG    1 
ATOM   2759 C  CD    . GLN A 1 334 ? -29.444 29.805  -10.358 1.00 30.61  ? 334 GLN A CD    1 
ATOM   2760 O  OE1   . GLN A 1 334 ? -29.166 29.733  -11.533 1.00 32.07  ? 334 GLN A OE1   1 
ATOM   2761 N  NE2   . GLN A 1 334 ? -30.217 28.920  -9.758  1.00 32.13  ? 334 GLN A NE2   1 
ATOM   2762 N  N     . ILE A 1 335 ? -27.647 31.359  -5.047  1.00 29.01  ? 335 ILE A N     1 
ATOM   2763 C  CA    . ILE A 1 335 ? -27.644 30.918  -3.671  1.00 29.34  ? 335 ILE A CA    1 
ATOM   2764 C  C     . ILE A 1 335 ? -27.230 32.065  -2.779  1.00 30.08  ? 335 ILE A C     1 
ATOM   2765 O  O     . ILE A 1 335 ? -26.114 32.561  -2.879  1.00 30.12  ? 335 ILE A O     1 
ATOM   2766 C  CB    . ILE A 1 335 ? -26.669 29.763  -3.480  1.00 29.24  ? 335 ILE A CB    1 
ATOM   2767 C  CG1   . ILE A 1 335 ? -27.082 28.553  -4.340  1.00 28.67  ? 335 ILE A CG1   1 
ATOM   2768 C  CG2   . ILE A 1 335 ? -26.529 29.418  -1.993  1.00 30.10  ? 335 ILE A CG2   1 
ATOM   2769 C  CD1   . ILE A 1 335 ? -28.519 28.108  -4.179  1.00 26.37  ? 335 ILE A CD1   1 
ATOM   2770 N  N     . LYS A 1 336 ? -28.128 32.500  -1.907  1.00 31.20  ? 336 LYS A N     1 
ATOM   2771 C  CA    . LYS A 1 336 ? -27.802 33.576  -0.993  1.00 31.93  ? 336 LYS A CA    1 
ATOM   2772 C  C     . LYS A 1 336 ? -27.124 33.007  0.236   1.00 33.04  ? 336 LYS A C     1 
ATOM   2773 O  O     . LYS A 1 336 ? -26.333 33.685  0.906   1.00 33.73  ? 336 LYS A O     1 
ATOM   2774 C  CB    . LYS A 1 336 ? -29.051 34.351  -0.605  1.00 32.45  ? 336 LYS A CB    1 
ATOM   2775 C  CG    . LYS A 1 336 ? -29.606 35.186  -1.744  1.00 33.13  ? 336 LYS A CG    1 
ATOM   2776 C  CD    . LYS A 1 336 ? -31.098 35.431  -1.580  1.00 36.09  ? 336 LYS A CD    1 
ATOM   2777 C  CE    . LYS A 1 336 ? -31.346 36.621  -0.698  1.00 39.15  ? 336 LYS A CE    1 
ATOM   2778 N  NZ    . LYS A 1 336 ? -32.689 37.189  -0.987  1.00 43.21  ? 336 LYS A NZ    1 
ATOM   2779 N  N     . GLU A 1 337 ? -27.426 31.750  0.522   1.00 33.76  ? 337 GLU A N     1 
ATOM   2780 C  CA    . GLU A 1 337 ? -26.972 31.129  1.740   1.00 34.88  ? 337 GLU A CA    1 
ATOM   2781 C  C     . GLU A 1 337 ? -27.027 29.628  1.552   1.00 34.96  ? 337 GLU A C     1 
ATOM   2782 O  O     . GLU A 1 337 ? -28.059 29.079  1.164   1.00 35.41  ? 337 GLU A O     1 
ATOM   2783 C  CB    . GLU A 1 337 ? -27.845 31.593  2.913   1.00 36.18  ? 337 GLU A CB    1 
ATOM   2784 C  CG    . GLU A 1 337 ? -27.680 30.817  4.197   1.00 40.19  ? 337 GLU A CG    1 
ATOM   2785 C  CD    . GLU A 1 337 ? -28.075 31.629  5.430   1.00 45.82  ? 337 GLU A CD    1 
ATOM   2786 O  OE1   . GLU A 1 337 ? -29.295 31.861  5.632   1.00 48.13  ? 337 GLU A OE1   1 
ATOM   2787 O  OE2   . GLU A 1 337 ? -27.159 32.024  6.203   1.00 46.99  ? 337 GLU A OE2   1 
ATOM   2788 N  N     . ILE A 1 338 ? -25.894 28.978  1.790   1.00 34.79  ? 338 ILE A N     1 
ATOM   2789 C  CA    . ILE A 1 338 ? -25.808 27.529  1.739   1.00 35.21  ? 338 ILE A CA    1 
ATOM   2790 C  C     . ILE A 1 338 ? -25.767 27.004  3.163   1.00 36.66  ? 338 ILE A C     1 
ATOM   2791 O  O     . ILE A 1 338 ? -25.479 27.754  4.092   1.00 36.92  ? 338 ILE A O     1 
ATOM   2792 C  CB    . ILE A 1 338 ? -24.583 27.053  0.906   1.00 34.60  ? 338 ILE A CB    1 
ATOM   2793 C  CG1   . ILE A 1 338 ? -24.643 25.548  0.645   1.00 34.99  ? 338 ILE A CG1   1 
ATOM   2794 C  CG2   . ILE A 1 338 ? -23.282 27.442  1.571   1.00 34.53  ? 338 ILE A CG2   1 
ATOM   2795 C  CD1   . ILE A 1 338 ? -24.147 25.142  -0.717  1.00 34.31  ? 338 ILE A CD1   1 
ATOM   2796 N  N     . SER A 1 339 ? -26.080 25.723  3.338   1.00 38.02  ? 339 SER A N     1 
ATOM   2797 C  CA    . SER A 1 339 ? -25.964 25.078  4.635   1.00 39.71  ? 339 SER A CA    1 
ATOM   2798 C  C     . SER A 1 339 ? -24.516 25.080  5.093   1.00 40.39  ? 339 SER A C     1 
ATOM   2799 O  O     . SER A 1 339 ? -23.621 25.529  4.382   1.00 39.01  ? 339 SER A O     1 
ATOM   2800 C  CB    . SER A 1 339 ? -26.461 23.646  4.551   1.00 40.72  ? 339 SER A CB    1 
ATOM   2801 O  OG    . SER A 1 339 ? -25.647 22.897  3.674   1.00 40.63  ? 339 SER A OG    1 
ATOM   2802 N  N     . ARG A 1 340 ? -24.284 24.556  6.282   1.00 33.78  ? 340 ARG A N     1 
ATOM   2803 C  CA    . ARG A 1 340 ? -22.947 24.550  6.827   1.00 36.50  ? 340 ARG A CA    1 
ATOM   2804 C  C     . ARG A 1 340 ? -22.287 23.188  6.594   1.00 37.05  ? 340 ARG A C     1 
ATOM   2805 O  O     . ARG A 1 340 ? -21.098 23.128  6.267   1.00 38.06  ? 340 ARG A O     1 
ATOM   2806 C  CB    . ARG A 1 340 ? -22.984 24.939  8.302   1.00 39.10  ? 340 ARG A CB    1 
ATOM   2807 C  CG    . ARG A 1 340 ? -21.828 25.792  8.734   1.00 42.85  ? 340 ARG A CG    1 
ATOM   2808 C  CD    . ARG A 1 340 ? -22.094 26.474  10.074  1.00 48.09  ? 340 ARG A CD    1 
ATOM   2809 N  NE    . ARG A 1 340 ? -20.998 27.381  10.426  1.00 52.71  ? 340 ARG A NE    1 
ATOM   2810 C  CZ    . ARG A 1 340 ? -20.894 28.650  10.026  1.00 52.62  ? 340 ARG A CZ    1 
ATOM   2811 N  NH1   . ARG A 1 340 ? -21.829 29.199  9.266   1.00 50.11  ? 340 ARG A NH1   1 
ATOM   2812 N  NH2   . ARG A 1 340 ? -19.853 29.381  10.402  1.00 56.08  ? 340 ARG A NH2   1 
ATOM   2813 N  N     . VAL A 1 341 ? -23.060 22.106  6.740   1.00 36.99  ? 341 VAL A N     1 
ATOM   2814 C  CA    . VAL A 1 341 ? -22.563 20.753  6.435   1.00 37.43  ? 341 VAL A CA    1 
ATOM   2815 C  C     . VAL A 1 341 ? -22.557 20.496  4.951   1.00 36.29  ? 341 VAL A C     1 
ATOM   2816 O  O     . VAL A 1 341 ? -23.362 21.060  4.211   1.00 35.52  ? 341 VAL A O     1 
ATOM   2817 C  CB    . VAL A 1 341 ? -23.393 19.606  7.077   1.00 37.66  ? 341 VAL A CB    1 
ATOM   2818 C  CG1   . VAL A 1 341 ? -23.131 19.517  8.555   1.00 40.85  ? 341 VAL A CG1   1 
ATOM   2819 C  CG2   . VAL A 1 341 ? -24.870 19.764  6.801   1.00 36.57  ? 341 VAL A CG2   1 
ATOM   2820 N  N     . PHE A 1 342 ? -21.648 19.634  4.526   1.00 37.13  ? 342 PHE A N     1 
ATOM   2821 C  CA    . PHE A 1 342 ? -21.659 19.118  3.174   1.00 37.11  ? 342 PHE A CA    1 
ATOM   2822 C  C     . PHE A 1 342 ? -21.048 17.736  3.236   1.00 39.07  ? 342 PHE A C     1 
ATOM   2823 O  O     . PHE A 1 342 ? -20.508 17.350  4.275   1.00 40.15  ? 342 PHE A O     1 
ATOM   2824 C  CB    . PHE A 1 342 ? -20.888 20.037  2.221   1.00 37.46  ? 342 PHE A CB    1 
ATOM   2825 C  CG    . PHE A 1 342 ? -19.413 20.177  2.539   1.00 38.67  ? 342 PHE A CG    1 
ATOM   2826 C  CD1   . PHE A 1 342 ? -18.459 19.586  1.720   1.00 39.24  ? 342 PHE A CD1   1 
ATOM   2827 C  CD2   . PHE A 1 342 ? -18.985 20.919  3.638   1.00 39.77  ? 342 PHE A CD2   1 
ATOM   2828 C  CE1   . PHE A 1 342 ? -17.105 19.727  1.993   1.00 42.82  ? 342 PHE A CE1   1 
ATOM   2829 C  CE2   . PHE A 1 342 ? -17.631 21.057  3.932   1.00 42.65  ? 342 PHE A CE2   1 
ATOM   2830 C  CZ    . PHE A 1 342 ? -16.686 20.462  3.106   1.00 44.42  ? 342 PHE A CZ    1 
ATOM   2831 N  N     . ARG A 1 343 ? -21.144 16.985  2.145   1.00 40.29  ? 343 ARG A N     1 
ATOM   2832 C  CA    . ARG A 1 343 ? -20.541 15.663  2.101   1.00 42.92  ? 343 ARG A CA    1 
ATOM   2833 C  C     . ARG A 1 343 ? -19.236 15.614  1.313   1.00 45.41  ? 343 ARG A C     1 
ATOM   2834 O  O     . ARG A 1 343 ? -19.130 16.139  0.202   1.00 46.06  ? 343 ARG A O     1 
ATOM   2835 C  CB    . ARG A 1 343 ? -21.532 14.591  1.630   1.00 42.81  ? 343 ARG A CB    1 
ATOM   2836 C  CG    . ARG A 1 343 ? -22.479 14.994  0.510   1.00 43.25  ? 343 ARG A CG    1 
ATOM   2837 C  CD    . ARG A 1 343 ? -23.585 13.947  0.344   1.00 43.72  ? 343 ARG A CD    1 
ATOM   2838 N  NE    . ARG A 1 343 ? -23.079 12.711  -0.248  1.00 46.65  ? 343 ARG A NE    1 
ATOM   2839 C  CZ    . ARG A 1 343 ? -23.751 11.562  -0.299  1.00 48.98  ? 343 ARG A CZ    1 
ATOM   2840 N  NH1   . ARG A 1 343 ? -24.973 11.466  0.212   1.00 48.61  ? 343 ARG A NH1   1 
ATOM   2841 N  NH2   . ARG A 1 343 ? -23.196 10.497  -0.863  1.00 51.01  ? 343 ARG A NH2   1 
ATOM   2842 N  N     . ARG A 1 344 ? -18.240 14.992  1.933   1.00 48.01  ? 344 ARG A N     1 
ATOM   2843 C  CA    . ARG A 1 344 ? -16.950 14.724  1.324   1.00 51.30  ? 344 ARG A CA    1 
ATOM   2844 C  C     . ARG A 1 344 ? -16.906 13.238  0.972   1.00 52.76  ? 344 ARG A C     1 
ATOM   2845 O  O     . ARG A 1 344 ? -17.189 12.381  1.813   1.00 52.56  ? 344 ARG A O     1 
ATOM   2846 C  CB    . ARG A 1 344 ? -15.842 15.087  2.314   1.00 53.46  ? 344 ARG A CB    1 
ATOM   2847 C  CG    . ARG A 1 344 ? -14.417 14.977  1.786   1.00 58.30  ? 344 ARG A CG    1 
ATOM   2848 C  CD    . ARG A 1 344 ? -13.482 15.910  2.551   1.00 62.39  ? 344 ARG A CD    1 
ATOM   2849 N  NE    . ARG A 1 344 ? -13.671 17.307  2.147   1.00 62.91  ? 344 ARG A NE    1 
ATOM   2850 C  CZ    . ARG A 1 344 ? -13.111 18.356  2.747   1.00 65.21  ? 344 ARG A CZ    1 
ATOM   2851 N  NH1   . ARG A 1 344 ? -12.321 18.194  3.803   1.00 68.53  ? 344 ARG A NH1   1 
ATOM   2852 N  NH2   . ARG A 1 344 ? -13.351 19.579  2.293   1.00 64.59  ? 344 ARG A NH2   1 
ATOM   2853 N  N     . MET A 1 345 ? -16.575 12.935  -0.278  1.00 54.86  ? 345 MET A N     1 
ATOM   2854 C  CA    . MET A 1 345 ? -16.475 11.550  -0.725  1.00 57.04  ? 345 MET A CA    1 
ATOM   2855 C  C     . MET A 1 345 ? -15.292 10.850  -0.067  1.00 59.30  ? 345 MET A C     1 
ATOM   2856 O  O     . MET A 1 345 ? -14.241 11.456  0.118   1.00 61.22  ? 345 MET A O     1 
ATOM   2857 C  CB    . MET A 1 345 ? -16.376 11.487  -2.248  1.00 58.93  ? 345 MET A CB    1 
ATOM   2858 C  CG    . MET A 1 345 ? -15.670 10.268  -2.780  1.00 62.49  ? 345 MET A CG    1 
ATOM   2859 S  SD    . MET A 1 345 ? -16.322 9.798   -4.378  1.00 65.63  ? 345 MET A SD    1 
ATOM   2860 C  CE    . MET A 1 345 ? -14.811 9.440   -5.294  1.00 70.48  ? 345 MET A CE    1 
ATOM   2861 N  N     . GLY A 1 346 ? -15.482 9.582   0.295   1.00 59.74  ? 346 GLY A N     1 
ATOM   2862 C  CA    . GLY A 1 346 ? -14.424 8.778   0.896   1.00 62.23  ? 346 GLY A CA    1 
ATOM   2863 C  C     . GLY A 1 346 ? -14.079 7.554   0.069   1.00 64.87  ? 346 GLY A C     1 
ATOM   2864 O  O     . GLY A 1 346 ? -14.599 7.381   -1.037  1.00 64.78  ? 346 GLY A O     1 
ATOM   2865 N  N     . PRO A 1 347 ? -13.184 6.698   0.599   1.00 67.71  ? 347 PRO A N     1 
ATOM   2866 C  CA    . PRO A 1 347 ? -12.760 5.480   -0.086  1.00 70.74  ? 347 PRO A CA    1 
ATOM   2867 C  C     . PRO A 1 347 ? -13.836 4.402   -0.118  1.00 69.62  ? 347 PRO A C     1 
ATOM   2868 O  O     . PRO A 1 347 ? -14.795 4.436   0.667   1.00 66.62  ? 347 PRO A O     1 
ATOM   2869 C  CB    . PRO A 1 347 ? -11.575 5.000   0.754   1.00 73.81  ? 347 PRO A CB    1 
ATOM   2870 C  CG    . PRO A 1 347 ? -11.801 5.565   2.091   1.00 71.78  ? 347 PRO A CG    1 
ATOM   2871 C  CD    . PRO A 1 347 ? -12.508 6.861   1.900   1.00 68.65  ? 347 PRO A CD    1 
ATOM   2872 N  N     . GLN A 1 348 ? -13.658 3.454   -1.031  1.00 72.57  ? 348 GLN A N     1 
ATOM   2873 C  CA    . GLN A 1 348 ? -14.540 2.304   -1.146  1.00 72.63  ? 348 GLN A CA    1 
ATOM   2874 C  C     . GLN A 1 348 ? -14.232 1.362   0.008   1.00 73.56  ? 348 GLN A C     1 
ATOM   2875 O  O     . GLN A 1 348 ? -13.065 1.128   0.319   1.00 76.31  ? 348 GLN A O     1 
ATOM   2876 C  CB    . GLN A 1 348 ? -14.331 1.618   -2.495  1.00 75.99  ? 348 GLN A CB    1 
ATOM   2877 C  CG    . GLN A 1 348 ? -14.204 2.602   -3.662  1.00 76.96  ? 348 GLN A CG    1 
ATOM   2878 C  CD    . GLN A 1 348 ? -14.517 1.983   -5.010  1.00 80.15  ? 348 GLN A CD    1 
ATOM   2879 O  OE1   . GLN A 1 348 ? -14.078 0.874   -5.315  1.00 84.14  ? 348 GLN A OE1   1 
ATOM   2880 N  NE2   . GLN A 1 348 ? -15.277 2.704   -5.830  1.00 78.93  ? 348 GLN A NE2   1 
ATOM   2881 N  N     . PHE A 1 349 ? -15.279 0.840   0.648   1.00 72.07  ? 349 PHE A N     1 
ATOM   2882 C  CA    . PHE A 1 349 ? -15.142 0.012   1.855   1.00 73.04  ? 349 PHE A CA    1 
ATOM   2883 C  C     . PHE A 1 349 ? -14.096 -1.088  1.689   1.00 77.23  ? 349 PHE A C     1 
ATOM   2884 O  O     . PHE A 1 349 ? -13.582 -1.615  2.680   1.00 78.63  ? 349 PHE A O     1 
ATOM   2885 C  CB    . PHE A 1 349 ? -16.488 -0.614  2.234   1.00 71.43  ? 349 PHE A CB    1 
ATOM   2886 C  CG    . PHE A 1 349 ? -16.854 -1.806  1.395   1.00 73.55  ? 349 PHE A CG    1 
ATOM   2887 C  CD1   . PHE A 1 349 ? -16.573 -3.101  1.841   1.00 75.76  ? 349 PHE A CD1   1 
ATOM   2888 C  CD2   . PHE A 1 349 ? -17.457 -1.636  0.148   1.00 73.75  ? 349 PHE A CD2   1 
ATOM   2889 C  CE1   . PHE A 1 349 ? -16.892 -4.211  1.065   1.00 78.00  ? 349 PHE A CE1   1 
ATOM   2890 C  CE2   . PHE A 1 349 ? -17.787 -2.734  -0.635  1.00 76.54  ? 349 PHE A CE2   1 
ATOM   2891 C  CZ    . PHE A 1 349 ? -17.503 -4.030  -0.177  1.00 78.76  ? 349 PHE A CZ    1 
ATOM   2892 N  N     . GLU A 1 350 ? -13.814 -1.434  0.431   1.00 79.82  ? 350 GLU A N     1 
ATOM   2893 C  CA    . GLU A 1 350 ? -12.813 -2.437  0.070   1.00 84.68  ? 350 GLU A CA    1 
ATOM   2894 C  C     . GLU A 1 350 ? -11.512 -2.239  0.846   1.00 87.14  ? 350 GLU A C     1 
ATOM   2895 O  O     . GLU A 1 350 ? -11.327 -2.864  1.896   1.00 87.91  ? 350 GLU A O     1 
ATOM   2896 C  CB    . GLU A 1 350 ? -12.537 -2.431  -1.446  1.00 87.41  ? 350 GLU A CB    1 
ATOM   2897 C  CG    . GLU A 1 350 ? -13.774 -2.300  -2.344  1.00 86.28  ? 350 GLU A CG    1 
ATOM   2898 C  CD    . GLU A 1 350 ? -14.690 -3.515  -2.307  1.00 86.90  ? 350 GLU A CD    1 
ATOM   2899 O  OE1   . GLU A 1 350 ? -15.755 -3.472  -2.963  1.00 86.17  ? 350 GLU A OE1   1 
ATOM   2900 O  OE2   . GLU A 1 350 ? -14.352 -4.509  -1.629  1.00 88.11  ? 350 GLU A OE2   1 
ATOM   2901 N  N     . ASP A 1 351 ? -10.632 -1.364  0.347   1.00 88.91  ? 351 ASP A N     1 
ATOM   2902 C  CA    . ASP A 1 351 ? -9.307  -1.166  0.957   1.00 92.60  ? 351 ASP A CA    1 
ATOM   2903 C  C     . ASP A 1 351 ? -9.379  -0.457  2.311   1.00 90.62  ? 351 ASP A C     1 
ATOM   2904 O  O     . ASP A 1 351 ? -9.777  0.702   2.404   1.00 87.45  ? 351 ASP A O     1 
ATOM   2905 C  CB    . ASP A 1 351 ? -8.323  -0.468  0.000   1.00 95.89  ? 351 ASP A CB    1 
ATOM   2906 C  CG    . ASP A 1 351 ? -8.853  0.850   -0.534  1.00 93.19  ? 351 ASP A CG    1 
ATOM   2907 O  OD1   . ASP A 1 351 ? -10.047 0.906   -0.897  1.00 90.96  ? 351 ASP A OD1   1 
ATOM   2908 O  OD2   . ASP A 1 351 ? -8.078  1.828   -0.597  1.00 93.87  ? 351 ASP A OD2   1 
ATOM   2909 N  N     . GLU A 1 352 ? -9.000  -1.193  3.355   1.00 92.94  ? 352 GLU A N     1 
ATOM   2910 C  CA    . GLU A 1 352 ? -9.056  -0.711  4.736   1.00 92.32  ? 352 GLU A CA    1 
ATOM   2911 C  C     . GLU A 1 352 ? -8.041  0.392   4.991   1.00 94.60  ? 352 GLU A C     1 
ATOM   2912 O  O     . GLU A 1 352 ? -8.356  1.375   5.664   1.00 92.66  ? 352 GLU A O     1 
ATOM   2913 C  CB    . GLU A 1 352 ? -8.868  -1.865  5.742   1.00 94.83  ? 352 GLU A CB    1 
ATOM   2914 C  CG    . GLU A 1 352 ? -7.674  -2.781  5.479   1.00 100.25 ? 352 GLU A CG    1 
ATOM   2915 C  CD    . GLU A 1 352 ? -7.724  -4.069  6.295   1.00 102.66 ? 352 GLU A CD    1 
ATOM   2916 O  OE1   . GLU A 1 352 ? -8.679  -4.237  7.090   1.00 100.00 ? 352 GLU A OE1   1 
ATOM   2917 O  OE2   . GLU A 1 352 ? -6.807  -4.914  6.139   1.00 106.65 ? 352 GLU A OE2   1 
ATOM   2918 N  N     . ARG A 1 353 ? -6.839  0.221   4.431   1.00 99.06  ? 353 ARG A N     1 
ATOM   2919 C  CA    . ARG A 1 353 ? -5.714  1.137   4.622   1.00 102.67 ? 353 ARG A CA    1 
ATOM   2920 C  C     . ARG A 1 353 ? -6.168  2.596   4.525   1.00 98.99  ? 353 ARG A C     1 
ATOM   2921 O  O     . ARG A 1 353 ? -5.920  3.394   5.430   1.00 99.84  ? 353 ARG A O     1 
ATOM   2922 C  CB    . ARG A 1 353 ? -4.622  0.845   3.587   1.00 107.67 ? 353 ARG A CB    1 
ATOM   2923 C  CG    . ARG A 1 353 ? -3.219  0.646   4.162   1.00 115.04 ? 353 ARG A CG    1 
ATOM   2924 C  CD    . ARG A 1 353 ? -2.910  -0.836  4.405   1.00 118.62 ? 353 ARG A CD    1 
ATOM   2925 N  NE    . ARG A 1 353 ? -1.488  -1.068  4.667   1.00 126.58 ? 353 ARG A NE    1 
ATOM   2926 C  CZ    . ARG A 1 353 ? -0.881  -2.253  4.581   1.00 131.02 ? 353 ARG A CZ    1 
ATOM   2927 N  NH1   . ARG A 1 353 ? -1.563  -3.336  4.229   1.00 128.68 ? 353 ARG A NH1   1 
ATOM   2928 N  NH2   . ARG A 1 353 ? 0.415   -2.355  4.843   1.00 137.77 ? 353 ARG A NH2   1 
ATOM   2929 N  N     . ASN A 1 354 ? -6.853  2.921   3.432   1.00 95.23  ? 354 ASN A N     1 
ATOM   2930 C  CA    . ASN A 1 354 ? -7.429  4.247   3.222   1.00 91.49  ? 354 ASN A CA    1 
ATOM   2931 C  C     . ASN A 1 354 ? -8.625  4.566   4.125   1.00 86.52  ? 354 ASN A C     1 
ATOM   2932 O  O     . ASN A 1 354 ? -8.718  5.670   4.666   1.00 85.55  ? 354 ASN A O     1 
ATOM   2933 C  CB    . ASN A 1 354 ? -7.822  4.417   1.754   1.00 90.07  ? 354 ASN A CB    1 
ATOM   2934 C  CG    . ASN A 1 354 ? -6.643  4.787   0.875   1.00 95.16  ? 354 ASN A CG    1 
ATOM   2935 O  OD1   . ASN A 1 354 ? -6.011  5.824   1.072   1.00 97.21  ? 354 ASN A OD1   1 
ATOM   2936 N  ND2   . ASN A 1 354 ? -6.349  3.946   -0.108  1.00 98.08  ? 354 ASN A ND2   1 
ATOM   2937 N  N     . VAL A 1 355 ? -9.533  3.600   4.274   1.00 83.86  ? 355 VAL A N     1 
ATOM   2938 C  CA    . VAL A 1 355 ? -10.687 3.731   5.163   1.00 79.86  ? 355 VAL A CA    1 
ATOM   2939 C  C     . VAL A 1 355 ? -10.230 4.065   6.585   1.00 81.93  ? 355 VAL A C     1 
ATOM   2940 O  O     . VAL A 1 355 ? -10.778 4.971   7.215   1.00 79.94  ? 355 VAL A O     1 
ATOM   2941 C  CB    . VAL A 1 355 ? -11.578 2.453   5.157   1.00 78.53  ? 355 VAL A CB    1 
ATOM   2942 C  CG1   . VAL A 1 355 ? -12.695 2.559   6.186   1.00 75.71  ? 355 VAL A CG1   1 
ATOM   2943 C  CG2   . VAL A 1 355 ? -12.176 2.214   3.779   1.00 76.55  ? 355 VAL A CG2   1 
ATOM   2944 N  N     . LYS A 1 356 ? -9.219  3.343   7.070   1.00 86.32  ? 356 LYS A N     1 
ATOM   2945 C  CA    . LYS A 1 356 ? -8.622  3.606   8.380   1.00 89.86  ? 356 LYS A CA    1 
ATOM   2946 C  C     . LYS A 1 356 ? -8.258  5.083   8.576   1.00 90.27  ? 356 LYS A C     1 
ATOM   2947 O  O     . LYS A 1 356 ? -8.741  5.712   9.523   1.00 89.56  ? 356 LYS A O     1 
ATOM   2948 C  CB    . LYS A 1 356 ? -7.395  2.714   8.623   1.00 95.85  ? 356 LYS A CB    1 
ATOM   2949 C  CG    . LYS A 1 356 ? -7.720  1.267   9.023   1.00 96.74  ? 356 LYS A CG    1 
ATOM   2950 C  CD    . LYS A 1 356 ? -6.470  0.493   9.485   1.00 103.21 ? 356 LYS A CD    1 
ATOM   2951 C  CE    . LYS A 1 356 ? -5.616  0.018   8.306   1.00 105.87 ? 356 LYS A CE    1 
ATOM   2952 N  NZ    . LYS A 1 356 ? -4.236  -0.404  8.696   1.00 112.45 ? 356 LYS A NZ    1 
ATOM   2953 N  N     . LYS A 1 357 ? -7.436  5.641   7.682   1.00 91.61  ? 357 LYS A N     1 
ATOM   2954 C  CA    . LYS A 1 357 ? -7.006  7.041   7.817   1.00 92.56  ? 357 LYS A CA    1 
ATOM   2955 C  C     . LYS A 1 357 ? -8.098  8.055   7.505   1.00 86.82  ? 357 LYS A C     1 
ATOM   2956 O  O     . LYS A 1 357 ? -8.030  9.198   7.955   1.00 87.19  ? 357 LYS A O     1 
ATOM   2957 C  CB    . LYS A 1 357 ? -5.717  7.343   7.036   1.00 97.17  ? 357 LYS A CB    1 
ATOM   2958 C  CG    . LYS A 1 357 ? -4.450  6.942   7.804   1.00 104.46 ? 357 LYS A CG    1 
ATOM   2959 C  CD    . LYS A 1 357 ? -3.348  8.003   7.757   1.00 109.18 ? 357 LYS A CD    1 
ATOM   2960 C  CE    . LYS A 1 357 ? -2.245  7.669   8.766   1.00 116.77 ? 357 LYS A CE    1 
ATOM   2961 N  NZ    . LYS A 1 357 ? -1.034  8.518   8.623   1.00 123.06 ? 357 LYS A NZ    1 
ATOM   2962 N  N     . PHE A 1 358 ? -9.105  7.631   6.748   1.00 82.06  ? 358 PHE A N     1 
ATOM   2963 C  CA    . PHE A 1 358 ? -10.287 8.453   6.505   1.00 76.86  ? 358 PHE A CA    1 
ATOM   2964 C  C     . PHE A 1 358 ? -11.099 8.632   7.795   1.00 75.62  ? 358 PHE A C     1 
ATOM   2965 O  O     . PHE A 1 358 ? -11.516 9.743   8.118   1.00 74.15  ? 358 PHE A O     1 
ATOM   2966 C  CB    . PHE A 1 358 ? -11.137 7.851   5.378   1.00 73.28  ? 358 PHE A CB    1 
ATOM   2967 C  CG    . PHE A 1 358 ? -12.340 8.686   4.989   1.00 68.82  ? 358 PHE A CG    1 
ATOM   2968 C  CD1   . PHE A 1 358 ? -12.182 9.906   4.326   1.00 68.22  ? 358 PHE A CD1   1 
ATOM   2969 C  CD2   . PHE A 1 358 ? -13.632 8.235   5.259   1.00 65.20  ? 358 PHE A CD2   1 
ATOM   2970 C  CE1   . PHE A 1 358 ? -13.292 10.674  3.958   1.00 63.81  ? 358 PHE A CE1   1 
ATOM   2971 C  CE2   . PHE A 1 358 ? -14.744 8.990   4.892   1.00 61.49  ? 358 PHE A CE2   1 
ATOM   2972 C  CZ    . PHE A 1 358 ? -14.574 10.213  4.243   1.00 61.06  ? 358 PHE A CZ    1 
ATOM   2973 N  N     . LEU A 1 359 ? -11.295 7.545   8.540   1.00 76.78  ? 359 LEU A N     1 
ATOM   2974 C  CA    . LEU A 1 359 ? -12.069 7.586   9.787   1.00 76.52  ? 359 LEU A CA    1 
ATOM   2975 C  C     . LEU A 1 359 ? -11.256 8.078   10.985  1.00 81.38  ? 359 LEU A C     1 
ATOM   2976 O  O     . LEU A 1 359 ? -11.821 8.422   12.021  1.00 81.91  ? 359 LEU A O     1 
ATOM   2977 C  CB    . LEU A 1 359 ? -12.676 6.213   10.104  1.00 76.25  ? 359 LEU A CB    1 
ATOM   2978 C  CG    . LEU A 1 359 ? -13.556 5.502   9.067   1.00 72.92  ? 359 LEU A CG    1 
ATOM   2979 C  CD1   . LEU A 1 359 ? -14.085 4.194   9.637   1.00 74.23  ? 359 LEU A CD1   1 
ATOM   2980 C  CD2   . LEU A 1 359 ? -14.716 6.366   8.590   1.00 68.71  ? 359 LEU A CD2   1 
ATOM   2981 N  N     . SER A 1 360 ? -9.934  8.108   10.837  1.00 85.64  ? 360 SER A N     1 
ATOM   2982 C  CA    . SER A 1 360 ? -9.031  8.571   11.893  1.00 91.56  ? 360 SER A CA    1 
ATOM   2983 C  C     . SER A 1 360 ? -9.219  10.042  12.254  1.00 91.22  ? 360 SER A C     1 
ATOM   2984 O  O     . SER A 1 360 ? -8.766  10.493  13.309  1.00 95.84  ? 360 SER A O     1 
ATOM   2985 C  CB    . SER A 1 360 ? -7.586  8.345   11.470  1.00 96.57  ? 360 SER A CB    1 
ATOM   2986 O  OG    . SER A 1 360 ? -7.364  6.975   11.201  1.00 98.31  ? 360 SER A OG    1 
ATOM   2987 N  N     . ARG A 1 361 ? -9.885  10.776  11.365  1.00 86.04  ? 361 ARG A N     1 
ATOM   2988 C  CA    . ARG A 1 361 ? -10.118 12.202  11.528  1.00 85.15  ? 361 ARG A CA    1 
ATOM   2989 C  C     . ARG A 1 361 ? -11.186 12.491  12.577  1.00 83.93  ? 361 ARG A C     1 
ATOM   2990 O  O     . ARG A 1 361 ? -12.121 11.709  12.760  1.00 81.45  ? 361 ARG A O     1 
ATOM   2991 C  CB    . ARG A 1 361 ? -10.537 12.811  10.190  1.00 80.32  ? 361 ARG A CB    1 
ATOM   2992 C  CG    . ARG A 1 361 ? -9.423  12.919  9.163   1.00 82.73  ? 361 ARG A CG    1 
ATOM   2993 C  CD    . ARG A 1 361 ? -8.535  14.114  9.454   1.00 87.69  ? 361 ARG A CD    1 
ATOM   2994 N  NE    . ARG A 1 361 ? -8.448  14.991  8.290   1.00 86.39  ? 361 ARG A NE    1 
ATOM   2995 C  CZ    . ARG A 1 361 ? -8.065  16.264  8.329   1.00 88.52  ? 361 ARG A CZ    1 
ATOM   2996 N  NH1   . ARG A 1 361 ? -7.721  16.834  9.479   1.00 92.91  ? 361 ARG A NH1   1 
ATOM   2997 N  NH2   . ARG A 1 361 ? -8.026  16.972  7.209   1.00 86.71  ? 361 ARG A NH2   1 
ATOM   2998 N  N     . ASN A 1 362 ? -11.038 13.620  13.262  1.00 86.21  ? 362 ASN A N     1 
ATOM   2999 C  CA    . ASN A 1 362 ? -12.021 14.059  14.241  1.00 85.58  ? 362 ASN A CA    1 
ATOM   3000 C  C     . ASN A 1 362 ? -13.114 14.847  13.535  1.00 79.51  ? 362 ASN A C     1 
ATOM   3001 O  O     . ASN A 1 362 ? -12.869 15.956  13.058  1.00 79.05  ? 362 ASN A O     1 
ATOM   3002 C  CB    . ASN A 1 362 ? -11.347 14.933  15.309  1.00 91.82  ? 362 ASN A CB    1 
ATOM   3003 C  CG    . ASN A 1 362 ? -11.827 14.625  16.727  1.00 95.37  ? 362 ASN A CG    1 
ATOM   3004 O  OD1   . ASN A 1 362 ? -11.058 14.731  17.681  1.00 101.28 ? 362 ASN A OD1   1 
ATOM   3005 N  ND2   . ASN A 1 362 ? -13.095 14.248  16.868  1.00 91.57  ? 362 ASN A ND2   1 
ATOM   3006 N  N     . ARG A 1 363 ? -14.305 14.265  13.430  1.00 75.28  ? 363 ARG A N     1 
ATOM   3007 C  CA    . ARG A 1 363 ? -15.472 15.012  12.945  1.00 70.30  ? 363 ARG A CA    1 
ATOM   3008 C  C     . ARG A 1 363 ? -16.640 14.965  13.916  1.00 70.17  ? 363 ARG A C     1 
ATOM   3009 O  O     . ARG A 1 363 ? -16.679 14.133  14.821  1.00 73.11  ? 363 ARG A O     1 
ATOM   3010 C  CB    . ARG A 1 363 ? -15.898 14.620  11.520  1.00 65.30  ? 363 ARG A CB    1 
ATOM   3011 C  CG    . ARG A 1 363 ? -15.239 13.379  10.951  1.00 66.50  ? 363 ARG A CG    1 
ATOM   3012 C  CD    . ARG A 1 363 ? -15.158 13.472  9.430   1.00 63.95  ? 363 ARG A CD    1 
ATOM   3013 N  NE    . ARG A 1 363 ? -14.118 12.597  8.885   1.00 66.94  ? 363 ARG A NE    1 
ATOM   3014 C  CZ    . ARG A 1 363 ? -13.550 12.745  7.689   1.00 66.78  ? 363 ARG A CZ    1 
ATOM   3015 N  NH1   . ARG A 1 363 ? -13.908 13.740  6.888   1.00 64.92  ? 363 ARG A NH1   1 
ATOM   3016 N  NH2   . ARG A 1 363 ? -12.611 11.899  7.290   1.00 68.72  ? 363 ARG A NH2   1 
ATOM   3017 N  N     . ALA A 1 364 ? -17.580 15.884  13.730  1.00 67.27  ? 364 ALA A N     1 
ATOM   3018 C  CA    . ALA A 1 364 ? -18.689 16.039  14.656  1.00 67.98  ? 364 ALA A CA    1 
ATOM   3019 C  C     . ALA A 1 364 ? -19.764 14.969  14.486  1.00 65.73  ? 364 ALA A C     1 
ATOM   3020 O  O     . ALA A 1 364 ? -20.485 14.656  15.442  1.00 67.94  ? 364 ALA A O     1 
ATOM   3021 C  CB    . ALA A 1 364 ? -19.297 17.428  14.520  1.00 66.26  ? 364 ALA A CB    1 
ATOM   3022 N  N     . PHE A 1 365 ? -19.867 14.396  13.288  1.00 61.88  ? 365 PHE A N     1 
ATOM   3023 C  CA    . PHE A 1 365 ? -21.061 13.624  12.971  1.00 59.74  ? 365 PHE A CA    1 
ATOM   3024 C  C     . PHE A 1 365 ? -20.972 12.105  12.914  1.00 60.87  ? 365 PHE A C     1 
ATOM   3025 O  O     . PHE A 1 365 ? -21.691 11.438  13.663  1.00 62.85  ? 365 PHE A O     1 
ATOM   3026 C  CB    . PHE A 1 365 ? -21.828 14.224  11.795  1.00 55.18  ? 365 PHE A CB    1 
ATOM   3027 C  CG    . PHE A 1 365 ? -22.569 15.469  12.164  1.00 54.18  ? 365 PHE A CG    1 
ATOM   3028 C  CD1   . PHE A 1 365 ? -22.138 16.708  11.721  1.00 52.19  ? 365 PHE A CD1   1 
ATOM   3029 C  CD2   . PHE A 1 365 ? -23.669 15.405  13.011  1.00 55.20  ? 365 PHE A CD2   1 
ATOM   3030 C  CE1   . PHE A 1 365 ? -22.816 17.862  12.082  1.00 51.87  ? 365 PHE A CE1   1 
ATOM   3031 C  CE2   . PHE A 1 365 ? -24.348 16.555  13.382  1.00 55.22  ? 365 PHE A CE2   1 
ATOM   3032 C  CZ    . PHE A 1 365 ? -23.919 17.786  12.917  1.00 53.79  ? 365 PHE A CZ    1 
ATOM   3033 N  N     . ARG A 1 366 ? -20.113 11.551  12.067  1.00 60.22  ? 366 ARG A N     1 
ATOM   3034 C  CA    . ARG A 1 366 ? -20.018 10.086  11.933  1.00 61.40  ? 366 ARG A CA    1 
ATOM   3035 C  C     . ARG A 1 366 ? -20.217 9.735   10.475  1.00 57.99  ? 366 ARG A C     1 
ATOM   3036 O  O     . ARG A 1 366 ? -21.330 9.846   9.956   1.00 55.86  ? 366 ARG A O     1 
ATOM   3037 C  CB    . ARG A 1 366 ? -21.063 9.346   12.800  1.00 63.02  ? 366 ARG A CB    1 
ATOM   3038 C  CG    . ARG A 1 366 ? -20.687 7.926   13.246  1.00 67.52  ? 366 ARG A CG    1 
ATOM   3039 C  CD    . ARG A 1 366 ? -21.282 6.829   12.339  1.00 68.73  ? 366 ARG A CD    1 
ATOM   3040 N  NE    . ARG A 1 366 ? -20.557 5.550   12.413  1.00 72.29  ? 366 ARG A NE    1 
ATOM   3041 C  CZ    . ARG A 1 366 ? -19.360 5.321   11.861  1.00 73.74  ? 366 ARG A CZ    1 
ATOM   3042 N  NH1   . ARG A 1 366 ? -18.722 6.282   11.197  1.00 72.53  ? 366 ARG A NH1   1 
ATOM   3043 N  NH2   . ARG A 1 366 ? -18.783 4.130   11.981  1.00 76.25  ? 366 ARG A NH2   1 
ATOM   3044 N  N     . PRO A 1 367 ? -19.127 9.342   9.797   1.00 58.27  ? 367 PRO A N     1 
ATOM   3045 C  CA    . PRO A 1 367 ? -19.202 8.902   8.411   1.00 56.16  ? 367 PRO A CA    1 
ATOM   3046 C  C     . PRO A 1 367 ? -20.216 7.774   8.214   1.00 55.50  ? 367 PRO A C     1 
ATOM   3047 O  O     . PRO A 1 367 ? -20.612 7.126   9.179   1.00 57.32  ? 367 PRO A O     1 
ATOM   3048 C  CB    . PRO A 1 367 ? -17.773 8.425   8.132   1.00 58.23  ? 367 PRO A CB    1 
ATOM   3049 C  CG    . PRO A 1 367 ? -16.934 9.263   9.035   1.00 60.17  ? 367 PRO A CG    1 
ATOM   3050 C  CD    . PRO A 1 367 ? -17.738 9.333   10.293  1.00 61.29  ? 367 PRO A CD    1 
ATOM   3051 N  N     . PHE A 1 368 ? -20.646 7.564   6.976   1.00 53.52  ? 368 PHE A N     1 
ATOM   3052 C  CA    . PHE A 1 368 ? -21.621 6.526   6.671   1.00 53.41  ? 368 PHE A CA    1 
ATOM   3053 C  C     . PHE A 1 368 ? -21.246 5.849   5.366   1.00 53.51  ? 368 PHE A C     1 
ATOM   3054 O  O     . PHE A 1 368 ? -20.379 6.333   4.634   1.00 53.49  ? 368 PHE A O     1 
ATOM   3055 C  CB    . PHE A 1 368 ? -23.022 7.132   6.559   1.00 52.11  ? 368 PHE A CB    1 
ATOM   3056 C  CG    . PHE A 1 368 ? -23.130 8.228   5.530   1.00 50.18  ? 368 PHE A CG    1 
ATOM   3057 C  CD1   . PHE A 1 368 ? -22.883 9.556   5.877   1.00 49.18  ? 368 PHE A CD1   1 
ATOM   3058 C  CD2   . PHE A 1 368 ? -23.466 7.934   4.212   1.00 50.08  ? 368 PHE A CD2   1 
ATOM   3059 C  CE1   . PHE A 1 368 ? -22.971 10.566  4.928   1.00 47.91  ? 368 PHE A CE1   1 
ATOM   3060 C  CE2   . PHE A 1 368 ? -23.558 8.946   3.252   1.00 49.16  ? 368 PHE A CE2   1 
ATOM   3061 C  CZ    . PHE A 1 368 ? -23.314 10.261  3.613   1.00 47.73  ? 368 PHE A CZ    1 
ATOM   3062 N  N     . ILE A 1 369 ? -21.912 4.741   5.072   1.00 54.08  ? 369 ILE A N     1 
ATOM   3063 C  CA    . ILE A 1 369 ? -21.719 4.046   3.811   1.00 54.89  ? 369 ILE A CA    1 
ATOM   3064 C  C     . ILE A 1 369 ? -22.907 4.281   2.885   1.00 54.27  ? 369 ILE A C     1 
ATOM   3065 O  O     . ILE A 1 369 ? -24.057 4.122   3.277   1.00 54.41  ? 369 ILE A O     1 
ATOM   3066 C  CB    . ILE A 1 369 ? -21.482 2.519   4.020   1.00 57.30  ? 369 ILE A CB    1 
ATOM   3067 C  CG1   . ILE A 1 369 ? -20.141 2.265   4.709   1.00 58.64  ? 369 ILE A CG1   1 
ATOM   3068 C  CG2   . ILE A 1 369 ? -21.534 1.756   2.706   1.00 58.59  ? 369 ILE A CG2   1 
ATOM   3069 C  CD1   . ILE A 1 369 ? -20.265 2.058   6.191   1.00 60.42  ? 369 ILE A CD1   1 
ATOM   3070 N  N     . GLU A 1 370 ? -22.603 4.672   1.653   1.00 54.48  ? 370 GLU A N     1 
ATOM   3071 C  CA    . GLU A 1 370 ? -23.589 4.814   0.589   1.00 55.13  ? 370 GLU A CA    1 
ATOM   3072 C  C     . GLU A 1 370 ? -22.939 4.348   -0.713  1.00 57.05  ? 370 GLU A C     1 
ATOM   3073 O  O     . GLU A 1 370 ? -21.800 4.723   -1.018  1.00 57.11  ? 370 GLU A O     1 
ATOM   3074 C  CB    . GLU A 1 370 ? -24.048 6.272   0.488   1.00 53.31  ? 370 GLU A CB    1 
ATOM   3075 C  CG    . GLU A 1 370 ? -25.118 6.547   -0.556  1.00 55.25  ? 370 GLU A CG    1 
ATOM   3076 C  CD    . GLU A 1 370 ? -25.091 7.988   -1.033  1.00 55.61  ? 370 GLU A CD    1 
ATOM   3077 O  OE1   . GLU A 1 370 ? -25.737 8.854   -0.393  1.00 54.28  ? 370 GLU A OE1   1 
ATOM   3078 O  OE2   . GLU A 1 370 ? -24.409 8.255   -2.050  1.00 56.94  ? 370 GLU A OE2   1 
ATOM   3079 N  N     . ASN A 1 371 ? -23.662 3.521   -1.464  1.00 59.21  ? 371 ASN A N     1 
ATOM   3080 C  CA    . ASN A 1 371 ? -23.150 2.899   -2.693  1.00 62.42  ? 371 ASN A CA    1 
ATOM   3081 C  C     . ASN A 1 371 ? -21.700 2.398   -2.599  1.00 63.19  ? 371 ASN A C     1 
ATOM   3082 O  O     . ASN A 1 371 ? -20.839 2.792   -3.392  1.00 64.65  ? 371 ASN A O     1 
ATOM   3083 C  CB    . ASN A 1 371 ? -23.324 3.825   -3.900  1.00 63.34  ? 371 ASN A CB    1 
ATOM   3084 C  CG    . ASN A 1 371 ? -24.745 4.328   -4.048  1.00 63.85  ? 371 ASN A CG    1 
ATOM   3085 O  OD1   . ASN A 1 371 ? -25.676 3.549   -4.275  1.00 66.61  ? 371 ASN A OD1   1 
ATOM   3086 N  ND2   . ASN A 1 371 ? -24.922 5.645   -3.924  1.00 61.75  ? 371 ASN A ND2   1 
ATOM   3087 N  N     . GLY A 1 372 ? -21.439 1.549   -1.610  1.00 62.65  ? 372 GLY A N     1 
ATOM   3088 C  CA    . GLY A 1 372 ? -20.155 0.871   -1.487  1.00 63.97  ? 372 GLY A CA    1 
ATOM   3089 C  C     . GLY A 1 372 ? -18.932 1.746   -1.281  1.00 62.94  ? 372 GLY A C     1 
ATOM   3090 O  O     . GLY A 1 372 ? -17.806 1.341   -1.610  1.00 65.12  ? 372 GLY A O     1 
ATOM   3091 N  N     . ARG A 1 373 ? -19.146 2.945   -0.742  1.00 59.92  ? 373 ARG A N     1 
ATOM   3092 C  CA    . ARG A 1 373 ? -18.028 3.808   -0.330  1.00 59.30  ? 373 ARG A CA    1 
ATOM   3093 C  C     . ARG A 1 373 ? -18.367 4.624   0.919   1.00 56.35  ? 373 ARG A C     1 
ATOM   3094 O  O     . ARG A 1 373 ? -19.537 4.832   1.241   1.00 54.56  ? 373 ARG A O     1 
ATOM   3095 C  CB    . ARG A 1 373 ? -17.524 4.696   -1.488  1.00 59.98  ? 373 ARG A CB    1 
ATOM   3096 C  CG    . ARG A 1 373 ? -18.544 5.684   -2.038  1.00 58.32  ? 373 ARG A CG    1 
ATOM   3097 C  CD    . ARG A 1 373 ? -18.155 6.261   -3.405  1.00 60.45  ? 373 ARG A CD    1 
ATOM   3098 N  NE    . ARG A 1 373 ? -16.731 6.580   -3.528  1.00 61.87  ? 373 ARG A NE    1 
ATOM   3099 C  CZ    . ARG A 1 373 ? -15.932 6.092   -4.475  1.00 65.75  ? 373 ARG A CZ    1 
ATOM   3100 N  NH1   . ARG A 1 373 ? -16.412 5.272   -5.400  1.00 68.55  ? 373 ARG A NH1   1 
ATOM   3101 N  NH2   . ARG A 1 373 ? -14.651 6.430   -4.505  1.00 66.83  ? 373 ARG A NH2   1 
ATOM   3102 N  N     . TRP A 1 374 ? -17.336 5.052   1.637   1.00 56.49  ? 374 TRP A N     1 
ATOM   3103 C  CA    . TRP A 1 374 ? -17.531 5.906   2.798   1.00 54.40  ? 374 TRP A CA    1 
ATOM   3104 C  C     . TRP A 1 374 ? -17.689 7.359   2.366   1.00 52.52  ? 374 TRP A C     1 
ATOM   3105 O  O     . TRP A 1 374 ? -17.156 7.782   1.338   1.00 53.20  ? 374 TRP A O     1 
ATOM   3106 C  CB    . TRP A 1 374 ? -16.360 5.779   3.767   1.00 56.52  ? 374 TRP A CB    1 
ATOM   3107 C  CG    . TRP A 1 374 ? -16.382 4.545   4.588   1.00 57.89  ? 374 TRP A CG    1 
ATOM   3108 C  CD1   . TRP A 1 374 ? -15.837 3.342   4.267   1.00 60.37  ? 374 TRP A CD1   1 
ATOM   3109 C  CD2   . TRP A 1 374 ? -16.975 4.386   5.884   1.00 57.97  ? 374 TRP A CD2   1 
ATOM   3110 N  NE1   . TRP A 1 374 ? -16.056 2.436   5.280   1.00 61.61  ? 374 TRP A NE1   1 
ATOM   3111 C  CE2   . TRP A 1 374 ? -16.753 3.052   6.284   1.00 60.01  ? 374 TRP A CE2   1 
ATOM   3112 C  CE3   . TRP A 1 374 ? -17.680 5.242   6.742   1.00 56.39  ? 374 TRP A CE3   1 
ATOM   3113 C  CZ2   . TRP A 1 374 ? -17.205 2.551   7.509   1.00 61.22  ? 374 TRP A CZ2   1 
ATOM   3114 C  CZ3   . TRP A 1 374 ? -18.127 4.745   7.960   1.00 57.65  ? 374 TRP A CZ3   1 
ATOM   3115 C  CH2   . TRP A 1 374 ? -17.888 3.410   8.333   1.00 59.79  ? 374 TRP A CH2   1 
ATOM   3116 N  N     . TRP A 1 375 ? -18.446 8.105   3.164   1.00 50.31  ? 375 TRP A N     1 
ATOM   3117 C  CA    . TRP A 1 375 ? -18.659 9.531   2.979   1.00 48.11  ? 375 TRP A CA    1 
ATOM   3118 C  C     . TRP A 1 375 ? -18.623 10.152  4.365   1.00 47.42  ? 375 TRP A C     1 
ATOM   3119 O  O     . TRP A 1 375 ? -18.844 9.457   5.352   1.00 48.35  ? 375 TRP A O     1 
ATOM   3120 C  CB    . TRP A 1 375 ? -20.032 9.774   2.366   1.00 46.56  ? 375 TRP A CB    1 
ATOM   3121 C  CG    . TRP A 1 375 ? -20.216 9.212   1.000   1.00 47.43  ? 375 TRP A CG    1 
ATOM   3122 C  CD1   . TRP A 1 375 ? -20.491 7.917   0.679   1.00 49.28  ? 375 TRP A CD1   1 
ATOM   3123 C  CD2   . TRP A 1 375 ? -20.163 9.930   -0.235  1.00 47.63  ? 375 TRP A CD2   1 
ATOM   3124 N  NE1   . TRP A 1 375 ? -20.604 7.779   -0.683  1.00 51.01  ? 375 TRP A NE1   1 
ATOM   3125 C  CE2   . TRP A 1 375 ? -20.407 9.001   -1.269  1.00 49.99  ? 375 TRP A CE2   1 
ATOM   3126 C  CE3   . TRP A 1 375 ? -19.934 11.270  -0.569  1.00 47.36  ? 375 TRP A CE3   1 
ATOM   3127 C  CZ2   . TRP A 1 375 ? -20.425 9.365   -2.619  1.00 51.52  ? 375 TRP A CZ2   1 
ATOM   3128 C  CZ3   . TRP A 1 375 ? -19.949 11.633  -1.910  1.00 48.91  ? 375 TRP A CZ3   1 
ATOM   3129 C  CH2   . TRP A 1 375 ? -20.194 10.680  -2.919  1.00 50.82  ? 375 TRP A CH2   1 
ATOM   3130 N  N     . ALA A 1 376 ? -18.361 11.450  4.450   1.00 46.18  ? 376 ALA A N     1 
ATOM   3131 C  CA    . ALA A 1 376 ? -18.332 12.129  5.740   1.00 46.11  ? 376 ALA A CA    1 
ATOM   3132 C  C     . ALA A 1 376 ? -19.045 13.478  5.706   1.00 44.00  ? 376 ALA A C     1 
ATOM   3133 O  O     . ALA A 1 376 ? -19.138 14.118  4.659   1.00 42.75  ? 376 ALA A O     1 
ATOM   3134 C  CB    . ALA A 1 376 ? -16.898 12.298  6.212   1.00 49.00  ? 376 ALA A CB    1 
ATOM   3135 N  N     . PHE A 1 377 ? -19.555 13.900  6.858   1.00 43.82  ? 377 PHE A N     1 
ATOM   3136 C  CA    . PHE A 1 377 ? -20.115 15.233  6.998   1.00 42.28  ? 377 PHE A CA    1 
ATOM   3137 C  C     . PHE A 1 377 ? -19.057 16.212  7.502   1.00 44.17  ? 377 PHE A C     1 
ATOM   3138 O  O     . PHE A 1 377 ? -18.489 16.042  8.582   1.00 46.83  ? 377 PHE A O     1 
ATOM   3139 C  CB    . PHE A 1 377 ? -21.308 15.229  7.946   1.00 41.97  ? 377 PHE A CB    1 
ATOM   3140 C  CG    . PHE A 1 377 ? -22.498 14.495  7.425   1.00 39.87  ? 377 PHE A CG    1 
ATOM   3141 C  CD1   . PHE A 1 377 ? -22.923 13.329  8.035   1.00 40.50  ? 377 PHE A CD1   1 
ATOM   3142 C  CD2   . PHE A 1 377 ? -23.212 14.983  6.334   1.00 38.03  ? 377 PHE A CD2   1 
ATOM   3143 C  CE1   . PHE A 1 377 ? -24.038 12.647  7.562   1.00 40.28  ? 377 PHE A CE1   1 
ATOM   3144 C  CE2   . PHE A 1 377 ? -24.323 14.311  5.856   1.00 36.76  ? 377 PHE A CE2   1 
ATOM   3145 C  CZ    . PHE A 1 377 ? -24.740 13.141  6.472   1.00 38.38  ? 377 PHE A CZ    1 
ATOM   3146 N  N     . GLU A 1 378 ? -18.819 17.245  6.709   1.00 43.30  ? 378 GLU A N     1 
ATOM   3147 C  CA    . GLU A 1 378 ? -17.820 18.248  7.007   1.00 45.55  ? 378 GLU A CA    1 
ATOM   3148 C  C     . GLU A 1 378 ? -18.483 19.633  7.024   1.00 43.87  ? 378 GLU A C     1 
ATOM   3149 O  O     . GLU A 1 378 ? -19.539 19.829  6.401   1.00 41.30  ? 378 GLU A O     1 
ATOM   3150 C  CB    . GLU A 1 378 ? -16.712 18.174  5.951   1.00 46.86  ? 378 GLU A CB    1 
ATOM   3151 C  CG    . GLU A 1 378 ? -15.291 18.214  6.509   1.00 53.06  ? 378 GLU A CG    1 
ATOM   3152 C  CD    . GLU A 1 378 ? -14.831 16.877  7.078   1.00 57.06  ? 378 GLU A CD    1 
ATOM   3153 O  OE1   . GLU A 1 378 ? -15.631 16.204  7.761   1.00 57.51  ? 378 GLU A OE1   1 
ATOM   3154 O  OE2   . GLU A 1 378 ? -13.659 16.504  6.851   1.00 60.91  ? 378 GLU A OE2   1 
ATOM   3155 N  N     . MET A 1 379 ? -17.867 20.581  7.735   1.00 45.43  ? 379 MET A N     1 
ATOM   3156 C  CA    . MET A 1 379 ? -18.433 21.923  7.911   1.00 44.26  ? 379 MET A CA    1 
ATOM   3157 C  C     . MET A 1 379 ? -17.748 22.989  7.047   1.00 43.62  ? 379 MET A C     1 
ATOM   3158 O  O     . MET A 1 379 ? -16.522 23.011  6.917   1.00 46.44  ? 379 MET A O     1 
ATOM   3159 C  CB    . MET A 1 379 ? -18.379 22.345  9.384   1.00 47.54  ? 379 MET A CB    1 
ATOM   3160 C  CG    . MET A 1 379 ? -19.113 21.411  10.330  1.00 50.09  ? 379 MET A CG    1 
ATOM   3161 S  SD    . MET A 1 379 ? -20.918 21.535  10.226  1.00 52.03  ? 379 MET A SD    1 
ATOM   3162 C  CE    . MET A 1 379 ? -21.303 22.336  11.794  1.00 54.69  ? 379 MET A CE    1 
ATOM   3163 N  N     . ARG A 1 380 ? -18.550 23.875  6.464   1.00 40.10  ? 380 ARG A N     1 
ATOM   3164 C  CA    . ARG A 1 380 ? -18.035 25.033  5.734   1.00 38.97  ? 380 ARG A CA    1 
ATOM   3165 C  C     . ARG A 1 380 ? -17.603 26.150  6.678   1.00 40.92  ? 380 ARG A C     1 
ATOM   3166 O  O     . ARG A 1 380 ? -18.201 26.348  7.734   1.00 40.88  ? 380 ARG A O     1 
ATOM   3167 C  CB    . ARG A 1 380 ? -19.104 25.578  4.784   1.00 35.92  ? 380 ARG A CB    1 
ATOM   3168 C  CG    . ARG A 1 380 ? -19.352 24.748  3.548   1.00 32.46  ? 380 ARG A CG    1 
ATOM   3169 C  CD    . ARG A 1 380 ? -20.444 25.373  2.720   1.00 27.44  ? 380 ARG A CD    1 
ATOM   3170 N  NE    . ARG A 1 380 ? -20.658 24.617  1.500   1.00 26.31  ? 380 ARG A NE    1 
ATOM   3171 C  CZ    . ARG A 1 380 ? -21.560 23.647  1.354   1.00 27.11  ? 380 ARG A CZ    1 
ATOM   3172 N  NH1   . ARG A 1 380 ? -22.373 23.297  2.350   1.00 25.88  ? 380 ARG A NH1   1 
ATOM   3173 N  NH2   . ARG A 1 380 ? -21.649 23.015  0.193   1.00 28.49  ? 380 ARG A NH2   1 
ATOM   3174 N  N     . LYS A 1 381 ? -16.582 26.900  6.277   1.00 42.76  ? 381 LYS A N     1 
ATOM   3175 C  CA    . LYS A 1 381 ? -16.123 28.046  7.072   1.00 45.62  ? 381 LYS A CA    1 
ATOM   3176 C  C     . LYS A 1 381 ? -16.755 29.364  6.621   1.00 43.40  ? 381 LYS A C     1 
ATOM   3177 O  O     . LYS A 1 381 ? -16.378 30.433  7.097   1.00 46.01  ? 381 LYS A O     1 
ATOM   3178 C  CB    . LYS A 1 381 ? -14.585 28.121  7.149   1.00 50.19  ? 381 LYS A CB    1 
ATOM   3179 C  CG    . LYS A 1 381 ? -13.877 28.217  5.811   1.00 52.31  ? 381 LYS A CG    1 
ATOM   3180 C  CD    . LYS A 1 381 ? -12.514 28.941  5.902   1.00 60.07  ? 381 LYS A CD    1 
ATOM   3181 C  CE    . LYS A 1 381 ? -11.363 27.992  6.255   1.00 65.69  ? 381 LYS A CE    1 
ATOM   3182 N  NZ    . LYS A 1 381 ? -11.470 27.430  7.640   1.00 68.43  ? 381 LYS A NZ    1 
ATOM   3183 N  N     . PHE A 1 382 ? -17.722 29.263  5.709   1.00 39.13  ? 382 PHE A N     1 
ATOM   3184 C  CA    . PHE A 1 382 ? -18.558 30.381  5.261   1.00 37.17  ? 382 PHE A CA    1 
ATOM   3185 C  C     . PHE A 1 382 ? -19.821 29.832  4.614   1.00 33.91  ? 382 PHE A C     1 
ATOM   3186 O  O     . PHE A 1 382 ? -19.817 28.718  4.089   1.00 33.24  ? 382 PHE A O     1 
ATOM   3187 C  CB    . PHE A 1 382 ? -17.825 31.303  4.262   1.00 37.80  ? 382 PHE A CB    1 
ATOM   3188 C  CG    . PHE A 1 382 ? -17.168 30.578  3.118   1.00 37.37  ? 382 PHE A CG    1 
ATOM   3189 C  CD1   . PHE A 1 382 ? -17.916 29.802  2.227   1.00 35.13  ? 382 PHE A CD1   1 
ATOM   3190 C  CD2   . PHE A 1 382 ? -15.802 30.682  2.916   1.00 39.27  ? 382 PHE A CD2   1 
ATOM   3191 C  CE1   . PHE A 1 382 ? -17.300 29.124  1.170   1.00 35.30  ? 382 PHE A CE1   1 
ATOM   3192 C  CE2   . PHE A 1 382 ? -15.186 30.014  1.866   1.00 40.22  ? 382 PHE A CE2   1 
ATOM   3193 C  CZ    . PHE A 1 382 ? -15.932 29.236  0.989   1.00 37.44  ? 382 PHE A CZ    1 
ATOM   3194 N  N     . THR A 1 383 ? -20.898 30.614  4.622   1.00 32.82  ? 383 THR A N     1 
ATOM   3195 C  CA    . THR A 1 383 ? -22.153 30.157  4.030   1.00 30.33  ? 383 THR A CA    1 
ATOM   3196 C  C     . THR A 1 383 ? -22.855 31.162  3.106   1.00 29.50  ? 383 THR A C     1 
ATOM   3197 O  O     . THR A 1 383 ? -23.927 30.866  2.574   1.00 28.62  ? 383 THR A O     1 
ATOM   3198 C  CB    . THR A 1 383 ? -23.148 29.685  5.101   1.00 29.84  ? 383 THR A CB    1 
ATOM   3199 O  OG1   . THR A 1 383 ? -23.786 30.819  5.688   1.00 31.51  ? 383 THR A OG1   1 
ATOM   3200 C  CG2   . THR A 1 383 ? -22.450 28.881  6.175   1.00 30.91  ? 383 THR A CG2   1 
ATOM   3201 N  N     . THR A 1 384 ? -22.279 32.339  2.913   1.00 30.70  ? 384 THR A N     1 
ATOM   3202 C  CA    . THR A 1 384 ? -22.857 33.267  1.954   1.00 29.80  ? 384 THR A CA    1 
ATOM   3203 C  C     . THR A 1 384 ? -21.824 33.549  0.879   1.00 29.26  ? 384 THR A C     1 
ATOM   3204 O  O     . THR A 1 384 ? -20.631 33.395  1.130   1.00 29.40  ? 384 THR A O     1 
ATOM   3205 C  CB    . THR A 1 384 ? -23.370 34.582  2.615   1.00 30.38  ? 384 THR A CB    1 
ATOM   3206 O  OG1   . THR A 1 384 ? -22.276 35.330  3.166   1.00 31.11  ? 384 THR A OG1   1 
ATOM   3207 C  CG2   . THR A 1 384 ? -24.416 34.296  3.697   1.00 30.08  ? 384 THR A CG2   1 
ATOM   3208 N  N     . PRO A 1 385 ? -22.266 33.941  -0.336  1.00 29.08  ? 385 PRO A N     1 
ATOM   3209 C  CA    . PRO A 1 385 ? -21.257 34.177  -1.369  1.00 28.73  ? 385 PRO A CA    1 
ATOM   3210 C  C     . PRO A 1 385 ? -20.325 35.327  -0.997  1.00 29.14  ? 385 PRO A C     1 
ATOM   3211 O  O     . PRO A 1 385 ? -19.133 35.262  -1.306  1.00 28.84  ? 385 PRO A O     1 
ATOM   3212 C  CB    . PRO A 1 385 ? -22.087 34.518  -2.610  1.00 28.30  ? 385 PRO A CB    1 
ATOM   3213 C  CG    . PRO A 1 385 ? -23.466 34.087  -2.299  1.00 28.29  ? 385 PRO A CG    1 
ATOM   3214 C  CD    . PRO A 1 385 ? -23.631 34.181  -0.841  1.00 28.86  ? 385 PRO A CD    1 
ATOM   3215 N  N     . GLU A 1 386 ? -20.868 36.346  -0.321  1.00 29.95  ? 386 GLU A N     1 
ATOM   3216 C  CA    . GLU A 1 386 ? -20.082 37.470  0.219   1.00 30.74  ? 386 GLU A CA    1 
ATOM   3217 C  C     . GLU A 1 386 ? -18.965 37.018  1.152   1.00 31.06  ? 386 GLU A C     1 
ATOM   3218 O  O     . GLU A 1 386 ? -17.808 37.417  1.011   1.00 30.71  ? 386 GLU A O     1 
ATOM   3219 C  CB    . GLU A 1 386 ? -20.979 38.437  0.978   1.00 31.69  ? 386 GLU A CB    1 
ATOM   3220 C  CG    . GLU A 1 386 ? -22.007 39.142  0.123   1.00 33.87  ? 386 GLU A CG    1 
ATOM   3221 C  CD    . GLU A 1 386 ? -23.331 38.411  0.074   1.00 36.60  ? 386 GLU A CD    1 
ATOM   3222 O  OE1   . GLU A 1 386 ? -23.389 37.237  0.501   1.00 38.10  ? 386 GLU A OE1   1 
ATOM   3223 O  OE2   . GLU A 1 386 ? -24.318 39.019  -0.392  1.00 38.63  ? 386 GLU A OE2   1 
ATOM   3224 N  N     . GLU A 1 387 ? -19.327 36.187  2.119   1.00 31.70  ? 387 GLU A N     1 
ATOM   3225 C  CA    . GLU A 1 387 ? -18.360 35.656  3.048   1.00 32.74  ? 387 GLU A CA    1 
ATOM   3226 C  C     . GLU A 1 387 ? -17.336 34.879  2.243   1.00 31.26  ? 387 GLU A C     1 
ATOM   3227 O  O     . GLU A 1 387 ? -16.135 34.962  2.498   1.00 31.86  ? 387 GLU A O     1 
ATOM   3228 C  CB    . GLU A 1 387 ? -19.045 34.760  4.069   1.00 33.13  ? 387 GLU A CB    1 
ATOM   3229 C  CG    . GLU A 1 387 ? -20.049 35.466  4.955   1.00 35.47  ? 387 GLU A CG    1 
ATOM   3230 C  CD    . GLU A 1 387 ? -20.580 34.558  6.072   1.00 38.30  ? 387 GLU A CD    1 
ATOM   3231 O  OE1   . GLU A 1 387 ? -20.323 33.331  6.023   1.00 41.95  ? 387 GLU A OE1   1 
ATOM   3232 O  OE2   . GLU A 1 387 ? -21.252 35.065  7.013   1.00 43.95  ? 387 GLU A OE2   1 
ATOM   3233 N  N     . GLY A 1 388 ? -17.822 34.146  1.249   1.00 29.94  ? 388 GLY A N     1 
ATOM   3234 C  CA    . GLY A 1 388 ? -16.954 33.356  0.388   1.00 28.91  ? 388 GLY A CA    1 
ATOM   3235 C  C     . GLY A 1 388 ? -15.910 34.212  -0.306  1.00 27.78  ? 388 GLY A C     1 
ATOM   3236 O  O     . GLY A 1 388 ? -14.713 33.936  -0.209  1.00 28.15  ? 388 GLY A O     1 
ATOM   3237 N  N     . VAL A 1 389 ? -16.368 35.254  -0.995  1.00 26.10  ? 389 VAL A N     1 
ATOM   3238 C  CA    . VAL A 1 389 ? -15.479 36.150  -1.706  1.00 25.36  ? 389 VAL A CA    1 
ATOM   3239 C  C     . VAL A 1 389 ? -14.484 36.820  -0.757  1.00 25.88  ? 389 VAL A C     1 
ATOM   3240 O  O     . VAL A 1 389 ? -13.310 36.954  -1.085  1.00 25.68  ? 389 VAL A O     1 
ATOM   3241 C  CB    . VAL A 1 389 ? -16.266 37.218  -2.503  1.00 25.06  ? 389 VAL A CB    1 
ATOM   3242 C  CG1   . VAL A 1 389 ? -15.318 38.284  -3.068  1.00 25.34  ? 389 VAL A CG1   1 
ATOM   3243 C  CG2   . VAL A 1 389 ? -17.078 36.574  -3.631  1.00 23.62  ? 389 VAL A CG2   1 
ATOM   3244 N  N     . ARG A 1 390 ? -14.958 37.223  0.423   1.00 26.47  ? 390 ARG A N     1 
ATOM   3245 C  CA    . ARG A 1 390 ? -14.118 37.912  1.404   1.00 27.16  ? 390 ARG A CA    1 
ATOM   3246 C  C     . ARG A 1 390 ? -12.946 37.024  1.796   1.00 27.97  ? 390 ARG A C     1 
ATOM   3247 O  O     . ARG A 1 390 ? -11.807 37.485  1.929   1.00 28.45  ? 390 ARG A O     1 
ATOM   3248 C  CB    . ARG A 1 390 ? -14.922 38.290  2.641   1.00 27.59  ? 390 ARG A CB    1 
ATOM   3249 C  CG    . ARG A 1 390 ? -14.122 39.072  3.661   1.00 27.85  ? 390 ARG A CG    1 
ATOM   3250 C  CD    . ARG A 1 390 ? -14.376 38.511  5.032   1.00 29.66  ? 390 ARG A CD    1 
ATOM   3251 N  NE    . ARG A 1 390 ? -15.620 38.986  5.635   1.00 29.84  ? 390 ARG A NE    1 
ATOM   3252 C  CZ    . ARG A 1 390 ? -16.437 38.247  6.380   1.00 30.22  ? 390 ARG A CZ    1 
ATOM   3253 N  NH1   . ARG A 1 390 ? -16.197 36.962  6.619   1.00 29.88  ? 390 ARG A NH1   1 
ATOM   3254 N  NH2   . ARG A 1 390 ? -17.522 38.802  6.874   1.00 32.28  ? 390 ARG A NH2   1 
ATOM   3255 N  N     . SER A 1 391 ? -13.246 35.744  1.971   1.00 28.14  ? 391 SER A N     1 
ATOM   3256 C  CA    . SER A 1 391 ? -12.228 34.750  2.196   1.00 29.08  ? 391 SER A CA    1 
ATOM   3257 C  C     . SER A 1 391 ? -11.333 34.645  0.963   1.00 28.65  ? 391 SER A C     1 
ATOM   3258 O  O     . SER A 1 391 ? -10.118 34.740  1.069   1.00 29.42  ? 391 SER A O     1 
ATOM   3259 C  CB    . SER A 1 391 ? -12.878 33.412  2.487   1.00 29.42  ? 391 SER A CB    1 
ATOM   3260 O  OG    . SER A 1 391 ? -11.889 32.435  2.697   1.00 31.51  ? 391 SER A OG    1 
ATOM   3261 N  N     . TYR A 1 392 ? -11.945 34.489  -0.209  1.00 27.49  ? 392 TYR A N     1 
ATOM   3262 C  CA    . TYR A 1 392 ? -11.193 34.331  -1.445  1.00 26.82  ? 392 TYR A CA    1 
ATOM   3263 C  C     . TYR A 1 392 ? -10.218 35.489  -1.721  1.00 26.90  ? 392 TYR A C     1 
ATOM   3264 O  O     . TYR A 1 392 ? -9.009  35.288  -1.790  1.00 27.48  ? 392 TYR A O     1 
ATOM   3265 C  CB    . TYR A 1 392 ? -12.134 34.095  -2.628  1.00 25.52  ? 392 TYR A CB    1 
ATOM   3266 C  CG    . TYR A 1 392 ? -11.386 33.750  -3.893  1.00 25.31  ? 392 TYR A CG    1 
ATOM   3267 C  CD1   . TYR A 1 392 ? -10.631 32.579  -3.978  1.00 24.91  ? 392 TYR A CD1   1 
ATOM   3268 C  CD2   . TYR A 1 392 ? -11.407 34.610  -4.997  1.00 23.57  ? 392 TYR A CD2   1 
ATOM   3269 C  CE1   . TYR A 1 392 ? -9.924  32.270  -5.126  1.00 25.28  ? 392 TYR A CE1   1 
ATOM   3270 C  CE2   . TYR A 1 392 ? -10.709 34.302  -6.156  1.00 23.47  ? 392 TYR A CE2   1 
ATOM   3271 C  CZ    . TYR A 1 392 ? -9.965  33.133  -6.208  1.00 24.83  ? 392 TYR A CZ    1 
ATOM   3272 O  OH    . TYR A 1 392 ? -9.275  32.820  -7.346  1.00 25.81  ? 392 TYR A OH    1 
ATOM   3273 N  N     . ALA A 1 393 ? -10.750 36.698  -1.846  1.00 26.61  ? 393 ALA A N     1 
ATOM   3274 C  CA    . ALA A 1 393 ? -9.958  37.879  -2.193  1.00 26.69  ? 393 ALA A CA    1 
ATOM   3275 C  C     . ALA A 1 393 ? -8.908  38.271  -1.144  1.00 28.13  ? 393 ALA A C     1 
ATOM   3276 O  O     . ALA A 1 393 ? -7.887  38.871  -1.490  1.00 28.59  ? 393 ALA A O     1 
ATOM   3277 C  CB    . ALA A 1 393 ? -10.869 39.040  -2.482  1.00 26.04  ? 393 ALA A CB    1 
ATOM   3278 N  N     . SER A 1 394 ? -9.146  37.937  0.128   1.00 28.86  ? 394 SER A N     1 
ATOM   3279 C  CA    . SER A 1 394 ? -8.133  38.177  1.159   1.00 29.94  ? 394 SER A CA    1 
ATOM   3280 C  C     . SER A 1 394 ? -6.994  37.191  1.049   1.00 30.63  ? 394 SER A C     1 
ATOM   3281 O  O     . SER A 1 394 ? -5.868  37.487  1.417   1.00 31.72  ? 394 SER A O     1 
ATOM   3282 C  CB    . SER A 1 394 ? -8.736  38.104  2.549   1.00 30.38  ? 394 SER A CB    1 
ATOM   3283 O  OG    . SER A 1 394 ? -9.652  39.162  2.730   1.00 30.69  ? 394 SER A OG    1 
ATOM   3284 N  N     . THR A 1 395 ? -7.292  36.029  0.495   1.00 30.55  ? 395 THR A N     1 
ATOM   3285 C  CA    . THR A 1 395 ? -6.361  34.925  0.487   1.00 31.69  ? 395 THR A CA    1 
ATOM   3286 C  C     . THR A 1 395 ? -5.706  34.694  -0.897  1.00 31.67  ? 395 THR A C     1 
ATOM   3287 O  O     . THR A 1 395 ? -4.587  34.190  -0.975  1.00 32.96  ? 395 THR A O     1 
ATOM   3288 C  CB    . THR A 1 395 ? -7.077  33.670  1.060   1.00 31.95  ? 395 THR A CB    1 
ATOM   3289 O  OG1   . THR A 1 395 ? -6.152  32.838  1.745   1.00 34.84  ? 395 THR A OG1   1 
ATOM   3290 C  CG2   . THR A 1 395 ? -7.776  32.875  0.000   1.00 31.32  ? 395 THR A CG2   1 
ATOM   3291 N  N     . HIS A 1 396 ? -6.382  35.098  -1.977  1.00 30.52  ? 396 HIS A N     1 
ATOM   3292 C  CA    . HIS A 1 396 ? -5.921  34.829  -3.345  1.00 30.23  ? 396 HIS A CA    1 
ATOM   3293 C  C     . HIS A 1 396 ? -5.668  36.080  -4.192  1.00 30.07  ? 396 HIS A C     1 
ATOM   3294 O  O     . HIS A 1 396 ? -5.652  35.994  -5.427  1.00 30.10  ? 396 HIS A O     1 
ATOM   3295 C  CB    . HIS A 1 396 ? -6.941  33.957  -4.076  1.00 29.41  ? 396 HIS A CB    1 
ATOM   3296 C  CG    . HIS A 1 396 ? -7.024  32.559  -3.557  1.00 30.59  ? 396 HIS A CG    1 
ATOM   3297 N  ND1   . HIS A 1 396 ? -6.560  31.474  -4.268  1.00 31.84  ? 396 HIS A ND1   1 
ATOM   3298 C  CD2   . HIS A 1 396 ? -7.517  32.065  -2.399  1.00 29.71  ? 396 HIS A CD2   1 
ATOM   3299 C  CE1   . HIS A 1 396 ? -6.755  30.373  -3.563  1.00 31.41  ? 396 HIS A CE1   1 
ATOM   3300 N  NE2   . HIS A 1 396 ? -7.329  30.706  -2.424  1.00 30.46  ? 396 HIS A NE2   1 
ATOM   3301 N  N     . TRP A 1 397 ? -5.477  37.235  -3.552  1.00 29.90  ? 397 TRP A N     1 
ATOM   3302 C  CA    . TRP A 1 397 ? -5.318  38.498  -4.273  1.00 29.35  ? 397 TRP A CA    1 
ATOM   3303 C  C     . TRP A 1 397 ? -4.273  38.386  -5.394  1.00 30.54  ? 397 TRP A C     1 
ATOM   3304 O  O     . TRP A 1 397 ? -4.401  39.008  -6.456  1.00 29.97  ? 397 TRP A O     1 
ATOM   3305 C  CB    . TRP A 1 397 ? -4.932  39.617  -3.307  1.00 29.07  ? 397 TRP A CB    1 
ATOM   3306 C  CG    . TRP A 1 397 ? -3.693  39.308  -2.511  1.00 29.92  ? 397 TRP A CG    1 
ATOM   3307 C  CD1   . TRP A 1 397 ? -3.632  38.692  -1.287  1.00 29.38  ? 397 TRP A CD1   1 
ATOM   3308 C  CD2   . TRP A 1 397 ? -2.332  39.570  -2.893  1.00 30.54  ? 397 TRP A CD2   1 
ATOM   3309 N  NE1   . TRP A 1 397 ? -2.326  38.568  -0.884  1.00 29.58  ? 397 TRP A NE1   1 
ATOM   3310 C  CE2   . TRP A 1 397 ? -1.506  39.101  -1.842  1.00 30.26  ? 397 TRP A CE2   1 
ATOM   3311 C  CE3   . TRP A 1 397 ? -1.729  40.164  -4.017  1.00 29.31  ? 397 TRP A CE3   1 
ATOM   3312 C  CZ2   . TRP A 1 397 ? -0.116  39.204  -1.881  1.00 31.16  ? 397 TRP A CZ2   1 
ATOM   3313 C  CZ3   . TRP A 1 397 ? -0.342  40.261  -4.050  1.00 30.60  ? 397 TRP A CZ3   1 
ATOM   3314 C  CH2   . TRP A 1 397 ? 0.445   39.785  -2.989  1.00 31.89  ? 397 TRP A CH2   1 
ATOM   3315 N  N     . HIS A 1 398 ? -3.252  37.569  -5.157  1.00 32.20  ? 398 HIS A N     1 
ATOM   3316 C  CA    . HIS A 1 398 ? -2.109  37.457  -6.075  1.00 33.89  ? 398 HIS A CA    1 
ATOM   3317 C  C     . HIS A 1 398 ? -2.476  36.800  -7.406  1.00 33.62  ? 398 HIS A C     1 
ATOM   3318 O  O     . HIS A 1 398 ? -1.739  36.913  -8.374  1.00 34.60  ? 398 HIS A O     1 
ATOM   3319 C  CB    . HIS A 1 398 ? -0.963  36.689  -5.403  1.00 35.24  ? 398 HIS A CB    1 
ATOM   3320 C  CG    . HIS A 1 398 ? -1.416  35.446  -4.704  1.00 36.47  ? 398 HIS A CG    1 
ATOM   3321 N  ND1   . HIS A 1 398 ? -1.655  35.398  -3.345  1.00 38.17  ? 398 HIS A ND1   1 
ATOM   3322 C  CD2   . HIS A 1 398 ? -1.725  34.219  -5.184  1.00 37.03  ? 398 HIS A CD2   1 
ATOM   3323 C  CE1   . HIS A 1 398 ? -2.067  34.186  -3.017  1.00 38.61  ? 398 HIS A CE1   1 
ATOM   3324 N  NE2   . HIS A 1 398 ? -2.119  33.452  -4.116  1.00 38.36  ? 398 HIS A NE2   1 
ATOM   3325 N  N     . THR A 1 399 ? -3.605  36.103  -7.450  1.00 33.03  ? 399 THR A N     1 
ATOM   3326 C  CA    . THR A 1 399 ? -4.039  35.467  -8.686  1.00 33.03  ? 399 THR A CA    1 
ATOM   3327 C  C     . THR A 1 399 ? -5.010  36.371  -9.477  1.00 31.92  ? 399 THR A C     1 
ATOM   3328 O  O     . THR A 1 399 ? -5.460  36.013  -10.565 1.00 31.61  ? 399 THR A O     1 
ATOM   3329 C  CB    . THR A 1 399 ? -4.625  34.040  -8.425  1.00 33.14  ? 399 THR A CB    1 
ATOM   3330 O  OG1   . THR A 1 399 ? -4.482  33.239  -9.599  1.00 34.53  ? 399 THR A OG1   1 
ATOM   3331 C  CG2   . THR A 1 399 ? -6.095  34.091  -8.048  1.00 31.79  ? 399 THR A CG2   1 
ATOM   3332 N  N     . LEU A 1 400 ? -5.304  37.552  -8.940  1.00 31.44  ? 400 LEU A N     1 
ATOM   3333 C  CA    . LEU A 1 400 ? -6.276  38.452  -9.570  1.00 30.76  ? 400 LEU A CA    1 
ATOM   3334 C  C     . LEU A 1 400 ? -5.681  39.595  -10.414 1.00 31.11  ? 400 LEU A C     1 
ATOM   3335 O  O     . LEU A 1 400 ? -6.240  40.680  -10.441 1.00 31.27  ? 400 LEU A O     1 
ATOM   3336 C  CB    . LEU A 1 400 ? -7.227  39.027  -8.508  1.00 30.03  ? 400 LEU A CB    1 
ATOM   3337 C  CG    . LEU A 1 400 ? -7.783  38.117  -7.401  1.00 30.26  ? 400 LEU A CG    1 
ATOM   3338 C  CD1   . LEU A 1 400 ? -8.630  38.934  -6.424  1.00 28.52  ? 400 LEU A CD1   1 
ATOM   3339 C  CD2   . LEU A 1 400 ? -8.593  36.933  -7.976  1.00 30.43  ? 400 LEU A CD2   1 
ATOM   3340 N  N     . GLY A 1 401 ? -4.571  39.364  -11.107 1.00 31.92  ? 401 GLY A N     1 
ATOM   3341 C  CA    . GLY A 1 401 ? -3.951  40.421  -11.916 1.00 32.57  ? 401 GLY A CA    1 
ATOM   3342 C  C     . GLY A 1 401 ? -2.843  41.160  -11.176 1.00 33.66  ? 401 GLY A C     1 
ATOM   3343 O  O     . GLY A 1 401 ? -2.975  41.452  -9.978  1.00 33.57  ? 401 GLY A O     1 
ATOM   3344 N  N     . LYS A 1 402 ? -1.749  41.470  -11.873 1.00 34.35  ? 402 LYS A N     1 
ATOM   3345 C  CA    . LYS A 1 402 ? -0.594  42.073  -11.205 1.00 35.40  ? 402 LYS A CA    1 
ATOM   3346 C  C     . LYS A 1 402 ? -0.996  43.274  -10.352 1.00 34.94  ? 402 LYS A C     1 
ATOM   3347 O  O     . LYS A 1 402 ? -0.748  43.303  -9.153  1.00 35.47  ? 402 LYS A O     1 
ATOM   3348 C  CB    . LYS A 1 402 ? 0.498   42.467  -12.209 1.00 37.05  ? 402 LYS A CB    1 
ATOM   3349 C  CG    . LYS A 1 402 ? 1.893   42.642  -11.603 1.00 38.70  ? 402 LYS A CG    1 
ATOM   3350 C  CD    . LYS A 1 402 ? 2.394   41.322  -10.989 1.00 41.93  ? 402 LYS A CD    1 
ATOM   3351 C  CE    . LYS A 1 402 ? 3.776   41.445  -10.311 1.00 43.32  ? 402 LYS A CE    1 
ATOM   3352 N  NZ    . LYS A 1 402 ? 4.894   41.126  -11.250 1.00 45.10  ? 402 LYS A NZ    1 
ATOM   3353 N  N     . ASN A 1 403 ? -1.649  44.247  -10.973 1.00 34.17  ? 403 ASN A N     1 
ATOM   3354 C  CA    . ASN A 1 403 ? -1.965  45.504  -10.316 1.00 33.78  ? 403 ASN A CA    1 
ATOM   3355 C  C     . ASN A 1 403 ? -3.313  45.475  -9.611  1.00 32.52  ? 403 ASN A C     1 
ATOM   3356 O  O     . ASN A 1 403 ? -3.469  46.007  -8.513  1.00 32.73  ? 403 ASN A O     1 
ATOM   3357 C  CB    . ASN A 1 403 ? -1.906  46.625  -11.348 1.00 34.42  ? 403 ASN A CB    1 
ATOM   3358 C  CG    . ASN A 1 403 ? -0.631  46.581  -12.169 1.00 34.90  ? 403 ASN A CG    1 
ATOM   3359 O  OD1   . ASN A 1 403 ? 0.421   47.029  -11.717 1.00 36.97  ? 403 ASN A OD1   1 
ATOM   3360 N  ND2   . ASN A 1 403 ? -0.714  46.021  -13.368 1.00 32.53  ? 403 ASN A ND2   1 
ATOM   3361 N  N     . VAL A 1 404 ? -4.285  44.842  -10.250 1.00 31.24  ? 404 VAL A N     1 
ATOM   3362 C  CA    . VAL A 1 404 ? -5.594  44.656  -9.648  1.00 29.99  ? 404 VAL A CA    1 
ATOM   3363 C  C     . VAL A 1 404 ? -5.461  43.856  -8.346  1.00 29.86  ? 404 VAL A C     1 
ATOM   3364 O  O     . VAL A 1 404 ? -5.972  44.284  -7.303  1.00 29.95  ? 404 VAL A O     1 
ATOM   3365 C  CB    . VAL A 1 404 ? -6.582  44.033  -10.664 1.00 29.05  ? 404 VAL A CB    1 
ATOM   3366 C  CG1   . VAL A 1 404 ? -7.860  43.554  -9.994  1.00 27.35  ? 404 VAL A CG1   1 
ATOM   3367 C  CG2   . VAL A 1 404 ? -6.902  45.048  -11.755 1.00 29.05  ? 404 VAL A CG2   1 
ATOM   3368 N  N     . GLY A 1 405 ? -4.746  42.732  -8.400  1.00 29.70  ? 405 GLY A N     1 
ATOM   3369 C  CA    . GLY A 1 405 ? -4.489  41.920  -7.210  1.00 30.30  ? 405 GLY A CA    1 
ATOM   3370 C  C     . GLY A 1 405 ? -3.737  42.644  -6.098  1.00 31.84  ? 405 GLY A C     1 
ATOM   3371 O  O     . GLY A 1 405 ? -4.018  42.432  -4.914  1.00 31.57  ? 405 GLY A O     1 
ATOM   3372 N  N     . GLU A 1 406 ? -2.784  43.494  -6.489  1.00 33.11  ? 406 GLU A N     1 
ATOM   3373 C  CA    . GLU A 1 406 ? -2.018  44.309  -5.558  1.00 35.33  ? 406 GLU A CA    1 
ATOM   3374 C  C     . GLU A 1 406 ? -2.929  45.310  -4.868  1.00 34.85  ? 406 GLU A C     1 
ATOM   3375 O  O     . GLU A 1 406 ? -2.860  45.496  -3.660  1.00 36.10  ? 406 GLU A O     1 
ATOM   3376 C  CB    . GLU A 1 406 ? -0.869  45.045  -6.267  1.00 36.37  ? 406 GLU A CB    1 
ATOM   3377 C  CG    . GLU A 1 406 ? 0.524   44.375  -6.175  1.00 38.84  ? 406 GLU A CG    1 
ATOM   3378 C  CD    . GLU A 1 406 ? 1.593   45.038  -7.091  1.00 40.85  ? 406 GLU A CD    1 
ATOM   3379 O  OE1   . GLU A 1 406 ? 2.739   45.263  -6.626  1.00 45.27  ? 406 GLU A OE1   1 
ATOM   3380 O  OE2   . GLU A 1 406 ? 1.301   45.340  -8.277  1.00 43.38  ? 406 GLU A OE2   1 
ATOM   3381 N  N     . SER A 1 407 ? -3.797  45.947  -5.632  1.00 34.19  ? 407 SER A N     1 
ATOM   3382 C  CA    . SER A 1 407 ? -4.702  46.939  -5.078  1.00 34.24  ? 407 SER A CA    1 
ATOM   3383 C  C     . SER A 1 407 ? -5.688  46.300  -4.092  1.00 33.78  ? 407 SER A C     1 
ATOM   3384 O  O     . SER A 1 407 ? -6.060  46.903  -3.076  1.00 34.24  ? 407 SER A O     1 
ATOM   3385 C  CB    . SER A 1 407 ? -5.445  47.621  -6.213  1.00 33.78  ? 407 SER A CB    1 
ATOM   3386 O  OG    . SER A 1 407 ? -6.391  48.528  -5.715  1.00 34.20  ? 407 SER A OG    1 
ATOM   3387 N  N     . ILE A 1 408 ? -6.098  45.072  -4.401  1.00 32.72  ? 408 ILE A N     1 
ATOM   3388 C  CA    . ILE A 1 408 ? -7.033  44.335  -3.560  1.00 32.01  ? 408 ILE A CA    1 
ATOM   3389 C  C     . ILE A 1 408 ? -6.363  43.881  -2.261  1.00 33.14  ? 408 ILE A C     1 
ATOM   3390 O  O     . ILE A 1 408 ? -7.015  43.805  -1.220  1.00 33.01  ? 408 ILE A O     1 
ATOM   3391 C  CB    . ILE A 1 408 ? -7.707  43.181  -4.353  1.00 30.54  ? 408 ILE A CB    1 
ATOM   3392 C  CG1   . ILE A 1 408 ? -8.806  43.753  -5.256  1.00 29.14  ? 408 ILE A CG1   1 
ATOM   3393 C  CG2   . ILE A 1 408 ? -8.312  42.137  -3.431  1.00 29.54  ? 408 ILE A CG2   1 
ATOM   3394 C  CD1   . ILE A 1 408 ? -9.201  42.869  -6.418  1.00 25.63  ? 408 ILE A CD1   1 
ATOM   3395 N  N     . ARG A 1 409 ? -5.058  43.611  -2.327  1.00 34.35  ? 409 ARG A N     1 
ATOM   3396 C  CA    . ARG A 1 409 ? -4.265  43.265  -1.140  1.00 36.10  ? 409 ARG A CA    1 
ATOM   3397 C  C     . ARG A 1 409 ? -4.325  44.410  -0.149  1.00 36.99  ? 409 ARG A C     1 
ATOM   3398 O  O     . ARG A 1 409 ? -4.434  44.202  1.054   1.00 37.25  ? 409 ARG A O     1 
ATOM   3399 C  CB    . ARG A 1 409 ? -2.800  42.995  -1.513  1.00 36.64  ? 409 ARG A CB    1 
ATOM   3400 C  CG    . ARG A 1 409 ? -1.870  42.629  -0.347  1.00 38.84  ? 409 ARG A CG    1 
ATOM   3401 C  CD    . ARG A 1 409 ? -0.378  42.924  -0.652  1.00 41.13  ? 409 ARG A CD    1 
ATOM   3402 N  NE    . ARG A 1 409 ? -0.118  44.312  -1.084  1.00 47.52  ? 409 ARG A NE    1 
ATOM   3403 C  CZ    . ARG A 1 409 ? 0.163   44.695  -2.346  1.00 48.81  ? 409 ARG A CZ    1 
ATOM   3404 N  NH1   . ARG A 1 409 ? 0.234   43.800  -3.329  1.00 48.65  ? 409 ARG A NH1   1 
ATOM   3405 N  NH2   . ARG A 1 409 ? 0.377   45.982  -2.638  1.00 48.29  ? 409 ARG A NH2   1 
ATOM   3406 N  N     . GLU A 1 410 ? -4.253  45.632  -0.660  1.00 37.90  ? 410 GLU A N     1 
ATOM   3407 C  CA    . GLU A 1 410 ? -4.140  46.779  0.230   1.00 39.51  ? 410 GLU A CA    1 
ATOM   3408 C  C     . GLU A 1 410 ? -5.486  47.339  0.694   1.00 39.39  ? 410 GLU A C     1 
ATOM   3409 O  O     . GLU A 1 410 ? -5.565  47.951  1.759   1.00 40.84  ? 410 GLU A O     1 
ATOM   3410 C  CB    . GLU A 1 410 ? -3.201  47.855  -0.342  1.00 40.21  ? 410 GLU A CB    1 
ATOM   3411 C  CG    . GLU A 1 410 ? -3.685  48.576  -1.566  1.00 40.03  ? 410 GLU A CG    1 
ATOM   3412 C  CD    . GLU A 1 410 ? -2.551  49.274  -2.283  1.00 42.30  ? 410 GLU A CD    1 
ATOM   3413 O  OE1   . GLU A 1 410 ? -1.518  49.535  -1.639  1.00 44.79  ? 410 GLU A OE1   1 
ATOM   3414 O  OE2   . GLU A 1 410 ? -2.678  49.560  -3.490  1.00 43.09  ? 410 GLU A OE2   1 
ATOM   3415 N  N     . TYR A 1 411 ? -6.528  47.118  -0.099  1.00 38.20  ? 411 TYR A N     1 
ATOM   3416 C  CA    . TYR A 1 411 ? -7.884  47.492  0.278   1.00 38.45  ? 411 TYR A CA    1 
ATOM   3417 C  C     . TYR A 1 411 ? -8.901  46.913  -0.688  1.00 37.02  ? 411 TYR A C     1 
ATOM   3418 O  O     . TYR A 1 411 ? -8.739  47.007  -1.913  1.00 36.47  ? 411 TYR A O     1 
ATOM   3419 C  CB    . TYR A 1 411 ? -8.065  49.017  0.370   1.00 40.20  ? 411 TYR A CB    1 
ATOM   3420 C  CG    . TYR A 1 411 ? -9.518  49.466  0.311   1.00 41.21  ? 411 TYR A CG    1 
ATOM   3421 C  CD1   . TYR A 1 411 ? -10.021 50.111  -0.821  1.00 42.35  ? 411 TYR A CD1   1 
ATOM   3422 C  CD2   . TYR A 1 411 ? -10.397 49.219  1.372   1.00 41.96  ? 411 TYR A CD2   1 
ATOM   3423 C  CE1   . TYR A 1 411 ? -11.356 50.508  -0.892  1.00 42.51  ? 411 TYR A CE1   1 
ATOM   3424 C  CE2   . TYR A 1 411 ? -11.729 49.624  1.316   1.00 42.29  ? 411 TYR A CE2   1 
ATOM   3425 C  CZ    . TYR A 1 411 ? -12.201 50.262  0.181   1.00 42.45  ? 411 TYR A CZ    1 
ATOM   3426 O  OH    . TYR A 1 411 ? -13.515 50.660  0.105   1.00 42.52  ? 411 TYR A OH    1 
ATOM   3427 N  N     . PHE A 1 412 ? -9.934  46.301  -0.108  1.00 36.29  ? 412 PHE A N     1 
ATOM   3428 C  CA    . PHE A 1 412 ? -11.180 45.992  -0.796  1.00 34.96  ? 412 PHE A CA    1 
ATOM   3429 C  C     . PHE A 1 412 ? -12.297 45.906  0.239   1.00 35.60  ? 412 PHE A C     1 
ATOM   3430 O  O     . PHE A 1 412 ? -12.051 45.720  1.432   1.00 36.43  ? 412 PHE A O     1 
ATOM   3431 C  CB    . PHE A 1 412 ? -11.086 44.694  -1.598  1.00 32.96  ? 412 PHE A CB    1 
ATOM   3432 C  CG    . PHE A 1 412 ? -11.258 43.453  -0.770  1.00 32.15  ? 412 PHE A CG    1 
ATOM   3433 C  CD1   . PHE A 1 412 ? -12.529 42.935  -0.518  1.00 30.97  ? 412 PHE A CD1   1 
ATOM   3434 C  CD2   . PHE A 1 412 ? -10.155 42.798  -0.243  1.00 31.98  ? 412 PHE A CD2   1 
ATOM   3435 C  CE1   . PHE A 1 412 ? -12.696 41.795  0.252   1.00 29.89  ? 412 PHE A CE1   1 
ATOM   3436 C  CE2   . PHE A 1 412 ? -10.311 41.647  0.533   1.00 31.61  ? 412 PHE A CE2   1 
ATOM   3437 C  CZ    . PHE A 1 412 ? -11.582 41.145  0.777   1.00 31.22  ? 412 PHE A CZ    1 
ATOM   3438 N  N     . GLU A 1 413 ? -13.526 46.058  -0.222  1.00 35.46  ? 413 GLU A N     1 
ATOM   3439 C  CA    . GLU A 1 413 ? -14.682 45.817  0.617   1.00 36.39  ? 413 GLU A CA    1 
ATOM   3440 C  C     . GLU A 1 413 ? -15.756 45.175  -0.248  1.00 34.90  ? 413 GLU A C     1 
ATOM   3441 O  O     . GLU A 1 413 ? -15.677 45.206  -1.477  1.00 34.24  ? 413 GLU A O     1 
ATOM   3442 C  CB    . GLU A 1 413 ? -15.178 47.111  1.274   1.00 37.83  ? 413 GLU A CB    1 
ATOM   3443 C  CG    . GLU A 1 413 ? -15.694 48.162  0.299   1.00 39.26  ? 413 GLU A CG    1 
ATOM   3444 C  CD    . GLU A 1 413 ? -16.262 49.395  0.987   1.00 41.57  ? 413 GLU A CD    1 
ATOM   3445 O  OE1   . GLU A 1 413 ? -17.077 49.255  1.925   1.00 44.24  ? 413 GLU A OE1   1 
ATOM   3446 O  OE2   . GLU A 1 413 ? -15.910 50.519  0.571   1.00 45.30  ? 413 GLU A OE2   1 
ATOM   3447 N  N     . ILE A 1 414 ? -16.742 44.569  0.395   1.00 34.88  ? 414 ILE A N     1 
ATOM   3448 C  CA    . ILE A 1 414 ? -17.846 43.966  -0.327  1.00 33.88  ? 414 ILE A CA    1 
ATOM   3449 C  C     . ILE A 1 414 ? -19.113 44.743  -0.052  1.00 35.09  ? 414 ILE A C     1 
ATOM   3450 O  O     . ILE A 1 414 ? -19.505 44.915  1.090   1.00 36.06  ? 414 ILE A O     1 
ATOM   3451 C  CB    . ILE A 1 414 ? -17.995 42.482  0.002   1.00 32.94  ? 414 ILE A CB    1 
ATOM   3452 C  CG1   . ILE A 1 414 ? -16.671 41.774  -0.308  1.00 31.94  ? 414 ILE A CG1   1 
ATOM   3453 C  CG2   . ILE A 1 414 ? -19.176 41.867  -0.775  1.00 31.91  ? 414 ILE A CG2   1 
ATOM   3454 C  CD1   . ILE A 1 414 ? -16.677 40.295  -0.084  1.00 31.81  ? 414 ILE A CD1   1 
ATOM   3455 N  N     . ILE A 1 415 ? -19.728 45.226  -1.121  1.00 35.60  ? 415 ILE A N     1 
ATOM   3456 C  CA    . ILE A 1 415 ? -20.940 46.013  -1.041  1.00 37.47  ? 415 ILE A CA    1 
ATOM   3457 C  C     . ILE A 1 415 ? -22.088 45.200  -1.604  1.00 37.17  ? 415 ILE A C     1 
ATOM   3458 O  O     . ILE A 1 415 ? -21.953 44.575  -2.648  1.00 35.96  ? 415 ILE A O     1 
ATOM   3459 C  CB    . ILE A 1 415 ? -20.839 47.302  -1.890  1.00 38.35  ? 415 ILE A CB    1 
ATOM   3460 C  CG1   . ILE A 1 415 ? -19.460 47.959  -1.784  1.00 38.63  ? 415 ILE A CG1   1 
ATOM   3461 C  CG2   . ILE A 1 415 ? -21.910 48.273  -1.490  1.00 40.56  ? 415 ILE A CG2   1 
ATOM   3462 C  CD1   . ILE A 1 415 ? -19.240 48.701  -0.513  1.00 40.78  ? 415 ILE A CD1   1 
ATOM   3463 N  N     . SER A 1 416 ? -23.204 45.196  -0.889  1.00 39.13  ? 416 SER A N     1 
ATOM   3464 C  CA    . SER A 1 416 ? -24.473 44.683  -1.401  1.00 40.09  ? 416 SER A CA    1 
ATOM   3465 C  C     . SER A 1 416 ? -25.587 45.570  -0.871  1.00 42.96  ? 416 SER A C     1 
ATOM   3466 O  O     . SER A 1 416 ? -25.309 46.659  -0.362  1.00 44.76  ? 416 SER A O     1 
ATOM   3467 C  CB    . SER A 1 416 ? -24.689 43.216  -1.017  1.00 39.07  ? 416 SER A CB    1 
ATOM   3468 O  OG    . SER A 1 416 ? -24.460 42.982  0.352   1.00 38.62  ? 416 SER A OG    1 
ATOM   3469 N  N     . GLY A 1 417 ? -26.837 45.126  -0.997  1.00 44.36  ? 417 GLY A N     1 
ATOM   3470 C  CA    . GLY A 1 417 ? -27.997 45.910  -0.524  1.00 47.50  ? 417 GLY A CA    1 
ATOM   3471 C  C     . GLY A 1 417 ? -28.111 47.306  -1.137  1.00 49.49  ? 417 GLY A C     1 
ATOM   3472 O  O     . GLY A 1 417 ? -27.535 47.580  -2.204  1.00 48.46  ? 417 GLY A O     1 
ATOM   3473 N  N     . GLU A 1 418 ? -28.849 48.185  -0.455  1.00 52.33  ? 418 GLU A N     1 
ATOM   3474 C  CA    . GLU A 1 418 ? -28.984 49.596  -0.866  1.00 55.08  ? 418 GLU A CA    1 
ATOM   3475 C  C     . GLU A 1 418 ? -27.612 50.251  -1.077  1.00 54.73  ? 418 GLU A C     1 
ATOM   3476 O  O     . GLU A 1 418 ? -27.439 51.070  -1.985  1.00 55.48  ? 418 GLU A O     1 
ATOM   3477 C  CB    . GLU A 1 418 ? -29.780 50.430  0.167   1.00 58.19  ? 418 GLU A CB    1 
ATOM   3478 C  CG    . GLU A 1 418 ? -30.803 49.664  1.049   1.00 61.10  ? 418 GLU A CG    1 
ATOM   3479 C  CD    . GLU A 1 418 ? -32.017 49.157  0.268   1.00 63.54  ? 418 GLU A CD    1 
ATOM   3480 O  OE1   . GLU A 1 418 ? -32.033 47.950  -0.077  1.00 62.68  ? 418 GLU A OE1   1 
ATOM   3481 O  OE2   . GLU A 1 418 ? -32.939 49.964  -0.009  1.00 65.63  ? 418 GLU A OE2   1 
ATOM   3482 N  N     . LYS A 1 419 ? -26.647 49.886  -0.230  1.00 53.83  ? 419 LYS A N     1 
ATOM   3483 C  CA    . LYS A 1 419 ? -25.282 50.427  -0.291  1.00 53.50  ? 419 LYS A CA    1 
ATOM   3484 C  C     . LYS A 1 419 ? -24.676 50.332  -1.704  1.00 51.17  ? 419 LYS A C     1 
ATOM   3485 O  O     . LYS A 1 419 ? -23.862 51.172  -2.099  1.00 51.49  ? 419 LYS A O     1 
ATOM   3486 C  CB    . LYS A 1 419 ? -24.395 49.709  0.745   1.00 52.96  ? 419 LYS A CB    1 
ATOM   3487 C  CG    . LYS A 1 419 ? -23.031 50.360  1.035   1.00 54.21  ? 419 LYS A CG    1 
ATOM   3488 C  CD    . LYS A 1 419 ? -22.237 49.570  2.105   1.00 53.85  ? 419 LYS A CD    1 
ATOM   3489 C  CE    . LYS A 1 419 ? -22.204 50.279  3.475   1.00 57.58  ? 419 LYS A CE    1 
ATOM   3490 N  NZ    . LYS A 1 419 ? -23.522 50.319  4.176   1.00 59.12  ? 419 LYS A NZ    1 
ATOM   3491 N  N     . LEU A 1 420 ? -25.091 49.308  -2.454  1.00 48.73  ? 420 LEU A N     1 
ATOM   3492 C  CA    . LEU A 1 420 ? -24.571 49.041  -3.797  1.00 46.09  ? 420 LEU A CA    1 
ATOM   3493 C  C     . LEU A 1 420 ? -25.345 49.789  -4.876  1.00 46.82  ? 420 LEU A C     1 
ATOM   3494 O  O     . LEU A 1 420 ? -24.792 50.119  -5.928  1.00 46.54  ? 420 LEU A O     1 
ATOM   3495 C  CB    . LEU A 1 420 ? -24.578 47.533  -4.074  1.00 43.99  ? 420 LEU A CB    1 
ATOM   3496 C  CG    . LEU A 1 420 ? -24.295 46.980  -5.477  1.00 41.37  ? 420 LEU A CG    1 
ATOM   3497 C  CD1   . LEU A 1 420 ? -22.865 47.191  -5.900  1.00 39.46  ? 420 LEU A CD1   1 
ATOM   3498 C  CD2   . LEU A 1 420 ? -24.628 45.519  -5.522  1.00 40.66  ? 420 LEU A CD2   1 
ATOM   3499 N  N     . PHE A 1 421 ? -26.619 50.061  -4.616  1.00 47.62  ? 421 PHE A N     1 
ATOM   3500 C  CA    . PHE A 1 421 ? -27.458 50.725  -5.607  1.00 48.35  ? 421 PHE A CA    1 
ATOM   3501 C  C     . PHE A 1 421 ? -27.171 52.223  -5.719  1.00 50.25  ? 421 PHE A C     1 
ATOM   3502 O  O     . PHE A 1 421 ? -27.591 52.860  -6.687  1.00 51.27  ? 421 PHE A O     1 
ATOM   3503 C  CB    . PHE A 1 421 ? -28.948 50.466  -5.348  1.00 49.14  ? 421 PHE A CB    1 
ATOM   3504 C  CG    . PHE A 1 421 ? -29.315 49.006  -5.278  1.00 46.90  ? 421 PHE A CG    1 
ATOM   3505 C  CD1   . PHE A 1 421 ? -30.275 48.567  -4.383  1.00 47.64  ? 421 PHE A CD1   1 
ATOM   3506 C  CD2   . PHE A 1 421 ? -28.693 48.074  -6.093  1.00 44.51  ? 421 PHE A CD2   1 
ATOM   3507 C  CE1   . PHE A 1 421 ? -30.613 47.222  -4.304  1.00 46.33  ? 421 PHE A CE1   1 
ATOM   3508 C  CE2   . PHE A 1 421 ? -29.026 46.731  -6.020  1.00 42.90  ? 421 PHE A CE2   1 
ATOM   3509 C  CZ    . PHE A 1 421 ? -29.983 46.305  -5.124  1.00 43.95  ? 421 PHE A CZ    1 
ATOM   3510 N  N     . LYS A 1 422 ? -26.453 52.780  -4.743  1.00 50.72  ? 422 LYS A N     1 
ATOM   3511 C  CA    . LYS A 1 422 ? -26.039 54.181  -4.817  1.00 52.52  ? 422 LYS A CA    1 
ATOM   3512 C  C     . LYS A 1 422 ? -24.632 54.350  -5.405  1.00 51.03  ? 422 LYS A C     1 
ATOM   3513 O  O     . LYS A 1 422 ? -24.193 55.465  -5.677  1.00 52.89  ? 422 LYS A O     1 
ATOM   3514 C  CB    . LYS A 1 422 ? -26.200 54.893  -3.468  1.00 54.71  ? 422 LYS A CB    1 
ATOM   3515 C  CG    . LYS A 1 422 ? -27.672 55.160  -3.095  1.00 57.18  ? 422 LYS A CG    1 
ATOM   3516 C  CD    . LYS A 1 422 ? -27.827 56.065  -1.866  1.00 59.99  ? 422 LYS A CD    1 
ATOM   3517 C  CE    . LYS A 1 422 ? -27.976 57.553  -2.238  1.00 65.16  ? 422 LYS A CE    1 
ATOM   3518 N  NZ    . LYS A 1 422 ? -26.733 58.202  -2.780  1.00 65.67  ? 422 LYS A NZ    1 
ATOM   3519 N  N     . GLU A 1 423 ? -23.944 53.238  -5.636  1.00 47.90  ? 423 GLU A N     1 
ATOM   3520 C  CA    . GLU A 1 423 ? -22.667 53.257  -6.341  1.00 46.21  ? 423 GLU A CA    1 
ATOM   3521 C  C     . GLU A 1 423 ? -22.898 53.491  -7.834  1.00 45.54  ? 423 GLU A C     1 
ATOM   3522 O  O     . GLU A 1 423 ? -23.998 53.251  -8.325  1.00 45.76  ? 423 GLU A O     1 
ATOM   3523 C  CB    . GLU A 1 423 ? -21.940 51.937  -6.115  1.00 44.19  ? 423 GLU A CB    1 
ATOM   3524 C  CG    . GLU A 1 423 ? -21.606 51.661  -4.647  1.00 45.07  ? 423 GLU A CG    1 
ATOM   3525 C  CD    . GLU A 1 423 ? -20.544 52.607  -4.082  1.00 47.56  ? 423 GLU A CD    1 
ATOM   3526 O  OE1   . GLU A 1 423 ? -19.794 53.230  -4.871  1.00 47.53  ? 423 GLU A OE1   1 
ATOM   3527 O  OE2   . GLU A 1 423 ? -20.452 52.716  -2.839  1.00 49.19  ? 423 GLU A OE2   1 
ATOM   3528 N  N     . PRO A 1 424 ? -21.874 53.972  -8.570  1.00 44.97  ? 424 PRO A N     1 
ATOM   3529 C  CA    . PRO A 1 424 ? -22.083 54.196  -10.005 1.00 44.48  ? 424 PRO A CA    1 
ATOM   3530 C  C     . PRO A 1 424 ? -21.957 52.909  -10.842 1.00 41.90  ? 424 PRO A C     1 
ATOM   3531 O  O     . PRO A 1 424 ? -21.177 52.867  -11.810 1.00 41.50  ? 424 PRO A O     1 
ATOM   3532 C  CB    . PRO A 1 424 ? -20.969 55.178  -10.356 1.00 45.25  ? 424 PRO A CB    1 
ATOM   3533 C  CG    . PRO A 1 424 ? -19.862 54.809  -9.433  1.00 44.54  ? 424 PRO A CG    1 
ATOM   3534 C  CD    . PRO A 1 424 ? -20.507 54.344  -8.154  1.00 44.94  ? 424 PRO A CD    1 
ATOM   3535 N  N     . VAL A 1 425 ? -22.724 51.882  -10.478 1.00 40.01  ? 425 VAL A N     1 
ATOM   3536 C  CA    . VAL A 1 425 ? -22.667 50.587  -11.159 1.00 37.99  ? 425 VAL A CA    1 
ATOM   3537 C  C     . VAL A 1 425 ? -24.012 50.140  -11.745 1.00 37.78  ? 425 VAL A C     1 
ATOM   3538 O  O     . VAL A 1 425 ? -24.128 49.021  -12.266 1.00 36.52  ? 425 VAL A O     1 
ATOM   3539 C  CB    . VAL A 1 425 ? -22.133 49.466  -10.231 1.00 36.48  ? 425 VAL A CB    1 
ATOM   3540 C  CG1   . VAL A 1 425 ? -20.667 49.681  -9.911  1.00 36.09  ? 425 VAL A CG1   1 
ATOM   3541 C  CG2   . VAL A 1 425 ? -22.966 49.379  -8.956  1.00 37.37  ? 425 VAL A CG2   1 
ATOM   3542 N  N     . THR A 1 426 ? -25.014 51.014  -11.674 1.00 39.00  ? 426 THR A N     1 
ATOM   3543 C  CA    . THR A 1 426 ? -26.382 50.660  -12.064 1.00 38.83  ? 426 THR A CA    1 
ATOM   3544 C  C     . THR A 1 426 ? -26.505 50.276  -13.543 1.00 38.21  ? 426 THR A C     1 
ATOM   3545 O  O     . THR A 1 426 ? -27.248 49.358  -13.896 1.00 37.42  ? 426 THR A O     1 
ATOM   3546 C  CB    . THR A 1 426 ? -27.377 51.786  -11.738 1.00 41.06  ? 426 THR A CB    1 
ATOM   3547 O  OG1   . THR A 1 426 ? -27.240 52.828  -12.702 1.00 42.09  ? 426 THR A OG1   1 
ATOM   3548 C  CG2   . THR A 1 426 ? -27.135 52.347  -10.331 1.00 41.41  ? 426 THR A CG2   1 
ATOM   3549 N  N     . ALA A 1 427 ? -25.772 50.978  -14.400 1.00 38.51  ? 427 ALA A N     1 
ATOM   3550 C  CA    . ALA A 1 427 ? -25.708 50.641  -15.811 1.00 37.96  ? 427 ALA A CA    1 
ATOM   3551 C  C     . ALA A 1 427 ? -25.254 49.194  -15.991 1.00 36.19  ? 427 ALA A C     1 
ATOM   3552 O  O     . ALA A 1 427 ? -25.862 48.439  -16.740 1.00 36.12  ? 427 ALA A O     1 
ATOM   3553 C  CB    . ALA A 1 427 ? -24.773 51.584  -16.522 1.00 38.74  ? 427 ALA A CB    1 
ATOM   3554 N  N     . GLU A 1 428 ? -24.198 48.804  -15.281 1.00 35.34  ? 428 GLU A N     1 
ATOM   3555 C  CA    . GLU A 1 428 ? -23.657 47.450  -15.372 1.00 34.00  ? 428 GLU A CA    1 
ATOM   3556 C  C     . GLU A 1 428 ? -24.585 46.443  -14.699 1.00 33.07  ? 428 GLU A C     1 
ATOM   3557 O  O     . GLU A 1 428 ? -24.709 45.312  -15.151 1.00 32.18  ? 428 GLU A O     1 
ATOM   3558 C  CB    . GLU A 1 428 ? -22.257 47.377  -14.748 1.00 33.44  ? 428 GLU A CB    1 
ATOM   3559 C  CG    . GLU A 1 428 ? -21.137 47.980  -15.586 1.00 35.35  ? 428 GLU A CG    1 
ATOM   3560 C  CD    . GLU A 1 428 ? -21.188 49.510  -15.647 1.00 40.21  ? 428 GLU A CD    1 
ATOM   3561 O  OE1   . GLU A 1 428 ? -21.888 50.133  -14.806 1.00 41.72  ? 428 GLU A OE1   1 
ATOM   3562 O  OE2   . GLU A 1 428 ? -20.521 50.093  -16.540 1.00 41.65  ? 428 GLU A OE2   1 
ATOM   3563 N  N     . LEU A 1 429 ? -25.231 46.862  -13.615 1.00 33.26  ? 429 LEU A N     1 
ATOM   3564 C  CA    . LEU A 1 429 ? -26.197 46.025  -12.934 1.00 32.78  ? 429 LEU A CA    1 
ATOM   3565 C  C     . LEU A 1 429 ? -27.356 45.679  -13.845 1.00 33.13  ? 429 LEU A C     1 
ATOM   3566 O  O     . LEU A 1 429 ? -27.756 44.523  -13.946 1.00 32.28  ? 429 LEU A O     1 
ATOM   3567 C  CB    . LEU A 1 429 ? -26.705 46.714  -11.671 1.00 33.78  ? 429 LEU A CB    1 
ATOM   3568 C  CG    . LEU A 1 429 ? -25.958 46.318  -10.398 1.00 33.52  ? 429 LEU A CG    1 
ATOM   3569 C  CD1   . LEU A 1 429 ? -26.374 47.170  -9.210  1.00 33.50  ? 429 LEU A CD1   1 
ATOM   3570 C  CD2   . LEU A 1 429 ? -26.235 44.857  -10.121 1.00 33.41  ? 429 LEU A CD2   1 
ATOM   3571 N  N     . CYS A 1 430 ? -27.881 46.692  -14.520 1.00 34.76  ? 430 CYS A N     1 
ATOM   3572 C  CA    . CYS A 1 430 ? -29.014 46.519  -15.404 1.00 35.44  ? 430 CYS A CA    1 
ATOM   3573 C  C     . CYS A 1 430 ? -28.677 45.611  -16.570 1.00 34.84  ? 430 CYS A C     1 
ATOM   3574 O  O     . CYS A 1 430 ? -29.426 44.689  -16.876 1.00 34.21  ? 430 CYS A O     1 
ATOM   3575 C  CB    . CYS A 1 430 ? -29.492 47.871  -15.889 1.00 37.06  ? 430 CYS A CB    1 
ATOM   3576 S  SG    . CYS A 1 430 ? -30.433 48.707  -14.625 1.00 38.67  ? 430 CYS A SG    1 
ATOM   3577 N  N     . GLU A 1 431 ? -27.531 45.877  -17.192 1.00 35.19  ? 431 GLU A N     1 
ATOM   3578 C  CA    . GLU A 1 431 ? -27.012 45.093  -18.313 1.00 35.55  ? 431 GLU A CA    1 
ATOM   3579 C  C     . GLU A 1 431 ? -26.887 43.612  -17.953 1.00 34.08  ? 431 GLU A C     1 
ATOM   3580 O  O     . GLU A 1 431 ? -27.257 42.729  -18.717 1.00 34.27  ? 431 GLU A O     1 
ATOM   3581 C  CB    . GLU A 1 431 ? -25.644 45.655  -18.708 1.00 35.79  ? 431 GLU A CB    1 
ATOM   3582 C  CG    . GLU A 1 431 ? -24.841 44.807  -19.669 1.00 38.22  ? 431 GLU A CG    1 
ATOM   3583 C  CD    . GLU A 1 431 ? -25.384 44.878  -21.071 1.00 45.16  ? 431 GLU A CD    1 
ATOM   3584 O  OE1   . GLU A 1 431 ? -26.189 45.806  -21.345 1.00 49.16  ? 431 GLU A OE1   1 
ATOM   3585 O  OE2   . GLU A 1 431 ? -25.009 44.015  -21.905 1.00 47.53  ? 431 GLU A OE2   1 
ATOM   3586 N  N     . MET A 1 432 ? -26.365 43.384  -16.761 1.00 33.20  ? 432 MET A N     1 
ATOM   3587 C  CA    . MET A 1 432 ? -26.027 42.090  -16.226 1.00 32.40  ? 432 MET A CA    1 
ATOM   3588 C  C     . MET A 1 432 ? -27.259 41.206  -15.999 1.00 31.45  ? 432 MET A C     1 
ATOM   3589 O  O     . MET A 1 432 ? -27.267 40.021  -16.353 1.00 31.20  ? 432 MET A O     1 
ATOM   3590 C  CB    . MET A 1 432 ? -25.345 42.366  -14.896 1.00 32.21  ? 432 MET A CB    1 
ATOM   3591 C  CG    . MET A 1 432 ? -24.565 41.260  -14.290 1.00 31.88  ? 432 MET A CG    1 
ATOM   3592 S  SD    . MET A 1 432 ? -24.115 41.873  -12.658 1.00 33.53  ? 432 MET A SD    1 
ATOM   3593 C  CE    . MET A 1 432 ? -23.465 40.327  -12.022 1.00 32.51  ? 432 MET A CE    1 
ATOM   3594 N  N     . MET A 1 433 ? -28.285 41.792  -15.394 1.00 30.73  ? 433 MET A N     1 
ATOM   3595 C  CA    . MET A 1 433 ? -29.530 41.103  -15.103 1.00 29.83  ? 433 MET A CA    1 
ATOM   3596 C  C     . MET A 1 433 ? -30.486 41.148  -16.289 1.00 29.71  ? 433 MET A C     1 
ATOM   3597 O  O     . MET A 1 433 ? -31.561 40.550  -16.256 1.00 30.06  ? 433 MET A O     1 
ATOM   3598 C  CB    . MET A 1 433 ? -30.186 41.746  -13.885 1.00 30.49  ? 433 MET A CB    1 
ATOM   3599 C  CG    . MET A 1 433 ? -29.278 41.779  -12.666 1.00 30.28  ? 433 MET A CG    1 
ATOM   3600 S  SD    . MET A 1 433 ? -30.145 42.289  -11.183 1.00 31.45  ? 433 MET A SD    1 
ATOM   3601 C  CE    . MET A 1 433 ? -30.081 44.067  -11.341 1.00 34.33  ? 433 MET A CE    1 
ATOM   3602 N  N     . GLY A 1 434 ? -30.094 41.875  -17.330 1.00 29.10  ? 434 GLY A N     1 
ATOM   3603 C  CA    . GLY A 1 434 ? -30.912 42.035  -18.525 1.00 28.76  ? 434 GLY A CA    1 
ATOM   3604 C  C     . GLY A 1 434 ? -32.234 42.719  -18.251 1.00 28.90  ? 434 GLY A C     1 
ATOM   3605 O  O     . GLY A 1 434 ? -33.263 42.330  -18.790 1.00 29.69  ? 434 GLY A O     1 
ATOM   3606 N  N     . VAL A 1 435 ? -32.199 43.733  -17.400 1.00 28.51  ? 435 VAL A N     1 
ATOM   3607 C  CA    . VAL A 1 435 ? -33.355 44.571  -17.131 1.00 29.89  ? 435 VAL A CA    1 
ATOM   3608 C  C     . VAL A 1 435 ? -33.846 45.168  -18.442 1.00 31.36  ? 435 VAL A C     1 
ATOM   3609 O  O     . VAL A 1 435 ? -33.044 45.665  -19.235 1.00 32.01  ? 435 VAL A O     1 
ATOM   3610 C  CB    . VAL A 1 435 ? -32.980 45.705  -16.162 1.00 30.23  ? 435 VAL A CB    1 
ATOM   3611 C  CG1   . VAL A 1 435 ? -34.161 46.608  -15.886 1.00 31.85  ? 435 VAL A CG1   1 
ATOM   3612 C  CG2   . VAL A 1 435 ? -32.435 45.127  -14.862 1.00 29.33  ? 435 VAL A CG2   1 
ATOM   3613 N  N     . LYS A 1 436 ? -35.149 45.106  -18.685 1.00 32.38  ? 436 LYS A N     1 
ATOM   3614 C  CA    . LYS A 1 436 ? -35.707 45.677  -19.904 1.00 34.12  ? 436 LYS A CA    1 
ATOM   3615 C  C     . LYS A 1 436 ? -35.880 47.186  -19.784 1.00 35.94  ? 436 LYS A C     1 
ATOM   3616 O  O     . LYS A 1 436 ? -36.028 47.700  -18.686 1.00 36.40  ? 436 LYS A O     1 
ATOM   3617 C  CB    . LYS A 1 436 ? -37.022 44.987  -20.278 1.00 34.72  ? 436 LYS A CB    1 
ATOM   3618 C  CG    . LYS A 1 436 ? -36.809 43.546  -20.705 1.00 33.01  ? 436 LYS A CG    1 
ATOM   3619 C  CD    . LYS A 1 436 ? -38.051 42.703  -20.531 1.00 32.73  ? 436 LYS A CD    1 
ATOM   3620 C  CE    . LYS A 1 436 ? -38.684 42.375  -21.851 1.00 33.62  ? 436 LYS A CE    1 
ATOM   3621 N  NZ    . LYS A 1 436 ? -39.782 41.388  -21.675 1.00 33.24  ? 436 LYS A NZ    1 
ATOM   3622 N  N     . ASP A 1 437 ? -35.827 47.880  -20.919 1.00 37.52  ? 437 ASP A N     1 
ATOM   3623 C  CA    . ASP A 1 437 ? -36.123 49.310  -21.007 1.00 40.22  ? 437 ASP A CA    1 
ATOM   3624 C  C     . ASP A 1 437 ? -35.174 50.153  -20.175 1.00 40.52  ? 437 ASP A C     1 
ATOM   3625 O  O     . ASP A 1 437 ? -35.581 50.760  -19.192 1.00 41.52  ? 437 ASP A O     1 
ATOM   3626 C  CB    . ASP A 1 437 ? -37.581 49.562  -20.622 1.00 41.87  ? 437 ASP A CB    1 
ATOM   3627 C  CG    . ASP A 1 437 ? -38.550 48.839  -21.545 1.00 43.04  ? 437 ASP A CG    1 
ATOM   3628 O  OD1   . ASP A 1 437 ? -38.365 48.914  -22.782 1.00 43.85  ? 437 ASP A OD1   1 
ATOM   3629 O  OD2   . ASP A 1 437 ? -39.479 48.179  -21.038 1.00 42.31  ? 437 ASP A OD2   1 
ATOM   3630 N  N     . VAL A 1 438 ? -33.910 50.224  -20.593 1.00 40.47  ? 438 VAL A N     1 
ATOM   3631 C  CA    . VAL A 1 438 ? -32.860 50.591  -19.638 1.00 39.97  ? 438 VAL A CA    1 
ATOM   3632 C  C     . VAL A 1 438 ? -31.969 51.842  -19.677 1.00 41.11  ? 438 VAL A C     1 
ATOM   3633 O  O     . VAL A 1 438 ? -31.611 52.231  -18.586 1.00 41.42  ? 438 VAL A O     1 
ATOM   3634 C  CB    . VAL A 1 438 ? -32.081 49.331  -19.112 1.00 37.42  ? 438 VAL A CB    1 
ATOM   3635 C  CG1   . VAL A 1 438 ? -30.556 49.511  -19.156 1.00 37.63  ? 438 VAL A CG1   1 
ATOM   3636 C  CG2   . VAL A 1 438 ? -32.508 49.043  -17.718 1.00 36.36  ? 438 VAL A CG2   1 
ATOM   3637 N  N     . CYS A 1 439 ? -31.552 52.527  -20.757 1.00 42.41  ? 439 CYS A N     1 
ATOM   3638 C  CA    . CYS A 1 439 ? -31.484 52.266  -22.209 1.00 43.03  ? 439 CYS A CA    1 
ATOM   3639 C  C     . CYS A 1 439 ? -32.314 53.200  -23.062 1.00 45.20  ? 439 CYS A C     1 
ATOM   3640 O  O     . CYS A 1 439 ? -33.529 53.067  -23.107 1.00 46.43  ? 439 CYS A O     1 
ATOM   3641 C  CB    . CYS A 1 439 ? -31.580 50.814  -22.614 1.00 41.70  ? 439 CYS A CB    1 
ATOM   3642 S  SG    . CYS A 1 439 ? -29.936 50.146  -22.481 1.00 42.26  ? 439 CYS A SG    1 
ATOM   3643 N  N     . CYS A 1 440 ? -31.642 54.129  -23.749 1.00 46.33  ? 440 CYS A N     1 
ATOM   3644 C  CA    . CYS A 1 440 ? -32.341 55.177  -24.502 1.00 48.66  ? 440 CYS A CA    1 
ATOM   3645 C  C     . CYS A 1 440 ? -31.553 56.009  -25.537 1.00 49.77  ? 440 CYS A C     1 
ATOM   3646 O  O     . CYS A 1 440 ? -30.332 56.057  -25.516 1.00 48.12  ? 440 CYS A O     1 
ATOM   3647 C  CB    . CYS A 1 440 ? -32.980 56.119  -23.512 1.00 50.46  ? 440 CYS A CB    1 
ATOM   3648 S  SG    . CYS A 1 440 ? -34.084 57.229  -24.275 1.00 55.40  ? 440 CYS A SG    1 
ATOM   3649 N  N     . MET A 1 441 ? -32.316 56.709  -26.391 1.00 52.67  ? 441 MET A N     1 
ATOM   3650 C  CA    . MET A 1 441 ? -31.870 57.514  -27.557 1.00 54.43  ? 441 MET A CA    1 
ATOM   3651 C  C     . MET A 1 441 ? -31.172 56.656  -28.583 1.00 52.87  ? 441 MET A C     1 
ATOM   3652 O  O     . MET A 1 441 ? -31.817 55.852  -29.240 1.00 52.83  ? 441 MET A O     1 
ATOM   3653 C  CB    . MET A 1 441 ? -31.005 58.726  -27.186 1.00 55.73  ? 441 MET A CB    1 
ATOM   3654 C  CG    . MET A 1 441 ? -31.506 59.546  -26.006 1.00 57.76  ? 441 MET A CG    1 
ATOM   3655 S  SD    . MET A 1 441 ? -32.868 60.665  -26.326 1.00 64.17  ? 441 MET A SD    1 
ATOM   3656 C  CE    . MET A 1 441 ? -34.316 59.633  -26.168 1.00 61.06  ? 441 MET A CE    1 
ATOM   3657 N  N     . MET B 1 1   ? -11.513 -11.203 27.640  1.00 190.57 ? 1   MET B N     1 
ATOM   3658 C  CA    . MET B 1 1   ? -10.774 -10.045 27.056  1.00 188.64 ? 1   MET B CA    1 
ATOM   3659 C  C     . MET B 1 1   ? -10.094 -10.405 25.739  1.00 185.53 ? 1   MET B C     1 
ATOM   3660 O  O     . MET B 1 1   ? -10.219 -9.676  24.750  1.00 178.76 ? 1   MET B O     1 
ATOM   3661 C  CB    . MET B 1 1   ? -9.724  -9.512  28.039  1.00 197.89 ? 1   MET B CB    1 
ATOM   3662 C  CG    . MET B 1 1   ? -8.938  -8.304  27.524  1.00 196.70 ? 1   MET B CG    1 
ATOM   3663 S  SD    . MET B 1 1   ? -7.187  -8.326  27.977  1.00 207.94 ? 1   MET B SD    1 
ATOM   3664 C  CE    . MET B 1 1   ? -6.495  -9.380  26.706  1.00 206.00 ? 1   MET B CE    1 
ATOM   3665 N  N     . LYS B 1 2   ? -9.371  -11.525 25.735  1.00 191.13 ? 2   LYS B N     1 
ATOM   3666 C  CA    . LYS B 1 2   ? -8.517  -11.888 24.603  1.00 190.50 ? 2   LYS B CA    1 
ATOM   3667 C  C     . LYS B 1 2   ? -9.299  -12.557 23.466  1.00 182.97 ? 2   LYS B C     1 
ATOM   3668 O  O     . LYS B 1 2   ? -10.516 -12.371 23.343  1.00 176.30 ? 2   LYS B O     1 
ATOM   3669 C  CB    . LYS B 1 2   ? -7.329  -12.748 25.067  1.00 200.69 ? 2   LYS B CB    1 
ATOM   3670 C  CG    . LYS B 1 2   ? -5.979  -12.279 24.512  1.00 204.15 ? 2   LYS B CG    1 
ATOM   3671 C  CD    . LYS B 1 2   ? -4.797  -13.032 25.122  1.00 215.29 ? 2   LYS B CD    1 
ATOM   3672 C  CE    . LYS B 1 2   ? -4.215  -14.059 24.158  1.00 216.46 ? 2   LYS B CE    1 
ATOM   3673 N  NZ    . LYS B 1 2   ? -5.190  -15.112 23.757  1.00 211.75 ? 2   LYS B NZ    1 
ATOM   3674 N  N     . VAL B 1 3   ? -8.583  -13.339 22.656  1.00 184.77 ? 3   VAL B N     1 
ATOM   3675 C  CA    . VAL B 1 3   ? -9.082  -13.915 21.397  1.00 178.57 ? 3   VAL B CA    1 
ATOM   3676 C  C     . VAL B 1 3   ? -10.490 -14.536 21.480  1.00 173.71 ? 3   VAL B C     1 
ATOM   3677 O  O     . VAL B 1 3   ? -11.469 -13.908 21.068  1.00 166.00 ? 3   VAL B O     1 
ATOM   3678 C  CB    . VAL B 1 3   ? -8.048  -14.914 20.772  1.00 184.01 ? 3   VAL B CB    1 
ATOM   3679 C  CG1   . VAL B 1 3   ? -8.463  -15.320 19.361  1.00 177.99 ? 3   VAL B CG1   1 
ATOM   3680 C  CG2   . VAL B 1 3   ? -6.640  -14.305 20.752  1.00 189.56 ? 3   VAL B CG2   1 
ATOM   3681 N  N     . GLU B 1 4   ? -10.583 -15.755 22.014  1.00 178.63 ? 4   GLU B N     1 
ATOM   3682 C  CA    . GLU B 1 4   ? -11.851 -16.501 22.054  1.00 175.07 ? 4   GLU B CA    1 
ATOM   3683 C  C     . GLU B 1 4   ? -12.538 -16.462 23.424  1.00 177.64 ? 4   GLU B C     1 
ATOM   3684 O  O     . GLU B 1 4   ? -13.425 -17.274 23.715  1.00 177.40 ? 4   GLU B O     1 
ATOM   3685 C  CB    . GLU B 1 4   ? -11.641 -17.948 21.586  1.00 178.55 ? 4   GLU B CB    1 
ATOM   3686 C  CG    . GLU B 1 4   ? -11.390 -18.078 20.086  1.00 174.46 ? 4   GLU B CG    1 
ATOM   3687 C  CD    . GLU B 1 4   ? -11.113 -19.505 19.645  1.00 178.87 ? 4   GLU B CD    1 
ATOM   3688 O  OE1   . GLU B 1 4   ? -11.770 -19.954 18.671  1.00 174.06 ? 4   GLU B OE1   1 
ATOM   3689 O  OE2   . GLU B 1 4   ? -10.241 -20.176 20.266  1.00 187.47 ? 4   GLU B OE2   1 
ATOM   3690 N  N     . GLU B 1 5   ? -12.123 -15.500 24.247  1.00 180.32 ? 5   GLU B N     1 
ATOM   3691 C  CA    . GLU B 1 5   ? -12.698 -15.278 25.572  1.00 183.39 ? 5   GLU B CA    1 
ATOM   3692 C  C     . GLU B 1 5   ? -14.085 -14.651 25.461  1.00 175.44 ? 5   GLU B C     1 
ATOM   3693 O  O     . GLU B 1 5   ? -14.976 -14.949 26.261  1.00 176.82 ? 5   GLU B O     1 
ATOM   3694 C  CB    . GLU B 1 5   ? -11.792 -14.359 26.401  1.00 189.18 ? 5   GLU B CB    1 
ATOM   3695 C  CG    . GLU B 1 5   ? -10.311 -14.758 26.439  1.00 197.08 ? 5   GLU B CG    1 
ATOM   3696 C  CD    . GLU B 1 5   ? -9.993  -15.844 27.459  1.00 206.73 ? 5   GLU B CD    1 
ATOM   3697 O  OE1   . GLU B 1 5   ? -10.922 -16.368 28.111  1.00 207.30 ? 5   GLU B OE1   1 
ATOM   3698 O  OE2   . GLU B 1 5   ? -8.797  -16.174 27.609  1.00 214.45 ? 5   GLU B OE2   1 
ATOM   3699 N  N     . ILE B 1 6   ? -14.253 -13.784 24.462  1.00 167.52 ? 6   ILE B N     1 
ATOM   3700 C  CA    . ILE B 1 6   ? -15.494 -13.041 24.257  1.00 159.93 ? 6   ILE B CA    1 
ATOM   3701 C  C     . ILE B 1 6   ? -16.624 -13.945 23.757  1.00 155.42 ? 6   ILE B C     1 
ATOM   3702 O  O     . ILE B 1 6   ? -17.772 -13.812 24.192  1.00 153.32 ? 6   ILE B O     1 
ATOM   3703 C  CB    . ILE B 1 6   ? -15.295 -11.849 23.268  1.00 153.80 ? 6   ILE B CB    1 
ATOM   3704 C  CG1   . ILE B 1 6   ? -13.976 -11.096 23.539  1.00 158.41 ? 6   ILE B CG1   1 
ATOM   3705 C  CG2   . ILE B 1 6   ? -16.524 -10.916 23.267  1.00 147.81 ? 6   ILE B CG2   1 
ATOM   3706 C  CD1   . ILE B 1 6   ? -13.895 -10.359 24.878  1.00 163.74 ? 6   ILE B CD1   1 
ATOM   3707 N  N     . LEU B 1 7   ? -16.290 -14.863 22.851  1.00 154.35 ? 7   LEU B N     1 
ATOM   3708 C  CA    . LEU B 1 7   ? -17.270 -15.781 22.265  1.00 150.58 ? 7   LEU B CA    1 
ATOM   3709 C  C     . LEU B 1 7   ? -18.013 -16.599 23.321  1.00 154.67 ? 7   LEU B C     1 
ATOM   3710 O  O     . LEU B 1 7   ? -19.170 -16.975 23.120  1.00 151.26 ? 7   LEU B O     1 
ATOM   3711 C  CB    . LEU B 1 7   ? -16.611 -16.711 21.237  1.00 151.17 ? 7   LEU B CB    1 
ATOM   3712 C  CG    . LEU B 1 7   ? -15.885 -16.104 20.027  1.00 147.32 ? 7   LEU B CG    1 
ATOM   3713 C  CD1   . LEU B 1 7   ? -15.477 -17.195 19.046  1.00 148.20 ? 7   LEU B CD1   1 
ATOM   3714 C  CD2   . LEU B 1 7   ? -16.740 -15.053 19.324  1.00 139.34 ? 7   LEU B CD2   1 
ATOM   3715 N  N     . GLU B 1 8   ? -17.338 -16.862 24.440  1.00 162.33 ? 8   GLU B N     1 
ATOM   3716 C  CA    . GLU B 1 8   ? -17.932 -17.559 25.579  1.00 167.45 ? 8   GLU B CA    1 
ATOM   3717 C  C     . GLU B 1 8   ? -19.078 -16.736 26.163  1.00 164.34 ? 8   GLU B C     1 
ATOM   3718 O  O     . GLU B 1 8   ? -20.210 -17.216 26.261  1.00 162.85 ? 8   GLU B O     1 
ATOM   3719 C  CB    . GLU B 1 8   ? -16.886 -17.824 26.675  1.00 177.21 ? 8   GLU B CB    1 
ATOM   3720 C  CG    . GLU B 1 8   ? -15.479 -18.197 26.195  1.00 180.92 ? 8   GLU B CG    1 
ATOM   3721 C  CD    . GLU B 1 8   ? -15.371 -19.649 25.738  1.00 183.50 ? 8   GLU B CD    1 
ATOM   3722 O  OE1   . GLU B 1 8   ? -15.927 -19.929 24.510  1.00 176.66 ? 8   GLU B OE1   1 
ATOM   3723 O  OE2   . GLU B 1 8   ? -14.614 -20.504 26.701  1.00 193.71 ? 8   GLU B OE2   1 
ATOM   3724 N  N     . LYS B 1 9   ? -18.775 -15.488 26.523  1.00 163.56 ? 9   LYS B N     1 
ATOM   3725 C  CA    . LYS B 1 9   ? -19.721 -14.597 27.200  1.00 162.00 ? 9   LYS B CA    1 
ATOM   3726 C  C     . LYS B 1 9   ? -20.935 -14.235 26.331  1.00 153.23 ? 9   LYS B C     1 
ATOM   3727 O  O     . LYS B 1 9   ? -21.973 -13.805 26.846  1.00 152.44 ? 9   LYS B O     1 
ATOM   3728 C  CB    . LYS B 1 9   ? -19.012 -13.322 27.675  1.00 163.78 ? 9   LYS B CB    1 
ATOM   3729 C  CG    . LYS B 1 9   ? -17.529 -13.491 28.015  1.00 170.55 ? 9   LYS B CG    1 
ATOM   3730 C  CD    . LYS B 1 9   ? -16.886 -12.148 28.365  1.00 172.04 ? 9   LYS B CD    1 
ATOM   3731 C  CE    . LYS B 1 9   ? -15.406 -12.078 27.967  1.00 174.94 ? 9   LYS B CE    1 
ATOM   3732 N  NZ    . LYS B 1 9   ? -14.530 -13.020 28.725  1.00 184.46 ? 9   LYS B NZ    1 
ATOM   3733 N  N     . ALA B 1 10  ? -20.799 -14.416 25.018  1.00 147.20 ? 10  ALA B N     1 
ATOM   3734 C  CA    . ALA B 1 10  ? -21.870 -14.106 24.067  1.00 139.18 ? 10  ALA B CA    1 
ATOM   3735 C  C     . ALA B 1 10  ? -22.889 -15.233 23.957  1.00 138.67 ? 10  ALA B C     1 
