data_3OYA
# 
_entry.id   3OYA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OYA         
NDB   NA0781       
RCSB  RCSB061723   
WWPDB D_1000061723 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2010-10-20 
_pdbx_database_PDB_obs_spr.pdb_id           3OYA 
_pdbx_database_PDB_obs_spr.replace_pdb_id   3L2T 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3DLR 'Catalytic core domain of PFV integrase'                  unspecified 
PDB 3L2Q 'PFV intasome in apo form'                                unspecified 
PDB 3L2R 'PFV intasome in complex with magnesium'                  unspecified 
PDB 3L2U 'PFV intasome in complex with magnesium and elvitegravir' unspecified 
PDB 3L2V 'PFV intasome in complex with manganese and raltegravir'  unspecified 
PDB 3L2W 'PFV intasome in complex with manganese and elvitegravir' unspecified 
PDB 3OY9 'PFV intasome in complex with manganese'                  unspecified 
PDB 3OYB 'PFV intasome in complex with magnesium and MK2048'       unspecified 
PDB 3OYC 'PFV intasome in complex with magnesium and PICA'         unspecified 
PDB 3OYD 'PFV intasome in complex with magnesium and GS9160'       unspecified 
PDB 3OYE 'PFV intasome in complex with magnesium and COMPOUND2'    unspecified 
PDB 3OYF 'PFV intasome in complex with magnesium and L870810'      unspecified 
PDB 3OYG 'PFV intasome in complex with magnesium and COMPOUND G'   unspecified 
PDB 3OYH 'PFV intasome in complex with magnesium and MK0536'       unspecified 
PDB 3OYI 'S217Q PFV intasome in complex with manganese'            unspecified 
PDB 3OYJ 'S217Q PFV intasome in complex with magnesium and MK2048' unspecified 
PDB 3OYK 'S217H PFV intasome in complex with manganese'            unspecified 
PDB 3OYL 'S217H PFV intasome in complex with magnesium and MK2048' unspecified 
PDB 3OYM 'N224H PFV intasome in complex with manganese'            unspecified 
PDB 3OYN 'N224H PFV intasome in complex with magnesium and MK2048' unspecified 
# 
_pdbx_database_status.entry_id                        3OYA 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-23 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hare, S.'       1 
'Cherepanov, P.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.' Proc.Natl.Acad.Sci.USA 
107 20057 20062 2010 PNASA6 US 0027-8424 0040 ? 21030679 10.1073/pnas.1010246107 
1       'Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.' Proc.Natl.Acad.Sci.USA ? 
?     ?     2010 PNASA6 US 1091-6490 0040 ? 21030679 10.1073/pnas.1010246107 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hare, S.'       1  
primary 'Vos, A.M.'      2  
primary 'Clayton, R.F.'  3  
primary 'Thuring, J.W.'  4  
primary 'Cummings, M.D.' 5  
primary 'Cherepanov, P.' 6  
1       'Hare, S.'       7  
1       'Vos, A.M.'      8  
1       'Clayton, R.F.'  9  
1       'Thuring, J.W.'  10 
1       'Cummings, M.D.' 11 
1       'Cherepanov, P.' 12 
# 
_cell.length_a           159.755 
_cell.length_b           159.755 
_cell.length_c           124.139 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3OYA 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.entry_id                         3OYA 
_symmetry.Int_Tables_number                92 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'PFV integrase' 44456.695 2   ? ? ? ?                                                                   
2  polymer     syn 
;DNA (5'-D(*AP*TP*TP*GP*TP*CP*AP*TP*GP*GP*AP*AP*TP*TP*TP*CP*GP*CP*A)-3')
;
5834.794  1   ? ? ? '19 nucleotide preprocessed PFV donor DNA (non-transferred strand)' 
3  polymer     syn 
;DNA (5'-D(*TP*GP*CP*GP*AP*AP*AP*TP*TP*CP*CP*AP*TP*GP*AP*CP*A)-3')
;
5195.399  1   ? ? ? '17 nucleotide preprocessed PFV donor DNA (transferred strand)'     
4  non-polymer syn 'ZINC ION' 65.409    1   ? ? ? ?                                                                   
5  non-polymer syn 'SULFATE ION' 96.063    2   ? ? ? ?                                                                   
6  non-polymer syn GLYCEROL 92.094    4   ? ? ? ?                                                                   
7  non-polymer syn 'AMMONIUM ION' 18.038    1   ? ? ? ?                                                                   
8  non-polymer syn 'MAGNESIUM ION' 24.305    3   ? ? ? ?                                                                   
9  non-polymer syn 
;N-(4-fluorobenzyl)-5-hydroxy-1-methyl-2-(1-methyl-1-{[(5-methyl-1,3,4-oxadiazol-2-yl)carbonyl]amino}ethyl)-6-oxo-1,6-dihydropyrimidine-4-carboxamide
;
444.416   1   ? ? ? ?                                                                   
10 water       nat water 18.015    234 ? ? ? ?                                                                   
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        p42In 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
A,B ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DT)(DG)(DT)(DC)(DA)(DT)(DG)(DG)(DA)(DA)(DT)(DT)(DT)(DC)(DG)(DC)(DA)' ATTGTCATGGAATTTCGCA 
C   ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DG)(DA)(DA)(DA)(DT)(DT)(DC)(DC)(DA)(DT)(DG)(DA)(DC)(DA)' TGCGAAATTCCATGACA D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   CYS n 
1 5   ASN n 
1 6   THR n 
1 7   LYS n 
1 8   LYS n 
1 9   PRO n 
1 10  ASN n 
1 11  LEU n 
1 12  ASP n 
1 13  ALA n 
1 14  GLU n 
1 15  LEU n 
1 16  ASP n 
1 17  GLN n 
1 18  LEU n 
1 19  LEU n 
1 20  GLN n 
1 21  GLY n 
1 22  HIS n 
1 23  TYR n 
1 24  ILE n 
1 25  LYS n 
1 26  GLY n 
1 27  TYR n 
1 28  PRO n 
1 29  LYS n 
1 30  GLN n 
1 31  TYR n 
1 32  THR n 
1 33  TYR n 
1 34  PHE n 
1 35  LEU n 
1 36  GLU n 
1 37  ASP n 
1 38  GLY n 
1 39  LYS n 
1 40  VAL n 
1 41  LYS n 
1 42  VAL n 
1 43  SER n 
1 44  ARG n 
1 45  PRO n 
1 46  GLU n 
1 47  GLY n 
1 48  VAL n 
1 49  LYS n 
1 50  ILE n 
1 51  ILE n 
1 52  PRO n 
1 53  PRO n 
1 54  GLN n 
1 55  SER n 
1 56  ASP n 
1 57  ARG n 
1 58  GLN n 
1 59  LYS n 
1 60  ILE n 
1 61  VAL n 
1 62  LEU n 
1 63  GLN n 
1 64  ALA n 
1 65  HIS n 
1 66  ASN n 
1 67  LEU n 
1 68  ALA n 
1 69  HIS n 
1 70  THR n 
1 71  GLY n 
1 72  ARG n 
1 73  GLU n 
1 74  ALA n 
1 75  THR n 
1 76  LEU n 
1 77  LEU n 
1 78  LYS n 
1 79  ILE n 
1 80  ALA n 
1 81  ASN n 
1 82  LEU n 
1 83  TYR n 
1 84  TRP n 
1 85  TRP n 
1 86  PRO n 
1 87  ASN n 
1 88  MET n 
1 89  ARG n 
1 90  LYS n 
1 91  ASP n 
1 92  VAL n 
1 93  VAL n 
1 94  LYS n 
1 95  GLN n 
1 96  LEU n 
1 97  GLY n 
1 98  ARG n 
1 99  CYS n 
1 100 GLN n 
1 101 GLN n 
1 102 CYS n 
1 103 LEU n 
1 104 ILE n 
1 105 THR n 
1 106 ASN n 
1 107 ALA n 
1 108 SER n 
1 109 ASN n 
1 110 LYS n 
1 111 ALA n 
1 112 SER n 
1 113 GLY n 
1 114 PRO n 
1 115 ILE n 
1 116 LEU n 
1 117 ARG n 
1 118 PRO n 
1 119 ASP n 
1 120 ARG n 
1 121 PRO n 
1 122 GLN n 
1 123 LYS n 
1 124 PRO n 
1 125 PHE n 
1 126 ASP n 
1 127 LYS n 
1 128 PHE n 
1 129 PHE n 
1 130 ILE n 
1 131 ASP n 
1 132 TYR n 
1 133 ILE n 
1 134 GLY n 
1 135 PRO n 
1 136 LEU n 
1 137 PRO n 
1 138 PRO n 
1 139 SER n 
1 140 GLN n 
1 141 GLY n 
1 142 TYR n 
1 143 LEU n 
1 144 TYR n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 VAL n 
1 149 VAL n 
1 150 ASP n 
1 151 GLY n 
1 152 MET n 
1 153 THR n 
1 154 GLY n 
1 155 PHE n 
1 156 THR n 
1 157 TRP n 
1 158 LEU n 
1 159 TYR n 
1 160 PRO n 
1 161 THR n 
1 162 LYS n 
1 163 ALA n 
1 164 PRO n 
1 165 SER n 
1 166 THR n 
1 167 SER n 
1 168 ALA n 
1 169 THR n 
1 170 VAL n 
1 171 LYS n 
1 172 SER n 
1 173 LEU n 
1 174 ASN n 
1 175 VAL n 
1 176 LEU n 
1 177 THR n 
1 178 SER n 
1 179 ILE n 
1 180 ALA n 
1 181 ILE n 
1 182 PRO n 
1 183 LYS n 
1 184 VAL n 
1 185 ILE n 
1 186 HIS n 
1 187 SER n 
1 188 ASP n 
1 189 GLN n 
1 190 GLY n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 THR n 
1 195 SER n 
1 196 SER n 
1 197 THR n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 TRP n 
1 202 ALA n 
1 203 LYS n 
1 204 GLU n 
1 205 ARG n 
1 206 GLY n 
1 207 ILE n 
1 208 HIS n 
1 209 LEU n 
1 210 GLU n 
1 211 PHE n 
1 212 SER n 
1 213 THR n 
1 214 PRO n 
1 215 TYR n 
1 216 HIS n 
1 217 PRO n 
1 218 GLN n 
1 219 SER n 
1 220 SER n 
1 221 GLY n 
1 222 LYS n 
1 223 VAL n 
1 224 GLU n 
1 225 ARG n 
1 226 LYS n 
1 227 ASN n 
1 228 SER n 
1 229 ASP n 
1 230 ILE n 
1 231 LYS n 
1 232 ARG n 
1 233 LEU n 
1 234 LEU n 
1 235 THR n 
1 236 LYS n 
1 237 LEU n 
1 238 LEU n 
1 239 VAL n 
1 240 GLY n 
1 241 ARG n 
1 242 PRO n 
1 243 THR n 
1 244 LYS n 
1 245 TRP n 
1 246 TYR n 
1 247 ASP n 
1 248 LEU n 
1 249 LEU n 
1 250 PRO n 
1 251 VAL n 
1 252 VAL n 
1 253 GLN n 
1 254 LEU n 
1 255 ALA n 
1 256 LEU n 
1 257 ASN n 
1 258 ASN n 
1 259 THR n 
1 260 TYR n 
1 261 SER n 
1 262 PRO n 
1 263 VAL n 
1 264 LEU n 
1 265 LYS n 
1 266 TYR n 
1 267 THR n 
1 268 PRO n 
1 269 HIS n 
1 270 GLN n 
1 271 LEU n 
1 272 LEU n 
1 273 PHE n 
1 274 GLY n 
1 275 ILE n 
1 276 ASP n 
1 277 SER n 
1 278 ASN n 
1 279 THR n 
1 280 PRO n 
1 281 PHE n 
1 282 ALA n 
1 283 ASN n 
1 284 GLN n 
1 285 ASP n 
1 286 THR n 
1 287 LEU n 
1 288 ASP n 
1 289 LEU n 
1 290 THR n 
1 291 ARG n 
1 292 GLU n 
1 293 GLU n 
1 294 GLU n 
1 295 LEU n 
1 296 SER n 
1 297 LEU n 
1 298 LEU n 
1 299 GLN n 
1 300 GLU n 
1 301 ILE n 
1 302 ARG n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 TYR n 
1 307 HIS n 
1 308 PRO n 
1 309 SER n 
1 310 THR n 
1 311 PRO n 
1 312 PRO n 
1 313 ALA n 
1 314 SER n 
1 315 SER n 
1 316 ARG n 
1 317 SER n 
1 318 TRP n 
1 319 SER n 
1 320 PRO n 
1 321 VAL n 
1 322 VAL n 
1 323 GLY n 
1 324 GLN n 
1 325 LEU n 
1 326 VAL n 
1 327 GLN n 
1 328 GLU n 
1 329 ARG n 
1 330 VAL n 
1 331 ALA n 
1 332 ARG n 
1 333 PRO n 
1 334 ALA n 
1 335 SER n 
1 336 LEU n 
1 337 ARG n 
1 338 PRO n 
1 339 ARG n 
1 340 TRP n 
1 341 HIS n 
1 342 LYS n 
1 343 PRO n 
1 344 SER n 
1 345 THR n 
1 346 VAL n 
1 347 LEU n 
1 348 LYS n 
1 349 VAL n 
1 350 LEU n 
1 351 ASN n 
1 352 PRO n 
1 353 ARG n 
1 354 THR n 
1 355 VAL n 
1 356 VAL n 
1 357 ILE n 
1 358 LEU n 
1 359 ASP n 
1 360 HIS n 
1 361 LEU n 
1 362 GLY n 
1 363 ASN n 
1 364 ASN n 
1 365 ARG n 
1 366 THR n 
1 367 VAL n 
1 368 SER n 
1 369 ILE n 
1 370 ASP n 
1 371 ASN n 
1 372 LEU n 
1 373 LYS n 
1 374 PRO n 
1 375 THR n 
1 376 SER n 
1 377 HIS n 
1 378 GLN n 
1 379 ASN n 
1 380 GLY n 
1 381 THR n 
1 382 THR n 
1 383 ASN n 
1 384 ASP n 
1 385 THR n 
1 386 ALA n 
1 387 THR n 
1 388 MET n 
1 389 ASP n 
1 390 HIS n 
1 391 LEU n 
1 392 GLU n 
1 393 LYS n 
1 394 ASN n 
1 395 GLU n 
2 1   DA  n 
2 2   DT  n 
2 3   DT  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
2 9   DG  n 
2 10  DG  n 
2 11  DA  n 
2 12  DA  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DC  n 
2 17  DG  n 
2 18  DC  n 
2 19  DA  n 
3 1   DT  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DA  n 
3 6   DA  n 
3 7   DA  n 
3 8   DT  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DA  n 
3 13  DT  n 
3 14  DG  n 
3 15  DA  n 
3 16  DC  n 
3 17  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'SFVcpz(hu)' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 POL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    HSRV2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human spumaretrovirus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11963 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               PC2 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pSSH6P-PFV-INFL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'Donor DNA non-transferred strand' 
3 1 sample ? ? ? ? ? 'Donor DNA transferred strand'     
# 
loop_
_struct_ref.id 
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 POL_FOAMV UNP 1 P14350 752 
;CNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLY
WWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKA
PSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPT
KWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVG
QLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
? 
2 3OYA      PDB 2 3OYA   1   ATTGTCATGGAATTTCGCA ? 
3 3OYA      PDB 3 3OYA   1   TGCGAAATTCCATGACA ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3OYA A 4 ? 395 ? P14350 752 ? 1143 ? 1 392 
2 1 3OYA B 4 ? 395 ? P14350 752 ? 1143 ? 1 392 
3 2 3OYA C 1 ? 19  ? 3OYA   1   ? 19   ? 1 19  
4 3 3OYA D 1 ? 17  ? 3OYA   1   ? 17   ? 1 17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3OYA GLY A 1   ? UNP P14350 ?   ?   'EXPRESSION TAG' -2  1  
1 3OYA PRO A 2   ? UNP P14350 ?   ?   'EXPRESSION TAG' -1  2  
1 3OYA GLY A 3   ? UNP P14350 ?   ?   'EXPRESSION TAG' 0   3  
1 3OYA SER A 220 ? UNP P14350 GLY 968 VARIANT          217 4  
1 3OYA GLY A 221 ? UNP P14350 SER 969 VARIANT          218 5  
2 3OYA GLY B 1   ? UNP P14350 ?   ?   'EXPRESSION TAG' -2  6  
2 3OYA PRO B 2   ? UNP P14350 ?   ?   'EXPRESSION TAG' -1  7  
2 3OYA GLY B 3   ? UNP P14350 ?   ?   'EXPRESSION TAG' 0   8  
2 3OYA SER B 220 ? UNP P14350 GLY 968 VARIANT          217 9  
2 3OYA GLY B 221 ? UNP P14350 SER 969 VARIANT          218 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                               'Mg 2'            24.305  
NH4 non-polymer         . 'AMMONIUM ION' ?                               'H4 N 1'          18.038  
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'      115.130 
RLT non-polymer         . 
;N-(4-fluorobenzyl)-5-hydroxy-1-methyl-2-(1-methyl-1-{[(5-methyl-1,3,4-oxadiazol-2-yl)carbonyl]amino}ethyl)-6-oxo-1,6-dihydropyrimidine-4-carboxamide
;
'RALTEGRAVIR, MK0518'           'C20 H21 F N6 O5' 444.416 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION' ?                               'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION' ?                               'Zn 2'            65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3OYA 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.96 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   68.96 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
;1.35 M ammonium sulfate, 25% (v/v) glycerol, 4.8% (v/v) 1,6-hexanediol, 50 mM Mes-NaOH, 1mM EDTA, pH 6.5, vapor diffusion, hanging drop, temperature 291K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   2010-06-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98011 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 1' 
_diffrn_source.pdbx_wavelength_list        0.98011 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 1' 
# 
_reflns.entry_id                     3OYA 
_reflns.d_resolution_high            2.646 
_reflns.d_resolution_low             38.019 
_reflns.number_all                   ? 
_reflns.number_obs                   46986 
_reflns.pdbx_netI_over_sigmaI        8.100 
_reflns.pdbx_Rsym_value              0.097 
_reflns.pdbx_redundancy              3.700 
_reflns.percent_possible_obs         99.300 
_reflns.observed_criterion_sigma_F   -3 
_reflns.observed_criterion_sigma_I   -3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.650 2.790  ? 24377 ? 0.856 1.6  0.856 ? 3.600 ? 6741 99.200 ? 1  
2.790 2.960  ? 23393 ? 0.505 2.5  0.505 ? 3.600 ? 6412 99.300 ? 2  
2.960 3.170  ? 22133 ? 0.301 3.9  0.301 ? 3.700 ? 6000 99.300 ? 3  
3.170 3.420  ? 20873 ? 0.164 6.3  0.164 ? 3.700 ? 5636 99.500 ? 4  
3.420 3.750  ? 19417 ? 0.110 9.2  0.110 ? 3.700 ? 5214 99.300 ? 5  
3.750 4.190  ? 17728 ? 0.069 11.9 0.069 ? 3.700 ? 4735 99.600 ? 6  
4.190 4.840  ? 15701 ? 0.061 14.4 0.061 ? 3.700 ? 4220 99.700 ? 7  
4.840 5.930  ? 13073 ? 0.099 14.5 0.099 ? 3.600 ? 3610 99.700 ? 8  
5.930 8.380  ? 9832  ? 0.047 16.8 0.047 ? 3.500 ? 2810 98.800 ? 9  
8.380 38.746 ? 5627  ? 0.028 19.8 0.028 ? 3.500 ? 1608 97.200 ? 10 
# 
_refine.entry_id                                 3OYA 
_refine.ls_d_res_high                            2.6500 
_refine.ls_d_res_low                             38.0200 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.8800 
_refine.ls_number_reflns_obs                     46802 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.21 
_refine.ls_R_factor_obs                          0.2064 
_refine.ls_R_factor_R_work                       0.2052 
_refine.ls_wR_factor_R_work                      0.2045 
_refine.ls_R_factor_R_free                       0.2282 
_refine.ls_wR_factor_R_free                      0.2284 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  2359 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               55.6999 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            1.2200 
_refine.aniso_B[2][2]                            1.2200 
_refine.aniso_B[3][3]                            -2.4400 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9440 
_refine.correlation_coeff_Fo_to_Fc_free          0.9300 
_refine.overall_SU_R_Cruickshank_DPI             0.2696 
_refine.overall_SU_R_free                        0.2149 
_refine.pdbx_overall_ESU_R_Free                  0.2150 
_refine.overall_SU_ML                            0.1640 
_refine.overall_SU_B                             8.0240 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8519 
_refine.B_iso_max                                134.300 
_refine.B_iso_min                                26.150 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_starting_model                      'PDB entry 3OYB' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4362 
_refine_hist.pdbx_number_atoms_nucleic_acid   732 
_refine_hist.pdbx_number_atoms_ligand         71 
_refine_hist.number_atoms_solvent             234 
_refine_hist.number_atoms_total               5399 
_refine_hist.d_res_high                       2.6500 
_refine_hist.d_res_low                        38.0200 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       5364 0.012  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    7467 1.556  2.155  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 550  5.982  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 186  33.509 23.763 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 733  15.971 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 25   17.239 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         840  0.088  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   3802 0.007  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            2777 0.709  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           4536 1.361  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            2587 1.744  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           2931 2.988  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.6460 
_refine_ls_shell.d_res_low                        2.7150 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.7800 
_refine_ls_shell.number_reflns_R_work             3203 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3640 
_refine_ls_shell.R_factor_R_free                  0.4260 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             188 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                3391 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3OYA 
_struct.title                     
'Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium and raltegravir at 2.65 resolution' 
_struct.pdbx_descriptor           'PFV integrase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OYA 
_struct_keywords.text            
;PROTEIN-DNA COMPLEX, TETRAMER, DNA INTEGRATION, ENDONUCLEASE, METAL-BINDING, MULTIFUNCTIONAL ENZYME, NUCLEASE, NUCLEOTIDYLTRANSFERASE, NUCLEUS, TRANSFERASE, VIRAL NUCLEOPROTEIN, VIRION, DNA-BINDING, ZINC BINDING, HHCC MOTIF, VIRAL PROTEIN, RECOMBINATION, INHIBITOR, DNA-BINDING PROTEIN-DNA complex, VIRAL PROTEIN-DNA complex
;
_struct_keywords.pdbx_keywords   'RECOMBINATION,VIRAL PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 6  ? 
I N N 6  ? 
J N N 7  ? 
K N N 8  ? 
L N N 8  ? 
M N N 9  ? 
N N N 5  ? 
O N N 6  ? 
P N N 8  ? 
Q N N 10 ? 
R N N 10 ? 
S N N 10 ? 
T N N 10 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 11  ? GLN A 20  ? LEU A 8   GLN A 17  1 ? 10 
HELX_P HELX_P2  2  PRO A 53  ? LEU A 67  ? PRO A 50  LEU A 64  1 ? 15 
HELX_P HELX_P3  3  GLY A 71  ? ASN A 81  ? GLY A 68  ASN A 78  1 ? 11 
HELX_P HELX_P4  4  ASN A 87  ? GLY A 97  ? ASN A 84  GLY A 94  1 ? 11 
HELX_P HELX_P5  5  CYS A 99  ? ASN A 106 ? CYS A 96  ASN A 103 1 ? 8  
HELX_P HELX_P6  6  SER A 165 ? THR A 177 ? SER A 162 THR A 174 1 ? 13 
HELX_P HELX_P7  7  GLY A 190 ? SER A 195 ? GLY A 187 SER A 192 1 ? 6  
HELX_P HELX_P8  8  SER A 195 ? GLU A 204 ? SER A 192 GLU A 201 1 ? 10 
HELX_P HELX_P9  9  HIS A 216 ? SER A 219 ? HIS A 213 SER A 216 5 ? 4  
HELX_P HELX_P10 10 SER A 220 ? VAL A 239 ? SER A 217 VAL A 236 1 ? 20 
HELX_P HELX_P11 11 LEU A 248 ? ASN A 258 ? LEU A 245 ASN A 255 1 ? 11 
HELX_P HELX_P12 12 THR A 267 ? GLY A 274 ? THR A 264 GLY A 271 1 ? 8  
HELX_P HELX_P13 13 THR A 290 ? SER A 304 ? THR A 287 SER A 301 1 ? 15 
HELX_P HELX_P14 14 SER B 165 ? THR B 177 ? SER B 162 THR B 174 1 ? 13 
HELX_P HELX_P15 15 GLY B 190 ? SER B 195 ? GLY B 187 SER B 192 1 ? 6  
HELX_P HELX_P16 16 SER B 195 ? ARG B 205 ? SER B 192 ARG B 202 1 ? 11 
HELX_P HELX_P17 17 SER B 220 ? VAL B 239 ? SER B 217 VAL B 236 1 ? 20 
HELX_P HELX_P18 18 TRP B 245 ? ASP B 247 ? TRP B 242 ASP B 244 5 ? 3  
HELX_P HELX_P19 19 LEU B 248 ? ASN B 258 ? LEU B 245 ASN B 255 1 ? 11 
HELX_P HELX_P20 20 THR B 267 ? GLY B 274 ? THR B 264 GLY B 271 1 ? 8  
HELX_P HELX_P21 21 THR B 290 ? ILE B 301 ? THR B 287 ILE B 298 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? K MG  .   MG  ? ? ? 1_555 M RLT .  OAG ? ? A MG  396 A RLT 398 1_555 ? ? ? ? ? ? ?            1.837 ? 
metalc2  metalc ? ? A ASP 188 OD1 ? ? ? 1_555 K MG  .  MG  ? ? A ASP 185 A MG  396 1_555 ? ? ? ? ? ? ?            1.924 ? 
metalc3  metalc ? ? A HIS 65  NE2 ? ? ? 1_555 E ZN  .  ZN  ? ? A HIS 62  A ZN  393 1_555 ? ? ? ? ? ? ?            1.939 ? 
metalc4  metalc ? ? L MG  .   MG  ? ? ? 1_555 M RLT .  OAH ? ? A MG  397 A RLT 398 1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc5  metalc ? ? A HIS 69  ND1 ? ? ? 1_555 E ZN  .  ZN  ? ? A HIS 66  A ZN  393 1_555 ? ? ? ? ? ? ?            2.032 ? 
metalc6  metalc ? ? L MG  .   MG  ? ? ? 1_555 M RLT .  OAE ? ? A MG  397 A RLT 398 1_555 ? ? ? ? ? ? ?            2.032 ? 
metalc7  metalc ? ? K MG  .   MG  ? ? ? 1_555 Q HOH .  O   ? ? A MG  396 A HOH 534 1_555 ? ? ? ? ? ? ?            2.048 ? 
metalc8  metalc ? ? A GLU 224 OE2 ? ? ? 1_555 L MG  .  MG  ? ? A GLU 221 A MG  397 1_555 ? ? ? ? ? ? ?            2.052 ? 
metalc9  metalc ? ? A ASP 131 OD2 ? ? ? 1_555 L MG  .  MG  ? ? A ASP 128 A MG  397 1_555 ? ? ? ? ? ? ?            2.070 ? 
metalc10 metalc ? ? L MG  .   MG  ? ? ? 1_555 Q HOH .  O   ? ? A MG  397 A HOH 400 1_555 ? ? ? ? ? ? ?            2.071 ? 
metalc11 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 K MG  .  MG  ? ? A ASP 128 A MG  396 1_555 ? ? ? ? ? ? ?            2.082 ? 
metalc12 metalc ? ? A GLU 224 OE1 ? ? ? 1_555 L MG  .  MG  ? ? A GLU 221 A MG  397 1_555 ? ? ? ? ? ? ?            2.088 ? 
metalc13 metalc ? ? K MG  .   MG  ? ? ? 1_555 Q HOH .  O   ? ? A MG  396 A HOH 401 1_555 ? ? ? ? ? ? ?            2.204 ? 
metalc14 metalc ? ? P MG  .   MG  ? ? ? 1_555 R HOH .  O   ? ? B MG  394 B HOH 396 1_555 ? ? ? ? ? ? ?            2.231 ? 
metalc15 metalc ? ? A CYS 102 SG  ? ? ? 1_555 E ZN  .  ZN  ? ? A CYS 99  A ZN  393 1_555 ? ? ? ? ? ? ?            2.231 ? 
metalc16 metalc ? ? P MG  .   MG  ? ? ? 1_555 R HOH .  O   ? ? B MG  394 B HOH 395 1_555 ? ? ? ? ? ? ?            2.237 ? 
metalc17 metalc ? ? K MG  .   MG  ? ? ? 1_555 M RLT .  OAH ? ? A MG  396 A RLT 398 1_555 ? ? ? ? ? ? ?            2.257 ? 
metalc18 metalc ? ? B ASP 188 OD1 ? ? ? 1_555 P MG  .  MG  ? ? B ASP 185 B MG  394 1_555 ? ? ? ? ? ? ?            2.265 ? 
metalc19 metalc ? ? A CYS 99  SG  ? ? ? 1_555 E ZN  .  ZN  ? ? A CYS 96  A ZN  393 1_555 ? ? ? ? ? ? ?            2.270 ? 
metalc20 metalc ? ? B ASP 131 OD1 ? ? ? 1_555 P MG  .  MG  ? ? B ASP 128 B MG  394 1_555 ? ? ? ? ? ? ?            2.363 ? 
metalc21 metalc ? ? P MG  .   MG  ? ? ? 1_555 R HOH .  O   ? ? B MG  394 B HOH 433 1_555 ? ? ? ? ? ? ?            2.519 ? 
hydrog1  hydrog ? ? C DG  4   N1  ? ? ? 1_555 D DC  16 N3  ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  4   N2  ? ? ? 1_555 D DC  16 O2  ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  4   O6  ? ? ? 1_555 D DC  16 N4  ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DT  5   N3  ? ? ? 1_555 D DA  15 N1  ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DT  5   O4  ? ? ? 1_555 D DA  15 N6  ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DC  6   N3  ? ? ? 1_555 D DG  14 N1  ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DC  6   N4  ? ? ? 1_555 D DG  14 O6  ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DC  6   O2  ? ? ? 1_555 D DG  14 N2  ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DA  7   N1  ? ? ? 1_555 D DT  13 N3  ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DA  7   N6  ? ? ? 1_555 D DT  13 O4  ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DT  8   N3  ? ? ? 1_555 D DA  12 N1  ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DT  8   O4  ? ? ? 1_555 D DA  12 N6  ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DG  9   N1  ? ? ? 1_555 D DC  11 N3  ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DG  9   N2  ? ? ? 1_555 D DC  11 O2  ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DG  9   O6  ? ? ? 1_555 D DC  11 N4  ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DG  10  N1  ? ? ? 1_555 D DC  10 N3  ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DG  10  N2  ? ? ? 1_555 D DC  10 O2  ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  10  O6  ? ? ? 1_555 D DC  10 N4  ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DA  11  N1  ? ? ? 1_555 D DT  9  N3  ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DA  11  N6  ? ? ? 1_555 D DT  9  O4  ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DA  12  N1  ? ? ? 1_555 D DT  8  N3  ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DA  12  N6  ? ? ? 1_555 D DT  8  O4  ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DT  13  N3  ? ? ? 1_555 D DA  7  N1  ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DT  13  O4  ? ? ? 1_555 D DA  7  N6  ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DT  14  N3  ? ? ? 1_555 D DA  6  N1  ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DT  14  O4  ? ? ? 1_555 D DA  6  N6  ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DT  15  N3  ? ? ? 1_555 D DA  5  N1  ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DT  15  O4  ? ? ? 1_555 D DA  5  N6  ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DC  16  N3  ? ? ? 1_555 D DG  4  N1  ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DC  16  N4  ? ? ? 1_555 D DG  4  O6  ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DC  16  O2  ? ? ? 1_555 D DG  4  N2  ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DG  17  N1  ? ? ? 1_555 D DC  3  N3  ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DG  17  N2  ? ? ? 1_555 D DC  3  O2  ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DG  17  O6  ? ? ? 1_555 D DC  3  N4  ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DC  18  N3  ? ? ? 1_555 D DG  2  N1  ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DC  18  N4  ? ? ? 1_555 D DG  2  O6  ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DC  18  O2  ? ? ? 1_555 D DG  2  N2  ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DA  19  N1  ? ? ? 1_555 D DT  1  N3  ? ? C DA  19  D DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DA  19  N6  ? ? ? 1_555 D DT  1  O4  ? ? C DA  19  D DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 134 A . ? GLY 131 A PRO 135 A ? PRO 132 A 1 3.84  
2 LEU 361 A . ? LEU 358 A GLY 362 A ? GLY 359 A 1 -5.68 
3 GLY 134 B . ? GLY 131 B PRO 135 B ? PRO 132 B 1 7.66  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 5 ? 
D ? 5 ? 
E ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 33  ? GLU A 36  ? TYR A 30  GLU A 33  
A 2 LYS A 39  ? ARG A 44  ? LYS A 36  ARG A 41  
A 3 GLY A 47  ? ILE A 50  ? GLY A 44  ILE A 47  
B 1 ALA A 111 ? SER A 112 ? ALA A 108 SER A 109 
B 2 SER A 317 ? TRP A 318 ? SER A 314 TRP A 315 
C 1 THR A 156 ? THR A 161 ? THR A 153 THR A 158 
C 2 TYR A 144 ? ASP A 150 ? TYR A 141 ASP A 147 
C 3 LYS A 127 ? ILE A 133 ? LYS A 124 ILE A 130 
C 4 VAL A 184 ? SER A 187 ? VAL A 181 SER A 184 
C 5 HIS A 208 ? PHE A 211 ? HIS A 205 PHE A 208 
D 1 ASN A 364 ? SER A 368 ? ASN A 361 SER A 365 
D 2 THR A 354 ? LEU A 358 ? THR A 351 LEU A 355 
D 3 SER A 344 ? ASN A 351 ? SER A 341 ASN A 348 
D 4 LEU A 325 ? GLU A 328 ? LEU A 322 GLU A 325 
D 5 LEU A 372 ? PRO A 374 ? LEU A 369 PRO A 371 
E 1 THR B 156 ? THR B 161 ? THR B 153 THR B 158 
E 2 TYR B 144 ? ASP B 150 ? TYR B 141 ASP B 147 
E 3 LYS B 127 ? ILE B 133 ? LYS B 124 ILE B 130 
E 4 VAL B 184 ? SER B 187 ? VAL B 181 SER B 184 
E 5 HIS B 208 ? PHE B 211 ? HIS B 205 PHE B 208 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 34  ? N PHE A 31  O LYS A 41  ? O LYS A 38  
A 2 3 N ARG A 44  ? N ARG A 41  O GLY A 47  ? O GLY A 44  
B 1 2 N ALA A 111 ? N ALA A 108 O TRP A 318 ? O TRP A 315 
C 1 2 O TYR A 159 ? O TYR A 156 N LEU A 146 ? N LEU A 143 
C 2 3 O VAL A 149 ? O VAL A 146 N PHE A 129 ? N PHE A 126 
C 3 4 N PHE A 128 ? N PHE A 125 O HIS A 186 ? O HIS A 183 
C 4 5 N SER A 187 ? N SER A 184 O GLU A 210 ? O GLU A 207 
D 1 2 O VAL A 367 ? O VAL A 364 N VAL A 355 ? N VAL A 352 
D 2 3 O VAL A 356 ? O VAL A 353 N LYS A 348 ? N LYS A 345 
D 3 4 O SER A 344 ? O SER A 341 N VAL A 326 ? N VAL A 323 
D 4 5 N GLN A 327 ? N GLN A 324 O LYS A 373 ? O LYS A 370 
E 1 2 O TYR B 159 ? O TYR B 156 N LEU B 146 ? N LEU B 143 
E 2 3 O VAL B 147 ? O VAL B 144 N ASP B 131 ? N ASP B 128 
E 3 4 N PHE B 128 ? N PHE B 125 O HIS B 186 ? O HIS B 183 
E 4 5 N SER B 187 ? N SER B 184 O GLU B 210 ? O GLU B 207 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 393'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 A 394' 
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE GOL A 801' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 802' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 805' 
AC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NH4 A 395' 
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 396'  
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 397'  
AC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE RLT A 398' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 393' 
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL B 803' 
BC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG B 394'  
1   ?        ? ? ? ? ?  ?                                    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HIS A 65  ? HIS A 62  . ? 1_555 ? 
2  AC1 4  HIS A 69  ? HIS A 66  . ? 1_555 ? 
3  AC1 4  CYS A 99  ? CYS A 96  . ? 1_555 ? 
4  AC1 4  CYS A 102 ? CYS A 99  . ? 1_555 ? 
5  AC2 5  HIS A 341 ? HIS A 338 . ? 1_555 ? 
6  AC2 5  LYS A 342 ? LYS A 339 . ? 1_555 ? 
7  AC2 5  HIS A 360 ? HIS A 357 . ? 1_555 ? 
8  AC2 5  HOH Q .   ? HOH A 429 . ? 1_555 ? 
9  AC2 5  HOH Q .   ? HOH A 463 . ? 1_555 ? 
10 AC3 2  SER A 165 ? SER A 162 . ? 1_555 ? 
11 AC3 2  THR A 166 ? THR A 163 . ? 1_555 ? 
12 AC4 4  PRO A 138 ? PRO A 135 . ? 1_555 ? 
13 AC4 4  SER A 139 ? SER A 136 . ? 1_555 ? 
14 AC4 4  GLN A 140 ? GLN A 137 . ? 1_555 ? 
15 AC4 4  LYS A 244 ? LYS A 241 . ? 1_555 ? 
16 AC5 4  GLN A 63  ? GLN A 60  . ? 1_555 ? 
17 AC5 4  TYR A 83  ? TYR A 80  . ? 1_555 ? 
18 AC5 4  PRO A 280 ? PRO A 277 . ? 8_554 ? 
19 AC5 4  PHE A 281 ? PHE A 278 . ? 8_554 ? 
20 AC6 1  ASP A 119 ? ASP A 116 . ? 1_555 ? 
21 AC7 5  ASP A 131 ? ASP A 128 . ? 1_555 ? 
22 AC7 5  ASP A 188 ? ASP A 185 . ? 1_555 ? 
23 AC7 5  RLT M .   ? RLT A 398 . ? 1_555 ? 
24 AC7 5  HOH Q .   ? HOH A 401 . ? 1_555 ? 
25 AC7 5  HOH Q .   ? HOH A 534 . ? 1_555 ? 
26 AC8 5  ASP A 131 ? ASP A 128 . ? 1_555 ? 
27 AC8 5  GLU A 224 ? GLU A 221 . ? 1_555 ? 
28 AC8 5  ASN A 227 ? ASN A 224 . ? 1_555 ? 
29 AC8 5  RLT M .   ? RLT A 398 . ? 1_555 ? 
30 AC8 5  HOH Q .   ? HOH A 400 . ? 1_555 ? 
31 AC9 14 ASP A 131 ? ASP A 128 . ? 1_555 ? 
32 AC9 14 ASP A 188 ? ASP A 185 . ? 1_555 ? 
33 AC9 14 TYR A 215 ? TYR A 212 . ? 1_555 ? 
34 AC9 14 PRO A 217 ? PRO A 214 . ? 1_555 ? 
35 AC9 14 GLN A 218 ? GLN A 215 . ? 1_555 ? 
36 AC9 14 GLU A 224 ? GLU A 221 . ? 1_555 ? 
37 AC9 14 MG  K .   ? MG  A 396 . ? 1_555 ? 
38 AC9 14 MG  L .   ? MG  A 397 . ? 1_555 ? 
39 AC9 14 HOH Q .   ? HOH A 400 . ? 1_555 ? 
40 AC9 14 HOH Q .   ? HOH A 401 . ? 1_555 ? 
41 AC9 14 HOH Q .   ? HOH A 534 . ? 1_555 ? 
42 AC9 14 DG  C 4   ? DG  C 4   . ? 1_555 ? 
43 AC9 14 DC  D 16  ? DC  D 16  . ? 1_555 ? 
44 AC9 14 DA  D 17  ? DA  D 17  . ? 1_555 ? 
45 BC1 5  LYS B 222 ? LYS B 219 . ? 1_555 ? 
46 BC1 5  ARG B 225 ? ARG B 222 . ? 1_555 ? 
47 BC1 5  SER B 261 ? SER B 258 . ? 1_555 ? 
48 BC1 5  PRO B 262 ? PRO B 259 . ? 1_555 ? 
49 BC1 5  VAL B 263 ? VAL B 260 . ? 1_555 ? 
50 BC2 4  LEU A 295 ? LEU A 292 . ? 1_555 ? 
51 BC2 4  GLN A 299 ? GLN A 296 . ? 1_555 ? 
52 BC2 4  GLY B 274 ? GLY B 271 . ? 1_555 ? 
53 BC2 4  ASP B 276 ? ASP B 273 . ? 1_555 ? 
54 BC3 6  ASP B 131 ? ASP B 128 . ? 1_555 ? 
55 BC3 6  ASP B 188 ? ASP B 185 . ? 1_555 ? 
56 BC3 6  HOH R .   ? HOH B 395 . ? 1_555 ? 
57 BC3 6  HOH R .   ? HOH B 396 . ? 1_555 ? 
58 BC3 6  HOH R .   ? HOH B 433 . ? 1_555 ? 
59 BC3 6  DA  C 19  ? DA  C 19  . ? 3_555 ? 
# 
_atom_sites.entry_id                    3OYA 
_atom_sites.fract_transf_matrix[1][1]   0.006260 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006260 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008055 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
F  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LEU A 1  11  ? -78.057 18.036 -56.475 1.00 115.63 ? 8   LEU A N     1 
ATOM   2    C  CA    . LEU A 1  11  ? -77.264 17.450 -57.605 1.00 115.48 ? 8   LEU A CA    1 
ATOM   3    C  C     . LEU A 1  11  ? -77.985 17.629 -58.963 1.00 115.33 ? 8   LEU A C     1 
ATOM   4    O  O     . LEU A 1  11  ? -78.255 18.767 -59.361 1.00 115.21 ? 8   LEU A O     1 
ATOM   5    C  CB    . LEU A 1  11  ? -76.896 15.983 -57.315 1.00 115.42 ? 8   LEU A CB    1 
ATOM   6    N  N     . ASP A 1  12  ? -78.288 16.520 -59.654 1.00 115.17 ? 9   ASP A N     1 
ATOM   7    C  CA    . ASP A 1  12  ? -78.926 16.531 -60.996 1.00 114.87 ? 9   ASP A CA    1 
ATOM   8    C  C     . ASP A 1  12  ? -80.424 16.833 -60.963 1.00 114.41 ? 9   ASP A C     1 
ATOM   9    O  O     . ASP A 1  12  ? -80.992 17.291 -61.958 1.00 114.24 ? 9   ASP A O     1 
ATOM   10   C  CB    . ASP A 1  12  ? -78.710 15.196 -61.730 1.00 115.07 ? 9   ASP A CB    1 
ATOM   11   C  CG    . ASP A 1  12  ? -77.250 14.928 -62.054 1.00 115.54 ? 9   ASP A CG    1 
ATOM   12   O  OD1   . ASP A 1  12  ? -76.565 15.843 -62.567 1.00 115.31 ? 9   ASP A OD1   1 
ATOM   13   O  OD2   . ASP A 1  12  ? -76.795 13.789 -61.801 1.00 116.15 ? 9   ASP A OD2   1 
ATOM   14   N  N     . ALA A 1  13  ? -81.055 16.543 -59.827 1.00 113.82 ? 10  ALA A N     1 
ATOM   15   C  CA    . ALA A 1  13  ? -82.455 16.871 -59.606 1.00 113.30 ? 10  ALA A CA    1 
ATOM   16   C  C     . ALA A 1  13  ? -82.653 18.385 -59.679 1.00 112.97 ? 10  ALA A C     1 
ATOM   17   O  O     . ALA A 1  13  ? -83.351 18.883 -60.571 1.00 112.92 ? 10  ALA A O     1 
ATOM   18   C  CB    . ALA A 1  13  ? -82.913 16.329 -58.259 1.00 113.33 ? 10  ALA A CB    1 
ATOM   19   N  N     . GLU A 1  14  ? -82.017 19.101 -58.747 1.00 112.51 ? 11  GLU A N     1 
ATOM   20   C  CA    . GLU A 1  14  ? -82.059 20.565 -58.677 1.00 111.91 ? 11  GLU A CA    1 
ATOM   21   C  C     . GLU A 1  14  ? -81.775 21.221 -60.017 1.00 111.21 ? 11  GLU A C     1 
ATOM   22   O  O     . GLU A 1  14  ? -82.588 21.991 -60.525 1.00 111.05 ? 11  GLU A O     1 
ATOM   23   C  CB    . GLU A 1  14  ? -81.042 21.077 -57.660 1.00 112.06 ? 11  GLU A CB    1 
ATOM   24   C  CG    . GLU A 1  14  ? -81.520 21.073 -56.225 1.00 112.92 ? 11  GLU A CG    1 
ATOM   25   C  CD    . GLU A 1  14  ? -80.601 21.863 -55.302 1.00 113.82 ? 11  GLU A CD    1 
ATOM   26   O  OE1   . GLU A 1  14  ? -79.660 22.531 -55.796 1.00 114.07 ? 11  GLU A OE1   1 
ATOM   27   O  OE2   . GLU A 1  14  ? -80.825 21.816 -54.076 1.00 113.73 ? 11  GLU A OE2   1 
ATOM   28   N  N     . LEU A 1  15  ? -80.617 20.899 -60.582 1.00 110.52 ? 12  LEU A N     1 
ATOM   29   C  CA    . LEU A 1  15  ? -80.160 21.500 -61.828 1.00 110.00 ? 12  LEU A CA    1 
ATOM   30   C  C     . LEU A 1  15  ? -81.157 21.306 -62.972 1.00 109.84 ? 12  LEU A C     1 
ATOM   31   O  O     . LEU A 1  15  ? -81.295 22.176 -63.831 1.00 109.74 ? 12  LEU A O     1 
ATOM   32   C  CB    . LEU A 1  15  ? -78.763 20.975 -62.202 1.00 109.93 ? 12  LEU A CB    1 
ATOM   33   C  CG    . LEU A 1  15  ? -77.510 21.734 -61.720 1.00 109.29 ? 12  LEU A CG    1 
ATOM   34   C  CD1   . LEU A 1  15  ? -77.488 21.958 -60.212 1.00 109.25 ? 12  LEU A CD1   1 
ATOM   35   C  CD2   . LEU A 1  15  ? -76.234 21.028 -62.161 1.00 108.34 ? 12  LEU A CD2   1 
ATOM   36   N  N     . ASP A 1  16  ? -81.863 20.175 -62.963 1.00 109.69 ? 13  ASP A N     1 
ATOM   37   C  CA    . ASP A 1  16  ? -82.868 19.883 -63.985 1.00 109.28 ? 13  ASP A CA    1 
ATOM   38   C  C     . ASP A 1  16  ? -84.028 20.867 -63.885 1.00 108.94 ? 13  ASP A C     1 
ATOM   39   O  O     . ASP A 1  16  ? -84.294 21.593 -64.849 1.00 108.66 ? 13  ASP A O     1 
ATOM   40   C  CB    . ASP A 1  16  ? -83.367 18.438 -63.879 1.00 109.42 ? 13  ASP A CB    1 
ATOM   41   C  CG    . ASP A 1  16  ? -83.485 17.751 -65.240 1.00 109.69 ? 13  ASP A CG    1 
ATOM   42   O  OD1   . ASP A 1  16  ? -83.858 18.411 -66.237 1.00 110.12 ? 13  ASP A OD1   1 
ATOM   43   O  OD2   . ASP A 1  16  ? -83.202 16.536 -65.310 1.00 109.78 ? 13  ASP A OD2   1 
ATOM   44   N  N     . GLN A 1  17  ? -84.690 20.907 -62.720 1.00 108.64 ? 14  GLN A N     1 
ATOM   45   C  CA    . GLN A 1  17  ? -85.790 21.862 -62.470 1.00 108.52 ? 14  GLN A CA    1 
ATOM   46   C  C     . GLN A 1  17  ? -85.419 23.252 -62.929 1.00 108.02 ? 14  GLN A C     1 
ATOM   47   O  O     . GLN A 1  17  ? -86.263 24.006 -63.423 1.00 108.04 ? 14  GLN A O     1 
ATOM   48   C  CB    . GLN A 1  17  ? -86.167 21.943 -60.990 1.00 108.63 ? 14  GLN A CB    1 
ATOM   49   C  CG    . GLN A 1  17  ? -87.519 21.351 -60.640 1.00 109.72 ? 14  GLN A CG    1 
ATOM   50   C  CD    . GLN A 1  17  ? -87.422 19.882 -60.263 1.00 111.37 ? 14  GLN A CD    1 
ATOM   51   O  OE1   . GLN A 1  17  ? -86.383 19.418 -59.781 1.00 112.02 ? 14  GLN A OE1   1 
ATOM   52   N  NE2   . GLN A 1  17  ? -88.508 19.142 -60.479 1.00 111.87 ? 14  GLN A NE2   1 
ATOM   53   N  N     . LEU A 1  18  ? -84.141 23.573 -62.753 1.00 107.41 ? 15  LEU A N     1 
ATOM   54   C  CA    . LEU A 1  18  ? -83.614 24.882 -63.075 1.00 106.81 ? 15  LEU A CA    1 
ATOM   55   C  C     . LEU A 1  18  ? -83.602 25.104 -64.577 1.00 106.41 ? 15  LEU A C     1 
ATOM   56   O  O     . LEU A 1  18  ? -83.991 26.173 -65.049 1.00 106.39 ? 15  LEU A O     1 
ATOM   57   C  CB    . LEU A 1  18  ? -82.207 25.049 -62.487 1.00 106.81 ? 15  LEU A CB    1 
ATOM   58   C  CG    . LEU A 1  18  ? -81.577 26.445 -62.470 1.00 106.19 ? 15  LEU A CG    1 
ATOM   59   C  CD1   . LEU A 1  18  ? -82.145 27.308 -61.341 1.00 105.54 ? 15  LEU A CD1   1 
ATOM   60   C  CD2   . LEU A 1  18  ? -80.079 26.312 -62.350 1.00 105.38 ? 15  LEU A CD2   1 
ATOM   61   N  N     . LEU A 1  19  ? -83.171 24.090 -65.321 1.00 106.00 ? 16  LEU A N     1 
ATOM   62   C  CA    . LEU A 1  19  ? -83.034 24.218 -66.767 1.00 105.77 ? 16  LEU A CA    1 
ATOM   63   C  C     . LEU A 1  19  ? -84.365 24.528 -67.468 1.00 105.77 ? 16  LEU A C     1 
ATOM   64   O  O     . LEU A 1  19  ? -84.412 25.358 -68.387 1.00 105.71 ? 16  LEU A O     1 
ATOM   65   C  CB    . LEU A 1  19  ? -82.349 22.988 -67.372 1.00 105.62 ? 16  LEU A CB    1 
ATOM   66   C  CG    . LEU A 1  19  ? -80.819 23.014 -67.436 1.00 105.12 ? 16  LEU A CG    1 
ATOM   67   C  CD1   . LEU A 1  19  ? -80.284 21.711 -68.002 1.00 104.71 ? 16  LEU A CD1   1 
ATOM   68   C  CD2   . LEU A 1  19  ? -80.316 24.192 -68.258 1.00 104.66 ? 16  LEU A CD2   1 
ATOM   69   N  N     . GLN A 1  20  ? -85.439 23.878 -67.015 1.00 105.56 ? 17  GLN A N     1 
ATOM   70   C  CA    . GLN A 1  20  ? -86.770 24.101 -67.588 1.00 105.33 ? 17  GLN A CA    1 
ATOM   71   C  C     . GLN A 1  20  ? -87.417 25.416 -67.113 1.00 104.93 ? 17  GLN A C     1 
ATOM   72   O  O     . GLN A 1  20  ? -88.628 25.615 -67.272 1.00 104.99 ? 17  GLN A O     1 
ATOM   73   C  CB    . GLN A 1  20  ? -87.687 22.885 -67.359 1.00 105.41 ? 17  GLN A CB    1 
ATOM   74   C  CG    . GLN A 1  20  ? -87.930 22.513 -65.899 1.00 105.99 ? 17  GLN A CG    1 
ATOM   75   C  CD    . GLN A 1  20  ? -88.503 21.104 -65.725 1.00 107.08 ? 17  GLN A CD    1 
ATOM   76   O  OE1   . GLN A 1  20  ? -88.122 20.167 -66.435 1.00 107.14 ? 17  GLN A OE1   1 
ATOM   77   N  NE2   . GLN A 1  20  ? -89.411 20.950 -64.763 1.00 107.39 ? 17  GLN A NE2   1 
ATOM   78   N  N     . GLY A 1  21  ? -86.597 26.298 -66.533 1.00 104.40 ? 18  GLY A N     1 
ATOM   79   C  CA    . GLY A 1  21  ? -86.997 27.656 -66.156 1.00 103.55 ? 18  GLY A CA    1 
ATOM   80   C  C     . GLY A 1  21  ? -87.712 27.863 -64.827 1.00 103.04 ? 18  GLY A C     1 
ATOM   81   O  O     . GLY A 1  21  ? -88.135 28.979 -64.538 1.00 102.91 ? 18  GLY A O     1 
ATOM   82   N  N     . HIS A 1  22  ? -87.864 26.809 -64.024 1.00 102.60 ? 19  HIS A N     1 
ATOM   83   C  CA    . HIS A 1  22  ? -88.451 26.938 -62.679 1.00 102.40 ? 19  HIS A CA    1 
ATOM   84   C  C     . HIS A 1  22  ? -87.472 27.568 -61.676 1.00 101.51 ? 19  HIS A C     1 
ATOM   85   O  O     . HIS A 1  22  ? -86.260 27.625 -61.931 1.00 101.57 ? 19  HIS A O     1 
ATOM   86   C  CB    . HIS A 1  22  ? -88.954 25.583 -62.159 1.00 102.98 ? 19  HIS A CB    1 
ATOM   87   C  CG    . HIS A 1  22  ? -90.136 25.047 -62.908 1.00 105.11 ? 19  HIS A CG    1 
ATOM   88   N  ND1   . HIS A 1  22  ? -91.322 25.747 -63.037 1.00 107.11 ? 19  HIS A ND1   1 
ATOM   89   C  CD2   . HIS A 1  22  ? -90.321 23.872 -63.559 1.00 106.53 ? 19  HIS A CD2   1 
ATOM   90   C  CE1   . HIS A 1  22  ? -92.180 25.031 -63.745 1.00 107.35 ? 19  HIS A CE1   1 
ATOM   91   N  NE2   . HIS A 1  22  ? -91.598 23.889 -64.073 1.00 107.59 ? 19  HIS A NE2   1 
ATOM   92   N  N     . TYR A 1  23  ? -87.995 28.038 -60.542 1.00 100.22 ? 20  TYR A N     1 
ATOM   93   C  CA    . TYR A 1  23  ? -87.175 28.739 -59.546 1.00 98.89  ? 20  TYR A CA    1 
ATOM   94   C  C     . TYR A 1  23  ? -86.713 27.860 -58.387 1.00 97.72  ? 20  TYR A C     1 
ATOM   95   O  O     . TYR A 1  23  ? -87.534 27.229 -57.726 1.00 97.38  ? 20  TYR A O     1 
ATOM   96   C  CB    . TYR A 1  23  ? -87.918 29.963 -58.984 1.00 99.10  ? 20  TYR A CB    1 
ATOM   97   C  CG    . TYR A 1  23  ? -87.222 30.584 -57.778 1.00 99.88  ? 20  TYR A CG    1 
ATOM   98   C  CD1   . TYR A 1  23  ? -86.114 31.432 -57.944 1.00 100.07 ? 20  TYR A CD1   1 
ATOM   99   C  CD2   . TYR A 1  23  ? -87.652 30.303 -56.467 1.00 100.07 ? 20  TYR A CD2   1 
ATOM   100  C  CE1   . TYR A 1  23  ? -85.456 31.997 -56.842 1.00 99.79  ? 20  TYR A CE1   1 
ATOM   101  C  CE2   . TYR A 1  23  ? -86.997 30.864 -55.354 1.00 100.10 ? 20  TYR A CE2   1 
ATOM   102  C  CZ    . TYR A 1  23  ? -85.901 31.712 -55.554 1.00 99.91  ? 20  TYR A CZ    1 
ATOM   103  O  OH    . TYR A 1  23  ? -85.248 32.273 -54.477 1.00 99.10  ? 20  TYR A OH    1 
ATOM   104  N  N     . ILE A 1  24  ? -85.402 27.856 -58.128 1.00 96.43  ? 21  ILE A N     1 
ATOM   105  C  CA    . ILE A 1  24  ? -84.833 27.195 -56.937 1.00 95.04  ? 21  ILE A CA    1 
ATOM   106  C  C     . ILE A 1  24  ? -84.201 28.225 -56.006 1.00 94.12  ? 21  ILE A C     1 
ATOM   107  O  O     . ILE A 1  24  ? -83.467 29.099 -56.464 1.00 93.99  ? 21  ILE A O     1 
ATOM   108  C  CB    . ILE A 1  24  ? -83.778 26.121 -57.300 1.00 94.88  ? 21  ILE A CB    1 
ATOM   109  C  CG1   . ILE A 1  24  ? -84.438 24.909 -57.963 1.00 94.79  ? 21  ILE A CG1   1 
ATOM   110  C  CG2   . ILE A 1  24  ? -83.032 25.654 -56.057 1.00 94.80  ? 21  ILE A CG2   1 
ATOM   111  C  CD1   . ILE A 1  24  ? -84.648 25.043 -59.454 1.00 94.18  ? 21  ILE A CD1   1 
ATOM   112  N  N     . LYS A 1  25  ? -84.488 28.120 -54.708 1.00 92.97  ? 22  LYS A N     1 
ATOM   113  C  CA    . LYS A 1  25  ? -83.937 29.055 -53.724 1.00 91.79  ? 22  LYS A CA    1 
ATOM   114  C  C     . LYS A 1  25  ? -82.412 29.079 -53.787 1.00 90.78  ? 22  LYS A C     1 
ATOM   115  O  O     . LYS A 1  25  ? -81.752 28.046 -53.646 1.00 90.80  ? 22  LYS A O     1 
ATOM   116  C  CB    . LYS A 1  25  ? -84.410 28.725 -52.301 1.00 91.94  ? 22  LYS A CB    1 
ATOM   117  C  CG    . LYS A 1  25  ? -84.174 29.854 -51.300 1.00 91.96  ? 22  LYS A CG    1 
ATOM   118  C  CD    . LYS A 1  25  ? -84.087 29.333 -49.874 1.00 92.67  ? 22  LYS A CD    1 
ATOM   119  C  CE    . LYS A 1  25  ? -83.616 30.422 -48.915 1.00 92.89  ? 22  LYS A CE    1 
ATOM   120  N  NZ    . LYS A 1  25  ? -83.270 29.865 -47.577 1.00 92.81  ? 22  LYS A NZ    1 
ATOM   121  N  N     . GLY A 1  26  ? -81.867 30.267 -54.013 1.00 89.60  ? 23  GLY A N     1 
ATOM   122  C  CA    . GLY A 1  26  ? -80.430 30.437 -54.122 1.00 88.06  ? 23  GLY A CA    1 
ATOM   123  C  C     . GLY A 1  26  ? -79.939 30.798 -55.510 1.00 86.85  ? 23  GLY A C     1 
ATOM   124  O  O     . GLY A 1  26  ? -78.924 31.467 -55.641 1.00 86.80  ? 23  GLY A O     1 
ATOM   125  N  N     . TYR A 1  27  ? -80.641 30.345 -56.545 1.00 85.67  ? 24  TYR A N     1 
ATOM   126  C  CA    . TYR A 1  27  ? -80.276 30.663 -57.923 1.00 84.35  ? 24  TYR A CA    1 
ATOM   127  C  C     . TYR A 1  27  ? -81.156 31.804 -58.388 1.00 84.32  ? 24  TYR A C     1 
ATOM   128  O  O     . TYR A 1  27  ? -82.343 31.596 -58.623 1.00 84.47  ? 24  TYR A O     1 
ATOM   129  C  CB    . TYR A 1  27  ? -80.455 29.445 -58.837 1.00 83.81  ? 24  TYR A CB    1 
ATOM   130  C  CG    . TYR A 1  27  ? -79.691 28.201 -58.408 1.00 81.70  ? 24  TYR A CG    1 
ATOM   131  C  CD1   . TYR A 1  27  ? -78.524 27.812 -59.056 1.00 80.27  ? 24  TYR A CD1   1 
ATOM   132  C  CD2   . TYR A 1  27  ? -80.142 27.414 -57.357 1.00 80.51  ? 24  TYR A CD2   1 
ATOM   133  C  CE1   . TYR A 1  27  ? -77.823 26.668 -58.664 1.00 79.98  ? 24  TYR A CE1   1 
ATOM   134  C  CE2   . TYR A 1  27  ? -79.456 26.273 -56.953 1.00 80.42  ? 24  TYR A CE2   1 
ATOM   135  C  CZ    . TYR A 1  27  ? -78.298 25.901 -57.606 1.00 80.44  ? 24  TYR A CZ    1 
ATOM   136  O  OH    . TYR A 1  27  ? -77.627 24.765 -57.189 1.00 80.15  ? 24  TYR A OH    1 
ATOM   137  N  N     . PRO A 1  28  ? -80.586 33.022 -58.508 1.00 84.29  ? 25  PRO A N     1 
ATOM   138  C  CA    . PRO A 1  28  ? -81.374 34.219 -58.848 1.00 84.31  ? 25  PRO A CA    1 
ATOM   139  C  C     . PRO A 1  28  ? -82.095 34.070 -60.185 1.00 84.46  ? 25  PRO A C     1 
ATOM   140  O  O     . PRO A 1  28  ? -81.495 33.579 -61.143 1.00 84.18  ? 25  PRO A O     1 
ATOM   141  C  CB    . PRO A 1  28  ? -80.324 35.339 -58.915 1.00 84.05  ? 25  PRO A CB    1 
ATOM   142  C  CG    . PRO A 1  28  ? -79.024 34.669 -59.000 1.00 83.87  ? 25  PRO A CG    1 
ATOM   143  C  CD    . PRO A 1  28  ? -79.157 33.337 -58.347 1.00 84.03  ? 25  PRO A CD    1 
ATOM   144  N  N     . LYS A 1  29  ? -83.366 34.493 -60.234 1.00 84.94  ? 26  LYS A N     1 
ATOM   145  C  CA    . LYS A 1  29  ? -84.265 34.241 -61.392 1.00 85.08  ? 26  LYS A CA    1 
ATOM   146  C  C     . LYS A 1  29  ? -83.970 35.058 -62.654 1.00 85.16  ? 26  LYS A C     1 
ATOM   147  O  O     . LYS A 1  29  ? -84.356 34.667 -63.756 1.00 85.09  ? 26  LYS A O     1 
ATOM   148  C  CB    . LYS A 1  29  ? -85.740 34.396 -60.999 1.00 84.78  ? 26  LYS A CB    1 
ATOM   149  N  N     . GLN A 1  30  ? -83.265 36.171 -62.494 1.00 85.48  ? 27  GLN A N     1 
ATOM   150  C  CA    . GLN A 1  30  ? -83.013 37.083 -63.607 1.00 86.09  ? 27  GLN A CA    1 
ATOM   151  C  C     . GLN A 1  30  ? -81.859 36.684 -64.550 1.00 86.26  ? 27  GLN A C     1 
ATOM   152  O  O     . GLN A 1  30  ? -81.533 37.428 -65.475 1.00 86.14  ? 27  GLN A O     1 
ATOM   153  C  CB    . GLN A 1  30  ? -82.814 38.508 -63.082 1.00 86.15  ? 27  GLN A CB    1 
ATOM   154  C  CG    . GLN A 1  30  ? -81.618 38.667 -62.165 1.00 86.80  ? 27  GLN A CG    1 
ATOM   155  C  CD    . GLN A 1  30  ? -81.208 40.111 -62.016 1.00 87.99  ? 27  GLN A CD    1 
ATOM   156  O  OE1   . GLN A 1  30  ? -81.854 40.881 -61.305 1.00 88.83  ? 27  GLN A OE1   1 
ATOM   157  N  NE2   . GLN A 1  30  ? -80.130 40.493 -62.691 1.00 88.16  ? 27  GLN A NE2   1 
ATOM   158  N  N     . TYR A 1  31  ? -81.239 35.529 -64.322 1.00 86.65  ? 28  TYR A N     1 
ATOM   159  C  CA    . TYR A 1  31  ? -80.138 35.086 -65.182 1.00 87.10  ? 28  TYR A CA    1 
ATOM   160  C  C     . TYR A 1  31  ? -80.580 33.919 -66.013 1.00 87.21  ? 28  TYR A C     1 
ATOM   161  O  O     . TYR A 1  31  ? -81.445 33.161 -65.586 1.00 87.37  ? 28  TYR A O     1 
ATOM   162  C  CB    . TYR A 1  31  ? -78.918 34.668 -64.360 1.00 87.22  ? 28  TYR A CB    1 
ATOM   163  C  CG    . TYR A 1  31  ? -78.266 35.804 -63.636 1.00 87.61  ? 28  TYR A CG    1 
ATOM   164  C  CD1   . TYR A 1  31  ? -77.642 36.841 -64.343 1.00 88.75  ? 28  TYR A CD1   1 
ATOM   165  C  CD2   . TYR A 1  31  ? -78.264 35.850 -62.250 1.00 87.30  ? 28  TYR A CD2   1 
ATOM   166  C  CE1   . TYR A 1  31  ? -77.043 37.901 -63.677 1.00 89.09  ? 28  TYR A CE1   1 
ATOM   167  C  CE2   . TYR A 1  31  ? -77.671 36.898 -61.573 1.00 88.43  ? 28  TYR A CE2   1 
ATOM   168  C  CZ    . TYR A 1  31  ? -77.064 37.924 -62.288 1.00 88.87  ? 28  TYR A CZ    1 
ATOM   169  O  OH    . TYR A 1  31  ? -76.476 38.966 -61.610 1.00 89.16  ? 28  TYR A OH    1 
ATOM   170  N  N     . THR A 1  32  ? -79.984 33.756 -67.189 1.00 87.34  ? 29  THR A N     1 
ATOM   171  C  CA    . THR A 1  32  ? -80.358 32.618 -68.031 1.00 87.57  ? 29  THR A CA    1 
ATOM   172  C  C     . THR A 1  32  ? -79.424 31.419 -67.832 1.00 87.22  ? 29  THR A C     1 
ATOM   173  O  O     . THR A 1  32  ? -78.209 31.521 -68.006 1.00 87.18  ? 29  THR A O     1 
ATOM   174  C  CB    . THR A 1  32  ? -80.566 32.988 -69.551 1.00 87.67  ? 29  THR A CB    1 
ATOM   175  O  OG1   . THR A 1  32  ? -79.494 33.819 -70.012 1.00 88.32  ? 29  THR A OG1   1 
ATOM   176  C  CG2   . THR A 1  32  ? -81.916 33.713 -69.774 1.00 87.55  ? 29  THR A CG2   1 
ATOM   177  N  N     . TYR A 1  33  ? -80.025 30.295 -67.452 1.00 86.96  ? 30  TYR A N     1 
ATOM   178  C  CA    . TYR A 1  33  ? -79.323 29.040 -67.201 1.00 86.74  ? 30  TYR A CA    1 
ATOM   179  C  C     . TYR A 1  33  ? -79.542 28.039 -68.341 1.00 86.69  ? 30  TYR A C     1 
ATOM   180  O  O     . TYR A 1  33  ? -80.675 27.672 -68.624 1.00 86.95  ? 30  TYR A O     1 
ATOM   181  C  CB    . TYR A 1  33  ? -79.836 28.412 -65.903 1.00 86.50  ? 30  TYR A CB    1 
ATOM   182  C  CG    . TYR A 1  33  ? -79.807 29.308 -64.686 1.00 86.48  ? 30  TYR A CG    1 
ATOM   183  C  CD1   . TYR A 1  33  ? -78.708 29.318 -63.825 1.00 86.10  ? 30  TYR A CD1   1 
ATOM   184  C  CD2   . TYR A 1  33  ? -80.893 30.127 -64.371 1.00 86.52  ? 30  TYR A CD2   1 
ATOM   185  C  CE1   . TYR A 1  33  ? -78.687 30.136 -62.682 1.00 85.79  ? 30  TYR A CE1   1 
ATOM   186  C  CE2   . TYR A 1  33  ? -80.881 30.948 -63.230 1.00 86.40  ? 30  TYR A CE2   1 
ATOM   187  C  CZ    . TYR A 1  33  ? -79.776 30.950 -62.393 1.00 85.53  ? 30  TYR A CZ    1 
ATOM   188  O  OH    . TYR A 1  33  ? -79.768 31.757 -61.276 1.00 84.45  ? 30  TYR A OH    1 
ATOM   189  N  N     . PHE A 1  34  ? -78.467 27.566 -68.967 1.00 86.52  ? 31  PHE A N     1 
ATOM   190  C  CA    . PHE A 1  34  ? -78.595 26.648 -70.097 1.00 86.44  ? 31  PHE A CA    1 
ATOM   191  C  C     . PHE A 1  34  ? -77.706 25.403 -70.031 1.00 86.78  ? 31  PHE A C     1 
ATOM   192  O  O     . PHE A 1  34  ? -76.946 25.228 -69.074 1.00 87.08  ? 31  PHE A O     1 
ATOM   193  C  CB    . PHE A 1  34  ? -78.353 27.395 -71.399 1.00 86.25  ? 31  PHE A CB    1 
ATOM   194  C  CG    . PHE A 1  34  ? -77.032 28.093 -71.466 1.00 85.59  ? 31  PHE A CG    1 
ATOM   195  C  CD1   . PHE A 1  34  ? -75.971 27.527 -72.164 1.00 85.51  ? 31  PHE A CD1   1 
ATOM   196  C  CD2   . PHE A 1  34  ? -76.853 29.336 -70.862 1.00 85.13  ? 31  PHE A CD2   1 
ATOM   197  C  CE1   . PHE A 1  34  ? -74.739 28.186 -72.251 1.00 84.85  ? 31  PHE A CE1   1 
ATOM   198  C  CE2   . PHE A 1  34  ? -75.632 30.001 -70.941 1.00 84.20  ? 31  PHE A CE2   1 
ATOM   199  C  CZ    . PHE A 1  34  ? -74.573 29.425 -71.637 1.00 84.19  ? 31  PHE A CZ    1 
ATOM   200  N  N     . LEU A 1  35  ? -77.833 24.537 -71.044 1.00 86.79  ? 32  LEU A N     1 
ATOM   201  C  CA    . LEU A 1  35  ? -76.956 23.365 -71.236 1.00 86.66  ? 32  LEU A CA    1 
ATOM   202  C  C     . LEU A 1  35  ? -76.016 23.589 -72.431 1.00 86.28  ? 32  LEU A C     1 
ATOM   203  O  O     . LEU A 1  35  ? -76.396 24.242 -73.396 1.00 86.56  ? 32  LEU A O     1 
ATOM   204  C  CB    . LEU A 1  35  ? -77.786 22.081 -71.420 1.00 86.65  ? 32  LEU A CB    1 
ATOM   205  C  CG    . LEU A 1  35  ? -77.068 20.724 -71.296 1.00 87.60  ? 32  LEU A CG    1 
ATOM   206  C  CD1   . LEU A 1  35  ? -77.876 19.731 -70.463 1.00 87.38  ? 32  LEU A CD1   1 
ATOM   207  C  CD2   . LEU A 1  35  ? -76.667 20.111 -72.671 1.00 88.85  ? 32  LEU A CD2   1 
ATOM   208  N  N     . GLU A 1  36  ? -74.797 23.055 -72.355 1.00 85.77  ? 33  GLU A N     1 
ATOM   209  C  CA    . GLU A 1  36  ? -73.772 23.229 -73.394 1.00 85.42  ? 33  GLU A CA    1 
ATOM   210  C  C     . GLU A 1  36  ? -72.582 22.342 -73.057 1.00 85.07  ? 33  GLU A C     1 
ATOM   211  O  O     . GLU A 1  36  ? -72.073 22.382 -71.935 1.00 85.06  ? 33  GLU A O     1 
ATOM   212  C  CB    . GLU A 1  36  ? -73.325 24.696 -73.487 1.00 85.29  ? 33  GLU A CB    1 
ATOM   213  C  CG    . GLU A 1  36  ? -72.350 25.002 -74.619 1.00 86.57  ? 33  GLU A CG    1 
ATOM   214  C  CD    . GLU A 1  36  ? -71.941 26.482 -74.692 1.00 88.75  ? 33  GLU A CD    1 
ATOM   215  O  OE1   . GLU A 1  36  ? -70.811 26.806 -74.275 1.00 89.04  ? 33  GLU A OE1   1 
ATOM   216  O  OE2   . GLU A 1  36  ? -72.736 27.327 -75.169 1.00 89.76  ? 33  GLU A OE2   1 
ATOM   217  N  N     . ASP A 1  37  ? -72.147 21.537 -74.025 1.00 84.60  ? 34  ASP A N     1 
ATOM   218  C  CA    . ASP A 1  37  ? -71.045 20.572 -73.828 1.00 84.30  ? 34  ASP A CA    1 
ATOM   219  C  C     . ASP A 1  37  ? -71.335 19.567 -72.704 1.00 83.46  ? 34  ASP A C     1 
ATOM   220  O  O     . ASP A 1  37  ? -70.416 18.985 -72.124 1.00 83.35  ? 34  ASP A O     1 
ATOM   221  C  CB    . ASP A 1  37  ? -69.692 21.280 -73.584 1.00 84.76  ? 34  ASP A CB    1 
ATOM   222  C  CG    . ASP A 1  37  ? -69.202 22.092 -74.797 1.00 85.95  ? 34  ASP A CG    1 
ATOM   223  O  OD1   . ASP A 1  37  ? -68.567 23.154 -74.587 1.00 86.32  ? 34  ASP A OD1   1 
ATOM   224  O  OD2   . ASP A 1  37  ? -69.435 21.675 -75.955 1.00 86.92  ? 34  ASP A OD2   1 
ATOM   225  N  N     . GLY A 1  38  ? -72.618 19.380 -72.402 1.00 82.55  ? 35  GLY A N     1 
ATOM   226  C  CA    . GLY A 1  38  ? -73.050 18.397 -71.410 1.00 81.44  ? 35  GLY A CA    1 
ATOM   227  C  C     . GLY A 1  38  ? -72.994 18.887 -69.977 1.00 80.51  ? 35  GLY A C     1 
ATOM   228  O  O     . GLY A 1  38  ? -73.048 18.096 -69.043 1.00 80.27  ? 35  GLY A O     1 
ATOM   229  N  N     . LYS A 1  39  ? -72.894 20.199 -69.799 1.00 79.75  ? 36  LYS A N     1 
ATOM   230  C  CA    . LYS A 1  39  ? -72.789 20.785 -68.462 1.00 78.74  ? 36  LYS A CA    1 
ATOM   231  C  C     . LYS A 1  39  ? -73.706 22.008 -68.307 1.00 77.73  ? 36  LYS A C     1 
ATOM   232  O  O     . LYS A 1  39  ? -73.921 22.751 -69.267 1.00 77.65  ? 36  LYS A O     1 
ATOM   233  C  CB    . LYS A 1  39  ? -71.320 21.123 -68.168 1.00 78.80  ? 36  LYS A CB    1 
ATOM   234  C  CG    . LYS A 1  39  ? -70.534 19.971 -67.484 1.00 79.90  ? 36  LYS A CG    1 
ATOM   235  C  CD    . LYS A 1  39  ? -69.175 19.658 -68.160 1.00 80.19  ? 36  LYS A CD    1 
ATOM   236  C  CE    . LYS A 1  39  ? -68.304 20.890 -68.359 1.00 79.32  ? 36  LYS A CE    1 
ATOM   237  N  NZ    . LYS A 1  39  ? -67.258 20.604 -69.353 1.00 79.35  ? 36  LYS A NZ    1 
ATOM   238  N  N     . VAL A 1  40  ? -74.256 22.205 -67.111 1.00 76.44  ? 37  VAL A N     1 
ATOM   239  C  CA    . VAL A 1  40  ? -75.150 23.341 -66.862 1.00 75.35  ? 37  VAL A CA    1 
ATOM   240  C  C     . VAL A 1  40  ? -74.379 24.641 -66.672 1.00 74.92  ? 37  VAL A C     1 
ATOM   241  O  O     . VAL A 1  40  ? -73.531 24.732 -65.790 1.00 75.27  ? 37  VAL A O     1 
ATOM   242  C  CB    . VAL A 1  40  ? -75.999 23.113 -65.620 1.00 75.22  ? 37  VAL A CB    1 
ATOM   243  C  CG1   . VAL A 1  40  ? -76.971 24.279 -65.414 1.00 74.59  ? 37  VAL A CG1   1 
ATOM   244  C  CG2   . VAL A 1  40  ? -76.725 21.808 -65.739 1.00 74.98  ? 37  VAL A CG2   1 
ATOM   245  N  N     . LYS A 1  41  ? -74.682 25.649 -67.483 1.00 74.03  ? 38  LYS A N     1 
ATOM   246  C  CA    . LYS A 1  41  ? -73.961 26.918 -67.413 1.00 73.01  ? 38  LYS A CA    1 
ATOM   247  C  C     . LYS A 1  41  ? -74.885 28.072 -67.072 1.00 73.07  ? 38  LYS A C     1 
ATOM   248  O  O     . LYS A 1  41  ? -76.095 27.920 -67.095 1.00 73.39  ? 38  LYS A O     1 
ATOM   249  C  CB    . LYS A 1  41  ? -73.235 27.186 -68.725 1.00 72.53  ? 38  LYS A CB    1 
ATOM   250  C  CG    . LYS A 1  41  ? -72.364 26.041 -69.160 1.00 70.87  ? 38  LYS A CG    1 
ATOM   251  C  CD    . LYS A 1  41  ? -71.394 26.463 -70.213 1.00 68.81  ? 38  LYS A CD    1 
ATOM   252  C  CE    . LYS A 1  41  ? -70.551 25.288 -70.632 1.00 68.30  ? 38  LYS A CE    1 
ATOM   253  N  NZ    . LYS A 1  41  ? -69.301 25.747 -71.275 1.00 68.61  ? 38  LYS A NZ    1 
ATOM   254  N  N     . VAL A 1  42  ? -74.307 29.219 -66.734 1.00 73.05  ? 39  VAL A N     1 
ATOM   255  C  CA    . VAL A 1  42  ? -75.070 30.433 -66.469 1.00 73.13  ? 39  VAL A CA    1 
ATOM   256  C  C     . VAL A 1  42  ? -74.276 31.638 -66.953 1.00 73.43  ? 39  VAL A C     1 
ATOM   257  O  O     . VAL A 1  42  ? -73.044 31.635 -66.935 1.00 73.37  ? 39  VAL A O     1 
ATOM   258  C  CB    . VAL A 1  42  ? -75.461 30.577 -64.963 1.00 73.14  ? 39  VAL A CB    1 
ATOM   259  C  CG1   . VAL A 1  42  ? -74.231 30.586 -64.064 1.00 73.00  ? 39  VAL A CG1   1 
ATOM   260  C  CG2   . VAL A 1  42  ? -76.293 31.837 -64.724 1.00 72.96  ? 39  VAL A CG2   1 
ATOM   261  N  N     . SER A 1  43  ? -74.994 32.659 -67.400 1.00 74.09  ? 40  SER A N     1 
ATOM   262  C  CA    . SER A 1  43  ? -74.380 33.873 -67.904 1.00 74.90  ? 40  SER A CA    1 
ATOM   263  C  C     . SER A 1  43  ? -74.393 34.971 -66.840 1.00 75.20  ? 40  SER A C     1 
ATOM   264  O  O     . SER A 1  43  ? -75.383 35.696 -66.672 1.00 75.48  ? 40  SER A O     1 
ATOM   265  C  CB    . SER A 1  43  ? -75.083 34.333 -69.181 1.00 74.99  ? 40  SER A CB    1 
ATOM   266  O  OG    . SER A 1  43  ? -74.465 35.498 -69.689 1.00 75.66  ? 40  SER A OG    1 
ATOM   267  N  N     . ARG A 1  44  ? -73.286 35.081 -66.113 1.00 75.45  ? 41  ARG A N     1 
ATOM   268  C  CA    . ARG A 1  44  ? -73.170 36.081 -65.059 1.00 75.50  ? 41  ARG A CA    1 
ATOM   269  C  C     . ARG A 1  44  ? -72.420 37.311 -65.567 1.00 75.64  ? 41  ARG A C     1 
ATOM   270  O  O     . ARG A 1  44  ? -71.723 37.223 -66.588 1.00 75.71  ? 41  ARG A O     1 
ATOM   271  C  CB    . ARG A 1  44  ? -72.533 35.463 -63.817 1.00 75.34  ? 41  ARG A CB    1 
ATOM   272  C  CG    . ARG A 1  44  ? -73.523 34.587 -63.055 1.00 75.29  ? 41  ARG A CG    1 
ATOM   273  C  CD    . ARG A 1  44  ? -73.067 34.235 -61.656 1.00 75.49  ? 41  ARG A CD    1 
ATOM   274  N  NE    . ARG A 1  44  ? -72.935 35.395 -60.772 1.00 76.38  ? 41  ARG A NE    1 
ATOM   275  C  CZ    . ARG A 1  44  ? -73.928 35.943 -60.072 1.00 76.28  ? 41  ARG A CZ    1 
ATOM   276  N  NH1   . ARG A 1  44  ? -75.162 35.457 -60.141 1.00 76.44  ? 41  ARG A NH1   1 
ATOM   277  N  NH2   . ARG A 1  44  ? -73.684 36.994 -59.301 1.00 76.32  ? 41  ARG A NH2   1 
ATOM   278  N  N     . PRO A 1  45  ? -72.591 38.473 -64.895 1.00 75.75  ? 42  PRO A N     1 
ATOM   279  C  CA    . PRO A 1  45  ? -71.910 39.677 -65.372 1.00 75.74  ? 42  PRO A CA    1 
ATOM   280  C  C     . PRO A 1  45  ? -70.443 39.463 -65.753 1.00 75.69  ? 42  PRO A C     1 
ATOM   281  O  O     . PRO A 1  45  ? -70.021 39.980 -66.776 1.00 75.90  ? 42  PRO A O     1 
ATOM   282  C  CB    . PRO A 1  45  ? -72.061 40.638 -64.193 1.00 75.77  ? 42  PRO A CB    1 
ATOM   283  C  CG    . PRO A 1  45  ? -73.433 40.311 -63.678 1.00 75.49  ? 42  PRO A CG    1 
ATOM   284  C  CD    . PRO A 1  45  ? -73.554 38.802 -63.821 1.00 75.71  ? 42  PRO A CD    1 
ATOM   285  N  N     . GLU A 1  46  ? -69.694 38.678 -64.976 1.00 75.66  ? 43  GLU A N     1 
ATOM   286  C  CA    . GLU A 1  46  ? -68.257 38.466 -65.236 1.00 75.69  ? 43  GLU A CA    1 
ATOM   287  C  C     . GLU A 1  46  ? -67.985 37.552 -66.448 1.00 74.64  ? 43  GLU A C     1 
ATOM   288  O  O     . GLU A 1  46  ? -66.878 37.554 -67.018 1.00 74.95  ? 43  GLU A O     1 
ATOM   289  C  CB    . GLU A 1  46  ? -67.531 37.902 -63.998 1.00 76.40  ? 43  GLU A CB    1 
ATOM   290  C  CG    . GLU A 1  46  ? -68.088 38.330 -62.631 1.00 79.39  ? 43  GLU A CG    1 
ATOM   291  C  CD    . GLU A 1  46  ? -69.273 37.464 -62.181 1.00 84.03  ? 43  GLU A CD    1 
ATOM   292  O  OE1   . GLU A 1  46  ? -69.296 36.251 -62.528 1.00 84.50  ? 43  GLU A OE1   1 
ATOM   293  O  OE2   . GLU A 1  46  ? -70.175 38.004 -61.482 1.00 85.70  ? 43  GLU A OE2   1 
ATOM   294  N  N     . GLY A 1  47  ? -68.992 36.767 -66.828 1.00 72.96  ? 44  GLY A N     1 
ATOM   295  C  CA    . GLY A 1  47  ? -68.849 35.799 -67.905 1.00 70.30  ? 44  GLY A CA    1 
ATOM   296  C  C     . GLY A 1  47  ? -69.671 34.554 -67.661 1.00 68.66  ? 44  GLY A C     1 
ATOM   297  O  O     . GLY A 1  47  ? -70.525 34.508 -66.770 1.00 68.52  ? 44  GLY A O     1 
ATOM   298  N  N     . VAL A 1  48  ? -69.406 33.536 -68.468 1.00 66.98  ? 45  VAL A N     1 
ATOM   299  C  CA    . VAL A 1  48  ? -70.154 32.291 -68.415 1.00 65.01  ? 45  VAL A CA    1 
ATOM   300  C  C     . VAL A 1  48  ? -69.425 31.333 -67.488 1.00 63.62  ? 45  VAL A C     1 
ATOM   301  O  O     . VAL A 1  48  ? -68.237 31.071 -67.677 1.00 63.37  ? 45  VAL A O     1 
ATOM   302  C  CB    . VAL A 1  48  ? -70.296 31.672 -69.834 1.00 65.12  ? 45  VAL A CB    1 
ATOM   303  C  CG1   . VAL A 1  48  ? -71.092 30.378 -69.792 1.00 64.49  ? 45  VAL A CG1   1 
ATOM   304  C  CG2   . VAL A 1  48  ? -70.956 32.661 -70.778 1.00 65.17  ? 45  VAL A CG2   1 
ATOM   305  N  N     . LYS A 1  49  ? -70.135 30.818 -66.491 1.00 61.82  ? 46  LYS A N     1 
ATOM   306  C  CA    . LYS A 1  49  ? -69.537 29.905 -65.534 1.00 60.47  ? 46  LYS A CA    1 
ATOM   307  C  C     . LYS A 1  49  ? -70.283 28.592 -65.526 1.00 59.98  ? 46  LYS A C     1 
ATOM   308  O  O     . LYS A 1  49  ? -71.470 28.552 -65.777 1.00 59.84  ? 46  LYS A O     1 
ATOM   309  C  CB    . LYS A 1  49  ? -69.527 30.515 -64.126 1.00 60.05  ? 46  LYS A CB    1 
ATOM   310  C  CG    . LYS A 1  49  ? -68.888 31.894 -64.031 1.00 59.32  ? 46  LYS A CG    1 
ATOM   311  C  CD    . LYS A 1  49  ? -67.400 31.862 -64.369 1.00 59.16  ? 46  LYS A CD    1 
ATOM   312  C  CE    . LYS A 1  49  ? -66.823 33.270 -64.417 1.00 59.23  ? 46  LYS A CE    1 
ATOM   313  N  NZ    . LYS A 1  49  ? -65.335 33.257 -64.482 1.00 58.12  ? 46  LYS A NZ    1 
ATOM   314  N  N     . ILE A 1  50  ? -69.580 27.512 -65.228 1.00 59.53  ? 47  ILE A N     1 
ATOM   315  C  CA    . ILE A 1  50  ? -70.214 26.223 -65.062 1.00 58.97  ? 47  ILE A CA    1 
ATOM   316  C  C     . ILE A 1  50  ? -70.840 26.127 -63.664 1.00 59.37  ? 47  ILE A C     1 
ATOM   317  O  O     . ILE A 1  50  ? -70.217 26.488 -62.673 1.00 59.47  ? 47  ILE A O     1 
ATOM   318  C  CB    . ILE A 1  50  ? -69.184 25.105 -65.282 1.00 58.77  ? 47  ILE A CB    1 
ATOM   319  C  CG1   . ILE A 1  50  ? -68.692 25.131 -66.735 1.00 58.29  ? 47  ILE A CG1   1 
ATOM   320  C  CG2   . ILE A 1  50  ? -69.744 23.744 -64.878 1.00 57.75  ? 47  ILE A CG2   1 
ATOM   321  C  CD1   . ILE A 1  50  ? -67.270 24.590 -66.935 1.00 57.85  ? 47  ILE A CD1   1 
ATOM   322  N  N     . ILE A 1  51  ? -72.078 25.656 -63.588 1.00 59.59  ? 48  ILE A N     1 
ATOM   323  C  CA    . ILE A 1  51  ? -72.693 25.379 -62.312 1.00 60.03  ? 48  ILE A CA    1 
ATOM   324  C  C     . ILE A 1  51  ? -72.589 23.905 -62.060 1.00 61.10  ? 48  ILE A C     1 
ATOM   325  O  O     . ILE A 1  51  ? -73.402 23.148 -62.569 1.00 61.94  ? 48  ILE A O     1 
ATOM   326  C  CB    . ILE A 1  51  ? -74.174 25.726 -62.289 1.00 59.61  ? 48  ILE A CB    1 
ATOM   327  C  CG1   . ILE A 1  51  ? -74.375 27.205 -62.579 1.00 58.85  ? 48  ILE A CG1   1 
ATOM   328  C  CG2   . ILE A 1  51  ? -74.764 25.362 -60.929 1.00 59.52  ? 48  ILE A CG2   1 
ATOM   329  C  CD1   . ILE A 1  51  ? -75.786 27.623 -62.557 1.00 57.64  ? 48  ILE A CD1   1 
ATOM   330  N  N     . PRO A 1  52  ? -71.600 23.475 -61.266 1.00 62.00  ? 49  PRO A N     1 
ATOM   331  C  CA    . PRO A 1  52  ? -71.530 22.043 -61.011 1.00 62.38  ? 49  PRO A CA    1 
ATOM   332  C  C     . PRO A 1  52  ? -72.688 21.554 -60.144 1.00 62.95  ? 49  PRO A C     1 
ATOM   333  O  O     . PRO A 1  52  ? -73.258 22.325 -59.365 1.00 62.16  ? 49  PRO A O     1 
ATOM   334  C  CB    . PRO A 1  52  ? -70.201 21.882 -60.261 1.00 62.66  ? 49  PRO A CB    1 
ATOM   335  C  CG    . PRO A 1  52  ? -69.979 23.192 -59.585 1.00 61.78  ? 49  PRO A CG    1 
ATOM   336  C  CD    . PRO A 1  52  ? -70.594 24.232 -60.490 1.00 62.14  ? 49  PRO A CD    1 
ATOM   337  N  N     . PRO A 1  53  ? -73.046 20.276 -60.302 1.00 64.03  ? 50  PRO A N     1 
ATOM   338  C  CA    . PRO A 1  53  ? -73.999 19.610 -59.417 1.00 64.81  ? 50  PRO A CA    1 
ATOM   339  C  C     . PRO A 1  53  ? -73.474 19.613 -57.988 1.00 65.49  ? 50  PRO A C     1 
ATOM   340  O  O     . PRO A 1  53  ? -72.277 19.423 -57.778 1.00 65.72  ? 50  PRO A O     1 
ATOM   341  C  CB    . PRO A 1  53  ? -74.034 18.168 -59.955 1.00 64.76  ? 50  PRO A CB    1 
ATOM   342  C  CG    . PRO A 1  53  ? -72.818 18.027 -60.845 1.00 64.61  ? 50  PRO A CG    1 
ATOM   343  C  CD    . PRO A 1  53  ? -72.602 19.397 -61.403 1.00 64.28  ? 50  PRO A CD    1 
ATOM   344  N  N     . GLN A 1  54  ? -74.361 19.811 -57.019 1.00 66.13  ? 51  GLN A N     1 
ATOM   345  C  CA    . GLN A 1  54  ? -73.966 19.863 -55.614 1.00 66.73  ? 51  GLN A CA    1 
ATOM   346  C  C     . GLN A 1  54  ? -73.109 18.679 -55.173 1.00 66.17  ? 51  GLN A C     1 
ATOM   347  O  O     . GLN A 1  54  ? -72.243 18.826 -54.304 1.00 66.45  ? 51  GLN A O     1 
ATOM   348  C  CB    . GLN A 1  54  ? -75.192 19.997 -54.719 1.00 67.27  ? 51  GLN A CB    1 
ATOM   349  C  CG    . GLN A 1  54  ? -74.863 20.291 -53.268 1.00 70.91  ? 51  GLN A CG    1 
ATOM   350  C  CD    . GLN A 1  54  ? -76.102 20.421 -52.395 1.00 76.09  ? 51  GLN A CD    1 
ATOM   351  O  OE1   . GLN A 1  54  ? -77.232 20.540 -52.896 1.00 78.38  ? 51  GLN A OE1   1 
ATOM   352  N  NE2   . GLN A 1  54  ? -75.895 20.408 -51.077 1.00 77.20  ? 51  GLN A NE2   1 
ATOM   353  N  N     . SER A 1  55  ? -73.328 17.518 -55.782 1.00 65.76  ? 52  SER A N     1 
ATOM   354  C  CA    . SER A 1  55  ? -72.572 16.311 -55.424 1.00 65.42  ? 52  SER A CA    1 
ATOM   355  C  C     . SER A 1  55  ? -71.109 16.361 -55.860 1.00 65.15  ? 52  SER A C     1 
ATOM   356  O  O     . SER A 1  55  ? -70.348 15.443 -55.570 1.00 65.38  ? 52  SER A O     1 
ATOM   357  C  CB    . SER A 1  55  ? -73.228 15.068 -56.017 1.00 65.39  ? 52  SER A CB    1 
ATOM   358  O  OG    . SER A 1  55  ? -73.343 15.209 -57.417 1.00 64.99  ? 52  SER A OG    1 
ATOM   359  N  N     . ASP A 1  56  ? -70.734 17.431 -56.555 1.00 64.58  ? 53  ASP A N     1 
ATOM   360  C  CA    . ASP A 1  56  ? -69.390 17.618 -57.081 1.00 64.44  ? 53  ASP A CA    1 
ATOM   361  C  C     . ASP A 1  56  ? -68.605 18.729 -56.374 1.00 63.97  ? 53  ASP A C     1 
ATOM   362  O  O     . ASP A 1  56  ? -67.372 18.824 -56.492 1.00 63.90  ? 53  ASP A O     1 
ATOM   363  C  CB    . ASP A 1  56  ? -69.491 18.001 -58.552 1.00 65.02  ? 53  ASP A CB    1 
ATOM   364  C  CG    . ASP A 1  56  ? -69.377 16.821 -59.478 1.00 66.58  ? 53  ASP A CG    1 
ATOM   365  O  OD1   . ASP A 1  56  ? -69.039 15.705 -59.016 1.00 67.82  ? 53  ASP A OD1   1 
ATOM   366  O  OD2   . ASP A 1  56  ? -69.612 17.035 -60.687 1.00 68.92  ? 53  ASP A OD2   1 
ATOM   367  N  N     . ARG A 1  57  ? -69.331 19.578 -55.656 1.00 63.12  ? 54  ARG A N     1 
ATOM   368  C  CA    . ARG A 1  57  ? -68.790 20.826 -55.160 1.00 62.21  ? 54  ARG A CA    1 
ATOM   369  C  C     . ARG A 1  57  ? -67.706 20.661 -54.089 1.00 61.98  ? 54  ARG A C     1 
ATOM   370  O  O     . ARG A 1  57  ? -66.674 21.314 -54.148 1.00 62.11  ? 54  ARG A O     1 
ATOM   371  C  CB    . ARG A 1  57  ? -69.928 21.741 -54.710 1.00 61.95  ? 54  ARG A CB    1 
ATOM   372  C  CG    . ARG A 1  57  ? -70.844 22.107 -55.864 1.00 60.48  ? 54  ARG A CG    1 
ATOM   373  C  CD    . ARG A 1  57  ? -71.981 22.991 -55.438 1.00 58.28  ? 54  ARG A CD    1 
ATOM   374  N  NE    . ARG A 1  57  ? -72.953 23.114 -56.513 1.00 56.66  ? 54  ARG A NE    1 
ATOM   375  C  CZ    . ARG A 1  57  ? -74.141 23.692 -56.389 1.00 55.19  ? 54  ARG A CZ    1 
ATOM   376  N  NH1   . ARG A 1  57  ? -74.509 24.216 -55.238 1.00 55.22  ? 54  ARG A NH1   1 
ATOM   377  N  NH2   . ARG A 1  57  ? -74.960 23.749 -57.422 1.00 54.58  ? 54  ARG A NH2   1 
ATOM   378  N  N     . GLN A 1  58  ? -67.920 19.775 -53.130 1.00 61.58  ? 55  GLN A N     1 
ATOM   379  C  CA    . GLN A 1  58  ? -66.896 19.529 -52.141 1.00 61.35  ? 55  GLN A CA    1 
ATOM   380  C  C     . GLN A 1  58  ? -65.564 19.251 -52.843 1.00 60.52  ? 55  GLN A C     1 
ATOM   381  O  O     . GLN A 1  58  ? -64.561 19.899 -52.542 1.00 61.13  ? 55  GLN A O     1 
ATOM   382  C  CB    . GLN A 1  58  ? -67.298 18.390 -51.200 1.00 61.75  ? 55  GLN A CB    1 
ATOM   383  C  CG    . GLN A 1  58  ? -66.111 17.597 -50.636 1.00 64.67  ? 55  GLN A CG    1 
ATOM   384  C  CD    . GLN A 1  58  ? -66.408 16.874 -49.322 1.00 68.37  ? 55  GLN A CD    1 
ATOM   385  O  OE1   . GLN A 1  58  ? -67.232 17.324 -48.513 1.00 69.21  ? 55  GLN A OE1   1 
ATOM   386  N  NE2   . GLN A 1  58  ? -65.711 15.756 -49.096 1.00 68.94  ? 55  GLN A NE2   1 
ATOM   387  N  N     . LYS A 1  59  ? -65.568 18.323 -53.798 1.00 59.21  ? 56  LYS A N     1 
ATOM   388  C  CA    . LYS A 1  59  ? -64.358 17.926 -54.525 1.00 58.03  ? 56  LYS A CA    1 
ATOM   389  C  C     . LYS A 1  59  ? -63.671 19.117 -55.221 1.00 56.69  ? 56  LYS A C     1 
ATOM   390  O  O     . LYS A 1  59  ? -62.442 19.191 -55.282 1.00 56.08  ? 56  LYS A O     1 
ATOM   391  C  CB    . LYS A 1  59  ? -64.717 16.858 -55.564 1.00 58.51  ? 56  LYS A CB    1 
ATOM   392  C  CG    . LYS A 1  59  ? -63.568 15.970 -56.000 1.00 60.76  ? 56  LYS A CG    1 
ATOM   393  C  CD    . LYS A 1  59  ? -63.838 15.321 -57.362 1.00 65.24  ? 56  LYS A CD    1 
ATOM   394  C  CE    . LYS A 1  59  ? -62.702 14.338 -57.736 1.00 67.88  ? 56  LYS A CE    1 
ATOM   395  N  NZ    . LYS A 1  59  ? -62.932 13.654 -59.055 1.00 69.69  ? 56  LYS A NZ    1 
ATOM   396  N  N     . ILE A 1  60  ? -64.481 20.028 -55.762 1.00 55.09  ? 57  ILE A N     1 
ATOM   397  C  CA    . ILE A 1  60  ? -63.981 21.206 -56.446 1.00 53.42  ? 57  ILE A CA    1 
ATOM   398  C  C     . ILE A 1  60  ? -63.266 22.122 -55.458 1.00 52.79  ? 57  ILE A C     1 
ATOM   399  O  O     . ILE A 1  60  ? -62.105 22.495 -55.680 1.00 52.39  ? 57  ILE A O     1 
ATOM   400  C  CB    . ILE A 1  60  ? -65.104 21.929 -57.220 1.00 53.32  ? 57  ILE A CB    1 
ATOM   401  C  CG1   . ILE A 1  60  ? -65.543 21.054 -58.409 1.00 53.34  ? 57  ILE A CG1   1 
ATOM   402  C  CG2   . ILE A 1  60  ? -64.661 23.333 -57.680 1.00 52.34  ? 57  ILE A CG2   1 
ATOM   403  C  CD1   . ILE A 1  60  ? -66.613 21.665 -59.313 1.00 51.27  ? 57  ILE A CD1   1 
ATOM   404  N  N     . VAL A 1  61  ? -63.949 22.449 -54.362 1.00 51.75  ? 58  VAL A N     1 
ATOM   405  C  CA    . VAL A 1  61  ? -63.397 23.298 -53.312 1.00 50.93  ? 58  VAL A CA    1 
ATOM   406  C  C     . VAL A 1  61  ? -62.092 22.691 -52.799 1.00 50.89  ? 58  VAL A C     1 
ATOM   407  O  O     . VAL A 1  61  ? -61.082 23.370 -52.608 1.00 50.69  ? 58  VAL A O     1 
ATOM   408  C  CB    . VAL A 1  61  ? -64.397 23.472 -52.153 1.00 50.64  ? 58  VAL A CB    1 
ATOM   409  C  CG1   . VAL A 1  61  ? -63.802 24.345 -51.047 1.00 49.96  ? 58  VAL A CG1   1 