ATOM   3736 O  O     . ALA B 1 10  ? -24.091 -14.983 23.820  1.00 135.01 ? 10  ALA B O     1 
ATOM   3737 C  CB    . ALA B 1 10  ? -21.287 -13.789 22.698  1.00 133.93 ? 10  ALA B CB    1 
ATOM   3738 N  N     . LEU B 1 11  ? -22.395 -16.468 24.026  1.00 142.72 ? 11  LEU B N     1 
ATOM   3739 C  CA    . LEU B 1 11  ? -23.222 -17.666 23.887  1.00 143.02 ? 11  LEU B CA    1 
ATOM   3740 C  C     . LEU B 1 11  ? -24.350 -17.745 24.912  1.00 145.27 ? 11  LEU B C     1 
ATOM   3741 O  O     . LEU B 1 11  ? -25.239 -18.590 24.802  1.00 145.44 ? 11  LEU B O     1 
ATOM   3742 C  CB    . LEU B 1 11  ? -22.354 -18.927 23.952  1.00 148.90 ? 11  LEU B CB    1 
ATOM   3743 C  CG    . LEU B 1 11  ? -21.500 -19.246 22.720  1.00 146.77 ? 11  LEU B CG    1 
ATOM   3744 C  CD1   . LEU B 1 11  ? -20.346 -20.169 23.079  1.00 154.40 ? 11  LEU B CD1   1 
ATOM   3745 C  CD2   . LEU B 1 11  ? -22.341 -19.840 21.598  1.00 142.20 ? 11  LEU B CD2   1 
ATOM   3746 N  N     . GLU B 1 12  ? -24.308 -16.860 25.902  1.00 147.40 ? 12  GLU B N     1 
ATOM   3747 C  CA    . GLU B 1 12  ? -25.360 -16.774 26.903  1.00 149.96 ? 12  GLU B CA    1 
ATOM   3748 C  C     . GLU B 1 12  ? -26.612 -16.160 26.300  1.00 143.10 ? 12  GLU B C     1 
ATOM   3749 O  O     . GLU B 1 12  ? -27.727 -16.589 26.598  1.00 144.07 ? 12  GLU B O     1 
ATOM   3750 C  CB    . GLU B 1 12  ? -24.900 -15.938 28.093  1.00 155.14 ? 12  GLU B CB    1 
ATOM   3751 C  CG    . GLU B 1 12  ? -23.700 -16.512 28.819  1.00 163.09 ? 12  GLU B CG    1 
ATOM   3752 C  CD    . GLU B 1 12  ? -23.381 -15.762 30.093  1.00 169.60 ? 12  GLU B CD    1 
ATOM   3753 O  OE1   . GLU B 1 12  ? -24.276 -15.652 30.957  1.00 173.03 ? 12  GLU B OE1   1 
ATOM   3754 O  OE2   . GLU B 1 12  ? -22.232 -15.289 30.233  1.00 171.75 ? 12  GLU B OE2   1 
ATOM   3755 N  N     . LEU B 1 13  ? -26.412 -15.164 25.442  1.00 136.52 ? 13  LEU B N     1 
ATOM   3756 C  CA    . LEU B 1 13  ? -27.514 -14.405 24.856  1.00 130.22 ? 13  LEU B CA    1 
ATOM   3757 C  C     . LEU B 1 13  ? -28.043 -15.028 23.561  1.00 124.82 ? 13  LEU B C     1 
ATOM   3758 O  O     . LEU B 1 13  ? -29.091 -14.614 23.058  1.00 120.67 ? 13  LEU B O     1 
ATOM   3759 C  CB    . LEU B 1 13  ? -27.092 -12.948 24.619  1.00 126.76 ? 13  LEU B CB    1 
ATOM   3760 C  CG    . LEU B 1 13  ? -26.291 -12.224 25.711  1.00 131.56 ? 13  LEU B CG    1 
ATOM   3761 C  CD1   . LEU B 1 13  ? -25.760 -10.910 25.176  1.00 127.19 ? 13  LEU B CD1   1 
ATOM   3762 C  CD2   . LEU B 1 13  ? -27.099 -11.997 26.989  1.00 136.33 ? 13  LEU B CD2   1 
ATOM   3763 N  N     . VAL B 1 14  ? -27.330 -16.024 23.033  1.00 125.41 ? 14  VAL B N     1 
ATOM   3764 C  CA    . VAL B 1 14  ? -27.720 -16.673 21.770  1.00 121.04 ? 14  VAL B CA    1 
ATOM   3765 C  C     . VAL B 1 14  ? -28.408 -18.036 21.956  1.00 124.26 ? 14  VAL B C     1 
ATOM   3766 O  O     . VAL B 1 14  ? -29.454 -18.291 21.358  1.00 121.48 ? 14  VAL B O     1 
ATOM   3767 C  CB    . VAL B 1 14  ? -26.543 -16.747 20.736  1.00 118.85 ? 14  VAL B CB    1 
ATOM   3768 C  CG1   . VAL B 1 14  ? -25.873 -15.387 20.580  1.00 115.76 ? 14  VAL B CG1   1 
ATOM   3769 C  CG2   . VAL B 1 14  ? -25.517 -17.797 21.119  1.00 124.69 ? 14  VAL B CG2   1 
ATOM   3770 N  N     . ILE B 1 15  ? -27.824 -18.898 22.787  1.00 130.52 ? 15  ILE B N     1 
ATOM   3771 C  CA    . ILE B 1 15  ? -28.400 -20.213 23.078  1.00 134.63 ? 15  ILE B CA    1 
ATOM   3772 C  C     . ILE B 1 15  ? -29.567 -20.058 24.056  1.00 136.95 ? 15  ILE B C     1 
ATOM   3773 O  O     . ILE B 1 15  ? -29.406 -19.449 25.116  1.00 140.04 ? 15  ILE B O     1 
ATOM   3774 C  CB    . ILE B 1 15  ? -27.351 -21.201 23.666  1.00 141.59 ? 15  ILE B CB    1 
ATOM   3775 C  CG1   . ILE B 1 15  ? -26.062 -21.195 22.836  1.00 140.16 ? 15  ILE B CG1   1 
ATOM   3776 C  CG2   . ILE B 1 15  ? -27.922 -22.620 23.748  1.00 145.80 ? 15  ILE B CG2   1 
ATOM   3777 C  CD1   . ILE B 1 15  ? -24.889 -21.909 23.496  1.00 147.41 ? 15  ILE B CD1   1 
ATOM   3778 N  N     . PRO B 1 16  ? -30.747 -20.603 23.698  1.00 109.78 ? 16  PRO B N     1 
ATOM   3779 C  CA    . PRO B 1 16  ? -31.934 -20.531 24.549  1.00 110.62 ? 16  PRO B CA    1 
ATOM   3780 C  C     . PRO B 1 16  ? -31.838 -21.444 25.765  1.00 116.04 ? 16  PRO B C     1 
ATOM   3781 O  O     . PRO B 1 16  ? -31.294 -22.551 25.679  1.00 118.42 ? 16  PRO B O     1 
ATOM   3782 C  CB    . PRO B 1 16  ? -33.065 -21.014 23.628  1.00 107.29 ? 16  PRO B CB    1 
ATOM   3783 C  CG    . PRO B 1 16  ? -32.480 -21.067 22.250  1.00 104.29 ? 16  PRO B CG    1 
ATOM   3784 C  CD    . PRO B 1 16  ? -31.031 -21.323 22.447  1.00 107.05 ? 16  PRO B CD    1 
ATOM   3785 N  N     . ASP B 1 17  ? -32.369 -20.970 26.889  1.00 118.35 ? 17  ASP B N     1 
ATOM   3786 C  CA    . ASP B 1 17  ? -32.458 -21.760 28.111  1.00 123.81 ? 17  ASP B CA    1 
ATOM   3787 C  C     . ASP B 1 17  ? -33.426 -22.932 27.928  1.00 124.02 ? 17  ASP B C     1 
ATOM   3788 O  O     . ASP B 1 17  ? -34.301 -22.893 27.059  1.00 119.90 ? 17  ASP B O     1 
ATOM   3789 C  CB    . ASP B 1 17  ? -32.876 -20.871 29.289  1.00 126.55 ? 17  ASP B CB    1 
ATOM   3790 C  CG    . ASP B 1 17  ? -34.211 -20.168 29.064  1.00 123.50 ? 17  ASP B CG    1 
ATOM   3791 O  OD1   . ASP B 1 17  ? -34.534 -19.801 27.913  1.00 118.51 ? 17  ASP B OD1   1 
ATOM   3792 O  OD2   . ASP B 1 17  ? -34.940 -19.968 30.056  1.00 126.86 ? 17  ASP B OD2   1 
ATOM   3793 N  N     . GLU B 1 18  ? -33.260 -23.971 28.744  1.00 129.18 ? 18  GLU B N     1 
ATOM   3794 C  CA    . GLU B 1 18  ? -34.044 -25.202 28.612  1.00 130.14 ? 18  GLU B CA    1 
ATOM   3795 C  C     . GLU B 1 18  ? -35.565 -25.011 28.650  1.00 128.50 ? 18  GLU B C     1 
ATOM   3796 O  O     . GLU B 1 18  ? -36.287 -25.735 27.970  1.00 126.76 ? 18  GLU B O     1 
ATOM   3797 C  CB    . GLU B 1 18  ? -33.629 -26.223 29.669  1.00 137.17 ? 18  GLU B CB    1 
ATOM   3798 C  CG    . GLU B 1 18  ? -32.380 -27.011 29.320  1.00 138.82 ? 18  GLU B CG    1 
ATOM   3799 C  CD    . GLU B 1 18  ? -32.048 -28.075 30.358  1.00 146.26 ? 18  GLU B CD    1 
ATOM   3800 O  OE1   . GLU B 1 18  ? -31.321 -29.030 30.016  1.00 147.83 ? 18  GLU B OE1   1 
ATOM   3801 O  OE2   . GLU B 1 18  ? -32.510 -27.961 31.515  1.00 149.81 ? 18  GLU B OE2   1 
ATOM   3802 N  N     . GLU B 1 19  ? -36.040 -24.046 29.438  1.00 129.27 ? 19  GLU B N     1 
ATOM   3803 C  CA    . GLU B 1 19  ? -37.483 -23.827 29.617  1.00 128.59 ? 19  GLU B CA    1 
ATOM   3804 C  C     . GLU B 1 19  ? -38.148 -23.092 28.457  1.00 121.99 ? 19  GLU B C     1 
ATOM   3805 O  O     . GLU B 1 19  ? -39.374 -23.108 28.340  1.00 121.16 ? 19  GLU B O     1 
ATOM   3806 C  CB    . GLU B 1 19  ? -37.811 -23.152 30.960  1.00 133.15 ? 19  GLU B CB    1 
ATOM   3807 C  CG    . GLU B 1 19  ? -36.901 -22.001 31.376  1.00 133.78 ? 19  GLU B CG    1 
ATOM   3808 C  CD    . GLU B 1 19  ? -35.607 -22.477 32.030  1.00 138.83 ? 19  GLU B CD    1 
ATOM   3809 O  OE1   . GLU B 1 19  ? -34.624 -22.720 31.299  1.00 136.89 ? 19  GLU B OE1   1 
ATOM   3810 O  OE2   . GLU B 1 19  ? -35.568 -22.604 33.274  1.00 144.79 ? 19  GLU B OE2   1 
ATOM   3811 N  N     . GLU B 1 20  ? -37.344 -22.449 27.611  1.00 117.68 ? 20  GLU B N     1 
ATOM   3812 C  CA    . GLU B 1 20  ? -37.830 -21.929 26.334  1.00 111.67 ? 20  GLU B CA    1 
ATOM   3813 C  C     . GLU B 1 20  ? -37.825 -23.066 25.317  1.00 109.63 ? 20  GLU B C     1 
ATOM   3814 O  O     . GLU B 1 20  ? -38.741 -23.187 24.498  1.00 106.55 ? 20  GLU B O     1 
ATOM   3815 C  CB    . GLU B 1 20  ? -36.966 -20.768 25.840  1.00 108.64 ? 20  GLU B CB    1 
ATOM   3816 C  CG    . GLU B 1 20  ? -37.464 -20.126 24.541  1.00 103.28 ? 20  GLU B CG    1 
ATOM   3817 C  CD    . GLU B 1 20  ? -36.446 -19.190 23.899  1.00 100.89 ? 20  GLU B CD    1 
ATOM   3818 O  OE1   . GLU B 1 20  ? -35.400 -18.901 24.524  1.00 103.71 ? 20  GLU B OE1   1 
ATOM   3819 O  OE2   . GLU B 1 20  ? -36.698 -18.736 22.761  1.00 97.40  ? 20  GLU B OE2   1 
ATOM   3820 N  N     . VAL B 1 21  ? -36.781 -23.890 25.384  1.00 111.62 ? 21  VAL B N     1 
ATOM   3821 C  CA    . VAL B 1 21  ? -36.675 -25.118 24.599  1.00 111.17 ? 21  VAL B CA    1 
ATOM   3822 C  C     . VAL B 1 21  ? -37.808 -26.084 24.977  1.00 113.47 ? 21  VAL B C     1 
ATOM   3823 O  O     . VAL B 1 21  ? -38.396 -26.740 24.111  1.00 111.47 ? 21  VAL B O     1 
ATOM   3824 C  CB    . VAL B 1 21  ? -35.286 -25.797 24.810  1.00 114.56 ? 21  VAL B CB    1 
ATOM   3825 C  CG1   . VAL B 1 21  ? -35.210 -27.158 24.115  1.00 115.31 ? 21  VAL B CG1   1 
ATOM   3826 C  CG2   . VAL B 1 21  ? -34.157 -24.885 24.331  1.00 112.01 ? 21  VAL B CG2   1 
ATOM   3827 N  N     . ARG B 1 22  ? -38.114 -26.138 26.275  1.00 117.75 ? 22  ARG B N     1 
ATOM   3828 C  CA    . ARG B 1 22  ? -39.128 -27.034 26.831  1.00 121.05 ? 22  ARG B CA    1 
ATOM   3829 C  C     . ARG B 1 22  ? -40.545 -26.612 26.449  1.00 118.05 ? 22  ARG B C     1 
ATOM   3830 O  O     . ARG B 1 22  ? -41.428 -27.460 26.298  1.00 119.11 ? 22  ARG B O     1 
ATOM   3831 C  CB    . ARG B 1 22  ? -38.996 -27.093 28.352  1.00 127.16 ? 22  ARG B CB    1 
ATOM   3832 C  CG    . ARG B 1 22  ? -39.008 -28.490 28.914  1.00 132.38 ? 22  ARG B CG    1 
ATOM   3833 C  CD    . ARG B 1 22  ? -38.563 -28.487 30.365  1.00 138.38 ? 22  ARG B CD    1 
ATOM   3834 N  NE    . ARG B 1 22  ? -39.651 -28.117 31.269  1.00 140.55 ? 22  ARG B NE    1 
ATOM   3835 C  CZ    . ARG B 1 22  ? -40.526 -28.977 31.788  1.00 144.15 ? 22  ARG B CZ    1 
ATOM   3836 N  NH1   . ARG B 1 22  ? -40.453 -30.268 31.497  1.00 145.64 ? 22  ARG B NH1   1 
ATOM   3837 N  NH2   . ARG B 1 22  ? -41.479 -28.544 32.602  1.00 146.44 ? 22  ARG B NH2   1 
ATOM   3838 N  N     . LYS B 1 23  ? -40.752 -25.301 26.312  1.00 114.67 ? 23  LYS B N     1 
ATOM   3839 C  CA    . LYS B 1 23  ? -42.009 -24.746 25.802  1.00 111.35 ? 23  LYS B CA    1 
ATOM   3840 C  C     . LYS B 1 23  ? -42.194 -25.084 24.325  1.00 106.52 ? 23  LYS B C     1 
ATOM   3841 O  O     . LYS B 1 23  ? -43.314 -25.307 23.862  1.00 105.11 ? 23  LYS B O     1 
ATOM   3842 C  CB    . LYS B 1 23  ? -42.042 -23.224 25.983  1.00 109.55 ? 23  LYS B CB    1 
ATOM   3843 C  CG    . LYS B 1 23  ? -42.507 -22.751 27.358  1.00 114.13 ? 23  LYS B CG    1 
ATOM   3844 C  CD    . LYS B 1 23  ? -42.924 -21.281 27.330  1.00 112.08 ? 23  LYS B CD    1 
ATOM   3845 C  CE    . LYS B 1 23  ? -44.253 -21.091 26.599  1.00 109.46 ? 23  LYS B CE    1 
ATOM   3846 N  NZ    . LYS B 1 23  ? -44.650 -19.663 26.482  1.00 107.38 ? 23  LYS B NZ    1 
ATOM   3847 N  N     . GLY B 1 24  ? -41.079 -25.119 23.602  1.00 104.25 ? 24  GLY B N     1 
ATOM   3848 C  CA    . GLY B 1 24  ? -41.074 -25.380 22.170  1.00 100.23 ? 24  GLY B CA    1 
ATOM   3849 C  C     . GLY B 1 24  ? -41.198 -26.842 21.794  1.00 101.88 ? 24  GLY B C     1 
ATOM   3850 O  O     . GLY B 1 24  ? -41.720 -27.166 20.729  1.00 99.40  ? 24  GLY B O     1 
ATOM   3851 N  N     . ARG B 1 25  ? -40.706 -27.729 22.654  1.00 106.54 ? 25  ARG B N     1 
ATOM   3852 C  CA    . ARG B 1 25  ? -40.841 -29.163 22.422  1.00 109.13 ? 25  ARG B CA    1 
ATOM   3853 C  C     . ARG B 1 25  ? -42.282 -29.613 22.634  1.00 110.29 ? 25  ARG B C     1 
ATOM   3854 O  O     . ARG B 1 25  ? -42.820 -30.387 21.842  1.00 109.50 ? 25  ARG B O     1 
ATOM   3855 C  CB    . ARG B 1 25  ? -39.898 -29.953 23.329  1.00 114.48 ? 25  ARG B CB    1 
ATOM   3856 C  CG    . ARG B 1 25  ? -38.437 -29.931 22.903  1.00 114.41 ? 25  ARG B CG    1 
ATOM   3857 C  CD    . ARG B 1 25  ? -38.198 -30.711 21.612  1.00 113.06 ? 25  ARG B CD    1 
ATOM   3858 N  NE    . ARG B 1 25  ? -36.874 -31.331 21.592  1.00 116.45 ? 25  ARG B NE    1 
ATOM   3859 C  CZ    . ARG B 1 25  ? -35.746 -30.720 21.233  1.00 115.27 ? 25  ARG B CZ    1 
ATOM   3860 N  NH1   . ARG B 1 25  ? -35.748 -29.445 20.849  1.00 110.35 ? 25  ARG B NH1   1 
ATOM   3861 N  NH2   . ARG B 1 25  ? -34.604 -31.395 21.262  1.00 118.79 ? 25  ARG B NH2   1 
ATOM   3862 N  N     . GLU B 1 26  ? -42.901 -29.109 23.700  1.00 112.47 ? 26  GLU B N     1 
ATOM   3863 C  CA    . GLU B 1 26  ? -44.294 -29.420 24.026  1.00 114.41 ? 26  GLU B CA    1 
ATOM   3864 C  C     . GLU B 1 26  ? -45.263 -28.781 23.024  1.00 109.75 ? 26  GLU B C     1 
ATOM   3865 O  O     . GLU B 1 26  ? -46.459 -29.093 23.008  1.00 110.66 ? 26  GLU B O     1 
ATOM   3866 C  CB    . GLU B 1 26  ? -44.622 -28.992 25.463  1.00 118.49 ? 26  GLU B CB    1 
ATOM   3867 C  CG    . GLU B 1 26  ? -43.929 -29.833 26.540  1.00 124.62 ? 26  GLU B CG    1 
ATOM   3868 C  CD    . GLU B 1 26  ? -44.265 -29.394 27.961  1.00 129.34 ? 26  GLU B CD    1 
ATOM   3869 O  OE1   . GLU B 1 26  ? -45.340 -28.791 28.175  1.00 129.27 ? 26  GLU B OE1   1 
ATOM   3870 O  OE2   . GLU B 1 26  ? -43.452 -29.664 28.871  1.00 133.82 ? 26  GLU B OE2   1 
ATOM   3871 N  N     . ALA B 1 27  ? -44.731 -27.885 22.195  1.00 105.25 ? 27  ALA B N     1 
ATOM   3872 C  CA    . ALA B 1 27  ? -45.464 -27.309 21.075  1.00 100.83 ? 27  ALA B CA    1 
ATOM   3873 C  C     . ALA B 1 27  ? -45.222 -28.119 19.799  1.00 99.02  ? 27  ALA B C     1 
ATOM   3874 O  O     . ALA B 1 27  ? -46.114 -28.236 18.954  1.00 97.14  ? 27  ALA B O     1 
ATOM   3875 C  CB    . ALA B 1 27  ? -45.058 -25.864 20.871  1.00 97.38  ? 27  ALA B CB    1 
ATOM   3876 N  N     . GLU B 1 28  ? -44.015 -28.672 19.675  1.00 100.09 ? 28  GLU B N     1 
ATOM   3877 C  CA    . GLU B 1 28  ? -43.627 -29.496 18.527  1.00 99.42  ? 28  GLU B CA    1 
ATOM   3878 C  C     . GLU B 1 28  ? -44.447 -30.781 18.450  1.00 102.47 ? 28  GLU B C     1 
ATOM   3879 O  O     . GLU B 1 28  ? -44.930 -31.156 17.377  1.00 100.98 ? 28  GLU B O     1 
ATOM   3880 C  CB    . GLU B 1 28  ? -42.133 -29.839 18.586  1.00 100.87 ? 28  GLU B CB    1 
ATOM   3881 C  CG    . GLU B 1 28  ? -41.623 -30.629 17.378  1.00 100.38 ? 28  GLU B CG    1 
ATOM   3882 C  CD    . GLU B 1 28  ? -40.240 -31.226 17.582  1.00 103.29 ? 28  GLU B CD    1 
ATOM   3883 O  OE1   . GLU B 1 28  ? -39.593 -30.928 18.608  1.00 105.21 ? 28  GLU B OE1   1 
ATOM   3884 O  OE2   . GLU B 1 28  ? -39.797 -32.001 16.705  1.00 103.57 ? 28  GLU B OE2   1 
ATOM   3885 N  N     . GLU B 1 29  ? -44.593 -31.445 19.595  1.00 107.11 ? 29  GLU B N     1 
ATOM   3886 C  CA    . GLU B 1 29  ? -45.324 -32.697 19.690  1.00 110.74 ? 29  GLU B CA    1 
ATOM   3887 C  C     . GLU B 1 29  ? -46.781 -32.503 19.288  1.00 109.21 ? 29  GLU B C     1 
ATOM   3888 O  O     . GLU B 1 29  ? -47.279 -33.176 18.383  1.00 108.74 ? 29  GLU B O     1 
ATOM   3889 C  CB    . GLU B 1 29  ? -45.227 -33.254 21.114  1.00 116.29 ? 29  GLU B CB    1 
ATOM   3890 C  CG    . GLU B 1 29  ? -45.240 -34.773 21.196  1.00 120.99 ? 29  GLU B CG    1 
ATOM   3891 C  CD    . GLU B 1 29  ? -43.927 -35.406 20.753  1.00 122.09 ? 29  GLU B CD    1 
ATOM   3892 O  OE1   . GLU B 1 29  ? -43.480 -36.368 21.416  1.00 127.41 ? 29  GLU B OE1   1 
ATOM   3893 O  OE2   . GLU B 1 29  ? -43.339 -34.947 19.748  1.00 117.96 ? 29  GLU B OE2   1 
ATOM   3894 N  N     . GLU B 1 30  ? -47.442 -31.562 19.956  1.00 108.81 ? 30  GLU B N     1 
ATOM   3895 C  CA    . GLU B 1 30  ? -48.840 -31.219 19.701  1.00 107.93 ? 30  GLU B CA    1 
ATOM   3896 C  C     . GLU B 1 30  ? -49.137 -31.041 18.207  1.00 103.90 ? 30  GLU B C     1 
ATOM   3897 O  O     . GLU B 1 30  ? -50.221 -31.378 17.731  1.00 103.87 ? 30  GLU B O     1 
ATOM   3898 C  CB    . GLU B 1 30  ? -49.197 -29.946 20.480  1.00 107.30 ? 30  GLU B CB    1 
ATOM   3899 C  CG    . GLU B 1 30  ? -50.629 -29.449 20.318  1.00 106.42 ? 30  GLU B CG    1 
ATOM   3900 C  CD    . GLU B 1 30  ? -51.661 -30.447 20.783  1.00 110.52 ? 30  GLU B CD    1 
ATOM   3901 O  OE1   . GLU B 1 30  ? -51.472 -31.056 21.857  1.00 115.34 ? 30  GLU B OE1   1 
ATOM   3902 O  OE2   . GLU B 1 30  ? -52.666 -30.617 20.069  1.00 109.69 ? 30  GLU B OE2   1 
ATOM   3903 N  N     . LEU B 1 31  ? -48.150 -30.525 17.482  1.00 100.98 ? 31  LEU B N     1 
ATOM   3904 C  CA    . LEU B 1 31  ? -48.278 -30.245 16.060  1.00 97.57  ? 31  LEU B CA    1 
ATOM   3905 C  C     . LEU B 1 31  ? -48.234 -31.503 15.197  1.00 98.99  ? 31  LEU B C     1 
ATOM   3906 O  O     . LEU B 1 31  ? -48.938 -31.586 14.187  1.00 97.72  ? 31  LEU B O     1 
ATOM   3907 C  CB    . LEU B 1 31  ? -47.190 -29.268 15.622  1.00 94.27  ? 31  LEU B CB    1 
ATOM   3908 C  CG    . LEU B 1 31  ? -47.480 -28.393 14.398  1.00 90.71  ? 31  LEU B CG    1 
ATOM   3909 C  CD1   . LEU B 1 31  ? -48.776 -27.605 14.555  1.00 89.81  ? 31  LEU B CD1   1 
ATOM   3910 C  CD2   . LEU B 1 31  ? -46.321 -27.442 14.155  1.00 88.26  ? 31  LEU B CD2   1 
ATOM   3911 N  N     . ARG B 1 32  ? -47.405 -32.471 15.588  1.00 102.16 ? 32  ARG B N     1 
ATOM   3912 C  CA    . ARG B 1 32  ? -47.317 -33.744 14.874  1.00 104.24 ? 32  ARG B CA    1 
ATOM   3913 C  C     . ARG B 1 32  ? -48.636 -34.491 15.008  1.00 106.55 ? 32  ARG B C     1 
ATOM   3914 O  O     . ARG B 1 32  ? -49.123 -35.083 14.044  1.00 106.60 ? 32  ARG B O     1 
ATOM   3915 C  CB    . ARG B 1 32  ? -46.176 -34.613 15.415  1.00 107.94 ? 32  ARG B CB    1 
ATOM   3916 C  CG    . ARG B 1 32  ? -44.868 -33.875 15.669  1.00 106.77 ? 32  ARG B CG    1 
ATOM   3917 C  CD    . ARG B 1 32  ? -43.699 -34.838 15.807  1.00 110.46 ? 32  ARG B CD    1 
ATOM   3918 N  NE    . ARG B 1 32  ? -43.014 -35.038 14.532  1.00 109.34 ? 32  ARG B NE    1 
ATOM   3919 C  CZ    . ARG B 1 32  ? -41.987 -34.305 14.106  1.00 107.26 ? 32  ARG B CZ    1 
ATOM   3920 N  NH1   . ARG B 1 32  ? -41.510 -33.316 14.854  1.00 105.84 ? 32  ARG B NH1   1 
ATOM   3921 N  NH2   . ARG B 1 32  ? -41.432 -34.560 12.928  1.00 106.72 ? 32  ARG B NH2   1 
ATOM   3922 N  N     . ARG B 1 33  ? -49.208 -34.424 16.211  1.00 108.81 ? 33  ARG B N     1 
ATOM   3923 C  CA    . ARG B 1 33  ? -50.438 -35.136 16.575  1.00 111.94 ? 33  ARG B CA    1 
ATOM   3924 C  C     . ARG B 1 33  ? -51.656 -34.650 15.802  1.00 109.15 ? 33  ARG B C     1 
ATOM   3925 O  O     . ARG B 1 33  ? -52.567 -35.430 15.518  1.00 111.31 ? 33  ARG B O     1 
ATOM   3926 C  CB    . ARG B 1 33  ? -50.704 -34.996 18.076  1.00 115.23 ? 33  ARG B CB    1 
ATOM   3927 C  CG    . ARG B 1 33  ? -49.591 -35.530 18.955  1.00 119.42 ? 33  ARG B CG    1 
ATOM   3928 C  CD    . ARG B 1 33  ? -49.717 -35.014 20.373  1.00 123.11 ? 33  ARG B CD    1 
ATOM   3929 N  NE    . ARG B 1 33  ? -48.669 -35.554 21.237  1.00 127.82 ? 33  ARG B NE    1 
ATOM   3930 C  CZ    . ARG B 1 33  ? -48.682 -35.495 22.567  1.00 132.14 ? 33  ARG B CZ    1 
ATOM   3931 N  NH1   . ARG B 1 33  ? -49.693 -34.918 23.207  1.00 132.86 ? 33  ARG B NH1   1 
ATOM   3932 N  NH2   . ARG B 1 33  ? -47.680 -36.020 23.262  1.00 135.99 ? 33  ARG B NH2   1 
ATOM   3933 N  N     . ARG B 1 34  ? -51.667 -33.357 15.482  1.00 104.73 ? 34  ARG B N     1 
ATOM   3934 C  CA    . ARG B 1 34  ? -52.765 -32.734 14.746  1.00 101.93 ? 34  ARG B CA    1 
ATOM   3935 C  C     . ARG B 1 34  ? -52.676 -33.045 13.253  1.00 100.01 ? 34  ARG B C     1 
ATOM   3936 O  O     . ARG B 1 34  ? -53.695 -33.287 12.601  1.00 100.13 ? 34  ARG B O     1 
ATOM   3937 C  CB    . ARG B 1 34  ? -52.770 -31.220 14.978  1.00 98.64  ? 34  ARG B CB    1 
ATOM   3938 C  CG    . ARG B 1 34  ? -53.164 -30.802 16.389  1.00 100.18 ? 34  ARG B CG    1 
ATOM   3939 C  CD    . ARG B 1 34  ? -53.029 -29.302 16.573  1.00 96.27  ? 34  ARG B CD    1 
ATOM   3940 N  NE    . ARG B 1 34  ? -53.325 -28.875 17.941  1.00 98.23  ? 34  ARG B NE    1 
ATOM   3941 C  CZ    . ARG B 1 34  ? -53.369 -27.605 18.345  1.00 96.82  ? 34  ARG B CZ    1 
ATOM   3942 N  NH1   . ARG B 1 34  ? -53.138 -26.613 17.494  1.00 92.79  ? 34  ARG B NH1   1 
ATOM   3943 N  NH2   . ARG B 1 34  ? -53.648 -27.321 19.609  1.00 99.84  ? 34  ARG B NH2   1 
ATOM   3944 N  N     . LEU B 1 35  ? -51.449 -33.042 12.731  1.00 98.58  ? 35  LEU B N     1 
ATOM   3945 C  CA    . LEU B 1 35  ? -51.175 -33.295 11.312  1.00 97.07  ? 35  LEU B CA    1 
ATOM   3946 C  C     . LEU B 1 35  ? -51.407 -34.743 10.905  1.00 100.53 ? 35  LEU B C     1 
ATOM   3947 O  O     . LEU B 1 35  ? -51.960 -35.010 9.835   1.00 100.31 ? 35  LEU B O     1 
ATOM   3948 C  CB    . LEU B 1 35  ? -49.742 -32.883 10.961  1.00 95.14  ? 35  LEU B CB    1 
ATOM   3949 C  CG    . LEU B 1 35  ? -49.539 -31.407 10.617  1.00 90.80  ? 35  LEU B CG    1 
ATOM   3950 C  CD1   . LEU B 1 35  ? -48.080 -31.010 10.781  1.00 89.44  ? 35  LEU B CD1   1 
ATOM   3951 C  CD2   . LEU B 1 35  ? -50.035 -31.104 9.204   1.00 88.28  ? 35  LEU B CD2   1 
ATOM   3952 N  N     . ASP B 1 36  ? -50.975 -35.667 11.760  1.00 104.04 ? 36  ASP B N     1 
ATOM   3953 C  CA    . ASP B 1 36  ? -51.137 -37.093 11.511  1.00 108.01 ? 36  ASP B CA    1 
ATOM   3954 C  C     . ASP B 1 36  ? -52.592 -37.516 11.650  1.00 109.88 ? 36  ASP B C     1 
ATOM   3955 O  O     . ASP B 1 36  ? -53.058 -38.381 10.909  1.00 111.84 ? 36  ASP B O     1 
ATOM   3956 C  CB    . ASP B 1 36  ? -50.235 -37.906 12.440  1.00 111.86 ? 36  ASP B CB    1 
ATOM   3957 C  CG    . ASP B 1 36  ? -48.759 -37.728 12.121  1.00 110.81 ? 36  ASP B CG    1 
ATOM   3958 O  OD1   . ASP B 1 36  ? -48.423 -37.539 10.933  1.00 108.62 ? 36  ASP B OD1   1 
ATOM   3959 O  OD2   . ASP B 1 36  ? -47.933 -37.782 13.057  1.00 112.58 ? 36  ASP B OD2   1 
ATOM   3960 N  N     . GLU B 1 37  ? -53.298 -36.896 12.597  1.00 109.64 ? 37  GLU B N     1 
ATOM   3961 C  CA    . GLU B 1 37  ? -54.751 -37.025 12.722  1.00 111.13 ? 37  GLU B CA    1 
ATOM   3962 C  C     . GLU B 1 37  ? -55.428 -36.743 11.375  1.00 108.90 ? 37  GLU B C     1 
ATOM   3963 O  O     . GLU B 1 37  ? -56.391 -37.415 11.008  1.00 111.15 ? 37  GLU B O     1 
ATOM   3964 C  CB    . GLU B 1 37  ? -55.273 -36.094 13.833  1.00 110.62 ? 37  GLU B CB    1 
ATOM   3965 C  CG    . GLU B 1 37  ? -56.772 -35.761 13.812  1.00 111.16 ? 37  GLU B CG    1 
ATOM   3966 C  CD    . GLU B 1 37  ? -57.676 -36.917 14.241  1.00 117.21 ? 37  GLU B CD    1 
ATOM   3967 O  OE1   . GLU B 1 37  ? -58.882 -36.875 13.915  1.00 117.76 ? 37  GLU B OE1   1 
ATOM   3968 O  OE2   . GLU B 1 37  ? -57.198 -37.866 14.905  1.00 121.41 ? 37  GLU B OE2   1 
ATOM   3969 N  N     . LEU B 1 38  ? -54.892 -35.772 10.636  1.00 105.05 ? 38  LEU B N     1 
ATOM   3970 C  CA    . LEU B 1 38  ? -55.397 -35.411 9.306   1.00 103.09 ? 38  LEU B CA    1 
ATOM   3971 C  C     . LEU B 1 38  ? -54.726 -36.175 8.145   1.00 103.86 ? 38  LEU B C     1 
ATOM   3972 O  O     . LEU B 1 38  ? -55.083 -35.974 6.979   1.00 102.63 ? 38  LEU B O     1 
ATOM   3973 C  CB    . LEU B 1 38  ? -55.268 -33.896 9.082   1.00 98.89  ? 38  LEU B CB    1 
ATOM   3974 C  CG    . LEU B 1 38  ? -56.043 -32.914 9.976   1.00 98.29  ? 38  LEU B CG    1 
ATOM   3975 C  CD1   . LEU B 1 38  ? -55.716 -31.480 9.581   1.00 94.62  ? 38  LEU B CD1   1 
ATOM   3976 C  CD2   . LEU B 1 38  ? -57.553 -33.144 9.927   1.00 100.51 ? 38  LEU B CD2   1 
ATOM   3977 N  N     . GLY B 1 39  ? -53.770 -37.049 8.466   1.00 106.31 ? 39  GLY B N     1 
ATOM   3978 C  CA    . GLY B 1 39  ? -52.988 -37.774 7.454   1.00 107.60 ? 39  GLY B CA    1 
ATOM   3979 C  C     . GLY B 1 39  ? -51.778 -36.963 7.026   1.00 104.67 ? 39  GLY B C     1 
ATOM   3980 O  O     . GLY B 1 39  ? -50.775 -36.927 7.739   1.00 104.98 ? 39  GLY B O     1 
ATOM   3981 N  N     . VAL B 1 40  ? -51.882 -36.340 5.849   1.00 102.37 ? 40  VAL B N     1 
ATOM   3982 C  CA    . VAL B 1 40  ? -50.979 -35.262 5.361   1.00 99.00  ? 40  VAL B CA    1 
ATOM   3983 C  C     . VAL B 1 40  ? -49.462 -35.417 5.576   1.00 99.52  ? 40  VAL B C     1 
ATOM   3984 O  O     . VAL B 1 40  ? -48.980 -35.446 6.713   1.00 99.84  ? 40  VAL B O     1 
ATOM   3985 C  CB    . VAL B 1 40  ? -51.414 -33.865 5.881   1.00 95.24  ? 40  VAL B CB    1 
ATOM   3986 C  CG1   . VAL B 1 40  ? -50.616 -32.765 5.197   1.00 92.10  ? 40  VAL B CG1   1 
ATOM   3987 C  CG2   . VAL B 1 40  ? -52.898 -33.650 5.654   1.00 95.13  ? 40  VAL B CG2   1 
ATOM   3988 N  N     . GLU B 1 41  ? -48.725 -35.470 4.464   1.00 99.86  ? 41  GLU B N     1 
ATOM   3989 C  CA    . GLU B 1 41  ? -47.260 -35.477 4.482   1.00 100.39 ? 41  GLU B CA    1 
ATOM   3990 C  C     . GLU B 1 41  ? -46.715 -34.102 4.846   1.00 96.56  ? 41  GLU B C     1 
ATOM   3991 O  O     . GLU B 1 41  ? -47.161 -33.082 4.316   1.00 93.77  ? 41  GLU B O     1 
ATOM   3992 C  CB    . GLU B 1 41  ? -46.691 -35.933 3.138   1.00 102.34 ? 41  GLU B CB    1 
ATOM   3993 C  CG    . GLU B 1 41  ? -46.726 -37.443 2.937   1.00 107.34 ? 41  GLU B CG    1 
ATOM   3994 C  CD    . GLU B 1 41  ? -46.072 -37.892 1.639   1.00 110.06 ? 41  GLU B CD    1 
ATOM   3995 O  OE1   . GLU B 1 41  ? -46.517 -38.921 1.087   1.00 113.74 ? 41  GLU B OE1   1 
ATOM   3996 O  OE2   . GLU B 1 41  ? -45.117 -37.227 1.170   1.00 108.94 ? 41  GLU B OE2   1 
ATOM   3997 N  N     . TYR B 1 42  ? -45.745 -34.096 5.753   1.00 96.95  ? 42  TYR B N     1 
ATOM   3998 C  CA    . TYR B 1 42  ? -45.205 -32.871 6.322   1.00 93.79  ? 42  TYR B CA    1 
ATOM   3999 C  C     . TYR B 1 42  ? -43.722 -33.035 6.621   1.00 95.19  ? 42  TYR B C     1 
ATOM   4000 O  O     . TYR B 1 42  ? -43.320 -33.962 7.325   1.00 98.35  ? 42  TYR B O     1 
ATOM   4001 C  CB    . TYR B 1 42  ? -45.960 -32.509 7.609   1.00 92.80  ? 42  TYR B CB    1 
ATOM   4002 C  CG    . TYR B 1 42  ? -45.801 -33.514 8.736   1.00 96.28  ? 42  TYR B CG    1 
ATOM   4003 C  CD1   . TYR B 1 42  ? -45.148 -33.169 9.919   1.00 96.30  ? 42  TYR B CD1   1 
ATOM   4004 C  CD2   . TYR B 1 42  ? -46.291 -34.817 8.612   1.00 99.78  ? 42  TYR B CD2   1 
ATOM   4005 C  CE1   . TYR B 1 42  ? -44.999 -34.095 10.954  1.00 99.86  ? 42  TYR B CE1   1 
ATOM   4006 C  CE2   . TYR B 1 42  ? -46.141 -35.744 9.631   1.00 103.09 ? 42  TYR B CE2   1 
ATOM   4007 C  CZ    . TYR B 1 42  ? -45.499 -35.379 10.799  1.00 103.43 ? 42  TYR B CZ    1 
ATOM   4008 O  OH    . TYR B 1 42  ? -45.358 -36.308 11.806  1.00 107.85 ? 42  TYR B OH    1 
ATOM   4009 N  N     . VAL B 1 43  ? -42.907 -32.145 6.070   1.00 93.41  ? 43  VAL B N     1 
ATOM   4010 C  CA    . VAL B 1 43  ? -41.499 -32.079 6.458   1.00 94.43  ? 43  VAL B CA    1 
ATOM   4011 C  C     . VAL B 1 43  ? -41.247 -30.840 7.325   1.00 91.50  ? 43  VAL B C     1 
ATOM   4012 O  O     . VAL B 1 43  ? -41.758 -29.756 7.044   1.00 88.09  ? 43  VAL B O     1 
ATOM   4013 C  CB    . VAL B 1 43  ? -40.528 -32.164 5.233   1.00 95.71  ? 43  VAL B CB    1 
ATOM   4014 C  CG1   . VAL B 1 43  ? -40.687 -30.970 4.303   1.00 92.53  ? 43  VAL B CG1   1 
ATOM   4015 C  CG2   . VAL B 1 43  ? -39.075 -32.315 5.690   1.00 97.56  ? 43  VAL B CG2   1 
ATOM   4016 N  N     . PHE B 1 44  ? -40.496 -31.034 8.404   1.00 93.16  ? 44  PHE B N     1 
ATOM   4017 C  CA    . PHE B 1 44  ? -40.031 -29.934 9.234   1.00 91.31  ? 44  PHE B CA    1 
ATOM   4018 C  C     . PHE B 1 44  ? -38.715 -29.421 8.681   1.00 91.20  ? 44  PHE B C     1 
ATOM   4019 O  O     . PHE B 1 44  ? -37.779 -30.197 8.469   1.00 94.29  ? 44  PHE B O     1 
ATOM   4020 C  CB    . PHE B 1 44  ? -39.834 -30.395 10.678  1.00 93.60  ? 44  PHE B CB    1 
ATOM   4021 C  CG    . PHE B 1 44  ? -41.090 -30.378 11.497  1.00 93.42  ? 44  PHE B CG    1 
ATOM   4022 C  CD1   . PHE B 1 44  ? -41.940 -31.482 11.519  1.00 95.83  ? 44  PHE B CD1   1 
ATOM   4023 C  CD2   . PHE B 1 44  ? -41.421 -29.261 12.258  1.00 91.21  ? 44  PHE B CD2   1 
ATOM   4024 C  CE1   . PHE B 1 44  ? -43.106 -31.471 12.284  1.00 95.78  ? 44  PHE B CE1   1 
ATOM   4025 C  CE2   . PHE B 1 44  ? -42.584 -29.242 13.028  1.00 91.51  ? 44  PHE B CE2   1 
ATOM   4026 C  CZ    . PHE B 1 44  ? -43.430 -30.349 13.039  1.00 93.56  ? 44  PHE B CZ    1 
ATOM   4027 N  N     . VAL B 1 45  ? -38.657 -28.118 8.427   1.00 88.09  ? 45  VAL B N     1 
ATOM   4028 C  CA    . VAL B 1 45  ? -37.431 -27.463 7.976   1.00 87.96  ? 45  VAL B CA    1 
ATOM   4029 C  C     . VAL B 1 45  ? -37.173 -26.226 8.845   1.00 86.01  ? 45  VAL B C     1 
ATOM   4030 O  O     . VAL B 1 45  ? -37.798 -26.060 9.895   1.00 85.56  ? 45  VAL B O     1 
ATOM   4031 C  CB    . VAL B 1 45  ? -37.491 -27.074 6.468   1.00 86.95  ? 45  VAL B CB    1 
ATOM   4032 C  CG1   . VAL B 1 45  ? -37.621 -28.302 5.584   1.00 89.54  ? 45  VAL B CG1   1 
ATOM   4033 C  CG2   . VAL B 1 45  ? -38.630 -26.109 6.197   1.00 83.74  ? 45  VAL B CG2   1 
ATOM   4034 N  N     . GLY B 1 46  ? -36.255 -25.366 8.413   1.00 85.36  ? 46  GLY B N     1 
ATOM   4035 C  CA    . GLY B 1 46  ? -35.987 -24.116 9.114   1.00 83.70  ? 46  GLY B CA    1 
ATOM   4036 C  C     . GLY B 1 46  ? -35.009 -24.231 10.270  1.00 85.75  ? 46  GLY B C     1 
ATOM   4037 O  O     . GLY B 1 46  ? -34.270 -25.214 10.384  1.00 88.78  ? 46  GLY B O     1 
ATOM   4038 N  N     . SER B 1 47  ? -35.022 -23.218 11.133  1.00 84.40  ? 47  SER B N     1 
ATOM   4039 C  CA    . SER B 1 47  ? -34.061 -23.099 12.225  1.00 86.18  ? 47  SER B CA    1 
ATOM   4040 C  C     . SER B 1 47  ? -34.297 -24.065 13.382  1.00 88.49  ? 47  SER B C     1 
ATOM   4041 O  O     . SER B 1 47  ? -33.344 -24.628 13.918  1.00 91.54  ? 47  SER B O     1 
ATOM   4042 C  CB    . SER B 1 47  ? -34.049 -21.670 12.754  1.00 84.37  ? 47  SER B CB    1 
ATOM   4043 O  OG    . SER B 1 47  ? -33.108 -21.541 13.798  1.00 87.19  ? 47  SER B OG    1 
ATOM   4044 N  N     . TYR B 1 48  ? -35.557 -24.235 13.774  1.00 87.54  ? 48  TYR B N     1 
ATOM   4045 C  CA    . TYR B 1 48  ? -35.911 -25.112 14.888  1.00 90.21  ? 48  TYR B CA    1 
ATOM   4046 C  C     . TYR B 1 48  ? -35.560 -26.562 14.574  1.00 93.18  ? 48  TYR B C     1 
ATOM   4047 O  O     . TYR B 1 48  ? -35.138 -27.319 15.455  1.00 96.60  ? 48  TYR B O     1 
ATOM   4048 C  CB    . TYR B 1 48  ? -37.399 -24.985 15.240  1.00 88.99  ? 48  TYR B CB    1 
ATOM   4049 C  CG    . TYR B 1 48  ? -37.858 -25.933 16.335  1.00 92.46  ? 48  TYR B CG    1 
ATOM   4050 C  CD1   . TYR B 1 48  ? -37.533 -25.696 17.674  1.00 94.68  ? 48  TYR B CD1   1 
ATOM   4051 C  CD2   . TYR B 1 48  ? -38.616 -27.069 16.032  1.00 93.83  ? 48  TYR B CD2   1 
ATOM   4052 C  CE1   . TYR B 1 48  ? -37.951 -26.565 18.682  1.00 98.26  ? 48  TYR B CE1   1 
ATOM   4053 C  CE2   . TYR B 1 48  ? -39.039 -27.946 17.034  1.00 96.99  ? 48  TYR B CE2   1 
ATOM   4054 C  CZ    . TYR B 1 48  ? -38.705 -27.686 18.355  1.00 99.47  ? 48  TYR B CZ    1 
ATOM   4055 O  OH    . TYR B 1 48  ? -39.124 -28.541 19.350  1.00 103.45 ? 48  TYR B OH    1 
ATOM   4056 N  N     . ALA B 1 49  ? -35.725 -26.931 13.307  1.00 92.09  ? 49  ALA B N     1 
ATOM   4057 C  CA    . ALA B 1 49  ? -35.402 -28.268 12.838  1.00 95.04  ? 49  ALA B CA    1 
ATOM   4058 C  C     . ALA B 1 49  ? -33.890 -28.488 12.734  1.00 97.73  ? 49  ALA B C     1 
ATOM   4059 O  O     . ALA B 1 49  ? -33.443 -29.551 12.305  1.00 100.78 ? 49  ALA B O     1 
ATOM   4060 C  CB    . ALA B 1 49  ? -36.081 -28.529 11.500  1.00 93.46  ? 49  ALA B CB    1 
ATOM   4061 N  N     . ARG B 1 50  ? -33.108 -27.484 13.129  1.00 97.02  ? 50  ARG B N     1 
ATOM   4062 C  CA    . ARG B 1 50  ? -31.651 -27.577 13.076  1.00 99.81  ? 50  ARG B CA    1 
ATOM   4063 C  C     . ARG B 1 50  ? -30.958 -27.081 14.345  1.00 101.23 ? 50  ARG B C     1 
ATOM   4064 O  O     . ARG B 1 50  ? -29.730 -27.120 14.426  1.00 104.03 ? 50  ARG B O     1 
ATOM   4065 C  CB    . ARG B 1 50  ? -31.098 -26.847 11.848  1.00 97.88  ? 50  ARG B CB    1 
ATOM   4066 C  CG    . ARG B 1 50  ? -31.469 -27.479 10.513  1.00 98.10  ? 50  ARG B CG    1 
ATOM   4067 C  CD    . ARG B 1 50  ? -30.723 -26.813 9.362   1.00 97.97  ? 50  ARG B CD    1 
ATOM   4068 N  NE    . ARG B 1 50  ? -31.579 -26.605 8.191   1.00 96.83  ? 50  ARG B NE    1 
ATOM   4069 C  CZ    . ARG B 1 50  ? -32.167 -25.451 7.880   1.00 93.43  ? 50  ARG B CZ    1 
ATOM   4070 N  NH1   . ARG B 1 50  ? -31.996 -24.383 8.648   1.00 91.47  ? 50  ARG B NH1   1 
ATOM   4071 N  NH2   . ARG B 1 50  ? -32.931 -25.362 6.796   1.00 92.45  ? 50  ARG B NH2   1 
ATOM   4072 N  N     . ASN B 1 51  ? -31.739 -26.633 15.330  1.00 100.03 ? 51  ASN B N     1 
ATOM   4073 C  CA    . ASN B 1 51  ? -31.208 -26.158 16.622  1.00 101.82 ? 51  ASN B CA    1 
ATOM   4074 C  C     . ASN B 1 51  ? -30.335 -24.910 16.514  1.00 100.34 ? 51  ASN B C     1 
ATOM   4075 O  O     . ASN B 1 51  ? -29.284 -24.813 17.159  1.00 103.05 ? 51  ASN B O     1 
ATOM   4076 C  CB    . ASN B 1 51  ? -30.437 -27.271 17.350  1.00 107.00 ? 51  ASN B CB    1 
ATOM   4077 C  CG    . ASN B 1 51  ? -31.337 -28.373 17.832  1.00 109.33 ? 51  ASN B CG    1 
ATOM   4078 O  OD1   . ASN B 1 51  ? -32.322 -28.125 18.527  1.00 108.71 ? 51  ASN B OD1   1 
ATOM   4079 N  ND2   . ASN B 1 51  ? -31.006 -29.607 17.469  1.00 112.82 ? 51  ASN B ND2   1 
ATOM   4080 N  N     . THR B 1 52  ? -30.783 -23.953 15.707  1.00 96.39  ? 52  THR B N     1 
ATOM   4081 C  CA    . THR B 1 52  ? -29.974 -22.778 15.397  1.00 95.04  ? 52  THR B CA    1 
ATOM   4082 C  C     . THR B 1 52  ? -30.722 -21.457 15.603  1.00 91.81  ? 52  THR B C     1 
ATOM   4083 O  O     . THR B 1 52  ? -30.411 -20.457 14.961  1.00 89.93  ? 52  THR B O     1 
ATOM   4084 C  CB    . THR B 1 52  ? -29.427 -22.856 13.955  1.00 94.39  ? 52  THR B CB    1 
ATOM   4085 O  OG1   . THR B 1 52  ? -30.511 -23.075 13.045  1.00 91.77  ? 52  THR B OG1   1 
ATOM   4086 C  CG2   . THR B 1 52  ? -28.423 -23.995 13.817  1.00 98.32  ? 52  THR B CG2   1 
ATOM   4087 N  N     . TRP B 1 53  ? -31.701 -21.446 16.501  1.00 91.78  ? 53  TRP B N     1 
ATOM   4088 C  CA    . TRP B 1 53  ? -32.475 -20.227 16.744  1.00 89.48  ? 53  TRP B CA    1 
ATOM   4089 C  C     . TRP B 1 53  ? -31.968 -19.443 17.946  1.00 91.29  ? 53  TRP B C     1 
ATOM   4090 O  O     . TRP B 1 53  ? -31.392 -20.013 18.871  1.00 94.73  ? 53  TRP B O     1 
ATOM   4091 C  CB    . TRP B 1 53  ? -33.977 -20.528 16.863  1.00 88.30  ? 53  TRP B CB    1 
ATOM   4092 C  CG    . TRP B 1 53  ? -34.426 -21.135 18.168  1.00 90.87  ? 53  TRP B CG    1 
ATOM   4093 C  CD1   . TRP B 1 53  ? -34.972 -20.477 19.234  1.00 91.58  ? 53  TRP B CD1   1 
ATOM   4094 C  CD2   . TRP B 1 53  ? -34.393 -22.516 18.527  1.00 93.55  ? 53  TRP B CD2   1 
ATOM   4095 N  NE1   . TRP B 1 53  ? -35.271 -21.360 20.239  1.00 94.52  ? 53  TRP B NE1   1 
ATOM   4096 C  CE2   . TRP B 1 53  ? -34.926 -22.621 19.832  1.00 96.18  ? 53  TRP B CE2   1 
ATOM   4097 C  CE3   . TRP B 1 53  ? -33.957 -23.677 17.878  1.00 95.00  ? 53  TRP B CE3   1 
ATOM   4098 C  CZ2   . TRP B 1 53  ? -35.035 -23.845 20.503  1.00 99.99  ? 53  TRP B CZ2   1 
ATOM   4099 C  CZ3   . TRP B 1 53  ? -34.067 -24.896 18.547  1.00 98.72  ? 53  TRP B CZ3   1 
ATOM   4100 C  CH2   . TRP B 1 53  ? -34.601 -24.967 19.846  1.00 101.00 ? 53  TRP B CH2   1 
ATOM   4101 N  N     . LEU B 1 54  ? -32.187 -18.134 17.922  1.00 89.56  ? 54  LEU B N     1 
ATOM   4102 C  CA    . LEU B 1 54  ? -31.718 -17.258 18.987  1.00 91.52  ? 54  LEU B CA    1 
ATOM   4103 C  C     . LEU B 1 54  ? -32.563 -17.413 20.246  1.00 93.51  ? 54  LEU B C     1 
ATOM   4104 O  O     . LEU B 1 54  ? -33.711 -17.849 20.183  1.00 92.62  ? 54  LEU B O     1 
ATOM   4105 C  CB    . LEU B 1 54  ? -31.722 -15.799 18.519  1.00 89.20  ? 54  LEU B CB    1 
ATOM   4106 C  CG    . LEU B 1 54  ? -30.674 -14.857 19.121  1.00 91.12  ? 54  LEU B CG    1 
ATOM   4107 C  CD1   . LEU B 1 54  ? -29.287 -15.161 18.564  1.00 91.93  ? 54  LEU B CD1   1 
ATOM   4108 C  CD2   . LEU B 1 54  ? -31.040 -13.392 18.870  1.00 89.29  ? 54  LEU B CD2   1 
ATOM   4109 N  N     . LYS B 1 55  ? -31.973 -17.071 21.388  1.00 96.85  ? 55  LYS B N     1 
ATOM   4110 C  CA    . LYS B 1 55  ? -32.681 -17.001 22.661  1.00 99.52  ? 55  LYS B CA    1 
ATOM   4111 C  C     . LYS B 1 55  ? -33.775 -15.931 22.560  1.00 97.44  ? 55  LYS B C     1 
ATOM   4112 O  O     . LYS B 1 55  ? -33.529 -14.747 22.815  1.00 97.57  ? 55  LYS B O     1 
ATOM   4113 C  CB    . LYS B 1 55  ? -31.687 -16.675 23.782  1.00 103.34 ? 55  LYS B CB    1 
ATOM   4114 C  CG    . LYS B 1 55  ? -32.209 -16.827 25.204  1.00 107.50 ? 55  LYS B CG    1 
ATOM   4115 C  CD    . LYS B 1 55  ? -31.036 -16.853 26.184  1.00 112.11 ? 55  LYS B CD    1 
ATOM   4116 C  CE    . LYS B 1 55  ? -31.460 -17.181 27.608  1.00 116.89 ? 55  LYS B CE    1 
ATOM   4117 N  NZ    . LYS B 1 55  ? -31.763 -15.957 28.400  1.00 118.15 ? 55  LYS B NZ    1 
ATOM   4118 N  N     . GLY B 1 56  ? -34.973 -16.358 22.158  1.00 95.82  ? 56  GLY B N     1 
ATOM   4119 C  CA    . GLY B 1 56  ? -36.103 -15.452 21.971  1.00 94.02  ? 56  GLY B CA    1 
ATOM   4120 C  C     . GLY B 1 56  ? -36.695 -15.471 20.573  1.00 90.29  ? 56  GLY B C     1 
ATOM   4121 O  O     . GLY B 1 56  ? -37.812 -15.000 20.370  1.00 88.98  ? 56  GLY B O     1 
ATOM   4122 N  N     . SER B 1 57  ? -35.948 -16.008 19.609  1.00 89.15  ? 57  SER B N     1 
ATOM   4123 C  CA    . SER B 1 57  ? -36.423 -16.144 18.222  1.00 86.38  ? 57  SER B CA    1 
ATOM   4124 C  C     . SER B 1 57  ? -37.022 -17.530 17.975  1.00 86.85  ? 57  SER B C     1 
ATOM   4125 O  O     . SER B 1 57  ? -36.677 -18.209 16.999  1.00 85.88  ? 57  SER B O     1 
ATOM   4126 C  CB    . SER B 1 57  ? -35.293 -15.877 17.217  1.00 85.16  ? 57  SER B CB    1 
ATOM   4127 O  OG    . SER B 1 57  ? -34.914 -14.511 17.194  1.00 84.88  ? 57  SER B OG    1 
ATOM   4128 N  N     . LEU B 1 58  ? -37.922 -17.934 18.870  1.00 88.87  ? 58  LEU B N     1 
ATOM   4129 C  CA    . LEU B 1 58  ? -38.593 -19.227 18.805  1.00 89.86  ? 58  LEU B CA    1 
ATOM   4130 C  C     . LEU B 1 58  ? -39.705 -19.231 17.749  1.00 87.37  ? 58  LEU B C     1 
ATOM   4131 O  O     . LEU B 1 58  ? -40.811 -18.738 17.991  1.00 87.05  ? 58  LEU B O     1 
ATOM   4132 C  CB    . LEU B 1 58  ? -39.139 -19.597 20.193  1.00 93.15  ? 58  LEU B CB    1 
ATOM   4133 C  CG    . LEU B 1 58  ? -39.973 -20.868 20.403  1.00 95.07  ? 58  LEU B CG    1 
ATOM   4134 C  CD1   . LEU B 1 58  ? -39.171 -22.143 20.142  1.00 96.60  ? 58  LEU B CD1   1 
ATOM   4135 C  CD2   . LEU B 1 58  ? -40.566 -20.887 21.810  1.00 98.69  ? 58  LEU B CD2   1 
ATOM   4136 N  N     . GLU B 1 59  ? -39.396 -19.778 16.575  1.00 86.10  ? 59  GLU B N     1 
ATOM   4137 C  CA    . GLU B 1 59  ? -40.393 -19.976 15.524  1.00 84.50  ? 59  GLU B CA    1 
ATOM   4138 C  C     . GLU B 1 59  ? -40.227 -21.352 14.882  1.00 85.19  ? 59  GLU B C     1 
ATOM   4139 O  O     . GLU B 1 59  ? -39.103 -21.810 14.677  1.00 86.01  ? 59  GLU B O     1 
ATOM   4140 C  CB    . GLU B 1 59  ? -40.310 -18.876 14.462  1.00 81.90  ? 59  GLU B CB    1 
ATOM   4141 C  CG    . GLU B 1 59  ? -41.643 -18.613 13.763  1.00 81.20  ? 59  GLU B CG    1 
ATOM   4142 C  CD    . GLU B 1 59  ? -41.495 -18.101 12.338  1.00 80.49  ? 59  GLU B CD    1 
ATOM   4143 O  OE1   . GLU B 1 59  ? -41.941 -16.961 12.067  1.00 79.63  ? 59  GLU B OE1   1 
ATOM   4144 O  OE2   . GLU B 1 59  ? -40.945 -18.841 11.488  1.00 80.86  ? 59  GLU B OE2   1 
ATOM   4145 N  N     . ILE B 1 60  ? -41.350 -22.001 14.571  1.00 85.29  ? 60  ILE B N     1 
ATOM   4146 C  CA    . ILE B 1 60  ? -41.345 -23.366 14.026  1.00 86.71  ? 60  ILE B CA    1 
ATOM   4147 C  C     . ILE B 1 60  ? -41.824 -23.406 12.579  1.00 84.74  ? 60  ILE B C     1 
ATOM   4148 O  O     . ILE B 1 60  ? -42.940 -22.979 12.275  1.00 83.55  ? 60  ILE B O     1 
ATOM   4149 C  CB    . ILE B 1 60  ? -42.217 -24.335 14.868  1.00 89.15  ? 60  ILE B CB    1 
ATOM   4150 C  CG1   . ILE B 1 60  ? -41.838 -24.260 16.350  1.00 91.92  ? 60  ILE B CG1   1 
ATOM   4151 C  CG2   . ILE B 1 60  ? -42.085 -25.770 14.347  1.00 90.94  ? 60  ILE B CG2   1 
ATOM   4152 C  CD1   . ILE B 1 60  ? -42.689 -25.133 17.253  1.00 94.81  ? 60  ILE B CD1   1 
ATOM   4153 N  N     . ASP B 1 61  ? -40.983 -23.943 11.700  1.00 85.04  ? 61  ASP B N     1 
ATOM   4154 C  CA    . ASP B 1 61  ? -41.295 -24.017 10.277  1.00 83.89  ? 61  ASP B CA    1 
ATOM   4155 C  C     . ASP B 1 61  ? -41.714 -25.427 9.864   1.00 85.51  ? 61  ASP B C     1 
ATOM   4156 O  O     . ASP B 1 61  ? -40.965 -26.392 10.044  1.00 87.86  ? 61  ASP B O     1 
ATOM   4157 C  CB    . ASP B 1 61  ? -40.107 -23.534 9.436   1.00 83.61  ? 61  ASP B CB    1 
ATOM   4158 C  CG    . ASP B 1 61  ? -39.711 -22.088 9.741   1.00 82.99  ? 61  ASP B CG    1 
ATOM   4159 O  OD1   . ASP B 1 61  ? -38.598 -21.879 10.281  1.00 84.79  ? 61  ASP B OD1   1 
ATOM   4160 O  OD2   . ASP B 1 61  ? -40.504 -21.162 9.440   1.00 82.07  ? 61  ASP B OD2   1 
ATOM   4161 N  N     . VAL B 1 62  ? -42.924 -25.524 9.317   1.00 84.52  ? 62  VAL B N     1 
ATOM   4162 C  CA    . VAL B 1 62  ? -43.503 -26.781 8.851   1.00 86.06  ? 62  VAL B CA    1 
ATOM   4163 C  C     . VAL B 1 62  ? -43.855 -26.667 7.376   1.00 85.14  ? 62  VAL B C     1 
ATOM   4164 O  O     . VAL B 1 62  ? -44.525 -25.719 6.961   1.00 83.28  ? 62  VAL B O     1 
ATOM   4165 C  CB    . VAL B 1 62  ? -44.798 -27.126 9.610   1.00 86.63  ? 62  VAL B CB    1 
ATOM   4166 C  CG1   . VAL B 1 62  ? -45.222 -28.565 9.320   1.00 89.15  ? 62  VAL B CG1   1 
ATOM   4167 C  CG2   . VAL B 1 62  ? -44.622 -26.906 11.098  1.00 87.38  ? 62  VAL B CG2   1 
ATOM   4168 N  N     . PHE B 1 63  ? -43.419 -27.642 6.591   1.00 87.02  ? 63  PHE B N     1 
ATOM   4169 C  CA    . PHE B 1 63  ? -43.692 -27.645 5.164   1.00 86.95  ? 63  PHE B CA    1 
ATOM   4170 C  C     . PHE B 1 63  ? -44.610 -28.784 4.766   1.00 89.06  ? 63  PHE B C     1 
ATOM   4171 O  O     . PHE B 1 63  ? -44.382 -29.935 5.141   1.00 91.69  ? 63  PHE B O     1 
ATOM   4172 C  CB    . PHE B 1 63  ? -42.389 -27.705 4.373   1.00 87.99  ? 63  PHE B CB    1 
ATOM   4173 C  CG    . PHE B 1 63  ? -41.872 -26.360 3.956   1.00 85.87  ? 63  PHE B CG    1 
ATOM   4174 C  CD1   . PHE B 1 63  ? -41.623 -25.366 4.898   1.00 83.95  ? 63  PHE B CD1   1 
ATOM   4175 C  CD2   . PHE B 1 63  ? -41.627 -26.086 2.616   1.00 86.10  ? 63  PHE B CD2   1 
ATOM   4176 C  CE1   . PHE B 1 63  ? -41.143 -24.122 4.506   1.00 82.00  ? 63  PHE B CE1   1 
ATOM   4177 C  CE2   . PHE B 1 63  ? -41.148 -24.843 2.218   1.00 84.42  ? 63  PHE B CE2   1 
ATOM   4178 C  CZ    . PHE B 1 63  ? -40.905 -23.863 3.164   1.00 82.39  ? 63  PHE B CZ    1 
ATOM   4179 N  N     . LEU B 1 64  ? -45.650 -28.448 4.008   1.00 88.33  ? 64  LEU B N     1 
ATOM   4180 C  CA    . LEU B 1 64  ? -46.605 -29.436 3.513   1.00 90.34  ? 64  LEU B CA    1 
ATOM   4181 C  C     . LEU B 1 64  ? -46.213 -29.859 2.102   1.00 92.27  ? 64  LEU B C     1 
ATOM   4182 O  O     . LEU B 1 64  ? -46.041 -29.012 1.216   1.00 91.28  ? 64  LEU B O     1 
ATOM   4183 C  CB    . LEU B 1 64  ? -48.032 -28.873 3.527   1.00 88.90  ? 64  LEU B CB    1 
ATOM   4184 C  CG    . LEU B 1 64  ? -48.531 -28.136 4.777   1.00 86.87  ? 64  LEU B CG    1 
ATOM   4185 C  CD1   . LEU B 1 64  ? -49.924 -27.570 4.545   1.00 85.55  ? 64  LEU B CD1   1 
ATOM   4186 C  CD2   . LEU B 1 64  ? -48.516 -29.043 5.996   1.00 88.55  ? 64  LEU B CD2   1 
ATOM   4187 N  N     . LEU B 1 65  ? -46.064 -31.169 1.905   1.00 95.44  ? 65  LEU B N     1 
ATOM   4188 C  CA    . LEU B 1 65  ? -45.639 -31.721 0.621   1.00 98.00  ? 65  LEU B CA    1 
ATOM   4189 C  C     . LEU B 1 65  ? -46.820 -32.250 -0.194  1.00 99.64  ? 65  LEU B C     1 
ATOM   4190 O  O     . LEU B 1 65  ? -47.384 -33.304 0.108   1.00 101.73 ? 65  LEU B O     1 
ATOM   4191 C  CB    . LEU B 1 65  ? -44.574 -32.800 0.826   1.00 101.14 ? 65  LEU B CB    1 
ATOM   4192 C  CG    . LEU B 1 65  ? -43.245 -32.330 1.425   1.00 100.36 ? 65  LEU B CG    1 
ATOM   4193 C  CD1   . LEU B 1 65  ? -42.565 -33.453 2.186   1.00 102.96 ? 65  LEU B CD1   1 
ATOM   4194 C  CD2   . LEU B 1 65  ? -42.318 -31.753 0.355   1.00 100.83 ? 65  LEU B CD2   1 
ATOM   4195 N  N     . PHE B 1 66  ? -47.188 -31.494 -1.224  1.00 99.06  ? 66  PHE B N     1 
ATOM   4196 C  CA    . PHE B 1 66  ? -48.291 -31.850 -2.110  1.00 100.84 ? 66  PHE B CA    1 
ATOM   4197 C  C     . PHE B 1 66  ? -47.788 -32.519 -3.390  1.00 104.74 ? 66  PHE B C     1 
ATOM   4198 O  O     . PHE B 1 66  ? -46.806 -32.057 -3.984  1.00 105.18 ? 66  PHE B O     1 
ATOM   4199 C  CB    . PHE B 1 66  ? -49.103 -30.604 -2.475  1.00 98.33  ? 66  PHE B CB    1 
ATOM   4200 C  CG    . PHE B 1 66  ? -49.930 -30.063 -1.348  1.00 95.50  ? 66  PHE B CG    1 
ATOM   4201 C  CD1   . PHE B 1 66  ? -51.218 -30.537 -1.127  1.00 96.46  ? 66  PHE B CD1   1 
ATOM   4202 C  CD2   . PHE B 1 66  ? -49.429 -29.071 -0.513  1.00 92.52  ? 66  PHE B CD2   1 
ATOM   4203 C  CE1   . PHE B 1 66  ? -51.993 -30.034 -0.083  1.00 94.64  ? 66  PHE B CE1   1 
ATOM   4204 C  CE2   . PHE B 1 66  ? -50.195 -28.561 0.532   1.00 90.49  ? 66  PHE B CE2   1 
ATOM   4205 C  CZ    . PHE B 1 66  ? -51.479 -29.042 0.747   1.00 91.65  ? 66  PHE B CZ    1 
ATOM   4206 N  N     . PRO B 1 67  ? -48.459 -33.609 -3.819  1.00 107.95 ? 67  PRO B N     1 
ATOM   4207 C  CA    . PRO B 1 67  ? -48.159 -34.225 -5.112  1.00 112.18 ? 67  PRO B CA    1 
ATOM   4208 C  C     . PRO B 1 67  ? -48.357 -33.230 -6.255  1.00 111.91 ? 67  PRO B C     1 
ATOM   4209 O  O     . PRO B 1 67  ? -49.280 -32.409 -6.207  1.00 109.44 ? 67  PRO B O     1 
ATOM   4210 C  CB    . PRO B 1 67  ? -49.186 -35.360 -5.207  1.00 115.05 ? 67  PRO B CB    1 
ATOM   4211 C  CG    . PRO B 1 67  ? -49.564 -35.655 -3.799  1.00 113.10 ? 67  PRO B CG    1 
ATOM   4212 C  CD    . PRO B 1 67  ? -49.531 -34.330 -3.108  1.00 108.31 ? 67  PRO B CD    1 
ATOM   4213 N  N     . GLU B 1 68  ? -47.494 -33.310 -7.267  1.00 114.95 ? 68  GLU B N     1 
ATOM   4214 C  CA    . GLU B 1 68  ? -47.509 -32.368 -8.391  1.00 115.48 ? 68  GLU B CA    1 
ATOM   4215 C  C     . GLU B 1 68  ? -48.822 -32.320 -9.175  1.00 116.81 ? 68  GLU B C     1 
ATOM   4216 O  O     . GLU B 1 68  ? -49.113 -31.314 -9.829  1.00 116.24 ? 68  GLU B O     1 
ATOM   4217 C  CB    . GLU B 1 68  ? -46.349 -32.642 -9.346  1.00 119.57 ? 68  GLU B CB    1 
ATOM   4218 C  CG    . GLU B 1 68  ? -45.077 -31.899 -9.002  1.00 117.80 ? 68  GLU B CG    1 
ATOM   4219 C  CD    . GLU B 1 68  ? -44.252 -31.582 -10.231 1.00 121.59 ? 68  GLU B CD    1 
ATOM   4220 O  OE1   . GLU B 1 68  ? -43.125 -32.106 -10.341 1.00 124.74 ? 68  GLU B OE1   1 
ATOM   4221 O  OE2   . GLU B 1 68  ? -44.734 -30.818 -11.095 1.00 121.93 ? 68  GLU B OE2   1 
ATOM   4222 N  N     . GLU B 1 69  ? -49.597 -33.406 -9.111  1.00 118.95 ? 69  GLU B N     1 
ATOM   4223 C  CA    . GLU B 1 69  ? -50.930 -33.458 -9.721  1.00 120.33 ? 69  GLU B CA    1 
ATOM   4224 C  C     . GLU B 1 69  ? -51.721 -32.183 -9.440  1.00 116.49 ? 69  GLU B C     1 
ATOM   4225 O  O     . GLU B 1 69  ? -52.240 -31.561 -10.367 1.00 117.72 ? 69  GLU B O     1 
ATOM   4226 C  CB    . GLU B 1 69  ? -51.724 -34.680 -9.238  1.00 121.89 ? 69  GLU B CB    1 
ATOM   4227 C  CG    . GLU B 1 69  ? -51.499 -35.957 -10.045 1.00 127.53 ? 69  GLU B CG    1 
ATOM   4228 C  CD    . GLU B 1 69  ? -50.583 -36.958 -9.357  1.00 128.87 ? 69  GLU B CD    1 
ATOM   4229 O  OE1   . GLU B 1 69  ? -49.894 -37.719 -10.072 1.00 133.37 ? 69  GLU B OE1   1 
ATOM   4230 O  OE2   . GLU B 1 69  ? -50.557 -36.995 -8.107  1.00 125.74 ? 69  GLU B OE2   1 
ATOM   4231 N  N     . PHE B 1 70  ? -51.792 -31.796 -8.165  1.00 112.38 ? 70  PHE B N     1 
ATOM   4232 C  CA    . PHE B 1 70  ? -52.478 -30.569 -7.755  1.00 108.84 ? 70  PHE B CA    1 
ATOM   4233 C  C     . PHE B 1 70  ? -51.762 -29.329 -8.272  1.00 107.56 ? 70  PHE B C     1 
ATOM   4234 O  O     . PHE B 1 70  ? -50.550 -29.178 -8.092  1.00 106.86 ? 70  PHE B O     1 
ATOM   4235 C  CB    . PHE B 1 70  ? -52.665 -30.514 -6.231  1.00 105.45 ? 70  PHE B CB    1 
ATOM   4236 C  CG    . PHE B 1 70  ? -53.786 -31.390 -5.731  1.00 106.75 ? 70  PHE B CG    1 
ATOM   4237 C  CD1   . PHE B 1 70  ? -53.529 -32.680 -5.272  1.00 108.60 ? 70  PHE B CD1   1 
ATOM   4238 C  CD2   . PHE B 1 70  ? -55.103 -30.932 -5.740  1.00 106.34 ? 70  PHE B CD2   1 
ATOM   4239 C  CE1   . PHE B 1 70  ? -54.566 -33.496 -4.819  1.00 109.74 ? 70  PHE B CE1   1 
ATOM   4240 C  CE2   . PHE B 1 70  ? -56.145 -31.740 -5.290  1.00 107.54 ? 70  PHE B CE2   1 
ATOM   4241 C  CZ    . PHE B 1 70  ? -55.874 -33.026 -4.828  1.00 109.26 ? 70  PHE B CZ    1 
ATOM   4242 N  N     . SER B 1 71  ? -52.531 -28.460 -8.927  1.00 107.64 ? 71  SER B N     1 
ATOM   4243 C  CA    . SER B 1 71  ? -52.009 -27.242 -9.554  1.00 107.16 ? 71  SER B CA    1 
ATOM   4244 C  C     . SER B 1 71  ? -51.718 -26.141 -8.534  1.00 102.67 ? 71  SER B C     1 
ATOM   4245 O  O     . SER B 1 71  ? -52.029 -26.284 -7.350  1.00 99.87  ? 71  SER B O     1 
ATOM   4246 C  CB    . SER B 1 71  ? -52.978 -26.734 -10.630 1.00 109.64 ? 71  SER B CB    1 
ATOM   4247 O  OG    . SER B 1 71  ? -54.197 -26.292 -10.056 1.00 107.58 ? 71  SER B OG    1 
ATOM   4248 N  N     . LYS B 1 72  ? -51.127 -25.046 -9.012  1.00 102.28 ? 72  LYS B N     1 
ATOM   4249 C  CA    . LYS B 1 72  ? -50.698 -23.932 -8.169  1.00 98.57  ? 72  LYS B CA    1 
ATOM   4250 C  C     . LYS B 1 72  ? -51.840 -23.374 -7.313  1.00 95.90  ? 72  LYS B C     1 
ATOM   4251 O  O     . LYS B 1 72  ? -51.641 -23.046 -6.146  1.00 92.87  ? 72  LYS B O     1 
ATOM   4252 C  CB    . LYS B 1 72  ? -50.074 -22.828 -9.034  1.00 99.75  ? 72  LYS B CB    1 
ATOM   4253 C  CG    . LYS B 1 72  ? -48.815 -22.187 -8.446  1.00 98.05  ? 72  LYS B CG    1 
ATOM   4254 C  CD    . LYS B 1 72  ? -49.141 -21.123 -7.401  1.00 95.08  ? 72  LYS B CD    1 
ATOM   4255 C  CE    . LYS B 1 72  ? -47.935 -20.806 -6.529  1.00 92.83  ? 72  LYS B CE    1 
ATOM   4256 N  NZ    . LYS B 1 72  ? -48.341 -20.110 -5.276  1.00 89.34  ? 72  LYS B NZ    1 
ATOM   4257 N  N     . GLU B 1 73  ? -53.034 -23.288 -7.893  1.00 97.49  ? 73  GLU B N     1 
ATOM   4258 C  CA    . GLU B 1 73  ? -54.211 -22.748 -7.200  1.00 95.90  ? 73  GLU B CA    1 
ATOM   4259 C  C     . GLU B 1 73  ? -54.843 -23.765 -6.241  1.00 94.91  ? 73  GLU B C     1 
ATOM   4260 O  O     . GLU B 1 73  ? -55.346 -23.392 -5.180  1.00 92.71  ? 73  GLU B O     1 
ATOM   4261 C  CB    . GLU B 1 73  ? -55.263 -22.246 -8.204  1.00 98.69  ? 73  GLU B CB    1 
ATOM   4262 C  CG    . GLU B 1 73  ? -54.700 -21.575 -9.468  1.00 101.48 ? 73  GLU B CG    1 
ATOM   4263 C  CD    . GLU B 1 73  ? -54.469 -22.560 -10.617 1.00 105.33 ? 73  GLU B CD    1 
ATOM   4264 O  OE1   . GLU B 1 73  ? -53.304 -22.725 -11.043 1.00 106.08 ? 73  GLU B OE1   1 
ATOM   4265 O  OE2   . GLU B 1 73  ? -55.453 -23.172 -11.091 1.00 107.56 ? 73  GLU B OE2   1 
ATOM   4266 N  N     . GLU B 1 74  ? -54.823 -25.040 -6.635  1.00 96.96  ? 74  GLU B N     1 
ATOM   4267 C  CA    . GLU B 1 74  ? -55.295 -26.153 -5.800  1.00 96.64  ? 74  GLU B CA    1 
ATOM   4268 C  C     . GLU B 1 74  ? -54.395 -26.305 -4.577  1.00 93.83  ? 74  GLU B C     1 
ATOM   4269 O  O     . GLU B 1 74  ? -54.869 -26.589 -3.476  1.00 92.63  ? 74  GLU B O     1 
ATOM   4270 C  CB    . GLU B 1 74  ? -55.290 -27.461 -6.600  1.00 100.09 ? 74  GLU B CB    1 
ATOM   4271 C  CG    . GLU B 1 74  ? -56.116 -27.442 -7.883  1.00 103.53 ? 74  GLU B CG    1 
ATOM   4272 C  CD    . GLU B 1 74  ? -57.458 -28.131 -7.742  1.00 105.36 ? 74  GLU B CD    1 
ATOM   4273 O  OE1   . GLU B 1 74  ? -57.481 -29.337 -7.409  1.00 106.69 ? 74  GLU B OE1   1 
ATOM   4274 O  OE2   . GLU B 1 74  ? -58.491 -27.471 -7.984  1.00 105.79 ? 74  GLU B OE2   1 
ATOM   4275 N  N     . LEU B 1 75  ? -53.093 -26.114 -4.803  1.00 93.14  ? 75  LEU B N     1 
ATOM   4276 C  CA    . LEU B 1 75  ? -52.051 -26.179 -3.776  1.00 90.83  ? 75  LEU B CA    1 
ATOM   4277 C  C     . LEU B 1 75  ? -52.374 -25.316 -2.559  1.00 87.64  ? 75  LEU B C     1 
ATOM   4278 O  O     . LEU B 1 75  ? -52.408 -25.810 -1.428  1.00 86.83  ? 75  LEU B O     1 
ATOM   4279 C  CB    . LEU B 1 75  ? -50.700 -25.756 -4.382  1.00 91.00  ? 75  LEU B CB    1 
ATOM   4280 C  CG    . LEU B 1 75  ? -49.477 -25.439 -3.506  1.00 89.08  ? 75  LEU B CG    1 
ATOM   4281 C  CD1   . LEU B 1 75  ? -48.744 -26.702 -3.084  1.00 90.60  ? 75  LEU B CD1   1 
ATOM   4282 C  CD2   . LEU B 1 75  ? -48.520 -24.504 -4.233  1.00 89.25  ? 75  LEU B CD2   1 
ATOM   4283 N  N     . ARG B 1 76  ? -52.618 -24.030 -2.804  1.00 86.22  ? 76  ARG B N     1 
ATOM   4284 C  CA    . ARG B 1 76  ? -52.785 -23.063 -1.724  1.00 83.40  ? 76  ARG B CA    1 
ATOM   4285 C  C     . ARG B 1 76  ? -54.070 -23.211 -0.908  1.00 83.01  ? 76  ARG B C     1 
ATOM   4286 O  O     . ARG B 1 76  ? -54.049 -23.023 0.308   1.00 81.64  ? 76  ARG B O     1 
ATOM   4287 C  CB    . ARG B 1 76  ? -52.626 -21.624 -2.225  1.00 82.81  ? 76  ARG B CB    1 
ATOM   4288 C  CG    . ARG B 1 76  ? -53.435 -21.246 -3.446  1.00 85.01  ? 76  ARG B CG    1 
ATOM   4289 C  CD    . ARG B 1 76  ? -53.769 -19.766 -3.415  1.00 84.55  ? 76  ARG B CD    1 
ATOM   4290 N  NE    . ARG B 1 76  ? -54.925 -19.526 -2.559  1.00 84.25  ? 76  ARG B NE    1 
ATOM   4291 C  CZ    . ARG B 1 76  ? -56.179 -19.444 -2.996  1.00 86.46  ? 76  ARG B CZ    1 
ATOM   4292 N  NH1   . ARG B 1 76  ? -56.456 -19.559 -4.290  1.00 88.70  ? 76  ARG B NH1   1 
ATOM   4293 N  NH2   . ARG B 1 76  ? -57.163 -19.235 -2.133  1.00 86.42  ? 76  ARG B NH2   1 
ATOM   4294 N  N     . GLU B 1 77  ? -55.174 -23.554 -1.567  1.00 84.36  ? 77  GLU B N     1 
ATOM   4295 C  CA    . GLU B 1 77  ? -56.450 -23.719 -0.872  1.00 84.46  ? 77  GLU B CA    1 
ATOM   4296 C  C     . GLU B 1 77  ? -56.394 -24.867 0.139   1.00 84.10  ? 77  GLU B C     1 
ATOM   4297 O  O     . GLU B 1 77  ? -56.901 -24.738 1.254   1.00 83.62  ? 77  GLU B O     1 
ATOM   4298 C  CB    . GLU B 1 77  ? -57.608 -23.898 -1.869  1.00 87.07  ? 77  GLU B CB    1 
ATOM   4299 C  CG    . GLU B 1 77  ? -57.961 -22.620 -2.654  1.00 88.39  ? 77  GLU B CG    1 
ATOM   4300 C  CD    . GLU B 1 77  ? -59.227 -21.903 -2.085  1.00 90.09  ? 77  GLU B CD    1 
ATOM   4301 O  OE1   . GLU B 1 77  ? -59.198 -20.651 -1.938  1.00 89.16  ? 77  GLU B OE1   1 
ATOM   4302 O  OE2   . GLU B 1 77  ? -60.256 -22.587 -1.802  1.00 92.37  ? 77  GLU B OE2   1 
ATOM   4303 N  N     . ARG B 1 78  ? -55.756 -25.973 -0.239  1.00 84.56  ? 78  ARG B N     1 
ATOM   4304 C  CA    . ARG B 1 78  ? -55.613 -27.117 0.664   1.00 84.75  ? 78  ARG B CA    1 
ATOM   4305 C  C     . ARG B 1 78  ? -54.560 -26.846 1.738   1.00 82.30  ? 78  ARG B C     1 
ATOM   4306 O  O     . ARG B 1 78  ? -54.706 -27.279 2.881   1.00 82.40  ? 78  ARG B O     1 
ATOM   4307 C  CB    . ARG B 1 78  ? -55.282 -28.396 -0.110  1.00 87.19  ? 78  ARG B CB    1 
ATOM   4308 C  CG    . ARG B 1 78  ? -56.228 -28.701 -1.273  1.00 90.39  ? 78  ARG B CG    1 
ATOM   4309 C  CD    . ARG B 1 78  ? -57.634 -29.094 -0.811  1.00 93.32  ? 78  ARG B CD    1 
ATOM   4310 N  NE    . ARG B 1 78  ? -57.790 -30.539 -0.608  1.00 96.57  ? 78  ARG B NE    1 
ATOM   4311 C  CZ    . ARG B 1 78  ? -58.155 -31.407 -1.553  1.00 99.61  ? 78  ARG B CZ    1 
ATOM   4312 N  NH1   . ARG B 1 78  ? -58.397 -31.001 -2.796  1.00 100.35 ? 78  ARG B NH1   1 
ATOM   4313 N  NH2   . ARG B 1 78  ? -58.276 -32.695 -1.255  1.00 102.32 ? 78  ARG B NH2   1 
ATOM   4314 N  N     . GLY B 1 79  ? -53.512 -26.113 1.364   1.00 80.31  ? 79  GLY B N     1 
ATOM   4315 C  CA    . GLY B 1 79  ? -52.449 -25.722 2.294   1.00 77.69  ? 79  GLY B CA    1 
ATOM   4316 C  C     . GLY B 1 79  ? -52.950 -24.762 3.351   1.00 75.70  ? 79  GLY B C     1 
ATOM   4317 O  O     . GLY B 1 79  ? -52.511 -24.795 4.498   1.00 75.08  ? 79  GLY B O     1 
ATOM   4318 N  N     . LEU B 1 80  ? -53.884 -23.909 2.953   1.00 75.10  ? 80  LEU B N     1 
ATOM   4319 C  CA    . LEU B 1 80  ? -54.488 -22.941 3.852   1.00 74.03  ? 80  LEU B CA    1 
ATOM   4320 C  C     . LEU B 1 80  ? -55.477 -23.642 4.785   1.00 75.41  ? 80  LEU B C     1 
ATOM   4321 O  O     . LEU B 1 80  ? -55.465 -23.406 5.994   1.00 75.14  ? 80  LEU B O     1 
ATOM   4322 C  CB    . LEU B 1 80  ? -55.173 -21.832 3.039   1.00 74.02  ? 80  LEU B CB    1 
ATOM   4323 C  CG    . LEU B 1 80  ? -54.781 -20.359 3.242   1.00 72.58  ? 80  LEU B CG    1 
ATOM   4324 C  CD1   . LEU B 1 80  ? -53.268 -20.113 3.110   1.00 70.46  ? 80  LEU B CD1   1 
ATOM   4325 C  CD2   . LEU B 1 80  ? -55.550 -19.477 2.264   1.00 73.37  ? 80  LEU B CD2   1 
ATOM   4326 N  N     . GLU B 1 81  ? -56.308 -24.522 4.222   1.00 77.08  ? 81  GLU B N     1 
ATOM   4327 C  CA    . GLU B 1 81  ? -57.307 -25.273 4.993   1.00 79.08  ? 81  GLU B CA    1 
ATOM   4328 C  C     . GLU B 1 81  ? -56.650 -26.144 6.063   1.00 79.30  ? 81  GLU B C     1 
ATOM   4329 O  O     . GLU B 1 81  ? -57.162 -26.251 7.181   1.00 80.51  ? 81  GLU B O     1 
ATOM   4330 C  CB    . GLU B 1 81  ? -58.175 -26.134 4.069   1.00 81.18  ? 81  GLU B CB    1 
ATOM   4331 C  CG    . GLU B 1 81  ? -59.410 -26.725 4.741   1.00 84.72  ? 81  GLU B CG    1 
ATOM   4332 C  CD    . GLU B 1 81  ? -59.941 -27.966 4.031   1.00 89.01  ? 81  GLU B CD    1 
ATOM   4333 O  OE1   . GLU B 1 81  ? -59.811 -28.055 2.788   1.00 90.10  ? 81  GLU B OE1   1 
ATOM   4334 O  OE2   . GLU B 1 81  ? -60.492 -28.857 4.721   1.00 91.42  ? 81  GLU B OE2   1 
ATOM   4335 N  N     . ILE B 1 82  ? -55.522 -26.756 5.707   1.00 78.47  ? 82  ILE B N     1 
ATOM   4336 C  CA    . ILE B 1 82  ? -54.737 -27.571 6.630   1.00 78.93  ? 82  ILE B CA    1 
ATOM   4337 C  C     . ILE B 1 82  ? -54.130 -26.707 7.735   1.00 77.43  ? 82  ILE B C     1 
ATOM   4338 O  O     . ILE B 1 82  ? -54.279 -27.006 8.917   1.00 78.74  ? 82  ILE B O     1 
ATOM   4339 C  CB    . ILE B 1 82  ? -53.642 -28.379 5.881   1.00 79.25  ? 82  ILE B CB    1 
ATOM   4340 C  CG1   . ILE B 1 82  ? -54.284 -29.520 5.080   1.00 81.59  ? 82  ILE B CG1   1 
ATOM   4341 C  CG2   . ILE B 1 82  ? -52.610 -28.936 6.855   1.00 79.78  ? 82  ILE B CG2   1 
ATOM   4342 C  CD1   . ILE B 1 82  ? -53.365 -30.189 4.072   1.00 82.27  ? 82  ILE B CD1   1 
ATOM   4343 N  N     . GLY B 1 83  ? -53.469 -25.625 7.337   1.00 75.07  ? 83  GLY B N     1 
ATOM   4344 C  CA    . GLY B 1 83  ? -52.876 -24.676 8.277   1.00 73.75  ? 83  GLY B CA    1 
ATOM   4345 C  C     . GLY B 1 83  ? -53.868 -24.037 9.234   1.00 74.38  ? 83  GLY B C     1 
ATOM   4346 O  O     . GLY B 1 83  ? -53.542 -23.789 10.391  1.00 74.95  ? 83  GLY B O     1 
ATOM   4347 N  N     . LYS B 1 84  ? -55.079 -23.770 8.752   1.00 74.76  ? 84  LYS B N     1 
ATOM   4348 C  CA    . LYS B 1 84  ? -56.132 -23.195 9.587   1.00 76.01  ? 84  LYS B CA    1 
ATOM   4349 C  C     . LYS B 1 84  ? -56.698 -24.219 10.570  1.00 78.84  ? 84  LYS B C     1 
ATOM   4350 O  O     . LYS B 1 84  ? -57.137 -23.860 11.662  1.00 80.38  ? 84  LYS B O     1 
ATOM   4351 C  CB    . LYS B 1 84  ? -57.257 -22.621 8.718   1.00 76.31  ? 84  LYS B CB    1 
ATOM   4352 C  CG    . LYS B 1 84  ? -56.990 -21.223 8.168   1.00 73.98  ? 84  LYS B CG    1 
ATOM   4353 C  CD    . LYS B 1 84  ? -57.664 -20.986 6.813   1.00 73.43  ? 84  LYS B CD    1 
ATOM   4354 C  CE    . LYS B 1 84  ? -59.116 -20.556 6.932   1.00 75.35  ? 84  LYS B CE    1 
ATOM   4355 N  NZ    . LYS B 1 84  ? -60.042 -21.684 7.210   1.00 78.04  ? 84  LYS B NZ    1 
ATOM   4356 N  N     . ALA B 1 85  ? -56.689 -25.489 10.172  1.00 79.87  ? 85  ALA B N     1 
ATOM   4357 C  CA    . ALA B 1 85  ? -57.194 -26.569 11.014  1.00 83.09  ? 85  ALA B CA    1 
ATOM   4358 C  C     . ALA B 1 85  ? -56.046 -27.328 11.682  1.00 83.81  ? 85  ALA B C     1 
ATOM   4359 O  O     . ALA B 1 85  ? -56.048 -28.558 11.739  1.00 85.95  ? 85  ALA B O     1 
ATOM   4360 C  CB    . ALA B 1 85  ? -58.082 -27.516 10.197  1.00 84.60  ? 85  ALA B CB    1 
ATOM   4361 N  N     . VAL B 1 86  ? -55.072 -26.575 12.188  1.00 82.41  ? 86  VAL B N     1 
ATOM   4362 C  CA    . VAL B 1 86  ? -53.878 -27.134 12.819  1.00 83.09  ? 86  VAL B CA    1 
ATOM   4363 C  C     . VAL B 1 86  ? -53.219 -26.113 13.764  1.00 82.68  ? 86  VAL B C     1 
ATOM   4364 O  O     . VAL B 1 86  ? -52.441 -26.487 14.643  1.00 84.19  ? 86  VAL B O     1 
ATOM   4365 C  CB    . VAL B 1 86  ? -52.895 -27.737 11.752  1.00 81.72  ? 86  VAL B CB    1 
ATOM   4366 C  CG1   . VAL B 1 86  ? -51.469 -27.253 11.923  1.00 80.02  ? 86  VAL B CG1   1 
ATOM   4367 C  CG2   . VAL B 1 86  ? -52.961 -29.261 11.755  1.00 84.39  ? 86  VAL B CG2   1 
ATOM   4368 N  N     . LEU B 1 87  ? -53.550 -24.833 13.594  1.00 81.17  ? 87  LEU B N     1 
ATOM   4369 C  CA    . LEU B 1 87  ? -53.101 -23.779 14.516  1.00 81.34  ? 87  LEU B CA    1 
ATOM   4370 C  C     . LEU B 1 87  ? -54.262 -23.223 15.340  1.00 83.78  ? 87  LEU B C     1 
ATOM   4371 O  O     . LEU B 1 87  ? -55.367 -23.044 14.816  1.00 83.96  ? 87  LEU B O     1 
ATOM   4372 C  CB    . LEU B 1 87  ? -52.423 -22.639 13.757  1.00 78.12  ? 87  LEU B CB    1 
ATOM   4373 C  CG    . LEU B 1 87  ? -51.364 -23.015 12.718  1.00 76.19  ? 87  LEU B CG    1 
ATOM   4374 C  CD1   . LEU B 1 87  ? -51.030 -21.806 11.862  1.00 73.59  ? 87  LEU B CD1   1 
ATOM   4375 C  CD2   . LEU B 1 87  ? -50.112 -23.605 13.361  1.00 76.74  ? 87  LEU B CD2   1 
ATOM   4376 N  N     . ASP B 1 88  ? -53.999 -22.950 16.623  1.00 86.09  ? 88  ASP B N     1 
ATOM   4377 C  CA    . ASP B 1 88  ? -55.016 -22.446 17.563  1.00 89.05  ? 88  ASP B CA    1 
ATOM   4378 C  C     . ASP B 1 88  ? -55.670 -21.172 17.022  1.00 87.58  ? 88  ASP B C     1 
ATOM   4379 O  O     . ASP B 1 88  ? -56.843 -21.184 16.635  1.00 88.54  ? 88  ASP B O     1 
ATOM   4380 C  CB    . ASP B 1 88  ? -54.414 -22.204 18.957  1.00 91.57  ? 88  ASP B CB    1 
ATOM   4381 C  CG    . ASP B 1 88  ? -53.758 -23.448 19.546  1.00 93.79  ? 88  ASP B CG    1 
ATOM   4382 O  OD1   . ASP B 1 88  ? -52.790 -23.289 20.322  1.00 94.85  ? 88  ASP B OD1   1 
ATOM   4383 O  OD2   . ASP B 1 88  ? -54.203 -24.579 19.244  1.00 94.74  ? 88  ASP B OD2   1 
ATOM   4384 N  N     . SER B 1 89  ? -54.914 -20.079 16.997  1.00 85.52  ? 89  SER B N     1 
ATOM   4385 C  CA    . SER B 1 89  ? -55.301 -18.923 16.200  1.00 83.67  ? 89  SER B CA    1 
ATOM   4386 C  C     . SER B 1 89  ? -54.346 -18.830 15.011  1.00 79.78  ? 89  SER B C     1 
ATOM   4387 O  O     . SER B 1 89  ? -53.260 -19.426 15.025  1.00 78.63  ? 89  SER B O     1 
ATOM   4388 C  CB    . SER B 1 89  ? -55.327 -17.634 17.029  1.00 85.11  ? 89  SER B CB    1 
ATOM   4389 O  OG    . SER B 1 89  ? -54.036 -17.267 17.474  1.00 84.39  ? 89  SER B OG    1 
ATOM   4390 N  N     . TYR B 1 90  ? -54.767 -18.108 13.977  1.00 78.06  ? 90  TYR B N     1 
ATOM   4391 C  CA    . TYR B 1 90  ? -53.994 -18.025 12.745  1.00 74.93  ? 90  TYR B CA    1 
ATOM   4392 C  C     . TYR B 1 90  ? -54.041 -16.644 12.097  1.00 73.89  ? 90  TYR B C     1 
ATOM   4393 O  O     . TYR B 1 90  ? -54.978 -15.877 12.308  1.00 75.56  ? 90  TYR B O     1 
ATOM   4394 C  CB    . TYR B 1 90  ? -54.444 -19.101 11.752  1.00 74.42  ? 90  TYR B CB    1 
ATOM   4395 C  CG    . TYR B 1 90  ? -55.904 -19.040 11.330  1.00 75.77  ? 90  TYR B CG    1 
ATOM   4396 C  CD1   . TYR B 1 90  ? -56.325 -18.180 10.316  1.00 74.93  ? 90  TYR B CD1   1 
ATOM   4397 C  CD2   . TYR B 1 90  ? -56.856 -19.867 11.926  1.00 78.31  ? 90  TYR B CD2   1 
ATOM   4398 C  CE1   . TYR B 1 90  ? -57.659 -18.130 9.916   1.00 76.59  ? 90  TYR B CE1   1 
ATOM   4399 C  CE2   . TYR B 1 90  ? -58.193 -19.828 11.535  1.00 79.93  ? 90  TYR B CE2   1 
ATOM   4400 C  CZ    . TYR B 1 90  ? -58.587 -18.958 10.528  1.00 79.06  ? 90  TYR B CZ    1 
ATOM   4401 O  OH    . TYR B 1 90  ? -59.907 -18.914 10.134  1.00 80.72  ? 90  TYR B OH    1 
ATOM   4402 N  N     . GLU B 1 91  ? -53.018 -16.346 11.303  1.00 71.53  ? 91  GLU B N     1 
ATOM   4403 C  CA    . GLU B 1 91  ? -52.935 -15.104 10.555  1.00 70.82  ? 91  GLU B CA    1 
ATOM   4404 C  C     . GLU B 1 91  ? -52.492 -15.420 9.126   1.00 68.69  ? 91  GLU B C     1 
ATOM   4405 O  O     . GLU B 1 91  ? -51.438 -16.025 8.921   1.00 67.67  ? 91  GLU B O     1 
ATOM   4406 C  CB    . GLU B 1 91  ? -51.947 -14.150 11.237  1.00 70.45  ? 91  GLU B CB    1 
ATOM   4407 C  CG    . GLU B 1 91  ? -51.531 -12.966 10.374  1.00 70.48  ? 91  GLU B CG    1 
ATOM   4408 C  CD    . GLU B 1 91  ? -50.709 -11.937 11.125  1.00 70.81  ? 91  GLU B CD    1 
ATOM   4409 O  OE1   . GLU B 1 91  ? -49.482 -11.872 10.883  1.00 71.03  ? 91  GLU B OE1   1 
ATOM   4410 O  OE2   . GLU B 1 91  ? -51.288 -11.195 11.950  1.00 73.16  ? 91  GLU B OE2   1 
ATOM   4411 N  N     . ILE B 1 92  ? -53.300 -15.043 8.141   1.00 68.51  ? 92  ILE B N     1 
ATOM   4412 C  CA    . ILE B 1 92  ? -52.890 -15.213 6.750   1.00 67.16  ? 92  ILE B CA    1 
ATOM   4413 C  C     . ILE B 1 92  ? -52.594 -13.853 6.156   1.00 66.95  ? 92  ILE B C     1 
ATOM   4414 O  O     . ILE B 1 92  ? -53.474 -12.993 6.087   1.00 68.44  ? 92  ILE B O     1 
ATOM   4415 C  CB    . ILE B 1 92  ? -53.931 -15.980 5.880   1.00 68.02  ? 92  ILE B CB    1 
ATOM   4416 C  CG1   . ILE B 1 92  ? -53.899 -17.475 6.181   1.00 67.70  ? 92  ILE B CG1   1 
ATOM   4417 C  CG2   . ILE B 1 92  ? -53.647 -15.798 4.396   1.00 67.63  ? 92  ILE B CG2   1 
ATOM   4418 C  CD1   . ILE B 1 92  ? -55.115 -17.973 6.901   1.00 69.30  ? 92  ILE B CD1   1 
ATOM   4419 N  N     . ARG B 1 93  ? -51.343 -13.667 5.743   1.00 65.64  ? 93  ARG B N     1 
ATOM   4420 C  CA    . ARG B 1 93  ? -50.875 -12.411 5.161   1.00 65.72  ? 93  ARG B CA    1 
ATOM   4421 C  C     . ARG B 1 93  ? -49.517 -12.633 4.489   1.00 64.46  ? 93  ARG B C     1 
ATOM   4422 O  O     . ARG B 1 93  ? -48.518 -12.904 5.154   1.00 63.71  ? 93  ARG B O     1 
ATOM   4423 C  CB    . ARG B 1 93  ? -50.796 -11.323 6.237   1.00 66.25  ? 93  ARG B CB    1 
ATOM   4424 C  CG    . ARG B 1 93  ? -50.779 -9.914  5.693   1.00 68.17  ? 93  ARG B CG    1 
ATOM   4425 C  CD    . ARG B 1 93  ? -51.807 -9.045  6.398   1.00 71.61  ? 93  ARG B CD    1 
ATOM   4426 N  NE    . ARG B 1 93  ? -51.869 -7.680  5.864   1.00 74.34  ? 93  ARG B NE    1 
ATOM   4427 C  CZ    . ARG B 1 93  ? -52.296 -7.351  4.642   1.00 75.48  ? 93  ARG B CZ    1 
ATOM   4428 N  NH1   . ARG B 1 93  ? -52.688 -8.287  3.780   1.00 74.77  ? 93  ARG B NH1   1 
ATOM   4429 N  NH2   . ARG B 1 93  ? -52.320 -6.074  4.274   1.00 76.79  ? 93  ARG B NH2   1 
ATOM   4430 N  N     . TYR B 1 94  ? -49.485 -12.538 3.165   1.00 64.74  ? 94  TYR B N     1 
ATOM   4431 C  CA    . TYR B 1 94  ? -48.268 -12.849 2.418   1.00 64.10  ? 94  TYR B CA    1 
ATOM   4432 C  C     . TYR B 1 94  ? -48.152 -12.018 1.139   1.00 65.32  ? 94  TYR B C     1 
ATOM   4433 O  O     . TYR B 1 94  ? -49.108 -11.351 0.744   1.00 66.39  ? 94  TYR B O     1 
ATOM   4434 C  CB    . TYR B 1 94  ? -48.197 -14.348 2.120   1.00 63.92  ? 94  TYR B CB    1 
ATOM   4435 C  CG    . TYR B 1 94  ? -49.388 -14.882 1.366   1.00 64.83  ? 94  TYR B CG    1 
ATOM   4436 C  CD1   . TYR B 1 94  ? -49.422 -14.838 -0.027  1.00 66.55  ? 94  TYR B CD1   1 
ATOM   4437 C  CD2   . TYR B 1 94  ? -50.479 -15.433 2.038   1.00 64.80  ? 94  TYR B CD2   1 
ATOM   4438 C  CE1   . TYR B 1 94  ? -50.509 -15.322 -0.741  1.00 68.25  ? 94  TYR B CE1   1 
ATOM   4439 C  CE2   . TYR B 1 94  ? -51.582 -15.924 1.331   1.00 66.72  ? 94  TYR B CE2   1 
ATOM   4440 C  CZ    . TYR B 1 94  ? -51.585 -15.865 -0.063  1.00 67.94  ? 94  TYR B CZ    1 
ATOM   4441 O  OH    . TYR B 1 94  ? -52.654 -16.336 -0.793  1.00 69.26  ? 94  TYR B OH    1 
ATOM   4442 N  N     . ALA B 1 95  ? -46.984 -12.073 0.498   1.00 65.40  ? 95  ALA B N     1 
ATOM   4443 C  CA    . ALA B 1 95  ? -46.667 -11.190 -0.634  1.00 67.08  ? 95  ALA B CA    1 
ATOM   4444 C  C     . ALA B 1 95  ? -46.922 -11.819 -2.003  1.00 68.74  ? 95  ALA B C     1 
ATOM   4445 O  O     . ALA B 1 95  ? -47.451 -11.157 -2.906  1.00 70.47  ? 95  ALA B O     1 
ATOM   4446 C  CB    . ALA B 1 95  ? -45.227 -10.690 -0.534  1.00 66.94  ? 95  ALA B CB    1 
ATOM   4447 N  N     . GLU B 1 96  ? -46.516 -13.083 -2.155  1.00 68.44  ? 96  GLU B N     1 
ATOM   4448 C  CA    . GLU B 1 96  ? -46.810 -13.865 -3.363  1.00 70.36  ? 96  GLU B CA    1 
ATOM   4449 C  C     . GLU B 1 96  ? -47.080 -15.333 -3.049  1.00 69.27  ? 96  GLU B C     1 
ATOM   4450 O  O     . GLU B 1 96  ? -47.979 -15.933 -3.636  1.00 70.45  ? 96  GLU B O     1 
ATOM   4451 C  CB    . GLU B 1 96  ? -45.719 -13.697 -4.444  1.00 72.65  ? 96  GLU B CB    1 
ATOM   4452 C  CG    . GLU B 1 96  ? -44.504 -14.633 -4.345  1.00 73.44  ? 96  GLU B CG    1 
ATOM   4453 C  CD    . GLU B 1 96  ? -44.591 -15.852 -5.265  1.00 76.58  ? 96  GLU B CD    1 
ATOM   4454 O  OE1   . GLU B 1 96  ? -44.639 -15.664 -6.502  1.00 80.09  ? 96  GLU B OE1   1 
ATOM   4455 O  OE2   . GLU B 1 96  ? -44.589 -16.995 -4.753  1.00 75.52  ? 96  GLU B OE2   1 
ATOM   4456 N  N     . HIS B 1 97  ? -46.313 -15.904 -2.122  1.00 67.48  ? 97  HIS B N     1 
ATOM   4457 C  CA    . HIS B 1 97  ? -46.471 -17.313 -1.789  1.00 67.15  ? 97  HIS B CA    1 
ATOM   4458 C  C     . HIS B 1 97  ? -47.232 -17.574 -0.486  1.00 65.42  ? 97  HIS B C     1 
ATOM   4459 O  O     . HIS B 1 97  ? -46.772 -17.200 0.599   1.00 63.76  ? 97  HIS B O     1 
ATOM   4460 C  CB    . HIS B 1 97  ? -45.143 -18.062 -1.794  1.00 67.54  ? 97  HIS B CB    1 
ATOM   4461 C  CG    . HIS B 1 97  ? -45.310 -19.550 -1.812  1.00 68.39  ? 97  HIS B CG    1 
ATOM   4462 N  ND1   . HIS B 1 97  ? -45.467 -20.294 -0.662  1.00 66.57  ? 97  HIS B ND1   1 
ATOM   4463 C  CD2   . HIS B 1 97  ? -45.378 -20.428 -2.842  1.00 70.76  ? 97  HIS B CD2   1 
ATOM   4464 C  CE1   . HIS B 1 97  ? -45.607 -21.567 -0.982  1.00 68.68  ? 97  HIS B CE1   1 
ATOM   4465 N  NE2   . HIS B 1 97  ? -45.557 -21.676 -2.297  1.00 71.23  ? 97  HIS B NE2   1 
ATOM   4466 N  N     . PRO B 1 98  ? -48.400 -18.233 -0.608  1.00 66.09  ? 98  PRO B N     1 
ATOM   4467 C  CA    . PRO B 1 98  ? -49.379 -18.533 0.449   1.00 65.35  ? 98  PRO B CA    1 
ATOM   4468 C  C     . PRO B 1 98  ? -48.852 -19.344 1.634   1.00 64.42  ? 98  PRO B C     1 
ATOM   4469 O  O     . PRO B 1 98  ? -48.213 -20.382 1.438   1.00 65.28  ? 98  PRO B O     1 
ATOM   4470 C  CB    . PRO B 1 98  ? -50.458 -19.330 -0.297  1.00 66.97  ? 98  PRO B CB    1 
ATOM   4471 C  CG    . PRO B 1 98  ? -49.787 -19.819 -1.541  1.00 68.40  ? 98  PRO B CG    1 
ATOM   4472 C  CD    . PRO B 1 98  ? -48.857 -18.736 -1.917  1.00 68.08  ? 98  PRO B CD    1 
ATOM   4473 N  N     . TYR B 1 99  ? -49.133 -18.868 2.849   1.00 63.16  ? 99  TYR B N     1 
ATOM   4474 C  CA    . TYR B 1 99  ? -48.796 -19.589 4.079   1.00 62.73  ? 99  TYR B CA    1 
ATOM   4475 C  C     . TYR B 1 99  ? -49.606 -19.078 5.265   1.00 62.87  ? 99  TYR B C     1 
ATOM   4476 O  O     . TYR B 1 99  ? -49.976 -17.903 5.307   1.00 62.69  ? 99  TYR B O     1 
ATOM   4477 C  CB    . TYR B 1 99  ? -47.289 -19.505 4.381   1.00 61.83  ? 99  TYR B CB    1 
ATOM   4478 C  CG    . TYR B 1 99  ? -46.817 -18.194 4.980   1.00 59.73  ? 99  TYR B CG    1 
ATOM   4479 C  CD1   . TYR B 1 99  ? -46.524 -18.093 6.337   1.00 58.44  ? 99  TYR B CD1   1 
ATOM   4480 C  CD2   . TYR B 1 99  ? -46.652 -17.066 4.186   1.00 59.13  ? 99  TYR B CD2   1 
ATOM   4481 C  CE1   . TYR B 1 99  ? -46.088 -16.903 6.890   1.00 58.51  ? 99  TYR B CE1   1 
ATOM   4482 C  CE2   . TYR B 1 99  ? -46.219 -15.865 4.729   1.00 58.94  ? 99  TYR B CE2   1 
ATOM   4483 C  CZ    . TYR B 1 99  ? -45.940 -15.788 6.081   1.00 58.79  ? 99  TYR B CZ    1 
ATOM   4484 O  OH    . TYR B 1 99  ? -45.514 -14.593 6.616   1.00 58.37  ? 99  TYR B OH    1 
ATOM   4485 N  N     . VAL B 1 100 ? -49.870 -19.962 6.226   1.00 63.86  ? 100 VAL B N     1 
ATOM   4486 C  CA    . VAL B 1 100 ? -50.535 -19.581 7.474   1.00 64.68  ? 100 VAL B CA    1 
ATOM   4487 C  C     . VAL B 1 100 ? -49.510 -19.414 8.589   1.00 64.77  ? 100 VAL B C     1 
ATOM   4488 O  O     . VAL B 1 100 ? -48.655 -20.280 8.781   1.00 65.29  ? 100 VAL B O     1 
ATOM   4489 C  CB    . VAL B 1 100 ? -51.569 -20.629 7.931   1.00 66.18  ? 100 VAL B CB    1 
ATOM   4490 C  CG1   . VAL B 1 100 ? -52.523 -20.017 8.937   1.00 67.16  ? 100 VAL B CG1   1 
ATOM   4491 C  CG2   . VAL B 1 100 ? -52.346 -21.186 6.749   1.00 67.03  ? 100 VAL B CG2   1 
ATOM   4492 N  N     . HIS B 1 101 ? -49.599 -18.301 9.311   1.00 65.00  ? 101 HIS B N     1 
ATOM   4493 C  CA    . HIS B 1 101 ? -48.802 -18.084 10.518  1.00 65.79  ? 101 HIS B CA    1 
ATOM   4494 C  C     . HIS B 1 101 ? -49.712 -18.148 11.749  1.00 67.89  ? 101 HIS B C     1 
ATOM   4495 O  O     . HIS B 1 101 ? -50.818 -17.613 11.724  1.00 68.62  ? 101 HIS B O     1 
ATOM   4496 C  CB    . HIS B 1 101 ? -48.083 -16.736 10.448  1.00 64.89  ? 101 HIS B CB    1 
ATOM   4497 C  CG    . HIS B 1 101 ? -47.430 -16.330 11.733  1.00 66.04  ? 101 HIS B CG    1 
ATOM   4498 N  ND1   . HIS B 1 101 ? -46.230 -16.860 12.159  1.00 66.29  ? 101 HIS B ND1   1 
ATOM   4499 C  CD2   . HIS B 1 101 ? -47.811 -15.447 12.687  1.00 67.26  ? 101 HIS B CD2   1 
ATOM   4500 C  CE1   . HIS B 1 101 ? -45.901 -16.323 13.321  1.00 67.23  ? 101 HIS B CE1   1 
ATOM   4501 N  NE2   . HIS B 1 101 ? -46.843 -15.462 13.663  1.00 67.83  ? 101 HIS B NE2   1 
ATOM   4502 N  N     . GLY B 1 102 ? -49.251 -18.799 12.819  1.00 69.44  ? 102 GLY B N     1 
ATOM   4503 C  CA    . GLY B 1 102 ? -50.064 -18.949 14.032  1.00 72.32  ? 102 GLY B CA    1 
ATOM   4504 C  C     . GLY B 1 102 ? -49.342 -19.424 15.286  1.00 74.50  ? 102 GLY B C     1 
ATOM   4505 O  O     . GLY B 1 102 ? -48.107 -19.486 15.328  1.00 73.74  ? 102 GLY B O     1 
ATOM   4506 N  N     . VAL B 1 103 ? -50.128 -19.762 16.310  1.00 77.57  ? 103 VAL B N     1 
ATOM   4507 C  CA    . VAL B 1 103 ? -49.595 -20.134 17.629  1.00 80.58  ? 103 VAL B CA    1 
ATOM   4508 C  C     . VAL B 1 103 ? -50.095 -21.485 18.163  1.00 83.55  ? 103 VAL B C     1 
ATOM   4509 O  O     . VAL B 1 103 ? -51.300 -21.774 18.167  1.00 84.72  ? 103 VAL B O     1 
ATOM   4510 C  CB    . VAL B 1 103 ? -49.841 -19.021 18.702  1.00 82.65  ? 103 VAL B CB    1 
ATOM   4511 C  CG1   . VAL B 1 103 ? -48.833 -17.881 18.550  1.00 80.79  ? 103 VAL B CG1   1 
ATOM   4512 C  CG2   . VAL B 1 103 ? -51.283 -18.493 18.651  1.00 83.62  ? 103 VAL B CG2   1 
ATOM   4513 N  N     . VAL B 1 104 ? -49.146 -22.306 18.606  1.00 85.00  ? 104 VAL B N     1 
ATOM   4514 C  CA    . VAL B 1 104 ? -49.449 -23.593 19.234  1.00 88.67  ? 104 VAL B CA    1 
ATOM   4515 C  C     . VAL B 1 104 ? -48.884 -23.607 20.655  1.00 92.44  ? 104 VAL B C     1 
ATOM   4516 O  O     . VAL B 1 104 ? -47.678 -23.414 20.858  1.00 92.13  ? 104 VAL B O     1 
ATOM   4517 C  CB    . VAL B 1 104 ? -48.882 -24.792 18.428  1.00 87.88  ? 104 VAL B CB    1 
ATOM   4518 C  CG1   . VAL B 1 104 ? -49.314 -26.108 19.062  1.00 91.70  ? 104 VAL B CG1   1 
ATOM   4519 C  CG2   . VAL B 1 104 ? -49.336 -24.738 16.976  1.00 84.68  ? 104 VAL B CG2   1 
ATOM   4520 N  N     . LYS B 1 105 ? -49.768 -23.827 21.629  1.00 96.46  ? 105 LYS B N     1 
ATOM   4521 C  CA    . LYS B 1 105 ? -49.422 -23.833 23.060  1.00 100.94 ? 105 LYS B CA    1 
ATOM   4522 C  C     . LYS B 1 105 ? -48.575 -22.625 23.484  1.00 100.34 ? 105 LYS B C     1 
ATOM   4523 O  O     . LYS B 1 105 ? -47.820 -22.691 24.456  1.00 103.38 ? 105 LYS B O     1 
ATOM   4524 C  CB    . LYS B 1 105 ? -48.748 -25.155 23.465  1.00 103.64 ? 105 LYS B CB    1 
ATOM   4525 C  CG    . LYS B 1 105 ? -49.408 -26.402 22.886  1.00 103.98 ? 105 LYS B CG    1 
ATOM   4526 C  CD    . LYS B 1 105 ? -49.771 -27.402 23.973  1.00 109.68 ? 105 LYS B CD    1 
ATOM   4527 C  CE    . LYS B 1 105 ? -51.111 -27.049 24.610  1.00 112.16 ? 105 LYS B CE    1 
ATOM   4528 N  NZ    . LYS B 1 105 ? -51.292 -27.697 25.932  1.00 118.24 ? 105 LYS B NZ    1 
ATOM   4529 N  N     . GLY B 1 106 ? -48.721 -21.526 22.745  1.00 97.03  ? 106 GLY B N     1 
ATOM   4530 C  CA    . GLY B 1 106 ? -47.972 -20.289 22.985  1.00 96.38  ? 106 GLY B CA    1 
ATOM   4531 C  C     . GLY B 1 106 ? -46.661 -20.160 22.221  1.00 93.27  ? 106 GLY B C     1 
ATOM   4532 O  O     . GLY B 1 106 ? -45.745 -19.475 22.675  1.00 93.52  ? 106 GLY B O     1 
ATOM   4533 N  N     . VAL B 1 107 ? -46.565 -20.809 21.060  1.00 90.73  ? 107 VAL B N     1 
ATOM   4534 C  CA    . VAL B 1 107 ? -45.319 -20.829 20.281  1.00 88.49  ? 107 VAL B CA    1 
ATOM   4535 C  C     . VAL B 1 107 ? -45.549 -20.514 18.796  1.00 84.78  ? 107 VAL B C     1 
ATOM   4536 O  O     . VAL B 1 107 ? -46.391 -21.138 18.148  1.00 84.27  ? 107 VAL B O     1 
ATOM   4537 C  CB    . VAL B 1 107 ? -44.573 -22.185 20.438  1.00 90.25  ? 107 VAL B CB    1 
ATOM   4538 C  CG1   . VAL B 1 107 ? -43.392 -22.276 19.485  1.00 87.79  ? 107 VAL B CG1   1 
ATOM   4539 C  CG2   . VAL B 1 107 ? -44.106 -22.381 21.874  1.00 94.57  ? 107 VAL B CG2   1 
ATOM   4540 N  N     . GLU B 1 108 ? -44.789 -19.546 18.279  1.00 82.76  ? 108 GLU B N     1 
ATOM   4541 C  CA    . GLU B 1 108 ? -44.861 -19.104 16.882  1.00 79.86  ? 108 GLU B CA    1 
ATOM   4542 C  C     . GLU B 1 108 ? -44.689 -20.258 15.901  1.00 78.95  ? 108 GLU B C     1 
ATOM   4543 O  O     . GLU B 1 108 ? -43.711 -21.004 15.984  1.00 79.94  ? 108 GLU B O     1 
ATOM   4544 C  CB    . GLU B 1 108 ? -43.763 -18.071 16.602  1.00 78.61  ? 108 GLU B CB    1 
ATOM   4545 C  CG    . GLU B 1 108 ? -43.838 -16.793 17.422  1.00 80.54  ? 108 GLU B CG    1 
ATOM   4546 C  CD    . GLU B 1 108 ? -44.823 -15.800 16.850  1.00 80.44  ? 108 GLU B CD    1 
ATOM   4547 O  OE1   . GLU B 1 108 ? -44.501 -15.174 15.821  1.00 79.04  ? 108 GLU B OE1   1 
ATOM   4548 O  OE2   . GLU B 1 108 ? -45.916 -15.646 17.431  1.00 82.52  ? 108 GLU B OE2   1 
ATOM   4549 N  N     . VAL B 1 109 ? -45.630 -20.395 14.970  1.00 77.63  ? 109 VAL B N     1 
ATOM   4550 C  CA    . VAL B 1 109 ? -45.573 -21.459 13.960  1.00 77.21  ? 109 VAL B CA    1 
ATOM   4551 C  C     . VAL B 1 109 ? -45.874 -20.951 12.544  1.00 74.99  ? 109 VAL B C     1 
ATOM   4552 O  O     . VAL B 1 109 ? -46.713 -20.063 12.349  1.00 74.11  ? 109 VAL B O     1 
ATOM   4553 C  CB    . VAL B 1 109 ? -46.533 -22.644 14.296  1.00 79.20  ? 109 VAL B CB    1 
ATOM   4554 C  CG1   . VAL B 1 109 ? -46.412 -23.756 13.262  1.00 78.87  ? 109 VAL B CG1   1 
ATOM   4555 C  CG2   . VAL B 1 109 ? -46.244 -23.204 15.668  1.00 82.18  ? 109 VAL B CG2   1 
ATOM   4556 N  N     . ASP B 1 110 ? -45.181 -21.530 11.564  1.00 74.58  ? 110 ASP B N     1 
ATOM   4557 C  CA    . ASP B 1 110 ? -45.460 -21.293 10.153  1.00 73.38  ? 110 ASP B CA    1 
ATOM   4558 C  C     . ASP B 1 110 ? -45.810 -22.585 9.437   1.00 74.30  ? 110 ASP B C     1 
ATOM   4559 O  O     . ASP B 1 110 ? -45.082 -23.574 9.539   1.00 75.80  ? 110 ASP B O     1 
ATOM   4560 C  CB    . ASP B 1 110 ? -44.254 -20.659 9.468   1.00 72.52  ? 110 ASP B CB    1 
ATOM   4561 C  CG    . ASP B 1 110 ? -44.221 -19.155 9.616   1.00 72.26  ? 110 ASP B CG    1 
ATOM   4562 O  OD1   . ASP B 1 110 ? -44.656 -18.621 10.666  1.00 73.85  ? 110 ASP B OD1   1 
ATOM   4563 O  OD2   . ASP B 1 110 ? -43.748 -18.502 8.668   1.00 72.55  ? 110 ASP B OD2   1 
ATOM   4564 N  N     . VAL B 1 111 ? -46.928 -22.575 8.716   1.00 73.84  ? 111 VAL B N     1 
ATOM   4565 C  CA    . VAL B 1 111 ? -47.300 -23.701 7.866   1.00 74.77  ? 111 VAL B CA    1 
ATOM   4566 C  C     . VAL B 1 111 ? -47.215 -23.235 6.421   1.00 73.79  ? 111 VAL B C     1 
ATOM   4567 O  O     . VAL B 1 111 ? -47.879 -22.274 6.033   1.00 72.80  ? 111 VAL B O     1 
ATOM   4568 C  CB    . VAL B 1 111 ? -48.719 -24.236 8.167   1.00 75.87  ? 111 VAL B CB    1 
ATOM   4569 C  CG1   . VAL B 1 111 ? -48.818 -25.706 7.775   1.00 77.72  ? 111 VAL B CG1   1 
ATOM   4570 C  CG2   . VAL B 1 111 ? -49.069 -24.065 9.639   1.00 76.67  ? 111 VAL B CG2   1 
ATOM   4571 N  N     . VAL B 1 112 ? -46.377 -23.904 5.633   1.00 74.58  ? 112 VAL B N     1 
ATOM   4572 C  CA    . VAL B 1 112 ? -46.120 -23.480 4.256   1.00 74.20  ? 112 VAL B CA    1 
ATOM   4573 C  C     . VAL B 1 112 ? -46.269 -24.631 3.250   1.00 76.11  ? 112 VAL B C     1 
ATOM   4574 O  O     . VAL B 1 112 ? -45.452 -25.557 3.232   1.00 77.63  ? 112 VAL B O     1 
ATOM   4575 C  CB    . VAL B 1 112 ? -44.728 -22.811 4.106   1.00 73.68  ? 112 VAL B CB    1 
ATOM   4576 C  CG1   . VAL B 1 112 ? -44.641 -22.081 2.780   1.00 73.81  ? 112 VAL B CG1   1 
ATOM   4577 C  CG2   . VAL B 1 112 ? -44.455 -21.843 5.249   1.00 71.88  ? 112 VAL B CG2   1 
ATOM   4578 N  N     . PRO B 1 113 ? -47.329 -24.583 2.420   1.00 76.35  ? 113 PRO B N     1 
ATOM   4579 C  CA    . PRO B 1 113 ? -47.539 -25.575 1.366   1.00 78.55  ? 113 PRO B CA    1 
ATOM   4580 C  C     . PRO B 1 113 ? -46.493 -25.470 0.264   1.00 79.70  ? 113 PRO B C     1 
ATOM   4581 O  O     . PRO B 1 113 ? -46.155 -24.361 -0.157  1.00 78.74  ? 113 PRO B O     1 
ATOM   4582 C  CB    . PRO B 1 113 ? -48.924 -25.216 0.815   1.00 78.42  ? 113 PRO B CB    1 
ATOM   4583 C  CG    . PRO B 1 113 ? -49.127 -23.800 1.170   1.00 76.34  ? 113 PRO B CG    1 
ATOM   4584 C  CD    . PRO B 1 113 ? -48.415 -23.588 2.464   1.00 75.04  ? 113 PRO B CD    1 
ATOM   4585 N  N     . CYS B 1 114 ? -45.980 -26.617 -0.182  1.00 82.22  ? 114 CYS B N     1 
ATOM   4586 C  CA    . CYS B 1 114 ? -45.035 -26.674 -1.302  1.00 84.19  ? 114 CYS B CA    1 
ATOM   4587 C  C     . CYS B 1 114 ? -45.148 -27.997 -2.058  1.00 87.59  ? 114 CYS B C     1 
ATOM   4588 O  O     . CYS B 1 114 ? -46.066 -28.781 -1.808  1.00 88.29  ? 114 CYS B O     1 
ATOM   4589 C  CB    . CYS B 1 114 ? -43.598 -26.459 -0.817  1.00 83.97  ? 114 CYS B CB    1 
ATOM   4590 S  SG    . CYS B 1 114 ? -42.810 -27.926 -0.138  1.00 87.01  ? 114 CYS B SG    1 
ATOM   4591 N  N     . TYR B 1 115 ? -44.209 -28.238 -2.973  1.00 90.11  ? 115 TYR B N     1 
ATOM   4592 C  CA    . TYR B 1 115 ? -44.201 -29.453 -3.789  1.00 94.01  ? 115 TYR B CA    1 
ATOM   4593 C  C     . TYR B 1 115 ? -43.122 -30.450 -3.373  1.00 96.39  ? 115 TYR B C     1 
ATOM   4594 O  O     . TYR B 1 115 ? -42.070 -30.059 -2.869  1.00 95.55  ? 115 TYR B O     1 
ATOM   4595 C  CB    . TYR B 1 115 ? -44.047 -29.097 -5.272  1.00 96.36  ? 115 TYR B CB    1 
ATOM   4596 C  CG    . TYR B 1 115 ? -45.289 -28.474 -5.869  1.00 95.72  ? 115 TYR B CG    1 
ATOM   4597 C  CD1   . TYR B 1 115 ? -45.369 -27.096 -6.080  1.00 93.68  ? 115 TYR B CD1   1 
ATOM   4598 C  CD2   . TYR B 1 115 ? -46.394 -29.263 -6.208  1.00 97.63  ? 115 TYR B CD2   1 
ATOM   4599 C  CE1   . TYR B 1 115 ? -46.517 -26.516 -6.623  1.00 93.34  ? 115 TYR B CE1   1 
ATOM   4600 C  CE2   . TYR B 1 115 ? -47.547 -28.694 -6.749  1.00 97.29  ? 115 TYR B CE2   1 
ATOM   4601 C  CZ    . TYR B 1 115 ? -47.602 -27.321 -6.952  1.00 95.08  ? 115 TYR B CZ    1 
ATOM   4602 O  OH    . TYR B 1 115 ? -48.739 -26.758 -7.488  1.00 94.93  ? 115 TYR B OH    1 
ATOM   4603 N  N     . LYS B 1 116 ? -43.410 -31.738 -3.570  1.00 99.68  ? 116 LYS B N     1 
ATOM   4604 C  CA    . LYS B 1 116 ? -42.415 -32.808 -3.439  1.00 103.27 ? 116 LYS B CA    1 
ATOM   4605 C  C     . LYS B 1 116 ? -41.841 -33.106 -4.820  1.00 107.45 ? 116 LYS B C     1 
ATOM   4606 O  O     . LYS B 1 116 ? -42.587 -33.262 -5.791  1.00 109.07 ? 116 LYS B O     1 
ATOM   4607 C  CB    . LYS B 1 116 ? -43.030 -34.078 -2.833  1.00 105.07 ? 116 LYS B CB    1 
ATOM   4608 C  CG    . LYS B 1 116 ? -42.047 -35.243 -2.679  1.00 109.35 ? 116 LYS B CG    1 
ATOM   4609 C  CD    . LYS B 1 116 ? -42.762 -36.580 -2.516  1.00 112.50 ? 116 LYS B CD    1 
ATOM   4610 C  CE    . LYS B 1 116 ? -41.793 -37.752 -2.656  1.00 117.63 ? 116 LYS B CE    1 
ATOM   4611 N  NZ    . LYS B 1 116 ? -42.475 -39.065 -2.472  1.00 120.67 ? 116 LYS B NZ    1 
ATOM   4612 N  N     . LEU B 1 117 ? -40.517 -33.179 -4.902  1.00 109.62 ? 117 LEU B N     1 
ATOM   4613 C  CA    . LEU B 1 117 ? -39.839 -33.344 -6.180  1.00 113.97 ? 117 LEU B CA    1 
ATOM   4614 C  C     . LEU B 1 117 ? -38.687 -34.328 -6.101  1.00 118.59 ? 117 LEU B C     1 
ATOM   4615 O  O     . LEU B 1 117 ? -38.042 -34.473 -5.060  1.00 117.80 ? 117 LEU B O     1 
ATOM   4616 C  CB    . LEU B 1 117 ? -39.278 -32.000 -6.667  1.00 112.31 ? 117 LEU B CB    1 
ATOM   4617 C  CG    . LEU B 1 117 ? -40.133 -30.731 -6.733  1.00 107.83 ? 117 LEU B CG    1 
ATOM   4618 C  CD1   . LEU B 1 117 ? -39.238 -29.513 -6.897  1.00 106.28 ? 117 LEU B CD1   1 
ATOM   4619 C  CD2   . LEU B 1 117 ? -41.163 -30.804 -7.856  1.00 109.54 ? 117 LEU B CD2   1 
ATOM   4620 N  N     . LYS B 1 118 ? -38.445 -35.011 -7.212  1.00 123.96 ? 118 LYS B N     1 
ATOM   4621 C  CA    . LYS B 1 118 ? -37.123 -35.535 -7.490  1.00 128.93 ? 118 LYS B CA    1 
ATOM   4622 C  C     . LYS B 1 118 ? -36.463 -34.438 -8.312  1.00 129.08 ? 118 LYS B C     1 
ATOM   4623 O  O     . LYS B 1 118 ? -37.120 -33.829 -9.161  1.00 128.41 ? 118 LYS B O     1 
ATOM   4624 C  CB    . LYS B 1 118 ? -37.183 -36.846 -8.280  1.00 135.38 ? 118 LYS B CB    1 
ATOM   4625 C  CG    . LYS B 1 118 ? -37.822 -38.009 -7.530  1.00 136.14 ? 118 LYS B CG    1 
ATOM   4626 C  CD    . LYS B 1 118 ? -39.217 -38.322 -8.051  1.00 136.24 ? 118 LYS B CD    1 
ATOM   4627 C  CE    . LYS B 1 118 ? -39.149 -39.233 -9.277  1.00 143.38 ? 118 LYS B CE    1 
ATOM   4628 N  NZ    . LYS B 1 118 ? -40.492 -39.675 -9.742  1.00 143.73 ? 118 LYS B NZ    1 
ATOM   4629 N  N     . GLU B 1 119 ? -35.184 -34.171 -8.039  1.00 130.19 ? 119 GLU B N     1 
ATOM   4630 C  CA    . GLU B 1 119 ? -34.416 -33.098 -8.698  1.00 130.53 ? 119 GLU B CA    1 
ATOM   4631 C  C     . GLU B 1 119 ? -34.832 -31.687 -8.246  1.00 124.26 ? 119 GLU B C     1 
ATOM   4632 O  O     . GLU B 1 119 ? -36.024 -31.369 -8.189  1.00 120.76 ? 119 GLU B O     1 
ATOM   4633 C  CB    . GLU B 1 119 ? -34.475 -33.212 -10.232 1.00 135.55 ? 119 GLU B CB    1 
ATOM   4634 C  CG    . GLU B 1 119 ? -33.698 -34.385 -10.821 1.00 142.88 ? 119 GLU B CG    1 
ATOM   4635 C  CD    . GLU B 1 119 ? -32.229 -34.071 -11.064 1.00 146.43 ? 119 GLU B CD    1 
ATOM   4636 O  OE1   . GLU B 1 119 ? -31.763 -32.986 -10.650 1.00 142.82 ? 119 GLU B OE1   1 
ATOM   4637 O  OE2   . GLU B 1 119 ? -31.538 -34.915 -11.676 1.00 152.99 ? 119 GLU B OE2   1 
ATOM   4638 N  N     . PRO B 1 120 ? -33.845 -30.836 -7.917  1.00 123.13 ? 120 PRO B N     1 
ATOM   4639 C  CA    . PRO B 1 120 ? -34.154 -29.456 -7.546  1.00 117.85 ? 120 PRO B CA    1 
ATOM   4640 C  C     . PRO B 1 120 ? -34.282 -28.513 -8.752  1.00 118.83 ? 120 PRO B C     1 
ATOM   4641 O  O     . PRO B 1 120 ? -35.211 -27.702 -8.790  1.00 115.19 ? 120 PRO B O     1 
ATOM   4642 C  CB    . PRO B 1 120 ? -32.969 -29.052 -6.656  1.00 116.98 ? 120 PRO B CB    1 
ATOM   4643 C  CG    . PRO B 1 120 ? -31.922 -30.149 -6.813  1.00 122.72 ? 120 PRO B CG    1 
ATOM   4644 C  CD    . PRO B 1 120 ? -32.399 -31.109 -7.856  1.00 127.08 ? 120 PRO B CD    1 
ATOM   4645 N  N     . LYS B 1 121 ? -33.364 -28.625 -9.718  1.00 124.08 ? 121 LYS B N     1 
ATOM   4646 C  CA    . LYS B 1 121 ? -33.359 -27.778 -10.920 1.00 126.11 ? 121 LYS B CA    1 
ATOM   4647 C  C     . LYS B 1 121 ? -34.682 -27.901 -11.685 1.00 126.22 ? 121 LYS B C     1 
ATOM   4648 O  O     . LYS B 1 121 ? -35.187 -29.010 -11.890 1.00 128.43 ? 121 LYS B O     1 
ATOM   4649 C  CB    . LYS B 1 121 ? -32.158 -28.118 -11.815 1.00 132.86 ? 121 LYS B CB    1 
ATOM   4650 C  CG    . LYS B 1 121 ? -31.780 -27.048 -12.849 1.00 135.09 ? 121 LYS B CG    1 
ATOM   4651 C  CD    . LYS B 1 121 ? -32.237 -27.434 -14.256 1.00 140.07 ? 121 LYS B CD    1 
ATOM   4652 C  CE    . LYS B 1 121 ? -31.546 -26.607 -15.334 1.00 143.91 ? 121 LYS B CE    1 
ATOM   4653 N  NZ    . LYS B 1 121 ? -32.072 -25.218 -15.407 1.00 139.64 ? 121 LYS B NZ    1 
ATOM   4654 N  N     . ASN B 1 122 ? -35.219 -26.750 -12.098 1.00 124.10 ? 122 ASN B N     1 
ATOM   4655 C  CA    . ASN B 1 122 ? -36.584 -26.613 -12.639 1.00 123.07 ? 122 ASN B CA    1 
ATOM   4656 C  C     . ASN B 1 122 ? -37.663 -26.651 -11.558 1.00 117.14 ? 122 ASN B C     1 
ATOM   4657 O  O     . ASN B 1 122 ? -38.394 -27.634 -11.403 1.00 117.23 ? 122 ASN B O     1 
ATOM   4658 C  CB    . ASN B 1 122 ? -36.879 -27.603 -13.775 1.00 128.96 ? 122 ASN B CB    1 
ATOM   4659 C  CG    . ASN B 1 122 ? -36.526 -27.044 -15.140 1.00 134.17 ? 122 ASN B CG    1 
ATOM   4660 O  OD1   . ASN B 1 122 ? -35.411 -26.568 -15.367 1.00 136.54 ? 122 ASN B OD1   1 
ATOM   4661 N  ND2   . ASN B 1 122 ? -37.481 -27.100 -16.061 1.00 136.54 ? 122 ASN B ND2   1 
ATOM   4662 N  N     . ILE B 1 123 ? -37.732 -25.548 -10.820 1.00 112.30 ? 123 ILE B N     1 
ATOM   4663 C  CA    . ILE B 1 123 ? -38.687 -25.335 -9.739  1.00 106.75 ? 123 ILE B CA    1 
ATOM   4664 C  C     . ILE B 1 123 ? -40.115 -25.213 -10.292 1.00 106.30 ? 123 ILE B C     1 
ATOM   4665 O  O     . ILE B 1 123 ? -40.300 -24.900 -11.469 1.00 109.43 ? 123 ILE B O     1 
ATOM   4666 C  CB    . ILE B 1 123 ? -38.278 -24.062 -8.928  1.00 102.80 ? 123 ILE B CB    1 
ATOM   4667 C  CG1   . ILE B 1 123 ? -38.879 -24.072 -7.519  1.00 97.89  ? 123 ILE B CG1   1 
ATOM   4668 C  CG2   . ILE B 1 123 ? -38.588 -22.761 -9.709  1.00 102.94 ? 123 ILE B CG2   1 
ATOM   4669 C  CD1   . ILE B 1 123 ? -38.183 -23.133 -6.545  1.00 94.68  ? 123 ILE B CD1   1 
ATOM   4670 N  N     . LYS B 1 124 ? -41.115 -25.485 -9.452  1.00 102.92 ? 124 LYS B N     1 
ATOM   4671 C  CA    . LYS B 1 124 ? -42.519 -25.233 -9.809  1.00 102.07 ? 124 LYS B CA    1 
ATOM   4672 C  C     . LYS B 1 124 ? -43.025 -23.937 -9.158  1.00 97.76  ? 124 LYS B C     1 
ATOM   4673 O  O     . LYS B 1 124 ? -43.302 -22.957 -9.855  1.00 98.37  ? 124 LYS B O     1 
ATOM   4674 C  CB    . LYS B 1 124 ? -43.421 -26.424 -9.460  1.00 102.02 ? 124 LYS B CB    1 
ATOM   4675 C  CG    . LYS B 1 124 ? -44.870 -26.258 -9.914  1.00 101.89 ? 124 LYS B CG    1 
ATOM   4676 C  CD    . LYS B 1 124 ? -45.574 -27.600 -10.041 1.00 104.42 ? 124 LYS B CD    1 
ATOM   4677 C  CE    . LYS B 1 124 ? -47.080 -27.445 -10.246 1.00 104.11 ? 124 LYS B CE    1 
ATOM   4678 N  NZ    . LYS B 1 124 ? -47.474 -26.900 -11.575 1.00 107.39 ? 124 LYS B NZ    1 
ATOM   4679 N  N     . SER B 1 125 ? -43.142 -23.938 -7.831  1.00 93.86  ? 125 SER B N     1 
ATOM   4680 C  CA    . SER B 1 125 ? -43.449 -22.714 -7.090  1.00 89.99  ? 125 SER B CA    1 
ATOM   4681 C  C     . SER B 1 125 ? -42.152 -21.959 -6.751  1.00 89.05  ? 125 SER B C     1 
ATOM   4682 O  O     . SER B 1 125 ? -41.311 -21.750 -7.633  1.00 91.89  ? 125 SER B O     1 
ATOM   4683 C  CB    . SER B 1 125 ? -44.303 -23.006 -5.845  1.00 86.87  ? 125 SER B CB    1 
ATOM   4684 O  OG    . SER B 1 125 ? -43.579 -23.734 -4.868  1.00 86.25  ? 125 SER B OG    1 
ATOM   4685 N  N     . ALA B 1 126 ? -41.986 -21.570 -5.487  1.00 85.36  ? 126 ALA B N     1 
ATOM   4686 C  CA    . ALA B 1 126 ? -40.883 -20.695 -5.076  1.00 84.03  ? 126 ALA B CA    1 
ATOM   4687 C  C     . ALA B 1 126 ? -40.039 -21.270 -3.937  1.00 82.59  ? 126 ALA B C     1 
ATOM   4688 O  O     . ALA B 1 126 ? -38.819 -21.119 -3.917  1.00 83.59  ? 126 ALA B O     1 
ATOM   4689 C  CB    . ALA B 1 126 ? -41.424 -19.313 -4.695  1.00 81.42  ? 126 ALA B CB    1 
ATOM   4690 N  N     . VAL B 1 127 ? -40.703 -21.931 -2.998  1.00 80.56  ? 127 VAL B N     1 
ATOM   4691 C  CA    . VAL B 1 127 ? -40.057 -22.419 -1.783  1.00 79.28  ? 127 VAL B CA    1 
ATOM   4692 C  C     . VAL B 1 127 ? -39.642 -23.893 -1.896  1.00 81.70  ? 127 VAL B C     1 
ATOM   4693 O  O     . VAL B 1 127 ? -39.064 -24.452 -0.958  1.00 81.71  ? 127 VAL B O     1 
ATOM   4694 C  CB    . VAL B 1 127 ? -40.962 -22.194 -0.528  1.00 76.42  ? 127 VAL B CB    1 
ATOM   4695 C  CG1   . VAL B 1 127 ? -41.207 -20.699 -0.287  1.00 74.05  ? 127 VAL B CG1   1 
ATOM   4696 C  CG2   . VAL B 1 127 ? -42.291 -22.934 -0.667  1.00 76.43  ? 127 VAL B CG2   1 
ATOM   4697 N  N     . ASP B 1 128 ? -39.926 -24.503 -3.052  1.00 83.96  ? 128 ASP B N     1 
ATOM   4698 C  CA    . ASP B 1 128 ? -39.633 -25.924 -3.326  1.00 86.72  ? 128 ASP B CA    1 
ATOM   4699 C  C     . ASP B 1 128 ? -38.180 -26.322 -3.044  1.00 88.60  ? 128 ASP B C     1 
ATOM   4700 O  O     . ASP B 1 128 ? -37.870 -27.498 -2.846  1.00 90.93  ? 128 ASP B O     1 
ATOM   4701 C  CB    . ASP B 1 128 ? -39.972 -26.271 -4.784  1.00 89.81  ? 128 ASP B CB    1 
ATOM   4702 C  CG    . ASP B 1 128 ? -41.403 -25.925 -5.162  1.00 87.96  ? 128 ASP B CG    1 
ATOM   4703 O  OD1   . ASP B 1 128 ? -42.286 -25.936 -4.280  1.00 85.37  ? 128 ASP B OD1   1 
ATOM   4704 O  OD2   . ASP B 1 128 ? -41.650 -25.649 -6.352  1.00 89.21  ? 128 ASP B OD2   1 
ATOM   4705 N  N     . ARG B 1 129 ? -37.301 -25.325 -3.034  1.00 87.71  ? 129 ARG B N     1 
ATOM   4706 C  CA    . ARG B 1 129 ? -35.876 -25.517 -2.819  1.00 89.67  ? 129 ARG B CA    1 
ATOM   4707 C  C     . ARG B 1 129 ? -35.570 -25.775 -1.343  1.00 87.78  ? 129 ARG B C     1 
ATOM   4708 O  O     . ARG B 1 129 ? -34.537 -26.351 -1.006  1.00 90.01  ? 129 ARG B O     1 
ATOM   4709 C  CB    . ARG B 1 129 ? -35.133 -24.268 -3.305  1.00 89.62  ? 129 ARG B CB    1 
ATOM   4710 C  CG    . ARG B 1 129 ? -33.684 -24.484 -3.702  1.00 93.53  ? 129 ARG B CG    1 
ATOM   4711 C  CD    . ARG B 1 129 ? -32.972 -23.159 -3.997  1.00 93.34  ? 129 ARG B CD    1 