ATOM   410  C  CG2   . VAL A 1  61  ? -65.676 24.083 -52.658 1.00 49.54  ? 58  VAL A CG2   1 
ATOM   411  N  N     . LEU A 1  62  ? -62.115 21.388 -52.621 1.00 50.89  ? 59  LEU A N     1 
ATOM   412  C  CA    . LEU A 1  62  ? -60.957 20.679 -52.166 1.00 51.31  ? 59  LEU A CA    1 
ATOM   413  C  C     . LEU A 1  62  ? -59.787 20.787 -53.150 1.00 50.86  ? 59  LEU A C     1 
ATOM   414  O  O     . LEU A 1  62  ? -58.647 20.969 -52.740 1.00 50.86  ? 59  LEU A O     1 
ATOM   415  C  CB    . LEU A 1  62  ? -61.342 19.231 -51.931 1.00 51.80  ? 59  LEU A CB    1 
ATOM   416  C  CG    . LEU A 1  62  ? -60.292 18.457 -51.158 1.00 54.99  ? 59  LEU A CG    1 
ATOM   417  C  CD1   . LEU A 1  62  ? -60.205 19.030 -49.720 1.00 56.44  ? 59  LEU A CD1   1 
ATOM   418  C  CD2   . LEU A 1  62  ? -60.537 16.909 -51.220 1.00 56.48  ? 59  LEU A CD2   1 
ATOM   419  N  N     . GLN A 1  63  ? -60.073 20.688 -54.444 1.00 50.55  ? 60  GLN A N     1 
ATOM   420  C  CA    . GLN A 1  63  ? -59.034 20.766 -55.462 1.00 50.31  ? 60  GLN A CA    1 
ATOM   421  C  C     . GLN A 1  63  ? -58.432 22.163 -55.526 1.00 48.97  ? 60  GLN A C     1 
ATOM   422  O  O     . GLN A 1  63  ? -57.219 22.331 -55.621 1.00 48.93  ? 60  GLN A O     1 
ATOM   423  C  CB    . GLN A 1  63  ? -59.585 20.359 -56.823 1.00 50.93  ? 60  GLN A CB    1 
ATOM   424  C  CG    . GLN A 1  63  ? -59.537 18.852 -57.044 1.00 55.09  ? 60  GLN A CG    1 
ATOM   425  C  CD    . GLN A 1  63  ? -60.420 18.356 -58.223 1.00 60.87  ? 60  GLN A CD    1 
ATOM   426  O  OE1   . GLN A 1  63  ? -60.474 17.141 -58.486 1.00 62.23  ? 60  GLN A OE1   1 
ATOM   427  N  NE2   . GLN A 1  63  ? -61.111 19.287 -58.926 1.00 60.50  ? 60  GLN A NE2   1 
ATOM   428  N  N     . ALA A 1  64  ? -59.293 23.160 -55.481 1.00 47.45  ? 61  ALA A N     1 
ATOM   429  C  CA    . ALA A 1  64  ? -58.841 24.513 -55.509 1.00 46.24  ? 61  ALA A CA    1 
ATOM   430  C  C     . ALA A 1  64  ? -57.996 24.751 -54.275 1.00 45.71  ? 61  ALA A C     1 
ATOM   431  O  O     . ALA A 1  64  ? -56.846 25.174 -54.406 1.00 45.84  ? 61  ALA A O     1 
ATOM   432  C  CB    . ALA A 1  64  ? -59.999 25.456 -55.560 1.00 46.06  ? 61  ALA A CB    1 
ATOM   433  N  N     . HIS A 1  65  ? -58.532 24.441 -53.091 1.00 44.56  ? 62  HIS A N     1 
ATOM   434  C  CA    . HIS A 1  65  ? -57.781 24.667 -51.858 1.00 43.54  ? 62  HIS A CA    1 
ATOM   435  C  C     . HIS A 1  65  ? -56.421 23.980 -51.890 1.00 43.07  ? 62  HIS A C     1 
ATOM   436  O  O     . HIS A 1  65  ? -55.417 24.571 -51.499 1.00 42.91  ? 62  HIS A O     1 
ATOM   437  C  CB    . HIS A 1  65  ? -58.555 24.270 -50.584 1.00 43.20  ? 62  HIS A CB    1 
ATOM   438  C  CG    . HIS A 1  65  ? -57.726 24.353 -49.329 1.00 43.29  ? 62  HIS A CG    1 
ATOM   439  N  ND1   . HIS A 1  65  ? -57.451 25.548 -48.696 1.00 42.27  ? 62  HIS A ND1   1 
ATOM   440  C  CD2   . HIS A 1  65  ? -57.074 23.395 -48.620 1.00 42.19  ? 62  HIS A CD2   1 
ATOM   441  C  CE1   . HIS A 1  65  ? -56.688 25.318 -47.641 1.00 41.89  ? 62  HIS A CE1   1 
ATOM   442  N  NE2   . HIS A 1  65  ? -56.445 24.021 -47.572 1.00 40.74  ? 62  HIS A NE2   1 
ATOM   443  N  N     . ASN A 1  66  ? -56.371 22.746 -52.368 1.00 42.75  ? 63  ASN A N     1 
ATOM   444  C  CA    . ASN A 1  66  ? -55.124 21.973 -52.244 1.00 42.95  ? 63  ASN A CA    1 
ATOM   445  C  C     . ASN A 1  66  ? -53.941 22.415 -53.110 1.00 42.28  ? 63  ASN A C     1 
ATOM   446  O  O     . ASN A 1  66  ? -52.820 21.975 -52.889 1.00 42.19  ? 63  ASN A O     1 
ATOM   447  C  CB    . ASN A 1  66  ? -55.385 20.470 -52.424 1.00 43.43  ? 63  ASN A CB    1 
ATOM   448  C  CG    . ASN A 1  66  ? -56.067 19.848 -51.219 1.00 44.62  ? 63  ASN A CG    1 
ATOM   449  O  OD1   . ASN A 1  66  ? -56.116 20.434 -50.133 1.00 46.91  ? 63  ASN A OD1   1 
ATOM   450  N  ND2   . ASN A 1  66  ? -56.611 18.663 -51.410 1.00 45.16  ? 63  ASN A ND2   1 
ATOM   451  N  N     . LEU A 1  67  ? -54.194 23.277 -54.092 1.00 41.81  ? 64  LEU A N     1 
ATOM   452  C  CA    . LEU A 1  67  ? -53.150 23.729 -54.990 1.00 41.03  ? 64  LEU A CA    1 
ATOM   453  C  C     . LEU A 1  67  ? -52.024 24.359 -54.195 1.00 41.12  ? 64  LEU A C     1 
ATOM   454  O  O     . LEU A 1  67  ? -50.873 23.993 -54.375 1.00 41.51  ? 64  LEU A O     1 
ATOM   455  C  CB    . LEU A 1  67  ? -53.707 24.711 -56.012 1.00 41.23  ? 64  LEU A CB    1 
ATOM   456  C  CG    . LEU A 1  67  ? -54.791 24.166 -56.972 1.00 40.48  ? 64  LEU A CG    1 
ATOM   457  C  CD1   . LEU A 1  67  ? -55.419 25.303 -57.764 1.00 39.60  ? 64  LEU A CD1   1 
ATOM   458  C  CD2   . LEU A 1  67  ? -54.253 23.094 -57.908 1.00 37.77  ? 64  LEU A CD2   1 
ATOM   459  N  N     . ALA A 1  68  ? -52.357 25.273 -53.288 1.00 40.63  ? 65  ALA A N     1 
ATOM   460  C  CA    . ALA A 1  68  ? -51.354 25.892 -52.418 1.00 40.12  ? 65  ALA A CA    1 
ATOM   461  C  C     . ALA A 1  68  ? -51.838 26.025 -50.972 1.00 39.83  ? 65  ALA A C     1 
ATOM   462  O  O     . ALA A 1  68  ? -51.237 26.734 -50.175 1.00 39.44  ? 65  ALA A O     1 
ATOM   463  C  CB    . ALA A 1  68  ? -50.922 27.257 -52.976 1.00 39.83  ? 65  ALA A CB    1 
ATOM   464  N  N     . HIS A 1  69  ? -52.921 25.331 -50.643 1.00 39.72  ? 66  HIS A N     1 
ATOM   465  C  CA    . HIS A 1  69  ? -53.523 25.386 -49.302 1.00 39.60  ? 66  HIS A CA    1 
ATOM   466  C  C     . HIS A 1  69  ? -53.861 26.802 -48.900 1.00 39.66  ? 66  HIS A C     1 
ATOM   467  O  O     . HIS A 1  69  ? -53.476 27.271 -47.832 1.00 40.08  ? 66  HIS A O     1 
ATOM   468  C  CB    . HIS A 1  69  ? -52.672 24.664 -48.255 1.00 38.90  ? 66  HIS A CB    1 
ATOM   469  C  CG    . HIS A 1  69  ? -52.818 23.176 -48.301 1.00 39.11  ? 66  HIS A CG    1 
ATOM   470  N  ND1   . HIS A 1  69  ? -53.767 22.495 -47.560 1.00 38.33  ? 66  HIS A ND1   1 
ATOM   471  C  CD2   . HIS A 1  69  ? -52.162 22.238 -49.028 1.00 39.28  ? 66  HIS A CD2   1 
ATOM   472  C  CE1   . HIS A 1  69  ? -53.671 21.201 -47.813 1.00 38.38  ? 66  HIS A CE1   1 
ATOM   473  N  NE2   . HIS A 1  69  ? -52.711 21.017 -48.706 1.00 38.84  ? 66  HIS A NE2   1 
ATOM   474  N  N     . THR A 1  70  ? -54.599 27.462 -49.780 1.00 39.36  ? 67  THR A N     1 
ATOM   475  C  CA    . THR A 1  70  ? -54.955 28.855 -49.631 1.00 39.27  ? 67  THR A CA    1 
ATOM   476  C  C     . THR A 1  70  ? -56.153 29.078 -48.689 1.00 39.38  ? 67  THR A C     1 
ATOM   477  O  O     . THR A 1  70  ? -56.954 28.170 -48.432 1.00 38.97  ? 67  THR A O     1 
ATOM   478  C  CB    . THR A 1  70  ? -55.223 29.490 -51.024 1.00 39.48  ? 67  THR A CB    1 
ATOM   479  O  OG1   . THR A 1  70  ? -56.142 28.675 -51.766 1.00 40.44  ? 67  THR A OG1   1 
ATOM   480  C  CG2   . THR A 1  70  ? -53.944 29.599 -51.822 1.00 37.93  ? 67  THR A CG2   1 
ATOM   481  N  N     . GLY A 1  71  ? -56.258 30.302 -48.176 1.00 39.27  ? 68  GLY A N     1 
ATOM   482  C  CA    . GLY A 1  71  ? -57.363 30.696 -47.311 1.00 39.04  ? 68  GLY A CA    1 
ATOM   483  C  C     . GLY A 1  71  ? -58.571 31.059 -48.135 1.00 39.17  ? 68  GLY A C     1 
ATOM   484  O  O     . GLY A 1  71  ? -58.659 30.673 -49.289 1.00 39.57  ? 68  GLY A O     1 
ATOM   485  N  N     . ARG A 1  72  ? -59.489 31.827 -47.558 1.00 39.44  ? 69  ARG A N     1 
ATOM   486  C  CA    . ARG A 1  72  ? -60.822 32.024 -48.140 1.00 39.99  ? 69  ARG A CA    1 
ATOM   487  C  C     . ARG A 1  72  ? -60.817 32.627 -49.531 1.00 40.71  ? 69  ARG A C     1 
ATOM   488  O  O     . ARG A 1  72  ? -61.210 31.969 -50.495 1.00 41.47  ? 69  ARG A O     1 
ATOM   489  C  CB    . ARG A 1  72  ? -61.701 32.880 -47.231 1.00 39.81  ? 69  ARG A CB    1 
ATOM   490  C  CG    . ARG A 1  72  ? -63.184 32.857 -47.584 1.00 39.50  ? 69  ARG A CG    1 
ATOM   491  C  CD    . ARG A 1  72  ? -63.783 34.220 -47.390 1.00 38.61  ? 69  ARG A CD    1 
ATOM   492  N  NE    . ARG A 1  72  ? -63.520 34.667 -46.037 1.00 39.05  ? 69  ARG A NE    1 
ATOM   493  C  CZ    . ARG A 1  72  ? -63.191 35.905 -45.677 1.00 39.26  ? 69  ARG A CZ    1 
ATOM   494  N  NH1   . ARG A 1  72  ? -63.063 36.894 -46.560 1.00 35.76  ? 69  ARG A NH1   1 
ATOM   495  N  NH2   . ARG A 1  72  ? -62.983 36.142 -44.395 1.00 40.50  ? 69  ARG A NH2   1 
ATOM   496  N  N     . GLU A 1  73  ? -60.383 33.879 -49.625 1.00 40.87  ? 70  GLU A N     1 
ATOM   497  C  CA    . GLU A 1  73  ? -60.392 34.608 -50.882 1.00 40.69  ? 70  GLU A CA    1 
ATOM   498  C  C     . GLU A 1  73  ? -59.519 33.972 -51.963 1.00 40.90  ? 70  GLU A C     1 
ATOM   499  O  O     . GLU A 1  73  ? -59.969 33.799 -53.100 1.00 41.30  ? 70  GLU A O     1 
ATOM   500  C  CB    . GLU A 1  73  ? -60.016 36.068 -50.649 1.00 40.55  ? 70  GLU A CB    1 
ATOM   501  C  CG    . GLU A 1  73  ? -60.964 36.771 -49.702 1.00 40.34  ? 70  GLU A CG    1 
ATOM   502  C  CD    . GLU A 1  73  ? -62.413 36.701 -50.169 1.00 41.25  ? 70  GLU A CD    1 
ATOM   503  O  OE1   . GLU A 1  73  ? -62.650 37.078 -51.341 1.00 41.01  ? 70  GLU A OE1   1 
ATOM   504  O  OE2   . GLU A 1  73  ? -63.303 36.282 -49.372 1.00 39.26  ? 70  GLU A OE2   1 
ATOM   505  N  N     . ALA A 1  74  ? -58.289 33.605 -51.624 1.00 40.90  ? 71  ALA A N     1 
ATOM   506  C  CA    . ALA A 1  74  ? -57.403 32.993 -52.619 1.00 40.91  ? 71  ALA A CA    1 
ATOM   507  C  C     . ALA A 1  74  ? -57.976 31.675 -53.164 1.00 41.05  ? 71  ALA A C     1 
ATOM   508  O  O     . ALA A 1  74  ? -57.777 31.337 -54.318 1.00 41.33  ? 71  ALA A O     1 
ATOM   509  C  CB    . ALA A 1  74  ? -56.004 32.809 -52.068 1.00 40.04  ? 71  ALA A CB    1 
ATOM   510  N  N     . THR A 1  75  ? -58.707 30.941 -52.343 1.00 41.68  ? 72  THR A N     1 
ATOM   511  C  CA    . THR A 1  75  ? -59.368 29.728 -52.812 1.00 41.74  ? 72  THR A CA    1 
ATOM   512  C  C     . THR A 1  75  ? -60.577 30.095 -53.661 1.00 42.14  ? 72  THR A C     1 
ATOM   513  O  O     . THR A 1  75  ? -60.722 29.598 -54.783 1.00 42.61  ? 72  THR A O     1 
ATOM   514  C  CB    . THR A 1  75  ? -59.812 28.855 -51.660 1.00 41.45  ? 72  THR A CB    1 
ATOM   515  O  OG1   . THR A 1  75  ? -58.707 28.677 -50.769 1.00 41.07  ? 72  THR A OG1   1 
ATOM   516  C  CG2   . THR A 1  75  ? -60.298 27.497 -52.176 1.00 41.57  ? 72  THR A CG2   1 
ATOM   517  N  N     . LEU A 1  76  ? -61.430 30.976 -53.152 1.00 41.86  ? 73  LEU A N     1 
ATOM   518  C  CA    . LEU A 1  76  ? -62.581 31.394 -53.938 1.00 42.43  ? 73  LEU A CA    1 
ATOM   519  C  C     . LEU A 1  76  ? -62.188 31.821 -55.366 1.00 42.60  ? 73  LEU A C     1 
ATOM   520  O  O     . LEU A 1  76  ? -62.767 31.343 -56.345 1.00 43.16  ? 73  LEU A O     1 
ATOM   521  C  CB    . LEU A 1  76  ? -63.384 32.511 -53.254 1.00 42.25  ? 73  LEU A CB    1 
ATOM   522  C  CG    . LEU A 1  76  ? -64.543 32.833 -54.204 1.00 43.11  ? 73  LEU A CG    1 
ATOM   523  C  CD1   . LEU A 1  76  ? -65.790 32.019 -53.882 1.00 42.95  ? 73  LEU A CD1   1 
ATOM   524  C  CD2   . LEU A 1  76  ? -64.850 34.296 -54.302 1.00 44.00  ? 73  LEU A CD2   1 
ATOM   525  N  N     . LEU A 1  77  ? -61.202 32.709 -55.470 1.00 42.52  ? 74  LEU A N     1 
ATOM   526  C  CA    . LEU A 1  77  ? -60.815 33.295 -56.745 1.00 42.06  ? 74  LEU A CA    1 
ATOM   527  C  C     . LEU A 1  77  ? -60.442 32.264 -57.792 1.00 42.51  ? 74  LEU A C     1 
ATOM   528  O  O     . LEU A 1  77  ? -60.675 32.499 -58.987 1.00 42.86  ? 74  LEU A O     1 
ATOM   529  C  CB    . LEU A 1  77  ? -59.676 34.290 -56.571 1.00 41.65  ? 74  LEU A CB    1 
ATOM   530  C  CG    . LEU A 1  77  ? -60.088 35.643 -55.974 1.00 40.35  ? 74  LEU A CG    1 
ATOM   531  C  CD1   . LEU A 1  77  ? -58.920 36.258 -55.193 1.00 38.98  ? 74  LEU A CD1   1 
ATOM   532  C  CD2   . LEU A 1  77  ? -60.581 36.585 -57.048 1.00 35.88  ? 74  LEU A CD2   1 
ATOM   533  N  N     . LYS A 1  78  ? -59.875 31.135 -57.360 1.00 42.11  ? 75  LYS A N     1 
ATOM   534  C  CA    . LYS A 1  78  ? -59.569 30.053 -58.287 1.00 41.81  ? 75  LYS A CA    1 
ATOM   535  C  C     . LYS A 1  78  ? -60.855 29.446 -58.788 1.00 42.03  ? 75  LYS A C     1 
ATOM   536  O  O     . LYS A 1  78  ? -61.065 29.329 -59.984 1.00 42.66  ? 75  LYS A O     1 
ATOM   537  C  CB    . LYS A 1  78  ? -58.732 28.964 -57.625 1.00 41.53  ? 75  LYS A CB    1 
ATOM   538  C  CG    . LYS A 1  78  ? -57.265 29.265 -57.593 1.00 40.89  ? 75  LYS A CG    1 
ATOM   539  C  CD    . LYS A 1  78  ? -56.612 29.060 -58.932 1.00 38.52  ? 75  LYS A CD    1 
ATOM   540  C  CE    . LYS A 1  78  ? -55.292 29.773 -58.974 1.00 37.35  ? 75  LYS A CE    1 
ATOM   541  N  NZ    . LYS A 1  78  ? -54.545 29.602 -60.254 1.00 36.57  ? 75  LYS A NZ    1 
ATOM   542  N  N     . ILE A 1  79  ? -61.728 29.071 -57.864 1.00 42.29  ? 76  ILE A N     1 
ATOM   543  C  CA    . ILE A 1  79  ? -62.969 28.401 -58.221 1.00 42.20  ? 76  ILE A CA    1 
ATOM   544  C  C     . ILE A 1  79  ? -63.765 29.290 -59.171 1.00 43.06  ? 76  ILE A C     1 
ATOM   545  O  O     . ILE A 1  79  ? -64.257 28.816 -60.204 1.00 42.97  ? 76  ILE A O     1 
ATOM   546  C  CB    . ILE A 1  79  ? -63.800 28.077 -56.972 1.00 42.13  ? 76  ILE A CB    1 
ATOM   547  C  CG1   . ILE A 1  79  ? -63.015 27.152 -56.043 1.00 40.47  ? 76  ILE A CG1   1 
ATOM   548  C  CG2   . ILE A 1  79  ? -65.156 27.488 -57.358 1.00 40.90  ? 76  ILE A CG2   1 
ATOM   549  C  CD1   . ILE A 1  79  ? -63.606 27.023 -54.676 1.00 39.85  ? 76  ILE A CD1   1 
ATOM   550  N  N     . ALA A 1  80  ? -63.840 30.582 -58.838 1.00 43.44  ? 77  ALA A N     1 
ATOM   551  C  CA    . ALA A 1  80  ? -64.631 31.532 -59.605 1.00 44.39  ? 77  ALA A CA    1 
ATOM   552  C  C     . ALA A 1  80  ? -64.187 31.623 -61.064 1.00 45.09  ? 77  ALA A C     1 
ATOM   553  O  O     . ALA A 1  80  ? -64.957 32.048 -61.914 1.00 45.72  ? 77  ALA A O     1 
ATOM   554  C  CB    . ALA A 1  80  ? -64.598 32.896 -58.957 1.00 44.27  ? 77  ALA A CB    1 
ATOM   555  N  N     . ASN A 1  81  ? -62.956 31.223 -61.353 1.00 45.65  ? 78  ASN A N     1 
ATOM   556  C  CA    . ASN A 1  81  ? -62.469 31.221 -62.722 1.00 46.52  ? 78  ASN A CA    1 
ATOM   557  C  C     . ASN A 1  81  ? -63.301 30.340 -63.655 1.00 47.50  ? 78  ASN A C     1 
ATOM   558  O  O     . ASN A 1  81  ? -63.490 30.680 -64.823 1.00 47.30  ? 78  ASN A O     1 
ATOM   559  C  CB    . ASN A 1  81  ? -61.005 30.776 -62.774 1.00 46.31  ? 78  ASN A CB    1 
ATOM   560  C  CG    . ASN A 1  81  ? -60.044 31.904 -62.485 1.00 45.17  ? 78  ASN A CG    1 
ATOM   561  O  OD1   . ASN A 1  81  ? -60.389 33.076 -62.591 1.00 43.89  ? 78  ASN A OD1   1 
ATOM   562  N  ND2   . ASN A 1  81  ? -58.827 31.552 -62.126 1.00 44.63  ? 78  ASN A ND2   1 
ATOM   563  N  N     . LEU A 1  82  ? -63.785 29.220 -63.115 1.00 48.51  ? 79  LEU A N     1 
ATOM   564  C  CA    . LEU A 1  82  ? -64.543 28.234 -63.865 1.00 49.28  ? 79  LEU A CA    1 
ATOM   565  C  C     . LEU A 1  82  ? -66.000 28.124 -63.438 1.00 50.66  ? 79  LEU A C     1 
ATOM   566  O  O     . LEU A 1  82  ? -66.881 27.936 -64.297 1.00 51.53  ? 79  LEU A O     1 
ATOM   567  C  CB    . LEU A 1  82  ? -63.904 26.862 -63.737 1.00 48.75  ? 79  LEU A CB    1 
ATOM   568  C  CG    . LEU A 1  82  ? -62.526 26.717 -64.364 1.00 48.09  ? 79  LEU A CG    1 
ATOM   569  C  CD1   . LEU A 1  82  ? -62.191 25.255 -64.435 1.00 47.23  ? 79  LEU A CD1   1 
ATOM   570  C  CD2   . LEU A 1  82  ? -62.474 27.355 -65.737 1.00 47.09  ? 79  LEU A CD2   1 
ATOM   571  N  N     . TYR A 1  83  ? -66.267 28.226 -62.136 1.00 51.11  ? 80  TYR A N     1 
ATOM   572  C  CA    . TYR A 1  83  ? -67.594 27.898 -61.643 1.00 51.92  ? 80  TYR A CA    1 
ATOM   573  C  C     . TYR A 1  83  ? -68.366 29.015 -61.006 1.00 52.48  ? 80  TYR A C     1 
ATOM   574  O  O     . TYR A 1  83  ? -67.815 30.057 -60.656 1.00 53.16  ? 80  TYR A O     1 
ATOM   575  C  CB    . TYR A 1  83  ? -67.524 26.761 -60.647 1.00 52.07  ? 80  TYR A CB    1 
ATOM   576  C  CG    . TYR A 1  83  ? -66.788 25.583 -61.178 1.00 53.47  ? 80  TYR A CG    1 
ATOM   577  C  CD1   . TYR A 1  83  ? -67.399 24.690 -62.069 1.00 53.86  ? 80  TYR A CD1   1 
ATOM   578  C  CD2   . TYR A 1  83  ? -65.476 25.358 -60.801 1.00 54.44  ? 80  TYR A CD2   1 
ATOM   579  C  CE1   . TYR A 1  83  ? -66.717 23.599 -62.560 1.00 54.55  ? 80  TYR A CE1   1 
ATOM   580  C  CE2   . TYR A 1  83  ? -64.780 24.280 -61.281 1.00 56.53  ? 80  TYR A CE2   1 
ATOM   581  C  CZ    . TYR A 1  83  ? -65.396 23.397 -62.164 1.00 56.74  ? 80  TYR A CZ    1 
ATOM   582  O  OH    . TYR A 1  83  ? -64.661 22.324 -62.627 1.00 57.04  ? 80  TYR A OH    1 
ATOM   583  N  N     . TRP A 1  84  ? -69.667 28.783 -60.882 1.00 52.91  ? 81  TRP A N     1 
ATOM   584  C  CA    . TRP A 1  84  ? -70.513 29.565 -60.010 1.00 53.64  ? 81  TRP A CA    1 
ATOM   585  C  C     . TRP A 1  84  ? -71.527 28.640 -59.349 1.00 53.64  ? 81  TRP A C     1 
ATOM   586  O  O     . TRP A 1  84  ? -71.999 27.686 -59.969 1.00 53.62  ? 81  TRP A O     1 
ATOM   587  C  CB    . TRP A 1  84  ? -71.232 30.701 -60.756 1.00 54.08  ? 81  TRP A CB    1 
ATOM   588  C  CG    . TRP A 1  84  ? -72.088 31.521 -59.825 1.00 55.52  ? 81  TRP A CG    1 
ATOM   589  C  CD1   . TRP A 1  84  ? -71.724 32.665 -59.171 1.00 57.30  ? 81  TRP A CD1   1 
ATOM   590  C  CD2   . TRP A 1  84  ? -73.432 31.234 -59.409 1.00 57.65  ? 81  TRP A CD2   1 
ATOM   591  N  NE1   . TRP A 1  84  ? -72.764 33.126 -58.394 1.00 58.75  ? 81  TRP A NE1   1 
ATOM   592  C  CE2   . TRP A 1  84  ? -73.820 32.258 -58.511 1.00 58.85  ? 81  TRP A CE2   1 
ATOM   593  C  CE3   . TRP A 1  84  ? -74.352 30.215 -59.710 1.00 57.81  ? 81  TRP A CE3   1 
ATOM   594  C  CZ2   . TRP A 1  84  ? -75.080 32.281 -57.903 1.00 58.08  ? 81  TRP A CZ2   1 
ATOM   595  C  CZ3   . TRP A 1  84  ? -75.613 30.246 -59.104 1.00 56.97  ? 81  TRP A CZ3   1 
ATOM   596  C  CH2   . TRP A 1  84  ? -75.958 31.265 -58.215 1.00 57.86  ? 81  TRP A CH2   1 
ATOM   597  N  N     . TRP A 1  85  ? -71.839 28.920 -58.086 1.00 53.28  ? 82  TRP A N     1 
ATOM   598  C  CA    . TRP A 1  85  ? -72.999 28.340 -57.436 1.00 53.23  ? 82  TRP A CA    1 
ATOM   599  C  C     . TRP A 1  85  ? -73.400 29.212 -56.250 1.00 53.79  ? 82  TRP A C     1 
ATOM   600  O  O     . TRP A 1  85  ? -72.688 30.176 -55.951 1.00 54.20  ? 82  TRP A O     1 
ATOM   601  C  CB    . TRP A 1  85  ? -72.770 26.879 -57.072 1.00 52.76  ? 82  TRP A CB    1 
ATOM   602  C  CG    . TRP A 1  85  ? -71.776 26.579 -55.997 1.00 52.03  ? 82  TRP A CG    1 
ATOM   603  C  CD1   . TRP A 1  85  ? -71.976 26.649 -54.650 1.00 51.16  ? 82  TRP A CD1   1 
ATOM   604  C  CD2   . TRP A 1  85  ? -70.445 26.076 -56.178 1.00 51.28  ? 82  TRP A CD2   1 
ATOM   605  N  NE1   . TRP A 1  85  ? -70.848 26.234 -53.980 1.00 49.88  ? 82  TRP A NE1   1 
ATOM   606  C  CE2   . TRP A 1  85  ? -69.894 25.882 -54.899 1.00 50.79  ? 82  TRP A CE2   1 
ATOM   607  C  CE3   . TRP A 1  85  ? -69.660 25.779 -57.303 1.00 51.42  ? 82  TRP A CE3   1 
ATOM   608  C  CZ2   . TRP A 1  85  ? -68.594 25.411 -54.714 1.00 50.85  ? 82  TRP A CZ2   1 
ATOM   609  C  CZ3   . TRP A 1  85  ? -68.374 25.302 -57.121 1.00 49.44  ? 82  TRP A CZ3   1 
ATOM   610  C  CH2   . TRP A 1  85  ? -67.856 25.117 -55.837 1.00 50.74  ? 82  TRP A CH2   1 
ATOM   611  N  N     . PRO A 1  86  ? -74.557 28.922 -55.605 1.00 53.97  ? 83  PRO A N     1 
ATOM   612  C  CA    . PRO A 1  86  ? -75.008 29.762 -54.480 1.00 53.78  ? 83  PRO A CA    1 
ATOM   613  C  C     . PRO A 1  86  ? -74.080 29.649 -53.297 1.00 53.82  ? 83  PRO A C     1 
ATOM   614  O  O     . PRO A 1  86  ? -73.702 28.528 -52.924 1.00 54.14  ? 83  PRO A O     1 
ATOM   615  C  CB    . PRO A 1  86  ? -76.359 29.148 -54.086 1.00 53.53  ? 83  PRO A CB    1 
ATOM   616  C  CG    . PRO A 1  86  ? -76.791 28.383 -55.261 1.00 54.02  ? 83  PRO A CG    1 
ATOM   617  C  CD    . PRO A 1  86  ? -75.562 27.905 -55.961 1.00 53.64  ? 83  PRO A CD    1 
ATOM   618  N  N     . ASN A 1  87  ? -73.719 30.797 -52.720 1.00 53.60  ? 84  ASN A N     1 
ATOM   619  C  CA    . ASN A 1  87  ? -73.031 30.842 -51.429 1.00 53.34  ? 84  ASN A CA    1 
ATOM   620  C  C     . ASN A 1  87  ? -71.742 30.046 -51.430 1.00 53.00  ? 84  ASN A C     1 
ATOM   621  O  O     . ASN A 1  87  ? -71.488 29.249 -50.523 1.00 53.83  ? 84  ASN A O     1 
ATOM   622  C  CB    . ASN A 1  87  ? -73.963 30.345 -50.314 1.00 53.43  ? 84  ASN A CB    1 
ATOM   623  C  CG    . ASN A 1  87  ? -75.271 31.120 -50.261 1.00 54.92  ? 84  ASN A CG    1 
ATOM   624  O  OD1   . ASN A 1  87  ? -75.288 32.355 -50.338 1.00 56.04  ? 84  ASN A OD1   1 
ATOM   625  N  ND2   . ASN A 1  87  ? -76.380 30.396 -50.142 1.00 57.63  ? 84  ASN A ND2   1 
ATOM   626  N  N     . MET A 1  88  ? -70.936 30.266 -52.460 1.00 52.04  ? 85  MET A N     1 
ATOM   627  C  CA    . MET A 1  88  ? -69.682 29.571 -52.641 1.00 51.10  ? 85  MET A CA    1 
ATOM   628  C  C     . MET A 1  88  ? -68.762 29.616 -51.413 1.00 50.63  ? 85  MET A C     1 
ATOM   629  O  O     . MET A 1  88  ? -68.205 28.596 -51.000 1.00 50.18  ? 85  MET A O     1 
ATOM   630  C  CB    . MET A 1  88  ? -68.973 30.140 -53.871 1.00 51.35  ? 85  MET A CB    1 
ATOM   631  C  CG    . MET A 1  88  ? -69.722 29.908 -55.176 1.00 51.45  ? 85  MET A CG    1 
ATOM   632  S  SD    . MET A 1  88  ? -68.817 30.451 -56.646 1.00 54.92  ? 85  MET A SD    1 
ATOM   633  C  CE    . MET A 1  88  ? -67.651 29.130 -56.840 1.00 52.88  ? 85  MET A CE    1 
ATOM   634  N  N     . ARG A 1  89  ? -68.612 30.791 -50.818 1.00 50.27  ? 86  ARG A N     1 
ATOM   635  C  CA    . ARG A 1  89  ? -67.682 30.934 -49.712 1.00 50.33  ? 86  ARG A CA    1 
ATOM   636  C  C     . ARG A 1  89  ? -68.044 30.050 -48.522 1.00 50.98  ? 86  ARG A C     1 
ATOM   637  O  O     . ARG A 1  89  ? -67.151 29.581 -47.810 1.00 50.76  ? 86  ARG A O     1 
ATOM   638  C  CB    . ARG A 1  89  ? -67.525 32.394 -49.294 1.00 49.94  ? 86  ARG A CB    1 
ATOM   639  C  CG    . ARG A 1  89  ? -66.718 33.232 -50.268 1.00 48.43  ? 86  ARG A CG    1 
ATOM   640  C  CD    . ARG A 1  89  ? -66.828 34.687 -49.895 1.00 46.73  ? 86  ARG A CD    1 
ATOM   641  N  NE    . ARG A 1  89  ? -65.861 35.517 -50.597 1.00 45.24  ? 86  ARG A NE    1 
ATOM   642  C  CZ    . ARG A 1  89  ? -66.055 36.086 -51.789 1.00 44.73  ? 86  ARG A CZ    1 
ATOM   643  N  NH1   . ARG A 1  89  ? -67.189 35.927 -52.457 1.00 44.80  ? 86  ARG A NH1   1 
ATOM   644  N  NH2   . ARG A 1  89  ? -65.098 36.826 -52.322 1.00 43.20  ? 86  ARG A NH2   1 
ATOM   645  N  N     . LYS A 1  90  ? -69.336 29.789 -48.321 1.00 51.64  ? 87  LYS A N     1 
ATOM   646  C  CA    . LYS A 1  90  ? -69.742 28.897 -47.235 1.00 52.49  ? 87  LYS A CA    1 
ATOM   647  C  C     . LYS A 1  90  ? -69.128 27.526 -47.413 1.00 51.66  ? 87  LYS A C     1 
ATOM   648  O  O     . LYS A 1  90  ? -68.678 26.914 -46.450 1.00 51.42  ? 87  LYS A O     1 
ATOM   649  C  CB    . LYS A 1  90  ? -71.258 28.812 -47.080 1.00 53.15  ? 87  LYS A CB    1 
ATOM   650  C  CG    . LYS A 1  90  ? -71.828 29.972 -46.277 1.00 58.15  ? 87  LYS A CG    1 
ATOM   651  C  CD    . LYS A 1  90  ? -73.355 29.870 -46.114 1.00 65.95  ? 87  LYS A CD    1 
ATOM   652  C  CE    . LYS A 1  90  ? -73.930 31.063 -45.295 1.00 69.71  ? 87  LYS A CE    1 
ATOM   653  N  NZ    . LYS A 1  90  ? -75.262 31.521 -45.866 1.00 72.77  ? 87  LYS A NZ    1 
ATOM   654  N  N     . ASP A 1  91  ? -69.072 27.059 -48.647 1.00 51.22  ? 88  ASP A N     1 
ATOM   655  C  CA    . ASP A 1  91  ? -68.466 25.770 -48.898 1.00 51.63  ? 88  ASP A CA    1 
ATOM   656  C  C     . ASP A 1  91  ? -66.944 25.836 -48.756 1.00 51.50  ? 88  ASP A C     1 
ATOM   657  O  O     . ASP A 1  91  ? -66.324 24.898 -48.235 1.00 51.58  ? 88  ASP A O     1 
ATOM   658  C  CB    . ASP A 1  91  ? -68.868 25.240 -50.273 1.00 52.04  ? 88  ASP A CB    1 
ATOM   659  C  CG    . ASP A 1  91  ? -70.342 24.913 -50.355 1.00 53.49  ? 88  ASP A CG    1 
ATOM   660  O  OD1   . ASP A 1  91  ? -70.856 24.204 -49.465 1.00 55.58  ? 88  ASP A OD1   1 
ATOM   661  O  OD2   . ASP A 1  91  ? -70.987 25.375 -51.313 1.00 55.50  ? 88  ASP A OD2   1 
ATOM   662  N  N     . VAL A 1  92  ? -66.348 26.941 -49.215 1.00 50.58  ? 89  VAL A N     1 
ATOM   663  C  CA    . VAL A 1  92  ? -64.922 27.149 -49.059 1.00 49.42  ? 89  VAL A CA    1 
ATOM   664  C  C     . VAL A 1  92  ? -64.562 27.126 -47.564 1.00 48.76  ? 89  VAL A C     1 
ATOM   665  O  O     . VAL A 1  92  ? -63.692 26.370 -47.141 1.00 48.12  ? 89  VAL A O     1 
ATOM   666  C  CB    . VAL A 1  92  ? -64.474 28.461 -49.748 1.00 49.77  ? 89  VAL A CB    1 
ATOM   667  C  CG1   . VAL A 1  92  ? -63.031 28.814 -49.380 1.00 49.99  ? 89  VAL A CG1   1 
ATOM   668  C  CG2   . VAL A 1  92  ? -64.611 28.344 -51.243 1.00 49.34  ? 89  VAL A CG2   1 
ATOM   669  N  N     . VAL A 1  93  ? -65.259 27.925 -46.764 1.00 48.36  ? 90  VAL A N     1 
ATOM   670  C  CA    . VAL A 1  93  ? -64.985 27.978 -45.333 1.00 48.77  ? 90  VAL A CA    1 
ATOM   671  C  C     . VAL A 1  93  ? -65.163 26.628 -44.640 1.00 49.90  ? 90  VAL A C     1 
ATOM   672  O  O     . VAL A 1  93  ? -64.372 26.266 -43.773 1.00 50.03  ? 90  VAL A O     1 
ATOM   673  C  CB    . VAL A 1  93  ? -65.787 29.071 -44.629 1.00 48.31  ? 90  VAL A CB    1 
ATOM   674  C  CG1   . VAL A 1  93  ? -65.698 28.910 -43.141 1.00 47.15  ? 90  VAL A CG1   1 
ATOM   675  C  CG2   . VAL A 1  93  ? -65.230 30.427 -45.016 1.00 47.80  ? 90  VAL A CG2   1 
ATOM   676  N  N     . LYS A 1  94  ? -66.169 25.868 -45.060 1.00 51.00  ? 91  LYS A N     1 
ATOM   677  C  CA    . LYS A 1  94  ? -66.390 24.526 -44.547 1.00 51.96  ? 91  LYS A CA    1 
ATOM   678  C  C     . LYS A 1  94  ? -65.109 23.694 -44.674 1.00 52.04  ? 91  LYS A C     1 
ATOM   679  O  O     . LYS A 1  94  ? -64.698 23.017 -43.729 1.00 52.07  ? 91  LYS A O     1 
ATOM   680  C  CB    . LYS A 1  94  ? -67.563 23.881 -45.290 1.00 52.43  ? 91  LYS A CB    1 
ATOM   681  C  CG    . LYS A 1  94  ? -68.301 22.784 -44.533 1.00 55.85  ? 91  LYS A CG    1 
ATOM   682  C  CD    . LYS A 1  94  ? -69.380 22.085 -45.409 1.00 62.49  ? 91  LYS A CD    1 
ATOM   683  C  CE    . LYS A 1  94  ? -70.332 21.213 -44.529 1.00 66.81  ? 91  LYS A CE    1 
ATOM   684  N  NZ    . LYS A 1  94  ? -71.164 20.186 -45.256 1.00 68.19  ? 91  LYS A NZ    1 
ATOM   685  N  N     . GLN A 1  95  ? -64.462 23.770 -45.831 1.00 52.37  ? 92  GLN A N     1 
ATOM   686  C  CA    . GLN A 1  95  ? -63.260 22.991 -46.078 1.00 53.30  ? 92  GLN A CA    1 
ATOM   687  C  C     . GLN A 1  95  ? -62.035 23.503 -45.329 1.00 53.09  ? 92  GLN A C     1 
ATOM   688  O  O     . GLN A 1  95  ? -61.226 22.707 -44.825 1.00 52.91  ? 92  GLN A O     1 
ATOM   689  C  CB    . GLN A 1  95  ? -62.973 22.934 -47.569 1.00 53.81  ? 92  GLN A CB    1 
ATOM   690  C  CG    . GLN A 1  95  ? -63.893 21.960 -48.284 1.00 58.29  ? 92  GLN A CG    1 
ATOM   691  C  CD    . GLN A 1  95  ? -63.721 20.542 -47.776 1.00 62.56  ? 92  GLN A CD    1 
ATOM   692  O  OE1   . GLN A 1  95  ? -62.589 20.022 -47.731 1.00 64.66  ? 92  GLN A OE1   1 
ATOM   693  N  NE2   . GLN A 1  95  ? -64.835 19.909 -47.373 1.00 61.35  ? 92  GLN A NE2   1 
ATOM   694  N  N     . LEU A 1  96  ? -61.906 24.829 -45.247 1.00 52.28  ? 93  LEU A N     1 
ATOM   695  C  CA    . LEU A 1  96  ? -60.805 25.414 -44.521 1.00 51.37  ? 93  LEU A CA    1 
ATOM   696  C  C     . LEU A 1  96  ? -60.844 24.942 -43.081 1.00 51.70  ? 93  LEU A C     1 
ATOM   697  O  O     . LEU A 1  96  ? -59.805 24.620 -42.500 1.00 52.24  ? 93  LEU A O     1 
ATOM   698  C  CB    . LEU A 1  96  ? -60.857 26.931 -44.587 1.00 50.89  ? 93  LEU A CB    1 
ATOM   699  C  CG    . LEU A 1  96  ? -60.741 27.587 -45.964 1.00 49.49  ? 93  LEU A CG    1 
ATOM   700  C  CD1   . LEU A 1  96  ? -60.709 29.079 -45.800 1.00 47.01  ? 93  LEU A CD1   1 
ATOM   701  C  CD2   . LEU A 1  96  ? -59.545 27.084 -46.762 1.00 46.17  ? 93  LEU A CD2   1 
ATOM   702  N  N     . GLY A 1  97  ? -62.047 24.894 -42.513 1.00 51.40  ? 94  GLY A N     1 
ATOM   703  C  CA    . GLY A 1  97  ? -62.247 24.435 -41.150 1.00 51.00  ? 94  GLY A CA    1 
ATOM   704  C  C     . GLY A 1  97  ? -61.957 22.961 -40.960 1.00 51.44  ? 94  GLY A C     1 
ATOM   705  O  O     . GLY A 1  97  ? -61.801 22.514 -39.827 1.00 51.29  ? 94  GLY A O     1 
ATOM   706  N  N     . ARG A 1  98  ? -61.885 22.201 -42.056 1.00 51.85  ? 95  ARG A N     1 
ATOM   707  C  CA    . ARG A 1  98  ? -61.598 20.761 -41.990 1.00 52.43  ? 95  ARG A CA    1 
ATOM   708  C  C     . ARG A 1  98  ? -60.199 20.387 -42.473 1.00 51.97  ? 95  ARG A C     1 
ATOM   709  O  O     . ARG A 1  98  ? -59.857 19.204 -42.541 1.00 51.93  ? 95  ARG A O     1 
ATOM   710  C  CB    . ARG A 1  98  ? -62.603 19.979 -42.825 1.00 53.21  ? 95  ARG A CB    1 
ATOM   711  C  CG    . ARG A 1  98  ? -63.993 19.877 -42.230 1.00 57.74  ? 95  ARG A CG    1 
ATOM   712  C  CD    . ARG A 1  98  ? -64.892 19.029 -43.138 1.00 66.86  ? 95  ARG A CD    1 
ATOM   713  N  NE    . ARG A 1  98  ? -66.276 19.516 -43.152 1.00 73.38  ? 95  ARG A NE    1 
ATOM   714  C  CZ    . ARG A 1  98  ? -67.256 19.032 -42.392 1.00 77.10  ? 95  ARG A CZ    1 
ATOM   715  N  NH1   . ARG A 1  98  ? -67.023 18.027 -41.547 1.00 79.75  ? 95  ARG A NH1   1 
ATOM   716  N  NH2   . ARG A 1  98  ? -68.473 19.551 -42.481 1.00 78.50  ? 95  ARG A NH2   1 
ATOM   717  N  N     . CYS A 1  99  ? -59.390 21.373 -42.846 1.00 51.56  ? 96  CYS A N     1 
ATOM   718  C  CA    . CYS A 1  99  ? -58.057 21.055 -43.333 1.00 50.98  ? 96  CYS A CA    1 
ATOM   719  C  C     . CYS A 1  99  ? -57.063 20.966 -42.155 1.00 50.67  ? 96  CYS A C     1 
ATOM   720  O  O     . CYS A 1  99  ? -56.604 21.974 -41.604 1.00 50.32  ? 96  CYS A O     1 
ATOM   721  C  CB    . CYS A 1  99  ? -57.614 22.031 -44.430 1.00 50.63  ? 96  CYS A CB    1 
ATOM   722  S  SG    . CYS A 1  99  ? -56.052 21.551 -45.200 1.00 51.30  ? 96  CYS A SG    1 
ATOM   723  N  N     . GLN A 1  100 ? -56.761 19.744 -41.752 1.00 50.19  ? 97  GLN A N     1 
ATOM   724  C  CA    . GLN A 1  100 ? -55.839 19.535 -40.656 1.00 50.53  ? 97  GLN A CA    1 
ATOM   725  C  C     . GLN A 1  100 ? -54.597 20.385 -40.893 1.00 49.33  ? 97  GLN A C     1 
ATOM   726  O  O     . GLN A 1  100 ? -54.203 21.170 -40.039 1.00 49.48  ? 97  GLN A O     1 
ATOM   727  C  CB    . GLN A 1  100 ? -55.476 18.042 -40.534 1.00 51.39  ? 97  GLN A CB    1 
ATOM   728  C  CG    . GLN A 1  100 ? -54.976 17.581 -39.143 1.00 55.79  ? 97  GLN A CG    1 
ATOM   729  C  CD    . GLN A 1  100 ? -56.057 17.681 -38.042 1.00 62.19  ? 97  GLN A CD    1 
ATOM   730  O  OE1   . GLN A 1  100 ? -55.767 17.493 -36.851 1.00 66.31  ? 97  GLN A OE1   1 
ATOM   731  N  NE2   . GLN A 1  100 ? -57.302 17.976 -38.439 1.00 62.59  ? 97  GLN A NE2   1 
ATOM   732  N  N     . GLN A 1  101 ? -54.027 20.255 -42.087 1.00 47.88  ? 98  GLN A N     1 
ATOM   733  C  CA    . GLN A 1  101 ? -52.759 20.867 -42.431 1.00 46.35  ? 98  GLN A CA    1 
ATOM   734  C  C     . GLN A 1  101 ? -52.776 22.393 -42.296 1.00 45.08  ? 98  GLN A C     1 
ATOM   735  O  O     . GLN A 1  101 ? -51.842 22.971 -41.738 1.00 44.40  ? 98  GLN A O     1 
ATOM   736  C  CB    . GLN A 1  101 ? -52.363 20.433 -43.831 1.00 46.33  ? 98  GLN A CB    1 
ATOM   737  C  CG    . GLN A 1  101 ? -51.829 19.017 -43.898 1.00 48.73  ? 98  GLN A CG    1 
ATOM   738  C  CD    . GLN A 1  101 ? -52.199 18.293 -45.199 1.00 52.94  ? 98  GLN A CD    1 
ATOM   739  O  OE1   . GLN A 1  101 ? -53.383 18.038 -45.458 1.00 52.03  ? 98  GLN A OE1   1 
ATOM   740  N  NE2   . GLN A 1  101 ? -51.180 17.947 -46.020 1.00 53.89  ? 98  GLN A NE2   1 
ATOM   741  N  N     . CYS A 1  102 ? -53.831 23.042 -42.786 1.00 43.80  ? 99  CYS A N     1 
ATOM   742  C  CA    . CYS A 1  102 ? -53.937 24.500 -42.629 1.00 43.15  ? 99  CYS A CA    1 
ATOM   743  C  C     . CYS A 1  102 ? -54.090 24.887 -41.167 1.00 42.57  ? 99  CYS A C     1 
ATOM   744  O  O     . CYS A 1  102 ? -53.395 25.780 -40.690 1.00 41.68  ? 99  CYS A O     1 
ATOM   745  C  CB    . CYS A 1  102 ? -55.032 25.132 -43.492 1.00 42.83  ? 99  CYS A CB    1 
ATOM   746  S  SG    . CYS A 1  102 ? -54.562 25.178 -45.244 1.00 42.63  ? 99  CYS A SG    1 
ATOM   747  N  N     . LEU A 1  103 ? -54.941 24.162 -40.446 1.00 42.11  ? 100 LEU A N     1 
ATOM   748  C  CA    . LEU A 1  103 ? -55.247 24.516 -39.072 1.00 41.57  ? 100 LEU A CA    1 
ATOM   749  C  C     . LEU A 1  103 ? -54.012 24.486 -38.156 1.00 41.91  ? 100 LEU A C     1 
ATOM   750  O  O     . LEU A 1  103 ? -53.884 25.320 -37.248 1.00 42.29  ? 100 LEU A O     1 
ATOM   751  C  CB    . LEU A 1  103 ? -56.332 23.618 -38.522 1.00 40.93  ? 100 LEU A CB    1 
ATOM   752  C  CG    . LEU A 1  103 ? -57.731 23.709 -39.108 1.00 40.65  ? 100 LEU A CG    1 
ATOM   753  C  CD1   . LEU A 1  103 ? -58.494 22.527 -38.518 1.00 41.09  ? 100 LEU A CD1   1 
ATOM   754  C  CD2   . LEU A 1  103 ? -58.469 25.029 -38.820 1.00 37.38  ? 100 LEU A CD2   1 
ATOM   755  N  N     . ILE A 1  104 ? -53.097 23.554 -38.404 1.00 41.31  ? 101 ILE A N     1 
ATOM   756  C  CA    . ILE A 1  104 ? -51.956 23.419 -37.538 1.00 40.82  ? 101 ILE A CA    1 
ATOM   757  C  C     . ILE A 1  104 ? -50.699 24.121 -38.049 1.00 41.49  ? 101 ILE A C     1 
ATOM   758  O  O     . ILE A 1  104 ? -49.712 24.243 -37.310 1.00 42.65  ? 101 ILE A O     1 
ATOM   759  C  CB    . ILE A 1  104 ? -51.646 21.947 -37.248 1.00 40.60  ? 101 ILE A CB    1 
ATOM   760  C  CG1   . ILE A 1  104 ? -51.139 21.243 -38.493 1.00 40.02  ? 101 ILE A CG1   1 
ATOM   761  C  CG2   . ILE A 1  104 ? -52.852 21.255 -36.657 1.00 40.02  ? 101 ILE A CG2   1 
ATOM   762  C  CD1   . ILE A 1  104 ? -50.705 19.803 -38.233 1.00 39.03  ? 101 ILE A CD1   1 
ATOM   763  N  N     . THR A 1  105 ? -50.719 24.588 -39.296 1.00 41.28  ? 102 THR A N     1 
ATOM   764  C  CA    . THR A 1  105 ? -49.584 25.324 -39.841 1.00 40.11  ? 102 THR A CA    1 
ATOM   765  C  C     . THR A 1  105 ? -49.756 26.846 -39.883 1.00 39.89  ? 102 THR A C     1 
ATOM   766  O  O     . THR A 1  105 ? -48.794 27.560 -39.643 1.00 39.99  ? 102 THR A O     1 
ATOM   767  C  CB    . THR A 1  105 ? -49.243 24.838 -41.216 1.00 40.29  ? 102 THR A CB    1 
ATOM   768  O  OG1   . THR A 1  105 ? -49.084 23.418 -41.172 1.00 40.37  ? 102 THR A OG1   1 
ATOM   769  C  CG2   . THR A 1  105 ? -47.951 25.466 -41.686 1.00 39.29  ? 102 THR A CG2   1 
ATOM   770  N  N     . ASN A 1  106 ? -50.949 27.342 -40.199 1.00 38.81  ? 103 ASN A N     1 
ATOM   771  C  CA    . ASN A 1  106 ? -51.155 28.781 -40.300 1.00 38.60  ? 103 ASN A CA    1 
ATOM   772  C  C     . ASN A 1  106 ? -50.941 29.534 -38.986 1.00 38.96  ? 103 ASN A C     1 
ATOM   773  O  O     . ASN A 1  106 ? -51.079 28.966 -37.893 1.00 38.89  ? 103 ASN A O     1 
ATOM   774  C  CB    . ASN A 1  106 ? -52.554 29.112 -40.836 1.00 38.57  ? 103 ASN A CB    1 
ATOM   775  C  CG    . ASN A 1  106 ? -52.728 28.758 -42.319 1.00 38.84  ? 103 ASN A CG    1 
ATOM   776  O  OD1   . ASN A 1  106 ? -51.754 28.464 -43.040 1.00 36.74  ? 103 ASN A OD1   1 
ATOM   777  N  ND2   . ASN A 1  106 ? -53.984 28.788 -42.780 1.00 36.55  ? 103 ASN A ND2   1 
ATOM   778  N  N     . ALA A 1  107 ? -50.598 30.818 -39.105 1.00 38.55  ? 104 ALA A N     1 
ATOM   779  C  CA    . ALA A 1  107 ? -50.501 31.684 -37.961 1.00 38.63  ? 104 ALA A CA    1 
ATOM   780  C  C     . ALA A 1  107 ? -51.913 32.088 -37.584 1.00 39.20  ? 104 ALA A C     1 
ATOM   781  O  O     . ALA A 1  107 ? -52.825 31.953 -38.382 1.00 39.35  ? 104 ALA A O     1 
ATOM   782  C  CB    . ALA A 1  107 ? -49.666 32.901 -38.279 1.00 37.59  ? 104 ALA A CB    1 
ATOM   783  N  N     . SER A 1  108 ? -52.080 32.557 -36.355 1.00 40.21  ? 105 SER A N     1 
ATOM   784  C  CA    . SER A 1  108 ? -53.289 33.209 -35.912 1.00 41.40  ? 105 SER A CA    1 
ATOM   785  C  C     . SER A 1  108 ? -53.267 34.627 -36.418 1.00 41.59  ? 105 SER A C     1 
ATOM   786  O  O     . SER A 1  108 ? -52.213 35.174 -36.658 1.00 42.08  ? 105 SER A O     1 
ATOM   787  C  CB    . SER A 1  108 ? -53.307 33.246 -34.378 1.00 41.78  ? 105 SER A CB    1 
ATOM   788  O  OG    . SER A 1  108 ? -54.372 34.064 -33.878 1.00 44.17  ? 105 SER A OG    1 
ATOM   789  N  N     . ASN A 1  109 ? -54.425 35.242 -36.548 1.00 42.13  ? 106 ASN A N     1 
ATOM   790  C  CA    . ASN A 1  109 ? -54.456 36.657 -36.816 1.00 42.94  ? 106 ASN A CA    1 
ATOM   791  C  C     . ASN A 1  109 ? -55.334 37.399 -35.807 1.00 43.77  ? 106 ASN A C     1 
ATOM   792  O  O     . ASN A 1  109 ? -55.811 38.494 -36.081 1.00 44.17  ? 106 ASN A O     1 
ATOM   793  C  CB    . ASN A 1  109 ? -54.894 36.914 -38.247 1.00 42.65  ? 106 ASN A CB    1 
ATOM   794  C  CG    . ASN A 1  109 ? -56.301 36.442 -38.522 1.00 44.40  ? 106 ASN A CG    1 
ATOM   795  O  OD1   . ASN A 1  109 ? -56.943 35.790 -37.692 1.00 46.71  ? 106 ASN A OD1   1 
ATOM   796  N  ND2   . ASN A 1  109 ? -56.796 36.763 -39.708 1.00 47.22  ? 106 ASN A ND2   1 
ATOM   797  N  N     . LYS A 1  110 ? -55.554 36.779 -34.646 1.00 44.60  ? 107 LYS A N     1 
ATOM   798  C  CA    . LYS A 1  110 ? -56.214 37.427 -33.501 1.00 45.15  ? 107 LYS A CA    1 
ATOM   799  C  C     . LYS A 1  110 ? -55.240 37.507 -32.312 1.00 44.38  ? 107 LYS A C     1 
ATOM   800  O  O     . LYS A 1  110 ? -54.644 36.507 -31.935 1.00 44.76  ? 107 LYS A O     1 
ATOM   801  C  CB    . LYS A 1  110 ? -57.505 36.680 -33.100 1.00 45.66  ? 107 LYS A CB    1 
ATOM   802  C  CG    . LYS A 1  110 ? -58.684 36.758 -34.123 1.00 48.28  ? 107 LYS A CG    1 
ATOM   803  C  CD    . LYS A 1  110 ? -58.906 35.389 -34.835 1.00 52.74  ? 107 LYS A CD    1 
ATOM   804  C  CE    . LYS A 1  110 ? -60.018 35.449 -35.878 1.00 55.89  ? 107 LYS A CE    1 
ATOM   805  N  NZ    . LYS A 1  110 ? -59.890 36.495 -36.999 1.00 58.74  ? 107 LYS A NZ    1 
ATOM   806  N  N     . ALA A 1  111 ? -55.067 38.690 -31.740 1.00 43.44  ? 108 ALA A N     1 
ATOM   807  C  CA    . ALA A 1  111 ? -54.144 38.882 -30.628 1.00 42.59  ? 108 ALA A CA    1 
ATOM   808  C  C     . ALA A 1  111 ? -54.757 38.399 -29.319 1.00 42.42  ? 108 ALA A C     1 
ATOM   809  O  O     . ALA A 1  111 ? -55.979 38.312 -29.199 1.00 43.04  ? 108 ALA A O     1 
ATOM   810  C  CB    . ALA A 1  111 ? -53.796 40.345 -30.519 1.00 42.63  ? 108 ALA A CB    1 
ATOM   811  N  N     . SER A 1  112 ? -53.909 38.090 -28.344 1.00 41.72  ? 109 SER A N     1 
ATOM   812  C  CA    . SER A 1  112 ? -54.318 37.884 -26.966 1.00 41.83  ? 109 SER A CA    1 
ATOM   813  C  C     . SER A 1  112 ? -55.047 39.052 -26.285 1.00 42.08  ? 109 SER A C     1 
ATOM   814  O  O     . SER A 1  112 ? -54.866 40.233 -26.635 1.00 42.05  ? 109 SER A O     1 
ATOM   815  C  CB    . SER A 1  112 ? -53.090 37.597 -26.161 1.00 41.57  ? 109 SER A CB    1 
ATOM   816  O  OG    . SER A 1  112 ? -52.822 36.234 -26.275 1.00 44.62  ? 109 SER A OG    1 
ATOM   817  N  N     . GLY A 1  113 ? -55.856 38.728 -25.281 1.00 42.01  ? 110 GLY A N     1 
ATOM   818  C  CA    . GLY A 1  113 ? -56.524 39.771 -24.510 1.00 42.00  ? 110 GLY A CA    1 
ATOM   819  C  C     . GLY A 1  113 ? -55.499 40.529 -23.682 1.00 42.01  ? 110 GLY A C     1 
ATOM   820  O  O     . GLY A 1  113 ? -54.385 40.027 -23.447 1.00 42.13  ? 110 GLY A O     1 
ATOM   821  N  N     . PRO A 1  114 ? -55.874 41.722 -23.194 1.00 41.74  ? 111 PRO A N     1 
ATOM   822  C  CA    . PRO A 1  114 ? -54.909 42.554 -22.451 1.00 41.50  ? 111 PRO A CA    1 
ATOM   823  C  C     . PRO A 1  114 ? -54.400 41.866 -21.181 1.00 41.90  ? 111 PRO A C     1 
ATOM   824  O  O     . PRO A 1  114 ? -55.172 41.164 -20.509 1.00 42.25  ? 111 PRO A O     1 
ATOM   825  C  CB    . PRO A 1  114 ? -55.717 43.809 -22.103 1.00 41.62  ? 111 PRO A CB    1 
ATOM   826  C  CG    . PRO A 1  114 ? -57.160 43.385 -22.175 1.00 41.55  ? 111 PRO A CG    1 
ATOM   827  C  CD    . PRO A 1  114 ? -57.254 42.246 -23.147 1.00 41.12  ? 111 PRO A CD    1 
ATOM   828  N  N     . ILE A 1  115 ? -53.121 42.068 -20.854 1.00 41.69  ? 112 ILE A N     1 
ATOM   829  C  CA    . ILE A 1  115 ? -52.486 41.440 -19.675 1.00 41.37  ? 112 ILE A CA    1 
ATOM   830  C  C     . ILE A 1  115 ? -53.123 41.788 -18.315 1.00 41.41  ? 112 ILE A C     1 
ATOM   831  O  O     . ILE A 1  115 ? -53.710 42.853 -18.135 1.00 41.48  ? 112 ILE A O     1 
ATOM   832  C  CB    . ILE A 1  115 ? -50.957 41.781 -19.584 1.00 41.43  ? 112 ILE A CB    1 
ATOM   833  C  CG1   . ILE A 1  115 ? -50.763 43.303 -19.500 1.00 40.46  ? 112 ILE A CG1   1 
ATOM   834  C  CG2   . ILE A 1  115 ? -50.185 41.129 -20.732 1.00 40.09  ? 112 ILE A CG2   1 
ATOM   835  C  CD1   . ILE A 1  115 ? -49.387 43.732 -19.217 1.00 38.67  ? 112 ILE A CD1   1 
ATOM   836  N  N     . LEU A 1  116 ? -52.973 40.882 -17.354 1.00 41.45  ? 113 LEU A N     1 
ATOM   837  C  CA    . LEU A 1  116 ? -53.403 41.133 -15.980 1.00 41.01  ? 113 LEU A CA    1 
ATOM   838  C  C     . LEU A 1  116 ? -52.284 41.766 -15.189 1.00 40.53  ? 113 LEU A C     1 
ATOM   839  O  O     . LEU A 1  116 ? -51.116 41.460 -15.408 1.00 41.13  ? 113 LEU A O     1 
ATOM   840  C  CB    . LEU A 1  116 ? -53.796 39.822 -15.302 1.00 40.91  ? 113 LEU A CB    1 
ATOM   841  C  CG    . LEU A 1  116 ? -55.053 39.099 -15.786 1.00 39.94  ? 113 LEU A CG    1 
ATOM   842  C  CD1   . LEU A 1  116 ? -55.108 37.730 -15.107 1.00 42.44  ? 113 LEU A CD1   1 
ATOM   843  C  CD2   . LEU A 1  116 ? -56.296 39.902 -15.497 1.00 36.95  ? 113 LEU A CD2   1 
ATOM   844  N  N     . ARG A 1  117 ? -52.622 42.638 -14.257 1.00 39.77  ? 114 ARG A N     1 
ATOM   845  C  CA    . ARG A 1  117 ? -51.588 43.130 -13.362 1.00 39.16  ? 114 ARG A CA    1 
ATOM   846  C  C     . ARG A 1  117 ? -51.865 42.613 -11.950 1.00 39.20  ? 114 ARG A C     1 
ATOM   847  O  O     . ARG A 1  117 ? -52.473 43.298 -11.149 1.00 39.37  ? 114 ARG A O     1 
ATOM   848  C  CB    . ARG A 1  117 ? -51.504 44.661 -13.419 1.00 38.96  ? 114 ARG A CB    1 
ATOM   849  C  CG    . ARG A 1  117 ? -51.335 45.275 -14.816 1.00 37.70  ? 114 ARG A CG    1 
ATOM   850  C  CD    . ARG A 1  117 ? -50.163 44.665 -15.655 1.00 37.12  ? 114 ARG A CD    1 
ATOM   851  N  NE    . ARG A 1  117 ? -48.884 44.629 -14.947 1.00 38.00  ? 114 ARG A NE    1 
ATOM   852  C  CZ    . ARG A 1  117 ? -48.004 45.630 -14.863 1.00 37.77  ? 114 ARG A CZ    1 
ATOM   853  N  NH1   . ARG A 1  117 ? -48.206 46.801 -15.460 1.00 37.64  ? 114 ARG A NH1   1 
ATOM   854  N  NH2   . ARG A 1  117 ? -46.904 45.445 -14.158 1.00 37.95  ? 114 ARG A NH2   1 
ATOM   855  N  N     . PRO A 1  118 ? -51.442 41.385 -11.640 1.00 39.89  ? 115 PRO A N     1 
ATOM   856  C  CA    . PRO A 1  118 ? -51.812 40.809 -10.339 1.00 40.76  ? 115 PRO A CA    1 
ATOM   857  C  C     . PRO A 1  118 ? -51.466 41.741 -9.186  1.00 42.10  ? 115 PRO A C     1 
ATOM   858  O  O     . PRO A 1  118 ? -50.503 42.505 -9.285  1.00 42.01  ? 115 PRO A O     1 
ATOM   859  C  CB    . PRO A 1  118 ? -50.941 39.556 -10.243 1.00 40.43  ? 115 PRO A CB    1 
ATOM   860  C  CG    . PRO A 1  118 ? -50.605 39.209 -11.641 1.00 40.05  ? 115 PRO A CG    1 
ATOM   861  C  CD    . PRO A 1  118 ? -50.518 40.512 -12.390 1.00 40.10  ? 115 PRO A CD    1 
ATOM   862  N  N     . ASP A 1  119 ? -52.238 41.679 -8.100  1.00 43.79  ? 116 ASP A N     1 
ATOM   863  C  CA    . ASP A 1  119 ? -51.943 42.475 -6.904  1.00 45.28  ? 116 ASP A CA    1 
ATOM   864  C  C     . ASP A 1  119 ? -50.535 42.249 -6.350  1.00 44.81  ? 116 ASP A C     1 
ATOM   865  O  O     . ASP A 1  119 ? -50.030 41.131 -6.371  1.00 45.05  ? 116 ASP A O     1 
ATOM   866  C  CB    . ASP A 1  119 ? -52.944 42.139 -5.811  1.00 46.60  ? 116 ASP A CB    1 
ATOM   867  C  CG    . ASP A 1  119 ? -54.277 42.809 -6.017  1.00 49.73  ? 116 ASP A CG    1 
ATOM   868  O  OD1   . ASP A 1  119 ? -54.316 43.907 -6.648  1.00 53.73  ? 116 ASP A OD1   1 
ATOM   869  O  OD2   . ASP A 1  119 ? -55.278 42.228 -5.530  1.00 52.61  ? 116 ASP A OD2   1 
ATOM   870  N  N     . ARG A 1  120 ? -49.907 43.314 -5.862  1.00 44.51  ? 117 ARG A N     1 
ATOM   871  C  CA    . ARG A 1  120 ? -48.616 43.201 -5.207  1.00 44.14  ? 117 ARG A CA    1 
ATOM   872  C  C     . ARG A 1  120 ? -48.852 42.405 -3.931  1.00 44.08  ? 117 ARG A C     1 
ATOM   873  O  O     . ARG A 1  120 ? -49.851 42.634 -3.235  1.00 44.38  ? 117 ARG A O     1 
ATOM   874  C  CB    . ARG A 1  120 ? -48.064 44.585 -4.888  1.00 44.28  ? 117 ARG A CB    1 
ATOM   875  C  CG    . ARG A 1  120 ? -46.676 44.595 -4.250  1.00 44.66  ? 117 ARG A CG    1 
ATOM   876  C  CD    . ARG A 1  120 ? -46.197 46.028 -3.963  1.00 44.66  ? 117 ARG A CD    1 
ATOM   877  N  NE    . ARG A 1  120 ? -45.874 46.745 -5.194  1.00 44.92  ? 117 ARG A NE    1 
ATOM   878  C  CZ    . ARG A 1  120 ? -44.681 46.742 -5.793  1.00 45.26  ? 117 ARG A CZ    1 
ATOM   879  N  NH1   . ARG A 1  120 ? -43.657 46.061 -5.278  1.00 44.61  ? 117 ARG A NH1   1 
ATOM   880  N  NH2   . ARG A 1  120 ? -44.516 47.421 -6.929  1.00 44.92  ? 117 ARG A NH2   1 
ATOM   881  N  N     . PRO A 1  121 ? -47.990 41.419 -3.655  1.00 43.65  ? 118 PRO A N     1 
ATOM   882  C  CA    . PRO A 1  121 ? -48.042 40.675 -2.416  1.00 43.86  ? 118 PRO A CA    1 
ATOM   883  C  C     . PRO A 1  121 ? -48.126 41.651 -1.287  1.00 44.32  ? 118 PRO A C     1 
ATOM   884  O  O     . PRO A 1  121 ? -47.453 42.675 -1.320  1.00 44.39  ? 118 PRO A O     1 
ATOM   885  C  CB    . PRO A 1  121 ? -46.686 40.004 -2.380  1.00 44.17  ? 118 PRO A CB    1 
ATOM   886  C  CG    . PRO A 1  121 ? -46.417 39.725 -3.813  1.00 44.14  ? 118 PRO A CG    1 
ATOM   887  C  CD    . PRO A 1  121 ? -47.010 40.855 -4.588  1.00 43.48  ? 118 PRO A CD    1 
ATOM   888  N  N     . GLN A 1  122 ? -48.960 41.370 -0.301  1.00 45.08  ? 119 GLN A N     1 
ATOM   889  C  CA    . GLN A 1  122 ? -49.168 42.334 0.772   1.00 46.20  ? 119 GLN A CA    1 
ATOM   890  C  C     . GLN A 1  122 ? -47.943 42.552 1.669   1.00 45.72  ? 119 GLN A C     1 
ATOM   891  O  O     . GLN A 1  122 ? -47.686 43.660 2.103   1.00 45.68  ? 119 GLN A O     1 
ATOM   892  C  CB    . GLN A 1  122 ? -50.332 41.894 1.617   1.00 46.91  ? 119 GLN A CB    1 
ATOM   893  C  CG    . GLN A 1  122 ? -51.647 42.574 1.288   1.00 52.16  ? 119 GLN A CG    1 
ATOM   894  C  CD    . GLN A 1  122 ? -52.732 42.079 2.226   1.00 58.91  ? 119 GLN A CD    1 
ATOM   895  O  OE1   . GLN A 1  122 ? -52.476 41.837 3.427   1.00 61.28  ? 119 GLN A OE1   1 
ATOM   896  N  NE2   . GLN A 1  122 ? -53.936 41.884 1.689   1.00 59.97  ? 119 GLN A NE2   1 
ATOM   897  N  N     . LYS A 1  123 ? -47.185 41.492 1.918   1.00 44.95  ? 120 LYS A N     1 
ATOM   898  C  CA    . LYS A 1  123 ? -46.122 41.539 2.882   1.00 44.80  ? 120 LYS A CA    1 
ATOM   899  C  C     . LYS A 1  123 ? -44.780 41.003 2.340   1.00 43.45  ? 120 LYS A C     1 
ATOM   900  O  O     . LYS A 1  123 ? -44.759 40.121 1.494   1.00 43.32  ? 120 LYS A O     1 
ATOM   901  C  CB    . LYS A 1  123 ? -46.540 40.698 4.103   1.00 45.89  ? 120 LYS A CB    1 
ATOM   902  C  CG    . LYS A 1  123 ? -47.593 41.342 5.011   1.00 48.50  ? 120 LYS A CG    1 
ATOM   903  C  CD    . LYS A 1  123 ? -48.119 40.297 5.966   1.00 53.00  ? 120 LYS A CD    1 
ATOM   904  C  CE    . LYS A 1  123 ? -49.137 40.878 6.916   1.00 56.04  ? 120 LYS A CE    1 
ATOM   905  N  NZ    . LYS A 1  123 ? -49.566 39.789 7.867   1.00 59.59  ? 120 LYS A NZ    1 
ATOM   906  N  N     . PRO A 1  124 ? -43.653 41.511 2.862   1.00 41.85  ? 121 PRO A N     1 
ATOM   907  C  CA    . PRO A 1  124 ? -42.422 40.835 2.588   1.00 40.90  ? 121 PRO A CA    1 
ATOM   908  C  C     . PRO A 1  124 ? -42.588 39.400 3.022   1.00 40.62  ? 121 PRO A C     1 
ATOM   909  O  O     . PRO A 1  124 ? -43.210 39.144 4.045   1.00 40.89  ? 121 PRO A O     1 
ATOM   910  C  CB    . PRO A 1  124 ? -41.444 41.513 3.527   1.00 40.71  ? 121 PRO A CB    1 
ATOM   911  C  CG    . PRO A 1  124 ? -42.008 42.832 3.776   1.00 41.43  ? 121 PRO A CG    1 
ATOM   912  C  CD    . PRO A 1  124 ? -43.468 42.674 3.741   1.00 41.65  ? 121 PRO A CD    1 
ATOM   913  N  N     . PHE A 1  125 ? -42.035 38.488 2.236   1.00 40.03  ? 122 PHE A N     1 
ATOM   914  C  CA    . PHE A 1  125 ? -42.055 37.045 2.479   1.00 39.62  ? 122 PHE A CA    1 
ATOM   915  C  C     . PHE A 1  125 ? -43.355 36.325 2.162   1.00 40.06  ? 122 PHE A C     1 
ATOM   916  O  O     . PHE A 1  125 ? -43.397 35.081 2.227   1.00 40.15  ? 122 PHE A O     1 
ATOM   917  C  CB    . PHE A 1  125 ? -41.543 36.708 3.862   1.00 38.91  ? 122 PHE A CB    1 
ATOM   918  C  CG    . PHE A 1  125 ? -40.214 37.315 4.148   1.00 38.39  ? 122 PHE A CG    1 
ATOM   919  C  CD1   . PHE A 1  125 ? -40.098 38.394 5.009   1.00 36.36  ? 122 PHE A CD1   1 
ATOM   920  C  CD2   . PHE A 1  125 ? -39.065 36.832 3.516   1.00 37.84  ? 122 PHE A CD2   1 
ATOM   921  C  CE1   . PHE A 1  125 ? -38.849 38.963 5.274   1.00 33.98  ? 122 PHE A CE1   1 
ATOM   922  C  CE2   . PHE A 1  125 ? -37.823 37.409 3.762   1.00 36.36  ? 122 PHE A CE2   1 
ATOM   923  C  CZ    . PHE A 1  125 ? -37.723 38.479 4.652   1.00 33.89  ? 122 PHE A CZ    1 
ATOM   924  N  N     . ASP A 1  126 ? -44.392 37.085 1.782   1.00 39.78  ? 123 ASP A N     1 
ATOM   925  C  CA    . ASP A 1  126 ? -45.605 36.475 1.252   1.00 39.97  ? 123 ASP A CA    1 
ATOM   926  C  C     . ASP A 1  126 ? -45.337 35.663 0.003   1.00 40.03  ? 123 ASP A C     1 
ATOM   927  O  O     . ASP A 1  126 ? -45.889 34.558 -0.140  1.00 40.72  ? 123 ASP A O     1 
ATOM   928  C  CB    . ASP A 1  126 ? -46.673 37.502 0.937   1.00 40.08  ? 123 ASP A CB    1 
ATOM   929  C  CG    . ASP A 1  126 ? -47.397 37.981 2.162   1.00 42.10  ? 123 ASP A CG    1 
ATOM   930  O  OD1   . ASP A 1  126 ? -47.096 37.463 3.264   1.00 44.21  ? 123 ASP A OD1   1 
ATOM   931  O  OD2   . ASP A 1  126 ? -48.257 38.895 2.028   1.00 43.58  ? 123 ASP A OD2   1 
ATOM   932  N  N     . LYS A 1  127 ? -44.519 36.205 -0.911  1.00 39.47  ? 124 LYS A N     1 
ATOM   933  C  CA    . LYS A 1  127 ? -44.206 35.509 -2.165  1.00 38.81  ? 124 LYS A CA    1 
ATOM   934  C  C     . LYS A 1  127 ? -42.813 35.779 -2.725  1.00 39.03  ? 124 LYS A C     1 
ATOM   935  O  O     . LYS A 1  127 ? -42.449 36.912 -2.995  1.00 38.99  ? 124 LYS A O     1 
ATOM   936  C  CB    . LYS A 1  127 ? -45.248 35.847 -3.220  1.00 38.42  ? 124 LYS A CB    1 
ATOM   937  C  CG    . LYS A 1  127 ? -45.369 34.791 -4.289  1.00 38.40  ? 124 LYS A CG    1 
ATOM   938  C  CD    . LYS A 1  127 ? -46.307 35.238 -5.405  1.00 39.62  ? 124 LYS A CD    1 
ATOM   939  C  CE    . LYS A 1  127 ? -47.746 34.825 -5.133  1.00 39.03  ? 124 LYS A CE    1 
ATOM   940  N  NZ    . LYS A 1  127 ? -48.493 34.624 -6.397  1.00 38.42  ? 124 LYS A NZ    1 
ATOM   941  N  N     . PHE A 1  128 ? -42.032 34.726 -2.904  1.00 39.33  ? 125 PHE A N     1 
ATOM   942  C  CA    . PHE A 1  128 ? -40.775 34.846 -3.638  1.00 39.40  ? 125 PHE A CA    1 
ATOM   943  C  C     . PHE A 1  128 ? -40.985 34.463 -5.082  1.00 39.50  ? 125 PHE A C     1 
ATOM   944  O  O     . PHE A 1  128 ? -41.750 33.551 -5.369  1.00 39.50  ? 125 PHE A O     1 
ATOM   945  C  CB    . PHE A 1  128 ? -39.718 33.895 -3.077  1.00 39.48  ? 125 PHE A CB    1 
ATOM   946  C  CG    . PHE A 1  128 ? -39.074 34.365 -1.820  1.00 38.39  ? 125 PHE A CG    1 
ATOM   947  C  CD1   . PHE A 1  128 ? -39.400 35.605 -1.267  1.00 38.99  ? 125 PHE A CD1   1 
ATOM   948  C  CD2   . PHE A 1  128 ? -38.109 33.582 -1.205  1.00 37.13  ? 125 PHE A CD2   1 
ATOM   949  C  CE1   . PHE A 1  128 ? -38.791 36.049 -0.097  1.00 38.76  ? 125 PHE A CE1   1 
ATOM   950  C  CE2   . PHE A 1  128 ? -37.483 34.008 -0.030  1.00 37.10  ? 125 PHE A CE2   1 
ATOM   951  C  CZ    . PHE A 1  128 ? -37.821 35.248 0.524   1.00 38.60  ? 125 PHE A CZ    1 
ATOM   952  N  N     . PHE A 1  129 ? -40.277 35.142 -5.986  1.00 39.72  ? 126 PHE A N     1 
ATOM   953  C  CA    . PHE A 1  129 ? -40.184 34.728 -7.395  1.00 38.77  ? 126 PHE A CA    1 
ATOM   954  C  C     . PHE A 1  129 ? -38.738 34.329 -7.606  1.00 39.10  ? 126 PHE A C     1 
ATOM   955  O  O     . PHE A 1  129 ? -37.819 35.094 -7.265  1.00 39.42  ? 126 PHE A O     1 
ATOM   956  C  CB    . PHE A 1  129 ? -40.553 35.878 -8.328  1.00 38.16  ? 126 PHE A CB    1 
ATOM   957  C  CG    . PHE A 1  129 ? -42.015 36.207 -8.329  1.00 37.59  ? 126 PHE A CG    1 
ATOM   958  C  CD1   . PHE A 1  129 ? -42.871 35.630 -9.266  1.00 37.36  ? 126 PHE A CD1   1 
ATOM   959  C  CD2   . PHE A 1  129 ? -42.547 37.080 -7.387  1.00 35.84  ? 126 PHE A CD2   1 
ATOM   960  C  CE1   . PHE A 1  129 ? -44.242 35.925 -9.260  1.00 38.15  ? 126 PHE A CE1   1 
ATOM   961  C  CE2   . PHE A 1  129 ? -43.909 37.368 -7.370  1.00 35.92  ? 126 PHE A CE2   1 
ATOM   962  C  CZ    . PHE A 1  129 ? -44.759 36.796 -8.302  1.00 36.71  ? 126 PHE A CZ    1 
ATOM   963  N  N     . ILE A 1  130 ? -38.522 33.118 -8.109  1.00 38.59  ? 127 ILE A N     1 
ATOM   964  C  CA    . ILE A 1  130 ? -37.172 32.676 -8.377  1.00 38.91  ? 127 ILE A CA    1 
ATOM   965  C  C     . ILE A 1  130 ? -36.973 32.255 -9.827  1.00 39.37  ? 127 ILE A C     1 
ATOM   966  O  O     . ILE A 1  130 ? -37.915 31.869 -10.507 1.00 40.14  ? 127 ILE A O     1 
ATOM   967  C  CB    . ILE A 1  130 ? -36.730 31.587 -7.424  1.00 38.78  ? 127 ILE A CB    1 
ATOM   968  C  CG1   . ILE A 1  130 ? -37.466 30.270 -7.722  1.00 39.60  ? 127 ILE A CG1   1 
ATOM   969  C  CG2   . ILE A 1  130 ? -36.934 32.066 -5.978  1.00 39.20  ? 127 ILE A CG2   1 
ATOM   970  C  CD1   . ILE A 1  130 ? -37.016 29.070 -6.850  1.00 38.57  ? 127 ILE A CD1   1 
ATOM   971  N  N     . ASP A 1  131 ? -35.741 32.373 -10.305 1.00 39.61  ? 128 ASP A N     1 
ATOM   972  C  CA    . ASP A 1  131 ? -35.404 32.046 -11.685 1.00 39.74  ? 128 ASP A CA    1 
ATOM   973  C  C     . ASP A 1  131 ? -33.888 31.958 -11.844 1.00 39.54  ? 128 ASP A C     1 
ATOM   974  O  O     . ASP A 1  131 ? -33.148 32.495 -11.020 1.00 39.25  ? 128 ASP A O     1 
ATOM   975  C  CB    . ASP A 1  131 ? -35.978 33.101 -12.631 1.00 39.65  ? 128 ASP A CB    1 
ATOM   976  C  CG    . ASP A 1  131 ? -35.833 32.717 -14.073 1.00 40.32  ? 128 ASP A CG    1 
ATOM   977  O  OD1   . ASP A 1  131 ? -35.726 31.512 -14.370 1.00 41.56  ? 128 ASP A OD1   1 
ATOM   978  O  OD2   . ASP A 1  131 ? -35.820 33.618 -14.924 1.00 41.88  ? 128 ASP A OD2   1 
ATOM   979  N  N     . TYR A 1  132 ? -33.436 31.263 -12.882 1.00 39.93  ? 129 TYR A N     1 
ATOM   980  C  CA    . TYR A 1  132 ? -32.009 31.243 -13.211 1.00 40.97  ? 129 TYR A CA    1 
ATOM   981  C  C     . TYR A 1  132 ? -31.685 32.158 -14.363 1.00 41.26  ? 129 TYR A C     1 
ATOM   982  O  O     . TYR A 1  132 ? -32.520 32.371 -15.254 1.00 41.39  ? 129 TYR A O     1 
ATOM   983  C  CB    . TYR A 1  132 ? -31.498 29.840 -13.528 1.00 40.74  ? 129 TYR A CB    1 
ATOM   984  C  CG    . TYR A 1  132 ? -31.108 29.072 -12.292 1.00 41.94  ? 129 TYR A CG    1 
ATOM   985  C  CD1   . TYR A 1  132 ? -31.986 28.141 -11.714 1.00 42.19  ? 129 TYR A CD1   1 
ATOM   986  C  CD2   . TYR A 1  132 ? -29.868 29.273 -11.691 1.00 44.21  ? 129 TYR A CD2   1 
ATOM   987  C  CE1   . TYR A 1  132 ? -31.647 27.428 -10.576 1.00 42.22  ? 129 TYR A CE1   1 
ATOM   988  C  CE2   . TYR A 1  132 ? -29.511 28.554 -10.544 1.00 45.50  ? 129 TYR A CE2   1 
ATOM   989  C  CZ    . TYR A 1  132 ? -30.419 27.644 -9.995  1.00 44.53  ? 129 TYR A CZ    1 
ATOM   990  O  OH    . TYR A 1  132 ? -30.088 26.974 -8.857  1.00 46.06  ? 129 TYR A OH    1 
ATOM   991  N  N     . ILE A 1  133 ? -30.479 32.713 -14.279 1.00 41.77  ? 130 ILE A N     1 
ATOM   992  C  CA    . ILE A 1  133 ? -29.772 33.395 -15.347 1.00 42.76  ? 130 ILE A CA    1 
ATOM   993  C  C     . ILE A 1  133 ? -28.561 32.522 -15.726 1.00 43.36  ? 130 ILE A C     1 
ATOM   994  O  O     . ILE A 1  133 ? -27.862 32.005 -14.853 1.00 43.46  ? 130 ILE A O     1 
ATOM   995  C  CB    . ILE A 1  133 ? -29.246 34.736 -14.829 1.00 42.99  ? 130 ILE A CB    1 
ATOM   996  C  CG1   . ILE A 1  133 ? -30.368 35.741 -14.666 1.00 43.72  ? 130 ILE A CG1   1 
ATOM   997  C  CG2   . ILE A 1  133 ? -28.196 35.334 -15.732 1.00 43.79  ? 130 ILE A CG2   1 
ATOM   998  C  CD1   . ILE A 1  133 ? -29.869 36.948 -13.893 1.00 45.55  ? 130 ILE A CD1   1 
ATOM   999  N  N     . GLY A 1  134 ? -28.324 32.351 -17.024 1.00 44.24  ? 131 GLY A N     1 
ATOM   1000 C  CA    . GLY A 1  134 ? -27.136 31.673 -17.526 1.00 44.78  ? 131 GLY A CA    1 
ATOM   1001 C  C     . GLY A 1  134 ? -27.443 30.724 -18.668 1.00 45.50  ? 131 GLY A C     1 
ATOM   1002 O  O     . GLY A 1  134 ? -28.600 30.546 -19.040 1.00 46.05  ? 131 GLY A O     1 
ATOM   1003 N  N     . PRO A 1  135 ? -26.418 30.056 -19.196 1.00 46.06  ? 132 PRO A N     1 
ATOM   1004 C  CA    . PRO A 1  135 ? -25.026 30.097 -18.718 1.00 46.75  ? 132 PRO A CA    1 
ATOM   1005 C  C     . PRO A 1  135 ? -24.346 31.423 -19.008 1.00 46.99  ? 132 PRO A C     1 
ATOM   1006 O  O     . PRO A 1  135 ? -24.629 32.039 -20.023 1.00 47.53  ? 132 PRO A O     1 
ATOM   1007 C  CB    . PRO A 1  135 ? -24.344 28.968 -19.505 1.00 46.93  ? 132 PRO A CB    1 
ATOM   1008 C  CG    . PRO A 1  135 ? -25.232 28.742 -20.700 1.00 46.41  ? 132 PRO A CG    1 
ATOM   1009 C  CD    . PRO A 1  135 ? -26.621 29.028 -20.229 1.00 46.07  ? 132 PRO A CD    1 
ATOM   1010 N  N     . LEU A 1  136 ? -23.500 31.864 -18.087 1.00 47.26  ? 133 LEU A N     1 
ATOM   1011 C  CA    . LEU A 1  136 ? -22.683 33.063 -18.240 1.00 47.89  ? 133 LEU A CA    1 
ATOM   1012 C  C     . LEU A 1  136 ? -21.233 32.623 -18.538 1.00 49.17  ? 133 LEU A C     1 
ATOM   1013 O  O     . LEU A 1  136 ? -20.906 31.445 -18.375 1.00 49.68  ? 133 LEU A O     1 
ATOM   1014 C  CB    . LEU A 1  136 ? -22.744 33.916 -16.968 1.00 47.14  ? 133 LEU A CB    1 
ATOM   1015 C  CG    . LEU A 1  136 ? -24.082 34.517 -16.501 1.00 46.31  ? 133 LEU A CG    1 
ATOM   1016 C  CD1   . LEU A 1  136 ? -23.941 35.305 -15.210 1.00 42.40  ? 133 LEU A CD1   1 
ATOM   1017 C  CD2   . LEU A 1  136 ? -24.683 35.407 -17.557 1.00 45.90  ? 133 LEU A CD2   1 
ATOM   1018 N  N     . PRO A 1  137 ? -20.363 33.540 -19.014 1.00 50.22  ? 134 PRO A N     1 
ATOM   1019 C  CA    . PRO A 1  137 ? -18.988 33.096 -19.175 1.00 51.04  ? 134 PRO A CA    1 
ATOM   1020 C  C     . PRO A 1  137 ? -18.472 32.560 -17.835 1.00 52.23  ? 134 PRO A C     1 
ATOM   1021 O  O     . PRO A 1  137 ? -18.728 33.177 -16.810 1.00 52.41  ? 134 PRO A O     1 
ATOM   1022 C  CB    . PRO A 1  137 ? -18.227 34.382 -19.545 1.00 50.74  ? 134 PRO A CB    1 
ATOM   1023 C  CG    . PRO A 1  137 ? -19.199 35.403 -19.796 1.00 50.22  ? 134 PRO A CG    1 
ATOM   1024 C  CD    . PRO A 1  137 ? -20.576 34.898 -19.549 1.00 50.48  ? 134 PRO A CD    1 
ATOM   1025 N  N     . PRO A 1  138 ? -17.748 31.424 -17.837 1.00 53.30  ? 135 PRO A N     1 
ATOM   1026 C  CA    . PRO A 1  138 ? -17.276 30.875 -16.566 1.00 53.72  ? 135 PRO A CA    1 
ATOM   1027 C  C     . PRO A 1  138 ? -16.519 31.902 -15.751 1.00 53.99  ? 135 PRO A C     1 
ATOM   1028 O  O     . PRO A 1  138 ? -15.663 32.610 -16.283 1.00 53.86  ? 135 PRO A O     1 
ATOM   1029 C  CB    . PRO A 1  138 ? -16.336 29.741 -16.986 1.00 54.00  ? 135 PRO A CB    1 
ATOM   1030 C  CG    . PRO A 1  138 ? -16.825 29.328 -18.329 1.00 54.43  ? 135 PRO A CG    1 
ATOM   1031 C  CD    . PRO A 1  138 ? -17.356 30.583 -18.984 1.00 53.55  ? 135 PRO A CD    1 
ATOM   1032 N  N     . SER A 1  139 ? -16.886 31.978 -14.473 1.00 54.47  ? 136 SER A N     1 
ATOM   1033 C  CA    . SER A 1  139 ? -16.240 32.814 -13.478 1.00 54.85  ? 136 SER A CA    1 
ATOM   1034 C  C     . SER A 1  139 ? -16.054 31.935 -12.237 1.00 55.46  ? 136 SER A C     1 
ATOM   1035 O  O     . SER A 1  139 ? -17.032 31.475 -11.648 1.00 55.66  ? 136 SER A O     1 
ATOM   1036 C  CB    . SER A 1  139 ? -17.129 34.011 -13.176 1.00 54.48  ? 136 SER A CB    1 
ATOM   1037 O  OG    . SER A 1  139 ? -16.462 34.950 -12.376 1.00 54.06  ? 136 SER A OG    1 
ATOM   1038 N  N     . GLN A 1  140 ? -14.798 31.676 -11.875 1.00 56.13  ? 137 GLN A N     1 
ATOM   1039 C  CA    . GLN A 1  140 ? -14.435 30.753 -10.774 1.00 56.69  ? 137 GLN A CA    1 
ATOM   1040 C  C     . GLN A 1  140 ? -15.196 29.428 -10.810 1.00 56.28  ? 137 GLN A C     1 
ATOM   1041 O  O     . GLN A 1  140 ? -15.540 28.860 -9.773  1.00 56.56  ? 137 GLN A O     1 
ATOM   1042 C  CB    . GLN A 1  140 ? -14.637 31.410 -9.411  1.00 57.07  ? 137 GLN A CB    1 
ATOM   1043 C  CG    . GLN A 1  140 ? -14.266 32.877 -9.357  1.00 59.54  ? 137 GLN A CG    1 
ATOM   1044 C  CD    . GLN A 1  140 ? -12.992 33.113 -8.613  1.00 61.32  ? 137 GLN A CD    1 
ATOM   1045 O  OE1   . GLN A 1  140 ? -12.039 33.676 -9.155  1.00 62.21  ? 137 GLN A OE1   1 
ATOM   1046 N  NE2   . GLN A 1  140 ? -12.961 32.685 -7.351  1.00 62.47  ? 137 GLN A NE2   1 
ATOM   1047 N  N     . GLY A 1  141 ? -15.457 28.933 -12.008 1.00 56.08  ? 138 GLY A N     1 
ATOM   1048 C  CA    . GLY A 1  141 ? -16.102 27.636 -12.155 1.00 55.80  ? 138 GLY A CA    1 
ATOM   1049 C  C     . GLY A 1  141 ? -17.607 27.731 -12.036 1.00 55.60  ? 138 GLY A C     1 
ATOM   1050 O  O     . GLY A 1  141 ? -18.303 26.712 -12.067 1.00 55.90  ? 138 GLY A O     1 
ATOM   1051 N  N     . TYR A 1  142 ? -18.117 28.952 -11.904 1.00 54.93  ? 139 TYR A N     1 
ATOM   1052 C  CA    . TYR A 1  142 ? -19.555 29.171 -11.806 1.00 54.01  ? 139 TYR A CA    1 
ATOM   1053 C  C     . TYR A 1  142 ? -20.121 29.645 -13.138 1.00 53.24  ? 139 TYR A C     1 
ATOM   1054 O  O     . TYR A 1  142 ? -19.470 30.411 -13.861 1.00 53.15  ? 139 TYR A O     1 
ATOM   1055 C  CB    . TYR A 1  142 ? -19.853 30.185 -10.707 1.00 54.01  ? 139 TYR A CB    1 
ATOM   1056 C  CG    . TYR A 1  142 ? -19.617 29.640 -9.323  1.00 54.78  ? 139 TYR A CG    1 
ATOM   1057 C  CD1   . TYR A 1  142 ? -20.638 28.975 -8.629  1.00 54.98  ? 139 TYR A CD1   1 
ATOM   1058 C  CD2   . TYR A 1  142 ? -18.370 29.779 -8.700  1.00 55.50  ? 139 TYR A CD2   1 
ATOM   1059 C  CE1   . TYR A 1  142 ? -20.422 28.457 -7.353  1.00 55.25  ? 139 TYR A CE1   1 
ATOM   1060 C  CE2   . TYR A 1  142 ? -18.146 29.269 -7.412  1.00 56.04  ? 139 TYR A CE2   1 
ATOM   1061 C  CZ    . TYR A 1  142 ? -19.179 28.609 -6.753  1.00 55.90  ? 139 TYR A CZ    1 
ATOM   1062 O  OH    . TYR A 1  142 ? -18.965 28.103 -5.497  1.00 56.73  ? 139 TYR A OH    1 
ATOM   1063 N  N     . LEU A 1  143 ? -21.341 29.206 -13.442 1.00 51.87  ? 140 LEU A N     1 
ATOM   1064 C  CA    . LEU A 1  143 ? -21.939 29.466 -14.742 1.00 50.53  ? 140 LEU A CA    1 
ATOM   1065 C  C     . LEU A 1  143 ? -23.321 30.073 -14.652 1.00 49.82  ? 140 LEU A C     1 
ATOM   1066 O  O     . LEU A 1  143 ? -23.800 30.643 -15.620 1.00 50.02  ? 140 LEU A O     1 
ATOM   1067 C  CB    . LEU A 1  143 ? -22.014 28.172 -15.563 1.00 50.53  ? 140 LEU A CB    1 
ATOM   1068 C  CG    . LEU A 1  143 ? -20.717 27.500 -16.043 1.00 50.33  ? 140 LEU A CG    1 
ATOM   1069 C  CD1   . LEU A 1  143 ? -20.993 26.148 -16.657 1.00 49.53  ? 140 LEU A CD1   1 
ATOM   1070 C  CD2   . LEU A 1  143 ? -19.994 28.378 -17.032 1.00 50.14  ? 140 LEU A CD2   1 
ATOM   1071 N  N     . TYR A 1  144 ? -23.992 29.923 -13.517 1.00 48.64  ? 141 TYR A N     1 
ATOM   1072 C  CA    . TYR A 1  144 ? -25.361 30.413 -13.415 1.00 47.22  ? 141 TYR A CA    1 
ATOM   1073 C  C     . TYR A 1  144 ? -25.554 31.295 -12.180 1.00 46.33  ? 141 TYR A C     1 
ATOM   1074 O  O     . TYR A 1  144 ? -24.712 31.298 -11.284 1.00 46.22  ? 141 TYR A O     1 
ATOM   1075 C  CB    . TYR A 1  144 ? -26.342 29.250 -13.405 1.00 47.22  ? 141 TYR A CB    1 
ATOM   1076 C  CG    . TYR A 1  144 ? -26.386 28.445 -14.672 1.00 47.46  ? 141 TYR A CG    1 
ATOM   1077 C  CD1   . TYR A 1  144 ? -27.411 28.630 -15.597 1.00 48.10  ? 141 TYR A CD1   1 
ATOM   1078 C  CD2   . TYR A 1  144 ? -25.429 27.464 -14.936 1.00 48.08  ? 141 TYR A CD2   1 
ATOM   1079 C  CE1   . TYR A 1  144 ? -27.468 27.880 -16.772 1.00 47.94  ? 141 TYR A CE1   1 
ATOM   1080 C  CE2   . TYR A 1  144 ? -25.470 26.718 -16.107 1.00 48.59  ? 141 TYR A CE2   1 
ATOM   1081 C  CZ    . TYR A 1  144 ? -26.492 26.934 -17.018 1.00 48.96  ? 141 TYR A CZ    1 
ATOM   1082 O  OH    . TYR A 1  144 ? -26.540 26.197 -18.172 1.00 50.43  ? 141 TYR A OH    1 
ATOM   1083 N  N     . VAL A 1  145 ? -26.646 32.059 -12.157 1.00 44.96  ? 142 VAL A N     1 
ATOM   1084 C  CA    . VAL A 1  145 ? -27.023 32.828 -10.980 1.00 43.74  ? 142 VAL A CA    1 
ATOM   1085 C  C     . VAL A 1  145 ? -28.451 32.492 -10.603 1.00 43.49  ? 142 VAL A C     1 
ATOM   1086 O  O     . VAL A 1  145 ? -29.335 32.485 -11.462 1.00 43.47  ? 142 VAL A O     1 
ATOM   1087 C  CB    . VAL A 1  145 ? -26.935 34.338 -11.207 1.00 43.73  ? 142 VAL A CB    1 
ATOM   1088 C  CG1   . VAL A 1  145 ? -27.539 35.091 -10.006 1.00 42.77  ? 142 VAL A CG1   1 
ATOM   1089 C  CG2   . VAL A 1  145 ? -25.506 34.754 -11.429 1.00 41.92  ? 142 VAL A CG2   1 
ATOM   1090 N  N     . LEU A 1  146 ? -28.673 32.192 -9.322  1.00 42.65  ? 143 LEU A N     1 
ATOM   1091 C  CA    . LEU A 1  146 ? -30.027 32.046 -8.827  1.00 41.54  ? 143 LEU A CA    1 
ATOM   1092 C  C     . LEU A 1  146 ? -30.476 33.414 -8.363  1.00 40.77  ? 143 LEU A C     1 
ATOM   1093 O  O     . LEU A 1  146 ? -29.815 34.048 -7.556  1.00 40.94  ? 143 LEU A O     1 
ATOM   1094 C  CB    . LEU A 1  146 ? -30.099 31.046 -7.688  1.00 41.16  ? 143 LEU A CB    1 
ATOM   1095 C  CG    . LEU A 1  146 ? -31.474 30.861 -7.033  1.00 41.04  ? 143 LEU A CG    1 
ATOM   1096 C  CD1   . LEU A 1  146 ? -32.428 30.069 -7.912  1.00 42.09  ? 143 LEU A CD1   1 
ATOM   1097 C  CD2   . LEU A 1  146 ? -31.333 30.156 -5.711  1.00 41.31  ? 143 LEU A CD2   1 
ATOM   1098 N  N     . VAL A 1  147 ? -31.584 33.876 -8.905  1.00 39.92  ? 144 VAL A N     1 
ATOM   1099 C  CA    . VAL A 1  147 ? -32.128 35.153 -8.503  1.00 39.89  ? 144 VAL A CA    1 
ATOM   1100 C  C     . VAL A 1  147 ? -33.425 34.889 -7.742  1.00 39.85  ? 144 VAL A C     1 
ATOM   1101 O  O     . VAL A 1  147 ? -34.318 34.162 -8.221  1.00 39.19  ? 144 VAL A O     1 
ATOM   1102 C  CB    . VAL A 1  147 ? -32.397 36.079 -9.711  1.00 39.70  ? 144 VAL A CB    1 
ATOM   1103 C  CG1   . VAL A 1  147 ? -32.831 37.423 -9.247  1.00 39.43  ? 144 VAL A CG1   1 
ATOM   1104 C  CG2   . VAL A 1  147 ? -31.148 36.220 -10.573 1.00 40.66  ? 144 VAL A CG2   1 
ATOM   1105 N  N     . VAL A 1  148 ? -33.500 35.475 -6.549  1.00 39.40  ? 145 VAL A N     1 
ATOM   1106 C  CA    . VAL A 1  148 ? -34.669 35.368 -5.710  1.00 39.16  ? 145 VAL A CA    1 
ATOM   1107 C  C     . VAL A 1  148 ? -35.146 36.769 -5.432  1.00 39.40  ? 145 VAL A C     1 
ATOM   1108 O  O     . VAL A 1  148 ? -34.380 37.591 -4.909  1.00 40.15  ? 145 VAL A O     1 
ATOM   1109 C  CB    . VAL A 1  148 ? -34.343 34.721 -4.373  1.00 39.13  ? 145 VAL A CB    1 
ATOM   1110 C  CG1   . VAL A 1  148 ? -35.624 34.509 -3.621  1.00 38.66  ? 145 VAL A CG1   1 
ATOM   1111 C  CG2   . VAL A 1  148 ? -33.603 33.407 -4.570  1.00 37.56  ? 145 VAL A CG2   1 
ATOM   1112 N  N     . VAL A 1  149 ? -36.403 37.043 -5.773  1.00 39.06  ? 146 VAL A N     1 
ATOM   1113 C  CA    . VAL A 1  149 ? -36.951 38.387 -5.656  1.00 38.88  ? 146 VAL A CA    1 
ATOM   1114 C  C     . VAL A 1  149 ? -38.231 38.386 -4.815  1.00 38.69  ? 146 VAL A C     1 
ATOM   1115 O  O     . VAL A 1  149 ? -39.236 37.791 -5.204  1.00 39.16  ? 146 VAL A O     1 
ATOM   1116 C  CB    . VAL A 1  149 ? -37.247 38.987 -7.053  1.00 38.68  ? 146 VAL A CB    1 
ATOM   1117 C  CG1   . VAL A 1  149 ? -37.950 40.361 -6.943  1.00 38.56  ? 146 VAL A CG1   1 
ATOM   1118 C  CG2   . VAL A 1  149 ? -35.986 39.107 -7.840  1.00 39.41  ? 146 VAL A CG2   1 
ATOM   1119 N  N     . ASP A 1  150 ? -38.194 39.063 -3.680  1.00 37.99  ? 147 ASP A N     1 
ATOM   1120 C  CA    . ASP A 1  150 ? -39.367 39.188 -2.856  1.00 38.27  ? 147 ASP A CA    1 
ATOM   1121 C  C     . ASP A 1  150 ? -40.412 40.055 -3.551  1.00 38.14  ? 147 ASP A C     1 
ATOM   1122 O  O     . ASP A 1  150 ? -40.158 41.202 -3.896  1.00 38.46  ? 147 ASP A O     1 
ATOM   1123 C  CB    . ASP A 1  150 ? -39.013 39.786 -1.491  1.00 38.57  ? 147 ASP A CB    1 
ATOM   1124 C  CG    . ASP A 1  150 ? -40.255 40.124 -0.671  1.00 40.12  ? 147 ASP A CG    1 
ATOM   1125 O  OD1   . ASP A 1  150 ? -41.007 39.171 -0.303  1.00 42.02  ? 147 ASP A OD1   1 
ATOM   1126 O  OD2   . ASP A 1  150 ? -40.487 41.333 -0.419  1.00 38.86  ? 147 ASP A OD2   1 
ATOM   1127 N  N     . GLY A 1  151 ? -41.601 39.499 -3.714  1.00 37.93  ? 148 GLY A N     1 
ATOM   1128 C  CA    . GLY A 1  151 ? -42.646 40.111 -4.496  1.00 37.66  ? 148 GLY A CA    1 
ATOM   1129 C  C     . GLY A 1  151 ? -43.067 41.464 -3.995  1.00 37.82  ? 148 GLY A C     1 
ATOM   1130 O  O     . GLY A 1  151 ? -43.307 42.373 -4.781  1.00 38.42  ? 148 GLY A O     1 
ATOM   1131 N  N     . MET A 1  152 ? -43.170 41.611 -2.687  1.00 37.80  ? 149 MET A N     1 
ATOM   1132 C  CA    . MET A 1  152 ? -43.678 42.853 -2.143  1.00 37.64  ? 149 MET A CA    1 
ATOM   1133 C  C     . MET A 1  152 ? -42.659 43.984 -2.281  1.00 37.16  ? 149 MET A C     1 
ATOM   1134 O  O     . MET A 1  152 ? -42.988 45.073 -2.726  1.00 36.71  ? 149 MET A O     1 
ATOM   1135 C  CB    . MET A 1  152 ? -44.114 42.670 -0.686  1.00 37.57  ? 149 MET A CB    1 
ATOM   1136 C  CG    . MET A 1  152 ? -44.832 43.900 -0.122  1.00 38.26  ? 149 MET A CG    1 
ATOM   1137 S  SD    . MET A 1  152 ? -43.707 45.164 0.516   1.00 40.40  ? 149 MET A SD    1 
ATOM   1138 C  CE    . MET A 1  152 ? -44.408 46.638 -0.217  1.00 38.23  ? 149 MET A CE    1 
ATOM   1139 N  N     . THR A 1  153 ? -41.420 43.697 -1.913  1.00 37.19  ? 150 THR A N     1 
ATOM   1140 C  CA    . THR A 1  153 ? -40.412 44.734 -1.742  1.00 37.38  ? 150 THR A CA    1 
ATOM   1141 C  C     . THR A 1  153 ? -39.554 44.913 -2.978  1.00 37.84  ? 150 THR A C     1 
ATOM   1142 O  O     . THR A 1  153 ? -38.994 45.997 -3.219  1.00 38.46  ? 150 THR A O     1 
ATOM   1143 C  CB    . THR A 1  153 ? -39.460 44.405 -0.567  1.00 36.96  ? 150 THR A CB    1 
ATOM   1144 O  OG1   . THR A 1  153 ? -38.845 43.137 -0.807  1.00 35.75  ? 150 THR A OG1   1 
ATOM   1145 C  CG2   . THR A 1  153 ? -40.226 44.350 0.747   1.00 37.04  ? 150 THR A CG2   1 
ATOM   1146 N  N     . GLY A 1  154 ? -39.412 43.840 -3.740  1.00 37.60  ? 151 GLY A N     1 
ATOM   1147 C  CA    . GLY A 1  154 ? -38.429 43.835 -4.801  1.00 37.53  ? 151 GLY A CA    1 
ATOM   1148 C  C     . GLY A 1  154 ? -37.056 43.435 -4.291  1.00 37.29  ? 151 GLY A C     1 
ATOM   1149 O  O     . GLY A 1  154 ? -36.143 43.198 -5.079  1.00 37.87  ? 151 GLY A O     1 
ATOM   1150 N  N     . PHE A 1  155 ? -36.890 43.348 -2.981  1.00 36.65  ? 152 PHE A N     1 
ATOM   1151 C  CA    . PHE A 1  155 ? -35.594 42.993 -2.443  1.00 36.06  ? 152 PHE A CA    1 
ATOM   1152 C  C     . PHE A 1  155 ? -35.144 41.650 -3.037  1.00 36.54  ? 152 PHE A C     1 
ATOM   1153 O  O     . PHE A 1  155 ? -35.937 40.690 -3.132  1.00 36.20  ? 152 PHE A O     1 
ATOM   1154 C  CB    . PHE A 1  155 ? -35.667 42.931 -0.922  1.00 35.68  ? 152 PHE A CB    1 
ATOM   1155 C  CG    . PHE A 1  155 ? -34.341 42.981 -0.255  1.00 33.19  ? 152 PHE A CG    1 
ATOM   1156 C  CD1   . PHE A 1  155 ? -33.859 44.182 0.237   1.00 30.50  ? 152 PHE A CD1   1 
ATOM   1157 C  CD2   . PHE A 1  155 ? -33.568 41.824 -0.111  1.00 31.82  ? 152 PHE A CD2   1 
ATOM   1158 C  CE1   . PHE A 1  155 ? -32.629 44.248 0.869   1.00 29.02  ? 152 PHE A CE1   1 
ATOM   1159 C  CE2   . PHE A 1  155 ? -32.335 41.877 0.517   1.00 30.94  ? 152 PHE A CE2   1 
ATOM   1160 C  CZ    . PHE A 1  155 ? -31.869 43.111 1.017   1.00 30.96  ? 152 PHE A CZ    1 
ATOM   1161 N  N     . THR A 1  156 ? -33.874 41.595 -3.434  1.00 36.78  ? 153 THR A N     1 
ATOM   1162 C  CA    . THR A 1  156 ? -33.361 40.504 -4.258  1.00 37.31  ? 153 THR A CA    1 
ATOM   1163 C  C     . THR A 1  156 ? -32.135 39.842 -3.676  1.00 38.22  ? 153 THR A C     1 
ATOM   1164 O  O     . THR A 1  156 ? -31.258 40.520 -3.152  1.00 38.60  ? 153 THR A O     1 
ATOM   1165 C  CB    . THR A 1  156 ? -32.983 41.059 -5.640  1.00 37.08  ? 153 THR A CB    1 
ATOM   1166 O  OG1   . THR A 1  156 ? -34.155 41.611 -6.238  1.00 36.70  ? 153 THR A OG1   1 
ATOM   1167 C  CG2   . THR A 1  156 ? -32.412 39.987 -6.545  1.00 35.33  ? 153 THR A CG2   1 
ATOM   1168 N  N     . TRP A 1  157 ? -32.047 38.526 -3.819  1.00 39.33  ? 154 TRP A N     1 
ATOM   1169 C  CA    . TRP A 1  157 ? -30.873 37.790 -3.370  1.00 40.78  ? 154 TRP A CA    1 
ATOM   1170 C  C     . TRP A 1  157 ? -30.233 37.079 -4.535  1.00 41.44  ? 154 TRP A C     1 
ATOM   1171 O  O     . TRP A 1  157 ? -30.923 36.503 -5.368  1.00 41.90  ? 154 TRP A O     1 
ATOM   1172 C  CB    . TRP A 1  157 ? -31.254 36.721 -2.338  1.00 41.16  ? 154 TRP A CB    1 