ATOM   4712 N  NE    . ARG B 1 129 ? -33.357 -22.569 -5.281  1.00 95.13  ? 129 ARG B NE    1 
ATOM   4713 C  CZ    . ARG B 1 129 ? -33.921 -21.372 -5.432  1.00 92.65  ? 129 ARG B CZ    1 
ATOM   4714 N  NH1   . ARG B 1 129 ? -34.169 -20.603 -4.379  1.00 89.06  ? 129 ARG B NH1   1 
ATOM   4715 N  NH2   . ARG B 1 129 ? -34.229 -20.937 -6.647  1.00 94.46  ? 129 ARG B NH2   1 
ATOM   4716 N  N     . THR B 1 130 ? -36.485 -25.359 -0.474  1.00 84.09  ? 130 THR B N     1 
ATOM   4717 C  CA    . THR B 1 130 ? -36.246 -25.316 0.971   1.00 82.47  ? 130 THR B CA    1 
ATOM   4718 C  C     . THR B 1 130 ? -36.109 -26.666 1.683   1.00 84.53  ? 130 THR B C     1 
ATOM   4719 O  O     . THR B 1 130 ? -35.240 -26.805 2.551   1.00 85.28  ? 130 THR B O     1 
ATOM   4720 C  CB    . THR B 1 130 ? -37.290 -24.422 1.670   1.00 78.62  ? 130 THR B CB    1 
ATOM   4721 O  OG1   . THR B 1 130 ? -37.206 -23.101 1.121   1.00 77.54  ? 130 THR B OG1   1 
ATOM   4722 C  CG2   . THR B 1 130 ? -37.052 -24.360 3.174   1.00 77.46  ? 130 THR B CG2   1 
ATOM   4723 N  N     . PRO B 1 131 ? -36.965 -27.659 1.341   1.00 85.74  ? 131 PRO B N     1 
ATOM   4724 C  CA    . PRO B 1 131 ? -36.760 -28.995 1.905   1.00 88.38  ? 131 PRO B CA    1 
ATOM   4725 C  C     . PRO B 1 131 ? -35.412 -29.548 1.469   1.00 92.22  ? 131 PRO B C     1 
ATOM   4726 O  O     . PRO B 1 131 ? -34.660 -30.061 2.299   1.00 93.97  ? 131 PRO B O     1 
ATOM   4727 C  CB    . PRO B 1 131 ? -37.893 -29.821 1.286   1.00 89.39  ? 131 PRO B CB    1 
ATOM   4728 C  CG    . PRO B 1 131 ? -38.916 -28.833 0.883   1.00 86.10  ? 131 PRO B CG    1 
ATOM   4729 C  CD    . PRO B 1 131 ? -38.145 -27.628 0.456   1.00 85.12  ? 131 PRO B CD    1 
ATOM   4730 N  N     . PHE B 1 132 ? -35.118 -29.424 0.176   1.00 93.89  ? 132 PHE B N     1 
ATOM   4731 C  CA    . PHE B 1 132 ? -33.809 -29.764 -0.361  1.00 98.05  ? 132 PHE B CA    1 
ATOM   4732 C  C     . PHE B 1 132 ? -32.717 -29.101 0.483   1.00 97.51  ? 132 PHE B C     1 
ATOM   4733 O  O     . PHE B 1 132 ? -31.807 -29.781 0.957   1.00 100.60 ? 132 PHE B O     1 
ATOM   4734 C  CB    . PHE B 1 132 ? -33.696 -29.334 -1.828  1.00 99.45  ? 132 PHE B CB    1 
ATOM   4735 C  CG    . PHE B 1 132 ? -34.356 -30.274 -2.806  1.00 102.11 ? 132 PHE B CG    1 
ATOM   4736 C  CD1   . PHE B 1 132 ? -35.740 -30.286 -2.964  1.00 99.41  ? 132 PHE B CD1   1 
ATOM   4737 C  CD2   . PHE B 1 132 ? -33.586 -31.126 -3.594  1.00 107.34 ? 132 PHE B CD2   1 
ATOM   4738 C  CE1   . PHE B 1 132 ? -36.348 -31.148 -3.875  1.00 102.41 ? 132 PHE B CE1   1 
ATOM   4739 C  CE2   . PHE B 1 132 ? -34.184 -31.990 -4.508  1.00 110.37 ? 132 PHE B CE2   1 
ATOM   4740 C  CZ    . PHE B 1 132 ? -35.568 -32.002 -4.647  1.00 108.11 ? 132 PHE B CZ    1 
ATOM   4741 N  N     . HIS B 1 133 ? -32.833 -27.784 0.688   1.00 94.05  ? 133 HIS B N     1 
ATOM   4742 C  CA    . HIS B 1 133 ? -31.897 -27.020 1.524   1.00 93.34  ? 133 HIS B CA    1 
ATOM   4743 C  C     . HIS B 1 133 ? -31.586 -27.752 2.821   1.00 94.38  ? 133 HIS B C     1 
ATOM   4744 O  O     . HIS B 1 133 ? -30.425 -27.944 3.175   1.00 97.06  ? 133 HIS B O     1 
ATOM   4745 C  CB    . HIS B 1 133 ? -32.459 -25.632 1.877   1.00 88.88  ? 133 HIS B CB    1 
ATOM   4746 C  CG    . HIS B 1 133 ? -32.305 -24.605 0.796   1.00 88.68  ? 133 HIS B CG    1 
ATOM   4747 N  ND1   . HIS B 1 133 ? -33.201 -23.572 0.623   1.00 85.08  ? 133 HIS B ND1   1 
ATOM   4748 C  CD2   . HIS B 1 133 ? -31.364 -24.450 -0.166  1.00 91.92  ? 133 HIS B CD2   1 
ATOM   4749 C  CE1   . HIS B 1 133 ? -32.820 -22.826 -0.398  1.00 85.90  ? 133 HIS B CE1   1 
ATOM   4750 N  NE2   . HIS B 1 133 ? -31.707 -23.336 -0.893  1.00 90.28  ? 133 HIS B NE2   1 
ATOM   4751 N  N     . HIS B 1 134 ? -32.644 -28.159 3.515   1.00 92.84  ? 134 HIS B N     1 
ATOM   4752 C  CA    . HIS B 1 134 ? -32.543 -28.771 4.829   1.00 93.97  ? 134 HIS B CA    1 
ATOM   4753 C  C     . HIS B 1 134 ? -31.841 -30.128 4.792   1.00 99.17  ? 134 HIS B C     1 
ATOM   4754 O  O     . HIS B 1 134 ? -31.059 -30.458 5.689   1.00 101.21 ? 134 HIS B O     1 
ATOM   4755 C  CB    . HIS B 1 134 ? -33.940 -28.897 5.438   1.00 91.49  ? 134 HIS B CB    1 
ATOM   4756 C  CG    . HIS B 1 134 ? -33.977 -29.670 6.717   1.00 93.48  ? 134 HIS B CG    1 
ATOM   4757 N  ND1   . HIS B 1 134 ? -33.342 -29.243 7.863   1.00 93.79  ? 134 HIS B ND1   1 
ATOM   4758 C  CD2   . HIS B 1 134 ? -34.576 -30.843 7.033   1.00 96.05  ? 134 HIS B CD2   1 
ATOM   4759 C  CE1   . HIS B 1 134 ? -33.545 -30.121 8.829   1.00 96.03  ? 134 HIS B CE1   1 
ATOM   4760 N  NE2   . HIS B 1 134 ? -34.293 -31.101 8.352   1.00 97.52  ? 134 HIS B NE2   1 
ATOM   4761 N  N     . LYS B 1 135 ? -32.117 -30.904 3.747   1.00 101.75 ? 135 LYS B N     1 
ATOM   4762 C  CA    . LYS B 1 135 ? -31.539 -32.240 3.600   1.00 107.35 ? 135 LYS B CA    1 
ATOM   4763 C  C     . LYS B 1 135 ? -30.080 -32.183 3.142   1.00 110.98 ? 135 LYS B C     1 
ATOM   4764 O  O     . LYS B 1 135 ? -29.382 -33.200 3.128   1.00 116.04 ? 135 LYS B O     1 
ATOM   4765 C  CB    . LYS B 1 135 ? -32.393 -33.106 2.663   1.00 109.08 ? 135 LYS B CB    1 
ATOM   4766 C  CG    . LYS B 1 135 ? -33.683 -33.642 3.301   1.00 107.86 ? 135 LYS B CG    1 
ATOM   4767 C  CD    . LYS B 1 135 ? -33.515 -35.070 3.833   1.00 112.94 ? 135 LYS B CD    1 
ATOM   4768 C  CE    . LYS B 1 135 ? -34.489 -35.388 4.974   1.00 111.77 ? 135 LYS B CE    1 
ATOM   4769 N  NZ    . LYS B 1 135 ? -35.899 -34.964 4.713   1.00 108.08 ? 135 LYS B NZ    1 
ATOM   4770 N  N     . TRP B 1 136 ? -29.627 -30.991 2.770   1.00 108.93 ? 136 TRP B N     1 
ATOM   4771 C  CA    . TRP B 1 136 ? -28.210 -30.755 2.520   1.00 112.18 ? 136 TRP B CA    1 
ATOM   4772 C  C     . TRP B 1 136 ? -27.497 -30.333 3.811   1.00 111.57 ? 136 TRP B C     1 
ATOM   4773 O  O     . TRP B 1 136 ? -26.291 -30.542 3.955   1.00 115.40 ? 136 TRP B O     1 
ATOM   4774 C  CB    . TRP B 1 136 ? -28.016 -29.704 1.426   1.00 110.94 ? 136 TRP B CB    1 
ATOM   4775 C  CG    . TRP B 1 136 ? -26.625 -29.683 0.879   1.00 115.51 ? 136 TRP B CG    1 
ATOM   4776 C  CD1   . TRP B 1 136 ? -26.125 -30.473 -0.114  1.00 120.82 ? 136 TRP B CD1   1 
ATOM   4777 C  CD2   . TRP B 1 136 ? -25.547 -28.840 1.302   1.00 115.74 ? 136 TRP B CD2   1 
ATOM   4778 N  NE1   . TRP B 1 136 ? -24.806 -30.172 -0.339  1.00 124.24 ? 136 TRP B NE1   1 
ATOM   4779 C  CE2   . TRP B 1 136 ? -24.425 -29.173 0.517   1.00 121.09 ? 136 TRP B CE2   1 
ATOM   4780 C  CE3   . TRP B 1 136 ? -25.421 -27.834 2.269   1.00 112.22 ? 136 TRP B CE3   1 
ATOM   4781 C  CZ2   . TRP B 1 136 ? -23.192 -28.535 0.667   1.00 122.87 ? 136 TRP B CZ2   1 
ATOM   4782 C  CZ3   . TRP B 1 136 ? -24.198 -27.202 2.419   1.00 113.71 ? 136 TRP B CZ3   1 
ATOM   4783 C  CH2   . TRP B 1 136 ? -23.099 -27.556 1.621   1.00 119.03 ? 136 TRP B CH2   1 
ATOM   4784 N  N     . LEU B 1 137 ? -28.261 -29.765 4.747   1.00 107.22 ? 137 LEU B N     1 
ATOM   4785 C  CA    . LEU B 1 137 ? -27.735 -29.241 6.016   1.00 106.27 ? 137 LEU B CA    1 
ATOM   4786 C  C     . LEU B 1 137 ? -27.854 -30.184 7.225   1.00 108.10 ? 137 LEU B C     1 
ATOM   4787 O  O     . LEU B 1 137 ? -27.122 -30.019 8.207   1.00 109.21 ? 137 LEU B O     1 
ATOM   4788 C  CB    . LEU B 1 137 ? -28.400 -27.898 6.349   1.00 100.79 ? 137 LEU B CB    1 
ATOM   4789 C  CG    . LEU B 1 137 ? -27.777 -26.582 5.867   1.00 99.64  ? 137 LEU B CG    1 
ATOM   4790 C  CD1   . LEU B 1 137 ? -27.653 -26.506 4.354   1.00 101.02 ? 137 LEU B CD1   1 
ATOM   4791 C  CD2   . LEU B 1 137 ? -28.590 -25.399 6.377   1.00 94.78  ? 137 LEU B CD2   1 
ATOM   4792 N  N     . GLU B 1 138 ? -28.769 -31.155 7.158   1.00 108.57 ? 138 GLU B N     1 
ATOM   4793 C  CA    . GLU B 1 138 ? -29.007 -32.097 8.267   1.00 110.82 ? 138 GLU B CA    1 
ATOM   4794 C  C     . GLU B 1 138 ? -27.734 -32.720 8.842   1.00 115.87 ? 138 GLU B C     1 
ATOM   4795 O  O     . GLU B 1 138 ? -27.578 -32.803 10.060  1.00 116.83 ? 138 GLU B O     1 
ATOM   4796 C  CB    . GLU B 1 138 ? -29.973 -33.221 7.858   1.00 112.28 ? 138 GLU B CB    1 
ATOM   4797 C  CG    . GLU B 1 138 ? -31.442 -32.949 8.185   1.00 108.51 ? 138 GLU B CG    1 
ATOM   4798 C  CD    . GLU B 1 138 ? -32.242 -34.210 8.511   1.00 111.22 ? 138 GLU B CD    1 
ATOM   4799 O  OE1   . GLU B 1 138 ? -33.446 -34.080 8.826   1.00 108.14 ? 138 GLU B OE1   1 
ATOM   4800 O  OE2   . GLU B 1 138 ? -31.677 -35.326 8.463   1.00 116.61 ? 138 GLU B OE2   1 
ATOM   4801 N  N     . GLY B 1 139 ? -26.835 -33.152 7.959   1.00 119.39 ? 139 GLY B N     1 
ATOM   4802 C  CA    . GLY B 1 139 ? -25.622 -33.843 8.366   1.00 124.78 ? 139 GLY B CA    1 
ATOM   4803 C  C     . GLY B 1 139 ? -24.340 -33.045 8.225   1.00 125.49 ? 139 GLY B C     1 
ATOM   4804 O  O     . GLY B 1 139 ? -23.260 -33.543 8.561   1.00 130.71 ? 139 GLY B O     1 
ATOM   4805 N  N     . ARG B 1 140 ? -24.444 -31.813 7.732   1.00 120.72 ? 140 ARG B N     1 
ATOM   4806 C  CA    . ARG B 1 140 ? -23.258 -30.971 7.555   1.00 121.25 ? 140 ARG B CA    1 
ATOM   4807 C  C     . ARG B 1 140 ? -23.084 -29.936 8.666   1.00 118.31 ? 140 ARG B C     1 
ATOM   4808 O  O     . ARG B 1 140 ? -21.957 -29.608 9.036   1.00 120.72 ? 140 ARG B O     1 
ATOM   4809 C  CB    . ARG B 1 140 ? -23.255 -30.297 6.178   1.00 119.52 ? 140 ARG B CB    1 
ATOM   4810 C  CG    . ARG B 1 140 ? -23.040 -31.258 5.018   1.00 123.39 ? 140 ARG B CG    1 
ATOM   4811 C  CD    . ARG B 1 140 ? -22.958 -30.516 3.699   1.00 121.76 ? 140 ARG B CD    1 
ATOM   4812 N  NE    . ARG B 1 140 ? -23.250 -31.380 2.554   1.00 124.41 ? 140 ARG B NE    1 
ATOM   4813 C  CZ    . ARG B 1 140 ? -22.344 -31.839 1.692   1.00 129.77 ? 140 ARG B CZ    1 
ATOM   4814 N  NH1   . ARG B 1 140 ? -21.059 -31.526 1.823   1.00 133.13 ? 140 ARG B NH1   1 
ATOM   4815 N  NH2   . ARG B 1 140 ? -22.728 -32.613 0.686   1.00 132.14 ? 140 ARG B NH2   1 
ATOM   4816 N  N     . ILE B 1 141 ? -24.198 -29.433 9.198   1.00 113.53 ? 141 ILE B N     1 
ATOM   4817 C  CA    . ILE B 1 141 ? -24.164 -28.418 10.257  1.00 110.85 ? 141 ILE B CA    1 
ATOM   4818 C  C     . ILE B 1 141 ? -24.119 -29.047 11.653  1.00 113.16 ? 141 ILE B C     1 
ATOM   4819 O  O     . ILE B 1 141 ? -23.972 -28.344 12.659  1.00 112.04 ? 141 ILE B O     1 
ATOM   4820 C  CB    . ILE B 1 141 ? -25.345 -27.396 10.124  1.00 104.94 ? 141 ILE B CB    1 
ATOM   4821 C  CG1   . ILE B 1 141 ? -24.978 -26.039 10.739  1.00 102.72 ? 141 ILE B CG1   1 
ATOM   4822 C  CG2   . ILE B 1 141 ? -26.650 -27.955 10.720  1.00 103.55 ? 141 ILE B CG2   1 
ATOM   4823 C  CD1   . ILE B 1 141 ? -23.873 -25.288 10.007  1.00 104.26 ? 141 ILE B CD1   1 
ATOM   4824 N  N     . LYS B 1 142 ? -24.234 -30.375 11.688  1.00 116.79 ? 142 LYS B N     1 
ATOM   4825 C  CA    . LYS B 1 142 ? -24.211 -31.164 12.919  1.00 120.00 ? 142 LYS B CA    1 
ATOM   4826 C  C     . LYS B 1 142 ? -22.922 -30.896 13.695  1.00 123.39 ? 142 LYS B C     1 
ATOM   4827 O  O     . LYS B 1 142 ? -21.822 -30.862 13.104  1.00 126.07 ? 142 LYS B O     1 
ATOM   4828 C  CB    . LYS B 1 142 ? -24.296 -32.654 12.570  1.00 124.46 ? 142 LYS B CB    1 
ATOM   4829 C  CG    . LYS B 1 142 ? -25.247 -33.479 13.435  1.00 125.39 ? 142 LYS B CG    1 
ATOM   4830 C  CD    . LYS B 1 142 ? -26.680 -33.373 12.927  1.00 120.49 ? 142 LYS B CD    1 
ATOM   4831 C  CE    . LYS B 1 142 ? -27.415 -34.698 13.013  1.00 123.16 ? 142 LYS B CE    1 
ATOM   4832 N  NZ    . LYS B 1 142 ? -27.840 -35.008 14.399  1.00 124.95 ? 142 LYS B NZ    1 
ATOM   4833 N  N     . GLY B 1 143 ? -23.066 -30.692 15.011  1.00 123.55 ? 143 GLY B N     1 
ATOM   4834 C  CA    . GLY B 1 143 ? -21.913 -30.441 15.873  1.00 127.11 ? 143 GLY B CA    1 
ATOM   4835 C  C     . GLY B 1 143 ? -21.984 -29.101 16.574  1.00 123.55 ? 143 GLY B C     1 
ATOM   4836 O  O     . GLY B 1 143 ? -22.971 -28.795 17.242  1.00 120.82 ? 143 GLY B O     1 
ATOM   4837 N  N     . LYS B 1 144 ? -20.929 -28.305 16.421  1.00 149.83 ? 144 LYS B N     1 
ATOM   4838 C  CA    . LYS B 1 144 ? -20.875 -26.963 16.993  1.00 145.12 ? 144 LYS B CA    1 
ATOM   4839 C  C     . LYS B 1 144 ? -21.669 -25.991 16.114  1.00 136.50 ? 144 LYS B C     1 
ATOM   4840 O  O     . LYS B 1 144 ? -21.126 -25.003 15.610  1.00 132.74 ? 144 LYS B O     1 
ATOM   4841 C  CB    . LYS B 1 144 ? -19.412 -26.510 17.170  1.00 148.04 ? 144 LYS B CB    1 
ATOM   4842 C  CG    . LYS B 1 144 ? -19.210 -25.265 18.048  1.00 145.54 ? 144 LYS B CG    1 
ATOM   4843 C  CD    . LYS B 1 144 ? -17.734 -24.872 18.173  1.00 148.84 ? 144 LYS B CD    1 
ATOM   4844 C  CE    . LYS B 1 144 ? -17.138 -25.298 19.504  1.00 156.29 ? 144 LYS B CE    1 
ATOM   4845 N  NZ    . LYS B 1 144 ? -17.058 -26.779 19.648  1.00 163.27 ? 144 LYS B NZ    1 
ATOM   4846 N  N     . GLU B 1 145 ? -22.960 -26.272 15.933  1.00 133.93 ? 145 GLU B N     1 
ATOM   4847 C  CA    . GLU B 1 145 ? -23.835 -25.378 15.168  1.00 126.30 ? 145 GLU B CA    1 
ATOM   4848 C  C     . GLU B 1 145 ? -24.139 -24.083 15.931  1.00 122.12 ? 145 GLU B C     1 
ATOM   4849 O  O     . GLU B 1 145 ? -24.984 -23.289 15.520  1.00 116.33 ? 145 GLU B O     1 
ATOM   4850 C  CB    . GLU B 1 145 ? -25.124 -26.082 14.715  1.00 125.52 ? 145 GLU B CB    1 
ATOM   4851 C  CG    . GLU B 1 145 ? -25.984 -26.672 15.824  1.00 129.14 ? 145 GLU B CG    1 
ATOM   4852 C  CD    . GLU B 1 145 ? -25.867 -28.186 15.927  1.00 137.00 ? 145 GLU B CD    1 
ATOM   4853 O  OE1   . GLU B 1 145 ? -26.648 -28.796 16.691  1.00 140.19 ? 145 GLU B OE1   1 
ATOM   4854 O  OE2   . GLU B 1 145 ? -25.002 -28.771 15.243  1.00 140.29 ? 145 GLU B OE2   1 
ATOM   4855 N  N     . ASN B 1 146 ? -23.435 -23.881 17.042  1.00 125.79 ? 146 ASN B N     1 
ATOM   4856 C  CA    . ASN B 1 146 ? -23.493 -22.633 17.795  1.00 123.08 ? 146 ASN B CA    1 
ATOM   4857 C  C     . ASN B 1 146 ? -22.609 -21.561 17.160  1.00 119.55 ? 146 ASN B C     1 
ATOM   4858 O  O     . ASN B 1 146 ? -22.710 -20.373 17.493  1.00 116.02 ? 146 ASN B O     1 
ATOM   4859 C  CB    . ASN B 1 146 ? -23.086 -22.871 19.249  1.00 129.33 ? 146 ASN B CB    1 
ATOM   4860 C  CG    . ASN B 1 146 ? -24.048 -23.784 19.976  1.00 132.99 ? 146 ASN B CG    1 
ATOM   4861 O  OD1   . ASN B 1 146 ? -23.746 -24.950 20.220  1.00 138.78 ? 146 ASN B OD1   1 
ATOM   4862 N  ND2   . ASN B 1 146 ? -25.221 -23.263 20.310  1.00 129.86 ? 146 ASN B ND2   1 
ATOM   4863 N  N     . GLU B 1 147 ? -21.740 -21.996 16.247  1.00 120.94 ? 147 GLU B N     1 
ATOM   4864 C  CA    . GLU B 1 147 ? -20.954 -21.083 15.423  1.00 117.78 ? 147 GLU B CA    1 
ATOM   4865 C  C     . GLU B 1 147 ? -21.876 -20.342 14.458  1.00 110.62 ? 147 GLU B C     1 
ATOM   4866 O  O     . GLU B 1 147 ? -21.503 -19.304 13.909  1.00 107.31 ? 147 GLU B O     1 
ATOM   4867 C  CB    . GLU B 1 147 ? -19.855 -21.834 14.658  1.00 121.96 ? 147 GLU B CB    1 
ATOM   4868 C  CG    . GLU B 1 147 ? -18.748 -22.448 15.535  1.00 129.54 ? 147 GLU B CG    1 
ATOM   4869 C  CD    . GLU B 1 147 ? -17.863 -21.412 16.222  1.00 130.39 ? 147 GLU B CD    1 
ATOM   4870 O  OE1   . GLU B 1 147 ? -17.534 -20.379 15.599  1.00 126.57 ? 147 GLU B OE1   1 
ATOM   4871 O  OE2   . GLU B 1 147 ? -17.489 -21.636 17.390  1.00 135.44 ? 147 GLU B OE2   1 
ATOM   4872 N  N     . VAL B 1 148 ? -23.078 -20.881 14.262  1.00 109.02 ? 148 VAL B N     1 
ATOM   4873 C  CA    . VAL B 1 148 ? -24.135 -20.200 13.517  1.00 102.80 ? 148 VAL B CA    1 
ATOM   4874 C  C     . VAL B 1 148 ? -24.849 -19.191 14.421  1.00 99.96  ? 148 VAL B C     1 
ATOM   4875 O  O     . VAL B 1 148 ? -24.986 -18.018 14.062  1.00 95.43  ? 148 VAL B O     1 
ATOM   4876 C  CB    . VAL B 1 148 ? -25.153 -21.199 12.913  1.00 103.08 ? 148 VAL B CB    1 
ATOM   4877 C  CG1   . VAL B 1 148 ? -26.351 -20.472 12.333  1.00 97.58  ? 148 VAL B CG1   1 
ATOM   4878 C  CG2   . VAL B 1 148 ? -24.497 -22.053 11.845  1.00 105.79 ? 148 VAL B CG2   1 
ATOM   4879 N  N     . ARG B 1 149 ? -25.281 -19.648 15.597  1.00 103.10 ? 149 ARG B N     1 
ATOM   4880 C  CA    . ARG B 1 149 ? -26.040 -18.812 16.538  1.00 101.60 ? 149 ARG B CA    1 
ATOM   4881 C  C     . ARG B 1 149 ? -25.262 -17.587 17.028  1.00 100.68 ? 149 ARG B C     1 
ATOM   4882 O  O     . ARG B 1 149 ? -25.860 -16.599 17.452  1.00 98.26  ? 149 ARG B O     1 
ATOM   4883 C  CB    . ARG B 1 149 ? -26.530 -19.633 17.734  1.00 106.62 ? 149 ARG B CB    1 
ATOM   4884 C  CG    . ARG B 1 149 ? -27.082 -20.994 17.369  1.00 109.20 ? 149 ARG B CG    1 
ATOM   4885 C  CD    . ARG B 1 149 ? -27.540 -21.745 18.599  1.00 114.78 ? 149 ARG B CD    1 
ATOM   4886 N  NE    . ARG B 1 149 ? -28.993 -21.851 18.669  1.00 113.21 ? 149 ARG B NE    1 
ATOM   4887 C  CZ    . ARG B 1 149 ? -29.645 -22.612 19.540  1.00 117.53 ? 149 ARG B CZ    1 
ATOM   4888 N  NH1   . ARG B 1 149 ? -28.979 -23.330 20.433  1.00 123.92 ? 149 ARG B NH1   1 
ATOM   4889 N  NH2   . ARG B 1 149 ? -30.968 -22.652 19.522  1.00 116.47 ? 149 ARG B NH2   1 
ATOM   4890 N  N     . LEU B 1 150 ? -23.935 -17.661 16.980  1.00 103.22 ? 150 LEU B N     1 
ATOM   4891 C  CA    . LEU B 1 150 ? -23.095 -16.496 17.232  1.00 102.44 ? 150 LEU B CA    1 
ATOM   4892 C  C     . LEU B 1 150 ? -23.135 -15.569 16.026  1.00 96.57  ? 150 LEU B C     1 
ATOM   4893 O  O     . LEU B 1 150 ? -23.299 -14.360 16.176  1.00 93.69  ? 150 LEU B O     1 
ATOM   4894 C  CB    . LEU B 1 150 ? -21.653 -16.907 17.537  1.00 107.80 ? 150 LEU B CB    1 
ATOM   4895 C  CG    . LEU B 1 150 ? -21.371 -17.531 18.907  1.00 114.84 ? 150 LEU B CG    1 
ATOM   4896 C  CD1   . LEU B 1 150 ? -20.063 -18.319 18.885  1.00 120.75 ? 150 LEU B CD1   1 
ATOM   4897 C  CD2   . LEU B 1 150 ? -21.358 -16.475 20.011  1.00 115.86 ? 150 LEU B CD2   1 
ATOM   4898 N  N     . LEU B 1 151 ? -22.996 -16.146 14.833  1.00 95.29  ? 151 LEU B N     1 
ATOM   4899 C  CA    . LEU B 1 151 ? -23.066 -15.382 13.591  1.00 90.43  ? 151 LEU B CA    1 
ATOM   4900 C  C     . LEU B 1 151 ? -24.401 -14.654 13.482  1.00 85.65  ? 151 LEU B C     1 
ATOM   4901 O  O     . LEU B 1 151 ? -24.434 -13.464 13.189  1.00 82.30  ? 151 LEU B O     1 
ATOM   4902 C  CB    . LEU B 1 151 ? -22.838 -16.295 12.381  1.00 91.08  ? 151 LEU B CB    1 
ATOM   4903 C  CG    . LEU B 1 151 ? -22.860 -15.691 10.973  1.00 87.31  ? 151 LEU B CG    1 
ATOM   4904 C  CD1   . LEU B 1 151 ? -21.918 -14.506 10.854  1.00 86.46  ? 151 LEU B CD1   1 
ATOM   4905 C  CD2   . LEU B 1 151 ? -22.496 -16.752 9.946   1.00 89.80  ? 151 LEU B CD2   1 
ATOM   4906 N  N     . LYS B 1 152 ? -25.491 -15.376 13.737  1.00 85.93  ? 152 LYS B N     1 
ATOM   4907 C  CA    . LYS B 1 152 ? -26.836 -14.798 13.762  1.00 82.44  ? 152 LYS B CA    1 
ATOM   4908 C  C     . LYS B 1 152 ? -26.923 -13.665 14.780  1.00 81.97  ? 152 LYS B C     1 
ATOM   4909 O  O     . LYS B 1 152 ? -27.324 -12.554 14.446  1.00 78.40  ? 152 LYS B O     1 
ATOM   4910 C  CB    . LYS B 1 152 ? -27.887 -15.867 14.095  1.00 84.42  ? 152 LYS B CB    1 
ATOM   4911 C  CG    . LYS B 1 152 ? -28.169 -16.878 12.990  1.00 84.28  ? 152 LYS B CG    1 
ATOM   4912 C  CD    . LYS B 1 152 ? -29.360 -17.757 13.357  1.00 86.18  ? 152 LYS B CD    1 
ATOM   4913 C  CE    . LYS B 1 152 ? -29.698 -18.753 12.250  1.00 86.61  ? 152 LYS B CE    1 
ATOM   4914 N  NZ    . LYS B 1 152 ? -30.985 -19.470 12.507  1.00 87.69  ? 152 LYS B NZ    1 
ATOM   4915 N  N     . GLY B 1 153 ? -26.539 -13.962 16.020  1.00 86.11  ? 153 GLY B N     1 
ATOM   4916 C  CA    . GLY B 1 153 ? -26.540 -12.979 17.099  1.00 87.22  ? 153 GLY B CA    1 
ATOM   4917 C  C     . GLY B 1 153 ? -25.725 -11.748 16.752  1.00 85.21  ? 153 GLY B C     1 
ATOM   4918 O  O     . GLY B 1 153 ? -26.129 -10.621 17.046  1.00 83.67  ? 153 GLY B O     1 
ATOM   4919 N  N     . PHE B 1 154 ? -24.577 -11.982 16.119  1.00 85.67  ? 154 PHE B N     1 
ATOM   4920 C  CA    . PHE B 1 154 ? -23.707 -10.933 15.617  1.00 84.02  ? 154 PHE B CA    1 
ATOM   4921 C  C     . PHE B 1 154 ? -24.489 -10.011 14.685  1.00 79.00  ? 154 PHE B C     1 
ATOM   4922 O  O     . PHE B 1 154 ? -24.594 -8.802  14.930  1.00 77.72  ? 154 PHE B O     1 
ATOM   4923 C  CB    . PHE B 1 154 ? -22.534 -11.573 14.873  1.00 85.70  ? 154 PHE B CB    1 
ATOM   4924 C  CG    . PHE B 1 154 ? -21.349 -10.670 14.689  1.00 86.29  ? 154 PHE B CG    1 
ATOM   4925 C  CD1   . PHE B 1 154 ? -20.493 -10.393 15.752  1.00 90.81  ? 154 PHE B CD1   1 
ATOM   4926 C  CD2   . PHE B 1 154 ? -21.064 -10.127 13.440  1.00 83.67  ? 154 PHE B CD2   1 
ATOM   4927 C  CE1   . PHE B 1 154 ? -19.381 -9.570  15.582  1.00 92.09  ? 154 PHE B CE1   1 
ATOM   4928 C  CE2   . PHE B 1 154 ? -19.956 -9.298  13.257  1.00 85.14  ? 154 PHE B CE2   1 
ATOM   4929 C  CZ    . PHE B 1 154 ? -19.112 -9.020  14.332  1.00 89.14  ? 154 PHE B CZ    1 
ATOM   4930 N  N     . LEU B 1 155 ? -25.062 -10.596 13.637  1.00 76.64  ? 155 LEU B N     1 
ATOM   4931 C  CA    . LEU B 1 155 ? -25.800 -9.844  12.623  1.00 72.49  ? 155 LEU B CA    1 
ATOM   4932 C  C     . LEU B 1 155 ? -27.084 -9.209  13.145  1.00 70.99  ? 155 LEU B C     1 
ATOM   4933 O  O     . LEU B 1 155 ? -27.467 -8.129  12.700  1.00 68.47  ? 155 LEU B O     1 
ATOM   4934 C  CB    . LEU B 1 155 ? -26.113 -10.738 11.427  1.00 71.52  ? 155 LEU B CB    1 
ATOM   4935 C  CG    . LEU B 1 155 ? -24.889 -11.373 10.766  1.00 73.62  ? 155 LEU B CG    1 
ATOM   4936 C  CD1   . LEU B 1 155 ? -25.267 -12.632 10.026  1.00 74.92  ? 155 LEU B CD1   1 
ATOM   4937 C  CD2   . LEU B 1 155 ? -24.226 -10.392 9.837   1.00 72.81  ? 155 LEU B CD2   1 
ATOM   4938 N  N     . LYS B 1 156 ? -27.744 -9.877  14.086  1.00 73.18  ? 156 LYS B N     1 
ATOM   4939 C  CA    . LYS B 1 156 ? -28.987 -9.363  14.648  1.00 72.74  ? 156 LYS B CA    1 
ATOM   4940 C  C     . LYS B 1 156 ? -28.737 -8.136  15.512  1.00 73.48  ? 156 LYS B C     1 
ATOM   4941 O  O     . LYS B 1 156 ? -29.468 -7.154  15.412  1.00 71.97  ? 156 LYS B O     1 
ATOM   4942 C  CB    . LYS B 1 156 ? -29.732 -10.442 15.435  1.00 75.71  ? 156 LYS B CB    1 
ATOM   4943 C  CG    . LYS B 1 156 ? -31.208 -10.138 15.662  1.00 75.39  ? 156 LYS B CG    1 
ATOM   4944 C  CD    . LYS B 1 156 ? -32.008 -11.427 15.761  1.00 78.57  ? 156 LYS B CD    1 
ATOM   4945 C  CE    . LYS B 1 156 ? -33.510 -11.171 15.851  1.00 78.76  ? 156 LYS B CE    1 
ATOM   4946 N  NZ    . LYS B 1 156 ? -34.000 -11.106 17.258  1.00 82.97  ? 156 LYS B NZ    1 
ATOM   4947 N  N     . ALA B 1 157 ? -27.699 -8.189  16.344  1.00 76.42  ? 157 ALA B N     1 
ATOM   4948 C  CA    . ALA B 1 157 ? -27.332 -7.054  17.191  1.00 77.92  ? 157 ALA B CA    1 
ATOM   4949 C  C     . ALA B 1 157 ? -27.017 -5.808  16.365  1.00 74.73  ? 157 ALA B C     1 
ATOM   4950 O  O     . ALA B 1 157 ? -27.246 -4.683  16.814  1.00 74.95  ? 157 ALA B O     1 
ATOM   4951 C  CB    . ALA B 1 157 ? -26.152 -7.409  18.070  1.00 82.23  ? 157 ALA B CB    1 
ATOM   4952 N  N     . ASN B 1 158 ? -26.505 -6.024  15.155  1.00 72.13  ? 158 ASN B N     1 
ATOM   4953 C  CA    . ASN B 1 158 ? -26.023 -4.935  14.307  1.00 69.69  ? 158 ASN B CA    1 
ATOM   4954 C  C     . ASN B 1 158 ? -27.006 -4.464  13.234  1.00 65.80  ? 158 ASN B C     1 
ATOM   4955 O  O     . ASN B 1 158 ? -26.629 -3.726  12.323  1.00 64.00  ? 158 ASN B O     1 
ATOM   4956 C  CB    . ASN B 1 158 ? -24.664 -5.295  13.691  1.00 70.35  ? 158 ASN B CB    1 
ATOM   4957 C  CG    . ASN B 1 158 ? -23.525 -5.232  14.705  1.00 74.37  ? 158 ASN B CG    1 
ATOM   4958 O  OD1   . ASN B 1 158 ? -23.317 -4.215  15.370  1.00 75.16  ? 158 ASN B OD1   1 
ATOM   4959 N  ND2   . ASN B 1 158 ? -22.777 -6.321  14.816  1.00 77.23  ? 158 ASN B ND2   1 
ATOM   4960 N  N     . GLY B 1 159 ? -28.262 -4.886  13.354  1.00 65.02  ? 159 GLY B N     1 
ATOM   4961 C  CA    . GLY B 1 159 ? -29.322 -4.431  12.453  1.00 62.12  ? 159 GLY B CA    1 
ATOM   4962 C  C     . GLY B 1 159 ? -29.266 -4.972  11.034  1.00 59.79  ? 159 GLY B C     1 
ATOM   4963 O  O     . GLY B 1 159 ? -30.002 -4.513  10.163  1.00 58.05  ? 159 GLY B O     1 
ATOM   4964 N  N     . ILE B 1 160 ? -28.405 -5.954  10.797  1.00 60.53  ? 160 ILE B N     1 
ATOM   4965 C  CA    . ILE B 1 160 ? -28.259 -6.531  9.463   1.00 59.32  ? 160 ILE B CA    1 
ATOM   4966 C  C     . ILE B 1 160 ? -28.580 -8.029  9.387   1.00 60.60  ? 160 ILE B C     1 
ATOM   4967 O  O     . ILE B 1 160 ? -28.083 -8.719  8.492   1.00 60.76  ? 160 ILE B O     1 
ATOM   4968 C  CB    . ILE B 1 160 ? -26.850 -6.250  8.846   1.00 59.61  ? 160 ILE B CB    1 
ATOM   4969 C  CG1   . ILE B 1 160 ? -25.722 -6.699  9.794   1.00 62.46  ? 160 ILE B CG1   1 
ATOM   4970 C  CG2   . ILE B 1 160 ? -26.723 -4.786  8.479   1.00 58.32  ? 160 ILE B CG2   1 
ATOM   4971 C  CD1   . ILE B 1 160 ? -24.348 -6.790  9.149   1.00 63.60  ? 160 ILE B CD1   1 
ATOM   4972 N  N     . TYR B 1 161 ? -29.411 -8.540  10.297  1.00 61.92  ? 161 TYR B N     1 
ATOM   4973 C  CA    . TYR B 1 161 ? -29.763 -9.960  10.212  1.00 63.76  ? 161 TYR B CA    1 
ATOM   4974 C  C     . TYR B 1 161 ? -30.636 -10.258 8.986   1.00 62.50  ? 161 TYR B C     1 
ATOM   4975 O  O     . TYR B 1 161 ? -30.113 -10.258 7.878   1.00 62.58  ? 161 TYR B O     1 
ATOM   4976 C  CB    . TYR B 1 161 ? -30.343 -10.538 11.506  1.00 65.99  ? 161 TYR B CB    1 
ATOM   4977 C  CG    . TYR B 1 161 ? -30.608 -12.034 11.413  1.00 68.27  ? 161 TYR B CG    1 
ATOM   4978 C  CD1   . TYR B 1 161 ? -29.652 -12.908 10.877  1.00 69.17  ? 161 TYR B CD1   1 
ATOM   4979 C  CD2   . TYR B 1 161 ? -31.821 -12.576 11.850  1.00 69.69  ? 161 TYR B CD2   1 
ATOM   4980 C  CE1   . TYR B 1 161 ? -29.901 -14.278 10.780  1.00 71.27  ? 161 TYR B CE1   1 
ATOM   4981 C  CE2   . TYR B 1 161 ? -32.076 -13.946 11.762  1.00 71.60  ? 161 TYR B CE2   1 
ATOM   4982 C  CZ    . TYR B 1 161 ? -31.113 -14.788 11.229  1.00 72.73  ? 161 TYR B CZ    1 
ATOM   4983 O  OH    . TYR B 1 161 ? -31.372 -16.137 11.148  1.00 75.43  ? 161 TYR B OH    1 
ATOM   4984 N  N     . GLY B 1 162 ? -31.935 -10.485 9.162   1.00 62.10  ? 162 GLY B N     1 
ATOM   4985 C  CA    . GLY B 1 162 ? -32.801 -10.963 8.074   1.00 61.62  ? 162 GLY B CA    1 
ATOM   4986 C  C     . GLY B 1 162 ? -32.572 -10.461 6.650   1.00 59.95  ? 162 GLY B C     1 
ATOM   4987 O  O     . GLY B 1 162 ? -32.036 -9.375  6.435   1.00 58.41  ? 162 GLY B O     1 
ATOM   4988 N  N     . ALA B 1 163 ? -33.003 -11.254 5.671   1.00 60.91  ? 163 ALA B N     1 
ATOM   4989 C  CA    . ALA B 1 163 ? -32.823 -10.925 4.250   1.00 60.29  ? 163 ALA B CA    1 
ATOM   4990 C  C     . ALA B 1 163 ? -34.077 -10.357 3.579   1.00 59.78  ? 163 ALA B C     1 
ATOM   4991 O  O     . ALA B 1 163 ? -34.108 -10.181 2.359   1.00 60.06  ? 163 ALA B O     1 
ATOM   4992 C  CB    . ALA B 1 163 ? -32.326 -12.142 3.480   1.00 62.69  ? 163 ALA B CB    1 
ATOM   4993 N  N     . GLU B 1 164 ? -35.113 -10.089 4.368   1.00 59.51  ? 164 GLU B N     1 
ATOM   4994 C  CA    . GLU B 1 164 ? -36.304 -9.430  3.852   1.00 59.59  ? 164 GLU B CA    1 
ATOM   4995 C  C     . GLU B 1 164 ? -36.011 -7.948  3.592   1.00 57.85  ? 164 GLU B C     1 
ATOM   4996 O  O     . GLU B 1 164 ? -35.043 -7.395  4.131   1.00 56.40  ? 164 GLU B O     1 
ATOM   4997 C  CB    . GLU B 1 164 ? -37.485 -9.609  4.811   1.00 60.61  ? 164 GLU B CB    1 
ATOM   4998 C  CG    . GLU B 1 164 ? -37.435 -8.752  6.072   1.00 60.07  ? 164 GLU B CG    1 
ATOM   4999 C  CD    . GLU B 1 164 ? -36.667 -9.402  7.215   1.00 61.58  ? 164 GLU B CD    1 
ATOM   5000 O  OE1   . GLU B 1 164 ? -37.011 -9.124  8.384   1.00 62.70  ? 164 GLU B OE1   1 
ATOM   5001 O  OE2   . GLU B 1 164 ? -35.727 -10.189 6.959   1.00 62.21  ? 164 GLU B OE2   1 
ATOM   5002 N  N     . TYR B 1 165 ? -36.854 -7.311  2.780   1.00 58.37  ? 165 TYR B N     1 
ATOM   5003 C  CA    . TYR B 1 165 ? -36.598 -5.945  2.318   1.00 57.42  ? 165 TYR B CA    1 
ATOM   5004 C  C     . TYR B 1 165 ? -36.381 -4.893  3.393   1.00 56.03  ? 165 TYR B C     1 
ATOM   5005 O  O     . TYR B 1 165 ? -35.525 -4.029  3.237   1.00 55.36  ? 165 TYR B O     1 
ATOM   5006 C  CB    . TYR B 1 165 ? -37.636 -5.502  1.289   1.00 59.10  ? 165 TYR B CB    1 
ATOM   5007 C  CG    . TYR B 1 165 ? -37.365 -6.145  -0.046  1.00 61.05  ? 165 TYR B CG    1 
ATOM   5008 C  CD1   . TYR B 1 165 ? -38.248 -7.076  -0.584  1.00 64.16  ? 165 TYR B CD1   1 
ATOM   5009 C  CD2   . TYR B 1 165 ? -36.191 -5.860  -0.750  1.00 60.46  ? 165 TYR B CD2   1 
ATOM   5010 C  CE1   . TYR B 1 165 ? -37.985 -7.688  -1.809  1.00 66.38  ? 165 TYR B CE1   1 
ATOM   5011 C  CE2   . TYR B 1 165 ? -35.917 -6.464  -1.968  1.00 62.69  ? 165 TYR B CE2   1 
ATOM   5012 C  CZ    . TYR B 1 165 ? -36.817 -7.380  -2.492  1.00 65.67  ? 165 TYR B CZ    1 
ATOM   5013 O  OH    . TYR B 1 165 ? -36.555 -7.987  -3.700  1.00 68.21  ? 165 TYR B OH    1 
ATOM   5014 N  N     . LYS B 1 166 ? -37.124 -4.976  4.487   1.00 56.57  ? 166 LYS B N     1 
ATOM   5015 C  CA    . LYS B 1 166 ? -36.925 -4.067  5.607   1.00 56.05  ? 166 LYS B CA    1 
ATOM   5016 C  C     . LYS B 1 166 ? -35.455 -4.036  6.048   1.00 55.23  ? 166 LYS B C     1 
ATOM   5017 O  O     . LYS B 1 166 ? -34.995 -3.051  6.628   1.00 54.99  ? 166 LYS B O     1 
ATOM   5018 C  CB    . LYS B 1 166 ? -37.826 -4.465  6.770   1.00 57.42  ? 166 LYS B CB    1 
ATOM   5019 C  CG    . LYS B 1 166 ? -38.023 -3.389  7.801   1.00 57.35  ? 166 LYS B CG    1 
ATOM   5020 C  CD    . LYS B 1 166 ? -39.043 -3.811  8.831   1.00 59.38  ? 166 LYS B CD    1 
ATOM   5021 C  CE    . LYS B 1 166 ? -39.093 -2.808  9.952   1.00 60.97  ? 166 LYS B CE    1 
ATOM   5022 N  NZ    . LYS B 1 166 ? -39.855 -3.335  11.099  1.00 64.79  ? 166 LYS B NZ    1 
ATOM   5023 N  N     . VAL B 1 167 ? -34.718 -5.102  5.742   1.00 55.34  ? 167 VAL B N     1 
ATOM   5024 C  CA    . VAL B 1 167 ? -33.336 -5.234  6.196   1.00 55.28  ? 167 VAL B CA    1 
ATOM   5025 C  C     . VAL B 1 167 ? -32.321 -5.280  5.053   1.00 55.37  ? 167 VAL B C     1 
ATOM   5026 O  O     . VAL B 1 167 ? -31.291 -4.608  5.118   1.00 55.36  ? 167 VAL B O     1 
ATOM   5027 C  CB    . VAL B 1 167 ? -33.133 -6.479  7.109   1.00 56.49  ? 167 VAL B CB    1 
ATOM   5028 C  CG1   . VAL B 1 167 ? -31.726 -6.475  7.716   1.00 56.31  ? 167 VAL B CG1   1 
ATOM   5029 C  CG2   . VAL B 1 167 ? -34.201 -6.545  8.208   1.00 56.73  ? 167 VAL B CG2   1 
ATOM   5030 N  N     . ARG B 1 168 ? -32.597 -6.079  4.022   1.00 56.32  ? 168 ARG B N     1 
ATOM   5031 C  CA    . ARG B 1 168 ? -31.672 -6.253  2.895   1.00 56.95  ? 168 ARG B CA    1 
ATOM   5032 C  C     . ARG B 1 168 ? -30.318 -6.768  3.380   1.00 57.59  ? 168 ARG B C     1 
ATOM   5033 O  O     . ARG B 1 168 ? -29.273 -6.294  2.936   1.00 57.92  ? 168 ARG B O     1 
ATOM   5034 C  CB    . ARG B 1 168 ? -31.478 -4.934  2.135   1.00 56.52  ? 168 ARG B CB    1 
ATOM   5035 C  CG    . ARG B 1 168 ? -32.732 -4.341  1.513   1.00 57.21  ? 168 ARG B CG    1 
ATOM   5036 C  CD    . ARG B 1 168 ? -32.773 -4.566  0.015   1.00 59.89  ? 168 ARG B CD    1 
ATOM   5037 N  NE    . ARG B 1 168 ? -33.681 -3.623  -0.643  1.00 62.83  ? 168 ARG B NE    1 
ATOM   5038 C  CZ    . ARG B 1 168 ? -33.780 -3.441  -1.962  1.00 64.62  ? 168 ARG B CZ    1 
ATOM   5039 N  NH1   . ARG B 1 168 ? -33.016 -4.139  -2.799  1.00 66.42  ? 168 ARG B NH1   1 
ATOM   5040 N  NH2   . ARG B 1 168 ? -34.649 -2.556  -2.445  1.00 64.15  ? 168 ARG B NH2   1 
ATOM   5041 N  N     . GLY B 1 169 ? -30.344 -7.739  4.290   1.00 58.53  ? 169 GLY B N     1 
ATOM   5042 C  CA    . GLY B 1 169 ? -29.128 -8.264  4.895   1.00 59.85  ? 169 GLY B CA    1 
ATOM   5043 C  C     . GLY B 1 169 ? -28.945 -9.762  4.751   1.00 62.37  ? 169 GLY B C     1 
ATOM   5044 O  O     . GLY B 1 169 ? -29.247 -10.343 3.708   1.00 63.37  ? 169 GLY B O     1 
ATOM   5045 N  N     . PHE B 1 170 ? -28.453 -10.385 5.818   1.00 63.93  ? 170 PHE B N     1 
ATOM   5046 C  CA    . PHE B 1 170 ? -28.035 -11.778 5.797   1.00 66.65  ? 170 PHE B CA    1 
ATOM   5047 C  C     . PHE B 1 170 ? -29.174 -12.726 6.103   1.00 67.67  ? 170 PHE B C     1 
ATOM   5048 O  O     . PHE B 1 170 ? -29.769 -12.682 7.181   1.00 67.61  ? 170 PHE B O     1 
ATOM   5049 C  CB    . PHE B 1 170 ? -26.910 -11.991 6.804   1.00 68.71  ? 170 PHE B CB    1 
ATOM   5050 C  CG    . PHE B 1 170 ? -25.629 -11.291 6.442   1.00 69.48  ? 170 PHE B CG    1 
ATOM   5051 C  CD1   . PHE B 1 170 ? -25.491 -9.911  6.619   1.00 67.83  ? 170 PHE B CD1   1 
ATOM   5052 C  CD2   . PHE B 1 170 ? -24.556 -12.010 5.930   1.00 72.77  ? 170 PHE B CD2   1 
ATOM   5053 C  CE1   . PHE B 1 170 ? -24.307 -9.259  6.288   1.00 68.58  ? 170 PHE B CE1   1 
ATOM   5054 C  CE2   . PHE B 1 170 ? -23.362 -11.366 5.595   1.00 74.10  ? 170 PHE B CE2   1 
ATOM   5055 C  CZ    . PHE B 1 170 ? -23.241 -9.988  5.773   1.00 71.42  ? 170 PHE B CZ    1 
ATOM   5056 N  N     . SER B 1 171 ? -29.470 -13.595 5.145   1.00 69.37  ? 171 SER B N     1 
ATOM   5057 C  CA    . SER B 1 171 ? -30.437 -14.673 5.344   1.00 71.17  ? 171 SER B CA    1 
ATOM   5058 C  C     . SER B 1 171 ? -29.964 -15.649 6.420   1.00 74.05  ? 171 SER B C     1 
ATOM   5059 O  O     . SER B 1 171 ? -28.763 -15.889 6.566   1.00 75.72  ? 171 SER B O     1 
ATOM   5060 C  CB    . SER B 1 171 ? -30.654 -15.407 4.026   1.00 72.91  ? 171 SER B CB    1 
ATOM   5061 O  OG    . SER B 1 171 ? -31.363 -16.606 4.223   1.00 75.89  ? 171 SER B OG    1 
ATOM   5062 N  N     . GLY B 1 172 ? -30.912 -16.202 7.173   1.00 75.40  ? 172 GLY B N     1 
ATOM   5063 C  CA    . GLY B 1 172 ? -30.617 -17.212 8.194   1.00 79.09  ? 172 GLY B CA    1 
ATOM   5064 C  C     . GLY B 1 172 ? -29.837 -18.388 7.633   1.00 82.94  ? 172 GLY B C     1 
ATOM   5065 O  O     . GLY B 1 172 ? -28.815 -18.796 8.190   1.00 85.49  ? 172 GLY B O     1 
ATOM   5066 N  N     . TYR B 1 173 ? -30.330 -18.920 6.517   1.00 84.04  ? 173 TYR B N     1 
ATOM   5067 C  CA    . TYR B 1 173 ? -29.671 -19.982 5.756   1.00 88.11  ? 173 TYR B CA    1 
ATOM   5068 C  C     . TYR B 1 173 ? -28.262 -19.570 5.292   1.00 88.64  ? 173 TYR B C     1 
ATOM   5069 O  O     . TYR B 1 173 ? -27.314 -20.359 5.377   1.00 92.31  ? 173 TYR B O     1 
ATOM   5070 C  CB    . TYR B 1 173 ? -30.570 -20.363 4.571   1.00 88.54  ? 173 TYR B CB    1 
ATOM   5071 C  CG    . TYR B 1 173 ? -29.995 -21.335 3.567   1.00 92.52  ? 173 TYR B CG    1 
ATOM   5072 C  CD1   . TYR B 1 173 ? -29.629 -22.628 3.939   1.00 97.24  ? 173 TYR B CD1   1 
ATOM   5073 C  CD2   . TYR B 1 173 ? -29.854 -20.971 2.230   1.00 92.26  ? 173 TYR B CD2   1 
ATOM   5074 C  CE1   . TYR B 1 173 ? -29.116 -23.522 3.012   1.00 101.34 ? 173 TYR B CE1   1 
ATOM   5075 C  CE2   . TYR B 1 173 ? -29.345 -21.859 1.298   1.00 96.81  ? 173 TYR B CE2   1 
ATOM   5076 C  CZ    . TYR B 1 173 ? -28.977 -23.131 1.696   1.00 101.20 ? 173 TYR B CZ    1 
ATOM   5077 O  OH    . TYR B 1 173 ? -28.469 -24.009 0.773   1.00 106.49 ? 173 TYR B OH    1 
ATOM   5078 N  N     . LEU B 1 174 ? -28.133 -18.328 4.826   1.00 85.42  ? 174 LEU B N     1 
ATOM   5079 C  CA    . LEU B 1 174 ? -26.845 -17.778 4.419   1.00 85.99  ? 174 LEU B CA    1 
ATOM   5080 C  C     . LEU B 1 174 ? -25.821 -17.893 5.538   1.00 87.99  ? 174 LEU B C     1 
ATOM   5081 O  O     . LEU B 1 174 ? -24.627 -18.036 5.278   1.00 90.72  ? 174 LEU B O     1 
ATOM   5082 C  CB    . LEU B 1 174 ? -26.990 -16.317 3.982   1.00 81.70  ? 174 LEU B CB    1 
ATOM   5083 C  CG    . LEU B 1 174 ? -25.723 -15.544 3.590   1.00 81.97  ? 174 LEU B CG    1 
ATOM   5084 C  CD1   . LEU B 1 174 ? -25.002 -16.211 2.426   1.00 85.92  ? 174 LEU B CD1   1 
ATOM   5085 C  CD2   . LEU B 1 174 ? -26.023 -14.076 3.267   1.00 77.84  ? 174 LEU B CD2   1 
ATOM   5086 N  N     . CYS B 1 175 ? -26.292 -17.835 6.779   1.00 87.57  ? 175 CYS B N     1 
ATOM   5087 C  CA    . CYS B 1 175 ? -25.413 -17.974 7.930   1.00 90.16  ? 175 CYS B CA    1 
ATOM   5088 C  C     . CYS B 1 175 ? -24.906 -19.403 8.090   1.00 95.61  ? 175 CYS B C     1 
ATOM   5089 O  O     . CYS B 1 175 ? -23.710 -19.625 8.305   1.00 98.97  ? 175 CYS B O     1 
ATOM   5090 C  CB    . CYS B 1 175 ? -26.114 -17.507 9.202   1.00 88.61  ? 175 CYS B CB    1 
ATOM   5091 S  SG    . CYS B 1 175 ? -26.348 -15.732 9.255   1.00 84.10  ? 175 CYS B SG    1 
ATOM   5092 N  N     . GLU B 1 176 ? -25.813 -20.366 7.970   1.00 97.03  ? 176 GLU B N     1 
ATOM   5093 C  CA    . GLU B 1 176 ? -25.460 -21.775 8.140   1.00 102.64 ? 176 GLU B CA    1 
ATOM   5094 C  C     . GLU B 1 176 ? -24.513 -22.279 7.050   1.00 105.43 ? 176 GLU B C     1 
ATOM   5095 O  O     . GLU B 1 176 ? -23.732 -23.200 7.286   1.00 110.60 ? 176 GLU B O     1 
ATOM   5096 C  CB    . GLU B 1 176 ? -26.724 -22.641 8.229   1.00 103.93 ? 176 GLU B CB    1 
ATOM   5097 C  CG    . GLU B 1 176 ? -27.526 -22.389 9.504   1.00 103.54 ? 176 GLU B CG    1 
ATOM   5098 C  CD    . GLU B 1 176 ? -29.014 -22.678 9.362   1.00 103.84 ? 176 GLU B CD    1 
ATOM   5099 O  OE1   . GLU B 1 176 ? -29.792 -21.710 9.159   1.00 99.40  ? 176 GLU B OE1   1 
ATOM   5100 O  OE2   . GLU B 1 176 ? -29.405 -23.867 9.464   1.00 107.87 ? 176 GLU B OE2   1 
ATOM   5101 N  N     . LEU B 1 177 ? -24.575 -21.658 5.873   1.00 102.46 ? 177 LEU B N     1 
ATOM   5102 C  CA    . LEU B 1 177 ? -23.720 -22.029 4.748   1.00 105.47 ? 177 LEU B CA    1 
ATOM   5103 C  C     . LEU B 1 177 ? -22.273 -21.569 4.924   1.00 106.94 ? 177 LEU B C     1 
ATOM   5104 O  O     . LEU B 1 177 ? -21.336 -22.293 4.574   1.00 112.12 ? 177 LEU B O     1 
ATOM   5105 C  CB    . LEU B 1 177 ? -24.280 -21.484 3.433   1.00 102.77 ? 177 LEU B CB    1 
ATOM   5106 C  CG    . LEU B 1 177 ? -25.287 -22.318 2.637   1.00 104.43 ? 177 LEU B CG    1 
ATOM   5107 C  CD1   . LEU B 1 177 ? -25.786 -21.508 1.464   1.00 102.05 ? 177 LEU B CD1   1 
ATOM   5108 C  CD2   . LEU B 1 177 ? -24.674 -23.604 2.138   1.00 111.04 ? 177 LEU B CD2   1 
ATOM   5109 N  N     . LEU B 1 178 ? -22.098 -20.364 5.459   1.00 102.76 ? 178 LEU B N     1 
ATOM   5110 C  CA    . LEU B 1 178 ? -20.768 -19.797 5.663   1.00 103.99 ? 178 LEU B CA    1 
ATOM   5111 C  C     . LEU B 1 178 ? -19.993 -20.579 6.725   1.00 108.90 ? 178 LEU B C     1 
ATOM   5112 O  O     . LEU B 1 178 ? -18.775 -20.754 6.619   1.00 113.03 ? 178 LEU B O     1 
ATOM   5113 C  CB    . LEU B 1 178 ? -20.866 -18.311 6.036   1.00 98.86  ? 178 LEU B CB    1 
ATOM   5114 C  CG    . LEU B 1 178 ? -21.444 -17.337 4.997   1.00 94.46  ? 178 LEU B CG    1 
ATOM   5115 C  CD1   . LEU B 1 178 ? -21.809 -16.010 5.646   1.00 90.06  ? 178 LEU B CD1   1 
ATOM   5116 C  CD2   . LEU B 1 178 ? -20.494 -17.110 3.820   1.00 96.68  ? 178 LEU B CD2   1 
ATOM   5117 N  N     . ILE B 1 179 ? -20.715 -21.060 7.733   1.00 108.87 ? 179 ILE B N     1 
ATOM   5118 C  CA    . ILE B 1 179 ? -20.134 -21.857 8.814   1.00 114.12 ? 179 ILE B CA    1 
ATOM   5119 C  C     . ILE B 1 179 ? -19.654 -23.223 8.307   1.00 120.39 ? 179 ILE B C     1 
ATOM   5120 O  O     . ILE B 1 179 ? -18.686 -23.783 8.826   1.00 125.88 ? 179 ILE B O     1 
ATOM   5121 C  CB    . ILE B 1 179 ? -21.122 -21.986 10.012  1.00 112.99 ? 179 ILE B CB    1 
ATOM   5122 C  CG1   . ILE B 1 179 ? -21.396 -20.608 10.629  1.00 108.06 ? 179 ILE B CG1   1 
ATOM   5123 C  CG2   . ILE B 1 179 ? -20.615 -22.963 11.077  1.00 119.61 ? 179 ILE B CG2   1 
ATOM   5124 C  CD1   . ILE B 1 179 ? -20.160 -19.721 10.811  1.00 108.68 ? 179 ILE B CD1   1 
ATOM   5125 N  N     . VAL B 1 180 ? -20.333 -23.739 7.286   1.00 119.94 ? 180 VAL B N     1 
ATOM   5126 C  CA    . VAL B 1 180 ? -19.895 -24.941 6.578   1.00 126.00 ? 180 VAL B CA    1 
ATOM   5127 C  C     . VAL B 1 180 ? -18.687 -24.614 5.696   1.00 128.23 ? 180 VAL B C     1 
ATOM   5128 O  O     . VAL B 1 180 ? -17.738 -25.396 5.614   1.00 134.82 ? 180 VAL B O     1 
ATOM   5129 C  CB    . VAL B 1 180 ? -21.045 -25.548 5.727   1.00 125.33 ? 180 VAL B CB    1 
ATOM   5130 C  CG1   . VAL B 1 180 ? -20.534 -26.629 4.782   1.00 131.62 ? 180 VAL B CG1   1 
ATOM   5131 C  CG2   . VAL B 1 180 ? -22.136 -26.104 6.625   1.00 124.87 ? 180 VAL B CG2   1 
ATOM   5132 N  N     . PHE B 1 181 ? -18.719 -23.446 5.056   1.00 123.25 ? 181 PHE B N     1 
ATOM   5133 C  CA    . PHE B 1 181 ? -17.662 -23.061 4.123   1.00 125.25 ? 181 PHE B CA    1 
ATOM   5134 C  C     . PHE B 1 181 ? -16.349 -22.664 4.791   1.00 127.90 ? 181 PHE B C     1 
ATOM   5135 O  O     . PHE B 1 181 ? -15.275 -22.895 4.230   1.00 133.12 ? 181 PHE B O     1 
ATOM   5136 C  CB    . PHE B 1 181 ? -18.126 -21.958 3.176   1.00 119.67 ? 181 PHE B CB    1 
ATOM   5137 C  CG    . PHE B 1 181 ? -17.239 -21.791 1.978   1.00 122.89 ? 181 PHE B CG    1 
ATOM   5138 C  CD1   . PHE B 1 181 ? -17.401 -22.606 0.865   1.00 126.80 ? 181 PHE B CD1   1 
ATOM   5139 C  CD2   . PHE B 1 181 ? -16.230 -20.831 1.966   1.00 122.73 ? 181 PHE B CD2   1 
ATOM   5140 C  CE1   . PHE B 1 181 ? -16.581 -22.463 -0.247  1.00 130.77 ? 181 PHE B CE1   1 
ATOM   5141 C  CE2   . PHE B 1 181 ? -15.405 -20.681 0.860   1.00 126.37 ? 181 PHE B CE2   1 
ATOM   5142 C  CZ    . PHE B 1 181 ? -15.580 -21.501 -0.250  1.00 130.35 ? 181 PHE B CZ    1 
ATOM   5143 N  N     . TYR B 1 182 ? -16.427 -22.069 5.978   1.00 124.97 ? 182 TYR B N     1 
ATOM   5144 C  CA    . TYR B 1 182 ? -15.214 -21.631 6.668   1.00 127.70 ? 182 TYR B CA    1 
ATOM   5145 C  C     . TYR B 1 182 ? -14.787 -22.501 7.852   1.00 133.18 ? 182 TYR B C     1 
ATOM   5146 O  O     . TYR B 1 182 ? -13.589 -22.678 8.097   1.00 138.77 ? 182 TYR B O     1 
ATOM   5147 C  CB    . TYR B 1 182 ? -15.308 -20.150 7.045   1.00 121.84 ? 182 TYR B CB    1 
ATOM   5148 C  CG    . TYR B 1 182 ? -15.186 -19.247 5.836   1.00 118.82 ? 182 TYR B CG    1 
ATOM   5149 C  CD1   . TYR B 1 182 ? -14.014 -19.223 5.081   1.00 123.45 ? 182 TYR B CD1   1 
ATOM   5150 C  CD2   . TYR B 1 182 ? -16.240 -18.430 5.434   1.00 112.21 ? 182 TYR B CD2   1 
ATOM   5151 C  CE1   . TYR B 1 182 ? -13.891 -18.410 3.960   1.00 121.34 ? 182 TYR B CE1   1 
ATOM   5152 C  CE2   . TYR B 1 182 ? -16.125 -17.605 4.312   1.00 110.13 ? 182 TYR B CE2   1 
ATOM   5153 C  CZ    . TYR B 1 182 ? -14.943 -17.601 3.582   1.00 114.65 ? 182 TYR B CZ    1 
ATOM   5154 O  OH    . TYR B 1 182 ? -14.803 -16.798 2.473   1.00 113.13 ? 182 TYR B OH    1 
ATOM   5155 N  N     . GLY B 1 183 ? -15.760 -23.059 8.565   1.00 131.98 ? 183 GLY B N     1 
ATOM   5156 C  CA    . GLY B 1 183 ? -15.466 -23.942 9.685   1.00 137.59 ? 183 GLY B CA    1 
ATOM   5157 C  C     . GLY B 1 183 ? -15.987 -23.428 11.011  1.00 134.81 ? 183 GLY B C     1 
ATOM   5158 O  O     . GLY B 1 183 ? -16.473 -24.202 11.831  1.00 137.52 ? 183 GLY B O     1 
ATOM   5159 N  N     . SER B 1 184 ? -15.875 -22.122 11.227  1.00 130.06 ? 184 SER B N     1 
ATOM   5160 C  CA    . SER B 1 184 ? -16.357 -21.497 12.453  1.00 127.58 ? 184 SER B CA    1 
ATOM   5161 C  C     . SER B 1 184 ? -16.566 -20.010 12.225  1.00 120.91 ? 184 SER B C     1 
ATOM   5162 O  O     . SER B 1 184 ? -15.940 -19.423 11.341  1.00 119.83 ? 184 SER B O     1 
ATOM   5163 C  CB    . SER B 1 184 ? -15.368 -21.714 13.601  1.00 134.11 ? 184 SER B CB    1 
ATOM   5164 O  OG    . SER B 1 184 ? -14.276 -20.815 13.510  1.00 135.04 ? 184 SER B OG    1 
ATOM   5165 N  N     . PHE B 1 185 ? -17.444 -19.419 13.037  1.00 117.10 ? 185 PHE B N     1 
ATOM   5166 C  CA    . PHE B 1 185 ? -17.763 -17.985 13.001  1.00 111.05 ? 185 PHE B CA    1 
ATOM   5167 C  C     . PHE B 1 185 ? -16.524 -17.085 13.037  1.00 112.32 ? 185 PHE B C     1 
ATOM   5168 O  O     . PHE B 1 185 ? -16.396 -16.168 12.226  1.00 108.50 ? 185 PHE B O     1 
ATOM   5169 C  CB    . PHE B 1 185 ? -18.734 -17.647 14.145  1.00 109.21 ? 185 PHE B CB    1 
ATOM   5170 C  CG    . PHE B 1 185 ? -18.716 -16.202 14.574  1.00 106.01 ? 185 PHE B CG    1 
ATOM   5171 C  CD1   . PHE B 1 185 ? -18.050 -15.818 15.737  1.00 109.45 ? 185 PHE B CD1   1 
ATOM   5172 C  CD2   . PHE B 1 185 ? -19.382 -15.230 13.833  1.00 99.52  ? 185 PHE B CD2   1 
ATOM   5173 C  CE1   . PHE B 1 185 ? -18.038 -14.488 16.143  1.00 106.79 ? 185 PHE B CE1   1 
ATOM   5174 C  CE2   . PHE B 1 185 ? -19.374 -13.901 14.236  1.00 96.67  ? 185 PHE B CE2   1 
ATOM   5175 C  CZ    . PHE B 1 185 ? -18.700 -13.529 15.392  1.00 100.37 ? 185 PHE B CZ    1 
ATOM   5176 N  N     . LEU B 1 186 ? -15.619 -17.357 13.974  1.00 118.09 ? 186 LEU B N     1 
ATOM   5177 C  CA    . LEU B 1 186 ? -14.377 -16.599 14.078  1.00 120.45 ? 186 LEU B CA    1 
ATOM   5178 C  C     . LEU B 1 186 ? -13.583 -16.688 12.774  1.00 121.08 ? 186 LEU B C     1 
ATOM   5179 O  O     . LEU B 1 186 ? -13.133 -15.668 12.252  1.00 119.07 ? 186 LEU B O     1 
ATOM   5180 C  CB    . LEU B 1 186 ? -13.536 -17.079 15.266  1.00 127.93 ? 186 LEU B CB    1 
ATOM   5181 C  CG    . LEU B 1 186 ? -12.287 -16.260 15.621  1.00 131.55 ? 186 LEU B CG    1 
ATOM   5182 C  CD1   . LEU B 1 186 ? -12.641 -15.020 16.435  1.00 128.77 ? 186 LEU B CD1   1 
ATOM   5183 C  CD2   . LEU B 1 186 ? -11.281 -17.116 16.373  1.00 140.36 ? 186 LEU B CD2   1 
ATOM   5184 N  N     . GLU B 1 187 ? -13.439 -17.901 12.243  1.00 124.22 ? 187 GLU B N     1 
ATOM   5185 C  CA    . GLU B 1 187 ? -12.735 -18.111 10.975  1.00 125.58 ? 187 GLU B CA    1 
ATOM   5186 C  C     . GLU B 1 187 ? -13.479 -17.463 9.805   1.00 118.74 ? 187 GLU B C     1 
ATOM   5187 O  O     . GLU B 1 187 ? -12.865 -17.028 8.828   1.00 118.78 ? 187 GLU B O     1 
ATOM   5188 C  CB    . GLU B 1 187 ? -12.504 -19.603 10.714  1.00 131.42 ? 187 GLU B CB    1 
ATOM   5189 C  CG    . GLU B 1 187 ? -11.540 -20.292 11.695  1.00 139.34 ? 187 GLU B CG    1 
ATOM   5190 C  CD    . GLU B 1 187 ? -10.071 -19.988 11.428  1.00 143.99 ? 187 GLU B CD    1 
ATOM   5191 O  OE1   . GLU B 1 187 ? -9.673  -18.808 11.495  1.00 141.68 ? 187 GLU B OE1   1 
ATOM   5192 O  OE2   . GLU B 1 187 ? -9.306  -20.940 11.169  1.00 150.94 ? 187 GLU B OE2   1 
ATOM   5193 N  N     . THR B 1 188 ? -14.802 -17.399 9.922   1.00 113.28 ? 188 THR B N     1 
ATOM   5194 C  CA    . THR B 1 188 ? -15.638 -16.726 8.939   1.00 106.95 ? 188 THR B CA    1 
ATOM   5195 C  C     . THR B 1 188 ? -15.429 -15.217 9.023   1.00 103.16 ? 188 THR B C     1 
ATOM   5196 O  O     . THR B 1 188 ? -15.360 -14.535 7.997   1.00 100.61 ? 188 THR B O     1 
ATOM   5197 C  CB    . THR B 1 188 ? -17.128 -17.050 9.152   1.00 103.08 ? 188 THR B CB    1 
ATOM   5198 O  OG1   . THR B 1 188 ? -17.308 -18.470 9.260   1.00 107.16 ? 188 THR B OG1   1 
ATOM   5199 C  CG2   . THR B 1 188 ? -17.961 -16.518 7.995   1.00 98.07  ? 188 THR B CG2   1 
ATOM   5200 N  N     . VAL B 1 189 ? -15.324 -14.712 10.251  1.00 103.23 ? 189 VAL B N     1 
ATOM   5201 C  CA    . VAL B 1 189 ? -15.065 -13.297 10.504  1.00 100.50 ? 189 VAL B CA    1 
ATOM   5202 C  C     . VAL B 1 189 ? -13.689 -12.891 9.971   1.00 103.76 ? 189 VAL B C     1 
ATOM   5203 O  O     . VAL B 1 189 ? -13.552 -11.828 9.357   1.00 101.12 ? 189 VAL B O     1 
ATOM   5204 C  CB    . VAL B 1 189 ? -15.223 -12.951 12.009  1.00 101.35 ? 189 VAL B CB    1 
ATOM   5205 C  CG1   . VAL B 1 189 ? -14.518 -11.652 12.361  1.00 101.73 ? 189 VAL B CG1   1 
ATOM   5206 C  CG2   . VAL B 1 189 ? -16.688 -12.854 12.370  1.00 96.52  ? 189 VAL B CG2   1 
ATOM   5207 N  N     . LYS B 1 190 ? -12.688 -13.747 10.189  1.00 109.78 ? 190 LYS B N     1 
ATOM   5208 C  CA    . LYS B 1 190 ? -11.338 -13.520 9.666   1.00 114.01 ? 190 LYS B CA    1 
ATOM   5209 C  C     . LYS B 1 190 ? -11.349 -13.308 8.153   1.00 111.79 ? 190 LYS B C     1 
ATOM   5210 O  O     . LYS B 1 190 ? -10.724 -12.376 7.649   1.00 112.03 ? 190 LYS B O     1 
ATOM   5211 C  CB    . LYS B 1 190 ? -10.378 -14.670 10.020  1.00 121.89 ? 190 LYS B CB    1 
ATOM   5212 C  CG    . LYS B 1 190 ? -9.852  -14.665 11.459  1.00 126.17 ? 190 LYS B CG    1 
ATOM   5213 C  CD    . LYS B 1 190 ? -8.355  -14.979 11.540  1.00 134.47 ? 190 LYS B CD    1 
ATOM   5214 C  CE    . LYS B 1 190 ? -7.502  -13.725 11.294  1.00 134.87 ? 190 LYS B CE    1 
ATOM   5215 N  NZ    . LYS B 1 190 ? -6.060  -13.890 11.657  1.00 142.83 ? 190 LYS B NZ    1 
ATOM   5216 N  N     . ASN B 1 191 ? -12.066 -14.166 7.436   1.00 110.26 ? 191 ASN B N     1 
ATOM   5217 C  CA    . ASN B 1 191 ? -12.088 -14.108 5.977   1.00 109.15 ? 191 ASN B CA    1 
ATOM   5218 C  C     . ASN B 1 191 ? -12.921 -12.975 5.401   1.00 102.55 ? 191 ASN B C     1 
ATOM   5219 O  O     . ASN B 1 191 ? -12.514 -12.345 4.422   1.00 102.70 ? 191 ASN B O     1 
ATOM   5220 C  CB    . ASN B 1 191 ? -12.539 -15.444 5.392   1.00 110.94 ? 191 ASN B CB    1 
ATOM   5221 C  CG    . ASN B 1 191 ? -11.397 -16.409 5.225   1.00 118.70 ? 191 ASN B CG    1 
ATOM   5222 O  OD1   . ASN B 1 191 ? -11.140 -16.892 4.125   1.00 121.68 ? 191 ASN B OD1   1 
ATOM   5223 N  ND2   . ASN B 1 191 ? -10.685 -16.683 6.314   1.00 122.91 ? 191 ASN B ND2   1 
ATOM   5224 N  N     . ALA B 1 192 ? -14.077 -12.725 6.019   1.00 97.38  ? 192 ALA B N     1 
ATOM   5225 C  CA    . ALA B 1 192 ? -15.034 -11.718 5.567   1.00 91.19  ? 192 ALA B CA    1 
ATOM   5226 C  C     . ALA B 1 192 ? -14.408 -10.339 5.385   1.00 90.42  ? 192 ALA B C     1 
ATOM   5227 O  O     . ALA B 1 192 ? -14.937 -9.504  4.652   1.00 86.93  ? 192 ALA B O     1 
ATOM   5228 C  CB    . ALA B 1 192 ? -16.189 -11.639 6.531   1.00 87.30  ? 192 ALA B CB    1 
ATOM   5229 N  N     . ARG B 1 193 ? -13.288 -10.109 6.065   1.00 94.17  ? 193 ARG B N     1 
ATOM   5230 C  CA    . ARG B 1 193 ? -12.519 -8.874  5.933   1.00 94.75  ? 193 ARG B CA    1 
ATOM   5231 C  C     . ARG B 1 193 ? -11.954 -8.703  4.523   1.00 96.45  ? 193 ARG B C     1 
ATOM   5232 O  O     . ARG B 1 193 ? -11.928 -7.589  3.997   1.00 94.66  ? 193 ARG B O     1 
ATOM   5233 C  CB    . ARG B 1 193 ? -11.385 -8.838  6.963   1.00 99.72  ? 193 ARG B CB    1 
ATOM   5234 C  CG    . ARG B 1 193 ? -11.863 -8.888  8.408   1.00 99.00  ? 193 ARG B CG    1 
ATOM   5235 C  CD    . ARG B 1 193 ? -10.850 -9.564  9.314   1.00 105.19 ? 193 ARG B CD    1 
ATOM   5236 N  NE    . ARG B 1 193 ? -9.712  -8.703  9.619   1.00 109.06 ? 193 ARG B NE    1 
ATOM   5237 C  CZ    . ARG B 1 193 ? -8.635  -9.083  10.303  1.00 114.99 ? 193 ARG B CZ    1 
ATOM   5238 N  NH1   . ARG B 1 193 ? -8.531  -10.322 10.765  1.00 117.81 ? 193 ARG B NH1   1 
ATOM   5239 N  NH2   . ARG B 1 193 ? -7.658  -8.215  10.522  1.00 118.30 ? 193 ARG B NH2   1 
ATOM   5240 N  N     . ARG B 1 194 ? -11.513 -9.804  3.916   1.00 100.50 ? 194 ARG B N     1 
ATOM   5241 C  CA    . ARG B 1 194 ? -10.941 -9.768  2.568   1.00 103.29 ? 194 ARG B CA    1 
ATOM   5242 C  C     . ARG B 1 194 ? -11.993 -9.696  1.450   1.00 99.37  ? 194 ARG B C     1 
ATOM   5243 O  O     . ARG B 1 194 ? -11.669 -9.295  0.327   1.00 100.93 ? 194 ARG B O     1 
ATOM   5244 C  CB    . ARG B 1 194 ? -9.961  -10.930 2.344   1.00 110.32 ? 194 ARG B CB    1 
ATOM   5245 C  CG    . ARG B 1 194 ? -8.530  -10.643 2.833   1.00 116.29 ? 194 ARG B CG    1 
ATOM   5246 C  CD    . ARG B 1 194 ? -7.531  -11.741 2.443   1.00 123.83 ? 194 ARG B CD    1 
ATOM   5247 N  NE    . ARG B 1 194 ? -7.855  -13.037 3.059   1.00 125.98 ? 194 ARG B NE    1 
ATOM   5248 C  CZ    . ARG B 1 194 ? -7.071  -14.122 2.994   1.00 133.50 ? 194 ARG B CZ    1 
ATOM   5249 N  NH1   . ARG B 1 194 ? -5.881  -14.101 2.337   1.00 140.25 ? 194 ARG B NH1   1 
ATOM   5250 N  NH2   . ARG B 1 194 ? -7.479  -15.241 3.596   1.00 134.46 ? 194 ARG B NH2   1 
ATOM   5251 N  N     . TRP B 1 195 ? -13.236 -10.077 1.761   1.00 94.80  ? 195 TRP B N     1 
ATOM   5252 C  CA    . TRP B 1 195 ? -14.354 -10.006 0.807   1.00 91.15  ? 195 TRP B CA    1 
ATOM   5253 C  C     . TRP B 1 195 ? -14.429 -8.679  0.064   1.00 88.89  ? 195 TRP B C     1 
ATOM   5254 O  O     . TRP B 1 195 ? -14.351 -7.618  0.678   1.00 86.53  ? 195 TRP B O     1 
ATOM   5255 C  CB    . TRP B 1 195 ? -15.701 -10.190 1.513   1.00 86.33  ? 195 TRP B CB    1 
ATOM   5256 C  CG    . TRP B 1 195 ? -16.034 -11.577 1.961   1.00 87.84  ? 195 TRP B CG    1 
ATOM   5257 C  CD1   . TRP B 1 195 ? -15.331 -12.716 1.711   1.00 93.02  ? 195 TRP B CD1   1 
ATOM   5258 C  CD2   . TRP B 1 195 ? -17.191 -11.973 2.708   1.00 84.62  ? 195 TRP B CD2   1 
ATOM   5259 N  NE1   . TRP B 1 195 ? -15.963 -13.796 2.276   1.00 93.46  ? 195 TRP B NE1   1 
ATOM   5260 C  CE2   . TRP B 1 195 ? -17.110 -13.369 2.892   1.00 88.53  ? 195 TRP B CE2   1 
ATOM   5261 C  CE3   . TRP B 1 195 ? -18.285 -11.282 3.247   1.00 79.64  ? 195 TRP B CE3   1 
ATOM   5262 C  CZ2   . TRP B 1 195 ? -18.085 -14.092 3.596   1.00 86.97  ? 195 TRP B CZ2   1 
ATOM   5263 C  CZ3   . TRP B 1 195 ? -19.253 -11.998 3.947   1.00 78.15  ? 195 TRP B CZ3   1 
ATOM   5264 C  CH2   . TRP B 1 195 ? -19.144 -13.388 4.115   1.00 81.85  ? 195 TRP B CH2   1 
ATOM   5265 N  N     . THR B 1 196 ? -14.588 -8.754  -1.255  1.00 90.05  ? 196 THR B N     1 
ATOM   5266 C  CA    . THR B 1 196 ? -14.934 -7.594  -2.076  1.00 87.87  ? 196 THR B CA    1 
ATOM   5267 C  C     . THR B 1 196 ? -16.399 -7.723  -2.498  1.00 83.85  ? 196 THR B C     1 
ATOM   5268 O  O     . THR B 1 196 ? -17.114 -8.583  -1.993  1.00 82.21  ? 196 THR B O     1 
ATOM   5269 C  CB    . THR B 1 196 ? -14.032 -7.465  -3.342  1.00 92.99  ? 196 THR B CB    1 
ATOM   5270 O  OG1   . THR B 1 196 ? -14.254 -8.581  -4.215  1.00 96.30  ? 196 THR B OG1   1 
ATOM   5271 C  CG2   . THR B 1 196 ? -12.545 -7.377  -2.973  1.00 97.52  ? 196 THR B CG2   1 
ATOM   5272 N  N     . ARG B 1 197 ? -16.841 -6.863  -3.413  1.00 82.71  ? 197 ARG B N     1 
ATOM   5273 C  CA    . ARG B 1 197 ? -18.168 -6.985  -4.012  1.00 80.25  ? 197 ARG B CA    1 
ATOM   5274 C  C     . ARG B 1 197 ? -18.109 -7.875  -5.257  1.00 84.58  ? 197 ARG B C     1 
ATOM   5275 O  O     . ARG B 1 197 ? -19.117 -8.085  -5.940  1.00 84.01  ? 197 ARG B O     1 
ATOM   5276 C  CB    . ARG B 1 197 ? -18.739 -5.606  -4.354  1.00 77.48  ? 197 ARG B CB    1 
ATOM   5277 C  CG    . ARG B 1 197 ? -18.123 -4.960  -5.585  1.00 81.18  ? 197 ARG B CG    1 
ATOM   5278 C  CD    . ARG B 1 197 ? -18.441 -3.484  -5.662  1.00 79.16  ? 197 ARG B CD    1 
ATOM   5279 N  NE    . ARG B 1 197 ? -17.673 -2.712  -4.685  1.00 77.64  ? 197 ARG B NE    1 
ATOM   5280 C  CZ    . ARG B 1 197 ? -17.695 -1.386  -4.586  1.00 75.74  ? 197 ARG B CZ    1 
ATOM   5281 N  NH1   . ARG B 1 197 ? -18.442 -0.663  -5.411  1.00 74.49  ? 197 ARG B NH1   1 
ATOM   5282 N  NH2   . ARG B 1 197 ? -16.962 -0.782  -3.661  1.00 75.46  ? 197 ARG B NH2   1 
ATOM   5283 N  N     . ARG B 1 198 ? -16.917 -8.392  -5.543  1.00 89.52  ? 198 ARG B N     1 
ATOM   5284 C  CA    . ARG B 1 198 ? -16.707 -9.277  -6.683  1.00 94.78  ? 198 ARG B CA    1 
ATOM   5285 C  C     . ARG B 1 198 ? -16.617 -10.729 -6.213  1.00 96.46  ? 198 ARG B C     1 
ATOM   5286 O  O     . ARG B 1 198 ? -16.570 -11.652 -7.028  1.00 100.91 ? 198 ARG B O     1 
ATOM   5287 C  CB    . ARG B 1 198 ? -15.432 -8.889  -7.451  1.00 100.48 ? 198 ARG B CB    1 
ATOM   5288 C  CG    . ARG B 1 198 ? -15.119 -7.387  -7.538  1.00 100.30 ? 198 ARG B CG    1 
ATOM   5289 C  CD    . ARG B 1 198 ? -16.229 -6.577  -8.215  1.00 99.67  ? 198 ARG B CD    1 
ATOM   5290 N  NE    . ARG B 1 198 ? -16.280 -6.781  -9.661  1.00 106.02 ? 198 ARG B NE    1 
ATOM   5291 C  CZ    . ARG B 1 198 ? -17.086 -6.118  -10.488 1.00 106.34 ? 198 ARG B CZ    1 
ATOM   5292 N  NH1   . ARG B 1 198 ? -17.925 -5.192  -10.027 1.00 100.78 ? 198 ARG B NH1   1 
ATOM   5293 N  NH2   . ARG B 1 198 ? -17.047 -6.381  -11.789 1.00 112.37 ? 198 ARG B NH2   1 
ATOM   5294 N  N     . THR B 1 199 ? -16.607 -10.910 -4.892  1.00 93.19  ? 199 THR B N     1 
ATOM   5295 C  CA    . THR B 1 199 ? -16.430 -12.211 -4.247  1.00 95.00  ? 199 THR B CA    1 
ATOM   5296 C  C     . THR B 1 199 ? -17.542 -13.219 -4.574  1.00 94.89  ? 199 THR B C     1 
ATOM   5297 O  O     . THR B 1 199 ? -18.737 -12.902 -4.495  1.00 90.56  ? 199 THR B O     1 
ATOM   5298 C  CB    . THR B 1 199 ? -16.320 -12.043 -2.714  1.00 91.83  ? 199 THR B CB    1 
ATOM   5299 O  OG1   . THR B 1 199 ? -15.346 -11.035 -2.411  1.00 91.62  ? 199 THR B OG1   1 
ATOM   5300 C  CG2   . THR B 1 199 ? -15.931 -13.360 -2.037  1.00 95.07  ? 199 THR B CG2   1 
ATOM   5301 N  N     . VAL B 1 200 ? -17.131 -14.430 -4.948  1.00 100.05 ? 200 VAL B N     1 
ATOM   5302 C  CA    . VAL B 1 200 ? -18.050 -15.527 -5.226  1.00 100.90 ? 200 VAL B CA    1 
ATOM   5303 C  C     . VAL B 1 200 ? -17.642 -16.731 -4.379  1.00 103.97 ? 200 VAL B C     1 
ATOM   5304 O  O     . VAL B 1 200 ? -16.537 -17.258 -4.526  1.00 109.67 ? 200 VAL B O     1 
ATOM   5305 C  CB    . VAL B 1 200 ? -18.083 -15.894 -6.740  1.00 105.86 ? 200 VAL B CB    1 
ATOM   5306 C  CG1   . VAL B 1 200 ? -18.932 -17.138 -6.988  1.00 108.08 ? 200 VAL B CG1   1 
ATOM   5307 C  CG2   . VAL B 1 200 ? -18.618 -14.737 -7.567  1.00 103.00 ? 200 VAL B CG2   1 
ATOM   5308 N  N     . ILE B 1 201 ? -18.538 -17.152 -3.488  1.00 100.75 ? 201 ILE B N     1 
ATOM   5309 C  CA    . ILE B 1 201 ? -18.295 -18.298 -2.608  1.00 103.58 ? 201 ILE B CA    1 
ATOM   5310 C  C     . ILE B 1 201 ? -19.089 -19.529 -3.066  1.00 106.64 ? 201 ILE B C     1 
ATOM   5311 O  O     . ILE B 1 201 ? -20.328 -19.539 -3.026  1.00 103.24 ? 201 ILE B O     1 
ATOM   5312 C  CB    . ILE B 1 201 ? -18.615 -17.958 -1.126  1.00 98.84  ? 201 ILE B CB    1 
ATOM   5313 C  CG1   . ILE B 1 201 ? -17.667 -16.869 -0.613  1.00 97.12  ? 201 ILE B CG1   1 
ATOM   5314 C  CG2   . ILE B 1 201 ? -18.542 -19.212 -0.244  1.00 102.01 ? 201 ILE B CG2   1 
ATOM   5315 C  CD1   . ILE B 1 201 ? -18.128 -16.203 0.663   1.00 91.46  ? 201 ILE B CD1   1 
ATOM   5316 N  N     . ASP B 1 202 ? -18.367 -20.565 -3.492  1.00 113.57 ? 202 ASP B N     1 
ATOM   5317 C  CA    . ASP B 1 202 ? -18.998 -21.798 -3.961  1.00 117.63 ? 202 ASP B CA    1 
ATOM   5318 C  C     . ASP B 1 202 ? -18.873 -22.928 -2.945  1.00 120.35 ? 202 ASP B C     1 
ATOM   5319 O  O     . ASP B 1 202 ? -17.944 -23.733 -3.006  1.00 126.90 ? 202 ASP B O     1 
ATOM   5320 C  CB    . ASP B 1 202 ? -18.418 -22.222 -5.312  1.00 124.53 ? 202 ASP B CB    1 
ATOM   5321 C  CG    . ASP B 1 202 ? -19.364 -23.107 -6.103  1.00 127.66 ? 202 ASP B CG    1 
ATOM   5322 O  OD1   . ASP B 1 202 ? -19.925 -24.065 -5.529  1.00 128.75 ? 202 ASP B OD1   1 
ATOM   5323 O  OD2   . ASP B 1 202 ? -19.542 -22.842 -7.311  1.00 129.74 ? 202 ASP B OD2   1 
ATOM   5324 N  N     . VAL B 1 203 ? -19.830 -22.985 -2.024  1.00 115.88 ? 203 VAL B N     1 
ATOM   5325 C  CA    . VAL B 1 203 ? -19.846 -23.988 -0.960  1.00 118.30 ? 203 VAL B CA    1 
ATOM   5326 C  C     . VAL B 1 203 ? -19.658 -25.402 -1.515  1.00 126.14 ? 203 VAL B C     1 
ATOM   5327 O  O     . VAL B 1 203 ? -18.883 -26.196 -0.967  1.00 131.23 ? 203 VAL B O     1 
ATOM   5328 C  CB    . VAL B 1 203 ? -21.148 -23.917 -0.119  1.00 113.08 ? 203 VAL B CB    1 
ATOM   5329 C  CG1   . VAL B 1 203 ? -20.969 -24.654 1.196   1.00 115.02 ? 203 VAL B CG1   1 
ATOM   5330 C  CG2   . VAL B 1 203 ? -21.551 -22.462 0.147   1.00 105.89 ? 203 VAL B CG2   1 
ATOM   5331 N  N     . ALA B 1 204 ? -20.362 -25.692 -2.609  1.00 127.51 ? 204 ALA B N     1 
ATOM   5332 C  CA    . ALA B 1 204 ? -20.293 -26.987 -3.280  1.00 135.20 ? 204 ALA B CA    1 
ATOM   5333 C  C     . ALA B 1 204 ? -18.866 -27.342 -3.684  1.00 142.19 ? 204 ALA B C     1 
ATOM   5334 O  O     . ALA B 1 204 ? -18.352 -28.389 -3.295  1.00 148.26 ? 204 ALA B O     1 
ATOM   5335 C  CB    . ALA B 1 204 ? -21.219 -27.008 -4.493  1.00 135.56 ? 204 ALA B CB    1 
ATOM   5336 N  N     . LYS B 1 205 ? -18.226 -26.457 -4.443  1.00 141.76 ? 205 LYS B N     1 
ATOM   5337 C  CA    . LYS B 1 205 ? -16.883 -26.718 -4.951  1.00 149.00 ? 205 LYS B CA    1 
ATOM   5338 C  C     . LYS B 1 205 ? -15.739 -26.270 -4.036  1.00 148.91 ? 205 LYS B C     1 
ATOM   5339 O  O     . LYS B 1 205 ? -14.591 -26.648 -4.262  1.00 155.88 ? 205 LYS B O     1 
ATOM   5340 C  CB    . LYS B 1 205 ? -16.709 -26.123 -6.353  1.00 150.50 ? 205 LYS B CB    1 
ATOM   5341 C  CG    . LYS B 1 205 ? -16.539 -27.166 -7.447  1.00 159.41 ? 205 LYS B CG    1 
ATOM   5342 C  CD    . LYS B 1 205 ? -15.635 -26.640 -8.556  1.00 163.39 ? 205 LYS B CD    1 
ATOM   5343 C  CE    . LYS B 1 205 ? -14.666 -27.704 -9.059  1.00 173.45 ? 205 LYS B CE    1 
ATOM   5344 N  NZ    . LYS B 1 205 ? -15.326 -28.696 -9.940  1.00 179.02 ? 205 LYS B NZ    1 
ATOM   5345 N  N     . GLY B 1 206 ? -16.043 -25.482 -3.008  1.00 141.92 ? 206 GLY B N     1 
ATOM   5346 C  CA    . GLY B 1 206 ? -15.003 -24.915 -2.138  1.00 141.85 ? 206 GLY B CA    1 
ATOM   5347 C  C     . GLY B 1 206 ? -14.192 -23.827 -2.833  1.00 141.74 ? 206 GLY B C     1 
ATOM   5348 O  O     . GLY B 1 206 ? -12.994 -23.669 -2.585  1.00 145.43 ? 206 GLY B O     1 
ATOM   5349 N  N     . GLU B 1 207 ? -14.864 -23.059 -3.685  1.00 137.80 ? 207 GLU B N     1 
ATOM   5350 C  CA    . GLU B 1 207 ? -14.204 -22.146 -4.609  1.00 138.91 ? 207 GLU B CA    1 
ATOM   5351 C  C     . GLU B 1 207 ? -14.495 -20.686 -4.259  1.00 131.24 ? 207 GLU B C     1 
ATOM   5352 O  O     . GLU B 1 207 ? -15.647 -20.238 -4.329  1.00 125.53 ? 207 GLU B O     1 
ATOM   5353 C  CB    . GLU B 1 207 ? -14.685 -22.460 -6.023  1.00 142.04 ? 207 GLU B CB    1 
ATOM   5354 C  CG    . GLU B 1 207 ? -13.688 -22.199 -7.124  1.00 147.95 ? 207 GLU B CG    1 
ATOM   5355 C  CD    . GLU B 1 207 ? -13.881 -23.132 -8.314  1.00 154.90 ? 207 GLU B CD    1 
ATOM   5356 O  OE1   . GLU B 1 207 ? -15.026 -23.297 -8.783  1.00 152.47 ? 207 GLU B OE1   1 
ATOM   5357 O  OE2   . GLU B 1 207 ? -12.879 -23.706 -8.784  1.00 163.42 ? 207 GLU B OE2   1 
ATOM   5358 N  N     . VAL B 1 208 ? -13.449 -19.952 -3.877  1.00 131.75 ? 208 VAL B N     1 
ATOM   5359 C  CA    . VAL B 1 208 ? -13.581 -18.542 -3.499  1.00 125.18 ? 208 VAL B CA    1 
ATOM   5360 C  C     . VAL B 1 208 ? -13.171 -17.662 -4.683  1.00 126.48 ? 208 VAL B C     1 
ATOM   5361 O  O     . VAL B 1 208 ? -12.255 -16.844 -4.575  1.00 127.31 ? 208 VAL B O     1 
ATOM   5362 C  CB    . VAL B 1 208 ? -12.735 -18.189 -2.231  1.00 124.87 ? 208 VAL B CB    1 
ATOM   5363 C  CG1   . VAL B 1 208 ? -13.141 -16.829 -1.656  1.00 117.29 ? 208 VAL B CG1   1 
ATOM   5364 C  CG2   . VAL B 1 208 ? -12.868 -19.265 -1.164  1.00 126.22 ? 208 VAL B CG2   1 
ATOM   5365 N  N     . ARG B 1 209 ? -13.847 -17.840 -5.816  1.00 127.33 ? 209 ARG B N     1 
ATOM   5366 C  CA    . ARG B 1 209 ? -13.499 -17.098 -7.035  1.00 129.54 ? 209 ARG B CA    1 
ATOM   5367 C  C     . ARG B 1 209 ? -14.052 -15.660 -7.079  1.00 122.72 ? 209 ARG B C     1 
ATOM   5368 O  O     . ARG B 1 209 ? -14.771 -15.234 -6.176  1.00 116.15 ? 209 ARG B O     1 
ATOM   5369 C  CB    . ARG B 1 209 ? -13.841 -17.896 -8.304  1.00 134.95 ? 209 ARG B CB    1 
ATOM   5370 C  CG    . ARG B 1 209 ? -15.228 -18.506 -8.367  1.00 132.32 ? 209 ARG B CG    1 
ATOM   5371 C  CD    . ARG B 1 209 ? -15.272 -19.602 -9.430  1.00 140.19 ? 209 ARG B CD    1 
ATOM   5372 N  NE    . ARG B 1 209 ? -16.639 -19.977 -9.789  1.00 138.71 ? 209 ARG B NE    1 
ATOM   5373 C  CZ    . ARG B 1 209 ? -17.388 -20.850 -9.117  1.00 137.73 ? 209 ARG B CZ    1 
ATOM   5374 N  NH1   . ARG B 1 209 ? -16.914 -21.454 -8.038  1.00 138.29 ? 209 ARG B NH1   1 
ATOM   5375 N  NH2   . ARG B 1 209 ? -18.621 -21.122 -9.524  1.00 136.50 ? 209 ARG B NH2   1 
ATOM   5376 N  N     . LYS B 1 210 ? -13.691 -14.924 -8.128  1.00 124.97 ? 210 LYS B N     1 
ATOM   5377 C  CA    . LYS B 1 210 ? -13.971 -13.491 -8.220  1.00 119.97 ? 210 LYS B CA    1 
ATOM   5378 C  C     . LYS B 1 210 ? -14.792 -13.166 -9.474  1.00 120.09 ? 210 LYS B C     1 
ATOM   5379 O  O     . LYS B 1 210 ? -14.237 -12.890 -10.539 1.00 125.09 ? 210 LYS B O     1 
ATOM   5380 C  CB    . LYS B 1 210 ? -12.647 -12.710 -8.213  1.00 122.89 ? 210 LYS B CB    1 
ATOM   5381 C  CG    . LYS B 1 210 ? -12.732 -11.269 -7.708  1.00 117.57 ? 210 LYS B CG    1 
ATOM   5382 C  CD    . LYS B 1 210 ? -11.400 -10.524 -7.913  1.00 121.48 ? 210 LYS B CD    1 
ATOM   5383 C  CE    . LYS B 1 210 ? -11.491 -9.054  -7.503  1.00 116.17 ? 210 LYS B CE    1 
ATOM   5384 N  NZ    . LYS B 1 210 ? -10.203 -8.343  -7.730  1.00 120.37 ? 210 LYS B NZ    1 
ATOM   5385 N  N     . GLY B 1 211 ? -16.115 -13.208 -9.338  1.00 115.15 ? 211 GLY B N     1 
ATOM   5386 C  CA    . GLY B 1 211 ? -17.028 -12.941 -10.452 1.00 115.40 ? 211 GLY B CA    1 
ATOM   5387 C  C     . GLY B 1 211 ? -17.429 -11.483 -10.545 1.00 110.79 ? 211 GLY B C     1 
ATOM   5388 O  O     . GLY B 1 211 ? -16.743 -10.609 -10.016 1.00 108.92 ? 211 GLY B O     1 
ATOM   5389 N  N     . GLU B 1 212 ? -18.555 -11.223 -11.201 1.00 109.40 ? 212 GLU B N     1 
ATOM   5390 C  CA    . GLU B 1 212 ? -18.993 -9.851  -11.485 1.00 106.28 ? 212 GLU B CA    1 
ATOM   5391 C  C     . GLU B 1 212 ? -19.823 -9.204  -10.374 1.00 98.56  ? 212 GLU B C     1 
ATOM   5392 O  O     . GLU B 1 212 ? -20.229 -8.046  -10.485 1.00 95.93  ? 212 GLU B O     1 
ATOM   5393 C  CB    . GLU B 1 212 ? -19.785 -9.817  -12.791 1.00 109.53 ? 212 GLU B CB    1 
ATOM   5394 C  CG    . GLU B 1 212 ? -19.010 -10.314 -14.000 1.00 118.34 ? 212 GLU B CG    1 
ATOM   5395 C  CD    . GLU B 1 212 ? -19.457 -9.652  -15.288 1.00 122.21 ? 212 GLU B CD    1 
ATOM   5396 O  OE1   . GLU B 1 212 ? -20.261 -8.687  -15.222 1.00 118.09 ? 212 GLU B OE1   1 
ATOM   5397 O  OE2   . GLU B 1 212 ? -18.994 -10.094 -16.365 1.00 129.07 ? 212 GLU B OE2   1 
ATOM   5398 N  N     . GLU B 1 213 ? -20.053 -9.948  -9.299  1.00 95.50  ? 213 GLU B N     1 
ATOM   5399 C  CA    . GLU B 1 213 ? -21.052 -9.592  -8.304  1.00 89.03  ? 213 GLU B CA    1 
ATOM   5400 C  C     . GLU B 1 213 ? -20.877 -10.522 -7.102  1.00 87.44  ? 213 GLU B C     1 
ATOM   5401 O  O     . GLU B 1 213 ? -20.312 -11.613 -7.234  1.00 91.61  ? 213 GLU B O     1 
ATOM   5402 C  CB    . GLU B 1 213 ? -22.439 -9.752  -8.941  1.00 88.52  ? 213 GLU B CB    1 
ATOM   5403 C  CG    . GLU B 1 213 ? -23.633 -9.763  -8.006  1.00 83.62  ? 213 GLU B CG    1 
ATOM   5404 C  CD    . GLU B 1 213 ? -24.897 -10.259 -8.693  1.00 84.73  ? 213 GLU B CD    1 
ATOM   5405 O  OE1   . GLU B 1 213 ? -24.791 -10.848 -9.792  1.00 89.22  ? 213 GLU B OE1   1 
ATOM   5406 O  OE2   . GLU B 1 213 ? -25.997 -10.060 -8.129  1.00 81.39  ? 213 GLU B OE2   1 
ATOM   5407 N  N     . PHE B 1 214 ? -21.339 -10.090 -5.931  1.00 81.91  ? 214 PHE B N     1 
ATOM   5408 C  CA    . PHE B 1 214 ? -21.305 -10.943 -4.749  1.00 80.57  ? 214 PHE B CA    1 
ATOM   5409 C  C     . PHE B 1 214 ? -22.335 -12.070 -4.893  1.00 81.26  ? 214 PHE B C     1 
ATOM   5410 O  O     . PHE B 1 214 ? -23.536 -11.814 -4.999  1.00 78.70  ? 214 PHE B O     1 
ATOM   5411 C  CB    . PHE B 1 214 ? -21.553 -10.123 -3.485  1.00 75.38  ? 214 PHE B CB    1 
ATOM   5412 C  CG    . PHE B 1 214 ? -21.075 -10.788 -2.227  1.00 74.77  ? 214 PHE B CG    1 
ATOM   5413 C  CD1   . PHE B 1 214 ? -19.768 -10.622 -1.795  1.00 76.17  ? 214 PHE B CD1   1 
ATOM   5414 C  CD2   . PHE B 1 214 ? -21.933 -11.573 -1.470  1.00 72.52  ? 214 PHE B CD2   1 
ATOM   5415 C  CE1   . PHE B 1 214 ? -19.321 -11.230 -0.629  1.00 76.81  ? 214 PHE B CE1   1 
ATOM   5416 C  CE2   . PHE B 1 214 ? -21.492 -12.187 -0.304  1.00 73.30  ? 214 PHE B CE2   1 
ATOM   5417 C  CZ    . PHE B 1 214 ? -20.185 -12.016 0.117   1.00 75.50  ? 214 PHE B CZ    1 
ATOM   5418 N  N     . PHE B 1 215 ? -21.857 -13.315 -4.901  1.00 85.22  ? 215 PHE B N     1 
ATOM   5419 C  CA    . PHE B 1 215 ? -22.687 -14.460 -5.279  1.00 87.27  ? 215 PHE B CA    1 
ATOM   5420 C  C     . PHE B 1 215 ? -22.361 -15.697 -4.447  1.00 89.32  ? 215 PHE B C     1 
ATOM   5421 O  O     . PHE B 1 215 ? -21.411 -16.418 -4.741  1.00 94.38  ? 215 PHE B O     1 
ATOM   5422 C  CB    . PHE B 1 215 ? -22.481 -14.759 -6.774  1.00 92.54  ? 215 PHE B CB    1 
ATOM   5423 C  CG    . PHE B 1 215 ? -23.570 -15.596 -7.405  1.00 94.58  ? 215 PHE B CG    1 
ATOM   5424 C  CD1   . PHE B 1 215 ? -24.500 -15.011 -8.262  1.00 93.77  ? 215 PHE B CD1   1 
ATOM   5425 C  CD2   . PHE B 1 215 ? -23.640 -16.971 -7.183  1.00 98.12  ? 215 PHE B CD2   1 
ATOM   5426 C  CE1   . PHE B 1 215 ? -25.499 -15.773 -8.865  1.00 96.21  ? 215 PHE B CE1   1 
ATOM   5427 C  CE2   . PHE B 1 215 ? -24.635 -17.744 -7.780  1.00 100.45 ? 215 PHE B CE2   1 
ATOM   5428 C  CZ    . PHE B 1 215 ? -25.566 -17.143 -8.622  1.00 99.77  ? 215 PHE B CZ    1 
ATOM   5429 N  N     . VAL B 1 216 ? -23.145 -15.943 -3.404  1.00 86.18  ? 216 VAL B N     1 
ATOM   5430 C  CA    . VAL B 1 216 ? -23.027 -17.194 -2.661  1.00 88.71  ? 216 VAL B CA    1 
ATOM   5431 C  C     . VAL B 1 216 ? -23.847 -18.251 -3.396  1.00 92.07  ? 216 VAL B C     1 
ATOM   5432 O  O     . VAL B 1 216 ? -25.081 -18.258 -3.332  1.00 89.58  ? 216 VAL B O     1 
ATOM   5433 C  CB    . VAL B 1 216 ? -23.477 -17.059 -1.184  1.00 84.78  ? 216 VAL B CB    1 
ATOM   5434 C  CG1   . VAL B 1 216 ? -23.250 -18.360 -0.431  1.00 87.87  ? 216 VAL B CG1   1 
ATOM   5435 C  CG2   . VAL B 1 216 ? -22.727 -15.928 -0.501  1.00 81.92  ? 216 VAL B CG2   1 
ATOM   5436 N  N     . VAL B 1 217 ? -23.144 -19.125 -4.115  1.00 98.23  ? 217 VAL B N     1 
ATOM   5437 C  CA    . VAL B 1 217 ? -23.783 -20.164 -4.924  1.00 102.72 ? 217 VAL B CA    1 
ATOM   5438 C  C     . VAL B 1 217 ? -24.364 -21.286 -4.059  1.00 103.77 ? 217 VAL B C     1 
ATOM   5439 O  O     . VAL B 1 217 ? -23.669 -21.887 -3.233  1.00 105.59 ? 217 VAL B O     1 
ATOM   5440 C  CB    . VAL B 1 217 ? -22.867 -20.663 -6.106  1.00 109.62 ? 217 VAL B CB    1 
ATOM   5441 C  CG1   . VAL B 1 217 ? -21.461 -20.100 -5.995  1.00 110.30 ? 217 VAL B CG1   1 
ATOM   5442 C  CG2   . VAL B 1 217 ? -22.864 -22.196 -6.252  1.00 115.96 ? 217 VAL B CG2   1 
ATOM   5443 N  N     . ASP B 1 218 ? -25.659 -21.526 -4.254  1.00 102.97 ? 218 ASP B N     1 
ATOM   5444 C  CA    . ASP B 1 218 ? -26.424 -22.506 -3.494  1.00 103.92 ? 218 ASP B CA    1 
ATOM   5445 C  C     . ASP B 1 218 ? -26.016 -23.923 -3.898  1.00 111.33 ? 218 ASP B C     1 
ATOM   5446 O  O     . ASP B 1 218 ? -25.963 -24.239 -5.092  1.00 115.75 ? 218 ASP B O     1 
ATOM   5447 C  CB    . ASP B 1 218 ? -27.927 -22.279 -3.729  1.00 101.58 ? 218 ASP B CB    1 
ATOM   5448 C  CG    . ASP B 1 218 ? -28.812 -23.016 -2.727  1.00 101.19 ? 218 ASP B CG    1 
ATOM   5449 O  OD1   . ASP B 1 218 ? -28.597 -22.888 -1.506  1.00 98.41  ? 218 ASP B OD1   1 
ATOM   5450 O  OD2   . ASP B 1 218 ? -29.749 -23.707 -3.169  1.00 104.00 ? 218 ASP B OD2   1 
ATOM   5451 N  N     . PRO B 1 219 ? -25.710 -24.777 -2.903  1.00 113.36 ? 219 PRO B N     1 
ATOM   5452 C  CA    . PRO B 1 219 ? -25.331 -26.175 -3.145  1.00 120.81 ? 219 PRO B CA    1 
ATOM   5453 C  C     . PRO B 1 219 ? -26.422 -26.978 -3.849  1.00 124.21 ? 219 PRO B C     1 
ATOM   5454 O  O     . PRO B 1 219 ? -26.143 -28.048 -4.393  1.00 131.13 ? 219 PRO B O     1 
ATOM   5455 C  CB    . PRO B 1 219 ? -25.127 -26.735 -1.736  1.00 120.86 ? 219 PRO B CB    1 
ATOM   5456 C  CG    . PRO B 1 219 ? -24.898 -25.556 -0.875  1.00 114.63 ? 219 PRO B CG    1 
ATOM   5457 C  CD    . PRO B 1 219 ? -25.693 -24.444 -1.467  1.00 109.10 ? 219 PRO B CD    1 
ATOM   5458 N  N     . VAL B 1 220 ? -27.647 -26.460 -3.832  1.00 119.92 ? 220 VAL B N     1 
ATOM   5459 C  CA    . VAL B 1 220 ? -28.807 -27.158 -4.391  1.00 123.02 ? 220 VAL B CA    1 
ATOM   5460 C  C     . VAL B 1 220 ? -29.181 -26.625 -5.784  1.00 123.90 ? 220 VAL B C     1 
ATOM   5461 O  O     . VAL B 1 220 ? -29.820 -27.325 -6.576  1.00 128.77 ? 220 VAL B O     1 
ATOM   5462 C  CB    . VAL B 1 220 ? -30.030 -27.091 -3.437  1.00 119.06 ? 220 VAL B CB    1 
ATOM   5463 C  CG1   . VAL B 1 220 ? -30.951 -28.267 -3.679  1.00 124.31 ? 220 VAL B CG1   1 
ATOM   5464 C  CG2   . VAL B 1 220 ? -29.584 -27.080 -1.975  1.00 116.35 ? 220 VAL B CG2   1 
ATOM   5465 N  N     . ASP B 1 221 ? -28.780 -25.386 -6.067  1.00 119.68 ? 221 ASP B N     1 
ATOM   5466 C  CA    . ASP B 1 221 ? -28.960 -24.775 -7.384  1.00 120.93 ? 221 ASP B CA    1 
ATOM   5467 C  C     . ASP B 1 221 ? -27.864 -23.737 -7.602  1.00 118.60 ? 221 ASP B C     1 
ATOM   5468 O  O     . ASP B 1 221 ? -27.825 -22.715 -6.918  1.00 112.34 ? 221 ASP B O     1 
ATOM   5469 C  CB    . ASP B 1 221 ? -30.344 -24.125 -7.505  1.00 117.27 ? 221 ASP B CB    1 
ATOM   5470 C  CG    . ASP B 1 221 ? -30.741 -23.833 -8.951  1.00 120.83 ? 221 ASP B CG    1 
ATOM   5471 O  OD1   . ASP B 1 221 ? -29.875 -23.428 -9.759  1.00 122.89 ? 221 ASP B OD1   1 
ATOM   5472 O  OD2   . ASP B 1 221 ? -31.935 -24.001 -9.277  1.00 121.97 ? 221 ASP B OD2   1 
ATOM   5473 N  N     . GLU B 1 222 ? -26.981 -24.008 -8.560  1.00 124.23 ? 222 GLU B N     1 
ATOM   5474 C  CA    . GLU B 1 222 ? -25.813 -23.160 -8.800  1.00 123.37 ? 222 GLU B CA    1 
ATOM   5475 C  C     . GLU B 1 222 ? -26.108 -21.870 -9.581  1.00 120.50 ? 222 GLU B C     1 
ATOM   5476 O  O     . GLU B 1 222 ? -25.271 -20.965 -9.629  1.00 118.52 ? 222 GLU B O     1 
ATOM   5477 C  CB    . GLU B 1 222 ? -24.697 -23.965 -9.467  1.00 131.15 ? 222 GLU B CB    1 
ATOM   5478 C  CG    . GLU B 1 222 ? -24.057 -24.991 -8.545  1.00 133.95 ? 222 GLU B CG    1 
ATOM   5479 C  CD    . GLU B 1 222 ? -22.629 -25.329 -8.943  1.00 140.57 ? 222 GLU B CD    1 
ATOM   5480 O  OE1   . GLU B 1 222 ? -21.698 -24.956 -8.165  1.00 138.75 ? 222 GLU B OE1   1 
ATOM   5481 O  OE2   . GLU B 1 222 ? -22.434 -25.958 -10.031 1.00 147.73 ? 222 GLU B OE2   1 
ATOM   5482 N  N     . LYS B 1 223 ? -27.295 -21.793 -10.181 1.00 120.74 ? 223 LYS B N     1 
ATOM   5483 C  CA    . LYS B 1 223 ? -27.749 -20.586 -10.880 1.00 118.36 ? 223 LYS B CA    1 
ATOM   5484 C  C     . LYS B 1 223 ? -28.231 -19.536 -9.883  1.00 110.25 ? 223 LYS B C     1 
ATOM   5485 O  O     . LYS B 1 223 ? -28.344 -18.356 -10.218 1.00 107.31 ? 223 LYS B O     1 
ATOM   5486 C  CB    . LYS B 1 223 ? -28.896 -20.918 -11.844 1.00 122.26 ? 223 LYS B CB    1 
ATOM   5487 C  CG    . LYS B 1 223 ? -28.548 -21.879 -12.978 1.00 131.35 ? 223 LYS B CG    1 
ATOM   5488 C  CD    . LYS B 1 223 ? -28.324 -21.159 -14.301 1.00 134.76 ? 223 LYS B CD    1 
ATOM   5489 C  CE    . LYS B 1 223 ? -28.321 -22.151 -15.457 1.00 144.46 ? 223 LYS B CE    1 
ATOM   5490 N  NZ    . LYS B 1 223 ? -28.353 -21.473 -16.781 1.00 148.69 ? 223 LYS B NZ    1 
ATOM   5491 N  N     . ARG B 1 224 ? -28.504 -19.984 -8.657  1.00 107.20 ? 224 ARG B N     1 
ATOM   5492 C  CA    . ARG B 1 224 ? -29.188 -19.186 -7.645  1.00 100.45 ? 224 ARG B CA    1 
ATOM   5493 C  C     . ARG B 1 224 ? -28.254 -18.666 -6.549  1.00 96.12  ? 224 ARG B C     1 
ATOM   5494 O  O     . ARG B 1 224 ? -27.497 -19.426 -5.942  1.00 97.61  ? 224 ARG B O     1 
ATOM   5495 C  CB    . ARG B 1 224 ? -30.335 -20.003 -7.039  1.00 100.48 ? 224 ARG B CB    1 
ATOM   5496 C  CG    . ARG B 1 224 ? -31.320 -19.195 -6.222  1.00 95.89  ? 224 ARG B CG    1 
ATOM   5497 C  CD    . ARG B 1 224 ? -31.037 -19.274 -4.722  1.00 94.08  ? 224 ARG B CD    1 
ATOM   5498 N  NE    . ARG B 1 224 ? -31.516 -18.087 -4.008  1.00 89.32  ? 224 ARG B NE    1 
ATOM   5499 C  CZ    . ARG B 1 224 ? -32.019 -18.095 -2.774  1.00 87.00  ? 224 ARG B CZ    1 
ATOM   5500 N  NH1   . ARG B 1 224 ? -32.136 -19.235 -2.098  1.00 89.68  ? 224 ARG B NH1   1 
ATOM   5501 N  NH2   . ARG B 1 224 ? -32.421 -16.958 -2.217  1.00 81.72  ? 224 ARG B NH2   1 
ATOM   5502 N  N     . ASN B 1 225 ? -28.337 -17.359 -6.304  1.00 91.26  ? 225 ASN B N     1 
ATOM   5503 C  CA    . ASN B 1 225 ? -27.547 -16.675 -5.283  1.00 87.23  ? 225 ASN B CA    1 
ATOM   5504 C  C     . ASN B 1 225 ? -28.272 -16.639 -3.938  1.00 83.23  ? 225 ASN B C     1 
ATOM   5505 O  O     . ASN B 1 225 ? -29.401 -16.155 -3.848  1.00 80.76  ? 225 ASN B O     1 
ATOM   5506 C  CB    . ASN B 1 225 ? -27.224 -15.251 -5.742  1.00 84.58  ? 225 ASN B CB    1 
ATOM   5507 C  CG    . ASN B 1 225 ? -26.296 -14.512 -4.784  1.00 81.41  ? 225 ASN B CG    1 
ATOM   5508 O  OD1   . ASN B 1 225 ? -25.840 -15.063 -3.780  1.00 81.25  ? 225 ASN B OD1   1 
ATOM   5509 N  ND2   . ASN B 1 225 ? -26.006 -13.252 -5.100  1.00 78.62  ? 225 ASN B ND2   1 
ATOM   5510 N  N     . VAL B 1 226 ? -27.613 -17.146 -2.898  1.00 83.27  ? 226 VAL B N     1 
ATOM   5511 C  CA    . VAL B 1 226 ? -28.176 -17.165 -1.543  1.00 80.14  ? 226 VAL B CA    1 
ATOM   5512 C  C     . VAL B 1 226 ? -28.086 -15.791 -0.903  1.00 75.41  ? 226 VAL B C     1 
ATOM   5513 O  O     . VAL B 1 226 ? -28.802 -15.493 0.047   1.00 72.92  ? 226 VAL B O     1 
ATOM   5514 C  CB    . VAL B 1 226 ? -27.463 -18.190 -0.634  1.00 82.61  ? 226 VAL B CB    1 
ATOM   5515 C  CG1   . VAL B 1 226 ? -27.933 -18.061 0.808   1.00 79.64  ? 226 VAL B CG1   1 
ATOM   5516 C  CG2   . VAL B 1 226 ? -27.704 -19.605 -1.138  1.00 87.78  ? 226 VAL B CG2   1 
ATOM   5517 N  N     . ALA B 1 227 ? -27.198 -14.957 -1.426  1.00 75.06  ? 227 ALA B N     1 
ATOM   5518 C  CA    . ALA B 1 227 ? -26.996 -13.621 -0.892  1.00 71.13  ? 227 ALA B CA    1 
ATOM   5519 C  C     . ALA B 1 227 ? -27.668 -12.586 -1.781  1.00 69.45  ? 227 ALA B C     1 
ATOM   5520 O  O     . ALA B 1 227 ? -27.460 -11.383 -1.610  1.00 67.03  ? 227 ALA B O     1 
ATOM   5521 C  CB    . ALA B 1 227 ? -25.507 -13.332 -0.751  1.00 72.16  ? 227 ALA B CB    1 
ATOM   5522 N  N     . ALA B 1 228 ? -28.499 -13.060 -2.706  1.00 71.33  ? 228 ALA B N     1 
ATOM   5523 C  CA    . ALA B 1 228 ? -29.098 -12.217 -3.747  1.00 71.15  ? 228 ALA B CA    1 
ATOM   5524 C  C     . ALA B 1 228 ? -29.847 -10.977 -3.254  1.00 67.26  ? 228 ALA B C     1 
ATOM   5525 O  O     . ALA B 1 228 ? -30.054 -10.040 -4.028  1.00 67.31  ? 228 ALA B O     1 
ATOM   5526 C  CB    . ALA B 1 228 ? -29.994 -13.049 -4.649  1.00 74.44  ? 228 ALA B CB    1 
ATOM   5527 N  N     . ASN B 1 229 ? -30.255 -10.961 -1.986  1.00 64.62  ? 229 ASN B N     1 
ATOM   5528 C  CA    . ASN B 1 229 ? -30.973 -9.799  -1.451  1.00 61.45  ? 229 ASN B CA    1 
ATOM   5529 C  C     . ASN B 1 229 ? -30.219 -8.983  -0.404  1.00 58.93  ? 229 ASN B C     1 
ATOM   5530 O  O     . ASN B 1 229 ? -30.754 -8.014  0.133   1.00 56.93  ? 229 ASN B O     1 
ATOM   5531 C  CB    . ASN B 1 229 ? -32.355 -10.191 -0.926  1.00 61.17  ? 229 ASN B CB    1 
ATOM   5532 C  CG    . ASN B 1 229 ? -33.301 -9.010  -0.856  1.00 59.15  ? 229 ASN B CG    1 
ATOM   5533 O  OD1   . ASN B 1 229 ? -33.117 -8.009  -1.549  1.00 58.38  ? 229 ASN B OD1   1 
ATOM   5534 N  ND2   . ASN B 1 229 ? -34.321 -9.121  -0.019  1.00 59.32  ? 229 ASN B ND2   1 
ATOM   5535 N  N     . LEU B 1 230 ? -28.986 -9.380  -0.110  1.00 59.72  ? 230 LEU B N     1 
ATOM   5536 C  CA    . LEU B 1 230 ? -28.112 -8.591  0.744   1.00 58.13  ? 230 LEU B CA    1 
ATOM   5537 C  C     . LEU B 1 230 ? -27.575 -7.459  -0.113  1.00 57.96  ? 230 LEU B C     1 
ATOM   5538 O  O     . LEU B 1 230 ? -26.983 -7.705  -1.163  1.00 60.09  ? 230 LEU B O     1 
ATOM   5539 C  CB    . LEU B 1 230 ? -26.990 -9.469  1.301   1.00 60.06  ? 230 LEU B CB    1 
ATOM   5540 C  CG    . LEU B 1 230 ? -25.749 -8.897  1.991   1.00 60.47  ? 230 LEU B CG    1 
ATOM   5541 C  CD1   . LEU B 1 230 ? -25.209 -9.914  2.960   1.00 62.44  ? 230 LEU B CD1   1 
ATOM   5542 C  CD2   . LEU B 1 230 ? -24.677 -8.564  0.977   1.00 62.64  ? 230 LEU B CD2   1 
ATOM   5543 N  N     . SER B 1 231 ? -27.808 -6.223  0.323   1.00 55.97  ? 231 SER B N     1 
ATOM   5544 C  CA    . SER B 1 231 ? -27.434 -5.042  -0.454  1.00 56.06  ? 231 SER B CA    1 
ATOM   5545 C  C     . SER B 1 231 ? -25.934 -4.767  -0.375  1.00 57.13  ? 231 SER B C     1 
ATOM   5546 O  O     . SER B 1 231 ? -25.252 -5.232  0.545   1.00 57.11  ? 231 SER B O     1 
ATOM   5547 C  CB    . SER B 1 231 ? -28.205 -3.824  0.038   1.00 53.95  ? 231 SER B CB    1 
ATOM   5548 O  OG    . SER B 1 231 ? -27.785 -3.489  1.347   1.00 53.27  ? 231 SER B OG    1 
ATOM   5549 N  N     . LEU B 1 232 ? -25.435 -3.996  -1.339  1.00 58.33  ? 232 LEU B N     1 
ATOM   5550 C  CA    . LEU B 1 232 ? -24.020 -3.616  -1.389  1.00 60.04  ? 232 LEU B CA    1 
ATOM   5551 C  C     . LEU B 1 232 ? -23.564 -2.916  -0.108  1.00 58.69  ? 232 LEU B C     1 
ATOM   5552 O  O     . LEU B 1 232 ? -22.521 -3.256  0.451   1.00 60.21  ? 232 LEU B O     1 
ATOM   5553 C  CB    . LEU B 1 232 ? -23.745 -2.738  -2.617  1.00 61.55  ? 232 LEU B CB    1 
ATOM   5554 C  CG    . LEU B 1 232 ? -22.374 -2.076  -2.766  1.00 63.82  ? 232 LEU B CG    1 
ATOM   5555 C  CD1   . LEU B 1 232 ? -21.264 -3.107  -2.926  1.00 66.60  ? 232 LEU B CD1   1 
ATOM   5556 C  CD2   . LEU B 1 232 ? -22.373 -1.086  -3.937  1.00 65.64  ? 232 LEU B CD2   1 
ATOM   5557 N  N     . ASP B 1 233 ? -24.363 -1.956  0.354   1.00 56.62  ? 233 ASP B N     1 
ATOM   5558 C  CA    . ASP B 1 233 ? -24.055 -1.192  1.556   1.00 55.70  ? 233 ASP B CA    1 
ATOM   5559 C  C     . ASP B 1 233 ? -24.094 -2.044  2.803   1.00 55.00  ? 233 ASP B C     1 
ATOM   5560 O  O     . ASP B 1 233 ? -23.251 -1.895  3.677   1.00 55.93  ? 233 ASP B O     1 
ATOM   5561 C  CB    . ASP B 1 233 ? -25.009 -0.008  1.704   1.00 54.47  ? 233 ASP B CB    1 
ATOM   5562 C  CG    . ASP B 1 233 ? -24.667 1.140   0.768   1.00 56.53  ? 233 ASP B CG    1 
ATOM   5563 O  OD1   . ASP B 1 233 ? -23.569 1.136   0.162   1.00 58.90  ? 233 ASP B OD1   1 
ATOM   5564 O  OD2   . ASP B 1 233 ? -25.504 2.062   0.645   1.00 57.84  ? 233 ASP B OD2   1 
ATOM   5565 N  N     . ASN B 1 234 ? -25.068 -2.943  2.890   1.00 54.02  ? 234 ASN B N     1 
ATOM   5566 C  CA    . ASN B 1 234 ? -25.116 -3.865  4.020   1.00 54.12  ? 234 ASN B CA    1 
ATOM   5567 C  C     . ASN B 1 234 ? -23.911 -4.790  4.067   1.00 56.63  ? 234 ASN B C     1 
ATOM   5568 O  O     . ASN B 1 234 ? -23.413 -5.086  5.146   1.00 57.69  ? 234 ASN B O     1 
ATOM   5569 C  CB    . ASN B 1 234 ? -26.428 -4.647  4.063   1.00 52.83  ? 234 ASN B CB    1 
ATOM   5570 C  CG    . ASN B 1 234 ? -27.469 -3.993  4.958   1.00 50.82  ? 234 ASN B CG    1 
ATOM   5571 O  OD1   . ASN B 1 234 ? -28.630 -4.385  4.955   1.00 49.86  ? 234 ASN B OD1   1 
ATOM   5572 N  ND2   . ASN B 1 234 ? -27.054 -3.005  5.737   1.00 49.96  ? 234 ASN B ND2   1 
ATOM   5573 N  N     . LEU B 1 235 ? -23.438 -5.225  2.899   1.00 58.52  ? 235 LEU B N     1 
ATOM   5574 C  CA    . LEU B 1 235 ? -22.208 -6.019  2.810   1.00 62.01  ? 235 LEU B CA    1 
ATOM   5575 C  C     . LEU B 1 235 ? -21.027 -5.217  3.361   1.00 63.67  ? 235 LEU B C     1 
ATOM   5576 O  O     . LEU B 1 235 ? -20.270 -5.704  4.209   1.00 65.66  ? 235 LEU B O     1 
ATOM   5577 C  CB    . LEU B 1 235 ? -21.926 -6.459  1.361   1.00 64.02  ? 235 LEU B CB    1 
ATOM   5578 C  CG    . LEU B 1 235 ? -20.581 -7.125  1.006   1.00 67.82  ? 235 LEU B CG    1 
ATOM   5579 C  CD1   . LEU B 1 235 ? -20.454 -8.530  1.592   1.00 69.41  ? 235 LEU B CD1   1 
ATOM   5580 C  CD2   . LEU B 1 235 ? -20.369 -7.162  -0.503  1.00 69.99  ? 235 LEU B CD2   1 
ATOM   5581 N  N     . ALA B 1 236 ? -20.890 -3.986  2.879   1.00 63.19  ? 236 ALA B N     1 
ATOM   5582 C  CA    . ALA B 1 236 ? -19.876 -3.076  3.379   1.00 65.14  ? 236 ALA B CA    1 
ATOM   5583 C  C     . ALA B 1 236 ? -19.861 -3.002  4.912   1.00 65.40  ? 236 ALA B C     1 
ATOM   5584 O  O     . ALA B 1 236 ? -18.785 -3.082  5.524   1.00 68.16  ? 236 ALA B O     1 
ATOM   5585 C  CB    . ALA B 1 236 ? -20.064 -1.687  2.773   1.00 64.11  ? 236 ALA B CB    1 
ATOM   5586 N  N     . ARG B 1 237 ? -21.045 -2.866  5.519   1.00 63.13  ? 237 ARG B N     1 
ATOM   5587 C  CA    . ARG B 1 237 ? -21.157 -2.693  6.969   1.00 63.93  ? 237 ARG B CA    1 
ATOM   5588 C  C     . ARG B 1 237 ? -20.590 -3.876  7.721   1.00 66.58  ? 237 ARG B C     1 
ATOM   5589 O  O     . ARG B 1 237 ? -19.830 -3.692  8.669   1.00 69.38  ? 237 ARG B O     1 
ATOM   5590 C  CB    . ARG B 1 237 ? -22.599 -2.417  7.401   1.00 61.48  ? 237 ARG B CB    1 
ATOM   5591 C  CG    . ARG B 1 237 ? -22.939 -0.944  7.393   1.00 61.76  ? 237 ARG B CG    1 
ATOM   5592 C  CD    . ARG B 1 237 ? -24.435 -0.648  7.447   1.00 60.92  ? 237 ARG B CD    1 
ATOM   5593 N  NE    . ARG B 1 237 ? -24.714 0.543   6.640   1.00 61.44  ? 237 ARG B NE    1 
ATOM   5594 C  CZ    . ARG B 1 237 ? -25.648 0.630   5.694   1.00 60.10  ? 237 ARG B CZ    1 
ATOM   5595 N  NH1   . ARG B 1 237 ? -26.466 -0.386  5.440   1.00 59.10  ? 237 ARG B NH1   1 
ATOM   5596 N  NH2   . ARG B 1 237 ? -25.782 1.759   5.013   1.00 60.09  ? 237 ARG B NH2   1 
ATOM   5597 N  N     . PHE B 1 238 ? -20.947 -5.083  7.280   1.00 66.53  ? 238 PHE B N     1 
ATOM   5598 C  CA    . PHE B 1 238 ? -20.472 -6.322  7.887   1.00 69.19  ? 238 PHE B CA    1 
ATOM   5599 C  C     . PHE B 1 238 ? -18.959 -6.426  7.765   1.00 72.98  ? 238 PHE B C     1 
ATOM   5600 O  O     . PHE B 1 238 ? -18.260 -6.508  8.775   1.00 75.85  ? 238 PHE B O     1 
ATOM   5601 C  CB    . PHE B 1 238 ? -21.151 -7.525  7.229   1.00 68.71  ? 238 PHE B CB    1 
ATOM   5602 C  CG    . PHE B 1 238 ? -20.707 -8.865  7.771   1.00 72.03  ? 238 PHE B CG    1 
ATOM   5603 C  CD1   . PHE B 1 238 ? -21.069 -9.274  9.050   1.00 72.56  ? 238 PHE B CD1   1 
ATOM   5604 C  CD2   . PHE B 1 238 ? -19.946 -9.729  6.984   1.00 74.95  ? 238 PHE B CD2   1 
ATOM   5605 C  CE1   . PHE B 1 238 ? -20.666 -10.516 9.544   1.00 76.38  ? 238 PHE B CE1   1 
ATOM   5606 C  CE2   . PHE B 1 238 ? -19.542 -10.976 7.468   1.00 78.30  ? 238 PHE B CE2   1 
ATOM   5607 C  CZ    . PHE B 1 238 ? -19.903 -11.368 8.749   1.00 78.93  ? 238 PHE B CZ    1 
ATOM   5608 N  N     . VAL B 1 239 ? -18.465 -6.395  6.527   1.00 73.59  ? 239 VAL B N     1 
ATOM   5609 C  CA    . VAL B 1 239 ? -17.024 -6.467  6.233   1.00 77.70  ? 239 VAL B CA    1 
ATOM   5610 C  C     . VAL B 1 239 ? -16.205 -5.524  7.117   1.00 79.57  ? 239 VAL B C     1 
ATOM   5611 O  O     . VAL B 1 239 ? -15.106 -5.870  7.545   1.00 83.92  ? 239 VAL B O     1 
ATOM   5612 C  CB    . VAL B 1 239 ? -16.731 -6.191  4.733   1.00 77.79  ? 239 VAL B CB    1 
ATOM   5613 C  CG1   . VAL B 1 239 ? -15.239 -6.190  4.455   1.00 82.34  ? 239 VAL B CG1   1 
ATOM   5614 C  CG2   . VAL B 1 239 ? -17.416 -7.229  3.859   1.00 77.70  ? 239 VAL B CG2   1 
ATOM   5615 N  N     . HIS B 1 240 ? -16.753 -4.344  7.392   1.00 77.03  ? 240 HIS B N     1 
ATOM   5616 C  CA    . HIS B 1 240 ? -16.120 -3.391  8.290   1.00 79.04  ? 240 HIS B CA    1 
ATOM   5617 C  C     . HIS B 1 240 ? -16.254 -3.830  9.744   1.00 81.10  ? 240 HIS B C     1 
ATOM   5618 O  O     . HIS B 1 240 ? -15.280 -3.791  10.497  1.00 85.15  ? 240 HIS B O     1 
ATOM   5619 C  CB    . HIS B 1 240 ? -16.723 -1.999  8.104   1.00 76.04  ? 240 HIS B CB    1 
ATOM   5620 C  CG    . HIS B 1 240 ? -15.984 -0.919  8.834   1.00 77.72  ? 240 HIS B CG    1 
ATOM   5621 N  ND1   . HIS B 1 240 ? -16.524 -0.243  9.906   1.00 76.14  ? 240 HIS B ND1   1 
ATOM   5622 C  CD2   . HIS B 1 240 ? -14.743 -0.408  8.652   1.00 80.40  ? 240 HIS B CD2   1 
ATOM   5623 C  CE1   . HIS B 1 240 ? -15.650 0.644   10.349  1.00 79.16  ? 240 HIS B CE1   1 
ATOM   5624 N  NE2   . HIS B 1 240 ? -14.560 0.561   9.607   1.00 81.54  ? 240 HIS B NE2   1 
ATOM   5625 N  N     . LEU B 1 241 ? -17.460 -4.248  10.128  1.00 79.02  ? 241 LEU B N     1 
ATOM   5626 C  CA    . LEU B 1 241 ? -17.752 -4.655  11.504  1.00 81.37  ? 241 LEU B CA    1 
ATOM   5627 C  C     . LEU B 1 241 ? -16.824 -5.770  11.969  1.00 86.37  ? 241 LEU B C     1 
ATOM   5628 O  O     . LEU B 1 241 ? -16.322 -5.734  13.095  1.00 90.17  ? 241 LEU B O     1 
ATOM   5629 C  CB    . LEU B 1 241 ? -19.224 -5.074  11.651  1.00 78.18  ? 241 LEU B CB    1 
ATOM   5630 C  CG    . LEU B 1 241 ? -20.283 -4.105  12.224  1.00 76.45  ? 241 LEU B CG    1 
ATOM   5631 C  CD1   . LEU B 1 241 ? -20.266 -4.120  13.752  1.00 79.87  ? 241 LEU B CD1   1 
ATOM   5632 C  CD2   . LEU B 1 241 ? -20.192 -2.653  11.691  1.00 74.97  ? 241 LEU B CD2   1 
ATOM   5633 N  N     . CYS B 1 242 ? -16.597 -6.744  11.086  1.00 87.23  ? 242 CYS B N     1 
ATOM   5634 C  CA    . CYS B 1 242 ? -15.665 -7.845  11.328  1.00 92.51  ? 242 CYS B CA    1 
ATOM   5635 C  C     . CYS B 1 242 ? -14.251 -7.336  11.609  1.00 97.32  ? 242 CYS B C     1 
ATOM   5636 O  O     . CYS B 1 242 ? -13.611 -7.780  12.564  1.00 102.28 ? 242 CYS B O     1 
ATOM   5637 C  CB    . CYS B 1 242 ? -15.658 -8.809  10.140  1.00 92.31  ? 242 CYS B CB    1 
ATOM   5638 S  SG    . CYS B 1 242 ? -17.148 -9.841  9.994   1.00 90.17  ? 242 CYS B SG    1 
ATOM   5639 N  N     . ARG B 1 243 ? -13.778 -6.400  10.782  1.00 96.54  ? 243 ARG B N     1 
ATOM   5640 C  CA    . ARG B 1 243 ? -12.477 -5.750  10.971  1.00 100.91 ? 243 ARG B CA    1 
ATOM   5641 C  C     . ARG B 1 243 ? -12.394 -5.074  12.333  1.00 103.04 ? 243 ARG B C     1 
ATOM   5642 O  O     . ARG B 1 243 ? -11.393 -5.205  13.039  1.00 108.64 ? 243 ARG B O     1 
ATOM   5643 C  CB    . ARG B 1 243 ? -12.223 -4.705  9.879   1.00 98.97  ? 243 ARG B CB    1 
ATOM   5644 C  CG    . ARG B 1 243 ? -11.963 -5.275  8.501   1.00 98.69  ? 243 ARG B CG    1 
ATOM   5645 C  CD    . ARG B 1 243 ? -11.919 -4.179  7.450   1.00 96.13  ? 243 ARG B CD    1 
ATOM   5646 N  NE    . ARG B 1 243 ? -11.789 -4.738  6.104   1.00 95.86  ? 243 ARG B NE    1 
ATOM   5647 C  CZ    . ARG B 1 243 ? -11.827 -4.028  4.979   1.00 94.31  ? 243 ARG B CZ    1 
ATOM   5648 N  NH1   . ARG B 1 243 ? -11.995 -2.706  5.012   1.00 92.72  ? 243 ARG B NH1   1 
ATOM   5649 N  NH2   . ARG B 1 243 ? -11.702 -4.649  3.813   1.00 94.78  ? 243 ARG B NH2   1 
ATOM   5650 N  N     . GLU B 1 244 ? -13.455 -4.352  12.690  1.00 99.29  ? 244 GLU B N     1 
ATOM   5651 C  CA    . GLU B 1 244 ? -13.525 -3.637  13.958  1.00 101.52 ? 244 GLU B CA    1 
ATOM   5652 C  C     . GLU B 1 244 ? -13.530 -4.590  15.139  1.00 105.30 ? 244 GLU B C     1 
ATOM   5653 O  O     . GLU B 1 244 ? -12.910 -4.316  16.167  1.00 110.19 ? 244 GLU B O     1 
ATOM   5654 C  CB    . GLU B 1 244 ? -14.766 -2.752  14.009  1.00 96.72  ? 244 GLU B CB    1 
ATOM   5655 C  CG    . GLU B 1 244 ? -14.590 -1.383  13.375  1.00 95.35  ? 244 GLU B CG    1 
ATOM   5656 C  CD    . GLU B 1 244 ? -15.783 -0.468  13.622  1.00 92.15  ? 244 GLU B CD    1 
ATOM   5657 O  OE1   . GLU B 1 244 ? -15.610 0.771   13.530  1.00 92.72  ? 244 GLU B OE1   1 
ATOM   5658 O  OE2   . GLU B 1 244 ? -16.891 -0.988  13.908  1.00 90.03  ? 244 GLU B OE2   1 
ATOM   5659 N  N     . PHE B 1 245 ? -14.235 -5.708  14.985  1.00 103.69 ? 245 PHE B N     1 
ATOM   5660 C  CA    . PHE B 1 245 ? -14.278 -6.734  16.018  1.00 107.66 ? 245 PHE B CA    1 
ATOM   5661 C  C     . PHE B 1 245 ? -12.929 -7.440  16.168  1.00 114.10 ? 245 PHE B C     1 
ATOM   5662 O  O     . PHE B 1 245 ? -12.392 -7.528  17.273  1.00 119.62 ? 245 PHE B O     1 
ATOM   5663 C  CB    . PHE B 1 245 ? -15.392 -7.750  15.740  1.00 104.43 ? 245 PHE B CB    1 
ATOM   5664 C  CG    . PHE B 1 245 ? -15.334 -8.958  16.627  1.00 109.05 ? 245 PHE B CG    1 
ATOM   5665 C  CD1   . PHE B 1 245 ? -15.735 -8.880  17.958  1.00 111.76 ? 245 PHE B CD1   1 
ATOM   5666 C  CD2   . PHE B 1 245 ? -14.856 -10.171 16.140  1.00 111.73 ? 245 PHE B CD2   1 
ATOM   5667 C  CE1   . PHE B 1 245 ? -15.669 -9.995  18.792  1.00 116.89 ? 245 PHE B CE1   1 
ATOM   5668 C  CE2   . PHE B 1 245 ? -14.784 -11.293 16.964  1.00 116.75 ? 245 PHE B CE2   1 
ATOM   5669 C  CZ    . PHE B 1 245 ? -15.193 -11.205 18.294  1.00 118.99 ? 245 PHE B CZ    1 
ATOM   5670 N  N     . MET B 1 246 ? -12.395 -7.941  15.055  1.00 114.05 ? 246 MET B N     1 
ATOM   5671 C  CA    . MET B 1 246 ? -11.113 -8.650  15.049  1.00 120.60 ? 246 MET B CA    1 
ATOM   5672 C  C     . MET B 1 246 ? -10.027 -7.883  15.802  1.00 125.91 ? 246 MET B C     1 
ATOM   5673 O  O     . MET B 1 246 ? -9.362  -8.443  16.672  1.00 132.31 ? 246 MET B O     1 
ATOM   5674 C  CB    . MET B 1 246 ? -10.659 -8.941  13.615  1.00 119.81 ? 246 MET B CB    1 
ATOM   5675 C  CG    . MET B 1 246 ? -11.360 -10.121 12.959  1.00 118.30 ? 246 MET B CG    1 
ATOM   5676 S  SD    . MET B 1 246 ? -10.335 -11.601 12.816  1.00 127.29 ? 246 MET B SD    1 
ATOM   5677 C  CE    . MET B 1 246 ? -10.480 -12.335 14.446  1.00 131.53 ? 246 MET B CE    1 
ATOM   5678 N  N     . GLU B 1 247 ? -9.873  -6.600  15.478  1.00 123.64 ? 247 GLU B N     1 
ATOM   5679 C  CA    . GLU B 1 247 ? -8.857  -5.757  16.104  1.00 128.69 ? 247 GLU B CA    1 
ATOM   5680 C  C     . GLU B 1 247 ? -9.131  -5.518  17.590  1.00 131.42 ? 247 GLU B C     1 
ATOM   5681 O  O     . GLU B 1 247 ? -8.332  -5.913  18.436  1.00 138.45 ? 247 GLU B O     1 
ATOM   5682 C  CB    . GLU B 1 247 ? -8.717  -4.432  15.351  1.00 125.75 ? 247 GLU B CB    1 
ATOM   5683 C  CG    . GLU B 1 247 ? -8.169  -4.582  13.941  1.00 125.02 ? 247 GLU B CG    1 
ATOM   5684 C  CD    . GLU B 1 247 ? -7.930  -3.248  13.260  1.00 123.36 ? 247 GLU B CD    1 
ATOM   5685 O  OE1   . GLU B 1 247 ? -6.751  -2.917  13.009  1.00 128.47 ? 247 GLU B OE1   1 
ATOM   5686 O  OE2   . GLU B 1 247 ? -8.914  -2.527  12.979  1.00 117.76 ? 247 GLU B OE2   1 
ATOM   5687 N  N     . ALA B 1 248 ? -10.255 -4.880  17.904  1.00 126.49 ? 248 ALA B N     1 
ATOM   5688 C  CA    . ALA B 1 248 ? -10.657 -4.673  19.291  1.00 129.12 ? 248 ALA B CA    1 