ATOM   1173 C  CG    . TRP A 1  157 ? -31.637 37.219 -0.972  1.00 41.45  ? 154 TRP A CG    1 
ATOM   1174 C  CD1   . TRP A 1  157 ? -30.830 37.286 0.120   1.00 41.90  ? 154 TRP A CD1   1 
ATOM   1175 C  CD2   . TRP A 1  157 ? -32.934 37.677 -0.546  1.00 41.86  ? 154 TRP A CD2   1 
ATOM   1176 N  NE1   . TRP A 1  157 ? -31.528 37.767 1.191   1.00 43.09  ? 154 TRP A NE1   1 
ATOM   1177 C  CE2   . TRP A 1  157 ? -32.824 38.012 0.817   1.00 42.31  ? 154 TRP A CE2   1 
ATOM   1178 C  CE3   . TRP A 1  157 ? -34.176 37.828 -1.186  1.00 41.86  ? 154 TRP A CE3   1 
ATOM   1179 C  CZ2   . TRP A 1  157 ? -33.903 38.512 1.559   1.00 40.89  ? 154 TRP A CZ2   1 
ATOM   1180 C  CZ3   . TRP A 1  157 ? -35.249 38.318 -0.451  1.00 42.50  ? 154 TRP A CZ3   1 
ATOM   1181 C  CH2   . TRP A 1  157 ? -35.100 38.663 0.910   1.00 42.26  ? 154 TRP A CH2   1 
ATOM   1182 N  N     . LEU A 1  158 ? -28.910 37.051 -4.538  1.00 42.27  ? 155 LEU A N     1 
ATOM   1183 C  CA    . LEU A 1  158 ? -28.150 36.498 -5.641  1.00 42.93  ? 155 LEU A CA    1 
ATOM   1184 C  C     . LEU A 1  158 ? -27.199 35.389 -5.189  1.00 43.69  ? 155 LEU A C     1 
ATOM   1185 O  O     . LEU A 1  158 ? -26.420 35.582 -4.249  1.00 44.00  ? 155 LEU A O     1 
ATOM   1186 C  CB    . LEU A 1  158 ? -27.366 37.626 -6.323  1.00 42.77  ? 155 LEU A CB    1 
ATOM   1187 C  CG    . LEU A 1  158 ? -28.213 38.711 -6.991  1.00 41.56  ? 155 LEU A CG    1 
ATOM   1188 C  CD1   . LEU A 1  158 ? -27.344 39.757 -7.685  1.00 40.42  ? 155 LEU A CD1   1 
ATOM   1189 C  CD2   . LEU A 1  158 ? -29.147 38.075 -7.990  1.00 40.07  ? 155 LEU A CD2   1 
ATOM   1190 N  N     . TYR A 1  159 ? -27.267 34.236 -5.854  1.00 44.36  ? 156 TYR A N     1 
ATOM   1191 C  CA    . TYR A 1  159 ? -26.383 33.113 -5.555  1.00 45.64  ? 156 TYR A CA    1 
ATOM   1192 C  C     . TYR A 1  159 ? -25.777 32.542 -6.814  1.00 46.51  ? 156 TYR A C     1 
ATOM   1193 O  O     . TYR A 1  159 ? -26.514 32.171 -7.738  1.00 47.15  ? 156 TYR A O     1 
ATOM   1194 C  CB    . TYR A 1  159 ? -27.139 32.009 -4.842  1.00 45.55  ? 156 TYR A CB    1 
ATOM   1195 C  CG    . TYR A 1  159 ? -27.811 32.494 -3.594  1.00 47.33  ? 156 TYR A CG    1 
ATOM   1196 C  CD1   . TYR A 1  159 ? -27.208 32.335 -2.349  1.00 48.16  ? 156 TYR A CD1   1 
ATOM   1197 C  CD2   . TYR A 1  159 ? -29.048 33.135 -3.653  1.00 48.96  ? 156 TYR A CD2   1 
ATOM   1198 C  CE1   . TYR A 1  159 ? -27.828 32.788 -1.190  1.00 49.66  ? 156 TYR A CE1   1 
ATOM   1199 C  CE2   . TYR A 1  159 ? -29.670 33.599 -2.500  1.00 50.82  ? 156 TYR A CE2   1 
ATOM   1200 C  CZ    . TYR A 1  159 ? -29.053 33.422 -1.274  1.00 50.81  ? 156 TYR A CZ    1 
ATOM   1201 O  OH    . TYR A 1  159 ? -29.667 33.890 -0.135  1.00 53.14  ? 156 TYR A OH    1 
ATOM   1202 N  N     . PRO A 1  160 ? -24.436 32.461 -6.862  1.00 47.04  ? 157 PRO A N     1 
ATOM   1203 C  CA    . PRO A 1  160 ? -23.748 31.864 -8.012  1.00 47.39  ? 157 PRO A CA    1 
ATOM   1204 C  C     . PRO A 1  160 ? -23.845 30.348 -7.961  1.00 47.90  ? 157 PRO A C     1 
ATOM   1205 O  O     . PRO A 1  160 ? -23.644 29.775 -6.901  1.00 47.83  ? 157 PRO A O     1 
ATOM   1206 C  CB    . PRO A 1  160 ? -22.288 32.291 -7.813  1.00 47.37  ? 157 PRO A CB    1 
ATOM   1207 C  CG    . PRO A 1  160 ? -22.149 32.624 -6.337  1.00 47.17  ? 157 PRO A CG    1 
ATOM   1208 C  CD    . PRO A 1  160 ? -23.518 32.799 -5.753  1.00 46.99  ? 157 PRO A CD    1 
ATOM   1209 N  N     . THR A 1  161 ? -24.161 29.702 -9.080  1.00 48.73  ? 158 THR A N     1 
ATOM   1210 C  CA    . THR A 1  161 ? -24.149 28.239 -9.126  1.00 49.85  ? 158 THR A CA    1 
ATOM   1211 C  C     . THR A 1  161 ? -23.360 27.680 -10.312 1.00 50.48  ? 158 THR A C     1 
ATOM   1212 O  O     . THR A 1  161 ? -22.987 28.426 -11.231 1.00 51.01  ? 158 THR A O     1 
ATOM   1213 C  CB    . THR A 1  161 ? -25.570 27.637 -9.149  1.00 50.09  ? 158 THR A CB    1 
ATOM   1214 O  OG1   . THR A 1  161 ? -26.123 27.728 -10.470 1.00 49.72  ? 158 THR A OG1   1 
ATOM   1215 C  CG2   . THR A 1  161 ? -26.481 28.329 -8.136  1.00 50.38  ? 158 THR A CG2   1 
ATOM   1216 N  N     . LYS A 1  162 ? -23.118 26.370 -10.292 1.00 50.66  ? 159 LYS A N     1 
ATOM   1217 C  CA    . LYS A 1  162 ? -22.438 25.700 -11.393 1.00 50.97  ? 159 LYS A CA    1 
ATOM   1218 C  C     . LYS A 1  162 ? -23.439 25.121 -12.378 1.00 50.94  ? 159 LYS A C     1 
ATOM   1219 O  O     . LYS A 1  162 ? -23.086 24.804 -13.530 1.00 51.93  ? 159 LYS A O     1 
ATOM   1220 C  CB    . LYS A 1  162 ? -21.497 24.628 -10.871 1.00 50.89  ? 159 LYS A CB    1 
ATOM   1221 C  CG    . LYS A 1  162 ? -20.298 25.238 -10.202 1.00 53.51  ? 159 LYS A CG    1 
ATOM   1222 C  CD    . LYS A 1  162 ? -19.478 24.236 -9.417  1.00 58.01  ? 159 LYS A CD    1 
ATOM   1223 C  CE    . LYS A 1  162 ? -18.242 24.925 -8.848  1.00 59.99  ? 159 LYS A CE    1 
ATOM   1224 N  NZ    . LYS A 1  162 ? -17.621 24.080 -7.794  1.00 62.61  ? 159 LYS A NZ    1 
ATOM   1225 N  N     . ALA A 1  163 ? -24.688 25.007 -11.934 1.00 50.20  ? 160 ALA A N     1 
ATOM   1226 C  CA    . ALA A 1  163 ? -25.764 24.452 -12.753 1.00 49.77  ? 160 ALA A CA    1 
ATOM   1227 C  C     . ALA A 1  163 ? -27.115 24.979 -12.283 1.00 49.36  ? 160 ALA A C     1 
ATOM   1228 O  O     . ALA A 1  163 ? -27.254 25.375 -11.128 1.00 49.58  ? 160 ALA A O     1 
ATOM   1229 C  CB    . ALA A 1  163 ? -25.745 22.934 -12.692 1.00 49.72  ? 160 ALA A CB    1 
ATOM   1230 N  N     . PRO A 1  164 ? -28.112 25.009 -13.176 1.00 48.90  ? 161 PRO A N     1 
ATOM   1231 C  CA    . PRO A 1  164 ? -29.435 25.389 -12.699 1.00 49.02  ? 161 PRO A CA    1 
ATOM   1232 C  C     . PRO A 1  164 ? -30.143 24.165 -12.097 1.00 49.18  ? 161 PRO A C     1 
ATOM   1233 O  O     . PRO A 1  164 ? -31.223 23.786 -12.553 1.00 49.20  ? 161 PRO A O     1 
ATOM   1234 C  CB    . PRO A 1  164 ? -30.140 25.868 -13.977 1.00 49.04  ? 161 PRO A CB    1 
ATOM   1235 C  CG    . PRO A 1  164 ? -29.505 25.068 -15.084 1.00 48.51  ? 161 PRO A CG    1 
ATOM   1236 C  CD    . PRO A 1  164 ? -28.088 24.759 -14.632 1.00 48.86  ? 161 PRO A CD    1 
ATOM   1237 N  N     . SER A 1  165 ? -29.519 23.558 -11.091 1.00 49.09  ? 162 SER A N     1 
ATOM   1238 C  CA    . SER A 1  165 ? -29.995 22.319 -10.480 1.00 49.31  ? 162 SER A CA    1 
ATOM   1239 C  C     . SER A 1  165 ? -30.817 22.510 -9.201  1.00 49.63  ? 162 SER A C     1 
ATOM   1240 O  O     . SER A 1  165 ? -30.687 23.514 -8.480  1.00 49.51  ? 162 SER A O     1 
ATOM   1241 C  CB    . SER A 1  165 ? -28.803 21.432 -10.142 1.00 49.53  ? 162 SER A CB    1 
ATOM   1242 O  OG    . SER A 1  165 ? -27.894 22.105 -9.282  1.00 49.13  ? 162 SER A OG    1 
ATOM   1243 N  N     . THR A 1  166 ? -31.660 21.517 -8.928  1.00 49.72  ? 163 THR A N     1 
ATOM   1244 C  CA    . THR A 1  166 ? -32.384 21.412 -7.675  1.00 49.30  ? 163 THR A CA    1 
ATOM   1245 C  C     . THR A 1  166 ? -31.408 21.495 -6.500  1.00 49.42  ? 163 THR A C     1 
ATOM   1246 O  O     . THR A 1  166 ? -31.634 22.239 -5.534  1.00 49.80  ? 163 THR A O     1 
ATOM   1247 C  CB    . THR A 1  166 ? -33.159 20.092 -7.623  1.00 49.11  ? 163 THR A CB    1 
ATOM   1248 O  OG1   . THR A 1  166 ? -34.166 20.117 -8.636  1.00 48.72  ? 163 THR A OG1   1 
ATOM   1249 C  CG2   . THR A 1  166 ? -33.820 19.881 -6.255  1.00 49.22  ? 163 THR A CG2   1 
ATOM   1250 N  N     . SER A 1  167 ? -30.309 20.760 -6.582  1.00 48.99  ? 164 SER A N     1 
ATOM   1251 C  CA    . SER A 1  167 ? -29.458 20.677 -5.422  1.00 49.02  ? 164 SER A CA    1 
ATOM   1252 C  C     . SER A 1  167 ? -28.863 22.047 -5.090  1.00 49.00  ? 164 SER A C     1 
ATOM   1253 O  O     . SER A 1  167 ? -28.804 22.445 -3.921  1.00 49.64  ? 164 SER A O     1 
ATOM   1254 C  CB    . SER A 1  167 ? -28.404 19.579 -5.573  1.00 48.64  ? 164 SER A CB    1 
ATOM   1255 O  OG    . SER A 1  167 ? -27.314 20.027 -6.323  1.00 49.56  ? 164 SER A OG    1 
ATOM   1256 N  N     . ALA A 1  168 ? -28.469 22.789 -6.121  1.00 48.67  ? 165 ALA A N     1 
ATOM   1257 C  CA    . ALA A 1  168 ? -27.830 24.081 -5.919  1.00 47.64  ? 165 ALA A CA    1 
ATOM   1258 C  C     . ALA A 1  168 ? -28.888 25.093 -5.517  1.00 47.27  ? 165 ALA A C     1 
ATOM   1259 O  O     . ALA A 1  168 ? -28.606 26.042 -4.749  1.00 46.90  ? 165 ALA A O     1 
ATOM   1260 C  CB    . ALA A 1  168 ? -27.107 24.518 -7.163  1.00 47.93  ? 165 ALA A CB    1 
ATOM   1261 N  N     . THR A 1  169 ? -30.109 24.873 -6.008  1.00 46.27  ? 166 THR A N     1 
ATOM   1262 C  CA    . THR A 1  169 ? -31.239 25.675 -5.565  1.00 45.90  ? 166 THR A CA    1 
ATOM   1263 C  C     . THR A 1  169 ? -31.444 25.483 -4.063  1.00 45.75  ? 166 THR A C     1 
ATOM   1264 O  O     . THR A 1  169 ? -31.564 26.460 -3.308  1.00 45.55  ? 166 THR A O     1 
ATOM   1265 C  CB    . THR A 1  169 ? -32.514 25.348 -6.344  1.00 45.84  ? 166 THR A CB    1 
ATOM   1266 O  OG1   . THR A 1  169 ? -32.271 25.581 -7.732  1.00 45.87  ? 166 THR A OG1   1 
ATOM   1267 C  CG2   . THR A 1  169 ? -33.661 26.227 -5.890  1.00 44.64  ? 166 THR A CG2   1 
ATOM   1268 N  N     . VAL A 1  170 ? -31.434 24.228 -3.633  1.00 45.67  ? 167 VAL A N     1 
ATOM   1269 C  CA    . VAL A 1  170 ? -31.669 23.915 -2.232  1.00 46.03  ? 167 VAL A CA    1 
ATOM   1270 C  C     . VAL A 1  170 ? -30.546 24.493 -1.344  1.00 46.74  ? 167 VAL A C     1 
ATOM   1271 O  O     . VAL A 1  170 ? -30.836 25.151 -0.355  1.00 46.74  ? 167 VAL A O     1 
ATOM   1272 C  CB    . VAL A 1  170 ? -31.919 22.376 -2.013  1.00 46.11  ? 167 VAL A CB    1 
ATOM   1273 C  CG1   . VAL A 1  170 ? -31.740 21.976 -0.554  1.00 44.53  ? 167 VAL A CG1   1 
ATOM   1274 C  CG2   . VAL A 1  170 ? -33.305 21.972 -2.538  1.00 44.59  ? 167 VAL A CG2   1 
ATOM   1275 N  N     . LYS A 1  171 ? -29.282 24.279 -1.704  1.00 47.42  ? 168 LYS A N     1 
ATOM   1276 C  CA    . LYS A 1  171 ? -28.186 24.878 -0.951  1.00 48.69  ? 168 LYS A CA    1 
ATOM   1277 C  C     . LYS A 1  171 ? -28.411 26.372 -0.736  1.00 48.55  ? 168 LYS A C     1 
ATOM   1278 O  O     . LYS A 1  171 ? -28.313 26.853 0.394   1.00 49.03  ? 168 LYS A O     1 
ATOM   1279 C  CB    . LYS A 1  171 ? -26.823 24.658 -1.623  1.00 49.27  ? 168 LYS A CB    1 
ATOM   1280 C  CG    . LYS A 1  171 ? -26.349 23.202 -1.685  1.00 52.48  ? 168 LYS A CG    1 
ATOM   1281 C  CD    . LYS A 1  171 ? -24.828 23.153 -2.010  1.00 59.29  ? 168 LYS A CD    1 
ATOM   1282 C  CE    . LYS A 1  171 ? -24.411 21.931 -2.922  1.00 61.68  ? 168 LYS A CE    1 
ATOM   1283 N  NZ    . LYS A 1  171 ? -24.309 20.617 -2.199  1.00 61.20  ? 168 LYS A NZ    1 
ATOM   1284 N  N     . SER A 1  172 ? -28.730 27.099 -1.806  1.00 48.33  ? 169 SER A N     1 
ATOM   1285 C  CA    . SER A 1  172 ? -28.893 28.557 -1.725  1.00 47.96  ? 169 SER A CA    1 
ATOM   1286 C  C     . SER A 1  172 ? -30.053 28.947 -0.823  1.00 47.62  ? 169 SER A C     1 
ATOM   1287 O  O     . SER A 1  172 ? -29.908 29.819 0.039   1.00 47.83  ? 169 SER A O     1 
ATOM   1288 C  CB    . SER A 1  172 ? -29.090 29.178 -3.110  1.00 48.09  ? 169 SER A CB    1 
ATOM   1289 O  OG    . SER A 1  172 ? -28.011 28.876 -3.975  1.00 49.14  ? 169 SER A OG    1 
ATOM   1290 N  N     . LEU A 1  173 ? -31.201 28.301 -1.011  1.00 46.91  ? 170 LEU A N     1 
ATOM   1291 C  CA    . LEU A 1  173 ? -32.399 28.685 -0.258  1.00 46.42  ? 170 LEU A CA    1 
ATOM   1292 C  C     . LEU A 1  173 ? -32.344 28.341 1.248   1.00 46.53  ? 170 LEU A C     1 
ATOM   1293 O  O     . LEU A 1  173 ? -32.912 29.075 2.088   1.00 46.73  ? 170 LEU A O     1 
ATOM   1294 C  CB    . LEU A 1  173 ? -33.665 28.151 -0.927  1.00 45.92  ? 170 LEU A CB    1 
ATOM   1295 C  CG    . LEU A 1  173 ? -33.959 28.743 -2.302  1.00 44.57  ? 170 LEU A CG    1 
ATOM   1296 C  CD1   . LEU A 1  173 ? -35.278 28.236 -2.814  1.00 44.36  ? 170 LEU A CD1   1 
ATOM   1297 C  CD2   . LEU A 1  173 ? -33.986 30.251 -2.249  1.00 44.06  ? 170 LEU A CD2   1 
ATOM   1298 N  N     . ASN A 1  174 ? -31.641 27.263 1.590   1.00 45.85  ? 171 ASN A N     1 
ATOM   1299 C  CA    . ASN A 1  174 ? -31.326 26.997 2.987   1.00 45.95  ? 171 ASN A CA    1 
ATOM   1300 C  C     . ASN A 1  174 ? -30.634 28.202 3.594   1.00 45.97  ? 171 ASN A C     1 
ATOM   1301 O  O     . ASN A 1  174 ? -30.952 28.586 4.717   1.00 47.09  ? 171 ASN A O     1 
ATOM   1302 C  CB    . ASN A 1  174 ? -30.445 25.760 3.163   1.00 46.02  ? 171 ASN A CB    1 
ATOM   1303 C  CG    . ASN A 1  174 ? -31.203 24.447 2.971   1.00 46.53  ? 171 ASN A CG    1 
ATOM   1304 O  OD1   . ASN A 1  174 ? -32.437 24.366 3.069   1.00 48.20  ? 171 ASN A OD1   1 
ATOM   1305 N  ND2   . ASN A 1  174 ? -30.454 23.410 2.687   1.00 46.84  ? 171 ASN A ND2   1 
ATOM   1306 N  N     . VAL A 1  175 ? -29.714 28.823 2.852   1.00 45.30  ? 172 VAL A N     1 
ATOM   1307 C  CA    . VAL A 1  175 ? -29.016 30.005 3.363   1.00 44.32  ? 172 VAL A CA    1 
ATOM   1308 C  C     . VAL A 1  175 ? -29.960 31.212 3.421   1.00 43.96  ? 172 VAL A C     1 
ATOM   1309 O  O     . VAL A 1  175 ? -29.972 31.946 4.408   1.00 44.13  ? 172 VAL A O     1 
ATOM   1310 C  CB    . VAL A 1  175 ? -27.706 30.315 2.574   1.00 44.35  ? 172 VAL A CB    1 
ATOM   1311 C  CG1   . VAL A 1  175 ? -27.173 31.715 2.902   1.00 44.07  ? 172 VAL A CG1   1 
ATOM   1312 C  CG2   . VAL A 1  175 ? -26.633 29.254 2.847   1.00 42.93  ? 172 VAL A CG2   1 
ATOM   1313 N  N     . LEU A 1  176 ? -30.761 31.416 2.385   1.00 43.34  ? 173 LEU A N     1 
ATOM   1314 C  CA    . LEU A 1  176 ? -31.646 32.574 2.374   1.00 43.02  ? 173 LEU A CA    1 
ATOM   1315 C  C     . LEU A 1  176 ? -32.695 32.469 3.466   1.00 43.69  ? 173 LEU A C     1 
ATOM   1316 O  O     . LEU A 1  176 ? -32.968 33.460 4.153   1.00 43.67  ? 173 LEU A O     1 
ATOM   1317 C  CB    . LEU A 1  176 ? -32.285 32.756 1.004   1.00 42.14  ? 173 LEU A CB    1 
ATOM   1318 C  CG    . LEU A 1  176 ? -33.527 33.594 0.699   1.00 41.52  ? 173 LEU A CG    1 
ATOM   1319 C  CD1   . LEU A 1  176 ? -33.609 34.925 1.409   1.00 41.61  ? 173 LEU A CD1   1 
ATOM   1320 C  CD2   . LEU A 1  176 ? -33.600 33.812 -0.802  1.00 40.97  ? 173 LEU A CD2   1 
ATOM   1321 N  N     . THR A 1  177 ? -33.258 31.269 3.643   1.00 44.23  ? 174 THR A N     1 
ATOM   1322 C  CA    . THR A 1  177 ? -34.386 31.089 4.552   1.00 44.75  ? 174 THR A CA    1 
ATOM   1323 C  C     . THR A 1  177 ? -33.937 31.015 5.995   1.00 44.89  ? 174 THR A C     1 
ATOM   1324 O  O     . THR A 1  177 ? -34.763 30.806 6.876   1.00 45.22  ? 174 THR A O     1 
ATOM   1325 C  CB    . THR A 1  177 ? -35.201 29.823 4.245   1.00 44.78  ? 174 THR A CB    1 
ATOM   1326 O  OG1   . THR A 1  177 ? -34.344 28.679 4.320   1.00 46.18  ? 174 THR A OG1   1 
ATOM   1327 C  CG2   . THR A 1  177 ? -35.791 29.899 2.875   1.00 45.10  ? 174 THR A CG2   1 
ATOM   1328 N  N     . SER A 1  178 ? -32.628 31.144 6.227   1.00 44.84  ? 175 SER A N     1 
ATOM   1329 C  CA    . SER A 1  178 ? -32.106 31.449 7.561   1.00 44.78  ? 175 SER A CA    1 
ATOM   1330 C  C     . SER A 1  178 ? -32.704 32.730 8.058   1.00 44.64  ? 175 SER A C     1 
ATOM   1331 O  O     . SER A 1  178 ? -32.893 32.876 9.263   1.00 45.23  ? 175 SER A O     1 
ATOM   1332 C  CB    . SER A 1  178 ? -30.594 31.645 7.566   1.00 44.57  ? 175 SER A CB    1 
ATOM   1333 O  OG    . SER A 1  178 ? -29.950 30.420 7.332   1.00 46.01  ? 175 SER A OG    1 
ATOM   1334 N  N     . ILE A 1  179 ? -32.982 33.658 7.143   1.00 44.29  ? 176 ILE A N     1 
ATOM   1335 C  CA    . ILE A 1  179 ? -33.473 34.974 7.520   1.00 44.61  ? 176 ILE A CA    1 
ATOM   1336 C  C     . ILE A 1  179 ? -34.964 34.897 7.816   1.00 44.35  ? 176 ILE A C     1 
ATOM   1337 O  O     . ILE A 1  179 ? -35.416 35.439 8.827   1.00 44.73  ? 176 ILE A O     1 
ATOM   1338 C  CB    . ILE A 1  179 ? -33.124 36.080 6.463   1.00 45.03  ? 176 ILE A CB    1 
ATOM   1339 C  CG1   . ILE A 1  179 ? -31.592 36.208 6.252   1.00 47.76  ? 176 ILE A CG1   1 
ATOM   1340 C  CG2   . ILE A 1  179 ? -33.696 37.457 6.826   1.00 44.43  ? 176 ILE A CG2   1 
ATOM   1341 C  CD1   . ILE A 1  179 ? -30.677 35.872 7.456   1.00 50.12  ? 176 ILE A CD1   1 
ATOM   1342 N  N     . ALA A 1  180 ? -35.707 34.200 6.960   1.00 43.55  ? 177 ALA A N     1 
ATOM   1343 C  CA    . ALA A 1  180 ? -37.160 34.120 7.052   1.00 43.33  ? 177 ALA A CA    1 
ATOM   1344 C  C     . ALA A 1  180 ? -37.654 33.068 6.076   1.00 43.45  ? 177 ALA A C     1 
ATOM   1345 O  O     . ALA A 1  180 ? -36.998 32.815 5.073   1.00 43.72  ? 177 ALA A O     1 
ATOM   1346 C  CB    . ALA A 1  180 ? -37.805 35.462 6.755   1.00 42.37  ? 177 ALA A CB    1 
ATOM   1347 N  N     . ILE A 1  181 ? -38.793 32.449 6.378   1.00 43.28  ? 178 ILE A N     1 
ATOM   1348 C  CA    . ILE A 1  181 ? -39.397 31.461 5.490   1.00 43.52  ? 178 ILE A CA    1 
ATOM   1349 C  C     . ILE A 1  181 ? -40.528 32.167 4.743   1.00 43.43  ? 178 ILE A C     1 
ATOM   1350 O  O     . ILE A 1  181 ? -41.265 32.937 5.360   1.00 43.70  ? 178 ILE A O     1 
ATOM   1351 C  CB    . ILE A 1  181 ? -39.931 30.239 6.293   1.00 43.73  ? 178 ILE A CB    1 
ATOM   1352 C  CG1   . ILE A 1  181 ? -38.786 29.541 7.040   1.00 44.75  ? 178 ILE A CG1   1 
ATOM   1353 C  CG2   . ILE A 1  181 ? -40.648 29.235 5.407   1.00 42.47  ? 178 ILE A CG2   1 
ATOM   1354 C  CD1   . ILE A 1  181 ? -38.357 28.228 6.416   1.00 48.10  ? 178 ILE A CD1   1 
ATOM   1355 N  N     . PRO A 1  182 ? -40.639 31.959 3.411   1.00 43.05  ? 179 PRO A N     1 
ATOM   1356 C  CA    . PRO A 1  182 ? -41.724 32.610 2.667   1.00 42.87  ? 179 PRO A CA    1 
ATOM   1357 C  C     . PRO A 1  182 ? -42.982 31.757 2.657   1.00 43.05  ? 179 PRO A C     1 
ATOM   1358 O  O     . PRO A 1  182 ? -42.875 30.531 2.783   1.00 43.60  ? 179 PRO A O     1 
ATOM   1359 C  CB    . PRO A 1  182 ? -41.156 32.698 1.252   1.00 42.65  ? 179 PRO A CB    1 
ATOM   1360 C  CG    . PRO A 1  182 ? -40.266 31.507 1.137   1.00 42.56  ? 179 PRO A CG    1 
ATOM   1361 C  CD    . PRO A 1  182 ? -39.662 31.312 2.508   1.00 42.86  ? 179 PRO A CD    1 
ATOM   1362 N  N     . LYS A 1  183 ? -44.158 32.369 2.498   1.00 42.88  ? 180 LYS A N     1 
ATOM   1363 C  CA    . LYS A 1  183 ? -45.396 31.586 2.361   1.00 43.10  ? 180 LYS A CA    1 
ATOM   1364 C  C     . LYS A 1  183 ? -45.377 30.795 1.060   1.00 43.42  ? 180 LYS A C     1 
ATOM   1365 O  O     . LYS A 1  183 ? -45.648 29.584 1.044   1.00 44.20  ? 180 LYS A O     1 
ATOM   1366 C  CB    . LYS A 1  183 ? -46.638 32.478 2.343   1.00 43.33  ? 180 LYS A CB    1 
ATOM   1367 C  CG    . LYS A 1  183 ? -47.060 33.108 3.658   1.00 43.91  ? 180 LYS A CG    1 
ATOM   1368 C  CD    . LYS A 1  183 ? -48.344 33.920 3.458   1.00 45.03  ? 180 LYS A CD    1 
ATOM   1369 C  CE    . LYS A 1  183 ? -48.938 34.473 4.764   1.00 45.87  ? 180 LYS A CE    1 
ATOM   1370 N  NZ    . LYS A 1  183 ? -48.110 35.549 5.370   1.00 46.07  ? 180 LYS A NZ    1 
ATOM   1371 N  N     . VAL A 1  184 ? -45.060 31.499 -0.029  1.00 43.34  ? 181 VAL A N     1 
ATOM   1372 C  CA    . VAL A 1  184 ? -45.103 30.964 -1.394  1.00 43.10  ? 181 VAL A CA    1 
ATOM   1373 C  C     . VAL A 1  184 ? -43.793 31.278 -2.111  1.00 42.95  ? 181 VAL A C     1 
ATOM   1374 O  O     . VAL A 1  184 ? -43.220 32.366 -1.928  1.00 43.58  ? 181 VAL A O     1 
ATOM   1375 C  CB    . VAL A 1  184 ? -46.231 31.659 -2.217  1.00 43.20  ? 181 VAL A CB    1 
ATOM   1376 C  CG1   . VAL A 1  184 ? -46.277 31.129 -3.620  1.00 42.98  ? 181 VAL A CG1   1 
ATOM   1377 C  CG2   . VAL A 1  184 ? -47.599 31.519 -1.542  1.00 42.62  ? 181 VAL A CG2   1 
ATOM   1378 N  N     . ILE A 1  185 ? -43.331 30.327 -2.920  1.00 42.00  ? 182 ILE A N     1 
ATOM   1379 C  CA    . ILE A 1  185 ? -42.279 30.558 -3.904  1.00 41.35  ? 182 ILE A CA    1 
ATOM   1380 C  C     . ILE A 1  185 ? -42.835 30.301 -5.307  1.00 41.92  ? 182 ILE A C     1 
ATOM   1381 O  O     . ILE A 1  185 ? -43.343 29.199 -5.600  1.00 42.26  ? 182 ILE A O     1 
ATOM   1382 C  CB    . ILE A 1  185 ? -41.109 29.617 -3.697  1.00 40.91  ? 182 ILE A CB    1 
ATOM   1383 C  CG1   . ILE A 1  185 ? -40.231 30.110 -2.560  1.00 40.04  ? 182 ILE A CG1   1 
ATOM   1384 C  CG2   . ILE A 1  185 ? -40.282 29.536 -4.950  1.00 40.58  ? 182 ILE A CG2   1 
ATOM   1385 C  CD1   . ILE A 1  185 ? -39.248 29.073 -2.109  1.00 37.58  ? 182 ILE A CD1   1 
ATOM   1386 N  N     . HIS A 1  186 ? -42.749 31.311 -6.171  1.00 42.10  ? 183 HIS A N     1 
ATOM   1387 C  CA    . HIS A 1  186 ? -43.224 31.195 -7.550  1.00 42.37  ? 183 HIS A CA    1 
ATOM   1388 C  C     . HIS A 1  186 ? -42.055 30.990 -8.493  1.00 42.38  ? 183 HIS A C     1 
ATOM   1389 O  O     . HIS A 1  186 ? -41.094 31.751 -8.470  1.00 42.67  ? 183 HIS A O     1 
ATOM   1390 C  CB    . HIS A 1  186 ? -44.009 32.430 -8.000  1.00 42.34  ? 183 HIS A CB    1 
ATOM   1391 C  CG    . HIS A 1  186 ? -44.504 32.326 -9.408  1.00 43.89  ? 183 HIS A CG    1 
ATOM   1392 N  ND1   . HIS A 1  186 ? -45.840 32.366 -9.733  1.00 45.21  ? 183 HIS A ND1   1 
ATOM   1393 C  CD2   . HIS A 1  186 ? -43.842 32.119 -10.573 1.00 44.54  ? 183 HIS A CD2   1 
ATOM   1394 C  CE1   . HIS A 1  186 ? -45.980 32.211 -11.039 1.00 45.14  ? 183 HIS A CE1   1 
ATOM   1395 N  NE2   . HIS A 1  186 ? -44.782 32.060 -11.571 1.00 44.80  ? 183 HIS A NE2   1 
ATOM   1396 N  N     . SER A 1  187 ? -42.145 29.970 -9.330  1.00 42.38  ? 184 SER A N     1 
ATOM   1397 C  CA    . SER A 1  187 ? -41.121 29.741 -10.319 1.00 42.76  ? 184 SER A CA    1 
ATOM   1398 C  C     . SER A 1  187 ? -41.732 29.298 -11.641 1.00 43.00  ? 184 SER A C     1 
ATOM   1399 O  O     . SER A 1  187 ? -42.908 28.953 -11.703 1.00 42.76  ? 184 SER A O     1 
ATOM   1400 C  CB    . SER A 1  187 ? -40.148 28.702 -9.820  1.00 42.48  ? 184 SER A CB    1 
ATOM   1401 O  OG    . SER A 1  187 ? -40.557 27.420 -10.248 1.00 43.73  ? 184 SER A OG    1 
ATOM   1402 N  N     . ASP A 1  188 ? -40.920 29.346 -12.694 1.00 43.56  ? 185 ASP A N     1 
ATOM   1403 C  CA    . ASP A 1  188 ? -41.283 28.817 -14.010 1.00 44.33  ? 185 ASP A CA    1 
ATOM   1404 C  C     . ASP A 1  188 ? -41.074 27.307 -14.002 1.00 44.75  ? 185 ASP A C     1 
ATOM   1405 O  O     . ASP A 1  188 ? -40.774 26.737 -12.950 1.00 45.01  ? 185 ASP A O     1 
ATOM   1406 C  CB    . ASP A 1  188 ? -40.443 29.478 -15.117 1.00 44.30  ? 185 ASP A CB    1 
ATOM   1407 C  CG    . ASP A 1  188 ? -38.936 29.145 -15.030 1.00 44.09  ? 185 ASP A CG    1 
ATOM   1408 O  OD1   . ASP A 1  188 ? -38.118 30.019 -15.417 1.00 44.37  ? 185 ASP A OD1   1 
ATOM   1409 O  OD2   . ASP A 1  188 ? -38.559 28.033 -14.593 1.00 43.23  ? 185 ASP A OD2   1 
ATOM   1410 N  N     . GLN A 1  189 ? -41.158 26.659 -15.157 1.00 45.15  ? 186 GLN A N     1 
ATOM   1411 C  CA    . GLN A 1  189 ? -41.077 25.198 -15.147 1.00 45.75  ? 186 GLN A CA    1 
ATOM   1412 C  C     . GLN A 1  189 ? -39.721 24.545 -15.351 1.00 45.73  ? 186 GLN A C     1 
ATOM   1413 O  O     . GLN A 1  189 ? -39.620 23.415 -15.813 1.00 45.92  ? 186 GLN A O     1 
ATOM   1414 C  CB    . GLN A 1  189 ? -42.211 24.571 -15.953 1.00 45.52  ? 186 GLN A CB    1 
ATOM   1415 C  CG    . GLN A 1  189 ? -43.514 24.789 -15.186 1.00 47.75  ? 186 GLN A CG    1 
ATOM   1416 C  CD    . GLN A 1  189 ? -44.699 24.106 -15.784 1.00 52.79  ? 186 GLN A CD    1 
ATOM   1417 O  OE1   . GLN A 1  189 ? -44.589 22.991 -16.297 1.00 56.02  ? 186 GLN A OE1   1 
ATOM   1418 N  NE2   . GLN A 1  189 ? -45.864 24.768 -15.726 1.00 53.62  ? 186 GLN A NE2   1 
ATOM   1419 N  N     . GLY A 1  190 ? -38.679 25.239 -14.932 1.00 46.46  ? 187 GLY A N     1 
ATOM   1420 C  CA    . GLY A 1  190 ? -37.316 24.704 -15.026 1.00 47.65  ? 187 GLY A CA    1 
ATOM   1421 C  C     . GLY A 1  190 ? -37.137 23.359 -14.332 1.00 48.82  ? 187 GLY A C     1 
ATOM   1422 O  O     . GLY A 1  190 ? -37.782 23.073 -13.303 1.00 49.22  ? 187 GLY A O     1 
ATOM   1423 N  N     . ALA A 1  191 ? -36.261 22.521 -14.888 1.00 49.47  ? 188 ALA A N     1 
ATOM   1424 C  CA    . ALA A 1  191 ? -35.974 21.211 -14.296 1.00 49.56  ? 188 ALA A CA    1 
ATOM   1425 C  C     . ALA A 1  191 ? -35.773 21.332 -12.771 1.00 49.67  ? 188 ALA A C     1 
ATOM   1426 O  O     . ALA A 1  191 ? -36.344 20.551 -12.002 1.00 49.87  ? 188 ALA A O     1 
ATOM   1427 C  CB    . ALA A 1  191 ? -34.744 20.596 -14.958 1.00 49.88  ? 188 ALA A CB    1 
ATOM   1428 N  N     . ALA A 1  192 ? -34.986 22.334 -12.367 1.00 49.31  ? 189 ALA A N     1 
ATOM   1429 C  CA    . ALA A 1  192 ? -34.635 22.626 -10.969 1.00 49.13  ? 189 ALA A CA    1 
ATOM   1430 C  C     . ALA A 1  192 ? -35.803 22.763 -10.012 1.00 49.16  ? 189 ALA A C     1 
ATOM   1431 O  O     . ALA A 1  192 ? -35.670 22.424 -8.848  1.00 49.15  ? 189 ALA A O     1 
ATOM   1432 C  CB    . ALA A 1  192 ? -33.834 23.889 -10.899 1.00 48.95  ? 189 ALA A CB    1 
ATOM   1433 N  N     . PHE A 1  193 ? -36.929 23.266 -10.499 1.00 48.86  ? 190 PHE A N     1 
ATOM   1434 C  CA    . PHE A 1  193 ? -37.987 23.705 -9.621  1.00 48.88  ? 190 PHE A CA    1 
ATOM   1435 C  C     . PHE A 1  193 ? -39.150 22.735 -9.565  1.00 49.55  ? 190 PHE A C     1 
ATOM   1436 O  O     . PHE A 1  193 ? -40.004 22.836 -8.677  1.00 49.60  ? 190 PHE A O     1 
ATOM   1437 C  CB    . PHE A 1  193 ? -38.485 25.083 -10.074 1.00 48.59  ? 190 PHE A CB    1 
ATOM   1438 C  CG    . PHE A 1  193 ? -37.406 26.112 -10.156 1.00 48.34  ? 190 PHE A CG    1 
ATOM   1439 C  CD1   . PHE A 1  193 ? -36.458 26.228 -9.146  1.00 48.54  ? 190 PHE A CD1   1 
ATOM   1440 C  CD2   . PHE A 1  193 ? -37.330 26.964 -11.235 1.00 48.49  ? 190 PHE A CD2   1 
ATOM   1441 C  CE1   . PHE A 1  193 ? -35.456 27.169 -9.226  1.00 49.02  ? 190 PHE A CE1   1 
ATOM   1442 C  CE2   . PHE A 1  193 ? -36.332 27.926 -11.311 1.00 48.05  ? 190 PHE A CE2   1 
ATOM   1443 C  CZ    . PHE A 1  193 ? -35.394 28.026 -10.309 1.00 47.95  ? 190 PHE A CZ    1 
ATOM   1444 N  N     . THR A 1  194 ? -39.190 21.816 -10.529 1.00 49.90  ? 191 THR A N     1 
ATOM   1445 C  CA    . THR A 1  194 ? -40.332 20.938 -10.698 1.00 50.30  ? 191 THR A CA    1 
ATOM   1446 C  C     . THR A 1  194 ? -39.992 19.526 -10.227 1.00 50.61  ? 191 THR A C     1 
ATOM   1447 O  O     . THR A 1  194 ? -40.866 18.670 -10.146 1.00 50.62  ? 191 THR A O     1 
ATOM   1448 C  CB    . THR A 1  194 ? -40.813 20.899 -12.166 1.00 50.22  ? 191 THR A CB    1 
ATOM   1449 O  OG1   . THR A 1  194 ? -39.753 20.426 -12.982 1.00 51.13  ? 191 THR A OG1   1 
ATOM   1450 C  CG2   . THR A 1  194 ? -41.205 22.277 -12.670 1.00 49.67  ? 191 THR A CG2   1 
ATOM   1451 N  N     . SER A 1  195 ? -38.724 19.291 -9.909  1.00 51.11  ? 192 SER A N     1 
ATOM   1452 C  CA    . SER A 1  195 ? -38.287 17.989 -9.408  1.00 51.97  ? 192 SER A CA    1 
ATOM   1453 C  C     . SER A 1  195 ? -38.990 17.679 -8.095  1.00 52.68  ? 192 SER A C     1 
ATOM   1454 O  O     . SER A 1  195 ? -39.319 18.587 -7.325  1.00 52.82  ? 192 SER A O     1 
ATOM   1455 C  CB    . SER A 1  195 ? -36.775 17.953 -9.187  1.00 51.75  ? 192 SER A CB    1 
ATOM   1456 O  OG    . SER A 1  195 ? -36.439 18.613 -7.974  1.00 51.98  ? 192 SER A OG    1 
ATOM   1457 N  N     . SER A 1  196 ? -39.203 16.393 -7.836  1.00 53.26  ? 193 SER A N     1 
ATOM   1458 C  CA    . SER A 1  196 ? -39.864 15.978 -6.608  1.00 53.48  ? 193 SER A CA    1 
ATOM   1459 C  C     . SER A 1  196 ? -38.985 16.243 -5.384  1.00 53.43  ? 193 SER A C     1 
ATOM   1460 O  O     . SER A 1  196 ? -39.516 16.477 -4.289  1.00 53.93  ? 193 SER A O     1 
ATOM   1461 C  CB    . SER A 1  196 ? -40.325 14.519 -6.681  1.00 53.56  ? 193 SER A CB    1 
ATOM   1462 O  OG    . SER A 1  196 ? -39.312 13.675 -7.210  1.00 55.06  ? 193 SER A OG    1 
ATOM   1463 N  N     . THR A 1  197 ? -37.660 16.247 -5.559  1.00 52.92  ? 194 THR A N     1 
ATOM   1464 C  CA    . THR A 1  197 ? -36.772 16.637 -4.453  1.00 52.48  ? 194 THR A CA    1 
ATOM   1465 C  C     . THR A 1  197 ? -37.054 18.059 -3.997  1.00 52.48  ? 194 THR A C     1 
ATOM   1466 O  O     . THR A 1  197 ? -36.999 18.359 -2.805  1.00 52.78  ? 194 THR A O     1 
ATOM   1467 C  CB    . THR A 1  197 ? -35.301 16.529 -4.824  1.00 52.31  ? 194 THR A CB    1 
ATOM   1468 O  OG1   . THR A 1  197 ? -34.976 15.158 -5.023  1.00 53.67  ? 194 THR A OG1   1 
ATOM   1469 C  CG2   . THR A 1  197 ? -34.420 17.053 -3.712  1.00 51.67  ? 194 THR A CG2   1 
ATOM   1470 N  N     . PHE A 1  198 ? -37.356 18.940 -4.942  1.00 52.24  ? 195 PHE A N     1 
ATOM   1471 C  CA    . PHE A 1  198 ? -37.597 20.312 -4.574  1.00 51.84  ? 195 PHE A CA    1 
ATOM   1472 C  C     . PHE A 1  198 ? -38.962 20.421 -3.923  1.00 52.74  ? 195 PHE A C     1 
ATOM   1473 O  O     . PHE A 1  198 ? -39.122 21.162 -2.963  1.00 53.32  ? 195 PHE A O     1 
ATOM   1474 C  CB    . PHE A 1  198 ? -37.455 21.247 -5.775  1.00 51.24  ? 195 PHE A CB    1 
ATOM   1475 C  CG    . PHE A 1  198 ? -37.519 22.703 -5.418  1.00 47.58  ? 195 PHE A CG    1 
ATOM   1476 C  CD1   . PHE A 1  198 ? -36.469 23.316 -4.746  1.00 44.16  ? 195 PHE A CD1   1 
ATOM   1477 C  CD2   . PHE A 1  198 ? -38.634 23.465 -5.756  1.00 45.03  ? 195 PHE A CD2   1 
ATOM   1478 C  CE1   . PHE A 1  198 ? -36.533 24.671 -4.403  1.00 43.27  ? 195 PHE A CE1   1 
ATOM   1479 C  CE2   . PHE A 1  198 ? -38.707 24.822 -5.416  1.00 43.25  ? 195 PHE A CE2   1 
ATOM   1480 C  CZ    . PHE A 1  198 ? -37.650 25.427 -4.747  1.00 42.42  ? 195 PHE A CZ    1 
ATOM   1481 N  N     . ALA A 1  199 ? -39.932 19.657 -4.419  1.00 53.61  ? 196 ALA A N     1 
ATOM   1482 C  CA    . ALA A 1  199 ? -41.267 19.627 -3.828  1.00 54.52  ? 196 ALA A CA    1 
ATOM   1483 C  C     . ALA A 1  199 ? -41.197 19.265 -2.332  1.00 55.77  ? 196 ALA A C     1 
ATOM   1484 O  O     . ALA A 1  199 ? -41.837 19.914 -1.490  1.00 55.71  ? 196 ALA A O     1 
ATOM   1485 C  CB    . ALA A 1  199 ? -42.150 18.662 -4.582  1.00 53.74  ? 196 ALA A CB    1 
ATOM   1486 N  N     . GLU A 1  200 ? -40.397 18.239 -2.023  1.00 57.20  ? 197 GLU A N     1 
ATOM   1487 C  CA    . GLU A 1  200 ? -40.175 17.761 -0.649  1.00 58.71  ? 197 GLU A CA    1 
ATOM   1488 C  C     . GLU A 1  200 ? -39.559 18.833 0.206   1.00 57.87  ? 197 GLU A C     1 
ATOM   1489 O  O     . GLU A 1  200 ? -39.993 19.054 1.346   1.00 58.18  ? 197 GLU A O     1 
ATOM   1490 C  CB    . GLU A 1  200 ? -39.233 16.545 -0.618  1.00 59.58  ? 197 GLU A CB    1 
ATOM   1491 C  CG    . GLU A 1  200 ? -39.923 15.173 -0.748  1.00 65.25  ? 197 GLU A CG    1 
ATOM   1492 C  CD    . GLU A 1  200 ? -38.947 14.059 -1.191  1.00 72.58  ? 197 GLU A CD    1 
ATOM   1493 O  OE1   . GLU A 1  200 ? -37.759 14.058 -0.735  1.00 74.73  ? 197 GLU A OE1   1 
ATOM   1494 O  OE2   . GLU A 1  200 ? -39.379 13.191 -2.003  1.00 74.34  ? 197 GLU A OE2   1 
ATOM   1495 N  N     . TRP A 1  201 ? -38.527 19.473 -0.339  1.00 56.79  ? 198 TRP A N     1 
ATOM   1496 C  CA    . TRP A 1  201 ? -37.796 20.473 0.400   1.00 55.86  ? 198 TRP A CA    1 
ATOM   1497 C  C     . TRP A 1  201 ? -38.755 21.584 0.848   1.00 56.08  ? 198 TRP A C     1 
ATOM   1498 O  O     . TRP A 1  201 ? -38.631 22.097 1.952   1.00 56.08  ? 198 TRP A O     1 
ATOM   1499 C  CB    . TRP A 1  201 ? -36.635 21.022 -0.431  1.00 55.41  ? 198 TRP A CB    1 
ATOM   1500 C  CG    . TRP A 1  201 ? -35.997 22.198 0.215   1.00 53.13  ? 198 TRP A CG    1 
ATOM   1501 C  CD1   . TRP A 1  201 ? -34.957 22.186 1.078   1.00 52.62  ? 198 TRP A CD1   1 
ATOM   1502 C  CD2   . TRP A 1  201 ? -36.390 23.560 0.081   1.00 50.24  ? 198 TRP A CD2   1 
ATOM   1503 N  NE1   . TRP A 1  201 ? -34.660 23.463 1.489   1.00 51.21  ? 198 TRP A NE1   1 
ATOM   1504 C  CE2   . TRP A 1  201 ? -35.541 24.322 0.895   1.00 50.73  ? 198 TRP A CE2   1 
ATOM   1505 C  CE3   . TRP A 1  201 ? -37.377 24.210 -0.653  1.00 50.67  ? 198 TRP A CE3   1 
ATOM   1506 C  CZ2   . TRP A 1  201 ? -35.641 25.705 0.988   1.00 51.65  ? 198 TRP A CZ2   1 
ATOM   1507 C  CZ3   . TRP A 1  201 ? -37.480 25.588 -0.557  1.00 49.95  ? 198 TRP A CZ3   1 
ATOM   1508 C  CH2   . TRP A 1  201 ? -36.621 26.317 0.256   1.00 50.26  ? 198 TRP A CH2   1 
ATOM   1509 N  N     . ALA A 1  202 ? -39.718 21.926 -0.002  1.00 56.00  ? 199 ALA A N     1 
ATOM   1510 C  CA    . ALA A 1  202 ? -40.666 22.987 0.288   1.00 56.62  ? 199 ALA A CA    1 
ATOM   1511 C  C     . ALA A 1  202 ? -41.728 22.581 1.314   1.00 57.21  ? 199 ALA A C     1 
ATOM   1512 O  O     . ALA A 1  202 ? -42.095 23.363 2.204   1.00 57.15  ? 199 ALA A O     1 
ATOM   1513 C  CB    . ALA A 1  202 ? -41.340 23.424 -0.990  1.00 56.68  ? 199 ALA A CB    1 
ATOM   1514 N  N     . LYS A 1  203 ? -42.243 21.364 1.161   1.00 57.83  ? 200 LYS A N     1 
ATOM   1515 C  CA    . LYS A 1  203 ? -43.289 20.852 2.031   1.00 58.24  ? 200 LYS A CA    1 
ATOM   1516 C  C     . LYS A 1  203 ? -42.723 20.760 3.449   1.00 57.82  ? 200 LYS A C     1 
ATOM   1517 O  O     . LYS A 1  203 ? -43.359 21.225 4.401   1.00 57.65  ? 200 LYS A O     1 
ATOM   1518 C  CB    . LYS A 1  203 ? -43.775 19.500 1.515   1.00 58.68  ? 200 LYS A CB    1 
ATOM   1519 C  CG    . LYS A 1  203 ? -44.898 18.889 2.310   1.00 61.25  ? 200 LYS A CG    1 
ATOM   1520 C  CD    . LYS A 1  203 ? -45.230 17.480 1.793   1.00 65.94  ? 200 LYS A CD    1 
ATOM   1521 C  CE    . LYS A 1  203 ? -46.469 16.908 2.503   1.00 68.18  ? 200 LYS A CE    1 
ATOM   1522 N  NZ    . LYS A 1  203 ? -47.136 15.871 1.676   1.00 70.00  ? 200 LYS A NZ    1 
ATOM   1523 N  N     . GLU A 1  204 ? -41.512 20.200 3.562   1.00 57.06  ? 201 GLU A N     1 
ATOM   1524 C  CA    . GLU A 1  204 ? -40.739 20.231 4.794   1.00 56.64  ? 201 GLU A CA    1 
ATOM   1525 C  C     . GLU A 1  204 ? -40.829 21.562 5.532   1.00 55.69  ? 201 GLU A C     1 
ATOM   1526 O  O     . GLU A 1  204 ? -40.772 21.581 6.759   1.00 56.51  ? 201 GLU A O     1 
ATOM   1527 C  CB    . GLU A 1  204 ? -39.272 19.899 4.530   1.00 56.80  ? 201 GLU A CB    1 
ATOM   1528 C  CG    . GLU A 1  204 ? -38.938 18.435 4.770   1.00 60.90  ? 201 GLU A CG    1 
ATOM   1529 C  CD    . GLU A 1  204 ? -37.522 18.015 4.319   1.00 66.04  ? 201 GLU A CD    1 
ATOM   1530 O  OE1   . GLU A 1  204 ? -36.603 18.874 4.213   1.00 68.64  ? 201 GLU A OE1   1 
ATOM   1531 O  OE2   . GLU A 1  204 ? -37.331 16.800 4.079   1.00 66.81  ? 201 GLU A OE2   1 
ATOM   1532 N  N     . ARG A 1  205 ? -40.982 22.676 4.818   1.00 53.90  ? 202 ARG A N     1 
ATOM   1533 C  CA    . ARG A 1  205 ? -40.934 23.980 5.480   1.00 51.80  ? 202 ARG A CA    1 
ATOM   1534 C  C     . ARG A 1  205 ? -42.247 24.744 5.458   1.00 51.22  ? 202 ARG A C     1 
ATOM   1535 O  O     . ARG A 1  205 ? -42.310 25.904 5.880   1.00 51.29  ? 202 ARG A O     1 
ATOM   1536 C  CB    . ARG A 1  205 ? -39.808 24.806 4.894   1.00 51.44  ? 202 ARG A CB    1 
ATOM   1537 C  CG    . ARG A 1  205 ? -38.475 24.189 5.151   1.00 49.47  ? 202 ARG A CG    1 
ATOM   1538 C  CD    . ARG A 1  205 ? -37.430 24.654 4.171   1.00 46.85  ? 202 ARG A CD    1 
ATOM   1539 N  NE    . ARG A 1  205 ? -36.123 24.179 4.592   1.00 45.24  ? 202 ARG A NE    1 
ATOM   1540 C  CZ    . ARG A 1  205 ? -35.704 22.924 4.454   1.00 45.93  ? 202 ARG A CZ    1 
ATOM   1541 N  NH1   . ARG A 1  205 ? -36.478 22.001 3.878   1.00 45.28  ? 202 ARG A NH1   1 
ATOM   1542 N  NH2   . ARG A 1  205 ? -34.495 22.591 4.885   1.00 45.91  ? 202 ARG A NH2   1 
ATOM   1543 N  N     . GLY A 1  206 ? -43.297 24.092 4.982   1.00 50.25  ? 203 GLY A N     1 
ATOM   1544 C  CA    . GLY A 1  206 ? -44.603 24.714 4.934   1.00 49.89  ? 203 GLY A CA    1 
ATOM   1545 C  C     . GLY A 1  206 ? -44.682 25.772 3.857   1.00 50.05  ? 203 GLY A C     1 
ATOM   1546 O  O     . GLY A 1  206 ? -45.540 26.644 3.917   1.00 50.07  ? 203 GLY A O     1 
ATOM   1547 N  N     . ILE A 1  207 ? -43.777 25.683 2.875   1.00 50.03  ? 204 ILE A N     1 
ATOM   1548 C  CA    . ILE A 1  207 ? -43.727 26.583 1.713   1.00 49.73  ? 204 ILE A CA    1 
ATOM   1549 C  C     . ILE A 1  207 ? -44.554 26.000 0.564   1.00 49.99  ? 204 ILE A C     1 
ATOM   1550 O  O     . ILE A 1  207 ? -44.349 24.841 0.167   1.00 50.29  ? 204 ILE A O     1 
ATOM   1551 C  CB    . ILE A 1  207 ? -42.254 26.788 1.217   1.00 49.81  ? 204 ILE A CB    1 
ATOM   1552 C  CG1   . ILE A 1  207 ? -41.345 27.284 2.348   1.00 48.28  ? 204 ILE A CG1   1 
ATOM   1553 C  CG2   . ILE A 1  207 ? -42.198 27.730 0.009   1.00 49.24  ? 204 ILE A CG2   1 
ATOM   1554 C  CD1   . ILE A 1  207 ? -39.913 27.344 1.983   1.00 45.47  ? 204 ILE A CD1   1 
ATOM   1555 N  N     . HIS A 1  208 ? -45.473 26.802 0.033   1.00 49.92  ? 205 HIS A N     1 
ATOM   1556 C  CA    . HIS A 1  208 ? -46.295 26.394 -1.111  1.00 50.20  ? 205 HIS A CA    1 
ATOM   1557 C  C     . HIS A 1  208 ? -45.624 26.740 -2.457  1.00 49.66  ? 205 HIS A C     1 
ATOM   1558 O  O     . HIS A 1  208 ? -45.216 27.893 -2.678  1.00 50.32  ? 205 HIS A O     1 
ATOM   1559 C  CB    . HIS A 1  208 ? -47.685 27.032 -1.027  1.00 50.57  ? 205 HIS A CB    1 
ATOM   1560 C  CG    . HIS A 1  208 ? -48.553 26.752 -2.221  1.00 53.96  ? 205 HIS A CG    1 
ATOM   1561 N  ND1   . HIS A 1  208 ? -49.019 25.487 -2.527  1.00 56.03  ? 205 HIS A ND1   1 
ATOM   1562 C  CD2   . HIS A 1  208 ? -49.045 27.577 -3.182  1.00 55.78  ? 205 HIS A CD2   1 
ATOM   1563 C  CE1   . HIS A 1  208 ? -49.752 25.545 -3.627  1.00 56.79  ? 205 HIS A CE1   1 
ATOM   1564 N  NE2   . HIS A 1  208 ? -49.782 26.800 -4.046  1.00 57.23  ? 205 HIS A NE2   1 
ATOM   1565 N  N     . LEU A 1  209 ? -45.491 25.750 -3.341  1.00 48.53  ? 206 LEU A N     1 
ATOM   1566 C  CA    . LEU A 1  209 ? -44.932 25.989 -4.678  1.00 47.27  ? 206 LEU A CA    1 
ATOM   1567 C  C     . LEU A 1  209 ? -45.992 26.387 -5.713  1.00 47.55  ? 206 LEU A C     1 
ATOM   1568 O  O     . LEU A 1  209 ? -47.073 25.784 -5.805  1.00 47.99  ? 206 LEU A O     1 
ATOM   1569 C  CB    . LEU A 1  209 ? -44.134 24.805 -5.175  1.00 46.09  ? 206 LEU A CB    1 
ATOM   1570 C  CG    . LEU A 1  209 ? -42.937 24.434 -4.319  1.00 44.67  ? 206 LEU A CG    1 
ATOM   1571 C  CD1   . LEU A 1  209 ? -42.180 23.320 -4.994  1.00 43.86  ? 206 LEU A CD1   1 
ATOM   1572 C  CD2   . LEU A 1  209 ? -42.035 25.588 -4.061  1.00 42.16  ? 206 LEU A CD2   1 
ATOM   1573 N  N     . GLU A 1  210 ? -45.669 27.427 -6.475  1.00 47.44  ? 207 GLU A N     1 
ATOM   1574 C  CA    . GLU A 1  210 ? -46.557 27.987 -7.475  1.00 47.07  ? 207 GLU A CA    1 
ATOM   1575 C  C     . GLU A 1  210 ? -45.765 28.004 -8.765  1.00 47.05  ? 207 GLU A C     1 
ATOM   1576 O  O     . GLU A 1  210 ? -44.612 28.478 -8.774  1.00 48.10  ? 207 GLU A O     1 
ATOM   1577 C  CB    . GLU A 1  210 ? -46.943 29.405 -7.085  1.00 46.64  ? 207 GLU A CB    1 
ATOM   1578 C  CG    . GLU A 1  210 ? -48.183 29.881 -7.763  1.00 46.82  ? 207 GLU A CG    1 
ATOM   1579 C  CD    . GLU A 1  210 ? -48.542 31.311 -7.397  1.00 49.01  ? 207 GLU A CD    1 
ATOM   1580 O  OE1   . GLU A 1  210 ? -49.719 31.533 -7.058  1.00 49.26  ? 207 GLU A OE1   1 
ATOM   1581 O  OE2   . GLU A 1  210 ? -47.665 32.215 -7.445  1.00 48.97  ? 207 GLU A OE2   1 
ATOM   1582 N  N     . PHE A 1  211 ? -46.343 27.459 -9.839  1.00 46.02  ? 208 PHE A N     1 
ATOM   1583 C  CA    . PHE A 1  211 ? -45.632 27.426 -11.116 1.00 44.71  ? 208 PHE A CA    1 
ATOM   1584 C  C     . PHE A 1  211 ? -46.259 28.296 -12.208 1.00 44.64  ? 208 PHE A C     1 
ATOM   1585 O  O     . PHE A 1  211 ? -47.488 28.388 -12.327 1.00 44.41  ? 208 PHE A O     1 
ATOM   1586 C  CB    . PHE A 1  211 ? -45.464 26.007 -11.584 1.00 43.85  ? 208 PHE A CB    1 
ATOM   1587 C  CG    . PHE A 1  211 ? -44.689 25.158 -10.632 1.00 43.65  ? 208 PHE A CG    1 
ATOM   1588 C  CD1   . PHE A 1  211 ? -43.298 25.106 -10.702 1.00 43.33  ? 208 PHE A CD1   1 
ATOM   1589 C  CD2   . PHE A 1  211 ? -45.346 24.401 -9.659  1.00 41.47  ? 208 PHE A CD2   1 
ATOM   1590 C  CE1   . PHE A 1  211 ? -42.572 24.296 -9.815  1.00 44.09  ? 208 PHE A CE1   1 
ATOM   1591 C  CE2   . PHE A 1  211 ? -44.643 23.618 -8.770  1.00 39.73  ? 208 PHE A CE2   1 
ATOM   1592 C  CZ    . PHE A 1  211 ? -43.253 23.551 -8.839  1.00 41.58  ? 208 PHE A CZ    1 
ATOM   1593 N  N     . SER A 1  212 ? -45.397 28.949 -12.989 1.00 44.20  ? 209 SER A N     1 
ATOM   1594 C  CA    . SER A 1  212 ? -45.831 29.646 -14.192 1.00 43.88  ? 209 SER A CA    1 
ATOM   1595 C  C     . SER A 1  212 ? -46.426 28.632 -15.145 1.00 43.80  ? 209 SER A C     1 
ATOM   1596 O  O     . SER A 1  212 ? -46.097 27.440 -15.081 1.00 43.79  ? 209 SER A O     1 
ATOM   1597 C  CB    . SER A 1  212 ? -44.653 30.306 -14.880 1.00 43.63  ? 209 SER A CB    1 
ATOM   1598 O  OG    . SER A 1  212 ? -44.215 31.451 -14.188 1.00 44.78  ? 209 SER A OG    1 
ATOM   1599 N  N     . THR A 1  213 ? -47.310 29.093 -16.025 1.00 43.58  ? 210 THR A N     1 
ATOM   1600 C  CA    . THR A 1  213 ? -47.719 28.264 -17.145 1.00 43.04  ? 210 THR A CA    1 
ATOM   1601 C  C     . THR A 1  213 ? -46.479 27.996 -17.990 1.00 42.55  ? 210 THR A C     1 
ATOM   1602 O  O     . THR A 1  213 ? -45.456 28.662 -17.822 1.00 42.71  ? 210 THR A O     1 
ATOM   1603 C  CB    . THR A 1  213 ? -48.871 28.889 -17.943 1.00 43.59  ? 210 THR A CB    1 
ATOM   1604 O  OG1   . THR A 1  213 ? -48.596 30.272 -18.213 1.00 44.34  ? 210 THR A OG1   1 
ATOM   1605 C  CG2   . THR A 1  213 ? -50.168 28.783 -17.147 1.00 42.79  ? 210 THR A CG2   1 
ATOM   1606 N  N     . PRO A 1  214 ? -46.519 26.977 -18.852 1.00 42.39  ? 211 PRO A N     1 
ATOM   1607 C  CA    . PRO A 1  214 ? -45.236 26.698 -19.506 1.00 41.86  ? 211 PRO A CA    1 
ATOM   1608 C  C     . PRO A 1  214 ? -44.974 27.638 -20.676 1.00 41.58  ? 211 PRO A C     1 
ATOM   1609 O  O     . PRO A 1  214 ? -45.924 28.148 -21.291 1.00 41.17  ? 211 PRO A O     1 
ATOM   1610 C  CB    . PRO A 1  214 ? -45.379 25.249 -19.967 1.00 41.72  ? 211 PRO A CB    1 
ATOM   1611 C  CG    . PRO A 1  214 ? -46.824 24.998 -20.028 1.00 41.76  ? 211 PRO A CG    1 
ATOM   1612 C  CD    . PRO A 1  214 ? -47.524 25.929 -19.104 1.00 42.23  ? 211 PRO A CD    1 
ATOM   1613 N  N     . TYR A 1  215 ? -43.687 27.865 -20.956 1.00 41.51  ? 212 TYR A N     1 
ATOM   1614 C  CA    . TYR A 1  215 ? -43.237 28.770 -22.024 1.00 41.61  ? 212 TYR A CA    1 
ATOM   1615 C  C     . TYR A 1  215 ? -43.894 30.165 -21.974 1.00 41.07  ? 212 TYR A C     1 
ATOM   1616 O  O     . TYR A 1  215 ? -44.401 30.672 -22.984 1.00 41.59  ? 212 TYR A O     1 
ATOM   1617 C  CB    . TYR A 1  215 ? -43.411 28.107 -23.401 1.00 41.80  ? 212 TYR A CB    1 
ATOM   1618 C  CG    . TYR A 1  215 ? -42.443 26.967 -23.608 1.00 43.44  ? 212 TYR A CG    1 
ATOM   1619 C  CD1   . TYR A 1  215 ? -41.183 27.187 -24.193 1.00 45.97  ? 212 TYR A CD1   1 
ATOM   1620 C  CD2   . TYR A 1  215 ? -42.764 25.677 -23.193 1.00 44.26  ? 212 TYR A CD2   1 
ATOM   1621 C  CE1   . TYR A 1  215 ? -40.259 26.127 -24.368 1.00 47.75  ? 212 TYR A CE1   1 
ATOM   1622 C  CE2   . TYR A 1  215 ? -41.861 24.615 -23.361 1.00 47.33  ? 212 TYR A CE2   1 
ATOM   1623 C  CZ    . TYR A 1  215 ? -40.614 24.840 -23.946 1.00 49.13  ? 212 TYR A CZ    1 
ATOM   1624 O  OH    . TYR A 1  215 ? -39.741 23.774 -24.105 1.00 52.33  ? 212 TYR A OH    1 
ATOM   1625 N  N     . HIS A 1  216 ? -43.879 30.772 -20.789 1.00 40.07  ? 213 HIS A N     1 
ATOM   1626 C  CA    . HIS A 1  216 ? -44.478 32.086 -20.574 1.00 39.04  ? 213 HIS A CA    1 
ATOM   1627 C  C     . HIS A 1  216 ? -43.716 32.866 -19.498 1.00 38.80  ? 213 HIS A C     1 
ATOM   1628 O  O     . HIS A 1  216 ? -44.243 33.095 -18.401 1.00 38.73  ? 213 HIS A O     1 
ATOM   1629 C  CB    . HIS A 1  216 ? -45.947 31.959 -20.195 1.00 38.16  ? 213 HIS A CB    1 
ATOM   1630 C  CG    . HIS A 1  216 ? -46.724 33.208 -20.422 1.00 37.25  ? 213 HIS A CG    1 
ATOM   1631 N  ND1   . HIS A 1  216 ? -47.232 33.968 -19.393 1.00 36.83  ? 213 HIS A ND1   1 
ATOM   1632 C  CD2   . HIS A 1  216 ? -47.052 33.853 -21.564 1.00 37.36  ? 213 HIS A CD2   1 
ATOM   1633 C  CE1   . HIS A 1  216 ? -47.870 35.011 -19.892 1.00 36.85  ? 213 HIS A CE1   1 
ATOM   1634 N  NE2   . HIS A 1  216 ? -47.782 34.959 -21.209 1.00 37.15  ? 213 HIS A NE2   1 
ATOM   1635 N  N     . PRO A 1  217 ? -42.480 33.290 -19.815 1.00 38.43  ? 214 PRO A N     1 
ATOM   1636 C  CA    . PRO A 1  217 ? -41.650 33.928 -18.790 1.00 38.72  ? 214 PRO A CA    1 
ATOM   1637 C  C     . PRO A 1  217 ? -42.243 35.207 -18.202 1.00 39.25  ? 214 PRO A C     1 
ATOM   1638 O  O     . PRO A 1  217 ? -41.844 35.599 -17.112 1.00 39.45  ? 214 PRO A O     1 
ATOM   1639 C  CB    . PRO A 1  217 ? -40.336 34.201 -19.518 1.00 38.67  ? 214 PRO A CB    1 
ATOM   1640 C  CG    . PRO A 1  217 ? -40.350 33.261 -20.707 1.00 38.44  ? 214 PRO A CG    1 
ATOM   1641 C  CD    . PRO A 1  217 ? -41.776 33.167 -21.104 1.00 37.90  ? 214 PRO A CD    1 
ATOM   1642 N  N     . GLN A 1  218 ? -43.204 35.824 -18.883 1.00 39.70  ? 215 GLN A N     1 
ATOM   1643 C  CA    . GLN A 1  218 ? -43.900 36.974 -18.340 1.00 41.14  ? 215 GLN A CA    1 
ATOM   1644 C  C     . GLN A 1  218 ? -44.526 36.668 -16.985 1.00 41.81  ? 215 GLN A C     1 
ATOM   1645 O  O     . GLN A 1  218 ? -44.729 37.576 -16.148 1.00 42.63  ? 215 GLN A O     1 
ATOM   1646 C  CB    . GLN A 1  218 ? -45.036 37.383 -19.247 1.00 41.53  ? 215 GLN A CB    1 
ATOM   1647 C  CG    . GLN A 1  218 ? -44.607 37.833 -20.589 1.00 45.09  ? 215 GLN A CG    1 
ATOM   1648 C  CD    . GLN A 1  218 ? -44.571 36.698 -21.588 1.00 48.71  ? 215 GLN A CD    1 
ATOM   1649 O  OE1   . GLN A 1  218 ? -43.803 35.725 -21.452 1.00 46.43  ? 215 GLN A OE1   1 
ATOM   1650 N  NE2   . GLN A 1  218 ? -45.414 36.820 -22.618 1.00 51.26  ? 215 GLN A NE2   1 
ATOM   1651 N  N     . SER A 1  219 ? -44.883 35.400 -16.782 1.00 41.63  ? 216 SER A N     1 
ATOM   1652 C  CA    . SER A 1  219 ? -45.546 35.003 -15.561 1.00 40.94  ? 216 SER A CA    1 
ATOM   1653 C  C     . SER A 1  219 ? -44.591 35.163 -14.391 1.00 41.35  ? 216 SER A C     1 
ATOM   1654 O  O     . SER A 1  219 ? -45.026 35.532 -13.305 1.00 41.82  ? 216 SER A O     1 
ATOM   1655 C  CB    . SER A 1  219 ? -46.070 33.592 -15.677 1.00 40.67  ? 216 SER A CB    1 
ATOM   1656 O  OG    . SER A 1  219 ? -47.202 33.599 -16.516 1.00 40.22  ? 216 SER A OG    1 
ATOM   1657 N  N     . SER A 1  220 ? -43.292 34.928 -14.619 1.00 40.52  ? 217 SER A N     1 
ATOM   1658 C  CA    . SER A 1  220 ? -42.271 35.298 -13.650 1.00 39.39  ? 217 SER A CA    1 
ATOM   1659 C  C     . SER A 1  220 ? -41.707 36.715 -13.842 1.00 39.51  ? 217 SER A C     1 
ATOM   1660 O  O     . SER A 1  220 ? -40.566 36.998 -13.444 1.00 39.28  ? 217 SER A O     1 
ATOM   1661 C  CB    . SER A 1  220 ? -41.151 34.298 -13.715 1.00 39.03  ? 217 SER A CB    1 
ATOM   1662 O  OG    . SER A 1  220 ? -41.557 33.100 -13.140 1.00 37.87  ? 217 SER A OG    1 
ATOM   1663 N  N     . GLY A 1  221 ? -42.502 37.603 -14.438 1.00 39.24  ? 218 GLY A N     1 
ATOM   1664 C  CA    . GLY A 1  221 ? -42.073 38.973 -14.722 1.00 39.52  ? 218 GLY A CA    1 
ATOM   1665 C  C     . GLY A 1  221 ? -41.341 39.730 -13.603 1.00 40.01  ? 218 GLY A C     1 
ATOM   1666 O  O     . GLY A 1  221 ? -40.356 40.431 -13.864 1.00 39.62  ? 218 GLY A O     1 
ATOM   1667 N  N     . LYS A 1  222 ? -41.823 39.605 -12.363 1.00 39.91  ? 219 LYS A N     1 
ATOM   1668 C  CA    . LYS A 1  222 ? -41.134 40.188 -11.221 1.00 39.81  ? 219 LYS A CA    1 
ATOM   1669 C  C     . LYS A 1  222 ? -39.656 39.845 -11.217 1.00 39.66  ? 219 LYS A C     1 
ATOM   1670 O  O     . LYS A 1  222 ? -38.826 40.753 -11.148 1.00 39.96  ? 219 LYS A O     1 
ATOM   1671 C  CB    . LYS A 1  222 ? -41.786 39.807 -9.886  1.00 39.94  ? 219 LYS A CB    1 
ATOM   1672 C  CG    . LYS A 1  222 ? -42.751 40.861 -9.366  1.00 40.84  ? 219 LYS A CG    1 
ATOM   1673 C  CD    . LYS A 1  222 ? -42.070 41.771 -8.356  1.00 42.83  ? 219 LYS A CD    1 
ATOM   1674 C  CE    . LYS A 1  222 ? -42.826 43.105 -8.124  1.00 45.22  ? 219 LYS A CE    1 
ATOM   1675 N  NZ    . LYS A 1  222 ? -44.315 43.030 -7.955  1.00 45.02  ? 219 LYS A NZ    1 
ATOM   1676 N  N     . VAL A 1  223 ? -39.309 38.560 -11.296 1.00 38.88  ? 220 VAL A N     1 
ATOM   1677 C  CA    . VAL A 1  223 ? -37.890 38.207 -11.293 1.00 38.16  ? 220 VAL A CA    1 
ATOM   1678 C  C     . VAL A 1  223 ? -37.228 38.395 -12.675 1.00 38.49  ? 220 VAL A C     1 
ATOM   1679 O  O     . VAL A 1  223 ? -36.067 38.800 -12.760 1.00 38.59  ? 220 VAL A O     1 
ATOM   1680 C  CB    . VAL A 1  223 ? -37.636 36.795 -10.719 1.00 38.34  ? 220 VAL A CB    1 
ATOM   1681 C  CG1   . VAL A 1  223 ? -38.338 35.698 -11.549 1.00 37.06  ? 220 VAL A CG1   1 
ATOM   1682 C  CG2   . VAL A 1  223 ? -36.137 36.511 -10.582 1.00 37.36  ? 220 VAL A CG2   1 
ATOM   1683 N  N     . GLU A 1  224 ? -37.946 38.109 -13.763 1.00 38.59  ? 221 GLU A N     1 
ATOM   1684 C  CA    . GLU A 1  224 ? -37.332 38.258 -15.093 1.00 38.16  ? 221 GLU A CA    1 
ATOM   1685 C  C     . GLU A 1  224 ? -36.801 39.656 -15.233 1.00 38.23  ? 221 GLU A C     1 
ATOM   1686 O  O     . GLU A 1  224 ? -35.649 39.837 -15.624 1.00 38.48  ? 221 GLU A O     1 
ATOM   1687 C  CB    . GLU A 1  224 ? -38.308 37.953 -16.219 1.00 38.03  ? 221 GLU A CB    1 
ATOM   1688 C  CG    . GLU A 1  224 ? -38.767 36.500 -16.240 1.00 37.63  ? 221 GLU A CG    1 
ATOM   1689 C  CD    . GLU A 1  224 ? -37.639 35.526 -16.485 1.00 38.09  ? 221 GLU A CD    1 
ATOM   1690 O  OE1   . GLU A 1  224 ? -36.445 35.927 -16.545 1.00 38.17  ? 221 GLU A OE1   1 
ATOM   1691 O  OE2   . GLU A 1  224 ? -37.930 34.328 -16.608 1.00 37.97  ? 221 GLU A OE2   1 
ATOM   1692 N  N     . ARG A 1  225 ? -37.626 40.630 -14.832 1.00 37.86  ? 222 ARG A N     1 
ATOM   1693 C  CA    . ARG A 1  225 ? -37.316 42.048 -14.977 1.00 36.94  ? 222 ARG A CA    1 
ATOM   1694 C  C     . ARG A 1  225 ? -36.134 42.415 -14.135 1.00 37.29  ? 222 ARG A C     1 
ATOM   1695 O  O     . ARG A 1  225 ? -35.369 43.330 -14.492 1.00 38.33  ? 222 ARG A O     1 
ATOM   1696 C  CB    . ARG A 1  225 ? -38.505 42.930 -14.618 1.00 35.94  ? 222 ARG A CB    1 
ATOM   1697 C  CG    . ARG A 1  225 ? -38.257 44.389 -14.801 1.00 33.85  ? 222 ARG A CG    1 
ATOM   1698 C  CD    . ARG A 1  225 ? -37.780 44.737 -16.229 1.00 33.42  ? 222 ARG A CD    1 
ATOM   1699 N  NE    . ARG A 1  225 ? -37.779 46.180 -16.401 1.00 32.09  ? 222 ARG A NE    1 
ATOM   1700 C  CZ    . ARG A 1  225 ? -36.806 46.980 -15.962 1.00 33.20  ? 222 ARG A CZ    1 
ATOM   1701 N  NH1   . ARG A 1  225 ? -35.728 46.463 -15.383 1.00 33.76  ? 222 ARG A NH1   1 
ATOM   1702 N  NH2   . ARG A 1  225 ? -36.902 48.298 -16.107 1.00 32.88  ? 222 ARG A NH2   1 
ATOM   1703 N  N     . LYS A 1  226 ? -35.966 41.703 -13.035 1.00 36.80  ? 223 LYS A N     1 
ATOM   1704 C  CA    . LYS A 1  226 ? -34.853 41.996 -12.159 1.00 37.33  ? 223 LYS A CA    1 
ATOM   1705 C  C     . LYS A 1  226 ? -33.567 41.465 -12.802 1.00 37.69  ? 223 LYS A C     1 
ATOM   1706 O  O     . LYS A 1  226 ? -32.512 42.122 -12.737 1.00 38.11  ? 223 LYS A O     1 
ATOM   1707 C  CB    . LYS A 1  226 ? -35.099 41.439 -10.746 1.00 36.97  ? 223 LYS A CB    1 
ATOM   1708 C  CG    . LYS A 1  226 ? -34.016 41.791 -9.739  1.00 37.28  ? 223 LYS A CG    1 
ATOM   1709 C  CD    . LYS A 1  226 ? -34.009 43.272 -9.306  1.00 36.77  ? 223 LYS A CD    1 
ATOM   1710 C  CE    . LYS A 1  226 ? -35.353 43.686 -8.679  1.00 37.05  ? 223 LYS A CE    1 
ATOM   1711 N  NZ    . LYS A 1  226 ? -35.237 44.935 -7.891  1.00 36.25  ? 223 LYS A NZ    1 
ATOM   1712 N  N     . ASN A 1  227 ? -33.683 40.296 -13.443 1.00 37.72  ? 224 ASN A N     1 
ATOM   1713 C  CA    . ASN A 1  227 ? -32.619 39.723 -14.271 1.00 37.59  ? 224 ASN A CA    1 
ATOM   1714 C  C     . ASN A 1  227 ? -32.067 40.773 -15.225 1.00 37.71  ? 224 ASN A C     1 
ATOM   1715 O  O     . ASN A 1  227 ? -30.854 40.916 -15.364 1.00 38.39  ? 224 ASN A O     1 
ATOM   1716 C  CB    . ASN A 1  227 ? -33.136 38.539 -15.093 1.00 37.12  ? 224 ASN A CB    1 
ATOM   1717 C  CG    . ASN A 1  227 ? -33.450 37.324 -14.251 1.00 37.39  ? 224 ASN A CG    1 
ATOM   1718 O  OD1   . ASN A 1  227 ? -33.007 37.218 -13.121 1.00 35.48  ? 224 ASN A OD1   1 
ATOM   1719 N  ND2   . ASN A 1  227 ? -34.209 36.381 -14.816 1.00 38.37  ? 224 ASN A ND2   1 
ATOM   1720 N  N     . SER A 1  228 ? -32.957 41.520 -15.871 1.00 37.11  ? 225 SER A N     1 
ATOM   1721 C  CA    . SER A 1  228 ? -32.521 42.565 -16.751 1.00 37.12  ? 225 SER A CA    1 
ATOM   1722 C  C     . SER A 1  228 ? -31.558 43.514 -15.994 1.00 37.50  ? 225 SER A C     1 
ATOM   1723 O  O     . SER A 1  228 ? -30.421 43.719 -16.417 1.00 37.72  ? 225 SER A O     1 
ATOM   1724 C  CB    . SER A 1  228 ? -33.725 43.316 -17.337 1.00 37.35  ? 225 SER A CB    1 
ATOM   1725 O  OG    . SER A 1  228 ? -33.340 44.208 -18.376 1.00 35.43  ? 225 SER A OG    1 
ATOM   1726 N  N     . ASP A 1  229 ? -31.984 44.056 -14.865 1.00 37.09  ? 226 ASP A N     1 
ATOM   1727 C  CA    . ASP A 1  229 ? -31.148 45.029 -14.199 1.00 37.50  ? 226 ASP A CA    1 
ATOM   1728 C  C     . ASP A 1  229 ? -29.827 44.399 -13.759 1.00 37.47  ? 226 ASP A C     1 
ATOM   1729 O  O     . ASP A 1  229 ? -28.784 45.058 -13.759 1.00 37.11  ? 226 ASP A O     1 
ATOM   1730 C  CB    . ASP A 1  229 ? -31.874 45.648 -13.006 1.00 37.74  ? 226 ASP A CB    1 
ATOM   1731 C  CG    . ASP A 1  229 ? -33.082 46.480 -13.418 1.00 38.61  ? 226 ASP A CG    1 
ATOM   1732 O  OD1   . ASP A 1  229 ? -33.117 47.015 -14.547 1.00 39.08  ? 226 ASP A OD1   1 
ATOM   1733 O  OD2   . ASP A 1  229 ? -34.004 46.628 -12.591 1.00 41.40  ? 226 ASP A OD2   1 
ATOM   1734 N  N     . ILE A 1  230 ? -29.875 43.121 -13.396 1.00 37.34  ? 227 ILE A N     1 
ATOM   1735 C  CA    . ILE A 1  230 ? -28.700 42.443 -12.885 1.00 37.06  ? 227 ILE A CA    1 
ATOM   1736 C  C     . ILE A 1  230 ? -27.685 42.334 -14.015 1.00 37.34  ? 227 ILE A C     1 
ATOM   1737 O  O     . ILE A 1  230 ? -26.513 42.707 -13.852 1.00 37.32  ? 227 ILE A O     1 
ATOM   1738 C  CB    . ILE A 1  230 ? -29.052 41.057 -12.315 1.00 37.27  ? 227 ILE A CB    1 
ATOM   1739 C  CG1   . ILE A 1  230 ? -29.907 41.200 -11.052 1.00 37.42  ? 227 ILE A CG1   1 
ATOM   1740 C  CG2   . ILE A 1  230 ? -27.786 40.258 -12.022 1.00 36.26  ? 227 ILE A CG2   1 
ATOM   1741 C  CD1   . ILE A 1  230 ? -30.789 40.005 -10.770 1.00 38.66  ? 227 ILE A CD1   1 
ATOM   1742 N  N     . LYS A 1  231 ? -28.144 41.855 -15.172 1.00 37.24  ? 228 LYS A N     1 
ATOM   1743 C  CA    . LYS A 1  231 ? -27.290 41.785 -16.348 1.00 37.16  ? 228 LYS A CA    1 
ATOM   1744 C  C     . LYS A 1  231 ? -26.798 43.170 -16.785 1.00 37.17  ? 228 LYS A C     1 
ATOM   1745 O  O     . LYS A 1  231 ? -25.642 43.321 -17.147 1.00 37.39  ? 228 LYS A O     1 
ATOM   1746 C  CB    . LYS A 1  231 ? -28.008 41.068 -17.482 1.00 37.22  ? 228 LYS A CB    1 
ATOM   1747 C  CG    . LYS A 1  231 ? -28.067 39.519 -17.295 1.00 37.46  ? 228 LYS A CG    1 
ATOM   1748 C  CD    . LYS A 1  231 ? -28.734 38.845 -18.508 1.00 36.24  ? 228 LYS A CD    1 
ATOM   1749 C  CE    . LYS A 1  231 ? -27.906 37.670 -19.031 1.00 37.71  ? 228 LYS A CE    1 
ATOM   1750 N  NZ    . LYS A 1  231 ? -28.551 36.998 -20.204 1.00 36.95  ? 228 LYS A NZ    1 
ATOM   1751 N  N     . ARG A 1  232 ? -27.660 44.179 -16.724 1.00 37.28  ? 229 ARG A N     1 
ATOM   1752 C  CA    . ARG A 1  232 ? -27.312 45.514 -17.201 1.00 37.76  ? 229 ARG A CA    1 
ATOM   1753 C  C     . ARG A 1  232 ? -26.214 46.147 -16.336 1.00 38.69  ? 229 ARG A C     1 
ATOM   1754 O  O     . ARG A 1  232 ? -25.269 46.764 -16.849 1.00 38.63  ? 229 ARG A O     1 
ATOM   1755 C  CB    . ARG A 1  232 ? -28.556 46.408 -17.274 1.00 37.51  ? 229 ARG A CB    1 
ATOM   1756 C  CG    . ARG A 1  232 ? -28.324 47.853 -17.728 1.00 36.46  ? 229 ARG A CG    1 
ATOM   1757 C  CD    . ARG A 1  232 ? -29.597 48.477 -18.262 1.00 35.84  ? 229 ARG A CD    1 
ATOM   1758 N  NE    . ARG A 1  232 ? -30.591 48.557 -17.207 1.00 38.54  ? 229 ARG A NE    1 
ATOM   1759 C  CZ    . ARG A 1  232 ? -30.803 49.623 -16.441 1.00 39.72  ? 229 ARG A CZ    1 
ATOM   1760 N  NH1   . ARG A 1  232 ? -30.104 50.740 -16.633 1.00 37.96  ? 229 ARG A NH1   1 
ATOM   1761 N  NH2   . ARG A 1  232 ? -31.732 49.569 -15.481 1.00 40.44  ? 229 ARG A NH2   1 
ATOM   1762 N  N     . LEU A 1  233 ? -26.329 45.985 -15.022 1.00 39.58  ? 230 LEU A N     1 
ATOM   1763 C  CA    . LEU A 1  233 ? -25.327 46.544 -14.137 1.00 39.77  ? 230 LEU A CA    1 
ATOM   1764 C  C     . LEU A 1  233 ? -24.013 45.756 -14.249 1.00 39.44  ? 230 LEU A C     1 
ATOM   1765 O  O     . LEU A 1  233 ? -22.925 46.350 -14.289 1.00 39.41  ? 230 LEU A O     1 
ATOM   1766 C  CB    . LEU A 1  233 ? -25.835 46.633 -12.697 1.00 39.90  ? 230 LEU A CB    1 
ATOM   1767 C  CG    . LEU A 1  233 ? -24.836 47.310 -11.732 1.00 41.32  ? 230 LEU A CG    1 
ATOM   1768 C  CD1   . LEU A 1  233 ? -24.511 48.744 -12.142 1.00 39.80  ? 230 LEU A CD1   1 
ATOM   1769 C  CD2   . LEU A 1  233 ? -25.387 47.298 -10.329 1.00 42.24  ? 230 LEU A CD2   1 
ATOM   1770 N  N     . LEU A 1  234 ? -24.114 44.433 -14.327 1.00 39.18  ? 231 LEU A N     1 
ATOM   1771 C  CA    . LEU A 1  234 ? -22.919 43.608 -14.510 1.00 39.32  ? 231 LEU A CA    1 
ATOM   1772 C  C     . LEU A 1  234 ? -22.162 44.037 -15.761 1.00 39.63  ? 231 LEU A C     1 
ATOM   1773 O  O     . LEU A 1  234 ? -20.933 44.191 -15.741 1.00 39.82  ? 231 LEU A O     1 
ATOM   1774 C  CB    . LEU A 1  234 ? -23.269 42.122 -14.601 1.00 38.85  ? 231 LEU A CB    1 
ATOM   1775 C  CG    . LEU A 1  234 ? -23.553 41.445 -13.261 1.00 39.02  ? 231 LEU A CG    1 
ATOM   1776 C  CD1   . LEU A 1  234 ? -24.204 40.102 -13.464 1.00 38.96  ? 231 LEU A CD1   1 
ATOM   1777 C  CD2   . LEU A 1  234 ? -22.298 41.298 -12.417 1.00 39.21  ? 231 LEU A CD2   1 
ATOM   1778 N  N     . THR A 1  235 ? -22.900 44.242 -16.847 1.00 39.48  ? 232 THR A N     1 
ATOM   1779 C  CA    . THR A 1  235 ? -22.289 44.636 -18.090 1.00 39.72  ? 232 THR A CA    1 
ATOM   1780 C  C     . THR A 1  235 ? -21.493 45.943 -17.905 1.00 40.16  ? 232 THR A C     1 
ATOM   1781 O  O     . THR A 1  235 ? -20.324 46.014 -18.282 1.00 40.28  ? 232 THR A O     1 
ATOM   1782 C  CB    . THR A 1  235 ? -23.352 44.819 -19.160 1.00 39.60  ? 232 THR A CB    1 
ATOM   1783 O  OG1   . THR A 1  235 ? -23.966 43.560 -19.418 1.00 38.86  ? 232 THR A OG1   1 
ATOM   1784 C  CG2   . THR A 1  235 ? -22.733 45.364 -20.440 1.00 39.54  ? 232 THR A CG2   1 
ATOM   1785 N  N     . LYS A 1  236 ? -22.132 46.960 -17.316 1.00 40.17  ? 233 LYS A N     1 
ATOM   1786 C  CA    . LYS A 1  236 ? -21.518 48.269 -17.145 1.00 40.13  ? 233 LYS A CA    1 
ATOM   1787 C  C     . LYS A 1  236 ? -20.257 48.148 -16.304 1.00 41.11  ? 233 LYS A C     1 
ATOM   1788 O  O     . LYS A 1  236 ? -19.221 48.729 -16.627 1.00 41.53  ? 233 LYS A O     1 
ATOM   1789 C  CB    . LYS A 1  236 ? -22.489 49.235 -16.486 1.00 39.37  ? 233 LYS A CB    1 
ATOM   1790 C  CG    . LYS A 1  236 ? -23.692 49.519 -17.317 1.00 38.11  ? 233 LYS A CG    1 
ATOM   1791 C  CD    . LYS A 1  236 ? -24.685 50.391 -16.603 1.00 36.98  ? 233 LYS A CD    1 
ATOM   1792 C  CE    . LYS A 1  236 ? -25.897 50.672 -17.481 1.00 36.68  ? 233 LYS A CE    1 
ATOM   1793 N  NZ    . LYS A 1  236 ? -26.800 51.629 -16.807 1.00 37.51  ? 233 LYS A NZ    1 
ATOM   1794 N  N     . LEU A 1  237 ? -20.336 47.367 -15.234 1.00 41.52  ? 234 LEU A N     1 
ATOM   1795 C  CA    . LEU A 1  237 ? -19.205 47.232 -14.345 1.00 41.87  ? 234 LEU A CA    1 
ATOM   1796 C  C     . LEU A 1  237 ? -18.042 46.522 -14.999 1.00 42.51  ? 234 LEU A C     1 
ATOM   1797 O  O     . LEU A 1  237 ? -16.915 46.639 -14.526 1.00 43.19  ? 234 LEU A O     1 
ATOM   1798 C  CB    . LEU A 1  237 ? -19.610 46.498 -13.070 1.00 41.34  ? 234 LEU A CB    1 
ATOM   1799 C  CG    . LEU A 1  237 ? -20.486 47.324 -12.134 1.00 40.37  ? 234 LEU A CG    1 
ATOM   1800 C  CD1   . LEU A 1  237 ? -20.768 46.531 -10.900 1.00 39.00  ? 234 LEU A CD1   1 
ATOM   1801 C  CD2   . LEU A 1  237 ? -19.853 48.654 -11.764 1.00 37.95  ? 234 LEU A CD2   1 
ATOM   1802 N  N     . LEU A 1  238 ? -18.317 45.797 -16.079 1.00 42.77  ? 235 LEU A N     1 
ATOM   1803 C  CA    . LEU A 1  238 ? -17.328 44.921 -16.685 1.00 43.27  ? 235 LEU A CA    1 
ATOM   1804 C  C     . LEU A 1  238 ? -16.770 45.467 -18.013 1.00 44.07  ? 235 LEU A C     1 
ATOM   1805 O  O     . LEU A 1  238 ? -15.906 44.852 -18.640 1.00 44.21  ? 235 LEU A O     1 
ATOM   1806 C  CB    . LEU A 1  238 ? -17.938 43.543 -16.887 1.00 42.88  ? 235 LEU A CB    1 
ATOM   1807 C  CG    . LEU A 1  238 ? -18.129 42.726 -15.615 1.00 42.79  ? 235 LEU A CG    1 
ATOM   1808 C  CD1   . LEU A 1  238 ? -19.006 41.514 -15.876 1.00 42.41  ? 235 LEU A CD1   1 
ATOM   1809 C  CD2   . LEU A 1  238 ? -16.805 42.283 -15.000 1.00 42.57  ? 235 LEU A CD2   1 
ATOM   1810 N  N     . VAL A 1  239 ? -17.270 46.623 -18.437 1.00 45.00  ? 236 VAL A N     1 
ATOM   1811 C  CA    . VAL A 1  239 ? -16.813 47.278 -19.657 1.00 45.68  ? 236 VAL A CA    1 
ATOM   1812 C  C     . VAL A 1  239 ? -15.288 47.404 -19.625 1.00 46.92  ? 236 VAL A C     1 
ATOM   1813 O  O     . VAL A 1  239 ? -14.719 47.887 -18.655 1.00 46.80  ? 236 VAL A O     1 
ATOM   1814 C  CB    . VAL A 1  239 ? -17.467 48.665 -19.811 1.00 45.12  ? 236 VAL A CB    1 
ATOM   1815 C  CG1   . VAL A 1  239 ? -16.791 49.455 -20.904 1.00 44.27  ? 236 VAL A CG1   1 
ATOM   1816 C  CG2   . VAL A 1  239 ? -18.949 48.524 -20.079 1.00 44.53  ? 236 VAL A CG2   1 
ATOM   1817 N  N     . GLY A 1  240 ? -14.633 46.925 -20.679 1.00 48.70  ? 237 GLY A N     1 
ATOM   1818 C  CA    . GLY A 1  240 ? -13.177 47.016 -20.793 1.00 50.00  ? 237 GLY A CA    1 
ATOM   1819 C  C     . GLY A 1  240 ? -12.387 46.112 -19.859 1.00 50.96  ? 237 GLY A C     1 
ATOM   1820 O  O     . GLY A 1  240 ? -11.176 46.223 -19.801 1.00 51.96  ? 237 GLY A O     1 
ATOM   1821 N  N     . ARG A 1  241 ? -13.051 45.233 -19.116 1.00 51.12  ? 238 ARG A N     1 
ATOM   1822 C  CA    . ARG A 1  241 ? -12.347 44.236 -18.312 1.00 51.51  ? 238 ARG A CA    1 
ATOM   1823 C  C     . ARG A 1  241 ? -12.782 42.854 -18.749 1.00 51.38  ? 238 ARG A C     1 
ATOM   1824 O  O     . ARG A 1  241 ? -13.824 42.711 -19.408 1.00 51.43  ? 238 ARG A O     1 
ATOM   1825 C  CB    . ARG A 1  241 ? -12.679 44.372 -16.834 1.00 51.93  ? 238 ARG A CB    1 
ATOM   1826 C  CG    . ARG A 1  241 ? -12.471 45.726 -16.251 1.00 54.32  ? 238 ARG A CG    1 
ATOM   1827 C  CD    . ARG A 1  241 ? -12.594 45.646 -14.740 1.00 60.79  ? 238 ARG A CD    1 
ATOM   1828 N  NE    . ARG A 1  241 ? -12.136 46.887 -14.114 1.00 67.51  ? 238 ARG A NE    1 
ATOM   1829 C  CZ    . ARG A 1  241 ? -12.738 48.072 -14.259 1.00 70.77  ? 238 ARG A CZ    1 
ATOM   1830 N  NH1   . ARG A 1  241 ? -13.841 48.197 -15.016 1.00 72.53  ? 238 ARG A NH1   1 
ATOM   1831 N  NH2   . ARG A 1  241 ? -12.239 49.137 -13.647 1.00 70.67  ? 238 ARG A NH2   1 
ATOM   1832 N  N     . PRO A 1  242 ? -12.002 41.817 -18.380 1.00 51.16  ? 239 PRO A N     1 
ATOM   1833 C  CA    . PRO A 1  242 ? -12.547 40.470 -18.582 1.00 51.31  ? 239 PRO A CA    1 
ATOM   1834 C  C     . PRO A 1  242 ? -13.816 40.232 -17.722 1.00 51.35  ? 239 PRO A C     1 
ATOM   1835 O  O     . PRO A 1  242 ? -13.969 40.798 -16.629 1.00 51.23  ? 239 PRO A O     1 
ATOM   1836 C  CB    . PRO A 1  242 ? -11.389 39.550 -18.162 1.00 50.95  ? 239 PRO A CB    1 
ATOM   1837 C  CG    . PRO A 1  242 ? -10.521 40.405 -17.307 1.00 50.61  ? 239 PRO A CG    1 
ATOM   1838 C  CD    . PRO A 1  242 ? -10.621 41.779 -17.867 1.00 50.81  ? 239 PRO A CD    1 
ATOM   1839 N  N     . THR A 1  243 ? -14.715 39.403 -18.232 1.00 51.35  ? 240 THR A N     1 
ATOM   1840 C  CA    . THR A 1  243 ? -16.000 39.170 -17.588 1.00 51.19  ? 240 THR A CA    1 
ATOM   1841 C  C     . THR A 1  243 ? -15.920 38.275 -16.340 1.00 51.70  ? 240 THR A C     1 
ATOM   1842 O  O     . THR A 1  243 ? -16.524 37.201 -16.307 1.00 51.85  ? 240 THR A O     1 
ATOM   1843 C  CB    . THR A 1  243 ? -17.001 38.595 -18.587 1.00 50.63  ? 240 THR A CB    1 
ATOM   1844 O  OG1   . THR A 1  243 ? -16.544 37.309 -19.033 1.00 51.33  ? 240 THR A OG1   1 
ATOM   1845 C  CG2   . THR A 1  243 ? -17.143 39.520 -19.766 1.00 49.09  ? 240 THR A CG2   1 
ATOM   1846 N  N     . LYS A 1  244 ? -15.183 38.743 -15.325 1.00 52.10  ? 241 LYS A N     1 
ATOM   1847 C  CA    . LYS A 1  244 ? -15.114 38.120 -13.989 1.00 51.97  ? 241 LYS A CA    1 
ATOM   1848 C  C     . LYS A 1  244 ? -16.282 38.596 -13.104 1.00 52.19  ? 241 LYS A C     1 
ATOM   1849 O  O     . LYS A 1  244 ? -16.105 39.443 -12.219 1.00 52.85  ? 241 LYS A O     1 
ATOM   1850 C  CB    . LYS A 1  244 ? -13.762 38.447 -13.323 1.00 51.88  ? 241 LYS A CB    1 
ATOM   1851 N  N     . TRP A 1  245 ? -17.475 38.055 -13.350 1.00 51.71  ? 242 TRP A N     1 
ATOM   1852 C  CA    . TRP A 1  245 ? -18.677 38.463 -12.626 1.00 51.23  ? 242 TRP A CA    1 
ATOM   1853 C  C     . TRP A 1  245 ? -18.850 37.913 -11.202 1.00 51.34  ? 242 TRP A C     1 
ATOM   1854 O  O     . TRP A 1  245 ? -19.542 38.521 -10.397 1.00 52.02  ? 242 TRP A O     1 
ATOM   1855 C  CB    . TRP A 1  245 ? -19.927 38.132 -13.435 1.00 50.98  ? 242 TRP A CB    1 
ATOM   1856 C  CG    . TRP A 1  245 ? -20.065 36.689 -13.797 1.00 50.77  ? 242 TRP A CG    1 
ATOM   1857 C  CD1   . TRP A 1  245 ? -19.594 36.096 -14.919 1.00 50.55  ? 242 TRP A CD1   1 
ATOM   1858 C  CD2   . TRP A 1  245 ? -20.725 35.651 -13.043 1.00 50.78  ? 242 TRP A CD2   1 
ATOM   1859 N  NE1   . TRP A 1  245 ? -19.907 34.762 -14.924 1.00 50.10  ? 242 TRP A NE1   1 
ATOM   1860 C  CE2   . TRP A 1  245 ? -20.604 34.456 -13.790 1.00 49.85  ? 242 TRP A CE2   1 
ATOM   1861 C  CE3   . TRP A 1  245 ? -21.393 35.612 -11.809 1.00 50.47  ? 242 TRP A CE3   1 
ATOM   1862 C  CZ2   . TRP A 1  245 ? -21.126 33.229 -13.351 1.00 49.60  ? 242 TRP A CZ2   1 
ATOM   1863 C  CZ3   . TRP A 1  245 ? -21.923 34.391 -11.374 1.00 49.14  ? 242 TRP A CZ3   1 
ATOM   1864 C  CH2   . TRP A 1  245 ? -21.782 33.217 -12.148 1.00 49.26  ? 242 TRP A CH2   1 
ATOM   1865 N  N     . TYR A 1  246 ? -18.254 36.767 -10.891 1.00 51.14  ? 243 TYR A N     1 
ATOM   1866 C  CA    . TYR A 1  246 ? -18.461 36.113 -9.589  1.00 50.48  ? 243 TYR A CA    1 
ATOM   1867 C  C     . TYR A 1  246 ? -18.284 37.048 -8.395  1.00 50.48  ? 243 TYR A C     1 
ATOM   1868 O  O     . TYR A 1  246 ? -19.057 37.012 -7.443  1.00 51.06  ? 243 TYR A O     1 
ATOM   1869 C  CB    . TYR A 1  246 ? -17.508 34.936 -9.429  1.00 50.16  ? 243 TYR A CB    1 
ATOM   1870 C  CG    . TYR A 1  246 ? -17.625 34.242 -8.101  1.00 49.36  ? 243 TYR A CG    1 
ATOM   1871 C  CD1   . TYR A 1  246 ? -18.497 33.171 -7.938  1.00 47.99  ? 243 TYR A CD1   1 
ATOM   1872 C  CD2   . TYR A 1  246 ? -16.853 34.649 -6.996  1.00 48.95  ? 243 TYR A CD2   1 
ATOM   1873 C  CE1   . TYR A 1  246 ? -18.614 32.523 -6.722  1.00 47.53  ? 243 TYR A CE1   1 
ATOM   1874 C  CE2   . TYR A 1  246 ? -16.965 34.004 -5.771  1.00 46.97  ? 243 TYR A CE2   1 
ATOM   1875 C  CZ    . TYR A 1  246 ? -17.846 32.938 -5.653  1.00 48.15  ? 243 TYR A CZ    1 
ATOM   1876 O  OH    . TYR A 1  246 ? -17.986 32.276 -4.465  1.00 50.75  ? 243 TYR A OH    1 
ATOM   1877 N  N     . ASP A 1  247 ? -17.249 37.866 -8.452  1.00 50.35  ? 244 ASP A N     1 
ATOM   1878 C  CA    . ASP A 1  247 ? -16.893 38.763 -7.374  1.00 50.18  ? 244 ASP A CA    1 
ATOM   1879 C  C     . ASP A 1  247 ? -17.752 40.015 -7.376  1.00 49.41  ? 244 ASP A C     1 
ATOM   1880 O  O     . ASP A 1  247 ? -17.599 40.867 -6.516  1.00 49.96  ? 244 ASP A O     1 
ATOM   1881 C  CB    . ASP A 1  247 ? -15.428 39.183 -7.531  1.00 50.91  ? 244 ASP A CB    1 
ATOM   1882 C  CG    . ASP A 1  247 ? -14.464 38.251 -6.831  1.00 53.74  ? 244 ASP A CG    1 
ATOM   1883 O  OD1   . ASP A 1  247 ? -14.911 37.277 -6.169  1.00 56.63  ? 244 ASP A OD1   1 
ATOM   1884 O  OD2   . ASP A 1  247 ? -13.245 38.517 -6.932  1.00 56.50  ? 244 ASP A OD2   1 
ATOM   1885 N  N     . LEU A 1  248 ? -18.631 40.172 -8.349  1.00 48.18  ? 245 LEU A N     1 
ATOM   1886 C  CA    . LEU A 1  248 ? -19.425 41.387 -8.358  1.00 47.21  ? 245 LEU A CA    1 
ATOM   1887 C  C     . LEU A 1  248 ? -20.857 41.132 -7.910  1.00 46.51  ? 245 LEU A C     1 
ATOM   1888 O  O     . LEU A 1  248 ? -21.559 42.060 -7.500  1.00 46.69  ? 245 LEU A O     1 
ATOM   1889 C  CB    . LEU A 1  248 ? -19.391 42.061 -9.724  1.00 47.32  ? 245 LEU A CB    1 
ATOM   1890 C  CG    . LEU A 1  248 ? -18.066 42.626 -10.236 1.00 47.34  ? 245 LEU A CG    1 
ATOM   1891 C  CD1   . LEU A 1  248 ? -18.254 43.073 -11.675 1.00 46.26  ? 245 LEU A CD1   1 
ATOM   1892 C  CD2   . LEU A 1  248 ? -17.599 43.773 -9.391  1.00 46.27  ? 245 LEU A CD2   1 
ATOM   1893 N  N     . LEU A 1  249 ? -21.284 39.875 -7.972  1.00 45.18  ? 246 LEU A N     1 
ATOM   1894 C  CA    . LEU A 1  249 ? -22.597 39.514 -7.471  1.00 44.11  ? 246 LEU A CA    1 
ATOM   1895 C  C     . LEU A 1  249 ? -22.972 40.251 -6.183  1.00 43.36  ? 246 LEU A C     1 
ATOM   1896 O  O     . LEU A 1  249 ? -23.981 40.941 -6.166  1.00 43.06  ? 246 LEU A O     1 
ATOM   1897 C  CB    . LEU A 1  249 ? -22.714 38.010 -7.289  1.00 44.01  ? 246 LEU A CB    1 
ATOM   1898 C  CG    . LEU A 1  249 ? -22.914 37.240 -8.579  1.00 43.75  ? 246 LEU A CG    1 
ATOM   1899 C  CD1   . LEU A 1  249 ? -23.414 35.860 -8.217  1.00 43.26  ? 246 LEU A CD1   1 
ATOM   1900 C  CD2   . LEU A 1  249 ? -23.915 37.970 -9.477  1.00 42.56  ? 246 LEU A CD2   1 
ATOM   1901 N  N     . PRO A 1  250 ? -22.140 40.147 -5.120  1.00 43.26  ? 247 PRO A N     1 
ATOM   1902 C  CA    . PRO A 1  250 ? -22.482 40.836 -3.876  1.00 42.79  ? 247 PRO A CA    1 
ATOM   1903 C  C     . PRO A 1  250 ? -22.660 42.334 -4.072  1.00 42.69  ? 247 PRO A C     1 
ATOM   1904 O  O     . PRO A 1  250 ? -23.662 42.901 -3.608  1.00 42.87  ? 247 PRO A O     1 
ATOM   1905 C  CB    . PRO A 1  250 ? -21.279 40.547 -2.978  1.00 42.75  ? 247 PRO A CB    1 
ATOM   1906 C  CG    . PRO A 1  250 ? -20.757 39.267 -3.473  1.00 43.11  ? 247 PRO A CG    1 
ATOM   1907 C  CD    . PRO A 1  250 ? -20.909 39.340 -4.955  1.00 43.17  ? 247 PRO A CD    1 
ATOM   1908 N  N     . VAL A 1  251 ? -21.719 42.962 -4.770  1.00 42.01  ? 248 VAL A N     1 
ATOM   1909 C  CA    . VAL A 1  251 ? -21.806 44.383 -5.068  1.00 41.71  ? 248 VAL A CA    1 
ATOM   1910 C  C     . VAL A 1  251 ? -23.123 44.721 -5.782  1.00 41.79  ? 248 VAL A C     1 
ATOM   1911 O  O     . VAL A 1  251 ? -23.840 45.668 -5.401  1.00 41.72  ? 248 VAL A O     1 
ATOM   1912 C  CB    . VAL A 1  251 ? -20.620 44.811 -5.937  1.00 41.74  ? 248 VAL A CB    1 
ATOM   1913 C  CG1   . VAL A 1  251 ? -20.690 46.289 -6.279  1.00 41.29  ? 248 VAL A CG1   1 
ATOM   1914 C  CG2   . VAL A 1  251 ? -19.328 44.500 -5.212  1.00 42.66  ? 248 VAL A CG2   1 
ATOM   1915 N  N     . VAL A 1  252 ? -23.442 43.937 -6.806  1.00 41.03  ? 249 VAL A N     1 
ATOM   1916 C  CA    . VAL A 1  252 ? -24.613 44.191 -7.599  1.00 40.91  ? 249 VAL A CA    1 
ATOM   1917 C  C     . VAL A 1  252 ? -25.870 44.071 -6.731  1.00 41.02  ? 249 VAL A C     1 
ATOM   1918 O  O     . VAL A 1  252 ? -26.742 44.973 -6.752  1.00 41.39  ? 249 VAL A O     1 
ATOM   1919 C  CB    . VAL A 1  252 ? -24.655 43.266 -8.837  1.00 41.30  ? 249 VAL A CB    1 
ATOM   1920 C  CG1   . VAL A 1  252 ? -25.998 43.346 -9.548  1.00 41.06  ? 249 VAL A CG1   1 
ATOM   1921 C  CG2   . VAL A 1  252 ? -23.559 43.647 -9.805  1.00 41.29  ? 249 VAL A CG2   1 
ATOM   1922 N  N     . GLN A 1  253 ? -25.951 42.981 -5.960  1.00 40.09  ? 250 GLN A N     1 
ATOM   1923 C  CA    . GLN A 1  253 ? -27.066 42.752 -5.032  1.00 39.47  ? 250 GLN A CA    1 
ATOM   1924 C  C     . GLN A 1  253 ? -27.330 44.003 -4.208  1.00 38.85  ? 250 GLN A C     1 
ATOM   1925 O  O     . GLN A 1  253 ? -28.427 44.579 -4.240  1.00 38.55  ? 250 GLN A O     1 
ATOM   1926 C  CB    . GLN A 1  253 ? -26.729 41.597 -4.095  1.00 39.71  ? 250 GLN A CB    1 
ATOM   1927 C  CG    . GLN A 1  253 ? -27.892 41.100 -3.275  1.00 41.01  ? 250 GLN A CG    1 
ATOM   1928 C  CD    . GLN A 1  253 ? -27.496 39.953 -2.385  1.00 41.71  ? 250 GLN A CD    1 
ATOM   1929 O  OE1   . GLN A 1  253 ? -27.775 38.795 -2.685  1.00 44.51  ? 250 GLN A OE1   1 
ATOM   1930 N  NE2   . GLN A 1  253 ? -26.814 40.262 -1.297  1.00 41.62  ? 250 GLN A NE2   1 
ATOM   1931 N  N     . LEU A 1  254 ? -26.294 44.436 -3.495  1.00 37.96  ? 251 LEU A N     1 
ATOM   1932 C  CA    . LEU A 1  254 ? -26.400 45.592 -2.636  1.00 37.22  ? 251 LEU A CA    1 
ATOM   1933 C  C     . LEU A 1  254 ? -26.791 46.823 -3.438  1.00 37.00  ? 251 LEU A C     1 
ATOM   1934 O  O     . LEU A 1  254 ? -27.689 47.582 -3.028  1.00 37.07  ? 251 LEU A O     1 
ATOM   1935 C  CB    . LEU A 1  254 ? -25.098 45.824 -1.875  1.00 37.17  ? 251 LEU A CB    1 
ATOM   1936 C  CG    . LEU A 1  254 ? -25.044 46.988 -0.879  1.00 36.56  ? 251 LEU A CG    1 
ATOM   1937 C  CD1   . LEU A 1  254 ? -25.906 46.700 0.351   1.00 36.31  ? 251 LEU A CD1   1 
ATOM   1938 C  CD2   . LEU A 1  254 ? -23.625 47.254 -0.473  1.00 32.39  ? 251 LEU A CD2   1 
ATOM   1939 N  N     . ALA A 1  255 ? -26.136 47.005 -4.586  1.00 36.50  ? 252 ALA A N     1 
ATOM   1940 C  CA    . ALA A 1  255 ? -26.372 48.189 -5.425  1.00 35.67  ? 252 ALA A CA    1 
ATOM   1941 C  C     . ALA A 1  255 ? -27.846 48.285 -5.772  1.00 35.12  ? 252 ALA A C     1 
ATOM   1942 O  O     . ALA A 1  255 ? -28.473 49.317 -5.564  1.00 33.80  ? 252 ALA A O     1 
ATOM   1943 C  CB    . ALA A 1  255 ? -25.534 48.131 -6.686  1.00 35.20  ? 252 ALA A CB    1 
ATOM   1944 N  N     . LEU A 1  256 ? -28.399 47.174 -6.258  1.00 35.29  ? 253 LEU A N     1 
ATOM   1945 C  CA    . LEU A 1  256 ? -29.785 47.157 -6.730  1.00 35.57  ? 253 LEU A CA    1 
ATOM   1946 C  C     . LEU A 1  256 ? -30.824 47.244 -5.606  1.00 35.57  ? 253 LEU A C     1 
ATOM   1947 O  O     . LEU A 1  256 ? -31.842 47.889 -5.761  1.00 35.38  ? 253 LEU A O     1 
ATOM   1948 C  CB    . LEU A 1  256 ? -30.042 45.940 -7.610  1.00 35.11  ? 253 LEU A CB    1 
ATOM   1949 C  CG    . LEU A 1  256 ? -29.243 45.821 -8.908  1.00 35.47  ? 253 LEU A CG    1 
ATOM   1950 C  CD1   . LEU A 1  256 ? -29.723 44.614 -9.740  1.00 34.75  ? 253 LEU A CD1   1 
ATOM   1951 C  CD2   . LEU A 1  256 ? -29.275 47.112 -9.753  1.00 33.21  ? 253 LEU A CD2   1 
ATOM   1952 N  N     . ASN A 1  257 ? -30.554 46.609 -4.473  1.00 36.04  ? 254 ASN A N     1 
ATOM   1953 C  CA    . ASN A 1  257 ? -31.493 46.625 -3.369  1.00 36.34  ? 254 ASN A CA    1 
ATOM   1954 C  C     . ASN A 1  257 ? -31.581 48.017 -2.780  1.00 37.37  ? 254 ASN A C     1 
ATOM   1955 O  O     . ASN A 1  257 ? -32.564 48.371 -2.120  1.00 38.17  ? 254 ASN A O     1 
ATOM   1956 C  CB    . ASN A 1  257 ? -31.068 45.620 -2.316  1.00 36.02  ? 254 ASN A CB    1 
ATOM   1957 C  CG    . ASN A 1  257 ? -31.446 44.191 -2.678  1.00 36.56  ? 254 ASN A CG    1 
ATOM   1958 O  OD1   . ASN A 1  257 ? -32.373 43.946 -3.477  1.00 39.10  ? 254 ASN A OD1   1 
ATOM   1959 N  ND2   . ASN A 1  257 ? -30.743 43.228 -2.080  1.00 35.18  ? 254 ASN A ND2   1 
ATOM   1960 N  N     . ASN A 1  258 ? -30.560 48.828 -3.041  1.00 37.75  ? 255 ASN A N     1 
ATOM   1961 C  CA    . ASN A 1  258 ? -30.573 50.183 -2.543  1.00 38.15  ? 255 ASN A CA    1 
ATOM   1962 C  C     . ASN A 1  258 ? -30.830 51.267 -3.607  1.00 38.81  ? 255 ASN A C     1 
ATOM   1963 O  O     . ASN A 1  258 ? -30.591 52.452 -3.373  1.00 38.81  ? 255 ASN A O     1 
ATOM   1964 C  CB    . ASN A 1  258 ? -29.308 50.430 -1.736  1.00 38.30  ? 255 ASN A CB    1 
ATOM   1965 C  CG    . ASN A 1  258 ? -29.320 49.673 -0.414  1.00 38.85  ? 255 ASN A CG    1 
ATOM   1966 O  OD1   . ASN A 1  258 ? -29.957 50.101 0.560   1.00 38.51  ? 255 ASN A OD1   1 
ATOM   1967 N  ND2   . ASN A 1  258 ? -28.631 48.534 -0.378  1.00 36.81  ? 255 ASN A ND2   1 
ATOM   1968 N  N     . THR A 1  259 ? -31.369 50.855 -4.756  1.00 39.24  ? 256 THR A N     1 
ATOM   1969 C  CA    . THR A 1  259 ? -31.700 51.767 -5.852  1.00 39.30  ? 256 THR A CA    1 
ATOM   1970 C  C     . THR A 1  259 ? -33.188 52.160 -5.876  1.00 39.22  ? 256 THR A C     1 
ATOM   1971 O  O     . THR A 1  259 ? -34.073 51.335 -5.660  1.00 38.79  ? 256 THR A O     1 
ATOM   1972 C  CB    . THR A 1  259 ? -31.293 51.122 -7.176  1.00 39.61  ? 256 THR A CB    1 
ATOM   1973 O  OG1   . THR A 1  259 ? -29.864 51.038 -7.226  1.00 41.06  ? 256 THR A OG1   1 
ATOM   1974 C  CG2   . THR A 1  259 ? -31.802 51.912 -8.364  1.00 39.63  ? 256 THR A CG2   1 
ATOM   1975 N  N     . TYR A 1  260 ? -33.455 53.429 -6.138  1.00 39.19  ? 257 TYR A N     1 
ATOM   1976 C  CA    . TYR A 1  260 ? -34.809 53.921 -6.085  1.00 39.59  ? 257 TYR A CA    1 
ATOM   1977 C  C     . TYR A 1  260 ? -35.604 53.467 -7.310  1.00 39.70  ? 257 TYR A C     1 
ATOM   1978 O  O     . TYR A 1  260 ? -35.094 53.452 -8.415  1.00 40.26  ? 257 TYR A O     1 
ATOM   1979 C  CB    . TYR A 1  260 ? -34.807 55.455 -5.973  1.00 39.63  ? 257 TYR A CB    1 
ATOM   1980 C  CG    . TYR A 1  260 ? -34.684 56.002 -4.550  1.00 40.80  ? 257 TYR A CG    1 
ATOM   1981 C  CD1   . TYR A 1  260 ? -35.814 56.164 -3.748  1.00 39.47  ? 257 TYR A CD1   1 
ATOM   1982 C  CD2   . TYR A 1  260 ? -33.427 56.368 -4.009  1.00 40.94  ? 257 TYR A CD2   1 
ATOM   1983 C  CE1   . TYR A 1  260 ? -35.700 56.643 -2.445  1.00 39.42  ? 257 TYR A CE1   1 
ATOM   1984 C  CE2   . TYR A 1  260 ? -33.313 56.875 -2.716  1.00 38.48  ? 257 TYR A CE2   1 
ATOM   1985 C  CZ    . TYR A 1  260 ? -34.452 57.005 -1.939  1.00 39.02  ? 257 TYR A CZ    1 
ATOM   1986 O  OH    . TYR A 1  260 ? -34.376 57.484 -0.646  1.00 39.19  ? 257 TYR A OH    1 
ATOM   1987 N  N     . SER A 1  261 ? -36.850 53.074 -7.116  1.00 39.37  ? 258 SER A N     1 
ATOM   1988 C  CA    . SER A 1  261 ? -37.748 52.953 -8.231  1.00 39.46  ? 258 SER A CA    1 
ATOM   1989 C  C     . SER A 1  261 ? -38.434 54.301 -8.371  1.00 38.97  ? 258 SER A C     1 
ATOM   1990 O  O     . SER A 1  261 ? -39.237 54.668 -7.501  1.00 39.34  ? 258 SER A O     1 
ATOM   1991 C  CB    . SER A 1  261 ? -38.792 51.864 -7.977  1.00 39.77  ? 258 SER A CB    1 
ATOM   1992 O  OG    . SER A 1  261 ? -39.819 51.927 -8.961  1.00 40.99  ? 258 SER A OG    1 
ATOM   1993 N  N     . PRO A 1  262 ? -38.145 55.043 -9.455  1.00 38.24  ? 259 PRO A N     1 
ATOM   1994 C  CA    . PRO A 1  262 ? -38.755 56.374 -9.557  1.00 38.27  ? 259 PRO A CA    1 
ATOM   1995 C  C     . PRO A 1  262 ? -40.288 56.403 -9.440  1.00 38.31  ? 259 PRO A C     1 
ATOM   1996 O  O     . PRO A 1  262 ? -40.821 57.377 -8.917  1.00 38.40  ? 259 PRO A O     1 
ATOM   1997 C  CB    . PRO A 1  262 ? -38.288 56.878 -10.926 1.00 38.43  ? 259 PRO A CB    1 
ATOM   1998 C  CG    . PRO A 1  262 ? -36.998 56.143 -11.166 1.00 36.95  ? 259 PRO A CG    1 
ATOM   1999 C  CD    . PRO A 1  262 ? -37.153 54.804 -10.515 1.00 37.68  ? 259 PRO A CD    1 
ATOM   2000 N  N     . VAL A 1  263 ? -40.992 55.357 -9.874  1.00 38.03  ? 260 VAL A N     1 
ATOM   2001 C  CA    . VAL A 1  263 ? -42.455 55.367 -9.743  1.00 38.30  ? 260 VAL A CA    1 
ATOM   2002 C  C     . VAL A 1  263 ? -42.902 55.220 -8.281  1.00 39.18  ? 260 VAL A C     1 
ATOM   2003 O  O     . VAL A 1  263 ? -43.939 55.783 -7.884  1.00 39.65  ? 260 VAL A O     1 
ATOM   2004 C  CB    . VAL A 1  263 ? -43.164 54.295 -10.624 1.00 38.40  ? 260 VAL A CB    1 
ATOM   2005 C  CG1   . VAL A 1  263 ? -42.821 52.884 -10.144 1.00 37.99  ? 260 VAL A CG1   1 
ATOM   2006 C  CG2   . VAL A 1  263 ? -44.686 54.498 -10.643 1.00 37.07  ? 260 VAL A CG2   1 
ATOM   2007 N  N     . LEU A 1  264 ? -42.129 54.475 -7.488  1.00 39.29  ? 261 LEU A N     1 
ATOM   2008 C  CA    . LEU A 1  264 ? -42.508 54.195 -6.111  1.00 39.48  ? 261 LEU A CA    1 
ATOM   2009 C  C     . LEU A 1  264 ? -41.956 55.235 -5.181  1.00 40.35  ? 261 LEU A C     1 
ATOM   2010 O  O     . LEU A 1  264 ? -42.588 55.554 -4.183  1.00 41.02  ? 261 LEU A O     1 
ATOM   2011 C  CB    . LEU A 1  264 ? -41.999 52.823 -5.666  1.00 38.75  ? 261 LEU A CB    1 
ATOM   2012 C  CG    . LEU A 1  264 ? -42.530 51.603 -6.426  1.00 38.38  ? 261 LEU A CG    1 
ATOM   2013 C  CD1   . LEU A 1  264 ? -41.970 50.316 -5.825  1.00 35.92  ? 261 LEU A CD1   1 
ATOM   2014 C  CD2   . LEU A 1  264 ? -44.076 51.585 -6.504  1.00 34.33  ? 261 LEU A CD2   1 
ATOM   2015 N  N     . LYS A 1  265 ? -40.759 55.743 -5.499  1.00 41.11  ? 262 LYS A N     1 
ATOM   2016 C  CA    . LYS A 1  265 ? -39.990 56.647 -4.619  1.00 41.48  ? 262 LYS A CA    1 
ATOM   2017 C  C     . LYS A 1  265 ? -39.386 55.937 -3.421  1.00 41.47  ? 262 LYS A C     1 
ATOM   2018 O  O     . LYS A 1  265 ? -39.170 56.551 -2.376  1.00 42.28  ? 262 LYS A O     1 
ATOM   2019 C  CB    . LYS A 1  265 ? -40.844 57.808 -4.113  1.00 41.80  ? 262 LYS A CB    1 
ATOM   2020 C  CG    . LYS A 1  265 ? -41.619 58.524 -5.171  1.00 43.54  ? 262 LYS A CG    1 
ATOM   2021 C  CD    . LYS A 1  265 ? -40.839 59.676 -5.719  1.00 47.49  ? 262 LYS A CD    1 
ATOM   2022 C  CE    . LYS A 1  265 ? -41.816 60.637 -6.354  1.00 50.96  ? 262 LYS A CE    1 
ATOM   2023 N  NZ    . LYS A 1  265 ? -42.860 61.093 -5.374  1.00 51.93  ? 262 LYS A NZ    1 
ATOM   2024 N  N     . TYR A 1  266 ? -39.115 54.651 -3.566  1.00 41.34  ? 263 TYR A N     1 
ATOM   2025 C  CA    . TYR A 1  266 ? -38.510 53.870 -2.504  1.00 41.81  ? 263 TYR A CA    1 
ATOM   2026 C  C     . TYR A 1  266 ? -37.517 52.897 -3.093  1.00 41.74  ? 263 TYR A C     1 
ATOM   2027 O  O     . TYR A 1  266 ? -37.603 52.551 -4.268  1.00 42.17  ? 263 TYR A O     1 
ATOM   2028 C  CB    . TYR A 1  266 ? -39.585 53.139 -1.680  1.00 42.07  ? 263 TYR A CB    1 
ATOM   2029 C  CG    . TYR A 1  266 ? -40.435 54.125 -0.940  1.00 44.06  ? 263 TYR A CG    1 
ATOM   2030 C  CD1   . TYR A 1  266 ? -39.942 54.768 0.206   1.00 45.77  ? 263 TYR A CD1   1 
ATOM   2031 C  CD2   . TYR A 1  266 ? -41.693 54.491 -1.416  1.00 44.79  ? 263 TYR A CD2   1 
ATOM   2032 C  CE1   . TYR A 1  266 ? -40.684 55.709 0.868   1.00 46.47  ? 263 TYR A CE1   1 
ATOM   2033 C  CE2   . TYR A 1  266 ? -42.456 55.442 -0.746  1.00 46.34  ? 263 TYR A CE2   1 
ATOM   2034 C  CZ    . TYR A 1  266 ? -41.940 56.040 0.393   1.00 47.66  ? 263 TYR A CZ    1 
ATOM   2035 O  OH    . TYR A 1  266 ? -42.670 56.985 1.074   1.00 51.62  ? 263 TYR A OH    1 
ATOM   2036 N  N     . THR A 1  267 ? -36.558 52.471 -2.285  1.00 41.34  ? 264 THR A N     1 
ATOM   2037 C  CA    . THR A 1  267 ? -35.669 51.409 -2.692  1.00 40.95  ? 264 THR A CA    1 
ATOM   2038 C  C     . THR A 1  267 ? -36.224 50.122 -2.088  1.00 40.68  ? 264 THR A C     1 
ATOM   2039 O  O     . THR A 1  267 ? -36.970 50.166 -1.108  1.00 39.53  ? 264 THR A O     1 
ATOM   2040 C  CB    . THR A 1  267 ? -34.271 51.669 -2.187  1.00 40.96  ? 264 THR A CB    1 
ATOM   2041 O  OG1   . THR A 1  267 ? -34.230 51.422 -0.775  1.00 42.53  ? 264 THR A OG1   1 
ATOM   2042 C  CG2   . THR A 1  267 ? -33.897 53.122 -2.439  1.00 40.54  ? 264 THR A CG2   1 
ATOM   2043 N  N     . PRO A 1  268 ? -35.875 48.967 -2.672  1.00 40.72  ? 265 PRO A N     1 
ATOM   2044 C  CA    . PRO A 1  268 ? -36.351 47.734 -2.069  1.00 41.13  ? 265 PRO A CA    1 
ATOM   2045 C  C     . PRO A 1  268 ? -35.902 47.599 -0.599  1.00 41.35  ? 265 PRO A C     1 
ATOM   2046 O  O     . PRO A 1  268 ? -36.642 47.081 0.232   1.00 41.90  ? 265 PRO A O     1 
ATOM   2047 C  CB    . PRO A 1  268 ? -35.711 46.658 -2.956  1.00 41.15  ? 265 PRO A CB    1 
ATOM   2048 C  CG    . PRO A 1  268 ? -35.624 47.303 -4.265  1.00 40.56  ? 265 PRO A CG    1 
ATOM   2049 C  CD    . PRO A 1  268 ? -35.194 48.705 -3.946  1.00 40.58  ? 265 PRO A CD    1 
ATOM   2050 N  N     . HIS A 1  269 ? -34.715 48.087 -0.275  1.00 41.20  ? 266 HIS A N     1 
ATOM   2051 C  CA    . HIS A 1  269 ? -34.244 48.042 1.097   1.00 41.01  ? 266 HIS A CA    1 
ATOM   2052 C  C     . HIS A 1  269 ? -35.259 48.719 2.013   1.00 40.84  ? 266 HIS A C     1 
ATOM   2053 O  O     . HIS A 1  269 ? -35.735 48.124 2.988   1.00 40.80  ? 266 HIS A O     1 
ATOM   2054 C  CB    . HIS A 1  269 ? -32.896 48.729 1.215   1.00 41.12  ? 266 HIS A CB    1 
ATOM   2055 C  CG    . HIS A 1  269 ? -32.372 48.777 2.613   1.00 41.34  ? 266 HIS A CG    1 
ATOM   2056 N  ND1   . HIS A 1  269 ? -31.502 47.834 3.113   1.00 39.68  ? 266 HIS A ND1   1 
ATOM   2057 C  CD2   . HIS A 1  269 ? -32.595 49.657 3.617   1.00 41.02  ? 266 HIS A CD2   1 
ATOM   2058 C  CE1   . HIS A 1  269 ? -31.219 48.124 4.369   1.00 39.67  ? 266 HIS A CE1   1 
ATOM   2059 N  NE2   . HIS A 1  269 ? -31.864 49.228 4.698   1.00 40.30  ? 266 HIS A NE2   1 
ATOM   2060 N  N     . GLN A 1  270 ? -35.592 49.960 1.674   1.00 40.24  ? 267 GLN A N     1 
ATOM   2061 C  CA    . GLN A 1  270 ? -36.577 50.744 2.410   1.00 39.35  ? 267 GLN A CA    1 
ATOM   2062 C  C     . GLN A 1  270 ? -37.903 49.992 2.552   1.00 39.01  ? 267 GLN A C     1 
ATOM   2063 O  O     . GLN A 1  270 ? -38.445 49.867 3.645   1.00 39.14  ? 267 GLN A O     1 
ATOM   2064 C  CB    . GLN A 1  270 ? -36.730 52.112 1.753   1.00 39.19  ? 267 GLN A CB    1 
ATOM   2065 C  CG    . GLN A 1  270 ? -35.418 52.897 1.832   1.00 39.82  ? 267 GLN A CG    1 
ATOM   2066 C  CD    . GLN A 1  270 ? -35.297 54.071 0.892   1.00 41.00  ? 267 GLN A CD    1 
ATOM   2067 O  OE1   . GLN A 1  270 ? -36.144 54.298 0.031   1.00 43.34  ? 267 GLN A OE1   1 
ATOM   2068 N  NE2   . GLN A 1  270 ? -34.220 54.834 1.050   1.00 41.82  ? 267 GLN A NE2   1 
ATOM   2069 N  N     . LEU A 1  271 ? -38.385 49.407 1.472   1.00 38.63  ? 268 LEU A N     1 
ATOM   2070 C  CA    . LEU A 1  271 ? -39.612 48.637 1.554   1.00 38.19  ? 268 LEU A CA    1 
ATOM   2071 C  C     . LEU A 1  271 ? -39.474 47.463 2.531   1.00 38.73  ? 268 LEU A C     1 
ATOM   2072 O  O     . LEU A 1  271 ? -40.420 47.145 3.254   1.00 39.32  ? 268 LEU A O     1 
ATOM   2073 C  CB    . LEU A 1  271 ? -40.050 48.176 0.173   1.00 37.51  ? 268 LEU A CB    1 
ATOM   2074 C  CG    . LEU A 1  271 ? -40.481 49.349 -0.721  1.00 36.60  ? 268 LEU A CG    1 
ATOM   2075 C  CD1   . LEU A 1  271 ? -40.992 48.876 -2.054  1.00 35.21  ? 268 LEU A CD1   1 
ATOM   2076 C  CD2   . LEU A 1  271 ? -41.532 50.193 -0.042  1.00 34.45  ? 268 LEU A CD2   1 
ATOM   2077 N  N     . LEU A 1  272 ? -38.292 46.859 2.603   1.00 38.54  ? 269 LEU A N     1 
ATOM   2078 C  CA    . LEU A 1  272 ? -38.101 45.716 3.483   1.00 38.72  ? 269 LEU A CA    1 
ATOM   2079 C  C     . LEU A 1  272 ? -37.879 46.044 4.968   1.00 39.43  ? 269 LEU A C     1 
ATOM   2080 O  O     . LEU A 1  272 ? -38.276 45.261 5.842   1.00 39.58  ? 269 LEU A O     1 
ATOM   2081 C  CB    . LEU A 1  272 ? -36.944 44.859 2.995   1.00 38.30  ? 269 LEU A CB    1 
ATOM   2082 C  CG    . LEU A 1  272 ? -36.778 43.532 3.717   1.00 37.43  ? 269 LEU A CG    1 
ATOM   2083 C  CD1   . LEU A 1  272 ? -38.080 42.739 3.696   1.00 35.87  ? 269 LEU A CD1   1 
ATOM   2084 C  CD2   . LEU A 1  272 ? -35.666 42.754 3.070   1.00 35.07  ? 269 LEU A CD2   1 
ATOM   2085 N  N     . PHE A 1  273 ? -37.239 47.178 5.247   1.00 39.75  ? 270 PHE A N     1 
ATOM   2086 C  CA    . PHE A 1  273 ? -36.757 47.474 6.600   1.00 39.82  ? 270 PHE A CA    1 
ATOM   2087 C  C     . PHE A 1  273 ? -37.256 48.807 7.132   1.00 40.31  ? 270 PHE A C     1 
ATOM   2088 O  O     . PHE A 1  273 ? -37.110 49.079 8.329   1.00 40.61  ? 270 PHE A O     1 
ATOM   2089 C  CB    . PHE A 1  273 ? -35.232 47.541 6.652   1.00 39.61  ? 270 PHE A CB    1 
ATOM   2090 C  CG    . PHE A 1  273 ? -34.529 46.291 6.247   1.00 39.12  ? 270 PHE A CG    1 
ATOM   2091 C  CD1   . PHE A 1  273 ? -33.818 46.245 5.045   1.00 39.61  ? 270 PHE A CD1   1 
ATOM   2092 C  CD2   . PHE A 1  273 ? -34.502 45.190 7.087   1.00 38.38  ? 270 PHE A CD2   1 
ATOM   2093 C  CE1   . PHE A 1  273 ? -33.099 45.099 4.680   1.00 39.87  ? 270 PHE A CE1   1 
ATOM   2094 C  CE2   . PHE A 1  273 ? -33.802 44.023 6.732   1.00 38.15  ? 270 PHE A CE2   1 
ATOM   2095 C  CZ    . PHE A 1  273 ? -33.100 43.973 5.525   1.00 39.22  ? 270 PHE A CZ    1 
ATOM   2096 N  N     . GLY A 1  274 ? -37.799 49.654 6.257   1.00 40.35  ? 271 GLY A N     1 
ATOM   2097 C  CA    . GLY A 1  274 ? -38.287 50.969 6.672   1.00 40.69  ? 271 GLY A CA    1 
ATOM   2098 C  C     . GLY A 1  274 ? -37.190 51.928 7.101   1.00 40.92  ? 271 GLY A C     1 
ATOM   2099 O  O     . GLY A 1  274 ? -37.470 53.052 7.534   1.00 41.61  ? 271 GLY A O     1 
ATOM   2100 N  N     . ILE A 1  275 ? -35.940 51.496 6.993   1.00 40.71  ? 272 ILE A N     1 
ATOM   2101 C  CA    . ILE A 1  275 ? -34.819 52.387 7.274   1.00 41.08  ? 272 ILE A CA    1 
ATOM   2102 C  C     . ILE A 1  275 ? -33.545 51.990 6.519   1.00 41.07  ? 272 ILE A C     1 
ATOM   2103 O  O     . ILE A 1  275 ? -33.172 50.819 6.507   1.00 40.86  ? 272 ILE A O     1 
ATOM   2104 C  CB    . ILE A 1  275 ? -34.497 52.422 8.771   1.00 40.92  ? 272 ILE A CB    1 
ATOM   2105 C  CG1   . ILE A 1  275 ? -33.279 53.309 9.011   1.00 42.80  ? 272 ILE A CG1   1 
ATOM   2106 C  CG2   . ILE A 1  275 ? -34.207 51.041 9.276   1.00 39.97  ? 272 ILE A CG2   1 
ATOM   2107 C  CD1   . ILE A 1  275 ? -33.003 53.619 10.461  1.00 46.18  ? 272 ILE A CD1   1 
ATOM   2108 N  N     . ASP A 1  276 ? -32.853 52.968 5.933   1.00 41.11  ? 273 ASP A N     1 
ATOM   2109 C  CA    . ASP A 1  276 ? -31.579 52.685 5.261   1.00 41.25  ? 273 ASP A CA    1 
ATOM   2110 C  C     . ASP A 1  276 ? -30.524 52.176 6.227   1.00 40.88  ? 273 ASP A C     1 
ATOM   2111 O  O     . ASP A 1  276 ? -30.498 52.559 7.398   1.00 40.76  ? 273 ASP A O     1 
ATOM   2112 C  CB    . ASP A 1  276 ? -31.066 53.908 4.522   1.00 41.48  ? 273 ASP A CB    1 
ATOM   2113 C  CG    . ASP A 1  276 ? -31.757 54.116 3.171   1.00 43.69  ? 273 ASP A CG    1 
ATOM   2114 O  OD1   . ASP A 1  276 ? -32.454 53.184 2.705   1.00 45.27  ? 273 ASP A OD1   1 
ATOM   2115 O  OD2   . ASP A 1  276 ? -31.596 55.211 2.565   1.00 46.93  ? 273 ASP A OD2   1 
ATOM   2116 N  N     . SER A 1  277 ? -29.677 51.282 5.752   1.00 40.40  ? 274 SER A N     1 
ATOM   2117 C  CA    . SER A 1  277 ? -28.537 50.886 6.541   1.00 40.55  ? 274 SER A CA    1 
ATOM   2118 C  C     . SER A 1  277 ? -27.395 51.842 6.194   1.00 40.34  ? 274 SER A C     1 
ATOM   2119 O  O     . SER A 1  277 ? -27.627 52.889 5.581   1.00 40.56  ? 274 SER A O     1 
ATOM   2120 C  CB    . SER A 1  277 ? -28.187 49.418 6.297   1.00 40.62  ? 274 SER A CB    1 
ATOM   2121 O  OG    . SER A 1  277 ? -27.519 49.253 5.060   1.00 42.44  ? 274 SER A OG    1 
ATOM   2122 N  N     . ASN A 1  278 ? -26.172 51.506 6.582   1.00 40.00  ? 275 ASN A N     1 
ATOM   2123 C  CA    . ASN A 1  278 ? -25.056 52.438 6.434   1.00 40.16  ? 275 ASN A CA    1 
ATOM   2124 C  C     . ASN A 1  278 ? -24.465 52.335 5.022   1.00 40.68  ? 275 ASN A C     1 
ATOM   2125 O  O     . ASN A 1  278 ? -23.358 51.803 4.806   1.00 40.74  ? 275 ASN A O     1 
ATOM   2126 C  CB    . ASN A 1  278 ? -24.011 52.199 7.543   1.00 39.96  ? 275 ASN A CB    1 
ATOM   2127 C  CG    . ASN A 1  278 ? -22.734 53.038 7.373   1.00 39.19  ? 275 ASN A CG    1 
ATOM   2128 O  OD1   . ASN A 1  278 ? -22.783 54.189 6.929   1.00 36.86  ? 275 ASN A OD1   1 
ATOM   2129 N  ND2   . ASN A 1  278 ? -21.587 52.458 7.758   1.00 36.38  ? 275 ASN A ND2   1 
ATOM   2130 N  N     . THR A 1  279 ? -25.230 52.809 4.052   1.00 40.69  ? 276 THR A N     1 
ATOM   2131 C  CA    . THR A 1  279 ? -24.772 52.785 2.674   1.00 41.35  ? 276 THR A CA    1 
ATOM   2132 C  C     . THR A 1  279 ? -24.795 54.220 2.248   1.00 41.87  ? 276 THR A C     1 
ATOM   2133 O  O     . THR A 1  279 ? -25.406 55.036 2.926   1.00 42.90  ? 276 THR A O     1 
ATOM   2134 C  CB    . THR A 1  279 ? -25.671 51.924 1.768   1.00 41.19  ? 276 THR A CB    1 
ATOM   2135 O  OG1   . THR A 1  279 ? -27.032 52.319 1.931   1.00 40.56  ? 276 THR A OG1   1 
ATOM   2136 C  CG2   . THR A 1  279 ? -25.553 50.455 2.148   1.00 40.95  ? 276 THR A CG2   1 
ATOM   2137 N  N     . PRO A 1  280 ? -24.109 54.549 1.151   1.00 42.00  ? 277 PRO A N     1 
ATOM   2138 C  CA    . PRO A 1  280 ? -23.975 55.919 0.678   1.00 41.66  ? 277 PRO A CA    1 
ATOM   2139 C  C     . PRO A 1  280 ? -25.302 56.569 0.434   1.00 42.10  ? 277 PRO A C     1 
ATOM   2140 O  O     . PRO A 1  280 ? -26.226 55.917 -0.048  1.00 42.63  ? 277 PRO A O     1 
ATOM   2141 C  CB    . PRO A 1  280 ? -23.258 55.750 -0.651  1.00 41.46  ? 277 PRO A CB    1 
ATOM   2142 C  CG    . PRO A 1  280 ? -22.415 54.538 -0.444  1.00 42.15  ? 277 PRO A CG    1 
ATOM   2143 C  CD    . PRO A 1  280 ? -23.292 53.612 0.360   1.00 42.23  ? 277 PRO A CD    1 
ATOM   2144 N  N     . PHE A 1  281 ? -25.396 57.849 0.769   1.00 42.69  ? 278 PHE A N     1 
ATOM   2145 C  CA    . PHE A 1  281 ? -26.616 58.636 0.570   1.00 43.11  ? 278 PHE A CA    1 
ATOM   2146 C  C     . PHE A 1  281 ? -27.811 58.074 1.299   1.00 44.54  ? 278 PHE A C     1 
ATOM   2147 O  O     . PHE A 1  281 ? -28.930 58.126 0.767   1.00 45.35  ? 278 PHE A O     1 
ATOM   2148 C  CB    . PHE A 1  281 ? -26.944 58.792 -0.921  1.00 42.21  ? 278 PHE A CB    1 
ATOM   2149 C  CG    . PHE A 1  281 ? -25.929 59.574 -1.663  1.00 40.29  ? 278 PHE A CG    1 
ATOM   2150 C  CD1   . PHE A 1  281 ? -26.058 60.952 -1.792  1.00 38.35  ? 278 PHE A CD1   1 
ATOM   2151 C  CD2   . PHE A 1  281 ? -24.811 58.942 -2.198  1.00 38.57  ? 278 PHE A CD2   1 
ATOM   2152 C  CE1   . PHE A 1  281 ? -25.089 61.693 -2.442  1.00 37.99  ? 278 PHE A CE1   1 
ATOM   2153 C  CE2   . PHE A 1  281 ? -23.834 59.668 -2.868  1.00 38.68  ? 278 PHE A CE2   1 
ATOM   2154 C  CZ    . PHE A 1  281 ? -23.968 61.048 -2.986  1.00 38.18  ? 278 PHE A CZ    1 
ATOM   2155 N  N     . ALA A 1  282 ? -27.591 57.532 2.499   1.00 45.84  ? 279 ALA A N     1 
ATOM   2156 C  CA    . ALA A 1  282 ? -28.698 56.987 3.290   1.00 47.60  ? 279 ALA A CA    1 
ATOM   2157 C  C     . ALA A 1  282 ? -29.750 58.062 3.549   1.00 49.09  ? 279 ALA A C     1 
ATOM   2158 O  O     . ALA A 1  282 ? -29.419 59.234 3.795   1.00 49.86  ? 279 ALA A O     1 
ATOM   2159 C  CB    . ALA A 1  282 ? -28.204 56.406 4.591   1.00 47.00  ? 279 ALA A CB    1 
ATOM   2160 N  N     . ASN A 1  283 ? -31.015 57.683 3.466   1.00 50.43  ? 280 ASN A N     1 
ATOM   2161 C  CA    . ASN A 1  283 ? -32.072 58.622 3.772   1.00 52.11  ? 280 ASN A CA    1 
ATOM   2162 C  C     . ASN A 1  283 ? -32.195 58.800 5.286   1.00 53.65  ? 280 ASN A C     1 
ATOM   2163 O  O     . ASN A 1  283 ? -32.012 57.850 6.020   1.00 53.94  ? 280 ASN A O     1 
ATOM   2164 C  CB    . ASN A 1  283 ? -33.387 58.161 3.157   1.00 51.72  ? 280 ASN A CB    1 
ATOM   2165 C  CG    . ASN A 1  283 ? -34.553 59.043 3.561   1.00 51.17  ? 280 ASN A CG    1 
ATOM   2166 O  OD1   . ASN A 1  283 ? -35.129 58.862 4.621   1.00 51.80  ? 280 ASN A OD1   1 
ATOM   2167 N  ND2   . ASN A 1  283 ? -34.891 60.004 2.726   1.00 48.97  ? 280 ASN A ND2   1 
ATOM   2168 N  N     . GLN A 1  284 ? -32.514 60.011 5.741   1.00 55.73  ? 281 GLN A N     1 
ATOM   2169 C  CA    . GLN A 1  284 ? -32.496 60.348 7.177   1.00 57.91  ? 281 GLN A CA    1 
ATOM   2170 C  C     . GLN A 1  284 ? -33.819 60.871 7.709   1.00 58.50  ? 281 GLN A C     1 
ATOM   2171 O  O     . GLN A 1  284 ? -33.936 61.225 8.883   1.00 58.78  ? 281 GLN A O     1 
ATOM   2172 C  CB    . GLN A 1  284 ? -31.461 61.429 7.450   1.00 58.20  ? 281 GLN A CB    1 
ATOM   2173 C  CG    . GLN A 1  284 ? -30.164 61.254 6.717   1.00 61.63  ? 281 GLN A CG    1 
ATOM   2174 C  CD    . GLN A 1  284 ? -28.993 61.539 7.612   1.00 65.74  ? 281 GLN A CD    1 
ATOM   2175 O  OE1   . GLN A 1  284 ? -28.423 62.639 7.579   1.00 65.28  ? 281 GLN A OE1   1 
ATOM   2176 N  NE2   . GLN A 1  284 ? -28.639 60.553 8.457   1.00 67.32  ? 281 GLN A NE2   1 
ATOM   2177 N  N     . ASP A 1  285 ? -34.816 60.942 6.847   1.00 59.29  ? 282 ASP A N     1 
ATOM   2178 C  CA    . ASP A 1  285 ? -36.087 61.528 7.232   1.00 59.59  ? 282 ASP A CA    1 
ATOM   2179 C  C     . ASP A 1  285 ? -36.693 60.992 8.523   1.00 59.54  ? 282 ASP A C     1 
ATOM   2180 O  O     . ASP A 1  285 ? -37.420 61.722 9.168   1.00 60.61  ? 282 ASP A O     1 
ATOM   2181 C  CB    . ASP A 1  285 ? -37.099 61.423 6.092   1.00 59.69  ? 282 ASP A CB    1 
ATOM   2182 C  CG    . ASP A 1  285 ? -36.661 62.178 4.854   1.00 59.92  ? 282 ASP A CG    1 
ATOM   2183 O  OD1   . ASP A 1  285 ? -35.840 63.135 4.968   1.00 57.19  ? 282 ASP A OD1   1 
ATOM   2184 O  OD2   . ASP A 1  285 ? -37.161 61.787 3.774   1.00 60.20  ? 282 ASP A OD2   1 
ATOM   2185 N  N     . THR A 1  286 ? -36.400 59.757 8.917   1.00 59.01  ? 283 THR A N     1 
ATOM   2186 C  CA    . THR A 1  286 ? -37.015 59.201 10.119  1.00 58.73  ? 283 THR A CA    1 
ATOM   2187 C  C     . THR A 1  286 ? -36.078 59.158 11.323  1.00 59.17  ? 283 THR A C     1 
ATOM   2188 O  O     . THR A 1  286 ? -36.253 58.357 12.256  1.00 58.82  ? 283 THR A O     1 
ATOM   2189 C  CB    . THR A 1  286 ? -37.557 57.806 9.859   1.00 58.87  ? 283 THR A CB    1 
ATOM   2190 O  OG1   . THR A 1  286 ? -36.490 56.952 9.430   1.00 57.85  ? 283 THR A OG1   1 
ATOM   2191 C  CG2   . THR A 1  286 ? -38.632 57.863 8.795   1.00 58.84  ? 283 THR A CG2   1 
ATOM   2192 N  N     . LEU A 1  287 ? -35.088 60.040 11.321  1.00 59.72  ? 284 LEU A N     1 
ATOM   2193 C  CA    . LEU A 1  287 ? -34.068 59.998 12.355  1.00 60.42  ? 284 LEU A CA    1 
ATOM   2194 C  C     . LEU A 1  287 ? -34.662 60.248 13.733  1.00 60.63  ? 284 LEU A C     1 
ATOM   2195 O  O     . LEU A 1  287 ? -34.177 59.717 14.732  1.00 60.62  ? 284 LEU A O     1 
ATOM   2196 C  CB    . LEU A 1  287 ? -32.987 61.018 12.065  1.00 60.46  ? 284 LEU A CB    1 
ATOM   2197 C  CG    . LEU A 1  287 ? -31.570 60.468 12.134  1.00 62.40  ? 284 LEU A CG    1 
ATOM   2198 C  CD1   . LEU A 1  287 ? -31.422 59.130 11.350  1.00 64.53  ? 284 LEU A CD1   1 
ATOM   2199 C  CD2   . LEU A 1  287 ? -30.602 61.518 11.619  1.00 62.59  ? 284 LEU A CD2   1 
ATOM   2200 N  N     . ASP A 1  288 ? -35.727 61.049 13.774  1.00 60.80  ? 285 ASP A N     1 
ATOM   2201 C  CA    . ASP A 1  288 ? -36.335 61.452 15.042  1.00 60.54  ? 285 ASP A CA    1 
ATOM   2202 C  C     . ASP A 1  288 ? -37.563 60.642 15.456  1.00 59.84  ? 285 ASP A C     1 
ATOM   2203 O  O     . ASP A 1  288 ? -38.148 60.910 16.499  1.00 60.17  ? 285 ASP A O     1 
ATOM   2204 C  CB    . ASP A 1  288 ? -36.586 62.969 15.071  1.00 60.43  ? 285 ASP A CB    1 
ATOM   2205 C  CG    . ASP A 1  288 ? -35.279 63.767 15.206  1.00 62.54  ? 285 ASP A CG    1 
ATOM   2206 O  OD1   . ASP A 1  288 ? -34.370 63.317 15.961  1.00 65.73  ? 285 ASP A OD1   1 
ATOM   2207 O  OD2   . ASP A 1  288 ? -35.138 64.824 14.552  1.00 61.97  ? 285 ASP A OD2   1 
ATOM   2208 N  N     . LEU A 1  289 ? -37.922 59.628 14.670  1.00 58.66  ? 286 LEU A N     1 
ATOM   2209 C  CA    . LEU A 1  289 ? -39.019 58.746 15.044  1.00 57.61  ? 286 LEU A CA    1 
ATOM   2210 C  C     . LEU A 1  289 ? -38.468 57.589 15.836  1.00 56.98  ? 286 LEU A C     1 
ATOM   2211 O  O     . LEU A 1  289 ? -37.304 57.255 15.720  1.00 56.79  ? 286 LEU A O     1 
ATOM   2212 C  CB    . LEU A 1  289 ? -39.758 58.197 13.824  1.00 57.64  ? 286 LEU A CB    1 
ATOM   2213 C  CG    . LEU A 1  289 ? -40.297 59.100 12.720  1.00 57.78  ? 286 LEU A CG    1 
ATOM   2214 C  CD1   . LEU A 1  289 ? -41.297 58.293 11.920  1.00 57.46  ? 286 LEU A CD1   1 
ATOM   2215 C  CD2   . LEU A 1  289 ? -40.943 60.356 13.281  1.00 57.76  ? 286 LEU A CD2   1 
ATOM   2216 N  N     . THR A 1  290 ? -39.307 56.964 16.644  1.00 56.51  ? 287 THR A N     1 
ATOM   2217 C  CA    . THR A 1  290 ? -38.886 55.756 17.326  1.00 56.44  ? 287 THR A CA    1 
ATOM   2218 C  C     . THR A 1  290 ? -38.964 54.634 16.288  1.00 56.03  ? 287 THR A C     1 
ATOM   2219 O  O     . THR A 1  290 ? -39.518 54.823 15.204  1.00 55.74  ? 287 THR A O     1 
ATOM   2220 C  CB    . THR A 1  290 ? -39.755 55.468 18.578  1.00 56.59  ? 287 THR A CB    1 
ATOM   2221 O  OG1   . THR A 1  290 ? -41.080 55.080 18.179  1.00 57.67  ? 287 THR A OG1   1 
ATOM   2222 C  CG2   . THR A 1  290 ? -39.844 56.708 19.465  1.00 56.24  ? 287 THR A CG2   1 
ATOM   2223 N  N     . ARG A 1  291 ? -38.397 53.480 16.587  1.00 55.40  ? 288 ARG A N     1 
ATOM   2224 C  CA    . ARG A 1  291 ? -38.478 52.420 15.631  1.00 55.57  ? 288 ARG A CA    1 
ATOM   2225 C  C     . ARG A 1  291 ? -39.949 52.095 15.425  1.00 56.59  ? 288 ARG A C     1 
ATOM   2226 O  O     . ARG A 1  291 ? -40.389 51.788 14.308  1.00 56.83  ? 288 ARG A O     1 
ATOM   2227 C  CB    . ARG A 1  291 ? -37.697 51.196 16.102  1.00 55.24  ? 288 ARG A CB    1 
ATOM   2228 C  CG    . ARG A 1  291 ? -37.819 49.967 15.196  1.00 53.51  ? 288 ARG A CG    1 
ATOM   2229 C  CD    . ARG A 1  291 ? -37.528 50.281 13.726  1.00 49.94  ? 288 ARG A CD    1 
ATOM   2230 N  NE    . ARG A 1  291 ? -37.383 49.051 12.954  1.00 48.95  ? 288 ARG A NE    1 
ATOM   2231 C  CZ    . ARG A 1  291 ? -37.175 49.010 11.644  1.00 48.29  ? 288 ARG A CZ    1 
ATOM   2232 N  NH1   . ARG A 1  291 ? -37.100 50.133 10.951  1.00 47.93  ? 288 ARG A NH1   1 
ATOM   2233 N  NH2   . ARG A 1  291 ? -37.065 47.841 11.024  1.00 47.86  ? 288 ARG A NH2   1 
ATOM   2234 N  N     . GLU A 1  292 ? -40.715 52.175 16.507  1.00 57.37  ? 289 GLU A N     1 
ATOM   2235 C  CA    . GLU A 1  292 ? -42.115 51.815 16.445  1.00 58.00  ? 289 GLU A CA    1 
ATOM   2236 C  C     . GLU A 1  292 ? -42.866 52.855 15.636  1.00 57.08  ? 289 GLU A C     1 
ATOM   2237 O  O     . GLU A 1  292 ? -43.722 52.507 14.830  1.00 57.54  ? 289 GLU A O     1 
ATOM   2238 C  CB    . GLU A 1  292 ? -42.698 51.655 17.842  1.00 59.02  ? 289 GLU A CB    1 
ATOM   2239 C  CG    . GLU A 1  292 ? -43.751 50.560 17.943  1.00 63.62  ? 289 GLU A CG    1 
ATOM   2240 C  CD    . GLU A 1  292 ? -44.205 50.333 19.383  1.00 69.39  ? 289 GLU A CD    1 
ATOM   2241 O  OE1   . GLU A 1  292 ? -43.592 49.475 20.092  1.00 69.69  ? 289 GLU A OE1   1 
ATOM   2242 O  OE2   . GLU A 1  292 ? -45.181 51.024 19.785  1.00 70.83  ? 289 GLU A OE2   1 
ATOM   2243 N  N     . GLU A 1  293 ? -42.530 54.124 15.813  1.00 55.96  ? 290 GLU A N     1 
ATOM   2244 C  CA    . GLU A 1  293 ? -43.103 55.148 14.957  1.00 55.46  ? 290 GLU A CA    1 
ATOM   2245 C  C     . GLU A 1  293 ? -42.721 54.887 13.493  1.00 54.62  ? 290 GLU A C     1 
ATOM   2246 O  O     . GLU A 1  293 ? -43.524 55.068 12.580  1.00 54.24  ? 290 GLU A O     1 
ATOM   2247 C  CB    . GLU A 1  293 ? -42.688 56.545 15.424  1.00 55.65  ? 290 GLU A CB    1 
ATOM   2248 C  CG    . GLU A 1  293 ? -43.466 57.027 16.648  1.00 57.18  ? 290 GLU A CG    1 
ATOM   2249 C  CD    . GLU A 1  293 ? -42.771 58.160 17.431  1.00 61.04  ? 290 GLU A CD    1 
ATOM   2250 O  OE1   . GLU A 1  293 ? -41.670 58.614 17.051  1.00 63.03  ? 290 GLU A OE1   1 
ATOM   2251 O  OE2   . GLU A 1  293 ? -43.332 58.612 18.450  1.00 62.49  ? 290 GLU A OE2   1 
ATOM   2252 N  N     . GLU A 1  294 ? -41.498 54.414 13.292  1.00 54.05  ? 291 GLU A N     1 
ATOM   2253 C  CA    . GLU A 1  294 ? -40.950 54.159 11.964  1.00 53.05  ? 291 GLU A CA    1 
ATOM   2254 C  C     . GLU A 1  294 ? -41.655 53.015 11.245  1.00 52.85  ? 291 GLU A C     1 
ATOM   2255 O  O     . GLU A 1  294 ? -41.965 53.127 10.061  1.00 52.89  ? 291 GLU A O     1 
ATOM   2256 C  CB    . GLU A 1  294 ? -39.481 53.824 12.101  1.00 52.90  ? 291 GLU A CB    1 
ATOM   2257 C  CG    . GLU A 1  294 ? -38.605 54.315 10.990  1.00 52.07  ? 291 GLU A CG    1 
ATOM   2258 C  CD    . GLU A 1  294 ? -37.150 54.104 11.313  1.00 50.74  ? 291 GLU A CD    1 
ATOM   2259 O  OE1   . GLU A 1  294 ? -36.809 52.987 11.749  1.00 48.09  ? 291 GLU A OE1   1 
ATOM   2260 O  OE2   . GLU A 1  294 ? -36.357 55.057 11.152  1.00 51.64  ? 291 GLU A OE2   1 
ATOM   2261 N  N     . LEU A 1  295 ? -41.901 51.922 11.966  1.00 52.42  ? 292 LEU A N     1 
ATOM   2262 C  CA    . LEU A 1  295 ? -42.593 50.753 11.428  1.00 52.28  ? 292 LEU A CA    1 
ATOM   2263 C  C     . LEU A 1  295 ? -44.034 51.066 11.103  1.00 52.52  ? 292 LEU A C     1 
ATOM   2264 O  O     . LEU A 1  295 ? -44.682 50.400 10.294  1.00 52.93  ? 292 LEU A O     1 
ATOM   2265 C  CB    . LEU A 1  295 ? -42.554 49.601 12.430  1.00 51.95  ? 292 LEU A CB    1 
ATOM   2266 C  CG    . LEU A 1  295 ? -41.205 48.908 12.566  1.00 51.75  ? 292 LEU A CG    1 
ATOM   2267 C  CD1   . LEU A 1  295 ? -41.294 47.715 13.487  1.00 51.87  ? 292 LEU A CD1   1 
ATOM   2268 C  CD2   . LEU A 1  295 ? -40.707 48.477 11.207  1.00 50.66  ? 292 LEU A CD2   1 
ATOM   2269 N  N     . SER A 1  296 ? -44.534 52.089 11.760  1.00 52.72  ? 293 SER A N     1 
ATOM   2270 C  CA    . SER A 1  296 ? -45.897 52.492 11.605  1.00 53.11  ? 293 SER A CA    1 
ATOM   2271 C  C     . SER A 1  296 ? -46.006 53.264 10.291  1.00 53.19  ? 293 SER A C     1 
ATOM   2272 O  O     . SER A 1  296 ? -46.947 53.061 9.521   1.00 53.15  ? 293 SER A O     1 
ATOM   2273 C  CB    . SER A 1  296 ? -46.290 53.347 12.816  1.00 53.26  ? 293 SER A CB    1 
ATOM   2274 O  OG    . SER A 1  296 ? -47.668 53.612 12.839  1.00 53.50  ? 293 SER A OG    1 
ATOM   2275 N  N     . LEU A 1  297 ? -45.033 54.137 10.031  1.00 53.53  ? 294 LEU A N     1 
ATOM   2276 C  CA    . LEU A 1  297 ? -44.965 54.840 8.755   1.00 54.04  ? 294 LEU A CA    1 
ATOM   2277 C  C     . LEU A 1  297 ? -44.656 53.873 7.599   1.00 54.53  ? 294 LEU A C     1 
ATOM   2278 O  O     . LEU A 1  297 ? -45.179 54.044 6.503   1.00 55.12  ? 294 LEU A O     1 
ATOM   2279 C  CB    . LEU A 1  297 ? -43.937 55.946 8.817   1.00 54.10  ? 294 LEU A CB    1 
ATOM   2280 C  CG    . LEU A 1  297 ? -43.663 56.721 7.533   1.00 54.87  ? 294 LEU A CG    1 
ATOM   2281 C  CD1   . LEU A 1  297 ? -44.926 57.429 7.026   1.00 56.62  ? 294 LEU A CD1   1 
ATOM   2282 C  CD2   . LEU A 1  297 ? -42.523 57.712 7.770   1.00 54.06  ? 294 LEU A CD2   1 
ATOM   2283 N  N     . LEU A 1  298 ? -43.846 52.846 7.856   1.00 54.45  ? 295 LEU A N     1 
ATOM   2284 C  CA    . LEU A 1  298 ? -43.617 51.778 6.893   1.00 54.57  ? 295 LEU A CA    1 
ATOM   2285 C  C     . LEU A 1  298 ? -44.881 51.022 6.495   1.00 55.60  ? 295 LEU A C     1 
ATOM   2286 O  O     . LEU A 1  298 ? -45.108 50.802 5.304   1.00 55.78  ? 295 LEU A O     1 
ATOM   2287 C  CB    . LEU A 1  298 ? -42.570 50.795 7.408   1.00 54.17  ? 295 LEU A CB    1 
ATOM   2288 C  CG    . LEU A 1  298 ? -42.262 49.563 6.553   1.00 52.97  ? 295 LEU A CG    1 
ATOM   2289 C  CD1   . LEU A 1  298 ? -41.557 49.999 5.301   1.00 52.60  ? 295 LEU A CD1   1 
ATOM   2290 C  CD2   . LEU A 1  298 ? -41.428 48.538 7.328   1.00 51.49  ? 295 LEU A CD2   1 
ATOM   2291 N  N     . GLN A 1  299 ? -45.689 50.604 7.470   1.00 56.69  ? 296 GLN A N     1 
ATOM   2292 C  CA    . GLN A 1  299 ? -46.938 49.887 7.161   1.00 58.21  ? 296 GLN A CA    1 
ATOM   2293 C  C     . GLN A 1  299 ? -47.816 50.708 6.242   1.00 57.56  ? 296 GLN A C     1 
ATOM   2294 O  O     . GLN A 1  299 ? -48.426 50.176 5.331   1.00 57.43  ? 296 GLN A O     1 
ATOM   2295 C  CB    . GLN A 1  299 ? -47.707 49.500 8.423   1.00 58.70  ? 296 GLN A CB    1 
ATOM   2296 C  CG    . GLN A 1  299 ? -46.994 48.414 9.247   1.00 64.42  ? 296 GLN A CG    1 
ATOM   2297 C  CD    . GLN A 1  299 ? -47.566 48.260 10.670  1.00 70.92  ? 296 GLN A CD    1 
ATOM   2298 O  OE1   . GLN A 1  299 ? -46.898 48.581 11.674  1.00 71.77  ? 296 GLN A OE1   1 
ATOM   2299 N  NE2   . GLN A 1  299 ? -48.817 47.778 10.756  1.00 72.42  ? 296 GLN A NE2   1 
ATOM   2300 N  N     . GLU A 1  300 ? -47.827 52.012 6.471   1.00 57.55  ? 297 GLU A N     1 
ATOM   2301 C  CA    . GLU A 1  300 ? -48.605 52.941 5.672   1.00 58.07  ? 297 GLU A CA    1 
ATOM   2302 C  C     . GLU A 1  300 ? -48.014 53.133 4.267   1.00 56.85  ? 297 GLU A C     1 
ATOM   2303 O  O     . GLU A 1  300 ? -48.742 53.180 3.290   1.00 56.79  ? 297 GLU A O     1 
ATOM   2304 C  CB    . GLU A 1  300 ? -48.751 54.281 6.430   1.00 58.98  ? 297 GLU A CB    1 
ATOM   2305 C  CG    . GLU A 1  300 ? -49.647 55.346 5.764   1.00 63.65  ? 297 GLU A CG    1 
ATOM   2306 C  CD    . GLU A 1  300 ? -51.090 54.856 5.466   1.00 71.11  ? 297 GLU A CD    1 
ATOM   2307 O  OE1   . GLU A 1  300 ? -51.584 53.904 6.147   1.00 72.45  ? 297 GLU A OE1   1 
ATOM   2308 O  OE2   . GLU A 1  300 ? -51.724 55.432 4.536   1.00 73.27  ? 297 GLU A OE2   1 
ATOM   2309 N  N     . ILE A 1  301 ? -46.696 53.244 4.171   1.00 55.73  ? 298 ILE A N     1 
ATOM   2310 C  CA    . ILE A 1  301 ? -46.026 53.336 2.881   1.00 54.53  ? 298 ILE A CA    1 
ATOM   2311 C  C     . ILE A 1  301 ? -46.247 52.075 2.072   1.00 53.85  ? 298 ILE A C     1 
ATOM   2312 O  O     . ILE A 1  301 ? -46.481 52.145 0.871   1.00 54.33  ? 298 ILE A O     1 
ATOM   2313 C  CB    . ILE A 1  301 ? -44.516 53.579 3.042   1.00 54.82  ? 298 ILE A CB    1 
ATOM   2314 C  CG1   . ILE A 1  301 ? -44.248 55.066 3.250   1.00 54.24  ? 298 ILE A CG1   1 
ATOM   2315 C  CG2   . ILE A 1  301 ? -43.709 53.055 1.830   1.00 53.99  ? 298 ILE A CG2   1 
ATOM   2316 C  CD1   . ILE A 1  301 ? -42.926 55.313 3.996   1.00 56.35  ? 298 ILE A CD1   1 
ATOM   2317 N  N     . ARG A 1  302 ? -46.187 50.927 2.730   1.00 52.72  ? 299 ARG A N     1 
ATOM   2318 C  CA    . ARG A 1  302 ? -46.403 49.655 2.055   1.00 51.76  ? 299 ARG A CA    1 
ATOM   2319 C  C     . ARG A 1  302 ? -47.789 49.518 1.418   1.00 52.11  ? 299 ARG A C     1 
ATOM   2320 O  O     . ARG A 1  302 ? -47.931 48.899 0.363   1.00 52.58  ? 299 ARG A O     1 
ATOM   2321 C  CB    . ARG A 1  302 ? -46.137 48.488 3.006   1.00 51.08  ? 299 ARG A CB    1 
ATOM   2322 C  CG    . ARG A 1  302 ? -44.681 48.192 3.220   1.00 49.06  ? 299 ARG A CG    1 
ATOM   2323 C  CD    . ARG A 1  302 ? -44.465 47.118 4.270   1.00 47.74  ? 299 ARG A CD    1 
ATOM   2324 N  NE    . ARG A 1  302 ? -43.045 46.824 4.439   1.00 46.25  ? 299 ARG A NE    1 
ATOM   2325 C  CZ    . ARG A 1  302 ? -42.519 46.115 5.434   1.00 46.52  ? 299 ARG A CZ    1 
ATOM   2326 N  NH1   . ARG A 1  302 ? -43.283 45.623 6.409   1.00 45.34  ? 299 ARG A NH1   1 
ATOM   2327 N  NH2   . ARG A 1  302 ? -41.205 45.917 5.463   1.00 46.16  ? 299 ARG A NH2   1 
ATOM   2328 N  N     . THR A 1  303 ? -48.823 50.069 2.041   1.00 52.22  ? 300 THR A N     1 
ATOM   2329 C  CA    . THR A 1  303 ? -50.161 49.842 1.494   1.00 52.45  ? 300 THR A CA    1 
ATOM   2330 C  C     . THR A 1  303 ? -50.502 50.800 0.380   1.00 52.37  ? 300 THR A C     1 
ATOM   2331 O  O     . THR A 1  303 ? -51.272 50.443 -0.500  1.00 52.90  ? 300 THR A O     1 
ATOM   2332 C  CB    . THR A 1  303 ? -51.266 49.861 2.546   1.00 52.38  ? 300 THR A CB    1 
ATOM   2333 O  OG1   . THR A 1  303 ? -51.188 51.076 3.298   1.00 52.77  ? 300 THR A OG1   1 
ATOM   2334 C  CG2   . THR A 1  303 ? -51.129 48.660 3.471   1.00 53.20  ? 300 THR A CG2   1 
ATOM   2335 N  N     . SER A 1  304 ? -49.900 51.987 0.396   1.00 51.74  ? 301 SER A N     1 
ATOM   2336 C  CA    . SER A 1  304 ? -50.225 53.033 -0.566  1.00 51.52  ? 301 SER A CA    1 
ATOM   2337 C  C     . SER A 1  304 ? -49.376 53.036 -1.848  1.00 51.16  ? 301 SER A C     1 
ATOM   2338 O  O     . SER A 1  304 ? -49.372 54.027 -2.565  1.00 50.54  ? 301 SER A O     1 
ATOM   2339 C  CB    . SER A 1  304 ? -50.047 54.374 0.107   1.00 51.44  ? 301 SER A CB    1 
ATOM   2340 O  OG    . SER A 1  304 ? -48.670 54.527 0.375   1.00 52.86  ? 301 SER A OG    1 
ATOM   2341 N  N     . LEU A 1  305 ? -48.650 51.955 -2.137  1.00 51.23  ? 302 LEU A N     1 
ATOM   2342 C  CA    . LEU A 1  305 ? -47.791 51.927 -3.336  1.00 50.78  ? 302 LEU A CA    1 
ATOM   2343 C  C     . LEU A 1  305 ? -48.625 51.898 -4.610  1.00 51.75  ? 302 LEU A C     1 
ATOM   2344 O  O     . LEU A 1  305 ? -49.695 51.265 -4.661  1.00 52.19  ? 302 LEU A O     1 
ATOM   2345 C  CB    . LEU A 1  305 ? -46.837 50.733 -3.317  1.00 50.01  ? 302 LEU A CB    1 
ATOM   2346 C  CG    . LEU A 1  305 ? -45.756 50.638 -2.233  1.00 47.21  ? 302 LEU A CG    1 
ATOM   2347 C  CD1   . LEU A 1  305 ? -44.974 49.384 -2.416  1.00 45.51  ? 302 LEU A CD1   1 
ATOM   2348 C  CD2   . LEU A 1  305 ? -44.815 51.800 -2.243  1.00 42.41  ? 302 LEU A CD2   1 
ATOM   2349 N  N     . TYR A 1  306 ? -48.144 52.614 -5.617  1.00 52.19  ? 303 TYR A N     1 
ATOM   2350 C  CA    . TYR A 1  306 ? -48.740 52.636 -6.934  1.00 52.74  ? 303 TYR A CA    1 
ATOM   2351 C  C     . TYR A 1  306 ? -48.961 51.241 -7.501  1.00 53.12  ? 303 TYR A C     1 
ATOM   2352 O  O     . TYR A 1  306 ? -48.060 50.401 -7.508  1.00 53.99  ? 303 TYR A O     1 
ATOM   2353 C  CB    . TYR A 1  306 ? -47.805 53.359 -7.881  1.00 52.94  ? 303 TYR A CB    1 
ATOM   2354 C  CG    . TYR A 1  306 ? -48.168 53.142 -9.325  1.00 55.16  ? 303 TYR A CG    1 
ATOM   2355 C  CD1   . TYR A 1  306 ? -49.163 53.928 -9.935  1.00 58.03  ? 303 TYR A CD1   1 
ATOM   2356 C  CD2   . TYR A 1  306 ? -47.543 52.159 -10.083 1.00 55.15  ? 303 TYR A CD2   1 
ATOM   2357 C  CE1   . TYR A 1  306 ? -49.522 53.744 -11.267 1.00 58.38  ? 303 TYR A CE1   1 
ATOM   2358 C  CE2   . TYR A 1  306 ? -47.894 51.961 -11.412 1.00 57.00  ? 303 TYR A CE2   1 
ATOM   2359 C  CZ    . TYR A 1  306 ? -48.890 52.756 -12.002 1.00 58.82  ? 303 TYR A CZ    1 
ATOM   2360 O  OH    . TYR A 1  306 ? -49.261 52.573 -13.331 1.00 60.61  ? 303 TYR A OH    1 
ATOM   2361 N  N     . HIS A 1  307 ? -50.145 51.002 -8.028  1.00 53.31  ? 304 HIS A N     1 
ATOM   2362 C  CA    . HIS A 1  307 ? -50.389 49.747 -8.700  1.00 53.82  ? 304 HIS A CA    1 
ATOM   2363 C  C     . HIS A 1  307 ? -51.020 49.939 -10.076 1.00 53.30  ? 304 HIS A C     1 
ATOM   2364 O  O     . HIS A 1  307 ? -52.059 50.567 -10.189 1.00 53.24  ? 304 HIS A O     1 
ATOM   2365 C  CB    . HIS A 1  307 ? -51.255 48.820 -7.847  1.00 54.56  ? 304 HIS A CB    1 
ATOM   2366 C  CG    . HIS A 1  307 ? -51.260 47.416 -8.353  1.00 57.10  ? 304 HIS A CG    1 
ATOM   2367 N  ND1   . HIS A 1  307 ? -52.246 46.934 -9.190  1.00 58.63  ? 304 HIS A ND1   1 
ATOM   2368 C  CD2   . HIS A 1  307 ? -50.355 46.415 -8.212  1.00 57.77  ? 304 HIS A CD2   1 
ATOM   2369 C  CE1   . HIS A 1  307 ? -51.967 45.682 -9.509  1.00 59.06  ? 304 HIS A CE1   1 
ATOM   2370 N  NE2   . HIS A 1  307 ? -50.827 45.343 -8.927  1.00 58.35  ? 304 HIS A NE2   1 
ATOM   2371 N  N     . PRO A 1  308 ? -50.397 49.381 -11.125 1.00 53.08  ? 305 PRO A N     1 
ATOM   2372 C  CA    . PRO A 1  308 ? -50.877 49.588 -12.500 1.00 53.34  ? 305 PRO A CA    1 
ATOM   2373 C  C     . PRO A 1  308 ? -52.178 48.836 -12.806 1.00 54.22  ? 305 PRO A C     1 
ATOM   2374 O  O     . PRO A 1  308 ? -52.515 47.838 -12.140 1.00 54.04  ? 305 PRO A O     1 
ATOM   2375 C  CB    . PRO A 1  308 ? -49.743 49.008 -13.350 1.00 52.81  ? 305 PRO A CB    1 
ATOM   2376 C  CG    . PRO A 1  308 ? -49.149 47.953 -12.490 1.00 52.75  ? 305 PRO A CG    1 
ATOM   2377 C  CD    . PRO A 1  308 ? -49.254 48.449 -11.069 1.00 52.43  ? 305 PRO A CD    1 
ATOM   2378 N  N     . SER A 1  309 ? -52.905 49.294 -13.818 1.00 55.26  ? 306 SER A N     1 
ATOM   2379 C  CA    . SER A 1  309 ? -54.094 48.549 -14.241 1.00 56.52  ? 306 SER A CA    1 
ATOM   2380 C  C     . SER A 1  309 ? -53.924 47.872 -15.600 1.00 56.67  ? 306 SER A C     1 
ATOM   2381 O  O     . SER A 1  309 ? -53.101 48.293 -16.424 1.00 56.87  ? 306 SER A O     1 
ATOM   2382 C  CB    . SER A 1  309 ? -55.365 49.418 -14.204 1.00 56.97  ? 306 SER A CB    1 
ATOM   2383 O  OG    . SER A 1  309 ? -55.106 50.730 -14.686 1.00 58.93  ? 306 SER A OG    1 
ATOM   2384 N  N     . THR A 1  310 ? -54.688 46.792 -15.786 1.00 56.56  ? 307 THR A N     1 
ATOM   2385 C  CA    . THR A 1  310 ? -54.896 46.125 -17.066 1.00 55.96  ? 307 THR A CA    1 
ATOM   2386 C  C     . THR A 1  310 ? -55.077 47.167 -18.216 1.00 55.11  ? 307 THR A C     1 
ATOM   2387 O  O     . THR A 1  310 ? -55.948 48.028 -18.149 1.00 54.96  ? 307 THR A O     1 
ATOM   2388 C  CB    . THR A 1  310 ? -56.103 45.130 -16.934 1.00 56.23  ? 307 THR A CB    1 
ATOM   2389 O  OG1   . THR A 1  310 ? -56.105 44.198 -18.019 1.00 57.12  ? 307 THR A OG1   1 
ATOM   2390 C  CG2   . THR A 1  310 ? -57.482 45.875 -16.865 1.00 57.25  ? 307 THR A CG2   1 
ATOM   2391 N  N     . PRO A 1  311 ? -54.212 47.113 -19.245 1.00 54.56  ? 308 PRO A N     1 
ATOM   2392 C  CA    . PRO A 1  311 ? -54.248 48.067 -20.356 1.00 53.95  ? 308 PRO A CA    1 
ATOM   2393 C  C     . PRO A 1  311 ? -55.429 47.820 -21.281 1.00 53.60  ? 308 PRO A C     1 
ATOM   2394 O  O     . PRO A 1  311 ? -56.081 46.786 -21.171 1.00 53.38  ? 308 PRO A O     1 
ATOM   2395 C  CB    . PRO A 1  311 ? -52.938 47.779 -21.108 1.00 53.72  ? 308 PRO A CB    1 
ATOM   2396 C  CG    . PRO A 1  311 ? -52.635 46.373 -20.816 1.00 54.11  ? 308 PRO A CG    1 
ATOM   2397 C  CD    . PRO A 1  311 ? -53.145 46.102 -19.421 1.00 54.44  ? 308 PRO A CD    1 
ATOM   2398 N  N     . PRO A 1  312 ? -55.707 48.756 -22.206 1.00 53.54  ? 309 PRO A N     1 
ATOM   2399 C  CA    . PRO A 1  312 ? -56.822 48.478 -23.118 1.00 53.44  ? 309 PRO A CA    1 
ATOM   2400 C  C     . PRO A 1  312 ? -56.516 47.303 -24.059 1.00 53.16  ? 309 PRO A C     1 
ATOM   2401 O  O     . PRO A 1  312 ? -55.374 47.145 -24.508 1.00 52.77  ? 309 PRO A O     1 
ATOM   2402 C  CB    . PRO A 1  312 ? -56.967 49.787 -23.920 1.00 53.53  ? 309 PRO A CB    1 
ATOM   2403 C  CG    . PRO A 1  312 ? -56.076 50.788 -23.237 1.00 53.45  ? 309 PRO A CG    1 
ATOM   2404 C  CD    . PRO A 1  312 ? -55.003 49.996 -22.570 1.00 53.20  ? 309 PRO A CD    1 
ATOM   2405 N  N     . ALA A 1  313 ? -57.535 46.478 -24.319 1.00 52.81  ? 310 ALA A N     1 
ATOM   2406 C  CA    . ALA A 1  313 ? -57.473 45.396 -25.307 1.00 52.02  ? 310 ALA A CA    1 
ATOM   2407 C  C     . ALA A 1  313 ? -57.069 45.958 -26.670 1.00 51.94  ? 310 ALA A C     1 
ATOM   2408 O  O     . ALA A 1  313 ? -57.382 47.110 -26.974 1.00 52.17  ? 310 ALA A O     1 
ATOM   2409 C  CB    . ALA A 1  313 ? -58.822 44.730 -25.409 1.00 51.78  ? 310 ALA A CB    1 
ATOM   2410 N  N     . SER A 1  314 ? -56.372 45.176 -27.493 1.00 51.11  ? 311 SER A N     1 
ATOM   2411 C  CA    . SER A 1  314 ? -56.107 45.643 -28.839 1.00 50.81  ? 311 SER A CA    1 
ATOM   2412 C  C     . SER A 1  314 ? -57.387 45.463 -29.673 1.00 50.94  ? 311 SER A C     1 
ATOM   2413 O  O     . SER A 1  314 ? -58.277 44.699 -29.273 1.00 51.21  ? 311 SER A O     1 
ATOM   2414 C  CB    . SER A 1  314 ? -54.916 44.921 -29.439 1.00 50.57  ? 311 SER A CB    1 
ATOM   2415 O  OG    . SER A 1  314 ? -55.232 43.577 -29.672 1.00 50.41  ? 311 SER A OG    1 
ATOM   2416 N  N     . SER A 1  315 ? -57.497 46.152 -30.816 1.00 50.56  ? 312 SER A N     1 
ATOM   2417 C  CA    . SER A 1  315 ? -58.761 46.135 -31.585 1.00 50.34  ? 312 SER A CA    1 
ATOM   2418 C  C     . SER A 1  315 ? -59.230 44.752 -32.064 1.00 49.66  ? 312 SER A C     1 
ATOM   2419 O  O     . SER A 1  315 ? -60.393 44.581 -32.370 1.00 49.07  ? 312 SER A O     1 
ATOM   2420 C  CB    . SER A 1  315 ? -58.760 47.147 -32.745 1.00 50.81  ? 312 SER A CB    1 
ATOM   2421 O  OG    . SER A 1  315 ? -57.484 47.268 -33.337 1.00 51.75  ? 312 SER A OG    1 
ATOM   2422 N  N     . ARG A 1  316 ? -58.338 43.762 -32.087 1.00 49.19  ? 313 ARG A N     1 
ATOM   2423 C  CA    . ARG A 1  316 ? -58.722 42.433 -32.523 1.00 48.34  ? 313 ARG A CA    1 
ATOM   2424 C  C     . ARG A 1  316 ? -58.210 41.296 -31.649 1.00 48.62  ? 313 ARG A C     1 
ATOM   2425 O  O     . ARG A 1  316 ? -57.598 40.355 -32.143 1.00 48.68  ? 313 ARG A O     1 
ATOM   2426 C  CB    . ARG A 1  316 ? -58.288 42.238 -33.962 1.00 48.21  ? 313 ARG A CB    1 
ATOM   2427 C  CG    . ARG A 1  316 ? -58.944 43.221 -34.917 1.00 47.12  ? 313 ARG A CG    1 
ATOM   2428 C  CD    . ARG A 1  316 ? -58.750 42.774 -36.323 1.00 45.25  ? 313 ARG A CD    1 
ATOM   2429 N  NE    . ARG A 1  316 ? -59.141 43.785 -37.294 1.00 45.17  ? 313 ARG A NE    1 
ATOM   2430 C  CZ    . ARG A 1  316 ? -58.879 43.713 -38.596 1.00 45.16  ? 313 ARG A CZ    1 
ATOM   2431 N  NH1   . ARG A 1  316 ? -58.201 42.674 -39.100 1.00 44.36  ? 313 ARG A NH1   1 
ATOM   2432 N  NH2   . ARG A 1  316 ? -59.290 44.691 -39.394 1.00 44.91  ? 313 ARG A NH2   1 
ATOM   2433 N  N     . SER A 1  317 ? -58.487 41.371 -30.350 1.00 49.04  ? 314 SER A N     1 
ATOM   2434 C  CA    . SER A 1  317 ? -58.081 40.323 -29.397 1.00 49.07  ? 314 SER A CA    1 
ATOM   2435 C  C     . SER A 1  317 ? -59.167 39.272 -29.198 1.00 49.25  ? 314 SER A C     1 
ATOM   2436 O  O     . SER A 1  317 ? -60.306 39.440 -29.599 1.00 49.14  ? 314 SER A O     1 
ATOM   2437 C  CB    . SER A 1  317 ? -57.755 40.939 -28.039 1.00 49.11  ? 314 SER A CB    1 
ATOM   2438 O  OG    . SER A 1  317 ? -58.799 41.807 -27.630 1.00 48.83  ? 314 SER A OG    1 
ATOM   2439 N  N     . TRP A 1  318 ? -58.814 38.177 -28.563 1.00 49.57  ? 315 TRP A N     1 
ATOM   2440 C  CA    . TRP A 1  318 ? -59.811 37.204 -28.223 1.00 49.91  ? 315 TRP A CA    1 
ATOM   2441 C  C     . TRP A 1  318 ? -59.665 36.879 -26.752 1.00 50.97  ? 315 TRP A C     1 
ATOM   2442 O  O     . TRP A 1  318 ? -58.576 36.972 -26.182 1.00 51.04  ? 315 TRP A O     1 
ATOM   2443 C  CB    . TRP A 1  318 ? -59.644 35.960 -29.072 1.00 49.31  ? 315 TRP A CB    1 
ATOM   2444 C  CG    . TRP A 1  318 ? -58.395 35.203 -28.784 1.00 48.53  ? 315 TRP A CG    1 
ATOM   2445 C  CD1   . TRP A 1  318 ? -57.135 35.541 -29.151 1.00 46.94  ? 315 TRP A CD1   1 
ATOM   2446 C  CD2   . TRP A 1  318 ? -58.290 33.969 -28.073 1.00 47.86  ? 315 TRP A CD2   1 
ATOM   2447 N  NE1   . TRP A 1  318 ? -56.248 34.594 -28.722 1.00 46.19  ? 315 TRP A NE1   1 
ATOM   2448 C  CE2   . TRP A 1  318 ? -56.932 33.620 -28.048 1.00 47.13  ? 315 TRP A CE2   1 
ATOM   2449 C  CE3   . TRP A 1  318 ? -59.217 33.120 -27.456 1.00 48.57  ? 315 TRP A CE3   1 
ATOM   2450 C  CZ2   . TRP A 1  318 ? -56.468 32.457 -27.428 1.00 47.62  ? 315 TRP A CZ2   1 
ATOM   2451 C  CZ3   . TRP A 1  318 ? -58.762 31.967 -26.848 1.00 47.58  ? 315 TRP A CZ3   1 
ATOM   2452 C  CH2   . TRP A 1  318 ? -57.399 31.644 -26.841 1.00 47.84  ? 315 TRP A CH2   1 
ATOM   2453 N  N     . SER A 1  319 ? -60.779 36.539 -26.124 1.00 52.32  ? 316 SER A N     1 
ATOM   2454 C  CA    . SER A 1  319 ? -60.737 36.028 -24.767 1.00 53.23  ? 316 SER A CA    1 
ATOM   2455 C  C     . SER A 1  319 ? -61.421 34.681 -24.723 1.00 53.71  ? 316 SER A C     1 
ATOM   2456 O  O     . SER A 1  319 ? -62.461 34.490 -25.366 1.00 54.17  ? 316 SER A O     1 
ATOM   2457 C  CB    . SER A 1  319 ? -61.356 37.016 -23.805 1.00 53.24  ? 316 SER A CB    1 
ATOM   2458 O  OG    . SER A 1  319 ? -60.418 38.052 -23.599 1.00 54.18  ? 316 SER A OG    1 
ATOM   2459 N  N     . PRO A 1  320 ? -60.821 33.734 -23.987 1.00 54.04  ? 317 PRO A N     1 
ATOM   2460 C  CA    . PRO A 1  320 ? -61.236 32.329 -23.964 1.00 54.03  ? 317 PRO A CA    1 
ATOM   2461 C  C     . PRO A 1  320 ? -62.624 32.113 -23.346 1.00 54.05  ? 317 PRO A C     1 
ATOM   2462 O  O     . PRO A 1  320 ? -62.991 32.761 -22.370 1.00 53.90  ? 317 PRO A O     1 
ATOM   2463 C  CB    . PRO A 1  320 ? -60.157 31.667 -23.105 1.00 54.13  ? 317 PRO A CB    1 
ATOM   2464 C  CG    . PRO A 1  320 ? -59.690 32.753 -22.184 1.00 53.85  ? 317 PRO A CG    1 
ATOM   2465 C  CD    . PRO A 1  320 ? -59.752 34.013 -23.006 1.00 53.95  ? 317 PRO A CD    1 
ATOM   2466 N  N     . VAL A 1  321 ? -63.375 31.201 -23.946 1.00 54.50  ? 318 VAL A N     1 
ATOM   2467 C  CA    . VAL A 1  321 ? -64.717 30.831 -23.518 1.00 54.93  ? 318 VAL A CA    1 
ATOM   2468 C  C     . VAL A 1  321 ? -64.695 29.323 -23.214 1.00 55.15  ? 318 VAL A C     1 
ATOM   2469 O  O     . VAL A 1  321 ? -64.041 28.547 -23.925 1.00 54.96  ? 318 VAL A O     1 
ATOM   2470 C  CB    . VAL A 1  321 ? -65.740 31.192 -24.632 1.00 54.98  ? 318 VAL A CB    1 
ATOM   2471 C  CG1   . VAL A 1  321 ? -66.985 30.321 -24.574 1.00 56.39  ? 318 VAL A CG1   1 
ATOM   2472 C  CG2   . VAL A 1  321 ? -66.110 32.692 -24.580 1.00 54.72  ? 318 VAL A CG2   1 
ATOM   2473 N  N     . VAL A 1  322 ? -65.369 28.905 -22.142 1.00 55.32  ? 319 VAL A N     1 
ATOM   2474 C  CA    . VAL A 1  322 ? -65.461 27.472 -21.835 1.00 55.44  ? 319 VAL A CA    1 
ATOM   2475 C  C     . VAL A 1  322 ? -66.038 26.716 -23.040 1.00 55.10  ? 319 VAL A C     1 
ATOM   2476 O  O     . VAL A 1  322 ? -67.060 27.136 -23.617 1.00 54.62  ? 319 VAL A O     1 
ATOM   2477 C  CB    . VAL A 1  322 ? -66.329 27.195 -20.586 1.00 55.74  ? 319 VAL A CB    1 
ATOM   2478 C  CG1   . VAL A 1  322 ? -66.274 25.710 -20.212 1.00 55.24  ? 319 VAL A CG1   1 
ATOM   2479 C  CG2   . VAL A 1  322 ? -65.873 28.079 -19.395 1.00 57.33  ? 319 VAL A CG2   1 
ATOM   2480 N  N     . GLY A 1  323 ? -65.366 25.633 -23.434 1.00 54.45  ? 320 GLY A N     1 
ATOM   2481 C  CA    . GLY A 1  323 ? -65.837 24.813 -24.554 1.00 53.90  ? 320 GLY A CA    1 
ATOM   2482 C  C     . GLY A 1  323 ? -65.304 25.170 -25.939 1.00 53.44  ? 320 GLY A C     1 
ATOM   2483 O  O     . GLY A 1  323 ? -65.537 24.434 -26.899 1.00 53.68  ? 320 GLY A O     1 
ATOM   2484 N  N     . GLN A 1  324 ? -64.576 26.287 -26.040 1.00 52.54  ? 321 GLN A N     1 
ATOM   2485 C  CA    . GLN A 1  324 ? -63.975 26.765 -27.292 1.00 50.72  ? 321 GLN A CA    1 
ATOM   2486 C  C     . GLN A 1  324 ? -62.880 25.810 -27.786 1.00 49.62  ? 321 GLN A C     1 
ATOM   2487 O  O     . GLN A 1  324 ? -62.142 25.208 -26.993 1.00 49.02  ? 321 GLN A O     1 
ATOM   2488 C  CB    . GLN A 1  324 ? -63.407 28.165 -27.052 1.00 50.98  ? 321 GLN A CB    1 
ATOM   2489 C  CG    . GLN A 1  324 ? -62.942 28.959 -28.267 1.00 51.65  ? 321 GLN A CG    1 
ATOM   2490 C  CD    . GLN A 1  324 ? -62.615 30.420 -27.929 1.00 51.39  ? 321 GLN A CD    1 
ATOM   2491 O  OE1   . GLN A 1  324 ? -62.212 30.739 -26.814 1.00 50.40  ? 321 GLN A OE1   1 
ATOM   2492 N  NE2   . GLN A 1  324 ? -62.805 31.307 -28.897 1.00 52.26  ? 321 GLN A NE2   1 
ATOM   2493 N  N     . LEU A 1  325 ? -62.811 25.647 -29.104 1.00 48.43  ? 322 LEU A N     1 
ATOM   2494 C  CA    . LEU A 1  325 ? -61.706 24.940 -29.747 1.00 47.18  ? 322 LEU A CA    1 
ATOM   2495 C  C     . LEU A 1  325 ? -60.538 25.896 -29.916 1.00 45.88  ? 322 LEU A C     1 
ATOM   2496 O  O     . LEU A 1  325 ? -60.678 26.956 -30.518 1.00 45.31  ? 322 LEU A O     1 
ATOM   2497 C  CB    . LEU A 1  325 ? -62.133 24.430 -31.114 1.00 47.55  ? 322 LEU A CB    1 
ATOM   2498 C  CG    . LEU A 1  325 ? -63.062 23.224 -31.163 1.00 48.07  ? 322 LEU A CG    1 
ATOM   2499 C  CD1   . LEU A 1  325 ? -63.247 22.824 -32.620 1.00 48.06  ? 322 LEU A CD1   1 
ATOM   2500 C  CD2   . LEU A 1  325 ? -62.467 22.067 -30.356 1.00 48.78  ? 322 LEU A CD2   1 
ATOM   2501 N  N     . VAL A 1  326 ? -59.398 25.526 -29.358 1.00 44.30  ? 323 VAL A N     1 
ATOM   2502 C  CA    . VAL A 1  326 ? -58.244 26.394 -29.314 1.00 43.31  ? 323 VAL A CA    1 
ATOM   2503 C  C     . VAL A 1  326 ? -57.057 25.508 -29.588 1.00 43.30  ? 323 VAL A C     1 
ATOM   2504 O  O     . VAL A 1  326 ? -57.159 24.293 -29.460 1.00 43.21  ? 323 VAL A O     1 
ATOM   2505 C  CB    . VAL A 1  326 ? -58.081 27.074 -27.926 1.00 43.23  ? 323 VAL A CB    1 
ATOM   2506 C  CG1   . VAL A 1  326 ? -59.279 27.966 -27.593 1.00 42.08  ? 323 VAL A CG1   1 
ATOM   2507 C  CG2   . VAL A 1  326 ? -57.882 26.040 -26.828 1.00 42.53  ? 323 VAL A CG2   1 
ATOM   2508 N  N     . GLN A 1  327 ? -55.926 26.090 -29.965 1.00 43.22  ? 324 GLN A N     1 
ATOM   2509 C  CA    . GLN A 1  327 ? -54.759 25.267 -30.223 1.00 42.89  ? 324 GLN A CA    1 
ATOM   2510 C  C     . GLN A 1  327 ? -53.557 25.772 -29.483 1.00 43.73  ? 324 GLN A C     1 
ATOM   2511 O  O     . GLN A 1  327 ? -53.350 26.986 -29.359 1.00 44.30  ? 324 GLN A O     1 
ATOM   2512 C  CB    . GLN A 1  327 ? -54.483 25.200 -31.707 1.00 42.52  ? 324 GLN A CB    1 
ATOM   2513 C  CG    . GLN A 1  327 ? -55.576 24.517 -32.454 1.00 41.48  ? 324 GLN A CG    1 
ATOM   2514 C  CD    . GLN A 1  327 ? -55.400 24.574 -33.940 1.00 41.85  ? 324 GLN A CD    1 
ATOM   2515 O  OE1   . GLN A 1  327 ? -56.182 25.219 -34.657 1.00 40.29  ? 324 GLN A OE1   1 
ATOM   2516 N  NE2   . GLN A 1  327 ? -54.380 23.877 -34.432 1.00 41.93  ? 324 GLN A NE2   1 
ATOM   2517 N  N     . GLU A 1  328 ? -52.783 24.836 -28.965 1.00 44.23  ? 325 GLU A N     1 
ATOM   2518 C  CA    . GLU A 1  328 ? -51.608 25.173 -28.197 1.00 45.55  ? 325 GLU A CA    1 
ATOM   2519 C  C     . GLU A 1  328 ? -50.436 25.234 -29.152 1.00 46.42  ? 325 GLU A C     1 
ATOM   2520 O  O     . GLU A 1  328 ? -50.330 24.396 -30.046 1.00 46.71  ? 325 GLU A O     1 
ATOM   2521 C  CB    . GLU A 1  328 ? -51.347 24.136 -27.098 1.00 45.24  ? 325 GLU A CB    1 
ATOM   2522 C  CG    . GLU A 1  328 ? -50.284 24.566 -26.092 1.00 46.12  ? 325 GLU A CG    1 
ATOM   2523 C  CD    . GLU A 1  328 ? -49.867 23.470 -25.116 1.00 48.06  ? 325 GLU A CD    1 
ATOM   2524 O  OE1   . GLU A 1  328 ? -50.454 22.369 -25.155 1.00 49.66  ? 325 GLU A OE1   1 
ATOM   2525 O  OE2   . GLU A 1  328 ? -48.932 23.697 -24.314 1.00 48.21  ? 325 GLU A OE2   1 
ATOM   2526 N  N     . ARG A 1  329 ? -49.563 26.220 -28.953 1.00 47.22  ? 326 ARG A N     1 
ATOM   2527 C  CA    . ARG A 1  329 ? -48.375 26.382 -29.775 1.00 48.37  ? 326 ARG A CA    1 
ATOM   2528 C  C     . ARG A 1  329 ? -47.448 25.211 -29.545 1.00 48.05  ? 326 ARG A C     1 
ATOM   2529 O  O     . ARG A 1  329 ? -47.282 24.795 -28.420 1.00 48.62  ? 326 ARG A O     1 
ATOM   2530 C  CB    . ARG A 1  329 ? -47.656 27.693 -29.418 1.00 48.69  ? 326 ARG A CB    1 
ATOM   2531 C  CG    . ARG A 1  329 ? -46.573 28.096 -30.429 1.00 52.37  ? 326 ARG A CG    1 
ATOM   2532 C  CD    . ARG A 1  329 ? -45.692 29.267 -29.966 1.00 57.83  ? 326 ARG A CD    1 
ATOM   2533 N  NE    . ARG A 1  329 ? -46.479 30.446 -29.578 1.00 60.74  ? 326 ARG A NE    1 
ATOM   2534 C  CZ    . ARG A 1  329 ? -46.970 31.343 -30.434 1.00 60.45  ? 326 ARG A CZ    1 
ATOM   2535 N  NH1   . ARG A 1  329 ? -46.760 31.206 -31.752 1.00 56.28  ? 326 ARG A NH1   1 
ATOM   2536 N  NH2   . ARG A 1  329 ? -47.672 32.375 -29.958 1.00 59.39  ? 326 ARG A NH2   1 
ATOM   2537 N  N     . VAL A 1  330 ? -46.860 24.662 -30.597 1.00 48.14  ? 327 VAL A N     1 
ATOM   2538 C  CA    . VAL A 1  330 ? -45.809 23.675 -30.414 1.00 48.52  ? 327 VAL A CA    1 
ATOM   2539 C  C     . VAL A 1  330 ? -44.634 24.452 -29.799 1.00 49.86  ? 327 VAL A C     1 
ATOM   2540 O  O     . VAL A 1  330 ? -44.287 25.553 -30.258 1.00 50.54  ? 327 VAL A O     1 
ATOM   2541 C  CB    . VAL A 1  330 ? -45.425 22.961 -31.752 1.00 47.92  ? 327 VAL A CB    1 
ATOM   2542 C  CG1   . VAL A 1  330 ? -44.235 22.086 -31.578 1.00 47.38  ? 327 VAL A CG1   1 
ATOM   2543 C  CG2   . VAL A 1  330 ? -46.570 22.121 -32.266 1.00 47.17  ? 327 VAL A CG2   1 
ATOM   2544 N  N     . ALA A 1  331 ? -44.036 23.902 -28.751 1.00 50.61  ? 328 ALA A N     1 
ATOM   2545 C  CA    . ALA A 1  331 ? -43.014 24.630 -28.001 1.00 51.50  ? 328 ALA A CA    1 
ATOM   2546 C  C     . ALA A 1  331 ? -41.649 24.743 -28.714 1.00 51.66  ? 328 ALA A C     1 
ATOM   2547 O  O     . ALA A 1  331 ? -41.037 25.837 -28.759 1.00 52.19  ? 328 ALA A O     1 
ATOM   2548 C  CB    . ALA A 1  331 ? -42.839 24.005 -26.622 1.00 51.77  ? 328 ALA A CB    1 
ATOM   2549 N  N     . ARG A 1  332 ? -41.161 23.623 -29.240 1.00 50.90  ? 329 ARG A N     1 
ATOM   2550 C  CA    . ARG A 1  332 ? -39.846 23.608 -29.864 1.00 50.53  ? 329 ARG A CA    1 
ATOM   2551 C  C     . ARG A 1  332 ? -39.958 22.900 -31.225 1.00 50.10  ? 329 ARG A C     1 
ATOM   2552 O  O     . ARG A 1  332 ? -39.423 21.799 -31.429 1.00 50.10  ? 329 ARG A O     1 
ATOM   2553 C  CB    . ARG A 1  332 ? -38.809 22.983 -28.920 1.00 50.65  ? 329 ARG A CB    1 
ATOM   2554 N  N     . PRO A 1  333 ? -40.675 23.542 -32.167 1.00 49.46  ? 330 PRO A N     1 
ATOM   2555 C  CA    . PRO A 1  333 ? -41.064 22.857 -33.391 1.00 48.51  ? 330 PRO A CA    1 
ATOM   2556 C  C     . PRO A 1  333 ? -39.862 22.662 -34.254 1.00 47.99  ? 330 PRO A C     1 
ATOM   2557 O  O     . PRO A 1  333 ? -39.070 23.586 -34.420 1.00 48.10  ? 330 PRO A O     1 
ATOM   2558 C  CB    . PRO A 1  333 ? -42.036 23.825 -34.055 1.00 48.15  ? 330 PRO A CB    1 
ATOM   2559 C  CG    . PRO A 1  333 ? -41.694 25.150 -33.513 1.00 49.17  ? 330 PRO A CG    1 
ATOM   2560 C  CD    . PRO A 1  333 ? -41.047 24.971 -32.176 1.00 49.38  ? 330 PRO A CD    1 
ATOM   2561 N  N     . ALA A 1  334 ? -39.717 21.448 -34.768 1.00 47.54  ? 331 ALA A N     1 
ATOM   2562 C  CA    . ALA A 1  334 ? -38.648 21.103 -35.689 1.00 46.93  ? 331 ALA A CA    1 
ATOM   2563 C  C     . ALA A 1  334 ? -38.799 21.896 -36.985 1.00 46.87  ? 331 ALA A C     1 
ATOM   2564 O  O     . ALA A 1  334 ? -39.875 22.463 -37.287 1.00 46.87  ? 331 ALA A O     1 
ATOM   2565 C  CB    . ALA A 1  334 ? -38.654 19.620 -35.967 1.00 46.36  ? 331 ALA A CB    1 
ATOM   2566 N  N     . SER A 1  335 ? -37.714 21.953 -37.744 1.00 46.29  ? 332 SER A N     1 
ATOM   2567 C  CA    . SER A 1  335 ? -37.733 22.662 -39.002 1.00 46.02  ? 332 SER A CA    1 
ATOM   2568 C  C     . SER A 1  335 ? -38.778 22.067 -39.950 1.00 45.39  ? 332 SER A C     1 
ATOM   2569 O  O     . SER A 1  335 ? -38.872 20.846 -40.093 1.00 45.36  ? 332 SER A O     1 
ATOM   2570 C  CB    . SER A 1  335 ? -36.358 22.616 -39.638 1.00 46.13  ? 332 SER A CB    1 
ATOM   2571 O  OG    . SER A 1  335 ? -36.438 23.160 -40.929 1.00 47.72  ? 332 SER A OG    1 
ATOM   2572 N  N     . LEU A 1  336 ? -39.554 22.939 -40.590 1.00 44.44  ? 333 LEU A N     1 
ATOM   2573 C  CA    . LEU A 1  336 ? -40.597 22.534 -41.558 1.00 43.51  ? 333 LEU A CA    1 
ATOM   2574 C  C     . LEU A 1  336 ? -41.745 21.726 -40.956 1.00 43.37  ? 333 LEU A C     1 
ATOM   2575 O  O     . LEU A 1  336 ? -42.422 20.985 -41.679 1.00 43.46  ? 333 LEU A O     1 
ATOM   2576 C  CB    . LEU A 1  336 ? -40.014 21.788 -42.785 1.00 42.98  ? 333 LEU A CB    1 
ATOM   2577 C  CG    . LEU A 1  336 ? -38.995 22.437 -43.734 1.00 41.24  ? 333 LEU A CG    1 
ATOM   2578 C  CD1   . LEU A 1  336 ? -38.701 21.518 -44.902 1.00 40.61  ? 333 LEU A CD1   1 
ATOM   2579 C  CD2   . LEU A 1  336 ? -39.460 23.772 -44.256 1.00 40.09  ? 333 LEU A CD2   1 
ATOM   2580 N  N     . ARG A 1  337 ? -41.975 21.891 -39.653 1.00 42.84  ? 334 ARG A N     1 
ATOM   2581 C  CA    . ARG A 1  337 ? -43.060 21.205 -38.957 1.00 42.54  ? 334 ARG A CA    1 
ATOM   2582 C  C     . ARG A 1  337 ? -44.043 22.225 -38.402 1.00 42.74  ? 334 ARG A C     1 
ATOM   2583 O  O     . ARG A 1  337 ? -43.674 23.365 -38.130 1.00 43.30  ? 334 ARG A O     1 
ATOM   2584 C  CB    . ARG A 1  337 ? -42.498 20.329 -37.825 1.00 42.63  ? 334 ARG A CB    1 
ATOM   2585 C  CG    . ARG A 1  337 ? -41.646 19.123 -38.262 1.00 42.15  ? 334 ARG A CG    1 
ATOM   2586 C  CD    . ARG A 1  337 ? -42.485 18.133 -39.055 1.00 43.68  ? 334 ARG A CD    1 
ATOM   2587 N  NE    . ARG A 1  337 ? -41.771 16.887 -39.328 1.00 45.36  ? 334 ARG A NE    1 
ATOM   2588 C  CZ    . ARG A 1  337 ? -42.101 16.020 -40.293 1.00 44.55  ? 334 ARG A CZ    1 
ATOM   2589 N  NH1   . ARG A 1  337 ? -43.108 16.278 -41.120 1.00 44.43  ? 334 ARG A NH1   1 
ATOM   2590 N  NH2   . ARG A 1  337 ? -41.399 14.905 -40.458 1.00 41.48  ? 334 ARG A NH2   1 
ATOM   2591 N  N     . PRO A 1  338 ? -45.301 21.830 -38.209 1.00 42.72  ? 335 PRO A N     1 
ATOM   2592 C  CA    . PRO A 1  338 ? -46.313 22.779 -37.763 1.00 42.94  ? 335 PRO A CA    1 
ATOM   2593 C  C     . PRO A 1  338 ? -45.985 23.488 -36.453 1.00 43.60  ? 335 PRO A C     1 
ATOM   2594 O  O     . PRO A 1  338 ? -45.362 22.925 -35.555 1.00 43.42  ? 335 PRO A O     1 
ATOM   2595 C  CB    . PRO A 1  338 ? -47.538 21.898 -37.578 1.00 42.81  ? 335 PRO A CB    1 
ATOM   2596 C  CG    . PRO A 1  338 ? -47.335 20.819 -38.581 1.00 42.89  ? 335 PRO A CG    1 
ATOM   2597 C  CD    . PRO A 1  338 ? -45.882 20.516 -38.505 1.00 42.79  ? 335 PRO A CD    1 
ATOM   2598 N  N     . ARG A 1  339 ? -46.431 24.727 -36.348 1.00 44.27  ? 336 ARG A N     1 
ATOM   2599 C  CA    . ARG A 1  339 ? -46.167 25.535 -35.182 1.00 44.57  ? 336 ARG A CA    1 
ATOM   2600 C  C     . ARG A 1  339 ? -47.276 25.353 -34.143 1.00 44.91  ? 336 ARG A C     1 
ATOM   2601 O  O     . ARG A 1  339 ? -47.141 25.795 -33.001 1.00 45.11  ? 336 ARG A O     1 
ATOM   2602 C  CB    . ARG A 1  339 ? -46.012 26.995 -35.617 1.00 44.58  ? 336 ARG A CB    1 
ATOM   2603 C  CG    . ARG A 1  339 ? -44.548 27.508 -35.823 1.00 46.05  ? 336 ARG A CG    1 
ATOM   2604 C  CD    . ARG A 1  339 ? -43.636 26.583 -36.640 1.00 49.56  ? 336 ARG A CD    1 
ATOM   2605 N  NE    . ARG A 1  339 ? -42.248 27.081 -36.772 1.00 51.16  ? 336 ARG A NE    1 
ATOM   2606 C  CZ    . ARG A 1  339 ? -41.195 26.338 -37.154 1.00 51.30  ? 336 ARG A CZ    1 
ATOM   2607 N  NH1   . ARG A 1  339 ? -41.333 25.037 -37.441 1.00 50.66  ? 336 ARG A NH1   1 
ATOM   2608 N  NH2   . ARG A 1  339 ? -39.988 26.894 -37.247 1.00 50.43  ? 336 ARG A NH2   1 
ATOM   2609 N  N     . TRP A 1  340 ? -48.361 24.681 -34.530 1.00 45.36  ? 337 TRP A N     1 
ATOM   2610 C  CA    . TRP A 1  340 ? -49.492 24.438 -33.623 1.00 45.93  ? 337 TRP A CA    1 
ATOM   2611 C  C     . TRP A 1  340 ? -49.839 22.972 -33.458 1.00 46.21  ? 337 TRP A C     1 
ATOM   2612 O  O     . TRP A 1  340 ? -49.697 22.202 -34.402 1.00 46.62  ? 337 TRP A O     1 
ATOM   2613 C  CB    . TRP A 1  340 ? -50.720 25.204 -34.093 1.00 45.93  ? 337 TRP A CB    1 
ATOM   2614 C  CG    . TRP A 1  340 ? -50.439 26.658 -34.182 1.00 47.26  ? 337 TRP A CG    1 
ATOM   2615 C  CD1   . TRP A 1  340 ? -49.990 27.333 -35.274 1.00 47.51  ? 337 TRP A CD1   1 
ATOM   2616 C  CD2   . TRP A 1  340 ? -50.535 27.627 -33.120 1.00 48.42  ? 337 TRP A CD2   1 
ATOM   2617 N  NE1   . TRP A 1  340 ? -49.825 28.662 -34.974 1.00 48.14  ? 337 TRP A NE1   1 
ATOM   2618 C  CE2   . TRP A 1  340 ? -50.148 28.872 -33.660 1.00 47.23  ? 337 TRP A CE2   1 
ATOM   2619 C  CE3   . TRP A 1  340 ? -50.932 27.565 -31.770 1.00 48.16  ? 337 TRP A CE3   1 
ATOM   2620 C  CZ2   . TRP A 1  340 ? -50.135 30.046 -32.904 1.00 45.22  ? 337 TRP A CZ2   1 
ATOM   2621 C  CZ3   . TRP A 1  340 ? -50.917 28.738 -31.018 1.00 47.49  ? 337 TRP A CZ3   1 
ATOM   2622 C  CH2   . TRP A 1  340 ? -50.518 29.962 -31.594 1.00 46.03  ? 337 TRP A CH2   1 
ATOM   2623 N  N     . HIS A 1  341 ? -50.281 22.593 -32.253 1.00 46.40  ? 338 HIS A N     1 
ATOM   2624 C  CA    . HIS A 1  341 ? -50.861 21.265 -31.983 1.00 46.18  ? 338 HIS A CA    1 
ATOM   2625 C  C     . HIS A 1  341 ? -52.271 21.176 -32.542 1.00 46.69  ? 338 HIS A C     1 
ATOM   2626 O  O     . HIS A 1  341 ? -52.842 22.195 -32.957 1.00 46.63  ? 338 HIS A O     1 
ATOM   2627 C  CB    . HIS A 1  341 ? -50.937 21.018 -30.487 1.00 45.55  ? 338 HIS A CB    1 
ATOM   2628 C  CG    . HIS A 1  341 ? -49.606 20.801 -29.853 1.00 45.06  ? 338 HIS A CG    1 
ATOM   2629 N  ND1   . HIS A 1  341 ? -48.818 19.705 -30.136 1.00 43.30  ? 338 HIS A ND1   1 
ATOM   2630 C  CD2   . HIS A 1  341 ? -48.916 21.542 -28.947 1.00 44.69  ? 338 HIS A CD2   1 
ATOM   2631 C  CE1   . HIS A 1  341 ? -47.698 19.780 -29.431 1.00 44.16  ? 338 HIS A CE1   1 
ATOM   2632 N  NE2   . HIS A 1  341 ? -47.732 20.886 -28.703 1.00 43.38  ? 338 HIS A NE2   1 
ATOM   2633 N  N     . LYS A 1  342 ? -52.851 19.976 -32.520 1.00 47.28  ? 339 LYS A N     1 
ATOM   2634 C  CA    . LYS A 1  342 ? -54.211 19.783 -33.026 1.00 48.39  ? 339 LYS A CA    1 
ATOM   2635 C  C     . LYS A 1  342 ? -55.165 20.560 -32.164 1.00 47.57  ? 339 LYS A C     1 
ATOM   2636 O  O     . LYS A 1  342 ? -54.815 20.945 -31.063 1.00 47.47  ? 339 LYS A O     1 
ATOM   2637 C  CB    . LYS A 1  342 ? -54.588 18.299 -33.051 1.00 49.48  ? 339 LYS A CB    1 
ATOM   2638 C  CG    . LYS A 1  342 ? -53.935 17.533 -34.215 1.00 53.77  ? 339 LYS A CG    1 
ATOM   2639 C  CD    . LYS A 1  342 ? -53.738 16.046 -33.916 1.00 59.74  ? 339 LYS A CD    1 
ATOM   2640 C  CE    . LYS A 1  342 ? -53.162 15.310 -35.148 1.00 62.90  ? 339 LYS A CE    1 
ATOM   2641 N  NZ    . LYS A 1  342 ? -52.784 13.882 -34.846 1.00 64.28  ? 339 LYS A NZ    1 
ATOM   2642 N  N     . PRO A 1  343 ? -56.369 20.819 -32.662 1.00 47.54  ? 340 PRO A N     1 
ATOM   2643 C  CA    . PRO A 1  343 ? -57.327 21.514 -31.806 1.00 48.10  ? 340 PRO A CA    1 
ATOM   2644 C  C     . PRO A 1  343 ? -57.607 20.795 -30.479 1.00 49.07  ? 340 PRO A C     1 
ATOM   2645 O  O     . PRO A 1  343 ? -57.397 19.574 -30.364 1.00 49.73  ? 340 PRO A O     1 
ATOM   2646 C  CB    . PRO A 1  343 ? -58.578 21.575 -32.672 1.00 47.62  ? 340 PRO A CB    1 
ATOM   2647 C  CG    . PRO A 1  343 ? -58.037 21.626 -34.062 1.00 46.97  ? 340 PRO A CG    1 
ATOM   2648 C  CD    . PRO A 1  343 ? -56.854 20.700 -34.047 1.00 47.27  ? 340 PRO A CD    1 
ATOM   2649 N  N     . SER A 1  344 ? -58.035 21.561 -29.476 1.00 49.58  ? 341 SER A N     1 
ATOM   2650 C  CA    . SER A 1  344 ? -58.346 21.024 -28.155 1.00 49.99  ? 341 SER A CA    1 
ATOM   2651 C  C     . SER A 1  344 ? -59.352 21.949 -27.503 1.00 50.44  ? 341 SER A C     1 
ATOM   2652 O  O     . SER A 1  344 ? -59.657 23.014 -28.055 1.00 50.86  ? 341 SER A O     1 
ATOM   2653 C  CB    . SER A 1  344 ? -57.077 20.806 -27.308 1.00 50.16  ? 341 SER A CB    1 
ATOM   2654 O  OG    . SER A 1  344 ? -56.270 21.965 -27.204 1.00 50.99  ? 341 SER A OG    1 
ATOM   2655 N  N     . THR A 1  345 ? -59.908 21.544 -26.361 1.00 50.98  ? 342 THR A N     1 
ATOM   2656 C  CA    . THR A 1  345 ? -61.077 22.246 -25.815 1.00 51.04  ? 342 THR A CA    1 
ATOM   2657 C  C     . THR A 1  345 ? -60.778 22.881 -24.474 1.00 51.21  ? 342 THR A C     1 
ATOM   2658 O  O     . THR A 1  345 ? -60.039 22.318 -23.663 1.00 51.33  ? 342 THR A O     1 
ATOM   2659 C  CB    . THR A 1  345 ? -62.303 21.297 -25.697 1.00 51.22  ? 342 THR A CB    1 
ATOM   2660 O  OG1   . THR A 1  345 ? -62.236 20.308 -26.734 1.00 52.05  ? 342 THR A OG1   1 
ATOM   2661 C  CG2   . THR A 1  345 ? -63.627 22.066 -25.810 1.00 50.14  ? 342 THR A CG2   1 
ATOM   2662 N  N     . VAL A 1  346 ? -61.354 24.060 -24.263 1.00 51.59  ? 343 VAL A N     1 
ATOM   2663 C  CA    . VAL A 1  346 ? -61.223 24.797 -23.017 1.00 52.18  ? 343 VAL A CA    1 
ATOM   2664 C  C     . VAL A 1  346 ? -62.143 24.180 -21.965 1.00 52.81  ? 343 VAL A C     1 
ATOM   2665 O  O     . VAL A 1  346 ? -63.372 24.323 -22.039 1.00 52.62  ? 343 VAL A O     1 
ATOM   2666 C  CB    . VAL A 1  346 ? -61.600 26.301 -23.192 1.00 52.17  ? 343 VAL A CB    1 
ATOM   2667 C  CG1   . VAL A 1  346 ? -61.426 27.054 -21.897 1.00 51.35  ? 343 VAL A CG1   1 
ATOM   2668 C  CG2   . VAL A 1  346 ? -60.775 26.953 -24.269 1.00 52.18  ? 343 VAL A CG2   1 
ATOM   2669 N  N     . LEU A 1  347 ? -61.530 23.517 -20.983 1.00 53.70  ? 344 LEU A N     1 
ATOM   2670 C  CA    . LEU A 1  347 ? -62.238 22.974 -19.820 1.00 54.20  ? 344 LEU A CA    1 
ATOM   2671 C  C     . LEU A 1  347 ? -62.603 24.078 -18.863 1.00 54.57  ? 344 LEU A C     1 
ATOM   2672 O  O     . LEU A 1  347 ? -63.780 24.257 -18.536 1.00 55.18  ? 344 LEU A O     1 
ATOM   2673 C  CB    . LEU A 1  347 ? -61.395 21.936 -19.098 1.00 54.01  ? 344 LEU A CB    1 
ATOM   2674 C  CG    . LEU A 1  347 ? -61.223 20.657 -19.915 1.00 55.55  ? 344 LEU A CG    1 
ATOM   2675 C  CD1   . LEU A 1  347 ? -60.314 19.662 -19.206 1.00 55.87  ? 344 LEU A CD1   1 
ATOM   2676 C  CD2   . LEU A 1  347 ? -62.601 20.036 -20.239 1.00 56.67  ? 344 LEU A CD2   1 
ATOM   2677 N  N     . LYS A 1  348 ? -61.607 24.844 -18.426 1.00 54.53  ? 345 LYS A N     1 
ATOM   2678 C  CA    . LYS A 1  348 ? -61.887 25.902 -17.477 1.00 54.30  ? 345 LYS A CA    1 
ATOM   2679 C  C     . LYS A 1  348 ? -61.150 27.183 -17.834 1.00 53.38  ? 345 LYS A C     1 
ATOM   2680 O  O     . LYS A 1  348 ? -59.973 27.150 -18.200 1.00 53.01  ? 345 LYS A O     1 
ATOM   2681 C  CB    . LYS A 1  348 ? -61.521 25.422 -16.071 1.00 54.93  ? 345 LYS A CB    1 
ATOM   2682 C  CG    . LYS A 1  348 ? -62.179 26.206 -14.948 1.00 58.40  ? 345 LYS A CG    1 
ATOM   2683 C  CD    . LYS A 1  348 ? -62.034 25.461 -13.587 1.00 63.29  ? 345 LYS A CD    1 
ATOM   2684 C  CE    . LYS A 1  348 ? -62.228 26.418 -12.395 1.00 64.96  ? 345 LYS A CE    1 
ATOM   2685 N  NZ    . LYS A 1  348 ? -63.201 27.543 -12.707 1.00 65.68  ? 345 LYS A NZ    1 
ATOM   2686 N  N     . VAL A 1  349 ? -61.862 28.303 -17.737 1.00 52.40  ? 346 VAL A N     1 
ATOM   2687 C  CA    . VAL A 1  349 ? -61.255 29.636 -17.805 1.00 51.17  ? 346 VAL A CA    1 
ATOM   2688 C  C     . VAL A 1  349 ? -60.812 30.059 -16.396 1.00 50.59  ? 346 VAL A C     1 
ATOM   2689 O  O     . VAL A 1  349 ? -61.595 30.662 -15.653 1.00 50.60  ? 346 VAL A O     1 
ATOM   2690 C  CB    . VAL A 1  349 ? -62.253 30.689 -18.382 1.00 50.92  ? 346 VAL A CB    1 
ATOM   2691 C  CG1   . VAL A 1  349 ? -61.642 32.094 -18.407 1.00 50.93  ? 346 VAL A CG1   1 
ATOM   2692 C  CG2   . VAL A 1  349 ? -62.719 30.292 -19.765 1.00 50.73  ? 346 VAL A CG2   1 
ATOM   2693 N  N     . LEU A 1  350 ? -59.568 29.739 -16.027 1.00 49.85  ? 347 LEU A N     1 
ATOM   2694 C  CA    . LEU A 1  350 ? -59.024 30.112 -14.715 1.00 49.00  ? 347 LEU A CA    1 
ATOM   2695 C  C     . LEU A 1  350 ? -59.059 31.597 -14.439 1.00 48.90  ? 347 LEU A C     1 
ATOM   2696 O  O     . LEU A 1  350 ? -59.514 32.011 -13.380 1.00 49.60  ? 347 LEU A O     1 
ATOM   2697 C  CB    . LEU A 1  350 ? -57.607 29.610 -14.546 1.00 49.10  ? 347 LEU A CB    1 
ATOM   2698 C  CG    . LEU A 1  350 ? -57.417 28.100 -14.546 1.00 48.69  ? 347 LEU A CG    1 