ATOM   5689 C  C     . ALA B 1 248 ? -12.003 -5.344  19.544  1.00 125.08 ? 248 ALA B C     1 
ATOM   5690 O  O     . ALA B 1 248 ? -13.048 -4.781  19.225  1.00 119.39 ? 248 ALA B O     1 
ATOM   5691 C  CB    . ALA B 1 248 ? -10.717 -3.190  19.621  1.00 128.73 ? 248 ALA B CB    1 
ATOM   5692 N  N     . PRO B 1 249 ? -11.982 -6.571  20.093  1.00 128.50 ? 249 PRO B N     1 
ATOM   5693 C  CA    . PRO B 1 249 ? -13.214 -7.300  20.391  1.00 125.64 ? 249 PRO B CA    1 
ATOM   5694 C  C     . PRO B 1 249 ? -13.942 -6.752  21.611  1.00 127.02 ? 249 PRO B C     1 
ATOM   5695 O  O     . PRO B 1 249 ? -13.328 -6.125  22.476  1.00 132.28 ? 249 PRO B O     1 
ATOM   5696 C  CB    . PRO B 1 249 ? -12.727 -8.729  20.667  1.00 130.55 ? 249 PRO B CB    1 
ATOM   5697 C  CG    . PRO B 1 249 ? -11.284 -8.753  20.261  1.00 135.20 ? 249 PRO B CG    1 
ATOM   5698 C  CD    . PRO B 1 249 ? -10.793 -7.361  20.439  1.00 135.80 ? 249 PRO B CD    1 
ATOM   5699 N  N     . SER B 1 250 ? -15.249 -6.990  21.655  1.00 122.85 ? 250 SER B N     1 
ATOM   5700 C  CA    . SER B 1 250 ? -16.109 -6.578  22.761  1.00 124.20 ? 250 SER B CA    1 
ATOM   5701 C  C     . SER B 1 250 ? -17.403 -7.379  22.708  1.00 120.70 ? 250 SER B C     1 
ATOM   5702 O  O     . SER B 1 250 ? -17.775 -7.905  21.653  1.00 115.74 ? 250 SER B O     1 
ATOM   5703 C  CB    . SER B 1 250 ? -16.425 -5.081  22.679  1.00 121.55 ? 250 SER B CB    1 
ATOM   5704 O  OG    . SER B 1 250 ? -17.440 -4.715  23.601  1.00 122.59 ? 250 SER B OG    1 
ATOM   5705 N  N     . LEU B 1 251 ? -18.092 -7.461  23.843  1.00 123.68 ? 251 LEU B N     1 
ATOM   5706 C  CA    . LEU B 1 251 ? -19.398 -8.109  23.888  1.00 120.84 ? 251 LEU B CA    1 
ATOM   5707 C  C     . LEU B 1 251 ? -20.467 -7.219  23.261  1.00 114.14 ? 251 LEU B C     1 
ATOM   5708 O  O     . LEU B 1 251 ? -21.532 -7.702  22.873  1.00 110.46 ? 251 LEU B O     1 
ATOM   5709 C  CB    . LEU B 1 251 ? -19.782 -8.486  25.321  1.00 127.14 ? 251 LEU B CB    1 
ATOM   5710 C  CG    . LEU B 1 251 ? -20.718 -9.695  25.445  1.00 126.96 ? 251 LEU B CG    1 
ATOM   5711 C  CD1   . LEU B 1 251 ? -20.006 -10.975 25.023  1.00 128.62 ? 251 LEU B CD1   1 
ATOM   5712 C  CD2   . LEU B 1 251 ? -21.267 -9.829  26.857  1.00 133.15 ? 251 LEU B CD2   1 
ATOM   5713 N  N     . GLY B 1 252 ? -20.166 -5.923  23.155  1.00 113.01 ? 252 GLY B N     1 
ATOM   5714 C  CA    . GLY B 1 252 ? -21.055 -4.948  22.527  1.00 107.19 ? 252 GLY B CA    1 
ATOM   5715 C  C     . GLY B 1 252 ? -21.486 -5.336  21.125  1.00 100.51 ? 252 GLY B C     1 
ATOM   5716 O  O     . GLY B 1 252 ? -22.568 -4.960  20.683  1.00 96.36  ? 252 GLY B O     1 
ATOM   5717 N  N     . PHE B 1 253 ? -20.639 -6.099  20.432  1.00 100.20 ? 253 PHE B N     1 
ATOM   5718 C  CA    . PHE B 1 253 ? -20.950 -6.610  19.093  1.00 95.07  ? 253 PHE B CA    1 
ATOM   5719 C  C     . PHE B 1 253 ? -22.060 -7.670  19.083  1.00 93.81  ? 253 PHE B C     1 
ATOM   5720 O  O     . PHE B 1 253 ? -22.470 -8.134  18.019  1.00 89.90  ? 253 PHE B O     1 
ATOM   5721 C  CB    . PHE B 1 253 ? -19.689 -7.175  18.421  1.00 96.31  ? 253 PHE B CB    1 
ATOM   5722 C  CG    . PHE B 1 253 ? -18.674 -6.134  18.050  1.00 96.53  ? 253 PHE B CG    1 
ATOM   5723 C  CD1   . PHE B 1 253 ? -17.516 -5.976  18.804  1.00 102.41 ? 253 PHE B CD1   1 
ATOM   5724 C  CD2   . PHE B 1 253 ? -18.871 -5.312  16.943  1.00 91.64  ? 253 PHE B CD2   1 
ATOM   5725 C  CE1   . PHE B 1 253 ? -16.567 -5.009  18.460  1.00 103.09 ? 253 PHE B CE1   1 
ATOM   5726 C  CE2   . PHE B 1 253 ? -17.931 -4.342  16.595  1.00 92.10  ? 253 PHE B CE2   1 
ATOM   5727 C  CZ    . PHE B 1 253 ? -16.779 -4.191  17.353  1.00 97.82  ? 253 PHE B CZ    1 
ATOM   5728 N  N     . PHE B 1 254 ? -22.531 -8.057  20.268  1.00 97.80  ? 254 PHE B N     1 
ATOM   5729 C  CA    . PHE B 1 254 ? -23.582 -9.069  20.412  1.00 97.74  ? 254 PHE B CA    1 
ATOM   5730 C  C     . PHE B 1 254 ? -24.788 -8.514  21.155  1.00 98.11  ? 254 PHE B C     1 
ATOM   5731 O  O     . PHE B 1 254 ? -25.860 -9.123  21.167  1.00 97.30  ? 254 PHE B O     1 
ATOM   5732 C  CB    . PHE B 1 254 ? -23.043 -10.315 21.120  1.00 103.04 ? 254 PHE B CB    1 
ATOM   5733 C  CG    . PHE B 1 254 ? -22.150 -11.158 20.256  1.00 102.82 ? 254 PHE B CG    1 
ATOM   5734 C  CD1   . PHE B 1 254 ? -20.777 -10.938 20.227  1.00 105.20 ? 254 PHE B CD1   1 
ATOM   5735 C  CD2   . PHE B 1 254 ? -22.683 -12.167 19.460  1.00 100.61 ? 254 PHE B CD2   1 
ATOM   5736 C  CE1   . PHE B 1 254 ? -19.948 -11.713 19.420  1.00 105.76 ? 254 PHE B CE1   1 
ATOM   5737 C  CE2   . PHE B 1 254 ? -21.858 -12.950 18.652  1.00 101.12 ? 254 PHE B CE2   1 
ATOM   5738 C  CZ    . PHE B 1 254 ? -20.489 -12.722 18.633  1.00 103.63 ? 254 PHE B CZ    1 
ATOM   5739 N  N     . LYS B 1 255 ? -24.598 -7.354  21.774  1.00 100.05 ? 255 LYS B N     1 
ATOM   5740 C  CA    . LYS B 1 255 ? -25.681 -6.640  22.424  1.00 100.95 ? 255 LYS B CA    1 
ATOM   5741 C  C     . LYS B 1 255 ? -26.288 -5.657  21.431  1.00 95.65  ? 255 LYS B C     1 
ATOM   5742 O  O     . LYS B 1 255 ? -25.558 -4.950  20.730  1.00 93.41  ? 255 LYS B O     1 
ATOM   5743 C  CB    . LYS B 1 255 ? -25.183 -5.922  23.683  1.00 106.66 ? 255 LYS B CB    1 
ATOM   5744 C  CG    . LYS B 1 255 ? -24.666 -6.882  24.756  1.00 113.45 ? 255 LYS B CG    1 
ATOM   5745 C  CD    . LYS B 1 255 ? -24.564 -6.246  26.137  1.00 119.90 ? 255 LYS B CD    1 
ATOM   5746 C  CE    . LYS B 1 255 ? -24.185 -7.293  27.182  1.00 126.60 ? 255 LYS B CE    1 
ATOM   5747 N  NZ    . LYS B 1 255 ? -24.023 -6.722  28.550  1.00 134.06 ? 255 LYS B NZ    1 
ATOM   5748 N  N     . PRO B 1 256 ? -27.628 -5.633  21.335  1.00 94.15  ? 256 PRO B N     1 
ATOM   5749 C  CA    . PRO B 1 256 ? -28.258 -4.631  20.482  1.00 90.07  ? 256 PRO B CA    1 
ATOM   5750 C  C     . PRO B 1 256 ? -28.197 -3.261  21.158  1.00 92.63  ? 256 PRO B C     1 
ATOM   5751 O  O     . PRO B 1 256 ? -28.570 -3.133  22.329  1.00 97.31  ? 256 PRO B O     1 
ATOM   5752 C  CB    . PRO B 1 256 ? -29.712 -5.122  20.361  1.00 88.84  ? 256 PRO B CB    1 
ATOM   5753 C  CG    . PRO B 1 256 ? -29.743 -6.493  20.997  1.00 91.85  ? 256 PRO B CG    1 
ATOM   5754 C  CD    . PRO B 1 256 ? -28.622 -6.509  21.978  1.00 96.48  ? 256 PRO B CD    1 
ATOM   5755 N  N     . LYS B 1 257 ? -27.701 -2.260  20.434  1.00 90.33  ? 257 LYS B N     1 
ATOM   5756 C  CA    . LYS B 1 257 ? -27.632 -0.891  20.944  1.00 92.78  ? 257 LYS B CA    1 
ATOM   5757 C  C     . LYS B 1 257 ? -29.053 -0.376  21.198  1.00 93.12  ? 257 LYS B C     1 
ATOM   5758 O  O     . LYS B 1 257 ? -29.957 -0.637  20.398  1.00 89.53  ? 257 LYS B O     1 
ATOM   5759 C  CB    . LYS B 1 257 ? -26.906 0.009   19.935  1.00 89.81  ? 257 LYS B CB    1 
ATOM   5760 C  CG    . LYS B 1 257 ? -26.036 1.115   20.545  1.00 93.81  ? 257 LYS B CG    1 
ATOM   5761 C  CD    . LYS B 1 257 ? -26.833 2.379   20.892  1.00 95.44  ? 257 LYS B CD    1 
ATOM   5762 C  CE    . LYS B 1 257 ? -25.924 3.527   21.337  1.00 98.95  ? 257 LYS B CE    1 
ATOM   5763 N  NZ    . LYS B 1 257 ? -25.124 3.199   22.555  1.00 104.49 ? 257 LYS B NZ    1 
ATOM   5764 N  N     . HIS B 1 258 ? -29.250 0.326   22.317  1.00 98.07  ? 258 HIS B N     1 
ATOM   5765 C  CA    . HIS B 1 258 ? -30.538 0.972   22.617  1.00 99.40  ? 258 HIS B CA    1 
ATOM   5766 C  C     . HIS B 1 258 ? -30.820 2.079   21.581  1.00 95.64  ? 258 HIS B C     1 
ATOM   5767 O  O     . HIS B 1 258 ? -29.972 2.962   21.375  1.00 95.65  ? 258 HIS B O     1 
ATOM   5768 C  CB    . HIS B 1 258 ? -30.561 1.538   24.045  1.00 106.40 ? 258 HIS B CB    1 
ATOM   5769 C  CG    . HIS B 1 258 ? -30.395 0.505   25.122  1.00 111.45 ? 258 HIS B CG    1 
ATOM   5770 N  ND1   . HIS B 1 258 ? -29.376 0.553   26.051  1.00 117.03 ? 258 HIS B ND1   1 
ATOM   5771 C  CD2   . HIS B 1 258 ? -31.125 -0.597  25.426  1.00 112.59 ? 258 HIS B CD2   1 
ATOM   5772 C  CE1   . HIS B 1 258 ? -29.483 -0.473  26.878  1.00 120.61 ? 258 HIS B CE1   1 
ATOM   5773 N  NE2   . HIS B 1 258 ? -30.535 -1.187  26.519  1.00 118.03 ? 258 HIS B NE2   1 
ATOM   5774 N  N     . PRO B 1 259 ? -32.017 2.040   20.941  1.00 92.84  ? 259 PRO B N     1 
ATOM   5775 C  CA    . PRO B 1 259 ? -32.336 2.792   19.703  1.00 88.50  ? 259 PRO B CA    1 
ATOM   5776 C  C     . PRO B 1 259 ? -32.049 4.302   19.745  1.00 89.89  ? 259 PRO B C     1 
ATOM   5777 O  O     . PRO B 1 259 ? -32.186 4.986   18.722  1.00 87.11  ? 259 PRO B O     1 
ATOM   5778 C  CB    . PRO B 1 259 ? -33.837 2.531   19.507  1.00 88.17  ? 259 PRO B CB    1 
ATOM   5779 C  CG    . PRO B 1 259 ? -34.096 1.241   20.231  1.00 90.03  ? 259 PRO B CG    1 
ATOM   5780 C  CD    . PRO B 1 259 ? -33.176 1.255   21.416  1.00 94.37  ? 259 PRO B CD    1 
ATOM   5781 N  N     . LEU B 1 260 ? -31.649 4.792   20.919  1.00 112.43 ? 260 LEU B N     1 
ATOM   5782 C  CA    . LEU B 1 260 ? -31.249 6.190   21.155  1.00 111.40 ? 260 LEU B CA    1 
ATOM   5783 C  C     . LEU B 1 260 ? -32.383 7.214   20.987  1.00 108.10 ? 260 LEU B C     1 
ATOM   5784 O  O     . LEU B 1 260 ? -32.729 7.625   19.866  1.00 103.51 ? 260 LEU B O     1 
ATOM   5785 C  CB    . LEU B 1 260 ? -29.996 6.592   20.345  1.00 109.61 ? 260 LEU B CB    1 
ATOM   5786 C  CG    . LEU B 1 260 ? -29.042 7.591   21.022  1.00 111.92 ? 260 LEU B CG    1 
ATOM   5787 C  CD1   . LEU B 1 260 ? -28.064 6.878   21.975  1.00 117.18 ? 260 LEU B CD1   1 
ATOM   5788 C  CD2   . LEU B 1 260 ? -28.287 8.441   19.994  1.00 108.24 ? 260 LEU B CD2   1 
ATOM   5789 N  N     . GLU B 1 261 ? -32.944 7.607   22.134  1.00 110.43 ? 261 GLU B N     1 
ATOM   5790 C  CA    . GLU B 1 261 ? -33.951 8.665   22.228  1.00 108.21 ? 261 GLU B CA    1 
ATOM   5791 C  C     . GLU B 1 261 ? -33.261 10.007  22.484  1.00 107.63 ? 261 GLU B C     1 
ATOM   5792 O  O     . GLU B 1 261 ? -32.658 10.216  23.543  1.00 111.72 ? 261 GLU B O     1 
ATOM   5793 C  CB    . GLU B 1 261 ? -34.942 8.380   23.369  1.00 112.27 ? 261 GLU B CB    1 
ATOM   5794 C  CG    . GLU B 1 261 ? -35.496 6.953   23.428  1.00 113.45 ? 261 GLU B CG    1 
ATOM   5795 C  CD    . GLU B 1 261 ? -36.010 6.570   24.815  1.00 119.06 ? 261 GLU B CD    1 
ATOM   5796 O  OE1   . GLU B 1 261 ? -35.394 6.968   25.831  1.00 122.89 ? 261 GLU B OE1   1 
ATOM   5797 O  OE2   . GLU B 1 261 ? -37.031 5.855   24.889  1.00 119.81 ? 261 GLU B OE2   1 
ATOM   5798 N  N     . ILE B 1 262 ? -33.337 10.905  21.507  1.00 102.26 ? 262 ILE B N     1 
ATOM   5799 C  CA    . ILE B 1 262 ? -32.869 12.273  21.688  1.00 101.17 ? 262 ILE B CA    1 
ATOM   5800 C  C     . ILE B 1 262 ? -34.110 13.171  21.731  1.00 99.61  ? 262 ILE B C     1 
ATOM   5801 O  O     . ILE B 1 262 ? -35.099 12.904  21.036  1.00 96.81  ? 262 ILE B O     1 
ATOM   5802 C  CB    . ILE B 1 262 ? -31.845 12.687  20.571  1.00 97.74  ? 262 ILE B CB    1 
ATOM   5803 C  CG1   . ILE B 1 262 ? -30.479 13.056  21.174  1.00 100.72 ? 262 ILE B CG1   1 
ATOM   5804 C  CG2   . ILE B 1 262 ? -32.387 13.794  19.659  1.00 93.68  ? 262 ILE B CG2   1 
ATOM   5805 C  CD1   . ILE B 1 262 ? -29.563 11.861  21.461  1.00 103.24 ? 262 ILE B CD1   1 
ATOM   5806 N  N     . GLU B 1 263 ? -34.076 14.206  22.568  1.00 101.18 ? 263 GLU B N     1 
ATOM   5807 C  CA    . GLU B 1 263 ? -35.217 15.117  22.683  1.00 100.18 ? 263 GLU B CA    1 
ATOM   5808 C  C     . GLU B 1 263 ? -35.312 16.087  21.489  1.00 94.98  ? 263 GLU B C     1 
ATOM   5809 O  O     . GLU B 1 263 ? -34.281 16.479  20.924  1.00 92.84  ? 263 GLU B O     1 
ATOM   5810 C  CB    . GLU B 1 263 ? -35.227 15.857  24.035  1.00 105.45 ? 263 GLU B CB    1 
ATOM   5811 C  CG    . GLU B 1 263 ? -34.073 16.825  24.293  1.00 106.37 ? 263 GLU B CG    1 
ATOM   5812 C  CD    . GLU B 1 263 ? -32.852 16.159  24.908  1.00 108.46 ? 263 GLU B CD    1 
ATOM   5813 O  OE1   . GLU B 1 263 ? -32.610 16.363  26.117  1.00 113.11 ? 263 GLU B OE1   1 
ATOM   5814 O  OE2   . GLU B 1 263 ? -32.133 15.434  24.186  1.00 105.63 ? 263 GLU B OE2   1 
ATOM   5815 N  N     . PRO B 1 264 ? -36.553 16.438  21.079  1.00 92.81  ? 264 PRO B N     1 
ATOM   5816 C  CA    . PRO B 1 264 ? -36.819 17.426  20.024  1.00 88.63  ? 264 PRO B CA    1 
ATOM   5817 C  C     . PRO B 1 264 ? -35.924 18.667  20.086  1.00 88.12  ? 264 PRO B C     1 
ATOM   5818 O  O     . PRO B 1 264 ? -35.421 19.112  19.053  1.00 84.63  ? 264 PRO B O     1 
ATOM   5819 C  CB    . PRO B 1 264 ? -38.277 17.810  20.280  1.00 90.29  ? 264 PRO B CB    1 
ATOM   5820 C  CG    . PRO B 1 264 ? -38.885 16.560  20.811  1.00 92.25  ? 264 PRO B CG    1 
ATOM   5821 C  CD    . PRO B 1 264 ? -37.807 15.856  21.600  1.00 94.75  ? 264 PRO B CD    1 
ATOM   5822 N  N     . GLU B 1 265 ? -35.727 19.201  21.291  1.00 91.45  ? 265 GLU B N     1 
ATOM   5823 C  CA    . GLU B 1 265 ? -34.914 20.398  21.519  1.00 91.61  ? 265 GLU B CA    1 
ATOM   5824 C  C     . GLU B 1 265 ? -33.460 20.241  21.046  1.00 88.68  ? 265 GLU B C     1 
ATOM   5825 O  O     . GLU B 1 265 ? -32.899 21.158  20.450  1.00 86.79  ? 265 GLU B O     1 
ATOM   5826 C  CB    . GLU B 1 265 ? -34.963 20.782  23.005  1.00 97.62  ? 265 GLU B CB    1 
ATOM   5827 C  CG    . GLU B 1 265 ? -34.561 22.225  23.334  1.00 100.31 ? 265 GLU B CG    1 
ATOM   5828 C  CD    . GLU B 1 265 ? -35.600 23.254  22.901  1.00 100.78 ? 265 GLU B CD    1 
ATOM   5829 O  OE1   . GLU B 1 265 ? -36.236 23.876  23.787  1.00 104.65 ? 265 GLU B OE1   1 
ATOM   5830 O  OE2   . GLU B 1 265 ? -35.779 23.439  21.673  1.00 96.72  ? 265 GLU B OE2   1 
ATOM   5831 N  N     . ARG B 1 266 ? -32.867 19.078  21.312  1.00 88.13  ? 266 ARG B N     1 
ATOM   5832 C  CA    . ARG B 1 266 ? -31.499 18.773  20.883  1.00 85.68  ? 266 ARG B CA    1 
ATOM   5833 C  C     . ARG B 1 266 ? -31.416 18.612  19.368  1.00 79.52  ? 266 ARG B C     1 
ATOM   5834 O  O     . ARG B 1 266 ? -30.438 19.025  18.747  1.00 77.87  ? 266 ARG B O     1 
ATOM   5835 C  CB    . ARG B 1 266 ? -30.975 17.509  21.582  1.00 88.40  ? 266 ARG B CB    1 
ATOM   5836 C  CG    . ARG B 1 266 ? -29.519 17.163  21.252  1.00 88.88  ? 266 ARG B CG    1 
ATOM   5837 C  CD    . ARG B 1 266 ? -28.846 16.315  22.334  1.00 95.30  ? 266 ARG B CD    1 
ATOM   5838 N  NE    . ARG B 1 266 ? -27.386 16.318  22.196  1.00 96.96  ? 266 ARG B NE    1 
ATOM   5839 C  CZ    . ARG B 1 266 ? -26.682 15.417  21.510  1.00 95.99  ? 266 ARG B CZ    1 
ATOM   5840 N  NH1   . ARG B 1 266 ? -27.288 14.408  20.887  1.00 93.88  ? 266 ARG B NH1   1 
ATOM   5841 N  NH2   . ARG B 1 266 ? -25.361 15.522  21.448  1.00 96.90  ? 266 ARG B NH2   1 
ATOM   5842 N  N     . LEU B 1 267 ? -32.448 18.011  18.783  1.00 76.02  ? 267 LEU B N     1 
ATOM   5843 C  CA    . LEU B 1 267 ? -32.502 17.787  17.341  1.00 70.26  ? 267 LEU B CA    1 
ATOM   5844 C  C     . LEU B 1 267 ? -32.573 19.114  16.600  1.00 67.19  ? 267 LEU B C     1 
ATOM   5845 O  O     . LEU B 1 267 ? -31.763 19.379  15.711  1.00 64.95  ? 267 LEU B O     1 
ATOM   5846 C  CB    . LEU B 1 267 ? -33.707 16.915  16.991  1.00 69.10  ? 267 LEU B CB    1 
ATOM   5847 C  CG    . LEU B 1 267 ? -33.575 15.846  15.905  1.00 66.36  ? 267 LEU B CG    1 
ATOM   5848 C  CD1   . LEU B 1 267 ? -32.346 14.973  16.120  1.00 68.04  ? 267 LEU B CD1   1 
ATOM   5849 C  CD2   . LEU B 1 267 ? -34.829 14.984  15.885  1.00 66.13  ? 267 LEU B CD2   1 
ATOM   5850 N  N     . ARG B 1 268 ? -33.531 19.953  16.988  1.00 66.99  ? 268 ARG B N     1 
ATOM   5851 C  CA    . ARG B 1 268 ? -33.636 21.300  16.454  1.00 64.70  ? 268 ARG B CA    1 
ATOM   5852 C  C     . ARG B 1 268 ? -32.275 22.012  16.521  1.00 64.23  ? 268 ARG B C     1 
ATOM   5853 O  O     . ARG B 1 268 ? -31.852 22.633  15.550  1.00 61.63  ? 268 ARG B O     1 
ATOM   5854 C  CB    . ARG B 1 268 ? -34.728 22.081  17.187  1.00 67.36  ? 268 ARG B CB    1 
ATOM   5855 C  CG    . ARG B 1 268 ? -35.051 23.419  16.552  1.00 67.22  ? 268 ARG B CG    1 
ATOM   5856 C  CD    . ARG B 1 268 ? -35.835 24.333  17.478  1.00 72.39  ? 268 ARG B CD    1 
ATOM   5857 N  NE    . ARG B 1 268 ? -35.361 24.306  18.870  1.00 78.26  ? 268 ARG B NE    1 
ATOM   5858 C  CZ    . ARG B 1 268 ? -34.289 24.950  19.343  1.00 79.94  ? 268 ARG B CZ    1 
ATOM   5859 N  NH1   . ARG B 1 268 ? -33.526 25.698  18.551  1.00 76.99  ? 268 ARG B NH1   1 
ATOM   5860 N  NH2   . ARG B 1 268 ? -33.978 24.840  20.628  1.00 83.48  ? 268 ARG B NH2   1 
ATOM   5861 N  N     . LYS B 1 269 ? -31.589 21.883  17.655  1.00 66.54  ? 269 LYS B N     1 
ATOM   5862 C  CA    . LYS B 1 269 ? -30.241 22.428  17.834  1.00 66.72  ? 269 LYS B CA    1 
ATOM   5863 C  C     . LYS B 1 269 ? -29.219 21.878  16.831  1.00 63.11  ? 269 LYS B C     1 
ATOM   5864 O  O     . LYS B 1 269 ? -28.470 22.644  16.229  1.00 61.67  ? 269 LYS B O     1 
ATOM   5865 C  CB    . LYS B 1 269 ? -29.752 22.222  19.276  1.00 71.47  ? 269 LYS B CB    1 
ATOM   5866 C  CG    . LYS B 1 269 ? -29.491 23.513  20.064  1.00 75.15  ? 269 LYS B CG    1 
ATOM   5867 C  CD    . LYS B 1 269 ? -28.262 24.237  19.510  1.00 75.40  ? 269 LYS B CD    1 
ATOM   5868 C  CE    . LYS B 1 269 ? -27.956 25.540  20.237  1.00 79.35  ? 269 LYS B CE    1 
ATOM   5869 N  NZ    . LYS B 1 269 ? -27.184 25.317  21.490  1.00 84.35  ? 269 LYS B NZ    1 
ATOM   5870 N  N     . ILE B 1 270 ? -29.195 20.557  16.659  1.00 61.53  ? 270 ILE B N     1 
ATOM   5871 C  CA    . ILE B 1 270 ? -28.345 19.907  15.656  1.00 58.36  ? 270 ILE B CA    1 
ATOM   5872 C  C     . ILE B 1 270 ? -28.671 20.468  14.272  1.00 54.34  ? 270 ILE B C     1 
ATOM   5873 O  O     . ILE B 1 270 ? -27.780 20.905  13.542  1.00 53.25  ? 270 ILE B O     1 
ATOM   5874 C  CB    . ILE B 1 270 ? -28.529 18.344  15.650  1.00 58.32  ? 270 ILE B CB    1 
ATOM   5875 C  CG1   . ILE B 1 270 ? -28.137 17.700  17.002  1.00 62.32  ? 270 ILE B CG1   1 
ATOM   5876 C  CG2   . ILE B 1 270 ? -27.801 17.687  14.468  1.00 55.55  ? 270 ILE B CG2   1 
ATOM   5877 C  CD1   . ILE B 1 270 ? -26.627 17.537  17.281  1.00 63.28  ? 270 ILE B CD1   1 
ATOM   5878 N  N     . VAL B 1 271 ? -29.953 20.480  13.924  1.00 52.27  ? 271 VAL B N     1 
ATOM   5879 C  CA    . VAL B 1 271 ? -30.370 20.912  12.597  1.00 48.65  ? 271 VAL B CA    1 
ATOM   5880 C  C     . VAL B 1 271 ? -30.042 22.366  12.319  1.00 48.54  ? 271 VAL B C     1 
ATOM   5881 O  O     . VAL B 1 271 ? -29.592 22.696  11.217  1.00 46.72  ? 271 VAL B O     1 
ATOM   5882 C  CB    . VAL B 1 271 ? -31.859 20.640  12.354  1.00 47.80  ? 271 VAL B CB    1 
ATOM   5883 C  CG1   . VAL B 1 271 ? -32.370 21.388  11.111  1.00 44.79  ? 271 VAL B CG1   1 
ATOM   5884 C  CG2   . VAL B 1 271 ? -32.088 19.139  12.222  1.00 46.95  ? 271 VAL B CG2   1 
ATOM   5885 N  N     . GLU B 1 272 ? -30.254 23.230  13.311  1.00 50.81  ? 272 GLU B N     1 
ATOM   5886 C  CA    . GLU B 1 272 ? -30.010 24.660  13.131  1.00 51.29  ? 272 GLU B CA    1 
ATOM   5887 C  C     . GLU B 1 272 ? -28.513 24.925  12.999  1.00 50.43  ? 272 GLU B C     1 
ATOM   5888 O  O     . GLU B 1 272 ? -28.100 25.760  12.203  1.00 49.22  ? 272 GLU B O     1 
ATOM   5889 C  CB    . GLU B 1 272 ? -30.695 25.507  14.222  1.00 54.19  ? 272 GLU B CB    1 
ATOM   5890 C  CG    . GLU B 1 272 ? -29.883 25.779  15.491  1.00 59.51  ? 272 GLU B CG    1 
ATOM   5891 C  CD    . GLU B 1 272 ? -30.742 25.857  16.771  1.00 64.10  ? 272 GLU B CD    1 
ATOM   5892 O  OE1   . GLU B 1 272 ? -31.858 25.269  16.788  1.00 67.06  ? 272 GLU B OE1   1 
ATOM   5893 O  OE2   . GLU B 1 272 ? -30.291 26.487  17.772  1.00 69.94  ? 272 GLU B OE2   1 
ATOM   5894 N  N     . GLU B 1 273 ? -27.708 24.178  13.752  1.00 51.52  ? 273 GLU B N     1 
ATOM   5895 C  CA    . GLU B 1 273 ? -26.253 24.240  13.633  1.00 51.55  ? 273 GLU B CA    1 
ATOM   5896 C  C     . GLU B 1 273 ? -25.792 23.719  12.279  1.00 48.09  ? 273 GLU B C     1 
ATOM   5897 O  O     . GLU B 1 273 ? -24.844 24.242  11.690  1.00 47.71  ? 273 GLU B O     1 
ATOM   5898 C  CB    . GLU B 1 273 ? -25.573 23.467  14.767  1.00 54.52  ? 273 GLU B CB    1 
ATOM   5899 C  CG    . GLU B 1 273 ? -25.263 24.342  15.982  1.00 59.56  ? 273 GLU B CG    1 
ATOM   5900 C  CD    . GLU B 1 273 ? -25.149 23.572  17.304  1.00 65.10  ? 273 GLU B CD    1 
ATOM   5901 O  OE1   . GLU B 1 273 ? -25.155 22.313  17.300  1.00 65.33  ? 273 GLU B OE1   1 
ATOM   5902 O  OE2   . GLU B 1 273 ? -25.055 24.245  18.360  1.00 68.79  ? 273 GLU B OE2   1 
ATOM   5903 N  N     . ARG B 1 274 ? -26.480 22.696  11.782  1.00 45.59  ? 274 ARG B N     1 
ATOM   5904 C  CA    . ARG B 1 274 ? -26.185 22.153  10.465  1.00 42.39  ? 274 ARG B CA    1 
ATOM   5905 C  C     . ARG B 1 274 ? -26.540 23.111  9.337   1.00 39.95  ? 274 ARG B C     1 
ATOM   5906 O  O     . ARG B 1 274 ? -25.910 23.071  8.283   1.00 38.76  ? 274 ARG B O     1 
ATOM   5907 C  CB    . ARG B 1 274 ? -26.903 20.829  10.264  1.00 41.48  ? 274 ARG B CB    1 
ATOM   5908 C  CG    . ARG B 1 274 ? -26.121 19.648  10.737  1.00 41.72  ? 274 ARG B CG    1 
ATOM   5909 C  CD    . ARG B 1 274 ? -26.882 18.391  10.422  1.00 40.36  ? 274 ARG B CD    1 
ATOM   5910 N  NE    . ARG B 1 274 ? -25.983 17.254  10.307  1.00 40.47  ? 274 ARG B NE    1 
ATOM   5911 C  CZ    . ARG B 1 274 ? -25.945 16.426  9.271   1.00 38.65  ? 274 ARG B CZ    1 
ATOM   5912 N  NH1   . ARG B 1 274 ? -26.775 16.579  8.255   1.00 33.72  ? 274 ARG B NH1   1 
ATOM   5913 N  NH2   . ARG B 1 274 ? -25.079 15.424  9.271   1.00 41.36  ? 274 ARG B NH2   1 
ATOM   5914 N  N     . GLY B 1 275 ? -27.551 23.949  9.558   1.00 39.38  ? 275 GLY B N     1 
ATOM   5915 C  CA    . GLY B 1 275 ? -27.940 24.980  8.597   1.00 37.68  ? 275 GLY B CA    1 
ATOM   5916 C  C     . GLY B 1 275 ? -28.683 24.452  7.379   1.00 35.04  ? 275 GLY B C     1 
ATOM   5917 O  O     . GLY B 1 275 ? -28.864 25.170  6.390   1.00 33.75  ? 275 GLY B O     1 
ATOM   5918 N  N     . THR B 1 276 ? -29.124 23.199  7.463   1.00 34.27  ? 276 THR B N     1 
ATOM   5919 C  CA    . THR B 1 276 ? -29.824 22.526  6.368   1.00 32.32  ? 276 THR B CA    1 
ATOM   5920 C  C     . THR B 1 276 ? -31.345 22.706  6.378   1.00 32.21  ? 276 THR B C     1 
ATOM   5921 O  O     . THR B 1 276 ? -31.919 23.274  7.311   1.00 33.56  ? 276 THR B O     1 
ATOM   5922 C  CB    . THR B 1 276 ? -29.551 21.010  6.367   1.00 32.12  ? 276 THR B CB    1 
ATOM   5923 O  OG1   . THR B 1 276 ? -29.767 20.478  7.684   1.00 33.82  ? 276 THR B OG1   1 
ATOM   5924 C  CG2   . THR B 1 276 ? -28.134 20.699  5.888   1.00 31.46  ? 276 THR B CG2   1 
ATOM   5925 N  N     . ALA B 1 277 ? -31.976 22.219  5.312   1.00 30.82  ? 277 ALA B N     1 
ATOM   5926 C  CA    . ALA B 1 277 ? -33.411 22.146  5.212   1.00 30.94  ? 277 ALA B CA    1 
ATOM   5927 C  C     . ALA B 1 277 ? -33.787 20.697  5.474   1.00 31.14  ? 277 ALA B C     1 
ATOM   5928 O  O     . ALA B 1 277 ? -33.402 19.811  4.701   1.00 30.63  ? 277 ALA B O     1 
ATOM   5929 C  CB    . ALA B 1 277 ? -33.849 22.564  3.833   1.00 30.00  ? 277 ALA B CB    1 
ATOM   5930 N  N     . VAL B 1 278 ? -34.510 20.453  6.572   1.00 32.31  ? 278 VAL B N     1 
ATOM   5931 C  CA    . VAL B 1 278 ? -34.940 19.105  6.951   1.00 32.13  ? 278 VAL B CA    1 
ATOM   5932 C  C     . VAL B 1 278 ? -36.455 19.078  7.014   1.00 32.88  ? 278 VAL B C     1 
ATOM   5933 O  O     . VAL B 1 278 ? -37.070 19.869  7.738   1.00 34.90  ? 278 VAL B O     1 
ATOM   5934 C  CB    . VAL B 1 278 ? -34.387 18.679  8.321   1.00 33.80  ? 278 VAL B CB    1 
ATOM   5935 C  CG1   . VAL B 1 278 ? -34.859 17.277  8.671   1.00 33.66  ? 278 VAL B CG1   1 
ATOM   5936 C  CG2   . VAL B 1 278 ? -32.866 18.760  8.349   1.00 33.80  ? 278 VAL B CG2   1 
ATOM   5937 N  N     . PHE B 1 279 ? -37.055 18.164  6.260   1.00 31.92  ? 279 PHE B N     1 
ATOM   5938 C  CA    . PHE B 1 279 ? -38.506 18.094  6.133   1.00 32.31  ? 279 PHE B CA    1 
ATOM   5939 C  C     . PHE B 1 279 ? -38.878 16.671  5.764   1.00 31.94  ? 279 PHE B C     1 
ATOM   5940 O  O     . PHE B 1 279 ? -38.031 15.923  5.272   1.00 31.06  ? 279 PHE B O     1 
ATOM   5941 C  CB    . PHE B 1 279 ? -39.002 19.052  5.040   1.00 31.82  ? 279 PHE B CB    1 
ATOM   5942 C  CG    . PHE B 1 279 ? -38.488 18.714  3.656   1.00 30.12  ? 279 PHE B CG    1 
ATOM   5943 C  CD1   . PHE B 1 279 ? -39.203 17.870  2.820   1.00 29.91  ? 279 PHE B CD1   1 
ATOM   5944 C  CD2   . PHE B 1 279 ? -37.281 19.231  3.203   1.00 28.96  ? 279 PHE B CD2   1 
ATOM   5945 C  CE1   . PHE B 1 279 ? -38.722 17.541  1.554   1.00 29.13  ? 279 PHE B CE1   1 
ATOM   5946 C  CE2   . PHE B 1 279 ? -36.795 18.906  1.952   1.00 28.53  ? 279 PHE B CE2   1 
ATOM   5947 C  CZ    . PHE B 1 279 ? -37.519 18.061  1.122   1.00 28.57  ? 279 PHE B CZ    1 
ATOM   5948 N  N     . ALA B 1 280 ? -40.143 16.314  5.987   1.00 32.91  ? 280 ALA B N     1 
ATOM   5949 C  CA    . ALA B 1 280 ? -40.654 14.998  5.621   1.00 33.15  ? 280 ALA B CA    1 
ATOM   5950 C  C     . ALA B 1 280 ? -41.916 15.055  4.747   1.00 33.44  ? 280 ALA B C     1 
ATOM   5951 O  O     . ALA B 1 280 ? -42.653 16.053  4.770   1.00 34.66  ? 280 ALA B O     1 
ATOM   5952 C  CB    . ALA B 1 280 ? -40.916 14.171  6.868   1.00 34.30  ? 280 ALA B CB    1 
ATOM   5953 N  N     . VAL B 1 281 ? -42.142 13.989  3.976   1.00 32.61  ? 281 VAL B N     1 
ATOM   5954 C  CA    . VAL B 1 281 ? -43.418 13.766  3.313   1.00 33.18  ? 281 VAL B CA    1 
ATOM   5955 C  C     . VAL B 1 281 ? -44.163 12.728  4.128   1.00 34.27  ? 281 VAL B C     1 
ATOM   5956 O  O     . VAL B 1 281 ? -43.715 11.586  4.255   1.00 34.30  ? 281 VAL B O     1 
ATOM   5957 C  CB    . VAL B 1 281 ? -43.263 13.227  1.881   1.00 32.44  ? 281 VAL B CB    1 
ATOM   5958 C  CG1   . VAL B 1 281 ? -44.634 12.915  1.285   1.00 33.50  ? 281 VAL B CG1   1 
ATOM   5959 C  CG2   . VAL B 1 281 ? -42.509 14.224  0.992   1.00 32.71  ? 281 VAL B CG2   1 
ATOM   5960 N  N     . LYS B 1 282 ? -45.302 13.126  4.682   1.00 35.67  ? 282 LYS B N     1 
ATOM   5961 C  CA    . LYS B 1 282 ? -46.088 12.256  5.545   1.00 36.75  ? 282 LYS B CA    1 
ATOM   5962 C  C     . LYS B 1 282 ? -47.388 11.940  4.839   1.00 37.35  ? 282 LYS B C     1 
ATOM   5963 O  O     . LYS B 1 282 ? -48.075 12.835  4.346   1.00 38.20  ? 282 LYS B O     1 
ATOM   5964 C  CB    . LYS B 1 282 ? -46.352 12.947  6.890   1.00 38.82  ? 282 LYS B CB    1 
ATOM   5965 C  CG    . LYS B 1 282 ? -47.373 12.281  7.803   1.00 40.99  ? 282 LYS B CG    1 
ATOM   5966 C  CD    . LYS B 1 282 ? -48.129 13.355  8.551   1.00 44.58  ? 282 LYS B CD    1 
ATOM   5967 C  CE    . LYS B 1 282 ? -49.208 12.793  9.448   1.00 47.43  ? 282 LYS B CE    1 
ATOM   5968 N  NZ    . LYS B 1 282 ? -48.636 12.282  10.716  1.00 49.79  ? 282 LYS B NZ    1 
ATOM   5969 N  N     . PHE B 1 283 ? -47.719 10.659  4.788   1.00 37.13  ? 283 PHE B N     1 
ATOM   5970 C  CA    . PHE B 1 283 ? -48.927 10.214  4.127   1.00 37.59  ? 283 PHE B CA    1 
ATOM   5971 C  C     . PHE B 1 283 ? -49.399 8.931   4.779   1.00 38.54  ? 283 PHE B C     1 
ATOM   5972 O  O     . PHE B 1 283 ? -48.669 8.321   5.551   1.00 38.21  ? 283 PHE B O     1 
ATOM   5973 C  CB    . PHE B 1 283 ? -48.671 10.013  2.632   1.00 36.30  ? 283 PHE B CB    1 
ATOM   5974 C  CG    . PHE B 1 283 ? -47.522 9.094   2.328   1.00 34.63  ? 283 PHE B CG    1 
ATOM   5975 C  CD1   . PHE B 1 283 ? -47.749 7.750   2.030   1.00 34.41  ? 283 PHE B CD1   1 
ATOM   5976 C  CD2   . PHE B 1 283 ? -46.212 9.570   2.330   1.00 31.81  ? 283 PHE B CD2   1 
ATOM   5977 C  CE1   . PHE B 1 283 ? -46.683 6.896   1.747   1.00 34.01  ? 283 PHE B CE1   1 
ATOM   5978 C  CE2   . PHE B 1 283 ? -45.144 8.725   2.048   1.00 31.06  ? 283 PHE B CE2   1 
ATOM   5979 C  CZ    . PHE B 1 283 ? -45.377 7.385   1.755   1.00 32.59  ? 283 PHE B CZ    1 
ATOM   5980 N  N     . ARG B 1 284 ? -50.625 8.531   4.467   1.00 39.97  ? 284 ARG B N     1 
ATOM   5981 C  CA    . ARG B 1 284 ? -51.234 7.371   5.099   1.00 41.70  ? 284 ARG B CA    1 
ATOM   5982 C  C     . ARG B 1 284 ? -50.560 6.107   4.595   1.00 40.07  ? 284 ARG B C     1 
ATOM   5983 O  O     . ARG B 1 284 ? -50.367 5.931   3.393   1.00 39.39  ? 284 ARG B O     1 
ATOM   5984 C  CB    . ARG B 1 284 ? -52.737 7.337   4.810   1.00 43.54  ? 284 ARG B CB    1 
ATOM   5985 C  CG    . ARG B 1 284 ? -53.591 6.898   5.992   1.00 47.17  ? 284 ARG B CG    1 
ATOM   5986 C  CD    . ARG B 1 284 ? -55.068 7.269   5.802   1.00 49.99  ? 284 ARG B CD    1 
ATOM   5987 N  NE    . ARG B 1 284 ? -55.284 8.720   5.730   1.00 54.02  ? 284 ARG B NE    1 
ATOM   5988 C  CZ    . ARG B 1 284 ? -55.687 9.480   6.751   1.00 57.27  ? 284 ARG B CZ    1 
ATOM   5989 N  NH1   . ARG B 1 284 ? -55.923 8.936   7.945   1.00 58.83  ? 284 ARG B NH1   1 
ATOM   5990 N  NH2   . ARG B 1 284 ? -55.854 10.791  6.579   1.00 57.73  ? 284 ARG B NH2   1 
ATOM   5991 N  N     . LYS B 1 285 ? -50.182 5.241   5.524   1.00 40.20  ? 285 LYS B N     1 
ATOM   5992 C  CA    . LYS B 1 285 ? -49.555 3.971   5.190   1.00 39.30  ? 285 LYS B CA    1 
ATOM   5993 C  C     . LYS B 1 285 ? -50.565 3.068   4.509   1.00 39.96  ? 285 LYS B C     1 
ATOM   5994 O  O     . LYS B 1 285 ? -51.623 2.821   5.069   1.00 41.70  ? 285 LYS B O     1 
ATOM   5995 C  CB    . LYS B 1 285 ? -49.062 3.292   6.459   1.00 40.44  ? 285 LYS B CB    1 
ATOM   5996 C  CG    . LYS B 1 285 ? -48.231 2.076   6.196   1.00 40.64  ? 285 LYS B CG    1 
ATOM   5997 C  CD    . LYS B 1 285 ? -47.689 1.499   7.482   1.00 42.89  ? 285 LYS B CD    1 
ATOM   5998 C  CE    . LYS B 1 285 ? -48.341 0.176   7.846   1.00 43.99  ? 285 LYS B CE    1 
ATOM   5999 N  NZ    . LYS B 1 285 ? -47.454 -0.527  8.815   1.00 45.91  ? 285 LYS B NZ    1 
ATOM   6000 N  N     . PRO B 1 286 ? -50.258 2.592   3.289   1.00 38.98  ? 286 PRO B N     1 
ATOM   6001 C  CA    . PRO B 1 286 ? -51.161 1.656   2.619   1.00 39.99  ? 286 PRO B CA    1 
ATOM   6002 C  C     . PRO B 1 286 ? -51.162 0.292   3.296   1.00 41.41  ? 286 PRO B C     1 
ATOM   6003 O  O     . PRO B 1 286 ? -50.126 -0.173  3.765   1.00 41.23  ? 286 PRO B O     1 
ATOM   6004 C  CB    . PRO B 1 286 ? -50.583 1.559   1.209   1.00 38.97  ? 286 PRO B CB    1 
ATOM   6005 C  CG    . PRO B 1 286 ? -49.168 1.909   1.351   1.00 37.70  ? 286 PRO B CG    1 
ATOM   6006 C  CD    . PRO B 1 286 ? -49.083 2.913   2.461   1.00 37.21  ? 286 PRO B CD    1 
ATOM   6007 N  N     . ASP B 1 287 ? -52.329 -0.337  3.354   1.00 43.42  ? 287 ASP B N     1 
ATOM   6008 C  CA    . ASP B 1 287 ? -52.482 -1.616  4.044   1.00 45.13  ? 287 ASP B CA    1 
ATOM   6009 C  C     . ASP B 1 287 ? -51.850 -2.766  3.252   1.00 45.40  ? 287 ASP B C     1 
ATOM   6010 O  O     . ASP B 1 287 ? -52.557 -3.543  2.614   1.00 46.76  ? 287 ASP B O     1 
ATOM   6011 C  CB    . ASP B 1 287 ? -53.964 -1.893  4.302   1.00 47.21  ? 287 ASP B CB    1 
ATOM   6012 C  CG    . ASP B 1 287 ? -54.185 -3.044  5.261   1.00 49.62  ? 287 ASP B CG    1 
ATOM   6013 O  OD1   . ASP B 1 287 ? -53.216 -3.475  5.916   1.00 49.74  ? 287 ASP B OD1   1 
ATOM   6014 O  OD2   . ASP B 1 287 ? -55.335 -3.518  5.363   1.00 52.14  ? 287 ASP B OD2   1 
ATOM   6015 N  N     . ILE B 1 288 ? -50.520 -2.860  3.290   1.00 44.50  ? 288 ILE B N     1 
ATOM   6016 C  CA    . ILE B 1 288 ? -49.784 -3.922  2.586   1.00 45.18  ? 288 ILE B CA    1 
ATOM   6017 C  C     . ILE B 1 288 ? -48.656 -4.514  3.435   1.00 45.78  ? 288 ILE B C     1 
ATOM   6018 O  O     . ILE B 1 288 ? -48.208 -3.883  4.380   1.00 44.99  ? 288 ILE B O     1 
ATOM   6019 C  CB    . ILE B 1 288 ? -49.225 -3.439  1.207   1.00 44.13  ? 288 ILE B CB    1 
ATOM   6020 C  CG1   . ILE B 1 288 ? -48.285 -2.234  1.369   1.00 41.53  ? 288 ILE B CG1   1 
ATOM   6021 C  CG2   . ILE B 1 288 ? -50.375 -3.141  0.237   1.00 44.42  ? 288 ILE B CG2   1 
ATOM   6022 C  CD1   . ILE B 1 288 ? -47.512 -1.874  0.115   1.00 40.38  ? 288 ILE B CD1   1 
ATOM   6023 N  N     . VAL B 1 289 ? -48.199 -5.719  3.090   1.00 47.64  ? 289 VAL B N     1 
ATOM   6024 C  CA    . VAL B 1 289 ? -47.086 -6.367  3.801   1.00 49.04  ? 289 VAL B CA    1 
ATOM   6025 C  C     . VAL B 1 289 ? -45.775 -5.615  3.624   1.00 47.93  ? 289 VAL B C     1 
ATOM   6026 O  O     . VAL B 1 289 ? -45.636 -4.782  2.716   1.00 46.03  ? 289 VAL B O     1 
ATOM   6027 C  CB    . VAL B 1 289 ? -46.859 -7.821  3.353   1.00 51.65  ? 289 VAL B CB    1 
ATOM   6028 C  CG1   . VAL B 1 289 ? -48.035 -8.709  3.763   1.00 53.81  ? 289 VAL B CG1   1 
ATOM   6029 C  CG2   . VAL B 1 289 ? -46.599 -7.895  1.847   1.00 51.43  ? 289 VAL B CG2   1 
ATOM   6030 N  N     . ASP B 1 290 ? -44.815 -5.932  4.491   1.00 49.43  ? 290 ASP B N     1 
ATOM   6031 C  CA    . ASP B 1 290 ? -43.514 -5.274  4.515   1.00 48.78  ? 290 ASP B CA    1 
ATOM   6032 C  C     . ASP B 1 290 ? -42.768 -5.343  3.185   1.00 48.67  ? 290 ASP B C     1 
ATOM   6033 O  O     . ASP B 1 290 ? -42.217 -4.341  2.708   1.00 46.84  ? 290 ASP B O     1 
ATOM   6034 C  CB    . ASP B 1 290 ? -42.660 -5.868  5.629   1.00 51.12  ? 290 ASP B CB    1 
ATOM   6035 C  CG    . ASP B 1 290 ? -42.872 -5.169  6.955   1.00 52.08  ? 290 ASP B CG    1 
ATOM   6036 O  OD1   . ASP B 1 290 ? -43.689 -4.218  7.000   1.00 50.23  ? 290 ASP B OD1   1 
ATOM   6037 O  OD2   . ASP B 1 290 ? -42.215 -5.564  7.953   1.00 56.24  ? 290 ASP B OD2   1 
ATOM   6038 N  N     . ASP B 1 291 ? -42.785 -6.527  2.587   1.00 51.03  ? 291 ASP B N     1 
ATOM   6039 C  CA    . ASP B 1 291 ? -42.038 -6.821  1.372   1.00 51.95  ? 291 ASP B CA    1 
ATOM   6040 C  C     . ASP B 1 291 ? -42.617 -6.160  0.117   1.00 50.07  ? 291 ASP B C     1 
ATOM   6041 O  O     . ASP B 1 291 ? -41.968 -6.119  -0.930  1.00 50.71  ? 291 ASP B O     1 
ATOM   6042 C  CB    . ASP B 1 291 ? -41.939 -8.330  1.205   1.00 55.71  ? 291 ASP B CB    1 
ATOM   6043 C  CG    . ASP B 1 291 ? -41.664 -9.033  2.523   1.00 58.99  ? 291 ASP B CG    1 
ATOM   6044 O  OD1   . ASP B 1 291 ? -42.613 -9.208  3.324   1.00 60.50  ? 291 ASP B OD1   1 
ATOM   6045 O  OD2   . ASP B 1 291 ? -40.496 -9.402  2.763   1.00 62.40  ? 291 ASP B OD2   1 
ATOM   6046 N  N     . ASN B 1 292 ? -43.836 -5.644  0.223   1.00 48.18  ? 292 ASN B N     1 
ATOM   6047 C  CA    . ASN B 1 292 ? -44.372 -4.793  -0.826  1.00 46.45  ? 292 ASN B CA    1 
ATOM   6048 C  C     . ASN B 1 292 ? -44.192 -3.303  -0.509  1.00 43.55  ? 292 ASN B C     1 
ATOM   6049 O  O     . ASN B 1 292 ? -44.193 -2.461  -1.409  1.00 42.19  ? 292 ASN B O     1 
ATOM   6050 C  CB    . ASN B 1 292 ? -45.831 -5.143  -1.106  1.00 47.00  ? 292 ASN B CB    1 
ATOM   6051 C  CG    . ASN B 1 292 ? -45.989 -6.542  -1.676  1.00 50.42  ? 292 ASN B CG    1 
ATOM   6052 O  OD1   . ASN B 1 292 ? -45.041 -7.117  -2.213  1.00 52.81  ? 292 ASN B OD1   1 
ATOM   6053 N  ND2   . ASN B 1 292 ? -47.189 -7.100  -1.556  1.00 52.04  ? 292 ASN B ND2   1 
ATOM   6054 N  N     . LEU B 1 293 ? -44.012 -2.992  0.772   1.00 42.72  ? 293 LEU B N     1 
ATOM   6055 C  CA    . LEU B 1 293 ? -43.969 -1.617  1.216   1.00 40.33  ? 293 LEU B CA    1 
ATOM   6056 C  C     . LEU B 1 293 ? -42.567 -1.052  1.096   1.00 39.80  ? 293 LEU B C     1 
ATOM   6057 O  O     . LEU B 1 293 ? -42.349 -0.054  0.405   1.00 38.40  ? 293 LEU B O     1 
ATOM   6058 C  CB    . LEU B 1 293 ? -44.489 -1.489  2.656   1.00 40.54  ? 293 LEU B CB    1 
ATOM   6059 C  CG    . LEU B 1 293 ? -44.516 -0.088  3.306   1.00 38.70  ? 293 LEU B CG    1 
ATOM   6060 C  CD1   . LEU B 1 293 ? -45.235 0.961   2.449   1.00 36.57  ? 293 LEU B CD1   1 
ATOM   6061 C  CD2   . LEU B 1 293 ? -45.129 -0.151  4.693   1.00 39.25  ? 293 LEU B CD2   1 
ATOM   6062 N  N     . TYR B 1 294 ? -41.612 -1.694  1.757   1.00 41.01  ? 294 TYR B N     1 
ATOM   6063 C  CA    . TYR B 1 294 ? -40.275 -1.134  1.826   1.00 40.56  ? 294 TYR B CA    1 
ATOM   6064 C  C     . TYR B 1 294 ? -39.634 -0.832  0.472   1.00 40.32  ? 294 TYR B C     1 
ATOM   6065 O  O     . TYR B 1 294 ? -39.075 0.255   0.307   1.00 39.10  ? 294 TYR B O     1 
ATOM   6066 C  CB    . TYR B 1 294 ? -39.385 -1.925  2.778   1.00 42.70  ? 294 TYR B CB    1 
ATOM   6067 C  CG    . TYR B 1 294 ? -39.790 -1.645  4.202   1.00 42.81  ? 294 TYR B CG    1 
ATOM   6068 C  CD1   . TYR B 1 294 ? -40.634 -2.506  4.898   1.00 44.33  ? 294 TYR B CD1   1 
ATOM   6069 C  CD2   . TYR B 1 294 ? -39.372 -0.481  4.836   1.00 42.08  ? 294 TYR B CD2   1 
ATOM   6070 C  CE1   . TYR B 1 294 ? -41.024 -2.222  6.201   1.00 45.43  ? 294 TYR B CE1   1 
ATOM   6071 C  CE2   . TYR B 1 294 ? -39.756 -0.185  6.135   1.00 42.76  ? 294 TYR B CE2   1 
ATOM   6072 C  CZ    . TYR B 1 294 ? -40.580 -1.051  6.812   1.00 44.38  ? 294 TYR B CZ    1 
ATOM   6073 O  OH    . TYR B 1 294 ? -40.943 -0.736  8.102   1.00 45.75  ? 294 TYR B OH    1 
ATOM   6074 N  N     . PRO B 1 295 ? -39.761 -1.744  -0.516  1.00 41.76  ? 295 PRO B N     1 
ATOM   6075 C  CA    . PRO B 1 295 ? -39.225 -1.385  -1.826  1.00 41.78  ? 295 PRO B CA    1 
ATOM   6076 C  C     . PRO B 1 295 ? -39.948 -0.177  -2.424  1.00 39.74  ? 295 PRO B C     1 
ATOM   6077 O  O     . PRO B 1 295 ? -39.339 0.626   -3.128  1.00 39.15  ? 295 PRO B O     1 
ATOM   6078 C  CB    . PRO B 1 295 ? -39.489 -2.628  -2.675  1.00 44.28  ? 295 PRO B CB    1 
ATOM   6079 C  CG    . PRO B 1 295 ? -39.775 -3.713  -1.718  1.00 46.01  ? 295 PRO B CG    1 
ATOM   6080 C  CD    . PRO B 1 295 ? -40.375 -3.082  -0.525  1.00 43.90  ? 295 PRO B CD    1 
ATOM   6081 N  N     . GLN B 1 296 ? -41.237 -0.045  -2.143  1.00 39.11  ? 296 GLN B N     1 
ATOM   6082 C  CA    . GLN B 1 296 ? -41.990 1.093   -2.646  1.00 37.95  ? 296 GLN B CA    1 
ATOM   6083 C  C     . GLN B 1 296 ? -41.598 2.377   -1.930  1.00 36.68  ? 296 GLN B C     1 
ATOM   6084 O  O     . GLN B 1 296 ? -41.508 3.416   -2.563  1.00 35.60  ? 296 GLN B O     1 
ATOM   6085 C  CB    . GLN B 1 296 ? -43.490 0.864   -2.512  1.00 37.75  ? 296 GLN B CB    1 
ATOM   6086 C  CG    . GLN B 1 296 ? -44.095 0.087   -3.637  1.00 38.33  ? 296 GLN B CG    1 
ATOM   6087 C  CD    . GLN B 1 296 ? -45.586 0.045   -3.527  1.00 37.65  ? 296 GLN B CD    1 
ATOM   6088 O  OE1   . GLN B 1 296 ? -46.237 1.080   -3.359  1.00 35.09  ? 296 GLN B OE1   1 
ATOM   6089 N  NE2   . GLN B 1 296 ? -46.150 -1.157  -3.610  1.00 39.07  ? 296 GLN B NE2   1 
ATOM   6090 N  N     . LEU B 1 297 ? -41.379 2.296   -0.614  1.00 37.28  ? 297 LEU B N     1 
ATOM   6091 C  CA    . LEU B 1 297 ? -40.896 3.432   0.170   1.00 36.61  ? 297 LEU B CA    1 
ATOM   6092 C  C     . LEU B 1 297 ? -39.533 3.885   -0.303  1.00 37.00  ? 297 LEU B C     1 
ATOM   6093 O  O     . LEU B 1 297 ? -39.156 5.035   -0.121  1.00 36.10  ? 297 LEU B O     1 
ATOM   6094 C  CB    . LEU B 1 297 ? -40.797 3.080   1.649   1.00 36.98  ? 297 LEU B CB    1 
ATOM   6095 C  CG    . LEU B 1 297 ? -42.082 3.219   2.457   1.00 37.22  ? 297 LEU B CG    1 
ATOM   6096 C  CD1   . LEU B 1 297 ? -41.799 2.892   3.909   1.00 37.92  ? 297 LEU B CD1   1 
ATOM   6097 C  CD2   . LEU B 1 297 ? -42.673 4.617   2.326   1.00 35.56  ? 297 LEU B CD2   1 
ATOM   6098 N  N     . GLU B 1 298 ? -38.803 2.967   -0.914  1.00 39.31  ? 298 GLU B N     1 
ATOM   6099 C  CA    . GLU B 1 298 ? -37.471 3.233   -1.399  1.00 40.66  ? 298 GLU B CA    1 
ATOM   6100 C  C     . GLU B 1 298 ? -37.541 4.027   -2.692  1.00 40.25  ? 298 GLU B C     1 
ATOM   6101 O  O     . GLU B 1 298 ? -36.637 4.808   -3.000  1.00 39.82  ? 298 GLU B O     1 
ATOM   6102 C  CB    . GLU B 1 298 ? -36.787 1.905   -1.663  1.00 43.27  ? 298 GLU B CB    1 
ATOM   6103 C  CG    . GLU B 1 298 ? -35.334 1.873   -1.320  1.00 46.89  ? 298 GLU B CG    1 
ATOM   6104 C  CD    . GLU B 1 298 ? -34.836 0.449   -1.129  1.00 53.98  ? 298 GLU B CD    1 
ATOM   6105 O  OE1   . GLU B 1 298 ? -33.618 0.206   -1.335  1.00 57.82  ? 298 GLU B OE1   1 
ATOM   6106 O  OE2   . GLU B 1 298 ? -35.662 -0.434  -0.781  1.00 55.86  ? 298 GLU B OE2   1 
ATOM   6107 N  N     . ARG B 1 299 ? -38.642 3.843   -3.421  1.00 40.71  ? 299 ARG B N     1 
ATOM   6108 C  CA    . ARG B 1 299 ? -38.722 4.231   -4.819  1.00 41.31  ? 299 ARG B CA    1 
ATOM   6109 C  C     . ARG B 1 299 ? -38.527 5.691   -5.226  1.00 40.66  ? 299 ARG B C     1 
ATOM   6110 O  O     . ARG B 1 299 ? -37.456 5.987   -5.745  1.00 41.76  ? 299 ARG B O     1 
ATOM   6111 C  CB    . ARG B 1 299 ? -39.949 3.662   -5.511  1.00 42.34  ? 299 ARG B CB    1 
ATOM   6112 C  CG    . ARG B 1 299 ? -39.688 3.389   -6.966  1.00 43.81  ? 299 ARG B CG    1 
ATOM   6113 C  CD    . ARG B 1 299 ? -40.910 3.588   -7.830  1.00 43.04  ? 299 ARG B CD    1 
ATOM   6114 N  NE    . ARG B 1 299 ? -40.641 3.058   -9.158  1.00 45.23  ? 299 ARG B NE    1 
ATOM   6115 C  CZ    . ARG B 1 299 ? -40.183 3.757   -10.193 1.00 46.02  ? 299 ARG B CZ    1 
ATOM   6116 N  NH1   . ARG B 1 299 ? -39.954 5.055   -10.104 1.00 44.69  ? 299 ARG B NH1   1 
ATOM   6117 N  NH2   . ARG B 1 299 ? -39.966 3.145   -11.345 1.00 50.22  ? 299 ARG B NH2   1 
ATOM   6118 N  N     . ALA B 1 300 ? -39.441 6.650   -5.012  1.00 39.63  ? 300 ALA B N     1 
ATOM   6119 C  CA    . ALA B 1 300 ? -40.323 6.945   -3.873  1.00 38.24  ? 300 ALA B CA    1 
ATOM   6120 C  C     . ALA B 1 300 ? -39.421 7.879   -3.103  1.00 37.21  ? 300 ALA B C     1 
ATOM   6121 O  O     . ALA B 1 300 ? -39.389 9.086   -3.371  1.00 36.42  ? 300 ALA B O     1 
ATOM   6122 C  CB    . ALA B 1 300 ? -40.702 5.773   -3.075  1.00 38.78  ? 300 ALA B CB    1 
ATOM   6123 N  N     . SER B 1 301 ? -38.625 7.312   -2.206  1.00 37.46  ? 301 SER B N     1 
ATOM   6124 C  CA    . SER B 1 301 ? -37.577 8.069   -1.552  1.00 36.90  ? 301 SER B CA    1 
ATOM   6125 C  C     . SER B 1 301 ? -36.518 8.499   -2.576  1.00 37.07  ? 301 SER B C     1 
ATOM   6126 O  O     . SER B 1 301 ? -36.004 9.621   -2.512  1.00 36.60  ? 301 SER B O     1 
ATOM   6127 C  CB    . SER B 1 301 ? -36.944 7.227   -0.452  1.00 37.71  ? 301 SER B CB    1 
ATOM   6128 O  OG    . SER B 1 301 ? -35.781 7.845   0.066   1.00 39.10  ? 301 SER B OG    1 
ATOM   6129 N  N     . ARG B 1 302 ? -36.204 7.609   -3.517  1.00 38.10  ? 302 ARG B N     1 
ATOM   6130 C  CA    . ARG B 1 302 ? -35.128 7.837   -4.489  1.00 38.72  ? 302 ARG B CA    1 
ATOM   6131 C  C     . ARG B 1 302 ? -35.544 8.832   -5.573  1.00 37.89  ? 302 ARG B C     1 
ATOM   6132 O  O     . ARG B 1 302 ? -34.762 9.687   -5.974  1.00 37.91  ? 302 ARG B O     1 
ATOM   6133 C  CB    . ARG B 1 302 ? -34.694 6.505   -5.120  1.00 40.85  ? 302 ARG B CB    1 
ATOM   6134 C  CG    . ARG B 1 302 ? -33.530 6.595   -6.079  1.00 42.96  ? 302 ARG B CG    1 
ATOM   6135 C  CD    . ARG B 1 302 ? -33.312 5.290   -6.829  1.00 46.29  ? 302 ARG B CD    1 
ATOM   6136 N  NE    . ARG B 1 302 ? -34.042 5.238   -8.097  1.00 49.71  ? 302 ARG B NE    1 
ATOM   6137 C  CZ    . ARG B 1 302 ? -35.012 4.369   -8.394  1.00 52.09  ? 302 ARG B CZ    1 
ATOM   6138 N  NH1   . ARG B 1 302 ? -35.403 3.438   -7.520  1.00 52.50  ? 302 ARG B NH1   1 
ATOM   6139 N  NH2   . ARG B 1 302 ? -35.594 4.423   -9.586  1.00 53.96  ? 302 ARG B NH2   1 
ATOM   6140 N  N     . LYS B 1 303 ? -36.782 8.713   -6.038  1.00 37.33  ? 303 LYS B N     1 
ATOM   6141 C  CA    . LYS B 1 303 ? -37.267 9.527   -7.137  1.00 36.90  ? 303 LYS B CA    1 
ATOM   6142 C  C     . LYS B 1 303 ? -37.411 10.979  -6.715  1.00 35.22  ? 303 LYS B C     1 
ATOM   6143 O  O     . LYS B 1 303 ? -37.135 11.889  -7.499  1.00 35.76  ? 303 LYS B O     1 
ATOM   6144 C  CB    . LYS B 1 303 ? -38.598 8.985   -7.652  1.00 37.69  ? 303 LYS B CB    1 
ATOM   6145 C  CG    . LYS B 1 303 ? -38.498 7.626   -8.325  1.00 38.78  ? 303 LYS B CG    1 
ATOM   6146 C  CD    . LYS B 1 303 ? -37.776 7.691   -9.658  1.00 39.83  ? 303 LYS B CD    1 
ATOM   6147 C  CE    . LYS B 1 303 ? -38.633 8.347   -10.726 1.00 40.97  ? 303 LYS B CE    1 
ATOM   6148 N  NZ    . LYS B 1 303 ? -37.860 8.527   -11.999 1.00 43.96  ? 303 LYS B NZ    1 
ATOM   6149 N  N     . ILE B 1 304 ? -37.845 11.193  -5.476  1.00 33.30  ? 304 ILE B N     1 
ATOM   6150 C  CA    . ILE B 1 304 ? -37.907 12.534  -4.927  1.00 31.67  ? 304 ILE B CA    1 
ATOM   6151 C  C     . ILE B 1 304 ? -36.494 13.051  -4.682  1.00 31.35  ? 304 ILE B C     1 
ATOM   6152 O  O     . ILE B 1 304 ? -36.223 14.247  -4.854  1.00 30.77  ? 304 ILE B O     1 
ATOM   6153 C  CB    . ILE B 1 304 ? -38.730 12.578  -3.643  1.00 30.63  ? 304 ILE B CB    1 
ATOM   6154 C  CG1   . ILE B 1 304 ? -40.186 12.226  -3.951  1.00 31.36  ? 304 ILE B CG1   1 
ATOM   6155 C  CG2   . ILE B 1 304 ? -38.661 13.958  -3.014  1.00 29.56  ? 304 ILE B CG2   1 
ATOM   6156 C  CD1   . ILE B 1 304 ? -41.022 11.900  -2.720  1.00 30.53  ? 304 ILE B CD1   1 
ATOM   6157 N  N     . PHE B 1 305 ? -35.593 12.145  -4.303  1.00 31.62  ? 305 PHE B N     1 
ATOM   6158 C  CA    . PHE B 1 305 ? -34.214 12.524  -4.066  1.00 31.91  ? 305 PHE B CA    1 
ATOM   6159 C  C     . PHE B 1 305 ? -33.567 13.033  -5.349  1.00 33.29  ? 305 PHE B C     1 
ATOM   6160 O  O     . PHE B 1 305 ? -32.849 14.036  -5.329  1.00 33.26  ? 305 PHE B O     1 
ATOM   6161 C  CB    . PHE B 1 305 ? -33.405 11.372  -3.478  1.00 32.42  ? 305 PHE B CB    1 
ATOM   6162 C  CG    . PHE B 1 305 ? -32.003 11.761  -3.076  1.00 32.36  ? 305 PHE B CG    1 
ATOM   6163 C  CD1   . PHE B 1 305 ? -31.741 12.248  -1.800  1.00 31.11  ? 305 PHE B CD1   1 
ATOM   6164 C  CD2   . PHE B 1 305 ? -30.945 11.643  -3.973  1.00 33.28  ? 305 PHE B CD2   1 
ATOM   6165 C  CE1   . PHE B 1 305 ? -30.440 12.609  -1.427  1.00 32.19  ? 305 PHE B CE1   1 
ATOM   6166 C  CE2   . PHE B 1 305 ? -29.651 12.007  -3.609  1.00 33.28  ? 305 PHE B CE2   1 
ATOM   6167 C  CZ    . PHE B 1 305 ? -29.398 12.491  -2.336  1.00 32.48  ? 305 PHE B CZ    1 
ATOM   6168 N  N     . GLU B 1 306 ? -33.830 12.348  -6.456  1.00 35.04  ? 306 GLU B N     1 
ATOM   6169 C  CA    . GLU B 1 306 ? -33.310 12.761  -7.759  1.00 37.31  ? 306 GLU B CA    1 
ATOM   6170 C  C     . GLU B 1 306 ? -33.969 14.051  -8.252  1.00 37.11  ? 306 GLU B C     1 
ATOM   6171 O  O     . GLU B 1 306 ? -33.323 14.877  -8.910  1.00 37.98  ? 306 GLU B O     1 
ATOM   6172 C  CB    . GLU B 1 306 ? -33.483 11.654  -8.793  1.00 39.49  ? 306 GLU B CB    1 
ATOM   6173 C  CG    . GLU B 1 306 ? -32.671 10.407  -8.490  1.00 42.94  ? 306 GLU B CG    1 
ATOM   6174 C  CD    . GLU B 1 306 ? -33.187 9.170   -9.220  1.00 48.26  ? 306 GLU B CD    1 
ATOM   6175 O  OE1   . GLU B 1 306 ? -34.350 9.184   -9.705  1.00 49.69  ? 306 GLU B OE1   1 
ATOM   6176 O  OE2   . GLU B 1 306 ? -32.425 8.177   -9.303  1.00 50.58  ? 306 GLU B OE2   1 
ATOM   6177 N  N     . PHE B 1 307 ? -35.251 14.227  -7.932  1.00 36.26  ? 307 PHE B N     1 
ATOM   6178 C  CA    . PHE B 1 307 ? -35.924 15.465  -8.261  1.00 36.10  ? 307 PHE B CA    1 
ATOM   6179 C  C     . PHE B 1 307 ? -35.184 16.593  -7.584  1.00 35.39  ? 307 PHE B C     1 
ATOM   6180 O  O     . PHE B 1 307 ? -34.866 17.607  -8.208  1.00 36.79  ? 307 PHE B O     1 
ATOM   6181 C  CB    . PHE B 1 307 ? -37.382 15.461  -7.817  1.00 35.36  ? 307 PHE B CB    1 
ATOM   6182 C  CG    . PHE B 1 307 ? -37.988 16.835  -7.748  1.00 34.68  ? 307 PHE B CG    1 
ATOM   6183 C  CD1   . PHE B 1 307 ? -38.542 17.418  -8.879  1.00 35.08  ? 307 PHE B CD1   1 
ATOM   6184 C  CD2   . PHE B 1 307 ? -37.980 17.557  -6.554  1.00 32.56  ? 307 PHE B CD2   1 
ATOM   6185 C  CE1   . PHE B 1 307 ? -39.093 18.692  -8.824  1.00 35.25  ? 307 PHE B CE1   1 
ATOM   6186 C  CE2   . PHE B 1 307 ? -38.517 18.826  -6.492  1.00 33.03  ? 307 PHE B CE2   1 
ATOM   6187 C  CZ    . PHE B 1 307 ? -39.081 19.397  -7.633  1.00 34.92  ? 307 PHE B CZ    1 
ATOM   6188 N  N     . LEU B 1 308 ? -34.899 16.398  -6.306  1.00 34.11  ? 308 LEU B N     1 
ATOM   6189 C  CA    . LEU B 1 308 ? -34.222 17.404  -5.521  1.00 33.53  ? 308 LEU B CA    1 
ATOM   6190 C  C     . LEU B 1 308 ? -32.871 17.744  -6.103  1.00 34.71  ? 308 LEU B C     1 
ATOM   6191 O  O     . LEU B 1 308 ? -32.521 18.922  -6.188  1.00 34.65  ? 308 LEU B O     1 
ATOM   6192 C  CB    . LEU B 1 308 ? -34.087 16.952  -4.070  1.00 32.50  ? 308 LEU B CB    1 
ATOM   6193 C  CG    . LEU B 1 308 ? -35.359 17.149  -3.242  1.00 31.43  ? 308 LEU B CG    1 
ATOM   6194 C  CD1   . LEU B 1 308 ? -35.323 16.336  -1.965  1.00 30.80  ? 308 LEU B CD1   1 
ATOM   6195 C  CD2   . LEU B 1 308 ? -35.559 18.623  -2.945  1.00 31.33  ? 308 LEU B CD2   1 
ATOM   6196 N  N     . GLU B 1 309 ? -32.117 16.731  -6.525  1.00 36.11  ? 309 GLU B N     1 
ATOM   6197 C  CA    . GLU B 1 309 ? -30.796 17.028  -7.076  1.00 38.39  ? 309 GLU B CA    1 
ATOM   6198 C  C     . GLU B 1 309 ? -30.841 17.723  -8.428  1.00 38.96  ? 309 GLU B C     1 
ATOM   6199 O  O     . GLU B 1 309 ? -30.118 18.691  -8.626  1.00 39.67  ? 309 GLU B O     1 
ATOM   6200 C  CB    . GLU B 1 309 ? -29.807 15.855  -7.043  1.00 39.12  ? 309 GLU B CB    1 
ATOM   6201 C  CG    . GLU B 1 309 ? -30.329 14.511  -7.504  1.00 42.78  ? 309 GLU B CG    1 
ATOM   6202 C  CD    . GLU B 1 309 ? -29.199 13.498  -7.753  1.00 45.26  ? 309 GLU B CD    1 
ATOM   6203 O  OE1   . GLU B 1 309 ? -29.488 12.364  -8.231  1.00 49.66  ? 309 GLU B OE1   1 
ATOM   6204 O  OE2   . GLU B 1 309 ? -28.021 13.846  -7.476  1.00 48.67  ? 309 GLU B OE2   1 
ATOM   6205 N  N     . ARG B 1 310 ? -31.701 17.278  -9.339  1.00 39.57  ? 310 ARG B N     1 
ATOM   6206 C  CA    . ARG B 1 310 ? -31.761 17.932  -10.646 1.00 41.21  ? 310 ARG B CA    1 
ATOM   6207 C  C     . ARG B 1 310 ? -32.396 19.303  -10.495 1.00 40.51  ? 310 ARG B C     1 
ATOM   6208 O  O     . ARG B 1 310 ? -32.415 20.105  -11.430 1.00 42.17  ? 310 ARG B O     1 
ATOM   6209 C  CB    . ARG B 1 310 ? -32.481 17.080  -11.701 1.00 43.01  ? 310 ARG B CB    1 
ATOM   6210 C  CG    . ARG B 1 310 ? -33.956 17.375  -11.871 1.00 43.08  ? 310 ARG B CG    1 
ATOM   6211 C  CD    . ARG B 1 310 ? -34.585 16.508  -12.940 1.00 45.33  ? 310 ARG B CD    1 
ATOM   6212 N  NE    . ARG B 1 310 ? -35.998 16.271  -12.645 1.00 46.12  ? 310 ARG B NE    1 
ATOM   6213 C  CZ    . ARG B 1 310 ? -36.455 15.315  -11.835 1.00 45.70  ? 310 ARG B CZ    1 
ATOM   6214 N  NH1   . ARG B 1 310 ? -35.612 14.485  -11.231 1.00 44.94  ? 310 ARG B NH1   1 
ATOM   6215 N  NH2   . ARG B 1 310 ? -37.763 15.181  -11.628 1.00 46.06  ? 310 ARG B NH2   1 
ATOM   6216 N  N     . GLU B 1 311 ? -32.901 19.575  -9.301  1.00 38.46  ? 311 GLU B N     1 
ATOM   6217 C  CA    . GLU B 1 311 ? -33.523 20.855  -9.039  1.00 38.28  ? 311 GLU B CA    1 
ATOM   6218 C  C     . GLU B 1 311 ? -32.611 21.765  -8.230  1.00 37.17  ? 311 GLU B C     1 
ATOM   6219 O  O     . GLU B 1 311 ? -33.032 22.815  -7.760  1.00 37.38  ? 311 GLU B O     1 
ATOM   6220 C  CB    . GLU B 1 311 ? -34.859 20.648  -8.339  1.00 37.43  ? 311 GLU B CB    1 
ATOM   6221 C  CG    . GLU B 1 311 ? -35.904 21.684  -8.703  1.00 39.87  ? 311 GLU B CG    1 
ATOM   6222 C  CD    . GLU B 1 311 ? -36.240 21.718  -10.187 1.00 42.95  ? 311 GLU B CD    1 
ATOM   6223 O  OE1   . GLU B 1 311 ? -36.478 20.659  -10.798 1.00 43.57  ? 311 GLU B OE1   1 
ATOM   6224 O  OE2   . GLU B 1 311 ? -36.275 22.828  -10.743 1.00 46.02  ? 311 GLU B OE2   1 
ATOM   6225 N  N     . ASN B 1 312 ? -31.359 21.346  -8.076  1.00 36.79  ? 312 ASN B N     1 
ATOM   6226 C  CA    . ASN B 1 312 ? -30.305 22.121  -7.402  1.00 35.90  ? 312 ASN B CA    1 
ATOM   6227 C  C     . ASN B 1 312 ? -30.526 22.478  -5.936  1.00 34.32  ? 312 ASN B C     1 
ATOM   6228 O  O     . ASN B 1 312 ? -30.072 23.520  -5.468  1.00 34.39  ? 312 ASN B O     1 
ATOM   6229 C  CB    . ASN B 1 312 ? -29.940 23.366  -8.208  1.00 37.21  ? 312 ASN B CB    1 
ATOM   6230 C  CG    . ASN B 1 312 ? -29.346 23.024  -9.539  1.00 38.18  ? 312 ASN B CG    1 
ATOM   6231 O  OD1   . ASN B 1 312 ? -29.985 23.183  -10.573 1.00 38.08  ? 312 ASN B OD1   1 
ATOM   6232 N  ND2   . ASN B 1 312 ? -28.124 22.526  -9.523  1.00 38.58  ? 312 ASN B ND2   1 
ATOM   6233 N  N     . PHE B 1 313 ? -31.193 21.598  -5.206  1.00 33.29  ? 313 PHE B N     1 
ATOM   6234 C  CA    . PHE B 1 313 ? -31.357 21.810  -3.776  1.00 32.45  ? 313 PHE B CA    1 
ATOM   6235 C  C     . PHE B 1 313 ? -30.265 21.093  -3.010  1.00 32.13  ? 313 PHE B C     1 
ATOM   6236 O  O     . PHE B 1 313 ? -30.205 21.169  -1.775  1.00 31.77  ? 313 PHE B O     1 
ATOM   6237 C  CB    . PHE B 1 313 ? -32.755 21.398  -3.306  1.00 31.85  ? 313 PHE B CB    1 
ATOM   6238 C  CG    . PHE B 1 313 ? -33.843 22.303  -3.811  1.00 32.85  ? 313 PHE B CG    1 
ATOM   6239 C  CD1   . PHE B 1 313 ? -33.928 23.627  -3.366  1.00 33.25  ? 313 PHE B CD1   1 
ATOM   6240 C  CD2   . PHE B 1 313 ? -34.778 21.843  -4.736  1.00 32.83  ? 313 PHE B CD2   1 
ATOM   6241 C  CE1   . PHE B 1 313 ? -34.929 24.474  -3.832  1.00 34.12  ? 313 PHE B CE1   1 
ATOM   6242 C  CE2   . PHE B 1 313 ? -35.783 22.682  -5.205  1.00 33.70  ? 313 PHE B CE2   1 
ATOM   6243 C  CZ    . PHE B 1 313 ? -35.859 24.002  -4.752  1.00 34.61  ? 313 PHE B CZ    1 
ATOM   6244 N  N     . MET B 1 314 ? -29.401 20.414  -3.762  1.00 32.51  ? 314 MET B N     1 
ATOM   6245 C  CA    . MET B 1 314 ? -28.259 19.707  -3.208  1.00 33.37  ? 314 MET B CA    1 
ATOM   6246 C  C     . MET B 1 314 ? -28.644 18.868  -1.994  1.00 31.88  ? 314 MET B C     1 
ATOM   6247 O  O     . MET B 1 314 ? -28.220 19.159  -0.882  1.00 31.81  ? 314 MET B O     1 
ATOM   6248 C  CB    . MET B 1 314 ? -27.136 20.690  -2.846  1.00 33.83  ? 314 MET B CB    1 
ATOM   6249 C  CG    . MET B 1 314 ? -26.561 21.460  -4.029  1.00 35.56  ? 314 MET B CG    1 
ATOM   6250 S  SD    . MET B 1 314 ? -25.520 22.846  -3.501  1.00 37.84  ? 314 MET B SD    1 
ATOM   6251 C  CE    . MET B 1 314 ? -24.035 21.978  -2.959  1.00 40.15  ? 314 MET B CE    1 
ATOM   6252 N  N     . PRO B 1 315 ? -29.453 17.818  -2.202  1.00 31.40  ? 315 PRO B N     1 
ATOM   6253 C  CA    . PRO B 1 315 ? -29.813 16.984  -1.056  1.00 30.71  ? 315 PRO B CA    1 
ATOM   6254 C  C     . PRO B 1 315 ? -28.592 16.228  -0.523  1.00 31.45  ? 315 PRO B C     1 
ATOM   6255 O  O     . PRO B 1 315 ? -27.653 15.967  -1.274  1.00 32.31  ? 315 PRO B O     1 
ATOM   6256 C  CB    . PRO B 1 315 ? -30.835 16.018  -1.648  1.00 30.44  ? 315 PRO B CB    1 
ATOM   6257 C  CG    . PRO B 1 315 ? -30.464 15.934  -3.099  1.00 31.15  ? 315 PRO B CG    1 
ATOM   6258 C  CD    . PRO B 1 315 ? -30.056 17.320  -3.454  1.00 31.50  ? 315 PRO B CD    1 
ATOM   6259 N  N     . LEU B 1 316 ? -28.610 15.903  0.766   1.00 31.44  ? 316 LEU B N     1 
ATOM   6260 C  CA    . LEU B 1 316 ? -27.487 15.240  1.418   1.00 32.84  ? 316 LEU B CA    1 
ATOM   6261 C  C     . LEU B 1 316 ? -27.708 13.749  1.549   1.00 34.21  ? 316 LEU B C     1 
ATOM   6262 O  O     . LEU B 1 316 ? -26.858 12.958  1.144   1.00 35.96  ? 316 LEU B O     1 
ATOM   6263 C  CB    . LEU B 1 316 ? -27.256 15.832  2.797   1.00 32.76  ? 316 LEU B CB    1 
ATOM   6264 C  CG    . LEU B 1 316 ? -26.672 17.235  2.832   1.00 32.52  ? 316 LEU B CG    1 
ATOM   6265 C  CD1   . LEU B 1 316 ? -26.863 17.798  4.204   1.00 33.28  ? 316 LEU B CD1   1 
ATOM   6266 C  CD2   . LEU B 1 316 ? -25.203 17.203  2.469   1.00 33.00  ? 316 LEU B CD2   1 
ATOM   6267 N  N     . ARG B 1 317 ? -28.841 13.384  2.151   1.00 33.92  ? 317 ARG B N     1 
ATOM   6268 C  CA    . ARG B 1 317 ? -29.274 11.999  2.315   1.00 34.77  ? 317 ARG B CA    1 
ATOM   6269 C  C     . ARG B 1 317 ? -30.790 11.979  2.418   1.00 34.19  ? 317 ARG B C     1 
ATOM   6270 O  O     . ARG B 1 317 ? -31.435 13.036  2.547   1.00 33.16  ? 317 ARG B O     1 
ATOM   6271 C  CB    . ARG B 1 317 ? -28.701 11.366  3.581   1.00 36.02  ? 317 ARG B CB    1 
ATOM   6272 C  CG    . ARG B 1 317 ? -27.309 10.824  3.451   1.00 37.42  ? 317 ARG B CG    1 
ATOM   6273 C  CD    . ARG B 1 317 ? -26.859 10.199  4.755   1.00 37.33  ? 317 ARG B CD    1 
ATOM   6274 N  NE    . ARG B 1 317 ? -26.872 8.746   4.689   1.00 36.58  ? 317 ARG B NE    1 
ATOM   6275 C  CZ    . ARG B 1 317 ? -26.557 7.944   5.701   1.00 38.31  ? 317 ARG B CZ    1 
ATOM   6276 N  NH1   . ARG B 1 317 ? -26.221 8.443   6.886   1.00 37.37  ? 317 ARG B NH1   1 
ATOM   6277 N  NH2   . ARG B 1 317 ? -26.579 6.631   5.523   1.00 40.33  ? 317 ARG B NH2   1 
ATOM   6278 N  N     . SER B 1 318 ? -31.342 10.766  2.367   1.00 34.90  ? 318 SER B N     1 
ATOM   6279 C  CA    . SER B 1 318 ? -32.754 10.541  2.585   1.00 34.37  ? 318 SER B CA    1 
ATOM   6280 C  C     . SER B 1 318 ? -32.956 9.285   3.432   1.00 35.71  ? 318 SER B C     1 
ATOM   6281 O  O     . SER B 1 318 ? -32.056 8.465   3.570   1.00 37.56  ? 318 SER B O     1 
ATOM   6282 C  CB    . SER B 1 318 ? -33.479 10.423  1.246   1.00 33.70  ? 318 SER B CB    1 
ATOM   6283 O  OG    . SER B 1 318 ? -33.131 9.219   0.600   1.00 35.11  ? 318 SER B OG    1 
ATOM   6284 N  N     . ALA B 1 319 ? -34.142 9.154   4.009   1.00 35.49  ? 319 ALA B N     1 
ATOM   6285 C  CA    . ALA B 1 319 ? -34.496 8.003   4.826   1.00 37.03  ? 319 ALA B CA    1 
ATOM   6286 C  C     . ALA B 1 319 ? -36.013 7.903   4.887   1.00 36.57  ? 319 ALA B C     1 
ATOM   6287 O  O     . ALA B 1 319 ? -36.710 8.824   4.467   1.00 35.36  ? 319 ALA B O     1 
ATOM   6288 C  CB    . ALA B 1 319 ? -33.917 8.152   6.213   1.00 38.45  ? 319 ALA B CB    1 
ATOM   6289 N  N     . PHE B 1 320 ? -36.524 6.792   5.406   1.00 38.12  ? 320 PHE B N     1 
ATOM   6290 C  CA    . PHE B 1 320 ? -37.978 6.581   5.497   1.00 38.38  ? 320 PHE B CA    1 
ATOM   6291 C  C     . PHE B 1 320 ? -38.361 5.764   6.727   1.00 40.27  ? 320 PHE B C     1 
ATOM   6292 O  O     . PHE B 1 320 ? -37.573 4.952   7.215   1.00 42.02  ? 320 PHE B O     1 
ATOM   6293 C  CB    . PHE B 1 320 ? -38.532 5.934   4.213   1.00 37.85  ? 320 PHE B CB    1 
ATOM   6294 C  CG    . PHE B 1 320 ? -37.820 4.662   3.817   1.00 39.72  ? 320 PHE B CG    1 
ATOM   6295 C  CD1   . PHE B 1 320 ? -38.162 3.440   4.401   1.00 40.66  ? 320 PHE B CD1   1 
ATOM   6296 C  CD2   . PHE B 1 320 ? -36.800 4.689   2.864   1.00 39.14  ? 320 PHE B CD2   1 
ATOM   6297 C  CE1   . PHE B 1 320 ? -37.497 2.278   4.045   1.00 42.09  ? 320 PHE B CE1   1 
ATOM   6298 C  CE2   . PHE B 1 320 ? -36.131 3.523   2.505   1.00 40.57  ? 320 PHE B CE2   1 
ATOM   6299 C  CZ    . PHE B 1 320 ? -36.478 2.320   3.096   1.00 42.06  ? 320 PHE B CZ    1 
ATOM   6300 N  N     . LYS B 1 321 ? -39.575 5.988   7.220   1.00 40.68  ? 321 LYS B N     1 
ATOM   6301 C  CA    . LYS B 1 321 ? -40.068 5.315   8.428   1.00 42.79  ? 321 LYS B CA    1 
ATOM   6302 C  C     . LYS B 1 321 ? -41.508 4.871   8.219   1.00 43.18  ? 321 LYS B C     1 
ATOM   6303 O  O     . LYS B 1 321 ? -42.334 5.627   7.690   1.00 42.16  ? 321 LYS B O     1 
ATOM   6304 C  CB    . LYS B 1 321 ? -39.971 6.247   9.647   1.00 43.48  ? 321 LYS B CB    1 
ATOM   6305 C  CG    . LYS B 1 321 ? -39.831 5.554   10.994  1.00 46.04  ? 321 LYS B CG    1 
ATOM   6306 C  CD    . LYS B 1 321 ? -41.182 5.206   11.618  1.00 48.44  ? 321 LYS B CD    1 
ATOM   6307 C  CE    . LYS B 1 321 ? -41.043 4.312   12.844  1.00 51.60  ? 321 LYS B CE    1 
ATOM   6308 N  NZ    . LYS B 1 321 ? -40.720 5.102   14.055  1.00 53.80  ? 321 LYS B NZ    1 
ATOM   6309 N  N     . ALA B 1 322 ? -41.806 3.642   8.629   1.00 45.19  ? 322 ALA B N     1 
ATOM   6310 C  CA    . ALA B 1 322 ? -43.175 3.151   8.609   1.00 46.08  ? 322 ALA B CA    1 
ATOM   6311 C  C     . ALA B 1 322 ? -43.731 3.001   10.028  1.00 48.71  ? 322 ALA B C     1 
ATOM   6312 O  O     . ALA B 1 322 ? -43.106 2.381   10.892  1.00 50.81  ? 322 ALA B O     1 
ATOM   6313 C  CB    . ALA B 1 322 ? -43.252 1.841   7.851   1.00 46.46  ? 322 ALA B CB    1 
ATOM   6314 N  N     . SER B 1 323 ? -44.905 3.581   10.255  1.00 49.32  ? 323 SER B N     1 
ATOM   6315 C  CA    . SER B 1 323 ? -45.590 3.493   11.542  1.00 52.48  ? 323 SER B CA    1 
ATOM   6316 C  C     . SER B 1 323 ? -46.822 2.605   11.489  1.00 53.97  ? 323 SER B C     1 
ATOM   6317 O  O     . SER B 1 323 ? -47.101 1.979   10.466  1.00 52.86  ? 323 SER B O     1 
ATOM   6318 C  CB    . SER B 1 323 ? -46.009 4.884   12.000  1.00 52.67  ? 323 SER B CB    1 
ATOM   6319 O  OG    . SER B 1 323 ? -44.963 5.482   12.731  1.00 54.50  ? 323 SER B OG    1 
ATOM   6320 N  N     . GLU B 1 324 ? -47.550 2.551   12.606  1.00 56.93  ? 324 GLU B N     1 
ATOM   6321 C  CA    . GLU B 1 324 ? -48.910 2.020   12.625  1.00 58.57  ? 324 GLU B CA    1 
ATOM   6322 C  C     . GLU B 1 324 ? -49.689 2.590   11.442  1.00 56.39  ? 324 GLU B C     1 
ATOM   6323 O  O     . GLU B 1 324 ? -50.013 1.855   10.510  1.00 55.63  ? 324 GLU B O     1 
ATOM   6324 C  CB    . GLU B 1 324 ? -49.620 2.402   13.924  1.00 62.00  ? 324 GLU B CB    1 
ATOM   6325 C  CG    . GLU B 1 324 ? -49.312 1.509   15.119  1.00 66.74  ? 324 GLU B CG    1 
ATOM   6326 C  CD    . GLU B 1 324 ? -50.337 0.403   15.310  1.00 70.53  ? 324 GLU B CD    1 
ATOM   6327 O  OE1   . GLU B 1 324 ? -51.102 0.133   14.355  1.00 69.97  ? 324 GLU B OE1   1 
ATOM   6328 O  OE2   . GLU B 1 324 ? -50.377 -0.195  16.416  1.00 74.09  ? 324 GLU B OE2   1 
ATOM   6329 N  N     . GLU B 1 325 ? -49.938 3.904   11.460  1.00 55.56  ? 325 GLU B N     1 
ATOM   6330 C  CA    . GLU B 1 325 ? -50.855 4.531   10.498  1.00 54.29  ? 325 GLU B CA    1 
ATOM   6331 C  C     . GLU B 1 325 ? -50.257 5.449   9.412   1.00 50.61  ? 325 GLU B C     1 
ATOM   6332 O  O     . GLU B 1 325 ? -50.969 5.825   8.481   1.00 49.92  ? 325 GLU B O     1 
ATOM   6333 C  CB    . GLU B 1 325 ? -52.051 5.197   11.222  1.00 57.36  ? 325 GLU B CB    1 
ATOM   6334 C  CG    . GLU B 1 325 ? -51.734 6.430   12.096  1.00 60.29  ? 325 GLU B CG    1 
ATOM   6335 C  CD    . GLU B 1 325 ? -51.587 6.127   13.597  1.00 65.63  ? 325 GLU B CD    1 
ATOM   6336 O  OE1   . GLU B 1 325 ? -50.537 6.490   14.187  1.00 65.33  ? 325 GLU B OE1   1 
ATOM   6337 O  OE2   . GLU B 1 325 ? -52.528 5.540   14.187  1.00 69.84  ? 325 GLU B OE2   1 
ATOM   6338 N  N     . PHE B 1 326 ? -48.972 5.799   9.516   1.00 48.42  ? 326 PHE B N     1 
ATOM   6339 C  CA    . PHE B 1 326 ? -48.341 6.750   8.580   1.00 45.01  ? 326 PHE B CA    1 
ATOM   6340 C  C     . PHE B 1 326 ? -46.980 6.323   8.066   1.00 43.31  ? 326 PHE B C     1 
ATOM   6341 O  O     . PHE B 1 326 ? -46.298 5.510   8.680   1.00 44.36  ? 326 PHE B O     1 
ATOM   6342 C  CB    . PHE B 1 326 ? -48.164 8.119   9.232   1.00 44.84  ? 326 PHE B CB    1 
ATOM   6343 C  CG    . PHE B 1 326 ? -49.444 8.796   9.578   1.00 45.45  ? 326 PHE B CG    1 
ATOM   6344 C  CD1   . PHE B 1 326 ? -49.815 8.956   10.899  1.00 47.08  ? 326 PHE B CD1   1 
ATOM   6345 C  CD2   . PHE B 1 326 ? -50.283 9.274   8.584   1.00 43.90  ? 326 PHE B CD2   1 
ATOM   6346 C  CE1   . PHE B 1 326 ? -51.006 9.578   11.223  1.00 49.24  ? 326 PHE B CE1   1 
ATOM   6347 C  CE2   . PHE B 1 326 ? -51.477 9.898   8.897   1.00 44.87  ? 326 PHE B CE2   1 
ATOM   6348 C  CZ    . PHE B 1 326 ? -51.838 10.054  10.212  1.00 48.73  ? 326 PHE B CZ    1 
ATOM   6349 N  N     . CYS B 1 327 ? -46.578 6.918   6.949   1.00 41.34  ? 327 CYS B N     1 
ATOM   6350 C  CA    . CYS B 1 327 ? -45.234 6.751   6.404   1.00 39.90  ? 327 CYS B CA    1 
ATOM   6351 C  C     . CYS B 1 327 ? -44.580 8.100   6.243   1.00 38.35  ? 327 CYS B C     1 
ATOM   6352 O  O     . CYS B 1 327 ? -45.261 9.112   6.054   1.00 38.53  ? 327 CYS B O     1 
ATOM   6353 C  CB    . CYS B 1 327 ? -45.279 6.050   5.053   1.00 39.18  ? 327 CYS B CB    1 
ATOM   6354 S  SG    . CYS B 1 327 ? -45.856 4.345   5.161   1.00 43.02  ? 327 CYS B SG    1 
ATOM   6355 N  N     . TYR B 1 328 ? -43.255 8.113   6.320   1.00 37.24  ? 328 TYR B N     1 
ATOM   6356 C  CA    . TYR B 1 328 ? -42.501 9.355   6.265   1.00 35.74  ? 328 TYR B CA    1 
ATOM   6357 C  C     . TYR B 1 328 ? -41.333 9.198   5.341   1.00 34.68  ? 328 TYR B C     1 
ATOM   6358 O  O     . TYR B 1 328 ? -40.523 8.291   5.520   1.00 35.51  ? 328 TYR B O     1 
ATOM   6359 C  CB    . TYR B 1 328 ? -41.968 9.713   7.642   1.00 36.52  ? 328 TYR B CB    1 
ATOM   6360 C  CG    . TYR B 1 328 ? -43.030 9.839   8.690   1.00 37.79  ? 328 TYR B CG    1 
ATOM   6361 C  CD1   . TYR B 1 328 ? -43.474 8.719   9.396   1.00 39.23  ? 328 TYR B CD1   1 
ATOM   6362 C  CD2   . TYR B 1 328 ? -43.591 11.074  8.989   1.00 37.46  ? 328 TYR B CD2   1 
ATOM   6363 C  CE1   . TYR B 1 328 ? -44.457 8.827   10.367  1.00 41.03  ? 328 TYR B CE1   1 
ATOM   6364 C  CE2   . TYR B 1 328 ? -44.572 11.192  9.959   1.00 40.37  ? 328 TYR B CE2   1 
ATOM   6365 C  CZ    . TYR B 1 328 ? -44.997 10.065  10.645  1.00 41.60  ? 328 TYR B CZ    1 
ATOM   6366 O  OH    . TYR B 1 328 ? -45.964 10.174  11.608  1.00 44.71  ? 328 TYR B OH    1 
ATOM   6367 N  N     . LEU B 1 329 ? -41.258 10.067  4.343   1.00 33.52  ? 329 LEU B N     1 
ATOM   6368 C  CA    . LEU B 1 329 ? -40.068 10.176  3.517   1.00 32.88  ? 329 LEU B CA    1 
ATOM   6369 C  C     . LEU B 1 329 ? -39.272 11.364  4.029   1.00 32.87  ? 329 LEU B C     1 
ATOM   6370 O  O     . LEU B 1 329 ? -39.747 12.507  4.016   1.00 32.57  ? 329 LEU B O     1 
ATOM   6371 C  CB    . LEU B 1 329 ? -40.440 10.349  2.048   1.00 32.32  ? 329 LEU B CB    1 
ATOM   6372 C  CG    . LEU B 1 329 ? -41.409 9.301   1.499   1.00 33.06  ? 329 LEU B CG    1 
ATOM   6373 C  CD1   . LEU B 1 329 ? -41.742 9.619   0.066   1.00 32.44  ? 329 LEU B CD1   1 
ATOM   6374 C  CD2   . LEU B 1 329 ? -40.828 7.891   1.620   1.00 34.18  ? 329 LEU B CD2   1 
ATOM   6375 N  N     . LEU B 1 330 ? -38.067 11.083  4.509   1.00 33.45  ? 330 LEU B N     1 
ATOM   6376 C  CA    . LEU B 1 330 ? -37.257 12.083  5.193   1.00 33.64  ? 330 LEU B CA    1 
ATOM   6377 C  C     . LEU B 1 330 ? -36.153 12.628  4.305   1.00 32.75  ? 330 LEU B C     1 
ATOM   6378 O  O     . LEU B 1 330 ? -35.436 11.867  3.663   1.00 33.01  ? 330 LEU B O     1 
ATOM   6379 C  CB    . LEU B 1 330 ? -36.669 11.464  6.450   1.00 35.03  ? 330 LEU B CB    1 
ATOM   6380 C  CG    . LEU B 1 330 ? -37.757 11.151  7.468   1.00 36.47  ? 330 LEU B CG    1 
ATOM   6381 C  CD1   . LEU B 1 330 ? -37.459 9.860   8.225   1.00 38.71  ? 330 LEU B CD1   1 
ATOM   6382 C  CD2   . LEU B 1 330 ? -37.914 12.331  8.412   1.00 37.52  ? 330 LEU B CD2   1 
ATOM   6383 N  N     . PHE B 1 331 ? -36.026 13.946  4.257   1.00 32.34  ? 331 PHE B N     1 
ATOM   6384 C  CA    . PHE B 1 331 ? -35.000 14.569  3.423   1.00 31.99  ? 331 PHE B CA    1 
ATOM   6385 C  C     . PHE B 1 331 ? -34.270 15.690  4.131   1.00 32.37  ? 331 PHE B C     1 
ATOM   6386 O  O     . PHE B 1 331 ? -34.845 16.388  4.971   1.00 33.02  ? 331 PHE B O     1 
ATOM   6387 C  CB    . PHE B 1 331 ? -35.599 15.102  2.120   1.00 31.17  ? 331 PHE B CB    1 
ATOM   6388 C  CG    . PHE B 1 331 ? -36.305 14.064  1.315   1.00 31.07  ? 331 PHE B CG    1 
ATOM   6389 C  CD1   . PHE B 1 331 ? -35.598 13.243  0.447   1.00 31.73  ? 331 PHE B CD1   1 
ATOM   6390 C  CD2   . PHE B 1 331 ? -37.673 13.896  1.430   1.00 30.48  ? 331 PHE B CD2   1 
ATOM   6391 C  CE1   . PHE B 1 331 ? -36.250 12.270  -0.300  1.00 31.97  ? 331 PHE B CE1   1 
ATOM   6392 C  CE2   . PHE B 1 331 ? -38.332 12.925  0.695   1.00 31.02  ? 331 PHE B CE2   1 
ATOM   6393 C  CZ    . PHE B 1 331 ? -37.621 12.112  -0.173  1.00 31.47  ? 331 PHE B CZ    1 
ATOM   6394 N  N     . GLU B 1 332 ? -32.998 15.848  3.768   1.00 32.56  ? 332 GLU B N     1 
ATOM   6395 C  CA    . GLU B 1 332 ? -32.176 16.973  4.185   1.00 32.84  ? 332 GLU B CA    1 
ATOM   6396 C  C     . GLU B 1 332 ? -31.410 17.543  2.998   1.00 32.05  ? 332 GLU B C     1 
ATOM   6397 O  O     . GLU B 1 332 ? -30.694 16.818  2.311   1.00 32.07  ? 332 GLU B O     1 
ATOM   6398 C  CB    . GLU B 1 332 ? -31.192 16.553  5.265   1.00 34.30  ? 332 GLU B CB    1 
ATOM   6399 C  CG    . GLU B 1 332 ? -30.300 17.692  5.723   1.00 35.69  ? 332 GLU B CG    1 
ATOM   6400 C  CD    . GLU B 1 332 ? -29.267 17.253  6.721   1.00 38.85  ? 332 GLU B CD    1 
ATOM   6401 O  OE1   . GLU B 1 332 ? -28.750 16.126  6.563   1.00 41.60  ? 332 GLU B OE1   1 
ATOM   6402 O  OE2   . GLU B 1 332 ? -28.962 18.024  7.660   1.00 40.35  ? 332 GLU B OE2   1 
ATOM   6403 N  N     . CYS B 1 333 ? -31.554 18.849  2.784   1.00 31.80  ? 333 CYS B N     1 
ATOM   6404 C  CA    . CYS B 1 333 ? -30.929 19.543  1.654   1.00 31.41  ? 333 CYS B CA    1 
ATOM   6405 C  C     . CYS B 1 333 ? -30.067 20.670  2.138   1.00 31.14  ? 333 CYS B C     1 
ATOM   6406 O  O     . CYS B 1 333 ? -30.313 21.224  3.200   1.00 31.63  ? 333 CYS B O     1 
ATOM   6407 C  CB    . CYS B 1 333 ? -31.993 20.103  0.733   1.00 30.97  ? 333 CYS B CB    1 
ATOM   6408 S  SG    . CYS B 1 333 ? -33.081 18.804  0.140   1.00 34.09  ? 333 CYS B SG    1 
ATOM   6409 N  N     . GLN B 1 334 ? -29.057 21.006  1.349   1.00 30.63  ? 334 GLN B N     1 
ATOM   6410 C  CA    . GLN B 1 334 ? -28.116 22.051  1.706   1.00 30.76  ? 334 GLN B CA    1 
ATOM   6411 C  C     . GLN B 1 334 ? -28.692 23.409  1.397   1.00 30.00  ? 334 GLN B C     1 
ATOM   6412 O  O     . GLN B 1 334 ? -28.243 24.403  1.938   1.00 31.02  ? 334 GLN B O     1 
ATOM   6413 C  CB    . GLN B 1 334 ? -26.811 21.889  0.930   1.00 31.41  ? 334 GLN B CB    1 
ATOM   6414 C  CG    . GLN B 1 334 ? -26.103 20.557  1.133   1.00 32.68  ? 334 GLN B CG    1 
ATOM   6415 C  CD    . GLN B 1 334 ? -24.717 20.522  0.504   1.00 34.15  ? 334 GLN B CD    1 
ATOM   6416 O  OE1   . GLN B 1 334 ? -24.287 19.488  -0.009  1.00 36.63  ? 334 GLN B OE1   1 
ATOM   6417 N  NE2   . GLN B 1 334 ? -24.010 21.651  0.546   1.00 34.61  ? 334 GLN B NE2   1 
ATOM   6418 N  N     . ILE B 1 335 ? -29.669 23.453  0.501   1.00 28.87  ? 335 ILE B N     1 
ATOM   6419 C  CA    . ILE B 1 335 ? -30.269 24.705  0.096   1.00 28.89  ? 335 ILE B CA    1 
ATOM   6420 C  C     . ILE B 1 335 ? -31.677 24.850  0.657   1.00 28.74  ? 335 ILE B C     1 
ATOM   6421 O  O     . ILE B 1 335 ? -32.562 24.097  0.306   1.00 28.36  ? 335 ILE B O     1 
ATOM   6422 C  CB    . ILE B 1 335 ? -30.315 24.847  -1.436  1.00 29.23  ? 335 ILE B CB    1 
ATOM   6423 C  CG1   . ILE B 1 335 ? -28.932 24.587  -2.053  1.00 29.38  ? 335 ILE B CG1   1 
ATOM   6424 C  CG2   . ILE B 1 335 ? -30.905 26.232  -1.836  1.00 29.95  ? 335 ILE B CG2   1 
ATOM   6425 C  CD1   . ILE B 1 335 ? -27.875 25.637  -1.703  1.00 31.13  ? 335 ILE B CD1   1 
ATOM   6426 N  N     . LYS B 1 336 ? -31.869 25.835  1.522   1.00 29.63  ? 336 LYS B N     1 
ATOM   6427 C  CA    . LYS B 1 336 ? -33.159 26.087  2.132   1.00 30.17  ? 336 LYS B CA    1 
ATOM   6428 C  C     . LYS B 1 336 ? -34.002 26.932  1.198   1.00 30.52  ? 336 LYS B C     1 
ATOM   6429 O  O     . LYS B 1 336 ? -35.219 26.799  1.171   1.00 30.86  ? 336 LYS B O     1 
ATOM   6430 C  CB    . LYS B 1 336 ? -32.987 26.807  3.472   1.00 31.70  ? 336 LYS B CB    1 
ATOM   6431 C  CG    . LYS B 1 336 ? -32.203 26.010  4.521   1.00 32.11  ? 336 LYS B CG    1 
ATOM   6432 C  CD    . LYS B 1 336 ? -32.081 26.767  5.824   1.00 33.78  ? 336 LYS B CD    1 
ATOM   6433 C  CE    . LYS B 1 336 ? -33.431 26.823  6.518   1.00 37.68  ? 336 LYS B CE    1 
ATOM   6434 N  NZ    . LYS B 1 336 ? -33.431 27.664  7.770   1.00 43.16  ? 336 LYS B NZ    1 
ATOM   6435 N  N     . GLU B 1 337 ? -33.348 27.816  0.448   1.00 30.78  ? 337 GLU B N     1 
ATOM   6436 C  CA    . GLU B 1 337 ? -34.041 28.663  -0.519  1.00 31.64  ? 337 GLU B CA    1 
ATOM   6437 C  C     . GLU B 1 337 ? -33.167 29.009  -1.697  1.00 31.17  ? 337 GLU B C     1 
ATOM   6438 O  O     . GLU B 1 337 ? -32.023 29.419  -1.533  1.00 31.66  ? 337 GLU B O     1 
ATOM   6439 C  CB    . GLU B 1 337 ? -34.540 29.956  0.110   1.00 33.76  ? 337 GLU B CB    1 
ATOM   6440 C  CG    . GLU B 1 337 ? -35.640 30.567  -0.725  1.00 37.32  ? 337 GLU B CG    1 
ATOM   6441 C  CD    . GLU B 1 337 ? -36.108 31.913  -0.234  1.00 41.72  ? 337 GLU B CD    1 
ATOM   6442 O  OE1   . GLU B 1 337 ? -35.259 32.701  0.226   1.00 42.04  ? 337 GLU B OE1   1 
ATOM   6443 O  OE2   . GLU B 1 337 ? -37.333 32.183  -0.338  1.00 44.86  ? 337 GLU B OE2   1 
ATOM   6444 N  N     . ILE B 1 338 ? -33.726 28.870  -2.888  1.00 30.70  ? 338 ILE B N     1 
ATOM   6445 C  CA    . ILE B 1 338 ? -33.020 29.219  -4.103  1.00 30.60  ? 338 ILE B CA    1 
ATOM   6446 C  C     . ILE B 1 338 ? -33.637 30.483  -4.732  1.00 32.70  ? 338 ILE B C     1 
ATOM   6447 O  O     . ILE B 1 338 ? -34.737 30.912  -4.356  1.00 33.67  ? 338 ILE B O     1 
ATOM   6448 C  CB    . ILE B 1 338 ? -33.015 28.013  -5.064  1.00 29.91  ? 338 ILE B CB    1 
ATOM   6449 C  CG1   . ILE B 1 338 ? -31.971 28.189  -6.180  1.00 30.96  ? 338 ILE B CG1   1 
ATOM   6450 C  CG2   . ILE B 1 338 ? -34.428 27.704  -5.568  1.00 29.85  ? 338 ILE B CG2   1 
ATOM   6451 C  CD1   . ILE B 1 338 ? -31.536 26.871  -6.820  1.00 31.06  ? 338 ILE B CD1   1 
ATOM   6452 N  N     . SER B 1 339 ? -32.929 31.092  -5.674  1.00 33.00  ? 339 SER B N     1 
ATOM   6453 C  CA    . SER B 1 339 ? -33.433 32.288  -6.296  1.00 34.98  ? 339 SER B CA    1 
ATOM   6454 C  C     . SER B 1 339 ? -34.567 31.959  -7.274  1.00 36.33  ? 339 SER B C     1 
ATOM   6455 O  O     . SER B 1 339 ? -34.731 30.813  -7.698  1.00 34.91  ? 339 SER B O     1 
ATOM   6456 C  CB    . SER B 1 339 ? -32.296 33.039  -6.980  1.00 36.10  ? 339 SER B CB    1 
ATOM   6457 O  OG    . SER B 1 339 ? -31.798 32.327  -8.094  1.00 36.05  ? 339 SER B OG    1 
ATOM   6458 N  N     . ARG B 1 340 ? -35.363 32.970  -7.608  1.00 33.04  ? 340 ARG B N     1 
ATOM   6459 C  CA    . ARG B 1 340 ? -36.422 32.826  -8.589  1.00 33.16  ? 340 ARG B CA    1 
ATOM   6460 C  C     . ARG B 1 340 ? -35.817 32.663  -9.982  1.00 32.20  ? 340 ARG B C     1 
ATOM   6461 O  O     . ARG B 1 340 ? -36.233 31.780  -10.728 1.00 32.71  ? 340 ARG B O     1 
ATOM   6462 C  CB    . ARG B 1 340 ? -37.330 34.058  -8.569  1.00 33.75  ? 340 ARG B CB    1 
ATOM   6463 C  CG    . ARG B 1 340 ? -38.753 33.819  -9.046  1.00 35.52  ? 340 ARG B CG    1 
ATOM   6464 C  CD    . ARG B 1 340 ? -39.739 33.961  -7.901  1.00 37.68  ? 340 ARG B CD    1 
ATOM   6465 N  NE    . ARG B 1 340 ? -40.610 32.795  -7.823  1.00 41.10  ? 340 ARG B NE    1 
ATOM   6466 C  CZ    . ARG B 1 340 ? -41.238 32.399  -6.722  1.00 43.38  ? 340 ARG B CZ    1 
ATOM   6467 N  NH1   . ARG B 1 340 ? -41.100 33.075  -5.588  1.00 43.92  ? 340 ARG B NH1   1 
ATOM   6468 N  NH2   . ARG B 1 340 ? -41.998 31.315  -6.753  1.00 45.74  ? 340 ARG B NH2   1 
ATOM   6469 N  N     . VAL B 1 341 ? -34.845 33.506  -10.340 1.00 31.03  ? 341 VAL B N     1 
ATOM   6470 C  CA    . VAL B 1 341 ? -34.232 33.399  -11.669 1.00 30.32  ? 341 VAL B CA    1 
ATOM   6471 C  C     . VAL B 1 341 ? -33.229 32.261  -11.720 1.00 30.43  ? 341 VAL B C     1 
ATOM   6472 O  O     . VAL B 1 341 ? -32.656 31.873  -10.691 1.00 30.84  ? 341 VAL B O     1 
ATOM   6473 C  CB    . VAL B 1 341 ? -33.564 34.716  -12.204 1.00 29.40  ? 341 VAL B CB    1 
ATOM   6474 C  CG1   . VAL B 1 341 ? -34.513 35.864  -12.158 1.00 30.33  ? 341 VAL B CG1   1 
ATOM   6475 C  CG2   . VAL B 1 341 ? -32.337 35.060  -11.429 1.00 30.25  ? 341 VAL B CG2   1 
ATOM   6476 N  N     . PHE B 1 342 ? -33.054 31.726  -12.928 1.00 30.23  ? 342 PHE B N     1 
ATOM   6477 C  CA    . PHE B 1 342 ? -32.007 30.769  -13.252 1.00 30.32  ? 342 PHE B CA    1 
ATOM   6478 C  C     . PHE B 1 342 ? -31.664 30.948  -14.727 1.00 30.07  ? 342 PHE B C     1 
ATOM   6479 O  O     . PHE B 1 342 ? -32.390 31.651  -15.444 1.00 29.40  ? 342 PHE B O     1 
ATOM   6480 C  CB    . PHE B 1 342 ? -32.471 29.342  -12.950 1.00 31.69  ? 342 PHE B CB    1 
ATOM   6481 C  CG    . PHE B 1 342 ? -33.588 28.851  -13.829 1.00 31.18  ? 342 PHE B CG    1 
ATOM   6482 C  CD1   . PHE B 1 342 ? -33.314 28.122  -14.981 1.00 30.65  ? 342 PHE B CD1   1 
ATOM   6483 C  CD2   . PHE B 1 342 ? -34.916 29.093  -13.490 1.00 32.05  ? 342 PHE B CD2   1 
ATOM   6484 C  CE1   . PHE B 1 342 ? -34.355 27.656  -15.795 1.00 33.01  ? 342 PHE B CE1   1 
ATOM   6485 C  CE2   . PHE B 1 342 ? -35.977 28.626  -14.301 1.00 32.66  ? 342 PHE B CE2   1 
ATOM   6486 C  CZ    . PHE B 1 342 ? -35.693 27.901  -15.448 1.00 33.04  ? 342 PHE B CZ    1 
ATOM   6487 N  N     . ARG B 1 343 ? -30.571 30.337  -15.188 1.00 30.73  ? 343 ARG B N     1 
ATOM   6488 C  CA    . ARG B 1 343 ? -30.200 30.469  -16.599 1.00 30.76  ? 343 ARG B CA    1 
ATOM   6489 C  C     . ARG B 1 343 ? -30.696 29.290  -17.403 1.00 31.79  ? 343 ARG B C     1 
ATOM   6490 O  O     . ARG B 1 343 ? -30.636 28.156  -16.956 1.00 33.10  ? 343 ARG B O     1 
ATOM   6491 C  CB    . ARG B 1 343 ? -28.690 30.609  -16.825 1.00 30.88  ? 343 ARG B CB    1 
ATOM   6492 C  CG    . ARG B 1 343 ? -27.858 30.987  -15.647 1.00 32.59  ? 343 ARG B CG    1 
ATOM   6493 C  CD    . ARG B 1 343 ? -26.560 31.649  -16.091 1.00 34.92  ? 343 ARG B CD    1 
ATOM   6494 N  NE    . ARG B 1 343 ? -25.831 30.884  -17.095 1.00 36.26  ? 343 ARG B NE    1 
ATOM   6495 C  CZ    . ARG B 1 343 ? -24.815 31.368  -17.808 1.00 37.48  ? 343 ARG B CZ    1 
ATOM   6496 N  NH1   . ARG B 1 343 ? -24.409 32.619  -17.630 1.00 37.66  ? 343 ARG B NH1   1 
ATOM   6497 N  NH2   . ARG B 1 343 ? -24.201 30.604  -18.705 1.00 37.83  ? 343 ARG B NH2   1 
ATOM   6498 N  N     . ARG B 1 344 ? -31.185 29.573  -18.597 1.00 32.07  ? 344 ARG B N     1 
ATOM   6499 C  CA    . ARG B 1 344 ? -31.537 28.537  -19.540 1.00 34.15  ? 344 ARG B CA    1 
ATOM   6500 C  C     . ARG B 1 344 ? -30.631 28.671  -20.758 1.00 34.00  ? 344 ARG B C     1 
ATOM   6501 O  O     . ARG B 1 344 ? -30.423 29.764  -21.281 1.00 33.30  ? 344 ARG B O     1 
ATOM   6502 C  CB    . ARG B 1 344 ? -33.007 28.638  -19.920 1.00 34.83  ? 344 ARG B CB    1 
ATOM   6503 C  CG    . ARG B 1 344 ? -33.426 27.731  -21.061 1.00 38.66  ? 344 ARG B CG    1 
ATOM   6504 C  CD    . ARG B 1 344 ? -34.864 27.272  -20.902 1.00 42.58  ? 344 ARG B CD    1 
ATOM   6505 N  NE    . ARG B 1 344 ? -34.926 26.176  -19.941 1.00 46.08  ? 344 ARG B NE    1 
ATOM   6506 C  CZ    . ARG B 1 344 ? -35.927 25.961  -19.092 1.00 49.71  ? 344 ARG B CZ    1 
ATOM   6507 N  NH1   . ARG B 1 344 ? -36.984 26.783  -19.052 1.00 49.75  ? 344 ARG B NH1   1 
ATOM   6508 N  NH2   . ARG B 1 344 ? -35.860 24.919  -18.264 1.00 51.78  ? 344 ARG B NH2   1 
ATOM   6509 N  N     . MET B 1 345 ? -30.074 27.543  -21.185 1.00 35.46  ? 345 MET B N     1 
ATOM   6510 C  CA    . MET B 1 345 ? -29.178 27.493  -22.322 1.00 35.11  ? 345 MET B CA    1 
ATOM   6511 C  C     . MET B 1 345 ? -29.977 27.509  -23.612 1.00 34.99  ? 345 MET B C     1 
ATOM   6512 O  O     . MET B 1 345 ? -30.790 26.617  -23.841 1.00 36.61  ? 345 MET B O     1 
ATOM   6513 C  CB    . MET B 1 345 ? -28.352 26.212  -22.266 1.00 36.64  ? 345 MET B CB    1 
ATOM   6514 C  CG    . MET B 1 345 ? -27.149 26.242  -23.172 1.00 37.43  ? 345 MET B CG    1 
ATOM   6515 S  SD    . MET B 1 345 ? -26.435 24.623  -23.443 1.00 40.71  ? 345 MET B SD    1 
ATOM   6516 C  CE    . MET B 1 345 ? -27.561 23.896  -24.631 1.00 41.93  ? 345 MET B CE    1 
ATOM   6517 N  N     . GLY B 1 346 ? -29.739 28.522  -24.445 1.00 33.43  ? 346 GLY B N     1 
ATOM   6518 C  CA    . GLY B 1 346 ? -30.277 28.557  -25.801 1.00 33.27  ? 346 GLY B CA    1 
ATOM   6519 C  C     . GLY B 1 346 ? -29.287 28.060  -26.848 1.00 33.56  ? 346 GLY B C     1 
ATOM   6520 O  O     . GLY B 1 346 ? -28.281 27.423  -26.512 1.00 34.10  ? 346 GLY B O     1 
ATOM   6521 N  N     . PRO B 1 347 ? -29.565 28.348  -28.133 1.00 33.42  ? 347 PRO B N     1 
ATOM   6522 C  CA    . PRO B 1 347 ? -28.738 27.865  -29.237 1.00 34.04  ? 347 PRO B CA    1 
ATOM   6523 C  C     . PRO B 1 347 ? -27.489 28.723  -29.504 1.00 32.43  ? 347 PRO B C     1 
ATOM   6524 O  O     . PRO B 1 347 ? -27.388 29.845  -29.037 1.00 30.89  ? 347 PRO B O     1 
ATOM   6525 C  CB    . PRO B 1 347 ? -29.691 27.960  -30.425 1.00 34.67  ? 347 PRO B CB    1 
ATOM   6526 C  CG    . PRO B 1 347 ? -30.486 29.172  -30.116 1.00 34.01  ? 347 PRO B CG    1 
ATOM   6527 C  CD    . PRO B 1 347 ? -30.691 29.163  -28.623 1.00 33.11  ? 347 PRO B CD    1 
ATOM   6528 N  N     . GLN B 1 348 ? -26.552 28.169  -30.259 1.00 33.12  ? 348 GLN B N     1 
ATOM   6529 C  CA    . GLN B 1 348 ? -25.406 28.900  -30.736 1.00 32.45  ? 348 GLN B CA    1 
ATOM   6530 C  C     . GLN B 1 348 ? -25.857 29.970  -31.703 1.00 31.78  ? 348 GLN B C     1 
ATOM   6531 O  O     . GLN B 1 348 ? -26.832 29.786  -32.446 1.00 32.14  ? 348 GLN B O     1 
ATOM   6532 C  CB    . GLN B 1 348 ? -24.449 27.953  -31.434 1.00 34.13  ? 348 GLN B CB    1 
ATOM   6533 C  CG    . GLN B 1 348 ? -23.573 27.189  -30.480 1.00 36.69  ? 348 GLN B CG    1 
ATOM   6534 C  CD    . GLN B 1 348 ? -22.953 25.971  -31.116 1.00 41.36  ? 348 GLN B CD    1 
ATOM   6535 O  OE1   . GLN B 1 348 ? -23.136 25.715  -32.310 1.00 42.71  ? 348 GLN B OE1   1 
ATOM   6536 N  NE2   . GLN B 1 348 ? -22.204 25.203  -30.319 1.00 44.40  ? 348 GLN B NE2   1 
ATOM   6537 N  N     . PHE B 1 349 ? -25.129 31.079  -31.712 1.00 30.97  ? 349 PHE B N     1 
ATOM   6538 C  CA    . PHE B 1 349 ? -25.552 32.255  -32.448 1.00 30.88  ? 349 PHE B CA    1 
ATOM   6539 C  C     . PHE B 1 349 ? -25.766 32.041  -33.958 1.00 32.38  ? 349 PHE B C     1 
ATOM   6540 O  O     . PHE B 1 349 ? -26.583 32.732  -34.561 1.00 32.55  ? 349 PHE B O     1 
ATOM   6541 C  CB    . PHE B 1 349 ? -24.602 33.423  -32.173 1.00 30.20  ? 349 PHE B CB    1 
ATOM   6542 C  CG    . PHE B 1 349 ? -23.321 33.381  -32.961 1.00 30.69  ? 349 PHE B CG    1 
ATOM   6543 C  CD1   . PHE B 1 349 ? -23.241 33.972  -34.220 1.00 29.79  ? 349 PHE B CD1   1 
ATOM   6544 C  CD2   . PHE B 1 349 ? -22.182 32.780  -32.428 1.00 31.53  ? 349 PHE B CD2   1 
ATOM   6545 C  CE1   . PHE B 1 349 ? -22.060 33.942  -34.940 1.00 30.86  ? 349 PHE B CE1   1 
ATOM   6546 C  CE2   . PHE B 1 349 ? -20.994 32.754  -33.136 1.00 31.31  ? 349 PHE B CE2   1 
ATOM   6547 C  CZ    . PHE B 1 349 ? -20.930 33.337  -34.391 1.00 32.01  ? 349 PHE B CZ    1 
ATOM   6548 N  N     . GLU B 1 350 ? -25.050 31.085  -34.554 1.00 33.92  ? 350 GLU B N     1 
ATOM   6549 C  CA    . GLU B 1 350 ? -25.080 30.871  -36.006 1.00 35.61  ? 350 GLU B CA    1 
ATOM   6550 C  C     . GLU B 1 350 ? -26.432 30.350  -36.450 1.00 36.76  ? 350 GLU B C     1 
ATOM   6551 O  O     . GLU B 1 350 ? -26.901 30.664  -37.545 1.00 37.78  ? 350 GLU B O     1 
ATOM   6552 C  CB    . GLU B 1 350 ? -24.029 29.852  -36.438 1.00 36.65  ? 350 GLU B CB    1 
ATOM   6553 C  CG    . GLU B 1 350 ? -23.156 29.322  -35.306 1.00 39.07  ? 350 GLU B CG    1 
ATOM   6554 C  CD    . GLU B 1 350 ? -21.861 30.078  -35.184 1.00 40.15  ? 350 GLU B CD    1 
ATOM   6555 O  OE1   . GLU B 1 350 ? -21.163 29.919  -34.163 1.00 39.83  ? 350 GLU B OE1   1 
ATOM   6556 O  OE2   . GLU B 1 350 ? -21.555 30.841  -36.119 1.00 40.92  ? 350 GLU B OE2   1 
ATOM   6557 N  N     . ASP B 1 351 ? -27.053 29.547  -35.591 1.00 37.59  ? 351 ASP B N     1 
ATOM   6558 C  CA    . ASP B 1 351 ? -28.284 28.839  -35.923 1.00 39.24  ? 351 ASP B CA    1 
ATOM   6559 C  C     . ASP B 1 351 ? -29.487 29.776  -35.932 1.00 38.83  ? 351 ASP B C     1 
ATOM   6560 O  O     . ASP B 1 351 ? -30.319 29.740  -35.024 1.00 38.82  ? 351 ASP B O     1 
ATOM   6561 C  CB    . ASP B 1 351 ? -28.496 27.703  -34.925 1.00 40.12  ? 351 ASP B CB    1 
ATOM   6562 C  CG    . ASP B 1 351 ? -29.657 26.811  -35.298 1.00 43.35  ? 351 ASP B CG    1 
ATOM   6563 O  OD1   . ASP B 1 351 ? -29.960 25.883  -34.506 1.00 44.21  ? 351 ASP B OD1   1 
ATOM   6564 O  OD2   . ASP B 1 351 ? -30.260 27.038  -36.381 1.00 45.16  ? 351 ASP B OD2   1 
ATOM   6565 N  N     . GLU B 1 352 ? -29.591 30.580  -36.985 1.00 39.00  ? 352 GLU B N     1 
ATOM   6566 C  CA    . GLU B 1 352 ? -30.505 31.720  -36.997 1.00 39.24  ? 352 GLU B CA    1 
ATOM   6567 C  C     . GLU B 1 352 ? -32.002 31.406  -36.789 1.00 40.23  ? 352 GLU B C     1 
ATOM   6568 O  O     . GLU B 1 352 ? -32.703 32.200  -36.162 1.00 39.86  ? 352 GLU B O     1 
ATOM   6569 C  CB    . GLU B 1 352 ? -30.239 32.622  -38.212 1.00 39.24  ? 352 GLU B CB    1 
ATOM   6570 C  CG    . GLU B 1 352 ? -31.316 32.746  -39.247 1.00 42.50  ? 352 GLU B CG    1 
ATOM   6571 C  CD    . GLU B 1 352 ? -31.038 33.898  -40.214 1.00 43.64  ? 352 GLU B CD    1 
ATOM   6572 O  OE1   . GLU B 1 352 ? -31.389 35.049  -39.877 1.00 44.96  ? 352 GLU B OE1   1 
ATOM   6573 O  OE2   . GLU B 1 352 ? -30.462 33.656  -41.310 1.00 46.93  ? 352 GLU B OE2   1 
ATOM   6574 N  N     . ARG B 1 353 ? -32.475 30.254  -37.268 1.00 41.75  ? 353 ARG B N     1 
ATOM   6575 C  CA    . ARG B 1 353 ? -33.877 29.885  -37.089 1.00 43.66  ? 353 ARG B CA    1 
ATOM   6576 C  C     . ARG B 1 353 ? -34.212 29.574  -35.637 1.00 42.54  ? 353 ARG B C     1 
ATOM   6577 O  O     . ARG B 1 353 ? -35.207 30.060  -35.106 1.00 42.65  ? 353 ARG B O     1 
ATOM   6578 C  CB    . ARG B 1 353 ? -34.244 28.693  -37.959 1.00 46.99  ? 353 ARG B CB    1 
ATOM   6579 C  CG    . ARG B 1 353 ? -35.665 28.739  -38.482 1.00 51.59  ? 353 ARG B CG    1 
ATOM   6580 C  CD    . ARG B 1 353 ? -35.778 27.829  -39.672 1.00 58.00  ? 353 ARG B CD    1 
ATOM   6581 N  NE    . ARG B 1 353 ? -36.740 28.276  -40.681 1.00 64.42  ? 353 ARG B NE    1 
ATOM   6582 C  CZ    . ARG B 1 353 ? -36.421 28.613  -41.934 1.00 67.05  ? 353 ARG B CZ    1 
ATOM   6583 N  NH1   . ARG B 1 353 ? -35.155 28.566  -42.346 1.00 66.17  ? 353 ARG B NH1   1 
ATOM   6584 N  NH2   . ARG B 1 353 ? -37.371 28.997  -42.783 1.00 70.47  ? 353 ARG B NH2   1 
ATOM   6585 N  N     . ASN B 1 354 ? -33.376 28.765  -34.998 1.00 41.45  ? 354 ASN B N     1 
ATOM   6586 C  CA    . ASN B 1 354 ? -33.580 28.410  -33.598 1.00 40.63  ? 354 ASN B CA    1 
ATOM   6587 C  C     . ASN B 1 354 ? -33.299 29.556  -32.639 1.00 37.99  ? 354 ASN B C     1 
ATOM   6588 O  O     . ASN B 1 354 ? -33.807 29.564  -31.522 1.00 37.82  ? 354 ASN B O     1 
ATOM   6589 C  CB    . ASN B 1 354 ? -32.759 27.181  -33.234 1.00 41.11  ? 354 ASN B CB    1 
ATOM   6590 C  CG    . ASN B 1 354 ? -33.277 25.940  -33.909 1.00 44.65  ? 354 ASN B CG    1 
ATOM   6591 O  OD1   . ASN B 1 354 ? -34.274 25.367  -33.481 1.00 48.06  ? 354 ASN B OD1   1 
ATOM   6592 N  ND2   . ASN B 1 354 ? -32.623 25.529  -34.986 1.00 45.30  ? 354 ASN B ND2   1 
ATOM   6593 N  N     . VAL B 1 355 ? -32.500 30.527  -33.081 1.00 35.98  ? 355 VAL B N     1 
ATOM   6594 C  CA    . VAL B 1 355 ? -32.337 31.763  -32.341 1.00 33.59  ? 355 VAL B CA    1 
ATOM   6595 C  C     . VAL B 1 355 ? -33.648 32.549  -32.338 1.00 34.44  ? 355 VAL B C     1 
ATOM   6596 O  O     . VAL B 1 355 ? -34.034 33.086  -31.305 1.00 34.01  ? 355 VAL B O     1 
ATOM   6597 C  CB    . VAL B 1 355 ? -31.179 32.620  -32.894 1.00 32.37  ? 355 VAL B CB    1 
ATOM   6598 C  CG1   . VAL B 1 355 ? -31.129 34.000  -32.220 1.00 30.37  ? 355 VAL B CG1   1 
ATOM   6599 C  CG2   . VAL B 1 355 ? -29.868 31.913  -32.690 1.00 31.74  ? 355 VAL B CG2   1 
ATOM   6600 N  N     . LYS B 1 356 ? -34.335 32.599  -33.478 1.00 36.09  ? 356 LYS B N     1 
ATOM   6601 C  CA    . LYS B 1 356 ? -35.623 33.302  -33.572 1.00 37.84  ? 356 LYS B CA    1 
ATOM   6602 C  C     . LYS B 1 356 ? -36.660 32.724  -32.631 1.00 38.75  ? 356 LYS B C     1 
ATOM   6603 O  O     . LYS B 1 356 ? -37.334 33.461  -31.923 1.00 39.02  ? 356 LYS B O     1 
ATOM   6604 C  CB    . LYS B 1 356 ? -36.182 33.269  -34.992 1.00 40.13  ? 356 LYS B CB    1 
ATOM   6605 C  CG    . LYS B 1 356 ? -35.700 34.393  -35.856 1.00 41.25  ? 356 LYS B CG    1 
ATOM   6606 C  CD    . LYS B 1 356 ? -36.715 34.754  -36.921 1.00 46.13  ? 356 LYS B CD    1 
ATOM   6607 C  CE    . LYS B 1 356 ? -37.953 35.349  -36.286 1.00 48.75  ? 356 LYS B CE    1 
ATOM   6608 N  NZ    . LYS B 1 356 ? -38.559 36.335  -37.206 1.00 53.32  ? 356 LYS B NZ    1 
ATOM   6609 N  N     . LYS B 1 357 ? -36.793 31.402  -32.644 1.00 39.73  ? 357 LYS B N     1 
ATOM   6610 C  CA    . LYS B 1 357 ? -37.734 30.728  -31.769 1.00 41.21  ? 357 LYS B CA    1 
ATOM   6611 C  C     . LYS B 1 357 ? -37.393 31.012  -30.308 1.00 38.46  ? 357 LYS B C     1 
ATOM   6612 O  O     . LYS B 1 357 ? -38.274 31.335  -29.516 1.00 38.93  ? 357 LYS B O     1 
ATOM   6613 C  CB    . LYS B 1 357 ? -37.767 29.216  -32.050 1.00 43.05  ? 357 LYS B CB    1 
ATOM   6614 C  CG    . LYS B 1 357 ? -38.617 28.828  -33.260 1.00 47.27  ? 357 LYS B CG    1 
ATOM   6615 C  CD    . LYS B 1 357 ? -38.294 27.425  -33.814 1.00 49.59  ? 357 LYS B CD    1 
ATOM   6616 C  CE    . LYS B 1 357 ? -39.045 26.310  -33.079 1.00 54.38  ? 357 LYS B CE    1 
ATOM   6617 N  NZ    . LYS B 1 357 ? -38.690 24.957  -33.614 1.00 57.63  ? 357 LYS B NZ    1 
ATOM   6618 N  N     . PHE B 1 358 ? -36.111 30.905  -29.974 1.00 35.70  ? 358 PHE B N     1 
ATOM   6619 C  CA    . PHE B 1 358 ? -35.657 31.023  -28.600 1.00 33.92  ? 358 PHE B CA    1 
ATOM   6620 C  C     . PHE B 1 358 ? -35.939 32.427  -28.107 1.00 32.93  ? 358 PHE B C     1 
ATOM   6621 O  O     . PHE B 1 358 ? -36.460 32.611  -27.007 1.00 33.03  ? 358 PHE B O     1 
ATOM   6622 C  CB    . PHE B 1 358 ? -34.161 30.710  -28.500 1.00 32.43  ? 358 PHE B CB    1 
ATOM   6623 C  CG    . PHE B 1 358 ? -33.611 30.751  -27.095 1.00 31.02  ? 358 PHE B CG    1 
ATOM   6624 C  CD1   . PHE B 1 358 ? -33.841 29.697  -26.207 1.00 31.95  ? 358 PHE B CD1   1 
ATOM   6625 C  CD2   . PHE B 1 358 ? -32.847 31.842  -26.660 1.00 28.85  ? 358 PHE B CD2   1 
ATOM   6626 C  CE1   . PHE B 1 358 ? -33.329 29.739  -24.908 1.00 30.59  ? 358 PHE B CE1   1 
ATOM   6627 C  CE2   . PHE B 1 358 ? -32.315 31.893  -25.364 1.00 26.64  ? 358 PHE B CE2   1 
ATOM   6628 C  CZ    . PHE B 1 358 ? -32.553 30.846  -24.490 1.00 28.82  ? 358 PHE B CZ    1 
ATOM   6629 N  N     . LEU B 1 359 ? -35.625 33.410  -28.946 1.00 32.33  ? 359 LEU B N     1 
ATOM   6630 C  CA    . LEU B 1 359 ? -35.821 34.811  -28.606 1.00 31.32  ? 359 LEU B CA    1 
ATOM   6631 C  C     . LEU B 1 359 ? -37.280 35.266  -28.720 1.00 33.01  ? 359 LEU B C     1 
ATOM   6632 O  O     . LEU B 1 359 ? -37.614 36.354  -28.284 1.00 33.42  ? 359 LEU B O     1 
ATOM   6633 C  CB    . LEU B 1 359 ? -34.908 35.707  -29.452 1.00 30.57  ? 359 LEU B CB    1 
ATOM   6634 C  CG    . LEU B 1 359 ? -33.383 35.600  -29.298 1.00 29.44  ? 359 LEU B CG    1 
ATOM   6635 C  CD1   . LEU B 1 359 ? -32.718 36.533  -30.265 1.00 30.34  ? 359 LEU B CD1   1 
ATOM   6636 C  CD2   . LEU B 1 359 ? -32.899 35.907  -27.888 1.00 28.43  ? 359 LEU B CD2   1 
ATOM   6637 N  N     . SER B 1 360 ? -38.154 34.446  -29.284 1.00 34.66  ? 360 SER B N     1 
ATOM   6638 C  CA    . SER B 1 360 ? -39.550 34.857  -29.424 1.00 37.14  ? 360 SER B CA    1 
ATOM   6639 C  C     . SER B 1 360 ? -40.432 34.509  -28.220 1.00 38.20  ? 360 SER B C     1 
ATOM   6640 O  O     . SER B 1 360 ? -41.608 34.880  -28.198 1.00 40.59  ? 360 SER B O     1 
ATOM   6641 C  CB    . SER B 1 360 ? -40.166 34.280  -30.697 1.00 39.65  ? 360 SER B CB    1 
ATOM   6642 O  OG    . SER B 1 360 ? -40.273 32.872  -30.600 1.00 40.22  ? 360 SER B OG    1 
ATOM   6643 N  N     . ARG B 1 361 ? -39.882 33.797  -27.234 1.00 36.56  ? 361 ARG B N     1 
ATOM   6644 C  CA    . ARG B 1 361 ? -40.657 33.416  -26.051 1.00 37.60  ? 361 ARG B CA    1 
ATOM   6645 C  C     . ARG B 1 361 ? -40.660 34.597  -25.094 1.00 35.87  ? 361 ARG B C     1 
ATOM   6646 O  O     . ARG B 1 361 ? -39.632 35.234  -24.908 1.00 33.93  ? 361 ARG B O     1 
ATOM   6647 C  CB    . ARG B 1 361 ? -40.061 32.192  -25.334 1.00 36.95  ? 361 ARG B CB    1 
ATOM   6648 C  CG    . ARG B 1 361 ? -39.679 30.988  -26.207 1.00 39.81  ? 361 ARG B CG    1 
ATOM   6649 C  CD    . ARG B 1 361 ? -40.843 30.111  -26.713 1.00 47.53  ? 361 ARG B CD    1 
ATOM   6650 N  NE    . ARG B 1 361 ? -42.103 30.213  -25.960 1.00 54.51  ? 361 ARG B NE    1 
ATOM   6651 C  CZ    . ARG B 1 361 ? -42.316 29.809  -24.698 1.00 56.33  ? 361 ARG B CZ    1 
ATOM   6652 N  NH1   . ARG B 1 361 ? -41.343 29.273  -23.951 1.00 54.63  ? 361 ARG B NH1   1 
ATOM   6653 N  NH2   . ARG B 1 361 ? -43.525 29.966  -24.167 1.00 59.10  ? 361 ARG B NH2   1 
ATOM   6654 N  N     . ASN B 1 362 ? -41.799 34.881  -24.473 1.00 37.10  ? 362 ASN B N     1 
ATOM   6655 C  CA    . ASN B 1 362 ? -41.877 35.996  -23.535 1.00 35.59  ? 362 ASN B CA    1 
ATOM   6656 C  C     . ASN B 1 362 ? -41.259 35.711  -22.187 1.00 33.71  ? 362 ASN B C     1 
ATOM   6657 O  O     . ASN B 1 362 ? -41.660 34.774  -21.485 1.00 34.31  ? 362 ASN B O     1 
ATOM   6658 C  CB    . ASN B 1 362 ? -43.316 36.451  -23.355 1.00 38.27  ? 362 ASN B CB    1 
ATOM   6659 C  CG    . ASN B 1 362 ? -43.968 36.798  -24.651 1.00 39.15  ? 362 ASN B CG    1 
ATOM   6660 O  OD1   . ASN B 1 362 ? -45.038 36.309  -24.946 1.00 41.79  ? 362 ASN B OD1   1 
ATOM   6661 N  ND2   . ASN B 1 362 ? -43.315 37.625  -25.451 1.00 38.45  ? 362 ASN B ND2   1 
ATOM   6662 N  N     . ARG B 1 363 ? -40.279 36.533  -21.834 1.00 32.07  ? 363 ARG B N     1 
ATOM   6663 C  CA    . ARG B 1 363 ? -39.580 36.429  -20.555 1.00 30.83  ? 363 ARG B CA    1 
ATOM   6664 C  C     . ARG B 1 363 ? -39.557 37.802  -19.895 1.00 31.26  ? 363 ARG B C     1 
ATOM   6665 O  O     . ARG B 1 363 ? -39.841 38.810  -20.540 1.00 32.67  ? 363 ARG B O     1 
ATOM   6666 C  CB    . ARG B 1 363 ? -38.162 35.900  -20.757 1.00 28.69  ? 363 ARG B CB    1 
ATOM   6667 C  CG    . ARG B 1 363 ? -38.095 34.589  -21.519 1.00 29.60  ? 363 ARG B CG    1 
ATOM   6668 C  CD    . ARG B 1 363 ? -36.665 34.244  -21.857 1.00 31.44  ? 363 ARG B CD    1 
ATOM   6669 N  NE    . ARG B 1 363 ? -36.529 33.681  -23.203 1.00 33.75  ? 363 ARG B NE    1 
ATOM   6670 C  CZ    . ARG B 1 363 ? -36.464 32.381  -23.464 1.00 35.42  ? 363 ARG B CZ    1 
ATOM   6671 N  NH1   . ARG B 1 363 ? -36.520 31.493  -22.475 1.00 36.62  ? 363 ARG B NH1   1 
ATOM   6672 N  NH2   . ARG B 1 363 ? -36.354 31.962  -24.715 1.00 36.09  ? 363 ARG B NH2   1 
ATOM   6673 N  N     . ALA B 1 364 ? -39.248 37.844  -18.605 1.00 31.25  ? 364 ALA B N     1 
ATOM   6674 C  CA    . ALA B 1 364 ? -39.229 39.107  -17.865 1.00 32.01  ? 364 ALA B CA    1 
ATOM   6675 C  C     . ALA B 1 364 ? -37.946 39.901  -18.092 1.00 31.34  ? 364 ALA B C     1 
ATOM   6676 O  O     . ALA B 1 364 ? -37.892 41.095  -17.794 1.00 32.38  ? 364 ALA B O     1 
ATOM   6677 C  CB    . ALA B 1 364 ? -39.431 38.854  -16.381 1.00 31.77  ? 364 ALA B CB    1 
ATOM   6678 N  N     . PHE B 1 365 ? -36.921 39.233  -18.612 1.00 30.42  ? 365 PHE B N     1 
ATOM   6679 C  CA    . PHE B 1 365 ? -35.586 39.812  -18.722 1.00 30.29  ? 365 PHE B CA    1 
ATOM   6680 C  C     . PHE B 1 365 ? -34.986 39.483  -20.071 1.00 30.35  ? 365 PHE B C     1 
ATOM   6681 O  O     . PHE B 1 365 ? -35.231 38.407  -20.628 1.00 30.55  ? 365 PHE B O     1 
ATOM   6682 C  CB    . PHE B 1 365 ? -34.661 39.301  -17.607 1.00 29.35  ? 365 PHE B CB    1 
ATOM   6683 C  CG    . PHE B 1 365 ? -35.150 39.603  -16.217 1.00 29.83  ? 365 PHE B CG    1 
ATOM   6684 C  CD1   . PHE B 1 365 ? -35.810 38.635  -15.476 1.00 30.01  ? 365 PHE B CD1   1 
ATOM   6685 C  CD2   . PHE B 1 365 ? -34.948 40.859  -15.649 1.00 31.58  ? 365 PHE B CD2   1 
ATOM   6686 C  CE1   . PHE B 1 365 ? -36.273 38.907  -14.190 1.00 31.16  ? 365 PHE B CE1   1 
ATOM   6687 C  CE2   . PHE B 1 365 ? -35.402 41.150  -14.357 1.00 32.21  ? 365 PHE B CE2   1 
ATOM   6688 C  CZ    . PHE B 1 365 ? -36.065 40.170  -13.626 1.00 31.98  ? 365 PHE B CZ    1 
ATOM   6689 N  N     . ARG B 1 366 ? -34.191 40.417  -20.581 1.00 30.93  ? 366 ARG B N     1 
ATOM   6690 C  CA    . ARG B 1 366 ? -33.646 40.342  -21.922 1.00 31.46  ? 366 ARG B CA    1 
ATOM   6691 C  C     . ARG B 1 366 ? -32.613 39.203  -21.959 1.00 29.57  ? 366 ARG B C     1 
ATOM   6692 O  O     . ARG B 1 366 ? -31.776 39.112  -21.068 1.00 29.42  ? 366 ARG B O     1 
ATOM   6693 C  CB    . ARG B 1 366 ? -33.083 41.732  -22.298 1.00 32.89  ? 366 ARG B CB    1 
ATOM   6694 C  CG    . ARG B 1 366 ? -32.214 41.833  -23.564 1.00 38.14  ? 366 ARG B CG    1 
ATOM   6695 C  CD    . ARG B 1 366 ? -32.942 41.480  -24.889 1.00 46.04  ? 366 ARG B CD    1 
ATOM   6696 N  NE    . ARG B 1 366 ? -32.011 41.238  -26.009 1.00 50.43  ? 366 ARG B NE    1 
ATOM   6697 C  CZ    . ARG B 1 366 ? -32.381 40.967  -27.267 1.00 53.44  ? 366 ARG B CZ    1 
ATOM   6698 N  NH1   . ARG B 1 366 ? -33.672 40.892  -27.595 1.00 55.57  ? 366 ARG B NH1   1 
ATOM   6699 N  NH2   . ARG B 1 366 ? -31.460 40.771  -28.208 1.00 53.46  ? 366 ARG B NH2   1 
ATOM   6700 N  N     . PRO B 1 367 ? -32.727 38.266  -22.928 1.00 28.85  ? 367 PRO B N     1 
ATOM   6701 C  CA    . PRO B 1 367 ? -31.670 37.249  -23.072 1.00 27.79  ? 367 PRO B CA    1 
ATOM   6702 C  C     . PRO B 1 367 ? -30.296 37.860  -23.403 1.00 27.91  ? 367 PRO B C     1 
ATOM   6703 O  O     . PRO B 1 367 ? -30.193 39.069  -23.663 1.00 29.27  ? 367 PRO B O     1 
ATOM   6704 C  CB    . PRO B 1 367 ? -32.177 36.373  -24.225 1.00 27.81  ? 367 PRO B CB    1 
ATOM   6705 C  CG    . PRO B 1 367 ? -33.663 36.570  -24.222 1.00 27.97  ? 367 PRO B CG    1 
ATOM   6706 C  CD    . PRO B 1 367 ? -33.832 38.029  -23.875 1.00 29.37  ? 367 PRO B CD    1 
ATOM   6707 N  N     . PHE B 1 368 ? -29.253 37.036  -23.369 1.00 26.98  ? 368 PHE B N     1 
ATOM   6708 C  CA    . PHE B 1 368 ? -27.888 37.503  -23.543 1.00 26.57  ? 368 PHE B CA    1 
ATOM   6709 C  C     . PHE B 1 368 ? -27.030 36.417  -24.185 1.00 26.70  ? 368 PHE B C     1 
ATOM   6710 O  O     . PHE B 1 368 ? -27.422 35.245  -24.216 1.00 26.40  ? 368 PHE B O     1 
ATOM   6711 C  CB    . PHE B 1 368 ? -27.304 37.929  -22.189 1.00 26.67  ? 368 PHE B CB    1 
ATOM   6712 C  CG    . PHE B 1 368 ? -27.178 36.810  -21.193 1.00 25.37  ? 368 PHE B CG    1 
ATOM   6713 C  CD1   . PHE B 1 368 ? -28.242 36.481  -20.350 1.00 23.89  ? 368 PHE B CD1   1 
ATOM   6714 C  CD2   . PHE B 1 368 ? -25.997 36.086  -21.087 1.00 24.26  ? 368 PHE B CD2   1 
ATOM   6715 C  CE1   . PHE B 1 368 ? -28.132 35.429  -19.420 1.00 22.63  ? 368 PHE B CE1   1 
ATOM   6716 C  CE2   . PHE B 1 368 ? -25.885 35.033  -20.162 1.00 24.54  ? 368 PHE B CE2   1 
ATOM   6717 C  CZ    . PHE B 1 368 ? -26.955 34.711  -19.326 1.00 23.03  ? 368 PHE B CZ    1 
ATOM   6718 N  N     . ILE B 1 369 ? -25.871 36.814  -24.698 1.00 27.55  ? 369 ILE B N     1 
ATOM   6719 C  CA    . ILE B 1 369 ? -24.913 35.890  -25.296 1.00 28.26  ? 369 ILE B CA    1 
ATOM   6720 C  C     . ILE B 1 369 ? -23.706 35.714  -24.373 1.00 29.53  ? 369 ILE B C     1 
ATOM   6721 O  O     . ILE B 1 369 ? -23.258 36.657  -23.732 1.00 30.31  ? 369 ILE B O     1 
ATOM   6722 C  CB    . ILE B 1 369 ? -24.410 36.403  -26.659 1.00 28.75  ? 369 ILE B CB    1 
ATOM   6723 C  CG1   . ILE B 1 369 ? -25.548 36.490  -27.667 1.00 28.09  ? 369 ILE B CG1   1 
ATOM   6724 C  CG2   . ILE B 1 369 ? -23.294 35.528  -27.205 1.00 29.06  ? 369 ILE B CG2   1 
ATOM   6725 C  CD1   . ILE B 1 369 ? -25.166 37.291  -28.928 1.00 29.47  ? 369 ILE B CD1   1 
ATOM   6726 N  N     . GLU B 1 370 ? -23.193 34.491  -24.325 1.00 30.46  ? 370 GLU B N     1 
ATOM   6727 C  CA    . GLU B 1 370 ? -22.052 34.114  -23.513 1.00 32.03  ? 370 GLU B CA    1 
ATOM   6728 C  C     . GLU B 1 370 ? -21.380 32.918  -24.182 1.00 32.53  ? 370 GLU B C     1 
ATOM   6729 O  O     . GLU B 1 370 ? -21.993 31.857  -24.327 1.00 32.11  ? 370 GLU B O     1 
ATOM   6730 C  CB    . GLU B 1 370 ? -22.524 33.740  -22.109 1.00 32.32  ? 370 GLU B CB    1 
ATOM   6731 C  CG    . GLU B 1 370 ? -21.393 33.529  -21.116 1.00 36.27  ? 370 GLU B CG    1 
ATOM   6732 C  CD    . GLU B 1 370 ? -21.907 33.166  -19.744 1.00 40.52  ? 370 GLU B CD    1 
ATOM   6733 O  OE1   . GLU B 1 370 ? -22.512 34.050  -19.065 1.00 40.71  ? 370 GLU B OE1   1 
ATOM   6734 O  OE2   . GLU B 1 370 ? -21.696 31.995  -19.346 1.00 42.22  ? 370 GLU B OE2   1 
ATOM   6735 N  N     . ASN B 1 371 ? -20.129 33.094  -24.597 1.00 33.87  ? 371 ASN B N     1 
ATOM   6736 C  CA    . ASN B 1 371 ? -19.384 32.060  -25.338 1.00 35.14  ? 371 ASN B CA    1 
ATOM   6737 C  C     . ASN B 1 371 ? -20.099 31.473  -26.560 1.00 34.23  ? 371 ASN B C     1 
ATOM   6738 O  O     . ASN B 1 371 ? -20.000 30.274  -26.820 1.00 35.28  ? 371 ASN B O     1 
ATOM   6739 C  CB    . ASN B 1 371 ? -18.963 30.931  -24.411 1.00 36.33  ? 371 ASN B CB    1 
ATOM   6740 C  CG    . ASN B 1 371 ? -18.409 31.434  -23.120 1.00 38.16  ? 371 ASN B CG    1 
ATOM   6741 O  OD1   . ASN B 1 371 ? -17.354 32.068  -23.090 1.00 40.82  ? 371 ASN B OD1   1 
ATOM   6742 N  ND2   . ASN B 1 371 ? -19.114 31.158  -22.028 1.00 38.71  ? 371 ASN B ND2   1 
ATOM   6743 N  N     . GLY B 1 372 ? -20.822 32.304  -27.301 1.00 32.90  ? 372 GLY B N     1 
ATOM   6744 C  CA    . GLY B 1 372 ? -21.450 31.855  -28.541 1.00 32.59  ? 372 GLY B CA    1 
ATOM   6745 C  C     . GLY B 1 372 ? -22.865 31.295  -28.515 1.00 31.69  ? 372 GLY B C     1 
ATOM   6746 O  O     . GLY B 1 372 ? -23.357 30.894  -29.575 1.00 31.39  ? 372 GLY B O     1 
ATOM   6747 N  N     . ARG B 1 373 ? -23.473 31.212  -27.318 1.00 31.30  ? 373 ARG B N     1 
ATOM   6748 C  CA    . ARG B 1 373 ? -24.941 31.044  -27.085 1.00 31.27  ? 373 ARG B CA    1 
ATOM   6749 C  C     . ARG B 1 373 ? -25.214 32.319  -26.311 1.00 30.28  ? 373 ARG B C     1 
ATOM   6750 O  O     . ARG B 1 373 ? -24.373 32.674  -25.496 1.00 31.43  ? 373 ARG B O     1 
ATOM   6751 C  CB    . ARG B 1 373 ? -25.221 29.820  -26.214 1.00 31.88  ? 373 ARG B CB    1 
ATOM   6752 C  CG    . ARG B 1 373 ? -24.251 28.650  -26.427 1.00 34.37  ? 373 ARG B CG    1 
ATOM   6753 C  CD    . ARG B 1 373 ? -24.611 27.414  -25.589 1.00 35.94  ? 373 ARG B CD    1 
ATOM   6754 N  NE    . ARG B 1 373 ? -25.516 26.496  -26.287 1.00 41.20  ? 373 ARG B NE    1 
ATOM   6755 C  CZ    . ARG B 1 373 ? -25.138 25.469  -27.057 1.00 44.13  ? 373 ARG B CZ    1 
ATOM   6756 N  NH1   . ARG B 1 373 ? -23.851 25.197  -27.260 1.00 45.71  ? 373 ARG B NH1   1 
ATOM   6757 N  NH2   . ARG B 1 373 ? -26.059 24.706  -27.637 1.00 45.78  ? 373 ARG B NH2   1 
ATOM   6758 N  N     . TRP B 1 374 ? -26.341 33.023  -26.413 1.00 29.38  ? 374 TRP B N     1 
ATOM   6759 C  CA    . TRP B 1 374 ? -27.748 32.639  -26.266 1.00 27.80  ? 374 TRP B CA    1 
ATOM   6760 C  C     . TRP B 1 374 ? -28.125 31.827  -25.038 1.00 27.81  ? 374 TRP B C     1 
ATOM   6761 O  O     . TRP B 1 374 ? -28.151 30.593  -25.030 1.00 28.81  ? 374 TRP B O     1 
ATOM   6762 C  CB    . TRP B 1 374 ? -28.510 32.371  -27.553 1.00 27.56  ? 374 TRP B CB    1 
ATOM   6763 C  CG    . TRP B 1 374 ? -28.495 33.569  -28.488 1.00 26.62  ? 374 TRP B CG    1 
ATOM   6764 C  CD1   . TRP B 1 374 ? -28.149 33.553  -29.804 1.00 26.51  ? 374 TRP B CD1   1 
ATOM   6765 C  CD2   . TRP B 1 374 ? -28.801 34.943  -28.176 1.00 25.49  ? 374 TRP B CD2   1 
ATOM   6766 N  NE1   . TRP B 1 374 ? -28.233 34.807  -30.336 1.00 26.66  ? 374 TRP B NE1   1 
ATOM   6767 C  CE2   . TRP B 1 374 ? -28.625 35.687  -29.365 1.00 25.93  ? 374 TRP B CE2   1 
ATOM   6768 C  CE3   . TRP B 1 374 ? -29.214 35.614  -27.021 1.00 26.34  ? 374 TRP B CE3   1 
ATOM   6769 C  CZ2   . TRP B 1 374 ? -28.847 37.078  -29.438 1.00 25.72  ? 374 TRP B CZ2   1 
ATOM   6770 C  CZ3   . TRP B 1 374 ? -29.439 37.014  -27.093 1.00 26.48  ? 374 TRP B CZ3   1 
ATOM   6771 C  CH2   . TRP B 1 374 ? -29.252 37.720  -28.301 1.00 26.18  ? 374 TRP B CH2   1 
ATOM   6772 N  N     . TRP B 1 375 ? -28.369 32.602  -23.983 1.00 26.51  ? 375 TRP B N     1 
ATOM   6773 C  CA    . TRP B 1 375 ? -28.911 32.130  -22.728 1.00 26.19  ? 375 TRP B CA    1 
ATOM   6774 C  C     . TRP B 1 375 ? -30.070 33.047  -22.333 1.00 25.68  ? 375 TRP B C     1 
ATOM   6775 O  O     . TRP B 1 375 ? -30.102 34.227  -22.697 1.00 25.24  ? 375 TRP B O     1 
ATOM   6776 C  CB    . TRP B 1 375 ? -27.837 32.173  -21.639 1.00 25.97  ? 375 TRP B CB    1 
ATOM   6777 C  CG    . TRP B 1 375 ? -26.615 31.338  -21.933 1.00 26.25  ? 375 TRP B CG    1 
ATOM   6778 C  CD1   . TRP B 1 375 ? -25.601 31.647  -22.792 1.00 26.29  ? 375 TRP B CD1   1 
ATOM   6779 C  CD2   . TRP B 1 375 ? -26.272 30.076  -21.346 1.00 26.29  ? 375 TRP B CD2   1 
ATOM   6780 N  NE1   . TRP B 1 375 ? -24.654 30.653  -22.785 1.00 27.53  ? 375 TRP B NE1   1 
ATOM   6781 C  CE2   . TRP B 1 375 ? -25.037 29.677  -21.906 1.00 26.99  ? 375 TRP B CE2   1 
ATOM   6782 C  CE3   . TRP B 1 375 ? -26.884 29.248  -20.397 1.00 28.12  ? 375 TRP B CE3   1 
ATOM   6783 C  CZ2   . TRP B 1 375 ? -24.406 28.476  -21.564 1.00 28.83  ? 375 TRP B CZ2   1 
ATOM   6784 C  CZ3   . TRP B 1 375 ? -26.245 28.047  -20.041 1.00 30.06  ? 375 TRP B CZ3   1 
ATOM   6785 C  CH2   . TRP B 1 375 ? -25.022 27.675  -20.637 1.00 30.59  ? 375 TRP B CH2   1 
ATOM   6786 N  N     . ALA B 1 376 ? -31.022 32.503  -21.589 1.00 25.64  ? 376 ALA B N     1 
ATOM   6787 C  CA    . ALA B 1 376 ? -32.109 33.309  -21.079 1.00 25.54  ? 376 ALA B CA    1 
ATOM   6788 C  C     . ALA B 1 376 ? -32.241 33.164  -19.582 1.00 25.47  ? 376 ALA B C     1 
ATOM   6789 O  O     . ALA B 1 376 ? -31.987 32.098  -19.033 1.00 25.78  ? 376 ALA B O     1 
ATOM   6790 C  CB    . ALA B 1 376 ? -33.406 32.933  -21.745 1.00 26.55  ? 376 ALA B CB    1 
ATOM   6791 N  N     . PHE B 1 377 ? -32.623 34.260  -18.935 1.00 25.29  ? 377 PHE B N     1 
ATOM   6792 C  CA    . PHE B 1 377 ? -33.097 34.225  -17.569 1.00 25.53  ? 377 PHE B CA    1 
ATOM   6793 C  C     . PHE B 1 377 ? -34.550 33.773  -17.560 1.00 27.11  ? 377 PHE B C     1 
ATOM   6794 O  O     . PHE B 1 377 ? -35.384 34.325  -18.261 1.00 27.72  ? 377 PHE B O     1 
ATOM   6795 C  CB    . PHE B 1 377 ? -32.975 35.603  -16.933 1.00 25.03  ? 377 PHE B CB    1 
ATOM   6796 C  CG    . PHE B 1 377 ? -31.559 36.032  -16.681 1.00 23.79  ? 377 PHE B CG    1 
ATOM   6797 C  CD1   . PHE B 1 377 ? -31.036 37.121  -17.321 1.00 23.14  ? 377 PHE B CD1   1 
ATOM   6798 C  CD2   . PHE B 1 377 ? -30.758 35.347  -15.781 1.00 23.77  ? 377 PHE B CD2   1 
ATOM   6799 C  CE1   . PHE B 1 377 ? -29.736 37.524  -17.079 1.00 24.38  ? 377 PHE B CE1   1 
ATOM   6800 C  CE2   . PHE B 1 377 ? -29.468 35.744  -15.540 1.00 23.63  ? 377 PHE B CE2   1 
ATOM   6801 C  CZ    . PHE B 1 377 ? -28.953 36.835  -16.192 1.00 23.90  ? 377 PHE B CZ    1 
ATOM   6802 N  N     . GLU B 1 378 ? -34.839 32.757  -16.760 1.00 28.74  ? 378 GLU B N     1 
ATOM   6803 C  CA    . GLU B 1 378 ? -36.176 32.191  -16.631 1.00 30.78  ? 378 GLU B CA    1 
ATOM   6804 C  C     . GLU B 1 378 ? -36.573 32.324  -15.149 1.00 30.62  ? 378 GLU B C     1 
ATOM   6805 O  O     . GLU B 1 378 ? -35.711 32.559  -14.301 1.00 29.43  ? 378 GLU B O     1 
ATOM   6806 C  CB    . GLU B 1 378 ? -36.100 30.720  -17.055 1.00 32.60  ? 378 GLU B CB    1 
ATOM   6807 C  CG    . GLU B 1 378 ? -37.221 30.170  -17.947 1.00 37.21  ? 378 GLU B CG    1 
ATOM   6808 C  CD    . GLU B 1 378 ? -37.081 30.601  -19.398 1.00 41.34  ? 378 GLU B CD    1 
ATOM   6809 O  OE1   . GLU B 1 378 ? -37.002 31.828  -19.637 1.00 42.45  ? 378 GLU B OE1   1 
ATOM   6810 O  OE2   . GLU B 1 378 ? -37.051 29.728  -20.303 1.00 43.44  ? 378 GLU B OE2   1 
ATOM   6811 N  N     . MET B 1 379 ? -37.860 32.184  -14.836 1.00 31.98  ? 379 MET B N     1 
ATOM   6812 C  CA    . MET B 1 379 ? -38.340 32.229  -13.432 1.00 32.47  ? 379 MET B CA    1 
ATOM   6813 C  C     . MET B 1 379 ? -38.896 30.876  -12.966 1.00 33.70  ? 379 MET B C     1 
ATOM   6814 O  O     . MET B 1 379 ? -39.614 30.213  -13.714 1.00 35.40  ? 379 MET B O     1 
ATOM   6815 C  CB    . MET B 1 379 ? -39.401 33.318  -13.246 1.00 33.05  ? 379 MET B CB    1 
ATOM   6816 C  CG    . MET B 1 379 ? -38.940 34.718  -13.628 1.00 33.88  ? 379 MET B CG    1 
ATOM   6817 S  SD    . MET B 1 379 ? -37.758 35.482  -12.471 1.00 37.07  ? 379 MET B SD    1 
ATOM   6818 C  CE    . MET B 1 379 ? -38.859 36.394  -11.384 1.00 37.84  ? 379 MET B CE    1 
ATOM   6819 N  N     . ARG B 1 380 ? -38.564 30.477  -11.738 1.00 33.32  ? 380 ARG B N     1 
ATOM   6820 C  CA    . ARG B 1 380 ? -39.003 29.193  -11.161 1.00 34.81  ? 380 ARG B CA    1 
ATOM   6821 C  C     . ARG B 1 380 ? -40.413 29.288  -10.602 1.00 37.02  ? 380 ARG B C     1 
ATOM   6822 O  O     . ARG B 1 380 ? -40.836 30.372  -10.206 1.00 36.81  ? 380 ARG B O     1 
ATOM   6823 C  CB    . ARG B 1 380 ? -38.082 28.783  -10.007 1.00 34.57  ? 380 ARG B CB    1 
ATOM   6824 C  CG    . ARG B 1 380 ? -36.742 28.208  -10.384 1.00 32.68  ? 380 ARG B CG    1 
ATOM   6825 C  CD    . ARG B 1 380 ? -35.965 27.809  -9.122  1.00 33.05  ? 380 ARG B CD    1 
ATOM   6826 N  NE    . ARG B 1 380 ? -34.675 27.222  -9.472  1.00 30.67  ? 380 ARG B NE    1 
ATOM   6827 C  CZ    . ARG B 1 380 ? -33.541 27.905  -9.597  1.00 28.96  ? 380 ARG B CZ    1 
ATOM   6828 N  NH1   . ARG B 1 380 ? -33.507 29.208  -9.364  1.00 27.37  ? 380 ARG B NH1   1 
ATOM   6829 N  NH2   . ARG B 1 380 ? -32.430 27.281  -9.948  1.00 29.27  ? 380 ARG B NH2   1 
ATOM   6830 N  N     . LYS B 1 381 ? -41.123 28.161  -10.538 1.00 39.90  ? 381 LYS B N     1 
ATOM   6831 C  CA    . LYS B 1 381 ? -42.434 28.106  -9.846  1.00 42.86  ? 381 LYS B CA    1 
ATOM   6832 C  C     . LYS B 1 381 ? -42.286 28.038  -8.324  1.00 42.58  ? 381 LYS B C     1 
ATOM   6833 O  O     . LYS B 1 381 ? -43.198 28.410  -7.595  1.00 43.94  ? 381 LYS B O     1 
ATOM   6834 C  CB    . LYS B 1 381 ? -43.292 26.906  -10.295 1.00 46.48  ? 381 LYS B CB    1 
ATOM   6835 C  CG    . LYS B 1 381 ? -43.416 26.672  -11.801 1.00 49.21  ? 381 LYS B CG    1 
ATOM   6836 C  CD    . LYS B 1 381 ? -44.313 27.698  -12.486 1.00 52.52  ? 381 LYS B CD    1 
ATOM   6837 C  CE    . LYS B 1 381 ? -44.011 27.750  -13.984 1.00 53.85  ? 381 LYS B CE    1 
ATOM   6838 N  NZ    . LYS B 1 381 ? -44.062 29.142  -14.529 1.00 53.42  ? 381 LYS B NZ    1 
ATOM   6839 N  N     . PHE B 1 382 ? -41.150 27.534  -7.854  1.00 41.49  ? 382 PHE B N     1 
ATOM   6840 C  CA    . PHE B 1 382 ? -40.913 27.322  -6.428  1.00 41.77  ? 382 PHE B CA    1 
ATOM   6841 C  C     . PHE B 1 382 ? -39.483 27.709  -6.058  1.00 39.77  ? 382 PHE B C     1 
ATOM   6842 O  O     . PHE B 1 382 ? -38.586 27.668  -6.903  1.00 38.46  ? 382 PHE B O     1 
ATOM   6843 C  CB    . PHE B 1 382 ? -41.182 25.858  -6.053  1.00 44.54  ? 382 PHE B CB    1 
ATOM   6844 C  CG    . PHE B 1 382 ? -40.620 24.855  -7.031  1.00 45.28  ? 382 PHE B CG    1 
ATOM   6845 C  CD1   . PHE B 1 382 ? -39.236 24.684  -7.174  1.00 44.33  ? 382 PHE B CD1   1 
ATOM   6846 C  CD2   . PHE B 1 382 ? -41.473 24.070  -7.804  1.00 48.08  ? 382 PHE B CD2   1 
ATOM   6847 C  CE1   . PHE B 1 382 ? -38.710 23.762  -8.081  1.00 44.78  ? 382 PHE B CE1   1 
ATOM   6848 C  CE2   . PHE B 1 382 ? -40.962 23.127  -8.708  1.00 49.31  ? 382 PHE B CE2   1 
ATOM   6849 C  CZ    . PHE B 1 382 ? -39.572 22.975  -8.846  1.00 47.82  ? 382 PHE B CZ    1 
ATOM   6850 N  N     . THR B 1 383 ? -39.265 28.075  -4.797  1.00 39.88  ? 383 THR B N     1 
ATOM   6851 C  CA    . THR B 1 383 ? -37.937 28.528  -4.359  1.00 38.65  ? 383 THR B CA    1 
ATOM   6852 C  C     . THR B 1 383 ? -37.382 27.760  -3.138  1.00 40.22  ? 383 THR B C     1 
ATOM   6853 O  O     . THR B 1 383 ? -36.248 27.996  -2.702  1.00 39.03  ? 383 THR B O     1 
ATOM   6854 C  CB    . THR B 1 383 ? -37.914 30.056  -4.095  1.00 37.07  ? 383 THR B CB    1 
ATOM   6855 O  OG1   . THR B 1 383 ? -38.910 30.391  -3.120  1.00 38.89  ? 383 THR B OG1   1 
ATOM   6856 C  CG2   . THR B 1 383 ? -38.189 30.837  -5.363  1.00 35.21  ? 383 THR B CG2   1 
ATOM   6857 N  N     . THR B 1 384 ? -38.180 26.842  -2.597  1.00 28.89  ? 384 THR B N     1 
ATOM   6858 C  CA    . THR B 1 384 ? -37.757 26.046  -1.444  1.00 27.90  ? 384 THR B CA    1 
ATOM   6859 C  C     . THR B 1 384 ? -37.951 24.560  -1.748  1.00 27.67  ? 384 THR B C     1 
ATOM   6860 O  O     . THR B 1 384 ? -38.833 24.203  -2.535  1.00 27.69  ? 384 THR B O     1 
ATOM   6861 C  CB    . THR B 1 384 ? -38.485 26.471  -0.129  1.00 28.67  ? 384 THR B CB    1 
ATOM   6862 O  OG1   . THR B 1 384 ? -39.888 26.274  -0.265  1.00 29.05  ? 384 THR B OG1   1 
ATOM   6863 C  CG2   . THR B 1 384 ? -38.228 27.946  0.209   1.00 29.21  ? 384 THR B CG2   1 
ATOM   6864 N  N     . PRO B 1 385 ? -37.097 23.691  -1.166  1.00 27.52  ? 385 PRO B N     1 
ATOM   6865 C  CA    . PRO B 1 385 ? -37.216 22.232  -1.381  1.00 27.60  ? 385 PRO B CA    1 
ATOM   6866 C  C     . PRO B 1 385 ? -38.588 21.703  -0.990  1.00 29.22  ? 385 PRO B C     1 
ATOM   6867 O  O     . PRO B 1 385 ? -39.153 20.864  -1.697  1.00 29.84  ? 385 PRO B O     1 
ATOM   6868 C  CB    . PRO B 1 385 ? -36.162 21.631  -0.449  1.00 26.30  ? 385 PRO B CB    1 
ATOM   6869 C  CG    . PRO B 1 385 ? -35.257 22.723  -0.114  1.00 26.67  ? 385 PRO B CG    1 
ATOM   6870 C  CD    . PRO B 1 385 ? -35.956 24.036  -0.306  1.00 26.99  ? 385 PRO B CD    1 
ATOM   6871 N  N     . GLU B 1 386 ? -39.121 22.191  0.125   1.00 30.99  ? 386 GLU B N     1 
ATOM   6872 C  CA    . GLU B 1 386 ? -40.452 21.805  0.549   1.00 32.95  ? 386 GLU B CA    1 
ATOM   6873 C  C     . GLU B 1 386 ? -41.480 22.234  -0.491  1.00 34.56  ? 386 GLU B C     1 
ATOM   6874 O  O     . GLU B 1 386 ? -42.352 21.437  -0.854  1.00 34.92  ? 386 GLU B O     1 
ATOM   6875 C  CB    . GLU B 1 386 ? -40.782 22.413  1.910   1.00 34.63  ? 386 GLU B CB    1 
ATOM   6876 C  CG    . GLU B 1 386 ? -39.847 21.980  3.035   1.00 35.80  ? 386 GLU B CG    1 
ATOM   6877 C  CD    . GLU B 1 386 ? -38.714 22.970  3.316   1.00 38.54  ? 386 GLU B CD    1 
ATOM   6878 O  OE1   . GLU B 1 386 ? -38.391 23.821  2.440   1.00 39.48  ? 386 GLU B OE1   1 
ATOM   6879 O  OE2   . GLU B 1 386 ? -38.145 22.889  4.434   1.00 39.99  ? 386 GLU B OE2   1 
ATOM   6880 N  N     . GLU B 1 387 ? -41.365 23.484  -0.962  1.00 35.89  ? 387 GLU B N     1 
ATOM   6881 C  CA    . GLU B 1 387 ? -42.235 24.054  -2.010  1.00 38.10  ? 387 GLU B CA    1 
ATOM   6882 C  C     . GLU B 1 387 ? -42.130 23.139  -3.243  1.00 36.92  ? 387 GLU B C     1 
ATOM   6883 O  O     . GLU B 1 387 ? -43.129 22.835  -3.912  1.00 37.86  ? 387 GLU B O     1 
ATOM   6884 C  CB    . GLU B 1 387 ? -41.788 25.508  -2.337  1.00 39.26  ? 387 GLU B CB    1 
ATOM   6885 C  CG    . GLU B 1 387 ? -42.842 26.547  -2.847  1.00 42.97  ? 387 GLU B CG    1 
ATOM   6886 C  CD    . GLU B 1 387 ? -42.292 28.045  -2.950  1.00 45.21  ? 387 GLU B CD    1 
ATOM   6887 O  OE1   . GLU B 1 387 ? -42.768 28.839  -3.812  1.00 48.58  ? 387 GLU B OE1   1 
ATOM   6888 O  OE2   . GLU B 1 387 ? -41.391 28.443  -2.169  1.00 45.00  ? 387 GLU B OE2   1 
ATOM   6889 N  N     . GLY B 1 388 ? -40.913 22.667  -3.501  1.00 34.90  ? 388 GLY B N     1 
ATOM   6890 C  CA    . GLY B 1 388 ? -40.618 21.907  -4.702  1.00 34.92  ? 388 GLY B CA    1 
ATOM   6891 C  C     . GLY B 1 388 ? -41.191 20.508  -4.673  1.00 34.60  ? 388 GLY B C     1 
ATOM   6892 O  O     . GLY B 1 388 ? -41.798 20.048  -5.644  1.00 35.72  ? 388 GLY B O     1 
ATOM   6893 N  N     . VAL B 1 389 ? -41.001 19.824  -3.556  1.00 33.37  ? 389 VAL B N     1 
ATOM   6894 C  CA    . VAL B 1 389 ? -41.508 18.473  -3.425  1.00 33.33  ? 389 VAL B CA    1 
ATOM   6895 C  C     . VAL B 1 389 ? -43.048 18.425  -3.364  1.00 34.87  ? 389 VAL B C     1 
ATOM   6896 O  O     . VAL B 1 389 ? -43.648 17.474  -3.871  1.00 35.36  ? 389 VAL B O     1 
ATOM   6897 C  CB    . VAL B 1 389 ? -40.855 17.754  -2.243  1.00 32.33  ? 389 VAL B CB    1 
ATOM   6898 C  CG1   . VAL B 1 389 ? -41.478 16.373  -2.034  1.00 32.36  ? 389 VAL B CG1   1 
ATOM   6899 C  CG2   . VAL B 1 389 ? -39.335 17.647  -2.468  1.00 31.09  ? 389 VAL B CG2   1 
ATOM   6900 N  N     . ARG B 1 390 ? -43.677 19.452  -2.778  1.00 35.89  ? 390 ARG B N     1 
ATOM   6901 C  CA    . ARG B 1 390 ? -45.142 19.597  -2.819  1.00 38.06  ? 390 ARG B CA    1 
ATOM   6902 C  C     . ARG B 1 390 ? -45.642 19.456  -4.257  1.00 39.24  ? 390 ARG B C     1 
ATOM   6903 O  O     . ARG B 1 390 ? -46.646 18.795  -4.509  1.00 40.36  ? 390 ARG B O     1 
ATOM   6904 C  CB    . ARG B 1 390 ? -45.613 20.939  -2.216  1.00 39.50  ? 390 ARG B CB    1 
ATOM   6905 C  CG    . ARG B 1 390 ? -47.092 20.938  -1.727  1.00 41.91  ? 390 ARG B CG    1 
ATOM   6906 C  CD    . ARG B 1 390 ? -47.503 22.154  -0.850  1.00 44.91  ? 390 ARG B CD    1 
ATOM   6907 N  NE    . ARG B 1 390 ? -46.362 22.813  -0.196  1.00 49.03  ? 390 ARG B NE    1 
ATOM   6908 C  CZ    . ARG B 1 390 ? -45.946 24.063  -0.453  1.00 51.34  ? 390 ARG B CZ    1 
ATOM   6909 N  NH1   . ARG B 1 390 ? -46.598 24.826  -1.326  1.00 53.52  ? 390 ARG B NH1   1 
ATOM   6910 N  NH2   . ARG B 1 390 ? -44.876 24.564  0.168   1.00 50.01  ? 390 ARG B NH2   1 
ATOM   6911 N  N     . SER B 1 391 ? -44.919 20.070  -5.193  1.00 39.36  ? 391 SER B N     1 
ATOM   6912 C  CA    . SER B 1 391 ? -45.266 20.027  -6.603  1.00 40.64  ? 391 SER B CA    1 
ATOM   6913 C  C     . SER B 1 391 ? -44.972 18.660  -7.229  1.00 39.72  ? 391 SER B C     1 
ATOM   6914 O  O     . SER B 1 391 ? -45.848 18.055  -7.851  1.00 40.99  ? 391 SER B O     1 
ATOM   6915 C  CB    . SER B 1 391 ? -44.521 21.134  -7.343  1.00 41.45  ? 391 SER B CB    1 
ATOM   6916 O  OG    . SER B 1 391 ? -44.743 21.054  -8.738  1.00 44.03  ? 391 SER B OG    1 
ATOM   6917 N  N     . TYR B 1 392 ? -43.747 18.172  -7.052  1.00 37.75  ? 392 TYR B N     1 
ATOM   6918 C  CA    . TYR B 1 392 ? -43.320 16.924  -7.686  1.00 37.61  ? 392 TYR B CA    1 
ATOM   6919 C  C     . TYR B 1 392 ? -44.174 15.726  -7.274  1.00 37.63  ? 392 TYR B C     1 
ATOM   6920 O  O     . TYR B 1 392 ? -44.596 14.945  -8.127  1.00 39.07  ? 392 TYR B O     1 
ATOM   6921 C  CB    . TYR B 1 392 ? -41.837 16.646  -7.421  1.00 35.92  ? 392 TYR B CB    1 
ATOM   6922 C  CG    . TYR B 1 392 ? -41.368 15.321  -7.972  1.00 36.00  ? 392 TYR B CG    1 
ATOM   6923 C  CD1   . TYR B 1 392 ? -41.024 15.174  -9.315  1.00 37.72  ? 392 TYR B CD1   1 
ATOM   6924 C  CD2   . TYR B 1 392 ? -41.276 14.209  -7.148  1.00 35.61  ? 392 TYR B CD2   1 
ATOM   6925 C  CE1   . TYR B 1 392 ? -40.597 13.946  -9.821  1.00 38.59  ? 392 TYR B CE1   1 
ATOM   6926 C  CE2   . TYR B 1 392 ? -40.851 12.983  -7.640  1.00 36.38  ? 392 TYR B CE2   1 
ATOM   6927 C  CZ    . TYR B 1 392 ? -40.519 12.856  -8.971  1.00 37.50  ? 392 TYR B CZ    1 
ATOM   6928 O  OH    . TYR B 1 392 ? -40.107 11.627  -9.423  1.00 38.81  ? 392 TYR B OH    1 
ATOM   6929 N  N     . ALA B 1 393 ? -44.422 15.588  -5.971  1.00 36.31  ? 393 ALA B N     1 
ATOM   6930 C  CA    . ALA B 1 393 ? -45.270 14.528  -5.450  1.00 36.14  ? 393 ALA B CA    1 
ATOM   6931 C  C     . ALA B 1 393 ? -46.702 14.646  -5.982  1.00 38.54  ? 393 ALA B C     1 
ATOM   6932 O  O     . ALA B 1 393 ? -47.328 13.641  -6.319  1.00 39.64  ? 393 ALA B O     1 
ATOM   6933 C  CB    . ALA B 1 393 ? -45.258 14.552  -3.955  1.00 34.85  ? 393 ALA B CB    1 
ATOM   6934 N  N     . SER B 1 394 ? -47.211 15.871  -6.071  1.00 39.76  ? 394 SER B N     1 
ATOM   6935 C  CA    . SER B 1 394 ? -48.527 16.116  -6.651  1.00 42.38  ? 394 SER B CA    1 
ATOM   6936 C  C     . SER B 1 394 ? -48.659 15.642  -8.095  1.00 44.23  ? 394 SER B C     1 
ATOM   6937 O  O     . SER B 1 394 ? -49.701 15.093  -8.483  1.00 46.13  ? 394 SER B O     1 
ATOM   6938 C  CB    . SER B 1 394 ? -48.890 17.597  -6.569  1.00 43.74  ? 394 SER B CB    1 
ATOM   6939 O  OG    . SER B 1 394 ? -49.669 17.848  -5.414  1.00 44.45  ? 394 SER B OG    1 
ATOM   6940 N  N     . THR B 1 395 ? -47.616 15.861  -8.893  1.00 43.94  ? 395 THR B N     1 
ATOM   6941 C  CA    . THR B 1 395 ? -47.699 15.577  -10.325 1.00 46.04  ? 395 THR B CA    1 
ATOM   6942 C  C     . THR B 1 395 ? -47.129 14.216  -10.689 1.00 45.42  ? 395 THR B C     1 
ATOM   6943 O  O     . THR B 1 395 ? -47.530 13.625  -11.692 1.00 47.77  ? 395 THR B O     1 
ATOM   6944 C  CB    . THR B 1 395 ? -47.025 16.669  -11.178 1.00 47.08  ? 395 THR B CB    1 
ATOM   6945 O  OG1   . THR B 1 395 ? -45.788 17.056  -10.570 1.00 45.20  ? 395 THR B OG1   1 
ATOM   6946 C  CG2   . THR B 1 395 ? -47.930 17.888  -11.295 1.00 49.29  ? 395 THR B CG2   1 
ATOM   6947 N  N     . HIS B 1 396 ? -46.213 13.710  -9.872  1.00 42.70  ? 396 HIS B N     1 
ATOM   6948 C  CA    . HIS B 1 396 ? -45.535 12.472  -10.203 1.00 42.26  ? 396 HIS B CA    1 
ATOM   6949 C  C     . HIS B 1 396 ? -45.827 11.375  -9.202  1.00 41.36  ? 396 HIS B C     1 
ATOM   6950 O  O     . HIS B 1 396 ? -44.981 10.510  -8.971  1.00 40.75  ? 396 HIS B O     1 
ATOM   6951 C  CB    . HIS B 1 396 ? -44.030 12.701  -10.288 1.00 41.10  ? 396 HIS B CB    1 
ATOM   6952 C  CG    . HIS B 1 396 ? -43.617 13.614  -11.396 1.00 41.74  ? 396 HIS B CG    1 
ATOM   6953 N  ND1   . HIS B 1 396 ? -42.940 13.170  -12.511 1.00 43.12  ? 396 HIS B ND1   1 
ATOM   6954 C  CD2   . HIS B 1 396 ? -43.776 14.947  -11.558 1.00 41.31  ? 396 HIS B CD2   1 
ATOM   6955 C  CE1   . HIS B 1 396 ? -42.703 14.189  -13.314 1.00 44.11  ? 396 HIS B CE1   1 
ATOM   6956 N  NE2   . HIS B 1 396 ? -43.202 15.279  -12.761 1.00 43.67  ? 396 HIS B NE2   1 
ATOM   6957 N  N     . TRP B 1 397 ? -47.020 11.395  -8.611  1.00 41.83  ? 397 TRP B N     1 
ATOM   6958 C  CA    . TRP B 1 397 ? -47.410 10.356  -7.649  1.00 41.28  ? 397 TRP B CA    1 
ATOM   6959 C  C     . TRP B 1 397 ? -47.315 8.952   -8.256  1.00 42.53  ? 397 TRP B C     1 
ATOM   6960 O  O     . TRP B 1 397 ? -46.919 8.015   -7.581  1.00 42.10  ? 397 TRP B O     1 
ATOM   6961 C  CB    . TRP B 1 397 ? -48.815 10.608  -7.088  1.00 42.06  ? 397 TRP B CB    1 
ATOM   6962 C  CG    . TRP B 1 397 ? -49.834 10.831  -8.150  1.00 44.67  ? 397 TRP B CG    1 
ATOM   6963 C  CD1   . TRP B 1 397 ? -50.142 12.016  -8.747  1.00 45.77  ? 397 TRP B CD1   1 
ATOM   6964 C  CD2   . TRP B 1 397 ? -50.662 9.840   -8.769  1.00 46.32  ? 397 TRP B CD2   1 
ATOM   6965 N  NE1   . TRP B 1 397 ? -51.120 11.830  -9.691  1.00 48.95  ? 397 TRP B NE1   1 
ATOM   6966 C  CE2   . TRP B 1 397 ? -51.459 10.505  -9.730  1.00 48.76  ? 397 TRP B CE2   1 
ATOM   6967 C  CE3   . TRP B 1 397 ? -50.814 8.459   -8.601  1.00 46.16  ? 397 TRP B CE3   1 
ATOM   6968 C  CZ2   . TRP B 1 397 ? -52.395 9.838   -10.525 1.00 51.71  ? 397 TRP B CZ2   1 
ATOM   6969 C  CZ3   . TRP B 1 397 ? -51.751 7.791   -9.393  1.00 49.37  ? 397 TRP B CZ3   1 
ATOM   6970 C  CH2   . TRP B 1 397 ? -52.530 8.485   -10.343 1.00 51.76  ? 397 TRP B CH2   1 
ATOM   6971 N  N     . HIS B 1 398 ? -47.652 8.826   -9.537  1.00 44.76  ? 398 HIS B N     1 
ATOM   6972 C  CA    . HIS B 1 398 ? -47.692 7.541   -10.227 1.00 46.28  ? 398 HIS B CA    1 
ATOM   6973 C  C     . HIS B 1 398 ? -46.319 6.895   -10.416 1.00 45.72  ? 398 HIS B C     1 
ATOM   6974 O  O     . HIS B 1 398 ? -46.221 5.693   -10.619 1.00 46.79  ? 398 HIS B O     1 
ATOM   6975 C  CB    . HIS B 1 398 ? -48.365 7.712   -11.587 1.00 49.29  ? 398 HIS B CB    1 
ATOM   6976 C  CG    . HIS B 1 398 ? -47.867 8.899   -12.353 1.00 50.70  ? 398 HIS B CG    1 
ATOM   6977 N  ND1   . HIS B 1 398 ? -48.657 9.996   -12.624 1.00 51.88  ? 398 HIS B ND1   1 
ATOM   6978 C  CD2   . HIS B 1 398 ? -46.652 9.169   -12.889 1.00 50.68  ? 398 HIS B CD2   1 
ATOM   6979 C  CE1   . HIS B 1 398 ? -47.955 10.883  -13.305 1.00 52.83  ? 398 HIS B CE1   1 
ATOM   6980 N  NE2   . HIS B 1 398 ? -46.736 10.405  -13.479 1.00 52.22  ? 398 HIS B NE2   1 
ATOM   6981 N  N     . THR B 1 399 ? -45.256 7.683   -10.370 1.00 44.39  ? 399 THR B N     1 
ATOM   6982 C  CA    . THR B 1 399 ? -43.934 7.102   -10.522 1.00 44.34  ? 399 THR B CA    1 
ATOM   6983 C  C     . THR B 1 399 ? -43.350 6.699   -9.165  1.00 42.08  ? 399 THR B C     1 
ATOM   6984 O  O     . THR B 1 399 ? -42.239 6.177   -9.094  1.00 42.11  ? 399 THR B O     1 
ATOM   6985 C  CB    . THR B 1 399 ? -42.970 8.021   -11.336 1.00 44.96  ? 399 THR B CB    1 
ATOM   6986 O  OG1   . THR B 1 399 ? -41.805 7.276   -11.723 1.00 46.16  ? 399 THR B OG1   1 
ATOM   6987 C  CG2   . THR B 1 399 ? -42.543 9.258   -10.535 1.00 42.53  ? 399 THR B CG2   1 
ATOM   6988 N  N     . LEU B 1 400 ? -44.122 6.909   -8.098  1.00 40.59  ? 400 LEU B N     1 
ATOM   6989 C  CA    . LEU B 1 400 ? -43.633 6.701   -6.723  1.00 38.62  ? 400 LEU B CA    1 
ATOM   6990 C  C     . LEU B 1 400 ? -44.055 5.385   -6.052  1.00 39.12  ? 400 LEU B C     1 
ATOM   6991 O  O     . LEU B 1 400 ? -44.191 5.333   -4.827  1.00 38.46  ? 400 LEU B O     1 
ATOM   6992 C  CB    . LEU B 1 400 ? -44.040 7.875   -5.825  1.00 36.77  ? 400 LEU B CB    1 
ATOM   6993 C  CG    . LEU B 1 400 ? -43.646 9.299   -6.215  1.00 35.95  ? 400 LEU B CG    1 
ATOM   6994 C  CD1   . LEU B 1 400 ? -44.196 10.284  -5.203  1.00 33.52  ? 400 LEU B CD1   1 
ATOM   6995 C  CD2   . LEU B 1 400 ? -42.142 9.441   -6.330  1.00 35.56  ? 400 LEU B CD2   1 
ATOM   6996 N  N     . GLY B 1 401 ? -44.246 4.328   -6.836  1.00 40.76  ? 401 GLY B N     1 
ATOM   6997 C  CA    . GLY B 1 401 ? -44.635 3.040   -6.280  1.00 41.29  ? 401 GLY B CA    1 
ATOM   6998 C  C     . GLY B 1 401 ? -46.134 2.884   -6.386  1.00 42.31  ? 401 GLY B C     1 
ATOM   6999 O  O     . GLY B 1 401 ? -46.864 3.854   -6.241  1.00 41.75  ? 401 GLY B O     1 
ATOM   7000 N  N     . LYS B 1 402 ? -46.594 1.661   -6.640  1.00 44.14  ? 402 LYS B N     1 
ATOM   7001 C  CA    . LYS B 1 402 ? -48.001 1.403   -6.920  1.00 45.60  ? 402 LYS B CA    1 
ATOM   7002 C  C     . LYS B 1 402 ? -48.952 1.914   -5.831  1.00 44.50  ? 402 LYS B C     1 
ATOM   7003 O  O     . LYS B 1 402 ? -49.970 2.531   -6.132  1.00 44.99  ? 402 LYS B O     1 
ATOM   7004 C  CB    . LYS B 1 402 ? -48.225 -0.093  -7.154  1.00 47.93  ? 402 LYS B CB    1 
ATOM   7005 C  CG    . LYS B 1 402 ? -49.424 -0.440  -8.037  1.00 50.53  ? 402 LYS B CG    1 
ATOM   7006 C  CD    . LYS B 1 402 ? -50.729 -0.450  -7.265  1.00 52.13  ? 402 LYS B CD    1 
ATOM   7007 C  CE    . LYS B 1 402 ? -51.796 -1.297  -7.962  1.00 56.71  ? 402 LYS B CE    1 
ATOM   7008 N  NZ    . LYS B 1 402 ? -52.123 -0.806  -9.338  1.00 59.17  ? 402 LYS B NZ    1 
ATOM   7009 N  N     . ASN B 1 403 ? -48.623 1.649   -4.574  1.00 43.21  ? 403 ASN B N     1 
ATOM   7010 C  CA    . ASN B 1 403 ? -49.521 1.983   -3.478  1.00 42.74  ? 403 ASN B CA    1 
ATOM   7011 C  C     . ASN B 1 403 ? -49.073 3.244   -2.782  1.00 41.13  ? 403 ASN B C     1 
ATOM   7012 O  O     . ASN B 1 403 ? -49.865 4.151   -2.543  1.00 41.33  ? 403 ASN B O     1 
ATOM   7013 C  CB    . ASN B 1 403 ? -49.601 0.825   -2.495  1.00 43.16  ? 403 ASN B CB    1 
ATOM   7014 C  CG    . ASN B 1 403 ? -49.833 -0.492  -3.191  1.00 44.83  ? 403 ASN B CG    1 
ATOM   7015 O  OD1   . ASN B 1 403 ? -50.781 -0.639  -3.954  1.00 46.34  ? 403 ASN B OD1   1 
ATOM   7016 N  ND2   . ASN B 1 403 ? -48.952 -1.448  -2.959  1.00 45.24  ? 403 ASN B ND2   1 
ATOM   7017 N  N     . VAL B 1 404 ? -47.791 3.311   -2.467  1.00 40.11  ? 404 VAL B N     1 
ATOM   7018 C  CA    . VAL B 1 404 ? -47.243 4.519   -1.910  1.00 38.73  ? 404 VAL B CA    1 
ATOM   7019 C  C     . VAL B 1 404 ? -47.731 5.678   -2.761  1.00 39.02  ? 404 VAL B C     1 
ATOM   7020 O  O     . VAL B 1 404 ? -48.285 6.643   -2.230  1.00 38.91  ? 404 VAL B O     1 
ATOM   7021 C  CB    . VAL B 1 404 ? -45.724 4.452   -1.861  1.00 37.84  ? 404 VAL B CB    1 
ATOM   7022 C  CG1   . VAL B 1 404 ? -45.136 5.807   -1.528  1.00 36.02  ? 404 VAL B CG1   1 
ATOM   7023 C  CG2   . VAL B 1 404 ? -45.308 3.413   -0.826  1.00 38.91  ? 404 VAL B CG2   1 
ATOM   7024 N  N     . GLY B 1 405 ? -47.558 5.547   -4.079  1.00 40.09  ? 405 GLY B N     1 
ATOM   7025 C  CA    . GLY B 1 405 ? -48.027 6.526   -5.060  1.00 41.02  ? 405 GLY B CA    1 
ATOM   7026 C  C     . GLY B 1 405 ? -49.520 6.806   -5.019  1.00 42.85  ? 405 GLY B C     1 
ATOM   7027 O  O     . GLY B 1 405 ? -49.933 7.977   -4.973  1.00 43.26  ? 405 GLY B O     1 
ATOM   7028 N  N     . GLU B 1 406 ? -50.333 5.747   -5.034  1.00 44.22  ? 406 GLU B N     1 
ATOM   7029 C  CA    . GLU B 1 406 ? -51.785 5.892   -4.907  1.00 46.36  ? 406 GLU B CA    1 
ATOM   7030 C  C     . GLU B 1 406 ? -52.141 6.621   -3.606  1.00 45.19  ? 406 GLU B C     1 
ATOM   7031 O  O     . GLU B 1 406 ? -53.026 7.478   -3.594  1.00 46.64  ? 406 GLU B O     1 
ATOM   7032 C  CB    . GLU B 1 406 ? -52.519 4.537   -5.024  1.00 47.76  ? 406 GLU B CB    1 
ATOM   7033 C  CG    . GLU B 1 406 ? -52.877 4.103   -6.482  1.00 51.03  ? 406 GLU B CG    1 
ATOM   7034 C  CD    . GLU B 1 406 ? -53.436 2.655   -6.593  1.00 53.67  ? 406 GLU B CD    1 
ATOM   7035 O  OE1   . GLU B 1 406 ? -54.518 2.465   -7.196  1.00 58.29  ? 406 GLU B OE1   1 
ATOM   7036 O  OE2   . GLU B 1 406 ? -52.809 1.696   -6.079  1.00 55.78  ? 406 GLU B OE2   1 
ATOM   7037 N  N     . SER B 1 407 ? -51.430 6.305   -2.527  1.00 43.32  ? 407 SER B N     1 
ATOM   7038 C  CA    . SER B 1 407 ? -51.666 6.948   -1.244  1.00 42.90  ? 407 SER B CA    1 
ATOM   7039 C  C     . SER B 1 407 ? -51.294 8.419   -1.280  1.00 42.32  ? 407 SER B C     1 
ATOM   7040 O  O     . SER B 1 407 ? -52.055 9.256   -0.802  1.00 43.67  ? 407 SER B O     1 
ATOM   7041 C  CB    . SER B 1 407 ? -50.904 6.246   -0.121  1.00 42.06  ? 407 SER B CB    1 
ATOM   7042 O  OG    . SER B 1 407 ? -51.083 6.939   1.107   1.00 42.28  ? 407 SER B OG    1 
ATOM   7043 N  N     . ILE B 1 408 ? -50.126 8.734   -1.838  1.00 40.91  ? 408 ILE B N     1 
ATOM   7044 C  CA    . ILE B 1 408 ? -49.687 10.127  -1.973  1.00 40.14  ? 408 ILE B CA    1 
ATOM   7045 C  C     . ILE B 1 408 ? -50.688 10.907  -2.824  1.00 42.17  ? 408 ILE B C     1 
ATOM   7046 O  O     . ILE B 1 408 ? -50.994 12.063  -2.516  1.00 42.54  ? 408 ILE B O     1 
ATOM   7047 C  CB    . ILE B 1 408 ? -48.209 10.240  -2.508  1.00 38.39  ? 408 ILE B CB    1 
ATOM   7048 C  CG1   . ILE B 1 408 ? -47.222 9.988   -1.369  1.00 36.33  ? 408 ILE B CG1   1 
ATOM   7049 C  CG2   . ILE B 1 408 ? -47.922 11.613  -3.122  1.00 37.20  ? 408 ILE B CG2   1 
ATOM   7050 C  CD1   . ILE B 1 408 ? -45.837 9.598   -1.800  1.00 33.55  ? 408 ILE B CD1   1 
ATOM   7051 N  N     . ARG B 1 409 ? -51.217 10.257  -3.864  1.00 43.87  ? 409 ARG B N     1 
ATOM   7052 C  CA    . ARG B 1 409 ? -52.182 10.894  -4.764  1.00 46.84  ? 409 ARG B CA    1 
ATOM   7053 C  C     . ARG B 1 409 ? -53.384 11.469  -4.032  1.00 48.90  ? 409 ARG B C     1 
ATOM   7054 O  O     . ARG B 1 409 ? -53.816 12.579  -4.322  1.00 50.29  ? 409 ARG B O     1 
ATOM   7055 C  CB    . ARG B 1 409 ? -52.676 9.935   -5.841  1.00 48.47  ? 409 ARG B CB    1 
ATOM   7056 C  CG    . ARG B 1 409 ? -53.562 10.617  -6.891  1.00 51.93  ? 409 ARG B CG    1 
ATOM   7057 C  CD    . ARG B 1 409 ? -54.513 9.627   -7.515  1.00 56.06  ? 409 ARG B CD    1 
ATOM   7058 N  NE    . ARG B 1 409 ? -55.183 10.153  -8.702  1.00 60.88  ? 409 ARG B NE    1 
ATOM   7059 C  CZ    . ARG B 1 409 ? -55.917 9.412   -9.533  1.00 64.59  ? 409 ARG B CZ    1 
ATOM   7060 N  NH1   . ARG B 1 409 ? -56.070 8.112   -9.314  1.00 65.31  ? 409 ARG B NH1   1 
ATOM   7061 N  NH2   . ARG B 1 409 ? -56.499 9.965   -10.590 1.00 68.09  ? 409 ARG B NH2   1 
ATOM   7062 N  N     . GLU B 1 410 ? -53.929 10.715  -3.087  1.00 49.84  ? 410 GLU B N     1 
ATOM   7063 C  CA    . GLU B 1 410 ? -55.122 11.177  -2.400  1.00 52.87  ? 410 GLU B CA    1 
ATOM   7064 C  C     . GLU B 1 410 ? -54.819 12.124  -1.252  1.00 52.40  ? 410 GLU B C     1 
ATOM   7065 O  O     . GLU B 1 410 ? -55.643 12.966  -0.928  1.00 54.76  ? 410 GLU B O     1 
ATOM   7066 C  CB    . GLU B 1 410 ? -55.987 10.011  -1.936  1.00 54.28  ? 410 GLU B CB    1 
ATOM   7067 C  CG    . GLU B 1 410 ? -55.477 9.298   -0.715  1.00 54.51  ? 410 GLU B CG    1 
ATOM   7068 C  CD    . GLU B 1 410 ? -56.182 7.984   -0.490  1.00 58.58  ? 410 GLU B CD    1 
ATOM   7069 O  OE1   . GLU B 1 410 ? -56.711 7.400   -1.474  1.00 60.01  ? 410 GLU B OE1   1 
ATOM   7070 O  OE2   . GLU B 1 410 ? -56.197 7.535   0.677   1.00 60.22  ? 410 GLU B OE2   1 
ATOM   7071 N  N     . TYR B 1 411 ? -53.649 11.985  -0.636  1.00 50.23  ? 411 TYR B N     1 
ATOM   7072 C  CA    . TYR B 1 411 ? -53.246 12.907  0.424   1.00 50.34  ? 411 TYR B CA    1 
ATOM   7073 C  C     . TYR B 1 411 ? -51.825 12.734  0.921   1.00 47.77  ? 411 TYR B C     1 
ATOM   7074 O  O     . TYR B 1 411 ? -51.346 11.617  1.105   1.00 46.89  ? 411 TYR B O     1 
ATOM   7075 C  CB    . TYR B 1 411 ? -54.173 12.804  1.631   1.00 52.56  ? 411 TYR B CB    1 
ATOM   7076 C  CG    . TYR B 1 411 ? -53.827 13.792  2.717   1.00 53.29  ? 411 TYR B CG    1 
ATOM   7077 C  CD1   . TYR B 1 411 ? -53.203 13.374  3.897   1.00 51.69  ? 411 TYR B CD1   1 
ATOM   7078 C  CD2   . TYR B 1 411 ? -54.107 15.154  2.555   1.00 54.98  ? 411 TYR B CD2   1 
ATOM   7079 C  CE1   . TYR B 1 411 ? -52.890 14.284  4.896   1.00 52.81  ? 411 TYR B CE1   1 
ATOM   7080 C  CE2   . TYR B 1 411 ? -53.800 16.074  3.542   1.00 55.55  ? 411 TYR B CE2   1 
ATOM   7081 C  CZ    . TYR B 1 411 ? -53.193 15.636  4.712   1.00 55.20  ? 411 TYR B CZ    1 
ATOM   7082 O  OH    . TYR B 1 411 ? -52.884 16.561  5.691   1.00 57.23  ? 411 TYR B OH    1 
ATOM   7083 N  N     . PHE B 1 412 ? -51.177 13.864  1.161   1.00 47.13  ? 412 PHE B N     1 
ATOM   7084 C  CA    . PHE B 1 412 ? -49.924 13.911  1.887   1.00 45.41  ? 412 PHE B CA    1 
ATOM   7085 C  C     . PHE B 1 412 ? -49.790 15.301  2.458   1.00 46.33  ? 412 PHE B C     1 
ATOM   7086 O  O     . PHE B 1 412 ? -50.479 16.222  2.033   1.00 48.29  ? 412 PHE B O     1 
ATOM   7087 C  CB    . PHE B 1 412 ? -48.741 13.621  0.969   1.00 43.33  ? 412 PHE B CB    1 
ATOM   7088 C  CG    . PHE B 1 412 ? -48.454 14.715  -0.022  1.00 43.38  ? 412 PHE B CG    1 
ATOM   7089 C  CD1   . PHE B 1 412 ? -47.500 15.693  0.257   1.00 42.64  ? 412 PHE B CD1   1 
ATOM   7090 C  CD2   . PHE B 1 412 ? -49.123 14.759  -1.244  1.00 44.03  ? 412 PHE B CD2   1 
ATOM   7091 C  CE1   . PHE B 1 412 ? -47.226 16.706  -0.657  1.00 42.61  ? 412 PHE B CE1   1 
ATOM   7092 C  CE2   . PHE B 1 412 ? -48.853 15.767  -2.167  1.00 44.60  ? 412 PHE B CE2   1 
ATOM   7093 C  CZ    . PHE B 1 412 ? -47.905 16.743  -1.873  1.00 43.94  ? 412 PHE B CZ    1 
ATOM   7094 N  N     . GLU B 1 413 ? -48.911 15.456  3.428   1.00 45.64  ? 413 GLU B N     1 
ATOM   7095 C  CA    . GLU B 1 413 ? -48.527 16.787  3.849   1.00 46.64  ? 413 GLU B CA    1 
ATOM   7096 C  C     . GLU B 1 413 ? -47.017 16.876  4.014   1.00 44.27  ? 413 GLU B C     1 
ATOM   7097 O  O     . GLU B 1 413 ? -46.322 15.850  4.054   1.00 42.68  ? 413 GLU B O     1 
ATOM   7098 C  CB    . GLU B 1 413 ? -49.294 17.239  5.097   1.00 49.19  ? 413 GLU B CB    1 
ATOM   7099 C  CG    . GLU B 1 413 ? -49.314 16.261  6.247   1.00 50.36  ? 413 GLU B CG    1 
ATOM   7100 C  CD    . GLU B 1 413 ? -50.126 16.773  7.430   1.00 54.01  ? 413 GLU B CD    1 
ATOM   7101 O  OE1   . GLU B 1 413 ? -49.833 16.355  8.578   1.00 57.08  ? 413 GLU B OE1   1 
ATOM   7102 O  OE2   . GLU B 1 413 ? -51.056 17.588  7.219   1.00 56.58  ? 413 GLU B OE2   1 
ATOM   7103 N  N     . ILE B 1 414 ? -46.511 18.102  4.064   1.00 44.43  ? 414 ILE B N     1 
ATOM   7104 C  CA    . ILE B 1 414 ? -45.083 18.318  4.207   1.00 42.91  ? 414 ILE B CA    1 
ATOM   7105 C  C     . ILE B 1 414 ? -44.807 18.910  5.567   1.00 44.73  ? 414 ILE B C     1 
ATOM   7106 O  O     . ILE B 1 414 ? -45.287 19.989  5.887   1.00 46.79  ? 414 ILE B O     1 
ATOM   7107 C  CB    . ILE B 1 414 ? -44.513 19.154  3.057   1.00 41.65  ? 414 ILE B CB    1 
ATOM   7108 C  CG1   . ILE B 1 414 ? -44.371 18.257  1.840   1.00 39.11  ? 414 ILE B CG1   1 
ATOM   7109 C  CG2   . ILE B 1 414 ? -43.149 19.726  3.410   1.00 40.76  ? 414 ILE B CG2   1 
ATOM   7110 C  CD1   . ILE B 1 414 ? -44.519 18.959  0.573   1.00 38.87  ? 414 ILE B CD1   1 
ATOM   7111 N  N     . ILE B 1 415 ? -44.054 18.163  6.364   1.00 44.71  ? 415 ILE B N     1 
ATOM   7112 C  CA    . ILE B 1 415 ? -43.772 18.518  7.746   1.00 47.01  ? 415 ILE B CA    1 
ATOM   7113 C  C     . ILE B 1 415 ? -42.321 18.986  7.836   1.00 46.39  ? 415 ILE B C     1 
ATOM   7114 O  O     . ILE B 1 415 ? -41.420 18.315  7.339   1.00 44.38  ? 415 ILE B O     1 
ATOM   7115 C  CB    . ILE B 1 415 ? -43.980 17.299  8.695   1.00 47.60  ? 415 ILE B CB    1 
ATOM   7116 C  CG1   . ILE B 1 415 ? -45.248 16.513  8.345   1.00 48.08  ? 415 ILE B CG1   1 
ATOM   7117 C  CG2   . ILE B 1 415 ? -44.006 17.743  10.142  1.00 50.91  ? 415 ILE B CG2   1 
ATOM   7118 C  CD1   . ILE B 1 415 ? -46.559 17.092  8.904   1.00 51.81  ? 415 ILE B CD1   1 
ATOM   7119 N  N     . SER B 1 416 ? -42.098 20.136  8.461   1.00 48.79  ? 416 SER B N     1 
ATOM   7120 C  CA    . SER B 1 416 ? -40.745 20.656  8.639   1.00 49.28  ? 416 SER B CA    1 
ATOM   7121 C  C     . SER B 1 416 ? -40.605 21.437  9.926   1.00 52.64  ? 416 SER B C     1 
ATOM   7122 O  O     . SER B 1 416 ? -41.601 21.768  10.576  1.00 55.31  ? 416 SER B O     1 
ATOM   7123 C  CB    . SER B 1 416 ? -40.344 21.552  7.466   1.00 47.98  ? 416 SER B CB    1 
ATOM   7124 O  OG    . SER B 1 416 ? -41.191 22.682  7.388   1.00 49.88  ? 416 SER B OG    1 
ATOM   7125 N  N     . GLY B 1 417 ? -39.355 21.738  10.275  1.00 53.38  ? 417 GLY B N     1 
ATOM   7126 C  CA    . GLY B 1 417 ? -39.037 22.510  11.466  1.00 56.74  ? 417 GLY B CA    1 
ATOM   7127 C  C     . GLY B 1 417 ? -39.697 21.946  12.709  1.00 60.17  ? 417 GLY B C     1 
ATOM   7128 O  O     . GLY B 1 417 ? -39.694 20.728  12.942  1.00 59.42  ? 417 GLY B O     1 
ATOM   7129 N  N     . GLU B 1 418 ? -40.289 22.851  13.485  1.00 64.06  ? 418 GLU B N     1 
ATOM   7130 C  CA    . GLU B 1 418 ? -40.867 22.550  14.792  1.00 68.13  ? 418 GLU B CA    1 
ATOM   7131 C  C     . GLU B 1 418 ? -41.862 21.385  14.774  1.00 67.88  ? 418 GLU B C     1 
ATOM   7132 O  O     . GLU B 1 418 ? -41.807 20.498  15.634  1.00 69.46  ? 418 GLU B O     1 
ATOM   7133 C  CB    . GLU B 1 418 ? -41.529 23.810  15.357  1.00 72.09  ? 418 GLU B CB    1 
ATOM   7134 C  CG    . GLU B 1 418 ? -40.588 25.017  15.457  1.00 74.89  ? 418 GLU B CG    1 
ATOM   7135 C  CD    . GLU B 1 418 ? -39.743 25.017  16.737  1.00 80.21  ? 418 GLU B CD    1 
ATOM   7136 O  OE1   . GLU B 1 418 ? -38.742 25.774  16.801  1.00 80.80  ? 418 GLU B OE1   1 
ATOM   7137 O  OE2   . GLU B 1 418 ? -40.081 24.265  17.683  1.00 83.21  ? 418 GLU B OE2   1 
ATOM   7138 N  N     . LYS B 1 419 ? -42.758 21.381  13.790  1.00 66.24  ? 419 LYS B N     1 
ATOM   7139 C  CA    . LYS B 1 419 ? -43.813 20.367  13.709  1.00 66.11  ? 419 LYS B CA    1 
ATOM   7140 C  C     . LYS B 1 419 ? -43.257 18.948  13.534  1.00 63.10  ? 419 LYS B C     1 
ATOM   7141 O  O     . LYS B 1 419 ? -43.894 17.974  13.935  1.00 63.85  ? 419 LYS B O     1 
ATOM   7142 C  CB    . LYS B 1 419 ? -44.767 20.701  12.556  1.00 65.50  ? 419 LYS B CB    1 
ATOM   7143 C  CG    . LYS B 1 419 ? -46.174 20.125  12.688  1.00 68.13  ? 419 LYS B CG    1 
ATOM   7144 C  CD    . LYS B 1 419 ? -47.184 21.181  13.142  1.00 74.22  ? 419 LYS B CD    1 
ATOM   7145 C  CE    . LYS B 1 419 ? -47.382 21.212  14.664  1.00 79.34  ? 419 LYS B CE    1 
ATOM   7146 N  NZ    . LYS B 1 419 ? -46.324 22.006  15.357  1.00 81.10  ? 419 LYS B NZ    1 
ATOM   7147 N  N     . LEU B 1 420 ? -42.063 18.854  12.948  1.00 59.58  ? 420 LEU B N     1 
ATOM   7148 C  CA    . LEU B 1 420 ? -41.459 17.574  12.545  1.00 56.75  ? 420 LEU B CA    1 
ATOM   7149 C  C     . LEU B 1 420 ? -40.875 16.752  13.701  1.00 58.09  ? 420 LEU B C     1 
ATOM   7150 O  O     . LEU B 1 420 ? -41.066 15.530  13.758  1.00 57.80  ? 420 LEU B O     1 
ATOM   7151 C  CB    . LEU B 1 420 ? -40.406 17.806  11.447  1.00 53.57  ? 420 LEU B CB    1 
ATOM   7152 C  CG    . LEU B 1 420 ? -39.576 16.637  10.918  1.00 51.62  ? 420 LEU B CG    1 
ATOM   7153 C  CD1   . LEU B 1 420 ? -40.431 15.679  10.139  1.00 49.68  ? 420 LEU B CD1   1 
ATOM   7154 C  CD2   . LEU B 1 420 ? -38.436 17.141  10.055  1.00 49.74  ? 420 LEU B CD2   1 
ATOM   7155 N  N     . PHE B 1 421 ? -40.177 17.424  14.615  1.00 59.57  ? 421 PHE B N     1 
ATOM   7156 C  CA    . PHE B 1 421 ? -39.505 16.759  15.737  1.00 61.27  ? 421 PHE B CA    1 
ATOM   7157 C  C     . PHE B 1 421 ? -40.490 16.155  16.735  1.00 63.95  ? 421 PHE B C     1 
ATOM   7158 O  O     . PHE B 1 421 ? -40.084 15.495  17.691  1.00 66.29  ? 421 PHE B O     1 
ATOM   7159 C  CB    . PHE B 1 421 ? -38.537 17.721  16.439  1.00 63.16  ? 421 PHE B CB    1 
ATOM   7160 C  CG    . PHE B 1 421 ? -37.712 18.543  15.491  1.00 60.87  ? 421 PHE B CG    1 
ATOM   7161 C  CD1   . PHE B 1 421 ? -37.846 19.924  15.454  1.00 61.85  ? 421 PHE B CD1   1 
ATOM   7162 C  CD2   . PHE B 1 421 ? -36.821 17.934  14.605  1.00 58.97  ? 421 PHE B CD2   1 
ATOM   7163 C  CE1   . PHE B 1 421 ? -37.090 20.695  14.561  1.00 59.71  ? 421 PHE B CE1   1 
ATOM   7164 C  CE2   . PHE B 1 421 ? -36.064 18.699  13.702  1.00 56.72  ? 421 PHE B CE2   1 
ATOM   7165 C  CZ    . PHE B 1 421 ? -36.201 20.080  13.684  1.00 56.58  ? 421 PHE B CZ    1 
ATOM   7166 N  N     . LYS B 1 422 ? -41.779 16.382  16.494  1.00 63.77  ? 422 LYS B N     1 
ATOM   7167 C  CA    . LYS B 1 422 ? -42.844 15.811  17.308  1.00 66.29  ? 422 LYS B CA    1 
ATOM   7168 C  C     . LYS B 1 422 ? -43.363 14.503  16.710  1.00 64.06  ? 422 LYS B C     1 
ATOM   7169 O  O     . LYS B 1 422 ? -43.974 13.698  17.407  1.00 66.46  ? 422 LYS B O     1 
ATOM   7170 C  CB    . LYS B 1 422 ? -43.965 16.833  17.516  1.00 68.57  ? 422 LYS B CB    1 
ATOM   7171 C  CG    . LYS B 1 422 ? -43.615 17.889  18.564  1.00 72.67  ? 422 LYS B CG    1 
ATOM   7172 C  CD    . LYS B 1 422 ? -44.217 19.271  18.271  1.00 74.75  ? 422 LYS B CD    1 
ATOM   7173 C  CE    . LYS B 1 422 ? -45.577 19.503  18.945  1.00 79.16  ? 422 LYS B CE    1 
ATOM   7174 N  NZ    . LYS B 1 422 ? -46.733 19.096  18.088  1.00 77.77  ? 422 LYS B NZ    1 
ATOM   7175 N  N     . GLU B 1 423 ? -43.097 14.289  15.426  1.00 59.77  ? 423 GLU B N     1 
ATOM   7176 C  CA    . GLU B 1 423 ? -43.383 13.016  14.764  1.00 57.66  ? 423 GLU B CA    1 
ATOM   7177 C  C     . GLU B 1 423 ? -42.375 11.935  15.196  1.00 57.47  ? 423 GLU B C     1 
ATOM   7178 O  O     . GLU B 1 423 ? -41.252 12.263  15.587  1.00 57.80  ? 423 GLU B O     1 
ATOM   7179 C  CB    . GLU B 1 423 ? -43.353 13.188  13.239  1.00 54.18  ? 423 GLU B CB    1 
ATOM   7180 C  CG    . GLU B 1 423 ? -44.401 14.162  12.671  1.00 54.76  ? 423 GLU B CG    1 
ATOM   7181 C  CD    . GLU B 1 423 ? -45.832 13.614  12.697  1.00 57.07  ? 423 GLU B CD    1 
ATOM   7182 O  OE1   . GLU B 1 423 ? -46.082 12.532  12.136  1.00 56.10  ? 423 GLU B OE1   1 
ATOM   7183 O  OE2   . GLU B 1 423 ? -46.723 14.273  13.270  1.00 60.77  ? 423 GLU B OE2   1 
ATOM   7184 N  N     . PRO B 1 424 ? -42.771 10.642  15.129  1.00 57.21  ? 424 PRO B N     1 
ATOM   7185 C  CA    . PRO B 1 424 ? -41.901 9.527   15.537  1.00 57.54  ? 424 PRO B CA    1 
ATOM   7186 C  C     . PRO B 1 424 ? -40.787 9.203   14.524  1.00 54.51  ? 424 PRO B C     1 
ATOM   7187 O  O     . PRO B 1 424 ? -40.675 8.064   14.055  1.00 53.68  ? 424 PRO B O     1 
ATOM   7188 C  CB    . PRO B 1 424 ? -42.880 8.357   15.629  1.00 58.42  ? 424 PRO B CB    1 
ATOM   7189 C  CG    . PRO B 1 424 ? -43.916 8.675   14.610  1.00 56.35  ? 424 PRO B CG    1 
ATOM   7190 C  CD    . PRO B 1 424 ? -44.092 10.157  14.673  1.00 56.83  ? 424 PRO B CD    1 
ATOM   7191 N  N     . VAL B 1 425 ? -39.964 10.192  14.200  1.00 52.92  ? 425 VAL B N     1 
ATOM   7192 C  CA    . VAL B 1 425 ? -38.940 10.018  13.174  1.00 50.44  ? 425 VAL B CA    1 
ATOM   7193 C  C     . VAL B 1 425 ? -37.527 10.345  13.660  1.00 51.51  ? 425 VAL B C     1 
ATOM   7194 O  O     . VAL B 1 425 ? -36.598 10.419  12.854  1.00 49.90  ? 425 VAL B O     1 
ATOM   7195 C  CB    . VAL B 1 425 ? -39.245 10.859  11.897  1.00 47.37  ? 425 VAL B CB    1 
ATOM   7196 C  CG1   . VAL B 1 425 ? -40.550 10.430  11.262  1.00 46.05  ? 425 VAL B CG1   1 
ATOM   7197 C  CG2   . VAL B 1 425 ? -39.256 12.352  12.209  1.00 47.38  ? 425 VAL B CG2   1 
ATOM   7198 N  N     . THR B 1 426 ? -37.359 10.532  14.968  1.00 54.63  ? 426 THR B N     1 
ATOM   7199 C  CA    . THR B 1 426 ? -36.094 11.067  15.484  1.00 55.94  ? 426 THR B CA    1 
ATOM   7200 C  C     . THR B 1 426 ? -34.919 10.090  15.382  1.00 56.58  ? 426 THR B C     1 
ATOM   7201 O  O     . THR B 1 426 ? -33.791 10.506  15.111  1.00 56.13  ? 426 THR B O     1 
ATOM   7202 C  CB    . THR B 1 426 ? -36.212 11.644  16.918  1.00 59.39  ? 426 THR B CB    1 
ATOM   7203 O  OG1   . THR B 1 426 ? -36.095 10.593  17.872  1.00 62.40  ? 426 THR B OG1   1 
ATOM   7204 C  CG2   . THR B 1 426 ? -37.536 12.387  17.110  1.00 59.73  ? 426 THR B CG2   1 
ATOM   7205 N  N     . ALA B 1 427 ? -35.185 8.801   15.579  1.00 58.02  ? 427 ALA B N     1 
ATOM   7206 C  CA    . ALA B 1 427 ? -34.164 7.773   15.376  1.00 59.02  ? 427 ALA B CA    1 
ATOM   7207 C  C     . ALA B 1 427 ? -33.628 7.825   13.945  1.00 55.97  ? 427 ALA B C     1 
ATOM   7208 O  O     . ALA B 1 427 ? -32.420 7.806   13.727  1.00 56.07  ? 427 ALA B O     1 
ATOM   7209 C  CB    . ALA B 1 427 ? -34.722 6.402   15.692  1.00 60.62  ? 427 ALA B CB    1 
ATOM   7210 N  N     . GLU B 1 428 ? -34.543 7.921   12.985  1.00 53.87  ? 428 GLU B N     1 
ATOM   7211 C  CA    . GLU B 1 428 ? -34.202 7.997   11.559  1.00 51.89  ? 428 GLU B CA    1 
ATOM   7212 C  C     . GLU B 1 428 ? -33.406 9.244   11.208  1.00 50.76  ? 428 GLU B C     1 
ATOM   7213 O  O     . GLU B 1 428 ? -32.436 9.167   10.457  1.00 50.39  ? 428 GLU B O     1 
ATOM   7214 C  CB    . GLU B 1 428 ? -35.457 7.924   10.693  1.00 49.79  ? 428 GLU B CB    1 
ATOM   7215 C  CG    . GLU B 1 428 ? -36.014 6.513   10.516  1.00 52.49  ? 428 GLU B CG    1 
ATOM   7216 C  CD    . GLU B 1 428 ? -36.618 5.932   11.789  1.00 57.50  ? 428 GLU B CD    1 
ATOM   7217 O  OE1   . GLU B 1 428 ? -37.050 6.712   12.674  1.00 59.47  ? 428 GLU B OE1   1 
ATOM   7218 O  OE2   . GLU B 1 428 ? -36.666 4.686   11.899  1.00 60.32  ? 428 GLU B OE2   1 
ATOM   7219 N  N     . LEU B 1 429 ? -33.819 10.385  11.754  1.00 50.88  ? 429 LEU B N     1 
ATOM   7220 C  CA    . LEU B 1 429 ? -33.098 11.637  11.576  1.00 50.36  ? 429 LEU B CA    1 
ATOM   7221 C  C     . LEU B 1 429 ? -31.690 11.593  12.175  1.00 52.36  ? 429 LEU B C     1 
ATOM   7222 O  O     . LEU B 1 429 ? -30.769 12.211  11.653  1.00 51.47  ? 429 LEU B O     1 
ATOM   7223 C  CB    . LEU B 1 429 ? -33.885 12.789  12.192  1.00 50.96  ? 429 LEU B CB    1 
ATOM   7224 C  CG    . LEU B 1 429 ? -35.098 13.331  11.434  1.00 49.96  ? 429 LEU B CG    1 
ATOM   7225 C  CD1   . LEU B 1 429 ? -35.694 14.529  12.184  1.00 51.89  ? 429 LEU B CD1   1 
ATOM   7226 C  CD2   . LEU B 1 429 ? -34.734 13.719  9.997   1.00 48.21  ? 429 LEU B CD2   1 
ATOM   7227 N  N     . CYS B 1 430 ? -31.529 10.860  13.271  1.00 55.32  ? 430 CYS B N     1 
ATOM   7228 C  CA    . CYS B 1 430 ? -30.225 10.707  13.886  1.00 57.94  ? 430 CYS B CA    1 
ATOM   7229 C  C     . CYS B 1 430 ? -29.293 9.856   13.045  1.00 57.77  ? 430 CYS B C     1 
ATOM   7230 O  O     . CYS B 1 430 ? -28.158 10.251  12.804  1.00 58.10  ? 430 CYS B O     1 
ATOM   7231 C  CB    . CYS B 1 430 ? -30.358 10.154  15.299  1.00 61.71  ? 430 CYS B CB    1 
ATOM   7232 S  SG    . CYS B 1 430 ? -31.021 11.394  16.422  1.00 63.89  ? 430 CYS B SG    1 
ATOM   7233 N  N     . GLU B 1 431 ? -29.777 8.701   12.592  1.00 57.71  ? 431 GLU B N     1 
ATOM   7234 C  CA    . GLU B 1 431 ? -29.020 7.836   11.690  1.00 57.96  ? 431 GLU B CA    1 
ATOM   7235 C  C     . GLU B 1 431 ? -28.647 8.601   10.418  1.00 55.04  ? 431 GLU B C     1 
ATOM   7236 O  O     . GLU B 1 431 ? -27.506 8.565   9.957   1.00 55.78  ? 431 GLU B O     1 
ATOM   7237 C  CB    . GLU B 1 431 ? -29.849 6.613   11.319  1.00 58.03  ? 431 GLU B CB    1 
ATOM   7238 C  CG    . GLU B 1 431 ? -29.061 5.520   10.618  1.00 61.01  ? 431 GLU B CG    1 
ATOM   7239 C  CD    . GLU B 1 431 ? -28.719 4.367   11.547  1.00 67.41  ? 431 GLU B CD    1 
ATOM   7240 O  OE1   . GLU B 1 431 ? -29.646 3.593   11.900  1.00 69.49  ? 431 GLU B OE1   1 
ATOM   7241 O  OE2   . GLU B 1 431 ? -27.528 4.223   11.914  1.00 70.11  ? 431 GLU B OE2   1 
ATOM   7242 N  N     . MET B 1 432 ? -29.633 9.299   9.873   1.00 52.07  ? 432 MET B N     1 
ATOM   7243 C  CA    . MET B 1 432 ? -29.489 10.073  8.655   1.00 49.65  ? 432 MET B CA    1 
ATOM   7244 C  C     . MET B 1 432 ? -28.390 11.134  8.772   1.00 49.28  ? 432 MET B C     1 
ATOM   7245 O  O     . MET B 1 432 ? -27.512 11.225  7.914   1.00 48.83  ? 432 MET B O     1 
ATOM   7246 C  CB    . MET B 1 432 ? -30.829 10.731  8.342   1.00 47.19  ? 432 MET B CB    1 
ATOM   7247 C  CG    . MET B 1 432 ? -31.040 11.095  6.901   1.00 45.64  ? 432 MET B CG    1 
ATOM   7248 S  SD    . MET B 1 432 ? -32.540 12.072  6.747   1.00 44.86  ? 432 MET B SD    1 
ATOM   7249 C  CE    . MET B 1 432 ? -32.012 13.632  7.456   1.00 45.94  ? 432 MET B CE    1 
ATOM   7250 N  N     . MET B 1 433 ? -28.436 11.918  9.845   1.00 49.71  ? 433 MET B N     1 
ATOM   7251 C  CA    . MET B 1 433 ? -27.509 13.030  10.031  1.00 49.88  ? 433 MET B CA    1 
ATOM   7252 C  C     . MET B 1 433 ? -26.214 12.596  10.685  1.00 52.38  ? 433 MET B C     1 
ATOM   7253 O  O     . MET B 1 433 ? -25.328 13.414  10.916  1.00 53.03  ? 433 MET B O     1 
ATOM   7254 C  CB    . MET B 1 433 ? -28.160 14.139  10.856  1.00 49.67  ? 433 MET B CB    1 
ATOM   7255 C  CG    . MET B 1 433 ? -29.345 14.781  10.161  1.00 47.68  ? 433 MET B CG    1 
ATOM   7256 S  SD    . MET B 1 433 ? -30.015 16.229  10.990  1.00 48.78  ? 433 MET B SD    1 
ATOM   7257 C  CE    . MET B 1 433 ? -30.392 15.592  12.625  1.00 52.74  ? 433 MET B CE    1 
ATOM   7258 N  N     . GLY B 1 434 ? -26.110 11.302  10.970  1.00 54.27  ? 434 GLY B N     1 
ATOM   7259 C  CA    . GLY B 1 434 ? -24.992 10.748  11.721  1.00 57.49  ? 434 GLY B CA    1 
ATOM   7260 C  C     . GLY B 1 434 ? -24.837 11.475  13.039  1.00 59.53  ? 434 GLY B C     1 
ATOM   7261 O  O     . GLY B 1 434 ? -23.760 11.950  13.361  1.00 61.08  ? 434 GLY B O     1 
ATOM   7262 N  N     . VAL B 1 435 ? -25.922 11.600  13.792  1.00 59.69  ? 435 VAL B N     1 
ATOM   7263 C  CA    . VAL B 1 435 ? -25.827 12.206  15.109  1.00 62.59  ? 435 VAL B CA    1 
ATOM   7264 C  C     . VAL B 1 435 ? -25.156 11.192  16.017  1.00 67.32  ? 435 VAL B C     1 
ATOM   7265 O  O     . VAL B 1 435 ? -25.360 9.982   15.886  1.00 67.83  ? 435 VAL B O     1 
ATOM   7266 C  CB    . VAL B 1 435 ? -27.186 12.637  15.680  1.00 61.98  ? 435 VAL B CB    1 
ATOM   7267 C  CG1   . VAL B 1 435 ? -26.991 13.432  16.966  1.00 64.63  ? 435 VAL B CG1   1 
ATOM   7268 C  CG2   . VAL B 1 435 ? -27.950 13.468  14.668  1.00 57.78  ? 435 VAL B CG2   1 
ATOM   7269 N  N     . LYS B 1 436 ? -24.342 11.708  16.925  1.00 71.14  ? 436 LYS B N     1 
ATOM   7270 C  CA    . LYS B 1 436 ? -23.438 10.898  17.706  1.00 76.35  ? 436 LYS B CA    1 
ATOM   7271 C  C     . LYS B 1 436 ? -23.390 11.411  19.140  1.00 80.67  ? 436 LYS B C     1 
ATOM   7272 O  O     . LYS B 1 436 ? -23.171 12.604  19.381  1.00 80.85  ? 436 LYS B O     1 
ATOM   7273 C  CB    . LYS B 1 436 ? -22.052 10.903  17.027  1.00 76.84  ? 436 LYS B CB    1 
ATOM   7274 C  CG    . LYS B 1 436 ? -20.846 11.240  17.901  1.00 81.27  ? 436 LYS B CG    1 
ATOM   7275 C  CD    . LYS B 1 436 ? -19.761 11.899  17.058  1.00 81.14  ? 436 LYS B CD    1 
ATOM   7276 C  CE    . LYS B 1 436 ? -18.787 12.720  17.909  1.00 85.72  ? 436 LYS B CE    1 
ATOM   7277 N  NZ    . LYS B 1 436 ? -17.979 13.701  17.106  1.00 83.46  ? 436 LYS B NZ    1 
ATOM   7278 N  N     . ASP B 1 437 ? -23.636 10.504  20.081  1.00 84.68  ? 437 ASP B N     1 
ATOM   7279 C  CA    . ASP B 1 437 ? -23.404 10.750  21.501  1.00 89.96  ? 437 ASP B CA    1 
ATOM   7280 C  C     . ASP B 1 437 ? -23.538 9.425   22.245  1.00 94.14  ? 437 ASP B C     1 
ATOM   7281 O  O     . ASP B 1 437 ? -24.556 8.737   22.117  1.00 93.17  ? 437 ASP B O     1 
ATOM   7282 C  CB    . ASP B 1 437 ? -24.384 11.790  22.064  1.00 89.45  ? 437 ASP B CB    1 
ATOM   7283 C  CG    . ASP B 1 437 ? -23.841 12.497  23.302  1.00 94.92  ? 437 ASP B CG    1 
ATOM   7284 O  OD1   . ASP B 1 437 ? -22.925 13.336  23.158  1.00 95.12  ? 437 ASP B OD1   1 
ATOM   7285 O  OD2   . ASP B 1 437 ? -24.329 12.219  24.424  1.00 100.02 ? 437 ASP B OD2   1 
ATOM   7286 O  OP3   . G   C 2 1   ? 4.483   45.159  -18.190 1.00 59.84  ? 1   G   C OP3   1 
ATOM   7287 P  P     . G   C 2 1   ? 4.415   44.198  -16.678 0.00 57.37  ? 1   G   C P     1 
ATOM   7288 O  OP1   . G   C 2 1   ? 4.027   45.020  -17.858 0.00 55.72  ? 1   G   C OP1   1 
ATOM   7289 O  OP2   . G   C 2 1   ? 5.392   44.765  -15.710 0.00 60.28  ? 1   G   C OP2   1 
ATOM   7290 O  "O5'" . G   C 2 1   ? 3.079   43.741  -15.869 1.00 38.48  ? 1   G   C "O5'" 1 
ATOM   7291 C  "C5'" . G   C 2 1   ? 2.172   42.690  -16.075 1.00 34.49  ? 1   G   C "C5'" 1 
ATOM   7292 C  "C4'" . G   C 2 1   ? 0.825   43.258  -16.484 1.00 34.31  ? 1   G   C "C4'" 1 
ATOM   7293 O  "O4'" . G   C 2 1   ? 0.903   44.207  -17.603 1.00 32.93  ? 1   G   C "O4'" 1 
ATOM   7294 C  "C3'" . G   C 2 1   ? -0.113  42.153  -16.935 1.00 31.56  ? 1   G   C "C3'" 1 
ATOM   7295 O  "O3'" . G   C 2 1   ? -0.826  41.677  -15.827 1.00 30.40  ? 1   G   C "O3'" 1 
ATOM   7296 C  "C2'" . G   C 2 1   ? -0.976  42.833  -18.000 1.00 31.45  ? 1   G   C "C2'" 1 
ATOM   7297 O  "O2'" . G   C 2 1   ? -2.076  43.549  -17.470 1.00 33.73  ? 1   G   C "O2'" 1 
ATOM   7298 C  "C1'" . G   C 2 1   ? 0.027   43.793  -18.637 1.00 30.90  ? 1   G   C "C1'" 1 
ATOM   7299 N  N9    . G   C 2 1   ? 0.818   43.232  -19.741 1.00 30.51  ? 1   G   C N9    1 
ATOM   7300 C  C8    . G   C 2 1   ? 2.181   43.048  -19.748 1.00 31.46  ? 1   G   C C8    1 
ATOM   7301 N  N7    . G   C 2 1   ? 2.635   42.556  -20.858 1.00 31.39  ? 1   G   C N7    1 
ATOM   7302 C  C5    . G   C 2 1   ? 1.501   42.408  -21.658 1.00 29.70  ? 1   G   C C5    1 
ATOM   7303 C  C6    . G   C 2 1   ? 1.356   41.919  -22.983 1.00 28.12  ? 1   G   C C6    1 
ATOM   7304 O  O6    . G   C 2 1   ? 2.205   41.494  -23.757 1.00 29.53  ? 1   G   C O6    1 
ATOM   7305 N  N1    . G   C 2 1   ? 0.057   41.917  -23.438 1.00 27.29  ? 1   G   C N1    1 
ATOM   7306 C  C2    . G   C 2 1   ? -1.014  42.336  -22.711 1.00 27.18  ? 1   G   C C2    1 
ATOM   7307 N  N2    . G   C 2 1   ? -2.185  42.240  -23.353 1.00 25.99  ? 1   G   C N2    1 
ATOM   7308 N  N3    . G   C 2 1   ? -0.915  42.808  -21.463 1.00 28.98  ? 1   G   C N3    1 
ATOM   7309 C  C4    . G   C 2 1   ? 0.373   42.819  -20.990 1.00 29.61  ? 1   G   C C4    1 
ATOM   7310 P  P     . G   C 2 2   ? -1.080  40.110  -15.721 1.00 30.79  ? 2   G   C P     1 
ATOM   7311 O  OP1   . G   C 2 2   ? -1.894  39.827  -14.510 1.00 30.96  ? 2   G   C OP1   1 
ATOM   7312 O  OP2   . G   C 2 2   ? 0.203   39.406  -15.947 1.00 32.28  ? 2   G   C OP2   1 
ATOM   7313 O  "O5'" . G   C 2 2   ? -1.942  39.842  -17.026 1.00 29.65  ? 2   G   C "O5'" 1 
ATOM   7314 C  "C5'" . G   C 2 2   ? -3.324  40.044  -17.024 1.00 31.36  ? 2   G   C "C5'" 1 
ATOM   7315 C  "C4'" . G   C 2 2   ? -3.880  39.734  -18.396 1.00 30.91  ? 2   G   C "C4'" 1 
ATOM   7316 O  "O4'" . G   C 2 2   ? -3.160  40.481  -19.412 1.00 31.66  ? 2   G   C "O4'" 1 
ATOM   7317 C  "C3'" . G   C 2 2   ? -3.728  38.289  -18.824 1.00 30.24  ? 2   G   C "C3'" 1 
ATOM   7318 O  "O3'" . G   C 2 2   ? -4.722  37.519  -18.196 1.00 31.19  ? 2   G   C "O3'" 1 
ATOM   7319 C  "C2'" . G   C 2 2   ? -3.950  38.450  -20.323 1.00 29.74  ? 2   G   C "C2'" 1 
ATOM   7320 O  "O2'" . G   C 2 2   ? -5.310  38.609  -20.649 1.00 28.55  ? 2   G   C "O2'" 1 
ATOM   7321 C  "C1'" . G   C 2 2   ? -3.181  39.734  -20.621 1.00 30.45  ? 2   G   C "C1'" 1 
ATOM   7322 N  N9    . G   C 2 2   ? -1.804  39.487  -21.037 1.00 30.63  ? 2   G   C N9    1 
ATOM   7323 C  C8    . G   C 2 2   ? -0.695  39.668  -20.255 1.00 31.31  ? 2   G   C C8    1 
ATOM   7324 N  N7    . G   C 2 2   ? 0.419   39.381  -20.855 1.00 32.34  ? 2   G   C N7    1 
ATOM   7325 C  C5    . G   C 2 2   ? 0.024   38.973  -22.121 1.00 32.13  ? 2   G   C C5    1 
ATOM   7326 C  C6    . G   C 2 2   ? 0.801   38.540  -23.219 1.00 32.52  ? 2   G   C C6    1 
ATOM   7327 O  O6    . G   C 2 2   ? 2.027   38.430  -23.269 1.00 35.06  ? 2   G   C O6    1 
ATOM   7328 N  N1    . G   C 2 2   ? 0.051   38.213  -24.338 1.00 31.53  ? 2   G   C N1    1 
ATOM   7329 C  C2    . G   C 2 2   ? -1.307  38.304  -24.387 1.00 31.10  ? 2   G   C C2    1 
ATOM   7330 N  N2    . G   C 2 2   ? -1.853  37.958  -25.555 1.00 31.27  ? 2   G   C N2    1 
ATOM   7331 N  N3    . G   C 2 2   ? -2.064  38.716  -23.365 1.00 31.44  ? 2   G   C N3    1 
ATOM   7332 C  C4    . G   C 2 2   ? -1.343  39.035  -22.257 1.00 31.16  ? 2   G   C C4    1 
ATOM   7333 P  P     . A   C 2 3   ? -4.579  35.934  -18.022 1.00 32.81  ? 3   A   C P     1 
ATOM   7334 O  OP1   . A   C 2 3   ? -5.762  35.462  -17.264 1.00 32.63  ? 3   A   C OP1   1 
ATOM   7335 O  OP2   . A   C 2 3   ? -3.212  35.658  -17.573 1.00 32.34  ? 3   A   C OP2   1 
ATOM   7336 O  "O5'" . A   C 2 3   ? -4.665  35.334  -19.508 1.00 33.78  ? 3   A   C "O5'" 1 
ATOM   7337 C  "C5'" . A   C 2 3   ? -5.843  35.408  -20.314 1.00 34.75  ? 3   A   C "C5'" 1 
ATOM   7338 C  "C4'" . A   C 2 3   ? -5.536  35.003  -21.748 1.00 36.62  ? 3   A   C "C4'" 1 
ATOM   7339 O  "O4'" . A   C 2 3   ? -4.581  35.915  -22.343 1.00 36.48  ? 3   A   C "O4'" 1 
ATOM   7340 C  "C3'" . A   C 2 3   ? -4.843  33.658  -21.911 1.00 38.81  ? 3   A   C "C3'" 1 
ATOM   7341 O  "O3'" . A   C 2 3   ? -5.771  32.596  -21.846 1.00 41.05  ? 3   A   C "O3'" 1 
ATOM   7342 C  "C2'" . A   C 2 3   ? -4.242  33.782  -23.299 1.00 38.72  ? 3   A   C "C2'" 1 
ATOM   7343 O  "O2'" . A   C 2 3   ? -5.194  33.580  -24.313 1.00 41.62  ? 3   A   C "O2'" 1 
ATOM   7344 C  "C1'" . A   C 2 3   ? -3.806  35.237  -23.311 1.00 36.23  ? 3   A   C "C1'" 1 
ATOM   7345 N  N9    . A   C 2 3   ? -2.387  35.296  -22.995 1.00 36.40  ? 3   A   C N9    1 
ATOM   7346 C  C8    . A   C 2 3   ? -1.776  35.701  -21.847 1.00 35.45  ? 3   A   C C8    1 
ATOM   7347 N  N7    . A   C 2 3   ? -0.467  35.614  -21.899 1.00 36.22  ? 3   A   C N7    1 
ATOM   7348 C  C5    . A   C 2 3   ? -0.207  35.108  -23.152 1.00 36.78  ? 3   A   C C5    1 
ATOM   7349 C  C6    . A   C 2 3   ? 0.980   34.778  -23.827 1.00 38.93  ? 3   A   C C6    1 
ATOM   7350 N  N6    . A   C 2 3   ? 2.191   34.925  -23.294 1.00 40.34  ? 3   A   C N6    1 
ATOM   7351 N  N1    . A   C 2 3   ? 0.883   34.293  -25.086 1.00 39.98  ? 3   A   C N1    1 
ATOM   7352 C  C2    . A   C 2 3   ? -0.329  34.145  -25.636 1.00 39.25  ? 3   A   C C2    1 
ATOM   7353 N  N3    . A   C 2 3   ? -1.517  34.425  -25.106 1.00 37.85  ? 3   A   C N3    1 
ATOM   7354 C  C4    . A   C 2 3   ? -1.380  34.905  -23.848 1.00 37.45  ? 3   A   C C4    1 
ATOM   7355 P  P     . A   C 2 4   ? -5.278  31.144  -21.387 1.00 43.63  ? 4   A   C P     1 
ATOM   7356 O  OP1   . A   C 2 4   ? -6.491  30.306  -21.229 1.00 45.29  ? 4   A   C OP1   1 
ATOM   7357 O  OP2   . A   C 2 4   ? -4.359  31.305  -20.245 1.00 43.52  ? 4   A   C OP2   1 
ATOM   7358 O  "O5'" . A   C 2 4   ? -4.415  30.617  -22.630 1.00 46.03  ? 4   A   C "O5'" 1 
ATOM   7359 C  "C5'" . A   C 2 4   ? -5.064  29.852  -23.641 1.00 48.45  ? 4   A   C "C5'" 1 
ATOM   7360 C  "C4'" . A   C 2 4   ? -4.163  29.597  -24.830 1.00 50.38  ? 4   A   C "C4'" 1 
ATOM   7361 O  "O4'" . A   C 2 4   ? -3.322  30.742  -25.102 1.00 49.16  ? 4   A   C "O4'" 1 
ATOM   7362 C  "C3'" . A   C 2 4   ? -3.148  28.500  -24.619 1.00 53.07  ? 4   A   C "C3'" 1 
ATOM   7363 O  "O3'" . A   C 2 4   ? -3.766  27.241  -24.750 1.00 57.45  ? 4   A   C "O3'" 1 
ATOM   7364 C  "C2'" . A   C 2 4   ? -2.218  28.797  -25.782 1.00 53.73  ? 4   A   C "C2'" 1 
ATOM   7365 O  "O2'" . A   C 2 4   ? -2.827  28.513  -27.021 1.00 55.44  ? 4   A   C "O2'" 1 
ATOM   7366 C  "C1'" . A   C 2 4   ? -2.087  30.301  -25.644 1.00 49.83  ? 4   A   C "C1'" 1 
ATOM   7367 N  N9    . A   C 2 4   ? -0.984  30.754  -24.790 1.00 48.82  ? 4   A   C N9    1 
ATOM   7368 C  C8    . A   C 2 4   ? -1.094  31.361  -23.565 1.00 46.96  ? 4   A   C C8    1 
ATOM   7369 N  N7    . A   C 2 4   ? 0.055   31.677  -23.015 1.00 47.07  ? 4   A   C N7    1 
ATOM   7370 C  C5    . A   C 2 4   ? 0.988   31.251  -23.943 1.00 48.82  ? 4   A   C C5    1 
ATOM   7371 C  C6    . A   C 2 4   ? 2.400   31.304  -23.959 1.00 50.60  ? 4   A   C C6    1 
ATOM   7372 N  N6    . A   C 2 4   ? 3.124   31.830  -22.967 1.00 50.18  ? 4   A   C N6    1 
ATOM   7373 N  N1    . A   C 2 4   ? 3.037   30.791  -25.040 1.00 53.13  ? 4   A   C N1    1 
ATOM   7374 C  C2    . A   C 2 4   ? 2.308   30.265  -26.042 1.00 53.63  ? 4   A   C C2    1 
ATOM   7375 N  N3    . A   C 2 4   ? 0.979   30.162  -26.135 1.00 52.35  ? 4   A   C N3    1 
ATOM   7376 C  C4    . A   C 2 4   ? 0.369   30.681  -25.047 1.00 49.94  ? 4   A   C C4    1 
ATOM   7377 P  P     . G   C 2 5   ? -3.463  26.111  -23.658 1.00 60.28  ? 5   G   C P     1 
ATOM   7378 O  OP1   . G   C 2 5   ? -4.463  25.036  -23.845 1.00 62.34  ? 5   G   C OP1   1 
ATOM   7379 O  OP2   . G   C 2 5   ? -3.355  26.771  -22.337 1.00 58.26  ? 5   G   C OP2   1 
ATOM   7380 O  "O5'" . G   C 2 5   ? -2.011  25.576  -24.070 1.00 62.35  ? 5   G   C "O5'" 1 
ATOM   7381 C  "C5'" . G   C 2 5   ? -1.818  25.052  -25.376 1.00 66.54  ? 5   G   C "C5'" 1 
ATOM   7382 C  "C4'" . G   C 2 5   ? -0.389  25.238  -25.842 1.00 68.93  ? 5   G   C "C4'" 1 
ATOM   7383 O  "O4'" . G   C 2 5   ? 0.102   26.569  -25.547 1.00 66.04  ? 5   G   C "O4'" 1 
ATOM   7384 C  "C3'" . G   C 2 5   ? 0.646   24.391  -25.126 1.00 71.96  ? 5   G   C "C3'" 1 
ATOM   7385 O  "O3'" . G   C 2 5   ? 0.553   23.020  -25.468 1.00 78.37  ? 5   G   C "O3'" 1 
ATOM   7386 C  "C2'" . G   C 2 5   ? 1.923   25.041  -25.632 1.00 71.55  ? 5   G   C "C2'" 1 
ATOM   7387 O  "O2'" . G   C 2 5   ? 2.262   24.654  -26.948 1.00 74.20  ? 5   G   C "O2'" 1 
ATOM   7388 C  "C1'" . G   C 2 5   ? 1.522   26.519  -25.574 1.00 66.72  ? 5   G   C "C1'" 1 
ATOM   7389 N  N9    . G   C 2 5   ? 2.079   27.185  -24.396 1.00 64.18  ? 5   G   C N9    1 
ATOM   7390 C  C8    . G   C 2 5   ? 1.403   27.638  -23.289 1.00 61.40  ? 5   G   C C8    1 
ATOM   7391 N  N7    . G   C 2 5   ? 2.176   28.185  -22.391 1.00 60.42  ? 5   G   C N7    1 
ATOM   7392 C  C5    . G   C 2 5   ? 3.446   28.078  -22.935 1.00 62.87  ? 5   G   C C5    1 
ATOM   7393 C  C6    . G   C 2 5   ? 4.696   28.497  -22.418 1.00 64.37  ? 5   G   C C6    1 
ATOM   7394 O  O6    . G   C 2 5   ? 4.905   29.060  -21.334 1.00 63.31  ? 5   G   C O6    1 
ATOM   7395 N  N1    . G   C 2 5   ? 5.759   28.208  -23.283 1.00 67.08  ? 5   G   C N1    1 
ATOM   7396 C  C2    . G   C 2 5   ? 5.611   27.586  -24.505 1.00 68.94  ? 5   G   C C2    1 
ATOM   7397 N  N2    . G   C 2 5   ? 6.728   27.383  -25.215 1.00 72.31  ? 5   G   C N2    1 
ATOM   7398 N  N3    . G   C 2 5   ? 4.443   27.190  -25.003 1.00 67.90  ? 5   G   C N3    1 
ATOM   7399 C  C4    . G   C 2 5   ? 3.406   27.467  -24.170 1.00 64.90  ? 5   G   C C4    1 
ATOM   7400 P  P     . U   C 2 6   ? 0.811   21.947  -24.305 1.00 82.23  ? 6   U   C P     1 
ATOM   7401 O  OP1   . U   C 2 6   ? 0.326   20.633  -24.793 1.00 86.23  ? 6   U   C OP1   1 
ATOM   7402 O  OP2   . U   C 2 6   ? 0.285   22.486  -23.021 1.00 77.78  ? 6   U   C OP2   1 
ATOM   7403 O  "O5'" . U   C 2 6   ? 2.413   21.929  -24.221 1.00 84.66  ? 6   U   C "O5'" 1 
ATOM   7404 C  "C5'" . U   C 2 6   ? 3.197   21.341  -25.254 1.00 89.60  ? 6   U   C "C5'" 1 
ATOM   7405 C  "C4'" . U   C 2 6   ? 4.677   21.599  -25.031 1.00 91.81  ? 6   U   C "C4'" 1 
ATOM   7406 O  "O4'" . U   C 2 6   ? 4.928   23.026  -24.915 1.00 88.65  ? 6   U   C "O4'" 1 
ATOM   7407 C  "C3'" . U   C 2 6   ? 5.286   21.060  -23.741 1.00 92.96  ? 6   U   C "C3'" 1 
ATOM   7408 O  "O3'" . U   C 2 6   ? 5.488   19.640  -23.752 1.00 97.78  ? 6   U   C "O3'" 1 
ATOM   7409 C  "C2'" . U   C 2 6   ? 6.590   21.855  -23.728 1.00 93.39  ? 6   U   C "C2'" 1 
ATOM   7410 O  "O2'" . U   C 2 6   ? 7.507   21.435  -24.724 1.00 97.26  ? 6   U   C "O2'" 1 
ATOM   7411 C  "C1'" . U   C 2 6   ? 6.050   23.240  -24.067 1.00 88.96  ? 6   U   C "C1'" 1 
ATOM   7412 N  N1    . U   C 2 6   ? 5.669   24.089  -22.865 1.00 84.87  ? 6   U   C N1    1 
ATOM   7413 C  C2    . U   C 2 6   ? 6.645   24.842  -22.227 1.00 84.47  ? 6   U   C C2    1 
ATOM   7414 O  O2    . U   C 2 6   ? 7.817   24.859  -22.572 1.00 87.09  ? 6   U   C O2    1 
ATOM   7415 N  N3    . U   C 2 6   ? 6.194   25.583  -21.152 1.00 81.11  ? 6   U   C N3    1 
ATOM   7416 C  C4    . U   C 2 6   ? 4.895   25.649  -20.659 1.00 78.19  ? 6   U   C C4    1 
ATOM   7417 O  O4    . U   C 2 6   ? 4.635   26.357  -19.688 1.00 75.60  ? 6   U   C O4    1 
ATOM   7418 C  C5    . U   C 2 6   ? 3.934   24.841  -21.371 1.00 78.52  ? 6   U   C C5    1 
ATOM   7419 C  C6    . U   C 2 6   ? 4.352   24.114  -22.419 1.00 81.93  ? 6   U   C C6    1 
ATOM   7420 P  P     . A   C 2 7   ? 5.355   18.810  -22.381 1.00 98.08  ? 7   A   C P     1 
ATOM   7421 O  OP1   . A   C 2 7   ? 5.404   17.372  -22.733 1.00 103.30 ? 7   A   C OP1   1 
ATOM   7422 O  OP2   . A   C 2 7   ? 4.207   19.343  -21.603 1.00 91.94  ? 7   A   C OP2   1 
ATOM   7423 O  "O5'" . A   C 2 7   ? 6.701   19.186  -21.598 1.00 98.79  ? 7   A   C "O5'" 1 
ATOM   7424 C  "C5'" . A   C 2 7   ? 7.997   18.825  -22.099 1.00 103.22 ? 7   A   C "C5'" 1 
ATOM   7425 C  "C4'" . A   C 2 7   ? 9.096   19.395  -21.214 1.00 103.15 ? 7   A   C "C4'" 1 
ATOM   7426 O  "O4'" . A   C 2 7   ? 9.137   20.844  -21.349 1.00 98.69  ? 7   A   C "O4'" 1 
ATOM   7427 C  "C3'" . A   C 2 7   ? 8.929   19.185  -19.707 1.00 101.81 ? 7   A   C "C3'" 1 
ATOM   7428 O  "O3'" . A   C 2 7   ? 9.297   17.871  -19.265 1.00 106.16 ? 7   A   C "O3'" 1 
ATOM   7429 C  "C2'" . A   C 2 7   ? 9.859   20.278  -19.183 1.00 100.73 ? 7   A   C "C2'" 1 
ATOM   7430 O  "O2'" . A   C 2 7   ? 11.229  19.966  -19.342 1.00 105.97 ? 7   A   C "O2'" 1 
ATOM   7431 C  "C1'" . A   C 2 7   ? 9.456   21.433  -20.094 1.00 96.93  ? 7   A   C "C1'" 1 
ATOM   7432 N  N9    . A   C 2 7   ? 8.320   22.170  -19.521 1.00 91.63  ? 7   A   C N9    1 
ATOM   7433 C  C8    . A   C 2 7   ? 6.984   21.960  -19.745 1.00 89.01  ? 7   A   C C8    1 
ATOM   7434 N  N7    . A   C 2 7   ? 6.191   22.764  -19.081 1.00 84.79  ? 7   A   C N7    1 
ATOM   7435 C  C5    . A   C 2 7   ? 7.064   23.555  -18.359 1.00 84.58  ? 7   A   C C5    1 
ATOM   7436 C  C6    . A   C 2 7   ? 6.851   24.612  -17.449 1.00 81.54  ? 7   A   C C6    1 
ATOM   7437 N  N6    . A   C 2 7   ? 5.630   25.043  -17.124 1.00 77.83  ? 7   A   C N6    1 
ATOM   7438 N  N1    . A   C 2 7   ? 7.935   25.204  -16.891 1.00 82.80  ? 7   A   C N1    1 
ATOM   7439 C  C2    . A   C 2 7   ? 9.155   24.757  -17.228 1.00 86.94  ? 7   A   C C2    1 
ATOM   7440 N  N3    . A   C 2 7   ? 9.478   23.773  -18.073 1.00 90.20  ? 7   A   C N3    1 
ATOM   7441 C  C4    . A   C 2 7   ? 8.379   23.204  -18.611 1.00 88.78  ? 7   A   C C4    1 
ATOM   7442 P  P     . G   C 2 8   ? 8.790   17.284  -17.854 1.00 105.12 ? 8   G   C P     1 
ATOM   7443 O  OP1   . G   C 2 8   ? 9.537   16.034  -17.592 1.00 111.00 ? 8   G   C OP1   1 
ATOM   7444 O  OP2   . G   C 2 8   ? 7.313   17.245  -17.868 1.00 101.88 ? 8   G   C OP2   1 
ATOM   7445 O  "O5'" . G   C 2 8   ? 9.239   18.413  -16.811 1.00 102.28 ? 8   G   C "O5'" 1 
ATOM   7446 C  "C5'" . G   C 2 8   ? 9.513   18.146  -15.438 1.00 102.43 ? 8   G   C "C5'" 1 
ATOM   7447 C  "C4'" . G   C 2 8   ? 10.574  19.108  -14.926 1.00 102.59 ? 8   G   C "C4'" 1 
ATOM   7448 O  "O4'" . G   C 2 8   ? 10.599  20.331  -15.716 1.00 99.61  ? 8   G   C "O4'" 1 
ATOM   7449 C  "C3'" . G   C 2 8   ? 10.367  19.606  -13.504 1.00 100.16 ? 8   G   C "C3'" 1 
ATOM   7450 O  "O3'" . G   C 2 8   ? 10.836  18.660  -12.561 1.00 104.35 ? 8   G   C "O3'" 1 
ATOM   7451 C  "C2'" . G   C 2 8   ? 11.187  20.894  -13.529 1.00 99.36  ? 8   G   C "C2'" 1 
ATOM   7452 O  "O2'" . G   C 2 8   ? 12.589  20.702  -13.546 1.00 103.84 ? 8   G   C "O2'" 1 
ATOM   7453 C  "C1'" . G   C 2 8   ? 10.708  21.457  -14.862 1.00 96.53  ? 8   G   C "C1'" 1 
ATOM   7454 N  N9    . G   C 2 8   ? 9.406   22.114  -14.729 1.00 91.27  ? 8   G   C N9    1 
ATOM   7455 C  C8    . G   C 2 8   ? 8.211   21.728  -15.296 1.00 88.94  ? 8   G   C C8    1 
ATOM   7456 N  N7    . G   C 2 8   ? 7.210   22.501  -14.987 1.00 84.55  ? 8   G   C N7    1 
ATOM   7457 C  C5    . G   C 2 8   ? 7.770   23.462  -14.159 1.00 83.97  ? 8   G   C C5    1 
ATOM   7458 C  C6    . G   C 2 8   ? 7.170   24.570  -13.514 1.00 80.63  ? 8   G   C C6    1 
ATOM   7459 O  O6    . G   C 2 8   ? 5.982   24.922  -13.552 1.00 77.42  ? 8   G   C O6    1 
ATOM   7460 N  N1    . G   C 2 8   ? 8.091   25.302  -12.762 1.00 81.89  ? 8   G   C N1    1 
ATOM   7461 C  C2    . G   C 2 8   ? 9.429   25.002  -12.647 1.00 85.71  ? 8   G   C C2    1 
ATOM   7462 N  N2    . G   C 2 8   ? 10.162  25.821  -11.882 1.00 86.75  ? 8   G   C N2    1 
ATOM   7463 N  N3    . G   C 2 8   ? 10.002  23.967  -13.247 1.00 88.92  ? 8   G   C N3    1 
ATOM   7464 C  C4    . G   C 2 8   ? 9.121   23.241  -13.986 1.00 87.98  ? 8   G   C C4    1 
ATOM   7465 P  P     . A   C 2 9   ? 9.819   18.008  -11.511 1.00 103.17 ? 9   A   C P     1 
ATOM   7466 O  OP1   . A   C 2 9   ? 10.427  16.737  -11.072 1.00 108.67 ? 9   A   C OP1   1 
ATOM   7467 O  OP2   . A   C 2 9   ? 8.459   18.003  -12.096 1.00 99.87  ? 9   A   C OP2   1 
ATOM   7468 O  "O5'" . A   C 2 9   ? 9.832   19.025  -10.281 1.00 100.45 ? 9   A   C "O5'" 1 
ATOM   7469 C  "C5'" . A   C 2 9   ? 11.085  19.461  -9.797  1.00 103.73 ? 9   A   C "C5'" 1 
ATOM   7470 C  "C4'" . A   C 2 9   ? 10.988  20.815  -9.137  1.00 101.19 ? 9   A   C "C4'" 1 
ATOM   7471 O  "O4'" . A   C 2 9   ? 10.597  21.818  -10.107 1.00 98.01  ? 9   A   C "O4'" 1 
ATOM   7472 C  "C3'" . A   C 2 9   ? 9.949   20.906  -8.035  1.00 98.46  ? 9   A   C "C3'" 1 
ATOM   7473 O  "O3'" . A   C 2 9   ? 10.486  20.436  -6.811  1.00 102.24 ? 9   A   C "O3'" 1 
ATOM   7474 C  "C2'" . A   C 2 9   ? 9.693   22.405  -7.999  1.00 95.28  ? 9   A   C "C2'" 1 
ATOM   7475 O  "O2'" . A   C 2 9   ? 10.642  23.109  -7.222  1.00 97.61  ? 9   A   C "O2'" 1 
ATOM   7476 C  "C1'" . A   C 2 9   ? 9.779   22.788  -9.479  1.00 94.05  ? 9   A   C "C1'" 1 
ATOM   7477 N  N9    . A   C 2 9   ? 8.457   22.790  -10.103 1.00 90.00  ? 9   A   C N9    1 
ATOM   7478 C  C8    . A   C 2 9   ? 7.986   21.921  -11.046 1.00 90.10  ? 9   A   C C8    1 
ATOM   7479 N  N7    . A   C 2 9   ? 6.751   22.157  -11.410 1.00 86.54  ? 9   A   C N7    1 
ATOM   7480 C  C5    . A   C 2 9   ? 6.382   23.253  -10.652 1.00 83.76  ? 9   A   C C5    1 
ATOM   7481 C  C6    . A   C 2 9   ? 5.184   23.999  -10.568 1.00 80.16  ? 9   A   C C6    1 
ATOM   7482 N  N6    . A   C 2 9   ? 4.095   23.728  -11.297 1.00 78.09  ? 9   A   C N6    1 
ATOM   7483 N  N1    . A   C 2 9   ? 5.148   25.037  -9.701  1.00 78.81  ? 9   A   C N1    1 
ATOM   7484 C  C2    . A   C 2 9   ? 6.237   25.307  -8.970  1.00 81.03  ? 9   A   C C2    1 
ATOM   7485 N  N3    . A   C 2 9   ? 7.412   24.681  -8.968  1.00 84.53  ? 9   A   C N3    1 
ATOM   7486 C  C4    . A   C 2 9   ? 7.422   23.655  -9.838  1.00 85.69  ? 9   A   C C4    1 
ATOM   7487 P  P     . U   C 2 10  ? 9.525   19.780  -5.708  1.00 101.94 ? 10  U   C P     1 
ATOM   7488 O  OP1   . U   C 2 10  ? 10.398  19.051  -4.761  1.00 106.61 ? 10  U   C OP1   1 
ATOM   7489 O  OP2   . U   C 2 10  ? 8.417   19.068  -6.392  1.00 99.57  ? 10  U   C OP2   1 
ATOM   7490 O  "O5'" . U   C 2 10  ? 8.896   21.042  -4.955  1.00 98.02  ? 10  U   C "O5'" 1 
ATOM   7491 C  "C5'" . U   C 2 10  ? 9.744   22.000  -4.326  1.00 99.30  ? 10  U   C "C5'" 1 
ATOM   7492 C  "C4'" . U   C 2 10  ? 8.925   23.179  -3.852  1.00 95.08  ? 10  U   C "C4'" 1 
ATOM   7493 O  "O4'" . U   C 2 10  ? 8.450   23.927  -4.997  1.00 91.44  ? 10  U   C "O4'" 1 
ATOM   7494 C  "C3'" . U   C 2 10  ? 7.650   22.767  -3.139  1.00 92.65  ? 10  U   C "C3'" 1 
ATOM   7495 O  "O3'" . U   C 2 10  ? 7.897   22.448  -1.787  1.00 94.72  ? 10  U   C "O3'" 1 
ATOM   7496 C  "C2'" . U   C 2 10  ? 6.791   24.011  -3.321  1.00 88.96  ? 10  U   C "C2'" 1 
ATOM   7497 O  "O2'" . U   C 2 10  ? 7.158   25.078  -2.467  1.00 90.83  ? 10  U   C "O2'" 1 
ATOM   7498 C  "C1'" . U   C 2 10  ? 7.112   24.346  -4.776  1.00 87.41  ? 10  U   C "C1'" 1 
ATOM   7499 N  N1    . U   C 2 10  ? 6.141   23.705  -5.753  1.00 84.63  ? 10  U   C N1    1 
ATOM   7500 C  C2    . U   C 2 10  ? 4.892   24.282  -5.923  1.00 80.33  ? 10  U   C C2    1 
ATOM   7501 O  O2    . U   C 2 10  ? 4.523   25.278  -5.338  1.00 79.10  ? 10  U   C O2    1 
ATOM   7502 N  N3    . U   C 2 10  ? 4.065   23.653  -6.814  1.00 78.33  ? 10  U   C N3    1 
ATOM   7503 C  C4    . U   C 2 10  ? 4.349   22.518  -7.541  1.00 80.72  ? 10  U   C C4    1 
ATOM   7504 O  O4    . U   C 2 10  ? 3.496   22.081  -8.299  1.00 79.54  ? 10  U   C O4    1 
ATOM   7505 C  C5    . U   C 2 10  ? 5.663   21.954  -7.325  1.00 84.69  ? 10  U   C C5    1 
ATOM   7506 C  C6    . U   C 2 10  ? 6.487   22.557  -6.455  1.00 86.46  ? 10  U   C C6    1 
ATOM   7507 P  P     . G   C 2 11  ? 6.960   21.356  -1.080  1.00 94.98  ? 11  G   C P     1 
ATOM   7508 O  OP1   . G   C 2 11  ? 7.727   20.792  0.054   1.00 98.90  ? 11  G   C OP1   1 
ATOM   7509 O  OP2   . G   C 2 11  ? 6.397   20.444  -2.106  1.00 93.89  ? 11  G   C OP2   1 
ATOM   7510 O  "O5'" . G   C 2 11  ? 5.759   22.237  -0.491  1.00 90.25  ? 11  G   C "O5'" 1 
ATOM   7511 C  "C5'" . G   C 2 11  ? 6.059   23.374  0.332   1.00 88.32  ? 11  G   C "C5'" 1 
ATOM   7512 C  "C4'" . G   C 2 11  ? 4.885   24.332  0.396   1.00 82.17  ? 11  G   C "C4'" 1 
ATOM   7513 O  "O4'" . G   C 2 11  ? 4.624   24.878  -0.925  1.00 78.17  ? 11  G   C "O4'" 1 
ATOM   7514 C  "C3'" . G   C 2 11  ? 3.561   23.692  0.797   1.00 78.57  ? 11  G   C "C3'" 1 
ATOM   7515 O  "O3'" . G   C 2 11  ? 3.436   23.540  2.191   1.00 79.23  ? 11  G   C "O3'" 1 
ATOM   7516 C  "C2'" . G   C 2 11  ? 2.576   24.720  0.255   1.00 74.77  ? 11  G   C "C2'" 1 
ATOM   7517 O  "O2'" . G   C 2 11  ? 2.486   25.892  1.046   1.00 74.68  ? 11  G   C "O2'" 1 
ATOM   7518 C  "C1'" . G   C 2 11  ? 3.218   25.002  -1.100  1.00 73.23  ? 11  G   C "C1'" 1 
ATOM   7519 N  N9    . G   C 2 11  ? 2.714   24.116  -2.156  1.00 70.95  ? 11  G   C N9    1 
ATOM   7520 C  C8    . G   C 2 11  ? 3.342   23.063  -2.775  1.00 72.41  ? 11  G   C C8    1 
ATOM   7521 N  N7    . G   C 2 11  ? 2.611   22.475  -3.682  1.00 70.80  ? 11  G   C N7    1 
ATOM   7522 C  C5    . G   C 2 11  ? 1.417   23.186  -3.667  1.00 68.28  ? 11  G   C C5    1 
ATOM   7523 C  C6    . G   C 2 11  ? 0.227   23.034  -4.433  1.00 66.10  ? 11  G   C C6    1 
ATOM   7524 O  O6    . G   C 2 11  ? -0.033  22.208  -5.314  1.00 66.22  ? 11  G   C O6    1 
ATOM   7525 N  N1    . G   C 2 11  ? -0.746  23.970  -4.095  1.00 63.89  ? 11  G   C N1    1 
ATOM   7526 C  C2    . G   C 2 11  ? -0.595  24.940  -3.134  1.00 63.90  ? 11  G   C C2    1 
ATOM   7527 N  N2    . G   C 2 11  ? -1.636  25.755  -2.942  1.00 62.34  ? 11  G   C N2    1 
ATOM   7528 N  N3    . G   C 2 11  ? 0.506   25.103  -2.415  1.00 66.10  ? 11  G   C N3    1 
ATOM   7529 C  C4    . G   C 2 11  ? 1.468   24.195  -2.730  1.00 68.12  ? 11  G   C C4    1 
ATOM   7530 P  P     . G   C 2 12  ? 2.543   22.340  2.760   1.00 79.25  ? 12  G   C P     1 
ATOM   7531 O  OP1   . G   C 2 12  ? 2.780   22.285  4.219   1.00 81.03  ? 12  G   C OP1   1 
ATOM   7532 O  OP2   . G   C 2 12  ? 2.778   21.160  1.899   1.00 80.13  ? 12  G   C OP2   1 
ATOM   7533 O  "O5'" . G   C 2 12  ? 1.025   22.757  2.487   1.00 74.80  ? 12  G   C "O5'" 1 
ATOM   7534 C  "C5'" . G   C 2 12  ? 0.466   23.949  3.019   1.00 72.91  ? 12  G   C "C5'" 1 
ATOM   7535 C  "C4'" . G   C 2 12  ? -0.855  24.206  2.327   1.00 69.65  ? 12  G   C "C4'" 1 
ATOM   7536 O  "O4'" . G   C 2 12  ? -0.659  24.369  0.898   1.00 68.24  ? 12  G   C "O4'" 1 
ATOM   7537 C  "C3'" . G   C 2 12  ? -1.846  23.057  2.406   1.00 68.59  ? 12  G   C "C3'" 1 
ATOM   7538 O  "O3'" . G   C 2 12  ? -2.526  23.101  3.634   1.00 69.40  ? 12  G   C "O3'" 1 
ATOM   7539 C  "C2'" . G   C 2 12  ? -2.787  23.432  1.278   1.00 65.72  ? 12  G   C "C2'" 1 
ATOM   7540 O  "O2'" . G   C 2 12  ? -3.683  24.453  1.671   1.00 65.31  ? 12  G   C "O2'" 1 
ATOM   7541 C  "C1'" . G   C 2 12  ? -1.809  23.908  0.208   1.00 65.08  ? 12  G   C "C1'" 1 
ATOM   7542 N  N9    . G   C 2 12  ? -1.476  22.810  -0.703  1.00 65.41  ? 12  G   C N9    1 
ATOM   7543 C  C8    . G   C 2 12  ? -0.300  22.091  -0.787  1.00 67.39  ? 12  G   C C8    1 
ATOM   7544 N  N7    . G   C 2 12  ? -0.325  21.161  -1.702  1.00 67.50  ? 12  G   C N7    1 
ATOM   7545 C  C5    . G   C 2 12  ? -1.600  21.261  -2.252  1.00 65.30  ? 12  G   C C5    1 
ATOM   7546 C  C6    . G   C 2 12  ? -2.224  20.519  -3.284  1.00 64.91  ? 12  G   C C6    1 
ATOM   7547 O  O6    . G   C 2 12  ? -1.760  19.584  -3.940  1.00 66.87  ? 12  G   C O6    1 
ATOM   7548 N  N1    . G   C 2 12  ? -3.526  20.939  -3.539  1.00 62.91  ? 12  G   C N1    1 
ATOM   7549 C  C2    . G   C 2 12  ? -4.157  21.962  -2.876  1.00 61.45  ? 12  G   C C2    1 
ATOM   7550 N  N2    . G   C 2 12  ? -5.414  22.240  -3.256  1.00 60.09  ? 12  G   C N2    1 
ATOM   7551 N  N3    . G   C 2 12  ? -3.590  22.668  -1.906  1.00 61.74  ? 12  G   C N3    1 
ATOM   7552 C  C4    . G   C 2 12  ? -2.318  22.267  -1.647  1.00 63.79  ? 12  G   C C4    1 
ATOM   7553 P  P     . U   C 2 13  ? -3.074  21.765  4.317   1.00 70.06  ? 13  U   C P     1 
ATOM   7554 O  OP1   . U   C 2 13  ? -3.537  22.157  5.668   1.00 71.39  ? 13  U   C OP1   1 
ATOM   7555 O  OP2   . U   C 2 13  ? -2.081  20.682  4.126   1.00 71.66  ? 13  U   C OP2   1 
ATOM   7556 O  "O5'" . U   C 2 13  ? -4.345  21.391  3.442   1.00 66.04  ? 13  U   C "O5'" 1 
ATOM   7557 C  "C5'" . U   C 2 13  ? -5.478  22.223  3.490   1.00 62.31  ? 13  U   C "C5'" 1 
ATOM   7558 C  "C4'" . U   C 2 13  ? -6.403  21.751  2.403   1.00 59.20  ? 13  U   C "C4'" 1 
ATOM   7559 O  "O4'" . U   C 2 13  ? -5.690  21.767  1.145   1.00 57.04  ? 13  U   C "O4'" 1 
ATOM   7560 C  "C3'" . U   C 2 13  ? -6.801  20.292  2.530   1.00 59.36  ? 13  U   C "C3'" 1 
ATOM   7561 O  "O3'" . U   C 2 13  ? -7.802  20.097  3.523   1.00 60.11  ? 13  U   C "O3'" 1 
ATOM   7562 C  "C2'" . U   C 2 13  ? -7.319  20.043  1.124   1.00 57.23  ? 13  U   C "C2'" 1 
ATOM   7563 O  "O2'" . U   C 2 13  ? -8.599  20.589  0.925   1.00 55.02  ? 13  U   C "O2'" 1 
ATOM   7564 C  "C1'" . U   C 2 13  ? -6.291  20.806  0.296   1.00 56.01  ? 13  U   C "C1'" 1 
ATOM   7565 N  N1    . U   C 2 13  ? -5.257  19.903  -0.280  1.00 56.65  ? 13  U   C N1    1 
ATOM   7566 C  C2    . U   C 2 13  ? -5.616  19.127  -1.365  1.00 56.20  ? 13  U   C C2    1 
ATOM   7567 O  O2    . U   C 2 13  ? -6.725  19.151  -1.870  1.00 54.94  ? 13  U   C O2    1 
ATOM   7568 N  N3    . U   C 2 13  ? -4.619  18.320  -1.847  1.00 57.97  ? 13  U   C N3    1 
ATOM   7569 C  C4    . U   C 2 13  ? -3.333  18.216  -1.360  1.00 59.96  ? 13  U   C C4    1 
ATOM   7570 O  O4    . U   C 2 13  ? -2.564  17.443  -1.912  1.00 62.34  ? 13  U   C O4    1 
ATOM   7571 C  C5    . U   C 2 13  ? -3.023  19.051  -0.223  1.00 59.25  ? 13  U   C C5    1 
ATOM   7572 C  C6    . U   C 2 13  ? -3.982  19.848  0.266   1.00 58.04  ? 13  U   C C6    1 
ATOM   7573 P  P     . U   C 2 14  ? -7.782  18.775  4.437   1.00 62.26  ? 14  U   C P     1 
ATOM   7574 O  OP1   . U   C 2 14  ? -8.943  18.850  5.352   1.00 62.45  ? 14  U   C OP1   1 
ATOM   7575 O  OP2   . U   C 2 14  ? -6.420  18.579  4.986   1.00 62.68  ? 14  U   C OP2   1 
ATOM   7576 O  "O5'" . U   C 2 14  ? -8.030  17.597  3.389   1.00 62.13  ? 14  U   C "O5'" 1 
ATOM   7577 C  "C5'" . U   C 2 14  ? -9.278  17.426  2.737   1.00 60.62  ? 14  U   C "C5'" 1 
ATOM   7578 C  "C4'" . U   C 2 14  ? -9.164  16.294  1.734   1.00 61.83  ? 14  U   C "C4'" 1 
ATOM   7579 O  "O4'" . U   C 2 14  ? -8.205  16.646  0.708   1.00 60.36  ? 14  U   C "O4'" 1 
ATOM   7580 C  "C3'" . U   C 2 14  ? -8.640  14.958  2.263   1.00 63.64  ? 14  U   C "C3'" 1 
ATOM   7581 O  "O3'" . U   C 2 14  ? -9.644  14.243  2.981   1.00 64.84  ? 14  U   C "O3'" 1 
ATOM   7582 C  "C2'" . U   C 2 14  ? -8.265  14.280  0.952   1.00 64.31  ? 14  U   C "C2'" 1 
ATOM   7583 O  "O2'" . U   C 2 14  ? -9.373  13.792  0.222   1.00 63.98  ? 14  U   C "O2'" 1 
ATOM   7584 C  "C1'" . U   C 2 14  ? -7.651  15.452  0.188   1.00 62.95  ? 14  U   C "C1'" 1 
ATOM   7585 N  N1    . U   C 2 14  ? -6.152  15.477  0.259   1.00 64.26  ? 14  U   C N1    1 
ATOM   7586 C  C2    . U   C 2 14  ? -5.436  14.743  -0.676  1.00 65.99  ? 14  U   C C2    1 
ATOM   7587 O  O2    . U   C 2 14  ? -5.948  14.077  -1.563  1.00 66.77  ? 14  U   C O2    1 
ATOM   7588 N  N3    . U   C 2 14  ? -4.070  14.819  -0.537  1.00 67.39  ? 14  U   C N3    1 
ATOM   7589 C  C4    . U   C 2 14  ? -3.364  15.533  0.416   1.00 66.67  ? 14  U   C C4    1 
ATOM   7590 O  O4    . U   C 2 14  ? -2.139  15.497  0.396   1.00 68.76  ? 14  U   C O4    1 
ATOM   7591 C  C5    . U   C 2 14  ? -4.173  16.273  1.356   1.00 64.69  ? 14  U   C C5    1 
ATOM   7592 C  C6    . U   C 2 14  ? -5.506  16.220  1.242   1.00 63.84  ? 14  U   C C6    1 
ATOM   7593 P  P     . C   C 2 15  ? -9.291  13.499  4.356   1.00 67.50  ? 15  C   C P     1 
ATOM   7594 O  OP1   . C   C 2 15  ? -10.547 13.007  4.960   1.00 69.05  ? 15  C   C OP1   1 
ATOM   7595 O  OP2   . C   C 2 15  ? -8.431  14.405  5.153   1.00 66.70  ? 15  C   C OP2   1 
ATOM   7596 O  "O5'" . C   C 2 15  ? -8.448  12.229  3.855   1.00 70.39  ? 15  C   C "O5'" 1 
ATOM   7597 C  "C5'" . C   C 2 15  ? -8.185  11.096  4.683   1.00 72.21  ? 15  C   C "C5'" 1 
ATOM   7598 C  "C4'" . C   C 2 15  ? -7.582  9.950   3.882   1.00 75.21  ? 15  C   C "C4'" 1 
ATOM   7599 O  "O4'" . C   C 2 15  ? -8.629  9.118   3.304   1.00 76.85  ? 15  C   C "O4'" 1 
ATOM   7600 C  "C3'" . C   C 2 15  ? -6.737  10.320  2.671   1.00 74.85  ? 15  C   C "C3'" 1 
ATOM   7601 O  "O3'" . C   C 2 15  ? -5.425  10.754  3.046   1.00 75.87  ? 15  C   C "O3'" 1 
ATOM   7602 C  "C2'" . C   C 2 15  ? -6.696  8.977   1.952   1.00 78.14  ? 15  C   C "C2'" 1 
ATOM   7603 O  "O2'" . C   C 2 15  ? -5.725  8.114   2.497   1.00 81.33  ? 15  C   C "O2'" 1 
ATOM   7604 C  "C1'" . C   C 2 15  ? -8.082  8.394   2.211   1.00 79.03  ? 15  C   C "C1'" 1 
ATOM   7605 N  N1    . C   C 2 15  ? -8.972  8.378   0.974   1.00 79.21  ? 15  C   C N1    1 
ATOM   7606 C  C2    . C   C 2 15  ? -9.889  9.417   0.650   1.00 76.17  ? 15  C   C C2    1 
ATOM   7607 O  O2    . C   C 2 15  ? -10.025 10.409  1.375   1.00 73.31  ? 15  C   C O2    1 
ATOM   7608 N  N3    . C   C 2 15  ? -10.638 9.309   -0.482  1.00 76.28  ? 15  C   C N3    1 
ATOM   7609 C  C4    . C   C 2 15  ? -10.503 8.238   -1.279  1.00 80.15  ? 15  C   C C4    1 
ATOM   7610 N  N4    . C   C 2 15  ? -11.265 8.183   -2.379  1.00 80.96  ? 15  C   C N4    1 
ATOM   7611 C  C5    . C   C 2 15  ? -9.580  7.180   -0.986  1.00 82.78  ? 15  C   C C5    1 
ATOM   7612 C  C6    . C   C 2 15  ? -8.852  7.296   0.135   1.00 82.08  ? 15  C   C C6    1 
ATOM   7613 P  P     . A   C 2 16  ? -4.679  12.009  2.353   1.00 74.76  ? 16  A   C P     1 
ATOM   7614 O  OP1   . A   C 2 16  ? -3.402  12.198  3.064   1.00 75.89  ? 16  A   C OP1   1 
ATOM   7615 O  OP2   . A   C 2 16  ? -5.619  13.149  2.282   1.00 71.38  ? 16  A   C OP2   1 
ATOM   7616 O  "O5'" . A   C 2 16  ? -4.355  11.548  0.858   1.00 76.66  ? 16  A   C "O5'" 1 
ATOM   7617 C  "C5'" . A   C 2 16  ? -3.607  10.360  0.606   1.00 82.16  ? 16  A   C "C5'" 1 
ATOM   7618 C  "C4'" . A   C 2 16  ? -3.952  9.800   -0.760  1.00 84.97  ? 16  A   C "C4'" 1 
ATOM   7619 O  "O4'" . A   C 2 16  ? -5.318  9.323   -0.794  1.00 85.64  ? 16  A   C "O4'" 1 
ATOM   7620 C  "C3'" . A   C 2 16  ? -3.928  10.817  -1.884  1.00 83.84  ? 16  A   C "C3'" 1 
ATOM   7621 O  "O3'" . A   C 2 16  ? -2.592  11.045  -2.298  1.00 86.50  ? 16  A   C "O3'" 1 
ATOM   7622 C  "C2'" . A   C 2 16  ? -4.753  10.098  -2.945  1.00 85.27  ? 16  A   C "C2'" 1 
ATOM   7623 O  "O2'" . A   C 2 16  ? -4.024  9.097   -3.629  1.00 89.54  ? 16  A   C "O2'" 1 
ATOM   7624 C  "C1'" . A   C 2 16  ? -5.852  9.471   -2.098  1.00 85.81  ? 16  A   C "C1'" 1 
ATOM   7625 N  N9    . A   C 2 16  ? -7.060  10.301  -2.089  1.00 83.12  ? 16  A   C N9    1 
ATOM   7626 C  C8    . A   C 2 16  ? -7.458  11.201  -1.136  1.00 80.35  ? 16  A   C C8    1 
ATOM   7627 N  N7    . A   C 2 16  ? -8.588  11.807  -1.417  1.00 78.55  ? 16  A   C N7    1 
ATOM   7628 C  C5    . A   C 2 16  ? -8.962  11.275  -2.639  1.00 80.06  ? 16  A   C C5    1 
ATOM   7629 C  C6    . A   C 2 16  ? -10.073 11.495  -3.488  1.00 79.41  ? 16  A   C C6    1 
ATOM   7630 N  N6    . A   C 2 16  ? -11.056 12.353  -3.212  1.00 77.41  ? 16  A   C N6    1 
ATOM   7631 N  N1    . A   C 2 16  ? -10.143 10.797  -4.642  1.00 81.90  ? 16  A   C N1    1 
ATOM   7632 C  C2    . A   C 2 16  ? -9.164  9.932   -4.933  1.00 84.71  ? 16  A   C C2    1 
ATOM   7633 N  N3    . A   C 2 16  ? -8.076  9.637   -4.216  1.00 85.58  ? 16  A   C N3    1 
ATOM   7634 C  C4    . A   C 2 16  ? -8.030  10.346  -3.069  1.00 83.07  ? 16  A   C C4    1 
ATOM   7635 P  P     . A   C 2 17  ? -2.153  12.403  -3.015  1.00 84.31  ? 17  A   C P     1 
ATOM   7636 O  OP1   . A   C 2 17  ? -0.975  12.893  -2.274  1.00 85.29  ? 17  A   C OP1   1 
ATOM   7637 O  OP2   . A   C 2 17  ? -3.310  13.306  -3.184  1.00 80.97  ? 17  A   C OP2   1 
ATOM   7638 O  "O5'" . A   C 2 17  ? -1.718  11.869  -4.459  1.00 87.99  ? 17  A   C "O5'" 1 
ATOM   7639 C  "C5'" . A   C 2 17  ? -2.681  11.502  -5.452  1.00 89.99  ? 17  A   C "C5'" 1 
ATOM   7640 C  "C4'" . A   C 2 17  ? -2.632  12.417  -6.667  1.00 90.11  ? 17  A   C "C4'" 1 
ATOM   7641 O  "O4'" . A   C 2 17  ? -3.797  13.281  -6.679  1.00 87.07  ? 17  A   C "O4'" 1 