ATOM   2699 C  CD1   . LEU A 1  350 ? -56.057 27.770 -13.995 1.00 48.32  ? 347 LEU A CD1   1 
ATOM   2700 C  CD2   . LEU A 1  350 ? -58.469 27.437 -13.709 1.00 49.98  ? 347 LEU A CD2   1 
ATOM   2701 N  N     . ASN A 1  351 ? -58.555 32.396 -15.377 1.00 48.44  ? 348 ASN A N     1 
ATOM   2702 C  CA    . ASN A 1  351 ? -58.768 33.859 -15.406 1.00 47.74  ? 348 ASN A CA    1 
ATOM   2703 C  C     . ASN A 1  351 ? -58.786 34.220 -16.886 1.00 47.32  ? 348 ASN A C     1 
ATOM   2704 O  O     . ASN A 1  351 ? -58.557 33.323 -17.723 1.00 47.43  ? 348 ASN A O     1 
ATOM   2705 C  CB    . ASN A 1  351 ? -57.701 34.649 -14.604 1.00 47.74  ? 348 ASN A CB    1 
ATOM   2706 C  CG    . ASN A 1  351 ? -56.249 34.415 -15.094 1.00 48.13  ? 348 ASN A CG    1 
ATOM   2707 O  OD1   . ASN A 1  351 ? -55.939 34.480 -16.284 1.00 48.58  ? 348 ASN A OD1   1 
ATOM   2708 N  ND2   . ASN A 1  351 ? -55.358 34.179 -14.155 1.00 47.12  ? 348 ASN A ND2   1 
ATOM   2709 N  N     . PRO A 1  352 ? -59.040 35.499 -17.236 1.00 46.33  ? 349 PRO A N     1 
ATOM   2710 C  CA    . PRO A 1  352 ? -59.147 35.760 -18.673 1.00 45.92  ? 349 PRO A CA    1 
ATOM   2711 C  C     . PRO A 1  352 ? -57.830 35.552 -19.480 1.00 45.76  ? 349 PRO A C     1 
ATOM   2712 O  O     . PRO A 1  352 ? -57.840 35.651 -20.704 1.00 46.36  ? 349 PRO A O     1 
ATOM   2713 C  CB    . PRO A 1  352 ? -59.626 37.219 -18.743 1.00 46.01  ? 349 PRO A CB    1 
ATOM   2714 C  CG    . PRO A 1  352 ? -59.992 37.612 -17.336 1.00 45.83  ? 349 PRO A CG    1 
ATOM   2715 C  CD    . PRO A 1  352 ? -59.187 36.724 -16.437 1.00 46.22  ? 349 PRO A CD    1 
ATOM   2716 N  N     . ARG A 1  353 ? -56.717 35.251 -18.822 1.00 44.85  ? 350 ARG A N     1 
ATOM   2717 C  CA    . ARG A 1  353 ? -55.459 35.071 -19.539 1.00 44.21  ? 350 ARG A CA    1 
ATOM   2718 C  C     . ARG A 1  353 ? -54.907 33.683 -19.292 1.00 44.53  ? 350 ARG A C     1 
ATOM   2719 O  O     . ARG A 1  353 ? -53.851 33.330 -19.811 1.00 44.98  ? 350 ARG A O     1 
ATOM   2720 C  CB    . ARG A 1  353 ? -54.444 36.142 -19.131 1.00 43.55  ? 350 ARG A CB    1 
ATOM   2721 C  CG    . ARG A 1  353 ? -54.916 37.586 -19.392 1.00 42.18  ? 350 ARG A CG    1 
ATOM   2722 C  CD    . ARG A 1  353 ? -54.213 38.197 -20.601 1.00 42.07  ? 350 ARG A CD    1 
ATOM   2723 N  NE    . ARG A 1  353 ? -52.780 37.881 -20.578 1.00 42.02  ? 350 ARG A NE    1 
ATOM   2724 C  CZ    . ARG A 1  353 ? -52.032 37.656 -21.653 1.00 40.40  ? 350 ARG A CZ    1 
ATOM   2725 N  NH1   . ARG A 1  353 ? -52.558 37.730 -22.865 1.00 40.04  ? 350 ARG A NH1   1 
ATOM   2726 N  NH2   . ARG A 1  353 ? -50.749 37.358 -21.510 1.00 39.27  ? 350 ARG A NH2   1 
ATOM   2727 N  N     . THR A 1  354 ? -55.624 32.885 -18.501 1.00 44.79  ? 351 THR A N     1 
ATOM   2728 C  CA    . THR A 1  354 ? -55.169 31.522 -18.158 1.00 44.87  ? 351 THR A CA    1 
ATOM   2729 C  C     . THR A 1  354 ? -56.286 30.474 -18.237 1.00 45.06  ? 351 THR A C     1 
ATOM   2730 O  O     . THR A 1  354 ? -57.388 30.703 -17.727 1.00 45.11  ? 351 THR A O     1 
ATOM   2731 C  CB    . THR A 1  354 ? -54.604 31.482 -16.757 1.00 44.71  ? 351 THR A CB    1 
ATOM   2732 O  OG1   . THR A 1  354 ? -54.047 32.766 -16.449 1.00 44.92  ? 351 THR A OG1   1 
ATOM   2733 C  CG2   . THR A 1  354 ? -53.543 30.400 -16.653 1.00 43.70  ? 351 THR A CG2   1 
ATOM   2734 N  N     . VAL A 1  355 ? -55.998 29.343 -18.882 1.00 45.07  ? 352 VAL A N     1 
ATOM   2735 C  CA    . VAL A 1  355 ? -57.001 28.307 -19.076 1.00 45.72  ? 352 VAL A CA    1 
ATOM   2736 C  C     . VAL A 1  355 ? -56.470 26.897 -18.891 1.00 46.62  ? 352 VAL A C     1 
ATOM   2737 O  O     . VAL A 1  355 ? -55.277 26.646 -19.045 1.00 46.49  ? 352 VAL A O     1 
ATOM   2738 C  CB    . VAL A 1  355 ? -57.702 28.360 -20.459 1.00 45.02  ? 352 VAL A CB    1 
ATOM   2739 C  CG1   . VAL A 1  355 ? -58.157 29.743 -20.811 1.00 44.99  ? 352 VAL A CG1   1 
ATOM   2740 C  CG2   . VAL A 1  355 ? -56.816 27.805 -21.518 1.00 45.45  ? 352 VAL A CG2   1 
ATOM   2741 N  N     . VAL A 1  356 ? -57.391 25.993 -18.547 1.00 48.06  ? 353 VAL A N     1 
ATOM   2742 C  CA    . VAL A 1  356 ? -57.148 24.562 -18.567 1.00 49.42  ? 353 VAL A CA    1 
ATOM   2743 C  C     . VAL A 1  356 ? -57.768 24.030 -19.850 1.00 50.85  ? 353 VAL A C     1 
ATOM   2744 O  O     . VAL A 1  356 ? -58.895 24.404 -20.219 1.00 50.83  ? 353 VAL A O     1 
ATOM   2745 C  CB    . VAL A 1  356 ? -57.788 23.842 -17.346 1.00 49.60  ? 353 VAL A CB    1 
ATOM   2746 C  CG1   . VAL A 1  356 ? -57.403 22.346 -17.309 1.00 47.66  ? 353 VAL A CG1   1 
ATOM   2747 C  CG2   . VAL A 1  356 ? -57.397 24.538 -16.032 1.00 49.65  ? 353 VAL A CG2   1 
ATOM   2748 N  N     . ILE A 1  357 ? -57.027 23.165 -20.528 1.00 52.37  ? 354 ILE A N     1 
ATOM   2749 C  CA    . ILE A 1  357 ? -57.505 22.574 -21.754 1.00 54.51  ? 354 ILE A CA    1 
ATOM   2750 C  C     . ILE A 1  357 ? -57.364 21.057 -21.708 1.00 57.42  ? 354 ILE A C     1 
ATOM   2751 O  O     . ILE A 1  357 ? -56.424 20.518 -21.093 1.00 57.02  ? 354 ILE A O     1 
ATOM   2752 C  CB    . ILE A 1  357 ? -56.749 23.103 -23.016 1.00 53.65  ? 354 ILE A CB    1 
ATOM   2753 C  CG1   . ILE A 1  357 ? -55.249 22.835 -22.893 1.00 52.22  ? 354 ILE A CG1   1 
ATOM   2754 C  CG2   . ILE A 1  357 ? -57.062 24.552 -23.262 1.00 52.75  ? 354 ILE A CG2   1 
ATOM   2755 C  CD1   . ILE A 1  357 ? -54.478 23.108 -24.105 1.00 50.47  ? 354 ILE A CD1   1 
ATOM   2756 N  N     . LEU A 1  358 ? -58.301 20.383 -22.381 1.00 60.83  ? 355 LEU A N     1 
ATOM   2757 C  CA    . LEU A 1  358 ? -58.205 18.950 -22.610 1.00 64.26  ? 355 LEU A CA    1 
ATOM   2758 C  C     . LEU A 1  358 ? -57.580 18.722 -23.980 1.00 66.59  ? 355 LEU A C     1 
ATOM   2759 O  O     . LEU A 1  358 ? -58.161 19.091 -24.995 1.00 67.03  ? 355 LEU A O     1 
ATOM   2760 C  CB    . LEU A 1  358 ? -59.596 18.304 -22.500 1.00 64.10  ? 355 LEU A CB    1 
ATOM   2761 C  CG    . LEU A 1  358 ? -59.792 16.863 -22.995 1.00 63.97  ? 355 LEU A CG    1 
ATOM   2762 C  CD1   . LEU A 1  358 ? -58.931 15.868 -22.207 1.00 62.14  ? 355 LEU A CD1   1 
ATOM   2763 C  CD2   . LEU A 1  358 ? -61.279 16.521 -22.941 1.00 62.33  ? 355 LEU A CD2   1 
ATOM   2764 N  N     . ASP A 1  359 ? -56.405 18.108 -24.017 1.00 69.89  ? 356 ASP A N     1 
ATOM   2765 C  CA    . ASP A 1  359 ? -55.609 18.149 -25.247 1.00 73.08  ? 356 ASP A CA    1 
ATOM   2766 C  C     . ASP A 1  359 ? -55.818 17.082 -26.343 1.00 75.27  ? 356 ASP A C     1 
ATOM   2767 O  O     . ASP A 1  359 ? -54.929 16.966 -27.217 1.00 76.73  ? 356 ASP A O     1 
ATOM   2768 C  CB    . ASP A 1  359 ? -54.100 18.386 -24.955 1.00 73.10  ? 356 ASP A CB    1 
ATOM   2769 C  CG    . ASP A 1  359 ? -53.344 17.121 -24.563 1.00 74.71  ? 356 ASP A CG    1 
ATOM   2770 O  OD1   . ASP A 1  359 ? -53.616 16.042 -25.133 1.00 74.51  ? 356 ASP A OD1   1 
ATOM   2771 O  OD2   . ASP A 1  359 ? -52.448 17.221 -23.683 1.00 76.99  ? 356 ASP A OD2   1 
ATOM   2772 N  N     . HIS A 1  360 ? -56.957 16.354 -26.340 1.00 76.66  ? 357 HIS A N     1 
ATOM   2773 C  CA    . HIS A 1  360 ? -57.234 15.206 -27.285 1.00 77.99  ? 357 HIS A CA    1 
ATOM   2774 C  C     . HIS A 1  360 ? -56.521 13.856 -26.979 1.00 78.42  ? 357 HIS A C     1 
ATOM   2775 O  O     . HIS A 1  360 ? -56.917 12.814 -27.517 1.00 78.35  ? 357 HIS A O     1 
ATOM   2776 C  CB    . HIS A 1  360 ? -57.090 15.586 -28.798 1.00 78.41  ? 357 HIS A CB    1 
ATOM   2777 C  CG    . HIS A 1  360 ? -55.846 15.047 -29.478 1.00 80.35  ? 357 HIS A CG    1 
ATOM   2778 N  ND1   . HIS A 1  360 ? -55.843 13.883 -30.223 1.00 81.78  ? 357 HIS A ND1   1 
ATOM   2779 C  CD2   . HIS A 1  360 ? -54.575 15.529 -29.544 1.00 81.76  ? 357 HIS A CD2   1 
ATOM   2780 C  CE1   . HIS A 1  360 ? -54.626 13.663 -30.697 1.00 82.38  ? 357 HIS A CE1   1 
ATOM   2781 N  NE2   . HIS A 1  360 ? -53.838 14.649 -30.303 1.00 81.64  ? 357 HIS A NE2   1 
ATOM   2782 N  N     . LEU A 1  361 ? -55.472 13.882 -26.142 1.00 79.16  ? 358 LEU A N     1 
ATOM   2783 C  CA    . LEU A 1  361 ? -54.792 12.645 -25.668 1.00 79.49  ? 358 LEU A CA    1 
ATOM   2784 C  C     . LEU A 1  361 ? -55.649 11.796 -24.683 1.00 79.22  ? 358 LEU A C     1 
ATOM   2785 O  O     . LEU A 1  361 ? -55.632 10.556 -24.768 1.00 79.80  ? 358 LEU A O     1 
ATOM   2786 C  CB    . LEU A 1  361 ? -53.389 12.928 -25.067 1.00 79.67  ? 358 LEU A CB    1 
ATOM   2787 C  CG    . LEU A 1  361 ? -52.245 13.342 -26.014 1.00 80.84  ? 358 LEU A CG    1 
ATOM   2788 C  CD1   . LEU A 1  361 ? -50.979 13.796 -25.242 1.00 80.42  ? 358 LEU A CD1   1 
ATOM   2789 C  CD2   . LEU A 1  361 ? -51.930 12.232 -27.041 1.00 81.05  ? 358 LEU A CD2   1 
ATOM   2790 N  N     . GLY A 1  362 ? -56.374 12.425 -23.747 1.00 78.12  ? 359 GLY A N     1 
ATOM   2791 C  CA    . GLY A 1  362 ? -56.339 13.865 -23.492 1.00 76.75  ? 359 GLY A CA    1 
ATOM   2792 C  C     . GLY A 1  362 ? -55.909 14.210 -22.072 1.00 75.78  ? 359 GLY A C     1 
ATOM   2793 O  O     . GLY A 1  362 ? -56.492 13.736 -21.089 1.00 75.71  ? 359 GLY A O     1 
ATOM   2794 N  N     . ASN A 1  363 ? -54.886 15.045 -21.954 1.00 74.31  ? 360 ASN A N     1 
ATOM   2795 C  CA    . ASN A 1  363 ? -54.470 15.494 -20.645 1.00 72.59  ? 360 ASN A CA    1 
ATOM   2796 C  C     . ASN A 1  363 ? -55.010 16.869 -20.358 1.00 70.89  ? 360 ASN A C     1 
ATOM   2797 O  O     . ASN A 1  363 ? -55.361 17.617 -21.281 1.00 70.54  ? 360 ASN A O     1 
ATOM   2798 C  CB    . ASN A 1  363 ? -52.954 15.457 -20.533 1.00 73.26  ? 360 ASN A CB    1 
ATOM   2799 C  CG    . ASN A 1  363 ? -52.394 14.088 -20.847 1.00 74.56  ? 360 ASN A CG    1 
ATOM   2800 O  OD1   . ASN A 1  363 ? -53.094 13.223 -21.384 1.00 76.28  ? 360 ASN A OD1   1 
ATOM   2801 N  ND2   . ASN A 1  363 ? -51.132 13.878 -20.515 1.00 75.43  ? 360 ASN A ND2   1 
ATOM   2802 N  N     . ASN A 1  364 ? -55.123 17.167 -19.066 1.00 68.67  ? 361 ASN A N     1 
ATOM   2803 C  CA    . ASN A 1  364 ? -55.397 18.512 -18.597 1.00 66.41  ? 361 ASN A CA    1 
ATOM   2804 C  C     . ASN A 1  364 ? -54.080 19.267 -18.610 1.00 64.66  ? 361 ASN A C     1 
ATOM   2805 O  O     . ASN A 1  364 ? -53.073 18.771 -18.086 1.00 64.82  ? 361 ASN A O     1 
ATOM   2806 C  CB    . ASN A 1  364 ? -55.965 18.474 -17.175 1.00 66.74  ? 361 ASN A CB    1 
ATOM   2807 C  CG    . ASN A 1  364 ? -57.459 18.193 -17.142 1.00 67.01  ? 361 ASN A CG    1 
ATOM   2808 O  OD1   . ASN A 1  364 ? -58.016 17.612 -18.066 1.00 67.25  ? 361 ASN A OD1   1 
ATOM   2809 N  ND2   . ASN A 1  364 ? -58.118 18.623 -16.067 1.00 68.61  ? 361 ASN A ND2   1 
ATOM   2810 N  N     . ARG A 1  365 ? -54.067 20.433 -19.247 1.00 62.04  ? 362 ARG A N     1 
ATOM   2811 C  CA    . ARG A 1  365 ? -52.885 21.284 -19.241 1.00 59.56  ? 362 ARG A CA    1 
ATOM   2812 C  C     . ARG A 1  365 ? -53.301 22.685 -18.863 1.00 57.64  ? 362 ARG A C     1 
ATOM   2813 O  O     . ARG A 1  365 ? -54.309 23.197 -19.362 1.00 56.71  ? 362 ARG A O     1 
ATOM   2814 C  CB    . ARG A 1  365 ? -52.187 21.288 -20.605 1.00 59.80  ? 362 ARG A CB    1 
ATOM   2815 C  CG    . ARG A 1  365 ? -51.510 19.977 -20.997 1.00 60.94  ? 362 ARG A CG    1 
ATOM   2816 C  CD    . ARG A 1  365 ? -50.684 20.072 -22.309 1.00 62.26  ? 362 ARG A CD    1 
ATOM   2817 N  NE    . ARG A 1  365 ? -49.687 21.156 -22.295 1.00 63.51  ? 362 ARG A NE    1 
ATOM   2818 C  CZ    . ARG A 1  365 ? -48.509 21.137 -21.655 1.00 64.22  ? 362 ARG A CZ    1 
ATOM   2819 N  NH1   . ARG A 1  365 ? -48.127 20.085 -20.940 1.00 65.87  ? 362 ARG A NH1   1 
ATOM   2820 N  NH2   . ARG A 1  365 ? -47.691 22.180 -21.731 1.00 62.29  ? 362 ARG A NH2   1 
ATOM   2821 N  N     . THR A 1  366 ? -52.543 23.290 -17.955 1.00 55.59  ? 363 THR A N     1 
ATOM   2822 C  CA    . THR A 1  366 ? -52.756 24.698 -17.621 1.00 54.07  ? 363 THR A CA    1 
ATOM   2823 C  C     . THR A 1  366 ? -51.800 25.550 -18.459 1.00 52.51  ? 363 THR A C     1 
ATOM   2824 O  O     . THR A 1  366 ? -50.585 25.313 -18.497 1.00 52.78  ? 363 THR A O     1 
ATOM   2825 C  CB    . THR A 1  366 ? -52.632 24.986 -16.101 1.00 54.19  ? 363 THR A CB    1 
ATOM   2826 O  OG1   . THR A 1  366 ? -53.533 24.131 -15.399 1.00 55.94  ? 363 THR A OG1   1 
ATOM   2827 C  CG2   . THR A 1  366 ? -53.030 26.418 -15.777 1.00 53.41  ? 363 THR A CG2   1 
ATOM   2828 N  N     . VAL A 1  367 ? -52.364 26.557 -19.109 1.00 49.97  ? 364 VAL A N     1 
ATOM   2829 C  CA    . VAL A 1  367 ? -51.758 27.120 -20.277 1.00 47.70  ? 364 VAL A CA    1 
ATOM   2830 C  C     . VAL A 1  367 ? -52.115 28.598 -20.387 1.00 46.90  ? 364 VAL A C     1 
ATOM   2831 O  O     . VAL A 1  367 ? -53.246 28.990 -20.076 1.00 46.25  ? 364 VAL A O     1 
ATOM   2832 C  CB    . VAL A 1  367 ? -52.249 26.293 -21.484 1.00 47.36  ? 364 VAL A CB    1 
ATOM   2833 C  CG1   . VAL A 1  367 ? -52.768 27.141 -22.576 1.00 46.87  ? 364 VAL A CG1   1 
ATOM   2834 C  CG2   . VAL A 1  367 ? -51.171 25.319 -21.960 1.00 46.78  ? 364 VAL A CG2   1 
ATOM   2835 N  N     . SER A 1  368 ? -51.139 29.408 -20.804 1.00 45.63  ? 365 SER A N     1 
ATOM   2836 C  CA    . SER A 1  368 ? -51.331 30.844 -21.033 1.00 44.92  ? 365 SER A CA    1 
ATOM   2837 C  C     . SER A 1  368 ? -52.043 31.036 -22.346 1.00 44.41  ? 365 SER A C     1 
ATOM   2838 O  O     . SER A 1  368 ? -51.780 30.290 -23.275 1.00 44.12  ? 365 SER A O     1 
ATOM   2839 C  CB    . SER A 1  368 ? -49.957 31.528 -21.112 1.00 45.49  ? 365 SER A CB    1 
ATOM   2840 O  OG    . SER A 1  368 ? -50.040 32.861 -21.585 1.00 44.17  ? 365 SER A OG    1 
ATOM   2841 N  N     . ILE A 1  369 ? -52.922 32.027 -22.468 1.00 43.96  ? 366 ILE A N     1 
ATOM   2842 C  CA    . ILE A 1  369 ? -53.542 32.240 -23.783 1.00 44.19  ? 366 ILE A CA    1 
ATOM   2843 C  C     . ILE A 1  369 ? -52.547 32.757 -24.833 1.00 44.61  ? 366 ILE A C     1 
ATOM   2844 O  O     . ILE A 1  369 ? -52.794 32.643 -26.038 1.00 45.31  ? 366 ILE A O     1 
ATOM   2845 C  CB    . ILE A 1  369 ? -54.812 33.107 -23.765 1.00 44.08  ? 366 ILE A CB    1 
ATOM   2846 C  CG1   . ILE A 1  369 ? -54.514 34.547 -23.337 1.00 45.04  ? 366 ILE A CG1   1 
ATOM   2847 C  CG2   . ILE A 1  369 ? -55.867 32.475 -22.893 1.00 44.46  ? 366 ILE A CG2   1 
ATOM   2848 C  CD1   . ILE A 1  369 ? -55.673 35.509 -23.633 1.00 44.61  ? 366 ILE A CD1   1 
ATOM   2849 N  N     . ASP A 1  370 ? -51.432 33.330 -24.377 1.00 44.10  ? 367 ASP A N     1 
ATOM   2850 C  CA    . ASP A 1  370 ? -50.356 33.703 -25.271 1.00 43.67  ? 367 ASP A CA    1 
ATOM   2851 C  C     . ASP A 1  370 ? -49.824 32.489 -26.008 1.00 43.61  ? 367 ASP A C     1 
ATOM   2852 O  O     . ASP A 1  370 ? -49.223 32.636 -27.054 1.00 44.77  ? 367 ASP A O     1 
ATOM   2853 C  CB    . ASP A 1  370 ? -49.209 34.388 -24.526 1.00 43.30  ? 367 ASP A CB    1 
ATOM   2854 C  CG    . ASP A 1  370 ? -49.518 35.833 -24.164 1.00 44.12  ? 367 ASP A CG    1 
ATOM   2855 O  OD1   . ASP A 1  370 ? -50.532 36.425 -24.648 1.00 43.34  ? 367 ASP A OD1   1 
ATOM   2856 O  OD2   . ASP A 1  370 ? -48.724 36.384 -23.381 1.00 43.94  ? 367 ASP A OD2   1 
ATOM   2857 N  N     . ASN A 1  371 ? -50.030 31.291 -25.485 1.00 42.94  ? 368 ASN A N     1 
ATOM   2858 C  CA    . ASN A 1  371 ? -49.603 30.107 -26.210 1.00 42.55  ? 368 ASN A CA    1 
ATOM   2859 C  C     . ASN A 1  371 ? -50.765 29.389 -26.870 1.00 42.85  ? 368 ASN A C     1 
ATOM   2860 O  O     . ASN A 1  371 ? -50.700 28.196 -27.142 1.00 42.95  ? 368 ASN A O     1 
ATOM   2861 C  CB    . ASN A 1  371 ? -48.783 29.205 -25.317 1.00 42.29  ? 368 ASN A CB    1 
ATOM   2862 C  CG    . ASN A 1  371 ? -47.472 29.831 -24.962 1.00 42.86  ? 368 ASN A CG    1 
ATOM   2863 O  OD1   . ASN A 1  371 ? -46.874 30.483 -25.804 1.00 44.76  ? 368 ASN A OD1   1 
ATOM   2864 N  ND2   . ASN A 1  371 ? -47.020 29.668 -23.714 1.00 42.21  ? 368 ASN A ND2   1 
ATOM   2865 N  N     . LEU A 1  372 ? -51.814 30.148 -27.161 1.00 42.99  ? 369 LEU A N     1 
ATOM   2866 C  CA    . LEU A 1  372 ? -52.982 29.612 -27.825 1.00 43.83  ? 369 LEU A CA    1 
ATOM   2867 C  C     . LEU A 1  372 ? -53.473 30.474 -28.966 1.00 44.10  ? 369 LEU A C     1 
ATOM   2868 O  O     . LEU A 1  372 ? -53.369 31.705 -28.929 1.00 44.34  ? 369 LEU A O     1 
ATOM   2869 C  CB    . LEU A 1  372 ? -54.141 29.494 -26.835 1.00 44.11  ? 369 LEU A CB    1 
ATOM   2870 C  CG    . LEU A 1  372 ? -54.085 28.467 -25.706 1.00 44.63  ? 369 LEU A CG    1 
ATOM   2871 C  CD1   . LEU A 1  372 ? -55.375 28.540 -24.925 1.00 44.09  ? 369 LEU A CD1   1 
ATOM   2872 C  CD2   . LEU A 1  372 ? -53.837 27.071 -26.223 1.00 43.12  ? 369 LEU A CD2   1 
ATOM   2873 N  N     . LYS A 1  373 ? -54.048 29.820 -29.966 1.00 44.38  ? 370 LYS A N     1 
ATOM   2874 C  CA    . LYS A 1  373 ? -54.919 30.517 -30.903 1.00 44.53  ? 370 LYS A CA    1 
ATOM   2875 C  C     . LYS A 1  373 ? -56.317 29.886 -30.910 1.00 44.91  ? 370 LYS A C     1 
ATOM   2876 O  O     . LYS A 1  373 ? -56.479 28.675 -30.657 1.00 44.80  ? 370 LYS A O     1 
ATOM   2877 C  CB    . LYS A 1  373 ? -54.319 30.537 -32.311 1.00 44.54  ? 370 LYS A CB    1 
ATOM   2878 C  CG    . LYS A 1  373 ? -54.040 29.165 -32.908 1.00 44.06  ? 370 LYS A CG    1 
ATOM   2879 C  CD    . LYS A 1  373 ? -54.047 29.199 -34.428 1.00 42.46  ? 370 LYS A CD    1 
ATOM   2880 C  CE    . LYS A 1  373 ? -53.435 27.934 -35.032 1.00 40.27  ? 370 LYS A CE    1 
ATOM   2881 N  NZ    . LYS A 1  373 ? -53.550 27.971 -36.515 1.00 40.47  ? 370 LYS A NZ    1 
ATOM   2882 N  N     . PRO A 1  374 ? -57.336 30.706 -31.170 1.00 45.17  ? 371 PRO A N     1 
ATOM   2883 C  CA    . PRO A 1  374 ? -58.654 30.129 -31.373 1.00 45.77  ? 371 PRO A CA    1 
ATOM   2884 C  C     . PRO A 1  374 ? -58.678 29.436 -32.706 1.00 46.82  ? 371 PRO A C     1 
ATOM   2885 O  O     . PRO A 1  374 ? -58.278 30.024 -33.714 1.00 47.54  ? 371 PRO A O     1 
ATOM   2886 C  CB    . PRO A 1  374 ? -59.582 31.341 -31.422 1.00 45.35  ? 371 PRO A CB    1 
ATOM   2887 C  CG    . PRO A 1  374 ? -58.703 32.485 -31.758 1.00 45.78  ? 371 PRO A CG    1 
ATOM   2888 C  CD    . PRO A 1  374 ? -57.354 32.175 -31.185 1.00 44.98  ? 371 PRO A CD    1 
ATOM   2889 N  N     . THR A 1  375 ? -59.137 28.191 -32.728 1.00 47.76  ? 372 THR A N     1 
ATOM   2890 C  CA    . THR A 1  375 ? -59.259 27.469 -33.984 1.00 48.29  ? 372 THR A CA    1 
ATOM   2891 C  C     . THR A 1  375 ? -60.182 28.223 -34.942 1.00 49.03  ? 372 THR A C     1 
ATOM   2892 O  O     . THR A 1  375 ? -61.235 28.712 -34.562 1.00 49.40  ? 372 THR A O     1 
ATOM   2893 C  CB    . THR A 1  375 ? -59.636 26.027 -33.726 1.00 48.28  ? 372 THR A CB    1 
ATOM   2894 O  OG1   . THR A 1  375 ? -58.633 25.463 -32.863 1.00 47.90  ? 372 THR A OG1   1 
ATOM   2895 C  CG2   . THR A 1  375 ? -59.695 25.229 -35.021 1.00 47.63  ? 372 THR A CG2   1 
ATOM   2896 N  N     . SER A 1  376 ? -59.723 28.372 -36.172 1.00 50.24  ? 373 SER A N     1 
ATOM   2897 C  CA    . SER A 1  376 ? -60.417 29.177 -37.173 1.00 51.53  ? 373 SER A CA    1 
ATOM   2898 C  C     . SER A 1  376 ? -61.582 28.457 -37.803 1.00 52.01  ? 373 SER A C     1 
ATOM   2899 O  O     . SER A 1  376 ? -61.574 27.235 -37.943 1.00 51.84  ? 373 SER A O     1 
ATOM   2900 C  CB    . SER A 1  376 ? -59.443 29.583 -38.278 1.00 51.35  ? 373 SER A CB    1 
ATOM   2901 O  OG    . SER A 1  376 ? -58.654 30.653 -37.827 1.00 51.44  ? 373 SER A OG    1 
ATOM   2902 N  N     . HIS A 1  377 ? -62.571 29.231 -38.227 1.00 53.10  ? 374 HIS A N     1 
ATOM   2903 C  CA    . HIS A 1  377 ? -63.724 28.673 -38.934 1.00 54.18  ? 374 HIS A CA    1 
ATOM   2904 C  C     . HIS A 1  377 ? -64.602 27.780 -38.038 1.00 55.55  ? 374 HIS A C     1 
ATOM   2905 O  O     . HIS A 1  377 ? -65.387 27.003 -38.559 1.00 55.55  ? 374 HIS A O     1 
ATOM   2906 C  CB    . HIS A 1  377 ? -63.279 27.867 -40.176 1.00 53.85  ? 374 HIS A CB    1 
ATOM   2907 C  CG    . HIS A 1  377 ? -62.120 28.460 -40.924 1.00 52.27  ? 374 HIS A CG    1 
ATOM   2908 N  ND1   . HIS A 1  377 ? -62.198 29.662 -41.600 1.00 51.26  ? 374 HIS A ND1   1 
ATOM   2909 C  CD2   . HIS A 1  377 ? -60.862 28.002 -41.120 1.00 50.59  ? 374 HIS A CD2   1 
ATOM   2910 C  CE1   . HIS A 1  377 ? -61.033 29.924 -42.164 1.00 49.17  ? 374 HIS A CE1   1 
ATOM   2911 N  NE2   . HIS A 1  377 ? -60.205 28.935 -41.885 1.00 48.62  ? 374 HIS A NE2   1 
ATOM   2912 N  N     . GLN A 1  378 ? -64.440 27.883 -36.706 1.00 57.63  ? 375 GLN A N     1 
ATOM   2913 C  CA    . GLN A 1  378 ? -65.196 27.101 -35.675 1.00 59.01  ? 375 GLN A CA    1 
ATOM   2914 C  C     . GLN A 1  378 ? -64.829 25.611 -35.498 1.00 58.80  ? 375 GLN A C     1 
ATOM   2915 O  O     . GLN A 1  378 ? -63.816 25.114 -36.024 1.00 58.75  ? 375 GLN A O     1 
ATOM   2916 C  CB    . GLN A 1  378 ? -66.714 27.262 -35.879 1.00 59.65  ? 375 GLN A CB    1 
ATOM   2917 C  CG    . GLN A 1  378 ? -67.137 28.708 -36.121 1.00 63.36  ? 375 GLN A CG    1 
ATOM   2918 C  CD    . GLN A 1  378 ? -68.608 28.932 -35.870 1.00 70.25  ? 375 GLN A CD    1 
ATOM   2919 O  OE1   . GLN A 1  378 ? -69.215 28.262 -35.023 1.00 73.93  ? 375 GLN A OE1   1 
ATOM   2920 N  NE2   . GLN A 1  378 ? -69.200 29.886 -36.597 1.00 71.61  ? 375 GLN A NE2   1 
ATOM   2921 N  N     . ASP B 1  119 ? -30.952 63.535 21.851  1.00 78.28  ? 116 ASP B N     1 
ATOM   2922 C  CA    . ASP B 1  119 ? -30.398 62.236 21.354  1.00 78.11  ? 116 ASP B CA    1 
ATOM   2923 C  C     . ASP B 1  119 ? -31.424 61.427 20.521  1.00 76.90  ? 116 ASP B C     1 
ATOM   2924 O  O     . ASP B 1  119 ? -32.585 61.240 20.943  1.00 77.00  ? 116 ASP B O     1 
ATOM   2925 C  CB    . ASP B 1  119 ? -29.858 61.396 22.527  1.00 78.68  ? 116 ASP B CB    1 
ATOM   2926 C  CG    . ASP B 1  119 ? -28.611 60.583 22.149  1.00 80.93  ? 116 ASP B CG    1 
ATOM   2927 O  OD1   . ASP B 1  119 ? -28.170 60.616 20.964  1.00 83.06  ? 116 ASP B OD1   1 
ATOM   2928 O  OD2   . ASP B 1  119 ? -28.067 59.908 23.054  1.00 83.02  ? 116 ASP B OD2   1 
ATOM   2929 N  N     . ARG B 1  120 ? -30.985 60.953 19.347  1.00 74.72  ? 117 ARG B N     1 
ATOM   2930 C  CA    . ARG B 1  120 ? -31.856 60.203 18.424  1.00 72.23  ? 117 ARG B CA    1 
ATOM   2931 C  C     . ARG B 1  120 ? -32.106 58.765 18.912  1.00 69.33  ? 117 ARG B C     1 
ATOM   2932 O  O     . ARG B 1  120 ? -31.203 58.129 19.461  1.00 69.14  ? 117 ARG B O     1 
ATOM   2933 C  CB    . ARG B 1  120 ? -31.282 60.226 17.000  1.00 72.71  ? 117 ARG B CB    1 
ATOM   2934 C  CG    . ARG B 1  120 ? -29.820 59.770 16.899  1.00 75.97  ? 117 ARG B CG    1 
ATOM   2935 C  CD    . ARG B 1  120 ? -29.382 59.540 15.446  1.00 80.97  ? 117 ARG B CD    1 
ATOM   2936 N  NE    . ARG B 1  120 ? -28.260 58.597 15.320  1.00 84.26  ? 117 ARG B NE    1 
ATOM   2937 C  CZ    . ARG B 1  120 ? -28.372 57.284 15.055  1.00 86.28  ? 117 ARG B CZ    1 
ATOM   2938 N  NH1   . ARG B 1  120 ? -29.567 56.694 14.885  1.00 85.74  ? 117 ARG B NH1   1 
ATOM   2939 N  NH2   . ARG B 1  120 ? -27.267 56.547 14.956  1.00 86.42  ? 117 ARG B NH2   1 
ATOM   2940 N  N     . PRO B 1  121 ? -33.340 58.255 18.731  1.00 66.52  ? 118 PRO B N     1 
ATOM   2941 C  CA    . PRO B 1  121 ? -33.682 56.886 19.140  1.00 64.33  ? 118 PRO B CA    1 
ATOM   2942 C  C     . PRO B 1  121 ? -32.886 55.803 18.410  1.00 62.53  ? 118 PRO B C     1 
ATOM   2943 O  O     . PRO B 1  121 ? -32.509 55.960 17.256  1.00 62.27  ? 118 PRO B O     1 
ATOM   2944 C  CB    . PRO B 1  121 ? -35.163 56.766 18.787  1.00 64.16  ? 118 PRO B CB    1 
ATOM   2945 C  CG    . PRO B 1  121 ? -35.654 58.161 18.650  1.00 64.82  ? 118 PRO B CG    1 
ATOM   2946 C  CD    . PRO B 1  121 ? -34.504 58.977 18.189  1.00 66.19  ? 118 PRO B CD    1 
ATOM   2947 N  N     . GLN B 1  122 ? -32.650 54.705 19.104  1.00 60.52  ? 119 GLN B N     1 
ATOM   2948 C  CA    . GLN B 1  122 ? -31.873 53.589 18.603  1.00 58.62  ? 119 GLN B CA    1 
ATOM   2949 C  C     . GLN B 1  122 ? -32.542 52.922 17.380  1.00 56.47  ? 119 GLN B C     1 
ATOM   2950 O  O     . GLN B 1  122 ? -33.761 52.877 17.292  1.00 56.27  ? 119 GLN B O     1 
ATOM   2951 C  CB    . GLN B 1  122 ? -31.741 52.586 19.742  1.00 59.25  ? 119 GLN B CB    1 
ATOM   2952 C  CG    . GLN B 1  122 ? -30.379 51.906 19.870  1.00 63.00  ? 119 GLN B CG    1 
ATOM   2953 C  CD    . GLN B 1  122 ? -30.392 50.755 20.891  1.00 67.55  ? 119 GLN B CD    1 
ATOM   2954 O  OE1   . GLN B 1  122 ? -31.296 50.658 21.753  1.00 67.52  ? 119 GLN B OE1   1 
ATOM   2955 N  NE2   . GLN B 1  122 ? -29.387 49.865 20.790  1.00 69.47  ? 119 GLN B NE2   1 
ATOM   2956 N  N     . LYS B 1  123 ? -31.750 52.395 16.444  1.00 53.60  ? 120 LYS B N     1 
ATOM   2957 C  CA    . LYS B 1  123 ? -32.295 51.828 15.212  1.00 50.58  ? 120 LYS B CA    1 
ATOM   2958 C  C     . LYS B 1  123 ? -31.589 50.547 14.780  1.00 49.25  ? 120 LYS B C     1 
ATOM   2959 O  O     . LYS B 1  123 ? -30.467 50.288 15.214  1.00 49.17  ? 120 LYS B O     1 
ATOM   2960 C  CB    . LYS B 1  123 ? -32.241 52.853 14.086  1.00 50.12  ? 120 LYS B CB    1 
ATOM   2961 C  CG    . LYS B 1  123 ? -33.173 54.032 14.256  1.00 48.39  ? 120 LYS B CG    1 
ATOM   2962 C  CD    . LYS B 1  123 ? -34.618 53.587 14.216  1.00 46.47  ? 120 LYS B CD    1 
ATOM   2963 C  CE    . LYS B 1  123 ? -35.545 54.710 14.600  1.00 45.21  ? 120 LYS B CE    1 
ATOM   2964 N  NZ    . LYS B 1  123 ? -35.437 55.888 13.715  1.00 46.31  ? 120 LYS B NZ    1 
ATOM   2965 N  N     . PRO B 1  124 ? -32.254 49.725 13.931  1.00 47.58  ? 121 PRO B N     1 
ATOM   2966 C  CA    . PRO B 1  124 ? -31.581 48.587 13.320  1.00 46.05  ? 121 PRO B CA    1 
ATOM   2967 C  C     . PRO B 1  124 ? -30.414 49.120 12.521  1.00 45.16  ? 121 PRO B C     1 
ATOM   2968 O  O     . PRO B 1  124 ? -30.510 50.218 11.955  1.00 44.69  ? 121 PRO B O     1 
ATOM   2969 C  CB    . PRO B 1  124 ? -32.632 48.042 12.349  1.00 45.67  ? 121 PRO B CB    1 
ATOM   2970 C  CG    . PRO B 1  124 ? -33.910 48.510 12.865  1.00 45.83  ? 121 PRO B CG    1 
ATOM   2971 C  CD    . PRO B 1  124 ? -33.644 49.849 13.448  1.00 47.17  ? 121 PRO B CD    1 
ATOM   2972 N  N     . PHE B 1  125 ? -29.322 48.360 12.486  1.00 44.31  ? 122 PHE B N     1 
ATOM   2973 C  CA    . PHE B 1  125 ? -28.125 48.719 11.715  1.00 43.80  ? 122 PHE B CA    1 
ATOM   2974 C  C     . PHE B 1  125 ? -27.283 49.782 12.388  1.00 44.09  ? 122 PHE B C     1 
ATOM   2975 O  O     . PHE B 1  125 ? -26.244 50.164 11.844  1.00 44.31  ? 122 PHE B O     1 
ATOM   2976 C  CB    . PHE B 1  125 ? -28.452 49.204 10.285  1.00 43.33  ? 122 PHE B CB    1 
ATOM   2977 C  CG    . PHE B 1  125 ? -29.443 48.345 9.544   1.00 41.82  ? 122 PHE B CG    1 
ATOM   2978 C  CD1   . PHE B 1  125 ? -30.471 48.930 8.824   1.00 40.83  ? 122 PHE B CD1   1 
ATOM   2979 C  CD2   . PHE B 1  125 ? -29.357 46.957 9.577   1.00 40.09  ? 122 PHE B CD2   1 
ATOM   2980 C  CE1   . PHE B 1  125 ? -31.383 48.143 8.126   1.00 41.24  ? 122 PHE B CE1   1 
ATOM   2981 C  CE2   . PHE B 1  125 ? -30.268 46.164 8.897   1.00 39.71  ? 122 PHE B CE2   1 
ATOM   2982 C  CZ    . PHE B 1  125 ? -31.281 46.755 8.163   1.00 39.62  ? 122 PHE B CZ    1 
ATOM   2983 N  N     . ASP B 1  126 ? -27.725 50.281 13.544  1.00 44.60  ? 123 ASP B N     1 
ATOM   2984 C  CA    . ASP B 1  126 ? -26.911 51.214 14.330  1.00 44.95  ? 123 ASP B CA    1 
ATOM   2985 C  C     . ASP B 1  126 ? -25.655 50.569 14.870  1.00 44.47  ? 123 ASP B C     1 
ATOM   2986 O  O     . ASP B 1  126 ? -24.610 51.188 14.891  1.00 44.91  ? 123 ASP B O     1 
ATOM   2987 C  CB    . ASP B 1  126 ? -27.703 51.829 15.470  1.00 45.50  ? 123 ASP B CB    1 
ATOM   2988 C  CG    . ASP B 1  126 ? -28.507 53.036 15.031  1.00 48.05  ? 123 ASP B CG    1 
ATOM   2989 O  OD1   . ASP B 1  126 ? -28.431 53.395 13.826  1.00 50.78  ? 123 ASP B OD1   1 
ATOM   2990 O  OD2   . ASP B 1  126 ? -29.216 53.623 15.889  1.00 50.28  ? 123 ASP B OD2   1 
ATOM   2991 N  N     . LYS B 1  127 ? -25.751 49.315 15.273  1.00 44.11  ? 124 LYS B N     1 
ATOM   2992 C  CA    . LYS B 1  127 ? -24.631 48.639 15.874  1.00 44.35  ? 124 LYS B CA    1 
ATOM   2993 C  C     . LYS B 1  127 ? -24.777 47.130 15.742  1.00 43.78  ? 124 LYS B C     1 
ATOM   2994 O  O     . LYS B 1  127 ? -25.810 46.570 16.063  1.00 43.56  ? 124 LYS B O     1 
ATOM   2995 C  CB    . LYS B 1  127 ? -24.534 49.045 17.348  1.00 45.19  ? 124 LYS B CB    1 
ATOM   2996 C  CG    . LYS B 1  127 ? -23.294 48.537 18.096  1.00 47.22  ? 124 LYS B CG    1 
ATOM   2997 C  CD    . LYS B 1  127 ? -23.182 49.137 19.505  1.00 49.89  ? 124 LYS B CD    1 
ATOM   2998 C  CE    . LYS B 1  127 ? -22.999 50.656 19.455  1.00 52.54  ? 124 LYS B CE    1 
ATOM   2999 N  NZ    . LYS B 1  127 ? -21.990 51.103 20.449  1.00 54.52  ? 124 LYS B NZ    1 
ATOM   3000 N  N     . PHE B 1  128 ? -23.734 46.473 15.260  1.00 43.69  ? 125 PHE B N     1 
ATOM   3001 C  CA    . PHE B 1  128 ? -23.735 45.023 15.185  1.00 43.97  ? 125 PHE B CA    1 
ATOM   3002 C  C     . PHE B 1  128 ? -22.782 44.500 16.244  1.00 44.14  ? 125 PHE B C     1 
ATOM   3003 O  O     . PHE B 1  128 ? -21.673 44.994 16.368  1.00 44.35  ? 125 PHE B O     1 
ATOM   3004 C  CB    . PHE B 1  128 ? -23.269 44.559 13.800  1.00 43.94  ? 125 PHE B CB    1 
ATOM   3005 C  CG    . PHE B 1  128 ? -24.338 44.593 12.728  1.00 42.99  ? 125 PHE B CG    1 
ATOM   3006 C  CD1   . PHE B 1  128 ? -25.584 45.170 12.958  1.00 42.52  ? 125 PHE B CD1   1 
ATOM   3007 C  CD2   . PHE B 1  128 ? -24.076 44.062 11.468  1.00 40.77  ? 125 PHE B CD2   1 
ATOM   3008 C  CE1   . PHE B 1  128 ? -26.553 45.189 11.956  1.00 41.92  ? 125 PHE B CE1   1 
ATOM   3009 C  CE2   . PHE B 1  128 ? -25.024 44.087 10.477  1.00 39.44  ? 125 PHE B CE2   1 
ATOM   3010 C  CZ    . PHE B 1  128 ? -26.265 44.649 10.713  1.00 40.47  ? 125 PHE B CZ    1 
ATOM   3011 N  N     . PHE B 1  129 ? -23.202 43.507 17.010  1.00 44.28  ? 126 PHE B N     1 
ATOM   3012 C  CA    . PHE B 1  129 ? -22.296 42.916 17.984  1.00 44.87  ? 126 PHE B CA    1 
ATOM   3013 C  C     . PHE B 1  129 ? -21.834 41.582 17.442  1.00 45.42  ? 126 PHE B C     1 
ATOM   3014 O  O     . PHE B 1  129 ? -22.654 40.701 17.125  1.00 45.06  ? 126 PHE B O     1 
ATOM   3015 C  CB    . PHE B 1  129 ? -22.968 42.746 19.360  1.00 44.42  ? 126 PHE B CB    1 
ATOM   3016 C  CG    . PHE B 1  129 ? -23.234 44.047 20.076  1.00 44.30  ? 126 PHE B CG    1 
ATOM   3017 C  CD1   . PHE B 1  129 ? -22.336 44.534 21.029  1.00 44.44  ? 126 PHE B CD1   1 
ATOM   3018 C  CD2   . PHE B 1  129 ? -24.385 44.787 19.807  1.00 42.89  ? 126 PHE B CD2   1 
ATOM   3019 C  CE1   . PHE B 1  129 ? -22.576 45.735 21.700  1.00 42.12  ? 126 PHE B CE1   1 
ATOM   3020 C  CE2   . PHE B 1  129 ? -24.630 45.973 20.468  1.00 42.56  ? 126 PHE B CE2   1 
ATOM   3021 C  CZ    . PHE B 1  129 ? -23.720 46.447 21.421  1.00 42.82  ? 126 PHE B CZ    1 
ATOM   3022 N  N     . ILE B 1  130 ? -20.522 41.434 17.326  1.00 46.01  ? 127 ILE B N     1 
ATOM   3023 C  CA    . ILE B 1  130 ? -19.971 40.206 16.761  1.00 47.25  ? 127 ILE B CA    1 
ATOM   3024 C  C     . ILE B 1  130 ? -19.084 39.444 17.736  1.00 48.28  ? 127 ILE B C     1 
ATOM   3025 O  O     . ILE B 1  130 ? -18.438 40.028 18.625  1.00 48.31  ? 127 ILE B O     1 
ATOM   3026 C  CB    . ILE B 1  130 ? -19.196 40.450 15.426  1.00 47.33  ? 127 ILE B CB    1 
ATOM   3027 C  CG1   . ILE B 1  130 ? -17.893 41.219 15.674  1.00 46.45  ? 127 ILE B CG1   1 
ATOM   3028 C  CG2   . ILE B 1  130 ? -20.089 41.169 14.385  1.00 47.66  ? 127 ILE B CG2   1 
ATOM   3029 C  CD1   . ILE B 1  130 ? -16.952 41.171 14.539  1.00 46.05  ? 127 ILE B CD1   1 
ATOM   3030 N  N     . ASP B 1  131 ? -19.049 38.130 17.553  1.00 49.38  ? 128 ASP B N     1 
ATOM   3031 C  CA    . ASP B 1  131 ? -18.215 37.307 18.376  1.00 50.91  ? 128 ASP B CA    1 
ATOM   3032 C  C     . ASP B 1  131 ? -18.093 35.924 17.778  1.00 51.24  ? 128 ASP B C     1 
ATOM   3033 O  O     . ASP B 1  131 ? -18.926 35.537 16.962  1.00 52.01  ? 128 ASP B O     1 
ATOM   3034 C  CB    . ASP B 1  131 ? -18.840 37.213 19.758  1.00 51.72  ? 128 ASP B CB    1 
ATOM   3035 C  CG    . ASP B 1  131 ? -17.835 36.865 20.821  1.00 54.33  ? 128 ASP B CG    1 
ATOM   3036 O  OD1   . ASP B 1  131 ? -16.678 37.349 20.741  1.00 57.34  ? 128 ASP B OD1   1 
ATOM   3037 O  OD2   . ASP B 1  131 ? -18.205 36.103 21.737  1.00 56.73  ? 128 ASP B OD2   1 
ATOM   3038 N  N     . TYR B 1  132 ? -17.062 35.186 18.179  1.00 51.39  ? 129 TYR B N     1 
ATOM   3039 C  CA    . TYR B 1  132 ? -16.903 33.796 17.764  1.00 51.85  ? 129 TYR B CA    1 
ATOM   3040 C  C     . TYR B 1  132 ? -17.327 32.833 18.867  1.00 52.53  ? 129 TYR B C     1 
ATOM   3041 O  O     . TYR B 1  132 ? -17.241 33.156 20.041  1.00 53.34  ? 129 TYR B O     1 
ATOM   3042 C  CB    . TYR B 1  132 ? -15.455 33.507 17.338  1.00 51.53  ? 129 TYR B CB    1 
ATOM   3043 C  CG    . TYR B 1  132 ? -15.152 33.867 15.890  1.00 50.59  ? 129 TYR B CG    1 
ATOM   3044 C  CD1   . TYR B 1  132 ? -14.417 35.003 15.571  1.00 49.29  ? 129 TYR B CD1   1 
ATOM   3045 C  CD2   . TYR B 1  132 ? -15.615 33.071 14.846  1.00 50.20  ? 129 TYR B CD2   1 
ATOM   3046 C  CE1   . TYR B 1  132 ? -14.150 35.338 14.264  1.00 49.73  ? 129 TYR B CE1   1 
ATOM   3047 C  CE2   . TYR B 1  132 ? -15.357 33.397 13.527  1.00 50.06  ? 129 TYR B CE2   1 
ATOM   3048 C  CZ    . TYR B 1  132 ? -14.629 34.533 13.239  1.00 50.76  ? 129 TYR B CZ    1 
ATOM   3049 O  OH    . TYR B 1  132 ? -14.387 34.858 11.920  1.00 51.06  ? 129 TYR B OH    1 
ATOM   3050 N  N     . ILE B 1  133 ? -17.799 31.659 18.479  1.00 52.91  ? 130 ILE B N     1 
ATOM   3051 C  CA    . ILE B 1  133 ? -18.060 30.573 19.404  1.00 53.49  ? 130 ILE B CA    1 
ATOM   3052 C  C     . ILE B 1  133 ? -17.298 29.378 18.866  1.00 54.35  ? 130 ILE B C     1 
ATOM   3053 O  O     . ILE B 1  133 ? -17.388 29.081 17.681  1.00 54.47  ? 130 ILE B O     1 
ATOM   3054 C  CB    . ILE B 1  133 ? -19.568 30.238 19.469  1.00 53.51  ? 130 ILE B CB    1 
ATOM   3055 C  CG1   . ILE B 1  133 ? -20.279 31.198 20.407  1.00 52.63  ? 130 ILE B CG1   1 
ATOM   3056 C  CG2   . ILE B 1  133 ? -19.818 28.787 19.914  1.00 52.92  ? 130 ILE B CG2   1 
ATOM   3057 C  CD1   . ILE B 1  133 ? -21.767 31.109 20.291  1.00 53.43  ? 130 ILE B CD1   1 
ATOM   3058 N  N     . GLY B 1  134 ? -16.543 28.702 19.727  1.00 55.33  ? 131 GLY B N     1 
ATOM   3059 C  CA    . GLY B 1  134 ? -15.816 27.507 19.326  1.00 56.18  ? 131 GLY B CA    1 
ATOM   3060 C  C     . GLY B 1  134 ? -14.426 27.462 19.920  1.00 57.22  ? 131 GLY B C     1 
ATOM   3061 O  O     . GLY B 1  134 ? -14.048 28.359 20.677  1.00 56.92  ? 131 GLY B O     1 
ATOM   3062 N  N     . PRO B 1  135 ? -13.635 26.436 19.550  1.00 58.20  ? 132 PRO B N     1 
ATOM   3063 C  CA    . PRO B 1  135 ? -13.944 25.452 18.507  1.00 58.91  ? 132 PRO B CA    1 
ATOM   3064 C  C     . PRO B 1  135 ? -15.087 24.534 18.886  1.00 59.76  ? 132 PRO B C     1 
ATOM   3065 O  O     . PRO B 1  135 ? -15.358 24.335 20.055  1.00 59.87  ? 132 PRO B O     1 
ATOM   3066 C  CB    . PRO B 1  135 ? -12.655 24.626 18.379  1.00 58.87  ? 132 PRO B CB    1 
ATOM   3067 C  CG    . PRO B 1  135 ? -11.727 25.095 19.424  1.00 58.67  ? 132 PRO B CG    1 
ATOM   3068 C  CD    . PRO B 1  135 ? -12.409 26.097 20.295  1.00 58.35  ? 132 PRO B CD    1 
ATOM   3069 N  N     . LEU B 1  136 ? -15.742 23.980 17.883  1.00 60.98  ? 133 LEU B N     1 
ATOM   3070 C  CA    . LEU B 1  136 ? -16.799 23.008 18.085  1.00 62.28  ? 133 LEU B CA    1 
ATOM   3071 C  C     . LEU B 1  136 ? -16.370 21.704 17.428  1.00 63.62  ? 133 LEU B C     1 
ATOM   3072 O  O     . LEU B 1  136 ? -15.342 21.663 16.743  1.00 63.42  ? 133 LEU B O     1 
ATOM   3073 C  CB    . LEU B 1  136 ? -18.109 23.511 17.464  1.00 61.85  ? 133 LEU B CB    1 
ATOM   3074 C  CG    . LEU B 1  136 ? -18.550 24.929 17.840  1.00 61.39  ? 133 LEU B CG    1 
ATOM   3075 C  CD1   . LEU B 1  136 ? -19.678 25.395 16.955  1.00 60.02  ? 133 LEU B CD1   1 
ATOM   3076 C  CD2   . LEU B 1  136 ? -18.940 25.035 19.305  1.00 61.84  ? 133 LEU B CD2   1 
ATOM   3077 N  N     . PRO B 1  137 ? -17.136 20.620 17.647  1.00 65.09  ? 134 PRO B N     1 
ATOM   3078 C  CA    . PRO B 1  137 ? -16.825 19.421 16.869  1.00 66.17  ? 134 PRO B CA    1 
ATOM   3079 C  C     . PRO B 1  137 ? -16.974 19.737 15.385  1.00 66.98  ? 134 PRO B C     1 
ATOM   3080 O  O     . PRO B 1  137 ? -17.912 20.445 15.010  1.00 67.43  ? 134 PRO B O     1 
ATOM   3081 C  CB    . PRO B 1  137 ? -17.898 18.419 17.309  1.00 66.26  ? 134 PRO B CB    1 
ATOM   3082 C  CG    . PRO B 1  137 ? -18.284 18.865 18.678  1.00 65.96  ? 134 PRO B CG    1 
ATOM   3083 C  CD    . PRO B 1  137 ? -18.167 20.366 18.671  1.00 65.11  ? 134 PRO B CD    1 
ATOM   3084 N  N     . PRO B 1  138 ? -16.046 19.240 14.549  1.00 67.42  ? 135 PRO B N     1 
ATOM   3085 C  CA    . PRO B 1  138 ? -16.107 19.498 13.119  1.00 67.51  ? 135 PRO B CA    1 
ATOM   3086 C  C     . PRO B 1  138 ? -17.474 19.145 12.575  1.00 67.50  ? 135 PRO B C     1 
ATOM   3087 O  O     . PRO B 1  138 ? -17.980 18.067 12.872  1.00 67.72  ? 135 PRO B O     1 
ATOM   3088 C  CB    . PRO B 1  138 ? -15.070 18.532 12.556  1.00 67.84  ? 135 PRO B CB    1 
ATOM   3089 C  CG    . PRO B 1  138 ? -14.046 18.399 13.658  1.00 68.01  ? 135 PRO B CG    1 
ATOM   3090 C  CD    . PRO B 1  138 ? -14.864 18.436 14.922  1.00 67.69  ? 135 PRO B CD    1 
ATOM   3091 N  N     . SER B 1  139 ? -18.076 20.060 11.820  1.00 67.46  ? 136 SER B N     1 
ATOM   3092 C  CA    . SER B 1  139 ? -19.295 19.752 11.074  1.00 67.69  ? 136 SER B CA    1 
ATOM   3093 C  C     . SER B 1  139 ? -19.179 20.238 9.637   1.00 68.30  ? 136 SER B C     1 
ATOM   3094 O  O     . SER B 1  139 ? -19.205 21.449 9.386   1.00 68.43  ? 136 SER B O     1 
ATOM   3095 C  CB    . SER B 1  139 ? -20.518 20.379 11.729  1.00 67.39  ? 136 SER B CB    1 
ATOM   3096 O  OG    . SER B 1  139 ? -21.666 20.084 10.971  1.00 65.64  ? 136 SER B OG    1 
ATOM   3097 N  N     . GLN B 1  140 ? -19.068 19.289 8.702   1.00 68.68  ? 137 GLN B N     1 
ATOM   3098 C  CA    . GLN B 1  140 ? -18.821 19.582 7.280   1.00 69.22  ? 137 GLN B CA    1 
ATOM   3099 C  C     . GLN B 1  140 ? -17.557 20.433 7.096   1.00 68.68  ? 137 GLN B C     1 
ATOM   3100 O  O     . GLN B 1  140 ? -17.508 21.298 6.214   1.00 68.92  ? 137 GLN B O     1 
ATOM   3101 C  CB    . GLN B 1  140 ? -20.014 20.302 6.642   1.00 69.68  ? 137 GLN B CB    1 
ATOM   3102 C  CG    . GLN B 1  140 ? -21.377 19.843 7.145   1.00 73.28  ? 137 GLN B CG    1 
ATOM   3103 C  CD    . GLN B 1  140 ? -22.168 19.065 6.117   1.00 77.91  ? 137 GLN B CD    1 
ATOM   3104 O  OE1   . GLN B 1  140 ? -21.767 18.965 4.947   1.00 80.79  ? 137 GLN B OE1   1 
ATOM   3105 N  NE2   . GLN B 1  140 ? -23.314 18.514 6.544   1.00 78.34  ? 137 GLN B NE2   1 
ATOM   3106 N  N     . GLY B 1  141 ? -16.550 20.194 7.937   1.00 67.90  ? 138 GLY B N     1 
ATOM   3107 C  CA    . GLY B 1  141 ? -15.273 20.894 7.845   1.00 66.98  ? 138 GLY B CA    1 
ATOM   3108 C  C     . GLY B 1  141 ? -15.227 22.220 8.587   1.00 66.55  ? 138 GLY B C     1 
ATOM   3109 O  O     . GLY B 1  141 ? -14.215 22.935 8.522   1.00 66.92  ? 138 GLY B O     1 
ATOM   3110 N  N     . TYR B 1  142 ? -16.309 22.553 9.297   1.00 65.39  ? 139 TYR B N     1 
ATOM   3111 C  CA    . TYR B 1  142 ? -16.392 23.822 10.026  1.00 64.23  ? 139 TYR B CA    1 
ATOM   3112 C  C     . TYR B 1  142 ? -16.217 23.653 11.515  1.00 63.37  ? 139 TYR B C     1 
ATOM   3113 O  O     . TYR B 1  142 ? -16.620 22.625 12.072  1.00 63.84  ? 139 TYR B O     1 
ATOM   3114 C  CB    . TYR B 1  142 ? -17.710 24.512 9.753   1.00 64.09  ? 139 TYR B CB    1 
ATOM   3115 C  CG    . TYR B 1  142 ? -17.830 24.982 8.329   1.00 65.09  ? 139 TYR B CG    1 
ATOM   3116 C  CD1   . TYR B 1  142 ? -17.356 26.234 7.944   1.00 65.54  ? 139 TYR B CD1   1 
ATOM   3117 C  CD2   . TYR B 1  142 ? -18.410 24.168 7.355   1.00 65.46  ? 139 TYR B CD2   1 
ATOM   3118 C  CE1   . TYR B 1  142 ? -17.471 26.661 6.618   1.00 65.87  ? 139 TYR B CE1   1 
ATOM   3119 C  CE2   . TYR B 1  142 ? -18.527 24.587 6.037   1.00 65.40  ? 139 TYR B CE2   1 
ATOM   3120 C  CZ    . TYR B 1  142 ? -18.059 25.829 5.676   1.00 65.35  ? 139 TYR B CZ    1 
ATOM   3121 O  OH    . TYR B 1  142 ? -18.181 26.236 4.374   1.00 65.38  ? 139 TYR B OH    1 
ATOM   3122 N  N     . LEU B 1  143 ? -15.635 24.671 12.153  1.00 61.79  ? 140 LEU B N     1 
ATOM   3123 C  CA    . LEU B 1  143 ? -15.284 24.608 13.579  1.00 60.21  ? 140 LEU B CA    1 
ATOM   3124 C  C     . LEU B 1  143 ? -15.852 25.714 14.471  1.00 58.70  ? 140 LEU B C     1 
ATOM   3125 O  O     . LEU B 1  143 ? -15.979 25.527 15.677  1.00 58.87  ? 140 LEU B O     1 
ATOM   3126 C  CB    . LEU B 1  143 ? -13.754 24.554 13.755  1.00 60.58  ? 140 LEU B CB    1 
ATOM   3127 C  CG    . LEU B 1  143 ? -13.007 23.329 13.194  1.00 61.13  ? 140 LEU B CG    1 
ATOM   3128 C  CD1   . LEU B 1  143 ? -11.479 23.541 13.149  1.00 60.97  ? 140 LEU B CD1   1 
ATOM   3129 C  CD2   . LEU B 1  143 ? -13.378 22.057 13.964  1.00 61.67  ? 140 LEU B CD2   1 
ATOM   3130 N  N     . TYR B 1  144 ? -16.161 26.870 13.895  1.00 56.64  ? 141 TYR B N     1 
ATOM   3131 C  CA    . TYR B 1  144 ? -16.549 28.032 14.680  1.00 54.50  ? 141 TYR B CA    1 
ATOM   3132 C  C     . TYR B 1  144 ? -17.840 28.620 14.151  1.00 52.97  ? 141 TYR B C     1 
ATOM   3133 O  O     . TYR B 1  144 ? -18.297 28.267 13.070  1.00 53.41  ? 141 TYR B O     1 
ATOM   3134 C  CB    . TYR B 1  144 ? -15.456 29.094 14.631  1.00 54.73  ? 141 TYR B CB    1 
ATOM   3135 C  CG    . TYR B 1  144 ? -14.172 28.732 15.336  1.00 56.19  ? 141 TYR B CG    1 
ATOM   3136 C  CD1   . TYR B 1  144 ? -13.868 29.274 16.589  1.00 57.25  ? 141 TYR B CD1   1 
ATOM   3137 C  CD2   . TYR B 1  144 ? -13.242 27.861 14.745  1.00 58.18  ? 141 TYR B CD2   1 
ATOM   3138 C  CE1   . TYR B 1  144 ? -12.682 28.953 17.243  1.00 58.73  ? 141 TYR B CE1   1 
ATOM   3139 C  CE2   . TYR B 1  144 ? -12.053 27.523 15.398  1.00 59.36  ? 141 TYR B CE2   1 
ATOM   3140 C  CZ    . TYR B 1  144 ? -11.782 28.078 16.642  1.00 59.71  ? 141 TYR B CZ    1 
ATOM   3141 O  OH    . TYR B 1  144 ? -10.613 27.758 17.286  1.00 62.00  ? 141 TYR B OH    1 
ATOM   3142 N  N     . VAL B 1  145 ? -18.445 29.508 14.921  1.00 50.72  ? 142 VAL B N     1 
ATOM   3143 C  CA    . VAL B 1  145 ? -19.613 30.218 14.457  1.00 48.45  ? 142 VAL B CA    1 
ATOM   3144 C  C     . VAL B 1  145 ? -19.347 31.666 14.752  1.00 47.49  ? 142 VAL B C     1 
ATOM   3145 O  O     . VAL B 1  145 ? -19.031 32.016 15.871  1.00 47.38  ? 142 VAL B O     1 
ATOM   3146 C  CB    . VAL B 1  145 ? -20.888 29.789 15.188  1.00 48.12  ? 142 VAL B CB    1 
ATOM   3147 C  CG1   . VAL B 1  145 ? -22.072 30.607 14.697  1.00 48.16  ? 142 VAL B CG1   1 
ATOM   3148 C  CG2   . VAL B 1  145 ? -21.163 28.329 14.967  1.00 46.93  ? 142 VAL B CG2   1 
ATOM   3149 N  N     . LEU B 1  146 ? -19.425 32.505 13.737  1.00 46.30  ? 143 LEU B N     1 
ATOM   3150 C  CA    . LEU B 1  146 ? -19.391 33.921 13.961  1.00 45.41  ? 143 LEU B CA    1 
ATOM   3151 C  C     . LEU B 1  146 ? -20.819 34.320 14.248  1.00 44.84  ? 143 LEU B C     1 
ATOM   3152 O  O     . LEU B 1  146 ? -21.731 33.885 13.552  1.00 44.42  ? 143 LEU B O     1 
ATOM   3153 C  CB    . LEU B 1  146 ? -18.889 34.624 12.721  1.00 45.74  ? 143 LEU B CB    1 
ATOM   3154 C  CG    . LEU B 1  146 ? -18.857 36.142 12.820  1.00 46.32  ? 143 LEU B CG    1 
ATOM   3155 C  CD1   . LEU B 1  146 ? -17.820 36.593 13.839  1.00 44.15  ? 143 LEU B CD1   1 
ATOM   3156 C  CD2   . LEU B 1  146 ? -18.600 36.715 11.417  1.00 45.74  ? 143 LEU B CD2   1 
ATOM   3157 N  N     . VAL B 1  147 ? -21.009 35.123 15.288  1.00 44.13  ? 144 VAL B N     1 
ATOM   3158 C  CA    . VAL B 1  147 ? -22.340 35.510 15.733  1.00 43.31  ? 144 VAL B CA    1 
ATOM   3159 C  C     . VAL B 1  147 ? -22.507 37.001 15.526  1.00 42.74  ? 144 VAL B C     1 
ATOM   3160 O  O     . VAL B 1  147 ? -21.671 37.797 15.983  1.00 43.02  ? 144 VAL B O     1 
ATOM   3161 C  CB    . VAL B 1  147 ? -22.533 35.222 17.236  1.00 43.96  ? 144 VAL B CB    1 
ATOM   3162 C  CG1   . VAL B 1  147 ? -23.890 35.770 17.723  1.00 43.70  ? 144 VAL B CG1   1 
ATOM   3163 C  CG2   . VAL B 1  147 ? -22.397 33.729 17.534  1.00 43.14  ? 144 VAL B CG2   1 
ATOM   3164 N  N     . VAL B 1  148 ? -23.563 37.385 14.828  1.00 41.41  ? 145 VAL B N     1 
ATOM   3165 C  CA    . VAL B 1  148 ? -23.838 38.804 14.654  1.00 41.02  ? 145 VAL B CA    1 
ATOM   3166 C  C     . VAL B 1  148 ? -25.213 39.093 15.214  1.00 41.06  ? 145 VAL B C     1 
ATOM   3167 O  O     . VAL B 1  148 ? -26.193 38.392 14.908  1.00 41.67  ? 145 VAL B O     1 
ATOM   3168 C  CB    . VAL B 1  148 ? -23.773 39.278 13.175  1.00 40.77  ? 145 VAL B CB    1 
ATOM   3169 C  CG1   . VAL B 1  148 ? -23.866 40.769 13.127  1.00 40.01  ? 145 VAL B CG1   1 
ATOM   3170 C  CG2   . VAL B 1  148 ? -22.491 38.837 12.516  1.00 39.79  ? 145 VAL B CG2   1 
ATOM   3171 N  N     . VAL B 1  149 ? -25.285 40.101 16.064  1.00 40.66  ? 146 VAL B N     1 
ATOM   3172 C  CA    . VAL B 1  149 ? -26.544 40.463 16.667  1.00 40.59  ? 146 VAL B CA    1 
ATOM   3173 C  C     . VAL B 1  149 ? -26.706 41.940 16.498  1.00 41.01  ? 146 VAL B C     1 
ATOM   3174 O  O     . VAL B 1  149 ? -25.830 42.733 16.906  1.00 40.83  ? 146 VAL B O     1 
ATOM   3175 C  CB    . VAL B 1  149 ? -26.610 40.135 18.172  1.00 40.27  ? 146 VAL B CB    1 
ATOM   3176 C  CG1   . VAL B 1  149 ? -27.936 40.598 18.729  1.00 40.75  ? 146 VAL B CG1   1 
ATOM   3177 C  CG2   . VAL B 1  149 ? -26.438 38.649 18.417  1.00 39.82  ? 146 VAL B CG2   1 
ATOM   3178 N  N     . ASP B 1  150 ? -27.825 42.312 15.894  1.00 41.45  ? 147 ASP B N     1 
ATOM   3179 C  CA    . ASP B 1  150 ? -28.174 43.709 15.796  1.00 42.41  ? 147 ASP B CA    1 
ATOM   3180 C  C     . ASP B 1  150 ? -28.588 44.203 17.193  1.00 43.08  ? 147 ASP B C     1 
ATOM   3181 O  O     . ASP B 1  150 ? -29.368 43.544 17.891  1.00 43.27  ? 147 ASP B O     1 
ATOM   3182 C  CB    . ASP B 1  150 ? -29.295 43.895 14.794  1.00 42.07  ? 147 ASP B CB    1 
ATOM   3183 C  CG    . ASP B 1  150 ? -29.731 45.323 14.689  1.00 42.93  ? 147 ASP B CG    1 
ATOM   3184 O  OD1   . ASP B 1  150 ? -28.902 46.157 14.248  1.00 43.07  ? 147 ASP B OD1   1 
ATOM   3185 O  OD2   . ASP B 1  150 ? -30.902 45.609 15.051  1.00 42.59  ? 147 ASP B OD2   1 
ATOM   3186 N  N     . GLY B 1  151 ? -28.041 45.347 17.592  1.00 43.57  ? 148 GLY B N     1 
ATOM   3187 C  CA    . GLY B 1  151 ? -28.226 45.896 18.931  1.00 44.22  ? 148 GLY B CA    1 
ATOM   3188 C  C     . GLY B 1  151 ? -29.656 46.317 19.195  1.00 44.84  ? 148 GLY B C     1 
ATOM   3189 O  O     . GLY B 1  151 ? -30.239 45.954 20.217  1.00 45.36  ? 148 GLY B O     1 
ATOM   3190 N  N     . MET B 1  152 ? -30.232 47.074 18.272  1.00 44.86  ? 149 MET B N     1 
ATOM   3191 C  CA    . MET B 1  152 ? -31.609 47.531 18.420  1.00 44.85  ? 149 MET B CA    1 
ATOM   3192 C  C     . MET B 1  152 ? -32.650 46.396 18.343  1.00 44.83  ? 149 MET B C     1 
ATOM   3193 O  O     . MET B 1  152 ? -33.516 46.306 19.201  1.00 45.52  ? 149 MET B O     1 
ATOM   3194 C  CB    . MET B 1  152 ? -31.911 48.651 17.420  1.00 44.92  ? 149 MET B CB    1 
ATOM   3195 C  CG    . MET B 1  152 ? -33.213 49.391 17.666  1.00 45.75  ? 149 MET B CG    1 
ATOM   3196 S  SD    . MET B 1  152 ? -34.583 48.365 17.087  1.00 49.17  ? 149 MET B SD    1 
ATOM   3197 C  CE    . MET B 1  152 ? -35.876 48.953 18.180  1.00 50.00  ? 149 MET B CE    1 
ATOM   3198 N  N     . THR B 1  153 ? -32.567 45.519 17.349  1.00 44.53  ? 150 THR B N     1 
ATOM   3199 C  CA    . THR B 1  153 ? -33.624 44.524 17.169  1.00 43.84  ? 150 THR B CA    1 
ATOM   3200 C  C     . THR B 1  153 ? -33.339 43.228 17.894  1.00 43.75  ? 150 THR B C     1 
ATOM   3201 O  O     . THR B 1  153 ? -34.254 42.437 18.122  1.00 44.00  ? 150 THR B O     1 
ATOM   3202 C  CB    . THR B 1  153 ? -33.833 44.138 15.682  1.00 43.78  ? 150 THR B CB    1 
ATOM   3203 O  OG1   . THR B 1  153 ? -32.639 43.519 15.184  1.00 43.20  ? 150 THR B OG1   1 
ATOM   3204 C  CG2   . THR B 1  153 ? -34.187 45.339 14.841  1.00 42.75  ? 150 THR B CG2   1 
ATOM   3205 N  N     . GLY B 1  154 ? -32.075 42.963 18.197  1.00 43.34  ? 151 GLY B N     1 
ATOM   3206 C  CA    . GLY B 1  154 ? -31.713 41.648 18.720  1.00 43.24  ? 151 GLY B CA    1 
ATOM   3207 C  C     . GLY B 1  154 ? -31.661 40.552 17.660  1.00 43.30  ? 151 GLY B C     1 
ATOM   3208 O  O     . GLY B 1  154 ? -31.513 39.346 17.980  1.00 42.73  ? 151 GLY B O     1 
ATOM   3209 N  N     . PHE B 1  155 ? -31.768 40.960 16.392  1.00 43.29  ? 152 PHE B N     1 
ATOM   3210 C  CA    . PHE B 1  155 ? -31.740 40.010 15.291  1.00 43.23  ? 152 PHE B CA    1 
ATOM   3211 C  C     . PHE B 1  155 ? -30.367 39.345 15.184  1.00 43.59  ? 152 PHE B C     1 
ATOM   3212 O  O     . PHE B 1  155 ? -29.315 39.986 15.388  1.00 43.91  ? 152 PHE B O     1 
ATOM   3213 C  CB    . PHE B 1  155 ? -32.116 40.693 13.989  1.00 43.26  ? 152 PHE B CB    1 
ATOM   3214 C  CG    . PHE B 1  155 ? -32.613 39.748 12.926  1.00 42.51  ? 152 PHE B CG    1 
ATOM   3215 C  CD1   . PHE B 1  155 ? -33.972 39.479 12.807  1.00 41.05  ? 152 PHE B CD1   1 
ATOM   3216 C  CD2   . PHE B 1  155 ? -31.723 39.141 12.039  1.00 40.80  ? 152 PHE B CD2   1 
ATOM   3217 C  CE1   . PHE B 1  155 ? -34.439 38.624 11.820  1.00 41.84  ? 152 PHE B CE1   1 
ATOM   3218 C  CE2   . PHE B 1  155 ? -32.172 38.281 11.058  1.00 40.44  ? 152 PHE B CE2   1 
ATOM   3219 C  CZ    . PHE B 1  155 ? -33.529 38.020 10.935  1.00 41.68  ? 152 PHE B CZ    1 
ATOM   3220 N  N     . THR B 1  156 ? -30.374 38.056 14.886  1.00 43.38  ? 153 THR B N     1 
ATOM   3221 C  CA    . THR B 1  156 ? -29.132 37.296 14.877  1.00 43.64  ? 153 THR B CA    1 
ATOM   3222 C  C     . THR B 1  156 ? -28.843 36.732 13.498  1.00 43.50  ? 153 THR B C     1 
ATOM   3223 O  O     . THR B 1  156 ? -29.740 36.233 12.827  1.00 43.15  ? 153 THR B O     1 
ATOM   3224 C  CB    . THR B 1  156 ? -29.173 36.151 15.927  1.00 43.62  ? 153 THR B CB    1 
ATOM   3225 O  OG1   . THR B 1  156 ? -29.355 36.722 17.225  1.00 44.62  ? 153 THR B OG1   1 
ATOM   3226 C  CG2   . THR B 1  156 ? -27.896 35.333 15.905  1.00 42.86  ? 153 THR B CG2   1 
ATOM   3227 N  N     . TRP B 1  157 ? -27.586 36.845 13.085  1.00 43.84  ? 154 TRP B N     1 
ATOM   3228 C  CA    . TRP B 1  157 ? -27.069 36.102 11.948  1.00 44.20  ? 154 TRP B CA    1 
ATOM   3229 C  C     . TRP B 1  157 ? -25.924 35.231 12.436  1.00 44.57  ? 154 TRP B C     1 
ATOM   3230 O  O     . TRP B 1  157 ? -25.114 35.667 13.260  1.00 44.32  ? 154 TRP B O     1 
ATOM   3231 C  CB    . TRP B 1  157 ? -26.511 37.049 10.908  1.00 44.00  ? 154 TRP B CB    1 
ATOM   3232 C  CG    . TRP B 1  157 ? -27.512 37.872 10.207  1.00 44.73  ? 154 TRP B CG    1 
ATOM   3233 C  CD1   . TRP B 1  157 ? -28.128 37.574 9.030   1.00 44.80  ? 154 TRP B CD1   1 
ATOM   3234 C  CD2   . TRP B 1  157 ? -28.012 39.163 10.613  1.00 44.24  ? 154 TRP B CD2   1 
ATOM   3235 N  NE1   . TRP B 1  157 ? -28.989 38.592 8.677   1.00 44.35  ? 154 TRP B NE1   1 
ATOM   3236 C  CE2   . TRP B 1  157 ? -28.932 39.583 9.622   1.00 43.68  ? 154 TRP B CE2   1 
ATOM   3237 C  CE3   . TRP B 1  157 ? -27.760 40.008 11.710  1.00 43.29  ? 154 TRP B CE3   1 
ATOM   3238 C  CZ2   . TRP B 1  157 ? -29.604 40.814 9.686   1.00 43.65  ? 154 TRP B CZ2   1 
ATOM   3239 C  CZ3   . TRP B 1  157 ? -28.417 41.227 11.774  1.00 43.49  ? 154 TRP B CZ3   1 
ATOM   3240 C  CH2   . TRP B 1  157 ? -29.340 41.618 10.768  1.00 44.25  ? 154 TRP B CH2   1 
ATOM   3241 N  N     . LEU B 1  158 ? -25.849 34.016 11.908  1.00 44.99  ? 155 LEU B N     1 
ATOM   3242 C  CA    . LEU B 1  158 ? -24.773 33.104 12.230  1.00 46.04  ? 155 LEU B CA    1 
ATOM   3243 C  C     . LEU B 1  158 ? -23.983 32.668 10.982  1.00 47.23  ? 155 LEU B C     1 
ATOM   3244 O  O     . LEU B 1  158 ? -24.574 32.355 9.946   1.00 47.82  ? 155 LEU B O     1 
ATOM   3245 C  CB    . LEU B 1  158 ? -25.348 31.896 12.956  1.00 45.56  ? 155 LEU B CB    1 
ATOM   3246 C  CG    . LEU B 1  158 ? -26.250 32.213 14.154  1.00 45.19  ? 155 LEU B CG    1 
ATOM   3247 C  CD1   . LEU B 1  158 ? -26.936 30.959 14.657  1.00 44.77  ? 155 LEU B CD1   1 
ATOM   3248 C  CD2   . LEU B 1  158 ? -25.491 32.879 15.280  1.00 44.19  ? 155 LEU B CD2   1 
ATOM   3249 N  N     . TYR B 1  159 ? -22.654 32.662 11.063  1.00 48.21  ? 156 TYR B N     1 
ATOM   3250 C  CA    . TYR B 1  159 ? -21.839 32.151 9.951   1.00 49.16  ? 156 TYR B CA    1 
ATOM   3251 C  C     . TYR B 1  159 ? -20.838 31.123 10.429  1.00 49.26  ? 156 TYR B C     1 
ATOM   3252 O  O     . TYR B 1  159 ? -20.074 31.394 11.349  1.00 49.25  ? 156 TYR B O     1 
ATOM   3253 C  CB    . TYR B 1  159 ? -21.144 33.285 9.169   1.00 49.39  ? 156 TYR B CB    1 
ATOM   3254 C  CG    . TYR B 1  159 ? -22.140 34.311 8.665   1.00 51.04  ? 156 TYR B CG    1 
ATOM   3255 C  CD1   . TYR B 1  159 ? -22.841 34.102 7.468   1.00 51.54  ? 156 TYR B CD1   1 
ATOM   3256 C  CD2   . TYR B 1  159 ? -22.426 35.477 9.415   1.00 51.62  ? 156 TYR B CD2   1 
ATOM   3257 C  CE1   . TYR B 1  159 ? -23.786 35.032 7.030   1.00 52.83  ? 156 TYR B CE1   1 
ATOM   3258 C  CE2   . TYR B 1  159 ? -23.363 36.415 8.977   1.00 50.68  ? 156 TYR B CE2   1 
ATOM   3259 C  CZ    . TYR B 1  159 ? -24.042 36.179 7.793   1.00 52.53  ? 156 TYR B CZ    1 
ATOM   3260 O  OH    . TYR B 1  159 ? -24.975 37.080 7.354   1.00 53.94  ? 156 TYR B OH    1 
ATOM   3261 N  N     . PRO B 1  160 ? -20.856 29.928 9.813   1.00 49.63  ? 157 PRO B N     1 
ATOM   3262 C  CA    . PRO B 1  160 ? -19.870 28.881 10.078  1.00 50.08  ? 157 PRO B CA    1 
ATOM   3263 C  C     . PRO B 1  160 ? -18.513 29.280 9.496   1.00 50.63  ? 157 PRO B C     1 
ATOM   3264 O  O     . PRO B 1  160 ? -18.456 29.715 8.352   1.00 51.00  ? 157 PRO B O     1 
ATOM   3265 C  CB    . PRO B 1  160 ? -20.434 27.700 9.306   1.00 49.94  ? 157 PRO B CB    1 
ATOM   3266 C  CG    . PRO B 1  160 ? -21.119 28.345 8.139   1.00 49.53  ? 157 PRO B CG    1 
ATOM   3267 C  CD    . PRO B 1  160 ? -21.789 29.534 8.744   1.00 49.41  ? 157 PRO B CD    1 
ATOM   3268 N  N     . THR B 1  161 ? -17.446 29.189 10.280  1.00 51.27  ? 158 THR B N     1 
ATOM   3269 C  CA    . THR B 1  161 ? -16.101 29.394 9.749   1.00 52.15  ? 158 THR B CA    1 
ATOM   3270 C  C     . THR B 1  161 ? -15.192 28.203 10.100  1.00 53.27  ? 158 THR B C     1 
ATOM   3271 O  O     . THR B 1  161 ? -15.582 27.323 10.870  1.00 53.30  ? 158 THR B O     1 
ATOM   3272 C  CB    . THR B 1  161 ? -15.446 30.669 10.285  1.00 51.89  ? 158 THR B CB    1 
ATOM   3273 O  OG1   . THR B 1  161 ? -15.157 30.496 11.667  1.00 51.19  ? 158 THR B OG1   1 
ATOM   3274 C  CG2   . THR B 1  161 ? -16.322 31.887 10.098  1.00 51.79  ? 158 THR B CG2   1 
ATOM   3275 N  N     . LYS B 1  162 ? -13.986 28.180 9.532   1.00 54.37  ? 159 LYS B N     1 
ATOM   3276 C  CA    . LYS B 1  162 ? -13.016 27.124 9.831   1.00 55.57  ? 159 LYS B CA    1 
ATOM   3277 C  C     . LYS B 1  162 ? -11.981 27.601 10.838  1.00 55.19  ? 159 LYS B C     1 
ATOM   3278 O  O     . LYS B 1  162 ? -11.142 26.819 11.294  1.00 55.55  ? 159 LYS B O     1 
ATOM   3279 C  CB    . LYS B 1  162 ? -12.322 26.635 8.553   1.00 56.38  ? 159 LYS B CB    1 
ATOM   3280 C  CG    . LYS B 1  162 ? -13.264 25.970 7.509   1.00 60.63  ? 159 LYS B CG    1 
ATOM   3281 C  CD    . LYS B 1  162 ? -12.479 25.289 6.362   1.00 65.79  ? 159 LYS B CD    1 
ATOM   3282 C  CE    . LYS B 1  162 ? -13.227 25.358 5.004   1.00 68.28  ? 159 LYS B CE    1 
ATOM   3283 N  NZ    . LYS B 1  162 ? -14.378 24.414 4.937   1.00 68.46  ? 159 LYS B NZ    1 
ATOM   3284 N  N     . ALA B 1  163 ? -12.062 28.880 11.201  1.00 54.69  ? 160 ALA B N     1 
ATOM   3285 C  CA    . ALA B 1  163 ? -11.073 29.522 12.058  1.00 54.21  ? 160 ALA B CA    1 
ATOM   3286 C  C     . ALA B 1  163 ? -11.560 30.894 12.514  1.00 53.95  ? 160 ALA B C     1 
ATOM   3287 O  O     . ALA B 1  163 ? -12.287 31.564 11.789  1.00 53.82  ? 160 ALA B O     1 
ATOM   3288 C  CB    . ALA B 1  163 ? -9.744  29.667 11.314  1.00 54.01  ? 160 ALA B CB    1 
ATOM   3289 N  N     . PRO B 1  164 ? -11.140 31.327 13.715  1.00 53.68  ? 161 PRO B N     1 
ATOM   3290 C  CA    . PRO B 1  164 ? -11.445 32.671 14.174  1.00 53.06  ? 161 PRO B CA    1 
ATOM   3291 C  C     . PRO B 1  164 ? -10.440 33.678 13.646  1.00 52.60  ? 161 PRO B C     1 
ATOM   3292 O  O     . PRO B 1  164 ? -9.818  34.397 14.432  1.00 52.60  ? 161 PRO B O     1 
ATOM   3293 C  CB    . PRO B 1  164 ? -11.328 32.553 15.696  1.00 53.49  ? 161 PRO B CB    1 
ATOM   3294 C  CG    . PRO B 1  164 ? -10.417 31.392 15.950  1.00 53.54  ? 161 PRO B CG    1 
ATOM   3295 C  CD    . PRO B 1  164 ? -10.372 30.551 14.712  1.00 53.88  ? 161 PRO B CD    1 
ATOM   3296 N  N     . SER B 1  165 ? -10.285 33.735 12.325  1.00 52.08  ? 162 SER B N     1 
ATOM   3297 C  CA    . SER B 1  165 ? -9.268  34.591 11.703  1.00 51.48  ? 162 SER B CA    1 
ATOM   3298 C  C     . SER B 1  165 ? -9.889  35.831 11.115  1.00 50.90  ? 162 SER B C     1 
ATOM   3299 O  O     . SER B 1  165 ? -11.108 35.914 10.968  1.00 51.45  ? 162 SER B O     1 
ATOM   3300 C  CB    . SER B 1  165 ? -8.557  33.835 10.599  1.00 51.42  ? 162 SER B CB    1 
ATOM   3301 O  OG    . SER B 1  165 ? -9.517  33.257 9.743   1.00 52.92  ? 162 SER B OG    1 
ATOM   3302 N  N     . THR B 1  166 ? -9.054  36.803 10.782  1.00 49.95  ? 163 THR B N     1 
ATOM   3303 C  CA    . THR B 1  166 ? -9.527  37.980 10.089  1.00 49.16  ? 163 THR B CA    1 
ATOM   3304 C  C     . THR B 1  166 ? -10.117 37.588 8.746   1.00 49.27  ? 163 THR B C     1 
ATOM   3305 O  O     . THR B 1  166 ? -11.180 38.074 8.358   1.00 49.53  ? 163 THR B O     1 
ATOM   3306 C  CB    . THR B 1  166 ? -8.402  38.936 9.871   1.00 48.93  ? 163 THR B CB    1 
ATOM   3307 O  OG1   . THR B 1  166 ? -7.925  39.359 11.148  1.00 48.54  ? 163 THR B OG1   1 
ATOM   3308 C  CG2   . THR B 1  166 ? -8.878  40.135 9.078   1.00 48.69  ? 163 THR B CG2   1 
ATOM   3309 N  N     . SER B 1  167 ? -9.436  36.681 8.057   1.00 49.09  ? 164 SER B N     1 
ATOM   3310 C  CA    . SER B 1  167 ? -9.862  36.229 6.752   1.00 49.07  ? 164 SER B CA    1 
ATOM   3311 C  C     . SER B 1  167 ? -11.285 35.672 6.798   1.00 48.85  ? 164 SER B C     1 
ATOM   3312 O  O     . SER B 1  167 ? -12.131 36.080 6.007   1.00 48.44  ? 164 SER B O     1 
ATOM   3313 C  CB    . SER B 1  167 ? -8.867  35.210 6.177   1.00 49.19  ? 164 SER B CB    1 
ATOM   3314 O  OG    . SER B 1  167 ? -9.552  34.154 5.506   1.00 49.94  ? 164 SER B OG    1 
ATOM   3315 N  N     . ALA B 1  168 ? -11.545 34.756 7.735   1.00 48.83  ? 165 ALA B N     1 
ATOM   3316 C  CA    . ALA B 1  168 ? -12.866 34.106 7.843   1.00 48.19  ? 165 ALA B CA    1 
ATOM   3317 C  C     . ALA B 1  168 ? -13.944 35.109 8.245   1.00 47.88  ? 165 ALA B C     1 
ATOM   3318 O  O     . ALA B 1  168 ? -15.113 34.990 7.857   1.00 47.83  ? 165 ALA B O     1 
ATOM   3319 C  CB    . ALA B 1  168 ? -12.816 32.957 8.819   1.00 47.81  ? 165 ALA B CB    1 
ATOM   3320 N  N     . THR B 1  169 ? -13.542 36.104 9.021   1.00 47.36  ? 166 THR B N     1 
ATOM   3321 C  CA    . THR B 1  169 ? -14.467 37.121 9.450   1.00 47.48  ? 166 THR B CA    1 
ATOM   3322 C  C     . THR B 1  169 ? -14.869 37.948 8.237   1.00 47.82  ? 166 THR B C     1 
ATOM   3323 O  O     . THR B 1  169 ? -16.068 38.170 7.986   1.00 48.28  ? 166 THR B O     1 
ATOM   3324 C  CB    . THR B 1  169 ? -13.839 38.000 10.540  1.00 47.56  ? 166 THR B CB    1 
ATOM   3325 O  OG1   . THR B 1  169 ? -13.452 37.178 11.647  1.00 46.77  ? 166 THR B OG1   1 
ATOM   3326 C  CG2   . THR B 1  169 ? -14.806 39.063 11.008  1.00 46.74  ? 166 THR B CG2   1 
ATOM   3327 N  N     . VAL B 1  170 ? -13.867 38.379 7.473   1.00 47.67  ? 167 VAL B N     1 
ATOM   3328 C  CA    . VAL B 1  170 ? -14.105 39.206 6.291   1.00 47.49  ? 167 VAL B CA    1 
ATOM   3329 C  C     . VAL B 1  170 ? -14.972 38.464 5.275   1.00 47.29  ? 167 VAL B C     1 
ATOM   3330 O  O     . VAL B 1  170 ? -15.908 39.026 4.721   1.00 46.87  ? 167 VAL B O     1 
ATOM   3331 C  CB    . VAL B 1  170 ? -12.771 39.742 5.683   1.00 47.42  ? 167 VAL B CB    1 
ATOM   3332 C  CG1   . VAL B 1  170 ? -12.944 40.185 4.251   1.00 47.70  ? 167 VAL B CG1   1 
ATOM   3333 C  CG2   . VAL B 1  170 ? -12.251 40.912 6.507   1.00 47.37  ? 167 VAL B CG2   1 
ATOM   3334 N  N     . LYS B 1  171 ? -14.686 37.187 5.074   1.00 47.72  ? 168 LYS B N     1 
ATOM   3335 C  CA    . LYS B 1  171 ? -15.450 36.380 4.135   1.00 48.72  ? 168 LYS B CA    1 
ATOM   3336 C  C     . LYS B 1  171 ? -16.918 36.391 4.552   1.00 48.07  ? 168 LYS B C     1 
ATOM   3337 O  O     . LYS B 1  171 ? -17.797 36.716 3.754   1.00 48.54  ? 168 LYS B O     1 
ATOM   3338 C  CB    . LYS B 1  171 ? -14.902 34.959 4.062   1.00 49.17  ? 168 LYS B CB    1 
ATOM   3339 C  CG    . LYS B 1  171 ? -14.454 34.543 2.660   1.00 53.37  ? 168 LYS B CG    1 
ATOM   3340 C  CD    . LYS B 1  171 ? -13.735 33.151 2.636   1.00 59.08  ? 168 LYS B CD    1 
ATOM   3341 C  CE    . LYS B 1  171 ? -14.738 31.960 2.765   1.00 62.49  ? 168 LYS B CE    1 
ATOM   3342 N  NZ    . LYS B 1  171 ? -15.576 31.663 1.544   1.00 62.46  ? 168 LYS B NZ    1 
ATOM   3343 N  N     . SER B 1  172 ? -17.161 36.104 5.824   1.00 47.60  ? 169 SER B N     1 
ATOM   3344 C  CA    . SER B 1  172 ? -18.512 36.014 6.371   1.00 46.71  ? 169 SER B CA    1 
ATOM   3345 C  C     . SER B 1  172 ? -19.226 37.349 6.431   1.00 46.21  ? 169 SER B C     1 
ATOM   3346 O  O     . SER B 1  172 ? -20.388 37.448 6.035   1.00 46.24  ? 169 SER B O     1 
ATOM   3347 C  CB    . SER B 1  172 ? -18.466 35.408 7.757   1.00 46.72  ? 169 SER B CB    1 
ATOM   3348 O  OG    . SER B 1  172 ? -18.198 34.024 7.684   1.00 47.62  ? 169 SER B OG    1 
ATOM   3349 N  N     . LEU B 1  173 ? -18.549 38.378 6.923   1.00 45.47  ? 170 LEU B N     1 
ATOM   3350 C  CA    . LEU B 1  173 ? -19.179 39.693 6.976   1.00 45.33  ? 170 LEU B CA    1 
ATOM   3351 C  C     . LEU B 1  173 ? -19.483 40.253 5.592   1.00 45.29  ? 170 LEU B C     1 
ATOM   3352 O  O     . LEU B 1  173 ? -20.377 41.070 5.451   1.00 45.07  ? 170 LEU B O     1 
ATOM   3353 C  CB    . LEU B 1  173 ? -18.358 40.681 7.819   1.00 45.27  ? 170 LEU B CB    1 
ATOM   3354 C  CG    . LEU B 1  173 ? -18.402 40.415 9.333   1.00 44.80  ? 170 LEU B CG    1 
ATOM   3355 C  CD1   . LEU B 1  173 ? -17.768 41.547 10.106  1.00 42.63  ? 170 LEU B CD1   1 
ATOM   3356 C  CD2   . LEU B 1  173 ? -19.847 40.167 9.813   1.00 43.07  ? 170 LEU B CD2   1 
ATOM   3357 N  N     . ASN B 1  174 ? -18.756 39.781 4.573   1.00 45.67  ? 171 ASN B N     1 
ATOM   3358 C  CA    . ASN B 1  174 ? -18.991 40.193 3.188   1.00 45.11  ? 171 ASN B CA    1 
ATOM   3359 C  C     . ASN B 1  174 ? -20.344 39.730 2.722   1.00 45.01  ? 171 ASN B C     1 
ATOM   3360 O  O     . ASN B 1  174 ? -21.055 40.477 2.027   1.00 46.05  ? 171 ASN B O     1 
ATOM   3361 C  CB    . ASN B 1  174 ? -17.897 39.703 2.245   1.00 44.94  ? 171 ASN B CB    1 
ATOM   3362 C  CG    . ASN B 1  174 ? -16.735 40.697 2.132   1.00 45.06  ? 171 ASN B CG    1 
ATOM   3363 O  OD1   . ASN B 1  174 ? -16.853 41.875 2.511   1.00 44.56  ? 171 ASN B OD1   1 
ATOM   3364 N  ND2   . ASN B 1  174 ? -15.608 40.225 1.613   1.00 42.43  ? 171 ASN B ND2   1 
ATOM   3365 N  N     . VAL B 1  175 ? -20.717 38.519 3.123   1.00 44.00  ? 172 VAL B N     1 
ATOM   3366 C  CA    . VAL B 1  175 ? -22.068 38.032 2.876   1.00 43.20  ? 172 VAL B CA    1 
ATOM   3367 C  C     . VAL B 1  175 ? -23.064 38.956 3.587   1.00 43.31  ? 172 VAL B C     1 
ATOM   3368 O  O     . VAL B 1  175 ? -23.904 39.566 2.946   1.00 43.56  ? 172 VAL B O     1 
ATOM   3369 C  CB    . VAL B 1  175 ? -22.248 36.577 3.330   1.00 43.15  ? 172 VAL B CB    1 
ATOM   3370 C  CG1   . VAL B 1  175 ? -23.631 36.062 2.963   1.00 42.76  ? 172 VAL B CG1   1 
ATOM   3371 C  CG2   . VAL B 1  175 ? -21.173 35.685 2.711   1.00 42.36  ? 172 VAL B CG2   1 
ATOM   3372 N  N     . LEU B 1  176 ? -22.949 39.091 4.902   1.00 43.21  ? 173 LEU B N     1 
ATOM   3373 C  CA    . LEU B 1  176 ? -23.882 39.925 5.641   1.00 42.93  ? 173 LEU B CA    1 
ATOM   3374 C  C     . LEU B 1  176 ? -23.936 41.349 5.099   1.00 43.29  ? 173 LEU B C     1 
ATOM   3375 O  O     . LEU B 1  176 ? -25.028 41.905 4.901   1.00 43.41  ? 173 LEU B O     1 
ATOM   3376 C  CB    . LEU B 1  176 ? -23.549 39.948 7.132   1.00 42.61  ? 173 LEU B CB    1 
ATOM   3377 C  CG    . LEU B 1  176 ? -24.453 40.816 8.022   1.00 42.78  ? 173 LEU B CG    1 
ATOM   3378 C  CD1   . LEU B 1  176 ? -25.941 40.450 7.910   1.00 40.62  ? 173 LEU B CD1   1 
ATOM   3379 C  CD2   . LEU B 1  176 ? -24.006 40.771 9.465   1.00 41.55  ? 173 LEU B CD2   1 
ATOM   3380 N  N     . THR B 1  177 ? -22.773 41.945 4.859   1.00 43.08  ? 174 THR B N     1 
ATOM   3381 C  CA    . THR B 1  177 ? -22.744 43.370 4.552   1.00 43.21  ? 174 THR B CA    1 
ATOM   3382 C  C     . THR B 1  177 ? -23.137 43.628 3.112   1.00 43.56  ? 174 THR B C     1 
ATOM   3383 O  O     . THR B 1  177 ? -23.146 44.782 2.659   1.00 43.91  ? 174 THR B O     1 
ATOM   3384 C  CB    . THR B 1  177 ? -21.388 43.986 4.800   1.00 42.84  ? 174 THR B CB    1 
ATOM   3385 O  OG1   . THR B 1  177 ? -20.396 43.152 4.208   1.00 43.92  ? 174 THR B OG1   1 
ATOM   3386 C  CG2   . THR B 1  177 ? -21.120 44.083 6.267   1.00 43.14  ? 174 THR B CG2   1 
ATOM   3387 N  N     . SER B 1  178 ? -23.454 42.554 2.392   1.00 43.36  ? 175 SER B N     1 
ATOM   3388 C  CA    . SER B 1  178 ? -24.035 42.686 1.065   1.00 43.37  ? 175 SER B CA    1 
ATOM   3389 C  C     . SER B 1  178 ? -25.571 42.678 1.171   1.00 42.82  ? 175 SER B C     1 
ATOM   3390 O  O     . SER B 1  178 ? -26.282 42.843 0.178   1.00 42.35  ? 175 SER B O     1 
ATOM   3391 C  CB    . SER B 1  178 ? -23.546 41.563 0.174   1.00 43.24  ? 175 SER B CB    1 
ATOM   3392 O  OG    . SER B 1  178 ? -24.345 40.415 0.405   1.00 45.68  ? 175 SER B OG    1 
ATOM   3393 N  N     . ILE B 1  179 ? -26.071 42.476 2.389   1.00 42.63  ? 176 ILE B N     1 
ATOM   3394 C  CA    . ILE B 1  179 ? -27.492 42.630 2.667   1.00 42.02  ? 176 ILE B CA    1 
ATOM   3395 C  C     . ILE B 1  179 ? -27.734 43.943 3.381   1.00 41.55  ? 176 ILE B C     1 
ATOM   3396 O  O     . ILE B 1  179 ? -28.592 44.707 2.967   1.00 42.08  ? 176 ILE B O     1 
ATOM   3397 C  CB    . ILE B 1  179 ? -28.071 41.435 3.438   1.00 42.08  ? 176 ILE B CB    1 
ATOM   3398 C  CG1   . ILE B 1  179 ? -28.212 40.243 2.499   1.00 42.55  ? 176 ILE B CG1   1 
ATOM   3399 C  CG2   . ILE B 1  179 ? -29.430 41.773 4.060   1.00 41.11  ? 176 ILE B CG2   1 
ATOM   3400 C  CD1   . ILE B 1  179 ? -28.309 38.888 3.254   1.00 48.97  ? 176 ILE B CD1   1 
ATOM   3401 N  N     . ALA B 1  180 ? -26.989 44.219 4.439   1.00 41.39  ? 177 ALA B N     1 
ATOM   3402 C  CA    . ALA B 1  180 ? -27.116 45.509 5.133   1.00 41.70  ? 177 ALA B CA    1 
ATOM   3403 C  C     . ALA B 1  180 ? -25.823 45.839 5.828   1.00 41.78  ? 177 ALA B C     1 
ATOM   3404 O  O     . ALA B 1  180 ? -25.136 44.933 6.295   1.00 41.93  ? 177 ALA B O     1 
ATOM   3405 C  CB    . ALA B 1  180 ? -28.256 45.485 6.140   1.00 41.87  ? 177 ALA B CB    1 
ATOM   3406 N  N     . ILE B 1  181 ? -25.498 47.126 5.897   1.00 41.80  ? 178 ILE B N     1 
ATOM   3407 C  CA    . ILE B 1  181 ? -24.230 47.569 6.454   1.00 42.56  ? 178 ILE B CA    1 
ATOM   3408 C  C     . ILE B 1  181 ? -24.472 48.328 7.760   1.00 43.18  ? 178 ILE B C     1 
ATOM   3409 O  O     . ILE B 1  181 ? -25.281 49.261 7.783   1.00 43.38  ? 178 ILE B O     1 
ATOM   3410 C  CB    . ILE B 1  181 ? -23.435 48.455 5.452   1.00 42.37  ? 178 ILE B CB    1 
ATOM   3411 C  CG1   . ILE B 1  181 ? -23.180 47.690 4.145   1.00 42.40  ? 178 ILE B CG1   1 
ATOM   3412 C  CG2   . ILE B 1  181 ? -22.131 48.942 6.078   1.00 41.45  ? 178 ILE B CG2   1 
ATOM   3413 C  CD1   . ILE B 1  181 ? -22.551 48.526 3.022   1.00 41.81  ? 178 ILE B CD1   1 
ATOM   3414 N  N     . PRO B 1  182 ? -23.782 47.923 8.852   1.00 43.46  ? 179 PRO B N     1 
ATOM   3415 C  CA    . PRO B 1  182 ? -23.927 48.599 10.140  1.00 43.34  ? 179 PRO B CA    1 
ATOM   3416 C  C     . PRO B 1  182 ? -23.076 49.855 10.193  1.00 43.69  ? 179 PRO B C     1 
ATOM   3417 O  O     . PRO B 1  182 ? -22.042 49.910 9.532   1.00 43.72  ? 179 PRO B O     1 
ATOM   3418 C  CB    . PRO B 1  182 ? -23.391 47.565 11.132  1.00 43.02  ? 179 PRO B CB    1 
ATOM   3419 C  CG    . PRO B 1  182 ? -22.348 46.847 10.373  1.00 43.39  ? 179 PRO B CG    1 
ATOM   3420 C  CD    . PRO B 1  182 ? -22.902 46.739 8.957   1.00 43.42  ? 179 PRO B CD    1 
ATOM   3421 N  N     . LYS B 1  183 ? -23.511 50.857 10.960  1.00 43.73  ? 180 LYS B N     1 
ATOM   3422 C  CA    . LYS B 1  183 ? -22.658 52.014 11.259  1.00 43.69  ? 180 LYS B CA    1 
ATOM   3423 C  C     . LYS B 1  183 ? -21.454 51.616 12.130  1.00 43.71  ? 180 LYS B C     1 
ATOM   3424 O  O     . LYS B 1  183 ? -20.336 52.089 11.943  1.00 43.31  ? 180 LYS B O     1 
ATOM   3425 C  CB    . LYS B 1  183 ? -23.467 53.100 11.961  1.00 43.59  ? 180 LYS B CB    1 
ATOM   3426 C  CG    . LYS B 1  183 ? -24.588 53.648 11.105  1.00 44.98  ? 180 LYS B CG    1 
ATOM   3427 C  CD    . LYS B 1  183 ? -25.417 54.744 11.779  1.00 45.80  ? 180 LYS B CD    1 
ATOM   3428 C  CE    . LYS B 1  183 ? -26.417 55.282 10.751  1.00 49.01  ? 180 LYS B CE    1 
ATOM   3429 N  NZ    . LYS B 1  183 ? -27.440 56.215 11.305  1.00 50.90  ? 180 LYS B NZ    1 
ATOM   3430 N  N     . VAL B 1  184 ? -21.699 50.740 13.100  1.00 44.11  ? 181 VAL B N     1 
ATOM   3431 C  CA    . VAL B 1  184 ? -20.681 50.377 14.072  1.00 43.66  ? 181 VAL B CA    1 
ATOM   3432 C  C     . VAL B 1  184 ? -20.724 48.881 14.271  1.00 43.96  ? 181 VAL B C     1 
ATOM   3433 O  O     . VAL B 1  184 ? -21.811 48.301 14.370  1.00 43.87  ? 181 VAL B O     1 
ATOM   3434 C  CB    . VAL B 1  184 ? -20.933 51.035 15.447  1.00 43.60  ? 181 VAL B CB    1 
ATOM   3435 C  CG1   . VAL B 1  184 ? -19.942 50.490 16.462  1.00 43.43  ? 181 VAL B CG1   1 
ATOM   3436 C  CG2   . VAL B 1  184 ? -20.878 52.570 15.361  1.00 41.53  ? 181 VAL B CG2   1 
ATOM   3437 N  N     . ILE B 1  185 ? -19.539 48.268 14.307  1.00 43.99  ? 182 ILE B N     1 
ATOM   3438 C  CA    . ILE B 1  185 ? -19.379 46.890 14.758  1.00 43.96  ? 182 ILE B CA    1 
ATOM   3439 C  C     . ILE B 1  185 ? -18.706 46.917 16.140  1.00 44.62  ? 182 ILE B C     1 
ATOM   3440 O  O     . ILE B 1  185 ? -17.647 47.533 16.307  1.00 45.07  ? 182 ILE B O     1 
ATOM   3441 C  CB    . ILE B 1  185 ? -18.542 46.052 13.761  1.00 43.51  ? 182 ILE B CB    1 
ATOM   3442 C  CG1   . ILE B 1  185 ? -19.311 45.861 12.457  1.00 42.89  ? 182 ILE B CG1   1 
ATOM   3443 C  CG2   . ILE B 1  185 ? -18.158 44.695 14.358  1.00 42.25  ? 182 ILE B CG2   1 
ATOM   3444 C  CD1   . ILE B 1  185 ? -18.537 45.105 11.382  1.00 42.13  ? 182 ILE B CD1   1 
ATOM   3445 N  N     . HIS B 1  186 ? -19.327 46.270 17.124  1.00 44.99  ? 183 HIS B N     1 
ATOM   3446 C  CA    . HIS B 1  186 ? -18.728 46.116 18.448  1.00 45.99  ? 183 HIS B CA    1 
ATOM   3447 C  C     . HIS B 1  186 ? -18.169 44.715 18.636  1.00 46.41  ? 183 HIS B C     1 
ATOM   3448 O  O     . HIS B 1  186 ? -18.786 43.719 18.234  1.00 47.06  ? 183 HIS B O     1 
ATOM   3449 C  CB    . HIS B 1  186 ? -19.734 46.418 19.570  1.00 46.12  ? 183 HIS B CB    1 
ATOM   3450 C  CG    . HIS B 1  186 ? -19.172 46.217 20.948  1.00 47.21  ? 183 HIS B CG    1 
ATOM   3451 N  ND1   . HIS B 1  186 ? -18.778 47.266 21.756  1.00 47.02  ? 183 HIS B ND1   1 
ATOM   3452 C  CD2   . HIS B 1  186 ? -18.911 45.081 21.648  1.00 46.91  ? 183 HIS B CD2   1 
ATOM   3453 C  CE1   . HIS B 1  186 ? -18.309 46.785 22.895  1.00 47.27  ? 183 HIS B CE1   1 
ATOM   3454 N  NE2   . HIS B 1  186 ? -18.379 45.463 22.854  1.00 47.01  ? 183 HIS B NE2   1 
ATOM   3455 N  N     . SER B 1  187 ? -17.006 44.630 19.266  1.00 46.90  ? 184 SER B N     1 
ATOM   3456 C  CA    . SER B 1  187 ? -16.431 43.323 19.581  1.00 47.46  ? 184 SER B CA    1 
ATOM   3457 C  C     . SER B 1  187 ? -15.532 43.454 20.784  1.00 47.50  ? 184 SER B C     1 
ATOM   3458 O  O     . SER B 1  187 ? -15.159 44.576 21.167  1.00 46.94  ? 184 SER B O     1 
ATOM   3459 C  CB    . SER B 1  187 ? -15.613 42.768 18.392  1.00 47.71  ? 184 SER B CB    1 
ATOM   3460 O  OG    . SER B 1  187 ? -14.458 43.566 18.123  1.00 46.87  ? 184 SER B OG    1 
ATOM   3461 N  N     . ASP B 1  188 ? -15.171 42.303 21.355  1.00 47.69  ? 185 ASP B N     1 
ATOM   3462 C  CA    . ASP B 1  188 ? -14.047 42.242 22.274  1.00 48.69  ? 185 ASP B CA    1 