ATOM   7642 C  "C3'" . A   C 2 17  ? -1.430  13.356  -6.775  1.00 90.23  ? 17  A   C "C3'" 1 
ATOM   7643 O  "O3'" . A   C 2 17  ? -1.072  13.501  -8.144  1.00 92.35  ? 17  A   C "O3'" 1 
ATOM   7644 C  "C2'" . A   C 2 17  ? -1.979  14.657  -6.202  1.00 86.04  ? 17  A   C "C2'" 1 
ATOM   7645 O  "O2'" . A   C 2 17  ? -1.266  15.793  -6.636  1.00 84.04  ? 17  A   C "O2'" 1 
ATOM   7646 C  "C1'" . A   C 2 17  ? -3.373  14.625  -6.817  1.00 85.27  ? 17  A   C "C1'" 1 
ATOM   7647 N  N9    . A   C 2 17  ? -4.377  15.482  -6.189  1.00 82.51  ? 17  A   C N9    1 
ATOM   7648 C  C8    . A   C 2 17  ? -4.327  16.083  -4.957  1.00 81.03  ? 17  A   C C8    1 
ATOM   7649 N  N7    . A   C 2 17  ? -5.394  16.789  -4.671  1.00 78.98  ? 17  A   C N7    1 
ATOM   7650 C  C5    . A   C 2 17  ? -6.202  16.636  -5.790  1.00 78.98  ? 17  A   C C5    1 
ATOM   7651 C  C6    . A   C 2 17  ? -7.483  17.133  -6.123  1.00 77.32  ? 17  A   C C6    1 
ATOM   7652 N  N6    . A   C 2 17  ? -8.186  17.921  -5.307  1.00 75.46  ? 17  A   C N6    1 
ATOM   7653 N  N1    . A   C 2 17  ? -8.009  16.797  -7.327  1.00 78.11  ? 17  A   C N1    1 
ATOM   7654 C  C2    . A   C 2 17  ? -7.298  16.005  -8.147  1.00 80.38  ? 17  A   C C2    1 
ATOM   7655 N  N3    . A   C 2 17  ? -6.089  15.476  -7.944  1.00 82.23  ? 17  A   C N3    1 
ATOM   7656 C  C4    . A   C 2 17  ? -5.591  15.832  -6.739  1.00 81.25  ? 17  A   C C4    1 
ATOM   7657 P  P     . G   C 2 18  ? 0.432   13.314  -8.648  1.00 96.55  ? 18  G   C P     1 
ATOM   7658 O  OP1   . G   C 2 18  ? 0.394   12.369  -9.786  1.00 100.16 ? 18  G   C OP1   1 
ATOM   7659 O  OP2   . G   C 2 18  ? 1.304   13.039  -7.482  1.00 97.61  ? 18  G   C OP2   1 
ATOM   7660 O  "O5'" . G   C 2 18  ? 0.774   14.785  -9.187  1.00 94.03  ? 18  G   C "O5'" 1 
ATOM   7661 C  "C5'" . G   C 2 18  ? 1.802   15.025  -10.138 1.00 96.45  ? 18  G   C "C5'" 1 
ATOM   7662 C  "C4'" . G   C 2 18  ? 1.237   15.445  -11.485 1.00 96.12  ? 18  G   C "C4'" 1 
ATOM   7663 O  "O4'" . G   C 2 18  ? 1.218   14.296  -12.368 1.00 100.69 ? 18  G   C "O4'" 1 
ATOM   7664 C  "C3'" . G   C 2 18  ? -0.210  15.931  -11.523 1.00 93.08  ? 18  G   C "C3'" 1 
ATOM   7665 O  "O3'" . G   C 2 18  ? -0.349  17.302  -11.104 1.00 88.77  ? 18  G   C "O3'" 1 
ATOM   7666 C  "C2'" . G   C 2 18  ? -0.526  15.762  -13.006 1.00 94.69  ? 18  G   C "C2'" 1 
ATOM   7667 O  "O2'" . G   C 2 18  ? -0.083  16.847  -13.801 1.00 92.89  ? 18  G   C "O2'" 1 
ATOM   7668 C  "C1'" . G   C 2 18  ? 0.224   14.475  -13.361 1.00 100.33 ? 18  G   C "C1'" 1 
ATOM   7669 N  N9    . G   C 2 18  ? -0.666  13.310  -13.401 1.00 102.96 ? 18  G   C N9    1 
ATOM   7670 C  C8    . G   C 2 18  ? -0.590  12.173  -12.630 1.00 105.92 ? 18  G   C C8    1 
ATOM   7671 N  N7    . G   C 2 18  ? -1.527  11.301  -12.883 1.00 108.03 ? 18  G   C N7    1 
ATOM   7672 C  C5    . G   C 2 18  ? -2.285  11.893  -13.889 1.00 106.48 ? 18  G   C C5    1 
ATOM   7673 C  C6    . G   C 2 18  ? -3.442  11.422  -14.574 1.00 107.73 ? 18  G   C C6    1 
ATOM   7674 O  O6    . G   C 2 18  ? -4.041  10.346  -14.413 1.00 110.68 ? 18  G   C O6    1 
ATOM   7675 N  N1    . G   C 2 18  ? -3.901  12.338  -15.529 1.00 105.40 ? 18  G   C N1    1 
ATOM   7676 C  C2    . G   C 2 18  ? -3.313  13.560  -15.792 1.00 102.26 ? 18  G   C C2    1 
ATOM   7677 N  N2    . G   C 2 18  ? -3.878  14.326  -16.741 1.00 100.50 ? 18  G   C N2    1 
ATOM   7678 N  N3    . G   C 2 18  ? -2.232  14.006  -15.157 1.00 101.19 ? 18  G   C N3    1 
ATOM   7679 C  C4    . G   C 2 18  ? -1.767  13.130  -14.221 1.00 103.35 ? 18  G   C C4    1 
ATOM   7680 P  P     . U   C 2 19  ? -1.640  17.807  -10.287 1.00 84.47  ? 19  U   C P     1 
ATOM   7681 O  OP1   . U   C 2 19  ? -1.506  19.258  -10.068 1.00 81.02  ? 19  U   C OP1   1 
ATOM   7682 O  OP2   . U   C 2 19  ? -1.838  16.911  -9.126  1.00 85.70  ? 19  U   C OP2   1 
ATOM   7683 O  "O5'" . U   C 2 19  ? -2.845  17.533  -11.304 1.00 84.53  ? 19  U   C "O5'" 1 
ATOM   7684 C  "C5'" . U   C 2 19  ? -3.104  18.324  -12.472 1.00 82.24  ? 19  U   C "C5'" 1 
ATOM   7685 C  "C4'" . U   C 2 19  ? -4.406  17.851  -13.106 1.00 82.58  ? 19  U   C "C4'" 1 
ATOM   7686 O  "O4'" . U   C 2 19  ? -4.398  16.406  -13.282 1.00 86.87  ? 19  U   C "O4'" 1 
ATOM   7687 C  "C3'" . U   C 2 19  ? -5.658  18.144  -12.282 1.00 80.18  ? 19  U   C "C3'" 1 
ATOM   7688 O  "O3'" . U   C 2 19  ? -6.718  18.551  -13.136 1.00 77.63  ? 19  U   C "O3'" 1 
ATOM   7689 C  "C2'" . U   C 2 19  ? -5.974  16.824  -11.580 1.00 83.11  ? 19  U   C "C2'" 1 
ATOM   7690 O  "O2'" . U   C 2 19  ? -7.347  16.643  -11.307 1.00 82.82  ? 19  U   C "O2'" 1 
ATOM   7691 C  "C1'" . U   C 2 19  ? -5.515  15.823  -12.629 1.00 87.39  ? 19  U   C "C1'" 1 
ATOM   7692 N  N1    . U   C 2 19  ? -5.146  14.516  -12.017 1.00 91.09  ? 19  U   C N1    1 
ATOM   7693 C  C2    . U   C 2 19  ? -6.020  13.442  -12.142 1.00 94.30  ? 19  U   C C2    1 
ATOM   7694 O  O2    . U   C 2 19  ? -7.084  13.499  -12.738 1.00 94.60  ? 19  U   C O2    1 
ATOM   7695 N  N3    . U   C 2 19  ? -5.603  12.276  -11.540 1.00 97.26  ? 19  U   C N3    1 
ATOM   7696 C  C4    . U   C 2 19  ? -4.423  12.088  -10.837 1.00 97.77  ? 19  U   C C4    1 
ATOM   7697 O  O4    . U   C 2 19  ? -4.175  10.988  -10.350 1.00 100.98 ? 19  U   C O4    1 
ATOM   7698 C  C5    . U   C 2 19  ? -3.569  13.252  -10.746 1.00 95.20  ? 19  U   C C5    1 
ATOM   7699 C  C6    . U   C 2 19  ? -3.951  14.400  -11.324 1.00 91.60  ? 19  U   C C6    1 
ATOM   7700 P  P     . C   C 2 20  ? -7.408  19.971  -12.890 1.00 72.78  ? 20  C   C P     1 
ATOM   7701 O  OP1   . C   C 2 20  ? -8.509  20.103  -13.875 1.00 73.21  ? 20  C   C OP1   1 
ATOM   7702 O  OP2   . C   C 2 20  ? -6.334  20.996  -12.843 1.00 69.89  ? 20  C   C OP2   1 
ATOM   7703 O  "O5'" . C   C 2 20  ? -8.034  19.785  -11.418 1.00 69.63  ? 20  C   C "O5'" 1 
ATOM   7704 C  "C5'" . C   C 2 20  ? -9.394  20.130  -11.142 1.00 64.87  ? 20  C   C "C5'" 1 
ATOM   7705 C  "C4'" . C   C 2 20  ? -9.546  20.715  -9.748  1.00 60.34  ? 20  C   C "C4'" 1 
ATOM   7706 O  "O4'" . C   C 2 20  ? -9.002  19.797  -8.763  1.00 60.98  ? 20  C   C "O4'" 1 
ATOM   7707 C  "C3'" . C   C 2 20  ? -8.778  21.997  -9.470  1.00 56.06  ? 20  C   C "C3'" 1 
ATOM   7708 O  "O3'" . C   C 2 20  ? -9.419  23.133  -10.017 1.00 52.07  ? 20  C   C "O3'" 1 
ATOM   7709 C  "C2'" . C   C 2 20  ? -8.785  22.011  -7.944  1.00 55.92  ? 20  C   C "C2'" 1 
ATOM   7710 O  "O2'" . C   C 2 20  ? -10.005 22.461  -7.393  1.00 54.56  ? 20  C   C "O2'" 1 
ATOM   7711 C  "C1'" . C   C 2 20  ? -8.563  20.536  -7.631  1.00 58.55  ? 20  C   C "C1'" 1 
ATOM   7712 N  N1    . C   C 2 20  ? -7.124  20.228  -7.313  1.00 58.96  ? 20  C   C N1    1 
ATOM   7713 C  C2    . C   C 2 20  ? -6.583  20.675  -6.098  1.00 58.26  ? 20  C   C C2    1 
ATOM   7714 O  O2    . C   C 2 20  ? -7.298  21.311  -5.321  1.00 58.01  ? 20  C   C O2    1 
ATOM   7715 N  N3    . C   C 2 20  ? -5.288  20.401  -5.801  1.00 59.37  ? 20  C   C N3    1 
ATOM   7716 C  C4    . C   C 2 20  ? -4.537  19.713  -6.667  1.00 61.36  ? 20  C   C C4    1 
ATOM   7717 N  N4    . C   C 2 20  ? -3.265  19.471  -6.331  1.00 62.80  ? 20  C   C N4    1 
ATOM   7718 C  C5    . C   C 2 20  ? -5.061  19.243  -7.915  1.00 62.03  ? 20  C   C C5    1 
ATOM   7719 C  C6    . C   C 2 20  ? -6.343  19.524  -8.194  1.00 60.87  ? 20  C   C C6    1 
ATOM   7720 P  P     . C   C 2 21  ? -8.617  24.520  -10.090 1.00 49.41  ? 21  C   C P     1 
ATOM   7721 O  OP1   . C   C 2 21  ? -9.476  25.559  -10.697 1.00 48.87  ? 21  C   C OP1   1 
ATOM   7722 O  OP2   . C   C 2 21  ? -7.286  24.297  -10.688 1.00 50.58  ? 21  C   C OP2   1 
ATOM   7723 O  "O5'" . C   C 2 21  ? -8.376  24.831  -8.542  1.00 47.78  ? 21  C   C "O5'" 1 
ATOM   7724 C  "C5'" . C   C 2 21  ? -9.295  25.582  -7.754  1.00 43.73  ? 21  C   C "C5'" 1 
ATOM   7725 C  "C4'" . C   C 2 21  ? -8.583  26.151  -6.543  1.00 40.43  ? 21  C   C "C4'" 1 
ATOM   7726 O  "O4'" . C   C 2 21  ? -7.941  25.077  -5.822  1.00 40.61  ? 21  C   C "O4'" 1 
ATOM   7727 C  "C3'" . C   C 2 21  ? -7.454  27.117  -6.853  1.00 38.44  ? 21  C   C "C3'" 1 
ATOM   7728 O  "O3'" . C   C 2 21  ? -8.040  28.373  -7.103  1.00 36.89  ? 21  C   C "O3'" 1 
ATOM   7729 C  "C2'" . C   C 2 21  ? -6.703  27.046  -5.529  1.00 39.88  ? 21  C   C "C2'" 1 
ATOM   7730 O  "O2'" . C   C 2 21  ? -7.360  27.732  -4.482  1.00 41.03  ? 21  C   C "O2'" 1 
ATOM   7731 C  "C1'" . C   C 2 21  ? -6.756  25.552  -5.232  1.00 40.46  ? 21  C   C "C1'" 1 
ATOM   7732 N  N1    . C   C 2 21  ? -5.616  24.774  -5.777  1.00 41.54  ? 21  C   C N1    1 
ATOM   7733 C  C2    . C   C 2 21  ? -4.392  24.795  -5.091  1.00 43.03  ? 21  C   C C2    1 
ATOM   7734 O  O2    . C   C 2 21  ? -4.293  25.456  -4.049  1.00 43.41  ? 21  C   C O2    1 
ATOM   7735 N  N3    . C   C 2 21  ? -3.347  24.083  -5.591  1.00 43.59  ? 21  C   C N3    1 
ATOM   7736 C  C4    . C   C 2 21  ? -3.492  23.385  -6.719  1.00 43.44  ? 21  C   C C4    1 
ATOM   7737 N  N4    . C   C 2 21  ? -2.434  22.706  -7.158  1.00 45.81  ? 21  C   C N4    1 
ATOM   7738 C  C5    . C   C 2 21  ? -4.720  23.351  -7.444  1.00 42.72  ? 21  C   C C5    1 
ATOM   7739 C  C6    . C   C 2 21  ? -5.744  24.049  -6.936  1.00 41.84  ? 21  C   C C6    1 
ATOM   7740 P  P     . A   C 2 22  ? -7.354  29.551  -7.936  1.00 34.57  ? 22  A   C P     1 
ATOM   7741 O  OP1   . A   C 2 22  ? -8.289  30.698  -7.933  1.00 32.39  ? 22  A   C OP1   1 
ATOM   7742 O  OP2   . A   C 2 22  ? -6.868  28.995  -9.208  1.00 35.44  ? 22  A   C OP2   1 
ATOM   7743 O  "O5'" . A   C 2 22  ? -6.068  29.887  -7.044  1.00 37.23  ? 22  A   C "O5'" 1 
ATOM   7744 C  "C5'" . A   C 2 22  ? -4.796  30.150  -7.619  1.00 38.15  ? 22  A   C "C5'" 1 
ATOM   7745 C  "C4'" . A   C 2 22  ? -3.750  30.021  -6.536  1.00 40.72  ? 22  A   C "C4'" 1 
ATOM   7746 O  "O4'" . A   C 2 22  ? -3.726  28.658  -6.043  1.00 42.64  ? 22  A   C "O4'" 1 
ATOM   7747 C  "C3'" . A   C 2 22  ? -2.320  30.262  -6.978  1.00 41.65  ? 22  A   C "C3'" 1 
ATOM   7748 O  "O3'" . A   C 2 22  ? -2.068  31.638  -7.017  1.00 42.03  ? 22  A   C "O3'" 1 
ATOM   7749 C  "C2'" . A   C 2 22  ? -1.555  29.577  -5.860  1.00 44.24  ? 22  A   C "C2'" 1 
ATOM   7750 O  "O2'" . A   C 2 22  ? -1.542  30.297  -4.645  1.00 45.95  ? 22  A   C "O2'" 1 
ATOM   7751 C  "C1'" . A   C 2 22  ? -2.392  28.313  -5.695  1.00 44.42  ? 22  A   C "C1'" 1 
ATOM   7752 N  N9    . A   C 2 22  ? -1.885  27.253  -6.558  1.00 44.63  ? 22  A   C N9    1 
ATOM   7753 C  C8    . A   C 2 22  ? -2.482  26.683  -7.648  1.00 43.88  ? 22  A   C C8    1 
ATOM   7754 N  N7    . A   C 2 22  ? -1.757  25.757  -8.222  1.00 44.70  ? 22  A   C N7    1 
ATOM   7755 C  C5    . A   C 2 22  ? -0.606  25.724  -7.459  1.00 46.92  ? 22  A   C C5    1 
ATOM   7756 C  C6    . A   C 2 22  ? 0.574   24.956  -7.536  1.00 49.46  ? 22  A   C C6    1 
ATOM   7757 N  N6    . A   C 2 22  ? 0.778   24.034  -8.480  1.00 50.62  ? 22  A   C N6    1 
ATOM   7758 N  N1    . A   C 2 22  ? 1.545   25.176  -6.615  1.00 51.28  ? 22  A   C N1    1 
ATOM   7759 C  C2    . A   C 2 22  ? 1.351   26.109  -5.671  1.00 50.74  ? 22  A   C C2    1 
ATOM   7760 N  N3    . A   C 2 22  ? 0.284   26.892  -5.493  1.00 49.37  ? 22  A   C N3    1 
ATOM   7761 C  C4    . A   C 2 22  ? -0.665  26.645  -6.429  1.00 47.08  ? 22  A   C C4    1 
ATOM   7762 P  P     . U   C 2 23  ? -1.148  32.201  -8.187  1.00 40.99  ? 23  U   C P     1 
ATOM   7763 O  OP1   . U   C 2 23  ? -1.236  33.675  -8.232  1.00 40.90  ? 23  U   C OP1   1 
ATOM   7764 O  OP2   . U   C 2 23  ? -1.437  31.408  -9.398  1.00 39.82  ? 23  U   C OP2   1 
ATOM   7765 O  "O5'" . U   C 2 23  ? 0.286   31.769  -7.645  1.00 45.96  ? 23  U   C "O5'" 1 
ATOM   7766 C  "C5'" . U   C 2 23  ? 0.837   32.343  -6.470  1.00 50.62  ? 23  U   C "C5'" 1 
ATOM   7767 C  "C4'" . U   C 2 23  ? 2.137   31.651  -6.113  1.00 55.83  ? 23  U   C "C4'" 1 
ATOM   7768 O  "O4'" . U   C 2 23  ? 1.909   30.225  -5.988  1.00 56.37  ? 23  U   C "O4'" 1 
ATOM   7769 C  "C3'" . U   C 2 23  ? 3.222   31.718  -7.173  1.00 58.32  ? 23  U   C "C3'" 1 
ATOM   7770 O  "O3'" . U   C 2 23  ? 3.908   32.957  -7.154  1.00 62.06  ? 23  U   C "O3'" 1 
ATOM   7771 C  "C2'" . U   C 2 23  ? 4.114   30.556  -6.756  1.00 60.62  ? 23  U   C "C2'" 1 
ATOM   7772 O  "O2'" . U   C 2 23  ? 4.937   30.850  -5.644  1.00 63.76  ? 23  U   C "O2'" 1 
ATOM   7773 C  "C1'" . U   C 2 23  ? 3.066   29.514  -6.393  1.00 58.53  ? 23  U   C "C1'" 1 
ATOM   7774 N  N1    . U   C 2 23  ? 2.736   28.602  -7.539  1.00 57.65  ? 23  U   C N1    1 
ATOM   7775 C  C2    . U   C 2 23  ? 3.614   27.579  -7.857  1.00 59.91  ? 23  U   C C2    1 
ATOM   7776 O  O2    . U   C 2 23  ? 4.656   27.370  -7.257  1.00 62.53  ? 23  U   C O2    1 
ATOM   7777 N  N3    . U   C 2 23  ? 3.228   26.798  -8.919  1.00 58.76  ? 23  U   C N3    1 
ATOM   7778 C  C4    . U   C 2 23  ? 2.086   26.931  -9.676  1.00 55.90  ? 23  U   C C4    1 
ATOM   7779 O  O4    . U   C 2 23  ? 1.887   26.154  -10.591 1.00 56.59  ? 23  U   C O4    1 
ATOM   7780 C  C5    . U   C 2 23  ? 1.219   28.011  -9.296  1.00 54.19  ? 23  U   C C5    1 
ATOM   7781 C  C6    . U   C 2 23  ? 1.571   28.788  -8.265  1.00 54.98  ? 23  U   C C6    1 
ATOM   7782 P  P     . U   C 2 24  ? 4.338   33.597  -8.564  1.00 64.25  ? 24  U   C P     1 
ATOM   7783 O  OP1   . U   C 2 24  ? 4.824   34.978  -8.311  1.00 66.02  ? 24  U   C OP1   1 
ATOM   7784 O  OP2   . U   C 2 24  ? 3.262   33.378  -9.561  1.00 59.38  ? 24  U   C OP2   1 
ATOM   7785 O  "O5'" . U   C 2 24  ? 5.600   32.681  -8.950  1.00 67.19  ? 24  U   C "O5'" 1 
ATOM   7786 C  "C5'" . U   C 2 24  ? 6.733   32.607  -8.069  1.00 70.18  ? 24  U   C "C5'" 1 
ATOM   7787 C  "C4'" . U   C 2 24  ? 7.694   31.510  -8.484  1.00 72.24  ? 24  U   C "C4'" 1 
ATOM   7788 O  "O4'" . U   C 2 24  ? 7.032   30.229  -8.371  1.00 69.84  ? 24  U   C "O4'" 1 
ATOM   7789 C  "C3'" . U   C 2 24  ? 8.166   31.554  -9.935  1.00 72.73  ? 24  U   C "C3'" 1 
ATOM   7790 O  "O3'" . U   C 2 24  ? 9.244   32.460  -10.120 1.00 77.60  ? 24  U   C "O3'" 1 
ATOM   7791 C  "C2'" . U   C 2 24  ? 8.616   30.116  -10.136 1.00 73.49  ? 24  U   C "C2'" 1 
ATOM   7792 O  "O2'" . U   C 2 24  ? 9.882   29.834  -9.568  1.00 77.35  ? 24  U   C "O2'" 1 
ATOM   7793 C  "C1'" . U   C 2 24  ? 7.513   29.367  -9.389  1.00 70.19  ? 24  U   C "C1'" 1 
ATOM   7794 N  N1    . U   C 2 24  ? 6.395   28.907  -10.288 1.00 66.38  ? 24  U   C N1    1 
ATOM   7795 C  C2    . U   C 2 24  ? 6.610   27.824  -11.130 1.00 67.08  ? 24  U   C C2    1 
ATOM   7796 O  O2    . U   C 2 24  ? 7.653   27.201  -11.199 1.00 70.02  ? 24  U   C O2    1 
ATOM   7797 N  N3    . U   C 2 24  ? 5.545   27.472  -11.914 1.00 64.54  ? 24  U   C N3    1 
ATOM   7798 C  C4    . U   C 2 24  ? 4.315   28.081  -11.936 1.00 61.35  ? 24  U   C C4    1 
ATOM   7799 O  O4    . U   C 2 24  ? 3.467   27.641  -12.692 1.00 60.55  ? 24  U   C O4    1 
ATOM   7800 C  C5    . U   C 2 24  ? 4.156   29.202  -11.046 1.00 60.17  ? 24  U   C C5    1 
ATOM   7801 C  C6    . U   C 2 24  ? 5.180   29.567  -10.271 1.00 62.44  ? 24  U   C C6    1 
ATOM   7802 P  P     . U   C 2 25  ? 9.529   33.075  -11.572 1.00 79.43  ? 25  U   C P     1 
ATOM   7803 O  OP1   . U   C 2 25  ? 10.107  34.423  -11.382 1.00 80.83  ? 25  U   C OP1   1 
ATOM   7804 O  OP2   . U   C 2 25  ? 8.317   32.942  -12.422 1.00 75.86  ? 25  U   C OP2   1 
ATOM   7805 O  "O5'" . U   C 2 25  ? 10.631  32.064  -12.141 1.00 82.28  ? 25  U   C "O5'" 1 
ATOM   7806 C  "C5'" . U   C 2 25  ? 11.858  31.835  -11.464 1.00 87.07  ? 25  U   C "C5'" 1 
ATOM   7807 C  "C4'" . U   C 2 25  ? 12.667  30.796  -12.215 1.00 90.32  ? 25  U   C "C4'" 1 
ATOM   7808 O  "O4'" . U   C 2 25  ? 12.056  29.496  -12.010 1.00 89.76  ? 25  U   C "O4'" 1 
ATOM   7809 C  "C3'" . U   C 2 25  ? 12.686  30.949  -13.731 1.00 89.63  ? 25  U   C "C3'" 1 
ATOM   7810 O  "O3'" . U   C 2 25  ? 13.673  31.886  -14.163 1.00 92.53  ? 25  U   C "O3'" 1 
ATOM   7811 C  "C2'" . U   C 2 25  ? 12.989  29.520  -14.166 1.00 91.45  ? 25  U   C "C2'" 1 
ATOM   7812 O  "O2'" . U   C 2 25  ? 14.335  29.152  -13.963 1.00 96.78  ? 25  U   C "O2'" 1 
ATOM   7813 C  "C1'" . U   C 2 25  ? 12.108  28.737  -13.206 1.00 89.96  ? 25  U   C "C1'" 1 
ATOM   7814 N  N1    . U   C 2 25  ? 10.732  28.467  -13.757 1.00 85.94  ? 25  U   C N1    1 
ATOM   7815 C  C2    . U   C 2 25  ? 10.561  27.429  -14.659 1.00 86.59  ? 25  U   C C2    1 
ATOM   7816 O  O2    . U   C 2 25  ? 11.459  26.700  -15.038 1.00 90.21  ? 25  U   C O2    1 
ATOM   7817 N  N3    . U   C 2 25  ? 9.276   27.260  -15.112 1.00 83.16  ? 25  U   C N3    1 
ATOM   7818 C  C4    . U   C 2 25  ? 8.168   28.009  -14.768 1.00 79.22  ? 25  U   C C4    1 
ATOM   7819 O  O4    . U   C 2 25  ? 7.084   27.730  -15.261 1.00 77.17  ? 25  U   C O4    1 
ATOM   7820 C  C5    . U   C 2 25  ? 8.414   29.075  -13.831 1.00 78.75  ? 25  U   C C5    1 
ATOM   7821 C  C6    . U   C 2 25  ? 9.658   29.256  -13.376 1.00 82.02  ? 25  U   C C6    1 
ATOM   7822 P  P     . A   C 2 26  ? 13.436  32.737  -15.505 1.00 91.45  ? 26  A   C P     1 
ATOM   7823 O  OP1   . A   C 2 26  ? 14.486  33.773  -15.570 1.00 94.80  ? 26  A   C OP1   1 
ATOM   7824 O  OP2   . A   C 2 26  ? 12.021  33.167  -15.578 1.00 86.66  ? 26  A   C OP2   1 
ATOM   7825 O  "O5'" . A   C 2 26  ? 13.687  31.665  -16.672 1.00 92.57  ? 26  A   C "O5'" 1 
ATOM   7826 C  "C5'" . A   C 2 26  ? 14.922  30.931  -16.791 1.00 96.67  ? 26  A   C "C5'" 1 
ATOM   7827 C  "C4'" . A   C 2 26  ? 14.837  29.900  -17.904 1.00 96.97  ? 26  A   C "C4'" 1 
ATOM   7828 O  "O4'" . A   C 2 26  ? 13.988  28.790  -17.504 1.00 95.36  ? 26  A   C "O4'" 1 
ATOM   7829 C  "C3'" . A   C 2 26  ? 14.200  30.402  -19.195 1.00 94.24  ? 26  A   C "C3'" 1 
ATOM   7830 O  "O3'" . A   C 2 26  ? 15.143  31.101  -20.004 1.00 97.29  ? 26  A   C "O3'" 1 
ATOM   7831 C  "C2'" . A   C 2 26  ? 13.723  29.099  -19.829 1.00 94.11  ? 26  A   C "C2'" 1 
ATOM   7832 O  "O2'" . A   C 2 26  ? 14.747  28.376  -20.489 1.00 98.45  ? 26  A   C "O2'" 1 
ATOM   7833 C  "C1'" . A   C 2 26  ? 13.214  28.337  -18.609 1.00 92.88  ? 26  A   C "C1'" 1 
ATOM   7834 N  N9    . A   C 2 26  ? 11.768  28.528  -18.394 1.00 87.97  ? 26  A   C N9    1 
ATOM   7835 C  C8    . A   C 2 26  ? 11.148  29.426  -17.558 1.00 84.69  ? 26  A   C C8    1 
ATOM   7836 N  N7    . A   C 2 26  ? 9.833   29.367  -17.580 1.00 81.06  ? 26  A   C N7    1 
ATOM   7837 C  C5    . A   C 2 26  ? 9.560   28.363  -18.498 1.00 81.78  ? 26  A   C C5    1 
ATOM   7838 C  C6    . A   C 2 26  ? 8.351   27.805  -18.982 1.00 79.28  ? 26  A   C C6    1 
ATOM   7839 N  N6    . A   C 2 26  ? 7.143   28.207  -18.585 1.00 75.68  ? 26  A   C N6    1 
ATOM   7840 N  N1    . A   C 2 26  ? 8.431   26.810  -19.896 1.00 81.60  ? 26  A   C N1    1 
ATOM   7841 C  C2    . A   C 2 26  ? 9.644   26.401  -20.305 1.00 85.77  ? 26  A   C C2    1 
ATOM   7842 N  N3    . A   C 2 26  ? 10.847  26.847  -19.927 1.00 87.93  ? 26  A   C N3    1 
ATOM   7843 C  C4    . A   C 2 26  ? 10.742  27.836  -19.012 1.00 86.06  ? 26  A   C C4    1 
ATOM   7844 P  P     . C   C 2 27  ? 14.689  32.217  -21.068 1.00 95.25  ? 27  C   C P     1 
ATOM   7845 O  OP1   . C   C 2 27  ? 15.933  32.695  -21.716 1.00 99.09  ? 27  C   C OP1   1 
ATOM   7846 O  OP2   . C   C 2 27  ? 13.792  33.191  -20.404 1.00 91.20  ? 27  C   C OP2   1 
ATOM   7847 O  "O5'" . C   C 2 27  ? 13.820  31.412  -22.146 1.00 93.72  ? 27  C   C "O5'" 1 
ATOM   7848 C  "C5'" . C   C 2 27  ? 14.482  30.679  -23.177 1.00 98.28  ? 27  C   C "C5'" 1 
ATOM   7849 C  "C4'" . C   C 2 27  ? 13.557  29.664  -23.821 1.00 98.02  ? 27  C   C "C4'" 1 
ATOM   7850 O  "O4'" . C   C 2 27  ? 12.762  28.982  -22.818 1.00 96.52  ? 27  C   C "O4'" 1 
ATOM   7851 C  "C3'" . C   C 2 27  ? 12.511  30.259  -24.743 1.00 94.77  ? 27  C   C "C3'" 1 
ATOM   7852 O  "O3'" . C   C 2 27  ? 13.091  30.562  -26.003 1.00 97.49  ? 27  C   C "O3'" 1 
ATOM   7853 C  "C2'" . C   C 2 27  ? 11.488  29.130  -24.801 1.00 93.64  ? 27  C   C "C2'" 1 
ATOM   7854 O  "O2'" . C   C 2 27  ? 11.898  28.059  -25.636 1.00 97.81  ? 27  C   C "O2'" 1 
ATOM   7855 C  "C1'" . C   C 2 27  ? 11.474  28.699  -23.335 1.00 92.88  ? 27  C   C "C1'" 1 
ATOM   7856 N  N1    . C   C 2 27  ? 10.434  29.382  -22.493 1.00 88.27  ? 27  C   C N1    1 
ATOM   7857 C  C2    . C   C 2 27  ? 9.096   28.957  -22.564 1.00 85.67  ? 27  C   C C2    1 
ATOM   7858 O  O2    . C   C 2 27  ? 8.802   28.025  -23.323 1.00 87.20  ? 27  C   C O2    1 
ATOM   7859 N  N3    . C   C 2 27  ? 8.155   29.577  -21.795 1.00 81.54  ? 27  C   C N3    1 
ATOM   7860 C  C4    . C   C 2 27  ? 8.509   30.579  -20.983 1.00 80.66  ? 27  C   C C4    1 
ATOM   7861 N  N4    . C   C 2 27  ? 7.557   31.156  -20.248 1.00 77.58  ? 27  C   C N4    1 
ATOM   7862 C  C5    . C   C 2 27  ? 9.862   31.031  -20.892 1.00 83.85  ? 27  C   C C5    1 
ATOM   7863 C  C6    . C   C 2 27  ? 10.778  30.411  -21.653 1.00 87.39  ? 27  C   C C6    1 
ATOM   7864 P  P     . U   C 2 28  ? 12.483  31.755  -26.899 1.00 94.98  ? 28  U   C P     1 
ATOM   7865 O  OP1   . U   C 2 28  ? 13.498  32.073  -27.940 1.00 98.05  ? 28  U   C OP1   1 
ATOM   7866 O  OP2   . U   C 2 28  ? 11.924  32.821  -26.022 1.00 90.60  ? 28  U   C OP2   1 
ATOM   7867 O  "O5'" . U   C 2 28  ? 11.234  31.045  -27.594 1.00 91.15  ? 28  U   C "O5'" 1 
ATOM   7868 C  "C5'" . U   C 2 28  ? 11.421  29.994  -28.544 1.00 90.86  ? 28  U   C "C5'" 1 
ATOM   7869 C  "C4'" . U   C 2 28  ? 10.048  29.671  -29.077 1.00 85.44  ? 28  U   C "C4'" 1 
ATOM   7870 O  "O4'" . U   C 2 28  ? 9.278   29.075  -28.005 1.00 83.00  ? 28  U   C "O4'" 1 
ATOM   7871 C  "C3'" . U   C 2 28  ? 9.236   30.907  -29.432 1.00 78.98  ? 28  U   C "C3'" 1 
ATOM   7872 O  "O3'" . U   C 2 28  ? 9.612   31.434  -30.703 1.00 76.56  ? 28  U   C "O3'" 1 
ATOM   7873 C  "C2'" . U   C 2 28  ? 7.836   30.321  -29.380 1.00 77.22  ? 28  U   C "C2'" 1 
ATOM   7874 O  "O2'" . U   C 2 28  ? 7.556   29.483  -30.483 1.00 80.14  ? 28  U   C "O2'" 1 
ATOM   7875 C  "C1'" . U   C 2 28  ? 7.935   29.500  -28.102 1.00 78.14  ? 28  U   C "C1'" 1 
ATOM   7876 N  N1    . U   C 2 28  ? 7.510   30.237  -26.856 1.00 74.82  ? 28  U   C N1    1 
ATOM   7877 C  C2    . U   C 2 28  ? 6.158   30.231  -26.549 1.00 71.61  ? 28  U   C C2    1 
ATOM   7878 O  O2    . U   C 2 28  ? 5.323   29.668  -27.235 1.00 71.65  ? 28  U   C O2    1 
ATOM   7879 N  N3    . U   C 2 28  ? 5.809   30.908  -25.403 1.00 68.85  ? 28  U   C N3    1 
ATOM   7880 C  C4    . U   C 2 28  ? 6.661   31.587  -24.546 1.00 69.13  ? 28  U   C C4    1 
ATOM   7881 O  O4    . U   C 2 28  ? 6.186   32.154  -23.563 1.00 66.68  ? 28  U   C O4    1 
ATOM   7882 C  C5    . U   C 2 28  ? 8.062   31.552  -24.926 1.00 72.20  ? 28  U   C C5    1 
ATOM   7883 C  C6    . U   C 2 28  ? 8.429   30.893  -26.040 1.00 74.72  ? 28  U   C C6    1 
ATOM   7884 P  P     . U   C 2 29  ? 9.251   32.952  -31.056 1.00 70.88  ? 29  U   C P     1 
ATOM   7885 O  OP1   . U   C 2 29  ? 10.131  33.427  -32.145 1.00 72.90  ? 29  U   C OP1   1 
ATOM   7886 O  OP2   . U   C 2 29  ? 9.119   33.757  -29.814 1.00 68.02  ? 29  U   C OP2   1 
ATOM   7887 O  "O5'" . U   C 2 29  ? 7.798   32.726  -31.660 1.00 66.33  ? 29  U   C "O5'" 1 
ATOM   7888 C  "C5'" . U   C 2 29  ? 6.745   33.380  -31.042 1.00 58.66  ? 29  U   C "C5'" 1 
ATOM   7889 C  "C4'" . U   C 2 29  ? 5.464   32.632  -31.277 1.00 55.25  ? 29  U   C "C4'" 1 
ATOM   7890 O  "O4'" . U   C 2 29  ? 5.130   31.820  -30.126 1.00 54.40  ? 29  U   C "O4'" 1 
ATOM   7891 C  "C3'" . U   C 2 29  ? 4.361   33.651  -31.362 1.00 50.82  ? 29  U   C "C3'" 1 
ATOM   7892 O  "O3'" . U   C 2 29  ? 4.198   34.010  -32.725 1.00 48.82  ? 29  U   C "O3'" 1 
ATOM   7893 C  "C2'" . U   C 2 29  ? 3.174   32.994  -30.655 1.00 49.02  ? 29  U   C "C2'" 1 
ATOM   7894 O  "O2'" . U   C 2 29  ? 2.435   32.103  -31.460 1.00 51.08  ? 29  U   C "O2'" 1 
ATOM   7895 C  "C1'" . U   C 2 29  ? 3.897   32.226  -29.556 1.00 49.97  ? 29  U   C "C1'" 1 
ATOM   7896 N  N1    . U   C 2 29  ? 4.126   32.999  -28.271 1.00 47.85  ? 29  U   C N1    1 
ATOM   7897 C  C2    . U   C 2 29  ? 3.036   33.341  -27.473 1.00 45.56  ? 29  U   C C2    1 
ATOM   7898 O  O2    . U   C 2 29  ? 1.876   33.070  -27.747 1.00 44.60  ? 29  U   C O2    1 
ATOM   7899 N  N3    . U   C 2 29  ? 3.347   34.037  -26.322 1.00 43.93  ? 29  U   C N3    1 
ATOM   7900 C  C4    . U   C 2 29  ? 4.604   34.413  -25.889 1.00 44.80  ? 29  U   C C4    1 
ATOM   7901 O  O4    . U   C 2 29  ? 4.712   35.033  -24.840 1.00 44.16  ? 29  U   C O4    1 
ATOM   7902 C  C5    . U   C 2 29  ? 5.690   34.023  -26.758 1.00 47.58  ? 29  U   C C5    1 
ATOM   7903 C  C6    . U   C 2 29  ? 5.415   33.348  -27.882 1.00 48.76  ? 29  U   C C6    1 
ATOM   7904 P  P     . C   C 2 30  ? 4.236   35.574  -33.025 1.00 44.78  ? 30  C   C P     1 
ATOM   7905 O  OP1   . C   C 2 30  ? 4.318   35.782  -34.487 1.00 46.35  ? 30  C   C OP1   1 
ATOM   7906 O  OP2   . C   C 2 30  ? 5.218   36.196  -32.106 1.00 43.70  ? 30  C   C OP2   1 
ATOM   7907 O  "O5'" . C   C 2 30  ? 2.770   36.007  -32.563 1.00 40.23  ? 30  C   C "O5'" 1 
ATOM   7908 C  "C5'" . C   C 2 30  ? 1.653   35.325  -33.096 1.00 38.38  ? 30  C   C "C5'" 1 
ATOM   7909 C  "C4'" . C   C 2 30  ? 0.453   35.541  -32.212 1.00 34.95  ? 30  C   C "C4'" 1 
ATOM   7910 O  "O4'" . C   C 2 30  ? 0.733   34.999  -30.905 1.00 35.21  ? 30  C   C "O4'" 1 
ATOM   7911 C  "C3'" . C   C 2 30  ? 0.141   36.994  -31.908 1.00 31.88  ? 30  C   C "C3'" 1 
ATOM   7912 O  "O3'" . C   C 2 30  ? -0.517  37.626  -33.002 1.00 30.12  ? 30  C   C "O3'" 1 
ATOM   7913 C  "C2'" . C   C 2 30  ? -0.767  36.809  -30.706 1.00 30.77  ? 30  C   C "C2'" 1 
ATOM   7914 O  "O2'" . C   C 2 30  ? -2.043  36.342  -31.065 1.00 31.61  ? 30  C   C "O2'" 1 
ATOM   7915 C  "C1'" . C   C 2 30  ? -0.031  35.713  -29.947 1.00 32.82  ? 30  C   C "C1'" 1 
ATOM   7916 N  N1    . C   C 2 30  ? 0.829   36.307  -28.876 1.00 32.21  ? 30  C   C N1    1 
ATOM   7917 C  C2    . C   C 2 30  ? 0.235   36.751  -27.683 1.00 30.19  ? 30  C   C C2    1 
ATOM   7918 O  O2    . C   C 2 30  ? -0.985  36.633  -27.512 1.00 28.44  ? 30  C   C O2    1 
ATOM   7919 N  N3    . C   C 2 30  ? 1.032   37.307  -26.736 1.00 30.37  ? 30  C   C N3    1 
ATOM   7920 C  C4    . C   C 2 30  ? 2.350   37.415  -26.942 1.00 31.48  ? 30  C   C C4    1 
ATOM   7921 N  N4    . C   C 2 30  ? 3.087   37.957  -25.982 1.00 31.83  ? 30  C   C N4    1 
ATOM   7922 C  C5    . C   C 2 30  ? 2.979   36.980  -28.141 1.00 32.95  ? 30  C   C C5    1 
ATOM   7923 C  C6    . C   C 2 30  ? 2.179   36.446  -29.073 1.00 33.84  ? 30  C   C C6    1 
ATOM   7924 P  P     . C   C 2 31  ? -0.509  39.217  -33.155 1.00 25.93  ? 31  C   C P     1 
ATOM   7925 O  OP1   . C   C 2 31  ? -1.138  39.555  -34.446 1.00 27.70  ? 31  C   C OP1   1 
ATOM   7926 O  OP2   . C   C 2 31  ? 0.819   39.736  -32.778 1.00 25.35  ? 31  C   C OP2   1 
ATOM   7927 O  "O5'" . C   C 2 31  ? -1.500  39.666  -32.007 1.00 27.26  ? 31  C   C "O5'" 1 
ATOM   7928 C  "C5'" . C   C 2 31  ? -2.880  39.348  -32.089 1.00 29.26  ? 31  C   C "C5'" 1 
ATOM   7929 C  "C4'" . C   C 2 31  ? -3.590  39.874  -30.855 1.00 28.93  ? 31  C   C "C4'" 1 
ATOM   7930 O  "O4'" . C   C 2 31  ? -2.915  39.364  -29.701 1.00 28.71  ? 31  C   C "O4'" 1 
ATOM   7931 C  "C3'" . C   C 2 31  ? -3.502  41.372  -30.686 1.00 28.48  ? 31  C   C "C3'" 1 
ATOM   7932 O  "O3'" . C   C 2 31  ? -4.542  41.975  -31.420 1.00 28.30  ? 31  C   C "O3'" 1 
ATOM   7933 C  "C2'" . C   C 2 31  ? -3.674  41.547  -29.191 1.00 29.06  ? 31  C   C "C2'" 1 
ATOM   7934 O  "O2'" . C   C 2 31  ? -5.032  41.493  -28.777 1.00 29.73  ? 31  C   C "O2'" 1 
ATOM   7935 C  "C1'" . C   C 2 31  ? -2.958  40.317  -28.667 1.00 29.91  ? 31  C   C "C1'" 1 
ATOM   7936 N  N1    . C   C 2 31  ? -1.572  40.488  -28.156 1.00 31.52  ? 31  C   C N1    1 
ATOM   7937 C  C2    . C   C 2 31  ? -1.338  41.045  -26.877 1.00 32.13  ? 31  C   C C2    1 
ATOM   7938 O  O2    . C   C 2 31  ? -2.267  41.436  -26.162 1.00 30.77  ? 31  C   C O2    1 
ATOM   7939 N  N3    . C   C 2 31  ? -0.051  41.153  -26.448 1.00 33.69  ? 31  C   C N3    1 
ATOM   7940 C  C4    . C   C 2 31  ? 0.961   40.727  -27.212 1.00 33.02  ? 31  C   C C4    1 
ATOM   7941 N  N4    . C   C 2 31  ? 2.192   40.855  -26.719 1.00 33.71  ? 31  C   C N4    1 
ATOM   7942 C  C5    . C   C 2 31  ? 0.745   40.155  -28.503 1.00 33.40  ? 31  C   C C5    1 
ATOM   7943 C  C6    . C   C 2 31  ? -0.523  40.052  -28.926 1.00 32.39  ? 31  C   C C6    1 
ATOM   7944 P  P     . A   C 2 32  ? -4.265  43.433  -31.976 1.00 28.56  ? 32  A   C P     1 
ATOM   7945 O  OP1   . A   C 2 32  ? -5.331  43.807  -32.922 1.00 28.69  ? 32  A   C OP1   1 
ATOM   7946 O  OP2   . A   C 2 32  ? -2.853  43.480  -32.387 1.00 29.94  ? 32  A   C OP2   1 
ATOM   7947 O  "O5'" . A   C 2 32  ? -4.363  44.333  -30.661 1.00 29.15  ? 32  A   C "O5'" 1 
ATOM   7948 C  "C5'" . A   C 2 32  ? -5.612  44.729  -30.140 1.00 30.36  ? 32  A   C "C5'" 1 
ATOM   7949 C  "C4'" . A   C 2 32  ? -5.383  45.406  -28.817 1.00 32.91  ? 32  A   C "C4'" 1 
ATOM   7950 O  "O4'" . A   C 2 32  ? -4.362  44.670  -28.127 1.00 34.01  ? 32  A   C "O4'" 1 
ATOM   7951 C  "C3'" . A   C 2 32  ? -4.752  46.793  -28.850 1.00 35.20  ? 32  A   C "C3'" 1 
ATOM   7952 O  "O3'" . A   C 2 32  ? -5.735  47.762  -29.151 1.00 35.30  ? 32  A   C "O3'" 1 
ATOM   7953 C  "C2'" . A   C 2 32  ? -4.259  46.921  -27.406 1.00 36.78  ? 32  A   C "C2'" 1 
ATOM   7954 O  "O2'" . A   C 2 32  ? -5.294  47.136  -26.445 1.00 38.48  ? 32  A   C "O2'" 1 
ATOM   7955 C  "C1'" . A   C 2 32  ? -3.773  45.511  -27.155 1.00 34.06  ? 32  A   C "C1'" 1 
ATOM   7956 N  N9    . A   C 2 32  ? -2.341  45.261  -27.125 1.00 34.23  ? 32  A   C N9    1 
ATOM   7957 C  C8    . A   C 2 32  ? -1.521  44.915  -28.153 1.00 33.52  ? 32  A   C C8    1 
ATOM   7958 N  N7    . A   C 2 32  ? -0.288  44.713  -27.758 1.00 34.27  ? 32  A   C N7    1 
ATOM   7959 C  C5    . A   C 2 32  ? -0.304  44.925  -26.390 1.00 34.34  ? 32  A   C C5    1 
ATOM   7960 C  C6    . A   C 2 32  ? 0.674   44.873  -25.375 1.00 35.33  ? 32  A   C C6    1 
ATOM   7961 N  N6    . A   C 2 32  ? 1.957   44.569  -25.579 1.00 36.50  ? 32  A   C N6    1 
ATOM   7962 N  N1    . A   C 2 32  ? 0.291   45.146  -24.106 1.00 36.28  ? 32  A   C N1    1 
ATOM   7963 C  C2    . A   C 2 32  ? -0.982  45.465  -23.856 1.00 34.92  ? 32  A   C C2    1 
ATOM   7964 N  N3    . A   C 2 32  ? -1.977  45.540  -24.723 1.00 34.08  ? 32  A   C N3    1 
ATOM   7965 C  C4    . A   C 2 32  ? -1.573  45.258  -25.980 1.00 34.52  ? 32  A   C C4    1 
ATOM   7966 P  P     . C   C 2 33  ? -5.466  48.818  -30.299 1.00 35.95  ? 33  C   C P     1 
ATOM   7967 O  OP1   . C   C 2 33  ? -6.766  49.323  -30.790 1.00 38.49  ? 33  C   C OP1   1 
ATOM   7968 O  OP2   . C   C 2 33  ? -4.562  48.196  -31.277 1.00 37.74  ? 33  C   C OP2   1 
ATOM   7969 O  "O5'" . C   C 2 33  ? -4.701  49.965  -29.507 1.00 39.31  ? 33  C   C "O5'" 1 
ATOM   7970 C  "C5'" . C   C 2 33  ? -5.230  50.408  -28.236 1.00 42.33  ? 33  C   C "C5'" 1 
ATOM   7971 C  "C4'" . C   C 2 33  ? -4.197  51.161  -27.415 1.00 44.98  ? 33  C   C "C4'" 1 
ATOM   7972 O  "O4'" . C   C 2 33  ? -3.283  50.247  -26.741 1.00 45.13  ? 33  C   C "O4'" 1 
ATOM   7973 C  "C3'" . C   C 2 33  ? -3.290  52.047  -28.264 1.00 46.10  ? 33  C   C "C3'" 1 
ATOM   7974 O  "O3'" . C   C 2 33  ? -3.958  53.269  -28.615 1.00 47.09  ? 33  C   C "O3'" 1 
ATOM   7975 C  "C2'" . C   C 2 33  ? -2.051  52.210  -27.381 1.00 47.18  ? 33  C   C "C2'" 1 
ATOM   7976 O  "O2'" . C   C 2 33  ? -2.165  53.252  -26.427 1.00 48.04  ? 33  C   C "O2'" 1 
ATOM   7977 C  "C1'" . C   C 2 33  ? -1.979  50.835  -26.702 1.00 46.91  ? 33  C   C "C1'" 1 
ATOM   7978 N  N1    . C   C 2 33  ? -0.934  49.902  -27.302 1.00 46.71  ? 33  C   C N1    1 
ATOM   7979 C  C2    . C   C 2 33  ? 0.419   49.977  -26.882 1.00 48.16  ? 33  C   C C2    1 
ATOM   7980 O  O2    . C   C 2 33  ? 0.763   50.809  -26.024 1.00 49.80  ? 33  C   C O2    1 
ATOM   7981 N  N3    . C   C 2 33  ? 1.335   49.122  -27.433 1.00 47.39  ? 33  C   C N3    1 
ATOM   7982 C  C4    . C   C 2 33  ? 0.964   48.234  -28.361 1.00 45.85  ? 33  C   C C4    1 
ATOM   7983 N  N4    . C   C 2 33  ? 1.899   47.429  -28.868 1.00 45.71  ? 33  C   C N4    1 
ATOM   7984 C  C5    . C   C 2 33  ? -0.396  48.140  -28.803 1.00 45.79  ? 33  C   C C5    1 
ATOM   7985 C  C6    . C   C 2 33  ? -1.299  48.977  -28.255 1.00 45.93  ? 33  C   C C6    1 
ATOM   7986 P  P     . C   C 2 34  ? -3.894  53.768  -30.134 1.00 46.87  ? 34  C   C P     1 
ATOM   7987 O  OP1   . C   C 2 34  ? -4.777  54.947  -30.286 1.00 48.51  ? 34  C   C OP1   1 
ATOM   7988 O  OP2   . C   C 2 34  ? -4.045  52.586  -31.027 1.00 44.55  ? 34  C   C OP2   1 
ATOM   7989 O  "O5'" . C   C 2 34  ? -2.377  54.274  -30.187 1.00 48.05  ? 34  C   C "O5'" 1 
ATOM   7990 C  "C5'" . C   C 2 34  ? -2.000  55.307  -31.068 1.00 50.16  ? 34  C   C "C5'" 1 
ATOM   7991 C  "C4'" . C   C 2 34  ? -1.475  54.728  -32.369 1.00 50.16  ? 34  C   C "C4'" 1 
ATOM   7992 O  "O4'" . C   C 2 34  ? -1.045  53.338  -32.238 1.00 48.56  ? 34  C   C "O4'" 1 
ATOM   7993 C  "C3'" . C   C 2 34  ? -2.511  54.738  -33.484 1.00 49.86  ? 34  C   C "C3'" 1 
ATOM   7994 O  "O3'" . C   C 2 34  ? -2.370  55.933  -34.250 1.00 50.26  ? 34  C   C "O3'" 1 
ATOM   7995 C  "C2'" . C   C 2 34  ? -2.165  53.496  -34.310 1.00 48.53  ? 34  C   C "C2'" 1 
ATOM   7996 O  "O2'" . C   C 2 34  ? -1.670  53.847  -35.590 1.00 49.43  ? 34  C   C "O2'" 1 
ATOM   7997 C  "C1'" . C   C 2 34  ? -1.065  52.766  -33.532 1.00 46.84  ? 34  C   C "C1'" 1 
ATOM   7998 N  N1    . C   C 2 34  ? -1.255  51.263  -33.527 1.00 44.89  ? 34  C   C N1    1 
ATOM   7999 C  C2    . C   C 2 34  ? -0.826  50.508  -34.646 1.00 44.66  ? 34  C   C C2    1 
ATOM   8000 O  O2    . C   C 2 34  ? -0.298  51.076  -35.617 1.00 45.97  ? 34  C   C O2    1 
ATOM   8001 N  N3    . C   C 2 34  ? -0.988  49.160  -34.659 1.00 43.12  ? 34  C   C N3    1 
ATOM   8002 C  C4    . C   C 2 34  ? -1.560  48.551  -33.626 1.00 43.02  ? 34  C   C C4    1 
ATOM   8003 N  N4    . C   C 2 34  ? -1.706  47.223  -33.705 1.00 42.26  ? 34  C   C N4    1 
ATOM   8004 C  C5    . C   C 2 34  ? -2.001  49.289  -32.475 1.00 43.66  ? 34  C   C C5    1 
ATOM   8005 C  C6    . C   C 2 34  ? -1.840  50.625  -32.465 1.00 44.42  ? 34  C   C C6    1 
ATOM   8006 O  OP3   . G   D 2 1   ? -48.949 -5.643  -10.051 1.00 77.51  ? 1   G   D OP3   1 
ATOM   8007 P  P     . G   D 2 1   ? -47.760 -5.216  -8.733  0.00 74.81  ? 1   G   D P     1 
ATOM   8008 O  OP1   . G   D 2 1   ? -46.460 -5.462  -9.407  0.00 73.84  ? 1   G   D OP1   1 
ATOM   8009 O  OP2   . G   D 2 1   ? -48.319 -6.276  -7.843  0.00 75.83  ? 1   G   D OP2   1 
ATOM   8010 O  "O5'" . G   D 2 1   ? -47.633 -4.329  -7.656  1.00 59.15  ? 1   G   D "O5'" 1 
ATOM   8011 C  "C5'" . G   D 2 1   ? -47.679 -3.637  -6.417  1.00 55.75  ? 1   G   D "C5'" 1 
ATOM   8012 C  "C4'" . G   D 2 1   ? -46.421 -3.930  -5.628  1.00 52.55  ? 1   G   D "C4'" 1 
ATOM   8013 O  "O4'" . G   D 2 1   ? -46.326 -5.352  -5.365  1.00 51.74  ? 1   G   D "O4'" 1 
ATOM   8014 C  "C3'" . G   D 2 1   ? -45.112 -3.604  -6.335  1.00 49.76  ? 1   G   D "C3'" 1 
ATOM   8015 O  "O3'" . G   D 2 1   ? -44.870 -2.200  -6.344  1.00 48.77  ? 1   G   D "O3'" 1 
ATOM   8016 C  "C2'" . G   D 2 1   ? -44.151 -4.396  -5.449  1.00 48.85  ? 1   G   D "C2'" 1 
ATOM   8017 O  "O2'" . G   D 2 1   ? -43.860 -3.801  -4.198  1.00 47.28  ? 1   G   D "O2'" 1 
ATOM   8018 C  "C1'" . G   D 2 1   ? -44.955 -5.677  -5.227  1.00 51.00  ? 1   G   D "C1'" 1 
ATOM   8019 N  N9    . G   D 2 1   ? -44.586 -6.743  -6.165  1.00 51.76  ? 1   G   D N9    1 
ATOM   8020 C  C8    . G   D 2 1   ? -45.345 -7.259  -7.182  1.00 53.54  ? 1   G   D C8    1 
ATOM   8021 N  N7    . G   D 2 1   ? -44.738 -8.198  -7.853  1.00 54.72  ? 1   G   D N7    1 
ATOM   8022 C  C5    . G   D 2 1   ? -43.493 -8.314  -7.251  1.00 53.19  ? 1   G   D C5    1 
ATOM   8023 C  C6    . G   D 2 1   ? -42.399 -9.173  -7.546  1.00 54.32  ? 1   G   D C6    1 
ATOM   8024 O  O6    . G   D 2 1   ? -42.315 -10.035 -8.439  1.00 56.52  ? 1   G   D O6    1 
ATOM   8025 N  N1    . G   D 2 1   ? -41.317 -8.957  -6.687  1.00 52.66  ? 1   G   D N1    1 
ATOM   8026 C  C2    . G   D 2 1   ? -41.308 -8.033  -5.667  1.00 50.99  ? 1   G   D C2    1 
ATOM   8027 N  N2    . G   D 2 1   ? -40.195 -7.952  -4.924  1.00 50.73  ? 1   G   D N2    1 
ATOM   8028 N  N3    . G   D 2 1   ? -42.327 -7.233  -5.387  1.00 50.58  ? 1   G   D N3    1 
ATOM   8029 C  C4    . G   D 2 1   ? -43.385 -7.422  -6.212  1.00 51.26  ? 1   G   D C4    1 
ATOM   8030 P  P     . G   D 2 2   ? -44.235 -1.474  -7.623  1.00 48.68  ? 2   G   D P     1 
ATOM   8031 O  OP1   . G   D 2 2   ? -44.484 -0.020  -7.493  1.00 46.67  ? 2   G   D OP1   1 
ATOM   8032 O  OP2   . G   D 2 2   ? -44.684 -2.185  -8.833  1.00 50.94  ? 2   G   D OP2   1 
ATOM   8033 O  "O5'" . G   D 2 2   ? -42.674 -1.786  -7.537  1.00 47.83  ? 2   G   D "O5'" 1 
ATOM   8034 C  "C5'" . G   D 2 2   ? -41.903 -1.247  -6.483  1.00 49.33  ? 2   G   D "C5'" 1 
ATOM   8035 C  "C4'" . G   D 2 2   ? -40.649 -2.062  -6.273  1.00 51.33  ? 2   G   D "C4'" 1 
ATOM   8036 O  "O4'" . G   D 2 2   ? -40.989 -3.456  -6.072  1.00 53.97  ? 2   G   D "O4'" 1 
ATOM   8037 C  "C3'" . G   D 2 2   ? -39.695 -2.126  -7.450  1.00 52.46  ? 2   G   D "C3'" 1 
ATOM   8038 O  "O3'" . G   D 2 2   ? -38.980 -0.917  -7.540  1.00 53.00  ? 2   G   D "O3'" 1 
ATOM   8039 C  "C2'" . G   D 2 2   ? -38.839 -3.294  -6.984  1.00 53.86  ? 2   G   D "C2'" 1 
ATOM   8040 O  "O2'" . G   D 2 2   ? -38.028 -2.970  -5.873  1.00 54.12  ? 2   G   D "O2'" 1 
ATOM   8041 C  "C1'" . G   D 2 2   ? -39.925 -4.263  -6.528  1.00 54.73  ? 2   G   D "C1'" 1 
ATOM   8042 N  N9    . G   D 2 2   ? -40.409 -5.166  -7.573  1.00 56.24  ? 2   G   D N9    1 
ATOM   8043 C  C8    . G   D 2 2   ? -41.595 -5.127  -8.277  1.00 56.88  ? 2   G   D C8    1 
ATOM   8044 N  N7    . G   D 2 2   ? -41.720 -6.093  -9.156  1.00 58.64  ? 2   G   D N7    1 
ATOM   8045 C  C5    . G   D 2 2   ? -40.537 -6.823  -9.029  1.00 59.60  ? 2   G   D C5    1 
ATOM   8046 C  C6    . G   D 2 2   ? -40.073 -7.993  -9.705  1.00 61.91  ? 2   G   D C6    1 
ATOM   8047 O  O6    . G   D 2 2   ? -40.621 -8.667  -10.600 1.00 64.05  ? 2   G   D O6    1 
ATOM   8048 N  N1    . G   D 2 2   ? -38.811 -8.381  -9.245  1.00 61.95  ? 2   G   D N1    1 
ATOM   8049 C  C2    . G   D 2 2   ? -38.087 -7.737  -8.266  1.00 60.18  ? 2   G   D C2    1 
ATOM   8050 N  N2    . G   D 2 2   ? -36.895 -8.255  -7.957  1.00 61.52  ? 2   G   D N2    1 
ATOM   8051 N  N3    . G   D 2 2   ? -38.500 -6.653  -7.633  1.00 58.25  ? 2   G   D N3    1 
ATOM   8052 C  C4    . G   D 2 2   ? -39.727 -6.256  -8.057  1.00 58.16  ? 2   G   D C4    1 
ATOM   8053 P  P     . A   D 2 3   ? -38.519 -0.307  -8.945  1.00 54.81  ? 3   A   D P     1 
ATOM   8054 O  OP1   . A   D 2 3   ? -37.944 1.030   -8.648  1.00 54.63  ? 3   A   D OP1   1 
ATOM   8055 O  OP2   . A   D 2 3   ? -39.619 -0.429  -9.931  1.00 54.70  ? 3   A   D OP2   1 
ATOM   8056 O  "O5'" . A   D 2 3   ? -37.335 -1.297  -9.384  1.00 57.93  ? 3   A   D "O5'" 1 
ATOM   8057 C  "C5'" . A   D 2 3   ? -36.091 -1.240  -8.686  1.00 61.24  ? 3   A   D "C5'" 1 
ATOM   8058 C  "C4'" . A   D 2 3   ? -35.227 -2.465  -8.910  1.00 65.29  ? 3   A   D "C4'" 1 
ATOM   8059 O  "O4'" . A   D 2 3   ? -35.927 -3.680  -8.551  1.00 66.40  ? 3   A   D "O4'" 1 
ATOM   8060 C  "C3'" . A   D 2 3   ? -34.802 -2.697  -10.350 1.00 68.45  ? 3   A   D "C3'" 1 
ATOM   8061 O  "O3'" . A   D 2 3   ? -33.714 -1.839  -10.665 1.00 71.45  ? 3   A   D "O3'" 1 
ATOM   8062 C  "C2'" . A   D 2 3   ? -34.403 -4.165  -10.290 1.00 70.31  ? 3   A   D "C2'" 1 
ATOM   8063 O  "O2'" . A   D 2 3   ? -33.157 -4.393  -9.666  1.00 71.69  ? 3   A   D "O2'" 1 
ATOM   8064 C  "C1'" . A   D 2 3   ? -35.521 -4.725  -9.419  1.00 69.08  ? 3   A   D "C1'" 1 
ATOM   8065 N  N9    . A   D 2 3   ? -36.659 -5.184  -10.211 1.00 69.39  ? 3   A   D N9    1 
ATOM   8066 C  C8    . A   D 2 3   ? -37.906 -4.631  -10.283 1.00 68.03  ? 3   A   D C8    1 
ATOM   8067 N  N7    . A   D 2 3   ? -38.724 -5.266  -11.089 1.00 69.57  ? 3   A   D N7    1 
ATOM   8068 C  C5    . A   D 2 3   ? -37.958 -6.307  -11.592 1.00 72.30  ? 3   A   D C5    1 
ATOM   8069 C  C6    . A   D 2 3   ? -38.229 -7.360  -12.506 1.00 75.31  ? 3   A   D C6    1 
ATOM   8070 N  N6    . A   D 2 3   ? -39.410 -7.545  -13.105 1.00 76.35  ? 3   A   D N6    1 
ATOM   8071 N  N1    . A   D 2 3   ? -37.232 -8.230  -12.790 1.00 77.76  ? 3   A   D N1    1 
ATOM   8072 C  C2    . A   D 2 3   ? -36.043 -8.063  -12.194 1.00 77.28  ? 3   A   D C2    1 
ATOM   8073 N  N3    . A   D 2 3   ? -35.672 -7.125  -11.320 1.00 74.66  ? 3   A   D N3    1 
ATOM   8074 C  C4    . A   D 2 3   ? -36.679 -6.269  -11.058 1.00 72.17  ? 3   A   D C4    1 
ATOM   8075 P  P     . A   D 2 4   ? -33.551 -1.204  -12.124 1.00 73.56  ? 4   A   D P     1 
ATOM   8076 O  OP1   . A   D 2 4   ? -32.535 -0.126  -12.030 1.00 73.37  ? 4   A   D OP1   1 
ATOM   8077 O  OP2   . A   D 2 4   ? -34.896 -0.879  -12.657 1.00 71.89  ? 4   A   D OP2   1 
ATOM   8078 O  "O5'" . A   D 2 4   ? -32.972 -2.459  -12.947 1.00 78.16  ? 4   A   D "O5'" 1 
ATOM   8079 C  "C5'" . A   D 2 4   ? -31.653 -2.948  -12.688 1.00 82.38  ? 4   A   D "C5'" 1 
ATOM   8080 C  "C4'" . A   D 2 4   ? -31.406 -4.288  -13.348 1.00 87.45  ? 4   A   D "C4'" 1 
ATOM   8081 O  "O4'" . A   D 2 4   ? -32.410 -5.248  -12.935 1.00 86.54  ? 4   A   D "O4'" 1 
ATOM   8082 C  "C3'" . A   D 2 4   ? -31.539 -4.320  -14.860 1.00 91.40  ? 4   A   D "C3'" 1 
ATOM   8083 O  "O3'" . A   D 2 4   ? -30.400 -3.793  -15.498 1.00 96.77  ? 4   A   D "O3'" 1 
ATOM   8084 C  "C2'" . A   D 2 4   ? -31.665 -5.819  -15.102 1.00 93.74  ? 4   A   D "C2'" 1 
ATOM   8085 O  "O2'" . A   D 2 4   ? -30.443 -6.511  -14.940 1.00 96.62  ? 4   A   D "O2'" 1 
ATOM   8086 C  "C1'" . A   D 2 4   ? -32.636 -6.176  -13.988 1.00 89.87  ? 4   A   D "C1'" 1 
ATOM   8087 N  N9    . A   D 2 4   ? -34.034 -6.106  -14.414 1.00 88.35  ? 4   A   D N9    1 
ATOM   8088 C  C8    . A   D 2 4   ? -34.948 -5.149  -14.071 1.00 84.83  ? 4   A   D C8    1 
ATOM   8089 N  N7    . A   D 2 4   ? -36.136 -5.333  -14.590 1.00 84.85  ? 4   A   D N7    1 
ATOM   8090 C  C5    . A   D 2 4   ? -35.997 -6.490  -15.329 1.00 88.76  ? 4   A   D C5    1 
ATOM   8091 C  C6    . A   D 2 4   ? -36.907 -7.218  -16.123 1.00 91.59  ? 4   A   D C6    1 
ATOM   8092 N  N6    . A   D 2 4   ? -38.175 -6.833  -16.291 1.00 90.51  ? 4   A   D N6    1 
ATOM   8093 N  N1    . A   D 2 4   ? -36.461 -8.341  -16.741 1.00 95.79  ? 4   A   D N1    1 
ATOM   8094 C  C2    . A   D 2 4   ? -35.181 -8.704  -16.567 1.00 97.27  ? 4   A   D C2    1 
ATOM   8095 N  N3    . A   D 2 4   ? -34.234 -8.101  -15.839 1.00 95.36  ? 4   A   D N3    1 
ATOM   8096 C  C4    . A   D 2 4   ? -34.707 -6.986  -15.238 1.00 91.11  ? 4   A   D C4    1 
ATOM   8097 P  P     . G   D 2 5   ? -30.558 -3.086  -16.929 1.00 100.43 ? 5   G   D P     1 
ATOM   8098 O  OP1   . G   D 2 5   ? -29.189 -2.776  -17.394 1.00 104.43 ? 5   G   D OP1   1 
ATOM   8099 O  OP2   . G   D 2 5   ? -31.543 -1.989  -16.775 1.00 95.62  ? 5   G   D OP2   1 
ATOM   8100 O  "O5'" . G   D 2 5   ? -31.183 -4.210  -17.895 1.00 104.74 ? 5   G   D "O5'" 1 
ATOM   8101 C  "C5'" . G   D 2 5   ? -30.328 -5.163  -18.523 1.00 112.62 ? 5   G   D "C5'" 1 
ATOM   8102 C  "C4'" . G   D 2 5   ? -31.099 -6.249  -19.255 1.00 117.55 ? 5   G   D "C4'" 1 
ATOM   8103 O  "O4'" . G   D 2 5   ? -32.218 -6.727  -18.466 1.00 114.99 ? 5   G   D "O4'" 1 
ATOM   8104 C  "C3'" . G   D 2 5   ? -31.766 -5.844  -20.561 1.00 120.56 ? 5   G   D "C3'" 1 
ATOM   8105 O  "O3'" . G   D 2 5   ? -30.819 -5.710  -21.619 1.00 126.36 ? 5   G   D "O3'" 1 
ATOM   8106 C  "C2'" . G   D 2 5   ? -32.696 -7.038  -20.764 1.00 122.94 ? 5   G   D "C2'" 1 
ATOM   8107 O  "O2'" . G   D 2 5   ? -32.042 -8.209  -21.222 1.00 129.21 ? 5   G   D "O2'" 1 
ATOM   8108 C  "C1'" . G   D 2 5   ? -33.206 -7.252  -19.342 1.00 117.98 ? 5   G   D "C1'" 1 
ATOM   8109 N  N9    . G   D 2 5   ? -34.489 -6.594  -19.097 1.00 114.08 ? 5   G   D N9    1 
ATOM   8110 C  C8    . G   D 2 5   ? -34.730 -5.543  -18.243 1.00 109.06 ? 5   G   D C8    1 
ATOM   8111 N  N7    . G   D 2 5   ? -35.975 -5.155  -18.226 1.00 106.91 ? 5   G   D N7    1 
ATOM   8112 C  C5    . G   D 2 5   ? -36.605 -6.000  -19.132 1.00 110.96 ? 5   G   D C5    1 
ATOM   8113 C  C6    . G   D 2 5   ? -37.964 -6.059  -19.536 1.00 111.57 ? 5   G   D C6    1 
ATOM   8114 O  O6    . G   D 2 5   ? -38.905 -5.348  -19.159 1.00 108.58 ? 5   G   D O6    1 
ATOM   8115 N  N1    . G   D 2 5   ? -38.194 -7.061  -20.480 1.00 116.98 ? 5   G   D N1    1 
ATOM   8116 C  C2    . G   D 2 5   ? -37.222 -7.904  -20.972 1.00 121.43 ? 5   G   D C2    1 
ATOM   8117 N  N2    . G   D 2 5   ? -37.620 -8.815  -21.875 1.00 127.04 ? 5   G   D N2    1 
ATOM   8118 N  N3    . G   D 2 5   ? -35.947 -7.860  -20.597 1.00 120.89 ? 5   G   D N3    1 
ATOM   8119 C  C4    . G   D 2 5   ? -35.705 -6.891  -19.677 1.00 115.37 ? 5   G   D C4    1 
ATOM   8120 P  P     . U   D 2 6   ? -31.090 -4.723  -22.856 1.00 128.22 ? 6   U   D P     1 
ATOM   8121 O  OP1   . U   D 2 6   ? -29.821 -4.617  -23.606 1.00 133.71 ? 6   U   D OP1   1 
ATOM   8122 O  OP2   . U   D 2 6   ? -31.732 -3.483  -22.359 1.00 122.17 ? 6   U   D OP2   1 
ATOM   8123 O  "O5'" . U   D 2 6   ? -32.172 -5.523  -23.726 1.00 131.80 ? 6   U   D "O5'" 1 
ATOM   8124 C  "C5'" . U   D 2 6   ? -31.782 -6.444  -24.742 1.00 139.50 ? 6   U   D "C5'" 1 
ATOM   8125 C  "C4'" . U   D 2 6   ? -32.989 -6.992  -25.483 1.00 142.76 ? 6   U   D "C4'" 1 
ATOM   8126 O  "O4'" . U   D 2 6   ? -33.959 -7.520  -24.537 1.00 138.83 ? 6   U   D "O4'" 1 
ATOM   8127 C  "C3'" . U   D 2 6   ? -33.809 -5.992  -26.291 1.00 142.55 ? 6   U   D "C3'" 1 
ATOM   8128 O  "O3'" . U   D 2 6   ? -33.198 -5.653  -27.535 1.00 148.10 ? 6   U   D "O3'" 1 
ATOM   8129 C  "C2'" . U   D 2 6   ? -35.096 -6.795  -26.460 1.00 144.54 ? 6   U   D "C2'" 1 
ATOM   8130 O  "O2'" . U   D 2 6   ? -34.974 -7.877  -27.370 1.00 152.64 ? 6   U   D "O2'" 1 
ATOM   8131 C  "C1'" . U   D 2 6   ? -35.275 -7.303  -25.030 1.00 139.23 ? 6   U   D "C1'" 1 
ATOM   8132 N  N1    . U   D 2 6   ? -36.031 -6.336  -24.138 1.00 132.20 ? 6   U   D N1    1 
ATOM   8133 C  C2    . U   D 2 6   ? -37.400 -6.152  -24.308 1.00 131.65 ? 6   U   D C2    1 
ATOM   8134 O  O2    . U   D 2 6   ? -38.075 -6.730  -25.145 1.00 136.66 ? 6   U   D O2    1 
ATOM   8135 N  N3    . U   D 2 6   ? -37.972 -5.245  -23.442 1.00 125.42 ? 6   U   D N3    1 
ATOM   8136 C  C4    . U   D 2 6   ? -37.335 -4.517  -22.449 1.00 119.81 ? 6   U   D C4    1 
ATOM   8137 O  O4    . U   D 2 6   ? -37.981 -3.744  -21.754 1.00 115.34 ? 6   U   D O4    1 
ATOM   8138 C  C5    . U   D 2 6   ? -35.920 -4.753  -22.328 1.00 120.90 ? 6   U   D C5    1 
ATOM   8139 C  C6    . U   D 2 6   ? -35.342 -5.632  -23.157 1.00 126.95 ? 6   U   D C6    1 
ATOM   8140 P  P     . A   D 2 7   ? -33.520 -4.257  -28.259 1.00 146.87 ? 7   A   D P     1 
ATOM   8141 O  OP1   . A   D 2 7   ? -32.583 -4.137  -29.398 1.00 153.93 ? 7   A   D OP1   1 
ATOM   8142 O  OP2   . A   D 2 7   ? -33.566 -3.176  -27.250 1.00 138.63 ? 7   A   D OP2   1 
ATOM   8143 O  "O5'" . A   D 2 7   ? -35.009 -4.463  -28.816 1.00 148.67 ? 7   A   D "O5'" 1 
ATOM   8144 C  "C5'" . A   D 2 7   ? -35.262 -5.197  -30.020 1.00 157.15 ? 7   A   D "C5'" 1 
ATOM   8145 C  "C4'" . A   D 2 7   ? -36.752 -5.417  -30.237 1.00 157.99 ? 7   A   D "C4'" 1 
ATOM   8146 O  "O4'" . A   D 2 7   ? -37.358 -5.937  -29.020 1.00 153.03 ? 7   A   D "O4'" 1 
ATOM   8147 C  "C3'" . A   D 2 7   ? -37.581 -4.171  -30.534 1.00 155.15 ? 7   A   D "C3'" 1 
ATOM   8148 O  "O3'" . A   D 2 7   ? -37.485 -3.731  -31.894 1.00 160.59 ? 7   A   D "O3'" 1 
ATOM   8149 C  "C2'" . A   D 2 7   ? -38.974 -4.668  -30.150 1.00 154.58 ? 7   A   D "C2'" 1 
ATOM   8150 O  "O2'" . A   D 2 7   ? -39.519 -5.600  -31.065 1.00 162.81 ? 7   A   D "O2'" 1 
ATOM   8151 C  "C1'" . A   D 2 7   ? -38.645 -5.363  -28.831 1.00 149.96 ? 7   A   D "C1'" 1 
ATOM   8152 N  N9    . A   D 2 7   ? -38.653 -4.449  -27.679 1.00 141.45 ? 7   A   D N9    1 
ATOM   8153 C  C8    . A   D 2 7   ? -37.579 -3.808  -27.116 1.00 137.21 ? 7   A   D C8    1 
ATOM   8154 N  N7    . A   D 2 7   ? -37.879 -3.041  -26.095 1.00 130.56 ? 7   A   D N7    1 
ATOM   8155 C  C5    . A   D 2 7   ? -39.250 -3.184  -25.976 1.00 130.12 ? 7   A   D C5    1 
ATOM   8156 C  C6    . A   D 2 7   ? -40.183 -2.627  -25.077 1.00 124.82 ? 7   A   D C6    1 
ATOM   8157 N  N6    . A   D 2 7   ? -39.829 -1.781  -24.106 1.00 118.81 ? 7   A   D N6    1 
ATOM   8158 N  N1    . A   D 2 7   ? -41.487 -2.964  -25.220 1.00 126.73 ? 7   A   D N1    1 
ATOM   8159 C  C2    . A   D 2 7   ? -41.830 -3.810  -26.205 1.00 133.50 ? 7   A   D C2    1 
ATOM   8160 N  N3    . A   D 2 7   ? -41.040 -4.402  -27.107 1.00 138.93 ? 7   A   D N3    1 
ATOM   8161 C  C4    . A   D 2 7   ? -39.749 -4.045  -26.942 1.00 136.83 ? 7   A   D C4    1 
ATOM   8162 P  P     . G   D 2 8   ? -37.248 -2.178  -32.251 1.00 157.26 ? 8   G   D P     1 
ATOM   8163 O  OP1   . G   D 2 8   ? -37.905 -1.952  -33.559 1.00 164.21 ? 8   G   D OP1   1 
ATOM   8164 O  OP2   . G   D 2 8   ? -35.802 -1.897  -32.103 1.00 156.28 ? 8   G   D OP2   1 
ATOM   8165 O  "O5'" . G   D 2 8   ? -37.997 -1.336  -31.099 1.00 147.09 ? 8   G   D "O5'" 1 
ATOM   8166 C  "C5'" . G   D 2 8   ? -38.890 -0.247  -31.376 1.00 143.51 ? 8   G   D "C5'" 1 
ATOM   8167 C  "C4'" . G   D 2 8   ? -40.333 -0.727  -31.431 1.00 144.18 ? 8   G   D "C4'" 1 
ATOM   8168 O  "O4'" . G   D 2 8   ? -40.572 -1.722  -30.396 1.00 141.18 ? 8   G   D "O4'" 1 
ATOM   8169 C  "C3'" . G   D 2 8   ? -41.398 0.326   -31.158 1.00 139.36 ? 8   G   D "C3'" 1 
ATOM   8170 O  "O3'" . G   D 2 8   ? -41.741 1.076   -32.308 1.00 142.25 ? 8   G   D "O3'" 1 
ATOM   8171 C  "C2'" . G   D 2 8   ? -42.563 -0.533  -30.680 1.00 140.09 ? 8   G   D "C2'" 1 
ATOM   8172 O  "O2'" . G   D 2 8   ? -43.213 -1.248  -31.711 1.00 147.98 ? 8   G   D "O2'" 1 
ATOM   8173 C  "C1'" . G   D 2 8   ? -41.808 -1.474  -29.753 1.00 137.51 ? 8   G   D "C1'" 1 
ATOM   8174 N  N9    . G   D 2 8   ? -41.565 -0.867  -28.442 1.00 129.22 ? 8   G   D N9    1 
ATOM   8175 C  C8    . G   D 2 8   ? -40.348 -0.576  -27.870 1.00 125.18 ? 8   G   D C8    1 
ATOM   8176 N  N7    . G   D 2 8   ? -40.443 -0.028  -26.690 1.00 118.79 ? 8   G   D N7    1 
ATOM   8177 C  C5    . G   D 2 8   ? -41.811 0.053   -26.463 1.00 118.27 ? 8   G   D C5    1 
ATOM   8178 C  C6    . G   D 2 8   ? -42.525 0.558   -25.347 1.00 112.92 ? 8   G   D C6    1 
ATOM   8179 O  O6    . G   D 2 8   ? -42.069 1.048   -24.308 1.00 107.46 ? 8   G   D O6    1 
ATOM   8180 N  N1    . G   D 2 8   ? -43.908 0.459   -25.520 1.00 115.32 ? 8   G   D N1    1 
ATOM   8181 C  C2    . G   D 2 8   ? -44.526 -0.069  -26.633 1.00 121.90 ? 8   G   D C2    1 
ATOM   8182 N  N2    . G   D 2 8   ? -45.866 -0.089  -26.628 1.00 123.87 ? 8   G   D N2    1 
ATOM   8183 N  N3    . G   D 2 8   ? -43.868 -0.549  -27.681 1.00 126.86 ? 8   G   D N3    1 
ATOM   8184 C  C4    . G   D 2 8   ? -42.518 -0.457  -27.533 1.00 124.68 ? 8   G   D C4    1 
ATOM   8185 P  P     . A   D 2 9   ? -42.010 2.646   -32.145 1.00 136.19 ? 9   A   D P     1 
ATOM   8186 O  OP1   . A   D 2 9   ? -41.057 3.322   -33.047 1.00 138.76 ? 9   A   D OP1   1 
ATOM   8187 O  OP2   . A   D 2 9   ? -42.001 2.996   -30.706 1.00 127.89 ? 9   A   D OP2   1 
ATOM   8188 O  "O5'" . A   D 2 9   ? -43.493 2.863   -32.717 1.00 139.20 ? 9   A   D "O5'" 1 
ATOM   8189 C  "C5'" . A   D 2 9   ? -44.594 2.040   -32.324 1.00 138.95 ? 9   A   D "C5'" 1 
ATOM   8190 C  "C4'" . A   D 2 9   ? -45.513 2.699   -31.302 1.00 132.02 ? 9   A   D "C4'" 1 
ATOM   8191 O  "O4'" . A   D 2 9   ? -45.414 2.011   -30.027 1.00 126.91 ? 9   A   D "O4'" 1 
ATOM   8192 C  "C3'" . A   D 2 9   ? -45.210 4.129   -30.888 1.00 125.18 ? 9   A   D "C3'" 1 
ATOM   8193 O  "O3'" . A   D 2 9   ? -45.541 5.080   -31.887 1.00 127.34 ? 9   A   D "O3'" 1 
ATOM   8194 C  "C2'" . A   D 2 9   ? -46.065 4.247   -29.627 1.00 120.00 ? 9   A   D "C2'" 1 
ATOM   8195 O  "O2'" . A   D 2 9   ? -47.445 4.449   -29.863 1.00 123.05 ? 9   A   D "O2'" 1 
ATOM   8196 C  "C1'" . A   D 2 9   ? -45.778 2.895   -28.981 1.00 119.47 ? 9   A   D "C1'" 1 
ATOM   8197 N  N9    . A   D 2 9   ? -44.660 3.078   -28.074 1.00 113.16 ? 9   A   D N9    1 
ATOM   8198 C  C8    . A   D 2 9   ? -43.341 2.803   -28.300 1.00 113.01 ? 9   A   D C8    1 
ATOM   8199 N  N7    . A   D 2 9   ? -42.556 3.110   -27.296 1.00 107.47 ? 9   A   D N7    1 
ATOM   8200 C  C5    . A   D 2 9   ? -43.424 3.629   -26.351 1.00 103.22 ? 9   A   D C5    1 
ATOM   8201 C  C6    . A   D 2 9   ? -43.222 4.140   -25.057 1.00 97.07  ? 9   A   D C6    1 
ATOM   8202 N  N6    . A   D 2 9   ? -42.019 4.206   -24.478 1.00 93.74  ? 9   A   D N6    1 
ATOM   8203 N  N1    . A   D 2 9   ? -44.309 4.580   -24.383 1.00 95.34  ? 9   A   D N1    1 
ATOM   8204 C  C2    . A   D 2 9   ? -45.517 4.514   -24.961 1.00 99.13  ? 9   A   D C2    1 
ATOM   8205 N  N3    . A   D 2 9   ? -45.828 4.054   -26.171 1.00 105.02 ? 9   A   D N3    1 
ATOM   8206 C  C4    . A   D 2 9   ? -44.727 3.623   -26.816 1.00 106.91 ? 9   A   D C4    1 
ATOM   8207 P  P     . U   D 2 10  ? -44.917 6.550   -31.755 1.00 121.42 ? 10  U   D P     1 
ATOM   8208 O  OP1   . U   D 2 10  ? -44.525 7.003   -33.109 1.00 126.62 ? 10  U   D OP1   1 
ATOM   8209 O  OP2   . U   D 2 10  ? -43.918 6.546   -30.658 1.00 114.16 ? 10  U   D OP2   1 
ATOM   8210 O  "O5'" . U   D 2 10  ? -46.192 7.390   -31.290 1.00 118.66 ? 10  U   D "O5'" 1 
ATOM   8211 C  "C5'" . U   D 2 10  ? -46.061 8.362   -30.286 1.00 110.31 ? 10  U   D "C5'" 1 
ATOM   8212 C  "C4'" . U   D 2 10  ? -47.106 8.173   -29.207 1.00 107.12 ? 10  U   D "C4'" 1 
ATOM   8213 O  "O4'" . U   D 2 10  ? -46.807 7.024   -28.374 1.00 104.45 ? 10  U   D "O4'" 1 
ATOM   8214 C  "C3'" . U   D 2 10  ? -47.120 9.354   -28.263 1.00 100.87 ? 10  U   D "C3'" 1 
ATOM   8215 O  "O3'" . U   D 2 10  ? -48.075 10.271  -28.724 1.00 103.09 ? 10  U   D "O3'" 1 
ATOM   8216 C  "C2'" . U   D 2 10  ? -47.449 8.766   -26.898 1.00 96.94  ? 10  U   D "C2'" 1 
ATOM   8217 O  "O2'" . U   D 2 10  ? -48.828 8.675   -26.605 1.00 99.32  ? 10  U   D "O2'" 1 
ATOM   8218 C  "C1'" . U   D 2 10  ? -46.779 7.398   -27.005 1.00 97.94  ? 10  U   D "C1'" 1 
ATOM   8219 N  N1    . U   D 2 10  ? -45.363 7.461   -26.507 1.00 93.14  ? 10  U   D N1    1 
ATOM   8220 C  C2    . U   D 2 10  ? -45.114 7.947   -25.226 1.00 87.61  ? 10  U   D C2    1 
ATOM   8221 O  O2    . U   D 2 10  ? -45.972 8.330   -24.443 1.00 85.91  ? 10  U   D O2    1 
ATOM   8222 N  N3    . U   D 2 10  ? -43.789 7.971   -24.872 1.00 84.33  ? 10  U   D N3    1 
ATOM   8223 C  C4    . U   D 2 10  ? -42.713 7.569   -25.641 1.00 86.48  ? 10  U   D C4    1 
ATOM   8224 O  O4    . U   D 2 10  ? -41.587 7.659   -25.166 1.00 83.91  ? 10  U   D O4    1 
ATOM   8225 C  C5    . U   D 2 10  ? -43.040 7.079   -26.960 1.00 91.91  ? 10  U   D C5    1 
ATOM   8226 C  C6    . U   D 2 10  ? -44.326 7.047   -27.330 1.00 94.98  ? 10  U   D C6    1 
ATOM   8227 P  P     . G   D 2 11  ? -47.552 11.687  -29.238 1.00 101.86 ? 11  G   D P     1 
ATOM   8228 O  OP1   . G   D 2 11  ? -48.462 12.140  -30.318 1.00 107.87 ? 11  G   D OP1   1 
ATOM   8229 O  OP2   . G   D 2 11  ? -46.094 11.619  -29.494 1.00 99.94  ? 11  G   D OP2   1 
ATOM   8230 O  "O5'" . G   D 2 11  ? -47.769 12.588  -27.938 1.00 95.55  ? 11  G   D "O5'" 1 
ATOM   8231 C  "C5'" . G   D 2 11  ? -49.006 12.532  -27.234 1.00 94.79  ? 11  G   D "C5'" 1 
ATOM   8232 C  "C4'" . G   D 2 11  ? -48.777 12.823  -25.766 1.00 88.49  ? 11  G   D "C4'" 1 
ATOM   8233 O  "O4'" . G   D 2 11  ? -48.026 11.742  -25.154 1.00 85.74  ? 11  G   D "O4'" 1 
ATOM   8234 C  "C3'" . G   D 2 11  ? -47.911 14.030  -25.462 1.00 83.41  ? 11  G   D "C3'" 1 
ATOM   8235 O  "O3'" . G   D 2 11  ? -48.612 15.245  -25.622 1.00 84.44  ? 11  G   D "O3'" 1 
ATOM   8236 C  "C2'" . G   D 2 11  ? -47.583 13.762  -24.006 1.00 78.73  ? 11  G   D "C2'" 1 
ATOM   8237 O  "O2'" . G   D 2 11  ? -48.653 14.081  -23.137 1.00 78.91  ? 11  G   D "O2'" 1 
ATOM   8238 C  "C1'" . G   D 2 11  ? -47.299 12.261  -24.058 1.00 79.33  ? 11  G   D "C1'" 1 
ATOM   8239 N  N9    . G   D 2 11  ? -45.870 11.994  -24.229 1.00 77.14  ? 11  G   D N9    1 
ATOM   8240 C  C8    . G   D 2 11  ? -45.222 11.452  -25.318 1.00 79.34  ? 11  G   D C8    1 
ATOM   8241 N  N7    . G   D 2 11  ? -43.929 11.358  -25.153 1.00 77.01  ? 11  G   D N7    1 
ATOM   8242 C  C5    . G   D 2 11  ? -43.702 11.873  -23.873 1.00 72.88  ? 11  G   D C5    1 
ATOM   8243 C  C6    . G   D 2 11  ? -42.506 12.037  -23.117 1.00 69.29  ? 11  G   D C6    1 
ATOM   8244 O  O6    . G   D 2 11  ? -41.345 11.753  -23.435 1.00 69.43  ? 11  G   D O6    1 
ATOM   8245 N  N1    . G   D 2 11  ? -42.726 12.600  -21.859 1.00 66.25  ? 11  G   D N1    1 
ATOM   8246 C  C2    . G   D 2 11  ? -43.955 12.970  -21.375 1.00 66.25  ? 11  G   D C2    1 
ATOM   8247 N  N2    . G   D 2 11  ? -43.982 13.494  -20.144 1.00 63.75  ? 11  G   D N2    1 
ATOM   8248 N  N3    . G   D 2 11  ? -45.079 12.824  -22.061 1.00 69.58  ? 11  G   D N3    1 
ATOM   8249 C  C4    . G   D 2 11  ? -44.888 12.272  -23.295 1.00 72.82  ? 11  G   D C4    1 
ATOM   8250 P  P     . G   D 2 12  ? -47.769 16.545  -26.024 1.00 83.09  ? 12  G   D P     1 
ATOM   8251 O  OP1   . G   D 2 12  ? -48.703 17.654  -26.311 1.00 85.70  ? 12  G   D OP1   1 
ATOM   8252 O  OP2   . G   D 2 12  ? -46.756 16.161  -27.032 1.00 84.35  ? 12  G   D OP2   1 
ATOM   8253 O  "O5'" . G   D 2 12  ? -46.995 16.898  -24.674 1.00 77.21  ? 12  G   D "O5'" 1 
ATOM   8254 C  "C5'" . G   D 2 12  ? -47.729 17.333  -23.540 1.00 74.69  ? 12  G   D "C5'" 1 
ATOM   8255 C  "C4'" . G   D 2 12  ? -46.794 17.491  -22.364 1.00 69.45  ? 12  G   D "C4'" 1 
ATOM   8256 O  "O4'" . G   D 2 12  ? -46.084 16.254  -22.113 1.00 67.26  ? 12  G   D "O4'" 1 
ATOM   8257 C  "C3'" . G   D 2 12  ? -45.680 18.496  -22.574 1.00 67.07  ? 12  G   D "C3'" 1 
ATOM   8258 O  "O3'" . G   D 2 12  ? -46.180 19.803  -22.377 1.00 68.01  ? 12  G   D "O3'" 1 
ATOM   8259 C  "C2'" . G   D 2 12  ? -44.719 18.059  -21.475 1.00 63.25  ? 12  G   D "C2'" 1 
ATOM   8260 O  "O2'" . G   D 2 12  ? -45.160 18.397  -20.172 1.00 63.00  ? 12  G   D "O2'" 1 
ATOM   8261 C  "C1'" . G   D 2 12  ? -44.779 16.554  -21.652 1.00 62.44  ? 12  G   D "C1'" 1 
ATOM   8262 N  N9    . G   D 2 12  ? -43.802 16.048  -22.606 1.00 62.26  ? 12  G   D N9    1 
ATOM   8263 C  C8    . G   D 2 12  ? -44.048 15.609  -23.885 1.00 65.34  ? 12  G   D C8    1 
ATOM   8264 N  N7    . G   D 2 12  ? -42.981 15.202  -24.505 1.00 65.53  ? 12  G   D N7    1 
ATOM   8265 C  C5    . G   D 2 12  ? -41.968 15.378  -23.576 1.00 62.10  ? 12  G   D C5    1 
ATOM   8266 C  C6    . G   D 2 12  ? -40.586 15.107  -23.686 1.00 61.82  ? 12  G   D C6    1 
ATOM   8267 O  O6    . G   D 2 12  ? -39.995 14.648  -24.671 1.00 64.45  ? 12  G   D O6    1 
ATOM   8268 N  N1    . G   D 2 12  ? -39.884 15.424  -22.518 1.00 58.90  ? 12  G   D N1    1 
ATOM   8269 C  C2    . G   D 2 12  ? -40.457 15.951  -21.378 1.00 56.77  ? 12  G   D C2    1 
ATOM   8270 N  N2    . G   D 2 12  ? -39.632 16.201  -20.349 1.00 54.49  ? 12  G   D N2    1 
ATOM   8271 N  N3    . G   D 2 12  ? -41.761 16.208  -21.267 1.00 57.37  ? 12  G   D N3    1 
ATOM   8272 C  C4    . G   D 2 12  ? -42.452 15.898  -22.399 1.00 59.88  ? 12  G   D C4    1 
ATOM   8273 P  P     . U   D 2 13  ? -45.422 21.044  -23.038 1.00 68.54  ? 13  U   D P     1 
ATOM   8274 O  OP1   . U   D 2 13  ? -46.168 22.266  -22.654 1.00 69.73  ? 13  U   D OP1   1 
ATOM   8275 O  OP2   . U   D 2 13  ? -45.175 20.744  -24.468 1.00 69.91  ? 13  U   D OP2   1 
ATOM   8276 O  "O5'" . U   D 2 13  ? -44.006 21.042  -22.284 1.00 64.14  ? 13  U   D "O5'" 1 
ATOM   8277 C  "C5'" . U   D 2 13  ? -43.884 21.381  -20.894 1.00 60.42  ? 13  U   D "C5'" 1 
ATOM   8278 C  "C4'" . U   D 2 13  ? -42.433 21.300  -20.463 1.00 56.61  ? 13  U   D "C4'" 1 
ATOM   8279 O  "O4'" . U   D 2 13  ? -41.962 19.943  -20.676 1.00 56.12  ? 13  U   D "O4'" 1 
ATOM   8280 C  "C3'" . U   D 2 13  ? -41.468 22.133  -21.298 1.00 55.42  ? 13  U   D "C3'" 1 
ATOM   8281 O  "O3'" . U   D 2 13  ? -41.428 23.497  -20.919 1.00 53.08  ? 13  U   D "O3'" 1 
ATOM   8282 C  "C2'" . U   D 2 13  ? -40.142 21.417  -21.071 1.00 54.51  ? 13  U   D "C2'" 1 
ATOM   8283 O  "O2'" . U   D 2 13  ? -39.557 21.724  -19.819 1.00 52.69  ? 13  U   D "O2'" 1 
ATOM   8284 C  "C1'" . U   D 2 13  ? -40.615 19.964  -21.139 1.00 55.45  ? 13  U   D "C1'" 1 
ATOM   8285 N  N1    . U   D 2 13  ? -40.504 19.348  -22.525 1.00 57.51  ? 13  U   D N1    1 
ATOM   8286 C  C2    . U   D 2 13  ? -39.260 18.933  -22.999 1.00 58.00  ? 13  U   D C2    1 
ATOM   8287 O  O2    . U   D 2 13  ? -38.218 19.035  -22.363 1.00 56.58  ? 13  U   D O2    1 
ATOM   8288 N  N3    . U   D 2 13  ? -39.276 18.385  -24.269 1.00 60.07  ? 13  U   D N3    1 
ATOM   8289 C  C4    . U   D 2 13  ? -40.383 18.218  -25.088 1.00 62.67  ? 13  U   D C4    1 
ATOM   8290 O  O4    . U   D 2 13  ? -40.251 17.716  -26.199 1.00 66.00  ? 13  U   D O4    1 
ATOM   8291 C  C5    . U   D 2 13  ? -41.635 18.670  -24.533 1.00 61.97  ? 13  U   D C5    1 
ATOM   8292 C  C6    . U   D 2 13  ? -41.645 19.203  -23.305 1.00 59.27  ? 13  U   D C6    1 
ATOM   8293 P  P     . U   D 2 14  ? -41.372 24.591  -22.093 1.00 53.79  ? 14  U   D P     1 
ATOM   8294 O  OP1   . U   D 2 14  ? -41.352 25.945  -21.479 1.00 53.92  ? 14  U   D OP1   1 
ATOM   8295 O  OP2   . U   D 2 14  ? -42.405 24.233  -23.097 1.00 54.79  ? 14  U   D OP2   1 
ATOM   8296 O  "O5'" . U   D 2 14  ? -39.950 24.331  -22.782 1.00 51.64  ? 14  U   D "O5'" 1 
ATOM   8297 C  "C5'" . U   D 2 14  ? -38.711 24.597  -22.125 1.00 47.37  ? 14  U   D "C5'" 1 
ATOM   8298 C  "C4'" . U   D 2 14  ? -37.560 24.211  -23.036 1.00 45.52  ? 14  U   D "C4'" 1 
ATOM   8299 O  "O4'" . U   D 2 14  ? -37.652 22.805  -23.369 1.00 45.55  ? 14  U   D "O4'" 1 
ATOM   8300 C  "C3'" . U   D 2 14  ? -37.571 24.894  -24.389 1.00 46.02  ? 14  U   D "C3'" 1 
ATOM   8301 O  "O3'" . U   D 2 14  ? -37.019 26.224  -24.322 1.00 43.76  ? 14  U   D "O3'" 1 
ATOM   8302 C  "C2'" . U   D 2 14  ? -36.731 23.925  -25.211 1.00 47.82  ? 14  U   D "C2'" 1 
ATOM   8303 O  "O2'" . U   D 2 14  ? -35.345 24.085  -24.992 1.00 48.86  ? 14  U   D "O2'" 1 
ATOM   8304 C  "C1'" . U   D 2 14  ? -37.195 22.575  -24.681 1.00 47.36  ? 14  U   D "C1'" 1 
ATOM   8305 N  N1    . U   D 2 14  ? -38.299 21.985  -25.509 1.00 50.02  ? 14  U   D N1    1 
ATOM   8306 C  C2    . U   D 2 14  ? -37.991 21.241  -26.640 1.00 52.86  ? 14  U   D C2    1 
ATOM   8307 O  O2    . U   D 2 14  ? -36.857 21.014  -27.023 1.00 53.81  ? 14  U   D O2    1 
ATOM   8308 N  N3    . U   D 2 14  ? -39.078 20.757  -27.330 1.00 54.80  ? 14  U   D N3    1 
ATOM   8309 C  C4    . U   D 2 14  ? -40.412 20.934  -27.024 1.00 54.10  ? 14  U   D C4    1 
ATOM   8310 O  O4    . U   D 2 14  ? -41.266 20.439  -27.745 1.00 57.54  ? 14  U   D O4    1 
ATOM   8311 C  C5    . U   D 2 14  ? -40.666 21.714  -25.846 1.00 51.34  ? 14  U   D C5    1 
ATOM   8312 C  C6    . U   D 2 14  ? -39.625 22.188  -25.150 1.00 49.95  ? 14  U   D C6    1 
ATOM   8313 P  P     . C   D 2 15  ? -37.709 27.352  -25.222 1.00 42.12  ? 15  C   D P     1 
ATOM   8314 O  OP1   . C   D 2 15  ? -37.159 28.668  -24.841 1.00 41.97  ? 15  C   D OP1   1 
ATOM   8315 O  OP2   . C   D 2 15  ? -39.171 27.118  -25.187 1.00 43.27  ? 15  C   D OP2   1 
ATOM   8316 O  "O5'" . C   D 2 15  ? -37.209 26.951  -26.683 1.00 44.15  ? 15  C   D "O5'" 1 
ATOM   8317 C  "C5'" . C   D 2 15  ? -37.523 27.742  -27.821 1.00 46.53  ? 15  C   D "C5'" 1 
ATOM   8318 C  "C4'" . C   D 2 15  ? -36.811 27.209  -29.053 1.00 49.81  ? 15  C   D "C4'" 1 
ATOM   8319 O  "O4'" . C   D 2 15  ? -35.404 27.607  -29.065 1.00 49.40  ? 15  C   D "O4'" 1 
ATOM   8320 C  "C3'" . C   D 2 15  ? -36.787 25.692  -29.175 1.00 50.80  ? 15  C   D "C3'" 1 
ATOM   8321 O  "O3'" . C   D 2 15  ? -38.030 25.212  -29.691 1.00 54.46  ? 15  C   D "O3'" 1 
ATOM   8322 C  "C2'" . C   D 2 15  ? -35.633 25.515  -30.158 1.00 53.41  ? 15  C   D "C2'" 1 
ATOM   8323 O  "O2'" . C   D 2 15  ? -36.022 25.695  -31.506 1.00 56.45  ? 15  C   D "O2'" 1 
ATOM   8324 C  "C1'" . C   D 2 15  ? -34.651 26.613  -29.747 1.00 51.74  ? 15  C   D "C1'" 1 
ATOM   8325 N  N1    . C   D 2 15  ? -33.473 26.120  -28.930 1.00 50.60  ? 15  C   D N1    1 
ATOM   8326 C  C2    . C   D 2 15  ? -33.449 26.129  -27.512 1.00 48.07  ? 15  C   D C2    1 
ATOM   8327 O  O2    . C   D 2 15  ? -34.399 26.542  -26.845 1.00 46.87  ? 15  C   D O2    1 
ATOM   8328 N  N3    . C   D 2 15  ? -32.361 25.672  -26.849 1.00 47.04  ? 15  C   D N3    1 
ATOM   8329 C  C4    . C   D 2 15  ? -31.320 25.222  -27.528 1.00 50.08  ? 15  C   D C4    1 
ATOM   8330 N  N4    . C   D 2 15  ? -30.291 24.796  -26.798 1.00 50.99  ? 15  C   D N4    1 
ATOM   8331 C  C5    . C   D 2 15  ? -31.304 25.193  -28.960 1.00 53.72  ? 15  C   D C5    1 
ATOM   8332 C  C6    . C   D 2 15  ? -32.387 25.645  -29.614 1.00 53.24  ? 15  C   D C6    1 
ATOM   8333 P  P     . A   D 2 16  ? -38.675 23.794  -29.275 1.00 56.13  ? 16  A   D P     1 
ATOM   8334 O  OP1   . A   D 2 16  ? -39.843 23.585  -30.158 1.00 59.50  ? 16  A   D OP1   1 
ATOM   8335 O  OP2   . A   D 2 16  ? -38.881 23.778  -27.814 1.00 50.85  ? 16  A   D OP2   1 
ATOM   8336 O  "O5'" . A   D 2 16  ? -37.553 22.718  -29.671 1.00 60.92  ? 16  A   D "O5'" 1 
ATOM   8337 C  "C5'" . A   D 2 16  ? -37.208 22.502  -31.055 1.00 69.77  ? 16  A   D "C5'" 1 
ATOM   8338 C  "C4'" . A   D 2 16  ? -35.930 21.694  -31.221 1.00 75.08  ? 16  A   D "C4'" 1 
ATOM   8339 O  "O4'" . A   D 2 16  ? -34.791 22.417  -30.695 1.00 74.01  ? 16  A   D "O4'" 1 
ATOM   8340 C  "C3'" . A   D 2 16  ? -35.882 20.370  -30.472 1.00 76.57  ? 16  A   D "C3'" 1 
ATOM   8341 O  "O3'" . A   D 2 16  ? -36.498 19.358  -31.224 1.00 84.46  ? 16  A   D "O3'" 1 
ATOM   8342 C  "C2'" . A   D 2 16  ? -34.388 20.096  -30.393 1.00 76.91  ? 16  A   D "C2'" 1 
ATOM   8343 O  "O2'" . A   D 2 16  ? -33.870 19.556  -31.597 1.00 81.97  ? 16  A   D "O2'" 1 
ATOM   8344 C  "C1'" . A   D 2 16  ? -33.846 21.497  -30.159 1.00 74.58  ? 16  A   D "C1'" 1 
ATOM   8345 N  N9    . A   D 2 16  ? -33.597 21.778  -28.744 1.00 70.21  ? 16  A   D N9    1 
ATOM   8346 C  C8    . A   D 2 16  ? -34.439 22.395  -27.869 1.00 66.81  ? 16  A   D C8    1 
ATOM   8347 N  N7    . A   D 2 16  ? -33.946 22.515  -26.660 1.00 64.66  ? 16  A   D N7    1 
ATOM   8348 C  C5    . A   D 2 16  ? -32.690 21.940  -26.739 1.00 66.39  ? 16  A   D C5    1 
ATOM   8349 C  C6    . A   D 2 16  ? -31.648 21.757  -25.795 1.00 65.76  ? 16  A   D C6    1 
ATOM   8350 N  N6    . A   D 2 16  ? -31.727 22.148  -24.521 1.00 63.37  ? 16  A   D N6    1 
ATOM   8351 N  N1    . A   D 2 16  ? -30.511 21.150  -26.204 1.00 68.47  ? 16  A   D N1    1 
ATOM   8352 C  C2    . A   D 2 16  ? -30.425 20.749  -27.481 1.00 71.83  ? 16  A   D C2    1 
ATOM   8353 N  N3    . A   D 2 16  ? -31.334 20.870  -28.456 1.00 72.92  ? 16  A   D N3    1 
ATOM   8354 C  C4    . A   D 2 16  ? -32.458 21.479  -28.023 1.00 69.87  ? 16  A   D C4    1 
ATOM   8355 P  P     . A   D 2 17  ? -37.496 18.327  -30.525 1.00 86.61  ? 17  A   D P     1 
ATOM   8356 O  OP1   . A   D 2 17  ? -38.636 18.223  -31.464 1.00 90.08  ? 17  A   D OP1   1 
ATOM   8357 O  OP2   . A   D 2 17  ? -37.736 18.746  -29.127 1.00 81.75  ? 17  A   D OP2   1 
ATOM   8358 O  "O5'" . A   D 2 17  ? -36.691 16.935  -30.477 1.00 91.06  ? 17  A   D "O5'" 1 
ATOM   8359 C  "C5'" . A   D 2 17  ? -35.342 16.845  -29.996 1.00 94.81  ? 17  A   D "C5'" 1 
ATOM   8360 C  "C4'" . A   D 2 17  ? -35.045 15.577  -29.209 1.00 97.76  ? 17  A   D "C4'" 1 
ATOM   8361 O  "O4'" . A   D 2 17  ? -34.607 15.944  -27.875 1.00 94.58  ? 17  A   D "O4'" 1 
ATOM   8362 C  "C3'" . A   D 2 17  ? -36.208 14.596  -29.025 1.00 100.34 ? 17  A   D "C3'" 1 
ATOM   8363 O  "O3'" . A   D 2 17  ? -35.833 13.207  -29.139 1.00 106.25 ? 17  A   D "O3'" 1 
ATOM   8364 C  "C2'" . A   D 2 17  ? -36.687 14.892  -27.607 1.00 94.94  ? 17  A   D "C2'" 1 
ATOM   8365 O  "O2'" . A   D 2 17  ? -37.317 13.779  -27.002 1.00 93.36  ? 17  A   D "O2'" 1 
ATOM   8366 C  "C1'" . A   D 2 17  ? -35.365 15.225  -26.916 1.00 93.25  ? 17  A   D "C1'" 1 
ATOM   8367 N  N9    . A   D 2 17  ? -35.480 16.050  -25.712 1.00 89.45  ? 17  A   D N9    1 
ATOM   8368 C  C8    . A   D 2 17  ? -36.539 16.841  -25.346 1.00 87.50  ? 17  A   D C8    1 
ATOM   8369 N  N7    . A   D 2 17  ? -36.368 17.476  -24.211 1.00 84.80  ? 17  A   D N7    1 
ATOM   8370 C  C5    . A   D 2 17  ? -35.106 17.074  -23.801 1.00 84.95  ? 17  A   D C5    1 
ATOM   8371 C  C6    . A   D 2 17  ? -34.334 17.393  -22.666 1.00 82.82  ? 17  A   D C6    1 
ATOM   8372 N  N6    . A   D 2 17  ? -34.769 18.225  -21.720 1.00 80.56  ? 17  A   D N6    1 
ATOM   8373 N  N1    . A   D 2 17  ? -33.109 16.826  -22.545 1.00 84.15  ? 17  A   D N1    1 
ATOM   8374 C  C2    . A   D 2 17  ? -32.684 15.993  -23.504 1.00 86.94  ? 17  A   D C2    1 
ATOM   8375 N  N3    . A   D 2 17  ? -33.320 15.615  -24.615 1.00 89.15  ? 17  A   D N3    1 
ATOM   8376 C  C4    . A   D 2 17  ? -34.538 16.195  -24.711 1.00 87.87  ? 17  A   D C4    1 
ATOM   8377 P  P     . G   D 2 18  ? -34.606 12.631  -30.011 1.00 114.03 ? 18  G   D P     1 
ATOM   8378 O  OP1   . G   D 2 18  ? -33.426 12.557  -29.113 1.00 112.04 ? 18  G   D OP1   1 
ATOM   8379 O  OP2   . G   D 2 18  ? -34.508 13.380  -31.293 1.00 116.92 ? 18  G   D OP2   1 
ATOM   8380 O  "O5'" . G   D 2 18  ? -35.096 11.134  -30.345 1.00 117.94 ? 18  G   D "O5'" 1 
ATOM   8381 C  "C5'" . G   D 2 18  ? -35.871 10.349  -29.427 1.00 116.19 ? 18  G   D "C5'" 1 
ATOM   8382 C  "C4'" . G   D 2 18  ? -35.102 9.128   -28.947 1.00 117.88 ? 18  G   D "C4'" 1 
ATOM   8383 O  "O4'" . G   D 2 18  ? -34.370 8.541   -30.054 1.00 124.62 ? 18  G   D "O4'" 1 
ATOM   8384 C  "C3'" . G   D 2 18  ? -34.066 9.417   -27.866 1.00 114.65 ? 18  G   D "C3'" 1 
ATOM   8385 O  "O3'" . G   D 2 18  ? -34.633 9.208   -26.567 1.00 110.02 ? 18  G   D "O3'" 1 
ATOM   8386 C  "C2'" . G   D 2 18  ? -32.946 8.420   -28.159 1.00 118.94 ? 18  G   D "C2'" 1 
ATOM   8387 O  "O2'" . G   D 2 18  ? -33.131 7.194   -27.484 1.00 118.26 ? 18  G   D "O2'" 1 
ATOM   8388 C  "C1'" . G   D 2 18  ? -33.048 8.202   -29.669 1.00 125.85 ? 18  G   D "C1'" 1 
ATOM   8389 N  N9    . G   D 2 18  ? -32.102 8.978   -30.480 1.00 129.17 ? 18  G   D N9    1 
ATOM   8390 C  C8    . G   D 2 18  ? -31.735 10.290  -30.290 1.00 126.40 ? 18  G   D C8    1 
ATOM   8391 N  N7    . G   D 2 18  ? -30.878 10.736  -31.166 1.00 130.65 ? 18  G   D N7    1 
ATOM   8392 C  C5    . G   D 2 18  ? -30.653 9.650   -32.004 1.00 136.88 ? 18  G   D C5    1 
ATOM   8393 C  C6    . G   D 2 18  ? -29.809 9.537   -33.144 1.00 143.83 ? 18  G   D C6    1 
ATOM   8394 O  O6    . G   D 2 18  ? -29.076 10.403  -33.649 1.00 145.61 ? 18  G   D O6    1 
ATOM   8395 N  N1    . G   D 2 18  ? -29.864 8.262   -33.715 1.00 149.49 ? 18  G   D N1    1 
ATOM   8396 C  C2    . G   D 2 18  ? -30.639 7.223   -33.245 1.00 148.25 ? 18  G   D C2    1 
ATOM   8397 N  N2    . G   D 2 18  ? -30.555 6.071   -33.932 1.00 154.81 ? 18  G   D N2    1 
ATOM   8398 N  N3    . G   D 2 18  ? -31.435 7.319   -32.176 1.00 141.55 ? 18  G   D N3    1 
ATOM   8399 C  C4    . G   D 2 18  ? -31.399 8.555   -31.599 1.00 136.21 ? 18  G   D C4    1 
ATOM   8400 P  P     . U   D 2 19  ? -34.446 10.276  -25.380 1.00 104.58 ? 19  U   D P     1 
ATOM   8401 O  OP1   . U   D 2 19  ? -35.001 9.651   -24.159 1.00 100.92 ? 19  U   D OP1   1 
ATOM   8402 O  OP2   . U   D 2 19  ? -34.987 11.576  -25.845 1.00 103.72 ? 19  U   D OP2   1 
ATOM   8403 O  "O5'" . U   D 2 19  ? -32.851 10.437  -25.236 1.00 104.76 ? 19  U   D "O5'" 1 
ATOM   8404 C  "C5'" . U   D 2 19  ? -32.113 9.699   -24.258 1.00 102.26 ? 19  U   D "C5'" 1 
ATOM   8405 C  "C4'" . U   D 2 19  ? -30.929 10.487  -23.716 1.00 100.50 ? 19  U   D "C4'" 1 
ATOM   8406 O  "O4'" . U   D 2 19  ? -30.017 10.832  -24.788 1.00 104.72 ? 19  U   D "O4'" 1 
ATOM   8407 C  "C3'" . U   D 2 19  ? -31.266 11.792  -22.996 1.00 95.86  ? 19  U   D "C3'" 1 
ATOM   8408 O  "O3'" . U   D 2 19  ? -30.529 11.843  -21.774 1.00 93.44  ? 19  U   D "O3'" 1 
ATOM   8409 C  "C2'" . U   D 2 19  ? -30.840 12.888  -23.976 1.00 97.74  ? 19  U   D "C2'" 1 
ATOM   8410 O  "O2'" . U   D 2 19  ? -30.390 14.063  -23.326 1.00 94.85  ? 19  U   D "O2'" 1 
ATOM   8411 C  "C1'" . U   D 2 19  ? -29.693 12.207  -24.723 1.00 103.13 ? 19  U   D "C1'" 1 
ATOM   8412 N  N1    . U   D 2 19  ? -29.462 12.702  -26.120 1.00 107.02 ? 19  U   D N1    1 
ATOM   8413 C  C2    . U   D 2 19  ? -28.704 13.849  -26.334 1.00 108.15 ? 19  U   D C2    1 
ATOM   8414 O  O2    . U   D 2 19  ? -28.200 14.513  -25.442 1.00 106.24 ? 19  U   D O2    1 
ATOM   8415 N  N3    . U   D 2 19  ? -28.551 14.207  -27.659 1.00 111.88 ? 19  U   D N3    1 
ATOM   8416 C  C4    . U   D 2 19  ? -29.065 13.550  -28.768 1.00 115.03 ? 19  U   D C4    1 
ATOM   8417 O  O4    . U   D 2 19  ? -28.843 13.992  -29.890 1.00 118.57 ? 19  U   D O4    1 
ATOM   8418 C  C5    . U   D 2 19  ? -29.839 12.368  -28.468 1.00 114.51 ? 19  U   D C5    1 
ATOM   8419 C  C6    . U   D 2 19  ? -30.005 11.997  -27.187 1.00 110.39 ? 19  U   D C6    1 
ATOM   8420 P  P     . C   D 2 20  ? -31.131 11.295  -20.386 1.00 89.72  ? 20  C   D P     1 
ATOM   8421 O  OP1   . C   D 2 20  ? -29.975 11.085  -19.484 1.00 90.87  ? 20  C   D OP1   1 
ATOM   8422 O  OP2   . C   D 2 20  ? -32.071 10.164  -20.625 1.00 88.88  ? 20  C   D OP2   1 
ATOM   8423 O  "O5'" . C   D 2 20  ? -31.973 12.563  -19.876 1.00 83.61  ? 20  C   D "O5'" 1 
ATOM   8424 C  "C5'" . C   D 2 20  ? -31.473 13.412  -18.847 1.00 77.94  ? 20  C   D "C5'" 1 
ATOM   8425 C  "C4'" . C   D 2 20  ? -32.510 14.441  -18.453 1.00 71.90  ? 20  C   D "C4'" 1 
ATOM   8426 O  "O4'" . C   D 2 20  ? -32.905 15.179  -19.631 1.00 72.05  ? 20  C   D "O4'" 1 
ATOM   8427 C  "C3'" . C   D 2 20  ? -33.832 13.881  -17.955 1.00 67.44  ? 20  C   D "C3'" 1 
ATOM   8428 O  "O3'" . C   D 2 20  ? -33.742 13.489  -16.611 1.00 63.58  ? 20  C   D "O3'" 1 
ATOM   8429 C  "C2'" . C   D 2 20  ? -34.752 15.078  -18.148 1.00 66.47  ? 20  C   D "C2'" 1 
ATOM   8430 O  "O2'" . C   D 2 20  ? -34.571 16.122  -17.210 1.00 64.60  ? 20  C   D "O2'" 1 
ATOM   8431 C  "C1'" . C   D 2 20  ? -34.280 15.524  -19.527 1.00 69.17  ? 20  C   D "C1'" 1 
ATOM   8432 N  N1    . C   D 2 20  ? -35.070 14.897  -20.641 1.00 70.40  ? 20  C   D N1    1 
ATOM   8433 C  C2    . C   D 2 20  ? -36.393 15.325  -20.864 1.00 69.86  ? 20  C   D C2    1 
ATOM   8434 O  O2    . C   D 2 20  ? -36.893 16.209  -20.150 1.00 67.98  ? 20  C   D O2    1 
ATOM   8435 N  N3    . C   D 2 20  ? -37.099 14.747  -21.873 1.00 71.44  ? 20  C   D N3    1 
ATOM   8436 C  C4    . C   D 2 20  ? -36.539 13.801  -22.624 1.00 73.22  ? 20  C   D C4    1 
ATOM   8437 N  N4    . C   D 2 20  ? -37.287 13.283  -23.589 1.00 75.99  ? 20  C   D N4    1 
ATOM   8438 C  C5    . C   D 2 20  ? -35.203 13.348  -22.418 1.00 73.98  ? 20  C   D C5    1 
ATOM   8439 C  C6    . C   D 2 20  ? -34.513 13.919  -21.426 1.00 72.25  ? 20  C   D C6    1 
ATOM   8440 P  P     . C   D 2 21  ? -34.475 12.153  -16.141 1.00 60.05  ? 21  C   D P     1 
ATOM   8441 O  OP1   . C   D 2 21  ? -33.881 11.747  -14.855 1.00 60.53  ? 21  C   D OP1   1 
ATOM   8442 O  OP2   . C   D 2 21  ? -34.439 11.201  -17.271 1.00 63.06  ? 21  C   D OP2   1 
ATOM   8443 O  "O5'" . C   D 2 21  ? -36.004 12.591  -15.920 1.00 57.34  ? 21  C   D "O5'" 1 
ATOM   8444 C  "C5'" . C   D 2 21  ? -36.380 13.659  -15.050 1.00 53.95  ? 21  C   D "C5'" 1 
ATOM   8445 C  "C4'" . C   D 2 21  ? -37.795 14.159  -15.314 1.00 52.07  ? 21  C   D "C4'" 1 
ATOM   8446 O  "O4'" . C   D 2 21  ? -37.966 14.671  -16.670 1.00 52.54  ? 21  C   D "O4'" 1 
ATOM   8447 C  "C3'" . C   D 2 21  ? -38.883 13.109  -15.198 1.00 51.07  ? 21  C   D "C3'" 1 
ATOM   8448 O  "O3'" . C   D 2 21  ? -39.170 12.882  -13.833 1.00 49.45  ? 21  C   D "O3'" 1 
ATOM   8449 C  "C2'" . C   D 2 21  ? -40.026 13.794  -15.950 1.00 51.87  ? 21  C   D "C2'" 1 
ATOM   8450 O  "O2'" . C   D 2 21  ? -40.664 14.807  -15.188 1.00 52.09  ? 21  C   D "O2'" 1 
ATOM   8451 C  "C1'" . C   D 2 21  ? -39.289 14.426  -17.130 1.00 51.53  ? 21  C   D "C1'" 1 
ATOM   8452 N  N1    . C   D 2 21  ? -39.206 13.599  -18.388 1.00 52.56  ? 21  C   D N1    1 
ATOM   8453 C  C2    . C   D 2 21  ? -40.325 13.335  -19.229 1.00 53.45  ? 21  C   D C2    1 
ATOM   8454 O  O2    . C   D 2 21  ? -41.454 13.764  -18.981 1.00 53.09  ? 21  C   D O2    1 
ATOM   8455 N  N3    . C   D 2 21  ? -40.144 12.591  -20.350 1.00 55.24  ? 21  C   D N3    1 
ATOM   8456 C  C4    . C   D 2 21  ? -38.931 12.109  -20.651 1.00 56.47  ? 21  C   D C4    1 
ATOM   8457 N  N4    . C   D 2 21  ? -38.806 11.381  -21.762 1.00 58.94  ? 21  C   D N4    1 
ATOM   8458 C  C5    . C   D 2 21  ? -37.790 12.349  -19.821 1.00 55.15  ? 21  C   D C5    1 
ATOM   8459 C  C6    . C   D 2 21  ? -37.974 13.097  -18.724 1.00 53.26  ? 21  C   D C6    1 
ATOM   8460 P  P     . A   D 2 22  ? -39.246 11.409  -13.210 1.00 47.75  ? 22  A   D P     1 
ATOM   8461 O  OP1   . A   D 2 22  ? -39.072 11.568  -11.752 1.00 48.77  ? 22  A   D OP1   1 
ATOM   8462 O  OP2   . A   D 2 22  ? -38.321 10.508  -13.929 1.00 48.23  ? 22  A   D OP2   1 
ATOM   8463 O  "O5'" . A   D 2 22  ? -40.775 11.004  -13.480 1.00 49.74  ? 22  A   D "O5'" 1 
ATOM   8464 C  "C5'" . A   D 2 22  ? -41.163 10.039  -14.467 1.00 51.94  ? 22  A   D "C5'" 1 
ATOM   8465 C  "C4'" . A   D 2 22  ? -42.505 10.414  -15.070 1.00 53.71  ? 22  A   D "C4'" 1 
ATOM   8466 O  "O4'" . A   D 2 22  ? -42.302 11.332  -16.171 1.00 54.10  ? 22  A   D "O4'" 1 
ATOM   8467 C  "C3'" . A   D 2 22  ? -43.305 9.274   -15.687 1.00 56.08  ? 22  A   D "C3'" 1 
ATOM   8468 O  "O3'" . A   D 2 22  ? -44.076 8.604   -14.701 1.00 58.16  ? 22  A   D "O3'" 1 
ATOM   8469 C  "C2'" . A   D 2 22  ? -44.183 10.031  -16.681 1.00 57.50  ? 22  A   D "C2'" 1 
ATOM   8470 O  "O2'" . A   D 2 22  ? -45.209 10.809  -16.104 1.00 58.60  ? 22  A   D "O2'" 1 
ATOM   8471 C  "C1'" . A   D 2 22  ? -43.149 10.978  -17.255 1.00 55.68  ? 22  A   D "C1'" 1 
ATOM   8472 N  N9    . A   D 2 22  ? -42.400 10.370  -18.359 1.00 56.42  ? 22  A   D N9    1 
ATOM   8473 C  C8    . A   D 2 22  ? -41.061 10.080  -18.426 1.00 55.36  ? 22  A   D C8    1 
ATOM   8474 N  N7    . A   D 2 22  ? -40.684 9.535   -19.558 1.00 56.90  ? 22  A   D N7    1 
ATOM   8475 C  C5    . A   D 2 22  ? -41.864 9.458   -20.283 1.00 59.94  ? 22  A   D C5    1 
ATOM   8476 C  C6    . A   D 2 22  ? -42.167 8.976   -21.575 1.00 63.25  ? 22  A   D C6    1 
ATOM   8477 N  N6    . A   D 2 22  ? -41.252 8.458   -22.392 1.00 65.35  ? 22  A   D N6    1 
ATOM   8478 N  N1    . A   D 2 22  ? -43.448 9.040   -21.996 1.00 65.57  ? 22  A   D N1    1 
ATOM   8479 C  C2    . A   D 2 22  ? -44.384 9.554   -21.187 1.00 64.12  ? 22  A   D C2    1 
ATOM   8480 N  N3    . A   D 2 22  ? -44.226 10.037  -19.957 1.00 61.38  ? 22  A   D N3    1 
ATOM   8481 C  C4    . A   D 2 22  ? -42.934 9.963   -19.561 1.00 59.27  ? 22  A   D C4    1 
ATOM   8482 P  P     . U   D 2 23  ? -44.333 7.027   -14.786 1.00 59.68  ? 23  U   D P     1 
ATOM   8483 O  OP1   . U   D 2 23  ? -45.056 6.623   -13.557 1.00 60.08  ? 23  U   D OP1   1 
ATOM   8484 O  OP2   . U   D 2 23  ? -43.053 6.370   -15.132 1.00 58.91  ? 23  U   D OP2   1 
ATOM   8485 O  "O5'" . U   D 2 23  ? -45.301 6.903   -16.049 1.00 63.19  ? 23  U   D "O5'" 1 
ATOM   8486 C  "C5'" . U   D 2 23  ? -46.613 7.435   -16.014 1.00 66.25  ? 23  U   D "C5'" 1 
ATOM   8487 C  "C4'" . U   D 2 23  ? -47.306 7.176   -17.336 1.00 71.06  ? 23  U   D "C4'" 1 
ATOM   8488 O  "O4'" . U   D 2 23  ? -46.593 7.845   -18.408 1.00 71.70  ? 23  U   D "O4'" 1 
ATOM   8489 C  "C3'" . U   D 2 23  ? -47.335 5.727   -17.800 1.00 73.78  ? 23  U   D "C3'" 1 
ATOM   8490 O  "O3'" . U   D 2 23  ? -48.336 4.983   -17.104 1.00 76.79  ? 23  U   D "O3'" 1 
ATOM   8491 C  "C2'" . U   D 2 23  ? -47.667 5.954   -19.269 1.00 76.77  ? 23  U   D "C2'" 1 
ATOM   8492 O  "O2'" . U   D 2 23  ? -48.988 6.421   -19.450 1.00 79.40  ? 23  U   D "O2'" 1 
ATOM   8493 C  "C1'" . U   D 2 23  ? -46.693 7.075   -19.601 1.00 74.31  ? 23  U   D "C1'" 1 
ATOM   8494 N  N1    . U   D 2 23  ? -45.331 6.594   -20.061 1.00 73.34  ? 23  U   D N1    1 
ATOM   8495 C  C2    . U   D 2 23  ? -45.152 6.181   -21.372 1.00 76.28  ? 23  U   D C2    1 
ATOM   8496 O  O2    . U   D 2 23  ? -46.042 6.180   -22.204 1.00 80.11  ? 23  U   D O2    1 
ATOM   8497 N  N3    . U   D 2 23  ? -43.874 5.765   -21.679 1.00 75.71  ? 23  U   D N3    1 
ATOM   8498 C  C4    . U   D 2 23  ? -42.776 5.724   -20.830 1.00 72.70  ? 23  U   D C4    1 
ATOM   8499 O  O4    . U   D 2 23  ? -41.690 5.330   -21.238 1.00 73.27  ? 23  U   D O4    1 
ATOM   8500 C  C5    . U   D 2 23  ? -43.032 6.170   -19.484 1.00 69.55  ? 23  U   D C5    1 
ATOM   8501 C  C6    . U   D 2 23  ? -44.269 6.577   -19.164 1.00 70.25  ? 23  U   D C6    1 
ATOM   8502 P  P     . U   D 2 24  ? -48.265 3.387   -16.961 1.00 78.69  ? 24  U   D P     1 
ATOM   8503 O  OP1   . U   D 2 24  ? -49.481 2.992   -16.223 1.00 81.21  ? 24  U   D OP1   1 
ATOM   8504 O  OP2   . U   D 2 24  ? -46.921 2.995   -16.469 1.00 75.07  ? 24  U   D OP2   1 
ATOM   8505 O  "O5'" . U   D 2 24  ? -48.413 2.845   -18.458 1.00 83.74  ? 24  U   D "O5'" 1 
ATOM   8506 C  "C5'" . U   D 2 24  ? -49.649 2.928   -19.153 1.00 88.96  ? 24  U   D "C5'" 1 
ATOM   8507 C  "C4'" . U   D 2 24  ? -49.464 2.480   -20.589 1.00 93.94  ? 24  U   D "C4'" 1 
ATOM   8508 O  "O4'" . U   D 2 24  ? -48.412 3.254   -21.220 1.00 91.92  ? 24  U   D "O4'" 1 
ATOM   8509 C  "C3'" . U   D 2 24  ? -49.011 1.038   -20.760 1.00 96.22  ? 24  U   D "C3'" 1 
ATOM   8510 O  "O3'" . U   D 2 24  ? -50.118 0.148   -20.659 1.00 101.92 ? 24  U   D "O3'" 1 
ATOM   8511 C  "C2'" . U   D 2 24  ? -48.467 1.098   -22.179 1.00 99.42  ? 24  U   D "C2'" 1 
ATOM   8512 O  "O2'" . U   D 2 24  ? -49.471 1.031   -23.176 1.00 105.61 ? 24  U   D "O2'" 1 
ATOM   8513 C  "C1'" . U   D 2 24  ? -47.769 2.460   -22.200 1.00 95.10  ? 24  U   D "C1'" 1 
ATOM   8514 N  N1    . U   D 2 24  ? -46.289 2.341   -21.932 1.00 91.39  ? 24  U   D N1    1 
ATOM   8515 C  C2    . U   D 2 24  ? -45.466 1.750   -22.885 1.00 94.16  ? 24  U   D C2    1 
ATOM   8516 O  O2    . U   D 2 24  ? -45.856 1.314   -23.955 1.00 99.63  ? 24  U   D O2    1 
ATOM   8517 N  N3    . U   D 2 24  ? -44.139 1.672   -22.548 1.00 91.00  ? 24  U   D N3    1 
ATOM   8518 C  C4    . U   D 2 24  ? -43.559 2.124   -21.379 1.00 86.10  ? 24  U   D C4    1 
ATOM   8519 O  O4    . U   D 2 24  ? -42.355 1.988   -21.226 1.00 84.91  ? 24  U   D O4    1 
ATOM   8520 C  C5    . U   D 2 24  ? -44.464 2.724   -20.430 1.00 83.50  ? 24  U   D C5    1 
ATOM   8521 C  C6    . U   D 2 24  ? -45.765 2.808   -20.737 1.00 86.22  ? 24  U   D C6    1 
ATOM   8522 P  P     . U   D 2 25  ? -49.938 -1.379  -20.200 1.00 103.82 ? 25  U   D P     1 
ATOM   8523 O  OP1   . U   D 2 25  ? -51.246 -1.843  -19.693 1.00 105.91 ? 25  U   D OP1   1 
ATOM   8524 O  OP2   . U   D 2 25  ? -48.741 -1.452  -19.328 1.00 98.44  ? 25  U   D OP2   1 
ATOM   8525 O  "O5'" . U   D 2 25  ? -49.623 -2.161  -21.562 1.00 109.60 ? 25  U   D "O5'" 1 
ATOM   8526 C  "C5'" . U   D 2 25  ? -50.519 -2.104  -22.672 1.00 117.42 ? 25  U   D "C5'" 1 
ATOM   8527 C  "C4'" . U   D 2 25  ? -49.908 -2.782  -23.884 1.00 123.43 ? 25  U   D "C4'" 1 
ATOM   8528 O  "O4'" . U   D 2 25  ? -48.913 -1.916  -24.491 1.00 121.96 ? 25  U   D "O4'" 1 
ATOM   8529 C  "C3'" . U   D 2 25  ? -49.119 -4.047  -23.580 1.00 123.90 ? 25  U   D "C3'" 1 
ATOM   8530 O  "O3'" . U   D 2 25  ? -49.970 -5.159  -23.397 1.00 129.54 ? 25  U   D "O3'" 1 
ATOM   8531 C  "C2'" . U   D 2 25  ? -48.238 -4.149  -24.818 1.00 127.15 ? 25  U   D "C2'" 1 
ATOM   8532 O  "O2'" . U   D 2 25  ? -48.942 -4.544  -25.977 1.00 134.97 ? 25  U   D "O2'" 1 
ATOM   8533 C  "C1'" . U   D 2 25  ? -47.804 -2.692  -24.932 1.00 123.48 ? 25  U   D "C1'" 1 
ATOM   8534 N  N1    . U   D 2 25  ? -46.564 -2.364  -24.126 1.00 116.99 ? 25  U   D N1    1 
ATOM   8535 C  C2    . U   D 2 25  ? -45.305 -2.737  -24.583 1.00 117.63 ? 25  U   D C2    1 
ATOM   8536 O  O2    . U   D 2 25  ? -45.103 -3.333  -25.627 1.00 123.33 ? 25  U   D O2    1 
ATOM   8537 N  N3    . U   D 2 25  ? -44.263 -2.382  -23.755 1.00 112.19 ? 25  U   D N3    1 
ATOM   8538 C  C4    . U   D 2 25  ? -44.344 -1.704  -22.546 1.00 106.49 ? 25  U   D C4    1 
ATOM   8539 O  O4    . U   D 2 25  ? -43.329 -1.446  -21.906 1.00 102.57 ? 25  U   D O4    1 
ATOM   8540 C  C5    . U   D 2 25  ? -45.678 -1.355  -22.136 1.00 106.07 ? 25  U   D C5    1 
ATOM   8541 C  C6    . U   D 2 25  ? -46.703 -1.691  -22.925 1.00 111.12 ? 25  U   D C6    1 
ATOM   8542 P  P     . A   D 2 26  ? -49.538 -6.328  -22.389 1.00 128.44 ? 26  A   D P     1 
ATOM   8543 O  OP1   . A   D 2 26  ? -50.748 -7.135  -22.123 1.00 132.35 ? 26  A   D OP1   1 
ATOM   8544 O  OP2   . A   D 2 26  ? -48.778 -5.761  -21.255 1.00 121.07 ? 26  A   D OP2   1 
ATOM   8545 O  "O5'" . A   D 2 26  ? -48.505 -7.185  -23.256 1.00 133.68 ? 26  A   D "O5'" 1 
ATOM   8546 C  "C5'" . A   D 2 26  ? -48.933 -7.871  -24.431 1.00 144.26 ? 26  A   D "C5'" 1 
ATOM   8547 C  "C4'" . A   D 2 26  ? -47.744 -8.364  -25.235 1.00 148.99 ? 26  A   D "C4'" 1 
ATOM   8548 O  "O4'" . A   D 2 26  ? -46.954 -7.234  -25.693 1.00 147.51 ? 26  A   D "O4'" 1 
ATOM   8549 C  "C3'" . A   D 2 26  ? -46.750 -9.233  -24.472 1.00 146.92 ? 26  A   D "C3'" 1 
ATOM   8550 O  "O3'" . A   D 2 26  ? -47.191 -10.587 -24.393 1.00 152.09 ? 26  A   D "O3'" 1 
ATOM   8551 C  "C2'" . A   D 2 26  ? -45.503 -9.055  -25.333 1.00 149.04 ? 26  A   D "C2'" 1 
ATOM   8552 O  "O2'" . A   D 2 26  ? -45.548 -9.795  -26.539 1.00 157.77 ? 26  A   D "O2'" 1 
ATOM   8553 C  "C1'" . A   D 2 26  ? -45.575 -7.555  -25.615 1.00 146.64 ? 26  A   D "C1'" 1 
ATOM   8554 N  N9    . A   D 2 26  ? -44.940 -6.753  -24.566 1.00 139.00 ? 26  A   D N9    1 
ATOM   8555 C  C8    . A   D 2 26  ? -45.553 -6.050  -23.561 1.00 133.73 ? 26  A   D C8    1 
ATOM   8556 N  N7    . A   D 2 26  ? -44.729 -5.428  -22.753 1.00 127.85 ? 26  A   D N7    1 
ATOM   8557 C  C5    . A   D 2 26  ? -43.481 -5.750  -23.257 1.00 129.33 ? 26  A   D C5    1 
ATOM   8558 C  C6    . A   D 2 26  ? -42.177 -5.400  -22.850 1.00 125.62 ? 26  A   D C6    1 
ATOM   8559 N  N6    . A   D 2 26  ? -41.933 -4.619  -21.792 1.00 119.38 ? 26  A   D N6    1 
ATOM   8560 N  N1    . A   D 2 26  ? -41.138 -5.890  -23.571 1.00 129.26 ? 26  A   D N1    1 
ATOM   8561 C  C2    . A   D 2 26  ? -41.393 -6.675  -24.632 1.00 136.08 ? 26  A   D C2    1 
ATOM   8562 N  N3    . A   D 2 26  ? -42.576 -7.069  -25.112 1.00 140.12 ? 26  A   D N3    1 
ATOM   8563 C  C4    . A   D 2 26  ? -43.588 -6.568  -24.374 1.00 136.34 ? 26  A   D C4    1 
ATOM   8564 P  P     . C   D 2 27  ? -46.837 -11.509 -23.128 1.00 148.65 ? 27  C   D P     1 
ATOM   8565 O  OP1   . C   D 2 27  ? -47.697 -12.713 -23.214 1.00 153.99 ? 27  C   D OP1   1 
ATOM   8566 O  OP2   . C   D 2 27  ? -46.864 -10.680 -21.901 1.00 140.55 ? 27  C   D OP2   1 
ATOM   8567 O  "O5'" . C   D 2 27  ? -45.312 -11.922 -23.405 1.00 149.44 ? 27  C   D "O5'" 1 
ATOM   8568 C  "C5'" . C   D 2 27  ? -44.973 -12.865 -24.436 1.00 157.33 ? 27  C   D "C5'" 1 
ATOM   8569 C  "C4'" . C   D 2 27  ? -43.494 -12.829 -24.797 1.00 157.74 ? 27  C   D "C4'" 1 
ATOM   8570 O  "O4'" . C   D 2 27  ? -43.082 -11.475 -25.142 1.00 154.81 ? 27  C   D "O4'" 1 
ATOM   8571 C  "C3'" . C   D 2 27  ? -42.516 -13.203 -23.686 1.00 152.74 ? 27  C   D "C3'" 1 
ATOM   8572 O  "O3'" . C   D 2 27  ? -42.468 -14.610 -23.407 1.00 156.18 ? 27  C   D "O3'" 1 
ATOM   8573 C  "C2'" . C   D 2 27  ? -41.225 -12.618 -24.259 1.00 152.86 ? 27  C   D "C2'" 1 
ATOM   8574 O  "O2'" . C   D 2 27  ? -40.691 -13.337 -25.355 1.00 160.74 ? 27  C   D "O2'" 1 
ATOM   8575 C  "C1'" . C   D 2 27  ? -41.747 -11.255 -24.713 1.00 150.71 ? 27  C   D "C1'" 1 
ATOM   8576 N  N1    . C   D 2 27  ? -41.706 -10.245 -23.601 1.00 142.08 ? 27  C   D N1    1 
ATOM   8577 C  C2    . C   D 2 27  ? -40.484 -9.642  -23.259 1.00 138.43 ? 27  C   D C2    1 
ATOM   8578 O  O2    . C   D 2 27  ? -39.455 -9.928  -23.885 1.00 142.06 ? 27  C   D O2    1 
ATOM   8579 N  N3    . C   D 2 27  ? -40.461 -8.740  -22.242 1.00 131.57 ? 27  C   D N3    1 
ATOM   8580 C  C4    . C   D 2 27  ? -41.582 -8.439  -21.578 1.00 128.38 ? 27  C   D C4    1 
ATOM   8581 N  N4    . C   D 2 27  ? -41.498 -7.546  -20.589 1.00 122.33 ? 27  C   D N4    1 
ATOM   8582 C  C5    . C   D 2 27  ? -42.836 -9.040  -21.901 1.00 131.93 ? 27  C   D C5    1 
ATOM   8583 C  C6    . C   D 2 27  ? -42.845 -9.925  -22.905 1.00 138.56 ? 27  C   D C6    1 
ATOM   8584 P  P     . U   D 2 28  ? -42.523 -15.128 -21.881 1.00 150.61 ? 28  U   D P     1 
ATOM   8585 O  OP1   . U   D 2 28  ? -42.617 -16.604 -21.915 1.00 155.35 ? 28  U   D OP1   1 
ATOM   8586 O  OP2   . U   D 2 28  ? -43.540 -14.348 -21.137 1.00 145.52 ? 28  U   D OP2   1 
ATOM   8587 O  "O5'" . U   D 2 28  ? -41.094 -14.710 -21.296 1.00 145.74 ? 28  U   D "O5'" 1 
ATOM   8588 C  "C5'" . U   D 2 28  ? -39.913 -15.276 -21.855 1.00 149.34 ? 28  U   D "C5'" 1 
ATOM   8589 C  "C4'" . U   D 2 28  ? -38.669 -14.653 -21.254 1.00 144.17 ? 28  U   D "C4'" 1 
ATOM   8590 O  "O4'" . U   D 2 28  ? -38.703 -13.211 -21.387 1.00 140.33 ? 28  U   D "O4'" 1 
ATOM   8591 C  "C3'" . U   D 2 28  ? -38.482 -14.874 -19.760 1.00 137.76 ? 28  U   D "C3'" 1 
ATOM   8592 O  "O3'" . U   D 2 28  ? -38.066 -16.231 -19.512 1.00 139.54 ? 28  U   D "O3'" 1 
ATOM   8593 C  "C2'" . U   D 2 28  ? -37.431 -13.800 -19.467 1.00 134.40 ? 28  U   D "C2'" 1 
ATOM   8594 O  "O2'" . U   D 2 28  ? -36.100 -14.193 -19.745 1.00 137.72 ? 28  U   D "O2'" 1 
ATOM   8595 C  "C1'" . U   D 2 28  ? -37.847 -12.661 -20.399 1.00 135.21 ? 28  U   D "C1'" 1 
ATOM   8596 N  N1    . U   D 2 28  ? -38.525 -11.533 -19.671 1.00 129.19 ? 28  U   D N1    1 
ATOM   8597 C  C2    . U   D 2 28  ? -37.745 -10.558 -19.065 1.00 124.96 ? 28  U   D C2    1 
ATOM   8598 O  O2    . U   D 2 28  ? -36.526 -10.553 -19.092 1.00 125.92 ? 28  U   D O2    1 
ATOM   8599 N  N3    . U   D 2 28  ? -38.449 -9.565  -18.419 1.00 120.08 ? 28  U   D N3    1 
ATOM   8600 C  C4    . U   D 2 28  ? -39.828 -9.454  -18.314 1.00 119.08 ? 28  U   D C4    1 
ATOM   8601 O  O4    . U   D 2 28  ? -40.315 -8.508  -17.701 1.00 114.80 ? 28  U   D O4    1 
ATOM   8602 C  C5    . U   D 2 28  ? -40.574 -10.507 -18.963 1.00 123.96 ? 28  U   D C5    1 
ATOM   8603 C  C6    . U   D 2 28  ? -39.911 -11.484 -19.602 1.00 128.71 ? 28  U   D C6    1 
ATOM   8604 P  P     . U   D 2 29  ? -37.574 -16.775 -18.081 1.00 134.58 ? 29  U   D P     1 
ATOM   8605 O  OP1   . U   D 2 29  ? -37.806 -18.237 -18.014 1.00 138.08 ? 29  U   D OP1   1 
ATOM   8606 O  OP2   . U   D 2 29  ? -38.120 -15.902 -17.014 1.00 127.53 ? 29  U   D OP2   1 
ATOM   8607 O  "O5'" . U   D 2 29  ? -35.999 -16.528 -18.197 1.00 134.23 ? 29  U   D "O5'" 1 
ATOM   8608 C  "C5'" . U   D 2 29  ? -35.150 -16.796 -17.100 1.00 129.40 ? 29  U   D "C5'" 1 
ATOM   8609 C  "C4'" . U   D 2 29  ? -34.670 -15.525 -16.420 1.00 121.99 ? 29  U   D "C4'" 1 
ATOM   8610 O  "O4'" . U   D 2 29  ? -35.258 -14.297 -16.932 1.00 119.60 ? 29  U   D "O4'" 1 
ATOM   8611 C  "C3'" . U   D 2 29  ? -35.063 -15.401 -14.967 1.00 115.08 ? 29  U   D "C3'" 1 
ATOM   8612 O  "O3'" . U   D 2 29  ? -34.434 -16.377 -14.166 1.00 113.74 ? 29  U   D "O3'" 1 
ATOM   8613 C  "C2'" . U   D 2 29  ? -34.540 -13.997 -14.707 1.00 112.06 ? 29  U   D "C2'" 1 
ATOM   8614 O  "O2'" . U   D 2 29  ? -33.127 -13.932 -14.647 1.00 113.94 ? 29  U   D "O2'" 1 
ATOM   8615 C  "C1'" . U   D 2 29  ? -35.072 -13.282 -15.947 1.00 113.76 ? 29  U   D "C1'" 1 
ATOM   8616 N  N1    . U   D 2 29  ? -36.341 -12.497 -15.660 1.00 109.72 ? 29  U   D N1    1 
ATOM   8617 C  C2    . U   D 2 29  ? -36.282 -11.335 -14.897 1.00 105.07 ? 29  U   D C2    1 
ATOM   8618 O  O2    . U   D 2 29  ? -35.254 -10.876 -14.428 1.00 103.76 ? 29  U   D O2    1 