ATOM   3463 C  C     . ASP B 1  188 ? -12.738 42.427 21.486  1.00 49.48  ? 185 ASP B C     1 
ATOM   3464 O  O     . ASP B 1  188 ? -12.763 42.771 20.286  1.00 49.94  ? 185 ASP B O     1 
ATOM   3465 C  CB    . ASP B 1  188 ? -14.054 40.935 23.048  1.00 48.46  ? 185 ASP B CB    1 
ATOM   3466 C  CG    . ASP B 1  188 ? -13.825 39.738 22.171  1.00 49.36  ? 185 ASP B CG    1 
ATOM   3467 O  OD1   . ASP B 1  188 ? -14.166 38.614 22.610  1.00 49.83  ? 185 ASP B OD1   1 
ATOM   3468 O  OD2   . ASP B 1  188 ? -13.295 39.908 21.050  1.00 50.23  ? 185 ASP B OD2   1 
ATOM   3469 N  N     . GLN B 1  189 ? -11.601 42.198 22.132  1.00 49.85  ? 186 GLN B N     1 
ATOM   3470 C  CA    . GLN B 1  189 ? -10.324 42.436 21.465  1.00 50.57  ? 186 GLN B CA    1 
ATOM   3471 C  C     . GLN B 1  189 ? -9.701  41.169 20.904  1.00 50.93  ? 186 GLN B C     1 
ATOM   3472 O  O     . GLN B 1  189 ? -8.503  40.973 21.003  1.00 51.42  ? 186 GLN B O     1 
ATOM   3473 C  CB    . GLN B 1  189 ? -9.367  43.189 22.383  1.00 50.44  ? 186 GLN B CB    1 
ATOM   3474 C  CG    . GLN B 1  189 ? -10.003 44.449 22.948  1.00 51.11  ? 186 GLN B CG    1 
ATOM   3475 C  CD    . GLN B 1  189 ? -9.058  45.609 22.942  1.00 52.97  ? 186 GLN B CD    1 
ATOM   3476 O  OE1   . GLN B 1  189 ? -7.860  45.423 22.754  1.00 55.90  ? 186 GLN B OE1   1 
ATOM   3477 N  NE2   . GLN B 1  189 ? -9.581  46.823 23.127  1.00 52.17  ? 186 GLN B NE2   1 
ATOM   3478 N  N     . GLY B 1  190 ? -10.528 40.313 20.308  1.00 51.54  ? 187 GLY B N     1 
ATOM   3479 C  CA    . GLY B 1  190 ? -10.054 39.116 19.614  1.00 52.04  ? 187 GLY B CA    1 
ATOM   3480 C  C     . GLY B 1  190 ? -9.056  39.458 18.518  1.00 52.49  ? 187 GLY B C     1 
ATOM   3481 O  O     . GLY B 1  190 ? -9.090  40.555 17.946  1.00 52.28  ? 187 GLY B O     1 
ATOM   3482 N  N     . ALA B 1  191 ? -8.153  38.524 18.235  1.00 52.71  ? 188 ALA B N     1 
ATOM   3483 C  CA    . ALA B 1  191 ? -7.092  38.772 17.271  1.00 53.09  ? 188 ALA B CA    1 
ATOM   3484 C  C     . ALA B 1  191 ? -7.672  39.129 15.903  1.00 53.28  ? 188 ALA B C     1 
ATOM   3485 O  O     . ALA B 1  191 ? -7.234  40.089 15.268  1.00 53.69  ? 188 ALA B O     1 
ATOM   3486 C  CB    . ALA B 1  191 ? -6.196  37.578 17.168  1.00 53.18  ? 188 ALA B CB    1 
ATOM   3487 N  N     . ALA B 1  192 ? -8.677  38.363 15.481  1.00 53.05  ? 189 ALA B N     1 
ATOM   3488 C  CA    . ALA B 1  192 ? -9.372  38.580 14.219  1.00 52.63  ? 189 ALA B CA    1 
ATOM   3489 C  C     . ALA B 1  192 ? -9.982  39.965 14.117  1.00 52.55  ? 189 ALA B C     1 
ATOM   3490 O  O     . ALA B 1  192 ? -10.092 40.479 13.015  1.00 53.20  ? 189 ALA B O     1 
ATOM   3491 C  CB    . ALA B 1  192 ? -10.444 37.534 14.012  1.00 52.49  ? 189 ALA B CB    1 
ATOM   3492 N  N     . PHE B 1  193 ? -10.366 40.579 15.240  1.00 51.92  ? 190 PHE B N     1 
ATOM   3493 C  CA    . PHE B 1  193 ? -11.070 41.868 15.172  1.00 51.15  ? 190 PHE B CA    1 
ATOM   3494 C  C     . PHE B 1  193 ? -10.159 43.058 15.348  1.00 51.49  ? 190 PHE B C     1 
ATOM   3495 O  O     . PHE B 1  193 ? -10.534 44.179 14.996  1.00 52.01  ? 190 PHE B O     1 
ATOM   3496 C  CB    . PHE B 1  193 ? -12.253 41.956 16.151  1.00 50.28  ? 190 PHE B CB    1 
ATOM   3497 C  CG    . PHE B 1  193 ? -13.110 40.738 16.166  1.00 48.34  ? 190 PHE B CG    1 
ATOM   3498 C  CD1   . PHE B 1  193 ? -13.499 40.122 14.978  1.00 46.96  ? 190 PHE B CD1   1 
ATOM   3499 C  CD2   . PHE B 1  193 ? -13.540 40.202 17.362  1.00 47.37  ? 190 PHE B CD2   1 
ATOM   3500 C  CE1   . PHE B 1  193 ? -14.282 38.973 14.991  1.00 46.71  ? 190 PHE B CE1   1 
ATOM   3501 C  CE2   . PHE B 1  193 ? -14.324 39.040 17.384  1.00 47.10  ? 190 PHE B CE2   1 
ATOM   3502 C  CZ    . PHE B 1  193 ? -14.690 38.424 16.199  1.00 45.77  ? 190 PHE B CZ    1 
ATOM   3503 N  N     . THR B 1  194 ? -8.970  42.830 15.892  1.00 51.49  ? 191 THR B N     1 
ATOM   3504 C  CA    . THR B 1  194 ? -8.039  43.947 16.114  1.00 51.77  ? 191 THR B CA    1 
ATOM   3505 C  C     . THR B 1  194 ? -6.916  44.036 15.067  1.00 51.63  ? 191 THR B C     1 
ATOM   3506 O  O     . THR B 1  194 ? -6.118  44.964 15.112  1.00 52.15  ? 191 THR B O     1 
ATOM   3507 C  CB    . THR B 1  194 ? -7.454  43.970 17.546  1.00 51.36  ? 191 THR B CB    1 
ATOM   3508 O  OG1   . THR B 1  194 ? -6.995  42.665 17.903  1.00 52.29  ? 191 THR B OG1   1 
ATOM   3509 C  CG2   . THR B 1  194 ? -8.507  44.378 18.523  1.00 51.88  ? 191 THR B CG2   1 
ATOM   3510 N  N     . SER B 1  195 ? -6.876  43.091 14.124  1.00 51.27  ? 192 SER B N     1 
ATOM   3511 C  CA    . SER B 1  195 ? -5.922  43.128 13.016  1.00 51.00  ? 192 SER B CA    1 
ATOM   3512 C  C     . SER B 1  195 ? -6.131  44.374 12.170  1.00 51.19  ? 192 SER B C     1 
ATOM   3513 O  O     . SER B 1  195 ? -7.253  44.908 12.088  1.00 51.87  ? 192 SER B O     1 
ATOM   3514 C  CB    . SER B 1  195 ? -6.033  41.865 12.150  1.00 50.91  ? 192 SER B CB    1 
ATOM   3515 O  OG    . SER B 1  195 ? -7.246  41.820 11.424  1.00 50.29  ? 192 SER B OG    1 
ATOM   3516 N  N     . SER B 1  196 ? -5.060  44.849 11.547  1.00 50.87  ? 193 SER B N     1 
ATOM   3517 C  CA    . SER B 1  196 ? -5.168  46.019 10.674  1.00 50.84  ? 193 SER B CA    1 
ATOM   3518 C  C     . SER B 1  196 ? -5.879  45.696 9.334   1.00 50.27  ? 193 SER B C     1 
ATOM   3519 O  O     . SER B 1  196 ? -6.489  46.578 8.724   1.00 49.65  ? 193 SER B O     1 
ATOM   3520 C  CB    . SER B 1  196 ? -3.789  46.662 10.451  1.00 51.10  ? 193 SER B CB    1 
ATOM   3521 O  OG    . SER B 1  196 ? -2.906  45.719 9.864   1.00 51.64  ? 193 SER B OG    1 
ATOM   3522 N  N     . THR B 1  197 ? -5.804  44.443 8.894   1.00 49.68  ? 194 THR B N     1 
ATOM   3523 C  CA    . THR B 1  197 ? -6.616  44.010 7.771   1.00 50.41  ? 194 THR B CA    1 
ATOM   3524 C  C     . THR B 1  197 ? -8.081  44.240 8.087   1.00 50.12  ? 194 THR B C     1 
ATOM   3525 O  O     . THR B 1  197 ? -8.754  44.938 7.330   1.00 50.11  ? 194 THR B O     1 
ATOM   3526 C  CB    . THR B 1  197 ? -6.442  42.527 7.411   1.00 50.79  ? 194 THR B CB    1 
ATOM   3527 O  OG1   . THR B 1  197 ? -5.064  42.167 7.493   1.00 53.41  ? 194 THR B OG1   1 
ATOM   3528 C  CG2   . THR B 1  197 ? -6.938  42.242 6.009   1.00 50.30  ? 194 THR B CG2   1 
ATOM   3529 N  N     . PHE B 1  198 ? -8.567  43.685 9.202   1.00 49.84  ? 195 PHE B N     1 
ATOM   3530 C  CA    . PHE B 1  198 ? -9.956  43.921 9.590   1.00 49.67  ? 195 PHE B CA    1 
ATOM   3531 C  C     . PHE B 1  198 ? -10.265 45.396 9.740   1.00 49.94  ? 195 PHE B C     1 
ATOM   3532 O  O     . PHE B 1  198 ? -11.350 45.815 9.418   1.00 49.73  ? 195 PHE B O     1 
ATOM   3533 C  CB    . PHE B 1  198 ? -10.395 43.146 10.833  1.00 49.52  ? 195 PHE B CB    1 
ATOM   3534 C  CG    . PHE B 1  198 ? -11.902 43.141 11.044  1.00 48.62  ? 195 PHE B CG    1 
ATOM   3535 C  CD1   . PHE B 1  198 ? -12.745 42.420 10.188  1.00 48.97  ? 195 PHE B CD1   1 
ATOM   3536 C  CD2   . PHE B 1  198 ? -12.480 43.850 12.082  1.00 47.59  ? 195 PHE B CD2   1 
ATOM   3537 C  CE1   . PHE B 1  198 ? -14.140 42.405 10.367  1.00 45.95  ? 195 PHE B CE1   1 
ATOM   3538 C  CE2   . PHE B 1  198 ? -13.869 43.849 12.255  1.00 47.61  ? 195 PHE B CE2   1 
ATOM   3539 C  CZ    . PHE B 1  198 ? -14.690 43.113 11.391  1.00 46.73  ? 195 PHE B CZ    1 
ATOM   3540 N  N     . ALA B 1  199 ? -9.307  46.190 10.193  1.00 51.02  ? 196 ALA B N     1 
ATOM   3541 C  CA    . ALA B 1  199 ? -9.504  47.641 10.238  1.00 52.13  ? 196 ALA B CA    1 
ATOM   3542 C  C     . ALA B 1  199 ? -9.620  48.272 8.833   1.00 53.22  ? 196 ALA B C     1 
ATOM   3543 O  O     . ALA B 1  199 ? -10.486 49.137 8.611   1.00 53.48  ? 196 ALA B O     1 
ATOM   3544 C  CB    . ALA B 1  199 ? -8.415  48.316 11.067  1.00 51.59  ? 196 ALA B CB    1 
ATOM   3545 N  N     . GLU B 1  200 ? -8.772  47.844 7.887   1.00 54.42  ? 197 GLU B N     1 
ATOM   3546 C  CA    . GLU B 1  200 ? -8.885  48.316 6.493   1.00 55.47  ? 197 GLU B CA    1 
ATOM   3547 C  C     . GLU B 1  200 ? -10.296 48.056 5.954   1.00 54.80  ? 197 GLU B C     1 
ATOM   3548 O  O     . GLU B 1  200 ? -10.975 48.974 5.461   1.00 54.14  ? 197 GLU B O     1 
ATOM   3549 C  CB    . GLU B 1  200 ? -7.861  47.642 5.567   1.00 56.15  ? 197 GLU B CB    1 
ATOM   3550 C  CG    . GLU B 1  200 ? -6.407  48.128 5.695   1.00 62.18  ? 197 GLU B CG    1 
ATOM   3551 C  CD    . GLU B 1  200 ? -6.242  49.670 5.617   1.00 70.30  ? 197 GLU B CD    1 
ATOM   3552 O  OE1   . GLU B 1  200 ? -7.084  50.368 4.970   1.00 71.74  ? 197 GLU B OE1   1 
ATOM   3553 O  OE2   . GLU B 1  200 ? -5.247  50.178 6.211   1.00 73.33  ? 197 GLU B OE2   1 
ATOM   3554 N  N     . TRP B 1  201 ? -10.715 46.795 6.079   1.00 54.16  ? 198 TRP B N     1 
ATOM   3555 C  CA    . TRP B 1  201 ? -11.987 46.327 5.594   1.00 53.81  ? 198 TRP B CA    1 
ATOM   3556 C  C     . TRP B 1  201 ? -13.127 47.209 6.076   1.00 53.90  ? 198 TRP B C     1 
ATOM   3557 O  O     . TRP B 1  201 ? -13.981 47.630 5.291   1.00 54.15  ? 198 TRP B O     1 
ATOM   3558 C  CB    . TRP B 1  201 ? -12.208 44.904 6.061   1.00 53.81  ? 198 TRP B CB    1 
ATOM   3559 C  CG    . TRP B 1  201 ? -13.521 44.363 5.630   1.00 54.58  ? 198 TRP B CG    1 
ATOM   3560 C  CD1   . TRP B 1  201 ? -13.807 43.783 4.437   1.00 55.14  ? 198 TRP B CD1   1 
ATOM   3561 C  CD2   . TRP B 1  201 ? -14.734 44.355 6.384   1.00 54.66  ? 198 TRP B CD2   1 
ATOM   3562 N  NE1   . TRP B 1  201 ? -15.115 43.399 4.398   1.00 55.75  ? 198 TRP B NE1   1 
ATOM   3563 C  CE2   . TRP B 1  201 ? -15.716 43.747 5.580   1.00 55.57  ? 198 TRP B CE2   1 
ATOM   3564 C  CE3   . TRP B 1  201 ? -15.087 44.795 7.665   1.00 54.34  ? 198 TRP B CE3   1 
ATOM   3565 C  CZ2   . TRP B 1  201 ? -17.043 43.566 6.014   1.00 55.24  ? 198 TRP B CZ2   1 
ATOM   3566 C  CZ3   . TRP B 1  201 ? -16.404 44.618 8.094   1.00 55.00  ? 198 TRP B CZ3   1 
ATOM   3567 C  CH2   . TRP B 1  201 ? -17.364 44.007 7.268   1.00 54.12  ? 198 TRP B CH2   1 
ATOM   3568 N  N     . ALA B 1  202 ? -13.143 47.488 7.373   1.00 53.66  ? 199 ALA B N     1 
ATOM   3569 C  CA    . ALA B 1  202 ? -14.195 48.301 7.940   1.00 53.43  ? 199 ALA B CA    1 
ATOM   3570 C  C     . ALA B 1  202 ? -14.112 49.726 7.422   1.00 53.50  ? 199 ALA B C     1 
ATOM   3571 O  O     . ALA B 1  202 ? -15.125 50.317 7.069   1.00 53.47  ? 199 ALA B O     1 
ATOM   3572 C  CB    . ALA B 1  202 ? -14.132 48.267 9.437   1.00 53.06  ? 199 ALA B CB    1 
ATOM   3573 N  N     . LYS B 1  203 ? -12.904 50.273 7.373   1.00 54.02  ? 200 LYS B N     1 
ATOM   3574 C  CA    . LYS B 1  203 ? -12.716 51.637 6.910   1.00 54.83  ? 200 LYS B CA    1 
ATOM   3575 C  C     . LYS B 1  203 ? -13.222 51.803 5.479   1.00 54.82  ? 200 LYS B C     1 
ATOM   3576 O  O     . LYS B 1  203 ? -13.858 52.812 5.162   1.00 54.90  ? 200 LYS B O     1 
ATOM   3577 C  CB    . LYS B 1  203 ? -11.249 52.035 7.008   1.00 55.13  ? 200 LYS B CB    1 
ATOM   3578 C  CG    . LYS B 1  203 ? -10.983 53.508 6.754   1.00 57.48  ? 200 LYS B CG    1 
ATOM   3579 C  CD    . LYS B 1  203 ? -9.501  53.829 6.958   1.00 63.05  ? 200 LYS B CD    1 
ATOM   3580 C  CE    . LYS B 1  203 ? -9.143  55.236 6.446   1.00 65.91  ? 200 LYS B CE    1 
ATOM   3581 N  NZ    . LYS B 1  203 ? -7.728  55.590 6.778   1.00 67.74  ? 200 LYS B NZ    1 
ATOM   3582 N  N     . GLU B 1  204 ? -12.942 50.810 4.631   1.00 54.81  ? 201 GLU B N     1 
ATOM   3583 C  CA    . GLU B 1  204 ? -13.414 50.806 3.254   1.00 55.22  ? 201 GLU B CA    1 
ATOM   3584 C  C     . GLU B 1  204 ? -14.936 50.915 3.204   1.00 54.87  ? 201 GLU B C     1 
ATOM   3585 O  O     . GLU B 1  204 ? -15.493 51.564 2.324   1.00 55.28  ? 201 GLU B O     1 
ATOM   3586 C  CB    . GLU B 1  204 ? -13.004 49.524 2.543   1.00 55.49  ? 201 GLU B CB    1 
ATOM   3587 C  CG    . GLU B 1  204 ? -11.661 49.535 1.848   1.00 58.48  ? 201 GLU B CG    1 
ATOM   3588 C  CD    . GLU B 1  204 ? -11.168 48.103 1.548   1.00 64.00  ? 201 GLU B CD    1 
ATOM   3589 O  OE1   . GLU B 1  204 ? -12.017 47.170 1.508   1.00 65.99  ? 201 GLU B OE1   1 
ATOM   3590 O  OE2   . GLU B 1  204 ? -9.936  47.898 1.375   1.00 65.38  ? 201 GLU B OE2   1 
ATOM   3591 N  N     . ARG B 1  205 ? -15.620 50.278 4.143   1.00 54.01  ? 202 ARG B N     1 
ATOM   3592 C  CA    . ARG B 1  205 ? -17.072 50.283 4.100   1.00 52.88  ? 202 ARG B CA    1 
ATOM   3593 C  C     . ARG B 1  205 ? -17.697 51.383 4.947   1.00 52.49  ? 202 ARG B C     1 
ATOM   3594 O  O     . ARG B 1  205 ? -18.922 51.433 5.076   1.00 52.22  ? 202 ARG B O     1 
ATOM   3595 C  CB    . ARG B 1  205 ? -17.602 48.916 4.485   1.00 52.73  ? 202 ARG B CB    1 
ATOM   3596 C  CG    . ARG B 1  205 ? -17.463 47.917 3.380   1.00 53.03  ? 202 ARG B CG    1 
ATOM   3597 C  CD    . ARG B 1  205 ? -17.317 46.535 3.928   1.00 54.66  ? 202 ARG B CD    1 
ATOM   3598 N  NE    . ARG B 1  205 ? -16.818 45.587 2.936   1.00 55.76  ? 202 ARG B NE    1 
ATOM   3599 C  CZ    . ARG B 1  205 ? -15.614 45.646 2.374   1.00 55.38  ? 202 ARG B CZ    1 
ATOM   3600 N  NH1   . ARG B 1  205 ? -14.764 46.627 2.672   1.00 54.81  ? 202 ARG B NH1   1 
ATOM   3601 N  NH2   . ARG B 1  205 ? -15.264 44.712 1.505   1.00 55.33  ? 202 ARG B NH2   1 
ATOM   3602 N  N     . GLY B 1  206 ? -16.863 52.275 5.493   1.00 51.93  ? 203 GLY B N     1 
ATOM   3603 C  CA    . GLY B 1  206 ? -17.338 53.380 6.333   1.00 51.33  ? 203 GLY B CA    1 
ATOM   3604 C  C     . GLY B 1  206 ? -17.928 52.904 7.654   1.00 51.25  ? 203 GLY B C     1 
ATOM   3605 O  O     . GLY B 1  206 ? -18.801 53.560 8.217   1.00 51.23  ? 203 GLY B O     1 
ATOM   3606 N  N     . ILE B 1  207 ? -17.448 51.762 8.144   1.00 50.84  ? 204 ILE B N     1 
ATOM   3607 C  CA    . ILE B 1  207 ? -17.914 51.178 9.399   1.00 50.71  ? 204 ILE B CA    1 
ATOM   3608 C  C     . ILE B 1  207 ? -16.989 51.545 10.561  1.00 51.77  ? 204 ILE B C     1 
ATOM   3609 O  O     . ILE B 1  207 ? -15.807 51.213 10.538  1.00 51.91  ? 204 ILE B O     1 
ATOM   3610 C  CB    . ILE B 1  207 ? -17.952 49.639 9.307   1.00 50.12  ? 204 ILE B CB    1 
ATOM   3611 C  CG1   . ILE B 1  207 ? -18.936 49.175 8.225   1.00 48.84  ? 204 ILE B CG1   1 
ATOM   3612 C  CG2   . ILE B 1  207 ? -18.278 49.027 10.660  1.00 48.98  ? 204 ILE B CG2   1 
ATOM   3613 C  CD1   . ILE B 1  207 ? -18.876 47.673 7.946   1.00 46.02  ? 204 ILE B CD1   1 
ATOM   3614 N  N     . HIS B 1  208 ? -17.513 52.195 11.592  1.00 52.78  ? 205 HIS B N     1 
ATOM   3615 C  CA    . HIS B 1  208 ? -16.703 52.450 12.779  1.00 53.76  ? 205 HIS B CA    1 
ATOM   3616 C  C     . HIS B 1  208 ? -16.540 51.191 13.629  1.00 53.27  ? 205 HIS B C     1 
ATOM   3617 O  O     . HIS B 1  208 ? -17.517 50.522 13.967  1.00 53.57  ? 205 HIS B O     1 
ATOM   3618 C  CB    . HIS B 1  208 ? -17.266 53.611 13.614  1.00 54.66  ? 205 HIS B CB    1 
ATOM   3619 C  CG    . HIS B 1  208 ? -16.518 53.834 14.894  1.00 59.21  ? 205 HIS B CG    1 
ATOM   3620 N  ND1   . HIS B 1  208 ? -15.353 54.576 14.959  1.00 63.84  ? 205 HIS B ND1   1 
ATOM   3621 C  CD2   . HIS B 1  208 ? -16.737 53.369 16.148  1.00 61.96  ? 205 HIS B CD2   1 
ATOM   3622 C  CE1   . HIS B 1  208 ? -14.894 54.567 16.200  1.00 64.51  ? 205 HIS B CE1   1 
ATOM   3623 N  NE2   . HIS B 1  208 ? -15.714 53.840 16.941  1.00 64.77  ? 205 HIS B NE2   1 
ATOM   3624 N  N     . LEU B 1  209 ? -15.298 50.867 13.969  1.00 53.34  ? 206 LEU B N     1 
ATOM   3625 C  CA    . LEU B 1  209 ? -15.000 49.725 14.850  1.00 53.28  ? 206 LEU B CA    1 
ATOM   3626 C  C     . LEU B 1  209 ? -14.981 50.099 16.325  1.00 53.84  ? 206 LEU B C     1 
ATOM   3627 O  O     . LEU B 1  209 ? -14.492 51.175 16.689  1.00 54.18  ? 206 LEU B O     1 
ATOM   3628 C  CB    . LEU B 1  209 ? -13.666 49.083 14.489  1.00 52.69  ? 206 LEU B CB    1 
ATOM   3629 C  CG    . LEU B 1  209 ? -13.618 48.251 13.215  1.00 51.65  ? 206 LEU B CG    1 
ATOM   3630 C  CD1   . LEU B 1  209 ? -12.415 47.367 13.277  1.00 49.05  ? 206 LEU B CD1   1 
ATOM   3631 C  CD2   . LEU B 1  209 ? -14.894 47.417 13.020  1.00 50.45  ? 206 LEU B CD2   1 
ATOM   3632 N  N     . GLU B 1  210 ? -15.507 49.206 17.165  1.00 54.38  ? 207 GLU B N     1 
ATOM   3633 C  CA    . GLU B 1  210 ? -15.639 49.474 18.596  1.00 54.88  ? 207 GLU B CA    1 
ATOM   3634 C  C     . GLU B 1  210 ? -15.262 48.282 19.453  1.00 54.97  ? 207 GLU B C     1 
ATOM   3635 O  O     . GLU B 1  210 ? -15.745 47.166 19.258  1.00 54.59  ? 207 GLU B O     1 
ATOM   3636 C  CB    . GLU B 1  210 ? -17.053 49.923 18.939  1.00 55.11  ? 207 GLU B CB    1 
ATOM   3637 C  CG    . GLU B 1  210 ? -17.198 50.466 20.347  1.00 55.80  ? 207 GLU B CG    1 
ATOM   3638 C  CD    . GLU B 1  210 ? -18.651 50.611 20.760  1.00 57.04  ? 207 GLU B CD    1 
ATOM   3639 O  OE1   . GLU B 1  210 ? -19.095 51.771 20.816  1.00 57.31  ? 207 GLU B OE1   1 
ATOM   3640 O  OE2   . GLU B 1  210 ? -19.347 49.584 21.003  1.00 56.09  ? 207 GLU B OE2   1 
ATOM   3641 N  N     . PHE B 1  211 ? -14.405 48.550 20.427  1.00 55.68  ? 208 PHE B N     1 
ATOM   3642 C  CA    . PHE B 1  211 ? -13.844 47.512 21.260  1.00 56.34  ? 208 PHE B CA    1 
ATOM   3643 C  C     . PHE B 1  211 ? -14.198 47.690 22.722  1.00 57.31  ? 208 PHE B C     1 
ATOM   3644 O  O     . PHE B 1  211 ? -14.144 48.801 23.264  1.00 57.48  ? 208 PHE B O     1 
ATOM   3645 C  CB    . PHE B 1  211 ? -12.333 47.471 21.083  1.00 55.93  ? 208 PHE B CB    1 
ATOM   3646 C  CG    . PHE B 1  211 ? -11.918 47.264 19.673  1.00 55.80  ? 208 PHE B CG    1 
ATOM   3647 C  CD1   . PHE B 1  211 ? -12.014 45.996 19.089  1.00 55.17  ? 208 PHE B CD1   1 
ATOM   3648 C  CD2   . PHE B 1  211 ? -11.467 48.341 18.901  1.00 55.01  ? 208 PHE B CD2   1 
ATOM   3649 C  CE1   . PHE B 1  211 ? -11.650 45.798 17.756  1.00 54.35  ? 208 PHE B CE1   1 
ATOM   3650 C  CE2   . PHE B 1  211 ? -11.100 48.154 17.578  1.00 54.06  ? 208 PHE B CE2   1 
ATOM   3651 C  CZ    . PHE B 1  211 ? -11.192 46.879 17.003  1.00 54.01  ? 208 PHE B CZ    1 
ATOM   3652 N  N     . SER B 1  212 ? -14.589 46.580 23.335  1.00 58.30  ? 209 SER B N     1 
ATOM   3653 C  CA    . SER B 1  212 ? -14.722 46.502 24.760  1.00 59.70  ? 209 SER B CA    1 
ATOM   3654 C  C     . SER B 1  212 ? -13.306 46.381 25.306  1.00 61.08  ? 209 SER B C     1 
ATOM   3655 O  O     . SER B 1  212 ? -12.473 45.726 24.696  1.00 61.01  ? 209 SER B O     1 
ATOM   3656 C  CB    . SER B 1  212 ? -15.571 45.285 25.134  1.00 59.61  ? 209 SER B CB    1 
ATOM   3657 O  OG    . SER B 1  212 ? -14.910 44.061 24.851  1.00 58.92  ? 209 SER B OG    1 
ATOM   3658 N  N     . THR B 1  213 ? -13.030 47.022 26.442  1.00 63.24  ? 210 THR B N     1 
ATOM   3659 C  CA    . THR B 1  213 ? -11.710 46.936 27.097  1.00 64.90  ? 210 THR B CA    1 
ATOM   3660 C  C     . THR B 1  213 ? -11.377 45.469 27.436  1.00 65.89  ? 210 THR B C     1 
ATOM   3661 O  O     . THR B 1  213 ? -12.288 44.668 27.665  1.00 65.92  ? 210 THR B O     1 
ATOM   3662 C  CB    . THR B 1  213 ? -11.580 47.891 28.338  1.00 64.94  ? 210 THR B CB    1 
ATOM   3663 O  OG1   . THR B 1  213 ? -12.359 47.400 29.432  1.00 65.84  ? 210 THR B OG1   1 
ATOM   3664 C  CG2   . THR B 1  213 ? -12.033 49.323 27.992  1.00 65.11  ? 210 THR B CG2   1 
ATOM   3665 N  N     . PRO B 1  214 ? -10.080 45.095 27.409  1.00 67.21  ? 211 PRO B N     1 
ATOM   3666 C  CA    . PRO B 1  214 ? -9.769  43.659 27.565  1.00 68.29  ? 211 PRO B CA    1 
ATOM   3667 C  C     . PRO B 1  214 ? -10.227 43.105 28.910  1.00 69.61  ? 211 PRO B C     1 
ATOM   3668 O  O     . PRO B 1  214 ? -10.211 43.814 29.923  1.00 69.56  ? 211 PRO B O     1 
ATOM   3669 C  CB    . PRO B 1  214 ? -8.239  43.593 27.442  1.00 68.01  ? 211 PRO B CB    1 
ATOM   3670 C  CG    . PRO B 1  214 ? -7.826  44.895 26.817  1.00 67.38  ? 211 PRO B CG    1 
ATOM   3671 C  CD    . PRO B 1  214 ? -8.869  45.912 27.180  1.00 67.16  ? 211 PRO B CD    1 
ATOM   3672 N  N     . TYR B 1  215 ? -10.648 41.846 28.895  1.00 71.33  ? 212 TYR B N     1 
ATOM   3673 C  CA    . TYR B 1  215 ? -11.157 41.158 30.086  1.00 73.33  ? 212 TYR B CA    1 
ATOM   3674 C  C     . TYR B 1  215 ? -12.485 41.701 30.637  1.00 74.68  ? 212 TYR B C     1 
ATOM   3675 O  O     . TYR B 1  215 ? -13.073 41.070 31.504  1.00 75.07  ? 212 TYR B O     1 
ATOM   3676 C  CB    . TYR B 1  215 ? -10.083 41.068 31.187  1.00 72.95  ? 212 TYR B CB    1 
ATOM   3677 C  CG    . TYR B 1  215 ? -8.754  40.570 30.672  1.00 72.91  ? 212 TYR B CG    1 
ATOM   3678 C  CD1   . TYR B 1  215 ? -8.571  39.218 30.343  1.00 72.56  ? 212 TYR B CD1   1 
ATOM   3679 C  CD2   . TYR B 1  215 ? -7.680  41.450 30.496  1.00 72.76  ? 212 TYR B CD2   1 
ATOM   3680 C  CE1   . TYR B 1  215 ? -7.346  38.749 29.854  1.00 72.96  ? 212 TYR B CE1   1 
ATOM   3681 C  CE2   . TYR B 1  215 ? -6.442  40.996 30.007  1.00 73.25  ? 212 TYR B CE2   1 
ATOM   3682 C  CZ    . TYR B 1  215 ? -6.280  39.644 29.683  1.00 73.77  ? 212 TYR B CZ    1 
ATOM   3683 O  OH    . TYR B 1  215 ? -5.060  39.189 29.195  1.00 74.54  ? 212 TYR B OH    1 
ATOM   3684 N  N     . HIS B 1  216 ? -12.953 42.848 30.132  1.00 76.32  ? 213 HIS B N     1 
ATOM   3685 C  CA    . HIS B 1  216 ? -14.252 43.426 30.533  1.00 78.24  ? 213 HIS B CA    1 
ATOM   3686 C  C     . HIS B 1  216 ? -15.254 43.562 29.349  1.00 78.24  ? 213 HIS B C     1 
ATOM   3687 O  O     . HIS B 1  216 ? -15.467 44.686 28.834  1.00 78.16  ? 213 HIS B O     1 
ATOM   3688 C  CB    . HIS B 1  216 ? -14.086 44.806 31.232  1.00 79.22  ? 213 HIS B CB    1 
ATOM   3689 C  CG    . HIS B 1  216 ? -13.116 44.820 32.387  1.00 83.71  ? 213 HIS B CG    1 
ATOM   3690 N  ND1   . HIS B 1  216 ? -13.265 44.023 33.509  1.00 86.98  ? 213 HIS B ND1   1 
ATOM   3691 C  CD2   . HIS B 1  216 ? -12.002 45.568 32.604  1.00 86.17  ? 213 HIS B CD2   1 
ATOM   3692 C  CE1   . HIS B 1  216 ? -12.274 44.262 34.353  1.00 88.12  ? 213 HIS B CE1   1 
ATOM   3693 N  NE2   . HIS B 1  216 ? -11.494 45.196 33.828  1.00 88.02  ? 213 HIS B NE2   1 
ATOM   3694 N  N     . PRO B 1  217 ? -15.883 42.435 28.922  1.00 78.23  ? 214 PRO B N     1 
ATOM   3695 C  CA    . PRO B 1  217 ? -16.897 42.516 27.855  1.00 78.27  ? 214 PRO B CA    1 
ATOM   3696 C  C     . PRO B 1  217 ? -18.161 43.296 28.274  1.00 78.18  ? 214 PRO B C     1 
ATOM   3697 O  O     . PRO B 1  217 ? -18.802 42.951 29.275  1.00 78.59  ? 214 PRO B O     1 
ATOM   3698 C  CB    . PRO B 1  217 ? -17.233 41.033 27.568  1.00 78.28  ? 214 PRO B CB    1 
ATOM   3699 C  CG    . PRO B 1  217 ? -16.067 40.255 28.107  1.00 78.33  ? 214 PRO B CG    1 
ATOM   3700 C  CD    . PRO B 1  217 ? -15.649 41.034 29.327  1.00 78.32  ? 214 PRO B CD    1 
ATOM   3701 N  N     . GLN B 1  218 ? -18.489 44.355 27.530  1.00 77.75  ? 215 GLN B N     1 
ATOM   3702 C  CA    . GLN B 1  218 ? -19.727 45.113 27.749  1.00 77.13  ? 215 GLN B CA    1 
ATOM   3703 C  C     . GLN B 1  218 ? -20.508 45.208 26.439  1.00 75.96  ? 215 GLN B C     1 
ATOM   3704 O  O     . GLN B 1  218 ? -20.005 45.716 25.439  1.00 75.81  ? 215 GLN B O     1 
ATOM   3705 C  CB    . GLN B 1  218 ? -19.487 46.499 28.421  1.00 77.51  ? 215 GLN B CB    1 
ATOM   3706 C  CG    . GLN B 1  218 ? -18.402 47.438 27.799  1.00 79.64  ? 215 GLN B CG    1 
ATOM   3707 C  CD    . GLN B 1  218 ? -18.935 48.420 26.710  1.00 82.75  ? 215 GLN B CD    1 
ATOM   3708 O  OE1   . GLN B 1  218 ? -18.187 48.850 25.815  1.00 82.77  ? 215 GLN B OE1   1 
ATOM   3709 N  NE2   . GLN B 1  218 ? -20.223 48.770 26.792  1.00 83.14  ? 215 GLN B NE2   1 
ATOM   3710 N  N     . SER B 1  219 ? -21.724 44.664 26.449  1.00 74.63  ? 216 SER B N     1 
ATOM   3711 C  CA    . SER B 1  219 ? -22.622 44.713 25.297  1.00 72.93  ? 216 SER B CA    1 
ATOM   3712 C  C     . SER B 1  219 ? -23.778 45.627 25.627  1.00 71.42  ? 216 SER B C     1 
ATOM   3713 O  O     . SER B 1  219 ? -23.637 46.851 25.648  1.00 71.07  ? 216 SER B O     1 
ATOM   3714 C  CB    . SER B 1  219 ? -23.164 43.321 24.987  1.00 72.95  ? 216 SER B CB    1 
ATOM   3715 O  OG    . SER B 1  219 ? -22.146 42.349 25.111  1.00 74.94  ? 216 SER B OG    1 
ATOM   3716 N  N     . SER B 1  220 ? -24.928 45.002 25.849  1.00 69.75  ? 217 SER B N     1 
ATOM   3717 C  CA    . SER B 1  220 ? -26.085 45.617 26.473  1.00 68.27  ? 217 SER B CA    1 
ATOM   3718 C  C     . SER B 1  220 ? -26.875 44.450 27.070  1.00 67.33  ? 217 SER B C     1 
ATOM   3719 O  O     . SER B 1  220 ? -26.598 43.284 26.749  1.00 67.18  ? 217 SER B O     1 
ATOM   3720 C  CB    . SER B 1  220 ? -26.914 46.420 25.463  1.00 67.93  ? 217 SER B CB    1 
ATOM   3721 O  OG    . SER B 1  220 ? -27.534 45.574 24.514  1.00 67.66  ? 217 SER B OG    1 
ATOM   3722 N  N     . GLY B 1  221 ? -27.831 44.756 27.947  1.00 66.06  ? 218 GLY B N     1 
ATOM   3723 C  CA    . GLY B 1  221 ? -28.675 43.735 28.547  1.00 64.28  ? 218 GLY B CA    1 
ATOM   3724 C  C     . GLY B 1  221 ? -29.216 42.804 27.491  1.00 63.29  ? 218 GLY B C     1 
ATOM   3725 O  O     . GLY B 1  221 ? -28.995 41.588 27.544  1.00 63.24  ? 218 GLY B O     1 
ATOM   3726 N  N     . LYS B 1  222 ? -29.897 43.399 26.513  1.00 62.45  ? 219 LYS B N     1 
ATOM   3727 C  CA    . LYS B 1  222 ? -30.535 42.684 25.404  1.00 61.64  ? 219 LYS B CA    1 
ATOM   3728 C  C     . LYS B 1  222 ? -29.557 41.755 24.669  1.00 61.09  ? 219 LYS B C     1 
ATOM   3729 O  O     . LYS B 1  222 ? -29.840 40.563 24.448  1.00 60.75  ? 219 LYS B O     1 
ATOM   3730 C  CB    . LYS B 1  222 ? -31.164 43.713 24.457  1.00 61.83  ? 219 LYS B CB    1 
ATOM   3731 C  CG    . LYS B 1  222 ? -32.134 43.178 23.392  1.00 62.24  ? 219 LYS B CG    1 
ATOM   3732 C  CD    . LYS B 1  222 ? -32.978 44.343 22.815  1.00 63.14  ? 219 LYS B CD    1 
ATOM   3733 C  CE    . LYS B 1  222 ? -33.837 43.913 21.632  1.00 63.89  ? 219 LYS B CE    1 
ATOM   3734 N  NZ    . LYS B 1  222 ? -34.650 42.657 21.857  1.00 64.24  ? 219 LYS B NZ    1 
ATOM   3735 N  N     . VAL B 1  223 ? -28.395 42.298 24.323  1.00 60.26  ? 220 VAL B N     1 
ATOM   3736 C  CA    . VAL B 1  223 ? -27.408 41.533 23.582  1.00 59.88  ? 220 VAL B CA    1 
ATOM   3737 C  C     . VAL B 1  223 ? -26.819 40.381 24.405  1.00 60.29  ? 220 VAL B C     1 
ATOM   3738 O  O     . VAL B 1  223 ? -26.717 39.248 23.912  1.00 59.93  ? 220 VAL B O     1 
ATOM   3739 C  CB    . VAL B 1  223 ? -26.307 42.436 23.005  1.00 59.48  ? 220 VAL B CB    1 
ATOM   3740 C  CG1   . VAL B 1  223 ? -25.196 41.597 22.403  1.00 58.47  ? 220 VAL B CG1   1 
ATOM   3741 C  CG2   . VAL B 1  223 ? -26.903 43.362 21.979  1.00 58.11  ? 220 VAL B CG2   1 
ATOM   3742 N  N     . GLU B 1  224 ? -26.437 40.672 25.650  1.00 60.74  ? 221 GLU B N     1 
ATOM   3743 C  CA    . GLU B 1  224 ? -25.912 39.640 26.548  1.00 61.31  ? 221 GLU B CA    1 
ATOM   3744 C  C     . GLU B 1  224 ? -26.883 38.471 26.687  1.00 60.41  ? 221 GLU B C     1 
ATOM   3745 O  O     . GLU B 1  224 ? -26.487 37.300 26.564  1.00 59.72  ? 221 GLU B O     1 
ATOM   3746 C  CB    . GLU B 1  224 ? -25.579 40.225 27.918  1.00 62.14  ? 221 GLU B CB    1 
ATOM   3747 C  CG    . GLU B 1  224 ? -24.237 40.996 27.968  1.00 66.08  ? 221 GLU B CG    1 
ATOM   3748 C  CD    . GLU B 1  224 ? -24.008 41.721 29.312  1.00 70.52  ? 221 GLU B CD    1 
ATOM   3749 O  OE1   . GLU B 1  224 ? -23.626 42.926 29.297  1.00 71.33  ? 221 GLU B OE1   1 
ATOM   3750 O  OE2   . GLU B 1  224 ? -24.219 41.082 30.380  1.00 72.69  ? 221 GLU B OE2   1 
ATOM   3751 N  N     . ARG B 1  225 ? -28.155 38.803 26.915  1.00 59.82  ? 222 ARG B N     1 
ATOM   3752 C  CA    . ARG B 1  225 ? -29.207 37.800 27.038  1.00 59.50  ? 222 ARG B CA    1 
ATOM   3753 C  C     . ARG B 1  225 ? -29.366 36.997 25.757  1.00 59.30  ? 222 ARG B C     1 
ATOM   3754 O  O     . ARG B 1  225 ? -29.522 35.768 25.797  1.00 59.54  ? 222 ARG B O     1 
ATOM   3755 C  CB    . ARG B 1  225 ? -30.531 38.445 27.424  1.00 59.70  ? 222 ARG B CB    1 
ATOM   3756 C  CG    . ARG B 1  225 ? -30.576 38.935 28.863  1.00 60.33  ? 222 ARG B CG    1 
ATOM   3757 C  CD    . ARG B 1  225 ? -32.005 39.242 29.330  1.00 59.31  ? 222 ARG B CD    1 
ATOM   3758 N  NE    . ARG B 1  225 ? -32.505 40.515 28.821  1.00 57.86  ? 222 ARG B NE    1 
ATOM   3759 C  CZ    . ARG B 1  225 ? -32.084 41.704 29.238  1.00 58.09  ? 222 ARG B CZ    1 
ATOM   3760 N  NH1   . ARG B 1  225 ? -31.128 41.791 30.163  1.00 58.78  ? 222 ARG B NH1   1 
ATOM   3761 N  NH2   . ARG B 1  225 ? -32.609 42.808 28.726  1.00 56.57  ? 222 ARG B NH2   1 
ATOM   3762 N  N     . LYS B 1  226 ? -29.318 37.693 24.621  1.00 58.78  ? 223 LYS B N     1 
ATOM   3763 C  CA    . LYS B 1  226 ? -29.347 37.022 23.328  1.00 57.91  ? 223 LYS B CA    1 
ATOM   3764 C  C     . LYS B 1  226 ? -28.149 36.103 23.150  1.00 58.10  ? 223 LYS B C     1 
ATOM   3765 O  O     . LYS B 1  226 ? -28.311 34.970 22.723  1.00 57.66  ? 223 LYS B O     1 
ATOM   3766 C  CB    . LYS B 1  226 ? -29.426 38.026 22.178  1.00 57.52  ? 223 LYS B CB    1 
ATOM   3767 C  CG    . LYS B 1  226 ? -29.667 37.386 20.823  1.00 54.49  ? 223 LYS B CG    1 
ATOM   3768 C  CD    . LYS B 1  226 ? -30.940 36.584 20.793  1.00 50.80  ? 223 LYS B CD    1 
ATOM   3769 C  CE    . LYS B 1  226 ? -32.149 37.477 20.777  1.00 49.90  ? 223 LYS B CE    1 
ATOM   3770 N  NZ    . LYS B 1  226 ? -33.370 36.675 20.512  1.00 49.60  ? 223 LYS B NZ    1 
ATOM   3771 N  N     . ASN B 1  227 ? -26.956 36.591 23.491  1.00 58.85  ? 224 ASN B N     1 
ATOM   3772 C  CA    . ASN B 1  227 ? -25.733 35.788 23.347  1.00 59.90  ? 224 ASN B CA    1 
ATOM   3773 C  C     . ASN B 1  227 ? -25.760 34.579 24.230  1.00 60.01  ? 224 ASN B C     1 
ATOM   3774 O  O     . ASN B 1  227 ? -25.175 33.552 23.899  1.00 59.82  ? 224 ASN B O     1 
ATOM   3775 C  CB    . ASN B 1  227 ? -24.465 36.601 23.609  1.00 60.01  ? 224 ASN B CB    1 
ATOM   3776 C  CG    . ASN B 1  227 ? -23.862 37.149 22.327  1.00 61.81  ? 224 ASN B CG    1 
ATOM   3777 O  OD1   . ASN B 1  227 ? -23.098 36.461 21.634  1.00 62.82  ? 224 ASN B OD1   1 
ATOM   3778 N  ND2   . ASN B 1  227 ? -24.213 38.393 21.993  1.00 63.27  ? 224 ASN B ND2   1 
ATOM   3779 N  N     . SER B 1  228 ? -26.454 34.722 25.356  1.00 60.62  ? 225 SER B N     1 
ATOM   3780 C  CA    . SER B 1  228 ? -26.646 33.632 26.281  1.00 61.03  ? 225 SER B CA    1 
ATOM   3781 C  C     . SER B 1  228 ? -27.565 32.586 25.655  1.00 61.11  ? 225 SER B C     1 
ATOM   3782 O  O     . SER B 1  228 ? -27.207 31.402 25.597  1.00 60.84  ? 225 SER B O     1 
ATOM   3783 C  CB    . SER B 1  228 ? -27.214 34.154 27.590  1.00 61.27  ? 225 SER B CB    1 
ATOM   3784 O  OG    . SER B 1  228 ? -27.658 33.082 28.404  1.00 62.71  ? 225 SER B OG    1 
ATOM   3785 N  N     . ASP B 1  229 ? -28.726 33.028 25.165  1.00 61.26  ? 226 ASP B N     1 
ATOM   3786 C  CA    . ASP B 1  229 ? -29.663 32.137 24.478  1.00 61.89  ? 226 ASP B CA    1 
ATOM   3787 C  C     . ASP B 1  229 ? -28.974 31.312 23.394  1.00 61.89  ? 226 ASP B C     1 
ATOM   3788 O  O     . ASP B 1  229 ? -29.197 30.107 23.302  1.00 61.99  ? 226 ASP B O     1 
ATOM   3789 C  CB    . ASP B 1  229 ? -30.819 32.921 23.860  1.00 62.28  ? 226 ASP B CB    1 
ATOM   3790 C  CG    . ASP B 1  229 ? -31.754 33.521 24.897  1.00 63.94  ? 226 ASP B CG    1 
ATOM   3791 O  OD1   . ASP B 1  229 ? -31.639 33.192 26.096  1.00 65.73  ? 226 ASP B OD1   1 
ATOM   3792 O  OD2   . ASP B 1  229 ? -32.615 34.341 24.509  1.00 66.34  ? 226 ASP B OD2   1 
ATOM   3793 N  N     . ILE B 1  230 ? -28.128 31.969 22.597  1.00 61.94  ? 227 ILE B N     1 
ATOM   3794 C  CA    . ILE B 1  230 ? -27.385 31.319 21.518  1.00 61.95  ? 227 ILE B CA    1 
ATOM   3795 C  C     . ILE B 1  230 ? -26.509 30.182 22.032  1.00 62.84  ? 227 ILE B C     1 
ATOM   3796 O  O     . ILE B 1  230 ? -26.663 29.046 21.588  1.00 62.57  ? 227 ILE B O     1 
ATOM   3797 C  CB    . ILE B 1  230 ? -26.541 32.323 20.699  1.00 61.38  ? 227 ILE B CB    1 
ATOM   3798 C  CG1   . ILE B 1  230 ? -27.452 33.246 19.900  1.00 60.27  ? 227 ILE B CG1   1 
ATOM   3799 C  CG2   . ILE B 1  230 ? -25.657 31.587 19.725  1.00 61.08  ? 227 ILE B CG2   1 
ATOM   3800 C  CD1   . ILE B 1  230 ? -26.883 34.601 19.624  1.00 58.43  ? 227 ILE B CD1   1 
ATOM   3801 N  N     . LYS B 1  231 ? -25.609 30.479 22.971  1.00 64.09  ? 228 LYS B N     1 
ATOM   3802 C  CA    . LYS B 1  231 ? -24.727 29.441 23.541  1.00 65.46  ? 228 LYS B CA    1 
ATOM   3803 C  C     . LYS B 1  231 ? -25.555 28.254 24.079  1.00 65.95  ? 228 LYS B C     1 
ATOM   3804 O  O     . LYS B 1  231 ? -25.226 27.097 23.828  1.00 65.73  ? 228 LYS B O     1 
ATOM   3805 C  CB    . LYS B 1  231 ? -23.783 29.993 24.641  1.00 65.66  ? 228 LYS B CB    1 
ATOM   3806 C  CG    . LYS B 1  231 ? -22.848 31.158 24.246  1.00 66.18  ? 228 LYS B CG    1 
ATOM   3807 C  CD    . LYS B 1  231 ? -21.671 31.299 25.233  1.00 67.84  ? 228 LYS B CD    1 
ATOM   3808 C  CE    . LYS B 1  231 ? -21.303 32.773 25.539  1.00 69.38  ? 228 LYS B CE    1 
ATOM   3809 N  NZ    . LYS B 1  231 ? -22.146 33.374 26.644  1.00 68.18  ? 228 LYS B NZ    1 
ATOM   3810 N  N     . ARG B 1  232 ? -26.646 28.551 24.782  1.00 66.73  ? 229 ARG B N     1 
ATOM   3811 C  CA    . ARG B 1  232 ? -27.460 27.500 25.382  1.00 67.70  ? 229 ARG B CA    1 
ATOM   3812 C  C     . ARG B 1  232 ? -28.245 26.718 24.350  1.00 67.86  ? 229 ARG B C     1 
ATOM   3813 O  O     . ARG B 1  232 ? -28.315 25.492 24.443  1.00 68.21  ? 229 ARG B O     1 
ATOM   3814 C  CB    . ARG B 1  232 ? -28.395 28.041 26.472  1.00 68.05  ? 229 ARG B CB    1 
ATOM   3815 C  CG    . ARG B 1  232 ? -27.672 28.487 27.753  1.00 70.09  ? 229 ARG B CG    1 
ATOM   3816 C  CD    . ARG B 1  232 ? -28.505 28.235 29.001  1.00 74.07  ? 229 ARG B CD    1 
ATOM   3817 N  NE    . ARG B 1  232 ? -29.672 29.117 29.072  1.00 76.93  ? 229 ARG B NE    1 
ATOM   3818 C  CZ    . ARG B 1  232 ? -30.850 28.756 29.580  1.00 78.61  ? 229 ARG B CZ    1 
ATOM   3819 N  NH1   . ARG B 1  232 ? -31.023 27.516 30.053  1.00 79.19  ? 229 ARG B NH1   1 
ATOM   3820 N  NH2   . ARG B 1  232 ? -31.857 29.626 29.605  1.00 78.36  ? 229 ARG B NH2   1 
ATOM   3821 N  N     . LEU B 1  233 ? -28.833 27.406 23.372  1.00 68.03  ? 230 LEU B N     1 
ATOM   3822 C  CA    . LEU B 1  233 ? -29.597 26.711 22.335  1.00 68.43  ? 230 LEU B CA    1 
ATOM   3823 C  C     . LEU B 1  233 ? -28.693 25.810 21.501  1.00 69.19  ? 230 LEU B C     1 
ATOM   3824 O  O     . LEU B 1  233 ? -29.050 24.677 21.202  1.00 68.96  ? 230 LEU B O     1 
ATOM   3825 C  CB    . LEU B 1  233 ? -30.379 27.684 21.453  1.00 68.11  ? 230 LEU B CB    1 
ATOM   3826 C  CG    . LEU B 1  233 ? -31.225 27.117 20.301  1.00 67.32  ? 230 LEU B CG    1 
ATOM   3827 C  CD1   . LEU B 1  233 ? -32.161 25.970 20.718  1.00 67.12  ? 230 LEU B CD1   1 
ATOM   3828 C  CD2   . LEU B 1  233 ? -32.012 28.230 19.660  1.00 66.19  ? 230 LEU B CD2   1 
ATOM   3829 N  N     . LEU B 1  234 ? -27.513 26.314 21.156  1.00 70.47  ? 231 LEU B N     1 
ATOM   3830 C  CA    . LEU B 1  234 ? -26.513 25.509 20.471  1.00 71.80  ? 231 LEU B CA    1 
ATOM   3831 C  C     . LEU B 1  234 ? -26.224 24.243 21.254  1.00 73.13  ? 231 LEU B C     1 
ATOM   3832 O  O     . LEU B 1  234 ? -26.504 23.139 20.758  1.00 72.97  ? 231 LEU B O     1 
ATOM   3833 C  CB    . LEU B 1  234 ? -25.229 26.307 20.223  1.00 71.51  ? 231 LEU B CB    1 
ATOM   3834 C  CG    . LEU B 1  234 ? -25.296 27.256 19.020  1.00 70.84  ? 231 LEU B CG    1 
ATOM   3835 C  CD1   . LEU B 1  234 ? -24.084 28.175 18.936  1.00 69.82  ? 231 LEU B CD1   1 
ATOM   3836 C  CD2   . LEU B 1  234 ? -25.467 26.461 17.740  1.00 69.99  ? 231 LEU B CD2   1 
ATOM   3837 N  N     . THR B 1  235 ? -25.712 24.426 22.481  1.00 74.84  ? 232 THR B N     1 
ATOM   3838 C  CA    . THR B 1  235 ? -25.351 23.334 23.401  1.00 76.64  ? 232 THR B CA    1 
ATOM   3839 C  C     . THR B 1  235 ? -26.409 22.252 23.448  1.00 77.74  ? 232 THR B C     1 
ATOM   3840 O  O     . THR B 1  235 ? -26.083 21.067 23.366  1.00 77.58  ? 232 THR B O     1 
ATOM   3841 C  CB    . THR B 1  235 ? -25.160 23.813 24.859  1.00 76.70  ? 232 THR B CB    1 
ATOM   3842 O  OG1   . THR B 1  235 ? -24.375 25.006 24.895  1.00 77.57  ? 232 THR B OG1   1 
ATOM   3843 C  CG2   . THR B 1  235 ? -24.461 22.731 25.692  1.00 77.02  ? 232 THR B CG2   1 
ATOM   3844 N  N     . LYS B 1  236 ? -27.665 22.674 23.593  1.00 79.36  ? 233 LYS B N     1 
ATOM   3845 C  CA    . LYS B 1  236 ? -28.791 21.759 23.641  1.00 81.31  ? 233 LYS B CA    1 
ATOM   3846 C  C     . LYS B 1  236 ? -28.893 20.923 22.366  1.00 82.64  ? 233 LYS B C     1 
ATOM   3847 O  O     . LYS B 1  236 ? -29.125 19.714 22.432  1.00 83.12  ? 233 LYS B O     1 
ATOM   3848 C  CB    . LYS B 1  236 ? -30.103 22.506 23.904  1.00 81.34  ? 233 LYS B CB    1 
ATOM   3849 C  CG    . LYS B 1  236 ? -31.336 21.594 23.934  1.00 82.79  ? 233 LYS B CG    1 
ATOM   3850 C  CD    . LYS B 1  236 ? -32.561 22.239 24.598  1.00 85.23  ? 233 LYS B CD    1 
ATOM   3851 C  CE    . LYS B 1  236 ? -33.700 21.213 24.823  1.00 86.85  ? 233 LYS B CE    1 
ATOM   3852 N  NZ    . LYS B 1  236 ? -33.353 20.074 25.760  1.00 87.26  ? 233 LYS B NZ    1 
ATOM   3853 N  N     . LEU B 1  237 ? -28.701 21.540 21.204  1.00 84.19  ? 234 LEU B N     1 
ATOM   3854 C  CA    . LEU B 1  237 ? -28.908 20.790 19.963  1.00 85.51  ? 234 LEU B CA    1 
ATOM   3855 C  C     . LEU B 1  237 ? -27.672 20.005 19.482  1.00 86.08  ? 234 LEU B C     1 
ATOM   3856 O  O     . LEU B 1  237 ? -27.806 18.940 18.866  1.00 86.04  ? 234 LEU B O     1 
ATOM   3857 C  CB    . LEU B 1  237 ? -29.589 21.648 18.875  1.00 85.72  ? 234 LEU B CB    1 
ATOM   3858 C  CG    . LEU B 1  237 ? -31.050 22.076 19.206  1.00 86.24  ? 234 LEU B CG    1 
ATOM   3859 C  CD1   . LEU B 1  237 ? -31.672 22.990 18.126  1.00 85.83  ? 234 LEU B CD1   1 
ATOM   3860 C  CD2   . LEU B 1  237 ? -32.002 20.890 19.536  1.00 86.08  ? 234 LEU B CD2   1 
ATOM   3861 N  N     . LEU B 1  238 ? -26.482 20.505 19.803  1.00 86.94  ? 235 LEU B N     1 
ATOM   3862 C  CA    . LEU B 1  238 ? -25.260 19.755 19.507  1.00 88.10  ? 235 LEU B CA    1 
ATOM   3863 C  C     . LEU B 1  238 ? -25.157 18.415 20.273  1.00 88.42  ? 235 LEU B C     1 
ATOM   3864 O  O     . LEU B 1  238 ? -24.657 17.443 19.722  1.00 88.70  ? 235 LEU B O     1 
ATOM   3865 C  CB    . LEU B 1  238 ? -23.988 20.623 19.638  1.00 88.32  ? 235 LEU B CB    1 
ATOM   3866 C  CG    . LEU B 1  238 ? -23.436 21.091 20.997  1.00 89.84  ? 235 LEU B CG    1 
ATOM   3867 C  CD1   . LEU B 1  238 ? -22.635 19.980 21.733  1.00 91.01  ? 235 LEU B CD1   1 
ATOM   3868 C  CD2   . LEU B 1  238 ? -22.584 22.373 20.848  1.00 90.03  ? 235 LEU B CD2   1 
ATOM   3869 N  N     . VAL B 1  239 ? -25.634 18.344 21.521  1.00 88.76  ? 236 VAL B N     1 
ATOM   3870 C  CA    . VAL B 1  239 ? -25.698 17.035 22.224  1.00 88.77  ? 236 VAL B CA    1 
ATOM   3871 C  C     . VAL B 1  239 ? -26.718 16.109 21.544  1.00 88.62  ? 236 VAL B C     1 
ATOM   3872 O  O     . VAL B 1  239 ? -27.812 16.539 21.164  1.00 88.67  ? 236 VAL B O     1 
ATOM   3873 C  CB    . VAL B 1  239 ? -25.932 17.121 23.785  1.00 88.81  ? 236 VAL B CB    1 
ATOM   3874 C  CG1   . VAL B 1  239 ? -24.823 17.942 24.478  1.00 88.70  ? 236 VAL B CG1   1 
ATOM   3875 C  CG2   . VAL B 1  239 ? -27.328 17.645 24.136  1.00 88.87  ? 236 VAL B CG2   1 
ATOM   3876 N  N     . GLY B 1  240 ? -26.334 14.848 21.368  1.00 88.43  ? 237 GLY B N     1 
ATOM   3877 C  CA    . GLY B 1  240 ? -27.109 13.911 20.554  1.00 88.09  ? 237 GLY B CA    1 
ATOM   3878 C  C     . GLY B 1  240 ? -26.576 13.832 19.128  1.00 87.78  ? 237 GLY B C     1 
ATOM   3879 O  O     . GLY B 1  240 ? -26.392 12.731 18.588  1.00 87.85  ? 237 GLY B O     1 
ATOM   3880 N  N     . ARG B 1  241 ? -26.315 14.997 18.527  1.00 86.98  ? 238 ARG B N     1 
ATOM   3881 C  CA    . ARG B 1  241 ? -25.801 15.080 17.152  1.00 86.02  ? 238 ARG B CA    1 
ATOM   3882 C  C     . ARG B 1  241 ? -24.682 16.131 17.007  1.00 85.20  ? 238 ARG B C     1 
ATOM   3883 O  O     . ARG B 1  241 ? -24.835 17.094 16.242  1.00 85.34  ? 238 ARG B O     1 
ATOM   3884 C  CB    . ARG B 1  241 ? -26.956 15.357 16.168  1.00 86.16  ? 238 ARG B CB    1 
ATOM   3885 C  CG    . ARG B 1  241 ? -27.981 16.395 16.652  1.00 86.07  ? 238 ARG B CG    1 
ATOM   3886 C  CD    . ARG B 1  241 ? -29.280 16.362 15.839  1.00 86.35  ? 238 ARG B CD    1 
ATOM   3887 N  NE    . ARG B 1  241 ? -30.297 17.229 16.446  1.00 87.22  ? 238 ARG B NE    1 
ATOM   3888 C  CZ    . ARG B 1  241 ? -31.472 17.537 15.896  1.00 87.19  ? 238 ARG B CZ    1 
ATOM   3889 N  NH1   . ARG B 1  241 ? -31.808 17.053 14.706  1.00 86.74  ? 238 ARG B NH1   1 
ATOM   3890 N  NH2   . ARG B 1  241 ? -32.317 18.338 16.541  1.00 86.98  ? 238 ARG B NH2   1 
ATOM   3891 N  N     . PRO B 1  242 ? -23.539 15.931 17.711  1.00 84.03  ? 239 PRO B N     1 
ATOM   3892 C  CA    . PRO B 1  242 ? -22.517 16.987 17.883  1.00 83.16  ? 239 PRO B CA    1 
ATOM   3893 C  C     . PRO B 1  242 ? -21.822 17.409 16.589  1.00 82.22  ? 239 PRO B C     1 
ATOM   3894 O  O     . PRO B 1  242 ? -21.006 18.337 16.588  1.00 82.30  ? 239 PRO B O     1 
ATOM   3895 C  CB    . PRO B 1  242 ? -21.506 16.345 18.842  1.00 83.12  ? 239 PRO B CB    1 
ATOM   3896 C  CG    . PRO B 1  242 ? -21.609 14.893 18.572  1.00 83.74  ? 239 PRO B CG    1 
ATOM   3897 C  CD    . PRO B 1  242 ? -23.060 14.628 18.210  1.00 84.06  ? 239 PRO B CD    1 
ATOM   3898 N  N     . THR B 1  243 ? -22.171 16.734 15.500  1.00 80.85  ? 240 THR B N     1 
ATOM   3899 C  CA    . THR B 1  243 ? -21.469 16.850 14.237  1.00 79.28  ? 240 THR B CA    1 
ATOM   3900 C  C     . THR B 1  243 ? -22.408 17.307 13.117  1.00 78.06  ? 240 THR B C     1 
ATOM   3901 O  O     . THR B 1  243 ? -21.968 17.561 11.991  1.00 78.08  ? 240 THR B O     1 
ATOM   3902 C  CB    . THR B 1  243 ? -20.760 15.510 13.874  1.00 79.32  ? 240 THR B CB    1 
ATOM   3903 O  OG1   . THR B 1  243 ? -20.299 15.561 12.522  1.00 79.47  ? 240 THR B OG1   1 
ATOM   3904 C  CG2   . THR B 1  243 ? -21.703 14.307 14.042  1.00 79.68  ? 240 THR B CG2   1 
ATOM   3905 N  N     . LYS B 1  244 ? -23.695 17.425 13.436  1.00 76.19  ? 241 LYS B N     1 
ATOM   3906 C  CA    . LYS B 1  244 ? -24.690 17.808 12.445  1.00 74.50  ? 241 LYS B CA    1 
ATOM   3907 C  C     . LYS B 1  244 ? -25.157 19.267 12.602  1.00 73.28  ? 241 LYS B C     1 
ATOM   3908 O  O     . LYS B 1  244 ? -26.215 19.632 12.081  1.00 73.35  ? 241 LYS B O     1 
ATOM   3909 C  CB    . LYS B 1  244 ? -25.880 16.828 12.469  1.00 74.29  ? 241 LYS B CB    1 
ATOM   3910 N  N     . TRP B 1  245 ? -24.376 20.104 13.294  1.00 71.52  ? 242 TRP B N     1 
ATOM   3911 C  CA    . TRP B 1  245 ? -24.825 21.475 13.585  1.00 70.04  ? 242 TRP B CA    1 
ATOM   3912 C  C     . TRP B 1  245 ? -24.847 22.400 12.379  1.00 69.43  ? 242 TRP B C     1 
ATOM   3913 O  O     . TRP B 1  245 ? -25.722 23.261 12.265  1.00 69.62  ? 242 TRP B O     1 
ATOM   3914 C  CB    . TRP B 1  245 ? -24.070 22.120 14.747  1.00 69.76  ? 242 TRP B CB    1 
ATOM   3915 C  CG    . TRP B 1  245 ? -22.577 22.204 14.610  1.00 69.66  ? 242 TRP B CG    1 
ATOM   3916 C  CD1   . TRP B 1  245 ? -21.666 21.300 15.079  1.00 69.98  ? 242 TRP B CD1   1 
ATOM   3917 C  CD2   . TRP B 1  245 ? -21.810 23.270 14.026  1.00 68.51  ? 242 TRP B CD2   1 
ATOM   3918 N  NE1   . TRP B 1  245 ? -20.384 21.723 14.805  1.00 68.62  ? 242 TRP B NE1   1 
ATOM   3919 C  CE2   . TRP B 1  245 ? -20.443 22.927 14.160  1.00 67.94  ? 242 TRP B CE2   1 
ATOM   3920 C  CE3   . TRP B 1  245 ? -22.139 24.468 13.392  1.00 67.68  ? 242 TRP B CE3   1 
ATOM   3921 C  CZ2   . TRP B 1  245 ? -19.411 23.737 13.680  1.00 67.13  ? 242 TRP B CZ2   1 
ATOM   3922 C  CZ3   . TRP B 1  245 ? -21.098 25.279 12.916  1.00 67.34  ? 242 TRP B CZ3   1 
ATOM   3923 C  CH2   . TRP B 1  245 ? -19.757 24.906 13.066  1.00 66.40  ? 242 TRP B CH2   1 
ATOM   3924 N  N     . TYR B 1  246 ? -23.897 22.218 11.473  1.00 68.42  ? 243 TYR B N     1 
ATOM   3925 C  CA    . TYR B 1  246 ? -23.876 22.977 10.239  1.00 67.35  ? 243 TYR B CA    1 
ATOM   3926 C  C     . TYR B 1  246 ? -25.273 23.063 9.609   1.00 66.43  ? 243 TYR B C     1 
ATOM   3927 O  O     . TYR B 1  246 ? -25.718 24.142 9.228   1.00 66.23  ? 243 TYR B O     1 
ATOM   3928 C  CB    . TYR B 1  246 ? -22.867 22.374 9.250   1.00 67.82  ? 243 TYR B CB    1 
ATOM   3929 C  CG    . TYR B 1  246 ? -22.847 23.096 7.921   1.00 68.73  ? 243 TYR B CG    1 
ATOM   3930 C  CD1   . TYR B 1  246 ? -21.990 24.172 7.701   1.00 69.19  ? 243 TYR B CD1   1 
ATOM   3931 C  CD2   . TYR B 1  246 ? -23.722 22.727 6.898   1.00 70.03  ? 243 TYR B CD2   1 
ATOM   3932 C  CE1   . TYR B 1  246 ? -21.999 24.849 6.496   1.00 70.05  ? 243 TYR B CE1   1 
ATOM   3933 C  CE2   . TYR B 1  246 ? -23.744 23.400 5.696   1.00 70.71  ? 243 TYR B CE2   1 
ATOM   3934 C  CZ    . TYR B 1  246 ? -22.879 24.453 5.500   1.00 71.02  ? 243 TYR B CZ    1 
ATOM   3935 O  OH    . TYR B 1  246 ? -22.904 25.105 4.294   1.00 72.66  ? 243 TYR B OH    1 
ATOM   3936 N  N     . ASP B 1  247 ? -25.958 21.929 9.509   1.00 65.40  ? 244 ASP B N     1 
ATOM   3937 C  CA    . ASP B 1  247 ? -27.285 21.875 8.882   1.00 64.52  ? 244 ASP B CA    1 
ATOM   3938 C  C     . ASP B 1  247 ? -28.376 22.570 9.687   1.00 62.99  ? 244 ASP B C     1 
ATOM   3939 O  O     . ASP B 1  247 ? -29.447 22.886 9.151   1.00 62.60  ? 244 ASP B O     1 
ATOM   3940 C  CB    . ASP B 1  247 ? -27.716 20.423 8.625   1.00 65.45  ? 244 ASP B CB    1 
ATOM   3941 C  CG    . ASP B 1  247 ? -26.864 19.727 7.563   1.00 67.70  ? 244 ASP B CG    1 
ATOM   3942 O  OD1   . ASP B 1  247 ? -26.567 20.353 6.510   1.00 69.27  ? 244 ASP B OD1   1 
ATOM   3943 O  OD2   . ASP B 1  247 ? -26.502 18.545 7.786   1.00 70.77  ? 244 ASP B OD2   1 
ATOM   3944 N  N     . LEU B 1  248 ? -28.109 22.804 10.967  1.00 61.01  ? 245 LEU B N     1 
ATOM   3945 C  CA    . LEU B 1  248 ? -29.149 23.300 11.860  1.00 59.17  ? 245 LEU B CA    1 
ATOM   3946 C  C     . LEU B 1  248 ? -29.089 24.794 12.090  1.00 58.08  ? 245 LEU B C     1 
ATOM   3947 O  O     . LEU B 1  248 ? -30.043 25.382 12.631  1.00 57.86  ? 245 LEU B O     1 
ATOM   3948 C  CB    . LEU B 1  248 ? -29.118 22.549 13.183  1.00 59.11  ? 245 LEU B CB    1 
ATOM   3949 C  CG    . LEU B 1  248 ? -29.540 21.104 12.972  1.00 58.87  ? 245 LEU B CG    1 
ATOM   3950 C  CD1   . LEU B 1  248 ? -29.152 20.279 14.188  1.00 57.51  ? 245 LEU B CD1   1 
ATOM   3951 C  CD2   . LEU B 1  248 ? -31.046 21.030 12.642  1.00 58.03  ? 245 LEU B CD2   1 
ATOM   3952 N  N     . LEU B 1  249 ? -27.980 25.402 11.671  1.00 56.14  ? 246 LEU B N     1 
ATOM   3953 C  CA    . LEU B 1  249 ? -27.831 26.833 11.775  1.00 54.76  ? 246 LEU B CA    1 
ATOM   3954 C  C     . LEU B 1  249 ? -29.058 27.595 11.249  1.00 53.77  ? 246 LEU B C     1 
ATOM   3955 O  O     . LEU B 1  249 ? -29.553 28.486 11.919  1.00 53.48  ? 246 LEU B O     1 
ATOM   3956 C  CB    . LEU B 1  249 ? -26.557 27.292 11.081  1.00 54.88  ? 246 LEU B CB    1 
ATOM   3957 C  CG    . LEU B 1  249 ? -25.247 26.895 11.742  1.00 54.82  ? 246 LEU B CG    1 
ATOM   3958 C  CD1   . LEU B 1  249 ? -24.122 27.273 10.819  1.00 55.08  ? 246 LEU B CD1   1 
ATOM   3959 C  CD2   . LEU B 1  249 ? -25.074 27.577 13.080  1.00 55.59  ? 246 LEU B CD2   1 
ATOM   3960 N  N     . PRO B 1  250 ? -29.574 27.240 10.064  1.00 53.08  ? 247 PRO B N     1 
ATOM   3961 C  CA    . PRO B 1  250 ? -30.777 27.983 9.650   1.00 52.85  ? 247 PRO B CA    1 
ATOM   3962 C  C     . PRO B 1  250 ? -31.935 27.950 10.670  1.00 52.86  ? 247 PRO B C     1 
ATOM   3963 O  O     . PRO B 1  250 ? -32.534 28.998 10.973  1.00 53.08  ? 247 PRO B O     1 
ATOM   3964 C  CB    . PRO B 1  250 ? -31.179 27.299 8.342   1.00 52.58  ? 247 PRO B CB    1 
ATOM   3965 C  CG    . PRO B 1  250 ? -29.892 26.770 7.804   1.00 52.87  ? 247 PRO B CG    1 
ATOM   3966 C  CD    . PRO B 1  250 ? -29.077 26.352 8.997   1.00 52.75  ? 247 PRO B CD    1 
ATOM   3967 N  N     . VAL B 1  251 ? -32.253 26.772 11.206  1.00 52.36  ? 248 VAL B N     1 
ATOM   3968 C  CA    . VAL B 1  251 ? -33.390 26.692 12.114  1.00 51.53  ? 248 VAL B CA    1 
ATOM   3969 C  C     . VAL B 1  251 ? -33.069 27.344 13.463  1.00 50.82  ? 248 VAL B C     1 
ATOM   3970 O  O     . VAL B 1  251 ? -33.928 27.969 14.081  1.00 50.95  ? 248 VAL B O     1 
ATOM   3971 C  CB    . VAL B 1  251 ? -33.999 25.253 12.207  1.00 51.50  ? 248 VAL B CB    1 
ATOM   3972 C  CG1   . VAL B 1  251 ? -33.014 24.252 12.754  1.00 51.05  ? 248 VAL B CG1   1 
ATOM   3973 C  CG2   . VAL B 1  251 ? -35.288 25.273 13.018  1.00 51.69  ? 248 VAL B CG2   1 
ATOM   3974 N  N     . VAL B 1  252 ? -31.819 27.245 13.880  1.00 49.94  ? 249 VAL B N     1 
ATOM   3975 C  CA    . VAL B 1  252 ? -31.363 27.947 15.069  1.00 49.34  ? 249 VAL B CA    1 
ATOM   3976 C  C     . VAL B 1  252 ? -31.661 29.441 14.974  1.00 49.67  ? 249 VAL B C     1 
ATOM   3977 O  O     . VAL B 1  252 ? -32.197 30.023 15.914  1.00 49.70  ? 249 VAL B O     1 
ATOM   3978 C  CB    . VAL B 1  252 ? -29.858 27.738 15.304  1.00 49.13  ? 249 VAL B CB    1 
ATOM   3979 C  CG1   . VAL B 1  252 ? -29.343 28.682 16.358  1.00 48.20  ? 249 VAL B CG1   1 
ATOM   3980 C  CG2   . VAL B 1  252 ? -29.588 26.313 15.712  1.00 48.61  ? 249 VAL B CG2   1 
ATOM   3981 N  N     . GLN B 1  253 ? -31.316 30.059 13.847  1.00 49.73  ? 250 GLN B N     1 
ATOM   3982 C  CA    . GLN B 1  253 ? -31.566 31.482 13.651  1.00 50.04  ? 250 GLN B CA    1 
ATOM   3983 C  C     . GLN B 1  253 ? -33.049 31.821 13.648  1.00 49.94  ? 250 GLN B C     1 
ATOM   3984 O  O     . GLN B 1  253 ? -33.468 32.772 14.302  1.00 49.65  ? 250 GLN B O     1 
ATOM   3985 C  CB    . GLN B 1  253 ? -30.950 31.969 12.354  1.00 50.36  ? 250 GLN B CB    1 
ATOM   3986 C  CG    . GLN B 1  253 ? -29.508 32.291 12.463  1.00 52.47  ? 250 GLN B CG    1 
ATOM   3987 C  CD    . GLN B 1  253 ? -28.928 32.745 11.150  1.00 56.09  ? 250 GLN B CD    1 
ATOM   3988 O  OE1   . GLN B 1  253 ? -29.215 33.853 10.662  1.00 57.95  ? 250 GLN B OE1   1 
ATOM   3989 N  NE2   . GLN B 1  253 ? -28.097 31.893 10.563  1.00 56.57  ? 250 GLN B NE2   1 
ATOM   3990 N  N     . LEU B 1  254 ? -33.842 31.049 12.909  1.00 49.90  ? 251 LEU B N     1 
ATOM   3991 C  CA    . LEU B 1  254 ? -35.283 31.307 12.854  1.00 49.97  ? 251 LEU B CA    1 
ATOM   3992 C  C     . LEU B 1  254 ? -35.857 31.302 14.243  1.00 49.68  ? 251 LEU B C     1 
ATOM   3993 O  O     . LEU B 1  254 ? -36.667 32.180 14.588  1.00 50.22  ? 251 LEU B O     1 
ATOM   3994 C  CB    . LEU B 1  254 ? -36.014 30.270 12.004  1.00 50.14  ? 251 LEU B CB    1 
ATOM   3995 C  CG    . LEU B 1  254 ? -35.838 30.358 10.489  1.00 50.50  ? 251 LEU B CG    1 
ATOM   3996 C  CD1   . LEU B 1  254 ? -36.239 29.038 9.812   1.00 49.86  ? 251 LEU B CD1   1 
ATOM   3997 C  CD2   . LEU B 1  254 ? -36.633 31.553 9.943   1.00 50.49  ? 251 LEU B CD2   1 
ATOM   3998 N  N     . ALA B 1  255 ? -35.418 30.319 15.034  1.00 49.00  ? 252 ALA B N     1 
ATOM   3999 C  CA    . ALA B 1  255 ? -35.828 30.178 16.426  1.00 48.56  ? 252 ALA B CA    1 
ATOM   4000 C  C     . ALA B 1  255 ? -35.499 31.443 17.185  1.00 48.60  ? 252 ALA B C     1 
ATOM   4001 O  O     . ALA B 1  255 ? -36.387 32.130 17.642  1.00 48.25  ? 252 ALA B O     1 
ATOM   4002 C  CB    . ALA B 1  255 ? -35.154 29.000 17.049  1.00 48.17  ? 252 ALA B CB    1 
ATOM   4003 N  N     . LEU B 1  256 ? -34.215 31.771 17.254  1.00 49.32  ? 253 LEU B N     1 
ATOM   4004 C  CA    . LEU B 1  256 ? -33.744 32.959 17.935  1.00 50.06  ? 253 LEU B CA    1 
ATOM   4005 C  C     . LEU B 1  256 ? -34.478 34.202 17.520  1.00 51.17  ? 253 LEU B C     1 
ATOM   4006 O  O     . LEU B 1  256 ? -34.752 35.050 18.356  1.00 51.57  ? 253 LEU B O     1 
ATOM   4007 C  CB    . LEU B 1  256 ? -32.268 33.163 17.665  1.00 50.03  ? 253 LEU B CB    1 
ATOM   4008 C  CG    . LEU B 1  256 ? -31.351 32.090 18.253  1.00 50.24  ? 253 LEU B CG    1 
ATOM   4009 C  CD1   . LEU B 1  256 ? -30.000 32.105 17.570  1.00 49.85  ? 253 LEU B CD1   1 
ATOM   4010 C  CD2   . LEU B 1  256 ? -31.195 32.289 19.736  1.00 49.22  ? 253 LEU B CD2   1 
ATOM   4011 N  N     . ASN B 1  257 ? -34.807 34.311 16.236  1.00 52.44  ? 254 ASN B N     1 
ATOM   4012 C  CA    . ASN B 1  257 ? -35.290 35.566 15.686  1.00 53.58  ? 254 ASN B CA    1 
ATOM   4013 C  C     . ASN B 1  257 ? -36.799 35.668 15.763  1.00 55.00  ? 254 ASN B C     1 
ATOM   4014 O  O     . ASN B 1  257 ? -37.380 36.756 15.616  1.00 54.99  ? 254 ASN B O     1 
ATOM   4015 C  CB    . ASN B 1  257 ? -34.773 35.777 14.257  1.00 53.32  ? 254 ASN B CB    1 
ATOM   4016 C  CG    . ASN B 1  257 ? -33.309 36.184 14.215  1.00 52.70  ? 254 ASN B CG    1 
ATOM   4017 O  OD1   . ASN B 1  257 ? -32.873 37.061 14.952  1.00 52.76  ? 254 ASN B OD1   1 
ATOM   4018 N  ND2   . ASN B 1  257 ? -32.550 35.553 13.341  1.00 52.22  ? 254 ASN B ND2   1 
ATOM   4019 N  N     . ASN B 1  258 ? -37.440 34.537 16.006  1.00 56.75  ? 255 ASN B N     1 
ATOM   4020 C  CA    . ASN B 1  258 ? -38.873 34.566 16.275  1.00 59.15  ? 255 ASN B CA    1 
ATOM   4021 C  C     . ASN B 1  258 ? -39.176 34.247 17.743  1.00 61.18  ? 255 ASN B C     1 
ATOM   4022 O  O     . ASN B 1  258 ? -40.222 33.677 18.067  1.00 61.17  ? 255 ASN B O     1 
ATOM   4023 C  CB    . ASN B 1  258 ? -39.610 33.635 15.320  1.00 58.55  ? 255 ASN B CB    1 
ATOM   4024 C  CG    . ASN B 1  258 ? -39.516 34.100 13.885  1.00 58.20  ? 255 ASN B CG    1 
ATOM   4025 O  OD1   . ASN B 1  258 ? -40.238 35.009 13.476  1.00 56.94  ? 255 ASN B OD1   1 
ATOM   4026 N  ND2   . ASN B 1  258 ? -38.610 33.493 13.115  1.00 56.01  ? 255 ASN B ND2   1 
ATOM   4027 N  N     . THR B 1  259 ? -38.233 34.602 18.620  1.00 63.59  ? 256 THR B N     1 
ATOM   4028 C  CA    . THR B 1  259 ? -38.417 34.471 20.056  1.00 66.16  ? 256 THR B CA    1 
ATOM   4029 C  C     . THR B 1  259 ? -38.889 35.794 20.629  1.00 67.72  ? 256 THR B C     1 
ATOM   4030 O  O     . THR B 1  259 ? -38.294 36.851 20.387  1.00 67.44  ? 256 THR B O     1 
ATOM   4031 C  CB    . THR B 1  259 ? -37.129 34.024 20.785  1.00 66.39  ? 256 THR B CB    1 
ATOM   4032 O  OG1   . THR B 1  259 ? -36.768 32.713 20.340  1.00 67.02  ? 256 THR B OG1   1 
ATOM   4033 C  CG2   . THR B 1  259 ? -37.335 34.004 22.319  1.00 65.82  ? 256 THR B CG2   1 
ATOM   4034 N  N     . TYR B 1  260 ? -39.973 35.709 21.391  1.00 70.05  ? 257 TYR B N     1 
ATOM   4035 C  CA    . TYR B 1  260 ? -40.571 36.868 22.043  1.00 72.37  ? 257 TYR B CA    1 
ATOM   4036 C  C     . TYR B 1  260 ? -39.622 37.483 23.099  1.00 72.80  ? 257 TYR B C     1 
ATOM   4037 O  O     . TYR B 1  260 ? -39.022 36.764 23.915  1.00 73.36  ? 257 TYR B O     1 
ATOM   4038 C  CB    . TYR B 1  260 ? -41.935 36.473 22.619  1.00 72.77  ? 257 TYR B CB    1 
ATOM   4039 C  CG    . TYR B 1  260 ? -42.583 37.530 23.477  1.00 76.71  ? 257 TYR B CG    1 
ATOM   4040 C  CD1   . TYR B 1  260 ? -43.142 38.671 22.900  1.00 79.25  ? 257 TYR B CD1   1 
ATOM   4041 C  CD2   . TYR B 1  260 ? -42.656 37.386 24.883  1.00 79.50  ? 257 TYR B CD2   1 
ATOM   4042 C  CE1   . TYR B 1  260 ? -43.752 39.650 23.693  1.00 80.92  ? 257 TYR B CE1   1 
ATOM   4043 C  CE2   . TYR B 1  260 ? -43.263 38.360 25.680  1.00 80.67  ? 257 TYR B CE2   1 
ATOM   4044 C  CZ    . TYR B 1  260 ? -43.807 39.490 25.070  1.00 81.56  ? 257 TYR B CZ    1 
ATOM   4045 O  OH    . TYR B 1  260 ? -44.407 40.476 25.822  1.00 83.60  ? 257 TYR B OH    1 
ATOM   4046 N  N     . SER B 1  261 ? -39.461 38.807 23.037  1.00 73.38  ? 258 SER B N     1 
ATOM   4047 C  CA    . SER B 1  261 ? -38.642 39.562 23.995  1.00 73.62  ? 258 SER B CA    1 
ATOM   4048 C  C     . SER B 1  261 ? -39.520 40.059 25.156  1.00 74.32  ? 258 SER B C     1 
ATOM   4049 O  O     . SER B 1  261 ? -40.459 40.831 24.930  1.00 74.18  ? 258 SER B O     1 
ATOM   4050 C  CB    . SER B 1  261 ? -37.948 40.730 23.285  1.00 73.41  ? 258 SER B CB    1 
ATOM   4051 O  OG    . SER B 1  261 ? -37.784 41.858 24.128  1.00 72.63  ? 258 SER B OG    1 
ATOM   4052 N  N     . PRO B 1  262 ? -39.248 39.585 26.396  1.00 74.88  ? 259 PRO B N     1 
ATOM   4053 C  CA    . PRO B 1  262 ? -40.000 40.071 27.566  1.00 75.05  ? 259 PRO B CA    1 
ATOM   4054 C  C     . PRO B 1  262 ? -40.104 41.605 27.646  1.00 75.02  ? 259 PRO B C     1 
ATOM   4055 O  O     . PRO B 1  262 ? -41.209 42.129 27.858  1.00 75.05  ? 259 PRO B O     1 
ATOM   4056 C  CB    . PRO B 1  262 ? -39.197 39.516 28.747  1.00 75.49  ? 259 PRO B CB    1 
ATOM   4057 C  CG    . PRO B 1  262 ? -38.584 38.219 28.217  1.00 75.29  ? 259 PRO B CG    1 
ATOM   4058 C  CD    . PRO B 1  262 ? -38.419 38.398 26.721  1.00 74.93  ? 259 PRO B CD    1 
ATOM   4059 N  N     . VAL B 1  263 ? -38.975 42.300 27.437  1.00 74.60  ? 260 VAL B N     1 
ATOM   4060 C  CA    . VAL B 1  263 ? -38.870 43.773 27.577  1.00 73.99  ? 260 VAL B CA    1 
ATOM   4061 C  C     . VAL B 1  263 ? -39.655 44.550 26.501  1.00 73.56  ? 260 VAL B C     1 
ATOM   4062 O  O     . VAL B 1  263 ? -40.445 45.451 26.823  1.00 73.78  ? 260 VAL B O     1 
ATOM   4063 C  CB    . VAL B 1  263 ? -37.360 44.266 27.657  1.00 74.14  ? 260 VAL B CB    1 
ATOM   4064 C  CG1   . VAL B 1  263 ? -37.238 45.800 27.508  1.00 73.53  ? 260 VAL B CG1   1 
ATOM   4065 C  CG2   . VAL B 1  263 ? -36.677 43.784 28.961  1.00 73.78  ? 260 VAL B CG2   1 
ATOM   4066 N  N     . LEU B 1  264 ? -39.425 44.223 25.233  1.00 72.55  ? 261 LEU B N     1 
ATOM   4067 C  CA    . LEU B 1  264 ? -40.219 44.805 24.152  1.00 71.58  ? 261 LEU B CA    1 
ATOM   4068 C  C     . LEU B 1  264 ? -41.350 43.811 23.867  1.00 70.39  ? 261 LEU B C     1 
ATOM   4069 O  O     . LEU B 1  264 ? -41.226 42.612 24.129  1.00 70.39  ? 261 LEU B O     1 
ATOM   4070 C  CB    . LEU B 1  264 ? -39.343 45.086 22.915  1.00 72.01  ? 261 LEU B CB    1 
ATOM   4071 C  CG    . LEU B 1  264 ? -38.199 46.131 23.065  1.00 73.27  ? 261 LEU B CG    1 
ATOM   4072 C  CD1   . LEU B 1  264 ? -36.847 45.615 22.545  1.00 72.16  ? 261 LEU B CD1   1 
ATOM   4073 C  CD2   . LEU B 1  264 ? -38.530 47.540 22.466  1.00 74.50  ? 261 LEU B CD2   1 
ATOM   4074 N  N     . LYS B 1  265 ? -42.472 44.293 23.365  1.00 68.64  ? 262 LYS B N     1 
ATOM   4075 C  CA    . LYS B 1  265 ? -43.586 43.385 23.116  1.00 66.84  ? 262 LYS B CA    1 
ATOM   4076 C  C     . LYS B 1  265 ? -43.366 42.514 21.864  1.00 65.14  ? 262 LYS B C     1 
ATOM   4077 O  O     . LYS B 1  265 ? -44.293 41.821 21.426  1.00 65.34  ? 262 LYS B O     1 
ATOM   4078 C  CB    . LYS B 1  265 ? -44.902 44.182 23.001  1.00 67.52  ? 262 LYS B CB    1 
ATOM   4079 N  N     . TYR B 1  266 ? -42.148 42.530 21.305  1.00 62.82  ? 263 TYR B N     1 
ATOM   4080 C  CA    . TYR B 1  266 ? -41.910 42.030 19.933  1.00 60.35  ? 263 TYR B CA    1 
ATOM   4081 C  C     . TYR B 1  266 ? -40.694 41.126 19.749  1.00 58.67  ? 263 TYR B C     1 
ATOM   4082 O  O     . TYR B 1  266 ? -39.745 41.212 20.529  1.00 58.78  ? 263 TYR B O     1 
ATOM   4083 C  CB    . TYR B 1  266 ? -41.801 43.202 18.980  1.00 60.08  ? 263 TYR B CB    1 
ATOM   4084 C  CG    . TYR B 1  266 ? -43.004 44.125 18.968  1.00 61.09  ? 263 TYR B CG    1 
ATOM   4085 C  CD1   . TYR B 1  266 ? -44.279 43.658 18.585  1.00 62.75  ? 263 TYR B CD1   1 
ATOM   4086 C  CD2   . TYR B 1  266 ? -42.870 45.473 19.303  1.00 61.71  ? 263 TYR B CD2   1 
ATOM   4087 C  CE1   . TYR B 1  266 ? -45.394 44.517 18.557  1.00 63.43  ? 263 TYR B CE1   1 
ATOM   4088 C  CE2   . TYR B 1  266 ? -43.964 46.344 19.269  1.00 63.79  ? 263 TYR B CE2   1 
ATOM   4089 C  CZ    . TYR B 1  266 ? -45.224 45.859 18.899  1.00 64.91  ? 263 TYR B CZ    1 
ATOM   4090 O  OH    . TYR B 1  266 ? -46.302 46.726 18.879  1.00 67.36  ? 263 TYR B OH    1 
ATOM   4091 N  N     . THR B 1  267 ? -40.737 40.261 18.728  1.00 56.22  ? 264 THR B N     1 
ATOM   4092 C  CA    . THR B 1  267 ? -39.583 39.444 18.323  1.00 54.27  ? 264 THR B CA    1 
ATOM   4093 C  C     . THR B 1  267 ? -38.593 40.265 17.471  1.00 53.19  ? 264 THR B C     1 
ATOM   4094 O  O     . THR B 1  267 ? -38.944 41.341 16.957  1.00 53.12  ? 264 THR B O     1 
ATOM   4095 C  CB    . THR B 1  267 ? -39.988 38.198 17.489  1.00 54.45  ? 264 THR B CB    1 
ATOM   4096 O  OG1   . THR B 1  267 ? -40.557 38.601 16.233  1.00 53.74  ? 264 THR B OG1   1 
ATOM   4097 C  CG2   . THR B 1  267 ? -40.959 37.320 18.236  1.00 54.02  ? 264 THR B CG2   1 
ATOM   4098 N  N     . PRO B 1  268 ? -37.352 39.771 17.310  1.00 51.83  ? 265 PRO B N     1 
ATOM   4099 C  CA    . PRO B 1  268 ? -36.452 40.500 16.413  1.00 51.22  ? 265 PRO B CA    1 
ATOM   4100 C  C     . PRO B 1  268 ? -36.969 40.537 14.970  1.00 50.03  ? 265 PRO B C     1 
ATOM   4101 O  O     . PRO B 1  268 ? -36.849 41.561 14.305  1.00 49.62  ? 265 PRO B O     1 
ATOM   4102 C  CB    . PRO B 1  268 ? -35.141 39.715 16.514  1.00 51.47  ? 265 PRO B CB    1 
ATOM   4103 C  CG    . PRO B 1  268 ? -35.198 39.107 17.863  1.00 51.72  ? 265 PRO B CG    1 
ATOM   4104 C  CD    . PRO B 1  268 ? -36.638 38.727 18.058  1.00 51.72  ? 265 PRO B CD    1 
ATOM   4105 N  N     . HIS B 1  269 ? -37.574 39.446 14.508  1.00 48.89  ? 266 HIS B N     1 
ATOM   4106 C  CA    . HIS B 1  269 ? -38.197 39.454 13.200  1.00 47.84  ? 266 HIS B CA    1 
ATOM   4107 C  C     . HIS B 1  269 ? -39.130 40.640 13.059  1.00 47.50  ? 266 HIS B C     1 
ATOM   4108 O  O     . HIS B 1  269 ? -39.047 41.399 12.094  1.00 47.56  ? 266 HIS B O     1 
ATOM   4109 C  CB    . HIS B 1  269 ? -38.976 38.184 12.963  1.00 47.80  ? 266 HIS B CB    1 
ATOM   4110 C  CG    . HIS B 1  269 ? -39.674 38.155 11.641  1.00 48.68  ? 266 HIS B CG    1 
ATOM   4111 N  ND1   . HIS B 1  269 ? -39.222 37.403 10.573  1.00 48.82  ? 266 HIS B ND1   1 
ATOM   4112 C  CD2   . HIS B 1  269 ? -40.788 38.794 11.210  1.00 48.53  ? 266 HIS B CD2   1 
ATOM   4113 C  CE1   . HIS B 1  269 ? -40.035 37.571 9.548   1.00 50.02  ? 266 HIS B CE1   1 
ATOM   4114 N  NE2   . HIS B 1  269 ? -40.992 38.413 9.906   1.00 50.64  ? 266 HIS B NE2   1 
ATOM   4115 N  N     . GLN B 1  270 ? -40.016 40.811 14.027  1.00 47.06  ? 267 GLN B N     1 
ATOM   4116 C  CA    . GLN B 1  270 ? -41.002 41.871 13.944  1.00 46.57  ? 267 GLN B CA    1 
ATOM   4117 C  C     . GLN B 1  270 ? -40.365 43.258 13.938  1.00 45.95  ? 267 GLN B C     1 
ATOM   4118 O  O     . GLN B 1  270 ? -40.816 44.163 13.236  1.00 45.31  ? 267 GLN B O     1 
ATOM   4119 C  CB    . GLN B 1  270 ? -41.966 41.741 15.097  1.00 46.81  ? 267 GLN B CB    1 
ATOM   4120 C  CG    . GLN B 1  270 ? -42.649 40.391 15.138  1.00 48.36  ? 267 GLN B CG    1 
ATOM   4121 C  CD    . GLN B 1  270 ? -43.653 40.289 16.271  1.00 48.78  ? 267 GLN B CD    1 
ATOM   4122 O  OE1   . GLN B 1  270 ? -43.294 40.361 17.451  1.00 48.97  ? 267 GLN B OE1   1 
ATOM   4123 N  NE2   . GLN B 1  270 ? -44.919 40.121 15.914  1.00 48.10  ? 267 GLN B NE2   1 
ATOM   4124 N  N     . LEU B 1  271 ? -39.297 43.418 14.707  1.00 45.24  ? 268 LEU B N     1 
ATOM   4125 C  CA    . LEU B 1  271 ? -38.661 44.719 14.787  1.00 44.79  ? 268 LEU B CA    1 
ATOM   4126 C  C     . LEU B 1  271 ? -37.869 45.042 13.537  1.00 44.46  ? 268 LEU B C     1 
ATOM   4127 O  O     . LEU B 1  271 ? -37.739 46.216 13.145  1.00 44.62  ? 268 LEU B O     1 
ATOM   4128 C  CB    . LEU B 1  271 ? -37.782 44.818 16.040  1.00 44.93  ? 268 LEU B CB    1 
ATOM   4129 C  CG    . LEU B 1  271 ? -38.602 44.939 17.338  1.00 44.11  ? 268 LEU B CG    1 
ATOM   4130 C  CD1   . LEU B 1  271 ? -37.716 44.783 18.525  1.00 42.81  ? 268 LEU B CD1   1 
ATOM   4131 C  CD2   . LEU B 1  271 ? -39.376 46.260 17.417  1.00 42.76  ? 268 LEU B CD2   1 
ATOM   4132 N  N     . LEU B 1  272 ? -37.343 43.995 12.914  1.00 43.66  ? 269 LEU B N     1 
ATOM   4133 C  CA    . LEU B 1  272 ? -36.543 44.164 11.734  1.00 43.24  ? 269 LEU B CA    1 
ATOM   4134 C  C     . LEU B 1  272 ? -37.405 44.470 10.518  1.00 43.23  ? 269 LEU B C     1 
ATOM   4135 O  O     . LEU B 1  272 ? -37.057 45.350 9.739   1.00 43.62  ? 269 LEU B O     1 
ATOM   4136 C  CB    . LEU B 1  272 ? -35.670 42.941 11.481  1.00 42.98  ? 269 LEU B CB    1 
ATOM   4137 C  CG    . LEU B 1  272 ? -34.617 43.141 10.385  1.00 43.31  ? 269 LEU B CG    1 
ATOM   4138 C  CD1   . LEU B 1  272 ? -33.850 44.451 10.588  1.00 41.66  ? 269 LEU B CD1   1 
ATOM   4139 C  CD2   . LEU B 1  272 ? -33.659 41.956 10.342  1.00 42.12  ? 269 LEU B CD2   1 
ATOM   4140 N  N     . PHE B 1  273 ? -38.523 43.758 10.376  1.00 42.45  ? 270 PHE B N     1 
ATOM   4141 C  CA    . PHE B 1  273 ? -39.310 43.813 9.159   1.00 41.93  ? 270 PHE B CA    1 
ATOM   4142 C  C     . PHE B 1  273 ? -40.659 44.464 9.288   1.00 42.56  ? 270 PHE B C     1 
ATOM   4143 O  O     . PHE B 1  273 ? -41.254 44.792 8.272   1.00 43.37  ? 270 PHE B O     1 
ATOM   4144 C  CB    . PHE B 1  273 ? -39.526 42.417 8.608   1.00 41.46  ? 270 PHE B CB    1 
ATOM   4145 C  CG    . PHE B 1  273 ? -38.276 41.686 8.337   1.00 39.42  ? 270 PHE B CG    1 
ATOM   4146 C  CD1   . PHE B 1  273 ? -38.034 40.491 8.960   1.00 36.71  ? 270 PHE B CD1   1 
ATOM   4147 C  CD2   . PHE B 1  273 ? -37.337 42.194 7.436   1.00 39.80  ? 270 PHE B CD2   1 
ATOM   4148 C  CE1   . PHE B 1  273 ? -36.864 39.782 8.703   1.00 38.46  ? 270 PHE B CE1   1 
ATOM   4149 C  CE2   . PHE B 1  273 ? -36.157 41.501 7.175   1.00 40.14  ? 270 PHE B CE2   1 
ATOM   4150 C  CZ    . PHE B 1  273 ? -35.921 40.279 7.821   1.00 38.18  ? 270 PHE B CZ    1 
ATOM   4151 N  N     . GLY B 1  274 ? -41.170 44.606 10.509  1.00 42.80  ? 271 GLY B N     1 
ATOM   4152 C  CA    . GLY B 1  274 ? -42.433 45.294 10.743  1.00 43.35  ? 271 GLY B CA    1 
ATOM   4153 C  C     . GLY B 1  274 ? -43.668 44.483 10.399  1.00 44.06  ? 271 GLY B C     1 
ATOM   4154 O  O     . GLY B 1  274 ? -44.704 45.049 10.067  1.00 44.03  ? 271 GLY B O     1 
ATOM   4155 N  N     . ILE B 1  275 ? -43.549 43.163 10.482  1.00 45.20  ? 272 ILE B N     1 
ATOM   4156 C  CA    . ILE B 1  275 ? -44.634 42.231 10.151  1.00 46.63  ? 272 ILE B CA    1 
ATOM   4157 C  C     . ILE B 1  275 ? -44.516 40.989 11.030  1.00 47.90  ? 272 ILE B C     1 
ATOM   4158 O  O     . ILE B 1  275 ? -43.446 40.720 11.573  1.00 48.25  ? 272 ILE B O     1 
ATOM   4159 C  CB    . ILE B 1  275 ? -44.538 41.739 8.684   1.00 46.51  ? 272 ILE B CB    1 
ATOM   4160 C  CG1   . ILE B 1  275 ? -43.126 41.224 8.402   1.00 45.83  ? 272 ILE B CG1   1 
ATOM   4161 C  CG2   . ILE B 1  275 ? -44.944 42.845 7.691   1.00 46.16  ? 272 ILE B CG2   1 
ATOM   4162 C  CD1   . ILE B 1  275 ? -43.069 40.143 7.388   1.00 46.70  ? 272 ILE B CD1   1 
ATOM   4163 N  N     . ASP B 1  276 ? -45.595 40.222 11.159  1.00 49.43  ? 273 ASP B N     1 
ATOM   4164 C  CA    . ASP B 1  276 ? -45.504 38.914 11.798  1.00 51.40  ? 273 ASP B CA    1 
ATOM   4165 C  C     . ASP B 1  276 ? -44.729 38.011 10.865  1.00 52.49  ? 273 ASP B C     1 
ATOM   4166 O  O     . ASP B 1  276 ? -44.530 38.346 9.703   1.00 53.10  ? 273 ASP B O     1 
ATOM   4167 C  CB    . ASP B 1  276 ? -46.889 38.316 12.107  1.00 51.86  ? 273 ASP B CB    1 
ATOM   4168 C  CG    . ASP B 1  276 ? -47.634 39.058 13.248  1.00 53.39  ? 273 ASP B CG    1 
ATOM   4169 O  OD1   . ASP B 1  276 ? -47.008 39.814 14.020  1.00 53.24  ? 273 ASP B OD1   1 
ATOM   4170 O  OD2   . ASP B 1  276 ? -48.865 38.877 13.369  1.00 55.38  ? 273 ASP B OD2   1 
ATOM   4171 N  N     . SER B 1  277 ? -44.275 36.874 11.375  1.00 54.03  ? 274 SER B N     1 
ATOM   4172 C  CA    . SER B 1  277 ? -43.470 35.945 10.608  1.00 55.39  ? 274 SER B CA    1 
ATOM   4173 C  C     . SER B 1  277 ? -44.330 34.764 10.165  1.00 56.78  ? 274 SER B C     1 
ATOM   4174 O  O     . SER B 1  277 ? -45.369 34.523 10.746  1.00 57.26  ? 274 SER B O     1 
ATOM   4175 C  CB    . SER B 1  277 ? -42.320 35.492 11.488  1.00 54.95  ? 274 SER B CB    1 
ATOM   4176 O  OG    . SER B 1  277 ? -41.908 34.177 11.182  1.00 56.17  ? 274 SER B OG    1 
ATOM   4177 N  N     . ASN B 1  278 ? -43.908 34.020 9.153   1.00 58.70  ? 275 ASN B N     1 
ATOM   4178 C  CA    . ASN B 1  278 ? -44.623 32.804 8.775   1.00 60.90  ? 275 ASN B CA    1 
ATOM   4179 C  C     . ASN B 1  278 ? -44.175 31.575 9.574   1.00 63.29  ? 275 ASN B C     1 
ATOM   4180 O  O     . ASN B 1  278 ? -44.690 30.462 9.389   1.00 63.22  ? 275 ASN B O     1 
ATOM   4181 C  CB    . ASN B 1  278 ? -44.486 32.534 7.281   1.00 60.32  ? 275 ASN B CB    1 
ATOM   4182 C  CG    . ASN B 1  278 ? -44.865 33.709 6.451   1.00 59.36  ? 275 ASN B CG    1 
ATOM   4183 O  OD1   . ASN B 1  278 ? -45.973 34.231 6.555   1.00 58.77  ? 275 ASN B OD1   1 
ATOM   4184 N  ND2   . ASN B 1  278 ? -43.945 34.148 5.611   1.00 58.97  ? 275 ASN B ND2   1 
ATOM   4185 N  N     . THR B 1  279 ? -43.189 31.777 10.438  1.00 66.40  ? 276 THR B N     1 
ATOM   4186 C  CA    . THR B 1  279 ? -42.752 30.740 11.359  1.00 69.98  ? 276 THR B CA    1 
ATOM   4187 C  C     . THR B 1  279 ? -42.719 31.305 12.783  1.00 72.82  ? 276 THR B C     1 
ATOM   4188 O  O     . THR B 1  279 ? -41.650 31.708 13.268  1.00 73.05  ? 276 THR B O     1 
ATOM   4189 C  CB    . THR B 1  279 ? -41.351 30.153 10.988  1.00 69.70  ? 276 THR B CB    1 
ATOM   4190 O  OG1   . THR B 1  279 ? -40.364 31.188 11.005  1.00 69.28  ? 276 THR B OG1   1 
ATOM   4191 C  CG2   . THR B 1  279 ? -41.377 29.508 9.629   1.00 69.70  ? 276 THR B CG2   1 
ATOM   4192 N  N     . PRO B 1  280 ? -43.889 31.356 13.455  1.00 75.55  ? 277 PRO B N     1 
ATOM   4193 C  CA    . PRO B 1  280 ? -43.879 31.808 14.849  1.00 77.75  ? 277 PRO B CA    1 
ATOM   4194 C  C     . PRO B 1  280 ? -43.431 30.635 15.721  1.00 80.20  ? 277 PRO B C     1 
ATOM   4195 O  O     . PRO B 1  280 ? -43.823 29.497 15.456  1.00 80.33  ? 277 PRO B O     1 
ATOM   4196 C  CB    . PRO B 1  280 ? -45.344 32.181 15.115  1.00 77.60  ? 277 PRO B CB    1 
ATOM   4197 C  CG    . PRO B 1  280 ? -46.138 31.747 13.860  1.00 76.86  ? 277 PRO B CG    1 
ATOM   4198 C  CD    . PRO B 1  280 ? -45.225 30.890 13.038  1.00 75.73  ? 277 PRO B CD    1 
ATOM   4199 N  N     . PHE B 1  281 ? -42.575 30.877 16.704  1.00 83.19  ? 278 PHE B N     1 
ATOM   4200 C  CA    . PHE B 1  281 ? -42.140 29.772 17.549  1.00 86.64  ? 278 PHE B CA    1 
ATOM   4201 C  C     . PHE B 1  281 ? -42.941 29.804 18.839  1.00 89.19  ? 278 PHE B C     1 
ATOM   4202 O  O     . PHE B 1  281 ? -42.516 30.384 19.846  1.00 89.40  ? 278 PHE B O     1 
ATOM   4203 C  CB    . PHE B 1  281 ? -40.624 29.760 17.758  1.00 86.41  ? 278 PHE B CB    1 
ATOM   4204 C  CG    . PHE B 1  281 ? -39.867 29.033 16.660  1.00 87.15  ? 278 PHE B CG    1 
ATOM   4205 C  CD1   . PHE B 1  281 ? -39.305 27.772 16.893  1.00 87.81  ? 278 PHE B CD1   1 
ATOM   4206 C  CD2   . PHE B 1  281 ? -39.725 29.599 15.385  1.00 87.06  ? 278 PHE B CD2   1 
ATOM   4207 C  CE1   . PHE B 1  281 ? -38.607 27.093 15.878  1.00 87.10  ? 278 PHE B CE1   1 
ATOM   4208 C  CE2   . PHE B 1  281 ? -39.031 28.931 14.365  1.00 85.88  ? 278 PHE B CE2   1 
ATOM   4209 C  CZ    . PHE B 1  281 ? -38.471 27.679 14.613  1.00 86.40  ? 278 PHE B CZ    1 
ATOM   4210 N  N     . ALA B 1  282 ? -44.124 29.182 18.762  1.00 92.40  ? 279 ALA B N     1 
ATOM   4211 C  CA    . ALA B 1  282 ? -45.191 29.310 19.761  1.00 95.44  ? 279 ALA B CA    1 
ATOM   4212 C  C     . ALA B 1  282 ? -44.782 28.752 21.123  1.00 97.61  ? 279 ALA B C     1 
ATOM   4213 O  O     . ALA B 1  282 ? -45.123 29.329 22.167  1.00 97.80  ? 279 ALA B O     1 
ATOM   4214 C  CB    . ALA B 1  282 ? -46.482 28.656 19.256  1.00 95.18  ? 279 ALA B CB    1 
ATOM   4215 N  N     . ASN B 1  283 ? -44.049 27.635 21.095  1.00 100.29 ? 280 ASN B N     1 
ATOM   4216 C  CA    . ASN B 1  283 ? -43.404 27.083 22.290  1.00 102.95 ? 280 ASN B CA    1 
ATOM   4217 C  C     . ASN B 1  283 ? -42.166 27.907 22.697  1.00 104.59 ? 280 ASN B C     1 
ATOM   4218 O  O     . ASN B 1  283 ? -41.096 27.796 22.067  1.00 104.83 ? 280 ASN B O     1 
ATOM   4219 C  CB    . ASN B 1  283 ? -42.999 25.603 22.086  1.00 102.99 ? 280 ASN B CB    1 
ATOM   4220 C  CG    . ASN B 1  283 ? -44.105 24.759 21.449  1.00 103.86 ? 280 ASN B CG    1 
ATOM   4221 O  OD1   . ASN B 1  283 ? -45.299 25.004 21.656  1.00 104.93 ? 280 ASN B OD1   1 
ATOM   4222 N  ND2   . ASN B 1  283 ? -43.705 23.754 20.668  1.00 103.73 ? 280 ASN B ND2   1 
ATOM   4223 N  N     . GLN B 1  284 ? -42.322 28.749 23.723  1.00 106.49 ? 281 GLN B N     1 
ATOM   4224 C  CA    . GLN B 1  284 ? -41.171 29.236 24.480  1.00 108.29 ? 281 GLN B CA    1 
ATOM   4225 C  C     . GLN B 1  284 ? -40.556 27.943 25.045  1.00 109.56 ? 281 GLN B C     1 
ATOM   4226 O  O     . GLN B 1  284 ? -41.124 27.330 25.961  1.00 109.92 ? 281 GLN B O     1 
ATOM   4227 C  CB    . GLN B 1  284 ? -41.603 30.207 25.593  1.00 108.06 ? 281 GLN B CB    1 
ATOM   4228 N  N     . ASP B 1  285 ? -39.431 27.512 24.461  1.00 110.90 ? 282 ASP B N     1 
ATOM   4229 C  CA    . ASP B 1  285 ? -38.910 26.141 24.647  1.00 112.05 ? 282 ASP B CA    1 
ATOM   4230 C  C     . ASP B 1  285 ? -38.173 25.883 25.980  1.00 112.70 ? 282 ASP B C     1 
ATOM   4231 O  O     . ASP B 1  285 ? -37.839 26.835 26.702  1.00 112.94 ? 282 ASP B O     1 
ATOM   4232 C  CB    . ASP B 1  285 ? -38.032 25.743 23.455  1.00 112.03 ? 282 ASP B CB    1 
ATOM   4233 C  CG    . ASP B 1  285 ? -37.995 24.245 23.243  1.00 112.67 ? 282 ASP B CG    1 
ATOM   4234 O  OD1   . ASP B 1  285 ? -39.070 23.604 23.354  1.00 112.79 ? 282 ASP B OD1   1 
ATOM   4235 O  OD2   . ASP B 1  285 ? -36.892 23.713 22.980  1.00 112.92 ? 282 ASP B OD2   1 
ATOM   4236 N  N     . THR B 1  286 ? -37.930 24.601 26.296  1.00 113.37 ? 283 THR B N     1 
ATOM   4237 C  CA    . THR B 1  286 ? -37.263 24.194 27.559  1.00 113.83 ? 283 THR B CA    1 
ATOM   4238 C  C     . THR B 1  286 ? -35.878 24.833 27.728  1.00 113.93 ? 283 THR B C     1 
ATOM   4239 O  O     . THR B 1  286 ? -35.601 25.443 28.768  1.00 113.91 ? 283 THR B O     1 
ATOM   4240 C  CB    . THR B 1  286 ? -37.176 22.629 27.769  1.00 113.94 ? 283 THR B CB    1 
ATOM   4241 O  OG1   . THR B 1  286 ? -36.105 22.076 26.994  1.00 114.19 ? 283 THR B OG1   1 
ATOM   4242 C  CG2   . THR B 1  286 ? -38.501 21.921 27.423  1.00 114.03 ? 283 THR B CG2   1 
ATOM   4243 N  N     . LEU B 1  287 ? -35.031 24.697 26.703  1.00 114.09 ? 284 LEU B N     1 
ATOM   4244 C  CA    . LEU B 1  287 ? -33.711 25.348 26.646  1.00 114.33 ? 284 LEU B CA    1 
ATOM   4245 C  C     . LEU B 1  287 ? -32.738 24.822 27.707  1.00 114.90 ? 284 LEU B C     1 
ATOM   4246 O  O     . LEU B 1  287 ? -31.537 25.081 27.646  1.00 114.89 ? 284 LEU B O     1 
ATOM   4247 C  CB    . LEU B 1  287 ? -33.858 26.874 26.731  1.00 114.06 ? 284 LEU B CB    1 
ATOM   4248 C  CG    . LEU B 1  287 ? -32.737 27.798 26.261  1.00 113.10 ? 284 LEU B CG    1 
ATOM   4249 C  CD1   . LEU B 1  287 ? -32.367 27.515 24.829  1.00 112.01 ? 284 LEU B CD1   1 
ATOM   4250 C  CD2   . LEU B 1  287 ? -33.178 29.241 26.419  1.00 112.69 ? 284 LEU B CD2   1 
ATOM   4251 N  N     . ASP B 1  288 ? -33.277 24.081 28.671  1.00 115.80 ? 285 ASP B N     1 
ATOM   4252 C  CA    . ASP B 1  288 ? -32.500 23.403 29.707  1.00 116.53 ? 285 ASP B CA    1 
ATOM   4253 C  C     . ASP B 1  288 ? -32.246 21.950 29.309  1.00 117.12 ? 285 ASP B C     1 
ATOM   4254 O  O     . ASP B 1  288 ? -33.039 21.335 28.594  1.00 117.07 ? 285 ASP B O     1 
ATOM   4255 C  CB    . ASP B 1  288 ? -33.238 23.445 31.056  1.00 116.50 ? 285 ASP B CB    1 
ATOM   4256 C  CG    . ASP B 1  288 ? -33.320 24.847 31.644  1.00 116.27 ? 285 ASP B CG    1 
ATOM   4257 O  OD1   . ASP B 1  288 ? -32.299 25.330 32.171  1.00 115.63 ? 285 ASP B OD1   1 
ATOM   4258 O  OD2   . ASP B 1  288 ? -34.411 25.459 31.595  1.00 116.01 ? 285 ASP B OD2   1 
ATOM   4259 N  N     . LEU B 1  289 ? -31.135 21.414 29.797  1.00 118.08 ? 286 LEU B N     1 
ATOM   4260 C  CA    . LEU B 1  289 ? -30.717 20.039 29.532  1.00 119.09 ? 286 LEU B CA    1 
ATOM   4261 C  C     . LEU B 1  289 ? -31.575 19.016 30.305  1.00 119.88 ? 286 LEU B C     1 
ATOM   4262 O  O     . LEU B 1  289 ? -31.581 19.023 31.546  1.00 120.05 ? 286 LEU B O     1 
ATOM   4263 C  CB    . LEU B 1  289 ? -29.245 19.889 29.927  1.00 119.03 ? 286 LEU B CB    1 
ATOM   4264 C  CG    . LEU B 1  289 ? -28.288 21.001 29.476  1.00 119.07 ? 286 LEU B CG    1 
ATOM   4265 C  CD1   . LEU B 1  289 ? -27.602 21.709 30.656  1.00 118.42 ? 286 LEU B CD1   1 
ATOM   4266 C  CD2   . LEU B 1  289 ? -27.278 20.443 28.480  1.00 118.95 ? 286 LEU B CD2   1 
ATOM   4267 N  N     . THR B 1  290 ? -32.293 18.150 29.576  1.00 120.77 ? 287 THR B N     1 
ATOM   4268 C  CA    . THR B 1  290 ? -33.087 17.065 30.192  1.00 121.45 ? 287 THR B CA    1 
ATOM   4269 C  C     . THR B 1  290 ? -32.151 16.010 30.779  1.00 122.14 ? 287 THR B C     1 
ATOM   4270 O  O     . THR B 1  290 ? -31.036 15.821 30.287  1.00 122.07 ? 287 THR B O     1 
ATOM   4271 C  CB    . THR B 1  290 ? -34.097 16.392 29.213  1.00 121.31 ? 287 THR B CB    1 
ATOM   4272 O  OG1   . THR B 1  290 ? -33.415 15.461 28.364  1.00 121.28 ? 287 THR B OG1   1 
ATOM   4273 C  CG2   . THR B 1  290 ? -34.850 17.430 28.365  1.00 121.17 ? 287 THR B CG2   1 
ATOM   4274 N  N     . ARG B 1  291 ? -32.608 15.326 31.827  1.00 123.12 ? 288 ARG B N     1 
ATOM   4275 C  CA    . ARG B 1  291 ? -31.737 14.442 32.616  1.00 124.03 ? 288 ARG B CA    1 
ATOM   4276 C  C     . ARG B 1  291 ? -31.002 13.365 31.791  1.00 124.56 ? 288 ARG B C     1 
ATOM   4277 O  O     . ARG B 1  291 ? -29.875 12.985 32.132  1.00 124.49 ? 288 ARG B O     1 
ATOM   4278 C  CB    . ARG B 1  291 ? -32.489 13.870 33.833  1.00 124.04 ? 288 ARG B CB    1 
ATOM   4279 C  CG    . ARG B 1  291 ? -32.648 14.895 34.982  1.00 124.11 ? 288 ARG B CG    1 
ATOM   4280 C  CD    . ARG B 1  291 ? -33.499 14.375 36.146  1.00 124.08 ? 288 ARG B CD    1 
ATOM   4281 N  NE    . ARG B 1  291 ? -32.998 14.836 37.447  1.00 123.94 ? 288 ARG B NE    1 
ATOM   4282 C  CZ    . ARG B 1  291 ? -32.242 14.113 38.279  1.00 123.84 ? 288 ARG B CZ    1 
ATOM   4283 N  NH1   . ARG B 1  291 ? -31.884 12.870 37.969  1.00 123.78 ? 288 ARG B NH1   1 
ATOM   4284 N  NH2   . ARG B 1  291 ? -31.838 14.632 39.432  1.00 123.40 ? 288 ARG B NH2   1 
ATOM   4285 N  N     . GLU B 1  292 ? -31.627 12.917 30.698  1.00 125.32 ? 289 GLU B N     1 
ATOM   4286 C  CA    . GLU B 1  292 ? -30.992 12.018 29.711  1.00 126.10 ? 289 GLU B CA    1 
ATOM   4287 C  C     . GLU B 1  292 ? -29.735 12.631 29.072  1.00 126.48 ? 289 GLU B C     1 
ATOM   4288 O  O     . GLU B 1  292 ? -28.708 11.955 28.925  1.00 126.44 ? 289 GLU B O     1 
ATOM   4289 C  CB    . GLU B 1  292 ? -31.976 11.645 28.589  1.00 126.15 ? 289 GLU B CB    1 
ATOM   4290 C  CG    . GLU B 1  292 ? -33.138 10.737 28.984  1.00 126.55 ? 289 GLU B CG    1 
ATOM   4291 C  CD    . GLU B 1  292 ? -33.934 10.244 27.774  1.00 127.04 ? 289 GLU B CD    1 
ATOM   4292 O  OE1   . GLU B 1  292 ? -34.330 11.069 26.919  1.00 126.83 ? 289 GLU B OE1   1 
ATOM   4293 O  OE2   . GLU B 1  292 ? -34.168 9.021  27.680  1.00 127.22 ? 289 GLU B OE2   1 
ATOM   4294 N  N     . GLU B 1  293 ? -29.844 13.907 28.689  1.00 126.94 ? 290 GLU B N     1 
ATOM   4295 C  CA    . GLU B 1  293 ? -28.777 14.651 28.010  1.00 127.30 ? 290 GLU B CA    1 
ATOM   4296 C  C     . GLU B 1  293 ? -27.672 15.107 28.957  1.00 127.78 ? 290 GLU B C     1 
ATOM   4297 O  O     . GLU B 1  293 ? -26.553 15.372 28.520  1.00 127.88 ? 290 GLU B O     1 
ATOM   4298 C  CB    . GLU B 1  293 ? -29.347 15.876 27.299  1.00 127.08 ? 290 GLU B CB    1 
ATOM   4299 C  CG    . GLU B 1  293 ? -30.370 15.571 26.231  1.00 126.91 ? 290 GLU B CG    1 
ATOM   4300 C  CD    . GLU B 1  293 ? -31.269 16.755 25.947  1.00 126.85 ? 290 GLU B CD    1 
ATOM   4301 O  OE1   . GLU B 1  293 ? -30.772 17.900 25.939  1.00 126.80 ? 290 GLU B OE1   1 
ATOM   4302 O  OE2   . GLU B 1  293 ? -32.479 16.544 25.735  1.00 127.20 ? 290 GLU B OE2   1 
ATOM   4303 N  N     . GLU B 1  294 ? -27.993 15.216 30.244  1.00 128.34 ? 291 GLU B N     1 
ATOM   4304 C  CA    . GLU B 1  294 ? -27.011 15.613 31.251  1.00 128.87 ? 291 GLU B CA    1 
ATOM   4305 C  C     . GLU B 1  294 ? -25.964 14.518 31.472  1.00 129.39 ? 291 GLU B C     1 
ATOM   4306 O  O     . GLU B 1  294 ? -24.764 14.802 31.483  1.00 129.44 ? 291 GLU B O     1 
ATOM   4307 C  CB    . GLU B 1  294 ? -27.695 15.988 32.568  1.00 128.74 ? 291 GLU B CB    1 
ATOM   4308 C  CG    . GLU B 1  294 ? -28.589 17.219 32.478  1.00 128.52 ? 291 GLU B CG    1 
ATOM   4309 C  CD    . GLU B 1  294 ? -28.870 17.838 33.833  1.00 128.25 ? 291 GLU B CD    1 
ATOM   4310 O  OE1   . GLU B 1  294 ? -28.071 17.600 34.761  1.00 127.83 ? 291 GLU B OE1   1 
ATOM   4311 O  OE2   . GLU B 1  294 ? -29.880 18.566 33.973  1.00 127.95 ? 291 GLU B OE2   1 
ATOM   4312 N  N     . LEU B 1  295 ? -26.428 13.274 31.627  1.00 129.99 ? 292 LEU B N     1 
ATOM   4313 C  CA    . LEU B 1  295 ? -25.549 12.110 31.844  1.00 130.51 ? 292 LEU B CA    1 
ATOM   4314 C  C     . LEU B 1  295 ? -24.946 11.540 30.543  1.00 130.89 ? 292 LEU B C     1 
ATOM   4315 O  O     . LEU B 1  295 ? -24.060 10.672 30.595  1.00 130.99 ? 292 LEU B O     1 
ATOM   4316 C  CB    . LEU B 1  295 ? -26.280 11.009 32.629  1.00 130.24 ? 292 LEU B CB    1 
ATOM   4317 N  N     . SER B 1  296 ? -25.426 12.027 29.392  1.00 131.26 ? 293 SER B N     1 
ATOM   4318 C  CA    . SER B 1  296 ? -24.867 11.652 28.080  1.00 131.52 ? 293 SER B CA    1 
ATOM   4319 C  C     . SER B 1  296 ? -24.095 12.795 27.391  1.00 131.70 ? 293 SER B C     1 
ATOM   4320 O  O     . SER B 1  296 ? -23.468 12.584 26.350  1.00 131.64 ? 293 SER B O     1 
ATOM   4321 C  CB    . SER B 1  296 ? -25.935 11.038 27.152  1.00 131.48 ? 293 SER B CB    1 
ATOM   4322 O  OG    . SER B 1  296 ? -26.769 12.020 26.568  1.00 131.19 ? 293 SER B OG    1 
ATOM   4323 N  N     . LEU B 1  297 ? -24.147 13.994 27.978  1.00 132.03 ? 294 LEU B N     1 
ATOM   4324 C  CA    . LEU B 1  297 ? -23.234 15.083 27.609  1.00 132.37 ? 294 LEU B CA    1 
ATOM   4325 C  C     . LEU B 1  297 ? -21.920 14.932 28.375  1.00 132.63 ? 294 LEU B C     1 
ATOM   4326 O  O     . LEU B 1  297 ? -20.863 15.349 27.897  1.00 132.62 ? 294 LEU B O     1 
ATOM   4327 C  CB    . LEU B 1  297 ? -23.850 16.459 27.881  1.00 132.30 ? 294 LEU B CB    1 
ATOM   4328 N  N     . LEU B 1  298 ? -21.997 14.332 29.565  1.00 132.99 ? 295 LEU B N     1 
ATOM   4329 C  CA    . LEU B 1  298 ? -20.805 13.955 30.331  1.00 133.29 ? 295 LEU B CA    1 
ATOM   4330 C  C     . LEU B 1  298 ? -20.186 12.636 29.802  1.00 133.56 ? 295 LEU B C     1 
ATOM   4331 O  O     . LEU B 1  298 ? -19.081 12.253 30.211  1.00 133.59 ? 295 LEU B O     1 
ATOM   4332 C  CB    . LEU B 1  298 ? -21.109 13.880 31.843  1.00 133.18 ? 295 LEU B CB    1 
ATOM   4333 C  CG    . LEU B 1  298 ? -21.847 15.026 32.572  1.00 133.17 ? 295 LEU B CG    1 
ATOM   4334 C  CD1   . LEU B 1  298 ? -22.031 14.718 34.064  1.00 132.82 ? 295 LEU B CD1   1 
ATOM   4335 C  CD2   . LEU B 1  298 ? -21.191 16.400 32.386  1.00 132.73 ? 295 LEU B CD2   1 
ATOM   4336 N  N     . GLN B 1  299 ? -20.899 11.966 28.885  1.00 133.79 ? 296 GLN B N     1 
ATOM   4337 C  CA    . GLN B 1  299 ? -20.401 10.758 28.190  1.00 134.02 ? 296 GLN B CA    1 
ATOM   4338 C  C     . GLN B 1  299 ? -19.616 11.081 26.903  1.00 134.13 ? 296 GLN B C     1 
ATOM   4339 O  O     . GLN B 1  299 ? -18.627 10.401 26.594  1.00 134.30 ? 296 GLN B O     1 
ATOM   4340 C  CB    . GLN B 1  299 ? -21.537 9.765  27.895  1.00 133.84 ? 296 GLN B CB    1 
ATOM   4341 N  N     . GLU B 1  300 ? -20.057 12.109 26.168  1.00 134.08 ? 297 GLU B N     1 
ATOM   4342 C  CA    . GLU B 1  300 ? -19.345 12.617 24.974  1.00 133.91 ? 297 GLU B CA    1 
ATOM   4343 C  C     . GLU B 1  300 ? -18.016 13.322 25.299  1.00 133.85 ? 297 GLU B C     1 
ATOM   4344 O  O     . GLU B 1  300 ? -17.092 13.320 24.479  1.00 133.88 ? 297 GLU B O     1 
ATOM   4345 C  CB    . GLU B 1  300 ? -20.238 13.569 24.165  1.00 133.89 ? 297 GLU B CB    1 
ATOM   4346 C  CG    . GLU B 1  300 ? -21.280 12.887 23.278  1.00 133.67 ? 297 GLU B CG    1 
ATOM   4347 C  CD    . GLU B 1  300 ? -22.389 13.833 22.818  1.00 133.07 ? 297 GLU B CD    1 
ATOM   4348 O  OE1   . GLU B 1  300 ? -22.325 15.047 23.118  1.00 132.78 ? 297 GLU B OE1   1 
ATOM   4349 O  OE2   . GLU B 1  300 ? -23.334 13.356 22.157  1.00 132.59 ? 297 GLU B OE2   1 
ATOM   4350 N  N     . ILE B 1  301 ? -17.935 13.934 26.482  1.00 133.64 ? 298 ILE B N     1 
ATOM   4351 C  CA    . ILE B 1  301 ? -16.708 14.593 26.947  1.00 133.39 ? 298 ILE B CA    1 
ATOM   4352 C  C     . ILE B 1  301 ? -15.867 13.655 27.853  1.00 133.28 ? 298 ILE B C     1 
ATOM   4353 O  O     . ILE B 1  301 ? -15.204 14.102 28.795  1.00 133.30 ? 298 ILE B O     1 
ATOM   4354 C  CB    . ILE B 1  301 ? -17.019 16.004 27.589  1.00 133.35 ? 298 ILE B CB    1 
ATOM   4355 C  CG1   . ILE B 1  301 ? -15.781 16.914 27.557  1.00 133.34 ? 298 ILE B CG1   1 
ATOM   4356 C  CG2   . ILE B 1  301 ? -17.645 15.880 28.995  1.00 133.26 ? 298 ILE B CG2   1 
ATOM   4357 C  CD1   . ILE B 1  301 ? -16.082 18.386 27.764  1.00 132.83 ? 298 ILE B CD1   1 
ATOM   4358 N  N     . ARG B 1  302 ? -15.900 12.354 27.542  1.00 133.01 ? 299 ARG B N     1 
ATOM   4359 C  CA    . ARG B 1  302 ? -15.150 11.331 28.283  1.00 132.69 ? 299 ARG B CA    1 
ATOM   4360 C  C     . ARG B 1  302 ? -14.041 10.712 27.432  1.00 132.51 ? 299 ARG B C     1 
ATOM   4361 O  O     . ARG B 1  302 ? -13.777 11.155 26.315  1.00 132.19 ? 299 ARG B O     1 
ATOM   4362 C  CB    . ARG B 1  302 ? -16.088 10.234 28.801  1.00 132.53 ? 299 ARG B CB    1 
ATOM   4363 O  "O5'" . DA  C 2  1   ? -52.243 24.092 -6.728  1.00 98.44  ? 1   DA  C "O5'" 1 
ATOM   4364 C  "C5'" . DA  C 2  1   ? -53.335 24.434 -7.606  1.00 98.38  ? 1   DA  C "C5'" 1 
ATOM   4365 C  "C4'" . DA  C 2  1   ? -52.896 24.477 -9.067  1.00 97.92  ? 1   DA  C "C4'" 1 
ATOM   4366 O  "O4'" . DA  C 2  1   ? -53.514 23.398 -9.818  1.00 99.66  ? 1   DA  C "O4'" 1 
ATOM   4367 C  "C3'" . DA  C 2  1   ? -53.278 25.737 -9.848  1.00 96.19  ? 1   DA  C "C3'" 1 
ATOM   4368 O  "O3'" . DA  C 2  1   ? -52.436 26.884 -9.511  1.00 92.00  ? 1   DA  C "O3'" 1 
ATOM   4369 C  "C2'" . DA  C 2  1   ? -53.243 25.269 -11.308 1.00 96.96  ? 1   DA  C "C2'" 1 
ATOM   4370 C  "C1'" . DA  C 2  1   ? -53.693 23.804 -11.172 1.00 99.55  ? 1   DA  C "C1'" 1 
ATOM   4371 N  N9    . DA  C 2  1   ? -55.070 23.474 -11.594 1.00 100.42 ? 1   DA  C N9    1 
ATOM   4372 C  C8    . DA  C 2  1   ? -55.381 22.486 -12.492 1.00 100.73 ? 1   DA  C C8    1 
ATOM   4373 N  N7    . DA  C 2  1   ? -56.666 22.345 -12.732 1.00 100.68 ? 1   DA  C N7    1 
ATOM   4374 C  C5    . DA  C 2  1   ? -57.261 23.305 -11.932 1.00 100.93 ? 1   DA  C C5    1 
ATOM   4375 C  C6    . DA  C 2  1   ? -58.626 23.657 -11.745 1.00 101.10 ? 1   DA  C C6    1 
ATOM   4376 N  N6    . DA  C 2  1   ? -59.636 23.041 -12.389 1.00 100.38 ? 1   DA  C N6    1 
ATOM   4377 N  N1    . DA  C 2  1   ? -58.897 24.666 -10.872 1.00 101.05 ? 1   DA  C N1    1 
ATOM   4378 C  C2    . DA  C 2  1   ? -57.865 25.263 -10.236 1.00 101.22 ? 1   DA  C C2    1 
ATOM   4379 N  N3    . DA  C 2  1   ? -56.545 25.016 -10.334 1.00 100.81 ? 1   DA  C N3    1 
ATOM   4380 C  C4    . DA  C 2  1   ? -56.295 24.015 -11.210 1.00 100.78 ? 1   DA  C C4    1 
ATOM   4381 P  P     . DT  C 2  2   ? -50.824 27.038 -9.612  1.00 88.47  ? 2   DT  C P     1 
ATOM   4382 O  OP1   . DT  C 2  2   ? -50.110 25.850 -10.157 1.00 87.59  ? 2   DT  C OP1   1 
ATOM   4383 O  OP2   . DT  C 2  2   ? -50.367 27.596 -8.317  1.00 88.36  ? 2   DT  C OP2   1 
ATOM   4384 O  "O5'" . DT  C 2  2   ? -50.806 28.203 -10.721 1.00 84.18  ? 2   DT  C "O5'" 1 
ATOM   4385 C  "C5'" . DT  C 2  2   ? -50.841 27.877 -12.116 1.00 75.37  ? 2   DT  C "C5'" 1 
ATOM   4386 C  "C4'" . DT  C 2  2   ? -51.374 29.040 -12.910 1.00 69.04  ? 2   DT  C "C4'" 1 
ATOM   4387 O  "O4'" . DT  C 2  2   ? -52.752 29.289 -12.571 1.00 68.80  ? 2   DT  C "O4'" 1 
ATOM   4388 C  "C3'" . DT  C 2  2   ? -50.637 30.348 -12.698 1.00 65.37  ? 2   DT  C "C3'" 1 
ATOM   4389 O  "O3'" . DT  C 2  2   ? -50.356 30.832 -13.999 1.00 58.66  ? 2   DT  C "O3'" 1 
ATOM   4390 C  "C2'" . DT  C 2  2   ? -51.640 31.229 -11.952 1.00 67.97  ? 2   DT  C "C2'" 1 
ATOM   4391 C  "C1'" . DT  C 2  2   ? -52.976 30.670 -12.394 1.00 70.34  ? 2   DT  C "C1'" 1 
ATOM   4392 N  N1    . DT  C 2  2   ? -54.154 30.785 -11.475 1.00 74.37  ? 2   DT  C N1    1 
ATOM   4393 C  C2    . DT  C 2  2   ? -54.870 31.963 -11.302 1.00 78.12  ? 2   DT  C C2    1 
ATOM   4394 O  O2    . DT  C 2  2   ? -54.613 33.035 -11.817 1.00 80.85  ? 2   DT  C O2    1 
ATOM   4395 N  N3    . DT  C 2  2   ? -55.951 31.871 -10.458 1.00 79.67  ? 2   DT  C N3    1 
ATOM   4396 C  C4    . DT  C 2  2   ? -56.395 30.752 -9.772  1.00 79.55  ? 2   DT  C C4    1 
ATOM   4397 O  O4    . DT  C 2  2   ? -57.383 30.812 -9.040  1.00 79.62  ? 2   DT  C O4    1 
ATOM   4398 C  C5    . DT  C 2  2   ? -55.605 29.550 -9.987  1.00 78.68  ? 2   DT  C C5    1 
ATOM   4399 C  C7    . DT  C 2  2   ? -55.935 28.240 -9.324  1.00 78.04  ? 2   DT  C C7    1 
ATOM   4400 C  C6    . DT  C 2  2   ? -54.554 29.638 -10.820 1.00 76.99  ? 2   DT  C C6    1 
ATOM   4401 P  P     . DT  C 2  3   ? -49.217 31.889 -14.332 1.00 51.56  ? 3   DT  C P     1 
ATOM   4402 O  OP1   . DT  C 2  3   ? -48.622 31.448 -15.606 1.00 51.46  ? 3   DT  C OP1   1 
ATOM   4403 O  OP2   . DT  C 2  3   ? -48.326 32.069 -13.166 1.00 50.96  ? 3   DT  C OP2   1 
ATOM   4404 O  "O5'" . DT  C 2  3   ? -50.072 33.215 -14.507 1.00 46.14  ? 3   DT  C "O5'" 1 
ATOM   4405 C  "C5'" . DT  C 2  3   ? -51.036 33.271 -15.522 1.00 42.53  ? 3   DT  C "C5'" 1 
ATOM   4406 C  "C4'" . DT  C 2  3   ? -51.620 34.668 -15.599 1.00 41.58  ? 3   DT  C "C4'" 1 
ATOM   4407 O  "O4'" . DT  C 2  3   ? -52.444 34.878 -14.417 1.00 41.89  ? 3   DT  C "O4'" 1 
ATOM   4408 C  "C3'" . DT  C 2  3   ? -50.641 35.855 -15.653 1.00 39.91  ? 3   DT  C "C3'" 1 
ATOM   4409 O  "O3'" . DT  C 2  3   ? -51.213 36.979 -16.322 1.00 38.25  ? 3   DT  C "O3'" 1 
ATOM   4410 C  "C2'" . DT  C 2  3   ? -50.509 36.221 -14.189 1.00 39.66  ? 3   DT  C "C2'" 1 
ATOM   4411 C  "C1'" . DT  C 2  3   ? -51.935 35.977 -13.693 1.00 41.33  ? 3   DT  C "C1'" 1 
ATOM   4412 N  N1    . DT  C 2  3   ? -51.898 35.745 -12.222 1.00 42.56  ? 3   DT  C N1    1 
ATOM   4413 C  C2    . DT  C 2  3   ? -52.702 36.511 -11.407 1.00 43.47  ? 3   DT  C C2    1 
ATOM   4414 O  O2    . DT  C 2  3   ? -53.483 37.347 -11.832 1.00 43.95  ? 3   DT  C O2    1 
ATOM   4415 N  N3    . DT  C 2  3   ? -52.566 36.258 -10.056 1.00 45.31  ? 3   DT  C N3    1 
ATOM   4416 C  C4    . DT  C 2  3   ? -51.714 35.333 -9.467  1.00 45.19  ? 3   DT  C C4    1 
ATOM   4417 O  O4    . DT  C 2  3   ? -51.651 35.173 -8.255  1.00 47.39  ? 3   DT  C O4    1 
ATOM   4418 C  C5    . DT  C 2  3   ? -50.894 34.563 -10.370 1.00 43.19  ? 3   DT  C C5    1 
ATOM   4419 C  C7    . DT  C 2  3   ? -49.940 33.555 -9.813  1.00 40.70  ? 3   DT  C C7    1 
ATOM   4420 C  C6    . DT  C 2  3   ? -51.018 34.805 -11.690 1.00 43.38  ? 3   DT  C C6    1 
ATOM   4421 P  P     . DG  C 2  4   ? -50.631 37.565 -17.695 1.00 36.81  ? 4   DG  C P     1 
ATOM   4422 O  OP1   . DG  C 2  4   ? -51.577 38.595 -18.144 1.00 34.26  ? 4   DG  C OP1   1 
ATOM   4423 O  OP2   . DG  C 2  4   ? -50.192 36.453 -18.575 1.00 33.72  ? 4   DG  C OP2   1 
ATOM   4424 O  "O5'" . DG  C 2  4   ? -49.284 38.275 -17.225 1.00 37.65  ? 4   DG  C "O5'" 1 
ATOM   4425 C  "C5'" . DG  C 2  4   ? -49.280 39.456 -16.494 1.00 38.70  ? 4   DG  C "C5'" 1 
ATOM   4426 C  "C4'" . DG  C 2  4   ? -47.894 39.614 -15.897 1.00 39.93  ? 4   DG  C "C4'" 1 
ATOM   4427 O  "O4'" . DG  C 2  4   ? -46.868 39.509 -16.921 1.00 39.18  ? 4   DG  C "O4'" 1 
ATOM   4428 C  "C3'" . DG  C 2  4   ? -47.682 40.945 -15.180 1.00 39.83  ? 4   DG  C "C3'" 1 
ATOM   4429 O  "O3'" . DG  C 2  4   ? -47.092 40.705 -13.906 1.00 38.29  ? 4   DG  C "O3'" 1 
ATOM   4430 C  "C2'" . DG  C 2  4   ? -46.796 41.745 -16.130 1.00 38.20  ? 4   DG  C "C2'" 1 
ATOM   4431 C  "C1'" . DG  C 2  4   ? -46.002 40.625 -16.793 1.00 39.88  ? 4   DG  C "C1'" 1 
ATOM   4432 N  N9    . DG  C 2  4   ? -45.366 40.982 -18.085 1.00 40.34  ? 4   DG  C N9    1 
ATOM   4433 C  C8    . DG  C 2  4   ? -45.964 41.284 -19.295 1.00 37.96  ? 4   DG  C C8    1 
ATOM   4434 N  N7    . DG  C 2  4   ? -45.119 41.556 -20.247 1.00 36.87  ? 4   DG  C N7    1 
ATOM   4435 C  C5    . DG  C 2  4   ? -43.875 41.436 -19.639 1.00 39.07  ? 4   DG  C C5    1 
ATOM   4436 C  C6    . DG  C 2  4   ? -42.559 41.617 -20.172 1.00 39.33  ? 4   DG  C C6    1 
ATOM   4437 O  O6    . DG  C 2  4   ? -42.281 41.932 -21.332 1.00 40.47  ? 4   DG  C O6    1 
ATOM   4438 N  N1    . DG  C 2  4   ? -41.534 41.409 -19.227 1.00 37.60  ? 4   DG  C N1    1 
ATOM   4439 C  C2    . DG  C 2  4   ? -41.779 41.066 -17.900 1.00 37.58  ? 4   DG  C C2    1 
ATOM   4440 N  N2    . DG  C 2  4   ? -40.716 40.898 -17.103 1.00 36.26  ? 4   DG  C N2    1 
ATOM   4441 N  N3    . DG  C 2  4   ? -43.001 40.892 -17.388 1.00 37.97  ? 4   DG  C N3    1 
ATOM   4442 C  C4    . DG  C 2  4   ? -44.002 41.092 -18.306 1.00 39.26  ? 4   DG  C C4    1 
ATOM   4443 P  P     . DT  C 2  5   ? -47.037 41.860 -12.810 1.00 38.61  ? 5   DT  C P     1 
ATOM   4444 O  OP1   . DT  C 2  5   ? -46.835 41.180 -11.511 1.00 36.57  ? 5   DT  C OP1   1 
ATOM   4445 O  OP2   . DT  C 2  5   ? -48.121 42.850 -13.044 1.00 35.07  ? 5   DT  C OP2   1 
ATOM   4446 O  "O5'" . DT  C 2  5   ? -45.684 42.592 -13.215 1.00 38.76  ? 5   DT  C "O5'" 1 
ATOM   4447 C  "C5'" . DT  C 2  5   ? -44.445 41.868 -13.092 1.00 39.07  ? 5   DT  C "C5'" 1 
ATOM   4448 C  "C4'" . DT  C 2  5   ? -43.261 42.795 -13.361 1.00 39.33  ? 5   DT  C "C4'" 1 
ATOM   4449 O  "O4'" . DT  C 2  5   ? -43.019 42.901 -14.786 1.00 37.91  ? 5   DT  C "O4'" 1 
ATOM   4450 C  "C3'" . DT  C 2  5   ? -43.397 44.224 -12.806 1.00 37.85  ? 5   DT  C "C3'" 1 
ATOM   4451 O  "O3'" . DT  C 2  5   ? -42.483 44.361 -11.733 1.00 38.60  ? 5   DT  C "O3'" 1 
ATOM   4452 C  "C2'" . DT  C 2  5   ? -43.042 45.138 -13.969 1.00 38.00  ? 5   DT  C "C2'" 1 
ATOM   4453 C  "C1'" . DT  C 2  5   ? -42.530 44.194 -15.060 1.00 37.48  ? 5   DT  C "C1'" 1 
ATOM   4454 N  N1    . DT  C 2  5   ? -42.914 44.462 -16.488 1.00 37.66  ? 5   DT  C N1    1 
ATOM   4455 C  C2    . DT  C 2  5   ? -41.895 44.532 -17.386 1.00 37.18  ? 5   DT  C C2    1 
ATOM   4456 O  O2    . DT  C 2  5   ? -40.755 44.415 -17.022 1.00 38.84  ? 5   DT  C O2    1 
ATOM   4457 N  N3    . DT  C 2  5   ? -42.236 44.741 -18.694 1.00 36.31  ? 5   DT  C N3    1 
ATOM   4458 C  C4    . DT  C 2  5   ? -43.512 44.868 -19.180 1.00 37.77  ? 5   DT  C C4    1 
ATOM   4459 O  O4    . DT  C 2  5   ? -43.742 45.052 -20.372 1.00 38.37  ? 5   DT  C O4    1 
ATOM   4460 C  C5    . DT  C 2  5   ? -44.559 44.789 -18.187 1.00 37.86  ? 5   DT  C C5    1 
ATOM   4461 C  C7    . DT  C 2  5   ? -45.986 44.937 -18.606 1.00 35.82  ? 5   DT  C C7    1 
ATOM   4462 C  C6    . DT  C 2  5   ? -44.222 44.583 -16.904 1.00 38.07  ? 5   DT  C C6    1 
ATOM   4463 P  P     . DC  C 2  6   ? -42.427 45.634 -10.770 1.00 39.43  ? 6   DC  C P     1 
ATOM   4464 O  OP1   . DC  C 2  6   ? -41.792 45.265 -9.484  1.00 36.52  ? 6   DC  C OP1   1 
ATOM   4465 O  OP2   . DC  C 2  6   ? -43.752 46.300 -10.806 1.00 37.99  ? 6   DC  C OP2   1 
ATOM   4466 O  "O5'" . DC  C 2  6   ? -41.391 46.533 -11.591 1.00 38.03  ? 6   DC  C "O5'" 1 
ATOM   4467 C  "C5'" . DC  C 2  6   ? -40.010 46.232 -11.655 1.00 36.90  ? 6   DC  C "C5'" 1 
ATOM   4468 C  "C4'" . DC  C 2  6   ? -39.327 47.238 -12.574 1.00 36.66  ? 6   DC  C "C4'" 1 
ATOM   4469 O  "O4'" . DC  C 2  6   ? -39.871 47.124 -13.902 1.00 37.07  ? 6   DC  C "O4'" 1 
ATOM   4470 C  "C3'" . DC  C 2  6   ? -39.499 48.711 -12.228 1.00 37.07  ? 6   DC  C "C3'" 1 
ATOM   4471 O  "O3'" . DC  C 2  6   ? -38.281 49.339 -12.491 1.00 37.84  ? 6   DC  C "O3'" 1 
ATOM   4472 C  "C2'" . DC  C 2  6   ? -40.542 49.254 -13.196 1.00 36.80  ? 6   DC  C "C2'" 1 
ATOM   4473 C  "C1'" . DC  C 2  6   ? -40.171 48.418 -14.405 1.00 39.39  ? 6   DC  C "C1'" 1 
ATOM   4474 N  N1    . DC  C 2  6   ? -41.193 48.329 -15.508 1.00 42.30  ? 6   DC  C N1    1 
ATOM   4475 C  C2    . DC  C 2  6   ? -40.736 48.253 -16.832 1.00 44.48  ? 6   DC  C C2    1 
ATOM   4476 O  O2    . DC  C 2  6   ? -39.514 48.283 -17.022 1.00 45.47  ? 6   DC  C O2    1 
ATOM   4477 N  N3    . DC  C 2  6   ? -41.633 48.168 -17.864 1.00 45.18  ? 6   DC  C N3    1 
ATOM   4478 C  C4    . DC  C 2  6   ? -42.938 48.155 -17.601 1.00 44.79  ? 6   DC  C C4    1 
ATOM   4479 N  N4    . DC  C 2  6   ? -43.789 48.075 -18.625 1.00 44.29  ? 6   DC  C N4    1 
ATOM   4480 C  C5    . DC  C 2  6   ? -43.425 48.228 -16.259 1.00 44.44  ? 6   DC  C C5    1 
ATOM   4481 C  C6    . DC  C 2  6   ? -42.535 48.314 -15.260 1.00 43.17  ? 6   DC  C C6    1 
ATOM   4482 P  P     . DA  C 2  7   ? -37.741 50.421 -11.463 1.00 38.16  ? 7   DA  C P     1 
ATOM   4483 O  OP1   . DA  C 2  7   ? -37.274 49.725 -10.242 1.00 36.89  ? 7   DA  C OP1   1 
ATOM   4484 O  OP2   . DA  C 2  7   ? -38.755 51.512 -11.386 1.00 35.24  ? 7   DA  C OP2   1 
ATOM   4485 O  "O5'" . DA  C 2  7   ? -36.462 50.916 -12.257 1.00 36.65  ? 7   DA  C "O5'" 1 
ATOM   4486 C  "C5'" . DA  C 2  7   ? -35.370 50.073 -12.494 1.00 38.06  ? 7   DA  C "C5'" 1 
ATOM   4487 C  "C4'" . DA  C 2  7   ? -34.640 50.558 -13.756 1.00 39.33  ? 7   DA  C "C4'" 1 
ATOM   4488 O  "O4'" . DA  C 2  7   ? -35.491 50.434 -14.919 1.00 39.03  ? 7   DA  C "O4'" 1 
ATOM   4489 C  "C3'" . DA  C 2  7   ? -34.141 51.993 -13.796 1.00 38.87  ? 7   DA  C "C3'" 1 
ATOM   4490 O  "O3'" . DA  C 2  7   ? -32.919 51.992 -14.530 1.00 38.98  ? 7   DA  C "O3'" 1 
ATOM   4491 C  "C2'" . DA  C 2  7   ? -35.276 52.729 -14.512 1.00 39.49  ? 7   DA  C "C2'" 1 
ATOM   4492 C  "C1'" . DA  C 2  7   ? -35.722 51.674 -15.535 1.00 40.34  ? 7   DA  C "C1'" 1 
ATOM   4493 N  N9    . DA  C 2  7   ? -37.139 51.664 -15.912 1.00 40.03  ? 7   DA  C N9    1 
ATOM   4494 C  C8    . DA  C 2  7   ? -38.213 51.696 -15.072 1.00 41.07  ? 7   DA  C C8    1 
ATOM   4495 N  N7    . DA  C 2  7   ? -39.382 51.670 -15.666 1.00 40.72  ? 7   DA  C N7    1 
ATOM   4496 C  C5    . DA  C 2  7   ? -39.054 51.595 -16.993 1.00 40.74  ? 7   DA  C C5    1 
ATOM   4497 C  C6    . DA  C 2  7   ? -39.859 51.533 -18.155 1.00 39.90  ? 7   DA  C C6    1 
ATOM   4498 N  N6    . DA  C 2  7   ? -41.187 51.528 -18.115 1.00 36.44  ? 7   DA  C N6    1 
ATOM   4499 N  N1    . DA  C 2  7   ? -39.227 51.479 -19.350 1.00 39.41  ? 7   DA  C N1    1 
ATOM   4500 C  C2    . DA  C 2  7   ? -37.883 51.468 -19.360 1.00 39.50  ? 7   DA  C C2    1 
ATOM   4501 N  N3    . DA  C 2  7   ? -37.023 51.517 -18.330 1.00 40.75  ? 7   DA  C N3    1 
ATOM   4502 C  C4    . DA  C 2  7   ? -37.676 51.585 -17.162 1.00 40.03  ? 7   DA  C C4    1 
ATOM   4503 P  P     . DT  C 2  8   ? -32.061 53.341 -14.708 1.00 40.02  ? 8   DT  C P     1 
ATOM   4504 O  OP1   . DT  C 2  8   ? -30.704 52.854 -14.974 1.00 37.16  ? 8   DT  C OP1   1 
ATOM   4505 O  OP2   . DT  C 2  8   ? -32.353 54.345 -13.649 1.00 37.75  ? 8   DT  C OP2   1 
ATOM   4506 O  "O5'" . DT  C 2  8   ? -32.727 54.046 -15.989 1.00 40.62  ? 8   DT  C "O5'" 1 
ATOM   4507 C  "C5'" . DT  C 2  8   ? -32.442 53.663 -17.331 1.00 40.71  ? 8   DT  C "C5'" 1 
ATOM   4508 C  "C4'" . DT  C 2  8   ? -33.361 54.385 -18.293 1.00 39.94  ? 8   DT  C "C4'" 1 
ATOM   4509 O  "O4'" . DT  C 2  8   ? -34.736 54.073 -17.989 1.00 38.89  ? 8   DT  C "O4'" 1 
ATOM   4510 C  "C3'" . DT  C 2  8   ? -33.324 55.885 -18.159 1.00 41.42  ? 8   DT  C "C3'" 1 
ATOM   4511 O  "O3'" . DT  C 2  8   ? -32.289 56.427 -18.952 1.00 45.35  ? 8   DT  C "O3'" 1 
ATOM   4512 C  "C2'" . DT  C 2  8   ? -34.693 56.350 -18.643 1.00 40.03  ? 8   DT  C "C2'" 1 
ATOM   4513 C  "C1'" . DT  C 2  8   ? -35.482 55.058 -18.659 1.00 40.12  ? 8   DT  C "C1'" 1 
ATOM   4514 N  N1    . DT  C 2  8   ? -36.828 55.058 -18.065 1.00 41.11  ? 8   DT  C N1    1 
ATOM   4515 C  C2    . DT  C 2  8   ? -37.896 54.990 -18.931 1.00 41.18  ? 8   DT  C C2    1 
ATOM   4516 O  O2    . DT  C 2  8   ? -37.792 54.991 -20.136 1.00 40.40  ? 8   DT  C O2    1 
ATOM   4517 N  N3    . DT  C 2  8   ? -39.121 54.939 -18.345 1.00 41.93  ? 8   DT  C N3    1 
ATOM   4518 C  C4    . DT  C 2  8   ? -39.397 54.960 -17.008 1.00 42.73  ? 8   DT  C C4    1 
ATOM   4519 O  O4    . DT  C 2  8   ? -40.550 54.926 -16.612 1.00 43.63  ? 8   DT  C O4    1 
ATOM   4520 C  C5    . DT  C 2  8   ? -38.242 55.029 -16.147 1.00 43.78  ? 8   DT  C C5    1 
ATOM   4521 C  C7    . DT  C 2  8   ? -38.425 55.051 -14.661 1.00 45.18  ? 8   DT  C C7    1 
ATOM   4522 C  C6    . DT  C 2  8   ? -37.019 55.073 -16.705 1.00 42.79  ? 8   DT  C C6    1 
ATOM   4523 P  P     . DG  C 2  9   ? -31.741 57.944 -18.701 1.00 49.33  ? 9   DG  C P     1 
ATOM   4524 O  OP1   . DG  C 2  9   ? -30.275 57.845 -18.879 1.00 46.93  ? 9   DG  C OP1   1 
ATOM   4525 O  OP2   . DG  C 2  9   ? -32.293 58.613 -17.458 1.00 43.30  ? 9   DG  C OP2   1 
ATOM   4526 O  "O5'" . DG  C 2  9   ? -32.382 58.706 -19.968 1.00 46.40  ? 9   DG  C "O5'" 1 
ATOM   4527 C  "C5'" . DG  C 2  9   ? -32.699 58.169 -21.234 1.00 42.62  ? 9   DG  C "C5'" 1 
ATOM   4528 C  "C4'" . DG  C 2  9   ? -33.632 59.181 -21.871 1.00 41.39  ? 9   DG  C "C4'" 1 
ATOM   4529 O  "O4'" . DG  C 2  9   ? -34.917 58.946 -21.278 1.00 42.24  ? 9   DG  C "O4'" 1 
ATOM   4530 C  "C3'" . DG  C 2  9   ? -33.373 60.673 -21.633 1.00 41.24  ? 9   DG  C "C3'" 1 
ATOM   4531 O  "O3'" . DG  C 2  9   ? -33.906 61.497 -22.694 1.00 43.36  ? 9   DG  C "O3'" 1 
ATOM   4532 C  "C2'" . DG  C 2  9   ? -34.145 60.969 -20.364 1.00 40.85  ? 9   DG  C "C2'" 1 
ATOM   4533 C  "C1'" . DG  C 2  9   ? -35.373 60.092 -20.590 1.00 41.88  ? 9   DG  C "C1'" 1 
ATOM   4534 N  N9    . DG  C 2  9   ? -36.047 59.632 -19.368 1.00 42.11  ? 9   DG  C N9    1 
ATOM   4535 C  C8    . DG  C 2  9   ? -35.543 59.531 -18.079 1.00 41.21  ? 9   DG  C C8    1 
ATOM   4536 N  N7    . DG  C 2  9   ? -36.412 59.102 -17.204 1.00 39.75  ? 9   DG  C N7    1 
ATOM   4537 C  C5    . DG  C 2  9   ? -37.545 58.892 -17.965 1.00 40.42  ? 9   DG  C C5    1 
ATOM   4538 C  C6    . DG  C 2  9   ? -38.812 58.417 -17.586 1.00 40.99  ? 9   DG  C C6    1 
ATOM   4539 O  O6    . DG  C 2  9   ? -39.159 58.080 -16.448 1.00 42.36  ? 9   DG  C O6    1 
ATOM   4540 N  N1    . DG  C 2  9   ? -39.710 58.345 -18.655 1.00 39.35  ? 9   DG  C N1    1 
ATOM   4541 C  C2    . DG  C 2  9   ? -39.406 58.683 -19.944 1.00 40.25  ? 9   DG  C C2    1 
ATOM   4542 N  N2    . DG  C 2  9   ? -40.381 58.570 -20.869 1.00 37.64  ? 9   DG  C N2    1 
ATOM   4543 N  N3    . DG  C 2  9   ? -38.203 59.129 -20.304 1.00 41.69  ? 9   DG  C N3    1 
ATOM   4544 C  C4    . DG  C 2  9   ? -37.339 59.208 -19.280 1.00 40.57  ? 9   DG  C C4    1 
ATOM   4545 P  P     . DG  C 2  10  ? -33.089 61.839 -24.050 1.00 43.94  ? 10  DG  C P     1 
ATOM   4546 O  OP1   . DG  C 2  10  ? -32.716 60.574 -24.722 1.00 43.23  ? 10  DG  C OP1   1 
ATOM   4547 O  OP2   . DG  C 2  10  ? -31.974 62.771 -23.753 1.00 43.52  ? 10  DG  C OP2   1 
ATOM   4548 O  "O5'" . DG  C 2  10  ? -34.229 62.560 -24.890 1.00 40.51  ? 10  DG  C "O5'" 1 
ATOM   4549 C  "C5'" . DG  C 2  10  ? -34.893 63.677 -24.426 1.00 43.61  ? 10  DG  C "C5'" 1 
ATOM   4550 C  "C4'" . DG  C 2  10  ? -36.331 63.564 -24.864 1.00 45.36  ? 10  DG  C "C4'" 1 
ATOM   4551 O  "O4'" . DG  C 2  10  ? -36.998 62.726 -23.884 1.00 46.59  ? 10  DG  C "O4'" 1 
ATOM   4552 C  "C3'" . DG  C 2  10  ? -37.126 64.861 -24.894 1.00 47.54  ? 10  DG  C "C3'" 1 
ATOM   4553 O  "O3'" . DG  C 2  10  ? -38.197 64.796 -25.837 1.00 51.30  ? 10  DG  C "O3'" 1 
ATOM   4554 C  "C2'" . DG  C 2  10  ? -37.724 64.920 -23.497 1.00 46.65  ? 10  DG  C "C2'" 1 
ATOM   4555 C  "C1'" . DG  C 2  10  ? -38.036 63.455 -23.253 1.00 46.27  ? 10  DG  C "C1'" 1 
ATOM   4556 N  N9    . DG  C 2  10  ? -38.055 63.104 -21.831 1.00 47.17  ? 10  DG  C N9    1 
ATOM   4557 C  C8    . DG  C 2  10  ? -37.018 63.279 -20.935 1.00 45.91  ? 10  DG  C C8    1 
ATOM   4558 N  N7    . DG  C 2  10  ? -37.323 62.873 -19.741 1.00 45.30  ? 10  DG  C N7    1 
ATOM   4559 C  C5    . DG  C 2  10  ? -38.624 62.403 -19.830 1.00 45.01  ? 10  DG  C C5    1 
ATOM   4560 C  C6    . DG  C 2  10  ? -39.458 61.844 -18.833 1.00 44.51  ? 10  DG  C C6    1 
ATOM   4561 O  O6    . DG  C 2  10  ? -39.194 61.658 -17.652 1.00 44.89  ? 10  DG  C O6    1 
ATOM   4562 N  N1    . DG  C 2  10  ? -40.716 61.503 -19.313 1.00 44.01  ? 10  DG  C N1    1 
ATOM   4563 C  C2    . DG  C 2  10  ? -41.098 61.678 -20.625 1.00 44.17  ? 10  DG  C C2    1 
ATOM   4564 N  N2    . DG  C 2  10  ? -42.334 61.278 -20.910 1.00 44.24  ? 10  DG  C N2    1 
ATOM   4565 N  N3    . DG  C 2  10  ? -40.335 62.194 -21.586 1.00 43.61  ? 10  DG  C N3    1 
ATOM   4566 C  C4    . DG  C 2  10  ? -39.103 62.534 -21.116 1.00 45.39  ? 10  DG  C C4    1 
ATOM   4567 P  P     . DA  C 2  11  ? -38.950 66.134 -26.317 1.00 53.38  ? 11  DA  C P     1 
ATOM   4568 O  OP1   . DA  C 2  11  ? -38.952 66.047 -27.801 1.00 54.17  ? 11  DA  C OP1   1 
ATOM   4569 O  OP2   . DA  C 2  11  ? -38.363 67.296 -25.612 1.00 51.96  ? 11  DA  C OP2   1 
ATOM   4570 O  "O5'" . DA  C 2  11  ? -40.428 65.971 -25.758 1.00 51.45  ? 11  DA  C "O5'" 1 
ATOM   4571 C  "C5'" . DA  C 2  11  ? -40.979 64.716 -25.687 1.00 52.44  ? 11  DA  C "C5'" 1 
ATOM   4572 C  "C4'" . DA  C 2  11  ? -42.339 64.910 -25.070 1.00 55.09  ? 11  DA  C "C4'" 1 
ATOM   4573 O  "O4'" . DA  C 2  11  ? -42.298 64.613 -23.655 1.00 55.40  ? 11  DA  C "O4'" 1 
ATOM   4574 C  "C3'" . DA  C 2  11  ? -42.943 66.308 -25.169 1.00 56.11  ? 11  DA  C "C3'" 1 
ATOM   4575 O  "O3'" . DA  C 2  11  ? -44.316 66.012 -25.318 1.00 57.14  ? 11  DA  C "O3'" 1 
ATOM   4576 C  "C2'" . DA  C 2  11  ? -42.575 66.959 -23.832 1.00 55.61  ? 11  DA  C "C2'" 1 
ATOM   4577 C  "C1'" . DA  C 2  11  ? -42.639 65.752 -22.892 1.00 55.37  ? 11  DA  C "C1'" 1 
ATOM   4578 N  N9    . DA  C 2  11  ? -41.683 65.715 -21.786 1.00 54.56  ? 11  DA  C N9    1 
ATOM   4579 C  C8    . DA  C 2  11  ? -40.378 66.088 -21.825 1.00 54.49  ? 11  DA  C C8    1 
ATOM   4580 N  N7    . DA  C 2  11  ? -39.745 65.926 -20.691 1.00 54.30  ? 11  DA  C N7    1 
ATOM   4581 C  C5    . DA  C 2  11  ? -40.700 65.407 -19.845 1.00 52.93  ? 11  DA  C C5    1 
ATOM   4582 C  C6    . DA  C 2  11  ? -40.648 65.008 -18.492 1.00 52.12  ? 11  DA  C C6    1 
ATOM   4583 N  N6    . DA  C 2  11  ? -39.541 65.088 -17.750 1.00 50.40  ? 11  DA  C N6    1 
ATOM   4584 N  N1    . DA  C 2  11  ? -41.784 64.519 -17.936 1.00 52.78  ? 11  DA  C N1    1 
ATOM   4585 C  C2    . DA  C 2  11  ? -42.897 64.421 -18.692 1.00 53.45  ? 11  DA  C C2    1 
ATOM   4586 N  N3    . DA  C 2  11  ? -43.059 64.765 -19.983 1.00 54.11  ? 11  DA  C N3    1 
ATOM   4587 C  C4    . DA  C 2  11  ? -41.906 65.259 -20.506 1.00 53.80  ? 11  DA  C C4    1 
ATOM   4588 P  P     . DA  C 2  12  ? -45.509 67.071 -25.337 1.00 59.15  ? 12  DA  C P     1 
ATOM   4589 O  OP1   . DA  C 2  12  ? -46.506 66.476 -26.255 1.00 58.17  ? 12  DA  C OP1   1 
ATOM   4590 O  OP2   . DA  C 2  12  ? -44.950 68.433 -25.497 1.00 57.43  ? 12  DA  C OP2   1 
ATOM   4591 O  "O5'" . DA  C 2  12  ? -46.157 66.985 -23.876 1.00 58.18  ? 12  DA  C "O5'" 1 
ATOM   4592 C  "C5'" . DA  C 2  12  ? -46.682 65.724 -23.460 1.00 56.48  ? 12  DA  C "C5'" 1 
ATOM   4593 C  "C4'" . DA  C 2  12  ? -47.419 65.872 -22.144 1.00 55.42  ? 12  DA  C "C4'" 1 
ATOM   4594 O  "O4'" . DA  C 2  12  ? -46.521 65.927 -20.991 1.00 55.33  ? 12  DA  C "O4'" 1 
ATOM   4595 C  "C3'" . DA  C 2  12  ? -48.275 67.111 -22.062 1.00 54.90  ? 12  DA  C "C3'" 1 
ATOM   4596 O  "O3'" . DA  C 2  12  ? -49.447 66.662 -21.439 1.00 55.79  ? 12  DA  C "O3'" 1 
ATOM   4597 C  "C2'" . DA  C 2  12  ? -47.417 68.090 -21.245 1.00 54.28  ? 12  DA  C "C2'" 1 
ATOM   4598 C  "C1'" . DA  C 2  12  ? -46.620 67.173 -20.322 1.00 53.52  ? 12  DA  C "C1'" 1 
ATOM   4599 N  N9    . DA  C 2  12  ? -45.240 67.578 -20.027 1.00 51.39  ? 12  DA  C N9    1 
ATOM   4600 C  C8    . DA  C 2  12  ? -44.317 68.122 -20.878 1.00 50.06  ? 12  DA  C C8    1 
ATOM   4601 N  N7    . DA  C 2  12  ? -43.150 68.357 -20.326 1.00 49.12  ? 12  DA  C N7    1 
ATOM   4602 C  C5    . DA  C 2  12  ? -43.313 67.944 -19.014 1.00 48.38  ? 12  DA  C C5    1 
ATOM   4603 C  C6    . DA  C 2  12  ? -42.438 67.918 -17.894 1.00 48.00  ? 12  DA  C C6    1 
ATOM   4604 N  N6    . DA  C 2  12  ? -41.168 68.348 -17.906 1.00 45.62  ? 12  DA  C N6    1 
ATOM   4605 N  N1    . DA  C 2  12  ? -42.937 67.431 -16.728 1.00 47.98  ? 12  DA  C N1    1 
ATOM   4606 C  C2    . DA  C 2  12  ? -44.208 66.992 -16.696 1.00 47.78  ? 12  DA  C C2    1 
ATOM   4607 N  N3    . DA  C 2  12  ? -45.114 66.959 -17.672 1.00 47.81  ? 12  DA  C N3    1 
ATOM   4608 C  C4    . DA  C 2  12  ? -44.599 67.458 -18.814 1.00 49.29  ? 12  DA  C C4    1 
ATOM   4609 P  P     . DT  C 2  13  ? -50.534 67.662 -20.841 1.00 60.17  ? 13  DT  C P     1 
ATOM   4610 O  OP1   . DT  C 2  13  ? -51.827 66.944 -20.822 1.00 60.37  ? 13  DT  C OP1   1 
ATOM   4611 O  OP2   . DT  C 2  13  ? -50.408 68.990 -21.505 1.00 59.16  ? 13  DT  C OP2   1 
ATOM   4612 O  "O5'" . DT  C 2  13  ? -50.050 67.857 -19.323 1.00 58.74  ? 13  DT  C "O5'" 1 
ATOM   4613 C  "C5'" . DT  C 2  13  ? -50.278 66.892 -18.322 1.00 56.04  ? 13  DT  C "C5'" 1 
ATOM   4614 C  "C4'" . DT  C 2  13  ? -49.779 67.470 -17.020 1.00 55.55  ? 13  DT  C "C4'" 1 
ATOM   4615 O  "O4'" . DT  C 2  13  ? -48.424 67.951 -17.185 1.00 54.49  ? 13  DT  C "O4'" 1 
ATOM   4616 C  "C3'" . DT  C 2  13  ? -50.569 68.668 -16.510 1.00 55.80  ? 13  DT  C "C3'" 1 
ATOM   4617 O  "O3'" . DT  C 2  13  ? -51.305 68.201 -15.385 1.00 56.99  ? 13  DT  C "O3'" 1 
ATOM   4618 C  "C2'" . DT  C 2  13  ? -49.508 69.738 -16.189 1.00 55.26  ? 13  DT  C "C2'" 1 
ATOM   4619 C  "C1'" . DT  C 2  13  ? -48.207 68.945 -16.213 1.00 54.15  ? 13  DT  C "C1'" 1 
ATOM   4620 N  N1    . DT  C 2  13  ? -46.948 69.598 -16.660 1.00 54.43  ? 13  DT  C N1    1 
ATOM   4621 C  C2    . DT  C 2  13  ? -45.867 69.609 -15.799 1.00 55.05  ? 13  DT  C C2    1 
ATOM   4622 O  O2    . DT  C 2  13  ? -45.909 69.143 -14.664 1.00 55.93  ? 13  DT  C O2    1 
ATOM   4623 N  N3    . DT  C 2  13  ? -44.729 70.205 -16.310 1.00 53.66  ? 13  DT  C N3    1 
ATOM   4624 C  C4    . DT  C 2  13  ? -44.554 70.764 -17.567 1.00 53.64  ? 13  DT  C C4    1 
ATOM   4625 O  O4    . DT  C 2  13  ? -43.473 71.259 -17.912 1.00 53.22  ? 13  DT  C O4    1 
ATOM   4626 C  C5    . DT  C 2  13  ? -45.729 70.716 -18.423 1.00 53.24  ? 13  DT  C C5    1 
ATOM   4627 C  C7    . DT  C 2  13  ? -45.707 71.281 -19.811 1.00 51.41  ? 13  DT  C C7    1 
ATOM   4628 C  C6    . DT  C 2  13  ? -46.843 70.143 -17.936 1.00 54.61  ? 13  DT  C C6    1 
ATOM   4629 P  P     . DT  C 2  14  ? -51.906 69.140 -14.238 1.00 58.91  ? 14  DT  C P     1 
ATOM   4630 O  OP1   . DT  C 2  14  ? -52.883 68.297 -13.513 1.00 57.42  ? 14  DT  C OP1   1 
ATOM   4631 O  OP2   . DT  C 2  14  ? -52.204 70.503 -14.775 1.00 56.88  ? 14  DT  C OP2   1 
ATOM   4632 O  "O5'" . DT  C 2  14  ? -50.654 69.345 -13.275 1.00 58.07  ? 14  DT  C "O5'" 1 
ATOM   4633 C  "C5'" . DT  C 2  14  ? -50.258 68.379 -12.338 1.00 55.73  ? 14  DT  C "C5'" 1 
ATOM   4634 C  "C4'" . DT  C 2  14  ? -49.173 69.027 -11.509 1.00 55.10  ? 14  DT  C "C4'" 1 
ATOM   4635 O  "O4'" . DT  C 2  14  ? -48.168 69.664 -12.348 1.00 54.44  ? 14  DT  C "O4'" 1 
ATOM   4636 C  "C3'" . DT  C 2  14  ? -49.711 70.115 -10.604 1.00 55.44  ? 14  DT  C "C3'" 1 
ATOM   4637 O  "O3'" . DT  C 2  14  ? -49.353 69.710 -9.307  1.00 56.99  ? 14  DT  C "O3'" 1 
ATOM   4638 C  "C2'" . DT  C 2  14  ? -49.026 71.408 -11.085 1.00 54.57  ? 14  DT  C "C2'" 1 
ATOM   4639 C  "C1'" . DT  C 2  14  ? -47.761 70.888 -11.760 1.00 53.35  ? 14  DT  C "C1'" 1 
ATOM   4640 N  N1    . DT  C 2  14  ? -47.116 71.693 -12.865 1.00 51.58  ? 14  DT  C N1    1 
ATOM   4641 C  C2    . DT  C 2  14  ? -45.768 72.001 -12.784 1.00 52.03  ? 14  DT  C C2    1 
ATOM   4642 O  O2    . DT  C 2  14  ? -45.068 71.685 -11.848 1.00 53.03  ? 14  DT  C O2    1 
ATOM   4643 N  N3    . DT  C 2  14  ? -45.237 72.705 -13.836 1.00 51.23  ? 14  DT  C N3    1 
ATOM   4644 C  C4    . DT  C 2  14  ? -45.918 73.123 -14.970 1.00 51.41  ? 14  DT  C C4    1 
ATOM   4645 O  O4    . DT  C 2  14  ? -45.344 73.742 -15.871 1.00 50.21  ? 14  DT  C O4    1 
ATOM   4646 C  C5    . DT  C 2  14  ? -47.330 72.769 -15.000 1.00 50.35  ? 14  DT  C C5    1 
ATOM   4647 C  C7    . DT  C 2  14  ? -48.202 73.150 -16.157 1.00 49.87  ? 14  DT  C C7    1 
ATOM   4648 C  C6    . DT  C 2  14  ? -47.843 72.079 -13.971 1.00 50.60  ? 14  DT  C C6    1 
ATOM   4649 P  P     . DT  C 2  15  ? -49.656 70.633 -8.045  1.00 59.86  ? 15  DT  C P     1 
ATOM   4650 O  OP1   . DT  C 2  15  ? -49.930 69.735 -6.901  1.00 60.42  ? 15  DT  C OP1   1 
ATOM   4651 O  OP2   . DT  C 2  15  ? -50.638 71.671 -8.448  1.00 58.94  ? 15  DT  C OP2   1 
ATOM   4652 O  "O5'" . DT  C 2  15  ? -48.253 71.353 -7.812  1.00 58.66  ? 15  DT  C "O5'" 1 
ATOM   4653 C  "C5'" . DT  C 2  15  ? -47.088 70.590 -7.599  1.00 57.96  ? 15  DT  C "C5'" 1 
ATOM   4654 C  "C4'" . DT  C 2  15  ? -45.933 71.533 -7.332  1.00 58.31  ? 15  DT  C "C4'" 1 
ATOM   4655 O  "O4'" . DT  C 2  15  ? -45.489 72.250 -8.521  1.00 58.95  ? 15  DT  C "O4'" 1 
ATOM   4656 C  "C3'" . DT  C 2  15  ? -46.231 72.618 -6.310  1.00 59.26  ? 15  DT  C "C3'" 1 
ATOM   4657 O  "O3'" . DT  C 2  15  ? -45.071 72.611 -5.531  1.00 60.13  ? 15  DT  C "O3'" 1 
ATOM   4658 C  "C2'" . DT  C 2  15  ? -46.441 73.901 -7.146  1.00 59.27  ? 15  DT  C "C2'" 1 
ATOM   4659 C  "C1'" . DT  C 2  15  ? -45.473 73.663 -8.306  1.00 57.65  ? 15  DT  C "C1'" 1 
ATOM   4660 N  N1    . DT  C 2  15  ? -45.769 74.340 -9.629  1.00 54.84  ? 15  DT  C N1    1 
ATOM   4661 C  C2    . DT  C 2  15  ? -44.716 74.858 -10.375 1.00 54.04  ? 15  DT  C C2    1 
ATOM   4662 O  O2    . DT  C 2  15  ? -43.538 74.838 -10.051 1.00 53.25  ? 15  DT  C O2    1 
ATOM   4663 N  N3    . DT  C 2  15  ? -45.077 75.430 -11.566 1.00 53.88  ? 15  DT  C N3    1 
ATOM   4664 C  C4    . DT  C 2  15  ? -46.342 75.536 -12.096 1.00 54.23  ? 15  DT  C C4    1 
ATOM   4665 O  O4    . DT  C 2  15  ? -46.538 76.063 -13.181 1.00 55.41  ? 15  DT  C O4    1 
ATOM   4666 C  C5    . DT  C 2  15  ? -47.403 74.984 -11.292 1.00 54.32  ? 15  DT  C C5    1 
ATOM   4667 C  C7    . DT  C 2  15  ? -48.816 75.073 -11.799 1.00 52.48  ? 15  DT  C C7    1 
ATOM   4668 C  C6    . DT  C 2  15  ? -47.071 74.411 -10.108 1.00 54.74  ? 15  DT  C C6    1 
ATOM   4669 P  P     . DC  C 2  16  ? -44.871 73.534 -4.262  1.00 62.31  ? 16  DC  C P     1 
ATOM   4670 O  OP1   . DC  C 2  16  ? -44.263 72.660 -3.244  1.00 63.26  ? 16  DC  C OP1   1 
ATOM   4671 O  OP2   . DC  C 2  16  ? -46.091 74.344 -4.002  1.00 62.48  ? 16  DC  C OP2   1 
ATOM   4672 O  "O5'" . DC  C 2  16  ? -43.712 74.520 -4.716  1.00 62.18  ? 16  DC  C "O5'" 1 
ATOM   4673 C  "C5'" . DC  C 2  16  ? -42.505 74.004 -5.236  1.00 61.97  ? 16  DC  C "C5'" 1 
ATOM   4674 C  "C4'" . DC  C 2  16  ? -41.735 75.187 -5.779  1.00 62.43  ? 16  DC  C "C4'" 1 
ATOM   4675 O  "O4'" . DC  C 2  16  ? -42.374 75.697 -6.973  1.00 60.74  ? 16  DC  C "O4'" 1 
ATOM   4676 C  "C3'" . DC  C 2  16  ? -41.672 76.371 -4.826  1.00 63.37  ? 16  DC  C "C3'" 1 
ATOM   4677 O  "O3'" . DC  C 2  16  ? -40.324 76.780 -4.850  1.00 66.91  ? 16  DC  C "O3'" 1 
ATOM   4678 C  "C2'" . DC  C 2  16  ? -42.626 77.418 -5.412  1.00 61.71  ? 16  DC  C "C2'" 1 
ATOM   4679 C  "C1'" . DC  C 2  16  ? -42.455 77.110 -6.900  1.00 59.32  ? 16  DC  C "C1'" 1 
ATOM   4680 N  N1    . DC  C 2  16  ? -43.543 77.514 -7.850  1.00 56.50  ? 16  DC  C N1    1 
ATOM   4681 C  C2    . DC  C 2  16  ? -43.235 78.142 -9.070  1.00 54.87  ? 16  DC  C C2    1 
ATOM   4682 O  O2    . DC  C 2  16  ? -42.055 78.398 -9.362  1.00 53.74  ? 16  DC  C O2    1 
ATOM   4683 N  N3    . DC  C 2  16  ? -44.263 78.461 -9.903  1.00 54.43  ? 16  DC  C N3    1 
ATOM   4684 C  C4    . DC  C 2  16  ? -45.534 78.179 -9.578  1.00 54.37  ? 16  DC  C C4    1 
ATOM   4685 N  N4    . DC  C 2  16  ? -46.525 78.505 -10.420 1.00 53.59  ? 16  DC  C N4    1 
ATOM   4686 C  C5    . DC  C 2  16  ? -45.854 77.531 -8.357  1.00 54.91  ? 16  DC  C C5    1 
ATOM   4687 C  C6    . DC  C 2  16  ? -44.839 77.222 -7.540  1.00 56.09  ? 16  DC  C C6    1 
ATOM   4688 P  P     . DG  C 2  17  ? -39.730 77.648 -3.641  1.00 71.27  ? 17  DG  C P     1 
ATOM   4689 O  OP1   . DG  C 2  17  ? -38.371 77.073 -3.310  1.00 68.08  ? 17  DG  C OP1   1 
ATOM   4690 O  OP2   . DG  C 2  17  ? -40.819 77.901 -2.640  1.00 68.24  ? 17  DG  C OP2   1 
ATOM   4691 O  "O5'" . DG  C 2  17  ? -39.578 79.045 -4.409  1.00 67.91  ? 17  DG  C "O5'" 1 
ATOM   4692 C  "C5'" . DG  C 2  17  ? -38.413 79.337 -5.184  1.00 62.79  ? 17  DG  C "C5'" 1 
ATOM   4693 C  "C4'" . DG  C 2  17  ? -38.570 80.760 -5.679  1.00 58.47  ? 17  DG  C "C4'" 1 
ATOM   4694 O  "O4'" . DG  C 2  17  ? -39.759 80.849 -6.505  1.00 56.79  ? 17  DG  C "O4'" 1 
ATOM   4695 C  "C3'" . DG  C 2  17  ? -38.725 81.800 -4.592  1.00 56.48  ? 17  DG  C "C3'" 1 
ATOM   4696 O  "O3'" . DG  C 2  17  ? -37.650 82.646 -4.856  1.00 58.19  ? 17  DG  C "O3'" 1 
ATOM   4697 C  "C2'" . DG  C 2  17  ? -40.111 82.421 -4.813  1.00 55.39  ? 17  DG  C "C2'" 1 
ATOM   4698 C  "C1'" . DG  C 2  17  ? -40.471 82.032 -6.249  1.00 53.63  ? 17  DG  C "C1'" 1 
ATOM   4699 N  N9    . DG  C 2  17  ? -41.862 81.676 -6.561  1.00 51.18  ? 17  DG  C N9    1 
ATOM   4700 C  C8    . DG  C 2  17  ? -42.752 80.931 -5.810  1.00 49.25  ? 17  DG  C C8    1 
ATOM   4701 N  N7    . DG  C 2  17  ? -43.918 80.781 -6.395  1.00 48.11  ? 17  DG  C N7    1 
ATOM   4702 C  C5    . DG  C 2  17  ? -43.790 81.447 -7.609  1.00 47.41  ? 17  DG  C C5    1 
ATOM   4703 C  C6    . DG  C 2  17  ? -44.714 81.640 -8.671  1.00 47.80  ? 17  DG  C C6    1 
ATOM   4704 O  O6    . DG  C 2  17  ? -45.874 81.239 -8.754  1.00 49.88  ? 17  DG  C O6    1 
ATOM   4705 N  N1    . DG  C 2  17  ? -44.213 82.381 -9.739  1.00 47.16  ? 17  DG  C N1    1 
ATOM   4706 C  C2    . DG  C 2  17  ? -42.939 82.897 -9.770  1.00 47.86  ? 17  DG  C C2    1 
ATOM   4707 N  N2    . DG  C 2  17  ? -42.624 83.593 -10.872 1.00 45.95  ? 17  DG  C N2    1 
ATOM   4708 N  N3    . DG  C 2  17  ? -42.045 82.725 -8.781  1.00 48.59  ? 17  DG  C N3    1 
ATOM   4709 C  C4    . DG  C 2  17  ? -42.535 81.998 -7.730  1.00 49.04  ? 17  DG  C C4    1 
ATOM   4710 P  P     . DC  C 2  18  ? -37.325 83.981 -4.027  1.00 60.25  ? 18  DC  C P     1 
ATOM   4711 O  OP1   . DC  C 2  18  ? -35.889 84.269 -4.322  1.00 58.22  ? 18  DC  C OP1   1 
ATOM   4712 O  OP2   . DC  C 2  18  ? -37.785 83.816 -2.630  1.00 60.33  ? 18  DC  C OP2   1 
ATOM   4713 O  "O5'" . DC  C 2  18  ? -38.343 85.046 -4.668  1.00 57.22  ? 18  DC  C "O5'" 1 
ATOM   4714 C  "C5'" . DC  C 2  18  ? -38.228 85.415 -6.025  1.00 54.97  ? 18  DC  C "C5'" 1 
ATOM   4715 C  "C4'" . DC  C 2  18  ? -39.450 86.205 -6.462  1.00 54.48  ? 18  DC  C "C4'" 1 
ATOM   4716 O  "O4'" . DC  C 2  18  ? -40.615 85.366 -6.530  1.00 54.19  ? 18  DC  C "O4'" 1 
ATOM   4717 C  "C3'" . DC  C 2  18  ? -39.919 87.360 -5.578  1.00 54.15  ? 18  DC  C "C3'" 1 
ATOM   4718 O  "O3'" . DC  C 2  18  ? -39.280 88.526 -6.102  1.00 54.68  ? 18  DC  C "O3'" 1 
ATOM   4719 C  "C2'" . DC  C 2  18  ? -41.447 87.392 -5.744  1.00 52.94  ? 18  DC  C "C2'" 1 
ATOM   4720 C  "C1'" . DC  C 2  18  ? -41.707 86.244 -6.707  1.00 52.11  ? 18  DC  C "C1'" 1 
ATOM   4721 N  N1    . DC  C 2  18  ? -42.905 85.425 -6.454  1.00 50.41  ? 18  DC  C N1    1 
ATOM   4722 C  C2    . DC  C 2  18  ? -43.884 85.397 -7.434  1.00 51.63  ? 18  DC  C C2    1 
ATOM   4723 O  O2    . DC  C 2  18  ? -43.713 86.076 -8.447  1.00 53.31  ? 18  DC  C O2    1 
ATOM   4724 N  N3    . DC  C 2  18  ? -45.002 84.639 -7.249  1.00 52.57  ? 18  DC  C N3    1 
ATOM   4725 C  C4    . DC  C 2  18  ? -45.140 83.918 -6.121  1.00 52.23  ? 18  DC  C C4    1 
ATOM   4726 N  N4    . DC  C 2  18  ? -46.253 83.191 -5.994  1.00 51.41  ? 18  DC  C N4    1 
ATOM   4727 C  C5    . DC  C 2  18  ? -44.140 83.923 -5.096  1.00 50.77  ? 18  DC  C C5    1 
ATOM   4728 C  C6    . DC  C 2  18  ? -43.046 84.680 -5.309  1.00 50.77  ? 18  DC  C C6    1 
ATOM   4729 P  P     . DA  C 2  19  ? -39.665 90.024 -5.705  1.00 53.33  ? 19  DA  C P     1 
ATOM   4730 O  OP1   . DA  C 2  19  ? -38.540 90.820 -6.238  1.00 50.80  ? 19  DA  C OP1   1 
ATOM   4731 O  OP2   . DA  C 2  19  ? -39.970 90.027 -4.238  1.00 55.14  ? 19  DA  C OP2   1 
ATOM   4732 O  "O5'" . DA  C 2  19  ? -41.074 90.346 -6.383  1.00 50.35  ? 19  DA  C "O5'" 1 
ATOM   4733 C  "C5'" . DA  C 2  19  ? -41.226 90.445 -7.743  1.00 53.28  ? 19  DA  C "C5'" 1 
ATOM   4734 C  "C4'" . DA  C 2  19  ? -42.675 90.738 -8.026  1.00 55.71  ? 19  DA  C "C4'" 1 
ATOM   4735 O  "O4'" . DA  C 2  19  ? -43.420 89.571 -7.634  1.00 57.49  ? 19  DA  C "O4'" 1 
ATOM   4736 C  "C3'" . DA  C 2  19  ? -43.286 91.894 -7.246  1.00 56.80  ? 19  DA  C "C3'" 1 
ATOM   4737 O  "O3'" . DA  C 2  19  ? -44.045 92.721 -8.129  1.00 58.78  ? 19  DA  C "O3'" 1 
ATOM   4738 C  "C2'" . DA  C 2  19  ? -44.219 91.215 -6.259  1.00 57.71  ? 19  DA  C "C2'" 1 
ATOM   4739 C  "C1'" . DA  C 2  19  ? -44.623 89.996 -7.066  1.00 58.45  ? 19  DA  C "C1'" 1 
ATOM   4740 N  N9    . DA  C 2  19  ? -45.151 88.923 -6.242  1.00 60.86  ? 19  DA  C N9    1 
ATOM   4741 C  C8    . DA  C 2  19  ? -44.627 88.377 -5.090  1.00 62.01  ? 19  DA  C C8    1 
ATOM   4742 N  N7    . DA  C 2  19  ? -45.356 87.418 -4.574  1.00 62.97  ? 19  DA  C N7    1 
ATOM   4743 C  C5    . DA  C 2  19  ? -46.431 87.341 -5.463  1.00 63.96  ? 19  DA  C C5    1 
ATOM   4744 C  C6    . DA  C 2  19  ? -47.589 86.529 -5.512  1.00 65.44  ? 19  DA  C C6    1 
ATOM   4745 N  N6    . DA  C 2  19  ? -47.846 85.596 -4.589  1.00 66.23  ? 19  DA  C N6    1 
ATOM   4746 N  N1    . DA  C 2  19  ? -48.470 86.706 -6.540  1.00 66.74  ? 19  DA  C N1    1 
ATOM   4747 C  C2    . DA  C 2  19  ? -48.220 87.645 -7.473  1.00 66.06  ? 19  DA  C C2    1 
ATOM   4748 N  N3    . DA  C 2  19  ? -47.168 88.470 -7.529  1.00 65.03  ? 19  DA  C N3    1 
ATOM   4749 C  C4    . DA  C 2  19  ? -46.317 88.261 -6.494  1.00 63.03  ? 19  DA  C C4    1 
ATOM   4750 O  "O5'" . DT  D 3  1   ? -54.739 90.001 -8.378  1.00 103.02 ? 1   DT  D "O5'" 1 
ATOM   4751 C  "C5'" . DT  D 3  1   ? -55.605 88.901 -8.701  1.00 102.77 ? 1   DT  D "C5'" 1 
ATOM   4752 C  "C4'" . DT  D 3  1   ? -54.953 87.912 -9.679  1.00 102.02 ? 1   DT  D "C4'" 1 
ATOM   4753 O  "O4'" . DT  D 3  1   ? -53.648 87.456 -9.192  1.00 101.60 ? 1   DT  D "O4'" 1 
ATOM   4754 C  "C3'" . DT  D 3  1   ? -55.790 86.650 -9.945  1.00 100.59 ? 1   DT  D "C3'" 1 
ATOM   4755 O  "O3'" . DT  D 3  1   ? -56.002 86.425 -11.371 1.00 97.03  ? 1   DT  D "O3'" 1 
ATOM   4756 C  "C2'" . DT  D 3  1   ? -55.058 85.535 -9.177  1.00 100.74 ? 1   DT  D "C2'" 1 
ATOM   4757 C  "C1'" . DT  D 3  1   ? -53.603 86.034 -9.170  1.00 101.09 ? 1   DT  D "C1'" 1 
ATOM   4758 N  N1    . DT  D 3  1   ? -52.732 85.552 -8.024  1.00 100.77 ? 1   DT  D N1    1 
ATOM   4759 C  C2    . DT  D 3  1   ? -51.578 86.250 -7.658  1.00 99.89  ? 1   DT  D C2    1 
ATOM   4760 O  O2    . DT  D 3  1   ? -51.181 87.282 -8.182  1.00 98.58  ? 1   DT  D O2    1 
ATOM   4761 N  N3    . DT  D 3  1   ? -50.885 85.678 -6.616  1.00 99.32  ? 1   DT  D N3    1 
ATOM   4762 C  C4    . DT  D 3  1   ? -51.199 84.517 -5.922  1.00 99.77  ? 1   DT  D C4    1 
ATOM   4763 O  O4    . DT  D 3  1   ? -50.487 84.113 -5.008  1.00 99.13  ? 1   DT  D O4    1 
ATOM   4764 C  C5    . DT  D 3  1   ? -52.407 83.830 -6.350  1.00 100.60 ? 1   DT  D C5    1 
ATOM   4765 C  C7    . DT  D 3  1   ? -52.874 82.558 -5.686  1.00 100.50 ? 1   DT  D C7    1 
ATOM   4766 C  C6    . DT  D 3  1   ? -53.098 84.377 -7.368  1.00 100.82 ? 1   DT  D C6    1 
ATOM   4767 P  P     . DG  D 3  2   ? -54.944 85.826 -12.443 1.00 94.42  ? 2   DG  D P     1 
ATOM   4768 O  OP1   . DG  D 3  2   ? -55.567 86.027 -13.779 1.00 93.67  ? 2   DG  D OP1   1 
ATOM   4769 O  OP2   . DG  D 3  2   ? -54.515 84.466 -12.015 1.00 93.89  ? 2   DG  D OP2   1 
ATOM   4770 O  "O5'" . DG  D 3  2   ? -53.675 86.800 -12.359 1.00 88.58  ? 2   DG  D "O5'" 1 
ATOM   4771 C  "C5'" . DG  D 3  2   ? -53.224 87.452 -13.540 1.00 79.94  ? 2   DG  D "C5'" 1 
ATOM   4772 C  "C4'" . DG  D 3  2   ? -51.785 87.086 -13.827 1.00 73.47  ? 2   DG  D "C4'" 1 
ATOM   4773 O  "O4'" . DG  D 3  2   ? -51.088 86.672 -12.629 1.00 71.22  ? 2   DG  D "O4'" 1 
ATOM   4774 C  "C3'" . DG  D 3  2   ? -51.566 85.953 -14.804 1.00 71.21  ? 2   DG  D "C3'" 1 
ATOM   4775 O  "O3'" . DG  D 3  2   ? -50.607 86.448 -15.696 1.00 69.27  ? 2   DG  D "O3'" 1 
ATOM   4776 C  "C2'" . DG  D 3  2   ? -50.985 84.814 -13.966 1.00 69.17  ? 2   DG  D "C2'" 1 
ATOM   4777 C  "C1'" . DG  D 3  2   ? -50.230 85.592 -12.907 1.00 67.82  ? 2   DG  D "C1'" 1 
ATOM   4778 N  N9    . DG  D 3  2   ? -50.050 84.883 -11.644 1.00 65.31  ? 2   DG  D N9    1 
ATOM   4779 C  C8    . DG  D 3  2   ? -50.975 84.076 -11.012 1.00 64.13  ? 2   DG  D C8    1 
ATOM   4780 N  N7    . DG  D 3  2   ? -50.541 83.574 -9.885  1.00 63.02  ? 2   DG  D N7    1 
ATOM   4781 C  C5    . DG  D 3  2   ? -49.261 84.086 -9.753  1.00 61.71  ? 2   DG  D C5    1 
ATOM   4782 C  C6    . DG  D 3  2   ? -48.316 83.895 -8.727  1.00 61.07  ? 2   DG  D C6    1 
ATOM   4783 O  O6    . DG  D 3  2   ? -48.422 83.227 -7.705  1.00 61.68  ? 2   DG  D O6    1 
ATOM   4784 N  N1    . DG  D 3  2   ? -47.135 84.585 -8.944  1.00 61.25  ? 2   DG  D N1    1 
ATOM   4785 C  C2    . DG  D 3  2   ? -46.896 85.372 -10.041 1.00 60.93  ? 2   DG  D C2    1 
ATOM   4786 N  N2    . DG  D 3  2   ? -45.684 85.938 -10.061 1.00 59.77  ? 2   DG  D N2    1 
ATOM   4787 N  N3    . DG  D 3  2   ? -47.775 85.570 -11.028 1.00 61.17  ? 2   DG  D N3    1 
ATOM   4788 C  C4    . DG  D 3  2   ? -48.939 84.900 -10.819 1.00 62.77  ? 2   DG  D C4    1 
ATOM   4789 P  P     . DC  D 3  3   ? -50.431 85.826 -17.140 1.00 66.60  ? 3   DC  D P     1 
ATOM   4790 O  OP1   . DC  D 3  3   ? -50.869 86.828 -18.127 1.00 66.65  ? 3   DC  D OP1   1 
ATOM   4791 O  OP2   . DC  D 3  3   ? -51.093 84.504 -17.160 1.00 69.14  ? 3   DC  D OP2   1 
ATOM   4792 O  "O5'" . DC  D 3  3   ? -48.850 85.592 -17.150 1.00 63.62  ? 3   DC  D "O5'" 1 
ATOM   4793 C  "C5'" . DC  D 3  3   ? -48.025 86.719 -17.041 1.00 61.54  ? 3   DC  D "C5'" 1 
ATOM   4794 C  "C4'" . DC  D 3  3   ? -46.655 86.359 -16.529 1.00 59.97  ? 3   DC  D "C4'" 1 
ATOM   4795 O  "O4'" . DC  D 3  3   ? -46.749 85.816 -15.195 1.00 60.35  ? 3   DC  D "O4'" 1 
ATOM   4796 C  "C3'" . DC  D 3  3   ? -45.956 85.314 -17.360 1.00 58.95  ? 3   DC  D "C3'" 1 
ATOM   4797 O  "O3'" . DC  D 3  3   ? -44.815 85.906 -17.946 1.00 57.94  ? 3   DC  D "O3'" 1 
ATOM   4798 C  "C2'" . DC  D 3  3   ? -45.561 84.221 -16.369 1.00 59.51  ? 3   DC  D "C2'" 1 
ATOM   4799 C  "C1'" . DC  D 3  3   ? -45.721 84.874 -15.005 1.00 59.01  ? 3   DC  D "C1'" 1 
ATOM   4800 N  N1    . DC  D 3  3   ? -46.160 83.914 -13.911 1.00 57.73  ? 3   DC  D N1    1 
ATOM   4801 C  C2    . DC  D 3  3   ? -45.379 83.752 -12.753 1.00 58.31  ? 3   DC  D C2    1 
ATOM   4802 O  O2    . DC  D 3  3   ? -44.329 84.385 -12.601 1.00 57.59  ? 3   DC  D O2    1 
ATOM   4803 N  N3    . DC  D 3  3   ? -45.802 82.886 -11.794 1.00 58.98  ? 3   DC  D N3    1 
ATOM   4804 C  C4    . DC  D 3  3   ? -46.942 82.214 -11.952 1.00 58.12  ? 3   DC  D C4    1 
ATOM   4805 N  N4    . DC  D 3  3   ? -47.296 81.395 -10.958 1.00 58.60  ? 3   DC  D N4    1 
ATOM   4806 C  C5    . DC  D 3  3   ? -47.752 82.356 -13.120 1.00 56.24  ? 3   DC  D C5    1 
ATOM   4807 C  C6    . DC  D 3  3   ? -47.324 83.207 -14.052 1.00 55.97  ? 3   DC  D C6    1 
ATOM   4808 P  P     . DG  D 3  4   ? -44.074 85.156 -19.148 1.00 55.71  ? 4   DG  D P     1 
ATOM   4809 O  OP1   . DG  D 3  4   ? -43.452 86.214 -19.988 1.00 56.75  ? 4   DG  D OP1   1 
ATOM   4810 O  OP2   . DG  D 3  4   ? -45.065 84.218 -19.741 1.00 56.03  ? 4   DG  D OP2   1 
ATOM   4811 O  "O5'" . DG  D 3  4   ? -42.927 84.338 -18.435 1.00 52.66  ? 4   DG  D "O5'" 1 
ATOM   4812 C  "C5'" . DG  D 3  4   ? -41.747 85.050 -18.209 1.00 54.91  ? 4   DG  D "C5'" 1 
ATOM   4813 C  "C4'" . DG  D 3  4   ? -40.782 84.189 -17.445 1.00 55.46  ? 4   DG  D "C4'" 1 
ATOM   4814 O  "O4'" . DG  D 3  4   ? -41.524 83.589 -16.360 1.00 56.26  ? 4   DG  D "O4'" 1 
ATOM   4815 C  "C3'" . DG  D 3  4   ? -40.207 83.042 -18.255 1.00 54.96  ? 4   DG  D "C3'" 1 
ATOM   4816 O  "O3'" . DG  D 3  4   ? -38.842 83.082 -18.024 1.00 56.49  ? 4   DG  D "O3'" 1 
ATOM   4817 C  "C2'" . DG  D 3  4   ? -40.862 81.775 -17.703 1.00 53.20  ? 4   DG  D "C2'" 1 
ATOM   4818 C  "C1'" . DG  D 3  4   ? -41.281 82.200 -16.305 1.00 53.30  ? 4   DG  D "C1'" 1 
ATOM   4819 N  N9    . DG  D 3  4   ? -42.530 81.611 -15.828 1.00 51.54  ? 4   DG  D N9    1 
ATOM   4820 C  C8    . DG  D 3  4   ? -43.721 81.470 -16.502 1.00 49.69  ? 4   DG  D C8    1 
ATOM   4821 N  N7    . DG  D 3  4   ? -44.660 80.901 -15.788 1.00 49.05  ? 4   DG  D N7    1 
ATOM   4822 C  C5    . DG  D 3  4   ? -44.050 80.639 -14.562 1.00 49.61  ? 4   DG  D C5    1 
ATOM   4823 C  C6    . DG  D 3  4   ? -44.560 80.020 -13.376 1.00 48.88  ? 4   DG  D C6    1 
ATOM   4824 O  O6    . DG  D 3  4   ? -45.700 79.565 -13.177 1.00 47.30  ? 4   DG  D O6    1 
ATOM   4825 N  N1    . DG  D 3  4   ? -43.590 79.958 -12.360 1.00 48.18  ? 4   DG  D N1    1 
ATOM   4826 C  C2    . DG  D 3  4   ? -42.290 80.431 -12.474 1.00 48.56  ? 4   DG  D C2    1 
ATOM   4827 N  N2    . DG  D 3  4   ? -41.490 80.291 -11.401 1.00 47.41  ? 4   DG  D N2    1 
ATOM   4828 N  N3    . DG  D 3  4   ? -41.802 81.002 -13.578 1.00 49.32  ? 4   DG  D N3    1 
ATOM   4829 C  C4    . DG  D 3  4   ? -42.733 81.077 -14.573 1.00 50.32  ? 4   DG  D C4    1 
ATOM   4830 P  P     . DA  D 3  5   ? -37.917 81.884 -18.523 1.00 58.48  ? 5   DA  D P     1 
ATOM   4831 O  OP1   . DA  D 3  5   ? -36.530 82.386 -18.718 1.00 55.61  ? 5   DA  D OP1   1 
ATOM   4832 O  OP2   . DA  D 3  5   ? -38.678 81.149 -19.565 1.00 58.49  ? 5   DA  D OP2   1 
ATOM   4833 O  "O5'" . DA  D 3  5   ? -37.942 80.958 -17.240 1.00 60.16  ? 5   DA  D "O5'" 1 
ATOM   4834 C  "C5'" . DA  D 3  5   ? -37.088 81.298 -16.151 1.00 62.74  ? 5   DA  D "C5'" 1 
ATOM   4835 C  "C4'" . DA  D 3  5   ? -37.173 80.172 -15.151 1.00 62.73  ? 5   DA  D "C4'" 1 
ATOM   4836 O  "O4'" . DA  D 3  5   ? -38.576 79.855 -14.933 1.00 62.06  ? 5   DA  D "O4'" 1 
ATOM   4837 C  "C3'" . DA  D 3  5   ? -36.536 78.908 -15.691 1.00 63.51  ? 5   DA  D "C3'" 1 
ATOM   4838 O  "O3'" . DA  D 3  5   ? -35.692 78.456 -14.655 1.00 67.59  ? 5   DA  D "O3'" 1 
ATOM   4839 C  "C2'" . DA  D 3  5   ? -37.714 77.983 -16.033 1.00 59.98  ? 5   DA  D "C2'" 1 
ATOM   4840 C  "C1'" . DA  D 3  5   ? -38.741 78.457 -15.014 1.00 57.09  ? 5   DA  D "C1'" 1 
ATOM   4841 N  N9    . DA  D 3  5   ? -40.145 78.195 -15.299 1.00 51.11  ? 5   DA  D N9    1 
ATOM   4842 C  C8    . DA  D 3  5   ? -40.853 78.381 -16.447 1.00 49.70  ? 5   DA  D C8    1 
ATOM   4843 N  N7    . DA  D 3  5   ? -42.129 78.049 -16.366 1.00 47.32  ? 5   DA  D N7    1 
ATOM   4844 C  C5    . DA  D 3  5   ? -42.254 77.610 -15.056 1.00 47.43  ? 5   DA  D C5    1 
ATOM   4845 C  C6    . DA  D 3  5   ? -43.338 77.091 -14.304 1.00 45.36  ? 5   DA  D C6    1 
ATOM   4846 N  N6    . DA  D 3  5   ? -44.580 76.920 -14.755 1.00 39.56  ? 5   DA  D N6    1 
ATOM   4847 N  N1    . DA  D 3  5   ? -43.083 76.752 -13.020 1.00 46.79  ? 5   DA  D N1    1 
ATOM   4848 C  C2    . DA  D 3  5   ? -41.853 76.903 -12.505 1.00 47.01  ? 5   DA  D C2    1 
ATOM   4849 N  N3    . DA  D 3  5   ? -40.762 77.361 -13.104 1.00 48.68  ? 5   DA  D N3    1 
ATOM   4850 C  C4    . DA  D 3  5   ? -41.037 77.703 -14.387 1.00 49.26  ? 5   DA  D C4    1 
ATOM   4851 P  P     . DA  D 3  6   ? -34.691 77.221 -14.917 1.00 71.75  ? 6   DA  D P     1 
ATOM   4852 O  OP1   . DA  D 3  6   ? -33.338 77.819 -15.110 1.00 70.66  ? 6   DA  D OP1   1 
ATOM   4853 O  OP2   . DA  D 3  6   ? -35.284 76.279 -15.923 1.00 67.89  ? 6   DA  D OP2   1 
ATOM   4854 O  "O5'" . DA  D 3  6   ? -34.685 76.466 -13.488 1.00 68.24  ? 6   DA  D "O5'" 1 
ATOM   4855 C  "C5'" . DA  D 3  6   ? -35.291 76.997 -12.296 1.00 61.82  ? 6   DA  D "C5'" 1 
ATOM   4856 C  "C4'" . DA  D 3  6   ? -36.078 75.905 -11.581 1.00 55.69  ? 6   DA  D "C4'" 1 
ATOM   4857 O  "O4'" . DA  D 3  6   ? -37.426 75.790 -12.118 1.00 53.96  ? 6   DA  D "O4'" 1 
ATOM   4858 C  "C3'" . DA  D 3  6   ? -35.487 74.504 -11.618 1.00 52.67  ? 6   DA  D "C3'" 1 
ATOM   4859 O  "O3'" . DA  D 3  6   ? -35.594 74.066 -10.278 1.00 50.90  ? 6   DA  D "O3'" 1 
ATOM   4860 C  "C2'" . DA  D 3  6   ? -36.432 73.755 -12.561 1.00 52.64  ? 6   DA  D "C2'" 1 
ATOM   4861 C  "C1'" . DA  D 3  6   ? -37.777 74.424 -12.273 1.00 51.82  ? 6   DA  D "C1'" 1 
ATOM   4862 N  N9    . DA  D 3  6   ? -38.794 74.391 -13.338 1.00 49.34  ? 6   DA  D N9    1 
ATOM   4863 C  C8    . DA  D 3  6   ? -38.590 74.708 -14.649 1.00 47.64  ? 6   DA  D C8    1 
ATOM   4864 N  N7    . DA  D 3  6   ? -39.656 74.640 -15.387 1.00 45.75  ? 6   DA  D N7    1 
ATOM   4865 C  C5    . DA  D 3  6   ? -40.641 74.242 -14.513 1.00 45.49  ? 6   DA  D C5    1 
ATOM   4866 C  C6    . DA  D 3  6   ? -42.023 73.977 -14.702 1.00 46.86  ? 6   DA  D C6    1 
ATOM   4867 N  N6    . DA  D 3  6   ? -42.646 74.098 -15.899 1.00 43.28  ? 6   DA  D N6    1 
ATOM   4868 N  N1    . DA  D 3  6   ? -42.748 73.589 -13.614 1.00 46.46  ? 6   DA  D N1    1 
ATOM   4869 C  C2    . DA  D 3  6   ? -42.103 73.487 -12.446 1.00 46.96  ? 6   DA  D C2    1 
ATOM   4870 N  N3    . DA  D 3  6   ? -40.815 73.716 -12.166 1.00 46.92  ? 6   DA  D N3    1 
ATOM   4871 C  C4    . DA  D 3  6   ? -40.131 74.093 -13.249 1.00 46.30  ? 6   DA  D C4    1 
ATOM   4872 P  P     . DA  D 3  7   ? -35.003 72.701 -9.678  1.00 48.43  ? 7   DA  D P     1 
ATOM   4873 O  OP1   . DA  D 3  7   ? -34.421 72.991 -8.345  1.00 48.98  ? 7   DA  D OP1   1 
ATOM   4874 O  OP2   . DA  D 3  7   ? -34.162 72.070 -10.727 1.00 49.15  ? 7   DA  D OP2   1 
ATOM   4875 O  "O5'" . DA  D 3  7   ? -36.330 71.860 -9.457  1.00 44.86  ? 7   DA  D "O5'" 1 
ATOM   4876 C  "C5'" . DA  D 3  7   ? -37.319 72.336 -8.607  1.00 44.11  ? 7   DA  D "C5'" 1 
ATOM   4877 C  "C4'" . DA  D 3  7   ? -38.495 71.374 -8.627  1.00 45.23  ? 7   DA  D "C4'" 1 
ATOM   4878 O  "O4'" . DA  D 3  7   ? -39.240 71.533 -9.853  1.00 45.13  ? 7   DA  D "O4'" 1 
ATOM   4879 C  "C3'" . DA  D 3  7   ? -38.145 69.889 -8.521  1.00 45.52  ? 7   DA  D "C3'" 1 
ATOM   4880 O  "O3'" . DA  D 3  7   ? -38.870 69.387 -7.425  1.00 46.43  ? 7   DA  D "O3'" 1 
ATOM   4881 C  "C2'" . DA  D 3  7   ? -38.579 69.265 -9.849  1.00 44.78  ? 7   DA  D "C2'" 1 
ATOM   4882 C  "C1'" . DA  D 3  7   ? -39.603 70.269 -10.375 1.00 44.38  ? 7   DA  D "C1'" 1 
ATOM   4883 N  N9    . DA  D 3  7   ? -39.696 70.449 -11.827 1.00 41.69  ? 7   DA  D N9    1 
ATOM   4884 C  C8    . DA  D 3  7   ? -38.690 70.750 -12.689 1.00 41.69  ? 7   DA  D C8    1 
ATOM   4885 N  N7    . DA  D 3  7   ? -39.081 70.868 -13.942 1.00 41.85  ? 7   DA  D N7    1 
ATOM   4886 C  C5    . DA  D 3  7   ? -40.436 70.645 -13.893 1.00 41.16  ? 7   DA  D C5    1 
ATOM   4887 C  C6    . DA  D 3  7   ? -41.431 70.630 -14.893 1.00 42.67  ? 7   DA  D C6    1 
ATOM   4888 N  N6    . DA  D 3  7   ? -41.174 70.872 -16.196 1.00 39.80  ? 7   DA  D N6    1 
ATOM   4889 N  N1    . DA  D 3  7   ? -42.711 70.352 -14.494 1.00 43.17  ? 7   DA  D N1    1 
ATOM   4890 C  C2    . DA  D 3  7   ? -42.952 70.125 -13.202 1.00 42.31  ? 7   DA  D C2    1 
ATOM   4891 N  N3    . DA  D 3  7   ? -42.081 70.118 -12.184 1.00 42.08  ? 7   DA  D N3    1 
ATOM   4892 C  C4    . DA  D 3  7   ? -40.831 70.378 -12.599 1.00 41.27  ? 7   DA  D C4    1 
ATOM   4893 P  P     . DT  D 3  8   ? -38.752 67.868 -6.970  1.00 47.98  ? 8   DT  D P     1 
ATOM   4894 O  OP1   . DT  D 3  8   ? -39.141 67.794 -5.548  1.00 49.18  ? 8   DT  D OP1   1 
ATOM   4895 O  OP2   . DT  D 3  8   ? -37.453 67.274 -7.393  1.00 47.32  ? 8   DT  D OP2   1 
ATOM   4896 O  "O5'" . DT  D 3  8   ? -39.982 67.347 -7.833  1.00 48.02  ? 8   DT  D "O5'" 1 
ATOM   4897 C  "C5'" . DT  D 3  8   ? -41.271 67.888 -7.546  1.00 47.18  ? 8   DT  D "C5'" 1 
ATOM   4898 C  "C4'" . DT  D 3  8   ? -42.258 67.213 -8.473  1.00 47.77  ? 8   DT  D "C4'" 1 
ATOM   4899 O  "O4'" . DT  D 3  8   ? -41.947 67.547 -9.864  1.00 49.11  ? 8   DT  D "O4'" 1 
ATOM   4900 C  "C3'" . DT  D 3  8   ? -42.244 65.695 -8.395  1.00 46.49  ? 8   DT  D "C3'" 1 
ATOM   4901 O  "O3'" . DT  D 3  8   ? -43.552 65.363 -8.013  1.00 46.75  ? 8   DT  D "O3'" 1 
ATOM   4902 C  "C2'" . DT  D 3  8   ? -41.875 65.241 -9.818  1.00 47.64  ? 8   DT  D "C2'" 1 
ATOM   4903 C  "C1'" . DT  D 3  8   ? -42.264 66.442 -10.688 1.00 46.88  ? 8   DT  D "C1'" 1 
ATOM   4904 N  N1    . DT  D 3  8   ? -41.553 66.717 -11.988 1.00 45.31  ? 8   DT  D N1    1 
ATOM   4905 C  C2    . DT  D 3  8   ? -42.283 66.860 -13.159 1.00 45.90  ? 8   DT  D C2    1 
ATOM   4906 O  O2    . DT  D 3  8   ? -43.493 66.735 -13.221 1.00 47.80  ? 8   DT  D O2    1 
ATOM   4907 N  N3    . DT  D 3  8   ? -41.559 67.154 -14.287 1.00 44.10  ? 8   DT  D N3    1 
ATOM   4908 C  C4    . DT  D 3  8   ? -40.190 67.307 -14.360 1.00 44.45  ? 8   DT  D C4    1 
ATOM   4909 O  O4    . DT  D 3  8   ? -39.611 67.558 -15.410 1.00 46.23  ? 8   DT  D O4    1 
ATOM   4910 C  C5    . DT  D 3  8   ? -39.478 67.154 -13.120 1.00 43.37  ? 8   DT  D C5    1 
ATOM   4911 C  C7    . DT  D 3  8   ? -37.994 67.314 -13.100 1.00 39.68  ? 8   DT  D C7    1 
ATOM   4912 C  C6    . DT  D 3  8   ? -40.183 66.878 -12.008 1.00 44.83  ? 8   DT  D C6    1 
ATOM   4913 P  P     . DT  D 3  9   ? -44.106 63.863 -7.841  1.00 46.75  ? 9   DT  D P     1 
ATOM   4914 O  OP1   . DT  D 3  9   ? -45.253 63.937 -6.915  1.00 44.45  ? 9   DT  D OP1   1 
ATOM   4915 O  OP2   . DT  D 3  9   ? -42.971 62.942 -7.581  1.00 44.16  ? 9   DT  D OP2   1 
ATOM   4916 O  "O5'" . DT  D 3  9   ? -44.688 63.575 -9.297  1.00 45.92  ? 9   DT  D "O5'" 1 
ATOM   4917 C  "C5'" . DT  D 3  9   ? -45.652 64.437 -9.815  1.00 46.93  ? 9   DT  D "C5'" 1 
ATOM   4918 C  "C4'" . DT  D 3  9   ? -46.206 63.919 -11.129 1.00 48.29  ? 9   DT  D "C4'" 1 
ATOM   4919 O  "O4'" . DT  D 3  9   ? -45.327 64.300 -12.210 1.00 48.54  ? 9   DT  D "O4'" 1 
ATOM   4920 C  "C3'" . DT  D 3  9   ? -46.433 62.419 -11.240 1.00 47.95  ? 9   DT  D "C3'" 1 
ATOM   4921 O  "O3'" . DT  D 3  9   ? -47.679 62.356 -11.838 1.00 49.34  ? 9   DT  D "O3'" 1 
ATOM   4922 C  "C2'" . DT  D 3  9   ? -45.329 61.953 -12.179 1.00 48.60  ? 9   DT  D "C2'" 1 
ATOM   4923 C  "C1'" . DT  D 3  9   ? -45.074 63.186 -13.045 1.00 49.33  ? 9   DT  D "C1'" 1 
ATOM   4924 N  N1    . DT  D 3  9   ? -43.667 63.402 -13.585 1.00 49.11  ? 9   DT  D N1    1 
ATOM   4925 C  C2    . DT  D 3  9   ? -43.488 63.771 -14.903 1.00 47.98  ? 9   DT  D C2    1 
ATOM   4926 O  O2    . DT  D 3  9   ? -44.379 63.921 -15.715 1.00 49.02  ? 9   DT  D O2    1 
ATOM   4927 N  N3    . DT  D 3  9   ? -42.199 63.957 -15.272 1.00 47.52  ? 9   DT  D N3    1 
ATOM   4928 C  C4    . DT  D 3  9   ? -41.075 63.834 -14.497 1.00 48.48  ? 9   DT  D C4    1 
ATOM   4929 O  O4    . DT  D 3  9   ? -39.959 64.037 -14.962 1.00 48.63  ? 9   DT  D O4    1 
ATOM   4930 C  C5    . DT  D 3  9   ? -41.310 63.450 -13.129 1.00 49.39  ? 9   DT  D C5    1 
ATOM   4931 C  C7    . DT  D 3  9   ? -40.157 63.267 -12.183 1.00 49.63  ? 9   DT  D C7    1 
ATOM   4932 C  C6    . DT  D 3  9   ? -42.580 63.258 -12.741 1.00 49.22  ? 9   DT  D C6    1 
ATOM   4933 P  P     . DC  D 3  10  ? -48.429 61.017 -12.305 1.00 51.64  ? 10  DC  D P     1 
ATOM   4934 O  OP1   . DC  D 3  10  ? -49.884 61.299 -12.207 1.00 49.60  ? 10  DC  D OP1   1 
ATOM   4935 O  OP2   . DC  D 3  10  ? -47.803 59.861 -11.605 1.00 50.97  ? 10  DC  D OP2   1 
ATOM   4936 O  "O5'" . DC  D 3  10  ? -48.107 60.943 -13.870 1.00 49.86  ? 10  DC  D "O5'" 1 
ATOM   4937 C  "C5'" . DC  D 3  10  ? -48.658 61.952 -14.699 1.00 48.95  ? 10  DC  D "C5'" 1 
ATOM   4938 C  "C4'" . DC  D 3  10  ? -48.315 61.660 -16.137 1.00 49.32  ? 10  DC  D "C4'" 1 
ATOM   4939 O  "O4'" . DC  D 3  10  ? -46.892 61.817 -16.365 1.00 49.23  ? 10  DC  D "O4'" 1 
ATOM   4940 C  "C3'" . DC  D 3  10  ? -48.668 60.259 -16.599 1.00 49.79  ? 10  DC  D "C3'" 1 
ATOM   4941 O  "O3'" . DC  D 3  10  ? -49.316 60.448 -17.820 1.00 51.85  ? 10  DC  D "O3'" 1 
ATOM   4942 C  "C2'" . DC  D 3  10  ? -47.318 59.565 -16.780 1.00 49.76  ? 10  DC  D "C2'" 1 
ATOM   4943 C  "C1'" . DC  D 3  10  ? -46.376 60.725 -17.093 1.00 47.15  ? 10  DC  D "C1'" 1 
ATOM   4944 N  N1    . DC  D 3  10  ? -44.939 60.645 -16.652 1.00 45.30  ? 10  DC  D N1    1 
ATOM   4945 C  C2    . DC  D 3  10  ? -43.948 60.898 -17.593 1.00 44.59  ? 10  DC  D C2    1 
ATOM   4946 O  O2    . DC  D 3  10  ? -44.310 61.126 -18.747 1.00 45.59  ? 10  DC  D O2    1 
ATOM   4947 N  N3    . DC  D 3  10  ? -42.640 60.887 -17.215 1.00 44.00  ? 10  DC  D N3    1 
ATOM   4948 C  C4    . DC  D 3  10  ? -42.308 60.641 -15.940 1.00 43.45  ? 10  DC  D C4    1 
ATOM   4949 N  N4    . DC  D 3  10  ? -41.011 60.620 -15.615 1.00 41.09  ? 10  DC  D N4    1 
ATOM   4950 C  C5    . DC  D 3  10  ? -43.304 60.374 -14.951 1.00 43.52  ? 10  DC  D C5    1 
ATOM   4951 C  C6    . DC  D 3  10  ? -44.587 60.397 -15.351 1.00 44.77  ? 10  DC  D C6    1 
ATOM   4952 P  P     . DC  D 3  11  ? -50.115 59.291 -18.560 1.00 52.36  ? 11  DC  D P     1 
ATOM   4953 O  OP1   . DC  D 3  11  ? -51.052 59.988 -19.484 1.00 52.15  ? 11  DC  D OP1   1 
ATOM   4954 O  OP2   . DC  D 3  11  ? -50.562 58.334 -17.522 1.00 51.35  ? 11  DC  D OP2   1 
ATOM   4955 O  "O5'" . DC  D 3  11  ? -48.952 58.598 -19.424 1.00 49.62  ? 11  DC  D "O5'" 1 
ATOM   4956 C  "C5'" . DC  D 3  11  ? -48.465 59.127 -20.631 1.00 44.86  ? 11  DC  D "C5'" 1 
ATOM   4957 C  "C4'" . DC  D 3  11  ? -47.409 58.161 -21.122 1.00 45.43  ? 11  DC  D "C4'" 1 
ATOM   4958 O  "O4'" . DC  D 3  11  ? -46.190 58.360 -20.363 1.00 45.72  ? 11  DC  D "O4'" 1 
ATOM   4959 C  "C3'" . DC  D 3  11  ? -47.710 56.666 -20.988 1.00 44.20  ? 11  DC  D "C3'" 1 
ATOM   4960 O  "O3'" . DC  D 3  11  ? -47.279 56.025 -22.166 1.00 45.03  ? 11  DC  D "O3'" 1 
ATOM   4961 C  "C2'" . DC  D 3  11  ? -46.872 56.186 -19.814 1.00 43.24  ? 11  DC  D "C2'" 1 
ATOM   4962 C  "C1'" . DC  D 3  11  ? -45.670 57.090 -19.998 1.00 44.65  ? 11  DC  D "C1'" 1 
ATOM   4963 N  N1    . DC  D 3  11  ? -44.693 57.195 -18.827 1.00 44.94  ? 11  DC  D N1    1 
ATOM   4964 C  C2    . DC  D 3  11  ? -43.362 57.442 -19.150 1.00 44.35  ? 11  DC  D C2    1 
ATOM   4965 O  O2    . DC  D 3  11  ? -43.092 57.559 -20.338 1.00 45.89  ? 11  DC  D O2    1 
ATOM   4966 N  N3    . DC  D 3  11  ? -42.424 57.526 -18.171 1.00 44.25  ? 11  DC  D N3    1 
ATOM   4967 C  C4    . DC  D 3  11  ? -42.778 57.383 -16.887 1.00 43.60  ? 11  DC  D C4    1 
ATOM   4968 N  N4    . DC  D 3  11  ? -41.807 57.477 -15.975 1.00 41.70  ? 11  DC  D N4    1 
ATOM   4969 C  C5    . DC  D 3  11  ? -44.136 57.138 -16.509 1.00 42.79  ? 11  DC  D C5    1 
ATOM   4970 C  C6    . DC  D 3  11  ? -45.043 57.048 -17.501 1.00 44.33  ? 11  DC  D C6    1 
ATOM   4971 P  P     . DA  D 3  12  ? -48.373 55.512 -23.227 1.00 45.85  ? 12  DA  D P     1 
ATOM   4972 O  OP1   . DA  D 3  12  ? -49.431 56.544 -23.335 1.00 43.77  ? 12  DA  D OP1   1 
ATOM   4973 O  OP2   . DA  D 3  12  ? -48.670 54.106 -22.860 1.00 45.69  ? 12  DA  D OP2   1 
ATOM   4974 O  "O5'" . DA  D 3  12  ? -47.557 55.443 -24.604 1.00 45.46  ? 12  DA  D "O5'" 1 
ATOM   4975 C  "C5'" . DA  D 3  12  ? -46.795 56.530 -25.086 1.00 45.35  ? 12  DA  D "C5'" 1 
ATOM   4976 C  "C4'" . DA  D 3  12  ? -45.458 56.075 -25.647 1.00 45.87  ? 12  DA  D "C4'" 1 
ATOM   4977 O  "O4'" . DA  D 3  12  ? -44.456 55.898 -24.614 1.00 47.01  ? 12  DA  D "O4'" 1 
ATOM   4978 C  "C3'" . DA  D 3  12  ? -45.377 54.782 -26.433 1.00 46.88  ? 12  DA  D "C3'" 1 
ATOM   4979 O  "O3'" . DA  D 3  12  ? -44.374 55.121 -27.370 1.00 48.50  ? 12  DA  D "O3'" 1 
ATOM   4980 C  "C2'" . DA  D 3  12  ? -44.901 53.744 -25.410 1.00 45.90  ? 12  DA  D "C2'" 1 
ATOM   4981 C  "C1'" . DA  D 3  12  ? -43.937 54.573 -24.558 1.00 45.76  ? 12  DA  D "C1'" 1 
ATOM   4982 N  N9    . DA  D 3  12  ? -43.892 54.335 -23.119 1.00 44.06  ? 12  DA  D N9    1 
ATOM   4983 C  C8    . DA  D 3  12  ? -44.920 53.918 -22.337 1.00 44.17  ? 12  DA  D C8    1 
ATOM   4984 N  N7    . DA  D 3  12  ? -44.632 53.838 -21.064 1.00 44.28  ? 12  DA  D N7    1 
ATOM   4985 C  C5    . DA  D 3  12  ? -43.320 54.264 -20.991 1.00 43.27  ? 12  DA  D C5    1 
ATOM   4986 C  C6    . DA  D 3  12  ? -42.412 54.417 -19.904 1.00 41.56  ? 12  DA  D C6    1 
ATOM   4987 N  N6    . DA  D 3  12  ? -42.725 54.151 -18.630 1.00 38.30  ? 12  DA  D N6    1 
ATOM   4988 N  N1    . DA  D 3  12  ? -41.166 54.863 -20.185 1.00 40.48  ? 12  DA  D N1    1 