ATOM   8619 N  N3    . U   D 2 29  ? -37.489 -10.701 -14.694 1.00 102.27 ? 29  U   D N3    1 
ATOM   8620 C  C4    . U   D 2 29  ? -38.731 -11.100 -15.159 1.00 103.53 ? 29  U   D C4    1 
ATOM   8621 O  O4    . U   D 2 29  ? -39.723 -10.428 -14.899 1.00 101.05 ? 29  U   D O4    1 
ATOM   8622 C  C5    . U   D 2 29  ? -38.723 -12.314 -15.937 1.00 108.55 ? 29  U   D C5    1 
ATOM   8623 C  C6    . U   D 2 29  ? -37.559 -12.946 -16.145 1.00 111.42 ? 29  U   D C6    1 
ATOM   8624 P  P     . C   D 2 30  ? -35.137 -16.777 -12.786 1.00 107.72 ? 30  C   D P     1 
ATOM   8625 O  OP1   . C   D 2 30  ? -34.521 -18.036 -12.307 1.00 110.19 ? 30  C   D OP1   1 
ATOM   8626 O  OP2   . C   D 2 30  ? -36.603 -16.666 -12.965 1.00 106.30 ? 30  C   D OP2   1 
ATOM   8627 O  "O5'" . C   D 2 30  ? -34.709 -15.590 -11.811 1.00 101.27 ? 30  C   D "O5'" 1 
ATOM   8628 C  "C5'" . C   D 2 30  ? -33.334 -15.324 -11.567 1.00 99.91  ? 30  C   D "C5'" 1 
ATOM   8629 C  "C4'" . C   D 2 30  ? -33.221 -14.048 -10.765 1.00 93.53  ? 30  C   D "C4'" 1 
ATOM   8630 O  "O4'" . C   D 2 30  ? -33.824 -12.950 -11.498 1.00 91.58  ? 30  C   D "O4'" 1 
ATOM   8631 C  "C3'" . C   D 2 30  ? -33.984 -14.092 -9.453  1.00 87.97  ? 30  C   D "C3'" 1 
ATOM   8632 O  "O3'" . C   D 2 30  ? -33.204 -14.727 -8.461  1.00 86.07  ? 30  C   D "O3'" 1 
ATOM   8633 C  "C2'" . C   D 2 30  ? -34.178 -12.609 -9.183  1.00 85.01  ? 30  C   D "C2'" 1 
ATOM   8634 O  "O2'" . C   D 2 30  ? -33.018 -12.001 -8.655  1.00 85.57  ? 30  C   D "O2'" 1 
ATOM   8635 C  "C1'" . C   D 2 30  ? -34.458 -12.069 -10.585 1.00 86.44  ? 30  C   D "C1'" 1 
ATOM   8636 N  N1    . C   D 2 30  ? -35.934 -11.925 -10.881 1.00 85.00  ? 30  C   D N1    1 
ATOM   8637 C  C2    . C   D 2 30  ? -36.633 -10.838 -10.332 1.00 81.02  ? 30  C   D C2    1 
ATOM   8638 O  O2    . C   D 2 30  ? -36.036 -10.017 -9.628  1.00 78.93  ? 30  C   D O2    1 
ATOM   8639 N  N3    . C   D 2 30  ? -37.958 -10.704 -10.594 1.00 80.16  ? 30  C   D N3    1 
ATOM   8640 C  C4    . C   D 2 30  ? -38.589 -11.596 -11.354 1.00 82.76  ? 30  C   D C4    1 
ATOM   8641 N  N4    . C   D 2 30  ? -39.890 -11.398 -11.562 1.00 82.55  ? 30  C   D N4    1 
ATOM   8642 C  C5    . C   D 2 30  ? -37.910 -12.717 -11.924 1.00 86.89  ? 30  C   D C5    1 
ATOM   8643 C  C6    . C   D 2 30  ? -36.598 -12.840 -11.664 1.00 87.92  ? 30  C   D C6    1 
ATOM   8644 P  P     . C   D 2 31  ? -33.931 -15.525 -7.289  1.00 82.89  ? 31  C   D P     1 
ATOM   8645 O  OP1   . C   D 2 31  ? -32.963 -16.448 -6.662  1.00 84.58  ? 31  C   D OP1   1 
ATOM   8646 O  OP2   . C   D 2 31  ? -35.207 -16.028 -7.837  1.00 82.82  ? 31  C   D OP2   1 
ATOM   8647 O  "O5'" . C   D 2 31  ? -34.293 -14.386 -6.229  1.00 79.41  ? 31  C   D "O5'" 1 
ATOM   8648 C  "C5'" . C   D 2 31  ? -33.279 -13.585 -5.628  1.00 78.58  ? 31  C   D "C5'" 1 
ATOM   8649 C  "C4'" . C   D 2 31  ? -33.855 -12.298 -5.072  1.00 74.55  ? 31  C   D "C4'" 1 
ATOM   8650 O  "O4'" . C   D 2 31  ? -34.574 -11.595 -6.106  1.00 73.23  ? 31  C   D "O4'" 1 
ATOM   8651 C  "C3'" . C   D 2 31  ? -34.911 -12.514 -4.012  1.00 72.35  ? 31  C   D "C3'" 1 
ATOM   8652 O  "O3'" . C   D 2 31  ? -34.297 -12.667 -2.780  1.00 72.92  ? 31  C   D "O3'" 1 
ATOM   8653 C  "C2'" . C   D 2 31  ? -35.708 -11.230 -4.056  1.00 70.05  ? 31  C   D "C2'" 1 
ATOM   8654 O  "O2'" . C   D 2 31  ? -35.062 -10.191 -3.352  1.00 70.21  ? 31  C   D "O2'" 1 
ATOM   8655 C  "C1'" . C   D 2 31  ? -35.705 -10.950 -5.551  1.00 71.02  ? 31  C   D "C1'" 1 
ATOM   8656 N  N1    . C   D 2 31  ? -36.974 -11.369 -6.258  1.00 71.36  ? 31  C   D N1    1 
ATOM   8657 C  C2    . C   D 2 31  ? -38.127 -10.559 -6.153  1.00 69.69  ? 31  C   D C2    1 
ATOM   8658 O  O2    . C   D 2 31  ? -38.097 -9.520  -5.481  1.00 67.89  ? 31  C   D O2    1 
ATOM   8659 N  N3    . C   D 2 31  ? -39.266 -10.931 -6.795  1.00 69.86  ? 31  C   D N3    1 
ATOM   8660 C  C4    . C   D 2 31  ? -39.284 -12.051 -7.514  1.00 71.79  ? 31  C   D C4    1 
ATOM   8661 N  N4    . C   D 2 31  ? -40.428 -12.361 -8.122  1.00 73.01  ? 31  C   D N4    1 
ATOM   8662 C  C5    . C   D 2 31  ? -38.133 -12.890 -7.639  1.00 73.99  ? 31  C   D C5    1 
ATOM   8663 C  C6    . C   D 2 31  ? -37.014 -12.516 -7.004  1.00 73.35  ? 31  C   D C6    1 
ATOM   8664 P  P     . A   D 2 32  ? -34.547 -14.055 -2.051  1.00 74.03  ? 32  A   D P     1 
ATOM   8665 O  OP1   . A   D 2 32  ? -33.237 -14.493 -1.540  1.00 77.99  ? 32  A   D OP1   1 
ATOM   8666 O  OP2   . A   D 2 32  ? -35.319 -14.918 -2.969  1.00 74.17  ? 32  A   D OP2   1 
ATOM   8667 O  "O5'" . A   D 2 32  ? -35.478 -13.691 -0.812  1.00 73.23  ? 32  A   D "O5'" 1 
ATOM   8668 C  "C5'" . A   D 2 32  ? -35.184 -12.560 -0.002  1.00 74.03  ? 32  A   D "C5'" 1 
ATOM   8669 C  "C4'" . A   D 2 32  ? -36.409 -11.678 0.142   1.00 72.62  ? 32  A   D "C4'" 1 
ATOM   8670 O  "O4'" . A   D 2 32  ? -37.013 -11.441 -1.147  1.00 71.22  ? 32  A   D "O4'" 1 
ATOM   8671 C  "C3'" . A   D 2 32  ? -37.582 -12.273 0.898   1.00 73.22  ? 32  A   D "C3'" 1 
ATOM   8672 O  "O3'" . A   D 2 32  ? -37.319 -12.256 2.277   1.00 77.22  ? 32  A   D "O3'" 1 
ATOM   8673 C  "C2'" . A   D 2 32  ? -38.690 -11.297 0.532   1.00 70.78  ? 32  A   D "C2'" 1 
ATOM   8674 O  "O2'" . A   D 2 32  ? -38.570 -10.078 1.241   1.00 70.84  ? 32  A   D "O2'" 1 
ATOM   8675 C  "C1'" . A   D 2 32  ? -38.357 -11.030 -0.928  1.00 68.81  ? 32  A   D "C1'" 1 
ATOM   8676 N  N9    . A   D 2 32  ? -39.252 -11.545 -1.975  1.00 67.83  ? 32  A   D N9    1 
ATOM   8677 C  C8    . A   D 2 32  ? -39.087 -12.661 -2.743  1.00 68.70  ? 32  A   D C8    1 
ATOM   8678 N  N7    . A   D 2 32  ? -40.038 -12.835 -3.630  1.00 68.79  ? 32  A   D N7    1 
ATOM   8679 C  C5    . A   D 2 32  ? -40.880 -11.753 -3.450  1.00 67.38  ? 32  A   D C5    1 
ATOM   8680 C  C6    . A   D 2 32  ? -42.081 -11.345 -4.080  1.00 67.57  ? 32  A   D C6    1 
ATOM   8681 N  N6    . A   D 2 32  ? -42.664 -12.020 -5.073  1.00 69.02  ? 32  A   D N6    1 
ATOM   8682 N  N1    . A   D 2 32  ? -42.673 -10.205 -3.654  1.00 66.38  ? 32  A   D N1    1 
ATOM   8683 C  C2    . A   D 2 32  ? -42.093 -9.520  -2.662  1.00 65.35  ? 32  A   D C2    1 
ATOM   8684 N  N3    . A   D 2 32  ? -40.970 -9.807  -1.998  1.00 65.29  ? 32  A   D N3    1 
ATOM   8685 C  C4    . A   D 2 32  ? -40.404 -10.944 -2.437  1.00 66.38  ? 32  A   D C4    1 
ATOM   8686 P  P     . C   D 2 33  ? -37.731 -13.525 3.141   1.00 80.80  ? 33  C   D P     1 
ATOM   8687 O  OP1   . C   D 2 33  ? -37.296 -13.300 4.537   1.00 82.95  ? 33  C   D OP1   1 
ATOM   8688 O  OP2   . C   D 2 33  ? -37.250 -14.703 2.397   1.00 81.80  ? 33  C   D OP2   1 
ATOM   8689 O  "O5'" . C   D 2 33  ? -39.330 -13.500 3.098   1.00 82.50  ? 33  C   D "O5'" 1 
ATOM   8690 C  "C5'" . C   D 2 33  ? -40.024 -12.453 3.796   1.00 86.71  ? 33  C   D "C5'" 1 
ATOM   8691 C  "C4'" . C   D 2 33  ? -41.536 -12.546 3.664   1.00 89.53  ? 33  C   D "C4'" 1 
ATOM   8692 O  "O4'" . C   D 2 33  ? -41.978 -12.123 2.346   1.00 88.85  ? 33  C   D "O4'" 1 
ATOM   8693 C  "C3'" . C   D 2 33  ? -42.104 -13.948 3.811   1.00 92.23  ? 33  C   D "C3'" 1 
ATOM   8694 O  "O3'" . C   D 2 33  ? -42.228 -14.272 5.186   1.00 95.86  ? 33  C   D "O3'" 1 
ATOM   8695 C  "C2'" . C   D 2 33  ? -43.438 -13.850 3.072   1.00 91.95  ? 33  C   D "C2'" 1 
ATOM   8696 O  "O2'" . C   D 2 33  ? -44.471 -13.272 3.844   1.00 93.76  ? 33  C   D "O2'" 1 
ATOM   8697 C  "C1'" . C   D 2 33  ? -43.069 -12.924 1.914   1.00 90.03  ? 33  C   D "C1'" 1 
ATOM   8698 N  N1    . C   D 2 33  ? -42.694 -13.661 0.658   1.00 89.90  ? 33  C   D N1    1 
ATOM   8699 C  C2    . C   D 2 33  ? -43.697 -14.155 -0.198  1.00 90.75  ? 33  C   D C2    1 
ATOM   8700 O  O2    . C   D 2 33  ? -44.897 -13.987 0.074   1.00 91.05  ? 33  C   D O2    1 
ATOM   8701 N  N3    . C   D 2 33  ? -43.307 -14.819 -1.322  1.00 91.56  ? 33  C   D N3    1 
ATOM   8702 C  C4    . C   D 2 33  ? -42.007 -14.993 -1.606  1.00 91.03  ? 33  C   D C4    1 
ATOM   8703 N  N4    . C   D 2 33  ? -41.680 -15.651 -2.724  1.00 92.14  ? 33  C   D N4    1 
ATOM   8704 C  C5    . C   D 2 33  ? -40.980 -14.501 -0.747  1.00 90.22  ? 33  C   D C5    1 
ATOM   8705 C  C6    . C   D 2 33  ? -41.368 -13.852 0.355   1.00 89.63  ? 33  C   D C6    1 
ATOM   8706 P  P     . C   D 2 34  ? -41.516 -15.600 5.732   1.00 99.40  ? 34  C   D P     1 
ATOM   8707 O  OP1   . C   D 2 34  ? -41.616 -15.573 7.212   1.00 101.26 ? 34  C   D OP1   1 
ATOM   8708 O  OP2   . C   D 2 34  ? -40.189 -15.731 5.072   1.00 99.04  ? 34  C   D OP2   1 
ATOM   8709 O  "O5'" . C   D 2 34  ? -42.457 -16.762 5.144   1.00 99.57  ? 34  C   D "O5'" 1 
ATOM   8710 C  "C5'" . C   D 2 34  ? -42.656 -17.978 5.851   1.00 101.74 ? 34  C   D "C5'" 1 
ATOM   8711 C  "C4'" . C   D 2 34  ? -41.603 -19.016 5.505   1.00 102.82 ? 34  C   D "C4'" 1 
ATOM   8712 O  "O4'" . C   D 2 34  ? -41.330 -18.973 4.086   1.00 101.93 ? 34  C   D "O4'" 1 
ATOM   8713 C  "C3'" . C   D 2 34  ? -40.233 -18.819 6.139   1.00 103.78 ? 34  C   D "C3'" 1 
ATOM   8714 O  "O3'" . C   D 2 34  ? -40.222 -19.328 7.473   1.00 105.69 ? 34  C   D "O3'" 1 
ATOM   8715 C  "C2'" . C   D 2 34  ? -39.329 -19.618 5.200   1.00 104.22 ? 34  C   D "C2'" 1 
ATOM   8716 O  "O2'" . C   D 2 34  ? -39.163 -20.950 5.647   1.00 106.76 ? 34  C   D "O2'" 1 
ATOM   8717 C  "C1'" . C   D 2 34  ? -40.089 -19.609 3.868   1.00 102.34 ? 34  C   D "C1'" 1 
ATOM   8718 N  N1    . C   D 2 34  ? -39.369 -18.953 2.727   1.00 101.15 ? 34  C   D N1    1 
ATOM   8719 C  C2    . C   D 2 34  ? -38.536 -19.735 1.903   1.00 102.60 ? 34  C   D C2    1 
ATOM   8720 O  O2    . C   D 2 34  ? -38.404 -20.945 2.126   1.00 104.38 ? 34  C   D O2    1 
ATOM   8721 N  N3    . C   D 2 34  ? -37.883 -19.149 0.869   1.00 101.94 ? 34  C   D N3    1 
ATOM   8722 C  C4    . C   D 2 34  ? -38.038 -17.846 0.646   1.00 100.15 ? 34  C   D C4    1 
ATOM   8723 N  N4    . C   D 2 34  ? -37.370 -17.323 -0.388  1.00 100.22 ? 34  C   D N4    1 
ATOM   8724 C  C5    . C   D 2 34  ? -38.884 -17.033 1.467   1.00 98.59  ? 34  C   D C5    1 
ATOM   8725 C  C6    . C   D 2 34  ? -39.522 -17.616 2.487   1.00 98.85  ? 34  C   D C6    1 
HETATM 8726 N  N1    . CTP E 3 .   ? -4.003  49.124  -36.732 1.00 33.73  ? 501 CTP A N1    1 
HETATM 8727 C  C2    . CTP E 3 .   ? -4.114  47.737  -36.858 1.00 34.11  ? 501 CTP A C2    1 
HETATM 8728 N  N3    . CTP E 3 .   ? -4.725  47.007  -35.850 1.00 35.41  ? 501 CTP A N3    1 
HETATM 8729 C  C4    . CTP E 3 .   ? -5.117  47.607  -34.658 1.00 34.44  ? 501 CTP A C4    1 
HETATM 8730 C  C5    . CTP E 3 .   ? -4.931  48.978  -34.507 1.00 33.92  ? 501 CTP A C5    1 
HETATM 8731 C  C6    . CTP E 3 .   ? -4.451  49.723  -35.581 1.00 33.61  ? 501 CTP A C6    1 
HETATM 8732 O  O2    . CTP E 3 .   ? -3.687  47.114  -37.832 1.00 33.30  ? 501 CTP A O2    1 
HETATM 8733 N  N4    . CTP E 3 .   ? -5.658  46.874  -33.675 1.00 33.53  ? 501 CTP A N4    1 
HETATM 8734 C  "C1'" . CTP E 3 .   ? -3.373  49.972  -37.773 1.00 33.76  ? 501 CTP A "C1'" 1 
HETATM 8735 C  "C2'" . CTP E 3 .   ? -4.276  50.102  -38.982 1.00 34.26  ? 501 CTP A "C2'" 1 
HETATM 8736 O  "O2'" . CTP E 3 .   ? -3.445  50.054  -40.114 1.00 34.58  ? 501 CTP A "O2'" 1 
HETATM 8737 C  "C3'" . CTP E 3 .   ? -4.932  51.462  -38.828 1.00 33.94  ? 501 CTP A "C3'" 1 
HETATM 8738 C  "C4'" . CTP E 3 .   ? -3.859  52.261  -38.096 1.00 34.36  ? 501 CTP A "C4'" 1 
HETATM 8739 O  "O4'" . CTP E 3 .   ? -3.181  51.302  -37.298 1.00 34.59  ? 501 CTP A "O4'" 1 
HETATM 8740 O  "O3'" . CTP E 3 .   ? -5.308  52.034  -40.061 1.00 33.26  ? 501 CTP A "O3'" 1 
HETATM 8741 C  "C5'" . CTP E 3 .   ? -4.396  53.382  -37.219 1.00 34.28  ? 501 CTP A "C5'" 1 
HETATM 8742 O  "O5'" . CTP E 3 .   ? -5.274  52.826  -36.265 1.00 36.01  ? 501 CTP A "O5'" 1 
HETATM 8743 P  PA    . CTP E 3 .   ? -6.194  53.725  -35.291 1.00 36.72  ? 501 CTP A PA    1 
HETATM 8744 O  O1A   . CTP E 3 .   ? -5.604  55.113  -35.179 1.00 36.90  ? 501 CTP A O1A   1 
HETATM 8745 O  O2A   . CTP E 3 .   ? -6.305  53.057  -33.939 1.00 37.07  ? 501 CTP A O2A   1 
HETATM 8746 O  O3A   . CTP E 3 .   ? -7.675  53.839  -35.949 1.00 37.61  ? 501 CTP A O3A   1 
HETATM 8747 P  PB    . CTP E 3 .   ? -7.935  54.161  -37.511 1.00 37.27  ? 501 CTP A PB    1 
HETATM 8748 O  O1B   . CTP E 3 .   ? -7.596  52.895  -38.266 1.00 37.32  ? 501 CTP A O1B   1 
HETATM 8749 O  O2B   . CTP E 3 .   ? -7.111  55.346  -37.957 1.00 36.27  ? 501 CTP A O2B   1 
HETATM 8750 O  O3B   . CTP E 3 .   ? -9.515  54.473  -37.700 1.00 37.90  ? 501 CTP A O3B   1 
HETATM 8751 P  PG    . CTP E 3 .   ? -10.413 55.233  -36.590 1.00 38.10  ? 501 CTP A PG    1 
HETATM 8752 O  O1G   . CTP E 3 .   ? -9.563  56.350  -36.046 1.00 38.42  ? 501 CTP A O1G   1 
HETATM 8753 O  O2G   . CTP E 3 .   ? -11.683 55.829  -37.181 1.00 36.97  ? 501 CTP A O2G   1 
HETATM 8754 O  O3G   . CTP E 3 .   ? -10.731 54.230  -35.497 1.00 38.00  ? 501 CTP A O3G   1 
HETATM 8755 S  S     . SO4 F 4 .   ? -5.688  30.277  -14.350 1.00 64.74  ? 601 SO4 A S     1 
HETATM 8756 O  O1    . SO4 F 4 .   ? -5.862  31.190  -15.479 1.00 65.59  ? 601 SO4 A O1    1 
HETATM 8757 O  O2    . SO4 F 4 .   ? -6.952  29.569  -14.138 1.00 64.90  ? 601 SO4 A O2    1 
HETATM 8758 O  O3    . SO4 F 4 .   ? -4.610  29.334  -14.631 1.00 64.11  ? 601 SO4 A O3    1 
HETATM 8759 O  O4    . SO4 F 4 .   ? -5.345  31.043  -13.159 1.00 64.70  ? 601 SO4 A O4    1 
HETATM 8760 S  S     . SO4 G 4 .   ? -0.211  46.950  -54.108 1.00 68.76  ? 602 SO4 A S     1 
HETATM 8761 O  O1    . SO4 G 4 .   ? -1.217  47.350  -55.089 1.00 68.57  ? 602 SO4 A O1    1 
HETATM 8762 O  O2    . SO4 G 4 .   ? -0.388  45.554  -53.687 1.00 67.37  ? 602 SO4 A O2    1 
HETATM 8763 O  O3    . SO4 G 4 .   ? 1.103   47.097  -54.733 1.00 68.91  ? 602 SO4 A O3    1 
HETATM 8764 O  O4    . SO4 G 4 .   ? -0.320  47.844  -52.949 1.00 68.64  ? 602 SO4 A O4    1 
HETATM 8765 S  S     . SO4 H 4 .   ? 13.084  60.273  -39.187 1.00 90.71  ? 603 SO4 A S     1 
HETATM 8766 O  O1    . SO4 H 4 .   ? 13.991  61.366  -38.842 1.00 91.09  ? 603 SO4 A O1    1 
HETATM 8767 O  O2    . SO4 H 4 .   ? 11.698  60.641  -38.907 1.00 90.56  ? 603 SO4 A O2    1 
HETATM 8768 O  O3    . SO4 H 4 .   ? 13.280  59.981  -40.601 1.00 90.93  ? 603 SO4 A O3    1 
HETATM 8769 O  O4    . SO4 H 4 .   ? 13.395  59.082  -38.408 1.00 90.95  ? 603 SO4 A O4    1 
HETATM 8770 S  S     . SO4 I 4 .   ? -12.866 35.189  -27.405 1.00 65.31  ? 604 SO4 A S     1 
HETATM 8771 O  O1    . SO4 I 4 .   ? -12.557 33.812  -27.019 1.00 65.11  ? 604 SO4 A O1    1 
HETATM 8772 O  O2    . SO4 I 4 .   ? -12.266 36.187  -26.510 1.00 65.75  ? 604 SO4 A O2    1 
HETATM 8773 O  O3    . SO4 I 4 .   ? -12.344 35.417  -28.750 1.00 65.97  ? 604 SO4 A O3    1 
HETATM 8774 O  O4    . SO4 I 4 .   ? -14.314 35.351  -27.347 1.00 65.74  ? 604 SO4 A O4    1 
HETATM 8775 S  S     . SO4 J 4 .   ? 1.174   51.858  -17.327 1.00 81.25  ? 606 SO4 A S     1 
HETATM 8776 O  O1    . SO4 J 4 .   ? 2.227   51.625  -18.315 1.00 81.26  ? 606 SO4 A O1    1 
HETATM 8777 O  O2    . SO4 J 4 .   ? 1.467   51.138  -16.087 1.00 81.53  ? 606 SO4 A O2    1 
HETATM 8778 O  O3    . SO4 J 4 .   ? 1.087   53.295  -17.068 1.00 81.56  ? 606 SO4 A O3    1 
HETATM 8779 O  O4    . SO4 J 4 .   ? -0.103  51.371  -17.830 1.00 81.12  ? 606 SO4 A O4    1 
HETATM 8780 C  C1    . EDO K 5 .   ? -8.174  44.284  -56.087 1.00 26.02  ? 701 EDO A C1    1 
HETATM 8781 O  O1    . EDO K 5 .   ? -6.892  43.758  -55.754 1.00 24.20  ? 701 EDO A O1    1 
HETATM 8782 C  C2    . EDO K 5 .   ? -8.839  44.820  -54.824 1.00 27.94  ? 701 EDO A C2    1 
HETATM 8783 O  O2    . EDO K 5 .   ? -9.491  46.078  -55.078 1.00 28.88  ? 701 EDO A O2    1 
HETATM 8784 C  C1    . EDO L 5 .   ? -21.305 18.234  -2.117  1.00 62.55  ? 702 EDO A C1    1 
HETATM 8785 O  O1    . EDO L 5 .   ? -21.596 18.462  -0.734  1.00 61.81  ? 702 EDO A O1    1 
HETATM 8786 C  C2    . EDO L 5 .   ? -21.296 19.575  -2.841  1.00 62.51  ? 702 EDO A C2    1 
HETATM 8787 O  O2    . EDO L 5 .   ? -19.944 20.035  -2.963  1.00 62.77  ? 702 EDO A O2    1 
HETATM 8788 CA CA    . CA  M 6 .   ? -6.624  57.558  -35.426 1.00 40.31  ? 801 CA  A CA    1 
HETATM 8789 N  N1    . CTP N 3 .   ? -34.935 -19.520 2.954   0.80 64.13  ? 502 CTP B N1    1 
HETATM 8790 C  C2    . CTP N 3 .   ? -34.366 -19.173 1.726   0.80 63.66  ? 502 CTP B C2    1 
HETATM 8791 N  N3    . CTP N 3 .   ? -34.392 -17.852 1.322   0.80 63.84  ? 502 CTP B N3    1 
HETATM 8792 C  C4    . CTP N 3 .   ? -34.427 -16.868 2.298   0.80 64.07  ? 502 CTP B C4    1 
HETATM 8793 C  C5    . CTP N 3 .   ? -34.722 -17.219 3.615   0.80 63.93  ? 502 CTP B C5    1 
HETATM 8794 C  C6    . CTP N 3 .   ? -35.132 -18.522 3.883   0.80 64.14  ? 502 CTP B C6    1 
HETATM 8795 O  O2    . CTP N 3 .   ? -33.817 -19.992 0.994   0.80 62.97  ? 502 CTP B O2    1 
HETATM 8796 N  N4    . CTP N 3 .   ? -34.182 -15.599 1.982   0.80 63.89  ? 502 CTP B N4    1 
HETATM 8797 C  "C1'" . CTP N 3 .   ? -35.212 -20.934 3.323   0.80 63.92  ? 502 CTP B "C1'" 1 
HETATM 8798 C  "C2'" . CTP N 3 .   ? -33.957 -21.593 3.875   0.80 64.15  ? 502 CTP B "C2'" 1 
HETATM 8799 O  "O2'" . CTP N 3 .   ? -33.862 -22.904 3.362   0.80 64.56  ? 502 CTP B "O2'" 1 
HETATM 8800 C  "C3'" . CTP N 3 .   ? -34.158 -21.602 5.379   0.80 63.84  ? 502 CTP B "C3'" 1 
HETATM 8801 C  "C4'" . CTP N 3 .   ? -35.667 -21.696 5.487   0.80 64.20  ? 502 CTP B "C4'" 1 
HETATM 8802 O  "O4'" . CTP N 3 .   ? -36.181 -21.015 4.358   0.80 63.84  ? 502 CTP B "O4'" 1 
HETATM 8803 O  "O3'" . CTP N 3 .   ? -33.520 -22.681 6.026   0.80 63.13  ? 502 CTP B "O3'" 1 
HETATM 8804 C  "C5'" . CTP N 3 .   ? -36.171 -21.079 6.774   0.80 64.95  ? 502 CTP B "C5'" 1 
HETATM 8805 O  "O5'" . CTP N 3 .   ? -35.874 -19.706 6.771   0.80 65.95  ? 502 CTP B "O5'" 1 
HETATM 8806 P  PA    . CTP N 3 .   ? -36.659 -18.733 7.776   0.80 66.43  ? 502 CTP B PA    1 
HETATM 8807 O  O1A   . CTP N 3 .   ? -37.724 -19.518 8.513   0.80 66.29  ? 502 CTP B O1A   1 
HETATM 8808 O  O2A   . CTP N 3 .   ? -37.248 -17.582 7.000   0.80 66.56  ? 502 CTP B O2A   1 
HETATM 8809 O  O3A   . CTP N 3 .   ? -35.549 -18.214 8.832   0.80 66.98  ? 502 CTP B O3A   1 
HETATM 8810 P  PB    . CTP N 3 .   ? -34.607 -19.248 9.637   0.80 67.03  ? 502 CTP B PB    1 
HETATM 8811 O  O1B   . CTP N 3 .   ? -33.758 -20.013 8.640   0.80 66.78  ? 502 CTP B O1B   1 
HETATM 8812 O  O2B   . CTP N 3 .   ? -35.443 -20.186 10.475  0.80 67.17  ? 502 CTP B O2B   1 
HETATM 8813 O  O3B   . CTP N 3 .   ? -33.681 -18.315 10.564  0.80 66.63  ? 502 CTP B O3B   1 
HETATM 8814 P  PG    . CTP N 3 .   ? -34.185 -17.802 12.003  0.80 67.01  ? 502 CTP B PG    1 
HETATM 8815 O  O1G   . CTP N 3 .   ? -34.902 -18.923 12.715  0.80 67.06  ? 502 CTP B O1G   1 
HETATM 8816 O  O2G   . CTP N 3 .   ? -33.015 -17.358 12.852  0.80 66.84  ? 502 CTP B O2G   1 
HETATM 8817 O  O3G   . CTP N 3 .   ? -35.119 -16.637 11.807  0.80 66.87  ? 502 CTP B O3G   1 
HETATM 8818 S  S     . SO4 O 4 .   ? -36.888 4.781   -12.728 1.00 67.67  ? 605 SO4 B S     1 
HETATM 8819 O  O1    . SO4 O 4 .   ? -36.649 3.410   -12.286 1.00 67.53  ? 605 SO4 B O1    1 
HETATM 8820 O  O2    . SO4 O 4 .   ? -35.894 5.663   -12.110 1.00 67.53  ? 605 SO4 B O2    1 
HETATM 8821 O  O3    . SO4 O 4 .   ? -36.788 4.833   -14.184 1.00 67.93  ? 605 SO4 B O3    1 
HETATM 8822 O  O4    . SO4 O 4 .   ? -38.232 5.205   -12.349 1.00 67.75  ? 605 SO4 B O4    1 
HETATM 8823 C  C1    . EDO P 5 .   ? -19.621 22.861  -30.240 1.00 73.33  ? 703 EDO B C1    1 
HETATM 8824 O  O1    . EDO P 5 .   ? -19.266 24.232  -30.465 1.00 72.39  ? 703 EDO B O1    1 
HETATM 8825 C  C2    . EDO P 5 .   ? -19.135 22.417  -28.863 1.00 73.14  ? 703 EDO B C2    1 
HETATM 8826 O  O2    . EDO P 5 .   ? -20.179 22.630  -27.905 1.00 72.95  ? 703 EDO B O2    1 
HETATM 8827 O  O     . HOH Q 7 .   ? -24.263 53.647  -13.797 1.00 43.95  ? 442 HOH A O     1 
HETATM 8828 O  O     . HOH Q 7 .   ? -2.937  60.489  -40.661 1.00 28.42  ? 443 HOH A O     1 
HETATM 8829 O  O     . HOH Q 7 .   ? 2.361   61.841  -46.174 1.00 18.57  ? 444 HOH A O     1 
HETATM 8830 O  O     . HOH Q 7 .   ? 6.210   76.037  -38.699 1.00 39.42  ? 445 HOH A O     1 
HETATM 8831 O  O     . HOH Q 7 .   ? 3.863   55.198  -20.290 1.00 30.00  ? 446 HOH A O     1 
HETATM 8832 O  O     . HOH Q 7 .   ? -20.368 36.412  -16.270 1.00 31.03  ? 447 HOH A O     1 
HETATM 8833 O  O     . HOH Q 7 .   ? -13.596 33.392  -32.911 1.00 27.87  ? 448 HOH A O     1 
HETATM 8834 O  O     . HOH Q 7 .   ? 14.770  66.213  -34.458 1.00 5.31   ? 449 HOH A O     1 
HETATM 8835 O  O     . HOH Q 7 .   ? -23.053 57.018  -35.371 1.00 37.29  ? 450 HOH A O     1 
HETATM 8836 O  O     . HOH Q 7 .   ? -18.322 44.385  -17.589 1.00 20.26  ? 451 HOH A O     1 
HETATM 8837 O  O     . HOH Q 7 .   ? 8.468   62.813  -45.552 1.00 39.71  ? 452 HOH A O     1 
HETATM 8838 O  O     . HOH Q 7 .   ? -10.716 30.799  -9.009  1.00 29.23  ? 453 HOH A O     1 
HETATM 8839 O  O     . HOH Q 7 .   ? 11.003  67.681  -21.748 1.00 72.70  ? 454 HOH A O     1 
HETATM 8840 O  O     . HOH Q 7 .   ? -2.940  31.290  -1.543  1.00 37.07  ? 455 HOH A O     1 
HETATM 8841 O  O     . HOH Q 7 .   ? -10.196 30.684  0.731   1.00 23.01  ? 456 HOH A O     1 
HETATM 8842 O  O     . HOH Q 7 .   ? 2.483   69.743  -22.753 1.00 39.01  ? 457 HOH A O     1 
HETATM 8843 O  O     . HOH Q 7 .   ? -22.112 26.542  -8.423  1.00 20.00  ? 458 HOH A O     1 
HETATM 8844 O  O     . HOH Q 7 .   ? -15.956 24.710  1.740   1.00 28.98  ? 459 HOH A O     1 
HETATM 8845 O  O     . HOH Q 7 .   ? -8.373  49.397  -23.849 1.00 34.35  ? 460 HOH A O     1 
HETATM 8846 O  O     . HOH Q 7 .   ? -17.686 50.923  -29.514 1.00 31.16  ? 461 HOH A O     1 
HETATM 8847 O  O     . HOH Q 7 .   ? 1.880   46.293  -37.268 1.00 19.19  ? 462 HOH A O     1 
HETATM 8848 O  O     . HOH Q 7 .   ? -18.154 56.693  -50.442 1.00 36.69  ? 463 HOH A O     1 
HETATM 8849 O  O     . HOH Q 7 .   ? 1.345   47.379  -49.674 1.00 28.98  ? 464 HOH A O     1 
HETATM 8850 O  O     . HOH Q 7 .   ? 2.029   37.498  -37.241 1.00 41.11  ? 465 HOH A O     1 
HETATM 8851 O  O     . HOH Q 7 .   ? -6.055  54.637  -20.761 1.00 23.77  ? 466 HOH A O     1 
HETATM 8852 O  O     . HOH Q 7 .   ? -22.173 41.331  -18.179 1.00 21.01  ? 467 HOH A O     1 
HETATM 8853 O  O     . HOH Q 7 .   ? -14.857 26.248  3.815   1.00 21.81  ? 468 HOH A O     1 
HETATM 8854 O  O     . HOH Q 7 .   ? -14.081 23.803  5.145   1.00 26.01  ? 469 HOH A O     1 
HETATM 8855 O  O     . HOH Q 7 .   ? -33.043 47.919  -23.142 1.00 19.67  ? 470 HOH A O     1 
HETATM 8856 O  O     . HOH Q 7 .   ? -16.099 55.941  -8.096  1.00 40.52  ? 471 HOH A O     1 
HETATM 8857 O  O     . HOH Q 7 .   ? -20.216 39.696  -18.765 1.00 22.67  ? 472 HOH A O     1 
HETATM 8858 O  O     . HOH Q 7 .   ? -24.900 53.880  -49.626 1.00 37.03  ? 473 HOH A O     1 
HETATM 8859 O  O     . HOH Q 7 .   ? -13.312 64.912  -32.180 1.00 33.18  ? 474 HOH A O     1 
HETATM 8860 O  O     . HOH Q 7 .   ? -21.386 35.042  -46.225 1.00 32.47  ? 475 HOH A O     1 
HETATM 8861 O  O     . HOH Q 7 .   ? 6.895   42.927  -32.393 1.00 32.41  ? 476 HOH A O     1 
HETATM 8862 O  O     . HOH Q 7 .   ? -5.815  38.841  -47.342 1.00 21.52  ? 477 HOH A O     1 
HETATM 8863 O  O     . HOH Q 7 .   ? -35.009 60.977  -38.669 1.00 68.89  ? 478 HOH A O     1 
HETATM 8864 O  O     . HOH Q 7 .   ? -17.779 3.690   -7.198  1.00 44.48  ? 479 HOH A O     1 
HETATM 8865 O  O     . HOH Q 7 .   ? -16.034 66.003  -31.634 1.00 52.19  ? 480 HOH A O     1 
HETATM 8866 O  O     . HOH Q 7 .   ? -36.408 45.070  -24.338 1.00 36.58  ? 481 HOH A O     1 
HETATM 8867 O  O     . HOH Q 7 .   ? -3.522  51.062  -5.679  1.00 36.63  ? 482 HOH A O     1 
HETATM 8868 O  O     . HOH Q 7 .   ? 6.017   50.055  -19.998 1.00 45.10  ? 483 HOH A O     1 
HETATM 8869 O  O     . HOH Q 7 .   ? -39.719 53.956  -11.084 1.00 46.30  ? 484 HOH A O     1 
HETATM 8870 O  O     . HOH Q 7 .   ? 18.398  58.031  -41.722 1.00 27.55  ? 485 HOH A O     1 
HETATM 8871 O  O     . HOH Q 7 .   ? -2.284  37.911  -47.275 1.00 29.56  ? 486 HOH A O     1 
HETATM 8872 O  O     . HOH Q 7 .   ? 9.212   72.291  -36.377 1.00 24.23  ? 487 HOH A O     1 
HETATM 8873 O  O     . HOH Q 7 .   ? -8.348  35.706  -18.016 1.00 29.02  ? 488 HOH A O     1 
HETATM 8874 O  O     . HOH Q 7 .   ? -11.193 52.942  -32.735 1.00 22.24  ? 489 HOH A O     1 
HETATM 8875 O  O     . HOH Q 7 .   ? -28.533 41.475  -21.604 1.00 38.94  ? 490 HOH A O     1 
HETATM 8876 O  O     . HOH Q 7 .   ? -7.857  50.205  -36.994 1.00 40.14  ? 491 HOH A O     1 
HETATM 8877 O  O     . HOH Q 7 .   ? -35.692 55.006  -39.014 1.00 44.46  ? 492 HOH A O     1 
HETATM 8878 O  O     . HOH Q 7 .   ? -16.858 39.929  -25.091 1.00 37.59  ? 493 HOH A O     1 
HETATM 8879 O  O     . HOH Q 7 .   ? -8.048  28.949  -39.316 1.00 24.98  ? 494 HOH A O     1 
HETATM 8880 O  O     . HOH Q 7 .   ? -21.080 28.412  -28.467 1.00 22.81  ? 495 HOH A O     1 
HETATM 8881 O  O     . HOH Q 7 .   ? -33.101 40.110  -47.110 1.00 46.55  ? 496 HOH A O     1 
HETATM 8882 O  O     . HOH Q 7 .   ? -33.330 37.708  -35.964 1.00 36.97  ? 497 HOH A O     1 
HETATM 8883 O  O     . HOH Q 7 .   ? -28.761 51.031  -30.748 1.00 31.53  ? 498 HOH A O     1 
HETATM 8884 O  O     . HOH Q 7 .   ? -2.823  42.465  -52.417 1.00 23.93  ? 499 HOH A O     1 
HETATM 8885 O  O     . HOH Q 7 .   ? -12.483 25.249  -30.029 1.00 54.80  ? 500 HOH A O     1 
HETATM 8886 O  O     . HOH Q 7 .   ? -30.388 47.321  -31.733 1.00 28.50  ? 502 HOH A O     1 
HETATM 8887 O  O     . HOH Q 7 .   ? -29.355 47.788  -26.185 1.00 33.50  ? 503 HOH A O     1 
HETATM 8888 O  O     . HOH Q 7 .   ? -11.134 54.003  -17.325 1.00 41.31  ? 504 HOH A O     1 
HETATM 8889 O  O     . HOH Q 7 .   ? -0.090  51.128  0.505   1.00 48.24  ? 505 HOH A O     1 
HETATM 8890 O  O     . HOH Q 7 .   ? -26.745 56.654  -15.590 1.00 38.90  ? 506 HOH A O     1 
HETATM 8891 O  O     . HOH Q 7 .   ? -7.495  15.425  12.511  1.00 52.44  ? 507 HOH A O     1 
HETATM 8892 O  O     . HOH Q 7 .   ? -2.627  52.419  -41.736 1.00 19.02  ? 508 HOH A O     1 
HETATM 8893 O  O     . HOH Q 7 .   ? -9.688  53.146  -40.445 1.00 18.36  ? 509 HOH A O     1 
HETATM 8894 O  O     . HOH R 7 .   ? -39.806 0.485   12.489  1.00 42.83  ? 442 HOH B O     1 
HETATM 8895 O  O     . HOH R 7 .   ? -36.028 33.456  -3.762  1.00 32.88  ? 443 HOH B O     1 
HETATM 8896 O  O     . HOH R 7 .   ? -25.610 39.843  -25.269 1.00 34.64  ? 444 HOH B O     1 
HETATM 8897 O  O     . HOH R 7 .   ? -30.801 -5.420  -1.736  1.00 43.23  ? 445 HOH B O     1 
HETATM 8898 O  O     . HOH R 7 .   ? -27.565 -3.319  -3.901  1.00 29.24  ? 446 HOH B O     1 
HETATM 8899 O  O     . HOH R 7 .   ? -25.095 27.416  10.875  1.00 27.12  ? 447 HOH B O     1 
HETATM 8900 O  O     . HOH R 7 .   ? -29.474 4.477   -0.715  1.00 44.74  ? 448 HOH B O     1 
HETATM 8901 O  O     . HOH R 7 .   ? -54.295 4.609   2.058   1.00 32.54  ? 449 HOH B O     1 
HETATM 8902 O  O     . HOH R 7 .   ? -59.893 8.007   -3.745  1.00 43.90  ? 450 HOH B O     1 
HETATM 8903 O  O     . HOH R 7 .   ? -55.349 9.378   3.006   1.00 38.82  ? 451 HOH B O     1 
HETATM 8904 O  O     . HOH R 7 .   ? -28.558 19.491  -6.590  1.00 26.43  ? 452 HOH B O     1 
HETATM 8905 O  O     . HOH R 7 .   ? -39.408 31.779  -17.437 1.00 38.87  ? 453 HOH B O     1 
HETATM 8906 O  O     . HOH R 7 .   ? -42.756 19.833  -10.698 1.00 29.51  ? 454 HOH B O     1 
HETATM 8907 O  O     . HOH R 7 .   ? -39.583 17.426  -12.891 1.00 36.83  ? 455 HOH B O     1 
HETATM 8908 O  O     . HOH R 7 .   ? -44.022 32.923  -25.347 1.00 49.60  ? 456 HOH B O     1 
HETATM 8909 O  O     . HOH R 7 .   ? -50.310 19.050  -0.424  1.00 43.75  ? 457 HOH B O     1 
HETATM 8910 O  O     . HOH R 7 .   ? -28.183 -10.912 18.869  1.00 36.47  ? 458 HOH B O     1 
HETATM 8911 O  O     . HOH R 7 .   ? -34.379 4.760   6.041   1.00 37.89  ? 459 HOH B O     1 
HETATM 8912 O  O     . HOH R 7 .   ? -20.655 25.148  -27.800 1.00 30.03  ? 460 HOH B O     1 
HETATM 8913 O  O     . HOH R 7 .   ? -49.525 6.676   18.259  1.00 51.76  ? 461 HOH B O     1 
HETATM 8914 O  O     . HOH R 7 .   ? -32.384 -1.418  3.720   1.00 54.90  ? 462 HOH B O     1 
HETATM 8915 O  O     . HOH R 7 .   ? -39.619 -34.240 9.988   1.00 41.57  ? 463 HOH B O     1 
HETATM 8916 O  O     . HOH R 7 .   ? -39.547 35.842  -5.681  1.00 45.03  ? 464 HOH B O     1 
HETATM 8917 O  O     . HOH R 7 .   ? -55.131 7.001   -5.355  1.00 26.16  ? 465 HOH B O     1 
HETATM 8918 O  O     . HOH S 7 .   ? -10.226 27.912  -3.503  1.00 31.25  ? 35  HOH C O     1 
HETATM 8919 O  O     . HOH S 7 .   ? -2.741  37.120  -35.427 1.00 21.86  ? 47  HOH C O     1 
HETATM 8920 O  O     . HOH S 7 .   ? -7.479  12.529  -7.380  1.00 49.21  ? 50  HOH C O     1 
HETATM 8921 O  O     . HOH T 7 .   ? -50.445 5.176   -12.824 1.00 53.71  ? 54  HOH D O     1 
HETATM 8922 O  O     . HOH T 7 .   ? -28.671 23.434  -28.917 1.00 40.92  ? 60  HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.6616 1.3402 1.1432 0.1404  -0.1510 0.1666  1   MET A N     
2    C CA    . MET A 1   ? 0.6502 1.2658 1.0871 0.1251  -0.1329 0.1503  1   MET A CA    
3    C C     . MET A 1   ? 0.6405 1.2389 1.0301 0.0970  -0.1474 0.1469  1   MET A C     
4    O O     . MET A 1   ? 0.6238 1.2210 0.9984 0.0705  -0.1432 0.1313  1   MET A O     
5    C CB    . MET A 1   ? 0.6308 1.2518 1.0847 0.1161  -0.1095 0.1311  1   MET A CB    
6    C CG    . MET A 1   ? 0.6306 1.1926 1.0421 0.1017  -0.0915 0.1150  1   MET A CG    
7    S SD    . MET A 1   ? 0.6222 1.1766 1.0492 0.1033  -0.0603 0.0966  1   MET A SD    
8    C CE    . MET A 1   ? 0.6153 1.2468 1.0924 0.0936  -0.0620 0.0948  1   MET A CE    
9    N N     . LYS A 2   ? 0.6524 1.2365 1.0181 0.1038  -0.1638 0.1623  2   LYS A N     
10   C CA    . LYS A 2   ? 0.6477 1.2141 0.9666 0.0805  -0.1766 0.1598  2   LYS A CA    
11   C C     . LYS A 2   ? 0.6340 1.1368 0.9119 0.0724  -0.1592 0.1482  2   LYS A C     
12   O O     . LYS A 2   ? 0.6333 1.0996 0.9103 0.0894  -0.1443 0.1504  2   LYS A O     
13   C CB    . LYS A 2   ? 0.6755 1.2505 0.9812 0.0910  -0.1992 0.1814  2   LYS A CB    
14   C CG    . LYS A 2   ? 0.6863 1.2963 0.9758 0.0683  -0.2229 0.1812  2   LYS A CG    
15   C CD    . LYS A 2   ? 0.7166 1.3077 0.9649 0.0707  -0.2389 0.1969  2   LYS A CD    
16   C CE    . LYS A 2   ? 0.7193 1.2728 0.9138 0.0443  -0.2358 0.1822  2   LYS A CE    
17   N NZ    . LYS A 2   ? 0.6867 1.1948 0.8704 0.0367  -0.2102 0.1635  2   LYS A NZ    
18   N N     . VAL A 3   ? 0.6181 1.1086 0.8631 0.0462  -0.1613 0.1356  3   VAL A N     
19   C CA    . VAL A 3   ? 0.6023 1.0396 0.8103 0.0366  -0.1464 0.1238  3   VAL A CA    
20   C C     . VAL A 3   ? 0.6135 1.0102 0.7990 0.0516  -0.1436 0.1353  3   VAL A C     
21   O O     . VAL A 3   ? 0.6098 0.9698 0.7902 0.0582  -0.1263 0.1300  3   VAL A O     
22   C CB    . VAL A 3   ? 0.5996 1.0308 0.7735 0.0092  -0.1529 0.1121  3   VAL A CB    
23   C CG1   . VAL A 3   ? 0.5862 0.9695 0.7305 0.0013  -0.1363 0.0994  3   VAL A CG1   
24   C CG2   . VAL A 3   ? 0.5964 1.0673 0.7913 -0.0084 -0.1578 0.1024  3   VAL A CG2   
25   N N     . GLU A 4   ? 0.6268 1.0308 0.7977 0.0555  -0.1607 0.1511  4   GLU A N     
26   C CA    . GLU A 4   ? 0.6399 1.0057 0.7867 0.0672  -0.1586 0.1643  4   GLU A CA    
27   C C     . GLU A 4   ? 0.6360 0.9881 0.8095 0.0939  -0.1491 0.1755  4   GLU A C     
28   O O     . GLU A 4   ? 0.6454 0.9530 0.8021 0.0999  -0.1372 0.1780  4   GLU A O     
29   C CB    . GLU A 4   ? 0.6709 1.0494 0.7924 0.0641  -0.1794 0.1799  4   GLU A CB    
30   C CG    . GLU A 4   ? 0.6966 1.0607 0.7747 0.0395  -0.1813 0.1678  4   GLU A CG    
31   C CD    . GLU A 4   ? 0.7477 1.1524 0.8176 0.0248  -0.2028 0.1676  4   GLU A CD    
32   O OE1   . GLU A 4   ? 0.7798 1.2098 0.8507 0.0340  -0.2213 0.1864  4   GLU A OE1   
33   O OE2   . GLU A 4   ? 0.7525 1.1626 0.8137 0.0035  -0.2015 0.1486  4   GLU A OE2   
34   N N     . GLU A 5   ? 0.6185 1.0086 0.8346 0.1092  -0.1533 0.1813  5   GLU A N     
35   C CA    . GLU A 5   ? 0.6139 0.9918 0.8594 0.1366  -0.1423 0.1896  5   GLU A CA    
36   C C     . GLU A 5   ? 0.5807 0.9280 0.8296 0.1340  -0.1176 0.1695  5   GLU A C     
37   O O     . GLU A 5   ? 0.5951 0.9056 0.8463 0.1493  -0.1038 0.1713  5   GLU A O     
38   C CB    . GLU A 5   ? 0.6206 1.0530 0.9147 0.1542  -0.1520 0.1992  5   GLU A CB    
39   C CG    . GLU A 5   ? 0.6498 1.1277 0.9453 0.1532  -0.1800 0.2166  5   GLU A CG    
40   C CD    . GLU A 5   ? 0.7058 1.1792 1.0063 0.1807  -0.1914 0.2448  5   GLU A CD    
41   O OE1   . GLU A 5   ? 0.7404 1.1633 1.0067 0.1843  -0.1872 0.2541  5   GLU A OE1   
42   O OE2   . GLU A 5   ? 0.7103 1.2320 1.0495 0.1986  -0.2049 0.2587  5   GLU A OE2   
43   N N     . ILE A 6   ? 0.5327 0.8941 0.7804 0.1138  -0.1122 0.1505  6   ILE A N     
44   C CA    . ILE A 6   ? 0.4949 0.8305 0.7408 0.1086  -0.0906 0.1314  6   ILE A CA    
45   C C     . ILE A 6   ? 0.4888 0.7706 0.6972 0.1021  -0.0820 0.1274  6   ILE A C     
46   O O     . ILE A 6   ? 0.4918 0.7416 0.7012 0.1104  -0.0660 0.1213  6   ILE A O     
47   C CB    . ILE A 6   ? 0.4674 0.8273 0.7143 0.0866  -0.0884 0.1149  6   ILE A CB    
48   C CG1   . ILE A 6   ? 0.4559 0.8678 0.7468 0.0928  -0.0897 0.1151  6   ILE A CG1   
49   C CG2   . ILE A 6   ? 0.4548 0.7806 0.6844 0.0771  -0.0693 0.0971  6   ILE A CG2   
50   C CD1   . ILE A 6   ? 0.4657 0.8753 0.7856 0.1107  -0.0699 0.1091  6   ILE A CD1   
51   N N     . LEU A 7   ? 0.4752 0.7491 0.6512 0.0867  -0.0923 0.1300  7   LEU A N     
52   C CA    . LEU A 7   ? 0.4650 0.6952 0.6069 0.0781  -0.0848 0.1262  7   LEU A CA    
53   C C     . LEU A 7   ? 0.4913 0.6894 0.6285 0.0936  -0.0819 0.1408  7   LEU A C     
54   O O     . LEU A 7   ? 0.4964 0.6563 0.6169 0.0899  -0.0700 0.1354  7   LEU A O     
55   C CB    . LEU A 7   ? 0.4590 0.6927 0.5694 0.0592  -0.0957 0.1255  7   LEU A CB    
56   C CG    . LEU A 7   ? 0.4205 0.6752 0.5286 0.0409  -0.0974 0.1101  7   LEU A CG    
57   C CD1   . LEU A 7   ? 0.4109 0.6700 0.4896 0.0256  -0.1095 0.1109  7   LEU A CD1   
58   C CD2   . LEU A 7   ? 0.3806 0.6126 0.4828 0.0334  -0.0811 0.0933  7   LEU A CD2   
59   N N     . GLU A 8   ? 0.5098 0.7234 0.6623 0.1106  -0.0930 0.1601  8   GLU A N     
60   C CA    . GLU A 8   ? 0.5435 0.7235 0.6933 0.1275  -0.0897 0.1764  8   GLU A CA    
61   C C     . GLU A 8   ? 0.5438 0.6983 0.7154 0.1418  -0.0711 0.1680  8   GLU A C     
62   O O     . GLU A 8   ? 0.5668 0.6764 0.7254 0.1445  -0.0602 0.1696  8   GLU A O     
63   C CB    . GLU A 8   ? 0.5737 0.7773 0.7331 0.1438  -0.1080 0.2016  8   GLU A CB    
64   C CG    . GLU A 8   ? 0.6055 0.8224 0.7320 0.1287  -0.1253 0.2111  8   GLU A CG    
65   C CD    . GLU A 8   ? 0.6767 0.9017 0.7996 0.1445  -0.1422 0.2400  8   GLU A CD    
66   O OE1   . GLU A 8   ? 0.7177 0.9176 0.8044 0.1379  -0.1450 0.2517  8   GLU A OE1   
67   O OE2   . GLU A 8   ? 0.6833 0.9415 0.8393 0.1636  -0.1527 0.2518  8   GLU A OE2   
68   N N     . LYS A 9   ? 0.5231 0.7059 0.7266 0.1493  -0.0663 0.1579  9   LYS A N     
69   C CA    . LYS A 9   ? 0.5267 0.6872 0.7479 0.1605  -0.0465 0.1451  9   LYS A CA    
70   C C     . LYS A 9   ? 0.5096 0.6399 0.7061 0.1407  -0.0323 0.1236  9   LYS A C     
71   O O     . LYS A 9   ? 0.5259 0.6169 0.7181 0.1447  -0.0175 0.1160  9   LYS A O     
72   C CB    . LYS A 9   ? 0.5133 0.7172 0.7734 0.1714  -0.0438 0.1388  9   LYS A CB    
73   C CG    . LYS A 9   ? 0.5452 0.7705 0.8401 0.1997  -0.0505 0.1576  9   LYS A CG    
74   C CD    . LYS A 9   ? 0.5478 0.8391 0.8694 0.1982  -0.0659 0.1622  9   LYS A CD    
75   C CE    . LYS A 9   ? 0.5636 0.8882 0.9347 0.2270  -0.0644 0.1707  9   LYS A CE    
76   N NZ    . LYS A 9   ? 0.5503 0.8869 0.9458 0.2285  -0.0436 0.1496  9   LYS A NZ    
77   N N     . ALA A 10  ? 0.4786 0.6273 0.6589 0.1194  -0.0375 0.1141  10  ALA A N     
78   C CA    . ALA A 10  ? 0.4613 0.5887 0.6193 0.1012  -0.0273 0.0958  10  ALA A CA    
79   C C     . ALA A 10  ? 0.4811 0.5650 0.6139 0.0958  -0.0230 0.0983  10  ALA A C     
80   O O     . ALA A 10  ? 0.4819 0.5409 0.6041 0.0874  -0.0110 0.0837  10  ALA A O     
81   C CB    . ALA A 10  ? 0.4317 0.5848 0.5764 0.0819  -0.0359 0.0896  10  ALA A CB    
82   N N     . LEU A 11  ? 0.4996 0.5765 0.6227 0.0996  -0.0329 0.1172  11  LEU A N     
83   C CA    . LEU A 11  ? 0.5212 0.5579 0.6214 0.0940  -0.0283 0.1228  11  LEU A CA    
84   C C     . LEU A 11  ? 0.5493 0.5464 0.6580 0.1037  -0.0128 0.1180  11  LEU A C     
85   O O     . LEU A 11  ? 0.5590 0.5247 0.6514 0.0915  -0.0033 0.1092  11  LEU A O     
86   C CB    . LEU A 11  ? 0.5406 0.5779 0.6286 0.0984  -0.0413 0.1468  11  LEU A CB    
87   C CG    . LEU A 11  ? 0.5225 0.5896 0.5922 0.0858  -0.0562 0.1517  11  LEU A CG    
88   C CD1   . LEU A 11  ? 0.5568 0.6197 0.6121 0.0922  -0.0674 0.1764  11  LEU A CD1   
89   C CD2   . LEU A 11  ? 0.4900 0.5515 0.5355 0.0637  -0.0515 0.1369  11  LEU A CD2   
90   N N     . GLU A 12  ? 0.5659 0.5653 0.7008 0.1253  -0.0099 0.1227  12  GLU A N     
91   C CA    . GLU A 12  ? 0.5999 0.5584 0.7432 0.1365  0.0061  0.1167  12  GLU A CA    
92   C C     . GLU A 12  ? 0.5810 0.5306 0.7215 0.1249  0.0206  0.0893  12  GLU A C     
93   O O     . GLU A 12  ? 0.6121 0.5218 0.7495 0.1257  0.0345  0.0795  12  GLU A O     
94   C CB    . GLU A 12  ? 0.6257 0.5912 0.8003 0.1653  0.0067  0.1281  12  GLU A CB    
95   C CG    . GLU A 12  ? 0.6787 0.6396 0.8539 0.1804  -0.0060 0.1579  12  GLU A CG    
96   C CD    . GLU A 12  ? 0.7219 0.7175 0.9326 0.2074  -0.0135 0.1710  12  GLU A CD    
97   O OE1   . GLU A 12  ? 0.7124 0.7493 0.9454 0.2089  -0.0129 0.1583  12  GLU A OE1   
98   O OE2   . GLU A 12  ? 0.7618 0.7451 0.9790 0.2272  -0.0200 0.1950  12  GLU A OE2   
99   N N     . LEU A 13  ? 0.5358 0.5207 0.6753 0.1132  0.0171  0.0772  13  LEU A N     
100  C CA    . LEU A 13  ? 0.5153 0.4958 0.6470 0.1002  0.0283  0.0531  13  LEU A CA    
101  C C     . LEU A 13  ? 0.4966 0.4645 0.6008 0.0771  0.0267  0.0458  13  LEU A C     
102  O O     . LEU A 13  ? 0.4958 0.4537 0.5910 0.0664  0.0354  0.0275  13  LEU A O     
103  C CB    . LEU A 13  ? 0.4860 0.5093 0.6297 0.0991  0.0266  0.0447  13  LEU A CB    
104  C CG    . LEU A 13  ? 0.4918 0.5408 0.6672 0.1191  0.0297  0.0476  13  LEU A CG    
105  C CD1   . LEU A 13  ? 0.4604 0.5525 0.6420 0.1102  0.0266  0.0406  13  LEU A CD1   
106  C CD2   . LEU A 13  ? 0.5235 0.5460 0.7100 0.1328  0.0482  0.0351  13  LEU A CD2   
107  N N     . VAL A 14  ? 0.4845 0.4562 0.5755 0.0695  0.0158  0.0598  14  VAL A N     
108  C CA    . VAL A 14  ? 0.4609 0.4302 0.5298 0.0487  0.0140  0.0531  14  VAL A CA    
109  C C     . VAL A 14  ? 0.4800 0.4208 0.5340 0.0413  0.0147  0.0632  14  VAL A C     
110  O O     . VAL A 14  ? 0.4727 0.4068 0.5129 0.0247  0.0174  0.0548  14  VAL A O     
111  C CB    . VAL A 14  ? 0.4246 0.4302 0.4873 0.0405  0.0030  0.0537  14  VAL A CB    
112  C CG1   . VAL A 14  ? 0.4018 0.4341 0.4787 0.0451  0.0038  0.0444  14  VAL A CG1   
113  C CG2   . VAL A 14  ? 0.4322 0.4500 0.4915 0.0443  -0.0090 0.0729  14  VAL A CG2   
114  N N     . ILE A 15  ? 0.5054 0.4315 0.5628 0.0534  0.0122  0.0822  15  ILE A N     
115  C CA    . ILE A 15  ? 0.5328 0.4271 0.5754 0.0464  0.0153  0.0936  15  ILE A CA    
116  C C     . ILE A 15  ? 0.5673 0.4190 0.6145 0.0477  0.0293  0.0855  15  ILE A C     
117  O O     . ILE A 15  ? 0.5884 0.4282 0.6513 0.0652  0.0339  0.0858  15  ILE A O     
118  C CB    . ILE A 15  ? 0.5512 0.4459 0.5908 0.0581  0.0060  0.1199  15  ILE A CB    
119  C CG1   . ILE A 15  ? 0.5325 0.4647 0.5602 0.0509  -0.0071 0.1253  15  ILE A CG1   
120  C CG2   . ILE A 15  ? 0.5803 0.4339 0.6058 0.0532  0.0124  0.1333  15  ILE A CG2   
121  C CD1   . ILE A 15  ? 0.5577 0.5049 0.5851 0.0642  -0.0202 0.1480  15  ILE A CD1   
122  N N     . PRO A 16  ? 0.3548 0.6689 0.6815 0.0591  -0.0328 0.0735  16  PRO A N     
123  C CA    . PRO A 16  ? 0.3670 0.6743 0.7234 0.0832  -0.0208 0.0509  16  PRO A CA    
124  C C     . PRO A 16  ? 0.3924 0.6793 0.7887 0.1022  -0.0400 0.0613  16  PRO A C     
125  O O     . PRO A 16  ? 0.3999 0.6616 0.7808 0.0930  -0.0617 0.0870  16  PRO A O     
126  C CB    . PRO A 16  ? 0.3621 0.6241 0.6679 0.0752  -0.0115 0.0413  16  PRO A CB    
127  C CG    . PRO A 16  ? 0.3553 0.5880 0.6139 0.0538  -0.0259 0.0640  16  PRO A CG    
128  C CD    . PRO A 16  ? 0.3509 0.6213 0.6151 0.0406  -0.0337 0.0782  16  PRO A CD    
129  N N     . ASP A 17  ? 0.4136 0.7115 0.8608 0.1284  -0.0331 0.0413  17  ASP A N     
130  C CA    . ASP A 17  ? 0.4531 0.7284 0.9445 0.1483  -0.0539 0.0519  17  ASP A CA    
131  C C     . ASP A 17  ? 0.4754 0.6840 0.9410 0.1484  -0.0615 0.0552  17  ASP A C     
132  O O     . ASP A 17  ? 0.4671 0.6511 0.8837 0.1349  -0.0486 0.0461  17  ASP A O     
133  C CB    . ASP A 17  ? 0.4679 0.7823 1.0340 0.1793  -0.0470 0.0294  17  ASP A CB    
134  C CG    . ASP A 17  ? 0.4769 0.8154 1.0442 0.1881  -0.0157 -0.0106 17  ASP A CG    
135  O OD1   . ASP A 17  ? 0.4860 0.8807 1.1039 0.2059  -0.0028 -0.0307 17  ASP A OD1   
136  O OD2   . ASP A 17  ? 0.4848 0.7903 1.0031 0.1770  -0.0041 -0.0221 17  ASP A OD2   
137  N N     . GLU A 18  ? 0.5063 0.6884 1.0082 0.1627  -0.0840 0.0705  18  GLU A N     
138  C CA    . GLU A 18  ? 0.5358 0.6557 1.0205 0.1607  -0.0968 0.0816  18  GLU A CA    
139  C C     . GLU A 18  ? 0.5424 0.6362 1.0207 0.1684  -0.0779 0.0497  18  GLU A C     
140  O O     . GLU A 18  ? 0.5454 0.5995 0.9792 0.1528  -0.0768 0.0547  18  GLU A O     
141  C CB    . GLU A 18  ? 0.5709 0.6721 1.1090 0.1780  -0.1258 0.1027  18  GLU A CB    
142  C CG    . GLU A 18  ? 0.5853 0.7173 1.1413 0.1737  -0.1484 0.1339  18  GLU A CG    
143  C CD    . GLU A 18  ? 0.5928 0.7863 1.2127 0.1949  -0.1430 0.1186  18  GLU A CD    
144  O OE1   . GLU A 18  ? 0.5623 0.8026 1.1675 0.1855  -0.1233 0.1055  18  GLU A OE1   
145  O OE2   . GLU A 18  ? 0.6182 0.8151 1.3056 0.2205  -0.1594 0.1214  18  GLU A OE2   
146  N N     . GLU A 19  ? 0.5488 0.6680 1.0717 0.1919  -0.0629 0.0161  19  GLU A N     
147  C CA    . GLU A 19  ? 0.5646 0.6594 1.0859 0.2011  -0.0473 -0.0176 19  GLU A CA    
148  C C     . GLU A 19  ? 0.5370 0.6362 0.9955 0.1787  -0.0259 -0.0291 19  GLU A C     
149  O O     . GLU A 19  ? 0.5470 0.6069 0.9788 0.1718  -0.0226 -0.0377 19  GLU A O     
150  C CB    . GLU A 19  ? 0.5825 0.7081 1.1652 0.2325  -0.0350 -0.0555 19  GLU A CB    
151  C CG    . GLU A 19  ? 0.5851 0.7864 1.1925 0.2387  -0.0204 -0.0649 19  GLU A CG    
152  C CD    . GLU A 19  ? 0.6331 0.8583 1.3103 0.2608  -0.0392 -0.0513 19  GLU A CD    
153  O OE1   . GLU A 19  ? 0.6273 0.8591 1.2981 0.2472  -0.0583 -0.0140 19  GLU A OE1   
154  O OE2   . GLU A 19  ? 0.6657 0.9054 1.4056 0.2923  -0.0353 -0.0796 19  GLU A OE2   
155  N N     . GLU A 20  ? 0.5074 0.6539 0.9443 0.1661  -0.0135 -0.0272 20  GLU A N     
156  C CA    . GLU A 20  ? 0.4794 0.6302 0.8583 0.1440  0.0032  -0.0334 20  GLU A CA    
157  C C     . GLU A 20  ? 0.4729 0.5808 0.8029 0.1224  -0.0091 -0.0065 20  GLU A C     
158  O O     . GLU A 20  ? 0.4717 0.5562 0.7652 0.1116  -0.0009 -0.0146 20  GLU A O     
159  C CB    . GLU A 20  ? 0.4523 0.6609 0.8227 0.1340  0.0155  -0.0334 20  GLU A CB    
160  C CG    . GLU A 20  ? 0.4470 0.6599 0.7622 0.1127  0.0311  -0.0399 20  GLU A CG    
161  C CD    . GLU A 20  ? 0.4490 0.7215 0.7626 0.1044  0.0462  -0.0460 20  GLU A CD    
162  O OE1   . GLU A 20  ? 0.4569 0.7728 0.8125 0.1143  0.0463  -0.0454 20  GLU A OE1   
163  O OE2   . GLU A 20  ? 0.4430 0.7202 0.7145 0.0870  0.0570  -0.0497 20  GLU A OE2   
164  N N     . VAL A 21  ? 0.4719 0.5730 0.8018 0.1160  -0.0288 0.0246  21  VAL A N     
165  C CA    . VAL A 21  ? 0.4698 0.5368 0.7525 0.0955  -0.0393 0.0491  21  VAL A CA    
166  C C     . VAL A 21  ? 0.4903 0.5091 0.7681 0.0965  -0.0428 0.0476  21  VAL A C     
167  O O     . VAL A 21  ? 0.4802 0.4794 0.7157 0.0807  -0.0369 0.0490  21  VAL A O     
168  C CB    . VAL A 21  ? 0.4782 0.5468 0.7635 0.0893  -0.0621 0.0819  21  VAL A CB    
169  C CG1   . VAL A 21  ? 0.4788 0.5169 0.7118 0.0678  -0.0702 0.1037  21  VAL A CG1   
170  C CG2   . VAL A 21  ? 0.4594 0.5749 0.7498 0.0851  -0.0605 0.0844  21  VAL A CG2   
171  N N     . ARG A 22  ? 0.5188 0.5202 0.8441 0.1155  -0.0531 0.0441  22  ARG A N     
172  C CA    . ARG A 22  ? 0.5475 0.4998 0.8765 0.1159  -0.0612 0.0460  22  ARG A CA    
173  C C     . ARG A 22  ? 0.5388 0.4835 0.8537 0.1156  -0.0418 0.0140  22  ARG A C     
174  O O     . ARG A 22  ? 0.5443 0.4573 0.8324 0.1019  -0.0423 0.0185  22  ARG A O     
175  C CB    . ARG A 22  ? 0.5840 0.5181 0.9737 0.1383  -0.0797 0.0490  22  ARG A CB    
176  C CG    . ARG A 22  ? 0.6441 0.5223 1.0374 0.1328  -0.0990 0.0687  22  ARG A CG    
177  C CD    . ARG A 22  ? 0.7183 0.5816 1.1578 0.1449  -0.1279 0.0961  22  ARG A CD    
178  N NE    . ARG A 22  ? 0.7442 0.6404 1.2403 0.1729  -0.1275 0.0778  22  ARG A NE    
179  C CZ    . ARG A 22  ? 0.7742 0.6623 1.3239 0.2002  -0.1250 0.0468  22  ARG A CZ    
180  N NH1   . ARG A 22  ? 0.7994 0.6418 1.3527 0.2023  -0.1250 0.0304  22  ARG A NH1   
181  N NH2   . ARG A 22  ? 0.7698 0.6976 1.3709 0.2253  -0.1225 0.0305  22  ARG A NH2   
182  N N     . LYS A 23  ? 0.5269 0.5049 0.8594 0.1292  -0.0248 -0.0175 23  LYS A N     
183  C CA    . LYS A 23  ? 0.5234 0.5028 0.8383 0.1276  -0.0059 -0.0495 23  LYS A CA    
184  C C     . LYS A 23  ? 0.4979 0.4737 0.7549 0.1023  0.0011  -0.0389 23  LYS A C     
185  O O     . LYS A 23  ? 0.5073 0.4590 0.7461 0.0945  0.0050  -0.0489 23  LYS A O     
186  C CB    . LYS A 23  ? 0.5119 0.5418 0.8443 0.1408  0.0128  -0.0794 23  LYS A CB    
187  C CG    . LYS A 23  ? 0.5299 0.5611 0.8603 0.1469  0.0294  -0.1190 23  LYS A CG    
188  C CD    . LYS A 23  ? 0.5269 0.6182 0.8675 0.1560  0.0503  -0.1459 23  LYS A CD    
189  C CE    . LYS A 23  ? 0.5162 0.6423 0.8069 0.1326  0.0631  -0.1370 23  LYS A CE    
190  N NZ    . LYS A 23  ? 0.4926 0.6816 0.7887 0.1358  0.0831  -0.1574 23  LYS A NZ    
191  N N     . GLY A 24  ? 0.4700 0.4692 0.7013 0.0901  0.0010  -0.0191 24  GLY A N     
192  C CA    . GLY A 24  ? 0.4463 0.4440 0.6273 0.0690  0.0065  -0.0097 24  GLY A CA    
193  C C     . GLY A 24  ? 0.4579 0.4201 0.6183 0.0562  -0.0051 0.0136  24  GLY A C     
194  O O     . GLY A 24  ? 0.4466 0.3999 0.5749 0.0428  0.0011  0.0131  24  GLY A O     
195  N N     . ARG A 25  ? 0.4824 0.4282 0.6618 0.0594  -0.0222 0.0357  25  ARG A N     
196  C CA    . ARG A 25  ? 0.5056 0.4203 0.6674 0.0458  -0.0337 0.0601  25  ARG A CA    
197  C C     . ARG A 25  ? 0.5226 0.4059 0.6925 0.0448  -0.0321 0.0490  25  ARG A C     
198  O O     . ARG A 25  ? 0.5186 0.3889 0.6609 0.0285  -0.0299 0.0575  25  ARG A O     
199  C CB    . ARG A 25  ? 0.5320 0.4366 0.7151 0.0491  -0.0551 0.0880  25  ARG A CB    
200  C CG    . ARG A 25  ? 0.5531 0.4695 0.7015 0.0335  -0.0628 0.1146  25  ARG A CG    
201  C CD    . ARG A 25  ? 0.5891 0.5420 0.7335 0.0365  -0.0587 0.1089  25  ARG A CD    
202  N NE    . ARG A 25  ? 0.6373 0.5989 0.7354 0.0185  -0.0597 0.1229  25  ARG A NE    
203  C CZ    . ARG A 25  ? 0.6452 0.6317 0.7245 0.0141  -0.0531 0.1153  25  ARG A CZ    
204  N NH1   . ARG A 25  ? 0.6404 0.6506 0.7413 0.0239  -0.0441 0.0970  25  ARG A NH1   
205  N NH2   . ARG A 25  ? 0.6657 0.6539 0.7038 -0.0012 -0.0558 0.1255  25  ARG A NH2   
206  N N     . GLU A 26  ? 0.5441 0.4177 0.7538 0.0625  -0.0331 0.0280  26  GLU A N     
207  C CA    . GLU A 26  ? 0.5738 0.4142 0.7962 0.0626  -0.0342 0.0136  26  GLU A CA    
208  C C     . GLU A 26  ? 0.5482 0.3996 0.7390 0.0520  -0.0167 -0.0073 26  GLU A C     
209  O O     . GLU A 26  ? 0.5630 0.3913 0.7427 0.0389  -0.0183 -0.0049 26  GLU A O     
210  C CB    . GLU A 26  ? 0.5951 0.4233 0.8688 0.0869  -0.0392 -0.0097 26  GLU A CB    
211  C CG    . GLU A 26  ? 0.6381 0.4476 0.9509 0.0982  -0.0615 0.0137  26  GLU A CG    
212  C CD    . GLU A 26  ? 0.6822 0.4745 1.0531 0.1253  -0.0684 -0.0114 26  GLU A CD    
213  O OE1   . GLU A 26  ? 0.7436 0.4880 1.1407 0.1271  -0.0869 -0.0032 26  GLU A OE1   
214  O OE2   . GLU A 26  ? 0.6911 0.5182 1.0833 0.1447  -0.0558 -0.0391 26  GLU A OE2   
215  N N     . ALA A 27  ? 0.5143 0.4026 0.6915 0.0559  -0.0015 -0.0250 27  ALA A N     
216  C CA    . ALA A 27  ? 0.4904 0.3933 0.6363 0.0454  0.0128  -0.0411 27  ALA A CA    
217  C C     . ALA A 27  ? 0.4771 0.3783 0.5872 0.0261  0.0125  -0.0187 27  ALA A C     
218  O O     . ALA A 27  ? 0.4786 0.3698 0.5746 0.0150  0.0155  -0.0225 27  ALA A O     
219  C CB    . ALA A 27  ? 0.4652 0.4086 0.6042 0.0513  0.0260  -0.0574 27  ALA A CB    
220  N N     . GLU A 28  ? 0.4692 0.3824 0.5663 0.0226  0.0088  0.0030  28  GLU A N     
221  C CA    . GLU A 28  ? 0.4613 0.3761 0.5249 0.0068  0.0090  0.0221  28  GLU A CA    
222  C C     . GLU A 28  ? 0.4833 0.3725 0.5454 -0.0050 0.0036  0.0347  28  GLU A C     
223  O O     . GLU A 28  ? 0.4698 0.3632 0.5106 -0.0168 0.0104  0.0347  28  GLU A O     
224  C CB    . GLU A 28  ? 0.4558 0.3803 0.5114 0.0059  0.0013  0.0430  28  GLU A CB    
225  C CG    . GLU A 28  ? 0.4576 0.3891 0.4756 -0.0083 0.0037  0.0564  28  GLU A CG    
226  C CD    . GLU A 28  ? 0.4781 0.4123 0.4866 -0.0119 -0.0075 0.0788  28  GLU A CD    
227  O OE1   . GLU A 28  ? 0.4938 0.4315 0.5248 -0.0027 -0.0165 0.0833  28  GLU A OE1   
228  O OE2   . GLU A 28  ? 0.4910 0.4264 0.4701 -0.0241 -0.0073 0.0910  28  GLU A OE2   
229  N N     . GLU A 29  ? 0.5184 0.3824 0.6066 -0.0017 -0.0095 0.0463  29  GLU A N     
230  C CA    . GLU A 29  ? 0.5516 0.3889 0.6429 -0.0150 -0.0177 0.0625  29  GLU A CA    
231  C C     . GLU A 29  ? 0.5491 0.3780 0.6433 -0.0200 -0.0108 0.0420  29  GLU A C     
232  O O     . GLU A 29  ? 0.5488 0.3781 0.6272 -0.0367 -0.0078 0.0510  29  GLU A O     
233  C CB    . GLU A 29  ? 0.5873 0.3950 0.7124 -0.0084 -0.0365 0.0777  29  GLU A CB    
234  C CG    . GLU A 29  ? 0.6678 0.4476 0.7942 -0.0264 -0.0492 0.1055  29  GLU A CG    
235  C CD    . GLU A 29  ? 0.7356 0.5302 0.8300 -0.0434 -0.0519 0.1387  29  GLU A CD    
236  O OE1   . GLU A 29  ? 0.7292 0.5469 0.7902 -0.0566 -0.0381 0.1386  29  GLU A OE1   
237  O OE2   . GLU A 29  ? 0.7750 0.5590 0.8782 -0.0435 -0.0687 0.1644  29  GLU A OE2   
238  N N     . GLU A 30  ? 0.5489 0.3745 0.6626 -0.0062 -0.0077 0.0133  30  GLU A N     
239  C CA    . GLU A 30  ? 0.5559 0.3730 0.6717 -0.0113 -0.0034 -0.0085 30  GLU A CA    
240  C C     . GLU A 30  ? 0.5266 0.3717 0.6106 -0.0226 0.0094  -0.0130 30  GLU A C     
241  O O     . GLU A 30  ? 0.5321 0.3722 0.6112 -0.0364 0.0097  -0.0130 30  GLU A O     
242  C CB    . GLU A 30  ? 0.5660 0.3804 0.7040 0.0065  -0.0010 -0.0419 30  GLU A CB    
243  C CG    . GLU A 30  ? 0.5935 0.3953 0.7337 0.0010  0.0006  -0.0673 30  GLU A CG    
244  C CD    . GLU A 30  ? 0.6490 0.4117 0.8043 -0.0127 -0.0136 -0.0541 30  GLU A CD    
245  O OE1   . GLU A 30  ? 0.6796 0.4168 0.8547 -0.0116 -0.0270 -0.0315 30  GLU A OE1   
246  O OE2   . GLU A 30  ? 0.6659 0.4242 0.8141 -0.0261 -0.0129 -0.0643 30  GLU A OE2   
247  N N     . LEU A 31  ? 0.4975 0.3717 0.5632 -0.0168 0.0182  -0.0158 31  LEU A N     
248  C CA    . LEU A 31  ? 0.4691 0.3683 0.5082 -0.0242 0.0279  -0.0194 31  LEU A CA    
249  C C     . LEU A 31  ? 0.4713 0.3716 0.4964 -0.0389 0.0276  0.0020  31  LEU A C     
250  O O     . LEU A 31  ? 0.4667 0.3740 0.4858 -0.0487 0.0313  -0.0020 31  LEU A O     
251  C CB    . LEU A 31  ? 0.4465 0.3703 0.4723 -0.0161 0.0333  -0.0210 31  LEU A CB    
252  C CG    . LEU A 31  ? 0.4241 0.3727 0.4293 -0.0183 0.0414  -0.0319 31  LEU A CG    
253  C CD1   . LEU A 31  ? 0.4237 0.3732 0.4313 -0.0211 0.0440  -0.0525 31  LEU A CD1   
254  C CD2   . LEU A 31  ? 0.3931 0.3605 0.3958 -0.0098 0.0439  -0.0351 31  LEU A CD2   
255  N N     . ARG A 32  ? 0.4778 0.3747 0.4984 -0.0409 0.0231  0.0243  32  ARG A N     
256  C CA    . ARG A 32  ? 0.4854 0.3879 0.4911 -0.0555 0.0244  0.0446  32  ARG A CA    
257  C C     . ARG A 32  ? 0.5048 0.3938 0.5240 -0.0692 0.0214  0.0490  32  ARG A C     
258  O O     . ARG A 32  ? 0.5019 0.4077 0.5118 -0.0807 0.0281  0.0521  32  ARG A O     
259  C CB    . ARG A 32  ? 0.4998 0.3974 0.4992 -0.0578 0.0171  0.0689  32  ARG A CB    
260  C CG    . ARG A 32  ? 0.5013 0.4126 0.4867 -0.0480 0.0178  0.0681  32  ARG A CG    
261  C CD    . ARG A 32  ? 0.5494 0.4615 0.5200 -0.0552 0.0109  0.0931  32  ARG A CD    
262  N NE    . ARG A 32  ? 0.5763 0.5114 0.5155 -0.0584 0.0191  0.0916  32  ARG A NE    
263  C CZ    . ARG A 32  ? 0.5763 0.5211 0.5050 -0.0501 0.0189  0.0841  32  ARG A CZ    
264  N NH1   . ARG A 32  ? 0.5875 0.5271 0.5350 -0.0390 0.0125  0.0792  32  ARG A NH1   
265  N NH2   . ARG A 32  ? 0.5735 0.5340 0.4753 -0.0528 0.0248  0.0804  32  ARG A NH2   
266  N N     . ARG A 33  ? 0.5276 0.3864 0.5717 -0.0679 0.0104  0.0488  33  ARG A N     
267  C CA    . ARG A 33  ? 0.5561 0.3962 0.6157 -0.0832 0.0041  0.0545  33  ARG A CA    
268  C C     . ARG A 33  ? 0.5392 0.3899 0.5994 -0.0877 0.0103  0.0327  33  ARG A C     
269  O O     . ARG A 33  ? 0.5531 0.4056 0.6178 -0.1050 0.0093  0.0407  33  ARG A O     
270  C CB    . ARG A 33  ? 0.5951 0.3945 0.6846 -0.0785 -0.0118 0.0557  33  ARG A CB    
271  C CG    . ARG A 33  ? 0.6431 0.4296 0.7362 -0.0778 -0.0227 0.0839  33  ARG A CG    
272  C CD    . ARG A 33  ? 0.7280 0.4725 0.8496 -0.0865 -0.0415 0.0998  33  ARG A CD    
273  N NE    . ARG A 33  ? 0.7780 0.5022 0.9158 -0.0758 -0.0564 0.1164  33  ARG A NE    
274  C CZ    . ARG A 33  ? 0.8425 0.5290 1.0044 -0.0834 -0.0768 0.1397  33  ARG A CZ    
275  N NH1   . ARG A 33  ? 0.8761 0.5408 1.0473 -0.1038 -0.0840 0.1494  33  ARG A NH1   
276  N NH2   . ARG A 33  ? 0.8679 0.5385 1.0467 -0.0717 -0.0919 0.1554  33  ARG A NH2   
277  N N     . ARG A 34  ? 0.5136 0.3744 0.5696 -0.0739 0.0158  0.0070  34  ARG A N     
278  C CA    . ARG A 34  ? 0.4947 0.3675 0.5483 -0.0779 0.0197  -0.0136 34  ARG A CA    
279  C C     . ARG A 34  ? 0.4686 0.3759 0.5038 -0.0840 0.0291  -0.0076 34  ARG A C     
280  O O     . ARG A 34  ? 0.4634 0.3822 0.5016 -0.0944 0.0296  -0.0123 34  ARG A O     
281  C CB    . ARG A 34  ? 0.4829 0.3580 0.5353 -0.0627 0.0222  -0.0413 34  ARG A CB    
282  C CG    . ARG A 34  ? 0.4960 0.3398 0.5712 -0.0546 0.0140  -0.0561 34  ARG A CG    
283  C CD    . ARG A 34  ? 0.4626 0.3187 0.5344 -0.0392 0.0201  -0.0836 34  ARG A CD    
284  N NE    . ARG A 34  ? 0.4745 0.3030 0.5716 -0.0279 0.0137  -0.1027 34  ARG A NE    
285  C CZ    . ARG A 34  ? 0.4791 0.3166 0.5780 -0.0154 0.0192  -0.1336 34  ARG A CZ    
286  N NH1   . ARG A 34  ? 0.4555 0.3287 0.5298 -0.0156 0.0301  -0.1448 34  ARG A NH1   
287  N NH2   . ARG A 34  ? 0.5075 0.3192 0.6334 -0.0027 0.0136  -0.1535 34  ARG A NH2   
288  N N     . LEU A 35  ? 0.4530 0.3765 0.4716 -0.0767 0.0353  0.0018  35  LEU A N     
289  C CA    . LEU A 35  ? 0.4339 0.3876 0.4368 -0.0778 0.0436  0.0039  35  LEU A CA    
290  C C     . LEU A 35  ? 0.4479 0.4146 0.4508 -0.0911 0.0474  0.0221  35  LEU A C     
291  O O     . LEU A 35  ? 0.4406 0.4321 0.4432 -0.0952 0.0531  0.0195  35  LEU A O     
292  C CB    . LEU A 35  ? 0.4159 0.3784 0.4012 -0.0652 0.0473  0.0040  35  LEU A CB    
293  C CG    . LEU A 35  ? 0.3984 0.3628 0.3796 -0.0540 0.0468  -0.0127 35  LEU A CG    
294  C CD1   . LEU A 35  ? 0.3872 0.3552 0.3557 -0.0454 0.0476  -0.0064 35  LEU A CD1   
295  C CD2   . LEU A 35  ? 0.3720 0.3552 0.3475 -0.0552 0.0487  -0.0238 35  LEU A CD2   
296  N N     . ASP A 36  ? 0.4816 0.4352 0.4854 -0.0980 0.0443  0.0415  36  ASP A N     
297  C CA    . ASP A 36  ? 0.5135 0.4768 0.5223 -0.1168 0.0460  0.0607  36  ASP A CA    
298  C C     . ASP A 36  ? 0.5387 0.4852 0.5707 -0.1267 0.0379  0.0542  36  ASP A C     
299  O O     . ASP A 36  ? 0.5555 0.4796 0.5957 -0.1176 0.0311  0.0368  36  ASP A O     
300  C CB    . ASP A 36  ? 0.5334 0.4808 0.5384 -0.1244 0.0400  0.0854  36  ASP A CB    
301  C CG    . ASP A 36  ? 0.5365 0.4888 0.5192 -0.1126 0.0423  0.0891  36  ASP A CG    
302  O OD1   . ASP A 36  ? 0.5161 0.4885 0.4837 -0.1016 0.0508  0.0755  36  ASP A OD1   
303  O OD2   . ASP A 36  ? 0.5777 0.5117 0.5591 -0.1152 0.0332  0.1070  36  ASP A OD2   
304  N N     . GLU A 37  ? 0.5582 0.5166 0.6016 -0.1459 0.0384  0.0663  37  GLU A N     
305  C CA    . GLU A 37  ? 0.5825 0.5241 0.6482 -0.1568 0.0287  0.0576  37  GLU A CA    
306  C C     . GLU A 37  ? 0.5598 0.5246 0.6260 -0.1510 0.0328  0.0349  37  GLU A C     
307  O O     . GLU A 37  ? 0.5707 0.5433 0.6529 -0.1650 0.0286  0.0319  37  GLU A O     
308  C CB    . GLU A 37  ? 0.6032 0.4964 0.6810 -0.1511 0.0144  0.0493  37  GLU A CB    
309  C CG    . GLU A 37  ? 0.6157 0.4973 0.7011 -0.1441 0.0095  0.0185  37  GLU A CG    
310  C CD    . GLU A 37  ? 0.6798 0.5154 0.7870 -0.1485 -0.0062 0.0102  37  GLU A CD    
311  O OE1   . GLU A 37  ? 0.7022 0.5174 0.8108 -0.1315 -0.0093 -0.0129 37  GLU A OE1   
312  O OE2   . GLU A 37  ? 0.6935 0.5141 0.8177 -0.1692 -0.0156 0.0257  37  GLU A OE2   
313  N N     . LEU A 38  ? 0.5307 0.5068 0.5802 -0.1321 0.0389  0.0213  38  LEU A N     
314  C CA    . LEU A 38  ? 0.5124 0.5147 0.5605 -0.1272 0.0418  0.0060  38  LEU A CA    
315  C C     . LEU A 38  ? 0.4988 0.5406 0.5440 -0.1263 0.0527  0.0141  38  LEU A C     
316  O O     . LEU A 38  ? 0.4900 0.5547 0.5384 -0.1214 0.0534  0.0039  38  LEU A O     
317  C CB    . LEU A 38  ? 0.4975 0.4925 0.5307 -0.1095 0.0409  -0.0117 38  LEU A CB    
318  C CG    . LEU A 38  ? 0.5110 0.4925 0.5477 -0.1098 0.0325  -0.0325 38  LEU A CG    
319  C CD1   . LEU A 38  ? 0.4959 0.4800 0.5148 -0.0941 0.0347  -0.0455 38  LEU A CD1   
320  C CD2   . LEU A 38  ? 0.5096 0.5116 0.5566 -0.1217 0.0281  -0.0376 38  LEU A CD2   
321  N N     . GLY A 39  ? 0.5034 0.5542 0.5429 -0.1307 0.0604  0.0314  39  GLY A N     
322  C CA    . GLY A 39  ? 0.4933 0.5831 0.5281 -0.1267 0.0731  0.0345  39  GLY A CA    
323  C C     . GLY A 39  ? 0.4809 0.5664 0.4940 -0.1067 0.0760  0.0255  39  GLY A C     
324  O O     . GLY A 39  ? 0.5050 0.5762 0.5009 -0.1038 0.0772  0.0332  39  GLY A O     
325  N N     . VAL A 40  ? 0.4581 0.5558 0.4729 -0.0946 0.0752  0.0111  40  VAL A N     
326  C CA    . VAL A 40  ? 0.4387 0.5227 0.4362 -0.0780 0.0721  0.0014  40  VAL A CA    
327  C C     . VAL A 40  ? 0.4367 0.5140 0.4122 -0.0699 0.0768  0.0057  40  VAL A C     
328  O O     . VAL A 40  ? 0.4431 0.5032 0.4097 -0.0748 0.0759  0.0158  40  VAL A O     
329  C CB    . VAL A 40  ? 0.4401 0.4988 0.4370 -0.0774 0.0619  -0.0066 40  VAL A CB    
330  C CG1   . VAL A 40  ? 0.4331 0.4782 0.4123 -0.0647 0.0593  -0.0120 40  VAL A CG1   
331  C CG2   . VAL A 40  ? 0.4369 0.5082 0.4479 -0.0814 0.0558  -0.0158 40  VAL A CG2   
332  N N     . GLU A 41  ? 0.4272 0.5169 0.3957 -0.0578 0.0797  -0.0022 41  GLU A N     
333  C CA    . GLU A 41  ? 0.4361 0.5180 0.3825 -0.0494 0.0816  -0.0026 41  GLU A CA    
334  C C     . GLU A 41  ? 0.4227 0.4803 0.3590 -0.0424 0.0719  -0.0060 41  GLU A C     
335  O O     . GLU A 41  ? 0.4163 0.4728 0.3581 -0.0370 0.0657  -0.0135 41  GLU A O     
336  C CB    . GLU A 41  ? 0.4371 0.5390 0.3831 -0.0384 0.0869  -0.0131 41  GLU A CB    
337  C CG    . GLU A 41  ? 0.4889 0.6194 0.4342 -0.0423 0.1006  -0.0118 41  GLU A CG    
338  C CD    . GLU A 41  ? 0.5528 0.6961 0.4923 -0.0272 0.1055  -0.0272 41  GLU A CD    
339  O OE1   . GLU A 41  ? 0.5609 0.6830 0.4797 -0.0199 0.1000  -0.0321 41  GLU A OE1   
340  O OE2   . GLU A 41  ? 0.5864 0.7617 0.5442 -0.0226 0.1145  -0.0355 41  GLU A OE2   
341  N N     . TYR A 42  ? 0.4279 0.4695 0.3502 -0.0435 0.0699  0.0010  42  TYR A N     
342  C CA    . TYR A 42  ? 0.4189 0.4433 0.3349 -0.0382 0.0619  -0.0011 42  TYR A CA    
343  C C     . TYR A 42  ? 0.4255 0.4421 0.3234 -0.0362 0.0600  0.0045  42  TYR A C     
344  O O     . TYR A 42  ? 0.4432 0.4659 0.3303 -0.0397 0.0646  0.0101  42  TYR A O     
345  C CB    . TYR A 42  ? 0.4189 0.4312 0.3464 -0.0423 0.0583  0.0005  42  TYR A CB    
346  C CG    . TYR A 42  ? 0.4330 0.4363 0.3640 -0.0494 0.0589  0.0127  42  TYR A CG    
347  C CD1   . TYR A 42  ? 0.4383 0.4295 0.3625 -0.0476 0.0544  0.0215  42  TYR A CD1   
348  C CD2   . TYR A 42  ? 0.4363 0.4437 0.3790 -0.0595 0.0618  0.0178  42  TYR A CD2   
349  C CE1   . TYR A 42  ? 0.4595 0.4404 0.3881 -0.0547 0.0517  0.0362  42  TYR A CE1   
350  C CE2   . TYR A 42  ? 0.4600 0.4564 0.4063 -0.0684 0.0597  0.0329  42  TYR A CE2   
351  C CZ    . TYR A 42  ? 0.4740 0.4562 0.4130 -0.0656 0.0541  0.0426  42  TYR A CZ    
352  O OH    . TYR A 42  ? 0.5025 0.4720 0.4467 -0.0751 0.0490  0.0607  42  TYR A OH    
353  N N     . VAL A 43  ? 0.4196 0.4257 0.3134 -0.0322 0.0529  0.0036  43  VAL A N     
354  C CA    . VAL A 43  ? 0.4259 0.4250 0.3050 -0.0319 0.0484  0.0099  43  VAL A CA    
355  C C     . VAL A 43  ? 0.4170 0.4095 0.3025 -0.0299 0.0415  0.0114  43  VAL A C     
356  O O     . VAL A 43  ? 0.4084 0.4034 0.2983 -0.0277 0.0395  0.0049  43  VAL A O     
357  C CB    . VAL A 43  ? 0.4327 0.4337 0.2944 -0.0282 0.0476  0.0031  43  VAL A CB    
358  C CG1   . VAL A 43  ? 0.4176 0.4167 0.2845 -0.0224 0.0431  -0.0065 43  VAL A CG1   
359  C CG2   . VAL A 43  ? 0.4549 0.4483 0.2998 -0.0301 0.0407  0.0089  43  VAL A CG2   
360  N N     . PHE A 44  ? 0.4251 0.4124 0.3127 -0.0311 0.0377  0.0210  44  PHE A N     
361  C CA    . PHE A 44  ? 0.4206 0.4083 0.3175 -0.0281 0.0320  0.0220  44  PHE A CA    
362  C C     . PHE A 44  ? 0.4213 0.4103 0.3035 -0.0290 0.0255  0.0226  44  PHE A C     
363  O O     . PHE A 44  ? 0.4405 0.4256 0.3057 -0.0315 0.0221  0.0265  44  PHE A O     
364  C CB    . PHE A 44  ? 0.4326 0.4153 0.3419 -0.0273 0.0275  0.0326  44  PHE A CB    
365  C CG    . PHE A 44  ? 0.4497 0.4254 0.3785 -0.0261 0.0307  0.0310  44  PHE A CG    
366  C CD1   . PHE A 44  ? 0.4737 0.4438 0.3994 -0.0321 0.0344  0.0347  44  PHE A CD1   
367  C CD2   . PHE A 44  ? 0.4564 0.4323 0.4082 -0.0193 0.0299  0.0245  44  PHE A CD2   
368  C CE1   . PHE A 44  ? 0.4908 0.4507 0.4359 -0.0331 0.0348  0.0334  44  PHE A CE1   
369  C CE2   . PHE A 44  ? 0.4728 0.4374 0.4434 -0.0176 0.0311  0.0196  44  PHE A CE2   
370  C CZ    . PHE A 44  ? 0.4772 0.4313 0.4443 -0.0254 0.0323  0.0248  44  PHE A CZ    
371  N N     . VAL A 45  ? 0.4034 0.3984 0.2907 -0.0286 0.0233  0.0185  45  VAL A N     
372  C CA    . VAL A 45  ? 0.3991 0.3930 0.2756 -0.0319 0.0147  0.0206  45  VAL A CA    
373  C C     . VAL A 45  ? 0.3898 0.3972 0.2799 -0.0340 0.0112  0.0251  45  VAL A C     
374  O O     . VAL A 45  ? 0.3872 0.4054 0.2953 -0.0303 0.0167  0.0236  45  VAL A O     
375  C CB    . VAL A 45  ? 0.4015 0.3896 0.2687 -0.0323 0.0133  0.0135  45  VAL A CB    
376  C CG1   . VAL A 45  ? 0.4105 0.3932 0.2703 -0.0284 0.0192  0.0072  45  VAL A CG1   
377  C CG2   . VAL A 45  ? 0.3754 0.3730 0.2529 -0.0333 0.0157  0.0109  45  VAL A CG2   
378  N N     . GLY A 46  ? 0.3805 0.3886 0.2641 -0.0401 0.0020  0.0295  46  GLY A N     
379  C CA    . GLY A 46  ? 0.3602 0.3879 0.2581 -0.0445 -0.0005 0.0351  46  GLY A CA    
380  C C     . GLY A 46  ? 0.3497 0.3881 0.2624 -0.0424 -0.0037 0.0423  46  GLY A C     
381  O O     . GLY A 46  ? 0.3570 0.3839 0.2643 -0.0397 -0.0072 0.0460  46  GLY A O     
382  N N     . SER A 47  ? 0.3309 0.3948 0.2635 -0.0440 -0.0026 0.0452  47  SER A N     
383  C CA    . SER A 47  ? 0.3268 0.4066 0.2801 -0.0418 -0.0078 0.0531  47  SER A CA    
384  C C     . SER A 47  ? 0.3300 0.4041 0.2989 -0.0295 -0.0054 0.0525  47  SER A C     
385  O O     . SER A 47  ? 0.3373 0.4126 0.3150 -0.0284 -0.0154 0.0630  47  SER A O     
386  C CB    . SER A 47  ? 0.3172 0.4332 0.2931 -0.0450 -0.0039 0.0541  47  SER A CB    
387  O OG    . SER A 47  ? 0.3002 0.4314 0.2894 -0.0368 0.0108  0.0414  47  SER A OG    
388  N N     . TYR A 48  ? 0.3242 0.3907 0.2969 -0.0218 0.0053  0.0420  48  TYR A N     
389  C CA    . TYR A 48  ? 0.3325 0.3877 0.3213 -0.0120 0.0050  0.0432  48  TYR A CA    
390  C C     . TYR A 48  ? 0.3489 0.3813 0.3167 -0.0166 -0.0033 0.0546  48  TYR A C     
391  O O     . TYR A 48  ? 0.3609 0.3890 0.3386 -0.0141 -0.0123 0.0665  48  TYR A O     
392  C CB    . TYR A 48  ? 0.3290 0.3772 0.3256 -0.0052 0.0163  0.0289  48  TYR A CB    
393  C CG    . TYR A 48  ? 0.3387 0.3709 0.3552 0.0035  0.0124  0.0325  48  TYR A CG    
394  C CD1   . TYR A 48  ? 0.3426 0.3857 0.3942 0.0148  0.0089  0.0323  48  TYR A CD1   
395  C CD2   . TYR A 48  ? 0.3405 0.3475 0.3430 -0.0003 0.0109  0.0380  48  TYR A CD2   
396  C CE1   . TYR A 48  ? 0.3663 0.3897 0.4393 0.0229  0.0016  0.0382  48  TYR A CE1   
397  C CE2   . TYR A 48  ? 0.3363 0.3260 0.3573 0.0046  0.0045  0.0458  48  TYR A CE2   
398  C CZ    . TYR A 48  ? 0.3639 0.3587 0.4201 0.0165  -0.0014 0.0463  48  TYR A CZ    
399  O OH    . TYR A 48  ? 0.3963 0.3696 0.4747 0.0220  -0.0111 0.0557  48  TYR A OH    
400  N N     . ALA A 49  ? 0.3590 0.3791 0.2982 -0.0232 -0.0003 0.0509  49  ALA A N     
401  C CA    . ALA A 49  ? 0.3810 0.3850 0.2966 -0.0281 -0.0042 0.0578  49  ALA A CA    
402  C C     . ALA A 49  ? 0.3988 0.4043 0.2998 -0.0348 -0.0173 0.0681  49  ALA A C     
403  O O     . ALA A 49  ? 0.4219 0.4188 0.3027 -0.0396 -0.0219 0.0754  49  ALA A O     
404  C CB    . ALA A 49  ? 0.3785 0.3745 0.2728 -0.0308 0.0038  0.0474  49  ALA A CB    
405  N N     . ARG A 50  ? 0.3933 0.4121 0.3032 -0.0372 -0.0234 0.0689  50  ARG A N     
406  C CA    . ARG A 50  ? 0.4128 0.4336 0.3108 -0.0454 -0.0382 0.0782  50  ARG A CA    
407  C C     . ARG A 50  ? 0.4116 0.4517 0.3398 -0.0432 -0.0481 0.0906  50  ARG A C     
408  O O     . ARG A 50  ? 0.4237 0.4700 0.3470 -0.0512 -0.0624 0.0995  50  ARG A O     
409  C CB    . ARG A 50  ? 0.4166 0.4360 0.3007 -0.0535 -0.0417 0.0713  50  ARG A CB    
410  C CG    . ARG A 50  ? 0.4499 0.4481 0.3011 -0.0566 -0.0406 0.0611  50  ARG A CG    
411  C CD    . ARG A 50  ? 0.4733 0.4653 0.3186 -0.0628 -0.0456 0.0546  50  ARG A CD    
412  N NE    . ARG A 50  ? 0.4874 0.4724 0.3321 -0.0576 -0.0349 0.0443  50  ARG A NE    
413  C CZ    . ARG A 50  ? 0.4852 0.4766 0.3419 -0.0598 -0.0333 0.0442  50  ARG A CZ    
414  N NH1   . ARG A 50  ? 0.4818 0.4896 0.3529 -0.0677 -0.0395 0.0533  50  ARG A NH1   
415  N NH2   . ARG A 50  ? 0.4958 0.4803 0.3500 -0.0553 -0.0259 0.0362  50  ARG A NH2   
416  N N     . ASN A 51  ? 0.3974 0.4475 0.3586 -0.0319 -0.0414 0.0898  51  ASN A N     
417  C CA    . ASN A 51  ? 0.3945 0.4682 0.3940 -0.0256 -0.0483 0.0976  51  ASN A CA    
418  C C     . ASN A 51  ? 0.3810 0.4801 0.3888 -0.0335 -0.0534 0.0993  51  ASN A C     
419  O O     . ASN A 51  ? 0.3925 0.5076 0.4164 -0.0361 -0.0674 0.1118  51  ASN A O     
420  C CB    . ASN A 51  ? 0.4177 0.4851 0.4231 -0.0244 -0.0641 0.1154  51  ASN A CB    
421  C CG    . ASN A 51  ? 0.4548 0.4987 0.4565 -0.0189 -0.0605 0.1177  51  ASN A CG    
422  O OD1   . ASN A 51  ? 0.4857 0.5261 0.5089 -0.0082 -0.0493 0.1072  51  ASN A OD1   
423  N ND2   . ASN A 51  ? 0.5029 0.5312 0.4751 -0.0282 -0.0697 0.1309  51  ASN A ND2   
424  N N     . THR A 52  ? 0.3584 0.4623 0.3565 -0.0389 -0.0436 0.0888  52  THR A N     
425  C CA    . THR A 52  ? 0.3464 0.4762 0.3541 -0.0493 -0.0475 0.0923  52  THR A CA    
426  C C     . THR A 52  ? 0.3196 0.4808 0.3534 -0.0444 -0.0320 0.0834  52  THR A C     
427  O O     . THR A 52  ? 0.3158 0.5016 0.3551 -0.0556 -0.0320 0.0867  52  THR A O     
428  C CB    . THR A 52  ? 0.3589 0.4684 0.3307 -0.0651 -0.0546 0.0921  52  THR A CB    
429  O OG1   . THR A 52  ? 0.3682 0.4635 0.3237 -0.0635 -0.0421 0.0804  52  THR A OG1   
430  C CG2   . THR A 52  ? 0.3727 0.4541 0.3148 -0.0694 -0.0679 0.0958  52  THR A CG2   
431  N N     . TRP A 53  ? 0.3043 0.4655 0.3532 -0.0292 -0.0191 0.0721  53  TRP A N     
432  C CA    . TRP A 53  ? 0.2879 0.4801 0.3578 -0.0237 -0.0028 0.0591  53  TRP A CA    
433  C C     . TRP A 53  ? 0.2801 0.5168 0.3940 -0.0171 -0.0021 0.0612  53  TRP A C     
434  O O     . TRP A 53  ? 0.2872 0.5243 0.4247 -0.0083 -0.0126 0.0689  53  TRP A O     
435  C CB    . TRP A 53  ? 0.2852 0.4601 0.3550 -0.0103 0.0098  0.0426  53  TRP A CB    
436  C CG    . TRP A 53  ? 0.2944 0.4709 0.3997 0.0082  0.0103  0.0375  53  TRP A CG    
437  C CD1   . TRP A 53  ? 0.3023 0.5106 0.4461 0.0222  0.0204  0.0236  53  TRP A CD1   
438  C CD2   . TRP A 53  ? 0.2912 0.4359 0.3989 0.0152  -0.0008 0.0460  53  TRP A CD2   
439  N NE1   . TRP A 53  ? 0.3019 0.4949 0.4751 0.0393  0.0144  0.0224  53  TRP A NE1   
440  C CE2   . TRP A 53  ? 0.3024 0.4560 0.4532 0.0338  0.0005  0.0385  53  TRP A CE2   
441  C CE3   . TRP A 53  ? 0.2924 0.4037 0.3700 0.0071  -0.0115 0.0590  53  TRP A CE3   
442  C CZ2   . TRP A 53  ? 0.3233 0.4490 0.4880 0.0429  -0.0113 0.0476  53  TRP A CZ2   
443  C CZ3   . TRP A 53  ? 0.3288 0.4183 0.4166 0.0142  -0.0210 0.0683  53  TRP A CZ3   
444  C CH2   . TRP A 53  ? 0.3424 0.4369 0.4738 0.0313  -0.0222 0.0645  53  TRP A CH2   
445  N N     . LEU A 54  ? 0.2725 0.5494 0.3981 -0.0217 0.0104  0.0546  54  LEU A N     
446  C CA    . LEU A 54  ? 0.2674 0.5981 0.4366 -0.0172 0.0145  0.0548  54  LEU A CA    
447  C C     . LEU A 54  ? 0.2691 0.6154 0.4768 0.0081  0.0270  0.0353  54  LEU A C     
448  O O     . LEU A 54  ? 0.2735 0.6026 0.4703 0.0168  0.0390  0.0170  54  LEU A O     
449  C CB    . LEU A 54  ? 0.2619 0.6321 0.4238 -0.0347 0.0251  0.0554  54  LEU A CB    
450  C CG    . LEU A 54  ? 0.2682 0.6861 0.4535 -0.0494 0.0192  0.0714  54  LEU A CG    
451  C CD1   . LEU A 54  ? 0.2790 0.6737 0.4625 -0.0572 -0.0056 0.0914  54  LEU A CD1   
452  C CD2   . LEU A 54  ? 0.2592 0.6965 0.4201 -0.0737 0.0249  0.0781  54  LEU A CD2   
453  N N     . LYS A 55  ? 0.2711 0.6490 0.5261 0.0202  0.0223  0.0384  55  LYS A N     
454  C CA    . LYS A 55  ? 0.2792 0.6762 0.5806 0.0468  0.0326  0.0183  55  LYS A CA    
455  C C     . LYS A 55  ? 0.2867 0.7142 0.5859 0.0499  0.0582  -0.0083 55  LYS A C     
456  O O     . LYS A 55  ? 0.2850 0.7597 0.5805 0.0354  0.0692  -0.0076 55  LYS A O     
457  C CB    . LYS A 55  ? 0.2786 0.7228 0.6351 0.0556  0.0254  0.0268  55  LYS A CB    
458  C CG    . LYS A 55  ? 0.2810 0.7502 0.6958 0.0863  0.0344  0.0049  55  LYS A CG    
459  C CD    . LYS A 55  ? 0.2731 0.7934 0.7438 0.0931  0.0255  0.0166  55  LYS A CD    
460  C CE    . LYS A 55  ? 0.2982 0.8210 0.8304 0.1270  0.0217  0.0035  55  LYS A CE    
461  N NZ    . LYS A 55  ? 0.3217 0.9113 0.9029 0.1449  0.0453  -0.0247 55  LYS A NZ    
462  N N     . GLY A 56  ? 0.3006 0.7010 0.5994 0.0664  0.0665  -0.0309 56  GLY A N     
463  C CA    . GLY A 56  ? 0.3151 0.7419 0.6078 0.0695  0.0896  -0.0592 56  GLY A CA    
464  C C     . GLY A 56  ? 0.3185 0.7238 0.5537 0.0487  0.0946  -0.0584 56  GLY A C     
465  O O     . GLY A 56  ? 0.3295 0.7536 0.5525 0.0486  0.1117  -0.0806 56  GLY A O     
466  N N     . SER A 57  ? 0.3165 0.6838 0.5174 0.0318  0.0789  -0.0340 57  SER A N     
467  C CA    . SER A 57  ? 0.3190 0.6638 0.4696 0.0129  0.0798  -0.0299 57  SER A CA    
468  C C     . SER A 57  ? 0.3271 0.6099 0.4537 0.0156  0.0696  -0.0276 57  SER A C     
469  O O     . SER A 57  ? 0.3267 0.5837 0.4182 0.0004  0.0615  -0.0136 57  SER A O     
470  C CB    . SER A 57  ? 0.3113 0.6678 0.4416 -0.0111 0.0706  -0.0047 57  SER A CB    
471  O OG    . SER A 57  ? 0.3164 0.7275 0.4482 -0.0238 0.0831  -0.0058 57  SER A OG    
472  N N     . LEU A 58  ? 0.3430 0.6029 0.4904 0.0345  0.0696  -0.0411 58  LEU A N     
473  C CA    . LEU A 58  ? 0.3504 0.5564 0.4797 0.0355  0.0601  -0.0366 58  LEU A CA    
474  C C     . LEU A 58  ? 0.3628 0.5540 0.4599 0.0278  0.0680  -0.0489 58  LEU A C     
475  O O     . LEU A 58  ? 0.3765 0.5818 0.4792 0.0340  0.0803  -0.0722 58  LEU A O     
476  C CB    . LEU A 58  ? 0.3631 0.5477 0.5273 0.0557  0.0550  -0.0440 58  LEU A CB    
477  C CG    . LEU A 58  ? 0.3575 0.4907 0.5083 0.0565  0.0478  -0.0426 58  LEU A CG    
478  C CD1   . LEU A 58  ? 0.3183 0.4248 0.4504 0.0466  0.0324  -0.0150 58  LEU A CD1   
479  C CD2   . LEU A 58  ? 0.3905 0.5080 0.5807 0.0768  0.0459  -0.0574 58  LEU A CD2   
480  N N     . GLU A 59  ? 0.3705 0.5342 0.4348 0.0148  0.0601  -0.0343 59  GLU A N     
481  C CA    . GLU A 59  ? 0.3881 0.5379 0.4230 0.0062  0.0641  -0.0414 59  GLU A CA    
482  C C     . GLU A 59  ? 0.3883 0.5006 0.4023 0.0001  0.0534  -0.0262 59  GLU A C     
483  O O     . GLU A 59  ? 0.3957 0.5050 0.3984 -0.0074 0.0450  -0.0095 59  GLU A O     
484  C CB    . GLU A 59  ? 0.3858 0.5664 0.4013 -0.0081 0.0690  -0.0388 59  GLU A CB    
485  C CG    . GLU A 59  ? 0.4289 0.6033 0.4174 -0.0169 0.0722  -0.0460 59  GLU A CG    
486  C CD    . GLU A 59  ? 0.4840 0.6762 0.4499 -0.0343 0.0692  -0.0321 59  GLU A CD    
487  O OE1   . GLU A 59  ? 0.4948 0.6617 0.4438 -0.0416 0.0579  -0.0170 59  GLU A OE1   
488  O OE2   . GLU A 59  ? 0.4892 0.7210 0.4550 -0.0409 0.0777  -0.0362 59  GLU A OE2   
489  N N     . ILE A 60  ? 0.3932 0.4789 0.4024 0.0026  0.0537  -0.0330 60  ILE A N     
490  C CA    . ILE A 60  ? 0.3906 0.4476 0.3826 -0.0028 0.0461  -0.0199 60  ILE A CA    
491  C C     . ILE A 60  ? 0.3861 0.4403 0.3521 -0.0128 0.0471  -0.0204 60  ILE A C     
492  O O     . ILE A 60  ? 0.3902 0.4501 0.3527 -0.0144 0.0526  -0.0330 60  ILE A O     
493  C CB    . ILE A 60  ? 0.4020 0.4331 0.4065 0.0031  0.0442  -0.0221 60  ILE A CB    
494  C CG1   . ILE A 60  ? 0.4175 0.4464 0.4508 0.0139  0.0389  -0.0178 60  ILE A CG1   
495  C CG2   . ILE A 60  ? 0.4000 0.4099 0.3854 -0.0046 0.0392  -0.0089 60  ILE A CG2   
496  C CD1   . ILE A 60  ? 0.4540 0.4564 0.5062 0.0202  0.0354  -0.0213 60  ILE A CD1   
497  N N     . ASP A 61  ? 0.3877 0.4328 0.3366 -0.0187 0.0406  -0.0075 61  ASP A N     
498  C CA    . ASP A 61  ? 0.3873 0.4270 0.3165 -0.0255 0.0391  -0.0070 61  ASP A CA    
499  C C     . ASP A 61  ? 0.3885 0.4091 0.3121 -0.0248 0.0387  -0.0055 61  ASP A C     
500  O O     . ASP A 61  ? 0.3942 0.4044 0.3131 -0.0244 0.0353  0.0031  61  ASP A O     
501  C CB    . ASP A 61  ? 0.3900 0.4314 0.3062 -0.0316 0.0314  0.0034  61  ASP A CB    
502  C CG    . ASP A 61  ? 0.4089 0.4737 0.3287 -0.0369 0.0313  0.0054  61  ASP A CG    
503  O OD1   . ASP A 61  ? 0.4336 0.5031 0.3553 -0.0402 0.0253  0.0149  61  ASP A OD1   
504  O OD2   . ASP A 61  ? 0.4227 0.5039 0.3427 -0.0395 0.0372  -0.0022 61  ASP A OD2   
505  N N     . VAL A 62  ? 0.3842 0.4041 0.3075 -0.0264 0.0421  -0.0135 62  VAL A N     
506  C CA    . VAL A 62  ? 0.3822 0.3916 0.3029 -0.0275 0.0429  -0.0120 62  VAL A CA    
507  C C     . VAL A 62  ? 0.3728 0.3867 0.2838 -0.0299 0.0405  -0.0133 62  VAL A C     
508  O O     . VAL A 62  ? 0.3713 0.3944 0.2815 -0.0327 0.0391  -0.0182 62  VAL A O     
509  C CB    . VAL A 62  ? 0.3919 0.3968 0.3255 -0.0283 0.0467  -0.0195 62  VAL A CB    
510  C CG1   . VAL A 62  ? 0.4017 0.3997 0.3354 -0.0318 0.0480  -0.0136 62  VAL A CG1   
511  C CG2   . VAL A 62  ? 0.3987 0.3974 0.3477 -0.0236 0.0472  -0.0218 62  VAL A CG2   
512  N N     . PHE A 63  ? 0.3642 0.3726 0.2684 -0.0285 0.0394  -0.0092 63  PHE A N     
513  C CA    . PHE A 63  ? 0.3512 0.3623 0.2525 -0.0274 0.0360  -0.0116 63  PHE A CA    
514  C C     . PHE A 63  ? 0.3478 0.3638 0.2569 -0.0269 0.0416  -0.0146 63  PHE A C     
515  O O     . PHE A 63  ? 0.3558 0.3705 0.2629 -0.0268 0.0470  -0.0118 63  PHE A O     
516  C CB    . PHE A 63  ? 0.3596 0.3624 0.2498 -0.0246 0.0300  -0.0088 63  PHE A CB    
517  C CG    . PHE A 63  ? 0.3635 0.3649 0.2494 -0.0278 0.0207  -0.0048 63  PHE A CG    
518  C CD1   . PHE A 63  ? 0.3619 0.3707 0.2485 -0.0327 0.0211  -0.0012 63  PHE A CD1   
519  C CD2   . PHE A 63  ? 0.3754 0.3693 0.2588 -0.0263 0.0110  -0.0042 63  PHE A CD2   
520  C CE1   . PHE A 63  ? 0.3766 0.3896 0.2590 -0.0388 0.0135  0.0049  63  PHE A CE1   
521  C CE2   . PHE A 63  ? 0.3734 0.3648 0.2529 -0.0325 0.0004  0.0034  63  PHE A CE2   
522  C CZ    . PHE A 63  ? 0.3791 0.3820 0.2566 -0.0403 0.0022  0.0091  63  PHE A CZ    
523  N N     . LEU A 64  ? 0.3336 0.3585 0.2515 -0.0283 0.0398  -0.0187 64  LEU A N     
524  C CA    . LEU A 64  ? 0.3237 0.3595 0.2540 -0.0289 0.0440  -0.0212 64  LEU A CA    
525  C C     . LEU A 64  ? 0.3217 0.3633 0.2549 -0.0211 0.0416  -0.0236 64  LEU A C     
526  O O     . LEU A 64  ? 0.3197 0.3590 0.2532 -0.0178 0.0318  -0.0238 64  LEU A O     
527  C CB    . LEU A 64  ? 0.3250 0.3692 0.2651 -0.0347 0.0404  -0.0251 64  LEU A CB    
528  C CG    . LEU A 64  ? 0.3360 0.3745 0.2753 -0.0409 0.0414  -0.0290 64  LEU A CG    
529  C CD1   . LEU A 64  ? 0.3446 0.3937 0.2886 -0.0472 0.0359  -0.0355 64  LEU A CD1   
530  C CD2   . LEU A 64  ? 0.3325 0.3629 0.2795 -0.0443 0.0478  -0.0269 64  LEU A CD2   
531  N N     . LEU A 65  ? 0.3175 0.3679 0.2540 -0.0183 0.0501  -0.0254 65  LEU A N     
532  C CA    . LEU A 65  ? 0.3269 0.3840 0.2678 -0.0077 0.0499  -0.0325 65  LEU A CA    
533  C C     . LEU A 65  ? 0.3240 0.4051 0.2897 -0.0042 0.0520  -0.0371 65  LEU A C     
534  O O     . LEU A 65  ? 0.3246 0.4256 0.2991 -0.0083 0.0631  -0.0371 65  LEU A O     
535  C CB    . LEU A 65  ? 0.3384 0.3953 0.2647 -0.0053 0.0588  -0.0351 65  LEU A CB    
536  C CG    . LEU A 65  ? 0.3458 0.3829 0.2496 -0.0091 0.0559  -0.0296 65  LEU A CG    
537  C CD1   . LEU A 65  ? 0.3532 0.3969 0.2415 -0.0101 0.0652  -0.0308 65  LEU A CD1   
538  C CD2   . LEU A 65  ? 0.3496 0.3676 0.2461 -0.0040 0.0431  -0.0317 65  LEU A CD2   
539  N N     . PHE A 66  ? 0.3225 0.4037 0.3009 0.0024  0.0402  -0.0391 66  PHE A N     
540  C CA    . PHE A 66  ? 0.3226 0.4286 0.3292 0.0062  0.0387  -0.0419 66  PHE A CA    
541  C C     . PHE A 66  ? 0.3326 0.4489 0.3562 0.0237  0.0395  -0.0529 66  PHE A C     
542  O O     . PHE A 66  ? 0.3416 0.4382 0.3531 0.0329  0.0362  -0.0588 66  PHE A O     
543  C CB    . PHE A 66  ? 0.3213 0.4246 0.3342 0.0015  0.0226  -0.0355 66  PHE A CB    
544  C CG    . PHE A 66  ? 0.3239 0.4251 0.3261 -0.0143 0.0234  -0.0306 66  PHE A CG    
545  C CD1   . PHE A 66  ? 0.3190 0.4395 0.3369 -0.0233 0.0263  -0.0308 66  PHE A CD1   
546  C CD2   . PHE A 66  ? 0.3375 0.4185 0.3162 -0.0201 0.0206  -0.0272 66  PHE A CD2   
547  C CE1   . PHE A 66  ? 0.3175 0.4319 0.3263 -0.0369 0.0256  -0.0301 66  PHE A CE1   
548  C CE2   . PHE A 66  ? 0.3293 0.4090 0.3005 -0.0318 0.0220  -0.0273 66  PHE A CE2   
549  C CZ    . PHE A 66  ? 0.3239 0.4176 0.3094 -0.0397 0.0240  -0.0299 66  PHE A CZ    
550  N N     . PRO A 67  ? 0.3307 0.4789 0.3847 0.0285  0.0436  -0.0574 67  PRO A N     
551  C CA    . PRO A 67  ? 0.3481 0.5088 0.4254 0.0484  0.0432  -0.0705 67  PRO A CA    
552  C C     . PRO A 67  ? 0.3662 0.5013 0.4504 0.0590  0.0208  -0.0689 67  PRO A C     
553  O O     . PRO A 67  ? 0.3608 0.4912 0.4492 0.0511  0.0055  -0.0563 67  PRO A O     
554  C CB    . PRO A 67  ? 0.3373 0.5413 0.4511 0.0482  0.0487  -0.0712 67  PRO A CB    
555  C CG    . PRO A 67  ? 0.3234 0.5370 0.4249 0.0269  0.0592  -0.0613 67  PRO A CG    
556  C CD    . PRO A 67  ? 0.3207 0.4966 0.3921 0.0162  0.0485  -0.0516 67  PRO A CD    
557  N N     . GLU A 68  ? 0.3955 0.5134 0.4797 0.0754  0.0176  -0.0813 68  GLU A N     
558  C CA    . GLU A 68  ? 0.4245 0.5128 0.5173 0.0849  -0.0066 -0.0778 68  GLU A CA    
559  C C     . GLU A 68  ? 0.4206 0.5274 0.5546 0.0942  -0.0212 -0.0739 68  GLU A C     
560  O O     . GLU A 68  ? 0.4343 0.5190 0.5748 0.0955  -0.0451 -0.0623 68  GLU A O     
561  C CB    . GLU A 68  ? 0.4461 0.5073 0.5321 0.1004  -0.0090 -0.0941 68  GLU A CB    
562  C CG    . GLU A 68  ? 0.4862 0.5650 0.6051 0.1253  -0.0036 -0.1178 68  GLU A CG    
563  C CD    . GLU A 68  ? 0.5362 0.5809 0.6439 0.1395  -0.0084 -0.1370 68  GLU A CD    
564  O OE1   . GLU A 68  ? 0.5936 0.6403 0.7320 0.1637  -0.0119 -0.1579 68  GLU A OE1   
565  O OE2   . GLU A 68  ? 0.5837 0.5996 0.6536 0.1270  -0.0096 -0.1325 68  GLU A OE2   
566  N N     . GLU A 69  ? 0.4085 0.5581 0.5705 0.0986  -0.0079 -0.0810 69  GLU A N     
567  C CA    . GLU A 69  ? 0.4106 0.5858 0.6161 0.1066  -0.0211 -0.0768 69  GLU A CA    
568  C C     . GLU A 69  ? 0.3958 0.5681 0.5940 0.0872  -0.0385 -0.0543 69  GLU A C     
569  O O     . GLU A 69  ? 0.4052 0.5856 0.6325 0.0923  -0.0590 -0.0456 69  GLU A O     
570  C CB    . GLU A 69  ? 0.4037 0.6321 0.6400 0.1112  -0.0006 -0.0880 69  GLU A CB    
571  C CG    . GLU A 69  ? 0.4487 0.6944 0.7085 0.1363  0.0131  -0.1133 69  GLU A CG    
572  C CD    . GLU A 69  ? 0.4810 0.7483 0.7172 0.1298  0.0442  -0.1255 69  GLU A CD    
573  O OE1   . GLU A 69  ? 0.5053 0.8176 0.7706 0.1426  0.0618  -0.1424 69  GLU A OE1   
574  O OE2   . GLU A 69  ? 0.4635 0.7067 0.6545 0.1119  0.0506  -0.1177 69  GLU A OE2   
575  N N     . PHE A 70  ? 0.3765 0.5385 0.5369 0.0657  -0.0309 -0.0461 70  PHE A N     
576  C CA    . PHE A 70  ? 0.3677 0.5292 0.5149 0.0460  -0.0434 -0.0298 70  PHE A CA    
577  C C     . PHE A 70  ? 0.3891 0.5248 0.5301 0.0457  -0.0700 -0.0155 70  PHE A C     
578  O O     . PHE A 70  ? 0.3973 0.5017 0.5258 0.0526  -0.0761 -0.0153 70  PHE A O     
579  C CB    . PHE A 70  ? 0.3513 0.5006 0.4589 0.0273  -0.0294 -0.0280 70  PHE A CB    
580  C CG    . PHE A 70  ? 0.3241 0.4997 0.4368 0.0164  -0.0123 -0.0320 70  PHE A CG    
581  C CD1   . PHE A 70  ? 0.3102 0.5198 0.4556 0.0240  -0.0015 -0.0396 70  PHE A CD1   
582  C CD2   . PHE A 70  ? 0.3028 0.4693 0.3890 -0.0019 -0.0069 -0.0285 70  PHE A CD2   
583  C CE1   . PHE A 70  ? 0.2896 0.5226 0.4398 0.0102  0.0128  -0.0398 70  PHE A CE1   
584  C CE2   . PHE A 70  ? 0.2945 0.4789 0.3867 -0.0134 0.0059  -0.0307 70  PHE A CE2   
585  C CZ    . PHE A 70  ? 0.2939 0.5110 0.4173 -0.0090 0.0152  -0.0346 70  PHE A CZ    
586  N N     . SER A 71  ? 0.3984 0.5480 0.5467 0.0351  -0.0870 -0.0022 71  SER A N     
587  C CA    . SER A 71  ? 0.4276 0.5573 0.5614 0.0271  -0.1121 0.0163  71  SER A CA    
588  C C     . SER A 71  ? 0.4316 0.5431 0.5177 0.0081  -0.1046 0.0209  71  SER A C     
589  O O     . SER A 71  ? 0.4158 0.5327 0.4850 0.0008  -0.0833 0.0106  71  SER A O     
590  C CB    . SER A 71  ? 0.4352 0.5902 0.5863 0.0186  -0.1319 0.0292  71  SER A CB    
591  O OG    . SER A 71  ? 0.4268 0.6003 0.5570 -0.0019 -0.1222 0.0274  71  SER A OG    
592  N N     . LYS A 72  ? 0.4613 0.5524 0.5284 0.0001  -0.1229 0.0373  72  LYS A N     
593  C CA    . LYS A 72  ? 0.4694 0.5504 0.4946 -0.0184 -0.1171 0.0430  72  LYS A CA    
594  C C     . LYS A 72  ? 0.4644 0.5705 0.4725 -0.0366 -0.1123 0.0421  72  LYS A C     
595  O O     . LYS A 72  ? 0.4511 0.5574 0.4329 -0.0469 -0.0960 0.0345  72  LYS A O     
596  C CB    . LYS A 72  ? 0.4984 0.5579 0.5110 -0.0252 -0.1398 0.0640  72  LYS A CB    
597  C CG    . LYS A 72  ? 0.5350 0.5924 0.5063 -0.0462 -0.1347 0.0723  72  LYS A CG    
598  C CD    . LYS A 72  ? 0.5899 0.6691 0.5423 -0.0670 -0.1488 0.0882  72  LYS A CD    
599  C CE    . LYS A 72  ? 0.5893 0.6855 0.5059 -0.0843 -0.1305 0.0807  72  LYS A CE    
600  N NZ    . LYS A 72  ? 0.6098 0.7339 0.5127 -0.1002 -0.1386 0.0842  72  LYS A NZ    
601  N N     . GLU A 73  ? 0.4760 0.6028 0.5015 -0.0397 -0.1281 0.0487  73  GLU A N     
602  C CA    . GLU A 73  ? 0.4784 0.6296 0.4917 -0.0565 -0.1267 0.0451  73  GLU A CA    
603  C C     . GLU A 73  ? 0.4535 0.6114 0.4712 -0.0549 -0.1020 0.0249  73  GLU A C     
604  O O     . GLU A 73  ? 0.4461 0.6067 0.4394 -0.0683 -0.0913 0.0161  73  GLU A O     
605  C CB    . GLU A 73  ? 0.4939 0.6676 0.5341 -0.0572 -0.1492 0.0550  73  GLU A CB    
606  C CG    . GLU A 73  ? 0.5507 0.7176 0.5925 -0.0588 -0.1793 0.0797  73  GLU A CG    
607  C CD    . GLU A 73  ? 0.5731 0.7237 0.6553 -0.0344 -0.1903 0.0845  73  GLU A CD    
608  O OE1   . GLU A 73  ? 0.5556 0.6818 0.6374 -0.0217 -0.1769 0.0757  73  GLU A OE1   
609  O OE2   . GLU A 73  ? 0.5922 0.7544 0.7070 -0.0277 -0.2139 0.0964  73  GLU A OE2   
610  N N     . GLU A 74  ? 0.4433 0.6044 0.4932 -0.0386 -0.0933 0.0173  74  GLU A N     
611  C CA    . GLU A 74  ? 0.4294 0.5991 0.4870 -0.0386 -0.0715 0.0024  74  GLU A CA    
612  C C     . GLU A 74  ? 0.4221 0.5701 0.4526 -0.0400 -0.0526 -0.0050 74  GLU A C     
613  O O     . GLU A 74  ? 0.4137 0.5628 0.4358 -0.0487 -0.0395 -0.0136 74  GLU A O     
614  C CB    . GLU A 74  ? 0.4182 0.6038 0.5158 -0.0220 -0.0660 -0.0025 74  GLU A CB    
615  C CG    . GLU A 74  ? 0.4125 0.6294 0.5446 -0.0226 -0.0807 0.0019  74  GLU A CG    
616  C CD    . GLU A 74  ? 0.4049 0.6442 0.5809 -0.0041 -0.0735 -0.0045 74  GLU A CD    
617  O OE1   . GLU A 74  ? 0.4020 0.6269 0.5815 0.0133  -0.0663 -0.0101 74  GLU A OE1   
618  O OE2   . GLU A 74  ? 0.4048 0.6783 0.6124 -0.0074 -0.0748 -0.0053 74  GLU A OE2   
619  N N     . LEU A 75  ? 0.4310 0.5580 0.4501 -0.0318 -0.0539 -0.0006 75  LEU A N     
620  C CA    . LEU A 75  ? 0.4317 0.5393 0.4257 -0.0335 -0.0400 -0.0046 75  LEU A CA    
621  C C     . LEU A 75  ? 0.4410 0.5494 0.4081 -0.0494 -0.0378 -0.0058 75  LEU A C     
622  O O     . LEU A 75  ? 0.4380 0.5420 0.3968 -0.0523 -0.0230 -0.0150 75  LEU A O     
623  C CB    . LEU A 75  ? 0.4384 0.5247 0.4261 -0.0250 -0.0473 0.0024  75  LEU A CB    
624  C CG    . LEU A 75  ? 0.4307 0.4987 0.4028 -0.0216 -0.0335 -0.0028 75  LEU A CG    
625  C CD1   . LEU A 75  ? 0.4243 0.4938 0.4124 -0.0087 -0.0209 -0.0135 75  LEU A CD1   
626  C CD2   . LEU A 75  ? 0.4395 0.4867 0.3996 -0.0212 -0.0456 0.0072  75  LEU A CD2   
627  N N     . ARG A 76  ? 0.4676 0.5828 0.4213 -0.0596 -0.0527 0.0031  76  ARG A N     
628  C CA    . ARG A 76  ? 0.4838 0.6044 0.4097 -0.0741 -0.0484 -0.0016 76  ARG A CA    
629  C C     . ARG A 76  ? 0.4795 0.6115 0.4082 -0.0816 -0.0423 -0.0160 76  ARG A C     
630  O O     . ARG A 76  ? 0.4822 0.6093 0.3988 -0.0851 -0.0294 -0.0286 76  ARG A O     
631  C CB    . ARG A 76  ? 0.5024 0.6313 0.4066 -0.0863 -0.0641 0.0124  76  ARG A CB    
632  C CG    . ARG A 76  ? 0.5414 0.6828 0.4553 -0.0905 -0.0866 0.0257  76  ARG A CG    
633  C CD    . ARG A 76  ? 0.5683 0.7260 0.4510 -0.1101 -0.0989 0.0360  76  ARG A CD    
634  N NE    . ARG A 76  ? 0.6162 0.7904 0.4788 -0.1220 -0.0882 0.0177  76  ARG A NE    
635  C CZ    . ARG A 76  ? 0.6584 0.8455 0.5283 -0.1272 -0.0929 0.0079  76  ARG A CZ    
636  N NH1   . ARG A 76  ? 0.6797 0.8708 0.5790 -0.1216 -0.1074 0.0164  76  ARG A NH1   
637  N NH2   . ARG A 76  ? 0.6804 0.8774 0.5306 -0.1379 -0.0837 -0.0119 76  ARG A NH2   
638  N N     . GLU A 77  ? 0.4800 0.6264 0.4280 -0.0836 -0.0527 -0.0146 77  GLU A N     
639  C CA    . GLU A 77  ? 0.4811 0.6371 0.4343 -0.0932 -0.0497 -0.0278 77  GLU A CA    
640  C C     . GLU A 77  ? 0.4591 0.6012 0.4211 -0.0886 -0.0313 -0.0387 77  GLU A C     
641  O O     . GLU A 77  ? 0.4690 0.6054 0.4225 -0.0964 -0.0250 -0.0520 77  GLU A O     
642  C CB    . GLU A 77  ? 0.4854 0.6614 0.4662 -0.0949 -0.0633 -0.0224 77  GLU A CB    
643  C CG    . GLU A 77  ? 0.5390 0.7307 0.5115 -0.1032 -0.0859 -0.0107 77  GLU A CG    
644  C CD    . GLU A 77  ? 0.5904 0.8061 0.5908 -0.1081 -0.1007 -0.0078 77  GLU A CD    
645  O OE1   . GLU A 77  ? 0.6239 0.8530 0.6316 -0.1087 -0.1219 0.0074  77  GLU A OE1   
646  O OE2   . GLU A 77  ? 0.5966 0.8182 0.6133 -0.1125 -0.0928 -0.0190 77  GLU A OE2   
647  N N     . ARG A 78  ? 0.4371 0.5727 0.4154 -0.0758 -0.0236 -0.0332 78  ARG A N     
648  C CA    . ARG A 78  ? 0.4219 0.5478 0.4096 -0.0730 -0.0081 -0.0389 78  ARG A CA    
649  C C     . ARG A 78  ? 0.4167 0.5217 0.3845 -0.0702 0.0025  -0.0427 78  ARG A C     
650  O O     . ARG A 78  ? 0.4174 0.5117 0.3855 -0.0739 0.0107  -0.0502 78  ARG A O     
651  C CB    . ARG A 78  ? 0.4111 0.5453 0.4223 -0.0618 -0.0034 -0.0328 78  ARG A CB    
652  C CG    . ARG A 78  ? 0.3956 0.5558 0.4362 -0.0655 -0.0089 -0.0316 78  ARG A CG    
653  C CD    . ARG A 78  ? 0.4029 0.5682 0.4585 -0.0710 0.0042  -0.0337 78  ARG A CD    
654  N NE    . ARG A 78  ? 0.4281 0.5776 0.4725 -0.0849 0.0061  -0.0399 78  ARG A NE    
655  C CZ    . ARG A 78  ? 0.4361 0.5736 0.4821 -0.0896 0.0171  -0.0396 78  ARG A CZ    
656  N NH1   . ARG A 78  ? 0.4252 0.5683 0.4785 -0.0834 0.0289  -0.0327 78  ARG A NH1   
657  N NH2   . ARG A 78  ? 0.4521 0.5712 0.4916 -0.1008 0.0154  -0.0466 78  ARG A NH2   
658  N N     . GLY A 79  ? 0.4125 0.5117 0.3663 -0.0639 0.0007  -0.0366 79  GLY A N     
659  C CA    . GLY A 79  ? 0.4128 0.4981 0.3497 -0.0621 0.0089  -0.0392 79  GLY A CA    
660  C C     . GLY A 79  ? 0.4272 0.5142 0.3533 -0.0709 0.0110  -0.0519 79  GLY A C     
661  O O     . GLY A 79  ? 0.4309 0.5061 0.3594 -0.0696 0.0200  -0.0605 79  GLY A O     
662  N N     . LEU A 80  ? 0.4456 0.5472 0.3600 -0.0797 0.0017  -0.0539 80  LEU A N     
663  C CA    . LEU A 80  ? 0.4663 0.5730 0.3663 -0.0881 0.0040  -0.0702 80  LEU A CA    
664  C C     . LEU A 80  ? 0.4707 0.5668 0.3853 -0.0909 0.0075  -0.0843 80  LEU A C     
665  O O     . LEU A 80  ? 0.4831 0.5684 0.3956 -0.0895 0.0152  -0.0992 80  LEU A O     
666  C CB    . LEU A 80  ? 0.4854 0.6136 0.3664 -0.0999 -0.0082 -0.0683 80  LEU A CB    
667  C CG    . LEU A 80  ? 0.4982 0.6387 0.3556 -0.1033 -0.0096 -0.0590 80  LEU A CG    
668  C CD1   . LEU A 80  ? 0.4725 0.6019 0.3361 -0.0940 -0.0089 -0.0415 80  LEU A CD1   
669  C CD2   . LEU A 80  ? 0.5135 0.6756 0.3535 -0.1172 -0.0258 -0.0503 80  LEU A CD2   
670  N N     . GLU A 81  ? 0.4633 0.5626 0.3961 -0.0945 0.0012  -0.0792 81  GLU A N     
671  C CA    . GLU A 81  ? 0.4740 0.5622 0.4241 -0.0999 0.0030  -0.0879 81  GLU A CA    
672  C C     . GLU A 81  ? 0.4643 0.5288 0.4220 -0.0928 0.0144  -0.0898 81  GLU A C     
673  O O     . GLU A 81  ? 0.4794 0.5281 0.4378 -0.0952 0.0163  -0.1047 81  GLU A O     
674  C CB    . GLU A 81  ? 0.4709 0.5712 0.4445 -0.1030 -0.0022 -0.0763 81  GLU A CB    
675  C CG    . GLU A 81  ? 0.5170 0.6302 0.4989 -0.1173 -0.0141 -0.0826 81  GLU A CG    
676  C CD    . GLU A 81  ? 0.5632 0.6882 0.5761 -0.1208 -0.0147 -0.0723 81  GLU A CD    
677  O OE1   . GLU A 81  ? 0.5569 0.6949 0.5816 -0.1107 -0.0114 -0.0592 81  GLU A OE1   
678  O OE2   . GLU A 81  ? 0.5995 0.7215 0.6260 -0.1341 -0.0184 -0.0782 81  GLU A OE2   
679  N N     . ILE A 82  ? 0.4425 0.5042 0.4065 -0.0841 0.0204  -0.0750 82  ILE A N     
680  C CA    . ILE A 82  ? 0.4385 0.4804 0.4087 -0.0784 0.0289  -0.0716 82  ILE A CA    
681  C C     . ILE A 82  ? 0.4462 0.4767 0.4055 -0.0714 0.0333  -0.0810 82  ILE A C     
682  O O     . ILE A 82  ? 0.4558 0.4671 0.4243 -0.0700 0.0356  -0.0874 82  ILE A O     
683  C CB    . ILE A 82  ? 0.4218 0.4680 0.3949 -0.0712 0.0337  -0.0553 82  ILE A CB    
684  C CG1   . ILE A 82  ? 0.4252 0.4854 0.4160 -0.0772 0.0331  -0.0481 82  ILE A CG1   
685  C CG2   . ILE A 82  ? 0.4149 0.4427 0.3873 -0.0656 0.0405  -0.0500 82  ILE A CG2   
686  C CD1   . ILE A 82  ? 0.4419 0.5180 0.4345 -0.0687 0.0354  -0.0390 82  ILE A CD1   
687  N N     . GLY A 83  ? 0.4421 0.4856 0.3848 -0.0674 0.0336  -0.0807 83  GLY A N     
688  C CA    . GLY A 83  ? 0.4506 0.4931 0.3849 -0.0616 0.0390  -0.0899 83  GLY A CA    
689  C C     . GLY A 83  ? 0.4781 0.5153 0.4147 -0.0643 0.0398  -0.1126 83  GLY A C     
690  O O     . GLY A 83  ? 0.4904 0.5135 0.4374 -0.0568 0.0446  -0.1221 83  GLY A O     
691  N N     . LYS A 84  ? 0.4892 0.5372 0.4175 -0.0747 0.0335  -0.1223 84  LYS A N     
692  C CA    . LYS A 84  ? 0.5134 0.5550 0.4419 -0.0793 0.0321  -0.1474 84  LYS A CA    
693  C C     . LYS A 84  ? 0.5195 0.5302 0.4725 -0.0789 0.0301  -0.1512 84  LYS A C     
694  O O     . LYS A 84  ? 0.5476 0.5418 0.5076 -0.0759 0.0309  -0.1724 84  LYS A O     
695  C CB    . LYS A 84  ? 0.5277 0.5876 0.4413 -0.0933 0.0226  -0.1534 84  LYS A CB    
696  C CG    . LYS A 84  ? 0.5446 0.6330 0.4298 -0.0967 0.0240  -0.1596 84  LYS A CG    
697  C CD    . LYS A 84  ? 0.5599 0.6711 0.4301 -0.1088 0.0117  -0.1457 84  LYS A CD    
698  C CE    . LYS A 84  ? 0.5910 0.7090 0.4530 -0.1232 0.0009  -0.1619 84  LYS A CE    
699  N NZ    . LYS A 84  ? 0.5822 0.6956 0.4653 -0.1292 -0.0107 -0.1484 84  LYS A NZ    
700  N N     . ALA A 85  ? 0.4993 0.5028 0.4661 -0.0822 0.0273  -0.1306 85  ALA A N     
701  C CA    . ALA A 85  ? 0.5097 0.4866 0.4990 -0.0874 0.0233  -0.1288 85  ALA A CA    
702  C C     . ALA A 85  ? 0.5097 0.4626 0.5115 -0.0762 0.0275  -0.1255 85  ALA A C     
703  O O     . ALA A 85  ? 0.5362 0.4613 0.5566 -0.0792 0.0224  -0.1271 85  ALA A O     
704  C CB    . ALA A 85  ? 0.4904 0.4759 0.4898 -0.0963 0.0208  -0.1067 85  ALA A CB    
705  N N     . VAL A 86  ? 0.4874 0.4506 0.4803 -0.0643 0.0347  -0.1196 86  VAL A N     
706  C CA    . VAL A 86  ? 0.4782 0.4250 0.4830 -0.0548 0.0370  -0.1075 86  VAL A CA    
707  C C     . VAL A 86  ? 0.4944 0.4391 0.5033 -0.0406 0.0413  -0.1237 86  VAL A C     
708  O O     . VAL A 86  ? 0.5018 0.4286 0.5277 -0.0318 0.0400  -0.1179 86  VAL A O     
709  C CB    . VAL A 86  ? 0.4449 0.4059 0.4399 -0.0540 0.0405  -0.0833 86  VAL A CB    
710  C CG1   . VAL A 86  ? 0.4173 0.3841 0.4071 -0.0420 0.0451  -0.0790 86  VAL A CG1   
711  C CG2   . VAL A 86  ? 0.4341 0.3833 0.4398 -0.0618 0.0380  -0.0642 86  VAL A CG2   
712  N N     . LEU A 87  ? 0.5012 0.4674 0.4958 -0.0389 0.0459  -0.1434 87  LEU A N     
713  C CA    . LEU A 87  ? 0.5102 0.4864 0.5084 -0.0257 0.0531  -0.1599 87  LEU A CA    
714  C C     . LEU A 87  ? 0.5500 0.5154 0.5575 -0.0221 0.0529  -0.1931 87  LEU A C     
715  O O     . LEU A 87  ? 0.5657 0.5332 0.5606 -0.0332 0.0495  -0.2072 87  LEU A O     
716  C CB    . LEU A 87  ? 0.4920 0.5058 0.4663 -0.0274 0.0602  -0.1576 87  LEU A CB    
717  C CG    . LEU A 87  ? 0.4472 0.4706 0.4102 -0.0312 0.0588  -0.1290 87  LEU A CG    
718  C CD1   . LEU A 87  ? 0.4371 0.4926 0.3767 -0.0369 0.0617  -0.1276 87  LEU A CD1   
719  C CD2   . LEU A 87  ? 0.4395 0.4545 0.4167 -0.0211 0.0599  -0.1146 87  LEU A CD2   
720  N N     . ASP A 88  ? 0.5738 0.5277 0.6049 -0.0062 0.0554  -0.2065 88  ASP A N     
721  C CA    . ASP A 88  ? 0.6166 0.5558 0.6623 0.0017  0.0552  -0.2426 88  ASP A CA    
722  C C     . ASP A 88  ? 0.6313 0.6042 0.6488 -0.0041 0.0635  -0.2694 88  ASP A C     
723  O O     . ASP A 88  ? 0.6609 0.6235 0.6694 -0.0138 0.0580  -0.2891 88  ASP A O     
724  C CB    . ASP A 88  ? 0.6295 0.5627 0.7066 0.0239  0.0587  -0.2527 88  ASP A CB    
725  C CG    . ASP A 88  ? 0.6436 0.5353 0.7516 0.0289  0.0459  -0.2300 88  ASP A CG    
726  O OD1   . ASP A 88  ? 0.6409 0.5107 0.7439 0.0139  0.0363  -0.2070 88  ASP A OD1   
727  O OD2   . ASP A 88  ? 0.6627 0.5466 0.8012 0.0474  0.0451  -0.2339 88  ASP A OD2   
728  N N     . SER A 89  ? 0.6195 0.6340 0.6222 -0.0003 0.0757  -0.2687 89  SER A N     
729  C CA    . SER A 89  ? 0.6280 0.6820 0.5958 -0.0116 0.0826  -0.2815 89  SER A CA    
730  C C     . SER A 89  ? 0.5990 0.6819 0.5466 -0.0204 0.0847  -0.2490 89  SER A C     
731  O O     . SER A 89  ? 0.5727 0.6481 0.5342 -0.0147 0.0835  -0.2234 89  SER A O     
732  C CB    . SER A 89  ? 0.6539 0.7356 0.6226 -0.0002 0.0964  -0.3182 89  SER A CB    
733  O OG    . SER A 89  ? 0.6340 0.7304 0.6258 0.0161  0.1054  -0.3121 89  SER A OG    
734  N N     . TYR A 90  ? 0.6053 0.7195 0.5197 -0.0351 0.0858  -0.2496 90  TYR A N     
735  C CA    . TYR A 90  ? 0.5806 0.7136 0.4763 -0.0459 0.0826  -0.2172 90  TYR A CA    
736  C C     . TYR A 90  ? 0.5959 0.7724 0.4576 -0.0596 0.0865  -0.2201 90  TYR A C     
737  O O     . TYR A 90  ? 0.6282 0.8205 0.4736 -0.0646 0.0902  -0.2474 90  TYR A O     
738  C CB    . TYR A 90  ? 0.5623 0.6697 0.4581 -0.0546 0.0686  -0.1954 90  TYR A CB    
739  C CG    . TYR A 90  ? 0.5794 0.6853 0.4606 -0.0678 0.0600  -0.2084 90  TYR A CG    
740  C CD1   . TYR A 90  ? 0.5763 0.7108 0.4279 -0.0828 0.0549  -0.2022 90  TYR A CD1   
741  C CD2   . TYR A 90  ? 0.5952 0.6705 0.4931 -0.0670 0.0545  -0.2248 90  TYR A CD2   
742  C CE1   . TYR A 90  ? 0.5953 0.7308 0.4337 -0.0959 0.0448  -0.2133 90  TYR A CE1   
743  C CE2   . TYR A 90  ? 0.6109 0.6856 0.4966 -0.0809 0.0448  -0.2367 90  TYR A CE2   
744  C CZ    . TYR A 90  ? 0.6192 0.7255 0.4750 -0.0950 0.0401  -0.2313 90  TYR A CZ    
745  O OH    . TYR A 90  ? 0.6558 0.7639 0.4997 -0.1098 0.0283  -0.2422 90  TYR A OH    
746  N N     . GLU A 91  ? 0.5797 0.7737 0.4296 -0.0670 0.0842  -0.1910 91  GLU A N     
747  C CA    . GLU A 91  ? 0.5962 0.8291 0.4134 -0.0837 0.0839  -0.1827 91  GLU A CA    
748  C C     . GLU A 91  ? 0.5751 0.7987 0.3850 -0.0935 0.0690  -0.1467 91  GLU A C     
749  O O     . GLU A 91  ? 0.5559 0.7565 0.3847 -0.0854 0.0655  -0.1281 91  GLU A O     
750  C CB    . GLU A 91  ? 0.6011 0.8721 0.4172 -0.0815 0.0989  -0.1855 91  GLU A CB    
751  C CG    . GLU A 91  ? 0.6586 0.9790 0.4397 -0.0983 0.1053  -0.1937 91  GLU A CG    
752  C CD    . GLU A 91  ? 0.7025 1.0666 0.4889 -0.0928 0.1258  -0.2099 91  GLU A CD    
753  O OE1   . GLU A 91  ? 0.7383 1.1425 0.5012 -0.1004 0.1369  -0.2339 91  GLU A OE1   
754  O OE2   . GLU A 91  ? 0.6876 1.0491 0.5023 -0.0809 0.1308  -0.1998 91  GLU A OE2   
755  N N     . ILE A 92  ? 0.5863 0.8269 0.3693 -0.1103 0.0589  -0.1379 92  ILE A N     
756  C CA    . ILE A 92  ? 0.5677 0.8000 0.3465 -0.1184 0.0425  -0.1050 92  ILE A CA    
757  C C     . ILE A 92  ? 0.5816 0.8494 0.3334 -0.1352 0.0401  -0.0876 92  ILE A C     
758  O O     . ILE A 92  ? 0.6117 0.9086 0.3359 -0.1497 0.0392  -0.0953 92  ILE A O     
759  C CB    . ILE A 92  ? 0.5705 0.7883 0.3481 -0.1239 0.0271  -0.1035 92  ILE A CB    
760  C CG1   . ILE A 92  ? 0.5556 0.7390 0.3624 -0.1102 0.0285  -0.1136 92  ILE A CG1   
761  C CG2   . ILE A 92  ? 0.5622 0.7785 0.3355 -0.1319 0.0091  -0.0716 92  ILE A CG2   
762  C CD1   . ILE A 92  ? 0.5764 0.7529 0.3842 -0.1170 0.0176  -0.1222 92  ILE A CD1   
763  N N     . ARG A 93  ? 0.5653 0.8313 0.3239 -0.1350 0.0383  -0.0638 93  ARG A N     
764  C CA    . ARG A 93  ? 0.5797 0.8768 0.3160 -0.1534 0.0342  -0.0416 93  ARG A CA    
765  C C     . ARG A 93  ? 0.5531 0.8289 0.3040 -0.1517 0.0242  -0.0127 93  ARG A C     
766  O O     . ARG A 93  ? 0.5341 0.7994 0.3054 -0.1396 0.0332  -0.0157 93  ARG A O     
767  C CB    . ARG A 93  ? 0.5992 0.9408 0.3242 -0.1581 0.0545  -0.0585 93  ARG A CB    
768  C CG    . ARG A 93  ? 0.6500 1.0345 0.3434 -0.1834 0.0510  -0.0377 93  ARG A CG    
769  C CD    . ARG A 93  ? 0.7133 1.1517 0.3847 -0.1913 0.0715  -0.0636 93  ARG A CD    
770  N NE    . ARG A 93  ? 0.7667 1.2489 0.4001 -0.2202 0.0660  -0.0422 93  ARG A NE    
771  C CZ    . ARG A 93  ? 0.8021 1.2859 0.4063 -0.2373 0.0480  -0.0296 93  ARG A CZ    
772  N NH1   . ARG A 93  ? 0.7985 1.2443 0.4100 -0.2279 0.0343  -0.0373 93  ARG A NH1   
773  N NH2   . ARG A 93  ? 0.8347 1.3605 0.4034 -0.2655 0.0424  -0.0069 93  ARG A NH2   
774  N N     . TYR A 94  ? 0.5561 0.8238 0.2975 -0.1636 0.0037  0.0146  94  TYR A N     
775  C CA    . TYR A 94  ? 0.5362 0.7765 0.2917 -0.1618 -0.0099 0.0403  94  TYR A CA    
776  C C     . TYR A 94  ? 0.5591 0.8046 0.2981 -0.1818 -0.0319 0.0724  94  TYR A C     
777  O O     . TYR A 94  ? 0.5792 0.8449 0.2967 -0.1956 -0.0398 0.0767  94  TYR A O     
778  C CB    . TYR A 94  ? 0.5106 0.7092 0.2909 -0.1423 -0.0157 0.0348  94  TYR A CB    
779  C CG    . TYR A 94  ? 0.5142 0.7062 0.2940 -0.1411 -0.0262 0.0306  94  TYR A CG    
780  C CD1   . TYR A 94  ? 0.5342 0.7153 0.3145 -0.1467 -0.0490 0.0529  94  TYR A CD1   
781  C CD2   . TYR A 94  ? 0.5103 0.7064 0.2926 -0.1345 -0.0152 0.0046  94  TYR A CD2   
782  C CE1   . TYR A 94  ? 0.5437 0.7232 0.3282 -0.1455 -0.0600 0.0500  94  TYR A CE1   
783  C CE2   . TYR A 94  ? 0.5124 0.7052 0.2966 -0.1356 -0.0262 0.0016  94  TYR A CE2   
784  C CZ    . TYR A 94  ? 0.5289 0.7159 0.3147 -0.1409 -0.0482 0.0246  94  TYR A CZ    
785  O OH    . TYR A 94  ? 0.5258 0.7138 0.3177 -0.1418 -0.0606 0.0233  94  TYR A OH    
786  N N     . ALA A 95  ? 0.5554 0.7805 0.3042 -0.1843 -0.0439 0.0955  95  ALA A N     
787  C CA    . ALA A 95  ? 0.5782 0.7989 0.3170 -0.2028 -0.0687 0.1295  95  ALA A CA    
788  C C     . ALA A 95  ? 0.5805 0.7631 0.3350 -0.1920 -0.0914 0.1379  95  ALA A C     
789  O O     . ALA A 95  ? 0.6053 0.7962 0.3486 -0.2020 -0.1072 0.1500  95  ALA A O     
790  C CB    . ALA A 95  ? 0.5796 0.7940 0.3238 -0.2118 -0.0731 0.1497  95  ALA A CB    
791  N N     . GLU A 96  ? 0.5569 0.7016 0.3378 -0.1716 -0.0930 0.1307  96  GLU A N     
792  C CA    . GLU A 96  ? 0.5595 0.6722 0.3606 -0.1579 -0.1115 0.1343  96  GLU A CA    
793  C C     . GLU A 96  ? 0.5258 0.6262 0.3467 -0.1340 -0.0967 0.1061  96  GLU A C     
794  O O     . GLU A 96  ? 0.5227 0.6255 0.3520 -0.1274 -0.1006 0.0988  96  GLU A O     
795  C CB    . GLU A 96  ? 0.5738 0.6507 0.3886 -0.1574 -0.1330 0.1556  96  GLU A CB    
796  C CG    . GLU A 96  ? 0.6019 0.6448 0.4443 -0.1382 -0.1508 0.1548  96  GLU A CG    
797  C CD    . GLU A 96  ? 0.6192 0.6362 0.4828 -0.1139 -0.1385 0.1314  96  GLU A CD    
798  O OE1   . GLU A 96  ? 0.6177 0.6312 0.4993 -0.0959 -0.1341 0.1148  96  GLU A OE1   
799  O OE2   . GLU A 96  ? 0.6410 0.6441 0.5029 -0.1145 -0.1337 0.1304  96  GLU A OE2   
800  N N     . HIS A 97  ? 0.5032 0.5929 0.3320 -0.1232 -0.0809 0.0922  97  HIS A N     
801  C CA    . HIS A 97  ? 0.4820 0.5584 0.3285 -0.1032 -0.0688 0.0706  97  HIS A CA    
802  C C     . HIS A 97  ? 0.4662 0.5652 0.3061 -0.1029 -0.0482 0.0501  97  HIS A C     
803  O O     . HIS A 97  ? 0.4650 0.5782 0.2955 -0.1075 -0.0346 0.0443  97  HIS A O     
804  C CB    . HIS A 97  ? 0.4751 0.5266 0.3319 -0.0925 -0.0650 0.0674  97  HIS A CB    
805  C CG    . HIS A 97  ? 0.4693 0.5069 0.3429 -0.0736 -0.0555 0.0495  97  HIS A CG    
806  N ND1   . HIS A 97  ? 0.4663 0.5124 0.3405 -0.0681 -0.0360 0.0329  97  HIS A ND1   
807  C CD2   . HIS A 97  ? 0.4796 0.4977 0.3707 -0.0595 -0.0628 0.0459  97  HIS A CD2   
808  C CE1   . HIS A 97  ? 0.4604 0.4942 0.3489 -0.0542 -0.0317 0.0227  97  HIS A CE1   
809  N NE2   . HIS A 97  ? 0.4701 0.4894 0.3688 -0.0481 -0.0462 0.0287  97  HIS A NE2   
810  N N     . PRO A 98  ? 0.4602 0.5621 0.3085 -0.0968 -0.0467 0.0383  98  PRO A N     
811  C CA    . PRO A 98  ? 0.4486 0.5683 0.2908 -0.0987 -0.0313 0.0188  98  PRO A CA    
812  C C     . PRO A 98  ? 0.4249 0.5335 0.2779 -0.0867 -0.0135 0.0032  98  PRO A C     
813  O O     . PRO A 98  ? 0.4237 0.5121 0.2902 -0.0757 -0.0131 0.0055  98  PRO A O     
814  C CB    . PRO A 98  ? 0.4477 0.5690 0.3007 -0.0965 -0.0393 0.0144  98  PRO A CB    
815  C CG    . PRO A 98  ? 0.4484 0.5484 0.3237 -0.0835 -0.0483 0.0228  98  PRO A CG    
816  C CD    . PRO A 98  ? 0.4584 0.5475 0.3267 -0.0870 -0.0591 0.0410  98  PRO A CD    
817  N N     . TYR A 99  ? 0.4127 0.5346 0.2597 -0.0887 0.0000  -0.0128 99  TYR A N     
818  C CA    . TYR A 99  ? 0.3887 0.4996 0.2484 -0.0778 0.0141  -0.0262 99  TYR A CA    
819  C C     . TYR A 99  ? 0.3952 0.5216 0.2495 -0.0805 0.0251  -0.0458 99  TYR A C     
820  O O     . TYR A 99  ? 0.4134 0.5630 0.2503 -0.0912 0.0243  -0.0489 99  TYR A O     
821  C CB    . TYR A 99  ? 0.3752 0.4782 0.2379 -0.0732 0.0172  -0.0173 99  TYR A CB    
822  C CG    . TYR A 99  ? 0.3724 0.4983 0.2239 -0.0816 0.0216  -0.0144 99  TYR A CG    
823  C CD1   . TYR A 99  ? 0.3683 0.5039 0.2271 -0.0762 0.0352  -0.0267 99  TYR A CD1   
824  C CD2   . TYR A 99  ? 0.3652 0.5051 0.2016 -0.0953 0.0115  0.0019  99  TYR A CD2   
825  C CE1   . TYR A 99  ? 0.3714 0.5355 0.2240 -0.0834 0.0413  -0.0251 99  TYR A CE1   
826  C CE2   . TYR A 99  ? 0.3889 0.5559 0.2154 -0.1056 0.0169  0.0064  99  TYR A CE2   
827  C CZ    . TYR A 99  ? 0.3876 0.5693 0.2230 -0.0992 0.0330  -0.0082 99  TYR A CZ    
828  O OH    . TYR A 99  ? 0.3961 0.6120 0.2254 -0.1090 0.0401  -0.0047 99  TYR A OH    
829  N N     . VAL A 100 ? 0.3871 0.5004 0.2564 -0.0708 0.0347  -0.0591 100 VAL A N     
830  C CA    . VAL A 100 ? 0.4048 0.5260 0.2749 -0.0699 0.0441  -0.0815 100 VAL A CA    
831  C C     . VAL A 100 ? 0.4034 0.5278 0.2833 -0.0610 0.0547  -0.0860 100 VAL A C     
832  O O     . VAL A 100 ? 0.3908 0.4980 0.2845 -0.0529 0.0549  -0.0764 100 VAL A O     
833  C CB    . VAL A 100 ? 0.4041 0.5049 0.2886 -0.0667 0.0433  -0.0936 100 VAL A CB    
834  C CG1   . VAL A 100 ? 0.4252 0.5304 0.3095 -0.0667 0.0497  -0.1200 100 VAL A CG1   
835  C CG2   . VAL A 100 ? 0.4076 0.5087 0.2889 -0.0745 0.0319  -0.0857 100 VAL A CG2   
836  N N     . HIS A 101 ? 0.4160 0.5661 0.2889 -0.0629 0.0635  -0.1008 101 HIS A N     
837  C CA    . HIS A 101 ? 0.4169 0.5753 0.3057 -0.0526 0.0741  -0.1083 101 HIS A CA    
838  C C     . HIS A 101 ? 0.4346 0.5871 0.3377 -0.0428 0.0817  -0.1370 101 HIS A C     
839  O O     . HIS A 101 ? 0.4564 0.6219 0.3465 -0.0481 0.0845  -0.1570 101 HIS A O     
840  C CB    . HIS A 101 ? 0.4214 0.6196 0.2979 -0.0604 0.0804  -0.1044 101 HIS A CB    
841  C CG    . HIS A 101 ? 0.4221 0.6361 0.3201 -0.0491 0.0918  -0.1130 101 HIS A CG    
842  N ND1   . HIS A 101 ? 0.4029 0.6014 0.3211 -0.0406 0.0887  -0.0986 101 HIS A ND1   
843  C CD2   . HIS A 101 ? 0.4464 0.6933 0.3506 -0.0443 0.1059  -0.1352 101 HIS A CD2   
844  C CE1   . HIS A 101 ? 0.4162 0.6372 0.3550 -0.0310 0.0988  -0.1094 101 HIS A CE1   
845  N NE2   . HIS A 101 ? 0.4425 0.6940 0.3750 -0.0320 0.1104  -0.1326 101 HIS A NE2   
846  N N     . GLY A 102 ? 0.4264 0.5578 0.3561 -0.0289 0.0833  -0.1392 102 GLY A N     
847  C CA    . GLY A 102 ? 0.4436 0.5614 0.3921 -0.0183 0.0873  -0.1654 102 GLY A CA    
848  C C     . GLY A 102 ? 0.4417 0.5495 0.4221 -0.0015 0.0900  -0.1672 102 GLY A C     
849  O O     . GLY A 102 ? 0.4241 0.5476 0.4114 0.0018  0.0921  -0.1526 102 GLY A O     
850  N N     . VAL A 103 ? 0.4628 0.5430 0.4646 0.0081  0.0878  -0.1845 103 VAL A N     
851  C CA    . VAL A 103 ? 0.4695 0.5362 0.5066 0.0257  0.0875  -0.1883 103 VAL A CA    
852  C C     . VAL A 103 ? 0.4787 0.4971 0.5316 0.0267  0.0750  -0.1808 103 VAL A C     
853  O O     . VAL A 103 ? 0.4927 0.4919 0.5380 0.0187  0.0707  -0.1912 103 VAL A O     
854  C CB    . VAL A 103 ? 0.4953 0.5834 0.5487 0.0394  0.0987  -0.2244 103 VAL A CB    
855  C CG1   . VAL A 103 ? 0.5153 0.5727 0.6111 0.0591  0.0934  -0.2362 103 VAL A CG1   
856  C CG2   . VAL A 103 ? 0.4820 0.6220 0.5315 0.0406  0.1113  -0.2233 103 VAL A CG2   
857  N N     . VAL A 104 ? 0.4707 0.4721 0.5441 0.0338  0.0681  -0.1600 104 VAL A N     
858  C CA    . VAL A 104 ? 0.4866 0.4441 0.5799 0.0352  0.0556  -0.1507 104 VAL A CA    
859  C C     . VAL A 104 ? 0.5025 0.4502 0.6345 0.0544  0.0514  -0.1534 104 VAL A C     
860  O O     . VAL A 104 ? 0.4876 0.4506 0.6269 0.0597  0.0506  -0.1355 104 VAL A O     
861  C CB    . VAL A 104 ? 0.4651 0.4098 0.5428 0.0220  0.0482  -0.1169 104 VAL A CB    
862  C CG1   . VAL A 104 ? 0.4806 0.3848 0.5789 0.0211  0.0355  -0.1039 104 VAL A CG1   
863  C CG2   . VAL A 104 ? 0.4632 0.4175 0.5107 0.0060  0.0511  -0.1160 104 VAL A CG2   
864  N N     . LYS A 105 ? 0.5309 0.4525 0.6893 0.0648  0.0470  -0.1766 105 LYS A N     
865  C CA    . LYS A 105 ? 0.5502 0.4600 0.7526 0.0864  0.0414  -0.1839 105 LYS A CA    
866  C C     . LYS A 105 ? 0.5319 0.4896 0.7447 0.1002  0.0536  -0.1918 105 LYS A C     
867  O O     . LYS A 105 ? 0.5242 0.4868 0.7597 0.1094  0.0474  -0.1728 105 LYS A O     
868  C CB    . LYS A 105 ? 0.5568 0.4305 0.7766 0.0846  0.0232  -0.1490 105 LYS A CB    
869  C CG    . LYS A 105 ? 0.5785 0.4060 0.7951 0.0701  0.0104  -0.1396 105 LYS A CG    
870  C CD    . LYS A 105 ? 0.5861 0.3858 0.8130 0.0640  -0.0065 -0.1000 105 LYS A CD    
871  C CE    . LYS A 105 ? 0.6356 0.3987 0.9107 0.0808  -0.0232 -0.1013 105 LYS A CE    
872  N NZ    . LYS A 105 ? 0.6888 0.4091 0.9794 0.0782  -0.0318 -0.1207 105 LYS A NZ    
873  N N     . GLY A 106 ? 0.5291 0.5250 0.7240 0.0993  0.0702  -0.2183 106 GLY A N     
874  C CA    . GLY A 106 ? 0.5248 0.5727 0.7309 0.1106  0.0843  -0.2301 106 GLY A CA    
875  C C     . GLY A 106 ? 0.4944 0.5758 0.6835 0.1002  0.0868  -0.1995 106 GLY A C     
876  O O     . GLY A 106 ? 0.4960 0.6180 0.7042 0.1096  0.0947  -0.2025 106 GLY A O     
877  N N     . VAL A 107 ? 0.4728 0.5393 0.6287 0.0809  0.0798  -0.1713 107 VAL A N     
878  C CA    . VAL A 107 ? 0.4443 0.5372 0.5819 0.0699  0.0802  -0.1446 107 VAL A CA    
879  C C     . VAL A 107 ? 0.4318 0.5328 0.5245 0.0493  0.0839  -0.1377 107 VAL A C     
880  O O     . VAL A 107 ? 0.4337 0.5068 0.5093 0.0410  0.0794  -0.1379 107 VAL A O     
881  C CB    . VAL A 107 ? 0.4371 0.5066 0.5861 0.0704  0.0647  -0.1123 107 VAL A CB    
882  C CG1   . VAL A 107 ? 0.4569 0.4797 0.6264 0.0774  0.0521  -0.1096 107 VAL A CG1   
883  C CG2   . VAL A 107 ? 0.4125 0.4799 0.5241 0.0513  0.0603  -0.0854 107 VAL A CG2   
884  N N     . GLU A 108 ? 0.4198 0.5598 0.4971 0.0408  0.0907  -0.1304 108 GLU A N     
885  C CA    . GLU A 108 ? 0.4114 0.5613 0.4498 0.0219  0.0919  -0.1214 108 GLU A CA    
886  C C     . GLU A 108 ? 0.3958 0.5115 0.4169 0.0127  0.0798  -0.0981 108 GLU A C     
887  O O     . GLU A 108 ? 0.3877 0.4910 0.4166 0.0146  0.0718  -0.0789 108 GLU A O     
888  C CB    . GLU A 108 ? 0.4039 0.5958 0.4337 0.0130  0.0968  -0.1100 108 GLU A CB    
889  C CG    . GLU A 108 ? 0.4395 0.6784 0.4889 0.0206  0.1108  -0.1287 108 GLU A CG    
890  C CD    . GLU A 108 ? 0.4977 0.7512 0.5388 0.0227  0.1229  -0.1603 108 GLU A CD    
891  O OE1   . GLU A 108 ? 0.5113 0.7372 0.5306 0.0163  0.1184  -0.1658 108 GLU A OE1   
892  O OE2   . GLU A 108 ? 0.5283 0.8238 0.5856 0.0307  0.1371  -0.1810 108 GLU A OE2   
893  N N     . VAL A 109 ? 0.3920 0.4963 0.3898 0.0027  0.0785  -0.1007 109 VAL A N     
894  C CA    . VAL A 109 ? 0.3798 0.4597 0.3618 -0.0056 0.0694  -0.0816 109 VAL A CA    
895  C C     . VAL A 109 ? 0.3798 0.4726 0.3342 -0.0190 0.0686  -0.0774 109 VAL A C     
896  O O     . VAL A 109 ? 0.3937 0.5031 0.3384 -0.0235 0.0734  -0.0921 109 VAL A O     
897  C CB    . VAL A 109 ? 0.3852 0.4321 0.3754 -0.0035 0.0651  -0.0855 109 VAL A CB    
898  C CG1   . VAL A 109 ? 0.3667 0.3955 0.3453 -0.0103 0.0580  -0.0648 109 VAL A CG1   
899  C CG2   . VAL A 109 ? 0.3890 0.4207 0.4095 0.0097  0.0637  -0.0915 109 VAL A CG2   
900  N N     . ASP A 110 ? 0.3749 0.4602 0.3169 -0.0251 0.0615  -0.0579 110 ASP A N     
901  C CA    . ASP A 110 ? 0.3864 0.4754 0.3074 -0.0357 0.0566  -0.0513 110 ASP A CA    
902  C C     . ASP A 110 ? 0.3819 0.4463 0.3011 -0.0356 0.0508  -0.0446 110 ASP A C     
903  O O     . ASP A 110 ? 0.3793 0.4300 0.3004 -0.0326 0.0475  -0.0333 110 ASP A O     
904  C CB    . ASP A 110 ? 0.3890 0.4898 0.2996 -0.0427 0.0516  -0.0351 110 ASP A CB    
905  C CG    . ASP A 110 ? 0.4293 0.5639 0.3390 -0.0477 0.0578  -0.0383 110 ASP A CG    
906  O OD1   . ASP A 110 ? 0.4794 0.6324 0.3904 -0.0466 0.0668  -0.0559 110 ASP A OD1   
907  O OD2   . ASP A 110 ? 0.4750 0.6196 0.3822 -0.0539 0.0536  -0.0237 110 ASP A OD2   
908  N N     . VAL A 111 ? 0.3872 0.4498 0.3024 -0.0397 0.0496  -0.0518 111 VAL A N     
909  C CA    . VAL A 111 ? 0.3796 0.4278 0.2957 -0.0406 0.0450  -0.0454 111 VAL A CA    
910  C C     . VAL A 111 ? 0.3755 0.4311 0.2798 -0.0458 0.0372  -0.0368 111 VAL A C     
911  O O     . VAL A 111 ? 0.3843 0.4530 0.2810 -0.0526 0.0338  -0.0405 111 VAL A O     
912  C CB    . VAL A 111 ? 0.3858 0.4270 0.3112 -0.0425 0.0464  -0.0564 111 VAL A CB    
913  C CG1   . VAL A 111 ? 0.3803 0.4152 0.3096 -0.0445 0.0431  -0.0486 111 VAL A CG1   
914  C CG2   . VAL A 111 ? 0.3982 0.4253 0.3387 -0.0368 0.0507  -0.0626 111 VAL A CG2   
915  N N     . VAL A 112 ? 0.3685 0.4147 0.2712 -0.0427 0.0330  -0.0259 112 VAL A N     
916  C CA    . VAL A 112 ? 0.3741 0.4220 0.2697 -0.0454 0.0230  -0.0172 112 VAL A CA    
917  C C     . VAL A 112 ? 0.3730 0.4132 0.2766 -0.0402 0.0201  -0.0164 112 VAL A C     
918  O O     . VAL A 112 ? 0.3832 0.4142 0.2903 -0.0345 0.0248  -0.0165 112 VAL A O     
919  C CB    . VAL A 112 ? 0.3737 0.4163 0.2623 -0.0458 0.0183  -0.0072 112 VAL A CB    
920  C CG1   . VAL A 112 ? 0.3865 0.4229 0.2710 -0.0478 0.0050  0.0022  112 VAL A CG1   
921  C CG2   . VAL A 112 ? 0.3811 0.4401 0.2650 -0.0520 0.0219  -0.0067 112 VAL A CG2   
922  N N     . PRO A 113 ? 0.3777 0.4253 0.2850 -0.0423 0.0124  -0.0154 113 PRO A N     
923  C CA    . PRO A 113 ? 0.3807 0.4263 0.3011 -0.0352 0.0103  -0.0157 113 PRO A CA    
924  C C     . PRO A 113 ? 0.3958 0.4294 0.3154 -0.0284 0.0013  -0.0100 113 PRO A C     
925  O O     . PRO A 113 ? 0.4067 0.4358 0.3179 -0.0330 -0.0094 -0.0016 113 PRO A O     
926  C CB    . PRO A 113 ? 0.3825 0.4425 0.3106 -0.0400 0.0028  -0.0162 113 PRO A CB    
927  C CG    . PRO A 113 ? 0.3915 0.4566 0.3035 -0.0495 -0.0049 -0.0109 113 PRO A CG    
928  C CD    . PRO A 113 ? 0.3866 0.4479 0.2868 -0.0515 0.0049  -0.0137 113 PRO A CD    
929  N N     . CYS A 114 ? 0.4036 0.4326 0.3315 -0.0186 0.0054  -0.0149 114 CYS A N     
930  C CA    . CYS A 114 ? 0.4191 0.4352 0.3503 -0.0097 -0.0042 -0.0146 114 CYS A CA    
931  C C     . CYS A 114 ? 0.4239 0.4476 0.3719 0.0025  0.0015  -0.0248 114 CYS A C     
932  O O     . CYS A 114 ? 0.4177 0.4604 0.3766 0.0015  0.0114  -0.0285 114 CYS A O     
933  C CB    . CYS A 114 ? 0.4289 0.4269 0.3439 -0.0105 -0.0051 -0.0129 114 CYS A CB    
934  S SG    . CYS A 114 ? 0.4513 0.4461 0.3603 -0.0034 0.0081  -0.0231 114 CYS A SG    
935  N N     . TYR A 115 ? 0.4395 0.4495 0.3907 0.0134  -0.0049 -0.0302 115 TYR A N     
936  C CA    . TYR A 115 ? 0.4471 0.4677 0.4169 0.0279  0.0004  -0.0433 115 TYR A CA    
937  C C     . TYR A 115 ? 0.4587 0.4764 0.4147 0.0328  0.0132  -0.0549 115 TYR A C     
938  O O     . TYR A 115 ? 0.4685 0.4633 0.4073 0.0327  0.0074  -0.0562 115 TYR A O     
939  C CB    . TYR A 115 ? 0.4634 0.4709 0.4514 0.0399  -0.0177 -0.0449 115 TYR A CB    
940  C CG    . TYR A 115 ? 0.4647 0.4813 0.4702 0.0366  -0.0316 -0.0332 115 TYR A CG    
941  C CD1   . TYR A 115 ? 0.4770 0.4761 0.4736 0.0273  -0.0505 -0.0173 115 TYR A CD1   
942  C CD2   . TYR A 115 ? 0.4610 0.5068 0.4914 0.0407  -0.0270 -0.0365 115 TYR A CD2   
943  C CE1   . TYR A 115 ? 0.4704 0.4799 0.4789 0.0221  -0.0648 -0.0049 115 TYR A CE1   
944  C CE2   . TYR A 115 ? 0.4603 0.5159 0.5057 0.0365  -0.0422 -0.0252 115 TYR A CE2   
945  C CZ    . TYR A 115 ? 0.4677 0.5045 0.5002 0.0272  -0.0614 -0.0093 115 TYR A CZ    
946  O OH    . TYR A 115 ? 0.4808 0.5295 0.5241 0.0209  -0.0779 0.0036  115 TYR A OH    
947  N N     . LYS A 116 ? 0.4604 0.5036 0.4235 0.0350  0.0298  -0.0624 116 LYS A N     
948  C CA    . LYS A 116 ? 0.4820 0.5301 0.4311 0.0391  0.0429  -0.0739 116 LYS A CA    
949  C C     . LYS A 116 ? 0.5132 0.5556 0.4721 0.0573  0.0388  -0.0927 116 LYS A C     
950  O O     . LYS A 116 ? 0.5211 0.5884 0.5037 0.0691  0.0462  -0.1047 116 LYS A O     
951  C CB    . LYS A 116 ? 0.4742 0.5556 0.4281 0.0333  0.0617  -0.0736 116 LYS A CB    
952  C CG    . LYS A 116 ? 0.4919 0.5823 0.4246 0.0331  0.0757  -0.0821 116 LYS A CG    
953  C CD    . LYS A 116 ? 0.4981 0.6199 0.4322 0.0216  0.0925  -0.0748 116 LYS A CD    
954  C CE    . LYS A 116 ? 0.5238 0.6499 0.4273 0.0150  0.1029  -0.0754 116 LYS A CE    
955  N NZ    . LYS A 116 ? 0.5462 0.7117 0.4539 0.0061  0.1210  -0.0718 116 LYS A NZ    
956  N N     . LEU A 117 ? 0.5418 0.5515 0.4849 0.0595  0.0261  -0.0957 117 LEU A N     
957  C CA    . LEU A 117 ? 0.5824 0.5772 0.5307 0.0764  0.0200  -0.1164 117 LEU A CA    
958  C C     . LEU A 117 ? 0.6145 0.6122 0.5343 0.0759  0.0330  -0.1315 117 LEU A C     
959  O O     . LEU A 117 ? 0.6025 0.6092 0.4986 0.0612  0.0427  -0.1209 117 LEU A O     
960  C CB    . LEU A 117 ? 0.5924 0.5459 0.5392 0.0754  -0.0048 -0.1091 117 LEU A CB    
961  C CG    . LEU A 117 ? 0.5941 0.5352 0.5693 0.0809  -0.0249 -0.0995 117 LEU A CG    
962  C CD1   . LEU A 117 ? 0.5710 0.5446 0.5699 0.0805  -0.0194 -0.0905 117 LEU A CD1   
963  C CD2   . LEU A 117 ? 0.5944 0.5054 0.5557 0.0657  -0.0444 -0.0789 117 LEU A CD2   
964  N N     . LYS A 118 ? 0.6655 0.6561 0.5880 0.0924  0.0323  -0.1569 118 LYS A N     
965  C CA    . LYS A 118 ? 0.7160 0.6996 0.6054 0.0914  0.0381  -0.1738 118 LYS A CA    
966  C C     . LYS A 118 ? 0.7610 0.7030 0.6533 0.1038  0.0180  -0.1913 118 LYS A C     
967  O O     . LYS A 118 ? 0.7891 0.7285 0.7104 0.1243  0.0140  -0.2102 118 LYS A O     
968  C CB    . LYS A 118 ? 0.7314 0.7578 0.6156 0.0980  0.0635  -0.1938 118 LYS A CB    
969  C CG    . LYS A 118 ? 0.7321 0.7993 0.6547 0.1095  0.0770  -0.1983 118 LYS A CG    
970  C CD    . LYS A 118 ? 0.7642 0.8184 0.7275 0.1335  0.0636  -0.2145 118 LYS A CD    
971  C CE    . LYS A 118 ? 0.8163 0.8667 0.7796 0.1550  0.0671  -0.2525 118 LYS A CE    
972  N NZ    . LYS A 118 ? 0.8411 0.8750 0.8500 0.1797  0.0508  -0.2659 118 LYS A NZ    
973  N N     . GLU A 119 ? 0.7820 0.6912 0.6477 0.0912  0.0039  -0.1845 119 GLU A N     
974  C CA    . GLU A 119 ? 0.8210 0.6821 0.6918 0.0955  -0.0222 -0.1902 119 GLU A CA    
975  C C     . GLU A 119 ? 0.8000 0.6454 0.6919 0.0873  -0.0399 -0.1608 119 GLU A C     
976  O O     . GLU A 119 ? 0.7819 0.6430 0.7030 0.0954  -0.0385 -0.1546 119 GLU A O     
977  C CB    . GLU A 119 ? 0.8644 0.7125 0.7558 0.1212  -0.0263 -0.2244 119 GLU A CB    
978  C CG    . GLU A 119 ? 0.9142 0.7819 0.7833 0.1310  -0.0072 -0.2596 119 GLU A CG    
979  C CD    . GLU A 119 ? 0.9811 0.8145 0.8135 0.1227  -0.0193 -0.2734 119 GLU A CD    
980  O OE1   . GLU A 119 ? 1.0350 0.8505 0.8669 0.1395  -0.0231 -0.3094 119 GLU A OE1   
981  O OE2   . GLU A 119 ? 0.9751 0.8002 0.7810 0.0998  -0.0256 -0.2498 119 GLU A OE2   
982  N N     . PRO A 120 ? 0.8030 0.6220 0.6795 0.0695  -0.0565 -0.1418 120 PRO A N     
983  C CA    . PRO A 120 ? 0.7868 0.5935 0.6784 0.0589  -0.0733 -0.1140 120 PRO A CA    
984  C C     . PRO A 120 ? 0.8234 0.5913 0.7382 0.0680  -0.0994 -0.1164 120 PRO A C     
985  O O     . PRO A 120 ? 0.8314 0.5766 0.7478 0.0536  -0.1197 -0.0939 120 PRO A O     
986  C CB    . PRO A 120 ? 0.7764 0.5760 0.6429 0.0364  -0.0786 -0.0956 120 PRO A CB    
987  C CG    . PRO A 120 ? 0.7900 0.5962 0.6292 0.0359  -0.0665 -0.1128 120 PRO A CG    
988  C CD    . PRO A 120 ? 0.8182 0.6227 0.6622 0.0567  -0.0601 -0.1447 120 PRO A CD    
989  N N     . LYS A 121 ? 0.8512 0.6129 0.7854 0.0915  -0.0991 -0.1432 121 LYS A N     
990  C CA    . LYS A 121 ? 0.8854 0.6106 0.8499 0.1046  -0.1248 -0.1464 121 LYS A CA    
991  C C     . LYS A 121 ? 0.8598 0.6050 0.8547 0.1080  -0.1281 -0.1263 121 LYS A C     
992  O O     . LYS A 121 ? 0.8241 0.6133 0.8221 0.1095  -0.1064 -0.1245 121 LYS A O     
993  C CB    . LYS A 121 ? 0.9262 0.6409 0.9040 0.1319  -0.1218 -0.1872 121 LYS A CB    
994  C CG    . LYS A 121 ? 0.9641 0.6668 0.9075 0.1295  -0.1150 -0.2128 121 LYS A CG    
995  C CD    . LYS A 121 ? 1.0330 0.6752 0.9791 0.1327  -0.1445 -0.2263 121 LYS A CD    
996  C CE    . LYS A 121 ? 1.0614 0.6949 0.9707 0.1306  -0.1374 -0.2560 121 LYS A CE    
997  N NZ    . LYS A 121 ? 1.1283 0.7073 1.0471 0.1448  -0.1610 -0.2865 121 LYS A NZ    
998  N N     . ASN A 122 ? 0.8779 0.5896 0.8940 0.1070  -0.1575 -0.1095 122 ASN A N     
999  C CA    . ASN A 122 ? 0.8624 0.5868 0.9097 0.1114  -0.1680 -0.0903 122 ASN A CA    
1000 C C     . ASN A 122 ? 0.8102 0.5691 0.8444 0.0893  -0.1600 -0.0594 122 ASN A C     
1001 O O     . ASN A 122 ? 0.8207 0.5762 0.8694 0.0824  -0.1790 -0.0346 122 ASN A O     
1002 C CB    . ASN A 122 ? 0.8715 0.6174 0.9552 0.1417  -0.1587 -0.1161 122 ASN A CB    
1003 C CG    . ASN A 122 ? 0.9319 0.6449 1.0317 0.1667  -0.1664 -0.1513 122 ASN A CG    
1004 O OD1   . ASN A 122 ? 0.9471 0.6511 1.0200 0.1663  -0.1551 -0.1739 122 ASN A OD1   
1005 N ND2   . ASN A 122 ? 0.9789 0.6744 1.1237 0.1893  -0.1867 -0.1574 122 ASN A ND2   
1006 N N     . ILE A 123 ? 0.7548 0.5466 0.7629 0.0792  -0.1331 -0.0620 123 ILE A N     
1007 C CA    . ILE A 123 ? 0.7004 0.5189 0.6907 0.0568  -0.1251 -0.0370 123 ILE A CA    
1008 C C     . ILE A 123 ? 0.6703 0.5093 0.6790 0.0540  -0.1324 -0.0184 123 ILE A C     
1009 O O     . ILE A 123 ? 0.6885 0.5081 0.7074 0.0485  -0.1574 0.0009  123 ILE A O     
1010 C CB    . ILE A 123 ? 0.7105 0.5078 0.6756 0.0336  -0.1366 -0.0176 123 ILE A CB    
1011 C CG1   . ILE A 123 ? 0.7243 0.5154 0.6658 0.0317  -0.1241 -0.0336 123 ILE A CG1   
1012 C CG2   . ILE A 123 ? 0.6810 0.5050 0.6325 0.0122  -0.1320 0.0076  123 ILE A CG2   
1013 C CD1   . ILE A 123 ? 0.6995 0.5279 0.6252 0.0294  -0.0955 -0.0400 123 ILE A CD1   
1014 N N     . LYS A 124 ? 0.6228 0.5007 0.6339 0.0551  -0.1123 -0.0223 124 LYS A N     
1015 C CA    . LYS A 124 ? 0.5980 0.4981 0.6251 0.0514  -0.1195 -0.0069 124 LYS A CA    
1016 C C     . LYS A 124 ? 0.5759 0.4872 0.5784 0.0260  -0.1214 0.0168  124 LYS A C     
1017 O O     . LYS A 124 ? 0.5806 0.4982 0.5894 0.0181  -0.1373 0.0351  124 LYS A O     
1018 C CB    . LYS A 124 ? 0.5749 0.5121 0.6208 0.0633  -0.1003 -0.0221 124 LYS A CB    
1019 C CG    . LYS A 124 ? 0.5589 0.5172 0.6293 0.0634  -0.1124 -0.0095 124 LYS A CG    
1020 C CD    . LYS A 124 ? 0.5302 0.5261 0.6251 0.0752  -0.0951 -0.0249 124 LYS A CD    
1021 C CE    . LYS A 124 ? 0.5363 0.5541 0.6564 0.0735  -0.1101 -0.0112 124 LYS A CE    
1022 N NZ    . LYS A 124 ? 0.5297 0.5826 0.6877 0.0899  -0.1000 -0.0261 124 LYS A NZ    
1023 N N     . SER A 125 ? 0.5512 0.4676 0.5263 0.0137  -0.1055 0.0158  125 SER A N     
1024 C CA    . SER A 125 ? 0.5330 0.4626 0.4861 -0.0085 -0.1053 0.0343  125 SER A CA    
1025 C C     . SER A 125 ? 0.5322 0.4463 0.4640 -0.0206 -0.1057 0.0404  125 SER A C     
1026 O O     . SER A 125 ? 0.5353 0.4329 0.4640 -0.0133 -0.1006 0.0276  125 SER A O     
1027 C CB    . SER A 125 ? 0.5036 0.4667 0.4501 -0.0129 -0.0842 0.0279  125 SER A CB    
1028 O OG    . SER A 125 ? 0.4836 0.4500 0.4160 -0.0137 -0.0644 0.0171  125 SER A OG    
1029 N N     . ALA A 126 ? 0.5264 0.4502 0.4431 -0.0405 -0.1114 0.0598  126 ALA A N     
1030 C CA    . ALA A 126 ? 0.5222 0.4379 0.4228 -0.0552 -0.1139 0.0699  126 ALA A CA    
1031 C C     . ALA A 126 ? 0.4955 0.4146 0.3870 -0.0516 -0.0948 0.0549  126 ALA A C     
1032 O O     . ALA A 126 ? 0.5012 0.4038 0.3864 -0.0574 -0.1008 0.0580  126 ALA A O     
1033 C CB    . ALA A 126 ? 0.5236 0.4645 0.4094 -0.0770 -0.1158 0.0900  126 ALA A CB    
1034 N N     . VAL A 127 ? 0.4612 0.4002 0.3530 -0.0434 -0.0744 0.0403  127 VAL A N     
1035 C CA    . VAL A 127 ? 0.4382 0.3850 0.3210 -0.0430 -0.0574 0.0312  127 VAL A CA    
1036 C C     . VAL A 127 ? 0.4321 0.3683 0.3179 -0.0277 -0.0488 0.0133  127 VAL A C     
1037 O O     . VAL A 127 ? 0.4204 0.3630 0.2985 -0.0274 -0.0362 0.0075  127 VAL A O     
1038 C CB    . VAL A 127 ? 0.4192 0.3958 0.2985 -0.0480 -0.0412 0.0299  127 VAL A CB    
1039 C CG1   . VAL A 127 ? 0.4209 0.4144 0.2941 -0.0632 -0.0478 0.0444  127 VAL A CG1   
1040 C CG2   . VAL A 127 ? 0.4072 0.3925 0.2961 -0.0374 -0.0311 0.0176  127 VAL A CG2   
1041 N N     . ASP A 128 ? 0.4392 0.3610 0.3367 -0.0152 -0.0563 0.0051  128 ASP A N     
1042 C CA    . ASP A 128 ? 0.4302 0.3501 0.3310 -0.0003 -0.0458 -0.0141 128 ASP A CA    
1043 C C     . ASP A 128 ? 0.4377 0.3422 0.3226 -0.0001 -0.0445 -0.0222 128 ASP A C     
1044 O O     . ASP A 128 ? 0.4363 0.3467 0.3165 0.0081  -0.0321 -0.0366 128 ASP A O     
1045 C CB    . ASP A 128 ? 0.4477 0.3586 0.3692 0.0149  -0.0550 -0.0230 128 ASP A CB    
1046 C CG    . ASP A 128 ? 0.4355 0.3694 0.3748 0.0172  -0.0527 -0.0190 128 ASP A CG    
1047 O OD1   . ASP A 128 ? 0.4098 0.3671 0.3444 0.0097  -0.0394 -0.0158 128 ASP A OD1   
1048 O OD2   . ASP A 128 ? 0.4516 0.3789 0.4117 0.0269  -0.0661 -0.0194 128 ASP A OD2   
1049 N N     . ARG A 129 ? 0.4449 0.3325 0.3209 -0.0112 -0.0578 -0.0120 129 ARG A N     
1050 C CA    . ARG A 129 ? 0.4549 0.3274 0.3155 -0.0134 -0.0603 -0.0189 129 ARG A CA    
1051 C C     . ARG A 129 ? 0.4332 0.3257 0.2818 -0.0210 -0.0468 -0.0144 129 ARG A C     
1052 O O     . ARG A 129 ? 0.4447 0.3316 0.2794 -0.0215 -0.0457 -0.0212 129 ARG A O     
1053 C CB    . ARG A 129 ? 0.4751 0.3227 0.3334 -0.0251 -0.0818 -0.0077 129 ARG A CB    
1054 C CG    . ARG A 129 ? 0.5061 0.3229 0.3763 -0.0183 -0.1010 -0.0115 129 ARG A CG    
1055 C CD    . ARG A 129 ? 0.5384 0.3285 0.4039 -0.0338 -0.1228 0.0008  129 ARG A CD    
1056 N NE    . ARG A 129 ? 0.5785 0.3367 0.4595 -0.0311 -0.1459 0.0051  129 ARG A NE    
1057 C CZ    . ARG A 129 ? 0.5724 0.3315 0.4624 -0.0431 -0.1590 0.0295  129 ARG A CZ    
1058 N NH1   . ARG A 129 ? 0.5349 0.3284 0.4181 -0.0585 -0.1489 0.0484  129 ARG A NH1   
1059 N NH2   . ARG A 129 ? 0.6157 0.3414 0.5215 -0.0399 -0.1831 0.0348  129 ARG A NH2   
1060 N N     . THR A 130 ? 0.4066 0.3217 0.2609 -0.0270 -0.0384 -0.0032 130 THR A N     
1061 C CA    . THR A 130 ? 0.3904 0.3225 0.2397 -0.0338 -0.0291 0.0031  130 THR A CA    
1062 C C     . THR A 130 ? 0.3874 0.3242 0.2283 -0.0277 -0.0174 -0.0058 130 THR A C     
1063 O O     . THR A 130 ? 0.3949 0.3324 0.2270 -0.0327 -0.0187 -0.0020 130 THR A O     
1064 C CB    . THR A 130 ? 0.3716 0.3262 0.2304 -0.0385 -0.0217 0.0113  130 THR A CB    
1065 O OG1   . THR A 130 ? 0.3905 0.3449 0.2517 -0.0482 -0.0332 0.0226  130 THR A OG1   
1066 C CG2   . THR A 130 ? 0.3545 0.3253 0.2143 -0.0422 -0.0130 0.0154  130 THR A CG2   
1067 N N     . PRO A 131 ? 0.3786 0.3215 0.2230 -0.0185 -0.0068 -0.0155 131 PRO A N     
1068 C CA    . PRO A 131 ? 0.3739 0.3234 0.2076 -0.0155 0.0038  -0.0218 131 PRO A CA    
1069 C C     . PRO A 131 ? 0.3933 0.3288 0.2081 -0.0149 -0.0026 -0.0306 131 PRO A C     
1070 O O     . PRO A 131 ? 0.4046 0.3454 0.2042 -0.0188 0.0011  -0.0290 131 PRO A O     
1071 C CB    . PRO A 131 ? 0.3690 0.3294 0.2129 -0.0068 0.0140  -0.0313 131 PRO A CB    
1072 C CG    . PRO A 131 ? 0.3590 0.3230 0.2203 -0.0072 0.0106  -0.0261 131 PRO A CG    
1073 C CD    . PRO A 131 ? 0.3718 0.3203 0.2308 -0.0125 -0.0047 -0.0190 131 PRO A CD    
1074 N N     . PHE A 132 ? 0.4031 0.3196 0.2185 -0.0103 -0.0139 -0.0399 132 PHE A N     
1075 C CA    . PHE A 132 ? 0.4263 0.3251 0.2232 -0.0097 -0.0222 -0.0524 132 PHE A CA    
1076 C C     . PHE A 132 ? 0.4280 0.3181 0.2144 -0.0231 -0.0350 -0.0406 132 PHE A C     
1077 O O     . PHE A 132 ? 0.4469 0.3346 0.2129 -0.0271 -0.0372 -0.0455 132 PHE A O     
1078 C CB    . PHE A 132 ? 0.4451 0.3211 0.2502 0.0003  -0.0331 -0.0673 132 PHE A CB    
1079 C CG    . PHE A 132 ? 0.4435 0.3315 0.2611 0.0158  -0.0211 -0.0825 132 PHE A CG    
1080 C CD1   . PHE A 132 ? 0.4148 0.3120 0.2570 0.0202  -0.0197 -0.0751 132 PHE A CD1   
1081 C CD2   . PHE A 132 ? 0.4573 0.3513 0.2628 0.0255  -0.0114 -0.1049 132 PHE A CD2   
1082 C CE1   . PHE A 132 ? 0.4085 0.3208 0.2673 0.0344  -0.0098 -0.0884 132 PHE A CE1   
1083 C CE2   . PHE A 132 ? 0.4511 0.3630 0.2728 0.0402  0.0010  -0.1196 132 PHE A CE2   
1084 C CZ    . PHE A 132 ? 0.4341 0.3551 0.2848 0.0449  0.0012  -0.1107 132 PHE A CZ    
1085 N N     . HIS A 133 ? 0.4106 0.2998 0.2109 -0.0312 -0.0434 -0.0247 133 HIS A N     
1086 C CA    . HIS A 133 ? 0.4115 0.3016 0.2088 -0.0447 -0.0537 -0.0111 133 HIS A CA    
1087 C C     . HIS A 133 ? 0.4065 0.3151 0.1956 -0.0467 -0.0448 -0.0063 133 HIS A C     
1088 O O     . HIS A 133 ? 0.4243 0.3305 0.2007 -0.0541 -0.0535 -0.0038 133 HIS A O     
1089 C CB    . HIS A 133 ? 0.3893 0.2915 0.2050 -0.0526 -0.0559 0.0060  133 HIS A CB    
1090 C CG    . HIS A 133 ? 0.4008 0.2850 0.2238 -0.0556 -0.0691 0.0086  133 HIS A CG    
1091 N ND1   . HIS A 133 ? 0.3732 0.2701 0.2094 -0.0601 -0.0681 0.0209  133 HIS A ND1   
1092 C CD2   . HIS A 133 ? 0.4256 0.2788 0.2445 -0.0552 -0.0853 0.0011  133 HIS A CD2   
1093 C CE1   . HIS A 133 ? 0.3849 0.2600 0.2247 -0.0637 -0.0841 0.0245  133 HIS A CE1   
1094 N NE2   . HIS A 133 ? 0.4074 0.2535 0.2391 -0.0599 -0.0953 0.0122  133 HIS A NE2   
1095 N N     . HIS A 134 ? 0.3910 0.3170 0.1884 -0.0409 -0.0295 -0.0039 134 HIS A N     
1096 C CA    . HIS A 134 ? 0.3886 0.3294 0.1823 -0.0427 -0.0225 0.0037  134 HIS A CA    
1097 C C     . HIS A 134 ? 0.4144 0.3524 0.1826 -0.0427 -0.0214 -0.0043 134 HIS A C     
1098 O O     . HIS A 134 ? 0.4264 0.3689 0.1845 -0.0496 -0.0273 0.0046  134 HIS A O     
1099 C CB    . HIS A 134 ? 0.3691 0.3243 0.1788 -0.0377 -0.0084 0.0076  134 HIS A CB    
1100 C CG    . HIS A 134 ? 0.3754 0.3414 0.1875 -0.0400 -0.0048 0.0187  134 HIS A CG    
1101 N ND1   . HIS A 134 ? 0.3878 0.3614 0.2140 -0.0433 -0.0108 0.0306  134 HIS A ND1   
1102 C CD2   . HIS A 134 ? 0.3766 0.3474 0.1806 -0.0398 0.0025  0.0212  134 HIS A CD2   
1103 C CE1   . HIS A 134 ? 0.3959 0.3748 0.2245 -0.0434 -0.0089 0.0398  134 HIS A CE1   
1104 N NE2   . HIS A 134 ? 0.4086 0.3849 0.2222 -0.0428 -0.0013 0.0359  134 HIS A NE2   
1105 N N     . LYS A 135 ? 0.4263 0.3605 0.1845 -0.0352 -0.0140 -0.0210 135 LYS A N     
1106 C CA    . LYS A 135 ? 0.4638 0.4003 0.1936 -0.0361 -0.0111 -0.0316 135 LYS A CA    
1107 C C     . LYS A 135 ? 0.4784 0.3995 0.1894 -0.0439 -0.0285 -0.0348 135 LYS A C     
1108 O O     . LYS A 135 ? 0.5044 0.4317 0.1912 -0.0513 -0.0314 -0.0327 135 LYS A O     
1109 C CB    . LYS A 135 ? 0.4776 0.4148 0.2021 -0.0250 -0.0008 -0.0544 135 LYS A CB    
1110 C CG    . LYS A 135 ? 0.4897 0.4450 0.2335 -0.0176 0.0159  -0.0542 135 LYS A CG    
1111 C CD    . LYS A 135 ? 0.5090 0.4773 0.2434 -0.0080 0.0292  -0.0770 135 LYS A CD    
1112 C CE    . LYS A 135 ? 0.4994 0.4739 0.2630 0.0055  0.0365  -0.0870 135 LYS A CE    
1113 N NZ    . LYS A 135 ? 0.4465 0.4273 0.2364 0.0031  0.0384  -0.0697 135 LYS A NZ    
1114 N N     . TRP A 136 ? 0.4677 0.3690 0.1894 -0.0442 -0.0417 -0.0381 136 TRP A N     
1115 C CA    . TRP A 136 ? 0.4932 0.3754 0.1992 -0.0525 -0.0602 -0.0439 136 TRP A CA    
1116 C C     . TRP A 136 ? 0.4958 0.3889 0.2017 -0.0661 -0.0705 -0.0232 136 TRP A C     
1117 O O     . TRP A 136 ? 0.5263 0.4164 0.2089 -0.0747 -0.0814 -0.0259 136 TRP A O     
1118 C CB    . TRP A 136 ? 0.4816 0.3378 0.2023 -0.0516 -0.0737 -0.0493 136 TRP A CB    
1119 C CG    . TRP A 136 ? 0.5035 0.3329 0.2060 -0.0584 -0.0931 -0.0626 136 TRP A CG    
1120 C CD1   . TRP A 136 ? 0.5296 0.3379 0.2150 -0.0499 -0.0956 -0.0907 136 TRP A CD1   
1121 C CD2   . TRP A 136 ? 0.5006 0.3219 0.2016 -0.0753 -0.1131 -0.0503 136 TRP A CD2   
1122 N NE1   . TRP A 136 ? 0.5559 0.3387 0.2270 -0.0608 -0.1173 -0.0981 136 TRP A NE1   
1123 C CE2   . TRP A 136 ? 0.5424 0.3333 0.2229 -0.0777 -0.1290 -0.0720 136 TRP A CE2   
1124 C CE3   . TRP A 136 ? 0.4727 0.3118 0.1902 -0.0883 -0.1193 -0.0245 136 TRP A CE3   
1125 C CZ2   . TRP A 136 ? 0.5696 0.3451 0.2444 -0.0952 -0.1525 -0.0666 136 TRP A CZ2   
1126 C CZ3   . TRP A 136 ? 0.4961 0.3253 0.2103 -0.1050 -0.1412 -0.0181 136 TRP A CZ3   
1127 C CH2   . TRP A 136 ? 0.5476 0.3444 0.2401 -0.1095 -0.1583 -0.0381 136 TRP A CH2   
1128 N N     . LEU A 137 ? 0.4678 0.3759 0.2004 -0.0672 -0.0670 -0.0042 137 LEU A N     
1129 C CA    . LEU A 137 ? 0.4741 0.3962 0.2176 -0.0773 -0.0767 0.0152  137 LEU A CA    
1130 C C     . LEU A 137 ? 0.4886 0.4284 0.2251 -0.0775 -0.0716 0.0258  137 LEU A C     
1131 O O     . LEU A 137 ? 0.4986 0.4449 0.2280 -0.0865 -0.0844 0.0360  137 LEU A O     
1132 C CB    . LEU A 137 ? 0.4381 0.3724 0.2143 -0.0766 -0.0730 0.0274  137 LEU A CB    
1133 C CG    . LEU A 137 ? 0.4443 0.3813 0.2358 -0.0885 -0.0877 0.0380  137 LEU A CG    
1134 C CD1   . LEU A 137 ? 0.4575 0.3683 0.2312 -0.0983 -0.1064 0.0294  137 LEU A CD1   
1135 C CD2   . LEU A 137 ? 0.4147 0.3606 0.2292 -0.0865 -0.0797 0.0428  137 LEU A CD2   
1136 N N     . GLU A 138 ? 0.4936 0.4409 0.2339 -0.0688 -0.0548 0.0251  138 GLU A N     
1137 C CA    . GLU A 138 ? 0.5169 0.4770 0.2501 -0.0696 -0.0494 0.0362  138 GLU A CA    
1138 C C     . GLU A 138 ? 0.5522 0.5162 0.2635 -0.0806 -0.0645 0.0455  138 GLU A C     
1139 O O     . GLU A 138 ? 0.5555 0.5304 0.2834 -0.0839 -0.0731 0.0650  138 GLU A O     
1140 C CB    . GLU A 138 ? 0.5297 0.4903 0.2465 -0.0642 -0.0335 0.0238  138 GLU A CB    
1141 C CG    . GLU A 138 ? 0.5618 0.5354 0.2831 -0.0643 -0.0231 0.0371  138 GLU A CG    
1142 C CD    . GLU A 138 ? 0.6388 0.6185 0.3426 -0.0616 -0.0071 0.0239  138 GLU A CD    
1143 O OE1   . GLU A 138 ? 0.6440 0.6292 0.3666 -0.0564 0.0055  0.0247  138 GLU A OE1   
1144 O OE2   . GLU A 138 ? 0.6847 0.6660 0.3569 -0.0647 -0.0071 0.0108  138 GLU A OE2   
1145 N N     . GLY A 139 ? 0.5852 0.5411 0.2606 -0.0856 -0.0685 0.0304  139 GLY A N     
1146 C CA    . GLY A 139 ? 0.6122 0.5737 0.2578 -0.0977 -0.0821 0.0373  139 GLY A CA    
1147 C C     . GLY A 139 ? 0.6281 0.5813 0.2700 -0.1075 -0.1040 0.0363  139 GLY A C     
1148 O O     . GLY A 139 ? 0.6571 0.6164 0.2777 -0.1192 -0.1193 0.0442  139 GLY A O     
1149 N N     . ARG A 140 ? 0.6134 0.5536 0.2763 -0.1047 -0.1072 0.0284  140 ARG A N     
1150 C CA    . ARG A 140 ? 0.6220 0.5526 0.2854 -0.1161 -0.1285 0.0278  140 ARG A CA    
1151 C C     . ARG A 140 ? 0.5968 0.5456 0.2995 -0.1207 -0.1376 0.0514  140 ARG A C     
1152 O O     . ARG A 140 ? 0.6103 0.5580 0.3189 -0.1327 -0.1559 0.0557  140 ARG A O     
1153 C CB    . ARG A 140 ? 0.6232 0.5270 0.2851 -0.1129 -0.1291 0.0062  140 ARG A CB    
1154 C CG    . ARG A 140 ? 0.6535 0.5374 0.2750 -0.1136 -0.1326 -0.0208 140 ARG A CG    
1155 C CD    . ARG A 140 ? 0.6347 0.4871 0.2611 -0.1093 -0.1378 -0.0413 140 ARG A CD    
1156 N NE    . ARG A 140 ? 0.6171 0.4644 0.2415 -0.0920 -0.1182 -0.0602 140 ARG A NE    
1157 C CZ    . ARG A 140 ? 0.6436 0.4777 0.2407 -0.0849 -0.1144 -0.0897 140 ARG A CZ    
1158 N NH1   . ARG A 140 ? 0.6848 0.5058 0.2501 -0.0941 -0.1294 -0.1058 140 ARG A NH1   
1159 N NH2   . ARG A 140 ? 0.6361 0.4726 0.2393 -0.0682 -0.0956 -0.1047 140 ARG A NH2   
1160 N N     . ILE A 141 ? 0.5667 0.5335 0.2974 -0.1113 -0.1247 0.0654  141 ILE A N     
1161 C CA    . ILE A 141 ? 0.5436 0.5321 0.3163 -0.1113 -0.1285 0.0833  141 ILE A CA    
1162 C C     . ILE A 141 ? 0.5404 0.5495 0.3286 -0.1084 -0.1316 0.1029  141 ILE A C     
1163 O O     . ILE A 141 ? 0.5264 0.5572 0.3518 -0.1071 -0.1367 0.1168  141 ILE A O     
1164 C CB    . ILE A 141 ? 0.5123 0.5037 0.3126 -0.1013 -0.1114 0.0793  141 ILE A CB    
1165 C CG1   . ILE A 141 ? 0.4970 0.5114 0.3345 -0.1057 -0.1165 0.0912  141 ILE A CG1   
1166 C CG2   . ILE A 141 ? 0.5011 0.4973 0.3103 -0.0875 -0.0931 0.0803  141 ILE A CG2   
1167 C CD1   . ILE A 141 ? 0.5194 0.5252 0.3526 -0.1205 -0.1307 0.0889  141 ILE A CD1   
1168 N N     . LYS A 142 ? 0.5610 0.5648 0.3227 -0.1076 -0.1291 0.1047  142 LYS A N     
1169 C CA    . LYS A 142 ? 0.5701 0.5885 0.3445 -0.1066 -0.1364 0.1267  142 LYS A CA    
1170 C C     . LYS A 142 ? 0.5839 0.6182 0.3700 -0.1168 -0.1607 0.1421  142 LYS A C     
1171 O O     . LYS A 142 ? 0.6133 0.6422 0.3688 -0.1306 -0.1756 0.1372  142 LYS A O     
1172 C CB    . LYS A 142 ? 0.6010 0.6123 0.3362 -0.1104 -0.1333 0.1289  142 LYS A CB    
1173 C CG    . LYS A 142 ? 0.6043 0.6090 0.3415 -0.1002 -0.1110 0.1237  142 LYS A CG    
1174 C CD    . LYS A 142 ? 0.6824 0.6898 0.3944 -0.1067 -0.1121 0.1387  142 LYS A CD    
1175 C CE    . LYS A 142 ? 0.7097 0.7118 0.3969 -0.1050 -0.0906 0.1248  142 LYS A CE    
1176 N NZ    . LYS A 142 ? 0.6761 0.6745 0.3963 -0.0932 -0.0743 0.1245  142 LYS A NZ    
1177 N N     . GLY A 143 ? 0.5637 0.6186 0.3964 -0.1094 -0.1652 0.1591  143 GLY A N     
1178 C CA    . GLY A 143 ? 0.5716 0.6483 0.4253 -0.1171 -0.1888 0.1766  143 GLY A CA    
1179 C C     . GLY A 143 ? 0.5522 0.6447 0.4331 -0.1218 -0.1922 0.1718  143 GLY A C     
1180 O O     . GLY A 143 ? 0.5578 0.6719 0.4585 -0.1304 -0.2117 0.1849  143 GLY A O     
1181 N N     . LYS A 144 ? 0.5243 0.5563 0.3832 -0.0354 -0.0232 0.1322  144 LYS A N     
1182 C CA    . LYS A 144 ? 0.4976 0.5458 0.3726 -0.0308 -0.0309 0.1178  144 LYS A CA    
1183 C C     . LYS A 144 ? 0.4723 0.5129 0.3744 -0.0280 -0.0255 0.1072  144 LYS A C     
1184 O O     . LYS A 144 ? 0.4410 0.4935 0.3556 -0.0263 -0.0286 0.0941  144 LYS A O     
1185 C CB    . LYS A 144 ? 0.4866 0.5508 0.3485 -0.0380 -0.0305 0.1034  144 LYS A CB    
1186 C CG    . LYS A 144 ? 0.5259 0.6025 0.3638 -0.0390 -0.0411 0.1090  144 LYS A CG    
1187 C CD    . LYS A 144 ? 0.5693 0.6536 0.3885 -0.0471 -0.0364 0.0950  144 LYS A CD    
1188 C CE    . LYS A 144 ? 0.6096 0.7071 0.4085 -0.0492 -0.0491 0.0945  144 LYS A CE    
1189 N NZ    . LYS A 144 ? 0.6355 0.7374 0.4267 -0.0549 -0.0455 0.0746  144 LYS A NZ    
1190 N N     . GLU A 145 ? 0.4847 0.5039 0.3934 -0.0288 -0.0170 0.1131  145 GLU A N     
1191 C CA    . GLU A 145 ? 0.4717 0.4802 0.4017 -0.0283 -0.0108 0.1024  145 GLU A CA    
1192 C C     . GLU A 145 ? 0.4577 0.4689 0.4058 -0.0159 -0.0172 0.1006  145 GLU A C     
1193 O O     . GLU A 145 ? 0.4337 0.4519 0.3950 -0.0160 -0.0158 0.0857  145 GLU A O     
1194 C CB    . GLU A 145 ? 0.5005 0.4818 0.4311 -0.0335 -0.0004 0.1095  145 GLU A CB    
1195 C CG    . GLU A 145 ? 0.5615 0.5297 0.4733 -0.0336 -0.0002 0.1307  145 GLU A CG    
1196 C CD    . GLU A 145 ? 0.6025 0.5788 0.4955 -0.0470 0.0067  0.1310  145 GLU A CD    
1197 O OE1   . GLU A 145 ? 0.6442 0.6118 0.5168 -0.0493 0.0082  0.1483  145 GLU A OE1   
1198 O OE2   . GLU A 145 ? 0.5961 0.5883 0.4949 -0.0544 0.0110  0.1144  145 GLU A OE2   
1199 N N     . ASN A 146 ? 0.4711 0.4790 0.4203 -0.0049 -0.0242 0.1163  146 ASN A N     
1200 C CA    . ASN A 146 ? 0.4595 0.4746 0.4298 0.0084  -0.0295 0.1154  146 ASN A CA    
1201 C C     . ASN A 146 ? 0.4233 0.4674 0.3986 0.0068  -0.0363 0.1032  146 ASN A C     
1202 O O     . ASN A 146 ? 0.4056 0.4563 0.3988 0.0110  -0.0346 0.0930  146 ASN A O     
1203 C CB    . ASN A 146 ? 0.4845 0.4974 0.4563 0.0221  -0.0377 0.1363  146 ASN A CB    
1204 C CG    . ASN A 146 ? 0.5256 0.5039 0.4911 0.0244  -0.0302 0.1508  146 ASN A CG    
1205 O OD1   . ASN A 146 ? 0.5316 0.4851 0.5015 0.0188  -0.0179 0.1425  146 ASN A OD1   
1206 N ND2   . ASN A 146 ? 0.5669 0.5426 0.5208 0.0316  -0.0380 0.1728  146 ASN A ND2   
1207 N N     . GLU A 147 ? 0.4162 0.4753 0.3736 -0.0005 -0.0426 0.1040  147 GLU A N     
1208 C CA    . GLU A 147 ? 0.3922 0.4733 0.3489 -0.0056 -0.0480 0.0921  147 GLU A CA    
1209 C C     . GLU A 147 ? 0.3664 0.4442 0.3301 -0.0111 -0.0392 0.0747  147 GLU A C     
1210 O O     . GLU A 147 ? 0.3458 0.4345 0.3218 -0.0098 -0.0404 0.0660  147 GLU A O     
1211 C CB    . GLU A 147 ? 0.4028 0.4910 0.3335 -0.0138 -0.0527 0.0946  147 GLU A CB    
1212 C CG    . GLU A 147 ? 0.4125 0.5234 0.3385 -0.0153 -0.0655 0.0943  147 GLU A CG    
1213 C CD    . GLU A 147 ? 0.4276 0.5526 0.3694 -0.0048 -0.0766 0.1069  147 GLU A CD    
1214 O OE1   . GLU A 147 ? 0.4324 0.5766 0.3917 -0.0038 -0.0819 0.1006  147 GLU A OE1   
1215 O OE2   . GLU A 147 ? 0.4362 0.5546 0.3739 0.0026  -0.0798 0.1238  147 GLU A OE2   
1216 N N     . VAL A 148 ? 0.3642 0.4285 0.3204 -0.0177 -0.0303 0.0707  148 VAL A N     
1217 C CA    . VAL A 148 ? 0.3473 0.4102 0.3105 -0.0222 -0.0235 0.0561  148 VAL A CA    
1218 C C     . VAL A 148 ? 0.3441 0.3998 0.3252 -0.0165 -0.0200 0.0517  148 VAL A C     
1219 O O     . VAL A 148 ? 0.3319 0.3935 0.3191 -0.0176 -0.0183 0.0403  148 VAL A O     
1220 C CB    . VAL A 148 ? 0.3529 0.4067 0.3091 -0.0305 -0.0151 0.0536  148 VAL A CB    
1221 C CG1   . VAL A 148 ? 0.3438 0.4002 0.3088 -0.0343 -0.0106 0.0395  148 VAL A CG1   
1222 C CG2   . VAL A 148 ? 0.3510 0.4130 0.2895 -0.0357 -0.0155 0.0555  148 VAL A CG2   
1223 N N     . ARG A 149 ? 0.3618 0.4030 0.3494 -0.0098 -0.0182 0.0609  149 ARG A N     
1224 C CA    . ARG A 149 ? 0.3611 0.3919 0.3646 -0.0031 -0.0128 0.0556  149 ARG A CA    
1225 C C     . ARG A 149 ? 0.3500 0.3995 0.3670 0.0053  -0.0172 0.0534  149 ARG A C     
1226 O O     . ARG A 149 ? 0.3470 0.3969 0.3733 0.0068  -0.0117 0.0425  149 ARG A O     
1227 C CB    . ARG A 149 ? 0.3886 0.3945 0.3955 0.0032  -0.0087 0.0668  149 ARG A CB    
1228 C CG    . ARG A 149 ? 0.3935 0.3769 0.3923 -0.0077 -0.0002 0.0642  149 ARG A CG    
1229 C CD    . ARG A 149 ? 0.4376 0.3932 0.4350 -0.0030 0.0033  0.0795  149 ARG A CD    
1230 N NE    . ARG A 149 ? 0.4497 0.3796 0.4436 -0.0151 0.0138  0.0744  149 ARG A NE    
1231 C CZ    . ARG A 149 ? 0.4697 0.3753 0.4552 -0.0193 0.0185  0.0878  149 ARG A CZ    
1232 N NH1   . ARG A 149 ? 0.4754 0.3793 0.4523 -0.0111 0.0129  0.1084  149 ARG A NH1   
1233 N NH2   . ARG A 149 ? 0.4802 0.3642 0.4648 -0.0331 0.0284  0.0809  149 ARG A NH2   
1234 N N     . LEU A 150 ? 0.3497 0.4167 0.3669 0.0093  -0.0268 0.0631  150 LEU A N     
1235 C CA    . LEU A 150 ? 0.3365 0.4267 0.3684 0.0141  -0.0312 0.0607  150 LEU A CA    
1236 C C     . LEU A 150 ? 0.3198 0.4197 0.3482 0.0049  -0.0288 0.0465  150 LEU A C     
1237 O O     . LEU A 150 ? 0.3155 0.4230 0.3564 0.0075  -0.0244 0.0393  150 LEU A O     
1238 C CB    . LEU A 150 ? 0.3342 0.4447 0.3655 0.0165  -0.0440 0.0728  150 LEU A CB    
1239 C CG    . LEU A 150 ? 0.3423 0.4526 0.3836 0.0301  -0.0493 0.0896  150 LEU A CG    
1240 C CD1   . LEU A 150 ? 0.3174 0.4495 0.3505 0.0285  -0.0641 0.1007  150 LEU A CD1   
1241 C CD2   . LEU A 150 ? 0.3295 0.4480 0.3996 0.0441  -0.0456 0.0891  150 LEU A CD2   
1242 N N     . LEU A 151 ? 0.3175 0.4164 0.3283 -0.0050 -0.0308 0.0431  151 LEU A N     
1243 C CA    . LEU A 151 ? 0.3097 0.4143 0.3151 -0.0123 -0.0292 0.0322  151 LEU A CA    
1244 C C     . LEU A 151 ? 0.3158 0.4106 0.3246 -0.0125 -0.0205 0.0227  151 LEU A C     
1245 O O     . LEU A 151 ? 0.3105 0.4121 0.3233 -0.0133 -0.0177 0.0159  151 LEU A O     
1246 C CB    . LEU A 151 ? 0.3097 0.4111 0.2967 -0.0200 -0.0313 0.0308  151 LEU A CB    
1247 C CG    . LEU A 151 ? 0.3039 0.4129 0.2820 -0.0261 -0.0347 0.0255  151 LEU A CG    
1248 C CD1   . LEU A 151 ? 0.2917 0.3924 0.2566 -0.0301 -0.0311 0.0198  151 LEU A CD1   
1249 C CD2   . LEU A 151 ? 0.2895 0.4067 0.2772 -0.0269 -0.0337 0.0205  151 LEU A CD2   
1250 N N     . LYS A 152 ? 0.3303 0.4092 0.3357 -0.0133 -0.0160 0.0221  152 LYS A N     
1251 C CA    . LYS A 152 ? 0.3379 0.4075 0.3446 -0.0156 -0.0088 0.0117  152 LYS A CA    
1252 C C     . LYS A 152 ? 0.3435 0.4134 0.3627 -0.0084 -0.0038 0.0080  152 LYS A C     
1253 O O     . LYS A 152 ? 0.3476 0.4227 0.3654 -0.0105 -0.0002 -0.0012 152 LYS A O     
1254 C CB    . LYS A 152 ? 0.3529 0.4050 0.3567 -0.0194 -0.0046 0.0120  152 LYS A CB    
1255 C CG    . LYS A 152 ? 0.3571 0.4124 0.3505 -0.0277 -0.0064 0.0126  152 LYS A CG    
1256 C CD    . LYS A 152 ? 0.3688 0.4093 0.3623 -0.0344 -0.0007 0.0112  152 LYS A CD    
1257 C CE    . LYS A 152 ? 0.3828 0.4324 0.3698 -0.0426 -0.0010 0.0109  152 LYS A CE    
1258 N NZ    . LYS A 152 ? 0.4060 0.4454 0.3956 -0.0523 0.0050  0.0087  152 LYS A NZ    
1259 N N     . GLY A 153 ? 0.3507 0.4161 0.3816 0.0010  -0.0033 0.0159  153 GLY A N     
1260 C CA    . GLY A 153 ? 0.3569 0.4239 0.4034 0.0108  0.0030  0.0127  153 GLY A CA    
1261 C C     . GLY A 153 ? 0.3433 0.4343 0.3959 0.0105  0.0024  0.0092  153 GLY A C     
1262 O O     . GLY A 153 ? 0.3448 0.4375 0.4011 0.0118  0.0108  -0.0004 153 GLY A O     
1263 N N     . PHE A 154 ? 0.3324 0.4406 0.3840 0.0071  -0.0068 0.0165  154 PHE A N     
1264 C CA    . PHE A 154 ? 0.3228 0.4535 0.3800 0.0037  -0.0084 0.0150  154 PHE A CA    
1265 C C     . PHE A 154 ? 0.3184 0.4459 0.3617 -0.0050 -0.0033 0.0048  154 PHE A C     
1266 O O     . PHE A 154 ? 0.3223 0.4607 0.3708 -0.0059 0.0025  0.0002  154 PHE A O     
1267 C CB    . PHE A 154 ? 0.3180 0.4604 0.3705 -0.0016 -0.0200 0.0231  154 PHE A CB    
1268 C CG    . PHE A 154 ? 0.3233 0.4887 0.3838 -0.0071 -0.0230 0.0228  154 PHE A CG    
1269 C CD1   . PHE A 154 ? 0.3390 0.5279 0.4230 -0.0009 -0.0250 0.0279  154 PHE A CD1   
1270 C CD2   . PHE A 154 ? 0.3328 0.4967 0.3784 -0.0187 -0.0243 0.0183  154 PHE A CD2   
1271 C CE1   . PHE A 154 ? 0.3226 0.5352 0.4157 -0.0090 -0.0278 0.0274  154 PHE A CE1   
1272 C CE2   . PHE A 154 ? 0.3149 0.4966 0.3669 -0.0264 -0.0264 0.0181  154 PHE A CE2   
1273 C CZ    . PHE A 154 ? 0.3097 0.5169 0.3857 -0.0229 -0.0282 0.0223  154 PHE A CZ    
1274 N N     . LEU A 155 ? 0.3164 0.4306 0.3424 -0.0112 -0.0054 0.0023  155 LEU A N     
1275 C CA    . LEU A 155 ? 0.3083 0.4201 0.3202 -0.0180 -0.0028 -0.0051 155 LEU A CA    
1276 C C     . LEU A 155 ? 0.3168 0.4227 0.3280 -0.0164 0.0062  -0.0146 155 LEU A C     
1277 O O     . LEU A 155 ? 0.3212 0.4333 0.3275 -0.0189 0.0109  -0.0193 155 LEU A O     
1278 C CB    . LEU A 155 ? 0.3037 0.4071 0.3016 -0.0228 -0.0078 -0.0049 155 LEU A CB    
1279 C CG    . LEU A 155 ? 0.2953 0.4031 0.2885 -0.0256 -0.0150 0.0014  155 LEU A CG    
1280 C CD1   . LEU A 155 ? 0.2977 0.3981 0.2823 -0.0271 -0.0179 0.0027  155 LEU A CD1   
1281 C CD2   . LEU A 155 ? 0.2910 0.4029 0.2767 -0.0304 -0.0156 0.0002  155 LEU A CD2   
1282 N N     . LYS A 156 ? 0.3256 0.4176 0.3397 -0.0131 0.0092  -0.0175 156 LYS A N     
1283 C CA    . LYS A 156 ? 0.3447 0.4266 0.3549 -0.0133 0.0179  -0.0292 156 LYS A CA    
1284 C C     . LYS A 156 ? 0.3522 0.4416 0.3726 -0.0066 0.0273  -0.0334 156 LYS A C     
1285 O O     . LYS A 156 ? 0.3663 0.4557 0.3771 -0.0094 0.0347  -0.0437 156 LYS A O     
1286 C CB    . LYS A 156 ? 0.3599 0.4214 0.3728 -0.0120 0.0200  -0.0313 156 LYS A CB    
1287 C CG    . LYS A 156 ? 0.3869 0.4345 0.3923 -0.0154 0.0283  -0.0461 156 LYS A CG    
1288 C CD    . LYS A 156 ? 0.4357 0.4586 0.4462 -0.0142 0.0323  -0.0477 156 LYS A CD    
1289 C CE    . LYS A 156 ? 0.4763 0.4846 0.4743 -0.0243 0.0372  -0.0640 156 LYS A CE    
1290 N NZ    . LYS A 156 ? 0.5163 0.4992 0.5174 -0.0281 0.0393  -0.0639 156 LYS A NZ    
1291 N N     . ALA A 157 ? 0.3457 0.4439 0.3856 0.0023  0.0272  -0.0254 157 ALA A N     
1292 C CA    . ALA A 157 ? 0.3507 0.4609 0.4062 0.0103  0.0369  -0.0286 157 ALA A CA    
1293 C C     . ALA A 157 ? 0.3444 0.4737 0.3935 0.0027  0.0391  -0.0302 157 ALA A C     
1294 O O     . ALA A 157 ? 0.3578 0.4967 0.4122 0.0053  0.0504  -0.0365 157 ALA A O     
1295 C CB    . ALA A 157 ? 0.3495 0.4711 0.4299 0.0217  0.0335  -0.0173 157 ALA A CB    
1296 N N     . ASN A 158 ? 0.3314 0.4641 0.3681 -0.0067 0.0296  -0.0246 158 ASN A N     
1297 C CA    . ASN A 158 ? 0.3233 0.4685 0.3514 -0.0150 0.0312  -0.0240 158 ASN A CA    
1298 C C     . ASN A 158 ? 0.3282 0.4620 0.3294 -0.0230 0.0303  -0.0286 158 ASN A C     
1299 O O     . ASN A 158 ? 0.3333 0.4710 0.3228 -0.0301 0.0283  -0.0247 158 ASN A O     
1300 C CB    . ASN A 158 ? 0.3065 0.4640 0.3422 -0.0194 0.0221  -0.0138 158 ASN A CB    
1301 C CG    . ASN A 158 ? 0.2979 0.4742 0.3612 -0.0123 0.0218  -0.0087 158 ASN A CG    
1302 O OD1   . ASN A 158 ? 0.3081 0.5054 0.3849 -0.0148 0.0262  -0.0075 158 ASN A OD1   
1303 N ND2   . ASN A 158 ? 0.2873 0.4578 0.3601 -0.0034 0.0167  -0.0048 158 ASN A ND2   
1304 N N     . GLY A 159 ? 0.3297 0.4492 0.3217 -0.0218 0.0311  -0.0364 159 GLY A N     
1305 C CA    . GLY A 159 ? 0.3371 0.4506 0.3055 -0.0284 0.0305  -0.0427 159 GLY A CA    
1306 C C     . GLY A 159 ? 0.3303 0.4425 0.2859 -0.0334 0.0195  -0.0359 159 GLY A C     
1307 O O     . GLY A 159 ? 0.3376 0.4498 0.2742 -0.0379 0.0177  -0.0377 159 GLY A O     
1308 N N     . ILE A 160 ? 0.3177 0.4291 0.2830 -0.0319 0.0121  -0.0280 160 ILE A N     
1309 C CA    . ILE A 160 ? 0.3068 0.4160 0.2624 -0.0347 0.0032  -0.0223 160 ILE A CA    
1310 C C     . ILE A 160 ? 0.2983 0.4022 0.2587 -0.0333 -0.0026 -0.0219 160 ILE A C     
1311 O O     . ILE A 160 ? 0.2892 0.3925 0.2470 -0.0335 -0.0085 -0.0166 160 ILE A O     
1312 C CB    . ILE A 160 ? 0.3018 0.4141 0.2585 -0.0366 0.0010  -0.0139 160 ILE A CB    
1313 C CG1   . ILE A 160 ? 0.2966 0.4151 0.2720 -0.0345 0.0013  -0.0108 160 ILE A CG1   
1314 C CG2   . ILE A 160 ? 0.3119 0.4275 0.2584 -0.0407 0.0067  -0.0129 160 ILE A CG2   
1315 C CD1   . ILE A 160 ? 0.2951 0.4154 0.2711 -0.0387 -0.0037 -0.0043 160 ILE A CD1   
1316 N N     . TYR A 161 ? 0.3003 0.3989 0.2670 -0.0324 0.0005  -0.0277 161 TYR A N     
1317 C CA    . TYR A 161 ? 0.3009 0.3942 0.2710 -0.0337 -0.0031 -0.0275 161 TYR A CA    
1318 C C     . TYR A 161 ? 0.3072 0.4023 0.2684 -0.0392 -0.0056 -0.0345 161 TYR A C     
1319 O O     . TYR A 161 ? 0.3155 0.4088 0.2707 -0.0423 -0.0021 -0.0438 161 TYR A O     
1320 C CB    . TYR A 161 ? 0.3119 0.3948 0.2940 -0.0307 0.0014  -0.0279 161 TYR A CB    
1321 C CG    . TYR A 161 ? 0.3148 0.3906 0.2996 -0.0335 -0.0010 -0.0252 161 TYR A CG    
1322 C CD1   . TYR A 161 ? 0.3086 0.3893 0.2929 -0.0333 -0.0062 -0.0168 161 TYR A CD1   
1323 C CD2   . TYR A 161 ? 0.3336 0.3968 0.3203 -0.0375 0.0032  -0.0317 161 TYR A CD2   
1324 C CE1   . TYR A 161 ? 0.3191 0.3951 0.3049 -0.0366 -0.0064 -0.0138 161 TYR A CE1   
1325 C CE2   . TYR A 161 ? 0.3394 0.3964 0.3289 -0.0422 0.0025  -0.0283 161 TYR A CE2   
1326 C CZ    . TYR A 161 ? 0.3348 0.3996 0.3239 -0.0414 -0.0020 -0.0187 161 TYR A CZ    
1327 O OH    . TYR A 161 ? 0.3309 0.3914 0.3216 -0.0467 -0.0010 -0.0147 161 TYR A OH    
1328 N N     . GLY A 162 ? 0.3014 0.4022 0.2624 -0.0405 -0.0115 -0.0308 162 GLY A N     
1329 C CA    . GLY A 162 ? 0.3059 0.4151 0.2634 -0.0455 -0.0157 -0.0362 162 GLY A CA    
1330 C C     . GLY A 162 ? 0.3027 0.4230 0.2509 -0.0426 -0.0219 -0.0321 162 GLY A C     
1331 O O     . GLY A 162 ? 0.3139 0.4325 0.2523 -0.0403 -0.0211 -0.0298 162 GLY A O     
1332 N N     . ALA A 163 ? 0.3010 0.4329 0.2532 -0.0423 -0.0275 -0.0305 163 ALA A N     
1333 C CA    . ALA A 163 ? 0.2985 0.4400 0.2441 -0.0365 -0.0338 -0.0249 163 ALA A CA    
1334 C C     . ALA A 163 ? 0.3067 0.4640 0.2454 -0.0394 -0.0409 -0.0289 163 ALA A C     
1335 O O     . ALA A 163 ? 0.3154 0.4833 0.2507 -0.0329 -0.0477 -0.0227 163 ALA A O     
1336 C CB    . ALA A 163 ? 0.2914 0.4379 0.2468 -0.0309 -0.0351 -0.0195 163 ALA A CB    
1337 N N     . GLU A 164 ? 0.3069 0.4654 0.2427 -0.0485 -0.0397 -0.0392 164 GLU A N     
1338 C CA    . GLU A 164 ? 0.3191 0.4932 0.2441 -0.0534 -0.0472 -0.0447 164 GLU A CA    
1339 C C     . GLU A 164 ? 0.3328 0.5032 0.2363 -0.0486 -0.0484 -0.0391 164 GLU A C     
1340 O O     . GLU A 164 ? 0.3296 0.4840 0.2285 -0.0451 -0.0409 -0.0347 164 GLU A O     
1341 C CB    . GLU A 164 ? 0.3289 0.4996 0.2527 -0.0660 -0.0439 -0.0596 164 GLU A CB    
1342 C CG    . GLU A 164 ? 0.3439 0.4931 0.2578 -0.0672 -0.0332 -0.0656 164 GLU A CG    
1343 C CD    . GLU A 164 ? 0.3721 0.5027 0.3012 -0.0667 -0.0238 -0.0664 164 GLU A CD    
1344 O OE1   . GLU A 164 ? 0.4019 0.5173 0.3284 -0.0704 -0.0156 -0.0760 164 GLU A OE1   
1345 O OE2   . GLU A 164 ? 0.3768 0.5071 0.3191 -0.0620 -0.0241 -0.0573 164 GLU A OE2   
1346 N N     . TYR A 165 ? 0.3446 0.5312 0.2346 -0.0494 -0.0578 -0.0385 165 TYR A N     
1347 C CA    . TYR A 165 ? 0.3541 0.5367 0.2214 -0.0445 -0.0592 -0.0297 165 TYR A CA    
1348 C C     . TYR A 165 ? 0.3652 0.5338 0.2159 -0.0505 -0.0488 -0.0363 165 TYR A C     
1349 O O     . TYR A 165 ? 0.3810 0.5424 0.2147 -0.0475 -0.0458 -0.0281 165 TYR A O     
1350 C CB    . TYR A 165 ? 0.3735 0.5780 0.2282 -0.0427 -0.0732 -0.0250 165 TYR A CB    
1351 C CG    . TYR A 165 ? 0.3672 0.5825 0.2366 -0.0304 -0.0815 -0.0125 165 TYR A CG    
1352 C CD1   . TYR A 165 ? 0.3814 0.6242 0.2688 -0.0307 -0.0916 -0.0155 165 TYR A CD1   
1353 C CD2   . TYR A 165 ? 0.3541 0.5521 0.2217 -0.0189 -0.0781 0.0013  165 TYR A CD2   
1354 C CE1   . TYR A 165 ? 0.3681 0.6228 0.2723 -0.0173 -0.0974 -0.0047 165 TYR A CE1   
1355 C CE2   . TYR A 165 ? 0.3627 0.5669 0.2440 -0.0061 -0.0837 0.0112  165 TYR A CE2   
1356 C CZ    . TYR A 165 ? 0.3684 0.6018 0.2687 -0.0040 -0.0929 0.0083  165 TYR A CZ    
1357 O OH    . TYR A 165 ? 0.3660 0.6074 0.2822 0.0108  -0.0968 0.0177  165 TYR A OH    
1358 N N     . LYS A 166 ? 0.3634 0.5272 0.2194 -0.0586 -0.0421 -0.0510 166 LYS A N     
1359 C CA    . LYS A 166 ? 0.3783 0.5298 0.2215 -0.0626 -0.0303 -0.0593 166 LYS A CA    
1360 C C     . LYS A 166 ? 0.3681 0.5053 0.2220 -0.0565 -0.0196 -0.0522 166 LYS A C     
1361 O O     . LYS A 166 ? 0.3748 0.5065 0.2184 -0.0570 -0.0100 -0.0534 166 LYS A O     
1362 C CB    . LYS A 166 ? 0.3858 0.5324 0.2326 -0.0716 -0.0254 -0.0777 166 LYS A CB    
1363 C CG    . LYS A 166 ? 0.4015 0.5381 0.2309 -0.0751 -0.0133 -0.0889 166 LYS A CG    
1364 C CD    . LYS A 166 ? 0.4170 0.5405 0.2521 -0.0819 -0.0055 -0.1073 166 LYS A CD    
1365 C CE    . LYS A 166 ? 0.4567 0.5705 0.2739 -0.0827 0.0087  -0.1188 166 LYS A CE    
1366 N NZ    . LYS A 166 ? 0.4881 0.5824 0.3114 -0.0863 0.0198  -0.1369 166 LYS A NZ    
1367 N N     . VAL A 167 ? 0.3554 0.4892 0.2298 -0.0515 -0.0214 -0.0452 167 VAL A N     
1368 C CA    . VAL A 167 ? 0.3453 0.4686 0.2327 -0.0473 -0.0136 -0.0398 167 VAL A CA    
1369 C C     . VAL A 167 ? 0.3400 0.4618 0.2289 -0.0418 -0.0184 -0.0260 167 VAL A C     
1370 O O     . VAL A 167 ? 0.3420 0.4575 0.2304 -0.0408 -0.0132 -0.0199 167 VAL A O     
1371 C CB    . VAL A 167 ? 0.3330 0.4499 0.2413 -0.0471 -0.0105 -0.0448 167 VAL A CB    
1372 C CG1   . VAL A 167 ? 0.3166 0.4269 0.2380 -0.0425 -0.0049 -0.0384 167 VAL A CG1   
1373 C CG2   . VAL A 167 ? 0.3425 0.4545 0.2493 -0.0524 -0.0048 -0.0592 167 VAL A CG2   
1374 N N     . ARG A 168 ? 0.3396 0.4675 0.2317 -0.0387 -0.0275 -0.0221 168 ARG A N     
1375 C CA    . ARG A 168 ? 0.3379 0.4613 0.2314 -0.0320 -0.0312 -0.0107 168 ARG A CA    
1376 C C     . ARG A 168 ? 0.3268 0.4390 0.2319 -0.0312 -0.0257 -0.0083 168 ARG A C     
1377 O O     . ARG A 168 ? 0.3334 0.4358 0.2333 -0.0298 -0.0242 -0.0009 168 ARG A O     
1378 C CB    . ARG A 168 ? 0.3547 0.4745 0.2283 -0.0297 -0.0331 -0.0015 168 ARG A CB    
1379 C CG    . ARG A 168 ? 0.3748 0.5075 0.2377 -0.0264 -0.0432 0.0014  168 ARG A CG    
1380 C CD    . ARG A 168 ? 0.4347 0.5591 0.2753 -0.0237 -0.0441 0.0135  168 ARG A CD    
1381 N NE    . ARG A 168 ? 0.4722 0.5967 0.3111 -0.0127 -0.0532 0.0253  168 ARG A NE    
1382 C CZ    . ARG A 168 ? 0.4791 0.5927 0.3305 -0.0047 -0.0529 0.0306  168 ARG A CZ    
1383 N NH1   . ARG A 168 ? 0.4323 0.5356 0.2976 -0.0077 -0.0456 0.0253  168 ARG A NH1   
1384 N NH2   . ARG A 168 ? 0.5388 0.6525 0.3884 0.0072  -0.0603 0.0411  168 ARG A NH2   
1385 N N     . GLY A 169 ? 0.3136 0.4267 0.2329 -0.0332 -0.0231 -0.0143 169 GLY A N     
1386 C CA    . GLY A 169 ? 0.3044 0.4106 0.2345 -0.0327 -0.0197 -0.0120 169 GLY A CA    
1387 C C     . GLY A 169 ? 0.2938 0.4005 0.2338 -0.0307 -0.0223 -0.0114 169 GLY A C     
1388 O O     . GLY A 169 ? 0.3036 0.4145 0.2428 -0.0275 -0.0264 -0.0099 169 GLY A O     
1389 N N     . PHE A 170 ? 0.2861 0.3899 0.2356 -0.0318 -0.0196 -0.0119 170 PHE A N     
1390 C CA    . PHE A 170 ? 0.2851 0.3879 0.2403 -0.0308 -0.0207 -0.0098 170 PHE A CA    
1391 C C     . PHE A 170 ? 0.2889 0.3953 0.2512 -0.0333 -0.0197 -0.0135 170 PHE A C     
1392 O O     . PHE A 170 ? 0.2934 0.3959 0.2604 -0.0357 -0.0166 -0.0166 170 PHE A O     
1393 C CB    . PHE A 170 ? 0.2854 0.3840 0.2448 -0.0312 -0.0196 -0.0063 170 PHE A CB    
1394 C CG    . PHE A 170 ? 0.2894 0.3852 0.2436 -0.0319 -0.0208 -0.0032 170 PHE A CG    
1395 C CD1   . PHE A 170 ? 0.2918 0.3886 0.2443 -0.0337 -0.0186 -0.0033 170 PHE A CD1   
1396 C CD2   . PHE A 170 ? 0.2937 0.3854 0.2437 -0.0324 -0.0231 -0.0010 170 PHE A CD2   
1397 C CE1   . PHE A 170 ? 0.3021 0.3959 0.2508 -0.0371 -0.0189 -0.0004 170 PHE A CE1   
1398 C CE2   . PHE A 170 ? 0.2959 0.3828 0.2406 -0.0357 -0.0241 0.0003  170 PHE A CE2   
1399 C CZ    . PHE A 170 ? 0.3026 0.3905 0.2478 -0.0387 -0.0221 0.0011  170 PHE A CZ    
1400 N N     . SER A 171 ? 0.2892 0.4024 0.2536 -0.0329 -0.0213 -0.0134 171 SER A N     
1401 C CA    . SER A 171 ? 0.2920 0.4097 0.2649 -0.0381 -0.0194 -0.0166 171 SER A CA    
1402 C C     . SER A 171 ? 0.2975 0.4052 0.2734 -0.0398 -0.0154 -0.0125 171 SER A C     
1403 O O     . SER A 171 ? 0.2924 0.3948 0.2642 -0.0364 -0.0157 -0.0073 171 SER A O     
1404 C CB    . SER A 171 ? 0.2880 0.4210 0.2660 -0.0376 -0.0212 -0.0173 171 SER A CB    
1405 O OG    . SER A 171 ? 0.2878 0.4205 0.2654 -0.0334 -0.0190 -0.0130 171 SER A OG    
1406 N N     . GLY A 172 ? 0.3099 0.4147 0.2921 -0.0460 -0.0120 -0.0145 172 GLY A N     
1407 C CA    . GLY A 172 ? 0.3169 0.4101 0.3004 -0.0474 -0.0082 -0.0082 172 GLY A CA    
1408 C C     . GLY A 172 ? 0.3140 0.4130 0.2940 -0.0468 -0.0072 -0.0025 172 GLY A C     
1409 O O     . GLY A 172 ? 0.3174 0.4093 0.2918 -0.0450 -0.0066 0.0047  172 GLY A O     
1410 N N     . TYR A 173 ? 0.3106 0.4244 0.2936 -0.0477 -0.0071 -0.0061 173 TYR A N     
1411 C CA    . TYR A 173 ? 0.3152 0.4361 0.2952 -0.0463 -0.0040 -0.0030 173 TYR A CA    
1412 C C     . TYR A 173 ? 0.3158 0.4315 0.2843 -0.0389 -0.0069 -0.0010 173 TYR A C     
1413 O O     . TYR A 173 ? 0.3227 0.4345 0.2819 -0.0386 -0.0047 0.0029  173 TYR A O     
1414 C CB    . TYR A 173 ? 0.3125 0.4539 0.3031 -0.0469 -0.0028 -0.0078 173 TYR A CB    
1415 C CG    . TYR A 173 ? 0.3213 0.4725 0.3105 -0.0426 0.0021  -0.0066 173 TYR A CG    
1416 C CD1   . TYR A 173 ? 0.3357 0.4829 0.3185 -0.0468 0.0093  -0.0020 173 TYR A CD1   
1417 C CD2   . TYR A 173 ? 0.3153 0.4788 0.3082 -0.0336 0.0005  -0.0099 173 TYR A CD2   
1418 C CE1   . TYR A 173 ? 0.3447 0.5010 0.3240 -0.0430 0.0159  -0.0027 173 TYR A CE1   
1419 C CE2   . TYR A 173 ? 0.3330 0.5040 0.3252 -0.0280 0.0070  -0.0105 173 TYR A CE2   
1420 C CZ    . TYR A 173 ? 0.3393 0.5073 0.3242 -0.0332 0.0152  -0.0079 173 TYR A CZ    
1421 O OH    . TYR A 173 ? 0.3387 0.5143 0.3209 -0.0278 0.0236  -0.0101 173 TYR A OH    
1422 N N     . LEU A 174 ? 0.3115 0.4263 0.2787 -0.0344 -0.0117 -0.0038 174 LEU A N     
1423 C CA    . LEU A 174 ? 0.3134 0.4204 0.2701 -0.0303 -0.0143 -0.0025 174 LEU A CA    
1424 C C     . LEU A 174 ? 0.3148 0.4137 0.2663 -0.0327 -0.0158 0.0024  174 LEU A C     
1425 O O     . LEU A 174 ? 0.3202 0.4159 0.2614 -0.0325 -0.0167 0.0037  174 LEU A O     
1426 C CB    . LEU A 174 ? 0.3074 0.4126 0.2630 -0.0272 -0.0181 -0.0046 174 LEU A CB    
1427 C CG    . LEU A 174 ? 0.3131 0.4082 0.2590 -0.0259 -0.0203 -0.0035 174 LEU A CG    
1428 C CD1   . LEU A 174 ? 0.3171 0.4066 0.2537 -0.0235 -0.0185 -0.0049 174 LEU A CD1   
1429 C CD2   . LEU A 174 ? 0.3144 0.4072 0.2587 -0.0241 -0.0224 -0.0039 174 LEU A CD2   
1430 N N     . CYS A 175 ? 0.3137 0.4098 0.2722 -0.0344 -0.0161 0.0047  175 CYS A N     
1431 C CA    . CYS A 175 ? 0.3226 0.4137 0.2798 -0.0341 -0.0182 0.0114  175 CYS A CA    
1432 C C     . CYS A 175 ? 0.3366 0.4262 0.2847 -0.0360 -0.0170 0.0174  175 CYS A C     
1433 O O     . CYS A 175 ? 0.3497 0.4395 0.2893 -0.0357 -0.0213 0.0221  175 CYS A O     
1434 C CB    . CYS A 175 ? 0.3193 0.4051 0.2872 -0.0334 -0.0167 0.0126  175 CYS A CB    
1435 S SG    . CYS A 175 ? 0.3395 0.4278 0.3141 -0.0311 -0.0172 0.0061  175 CYS A SG    
1436 N N     . GLU A 176 ? 0.3385 0.4288 0.2877 -0.0393 -0.0111 0.0172  176 GLU A N     
1437 C CA    . GLU A 176 ? 0.3507 0.4398 0.2892 -0.0422 -0.0077 0.0234  176 GLU A CA    
1438 C C     . GLU A 176 ? 0.3426 0.4363 0.2666 -0.0413 -0.0081 0.0204  176 GLU A C     
1439 O O     . GLU A 176 ? 0.3603 0.4518 0.2695 -0.0427 -0.0096 0.0258  176 GLU A O     
1440 C CB    . GLU A 176 ? 0.3617 0.4531 0.3068 -0.0479 0.0004  0.0231  176 GLU A CB    
1441 C CG    . GLU A 176 ? 0.4118 0.4903 0.3597 -0.0518 0.0029  0.0315  176 GLU A CG    
1442 C CD    . GLU A 176 ? 0.4655 0.5424 0.4281 -0.0578 0.0073  0.0260  176 GLU A CD    
1443 O OE1   . GLU A 176 ? 0.4825 0.5641 0.4539 -0.0558 0.0040  0.0170  176 GLU A OE1   
1444 O OE2   . GLU A 176 ? 0.5093 0.5796 0.4733 -0.0657 0.0140  0.0305  176 GLU A OE2   
1445 N N     . LEU A 177 ? 0.3232 0.4216 0.2498 -0.0385 -0.0068 0.0118  177 LEU A N     
1446 C CA    . LEU A 177 ? 0.3224 0.4205 0.2352 -0.0367 -0.0051 0.0068  177 LEU A CA    
1447 C C     . LEU A 177 ? 0.3277 0.4191 0.2286 -0.0378 -0.0126 0.0071  177 LEU A C     
1448 O O     . LEU A 177 ? 0.3427 0.4317 0.2257 -0.0403 -0.0126 0.0061  177 LEU A O     
1449 C CB    . LEU A 177 ? 0.3108 0.4125 0.2311 -0.0311 -0.0024 -0.0011 177 LEU A CB    
1450 C CG    . LEU A 177 ? 0.2951 0.4105 0.2290 -0.0303 0.0044  -0.0025 177 LEU A CG    
1451 C CD1   . LEU A 177 ? 0.2838 0.4047 0.2268 -0.0224 0.0040  -0.0080 177 LEU A CD1   
1452 C CD2   . LEU A 177 ? 0.2979 0.4191 0.2242 -0.0325 0.0137  -0.0021 177 LEU A CD2   
1453 N N     . LEU A 178 ? 0.3162 0.4064 0.2268 -0.0372 -0.0188 0.0081  178 LEU A N     
1454 C CA    . LEU A 178 ? 0.3200 0.4091 0.2251 -0.0398 -0.0264 0.0089  178 LEU A CA    
1455 C C     . LEU A 178 ? 0.3291 0.4219 0.2261 -0.0423 -0.0310 0.0171  178 LEU A C     
1456 O O     . LEU A 178 ? 0.3477 0.4419 0.2302 -0.0465 -0.0363 0.0162  178 LEU A O     
1457 C CB    . LEU A 178 ? 0.3073 0.3985 0.2277 -0.0386 -0.0299 0.0095  178 LEU A CB    
1458 C CG    . LEU A 178 ? 0.3130 0.3997 0.2369 -0.0367 -0.0273 0.0032  178 LEU A CG    
1459 C CD1   . LEU A 178 ? 0.2841 0.3741 0.2205 -0.0365 -0.0292 0.0044  178 LEU A CD1   
1460 C CD2   . LEU A 178 ? 0.3144 0.3919 0.2245 -0.0389 -0.0276 -0.0026 178 LEU A CD2   
1461 N N     . ILE A 179 ? 0.3196 0.4132 0.2245 -0.0404 -0.0294 0.0255  179 ILE A N     
1462 C CA    . ILE A 179 ? 0.3301 0.4256 0.2266 -0.0410 -0.0341 0.0364  179 ILE A CA    
1463 C C     . ILE A 179 ? 0.3509 0.4454 0.2236 -0.0453 -0.0309 0.0362  179 ILE A C     
1464 O O     . ILE A 179 ? 0.3714 0.4700 0.2278 -0.0482 -0.0380 0.0395  179 ILE A O     
1465 C CB    . ILE A 179 ? 0.3309 0.4214 0.2399 -0.0373 -0.0320 0.0464  179 ILE A CB    
1466 C CG1   . ILE A 179 ? 0.2999 0.3920 0.2302 -0.0324 -0.0348 0.0452  179 ILE A CG1   
1467 C CG2   . ILE A 179 ? 0.3497 0.4393 0.2460 -0.0369 -0.0364 0.0607  179 ILE A CG2   
1468 C CD1   . ILE A 179 ? 0.2640 0.3682 0.1987 -0.0306 -0.0449 0.0474  179 ILE A CD1   
1469 N N     . VAL A 180 ? 0.3490 0.4408 0.2195 -0.0460 -0.0202 0.0315  180 VAL A N     
1470 C CA    . VAL A 180 ? 0.3677 0.4598 0.2155 -0.0496 -0.0141 0.0288  180 VAL A CA    
1471 C C     . VAL A 180 ? 0.3765 0.4672 0.2085 -0.0515 -0.0181 0.0182  180 VAL A C     
1472 O O     . VAL A 180 ? 0.4013 0.4920 0.2088 -0.0558 -0.0184 0.0174  180 VAL A O     
1473 C CB    . VAL A 180 ? 0.3651 0.4594 0.2187 -0.0491 -0.0007 0.0236  180 VAL A CB    
1474 C CG1   . VAL A 180 ? 0.3848 0.4806 0.2160 -0.0510 0.0075  0.0170  180 VAL A CG1   
1475 C CG2   . VAL A 180 ? 0.3679 0.4622 0.2306 -0.0517 0.0044  0.0341  180 VAL A CG2   
1476 N N     . PHE A 181 ? 0.3639 0.4517 0.2079 -0.0493 -0.0207 0.0100  181 PHE A N     
1477 C CA    . PHE A 181 ? 0.3795 0.4605 0.2090 -0.0524 -0.0227 -0.0012 181 PHE A CA    
1478 C C     . PHE A 181 ? 0.3921 0.4772 0.2118 -0.0594 -0.0354 0.0009  181 PHE A C     
1479 O O     . PHE A 181 ? 0.4102 0.4911 0.2077 -0.0658 -0.0375 -0.0070 181 PHE A O     
1480 C CB    . PHE A 181 ? 0.3641 0.4377 0.2082 -0.0482 -0.0205 -0.0089 181 PHE A CB    
1481 C CG    . PHE A 181 ? 0.3782 0.4379 0.2070 -0.0504 -0.0187 -0.0211 181 PHE A CG    
1482 C CD1   . PHE A 181 ? 0.4024 0.4544 0.2181 -0.0466 -0.0079 -0.0298 181 PHE A CD1   
1483 C CD2   . PHE A 181 ? 0.3753 0.4287 0.2036 -0.0565 -0.0263 -0.0245 181 PHE A CD2   
1484 C CE1   . PHE A 181 ? 0.4225 0.4561 0.2230 -0.0475 -0.0047 -0.0424 181 PHE A CE1   
1485 C CE2   . PHE A 181 ? 0.4087 0.4438 0.2217 -0.0601 -0.0238 -0.0365 181 PHE A CE2   
1486 C CZ    . PHE A 181 ? 0.4356 0.4585 0.2336 -0.0550 -0.0129 -0.0459 181 PHE A CZ    
1487 N N     . TYR A 182 ? 0.3815 0.4760 0.2187 -0.0583 -0.0438 0.0106  182 TYR A N     
1488 C CA    . TYR A 182 ? 0.3907 0.4956 0.2265 -0.0641 -0.0570 0.0132  182 TYR A CA    
1489 C C     . TYR A 182 ? 0.4014 0.5185 0.2316 -0.0632 -0.0651 0.0273  182 TYR A C     
1490 O O     . TYR A 182 ? 0.4158 0.5461 0.2415 -0.0681 -0.0775 0.0303  182 TYR A O     
1491 C CB    . TYR A 182 ? 0.3714 0.4816 0.2330 -0.0628 -0.0607 0.0133  182 TYR A CB    
1492 C CG    . TYR A 182 ? 0.3676 0.4655 0.2295 -0.0663 -0.0561 0.0011  182 TYR A CG    
1493 C CD1   . TYR A 182 ? 0.3842 0.4767 0.2304 -0.0765 -0.0599 -0.0087 182 TYR A CD1   
1494 C CD2   . TYR A 182 ? 0.3425 0.4326 0.2188 -0.0599 -0.0482 -0.0004 182 TYR A CD2   
1495 C CE1   . TYR A 182 ? 0.3827 0.4584 0.2280 -0.0795 -0.0548 -0.0185 182 TYR A CE1   
1496 C CE2   . TYR A 182 ? 0.3468 0.4236 0.2217 -0.0618 -0.0443 -0.0088 182 TYR A CE2   
1497 C CZ    . TYR A 182 ? 0.3790 0.4467 0.2387 -0.0712 -0.0470 -0.0173 182 TYR A CZ    
1498 O OH    . TYR A 182 ? 0.3924 0.4416 0.2497 -0.0729 -0.0423 -0.0243 182 TYR A OH    
1499 N N     . GLY A 183 ? 0.3983 0.5115 0.2293 -0.0575 -0.0586 0.0368  183 GLY A N     
1500 C CA    . GLY A 183 ? 0.4212 0.5409 0.2439 -0.0556 -0.0651 0.0527  183 GLY A CA    
1501 C C     . GLY A 183 ? 0.4125 0.5380 0.2611 -0.0473 -0.0709 0.0655  183 GLY A C     
1502 O O     . GLY A 183 ? 0.4228 0.5443 0.2705 -0.0421 -0.0703 0.0799  183 GLY A O     
1503 N N     . SER A 184 ? 0.3990 0.5326 0.2703 -0.0457 -0.0751 0.0604  184 SER A N     
1504 C CA    . SER A 184 ? 0.3943 0.5348 0.2923 -0.0364 -0.0789 0.0702  184 SER A CA    
1505 C C     . SER A 184 ? 0.3720 0.5147 0.2941 -0.0351 -0.0749 0.0605  184 SER A C     
1506 O O     . SER A 184 ? 0.3668 0.5088 0.2851 -0.0424 -0.0732 0.0481  184 SER A O     
1507 C CB    . SER A 184 ? 0.4111 0.5730 0.3107 -0.0348 -0.0946 0.0810  184 SER A CB    
1508 O OG    . SER A 184 ? 0.4064 0.5861 0.3184 -0.0405 -0.1015 0.0720  184 SER A OG    
1509 N N     . PHE A 185 ? 0.3648 0.5082 0.3100 -0.0256 -0.0730 0.0666  185 PHE A N     
1510 C CA    . PHE A 185 ? 0.3517 0.5015 0.3197 -0.0237 -0.0698 0.0594  185 PHE A CA    
1511 C C     . PHE A 185 ? 0.3559 0.5273 0.3296 -0.0305 -0.0787 0.0554  185 PHE A C     
1512 O O     . PHE A 185 ? 0.3465 0.5168 0.3211 -0.0377 -0.0750 0.0446  185 PHE A O     
1513 C CB    . PHE A 185 ? 0.3471 0.4971 0.3379 -0.0112 -0.0673 0.0674  185 PHE A CB    
1514 C CG    . PHE A 185 ? 0.3276 0.4887 0.3414 -0.0087 -0.0637 0.0607  185 PHE A CG    
1515 C CD1   . PHE A 185 ? 0.3222 0.5091 0.3559 -0.0050 -0.0712 0.0653  185 PHE A CD1   
1516 C CD2   . PHE A 185 ? 0.3189 0.4676 0.3345 -0.0106 -0.0528 0.0499  185 PHE A CD2   
1517 C CE1   . PHE A 185 ? 0.3220 0.5213 0.3774 -0.0035 -0.0657 0.0589  185 PHE A CE1   
1518 C CE2   . PHE A 185 ? 0.3132 0.4720 0.3464 -0.0091 -0.0482 0.0439  185 PHE A CE2   
1519 C CZ    . PHE A 185 ? 0.3086 0.4925 0.3620 -0.0057 -0.0535 0.0483  185 PHE A CZ    
1520 N N     . LEU A 186 ? 0.3752 0.5664 0.3525 -0.0287 -0.0910 0.0652  186 LEU A N     
1521 C CA    . LEU A 186 ? 0.3800 0.5972 0.3655 -0.0368 -0.1016 0.0624  186 LEU A CA    
1522 C C     . LEU A 186 ? 0.3898 0.6000 0.3522 -0.0529 -0.1024 0.0494  186 LEU A C     
1523 O O     . LEU A 186 ? 0.3861 0.6052 0.3571 -0.0624 -0.1031 0.0410  186 LEU A O     
1524 C CB    . LEU A 186 ? 0.3950 0.6369 0.3854 -0.0318 -0.1169 0.0764  186 LEU A CB    
1525 C CG    . LEU A 186 ? 0.4007 0.6786 0.4099 -0.0391 -0.1290 0.0749  186 LEU A CG    
1526 C CD1   . LEU A 186 ? 0.3743 0.6661 0.4195 -0.0337 -0.1216 0.0722  186 LEU A CD1   
1527 C CD2   . LEU A 186 ? 0.4163 0.7215 0.4272 -0.0345 -0.1468 0.0895  186 LEU A CD2   
1528 N N     . GLU A 187 ? 0.4061 0.5989 0.3395 -0.0560 -0.1008 0.0476  187 GLU A N     
1529 C CA    . GLU A 187 ? 0.4199 0.6000 0.3297 -0.0689 -0.0988 0.0338  187 GLU A CA    
1530 C C     . GLU A 187 ? 0.3992 0.5605 0.3138 -0.0700 -0.0863 0.0232  187 GLU A C     
1531 O O     . GLU A 187 ? 0.4071 0.5619 0.3144 -0.0804 -0.0857 0.0125  187 GLU A O     
1532 C CB    . GLU A 187 ? 0.4406 0.6071 0.3192 -0.0699 -0.0971 0.0341  187 GLU A CB    
1533 C CG    . GLU A 187 ? 0.5039 0.6870 0.3646 -0.0756 -0.1113 0.0397  187 GLU A CG    
1534 C CD    . GLU A 187 ? 0.5678 0.7641 0.4244 -0.0908 -0.1215 0.0289  187 GLU A CD    
1535 O OE1   . GLU A 187 ? 0.5971 0.7750 0.4392 -0.1003 -0.1146 0.0133  187 GLU A OE1   
1536 O OE2   . GLU A 187 ? 0.5748 0.8000 0.4438 -0.0932 -0.1363 0.0360  187 GLU A OE2   
1537 N N     . THR A 188 ? 0.3753 0.5268 0.3008 -0.0597 -0.0769 0.0264  188 THR A N     
1538 C CA    . THR A 188 ? 0.3582 0.4941 0.2865 -0.0593 -0.0664 0.0183  188 THR A CA    
1539 C C     . THR A 188 ? 0.3506 0.4962 0.2962 -0.0640 -0.0671 0.0155  188 THR A C     
1540 O O     . THR A 188 ? 0.3559 0.4930 0.2942 -0.0730 -0.0656 0.0076  188 THR A O     
1541 C CB    . THR A 188 ? 0.3413 0.4686 0.2774 -0.0491 -0.0580 0.0219  188 THR A CB    
1542 O OG1   . THR A 188 ? 0.3452 0.4642 0.2654 -0.0473 -0.0557 0.0243  188 THR A OG1   
1543 C CG2   . THR A 188 ? 0.3198 0.4353 0.2580 -0.0486 -0.0497 0.0146  188 THR A CG2   
1544 N N     . VAL A 189 ? 0.3377 0.5002 0.3063 -0.0579 -0.0684 0.0224  189 VAL A N     
1545 C CA    . VAL A 189 ? 0.3281 0.5065 0.3165 -0.0619 -0.0682 0.0212  189 VAL A CA    
1546 C C     . VAL A 189 ? 0.3426 0.5292 0.3254 -0.0773 -0.0754 0.0159  189 VAL A C     
1547 O O     . VAL A 189 ? 0.3488 0.5284 0.3315 -0.0863 -0.0703 0.0098  189 VAL A O     
1548 C CB    . VAL A 189 ? 0.3184 0.5194 0.3324 -0.0519 -0.0708 0.0301  189 VAL A CB    
1549 C CG1   . VAL A 189 ? 0.3236 0.5497 0.3610 -0.0571 -0.0715 0.0292  189 VAL A CG1   
1550 C CG2   . VAL A 189 ? 0.3091 0.4968 0.3287 -0.0397 -0.0609 0.0315  189 VAL A CG2   
1551 N N     . LYS A 190 ? 0.3518 0.5513 0.3277 -0.0815 -0.0870 0.0184  190 LYS A N     
1552 C CA    . LYS A 190 ? 0.3633 0.5717 0.3321 -0.0986 -0.0955 0.0118  190 LYS A CA    
1553 C C     . LYS A 190 ? 0.3718 0.5488 0.3170 -0.1086 -0.0885 -0.0002 190 LYS A C     
1554 O O     . LYS A 190 ? 0.3755 0.5507 0.3226 -0.1225 -0.0878 -0.0068 190 LYS A O     
1555 C CB    . LYS A 190 ? 0.3803 0.6052 0.3381 -0.1010 -0.1099 0.0158  190 LYS A CB    
1556 C CG    . LYS A 190 ? 0.3789 0.6443 0.3646 -0.0983 -0.1219 0.0259  190 LYS A CG    
1557 C CD    . LYS A 190 ? 0.3995 0.6822 0.3733 -0.0969 -0.1374 0.0340  190 LYS A CD    
1558 C CE    . LYS A 190 ? 0.4570 0.7475 0.4104 -0.1173 -0.1491 0.0241  190 LYS A CE    
1559 N NZ    . LYS A 190 ? 0.4932 0.8184 0.4462 -0.1181 -0.1690 0.0339  190 LYS A NZ    
1560 N N     . ASN A 191 ? 0.3727 0.5248 0.2975 -0.1012 -0.0822 -0.0024 191 ASN A N     
1561 C CA    . ASN A 191 ? 0.3881 0.5094 0.2915 -0.1065 -0.0748 -0.0130 191 ASN A CA    
1562 C C     . ASN A 191 ? 0.3768 0.4814 0.2874 -0.1031 -0.0640 -0.0138 191 ASN A C     
1563 O O     . ASN A 191 ? 0.3934 0.4787 0.2950 -0.1122 -0.0603 -0.0205 191 ASN A O     
1564 C CB    . ASN A 191 ? 0.3970 0.5024 0.2776 -0.0996 -0.0716 -0.0155 191 ASN A CB    
1565 C CG    . ASN A 191 ? 0.4293 0.5381 0.2883 -0.1096 -0.0800 -0.0210 191 ASN A CG    
1566 O OD1   . ASN A 191 ? 0.4605 0.5541 0.3033 -0.1217 -0.0799 -0.0328 191 ASN A OD1   
1567 N ND2   . ASN A 191 ? 0.4396 0.5668 0.2965 -0.1053 -0.0874 -0.0126 191 ASN A ND2   
1568 N N     . ALA A 192 ? 0.3526 0.4627 0.2773 -0.0905 -0.0592 -0.0067 192 ALA A N     
1569 C CA    . ALA A 192 ? 0.3403 0.4384 0.2701 -0.0866 -0.0502 -0.0061 192 ALA A CA    
1570 C C     . ALA A 192 ? 0.3495 0.4493 0.2862 -0.0990 -0.0490 -0.0075 192 ALA A C     
1571 O O     . ALA A 192 ? 0.3606 0.4407 0.2906 -0.1005 -0.0420 -0.0085 192 ALA A O     
1572 C CB    . ALA A 192 ? 0.3166 0.4271 0.2623 -0.0749 -0.0472 0.0004  192 ALA A CB    
1573 N N     . ARG A 193 ? 0.3477 0.4725 0.2985 -0.1081 -0.0560 -0.0064 193 ARG A N     
1574 C CA    . ARG A 193 ? 0.3578 0.4899 0.3180 -0.1236 -0.0554 -0.0081 193 ARG A CA    
1575 C C     . ARG A 193 ? 0.3862 0.4853 0.3258 -0.1356 -0.0511 -0.0151 193 ARG A C     
1576 O O     . ARG A 193 ? 0.3974 0.4916 0.3414 -0.1465 -0.0457 -0.0146 193 ARG A O     
1577 C CB    . ARG A 193 ? 0.3624 0.5264 0.3364 -0.1336 -0.0670 -0.0082 193 ARG A CB    
1578 C CG    . ARG A 193 ? 0.3394 0.5396 0.3455 -0.1329 -0.0669 -0.0018 193 ARG A CG    
1579 C CD    . ARG A 193 ? 0.3229 0.5558 0.3448 -0.1252 -0.0784 0.0040  193 ARG A CD    
1580 N NE    . ARG A 193 ? 0.3543 0.5874 0.3588 -0.1328 -0.0910 0.0004  193 ARG A NE    
1581 C CZ    . ARG A 193 ? 0.3764 0.6400 0.3913 -0.1446 -0.1040 0.0001  193 ARG A CZ    
1582 N NH1   . ARG A 193 ? 0.3805 0.6796 0.4277 -0.1495 -0.1055 0.0036  193 ARG A NH1   
1583 N NH2   . ARG A 193 ? 0.3975 0.6589 0.3906 -0.1517 -0.1153 -0.0040 193 ARG A NH2   
1584 N N     . ARG A 194 ? 0.4034 0.4784 0.3202 -0.1334 -0.0522 -0.0213 194 ARG A N     
1585 C CA    . ARG A 194 ? 0.4382 0.4768 0.3347 -0.1424 -0.0471 -0.0287 194 ARG A CA    
1586 C C     . ARG A 194 ? 0.4323 0.4393 0.3128 -0.1271 -0.0389 -0.0287 194 ARG A C     
1587 O O     . ARG A 194 ? 0.4618 0.4362 0.3233 -0.1301 -0.0350 -0.0358 194 ARG A O     
1588 C CB    . ARG A 194 ? 0.4718 0.5058 0.3545 -0.1590 -0.0543 -0.0398 194 ARG A CB    
1589 C CG    . ARG A 194 ? 0.4968 0.5550 0.3775 -0.1560 -0.0647 -0.0411 194 ARG A CG    
1590 C CD    . ARG A 194 ? 0.6059 0.6458 0.4603 -0.1685 -0.0685 -0.0547 194 ARG A CD    
1591 N NE    . ARG A 194 ? 0.6426 0.6801 0.4795 -0.1565 -0.0694 -0.0568 194 ARG A NE    
1592 C CZ    . ARG A 194 ? 0.6936 0.7081 0.5021 -0.1610 -0.0679 -0.0695 194 ARG A CZ    
1593 N NH1   . ARG A 194 ? 0.7321 0.7201 0.5254 -0.1775 -0.0660 -0.0826 194 ARG A NH1   
1594 N NH2   . ARG A 194 ? 0.6967 0.7133 0.4910 -0.1498 -0.0671 -0.0698 194 ARG A NH2   
1595 N N     . TRP A 195 ? 0.3980 0.4150 0.2873 -0.1109 -0.0362 -0.0213 195 TRP A N     
1596 C CA    . TRP A 195 ? 0.3910 0.3853 0.2705 -0.0966 -0.0295 -0.0196 195 TRP A CA    
1597 C C     . TRP A 195 ? 0.4067 0.3787 0.2817 -0.1006 -0.0234 -0.0156 195 TRP A C     
1598 O O     . TRP A 195 ? 0.4131 0.3957 0.2977 -0.1113 -0.0227 -0.0116 195 TRP A O     
1599 C CB    . TRP A 195 ? 0.3562 0.3697 0.2477 -0.0822 -0.0290 -0.0129 195 TRP A CB    
1600 C CG    . TRP A 195 ? 0.3450 0.3739 0.2388 -0.0756 -0.0327 -0.0143 195 TRP A CG    
1601 C CD1   . TRP A 195 ? 0.3612 0.3891 0.2444 -0.0792 -0.0362 -0.0202 195 TRP A CD1   
1602 C CD2   . TRP A 195 ? 0.3141 0.3596 0.2190 -0.0650 -0.0325 -0.0094 195 TRP A CD2   
1603 N NE1   . TRP A 195 ? 0.3382 0.3816 0.2254 -0.0712 -0.0378 -0.0173 195 TRP A NE1   
1604 C CE2   . TRP A 195 ? 0.3104 0.3636 0.2119 -0.0628 -0.0355 -0.0110 195 TRP A CE2   
1605 C CE3   . TRP A 195 ? 0.2864 0.3398 0.2018 -0.0585 -0.0298 -0.0044 195 TRP A CE3   
1606 C CZ2   . TRP A 195 ? 0.2986 0.3649 0.2085 -0.0549 -0.0353 -0.0067 195 TRP A CZ2   
1607 C CZ3   . TRP A 195 ? 0.2884 0.3548 0.2120 -0.0509 -0.0300 -0.0024 195 TRP A CZ3   
1608 C CH2   . TRP A 195 ? 0.2926 0.3644 0.2144 -0.0494 -0.0325 -0.0031 195 TRP A CH2   
1609 N N     . THR A 196 ? 0.4155 0.3576 0.2766 -0.0914 -0.0183 -0.0157 196 THR A N     
1610 C CA    . THR A 196 ? 0.4266 0.3442 0.2807 -0.0922 -0.0126 -0.0089 196 THR A CA    
1611 C C     . THR A 196 ? 0.4222 0.3369 0.2750 -0.0724 -0.0107 -0.0017 196 THR A C     
1612 O O     . THR A 196 ? 0.4047 0.3352 0.2630 -0.0605 -0.0130 -0.0039 196 THR A O     
1613 C CB    . THR A 196 ? 0.4669 0.3434 0.3032 -0.1003 -0.0084 -0.0150 196 THR A CB    
1614 O OG1   . THR A 196 ? 0.4857 0.3414 0.3114 -0.0840 -0.0058 -0.0192 196 THR A OG1   
1615 C CG2   . THR A 196 ? 0.4482 0.3290 0.2837 -0.1207 -0.0123 -0.0257 196 THR A CG2   
1616 N N     . ARG A 197 ? 0.4432 0.3394 0.2887 -0.0698 -0.0068 0.0077  197 ARG A N     
1617 C CA    . ARG A 197 ? 0.4454 0.3395 0.2884 -0.0511 -0.0068 0.0157  197 ARG A CA    
1618 C C     . ARG A 197 ? 0.4726 0.3460 0.3094 -0.0362 -0.0054 0.0116  197 ARG A C     
1619 O O     . ARG A 197 ? 0.4733 0.3527 0.3130 -0.0189 -0.0068 0.0168  197 ARG A O     
1620 C CB    . ARG A 197 ? 0.4661 0.3441 0.2990 -0.0525 -0.0035 0.0286  197 ARG A CB    
1621 C CG    . ARG A 197 ? 0.4980 0.3301 0.3141 -0.0556 0.0019  0.0323  197 ARG A CG    
1622 C CD    . ARG A 197 ? 0.5279 0.3479 0.3335 -0.0626 0.0058  0.0464  197 ARG A CD    
1623 N NE    . ARG A 197 ? 0.5188 0.3646 0.3336 -0.0814 0.0075  0.0449  197 ARG A NE    
1624 C CZ    . ARG A 197 ? 0.5403 0.3861 0.3489 -0.0913 0.0126  0.0552  197 ARG A CZ    
1625 N NH1   . ARG A 197 ? 0.5851 0.4046 0.3752 -0.0851 0.0156  0.0695  197 ARG A NH1   
1626 N NH2   . ARG A 197 ? 0.5313 0.4053 0.3527 -0.1068 0.0152  0.0520  197 ARG A NH2   
1627 N N     . ARG A 198 ? 0.4994 0.3502 0.3281 -0.0431 -0.0024 0.0015  198 ARG A N     
1628 C CA    . ARG A 198 ? 0.5263 0.3548 0.3480 -0.0291 0.0015  -0.0047 198 ARG A CA    
1629 C C     . ARG A 198 ? 0.5062 0.3535 0.3317 -0.0295 0.0006  -0.0176 198 ARG A C     
1630 O O     . ARG A 198 ? 0.5319 0.3603 0.3490 -0.0227 0.0057  -0.0269 198 ARG A O     
1631 C CB    . ARG A 198 ? 0.5807 0.3604 0.3850 -0.0353 0.0079  -0.0076 198 ARG A CB    
1632 C CG    . ARG A 198 ? 0.6396 0.3885 0.4368 -0.0191 0.0117  0.0048  198 ARG A CG    
1633 C CD    . ARG A 198 ? 0.7166 0.4523 0.5071 -0.0299 0.0120  0.0185  198 ARG A CD    
1634 N NE    . ARG A 198 ? 0.7814 0.5124 0.5701 -0.0105 0.0108  0.0353  198 ARG A NE    
1635 C CZ    . ARG A 198 ? 0.8215 0.5279 0.5977 -0.0130 0.0130  0.0506  198 ARG A CZ    
1636 N NH1   . ARG A 198 ? 0.8468 0.5290 0.6125 -0.0354 0.0181  0.0509  198 ARG A NH1   
1637 N NH2   . ARG A 198 ? 0.8359 0.5432 0.6097 0.0064  0.0097  0.0663  198 ARG A NH2   
1638 N N     . THR A 199 ? 0.4651 0.3483 0.3020 -0.0366 -0.0050 -0.0177 199 THR A N     
1639 C CA    . THR A 199 ? 0.4439 0.3445 0.2815 -0.0400 -0.0066 -0.0274 199 THR A CA    
1640 C C     . THR A 199 ? 0.4272 0.3453 0.2727 -0.0235 -0.0048 -0.0274 199 THR A C     
1641 O O     . THR A 199 ? 0.4066 0.3463 0.2656 -0.0160 -0.0073 -0.0195 199 THR A O     
1642 C CB    . THR A 199 ? 0.4142 0.3435 0.2611 -0.0541 -0.0135 -0.0261 199 THR A CB    
1643 O OG1   . THR A 199 ? 0.4227 0.3398 0.2644 -0.0713 -0.0148 -0.0278 199 THR A OG1   
1644 C CG2   . THR A 199 ? 0.3949 0.3414 0.2401 -0.0561 -0.0160 -0.0329 199 THR A CG2   
1645 N N     . VAL A 200 ? 0.4375 0.3472 0.2742 -0.0194 0.0003  -0.0374 200 VAL A N     
1646 C CA    . VAL A 200 ? 0.4161 0.3457 0.2612 -0.0063 0.0038  -0.0385 200 VAL A CA    
1647 C C     . VAL A 200 ? 0.4039 0.3515 0.2443 -0.0156 0.0026  -0.0443 200 VAL A C     
1648 O O     . VAL A 200 ? 0.4226 0.3562 0.2456 -0.0240 0.0044  -0.0541 200 VAL A O     
1649 C CB    . VAL A 200 ? 0.4454 0.3534 0.2852 0.0095  0.0134  -0.0445 200 VAL A CB    
1650 C CG1   . VAL A 200 ? 0.4320 0.3636 0.2798 0.0196  0.0191  -0.0484 200 VAL A CG1   
1651 C CG2   . VAL A 200 ? 0.4541 0.3491 0.3011 0.0230  0.0132  -0.0347 200 VAL A CG2   
1652 N N     . ILE A 201 ? 0.3760 0.3533 0.2303 -0.0148 -0.0007 -0.0379 201 ILE A N     
1653 C CA    . ILE A 201 ? 0.3712 0.3654 0.2214 -0.0204 -0.0008 -0.0403 201 ILE A CA    
1654 C C     . ILE A 201 ? 0.3751 0.3815 0.2309 -0.0091 0.0077  -0.0419 201 ILE A C     
1655 O O     . ILE A 201 ? 0.3560 0.3798 0.2302 -0.0019 0.0077  -0.0357 201 ILE A O     
1656 C CB    . ILE A 201 ? 0.3442 0.3606 0.2062 -0.0275 -0.0087 -0.0314 201 ILE A CB    
1657 C CG1   . ILE A 201 ? 0.3293 0.3400 0.1918 -0.0373 -0.0159 -0.0290 201 ILE A CG1   
1658 C CG2   . ILE A 201 ? 0.3367 0.3669 0.1919 -0.0328 -0.0092 -0.0313 201 ILE A CG2   
1659 C CD1   . ILE A 201 ? 0.2764 0.3074 0.1541 -0.0404 -0.0217 -0.0206 201 ILE A CD1   
1660 N N     . ASP A 202 ? 0.4075 0.4066 0.2475 -0.0087 0.0153  -0.0512 202 ASP A N     
1661 C CA    . ASP A 202 ? 0.4181 0.4320 0.2633 0.0005  0.0255  -0.0536 202 ASP A CA    
1662 C C     . ASP A 202 ? 0.4150 0.4456 0.2511 -0.0092 0.0261  -0.0519 202 ASP A C     
1663 O O     . ASP A 202 ? 0.4355 0.4579 0.2483 -0.0148 0.0302  -0.0596 202 ASP A O     
1664 C CB    . ASP A 202 ? 0.4571 0.4503 0.2905 0.0103  0.0370  -0.0657 202 ASP A CB    
1665 C CG    . ASP A 202 ? 0.4671 0.4790 0.3126 0.0232  0.0493  -0.0678 202 ASP A CG    
1666 O OD1   . ASP A 202 ? 0.4515 0.4925 0.3130 0.0216  0.0487  -0.0602 202 ASP A OD1   
1667 O OD2   . ASP A 202 ? 0.5164 0.5135 0.3564 0.0347  0.0604  -0.0778 202 ASP A OD2   
1668 N N     . VAL A 203 ? 0.3871 0.4391 0.2397 -0.0115 0.0222  -0.0416 203 VAL A N     
1669 C CA    . VAL A 203 ? 0.3833 0.4477 0.2285 -0.0209 0.0211  -0.0359 203 VAL A CA    
1670 C C     . VAL A 203 ? 0.4035 0.4724 0.2339 -0.0203 0.0335  -0.0414 203 VAL A C     
1671 O O     . VAL A 203 ? 0.4274 0.4936 0.2346 -0.0288 0.0328  -0.0418 203 VAL A O     
1672 C CB    . VAL A 203 ? 0.3592 0.4418 0.2265 -0.0218 0.0183  -0.0253 203 VAL A CB    
1673 C CG1   . VAL A 203 ? 0.3563 0.4437 0.2144 -0.0313 0.0147  -0.0169 203 VAL A CG1   
1674 C CG2   . VAL A 203 ? 0.3534 0.4337 0.2369 -0.0198 0.0094  -0.0218 203 VAL A CG2   
1675 N N     . ALA A 204 ? 0.3998 0.4779 0.2436 -0.0101 0.0448  -0.0455 204 ALA A N     
1676 C CA    . ALA A 204 ? 0.4118 0.4990 0.2456 -0.0089 0.0594  -0.0505 204 ALA A CA    
1677 C C     . ALA A 204 ? 0.4433 0.5099 0.2454 -0.0103 0.0644  -0.0631 204 ALA A C     
1678 O O     . ALA A 204 ? 0.4656 0.5358 0.2459 -0.0160 0.0725  -0.0659 204 ALA A O     
1679 C CB    . ALA A 204 ? 0.4080 0.5128 0.2676 0.0038  0.0704  -0.0531 204 ALA A CB    
1680 N N     . LYS A 205 ? 0.4500 0.4935 0.2472 -0.0064 0.0600  -0.0709 205 LYS A N     
1681 C CA    . LYS A 205 ? 0.4879 0.5076 0.2540 -0.0092 0.0649  -0.0855 205 LYS A CA    
1682 C C     . LYS A 205 ? 0.4898 0.4985 0.2327 -0.0254 0.0510  -0.0851 205 LYS A C     
1683 O O     . LYS A 205 ? 0.5250 0.5163 0.2385 -0.0319 0.0531  -0.0978 205 LYS A O     
1684 C CB    . LYS A 205 ? 0.5071 0.5033 0.2781 0.0039  0.0710  -0.0961 205 LYS A CB    
1685 C CG    . LYS A 205 ? 0.5380 0.5436 0.3226 0.0210  0.0883  -0.1018 205 LYS A CG    
1686 C CD    . LYS A 205 ? 0.6123 0.5890 0.3989 0.0356  0.0939  -0.1115 205 LYS A CD    
1687 C CE    . LYS A 205 ? 0.6524 0.6454 0.4649 0.0573  0.1081  -0.1128 205 LYS A CE    
1688 N NZ    . LYS A 205 ? 0.6870 0.6599 0.5161 0.0737  0.1052  -0.1108 205 LYS A NZ    
1689 N N     . GLY A 206 ? 0.4566 0.4769 0.2130 -0.0320 0.0370  -0.0714 206 GLY A N     
1690 C CA    . GLY A 206 ? 0.4658 0.4831 0.2064 -0.0461 0.0226  -0.0690 206 GLY A CA    
1691 C C     . GLY A 206 ? 0.4849 0.4784 0.2183 -0.0507 0.0172  -0.0792 206 GLY A C     
1692 O O     . GLY A 206 ? 0.5108 0.4963 0.2205 -0.0634 0.0105  -0.0864 206 GLY A O     
1693 N N     . GLU A 207 ? 0.4794 0.4619 0.2328 -0.0414 0.0194  -0.0791 207 GLU A N     
1694 C CA    . GLU A 207 ? 0.5087 0.4616 0.2545 -0.0430 0.0198  -0.0896 207 GLU A CA    
1695 C C     . GLU A 207 ? 0.4843 0.4345 0.2525 -0.0421 0.0119  -0.0802 207 GLU A C     
1696 O O     . GLU A 207 ? 0.4546 0.4203 0.2461 -0.0328 0.0114  -0.0692 207 GLU A O     
1697 C CB    . GLU A 207 ? 0.5346 0.4689 0.2767 -0.0283 0.0358  -0.1005 207 GLU A CB    
1698 C CG    . GLU A 207 ? 0.6020 0.4977 0.3286 -0.0301 0.0393  -0.1139 207 GLU A CG    
1699 C CD    . GLU A 207 ? 0.6707 0.5478 0.3990 -0.0110 0.0556  -0.1226 207 GLU A CD    
1700 O OE1   . GLU A 207 ? 0.6704 0.5464 0.4226 0.0040  0.0571  -0.1140 207 GLU A OE1   
1701 O OE2   . GLU A 207 ? 0.7406 0.6049 0.4459 -0.0103 0.0671  -0.1381 207 GLU A OE2   
1702 N N     . VAL A 208 ? 0.5023 0.4328 0.2617 -0.0534 0.0061  -0.0853 208 VAL A N     
1703 C CA    . VAL A 208 ? 0.4920 0.4158 0.2682 -0.0542 0.0010  -0.0775 208 VAL A CA    
1704 C C     . VAL A 208 ? 0.5317 0.4159 0.2967 -0.0527 0.0080  -0.0871 208 VAL A C     
1705 O O     . VAL A 208 ? 0.5646 0.4271 0.3068 -0.0631 0.0100  -0.1010 208 VAL A O     
1706 C CB    . VAL A 208 ? 0.4784 0.4179 0.2590 -0.0710 -0.0122 -0.0721 208 VAL A CB    
1707 C CG1   . VAL A 208 ? 0.4630 0.3981 0.2609 -0.0720 -0.0151 -0.0637 208 VAL A CG1   
1708 C CG2   . VAL A 208 ? 0.4519 0.4254 0.2420 -0.0703 -0.0183 -0.0623 208 VAL A CG2   
1709 N N     . ARG A 209 ? 0.5343 0.4072 0.3134 -0.0399 0.0118  -0.0798 209 ARG A N     
1710 C CA    . ARG A 209 ? 0.5825 0.4130 0.3511 -0.0358 0.0193  -0.0863 209 ARG A CA    
1711 C C     . ARG A 209 ? 0.5822 0.4023 0.3643 -0.0309 0.0171  -0.0731 209 ARG A C     
1712 O O     . ARG A 209 ? 0.5507 0.3985 0.3506 -0.0292 0.0106  -0.0602 209 ARG A O     
1713 C CB    . ARG A 209 ? 0.6063 0.4215 0.3681 -0.0176 0.0326  -0.0957 209 ARG A CB    
1714 C CG    . ARG A 209 ? 0.5775 0.4192 0.3617 0.0035  0.0360  -0.0860 209 ARG A CG    
1715 C CD    . ARG A 209 ? 0.6072 0.4399 0.3869 0.0206  0.0504  -0.0969 209 ARG A CD    
1716 N NE    . ARG A 209 ? 0.6076 0.4661 0.4133 0.0410  0.0532  -0.0868 209 ARG A NE    
1717 C CZ    . ARG A 209 ? 0.5933 0.4909 0.4125 0.0442  0.0545  -0.0840 209 ARG A CZ    
1718 N NH1   . ARG A 209 ? 0.5856 0.4988 0.3925 0.0301  0.0539  -0.0891 209 ARG A NH1   
1719 N NH2   . ARG A 209 ? 0.5739 0.4954 0.4187 0.0611  0.0560  -0.0753 209 ARG A NH2   
1720 N N     . LYS A 210 ? 0.6295 0.4071 0.4005 -0.0294 0.0232  -0.0767 210 LYS A N     
1721 C CA    . LYS A 210 ? 0.6394 0.4003 0.4174 -0.0251 0.0224  -0.0633 210 LYS A CA    
1722 C C     . LYS A 210 ? 0.6432 0.4018 0.4320 0.0019  0.0274  -0.0547 210 LYS A C     
1723 O O     . LYS A 210 ? 0.6747 0.4136 0.4581 0.0166  0.0366  -0.0629 210 LYS A O     
1724 C CB    . LYS A 210 ? 0.6876 0.4002 0.4471 -0.0385 0.0265  -0.0697 210 LYS A CB    
1725 C CG    . LYS A 210 ? 0.6933 0.4123 0.4538 -0.0635 0.0190  -0.0656 210 LYS A CG    
1726 C CD    . LYS A 210 ? 0.7256 0.4232 0.4889 -0.0623 0.0206  -0.0501 210 LYS A CD    
1727 C CE    . LYS A 210 ? 0.7872 0.4266 0.5308 -0.0719 0.0285  -0.0564 210 LYS A CE    
1728 N NZ    . LYS A 210 ? 0.8094 0.4304 0.5534 -0.0780 0.0294  -0.0401 210 LYS A NZ    
1729 N N     . GLY A 211 ? 0.6191 0.4001 0.4237 0.0087  0.0213  -0.0387 211 GLY A N     
1730 C CA    . GLY A 211 ? 0.6270 0.4124 0.4438 0.0335  0.0230  -0.0289 211 GLY A CA    
1731 C C     . GLY A 211 ? 0.6448 0.4150 0.4608 0.0364  0.0193  -0.0124 211 GLY A C     
1732 O O     . GLY A 211 ? 0.6648 0.4078 0.4678 0.0208  0.0197  -0.0106 211 GLY A O     
1733 N N     . GLU A 212 ? 0.6401 0.4292 0.4695 0.0554  0.0157  -0.0001 212 GLU A N     
1734 C CA    . GLU A 212 ? 0.6609 0.4386 0.4869 0.0601  0.0113  0.0176  212 GLU A CA    
1735 C C     . GLU A 212 ? 0.6211 0.4323 0.4519 0.0459  0.0028  0.0248  212 GLU A C     
1736 O O     . GLU A 212 ? 0.6337 0.4338 0.4556 0.0403  0.0005  0.0369  212 GLU A O     
1737 C CB    . GLU A 212 ? 0.6752 0.4600 0.5125 0.0882  0.0098  0.0280  212 GLU A CB    
1738 C CG    . GLU A 212 ? 0.7568 0.4964 0.5868 0.1063  0.0187  0.0277  212 GLU A CG    
1739 C CD    . GLU A 212 ? 0.8252 0.5682 0.6644 0.1333  0.0141  0.0455  212 GLU A CD    
1740 O OE1   . GLU A 212 ? 0.8460 0.5796 0.6756 0.1319  0.0077  0.0629  212 GLU A OE1   
1741 O OE2   . GLU A 212 ? 0.8510 0.6086 0.7073 0.1561  0.0168  0.0427  212 GLU A OE2   
1742 N N     . GLU A 213 ? 0.5772 0.4275