ATOM   4989 C  C2    . DA  D 3  12  ? -40.844 55.131 -21.451 1.00 39.80  ? 12  DA  D C2    1 
ATOM   4990 N  N3    . DA  D 3  12  ? -41.618 55.026 -22.537 1.00 42.96  ? 12  DA  D N3    1 
ATOM   4991 C  C4    . DA  D 3  12  ? -42.855 54.586 -22.252 1.00 43.25  ? 12  DA  D C4    1 
ATOM   4992 P  P     . DT  D 3  13  ? -43.981 54.210 -28.632 1.00 50.37  ? 13  DT  D P     1 
ATOM   4993 O  OP1   . DT  D 3  13  ? -43.596 55.247 -29.650 1.00 47.90  ? 13  DT  D OP1   1 
ATOM   4994 O  OP2   . DT  D 3  13  ? -45.000 53.149 -28.858 1.00 47.07  ? 13  DT  D OP2   1 
ATOM   4995 O  "O5'" . DT  D 3  13  ? -42.681 53.409 -28.118 1.00 47.11  ? 13  DT  D "O5'" 1 
ATOM   4996 C  "C5'" . DT  D 3  13  ? -41.575 54.148 -27.641 1.00 45.00  ? 13  DT  D "C5'" 1 
ATOM   4997 C  "C4'" . DT  D 3  13  ? -40.440 53.275 -27.155 1.00 42.98  ? 13  DT  D "C4'" 1 
ATOM   4998 O  "O4'" . DT  D 3  13  ? -40.574 53.141 -25.734 1.00 43.19  ? 13  DT  D "O4'" 1 
ATOM   4999 C  "C3'" . DT  D 3  13  ? -40.379 51.874 -27.729 1.00 42.72  ? 13  DT  D "C3'" 1 
ATOM   5000 O  "O3'" . DT  D 3  13  ? -39.092 51.717 -28.264 1.00 42.59  ? 13  DT  D "O3'" 1 
ATOM   5001 C  "C2'" . DT  D 3  13  ? -40.626 50.956 -26.533 1.00 43.22  ? 13  DT  D "C2'" 1 
ATOM   5002 C  "C1'" . DT  D 3  13  ? -40.187 51.839 -25.370 1.00 43.90  ? 13  DT  D "C1'" 1 
ATOM   5003 N  N1    . DT  D 3  13  ? -40.847 51.608 -24.046 1.00 43.66  ? 13  DT  D N1    1 
ATOM   5004 C  C2    . DT  D 3  13  ? -40.116 51.792 -22.871 1.00 43.77  ? 13  DT  D C2    1 
ATOM   5005 O  O2    . DT  D 3  13  ? -38.938 52.125 -22.831 1.00 41.93  ? 13  DT  D O2    1 
ATOM   5006 N  N3    . DT  D 3  13  ? -40.825 51.564 -21.714 1.00 43.83  ? 13  DT  D N3    1 
ATOM   5007 C  C4    . DT  D 3  13  ? -42.159 51.195 -21.610 1.00 44.09  ? 13  DT  D C4    1 
ATOM   5008 O  O4    . DT  D 3  13  ? -42.721 51.027 -20.539 1.00 42.96  ? 13  DT  D O4    1 
ATOM   5009 C  C5    . DT  D 3  13  ? -42.861 51.027 -22.861 1.00 45.17  ? 13  DT  D C5    1 
ATOM   5010 C  C7    . DT  D 3  13  ? -44.304 50.617 -22.841 1.00 43.89  ? 13  DT  D C7    1 
ATOM   5011 C  C6    . DT  D 3  13  ? -42.184 51.248 -24.009 1.00 44.20  ? 13  DT  D C6    1 
ATOM   5012 P  P     . DG  D 3  14  ? -38.703 50.474 -29.199 1.00 43.65  ? 14  DG  D P     1 
ATOM   5013 O  OP1   . DG  D 3  14  ? -37.795 50.942 -30.253 1.00 45.20  ? 14  DG  D OP1   1 
ATOM   5014 O  OP2   . DG  D 3  14  ? -39.921 49.730 -29.581 1.00 42.79  ? 14  DG  D OP2   1 
ATOM   5015 O  "O5'" . DG  D 3  14  ? -37.807 49.580 -28.236 1.00 42.95  ? 14  DG  D "O5'" 1 
ATOM   5016 C  "C5'" . DG  D 3  14  ? -36.921 50.183 -27.320 1.00 43.61  ? 14  DG  D "C5'" 1 
ATOM   5017 C  "C4'" . DG  D 3  14  ? -36.503 49.189 -26.263 1.00 44.33  ? 14  DG  D "C4'" 1 
ATOM   5018 O  "O4'" . DG  D 3  14  ? -37.509 49.126 -25.214 1.00 45.58  ? 14  DG  D "O4'" 1 
ATOM   5019 C  "C3'" . DG  D 3  14  ? -36.332 47.760 -26.729 1.00 45.31  ? 14  DG  D "C3'" 1 
ATOM   5020 O  "O3'" . DG  D 3  14  ? -35.207 47.275 -26.040 1.00 47.88  ? 14  DG  D "O3'" 1 
ATOM   5021 C  "C2'" . DG  D 3  14  ? -37.638 47.079 -26.272 1.00 45.25  ? 14  DG  D "C2'" 1 
ATOM   5022 C  "C1'" . DG  D 3  14  ? -37.838 47.772 -24.930 1.00 45.48  ? 14  DG  D "C1'" 1 
ATOM   5023 N  N9    . DG  D 3  14  ? -39.181 47.796 -24.337 1.00 45.09  ? 14  DG  D N9    1 
ATOM   5024 C  C8    . DG  D 3  14  ? -40.390 47.786 -24.983 1.00 42.58  ? 14  DG  D C8    1 
ATOM   5025 N  N7    . DG  D 3  14  ? -41.413 47.838 -24.177 1.00 41.76  ? 14  DG  D N7    1 
ATOM   5026 C  C5    . DG  D 3  14  ? -40.871 47.920 -22.905 1.00 44.40  ? 14  DG  D C5    1 
ATOM   5027 C  C6    . DG  D 3  14  ? -41.490 48.004 -21.618 1.00 44.92  ? 14  DG  D C6    1 
ATOM   5028 O  O6    . DG  D 3  14  ? -42.682 48.043 -21.318 1.00 44.70  ? 14  DG  D O6    1 
ATOM   5029 N  N1    . DG  D 3  14  ? -40.574 48.042 -20.571 1.00 45.53  ? 14  DG  D N1    1 
ATOM   5030 C  C2    . DG  D 3  14  ? -39.217 48.000 -20.753 1.00 45.01  ? 14  DG  D C2    1 
ATOM   5031 N  N2    . DG  D 3  14  ? -38.516 48.057 -19.629 1.00 44.91  ? 14  DG  D N2    1 
ATOM   5032 N  N3    . DG  D 3  14  ? -38.606 47.922 -21.939 1.00 45.69  ? 14  DG  D N3    1 
ATOM   5033 C  C4    . DG  D 3  14  ? -39.488 47.889 -22.983 1.00 45.61  ? 14  DG  D C4    1 
ATOM   5034 P  P     . DA  D 3  15  ? -34.346 46.062 -26.619 1.00 51.49  ? 15  DA  D P     1 
ATOM   5035 O  OP1   . DA  D 3  15  ? -33.116 46.679 -27.145 1.00 49.67  ? 15  DA  D OP1   1 
ATOM   5036 O  OP2   . DA  D 3  15  ? -35.216 45.180 -27.445 1.00 50.49  ? 15  DA  D OP2   1 
ATOM   5037 O  "O5'" . DA  D 3  15  ? -33.987 45.150 -25.356 1.00 49.90  ? 15  DA  D "O5'" 1 
ATOM   5038 C  "C5'" . DA  D 3  15  ? -33.310 45.616 -24.209 1.00 49.07  ? 15  DA  D "C5'" 1 
ATOM   5039 C  "C4'" . DA  D 3  15  ? -33.578 44.604 -23.106 1.00 47.89  ? 15  DA  D "C4'" 1 
ATOM   5040 O  "O4'" . DA  D 3  15  ? -34.923 44.861 -22.629 1.00 46.96  ? 15  DA  D "O4'" 1 
ATOM   5041 C  "C3'" . DA  D 3  15  ? -33.518 43.144 -23.547 1.00 46.58  ? 15  DA  D "C3'" 1 
ATOM   5042 O  "O3'" . DA  D 3  15  ? -32.937 42.309 -22.554 1.00 48.92  ? 15  DA  D "O3'" 1 
ATOM   5043 C  "C2'" . DA  D 3  15  ? -34.978 42.792 -23.754 1.00 46.32  ? 15  DA  D "C2'" 1 
ATOM   5044 C  "C1'" . DA  D 3  15  ? -35.668 43.661 -22.700 1.00 46.21  ? 15  DA  D "C1'" 1 
ATOM   5045 N  N9    . DA  D 3  15  ? -37.115 43.896 -22.914 1.00 45.11  ? 15  DA  D N9    1 
ATOM   5046 C  C8    . DA  D 3  15  ? -37.841 43.866 -24.081 1.00 44.13  ? 15  DA  D C8    1 
ATOM   5047 N  N7    . DA  D 3  15  ? -39.136 44.101 -23.939 1.00 43.17  ? 15  DA  D N7    1 
ATOM   5048 C  C5    . DA  D 3  15  ? -39.264 44.298 -22.579 1.00 43.76  ? 15  DA  D C5    1 
ATOM   5049 C  C6    . DA  D 3  15  ? -40.369 44.581 -21.756 1.00 43.67  ? 15  DA  D C6    1 
ATOM   5050 N  N6    . DA  D 3  15  ? -41.605 44.730 -22.214 1.00 42.02  ? 15  DA  D N6    1 
ATOM   5051 N  N1    . DA  D 3  15  ? -40.167 44.726 -20.433 1.00 43.69  ? 15  DA  D N1    1 
ATOM   5052 C  C2    . DA  D 3  15  ? -38.931 44.571 -19.962 1.00 43.78  ? 15  DA  D C2    1 
ATOM   5053 N  N3    . DA  D 3  15  ? -37.815 44.290 -20.628 1.00 44.55  ? 15  DA  D N3    1 
ATOM   5054 C  C4    . DA  D 3  15  ? -38.045 44.173 -21.940 1.00 44.53  ? 15  DA  D C4    1 
ATOM   5055 P  P     . DC  D 3  16  ? -32.339 40.857 -22.951 1.00 51.34  ? 16  DC  D P     1 
ATOM   5056 O  OP1   . DC  D 3  16  ? -30.898 41.063 -23.131 1.00 50.81  ? 16  DC  D OP1   1 
ATOM   5057 O  OP2   . DC  D 3  16  ? -33.158 40.256 -24.041 1.00 50.32  ? 16  DC  D OP2   1 
ATOM   5058 O  "O5'" . DC  D 3  16  ? -32.510 39.911 -21.651 1.00 50.87  ? 16  DC  D "O5'" 1 
ATOM   5059 C  "C5'" . DC  D 3  16  ? -32.318 40.408 -20.306 1.00 47.64  ? 16  DC  D "C5'" 1 
ATOM   5060 C  "C4'" . DC  D 3  16  ? -33.321 39.848 -19.309 1.00 45.07  ? 16  DC  D "C4'" 1 
ATOM   5061 O  "O4'" . DC  D 3  16  ? -34.546 40.583 -19.400 1.00 42.01  ? 16  DC  D "O4'" 1 
ATOM   5062 C  "C3'" . DC  D 3  16  ? -33.752 38.423 -19.555 1.00 45.76  ? 16  DC  D "C3'" 1 
ATOM   5063 O  "O3'" . DC  D 3  16  ? -32.885 37.650 -18.841 1.00 49.62  ? 16  DC  D "O3'" 1 
ATOM   5064 C  "C2'" . DC  D 3  16  ? -35.138 38.348 -18.939 1.00 42.89  ? 16  DC  D "C2'" 1 
ATOM   5065 C  "C1'" . DC  D 3  16  ? -35.614 39.794 -18.952 1.00 40.63  ? 16  DC  D "C1'" 1 
ATOM   5066 N  N1    . DC  D 3  16  ? -36.734 40.127 -19.872 1.00 38.34  ? 16  DC  D N1    1 
ATOM   5067 C  C2    . DC  D 3  16  ? -37.842 40.847 -19.384 1.00 38.34  ? 16  DC  D C2    1 
ATOM   5068 O  O2    . DC  D 3  16  ? -37.882 41.145 -18.191 1.00 40.15  ? 16  DC  D O2    1 
ATOM   5069 N  N3    . DC  D 3  16  ? -38.859 41.198 -20.228 1.00 38.20  ? 16  DC  D N3    1 
ATOM   5070 C  C4    . DC  D 3  16  ? -38.768 40.845 -21.524 1.00 37.45  ? 16  DC  D C4    1 
ATOM   5071 N  N4    . DC  D 3  16  ? -39.762 41.172 -22.317 1.00 34.70  ? 16  DC  D N4    1 
ATOM   5072 C  C5    . DC  D 3  16  ? -37.648 40.124 -22.058 1.00 37.53  ? 16  DC  D C5    1 
ATOM   5073 C  C6    . DC  D 3  16  ? -36.652 39.799 -21.205 1.00 37.55  ? 16  DC  D C6    1 
ATOM   5074 P  P     A DA  D 3  17  ? -32.118 36.370 -19.356 1.00 51.35  ? 17  DA  D P     1 
ATOM   5075 O  OP1   A DA  D 3  17  ? -32.762 35.312 -18.589 1.00 54.68  ? 17  DA  D OP1   1 
ATOM   5076 O  OP2   A DA  D 3  17  ? -30.699 36.527 -19.090 1.00 53.39  ? 17  DA  D OP2   1 
ATOM   5077 O  "O5'" A DA  D 3  17  ? -32.155 36.203 -20.942 1.00 60.51  ? 17  DA  D "O5'" 1 
ATOM   5078 C  "C5'" A DA  D 3  17  ? -33.206 36.539 -21.850 1.00 71.97  ? 17  DA  D "C5'" 1 
ATOM   5079 C  "C4'" A DA  D 3  17  ? -33.087 35.836 -23.205 1.00 79.14  ? 17  DA  D "C4'" 1 
ATOM   5080 O  "O4'" A DA  D 3  17  ? -32.234 34.658 -23.133 1.00 83.49  ? 17  DA  D "O4'" 1 
ATOM   5081 C  "C3'" A DA  D 3  17  ? -34.447 35.342 -23.695 1.00 82.24  ? 17  DA  D "C3'" 1 
ATOM   5082 O  "O3'" A DA  D 3  17  ? -34.866 36.069 -24.863 1.00 81.10  ? 17  DA  D "O3'" 1 
ATOM   5083 C  "C2'" A DA  D 3  17  ? -34.347 33.799 -23.820 1.00 85.04  ? 17  DA  D "C2'" 1 
ATOM   5084 C  "C1'" A DA  D 3  17  ? -32.973 33.424 -23.219 1.00 87.69  ? 17  DA  D "C1'" 1 
ATOM   5085 N  N9    A DA  D 3  17  ? -32.864 32.664 -21.925 1.00 91.85  ? 17  DA  D N9    1 
ATOM   5086 C  C8    A DA  D 3  17  ? -32.637 33.230 -20.696 1.00 93.45  ? 17  DA  D C8    1 
ATOM   5087 N  N7    A DA  D 3  17  ? -32.547 32.409 -19.669 1.00 94.08  ? 17  DA  D N7    1 
ATOM   5088 C  C5    A DA  D 3  17  ? -32.709 31.167 -20.235 1.00 94.29  ? 17  DA  D C5    1 
ATOM   5089 C  C6    A DA  D 3  17  ? -32.705 29.873 -19.648 1.00 95.10  ? 17  DA  D C6    1 
ATOM   5090 N  N6    A DA  D 3  17  ? -32.526 29.657 -18.334 1.00 94.80  ? 17  DA  D N6    1 
ATOM   5091 N  N1    A DA  D 3  17  ? -32.887 28.811 -20.471 1.00 95.88  ? 17  DA  D N1    1 
ATOM   5092 C  C2    A DA  D 3  17  ? -33.056 29.057 -21.786 1.00 96.49  ? 17  DA  D C2    1 
ATOM   5093 N  N3    A DA  D 3  17  ? -33.078 30.236 -22.451 1.00 96.03  ? 17  DA  D N3    1 
ATOM   5094 C  C4    A DA  D 3  17  ? -32.896 31.290 -21.621 1.00 94.11  ? 17  DA  D C4    1 
HETATM 5095 ZN ZN    . ZN  E 4  .   ? -55.150 23.311 -46.315 1.00 44.30  ? 393 ZN  A ZN    1 
HETATM 5096 S  S     . SO4 F 5  .   ? -50.609 17.106 -31.982 1.00 72.02  ? 394 SO4 A S     1 
HETATM 5097 O  O1    . SO4 F 5  .   ? -49.210 17.169 -31.562 1.00 70.67  ? 394 SO4 A O1    1 
HETATM 5098 O  O2    . SO4 F 5  .   ? -51.069 15.725 -32.009 1.00 74.02  ? 394 SO4 A O2    1 
HETATM 5099 O  O3    . SO4 F 5  .   ? -51.470 17.853 -31.070 1.00 72.62  ? 394 SO4 A O3    1 
HETATM 5100 O  O4    . SO4 F 5  .   ? -50.770 17.634 -33.339 1.00 73.28  ? 394 SO4 A O4    1 
HETATM 5101 C  C1    . GOL G 6  .   ? -28.718 17.710 -10.602 1.00 88.78  ? 801 GOL A C1    1 
HETATM 5102 O  O1    . GOL G 6  .   ? -28.113 17.445 -9.354  1.00 87.37  ? 801 GOL A O1    1 
HETATM 5103 C  C2    . GOL G 6  .   ? -30.068 18.382 -10.342 1.00 89.56  ? 801 GOL A C2    1 
HETATM 5104 O  O2    . GOL G 6  .   ? -30.572 17.948 -9.091  1.00 89.44  ? 801 GOL A O2    1 
HETATM 5105 C  C3    . GOL G 6  .   ? -31.063 18.161 -11.494 1.00 89.02  ? 801 GOL A C3    1 
HETATM 5106 O  O3    . GOL G 6  .   ? -32.264 18.888 -11.305 1.00 87.28  ? 801 GOL A O3    1 
HETATM 5107 C  C1    . GOL H 6  .   ? -12.014 34.719 -12.666 1.00 81.09  ? 802 GOL A C1    1 
HETATM 5108 O  O1    . GOL H 6  .   ? -13.039 35.508 -13.178 1.00 77.79  ? 802 GOL A O1    1 
HETATM 5109 C  C2    . GOL H 6  .   ? -12.406 33.290 -12.976 1.00 84.12  ? 802 GOL A C2    1 
HETATM 5110 O  O2    . GOL H 6  .   ? -11.389 32.431 -12.523 1.00 85.86  ? 802 GOL A O2    1 
HETATM 5111 C  C3    . GOL H 6  .   ? -12.544 33.082 -14.484 1.00 86.94  ? 802 GOL A C3    1 
HETATM 5112 O  O3    . GOL H 6  .   ? -12.861 31.726 -14.781 1.00 87.61  ? 802 GOL A O3    1 
HETATM 5113 C  C1    . GOL I 6  .   ? -61.134 20.920 -61.669 1.00 77.28  ? 805 GOL A C1    1 
HETATM 5114 O  O1    . GOL I 6  .   ? -62.541 20.838 -61.624 1.00 75.92  ? 805 GOL A O1    1 
HETATM 5115 C  C2    . GOL I 6  .   ? -60.745 21.749 -62.881 1.00 77.21  ? 805 GOL A C2    1 
HETATM 5116 O  O2    . GOL I 6  .   ? -61.279 21.104 -64.010 1.00 78.47  ? 805 GOL A O2    1 
HETATM 5117 C  C3    . GOL I 6  .   ? -59.229 21.838 -63.029 1.00 76.56  ? 805 GOL A C3    1 
HETATM 5118 O  O3    . GOL I 6  .   ? -58.942 22.956 -63.839 1.00 74.89  ? 805 GOL A O3    1 
HETATM 5119 N  N     . NH4 J 7  .   ? -54.701 39.452 -8.043  1.00 33.01  ? 395 NH4 A N     1 
HETATM 5120 MG MG    . MG  K 8  .   ? -36.286 30.272 -15.946 1.00 38.40  ? 396 MG  A MG    1 
HETATM 5121 MG MG    . MG  L 8  .   ? -35.946 33.943 -16.964 1.00 35.95  ? 397 MG  A MG    1 
HETATM 5122 C  CAA   . RLT M 9  .   ? -41.965 23.676 -19.541 1.00 57.66  ? 398 RLT A CAA   1 
HETATM 5123 C  CAB   . RLT M 9  .   ? -36.936 27.759 -19.638 1.00 42.38  ? 398 RLT A CAB   1 
HETATM 5124 C  CAC   . RLT M 9  .   ? -38.644 30.211 -22.994 1.00 39.15  ? 398 RLT A CAC   1 
HETATM 5125 C  CAD   . RLT M 9  .   ? -36.448 28.947 -23.079 1.00 38.33  ? 398 RLT A CAD   1 
HETATM 5126 O  OAE   . RLT M 9  .   ? -36.229 34.125 -18.968 1.00 37.55  ? 398 RLT A OAE   1 
HETATM 5127 O  OAF   . RLT M 9  .   ? -40.005 28.941 -20.412 1.00 52.45  ? 398 RLT A OAF   1 
HETATM 5128 O  OAG   . RLT M 9  .   ? -36.346 29.303 -17.505 1.00 39.74  ? 398 RLT A OAG   1 
HETATM 5129 O  OAH   . RLT M 9  .   ? -36.291 31.991 -17.408 1.00 38.83  ? 398 RLT A OAH   1 
HETATM 5130 F  FAI   . RLT M 9  .   ? -41.208 38.736 -20.549 1.00 35.05  ? 398 RLT A FAI   1 
HETATM 5131 C  CAJ   . RLT M 9  .   ? -39.262 37.689 -19.692 1.00 30.19  ? 398 RLT A CAJ   1 
HETATM 5132 C  CAK   . RLT M 9  .   ? -39.937 37.354 -21.997 1.00 28.87  ? 398 RLT A CAK   1 
HETATM 5133 C  CAL   . RLT M 9  .   ? -38.178 36.846 -19.914 1.00 30.86  ? 398 RLT A CAL   1 
HETATM 5134 C  CAM   . RLT M 9  .   ? -38.856 36.519 -22.233 1.00 26.15  ? 398 RLT A CAM   1 
HETATM 5135 C  CAN   . RLT M 9  .   ? -36.798 35.376 -21.431 1.00 30.14  ? 398 RLT A CAN   1 
HETATM 5136 N  NAO   . RLT M 9  .   ? -39.757 24.461 -20.455 1.00 55.96  ? 398 RLT A NAO   1 
HETATM 5137 N  NAP   . RLT M 9  .   ? -39.171 25.497 -20.793 1.00 55.40  ? 398 RLT A NAP   1 
HETATM 5138 N  NAQ   . RLT M 9  .   ? -37.276 31.313 -20.870 1.00 39.80  ? 398 RLT A NAQ   1 
HETATM 5139 N  NAR   . RLT M 9  .   ? -37.037 33.985 -21.075 1.00 35.48  ? 398 RLT A NAR   1 
HETATM 5140 N  NAS   . RLT M 9  .   ? -38.431 28.027 -21.812 1.00 46.19  ? 398 RLT A NAS   1 
HETATM 5141 O  OAT   . RLT M 9  .   ? -41.182 26.153 -20.099 1.00 52.90  ? 398 RLT A OAT   1 
HETATM 5142 C  CAU   . RLT M 9  .   ? -36.844 33.508 -19.843 1.00 38.32  ? 398 RLT A CAU   1 
HETATM 5143 C  CAV   . RLT M 9  .   ? -39.486 27.969 -20.958 1.00 50.14  ? 398 RLT A CAV   1 
HETATM 5144 C  CAW   . RLT M 9  .   ? -40.979 24.779 -20.026 1.00 56.04  ? 398 RLT A CAW   1 
HETATM 5145 C  CAX   . RLT M 9  .   ? -40.147 37.923 -20.740 1.00 30.75  ? 398 RLT A CAX   1 
HETATM 5146 C  CAY   . RLT M 9  .   ? -37.992 36.261 -21.184 1.00 30.00  ? 398 RLT A CAY   1 
HETATM 5147 C  CAZ   . RLT M 9  .   ? -36.618 31.318 -18.560 1.00 40.43  ? 398 RLT A CAZ   1 
HETATM 5148 C  CBA   . RLT M 9  .   ? -39.971 26.550 -20.621 1.00 52.81  ? 398 RLT A CBA   1 
HETATM 5149 C  CBB   . RLT M 9  .   ? -36.956 31.989 -19.750 1.00 39.95  ? 398 RLT A CBB   1 
HETATM 5150 C  CBC   . RLT M 9  .   ? -37.279 29.973 -20.908 1.00 41.25  ? 398 RLT A CBC   1 
HETATM 5151 C  CBD   . RLT M 9  .   ? -36.630 29.926 -18.540 1.00 41.26  ? 398 RLT A CBD   1 
HETATM 5152 N  NBE   . RLT M 9  .   ? -36.950 29.241 -19.723 1.00 41.57  ? 398 RLT A NBE   1 
HETATM 5153 C  CBF   . RLT M 9  .   ? -37.695 29.275 -22.226 1.00 42.54  ? 398 RLT A CBF   1 
HETATM 5154 S  S     . SO4 N 5  .   ? -34.856 40.963 26.186  1.00 84.10  ? 393 SO4 B S     1 
HETATM 5155 O  O1    . SO4 N 5  .   ? -35.308 40.667 24.826  1.00 85.23  ? 393 SO4 B O1    1 
HETATM 5156 O  O2    . SO4 N 5  .   ? -35.955 40.685 27.107  1.00 85.58  ? 393 SO4 B O2    1 
HETATM 5157 O  O3    . SO4 N 5  .   ? -33.755 40.072 26.553  1.00 85.19  ? 393 SO4 B O3    1 
HETATM 5158 O  O4    . SO4 N 5  .   ? -34.442 42.363 26.264  1.00 83.08  ? 393 SO4 B O4    1 
HETATM 5159 C  C1    . GOL O 6  .   ? -45.119 43.556 14.165  1.00 69.75  ? 803 GOL B C1    1 
HETATM 5160 O  O1    . GOL O 6  .   ? -46.396 42.984 13.920  1.00 68.40  ? 803 GOL B O1    1 
HETATM 5161 C  C2    . GOL O 6  .   ? -45.316 45.023 14.542  1.00 70.07  ? 803 GOL B C2    1 
HETATM 5162 O  O2    . GOL O 6  .   ? -45.804 45.723 13.429  1.00 72.66  ? 803 GOL B O2    1 
HETATM 5163 C  C3    . GOL O 6  .   ? -44.068 45.731 15.052  1.00 69.37  ? 803 GOL B C3    1 
HETATM 5164 O  O3    . GOL O 6  .   ? -44.396 47.077 15.354  1.00 67.48  ? 803 GOL B O3    1 
HETATM 5165 MG MG    . MG  P 8  .   ? -14.579 36.646 21.568  1.00 83.50  ? 394 MG  B MG    1 
HETATM 5166 O  O     . HOH Q 10 .   ? -29.941 33.596 -18.953 1.00 38.99  ? 399 HOH A O     1 
HETATM 5167 O  O     . HOH Q 10 .   ? -33.901 33.617 -17.017 1.00 31.78  ? 400 HOH A O     1 
HETATM 5168 O  O     . HOH Q 10 .   ? -35.724 28.590 -14.637 1.00 29.17  ? 401 HOH A O     1 
HETATM 5169 O  O     . HOH Q 10 .   ? -27.672 34.284 -20.534 1.00 55.15  ? 402 HOH A O     1 
HETATM 5170 O  O     . HOH Q 10 .   ? -43.575 39.069 -1.043  1.00 38.54  ? 403 HOH A O     1 
HETATM 5171 O  O     . HOH Q 10 .   ? -44.737 37.220 4.801   1.00 44.43  ? 404 HOH A O     1 
HETATM 5172 O  O     . HOH Q 10 .   ? -28.815 44.425 -0.223  1.00 35.82  ? 405 HOH A O     1 
HETATM 5173 O  O     . HOH Q 10 .   ? -29.022 50.290 3.140   1.00 38.71  ? 406 HOH A O     1 
HETATM 5174 O  O     . HOH Q 10 .   ? -33.153 44.409 -6.004  1.00 43.53  ? 407 HOH A O     1 
HETATM 5175 O  O     . HOH Q 10 .   ? -43.997 37.881 -11.919 1.00 34.54  ? 408 HOH A O     1 
HETATM 5176 O  O     . HOH Q 10 .   ? -48.267 45.710 -0.873  1.00 59.76  ? 409 HOH A O     1 
HETATM 5177 O  O     . HOH Q 10 .   ? -46.226 44.366 -8.229  1.00 30.16  ? 410 HOH A O     1 
HETATM 5178 O  O     . HOH Q 10 .   ? -20.425 35.717 -4.911  1.00 57.48  ? 411 HOH A O     1 
HETATM 5179 O  O     . HOH Q 10 .   ? -26.810 36.832 -1.197  1.00 63.65  ? 412 HOH A O     1 
HETATM 5180 O  O     . HOH Q 10 .   ? -23.555 24.702 -7.103  1.00 37.98  ? 413 HOH A O     1 
HETATM 5181 O  O     . HOH Q 10 .   ? -41.560 20.496 -7.487  1.00 41.73  ? 414 HOH A O     1 
HETATM 5182 O  O     . HOH Q 10 .   ? -44.574 20.528 -34.919 1.00 46.70  ? 415 HOH A O     1 
HETATM 5183 O  O     . HOH Q 10 .   ? -41.961 19.976 -34.351 1.00 58.49  ? 416 HOH A O     1 
HETATM 5184 O  O     . HOH Q 10 .   ? -32.339 46.564 -17.045 1.00 52.41  ? 417 HOH A O     1 
HETATM 5185 O  O     . HOH Q 10 .   ? -50.727 47.567 -17.180 1.00 48.11  ? 418 HOH A O     1 
HETATM 5186 O  O     . HOH Q 10 .   ? -34.543 26.124 6.404   1.00 47.12  ? 419 HOH A O     1 
HETATM 5187 O  O     . HOH Q 10 .   ? -61.453 38.515 -53.240 1.00 45.50  ? 420 HOH A O     1 
HETATM 5188 O  O     . HOH Q 10 .   ? -60.292 47.412 -23.755 1.00 47.94  ? 421 HOH A O     1 
HETATM 5189 O  O     . HOH Q 10 .   ? -36.589 14.739 -7.864  1.00 59.04  ? 422 HOH A O     1 
HETATM 5190 O  O     . HOH Q 10 .   ? -38.362 14.632 -9.994  1.00 66.22  ? 423 HOH A O     1 
HETATM 5191 O  O     . HOH Q 10 .   ? -31.343 49.477 -12.563 1.00 41.83  ? 424 HOH A O     1 
HETATM 5192 O  O     . HOH Q 10 .   ? -47.976 48.126 -5.728  1.00 61.40  ? 425 HOH A O     1 
HETATM 5193 O  O     . HOH Q 10 .   ? -33.883 57.704 8.915   1.00 59.13  ? 426 HOH A O     1 
HETATM 5194 O  O     . HOH Q 10 .   ? -38.852 25.922 -40.461 1.00 44.39  ? 427 HOH A O     1 
HETATM 5195 O  O     . HOH Q 10 .   ? -36.537 53.271 18.491  1.00 44.59  ? 428 HOH A O     1 
HETATM 5196 O  O     . HOH Q 10 .   ? -48.933 19.426 -34.851 1.00 48.93  ? 429 HOH A O     1 
HETATM 5197 O  O     . HOH Q 10 .   ? -53.680 21.814 -28.596 1.00 47.69  ? 430 HOH A O     1 
HETATM 5198 O  O     . HOH Q 10 .   ? -34.123 34.342 10.923  1.00 36.15  ? 431 HOH A O     1 
HETATM 5199 O  O     . HOH Q 10 .   ? -61.668 34.693 -60.492 1.00 55.41  ? 432 HOH A O     1 
HETATM 5200 O  O     . HOH Q 10 .   ? -46.699 26.231 -38.718 1.00 33.51  ? 433 HOH A O     1 
HETATM 5201 O  O     . HOH Q 10 .   ? -39.315 31.716 -12.775 1.00 43.44  ? 434 HOH A O     1 
HETATM 5202 O  O     . HOH Q 10 .   ? -42.192 32.215 -15.981 1.00 63.40  ? 435 HOH A O     1 
HETATM 5203 O  O     . HOH Q 10 .   ? -47.461 39.624 -22.812 1.00 67.29  ? 436 HOH A O     1 
HETATM 5204 O  O     . HOH Q 10 .   ? -51.661 43.372 -22.969 1.00 39.76  ? 437 HOH A O     1 
HETATM 5205 O  O     . HOH Q 10 .   ? -57.409 39.829 -20.663 1.00 46.79  ? 438 HOH A O     1 
HETATM 5206 O  O     . HOH Q 10 .   ? -58.027 37.724 -22.273 1.00 49.94  ? 439 HOH A O     1 
HETATM 5207 O  O     . HOH Q 10 .   ? -64.435 26.721 -30.766 1.00 51.43  ? 440 HOH A O     1 
HETATM 5208 O  O     . HOH Q 10 .   ? -30.015 20.349 -14.060 1.00 58.78  ? 441 HOH A O     1 
HETATM 5209 O  O     . HOH Q 10 .   ? -31.602 16.676 -6.442  1.00 69.68  ? 442 HOH A O     1 
HETATM 5210 O  O     . HOH Q 10 .   ? -31.033 55.179 -6.686  1.00 30.30  ? 443 HOH A O     1 
HETATM 5211 O  O     . HOH Q 10 .   ? -29.002 53.499 -6.452  1.00 29.81  ? 444 HOH A O     1 
HETATM 5212 O  O     . HOH Q 10 .   ? -27.742 51.654 -4.733  1.00 33.62  ? 445 HOH A O     1 
HETATM 5213 O  O     . HOH Q 10 .   ? -52.052 18.343 -49.756 1.00 44.59  ? 446 HOH A O     1 
HETATM 5214 O  O     . HOH Q 10 .   ? -56.661 19.716 -47.629 1.00 52.06  ? 447 HOH A O     1 
HETATM 5215 O  O     . HOH Q 10 .   ? -54.662 18.328 -43.848 1.00 47.49  ? 448 HOH A O     1 
HETATM 5216 O  O     . HOH Q 10 .   ? -57.272 17.601 -43.754 1.00 54.29  ? 449 HOH A O     1 
HETATM 5217 O  O     . HOH Q 10 .   ? -15.982 46.010 -23.258 1.00 53.59  ? 450 HOH A O     1 
HETATM 5218 O  O     . HOH Q 10 .   ? -44.420 18.948 -41.754 1.00 59.88  ? 451 HOH A O     1 
HETATM 5219 O  O     . HOH Q 10 .   ? -44.352 27.123 -40.329 1.00 44.23  ? 452 HOH A O     1 
HETATM 5220 O  O     . HOH Q 10 .   ? -42.701 28.900 -40.951 1.00 44.37  ? 453 HOH A O     1 
HETATM 5221 O  O     . HOH Q 10 .   ? -47.565 29.941 -38.962 1.00 43.73  ? 454 HOH A O     1 
HETATM 5222 O  O     . HOH Q 10 .   ? -41.690 49.645 -9.199  1.00 41.30  ? 455 HOH A O     1 
HETATM 5223 O  O     . HOH Q 10 .   ? -39.331 32.124 -16.486 1.00 65.45  ? 456 HOH A O     1 
HETATM 5224 O  O     . HOH Q 10 .   ? -33.324 24.082 -14.194 1.00 42.18  ? 457 HOH A O     1 
HETATM 5225 O  O     . HOH Q 10 .   ? -25.040 21.695 -8.903  1.00 64.83  ? 458 HOH A O     1 
HETATM 5226 O  O     . HOH Q 10 .   ? -24.640 22.315 -6.085  1.00 68.45  ? 459 HOH A O     1 
HETATM 5227 O  O     . HOH Q 10 .   ? -16.398 25.888 -5.958  1.00 71.64  ? 460 HOH A O     1 
HETATM 5228 O  O     . HOH Q 10 .   ? -46.606 49.638 -16.436 1.00 33.43  ? 461 HOH A O     1 
HETATM 5229 O  O     . HOH Q 10 .   ? -58.115 19.928 -59.928 1.00 60.02  ? 462 HOH A O     1 
HETATM 5230 O  O     . HOH Q 10 .   ? -46.534 16.540 -32.744 1.00 61.97  ? 463 HOH A O     1 
HETATM 5231 O  O     . HOH Q 10 .   ? -48.200 36.820 -10.520 1.00 32.59  ? 464 HOH A O     1 
HETATM 5232 O  O     . HOH Q 10 .   ? -33.400 57.304 14.667  1.00 54.44  ? 465 HOH A O     1 
HETATM 5233 O  O     . HOH Q 10 .   ? -33.594 55.642 6.068   1.00 56.40  ? 466 HOH A O     1 
HETATM 5234 O  O     . HOH Q 10 .   ? -31.845 52.144 0.098   1.00 43.29  ? 467 HOH A O     1 
HETATM 5235 O  O     . HOH Q 10 .   ? -48.213 26.374 -23.476 1.00 50.75  ? 468 HOH A O     1 
HETATM 5236 O  O     . HOH Q 10 .   ? -48.700 28.225 -21.578 1.00 53.08  ? 469 HOH A O     1 
HETATM 5237 O  O     . HOH Q 10 .   ? -50.917 33.739 -19.385 1.00 51.22  ? 470 HOH A O     1 
HETATM 5238 O  O     . HOH Q 10 .   ? -48.829 37.066 -7.880  1.00 43.41  ? 471 HOH A O     1 
HETATM 5239 O  O     . HOH Q 10 .   ? -40.302 59.891 -10.069 1.00 41.34  ? 472 HOH A O     1 
HETATM 5240 O  O     . HOH Q 10 .   ? -39.272 47.192 -5.535  1.00 36.14  ? 473 HOH A O     1 
HETATM 5241 O  O     . HOH Q 10 .   ? -36.164 49.870 -7.324  1.00 42.97  ? 474 HOH A O     1 
HETATM 5242 O  O     . HOH Q 10 .   ? -27.330 49.957 -14.512 1.00 38.16  ? 475 HOH A O     1 
HETATM 5243 O  O     . HOH Q 10 .   ? -29.116 47.858 -13.962 1.00 47.70  ? 476 HOH A O     1 
HETATM 5244 O  O     . HOH Q 10 .   ? -50.137 38.658 3.796   1.00 55.02  ? 477 HOH A O     1 
HETATM 5245 O  O     . HOH Q 10 .   ? -37.881 45.594 -7.708  1.00 45.04  ? 478 HOH A O     1 
HETATM 5246 O  O     . HOH Q 10 .   ? -92.029 28.586 -61.773 1.00 59.70  ? 479 HOH A O     1 
HETATM 5247 O  O     . HOH Q 10 .   ? -42.096 21.562 -28.612 1.00 47.57  ? 480 HOH A O     1 
HETATM 5248 O  O     . HOH Q 10 .   ? -45.064 21.668 -27.447 1.00 55.47  ? 481 HOH A O     1 
HETATM 5249 O  O     . HOH Q 10 .   ? -50.314 22.010 -16.874 1.00 52.43  ? 482 HOH A O     1 
HETATM 5250 O  O     . HOH Q 10 .   ? -48.868 24.308 -16.177 1.00 52.47  ? 483 HOH A O     1 
HETATM 5251 O  O     . HOH Q 10 .   ? -43.564 34.423 -23.952 1.00 54.30  ? 484 HOH A O     1 
HETATM 5252 O  O     . HOH Q 10 .   ? -45.355 33.032 -25.335 1.00 48.18  ? 485 HOH A O     1 
HETATM 5253 O  O     . HOH Q 10 .   ? -24.055 37.580 -3.595  1.00 50.97  ? 486 HOH A O     1 
HETATM 5254 O  O     . HOH Q 10 .   ? -52.471 49.932 -4.293  1.00 70.45  ? 487 HOH A O     1 
HETATM 5255 O  O     . HOH Q 10 .   ? -53.101 53.197 -4.045  1.00 61.58  ? 488 HOH A O     1 
HETATM 5256 O  O     . HOH Q 10 .   ? -54.941 26.997 -53.730 1.00 36.03  ? 489 HOH A O     1 
HETATM 5257 O  O     . HOH Q 10 .   ? -64.038 30.439 -35.514 1.00 58.59  ? 490 HOH A O     1 
HETATM 5258 O  O     . HOH Q 10 .   ? -52.374 53.185 -13.870 1.00 63.50  ? 491 HOH A O     1 
HETATM 5259 O  O     . HOH Q 10 .   ? -49.960 38.806 -0.106  1.00 50.11  ? 492 HOH A O     1 
HETATM 5260 O  O     . HOH Q 10 .   ? -36.326 45.604 -11.524 1.00 57.89  ? 493 HOH A O     1 
HETATM 5261 O  O     . HOH Q 10 .   ? -56.654 40.765 -37.622 1.00 40.46  ? 494 HOH A O     1 
HETATM 5262 O  O     . HOH Q 10 .   ? -55.309 42.839 -26.074 1.00 35.63  ? 495 HOH A O     1 
HETATM 5263 O  O     . HOH Q 10 .   ? -49.608 32.970 -34.998 1.00 39.14  ? 496 HOH A O     1 
HETATM 5264 O  O     . HOH Q 10 .   ? -46.138 54.730 -5.707  1.00 52.09  ? 497 HOH A O     1 
HETATM 5265 O  O     . HOH Q 10 .   ? -42.266 30.098 -18.408 1.00 59.18  ? 498 HOH A O     1 
HETATM 5266 O  O     . HOH Q 10 .   ? -27.072 53.652 -0.790  1.00 42.87  ? 499 HOH A O     1 
HETATM 5267 O  O     . HOH Q 10 .   ? -71.540 32.283 -54.694 1.00 42.88  ? 500 HOH A O     1 
HETATM 5268 O  O     . HOH Q 10 .   ? -33.002 62.166 4.049   1.00 54.58  ? 501 HOH A O     1 
HETATM 5269 O  O     . HOH Q 10 .   ? -65.575 22.629 -41.311 1.00 64.03  ? 502 HOH A O     1 
HETATM 5270 O  O     . HOH Q 10 .   ? -64.006 35.765 -64.069 1.00 60.72  ? 503 HOH A O     1 
HETATM 5271 O  O     . HOH Q 10 .   ? -32.971 48.389 -10.475 1.00 33.65  ? 504 HOH A O     1 
HETATM 5272 O  O     . HOH Q 10 .   ? -36.928 57.550 1.438   1.00 57.40  ? 505 HOH A O     1 
HETATM 5273 O  O     . HOH Q 10 .   ? -38.100 55.104 4.168   1.00 46.99  ? 506 HOH A O     1 
HETATM 5274 O  O     . HOH Q 10 .   ? -34.928 21.464 -36.981 1.00 57.93  ? 507 HOH A O     1 
HETATM 5275 O  O     . HOH Q 10 .   ? -21.888 32.384 -22.691 1.00 50.27  ? 508 HOH A O     1 
HETATM 5276 O  O     . HOH Q 10 .   ? -49.936 48.758 -3.060  1.00 74.08  ? 509 HOH A O     1 
HETATM 5277 O  O     . HOH Q 10 .   ? -45.326 55.811 -3.467  1.00 44.78  ? 510 HOH A O     1 
HETATM 5278 O  O     . HOH Q 10 .   ? -62.330 28.787 -31.665 1.00 48.76  ? 511 HOH A O     1 
HETATM 5279 O  O     . HOH Q 10 .   ? -58.481 18.865 -36.561 1.00 65.56  ? 512 HOH A O     1 
HETATM 5280 O  O     . HOH Q 10 .   ? -61.237 19.841 -36.975 1.00 64.65  ? 513 HOH A O     1 
HETATM 5281 O  O     . HOH Q 10 .   ? -50.973 37.861 -28.905 1.00 47.13  ? 514 HOH A O     1 
HETATM 5282 O  O     . HOH Q 10 .   ? -40.980 29.413 -36.477 1.00 47.00  ? 515 HOH A O     1 
HETATM 5283 O  O     . HOH Q 10 .   ? -52.211 53.021 -7.848  1.00 42.49  ? 516 HOH A O     1 
HETATM 5284 O  O     . HOH Q 10 .   ? -27.804 35.922 1.956   1.00 60.63  ? 517 HOH A O     1 
HETATM 5285 O  O     . HOH Q 10 .   ? -54.964 47.412 -32.438 1.00 61.25  ? 518 HOH A O     1 
HETATM 5286 O  O     . HOH Q 10 .   ? -34.008 47.464 -7.857  1.00 43.75  ? 519 HOH A O     1 
HETATM 5287 O  O     . HOH Q 10 .   ? -21.158 52.577 3.912   1.00 58.44  ? 520 HOH A O     1 
HETATM 5288 O  O     . HOH Q 10 .   ? -47.533 50.995 -15.523 1.00 48.09  ? 521 HOH A O     1 
HETATM 5289 O  O     . HOH Q 10 .   ? -50.874 34.117 -4.497  1.00 62.56  ? 522 HOH A O     1 
HETATM 5290 O  O     . HOH Q 10 .   ? -35.410 17.645 0.572   1.00 67.72  ? 523 HOH A O     1 
HETATM 5291 O  O     . HOH Q 10 .   ? -47.657 21.468 -16.538 1.00 48.95  ? 524 HOH A O     1 
HETATM 5292 O  O     . HOH Q 10 .   ? -57.072 27.477 -36.361 1.00 46.60  ? 525 HOH A O     1 
HETATM 5293 O  O     . HOH Q 10 .   ? -63.092 39.579 -55.115 1.00 43.48  ? 526 HOH A O     1 
HETATM 5294 O  O     . HOH Q 10 .   ? -25.870 51.732 -2.567  1.00 34.08  ? 527 HOH A O     1 
HETATM 5295 O  O     . HOH Q 10 .   ? -24.642 50.200 -2.230  1.00 50.15  ? 528 HOH A O     1 
HETATM 5296 O  O     . HOH Q 10 .   ? -22.964 50.470 -3.371  1.00 41.98  ? 529 HOH A O     1 
HETATM 5297 O  O     . HOH Q 10 .   ? -46.453 46.046 6.685   1.00 49.28  ? 530 HOH A O     1 
HETATM 5298 O  O     . HOH Q 10 .   ? -47.816 34.919 -12.511 1.00 53.28  ? 531 HOH A O     1 
HETATM 5299 O  O     . HOH Q 10 .   ? -68.821 33.533 -55.344 1.00 41.63  ? 532 HOH A O     1 
HETATM 5300 O  O     . HOH Q 10 .   ? -26.029 36.747 -22.017 1.00 39.17  ? 533 HOH A O     1 
HETATM 5301 O  O     . HOH Q 10 .   ? -34.279 30.103 -16.318 1.00 32.92  ? 534 HOH A O     1 
HETATM 5302 O  O     . HOH Q 10 .   ? -64.229 38.185 -56.661 1.00 43.14  ? 535 HOH A O     1 
HETATM 5303 O  O     . HOH Q 10 .   ? -21.007 55.706 3.620   1.00 54.08  ? 536 HOH A O     1 
HETATM 5304 O  O     . HOH Q 10 .   ? -68.933 34.701 -57.403 1.00 46.79  ? 537 HOH A O     1 
HETATM 5305 O  O     . HOH Q 10 .   ? -44.437 30.933 -41.757 1.00 44.62  ? 538 HOH A O     1 
HETATM 5306 O  O     . HOH Q 10 .   ? -44.021 19.475 -28.276 1.00 63.26  ? 539 HOH A O     1 
HETATM 5307 O  O     . HOH R 10 .   ? -14.982 34.563 20.859  1.00 63.06  ? 395 HOH B O     1 
HETATM 5308 O  O     . HOH R 10 .   ? -15.425 36.139 23.569  1.00 86.50  ? 396 HOH B O     1 
HETATM 5309 O  O     . HOH R 10 .   ? -48.024 41.407 9.971   1.00 51.27  ? 397 HOH B O     1 
HETATM 5310 O  O     . HOH R 10 .   ? -44.296 38.972 20.182  1.00 56.12  ? 398 HOH B O     1 
HETATM 5311 O  O     . HOH R 10 .   ? -32.134 36.744 17.587  1.00 48.81  ? 399 HOH B O     1 
HETATM 5312 O  O     . HOH R 10 .   ? -28.581 48.364 15.873  1.00 39.79  ? 400 HOH B O     1 
HETATM 5313 O  O     . HOH R 10 .   ? -29.538 46.683 1.481   1.00 40.89  ? 401 HOH B O     1 
HETATM 5314 O  O     . HOH R 10 .   ? -13.722 30.238 6.973   1.00 50.39  ? 402 HOH B O     1 
HETATM 5315 O  O     . HOH R 10 .   ? -34.082 54.199 21.738  1.00 55.91  ? 403 HOH B O     1 
HETATM 5316 O  O     . HOH R 10 .   ? -41.345 34.387 7.950   1.00 34.66  ? 404 HOH B O     1 
HETATM 5317 O  O     . HOH R 10 .   ? -37.711 35.105 10.383  1.00 44.28  ? 405 HOH B O     1 
HETATM 5318 O  O     . HOH R 10 .   ? -28.767 47.772 28.897  1.00 51.35  ? 406 HOH B O     1 
HETATM 5319 O  O     . HOH R 10 .   ? -30.370 46.403 27.409  1.00 62.17  ? 407 HOH B O     1 
HETATM 5320 O  O     . HOH R 10 .   ? -31.139 45.458 30.729  1.00 54.74  ? 408 HOH B O     1 
HETATM 5321 O  O     . HOH R 10 .   ? -16.626 39.825 20.716  1.00 46.68  ? 409 HOH B O     1 
HETATM 5322 O  O     . HOH R 10 .   ? -39.528 33.237 9.193   1.00 39.61  ? 410 HOH B O     1 
HETATM 5323 O  O     . HOH R 10 .   ? -16.148 17.926 9.042   1.00 70.88  ? 411 HOH B O     1 
HETATM 5324 O  O     . HOH R 10 .   ? -15.206 47.921 28.254  1.00 71.32  ? 412 HOH B O     1 
HETATM 5325 O  O     . HOH R 10 .   ? -13.067 52.933 13.670  1.00 52.39  ? 413 HOH B O     1 
HETATM 5326 O  O     . HOH R 10 .   ? -23.267 37.802 -1.235  1.00 60.47  ? 414 HOH B O     1 
HETATM 5327 O  O     . HOH R 10 .   ? -15.353 53.648 19.927  1.00 55.97  ? 415 HOH B O     1 
HETATM 5328 O  O     . HOH R 10 .   ? -4.660  39.739 9.133   1.00 54.70  ? 416 HOH B O     1 
HETATM 5329 O  O     . HOH R 10 .   ? -44.835 36.631 14.289  1.00 52.87  ? 417 HOH B O     1 
HETATM 5330 O  O     . HOH R 10 .   ? -9.325  36.246 16.851  1.00 50.82  ? 418 HOH B O     1 
HETATM 5331 O  O     . HOH R 10 .   ? -13.127 51.246 20.575  1.00 56.93  ? 419 HOH B O     1 
HETATM 5332 O  O     . HOH R 10 .   ? -20.566 42.995 -0.380  1.00 53.19  ? 420 HOH B O     1 
HETATM 5333 O  O     . HOH R 10 .   ? -9.450  44.657 3.170   1.00 61.89  ? 421 HOH B O     1 
HETATM 5334 O  O     . HOH R 10 .   ? -12.788 42.557 1.064   1.00 66.15  ? 422 HOH B O     1 
HETATM 5335 O  O     . HOH R 10 .   ? -15.639 37.687 0.647   1.00 53.22  ? 423 HOH B O     1 
HETATM 5336 O  O     . HOH R 10 .   ? -42.805 27.539 13.454  1.00 60.80  ? 424 HOH B O     1 
HETATM 5337 O  O     . HOH R 10 .   ? -25.679 44.686 30.684  1.00 62.14  ? 425 HOH B O     1 
HETATM 5338 O  O     . HOH R 10 .   ? -21.567 48.452 24.380  1.00 58.71  ? 426 HOH B O     1 
HETATM 5339 O  O     . HOH R 10 .   ? -20.732 50.880 24.938  1.00 54.60  ? 427 HOH B O     1 
HETATM 5340 O  O     . HOH R 10 .   ? -11.124 31.706 5.440   1.00 62.71  ? 428 HOH B O     1 
HETATM 5341 O  O     . HOH R 10 .   ? -22.411 39.020 19.605  1.00 51.93  ? 429 HOH B O     1 
HETATM 5342 O  O     . HOH R 10 .   ? -35.573 38.183 21.471  1.00 54.36  ? 430 HOH B O     1 
HETATM 5343 O  O     . HOH R 10 .   ? -19.275 44.682 1.678   1.00 49.04  ? 431 HOH B O     1 
HETATM 5344 O  O     . HOH R 10 .   ? -12.067 33.716 20.065  1.00 65.78  ? 432 HOH B O     1 
HETATM 5345 O  O     . HOH R 10 .   ? -12.795 37.182 19.873  1.00 70.35  ? 433 HOH B O     1 
HETATM 5346 O  O     . HOH R 10 .   ? -17.579 30.888 5.750   1.00 52.42  ? 434 HOH B O     1 
HETATM 5347 O  O     . HOH R 10 .   ? -20.196 32.143 5.577   1.00 60.87  ? 435 HOH B O     1 
HETATM 5348 O  O     . HOH S 10 .   ? -28.849 54.513 -16.326 1.00 37.34  ? 21  HOH C O     1 
HETATM 5349 O  O     . HOH S 10 .   ? -40.133 53.819 -12.099 1.00 44.53  ? 22  HOH C O     1 
HETATM 5350 O  O     . HOH S 10 .   ? -42.179 54.248 -14.309 1.00 26.74  ? 23  HOH C O     1 
HETATM 5351 O  O     . HOH S 10 .   ? -47.553 42.006 -8.995  1.00 30.88  ? 27  HOH C O     1 
HETATM 5352 O  O     . HOH S 10 .   ? -31.800 50.441 -20.082 1.00 33.32  ? 39  HOH C O     1 
HETATM 5353 O  O     . HOH S 10 .   ? -34.375 50.805 -19.176 1.00 38.31  ? 40  HOH C O     1 
HETATM 5354 O  O     . HOH S 10 .   ? -34.901 48.257 -18.997 1.00 44.52  ? 41  HOH C O     1 
HETATM 5355 O  O     . HOH S 10 .   ? -39.693 59.424 -23.983 1.00 38.47  ? 48  HOH C O     1 
HETATM 5356 O  O     . HOH S 10 .   ? -60.796 20.996 -14.670 1.00 66.24  ? 54  HOH C O     1 
HETATM 5357 O  O     . HOH S 10 .   ? -41.096 73.888 -9.109  1.00 41.17  ? 58  HOH C O     1 
HETATM 5358 O  O     . HOH S 10 .   ? -35.207 58.669 -14.399 1.00 37.63  ? 64  HOH C O     1 
HETATM 5359 O  O     . HOH S 10 .   ? -51.279 72.752 -13.241 1.00 60.22  ? 90  HOH C O     1 
HETATM 5360 O  O     . HOH S 10 .   ? -45.469 69.998 -23.518 1.00 51.41  ? 91  HOH C O     1 
HETATM 5361 O  O     . HOH S 10 .   ? -30.409 56.268 -20.725 1.00 46.40  ? 92  HOH C O     1 
HETATM 5362 O  O     . HOH S 10 .   ? -33.743 56.696 -13.307 1.00 35.73  ? 93  HOH C O     1 
HETATM 5363 O  O     . HOH S 10 .   ? -44.267 52.263 -14.207 1.00 29.20  ? 118 HOH C O     1 
HETATM 5364 O  O     . HOH S 10 .   ? -46.959 49.071 -19.274 1.00 41.54  ? 120 HOH C O     1 
HETATM 5365 O  O     . HOH S 10 .   ? -46.394 38.896 -10.445 1.00 36.19  ? 125 HOH C O     1 
HETATM 5366 O  O     . HOH S 10 .   ? -45.754 68.375 -10.157 1.00 54.58  ? 145 HOH C O     1 
HETATM 5367 O  O     . HOH S 10 .   ? -48.176 65.790 -14.027 1.00 51.40  ? 147 HOH C O     1 
HETATM 5368 O  O     . HOH S 10 .   ? -46.782 39.563 -7.815  1.00 39.52  ? 155 HOH C O     1 
HETATM 5369 O  O     . HOH S 10 .   ? -39.859 44.235 -8.504  1.00 46.63  ? 157 HOH C O     1 
HETATM 5370 O  O     . HOH S 10 .   ? -41.271 47.146 -7.333  1.00 43.67  ? 159 HOH C O     1 
HETATM 5371 O  O     . HOH S 10 .   ? -48.683 44.421 -11.053 1.00 49.20  ? 191 HOH C O     1 
HETATM 5372 O  O     . HOH S 10 .   ? -46.823 46.254 -9.602  1.00 41.88  ? 192 HOH C O     1 
HETATM 5373 O  O     . HOH S 10 .   ? -42.520 51.727 -15.170 1.00 38.82  ? 207 HOH C O     1 
HETATM 5374 O  O     . HOH S 10 .   ? -43.954 41.239 -23.605 1.00 53.16  ? 253 HOH C O     1 
HETATM 5375 O  O     . HOH S 10 .   ? -29.887 51.726 -12.842 1.00 46.56  ? 254 HOH C O     1 
HETATM 5376 O  O     . HOH S 10 .   ? -46.362 42.445 -22.633 1.00 45.94  ? 277 HOH C O     1 
HETATM 5377 O  O     . HOH S 10 .   ? -45.768 63.198 -20.340 1.00 48.03  ? 291 HOH C O     1 
HETATM 5378 O  O     . HOH S 10 .   ? -34.191 83.252 -6.217  1.00 72.31  ? 304 HOH C O     1 
HETATM 5379 O  O     . HOH S 10 .   ? -37.763 58.314 -13.969 1.00 42.65  ? 317 HOH C O     1 
HETATM 5380 O  O     . HOH S 10 .   ? -57.161 20.414 -13.970 1.00 66.04  ? 319 HOH C O     1 
HETATM 5381 O  O     . HOH S 10 .   ? -42.848 39.620 -24.889 1.00 61.69  ? 328 HOH C O     1 
HETATM 5382 O  O     . HOH S 10 .   ? -46.329 67.240 -12.809 1.00 46.74  ? 335 HOH C O     1 
HETATM 5383 O  O     . HOH S 10 .   ? -43.707 70.197 -9.865  1.00 58.10  ? 336 HOH C O     1 
HETATM 5384 O  O     . HOH T 10 .   ? -35.651 45.505 -19.354 1.00 40.94  ? 36  HOH D O     1 
HETATM 5385 O  O     . HOH T 10 .   ? -35.545 48.481 -21.793 1.00 50.37  ? 37  HOH D O     1 
HETATM 5386 O  O     . HOH T 10 .   ? -36.294 51.309 -23.052 1.00 46.82  ? 38  HOH D O     1 
HETATM 5387 O  O     . HOH T 10 .   ? -44.290 50.396 -26.779 1.00 43.37  ? 60  HOH D O     1 
HETATM 5388 O  O     . HOH T 10 .   ? -40.353 59.369 -12.880 1.00 30.29  ? 136 HOH D O     1 
HETATM 5389 O  O     . HOH T 10 .   ? -42.036 71.455 -7.896  1.00 47.40  ? 143 HOH D O     1 
HETATM 5390 O  O     . HOH T 10 .   ? -30.571 47.609 -25.709 1.00 38.30  ? 184 HOH D O     1 
HETATM 5391 O  O     . HOH T 10 .   ? -43.706 86.583 -22.698 1.00 47.04  ? 196 HOH D O     1 
HETATM 5392 O  O     . HOH T 10 .   ? -44.988 59.183 -9.527  1.00 49.94  ? 205 HOH D O     1 
HETATM 5393 O  O     . HOH T 10 .   ? -37.181 71.473 -16.137 1.00 46.14  ? 235 HOH D O     1 
HETATM 5394 O  O     . HOH T 10 .   ? -45.647 51.227 -19.523 1.00 40.57  ? 259 HOH D O     1 
HETATM 5395 O  O     . HOH T 10 .   ? -42.884 61.442 -9.666  1.00 51.28  ? 265 HOH D O     1 
HETATM 5396 O  O     . HOH T 10 .   ? -40.553 47.517 -28.297 1.00 47.36  ? 266 HOH D O     1 
HETATM 5397 O  O     . HOH T 10 .   ? -32.420 27.039 -17.384 1.00 48.76  ? 289 HOH D O     1 
HETATM 5398 O  O     . HOH T 10 .   ? -42.159 57.042 -13.091 1.00 41.50  ? 302 HOH D O     1 
HETATM 5399 O  O     . HOH T 10 .   ? -34.136 26.347 -15.516 1.00 32.70  ? 322 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   PRO 2   -1  ?   ?   ?   A . n 
A 1 3   GLY 3   0   ?   ?   ?   A . n 
A 1 4   CYS 4   1   ?   ?   ?   A . n 
A 1 5   ASN 5   2   ?   ?   ?   A . n 
A 1 6   THR 6   3   ?   ?   ?   A . n 
A 1 7   LYS 7   4   ?   ?   ?   A . n 
A 1 8   LYS 8   5   ?   ?   ?   A . n 
A 1 9   PRO 9   6   ?   ?   ?   A . n 
A 1 10  ASN 10  7   ?   ?   ?   A . n 
A 1 11  LEU 11  8   8   LEU LEU A . n 
A 1 12  ASP 12  9   9   ASP ASP A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  GLU 14  11  11  GLU GLU A . n 
A 1 15  LEU 15  12  12  LEU LEU A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  GLN 17  14  14  GLN GLN A . n 
A 1 18  LEU 18  15  15  LEU LEU A . n 
A 1 19  LEU 19  16  16  LEU LEU A . n 
A 1 20  GLN 20  17  17  GLN GLN A . n 
A 1 21  GLY 21  18  18  GLY GLY A . n 
A 1 22  HIS 22  19  19  HIS HIS A . n 
A 1 23  TYR 23  20  20  TYR TYR A . n 
A 1 24  ILE 24  21  21  ILE ILE A . n 
A 1 25  LYS 25  22  22  LYS LYS A . n 
A 1 26  GLY 26  23  23  GLY GLY A . n 
A 1 27  TYR 27  24  24  TYR TYR A . n 
A 1 28  PRO 28  25  25  PRO PRO A . n 
A 1 29  LYS 29  26  26  LYS LYS A . n 
A 1 30  GLN 30  27  27  GLN GLN A . n 
A 1 31  TYR 31  28  28  TYR TYR A . n 
A 1 32  THR 32  29  29  THR THR A . n 
A 1 33  TYR 33  30  30  TYR TYR A . n 
A 1 34  PHE 34  31  31  PHE PHE A . n 
A 1 35  LEU 35  32  32  LEU LEU A . n 
A 1 36  GLU 36  33  33  GLU GLU A . n 
A 1 37  ASP 37  34  34  ASP ASP A . n 
A 1 38  GLY 38  35  35  GLY GLY A . n 
A 1 39  LYS 39  36  36  LYS LYS A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  LYS 41  38  38  LYS LYS A . n 
A 1 42  VAL 42  39  39  VAL VAL A . n 
A 1 43  SER 43  40  40  SER SER A . n 
A 1 44  ARG 44  41  41  ARG ARG A . n 
A 1 45  PRO 45  42  42  PRO PRO A . n 
A 1 46  GLU 46  43  43  GLU GLU A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  VAL 48  45  45  VAL VAL A . n 
A 1 49  LYS 49  46  46  LYS LYS A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  PRO 52  49  49  PRO PRO A . n 
A 1 53  PRO 53  50  50  PRO PRO A . n 
A 1 54  GLN 54  51  51  GLN GLN A . n 
A 1 55  SER 55  52  52  SER SER A . n 
A 1 56  ASP 56  53  53  ASP ASP A . n 
A 1 57  ARG 57  54  54  ARG ARG A . n 
A 1 58  GLN 58  55  55  GLN GLN A . n 
A 1 59  LYS 59  56  56  LYS LYS A . n 
A 1 60  ILE 60  57  57  ILE ILE A . n 
A 1 61  VAL 61  58  58  VAL VAL A . n 
A 1 62  LEU 62  59  59  LEU LEU A . n 
A 1 63  GLN 63  60  60  GLN GLN A . n 
A 1 64  ALA 64  61  61  ALA ALA A . n 
A 1 65  HIS 65  62  62  HIS HIS A . n 
A 1 66  ASN 66  63  63  ASN ASN A . n 
A 1 67  LEU 67  64  64  LEU LEU A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  HIS 69  66  66  HIS HIS A . n 
A 1 70  THR 70  67  67  THR THR A . n 
A 1 71  GLY 71  68  68  GLY GLY A . n 
A 1 72  ARG 72  69  69  ARG ARG A . n 
A 1 73  GLU 73  70  70  GLU GLU A . n 
A 1 74  ALA 74  71  71  ALA ALA A . n 
A 1 75  THR 75  72  72  THR THR A . n 
A 1 76  LEU 76  73  73  LEU LEU A . n 
A 1 77  LEU 77  74  74  LEU LEU A . n 
A 1 78  LYS 78  75  75  LYS LYS A . n 
A 1 79  ILE 79  76  76  ILE ILE A . n 
A 1 80  ALA 80  77  77  ALA ALA A . n 
A 1 81  ASN 81  78  78  ASN ASN A . n 
A 1 82  LEU 82  79  79  LEU LEU A . n 
A 1 83  TYR 83  80  80  TYR TYR A . n 
A 1 84  TRP 84  81  81  TRP TRP A . n 
A 1 85  TRP 85  82  82  TRP TRP A . n 
A 1 86  PRO 86  83  83  PRO PRO A . n 
A 1 87  ASN 87  84  84  ASN ASN A . n 
A 1 88  MET 88  85  85  MET MET A . n 
A 1 89  ARG 89  86  86  ARG ARG A . n 
A 1 90  LYS 90  87  87  LYS LYS A . n 
A 1 91  ASP 91  88  88  ASP ASP A . n 
A 1 92  VAL 92  89  89  VAL VAL A . n 
A 1 93  VAL 93  90  90  VAL VAL A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  GLN 95  92  92  GLN GLN A . n 
A 1 96  LEU 96  93  93  LEU LEU A . n 
A 1 97  GLY 97  94  94  GLY GLY A . n 
A 1 98  ARG 98  95  95  ARG ARG A . n 
A 1 99  CYS 99  96  96  CYS CYS A . n 
A 1 100 GLN 100 97  97  GLN GLN A . n 
A 1 101 GLN 101 98  98  GLN GLN A . n 
A 1 102 CYS 102 99  99  CYS CYS A . n 
A 1 103 LEU 103 100 100 LEU LEU A . n 
A 1 104 ILE 104 101 101 ILE ILE A . n 
A 1 105 THR 105 102 102 THR THR A . n 
A 1 106 ASN 106 103 103 ASN ASN A . n 
A 1 107 ALA 107 104 104 ALA ALA A . n 
A 1 108 SER 108 105 105 SER SER A . n 
A 1 109 ASN 109 106 106 ASN ASN A . n 
A 1 110 LYS 110 107 107 LYS LYS A . n 
A 1 111 ALA 111 108 108 ALA ALA A . n 
A 1 112 SER 112 109 109 SER SER A . n 
A 1 113 GLY 113 110 110 GLY GLY A . n 
A 1 114 PRO 114 111 111 PRO PRO A . n 
A 1 115 ILE 115 112 112 ILE ILE A . n 
A 1 116 LEU 116 113 113 LEU LEU A . n 
A 1 117 ARG 117 114 114 ARG ARG A . n 
A 1 118 PRO 118 115 115 PRO PRO A . n 
A 1 119 ASP 119 116 116 ASP ASP A . n 
A 1 120 ARG 120 117 117 ARG ARG A . n 
A 1 121 PRO 121 118 118 PRO PRO A . n 
A 1 122 GLN 122 119 119 GLN GLN A . n 
A 1 123 LYS 123 120 120 LYS LYS A . n 
A 1 124 PRO 124 121 121 PRO PRO A . n 
A 1 125 PHE 125 122 122 PHE PHE A . n 
A 1 126 ASP 126 123 123 ASP ASP A . n 
A 1 127 LYS 127 124 124 LYS LYS A . n 
A 1 128 PHE 128 125 125 PHE PHE A . n 
A 1 129 PHE 129 126 126 PHE PHE A . n 
A 1 130 ILE 130 127 127 ILE ILE A . n 
A 1 131 ASP 131 128 128 ASP ASP A . n 
A 1 132 TYR 132 129 129 TYR TYR A . n 
A 1 133 ILE 133 130 130 ILE ILE A . n 
A 1 134 GLY 134 131 131 GLY GLY A . n 
A 1 135 PRO 135 132 132 PRO PRO A . n 
A 1 136 LEU 136 133 133 LEU LEU A . n 
A 1 137 PRO 137 134 134 PRO PRO A . n 
A 1 138 PRO 138 135 135 PRO PRO A . n 
A 1 139 SER 139 136 136 SER SER A . n 
A 1 140 GLN 140 137 137 GLN GLN A . n 
A 1 141 GLY 141 138 138 GLY GLY A . n 
A 1 142 TYR 142 139 139 TYR TYR A . n 
A 1 143 LEU 143 140 140 LEU LEU A . n 
A 1 144 TYR 144 141 141 TYR TYR A . n 
A 1 145 VAL 145 142 142 VAL VAL A . n 
A 1 146 LEU 146 143 143 LEU LEU A . n 
A 1 147 VAL 147 144 144 VAL VAL A . n 
A 1 148 VAL 148 145 145 VAL VAL A . n 
A 1 149 VAL 149 146 146 VAL VAL A . n 
A 1 150 ASP 150 147 147 ASP ASP A . n 
A 1 151 GLY 151 148 148 GLY GLY A . n 
A 1 152 MET 152 149 149 MET MET A . n 
A 1 153 THR 153 150 150 THR THR A . n 
A 1 154 GLY 154 151 151 GLY GLY A . n 
A 1 155 PHE 155 152 152 PHE PHE A . n 
A 1 156 THR 156 153 153 THR THR A . n 
A 1 157 TRP 157 154 154 TRP TRP A . n 
A 1 158 LEU 158 155 155 LEU LEU A . n 
A 1 159 TYR 159 156 156 TYR TYR A . n 
A 1 160 PRO 160 157 157 PRO PRO A . n 
A 1 161 THR 161 158 158 THR THR A . n 
A 1 162 LYS 162 159 159 LYS LYS A . n 
A 1 163 ALA 163 160 160 ALA ALA A . n 
A 1 164 PRO 164 161 161 PRO PRO A . n 
A 1 165 SER 165 162 162 SER SER A . n 
A 1 166 THR 166 163 163 THR THR A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ALA 168 165 165 ALA ALA A . n 
A 1 169 THR 169 166 166 THR THR A . n 
A 1 170 VAL 170 167 167 VAL VAL A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 SER 172 169 169 SER SER A . n 
A 1 173 LEU 173 170 170 LEU LEU A . n 
A 1 174 ASN 174 171 171 ASN ASN A . n 
A 1 175 VAL 175 172 172 VAL VAL A . n 
A 1 176 LEU 176 173 173 LEU LEU A . n 
A 1 177 THR 177 174 174 THR THR A . n 
A 1 178 SER 178 175 175 SER SER A . n 
A 1 179 ILE 179 176 176 ILE ILE A . n 
A 1 180 ALA 180 177 177 ALA ALA A . n 
A 1 181 ILE 181 178 178 ILE ILE A . n 
A 1 182 PRO 182 179 179 PRO PRO A . n 
A 1 183 LYS 183 180 180 LYS LYS A . n 
A 1 184 VAL 184 181 181 VAL VAL A . n 
A 1 185 ILE 185 182 182 ILE ILE A . n 
A 1 186 HIS 186 183 183 HIS HIS A . n 
A 1 187 SER 187 184 184 SER SER A . n 
A 1 188 ASP 188 185 185 ASP ASP A . n 
A 1 189 GLN 189 186 186 GLN GLN A . n 
A 1 190 GLY 190 187 187 GLY GLY A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 SER 195 192 192 SER SER A . n 
A 1 196 SER 196 193 193 SER SER A . n 
A 1 197 THR 197 194 194 THR THR A . n 
A 1 198 PHE 198 195 195 PHE PHE A . n 
A 1 199 ALA 199 196 196 ALA ALA A . n 
A 1 200 GLU 200 197 197 GLU GLU A . n 
A 1 201 TRP 201 198 198 TRP TRP A . n 
A 1 202 ALA 202 199 199 ALA ALA A . n 
A 1 203 LYS 203 200 200 LYS LYS A . n 
A 1 204 GLU 204 201 201 GLU GLU A . n 
A 1 205 ARG 205 202 202 ARG ARG A . n 
A 1 206 GLY 206 203 203 GLY GLY A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 HIS 208 205 205 HIS HIS A . n 
A 1 209 LEU 209 206 206 LEU LEU A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 PHE 211 208 208 PHE PHE A . n 
A 1 212 SER 212 209 209 SER SER A . n 
A 1 213 THR 213 210 210 THR THR A . n 
A 1 214 PRO 214 211 211 PRO PRO A . n 
A 1 215 TYR 215 212 212 TYR TYR A . n 
A 1 216 HIS 216 213 213 HIS HIS A . n 
A 1 217 PRO 217 214 214 PRO PRO A . n 
A 1 218 GLN 218 215 215 GLN GLN A . n 
A 1 219 SER 219 216 216 SER SER A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 GLY 221 218 218 GLY GLY A . n 
A 1 222 LYS 222 219 219 LYS LYS A . n 
A 1 223 VAL 223 220 220 VAL VAL A . n 
A 1 224 GLU 224 221 221 GLU GLU A . n 
A 1 225 ARG 225 222 222 ARG ARG A . n 
A 1 226 LYS 226 223 223 LYS LYS A . n 
A 1 227 ASN 227 224 224 ASN ASN A . n 
A 1 228 SER 228 225 225 SER SER A . n 
A 1 229 ASP 229 226 226 ASP ASP A . n 
A 1 230 ILE 230 227 227 ILE ILE A . n 
A 1 231 LYS 231 228 228 LYS LYS A . n 
A 1 232 ARG 232 229 229 ARG ARG A . n 
A 1 233 LEU 233 230 230 LEU LEU A . n 
A 1 234 LEU 234 231 231 LEU LEU A . n 
A 1 235 THR 235 232 232 THR THR A . n 
A 1 236 LYS 236 233 233 LYS LYS A . n 
A 1 237 LEU 237 234 234 LEU LEU A . n 
A 1 238 LEU 238 235 235 LEU LEU A . n 
A 1 239 VAL 239 236 236 VAL VAL A . n 
A 1 240 GLY 240 237 237 GLY GLY A . n 
A 1 241 ARG 241 238 238 ARG ARG A . n 
A 1 242 PRO 242 239 239 PRO PRO A . n 
A 1 243 THR 243 240 240 THR THR A . n 
A 1 244 LYS 244 241 241 LYS LYS A . n 
A 1 245 TRP 245 242 242 TRP TRP A . n 
A 1 246 TYR 246 243 243 TYR TYR A . n 
A 1 247 ASP 247 244 244 ASP ASP A . n 
A 1 248 LEU 248 245 245 LEU LEU A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PRO 250 247 247 PRO PRO A . n 
A 1 251 VAL 251 248 248 VAL VAL A . n 
A 1 252 VAL 252 249 249 VAL VAL A . n 
A 1 253 GLN 253 250 250 GLN GLN A . n 
A 1 254 LEU 254 251 251 LEU LEU A . n 
A 1 255 ALA 255 252 252 ALA ALA A . n 
A 1 256 LEU 256 253 253 LEU LEU A . n 
A 1 257 ASN 257 254 254 ASN ASN A . n 
A 1 258 ASN 258 255 255 ASN ASN A . n 
A 1 259 THR 259 256 256 THR THR A . n 
A 1 260 TYR 260 257 257 TYR TYR A . n 
A 1 261 SER 261 258 258 SER SER A . n 
A 1 262 PRO 262 259 259 PRO PRO A . n 
A 1 263 VAL 263 260 260 VAL VAL A . n 
A 1 264 LEU 264 261 261 LEU LEU A . n 
A 1 265 LYS 265 262 262 LYS LYS A . n 
A 1 266 TYR 266 263 263 TYR TYR A . n 
A 1 267 THR 267 264 264 THR THR A . n 
A 1 268 PRO 268 265 265 PRO PRO A . n 
A 1 269 HIS 269 266 266 HIS HIS A . n 
A 1 270 GLN 270 267 267 GLN GLN A . n 
A 1 271 LEU 271 268 268 LEU LEU A . n 
A 1 272 LEU 272 269 269 LEU LEU A . n 
A 1 273 PHE 273 270 270 PHE PHE A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 ASP 276 273 273 ASP ASP A . n 
A 1 277 SER 277 274 274 SER SER A . n 
A 1 278 ASN 278 275 275 ASN ASN A . n 
A 1 279 THR 279 276 276 THR THR A . n 
A 1 280 PRO 280 277 277 PRO PRO A . n 
A 1 281 PHE 281 278 278 PHE PHE A . n 
A 1 282 ALA 282 279 279 ALA ALA A . n 
A 1 283 ASN 283 280 280 ASN ASN A . n 
A 1 284 GLN 284 281 281 GLN GLN A . n 
A 1 285 ASP 285 282 282 ASP ASP A . n 
A 1 286 THR 286 283 283 THR THR A . n 
A 1 287 LEU 287 284 284 LEU LEU A . n 
A 1 288 ASP 288 285 285 ASP ASP A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 THR 290 287 287 THR THR A . n 
A 1 291 ARG 291 288 288 ARG ARG A . n 
A 1 292 GLU 292 289 289 GLU GLU A . n 
A 1 293 GLU 293 290 290 GLU GLU A . n 
A 1 294 GLU 294 291 291 GLU GLU A . n 
A 1 295 LEU 295 292 292 LEU LEU A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 LEU 297 294 294 LEU LEU A . n 
A 1 298 LEU 298 295 295 LEU LEU A . n 
A 1 299 GLN 299 296 296 GLN GLN A . n 
A 1 300 GLU 300 297 297 GLU GLU A . n 
A 1 301 ILE 301 298 298 ILE ILE A . n 
A 1 302 ARG 302 299 299 ARG ARG A . n 
A 1 303 THR 303 300 300 THR THR A . n 
A 1 304 SER 304 301 301 SER SER A . n 
A 1 305 LEU 305 302 302 LEU LEU A . n 
A 1 306 TYR 306 303 303 TYR TYR A . n 
A 1 307 HIS 307 304 304 HIS HIS A . n 
A 1 308 PRO 308 305 305 PRO PRO A . n 
A 1 309 SER 309 306 306 SER SER A . n 
A 1 310 THR 310 307 307 THR THR A . n 
A 1 311 PRO 311 308 308 PRO PRO A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 ALA 313 310 310 ALA ALA A . n 
A 1 314 SER 314 311 311 SER SER A . n 
A 1 315 SER 315 312 312 SER SER A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 SER 317 314 314 SER SER A . n 
A 1 318 TRP 318 315 315 TRP TRP A . n 
A 1 319 SER 319 316 316 SER SER A . n 
A 1 320 PRO 320 317 317 PRO PRO A . n 
A 1 321 VAL 321 318 318 VAL VAL A . n 
A 1 322 VAL 322 319 319 VAL VAL A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 GLN 324 321 321 GLN GLN A . n 
A 1 325 LEU 325 322 322 LEU LEU A . n 
A 1 326 VAL 326 323 323 VAL VAL A . n 
A 1 327 GLN 327 324 324 GLN GLN A . n 
A 1 328 GLU 328 325 325 GLU GLU A . n 
A 1 329 ARG 329 326 326 ARG ARG A . n 
A 1 330 VAL 330 327 327 VAL VAL A . n 
A 1 331 ALA 331 328 328 ALA ALA A . n 
A 1 332 ARG 332 329 329 ARG ARG A . n 
A 1 333 PRO 333 330 330 PRO PRO A . n 
A 1 334 ALA 334 331 331 ALA ALA A . n 
A 1 335 SER 335 332 332 SER SER A . n 
A 1 336 LEU 336 333 333 LEU LEU A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 PRO 338 335 335 PRO PRO A . n 
A 1 339 ARG 339 336 336 ARG ARG A . n 
A 1 340 TRP 340 337 337 TRP TRP A . n 
A 1 341 HIS 341 338 338 HIS HIS A . n 
A 1 342 LYS 342 339 339 LYS LYS A . n 
A 1 343 PRO 343 340 340 PRO PRO A . n 
A 1 344 SER 344 341 341 SER SER A . n 
A 1 345 THR 345 342 342 THR THR A . n 
A 1 346 VAL 346 343 343 VAL VAL A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 LYS 348 345 345 LYS LYS A . n 
A 1 349 VAL 349 346 346 VAL VAL A . n 
A 1 350 LEU 350 347 347 LEU LEU A . n 
A 1 351 ASN 351 348 348 ASN ASN A . n 
A 1 352 PRO 352 349 349 PRO PRO A . n 
A 1 353 ARG 353 350 350 ARG ARG A . n 
A 1 354 THR 354 351 351 THR THR A . n 
A 1 355 VAL 355 352 352 VAL VAL A . n 
A 1 356 VAL 356 353 353 VAL VAL A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 LEU 358 355 355 LEU LEU A . n 
A 1 359 ASP 359 356 356 ASP ASP A . n 
A 1 360 HIS 360 357 357 HIS HIS A . n 
A 1 361 LEU 361 358 358 LEU LEU A . n 
A 1 362 GLY 362 359 359 GLY GLY A . n 
A 1 363 ASN 363 360 360 ASN ASN A . n 
A 1 364 ASN 364 361 361 ASN ASN A . n 
A 1 365 ARG 365 362 362 ARG ARG A . n 
A 1 366 THR 366 363 363 THR THR A . n 
A 1 367 VAL 367 364 364 VAL VAL A . n 
A 1 368 SER 368 365 365 SER SER A . n 
A 1 369 ILE 369 366 366 ILE ILE A . n 
A 1 370 ASP 370 367 367 ASP ASP A . n 
A 1 371 ASN 371 368 368 ASN ASN A . n 
A 1 372 LEU 372 369 369 LEU LEU A . n 
A 1 373 LYS 373 370 370 LYS LYS A . n 
A 1 374 PRO 374 371 371 PRO PRO A . n 
A 1 375 THR 375 372 372 THR THR A . n 
A 1 376 SER 376 373 373 SER SER A . n 
A 1 377 HIS 377 374 374 HIS HIS A . n 
A 1 378 GLN 378 375 375 GLN GLN A . n 
A 1 379 ASN 379 376 ?   ?   ?   A . n 
A 1 380 GLY 380 377 ?   ?   ?   A . n 
A 1 381 THR 381 378 ?   ?   ?   A . n 
A 1 382 THR 382 379 ?   ?   ?   A . n 
A 1 383 ASN 383 380 ?   ?   ?   A . n 
A 1 384 ASP 384 381 ?   ?   ?   A . n 
A 1 385 THR 385 382 ?   ?   ?   A . n 
A 1 386 ALA 386 383 ?   ?   ?   A . n 
A 1 387 THR 387 384 ?   ?   ?   A . n 
A 1 388 MET 388 385 ?   ?   ?   A . n 
A 1 389 ASP 389 386 ?   ?   ?   A . n 
A 1 390 HIS 390 387 ?   ?   ?   A . n 
A 1 391 LEU 391 388 ?   ?   ?   A . n 
A 1 392 GLU 392 389 ?   ?   ?   A . n 
A 1 393 LYS 393 390 ?   ?   ?   A . n 
A 1 394 ASN 394 391 ?   ?   ?   A . n 
A 1 395 GLU 395 392 ?   ?   ?   A . n 
B 1 1   GLY 1   -2  ?   ?   ?   B . n 
B 1 2   PRO 2   -1  ?   ?   ?   B . n 
B 1 3   GLY 3   0   ?   ?   ?   B . n 
B 1 4   CYS 4   1   ?   ?   ?   B . n 
B 1 5   ASN 5   2   ?   ?   ?   B . n 
B 1 6   THR 6   3   ?   ?   ?   B . n 
B 1 7   LYS 7   4   ?   ?   ?   B . n 
B 1 8   LYS 8   5   ?   ?   ?   B . n 
B 1 9   PRO 9   6   ?   ?   ?   B . n 
B 1 10  ASN 10  7   ?   ?   ?   B . n 
B 1 11  LEU 11  8   ?   ?   ?   B . n 
B 1 12  ASP 12  9   ?   ?   ?   B . n 
B 1 13  ALA 13  10  ?   ?   ?   B . n 
B 1 14  GLU 14  11  ?   ?   ?   B . n 
B 1 15  LEU 15  12  ?   ?   ?   B . n 
B 1 16  ASP 16  13  ?   ?   ?   B . n 
B 1 17  GLN 17  14  ?   ?   ?   B . n 
B 1 18  LEU 18  15  ?   ?   ?   B . n 
B 1 19  LEU 19  16  ?   ?   ?   B . n 
B 1 20  GLN 20  17  ?   ?   ?   B . n 
B 1 21  GLY 21  18  ?   ?   ?   B . n 
B 1 22  HIS 22  19  ?   ?   ?   B . n 
B 1 23  TYR 23  20  ?   ?   ?   B . n 
B 1 24  ILE 24  21  ?   ?   ?   B . n 
B 1 25  LYS 25  22  ?   ?   ?   B . n 
B 1 26  GLY 26  23  ?   ?   ?   B . n 
B 1 27  TYR 27  24  ?   ?   ?   B . n 
B 1 28  PRO 28  25  ?   ?   ?   B . n 
B 1 29  LYS 29  26  ?   ?   ?   B . n 
B 1 30  GLN 30  27  ?   ?   ?   B . n 
B 1 31  TYR 31  28  ?   ?   ?   B . n 
B 1 32  THR 32  29  ?   ?   ?   B . n 
B 1 33  TYR 33  30  ?   ?   ?   B . n 
B 1 34  PHE 34  31  ?   ?   ?   B . n 
B 1 35  LEU 35  32  ?   ?   ?   B . n 
B 1 36  GLU 36  33  ?   ?   ?   B . n 
B 1 37  ASP 37  34  ?   ?   ?   B . n 
B 1 38  GLY 38  35  ?   ?   ?   B . n 
B 1 39  LYS 39  36  ?   ?   ?   B . n 
B 1 40  VAL 40  37  ?   ?   ?   B . n 
B 1 41  LYS 41  38  ?   ?   ?   B . n 
B 1 42  VAL 42  39  ?   ?   ?   B . n 
B 1 43  SER 43  40  ?   ?   ?   B . n 
B 1 44  ARG 44  41  ?   ?   ?   B . n 
B 1 45  PRO 45  42  ?   ?   ?   B . n 
B 1 46  GLU 46  43  ?   ?   ?   B . n 
B 1 47  GLY 47  44  ?   ?   ?   B . n 
B 1 48  VAL 48  45  ?   ?   ?   B . n 
B 1 49  LYS 49  46  ?   ?   ?   B . n 
B 1 50  ILE 50  47  ?   ?   ?   B . n 
B 1 51  ILE 51  48  ?   ?   ?   B . n 
B 1 52  PRO 52  49  ?   ?   ?   B . n 
B 1 53  PRO 53  50  ?   ?   ?   B . n 
B 1 54  GLN 54  51  ?   ?   ?   B . n 
B 1 55  SER 55  52  ?   ?   ?   B . n 
B 1 56  ASP 56  53  ?   ?   ?   B . n 
B 1 57  ARG 57  54  ?   ?   ?   B . n 
B 1 58  GLN 58  55  ?   ?   ?   B . n 
B 1 59  LYS 59  56  ?   ?   ?   B . n 
B 1 60  ILE 60  57  ?   ?   ?   B . n 
B 1 61  VAL 61  58  ?   ?   ?   B . n 
B 1 62  LEU 62  59  ?   ?   ?   B . n 
B 1 63  GLN 63  60  ?   ?   ?   B . n 
B 1 64  ALA 64  61  ?   ?   ?   B . n 
B 1 65  HIS 65  62  ?   ?   ?   B . n 
B 1 66  ASN 66  63  ?   ?   ?   B . n 
B 1 67  LEU 67  64  ?   ?   ?   B . n 
B 1 68  ALA 68  65  ?   ?   ?   B . n 
B 1 69  HIS 69  66  ?   ?   ?   B . n 
B 1 70  THR 70  67  ?   ?   ?   B . n 
B 1 71  GLY 71  68  ?   ?   ?   B . n 
B 1 72  ARG 72  69  ?   ?   ?   B . n 
B 1 73  GLU 73  70  ?   ?   ?   B . n 
B 1 74  ALA 74  71  ?   ?   ?   B . n 
B 1 75  THR 75  72  ?   ?   ?   B . n 
B 1 76  LEU 76  73  ?   ?   ?   B . n 
B 1 77  LEU 77  74  ?   ?   ?   B . n 
B 1 78  LYS 78  75  ?   ?   ?   B . n 
B 1 79  ILE 79  76  ?   ?   ?   B . n 
B 1 80  ALA 80  77  ?   ?   ?   B . n 
B 1 81  ASN 81  78  ?   ?   ?   B . n 
B 1 82  LEU 82  79  ?   ?   ?   B . n 
B 1 83  TYR 83  80  ?   ?   ?   B . n 
B 1 84  TRP 84  81  ?   ?   ?   B . n 
B 1 85  TRP 85  82  ?   ?   ?   B . n 
B 1 86  PRO 86  83  ?   ?   ?   B . n 
B 1 87  ASN 87  84  ?   ?   ?   B . n 
B 1 88  MET 88  85  ?   ?   ?   B . n 
B 1 89  ARG 89  86  ?   ?   ?   B . n 
B 1 90  LYS 90  87  ?   ?   ?   B . n 
B 1 91  ASP 91  88  ?   ?   ?   B . n 
B 1 92  VAL 92  89  ?   ?   ?   B . n 
B 1 93  VAL 93  90  ?   ?   ?   B . n 
B 1 94  LYS 94  91  ?   ?   ?   B . n 
B 1 95  GLN 95  92  ?   ?   ?   B . n 
B 1 96  LEU 96  93  ?   ?   ?   B . n 
B 1 97  GLY 97  94  ?   ?   ?   B . n 
B 1 98  ARG 98  95  ?   ?   ?   B . n 
B 1 99  CYS 99  96  ?   ?   ?   B . n 
B 1 100 GLN 100 97  ?   ?   ?   B . n 
B 1 101 GLN 101 98  ?   ?   ?   B . n 
B 1 102 CYS 102 99  ?   ?   ?   B . n 
B 1 103 LEU 103 100 ?   ?   ?   B . n 
B 1 104 ILE 104 101 ?   ?   ?   B . n 
B 1 105 THR 105 102 ?   ?   ?   B . n 
B 1 106 ASN 106 103 ?   ?   ?   B . n 
B 1 107 ALA 107 104 ?   ?   ?   B . n 
B 1 108 SER 108 105 ?   ?   ?   B . n 
B 1 109 ASN 109 106 ?   ?   ?   B . n 
B 1 110 LYS 110 107 ?   ?   ?   B . n 
B 1 111 ALA 111 108 ?   ?   ?   B . n 
B 1 112 SER 112 109 ?   ?   ?   B . n 
B 1 113 GLY 113 110 ?   ?   ?   B . n 
B 1 114 PRO 114 111 ?   ?   ?   B . n 
B 1 115 ILE 115 112 ?   ?   ?   B . n 
B 1 116 LEU 116 113 ?   ?   ?   B . n 
B 1 117 ARG 117 114 ?   ?   ?   B . n 
B 1 118 PRO 118 115 ?   ?   ?   B . n 
B 1 119 ASP 119 116 116 ASP ASP B . n 
B 1 120 ARG 120 117 117 ARG ARG B . n 
B 1 121 PRO 121 118 118 PRO PRO B . n 
B 1 122 GLN 122 119 119 GLN GLN B . n 
B 1 123 LYS 123 120 120 LYS LYS B . n 
B 1 124 PRO 124 121 121 PRO PRO B . n 
B 1 125 PHE 125 122 122 PHE PHE B . n 
B 1 126 ASP 126 123 123 ASP ASP B . n 
B 1 127 LYS 127 124 124 LYS LYS B . n 
B 1 128 PHE 128 125 125 PHE PHE B . n 
B 1 129 PHE 129 126 126 PHE PHE B . n 
B 1 130 ILE 130 127 127 ILE ILE B . n 
B 1 131 ASP 131 128 128 ASP ASP B . n 
B 1 132 TYR 132 129 129 TYR TYR B . n 
B 1 133 ILE 133 130 130 ILE ILE B . n 
B 1 134 GLY 134 131 131 GLY GLY B . n 
B 1 135 PRO 135 132 132 PRO PRO B . n 
B 1 136 LEU 136 133 133 LEU LEU B . n 
B 1 137 PRO 137 134 134 PRO PRO B . n 
B 1 138 PRO 138 135 135 PRO PRO B . n 
B 1 139 SER 139 136 136 SER SER B . n 
B 1 140 GLN 140 137 137 GLN GLN B . n 
B 1 141 GLY 141 138 138 GLY GLY B . n 
B 1 142 TYR 142 139 139 TYR TYR B . n 
B 1 143 LEU 143 140 140 LEU LEU B . n 
B 1 144 TYR 144 141 141 TYR TYR B . n 
B 1 145 VAL 145 142 142 VAL VAL B . n 
B 1 146 LEU 146 143 143 LEU LEU B . n 
B 1 147 VAL 147 144 144 VAL VAL B . n 
B 1 148 VAL 148 145 145 VAL VAL B . n 
B 1 149 VAL 149 146 146 VAL VAL B . n 
B 1 150 ASP 150 147 147 ASP ASP B . n 
B 1 151 GLY 151 148 148 GLY GLY B . n 
B 1 152 MET 152 149 149 MET MET B . n 
B 1 153 THR 153 150 150 THR THR B . n 
B 1 154 GLY 154 151 151 GLY GLY B . n 
B 1 155 PHE 155 152 152 PHE PHE B . n 
B 1 156 THR 156 153 153 THR THR B . n 
B 1 157 TRP 157 154 154 TRP TRP B . n 
B 1 158 LEU 158 155 155 LEU LEU B . n 
B 1 159 TYR 159 156 156 TYR TYR B . n 
B 1 160 PRO 160 157 157 PRO PRO B . n 
B 1 161 THR 161 158 158 THR THR B . n 
B 1 162 LYS 162 159 159 LYS LYS B . n 
B 1 163 ALA 163 160 160 ALA ALA B . n 
B 1 164 PRO 164 161 161 PRO PRO B . n 
B 1 165 SER 165 162 162 SER SER B . n 
B 1 166 THR 166 163 163 THR THR B . n 
B 1 167 SER 167 164 164 SER SER B . n 
B 1 168 ALA 168 165 165 ALA ALA B . n 
B 1 169 THR 169 166 166 THR THR B . n 
B 1 170 VAL 170 167 167 VAL VAL B . n 
B 1 171 LYS 171 168 168 LYS LYS B . n 
B 1 172 SER 172 169 169 SER SER B . n 
B 1 173 LEU 173 170 170 LEU LEU B . n 
B 1 174 ASN 174 171 171 ASN ASN B . n 
B 1 175 VAL 175 172 172 VAL VAL B . n 
B 1 176 LEU 176 173 173 LEU LEU B . n 
B 1 177 THR 177 174 174 THR THR B . n 
B 1 178 SER 178 175 175 SER SER B . n 
B 1 179 ILE 179 176 176 ILE ILE B . n 
B 1 180 ALA 180 177 177 ALA ALA B . n 
B 1 181 ILE 181 178 178 ILE ILE B . n 
B 1 182 PRO 182 179 179 PRO PRO B . n 
B 1 183 LYS 183 180 180 LYS LYS B . n 
B 1 184 VAL 184 181 181 VAL VAL B . n 
B 1 185 ILE 185 182 182 ILE ILE B . n 
B 1 186 HIS 186 183 183 HIS HIS B . n 
B 1 187 SER 187 184 184 SER SER B . n 
B 1 188 ASP 188 185 185 ASP ASP B . n 
B 1 189 GLN 189 186 186 GLN GLN B . n 
B 1 190 GLY 190 187 187 GLY GLY B . n 
B 1 191 ALA 191 188 188 ALA ALA B . n 
B 1 192 ALA 192 189 189 ALA ALA B . n 
B 1 193 PHE 193 190 190 PHE PHE B . n 
B 1 194 THR 194 191 191 THR THR B . n 
B 1 195 SER 195 192 192 SER SER B . n 
B 1 196 SER 196 193 193 SER SER B . n 
B 1 197 THR 197 194 194 THR THR B . n 
B 1 198 PHE 198 195 195 PHE PHE B . n 
B 1 199 ALA 199 196 196 ALA ALA B . n 
B 1 200 GLU 200 197 197 GLU GLU B . n 
B 1 201 TRP 201 198 198 TRP TRP B . n 
B 1 202 ALA 202 199 199 ALA ALA B . n 
B 1 203 LYS 203 200 200 LYS LYS B . n 
B 1 204 GLU 204 201 201 GLU GLU B . n 
B 1 205 ARG 205 202 202 ARG ARG B . n 
B 1 206 GLY 206 203 203 GLY GLY B . n 
B 1 207 ILE 207 204 204 ILE ILE B . n 
B 1 208 HIS 208 205 205 HIS HIS B . n 
B 1 209 LEU 209 206 206 LEU LEU B . n 
B 1 210 GLU 210 207 207 GLU GLU B . n 
B 1 211 PHE 211 208 208 PHE PHE B . n 
B 1 212 SER 212 209 209 SER SER B . n 
B 1 213 THR 213 210 210 THR THR B . n 
B 1 214 PRO 214 211 211 PRO PRO B . n 
B 1 215 TYR 215 212 212 TYR TYR B . n 
B 1 216 HIS 216 213 213 HIS HIS B . n 
B 1 217 PRO 217 214 214 PRO PRO B . n 
B 1 218 GLN 218 215 215 GLN GLN B . n 
B 1 219 SER 219 216 216 SER SER B . n 
B 1 220 SER 220 217 217 SER SER B . n 
B 1 221 GLY 221 218 218 GLY GLY B . n 
B 1 222 LYS 222 219 219 LYS LYS B . n 
B 1 223 VAL 223 220 220 VAL VAL B . n 
B 1 224 GLU 224 221 221 GLU GLU B . n 
B 1 225 ARG 225 222 222 ARG ARG B . n 
B 1 226 LYS 226 223 223 LYS LYS B . n 
B 1 227 ASN 227 224 224 ASN ASN B . n 
B 1 228 SER 228 225 225 SER SER B . n 
B 1 229 ASP 229 226 226 ASP ASP B . n 
B 1 230 ILE 230 227 227 ILE ILE B . n 
B 1 231 LYS 231 228 228 LYS LYS B . n 
B 1 232 ARG 232 229 229 ARG ARG B . n 
B 1 233 LEU 233 230 230 LEU LEU B . n 
B 1 234 LEU 234 231 231 LEU LEU B . n 
B 1 235 THR 235 232 232 THR THR B . n 
B 1 236 LYS 236 233 233 LYS LYS B . n 
B 1 237 LEU 237 234 234 LEU LEU B . n 
B 1 238 LEU 238 235 235 LEU LEU B . n 
B 1 239 VAL 239 236 236 VAL VAL B . n 
B 1 240 GLY 240 237 237 GLY GLY B . n 
B 1 241 ARG 241 238 238 ARG ARG B . n 
B 1 242 PRO 242 239 239 PRO PRO B . n 
B 1 243 THR 243 240 240 THR THR B . n 
B 1 244 LYS 244 241 241 LYS LYS B . n 
B 1 245 TRP 245 242 242 TRP TRP B . n 
B 1 246 TYR 246 243 243 TYR TYR B . n 
B 1 247 ASP 247 244 244 ASP ASP B . n 
B 1 248 LEU 248 245 245 LEU LEU B . n 
B 1 249 LEU 249 246 246 LEU LEU B . n 
B 1 250 PRO 250 247 247 PRO PRO B . n 
B 1 251 VAL 251 248 248 VAL VAL B . n 
B 1 252 VAL 252 249 249 VAL VAL B . n 
B 1 253 GLN 253 250 250 GLN GLN B . n 
B 1 254 LEU 254 251 251 LEU LEU B . n 
B 1 255 ALA 255 252 252 ALA ALA B . n 
B 1 256 LEU 256 253 253 LEU LEU B . n 
B 1 257 ASN 257 254 254 ASN ASN B . n 
B 1 258 ASN 258 255 255 ASN ASN B . n 
B 1 259 THR 259 256 256 THR THR B . n 
B 1 260 TYR 260 257 257 TYR TYR B . n 
B 1 261 SER 261 258 258 SER SER B . n 
B 1 262 PRO 262 259 259 PRO PRO B . n 
B 1 263 VAL 263 260 260 VAL VAL B . n 
B 1 264 LEU 264 261 261 LEU LEU B . n 
B 1 265 LYS 265 262 262 LYS LYS B . n 
B 1 266 TYR 266 263 263 TYR TYR B . n 
B 1 267 THR 267 264 264 THR THR B . n 
B 1 268 PRO 268 265 265 PRO PRO B . n 
B 1 269 HIS 269 266 266 HIS HIS B . n 
B 1 270 GLN 270 267 267 GLN GLN B . n 
B 1 271 LEU 271 268 268 LEU LEU B . n 
B 1 272 LEU 272 269 269 LEU LEU B . n 
B 1 273 PHE 273 270 270 PHE PHE B . n 
B 1 274 GLY 274 271 271 GLY GLY B . n 
B 1 275 ILE 275 272 272 ILE ILE B . n 
B 1 276 ASP 276 273 273 ASP ASP B . n 
B 1 277 SER 277 274 274 SER SER B . n 
B 1 278 ASN 278 275 275 ASN ASN B . n 
B 1 279 THR 279 276 276 THR THR B . n 
B 1 280 PRO 280 277 277 PRO PRO B . n 
B 1 281 PHE 281 278 278 PHE PHE B . n 
B 1 282 ALA 282 279 279 ALA ALA B . n 
B 1 283 ASN 283 280 280 ASN ASN B . n 
B 1 284 GLN 284 281 281 GLN GLN B . n 
B 1 285 ASP 285 282 282 ASP ASP B . n 
B 1 286 THR 286 283 283 THR THR B . n 
B 1 287 LEU 287 284 284 LEU LEU B . n 
B 1 288 ASP 288 285 285 ASP ASP B . n 
B 1 289 LEU 289 286 286 LEU LEU B . n 
B 1 290 THR 290 287 287 THR THR B . n 
B 1 291 ARG 291 288 288 ARG ARG B . n 
B 1 292 GLU 292 289 289 GLU GLU B . n 
B 1 293 GLU 293 290 290 GLU GLU B . n 
B 1 294 GLU 294 291 291 GLU GLU B . n 
B 1 295 LEU 295 292 292 LEU LEU B . n 
B 1 296 SER 296 293 293 SER SER B . n 
B 1 297 LEU 297 294 294 LEU LEU B . n 
B 1 298 LEU 298 295 295 LEU LEU B . n 
B 1 299 GLN 299 296 296 GLN GLN B . n 
B 1 300 GLU 300 297 297 GLU GLU B . n 
B 1 301 ILE 301 298 298 ILE ILE B . n 
B 1 302 ARG 302 299 299 ARG ARG B . n 
B 1 303 THR 303 300 ?   ?   ?   B . n 
B 1 304 SER 304 301 ?   ?   ?   B . n 
B 1 305 LEU 305 302 ?   ?   ?   B . n 
B 1 306 TYR 306 303 ?   ?   ?   B . n 
B 1 307 HIS 307 304 ?   ?   ?   B . n 
B 1 308 PRO 308 305 ?   ?   ?   B . n 
B 1 309 SER 309 306 ?   ?   ?   B . n 
B 1 310 THR 310 307 ?   ?   ?   B . n 
B 1 311 PRO 311 308 ?   ?   ?   B . n 
B 1 312 PRO 312 309 ?   ?   ?   B . n 
B 1 313 ALA 313 310 ?   ?   ?   B . n 
B 1 314 SER 314 311 ?   ?   ?   B . n 
B 1 315 SER 315 312 ?   ?   ?   B . n 
B 1 316 ARG 316 313 ?   ?   ?   B . n 
B 1 317 SER 317 314 ?   ?   ?   B . n 
B 1 318 TRP 318 315 ?   ?   ?   B . n 
B 1 319 SER 319 316 ?   ?   ?   B . n 
B 1 320 PRO 320 317 ?   ?   ?   B . n 
B 1 321 VAL 321 318 ?   ?   ?   B . n 
B 1 322 VAL 322 319 ?   ?   ?   B . n 
B 1 323 GLY 323 320 ?   ?   ?   B . n 
B 1 324 GLN 324 321 ?   ?   ?   B . n 
B 1 325 LEU 325 322 ?   ?   ?   B . n 
B 1 326 VAL 326 323 ?   ?   ?   B . n 
B 1 327 GLN 327 324 ?   ?   ?   B . n 
B 1 328 GLU 328 325 ?   ?   ?   B . n 
B 1 329 ARG 329 326 ?   ?   ?   B . n 
B 1 330 VAL 330 327 ?   ?   ?   B . n 
B 1 331 ALA 331 328 ?   ?   ?   B . n 
B 1 332 ARG 332 329 ?   ?   ?   B . n 
B 1 333 PRO 333 330 ?   ?   ?   B . n 
B 1 334 ALA 334 331 ?   ?   ?   B . n 
B 1 335 SER 335 332 ?   ?   ?   B . n 
B 1 336 LEU 336 333 ?   ?   ?   B . n 
B 1 337 ARG 337 334 ?   ?   ?   B . n 
B 1 338 PRO 338 335 ?   ?   ?   B . n 
B 1 339 ARG 339 336 ?   ?   ?   B . n 
B 1 340 TRP 340 337 ?   ?   ?   B . n 
B 1 341 HIS 341 338 ?   ?   ?   B . n 
B 1 342 LYS 342 339 ?   ?   ?   B . n 
B 1 343 PRO 343 340 ?   ?   ?   B . n 
B 1 344 SER 344 341 ?   ?   ?   B . n 
B 1 345 THR 345 342 ?   ?   ?   B . n 
B 1 346 VAL 346 343 ?   ?   ?   B . n 
B 1 347 LEU 347 344 ?   ?   ?   B . n 
B 1 348 LYS 348 345 ?   ?   ?   B . n 
B 1 349 VAL 349 346 ?   ?   ?   B . n 
B 1 350 LEU 350 347 ?   ?   ?   B . n 
B 1 351 ASN 351 348 ?   ?   ?   B . n 
B 1 352 PRO 352 349 ?   ?   ?   B . n 
B 1 353 ARG 353 350 ?   ?   ?   B . n 
B 1 354 THR 354 351 ?   ?   ?   B . n 
B 1 355 VAL 355 352 ?   ?   ?   B . n 
B 1 356 VAL 356 353 ?   ?   ?   B . n 
B 1 357 ILE 357 354 ?   ?   ?   B . n 
B 1 358 LEU 358 355 ?   ?   ?   B . n 
B 1 359 ASP 359 356 ?   ?   ?   B . n 
B 1 360 HIS 360 357 ?   ?   ?   B . n 
B 1 361 LEU 361 358 ?   ?   ?   B . n 
B 1 362 GLY 362 359 ?   ?   ?   B . n 
B 1 363 ASN 363 360 ?   ?   ?   B . n 
B 1 364 ASN 364 361 ?   ?   ?   B . n 
B 1 365 ARG 365 362 ?   ?   ?   B . n 
B 1 366 THR 366 363 ?   ?   ?   B . n 
B 1 367 VAL 367 364 ?   ?   ?   B . n 
B 1 368 SER 368 365 ?   ?   ?   B . n 
B 1 369 ILE 369 366 ?   ?   ?   B . n 
B 1 370 ASP 370 367 ?   ?   ?   B . n 
B 1 371 ASN 371 368 ?   ?   ?   B . n 
B 1 372 LEU 372 369 ?   ?   ?   B . n 
B 1 373 LYS 373 370 ?   ?   ?   B . n 
B 1 374 PRO 374 371 ?   ?   ?   B . n 
B 1 375 THR 375 372 ?   ?   ?   B . n 
B 1 376 SER 376 373 ?   ?   ?   B . n 
B 1 377 HIS 377 374 ?   ?   ?   B . n 
B 1 378 GLN 378 375 ?   ?   ?   B . n 
B 1 379 ASN 379 376 ?   ?   ?   B . n 
B 1 380 GLY 380 377 ?   ?   ?   B . n 
B 1 381 THR 381 378 ?   ?   ?   B . n 
B 1 382 THR 382 379 ?   ?   ?   B . n 
B 1 383 ASN 383 380 ?   ?   ?   B . n 
B 1 384 ASP 384 381 ?   ?   ?   B . n 
B 1 385 THR 385 382 ?   ?   ?   B . n 
B 1 386 ALA 386 383 ?   ?   ?   B . n 
B 1 387 THR 387 384 ?   ?   ?   B . n 
B 1 388 MET 388 385 ?   ?   ?   B . n 
B 1 389 ASP 389 386 ?   ?   ?   B . n 
B 1 390 HIS 390 387 ?   ?   ?   B . n 
B 1 391 LEU 391 388 ?   ?   ?   B . n 
B 1 392 GLU 392 389 ?   ?   ?   B . n 
B 1 393 LYS 393 390 ?   ?   ?   B . n 
B 1 394 ASN 394 391 ?   ?   ?   B . n 
B 1 395 GLU 395 392 ?   ?   ?   B . n 
C 2 1   DA  1   1   1   DA  DA  C . n 
C 2 2   DT  2   2   2   DT  DT  C . n 
C 2 3   DT  3   3   3   DT  DT  C . n 
C 2 4   DG  4   4   4   DG  DG  C . n 
C 2 5   DT  5   5   5   DT  DT  C . n 
C 2 6   DC  6   6   6   DC  DC  C . n 
C 2 7   DA  7   7   7   DA  DA  C . n 
C 2 8   DT  8   8   8   DT  DT  C . n 
C 2 9   DG  9   9   9   DG  DG  C . n 
C 2 10  DG  10  10  10  DG  DG  C . n 
C 2 11  DA  11  11  11  DA  DA  C . n 
C 2 12  DA  12  12  12  DA  DA  C . n 
C 2 13  DT  13  13  13  DT  DT  C . n 
C 2 14  DT  14  14  14  DT  DT  C . n 
C 2 15  DT  15  15  15  DT  DT  C . n 
C 2 16  DC  16  16  16  DC  DC  C . n 
C 2 17  DG  17  17  17  DG  DG  C . n 
C 2 18  DC  18  18  18  DC  DC  C . n 
C 2 19  DA  19  19  19  DA  DA  C . n 
D 3 1   DT  1   1   1   DT  DT  D . n 
D 3 2   DG  2   2   2   DG  DG  D . n 
D 3 3   DC  3   3   3   DC  DC  D . n 
D 3 4   DG  4   4   4   DG  DG  D . n 
D 3 5   DA  5   5   5   DA  DA  D . n 
D 3 6   DA  6   6   6   DA  DA  D . n 
D 3 7   DA  7   7   7   DA  DA  D . n 
D 3 8   DT  8   8   8   DT  DT  D . n 
D 3 9   DT  9   9   9   DT  DT  D . n 
D 3 10  DC  10  10  10  DC  DC  D . n 
D 3 11  DC  11  11  11  DC  DC  D . n 
D 3 12  DA  12  12  12  DA  DA  D . n 
D 3 13  DT  13  13  13  DT  DT  D . n 
D 3 14  DG  14  14  14  DG  DG  D . n 
D 3 15  DA  15  15  15  DA  DA  D . n 
D 3 16  DC  16  16  16  DC  DC  D . n 
D 3 17  DA  17  17  17  DA  A   D . n 
# 
_struct_site_keywords.site_id   1 
_struct_site_keywords.text      'OUTSIDE BINDER' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 27900 ? 
1 MORE         -247  ? 
1 'SSA (A^2)'  57360 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -62.0695000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OAG ? M RLT .   ? A RLT 398 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 97.6  ? 
2  OAG ? M RLT .   ? A RLT 398 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 O   ? Q HOH .   ? A HOH 534 ? 1_555 80.5  ? 
3  OD1 ? A ASP 188 ? A ASP 185 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 O   ? Q HOH .   ? A HOH 534 ? 1_555 166.5 ? 
4  OAG ? M RLT .   ? A RLT 398 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 164.9 ? 
5  OD1 ? A ASP 188 ? A ASP 185 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 97.3  ? 
6  O   ? Q HOH .   ? A HOH 534 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 85.6  ? 
7  OAG ? M RLT .   ? A RLT 398 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 O   ? Q HOH .   ? A HOH 401 ? 1_555 96.3  ? 
8  OD1 ? A ASP 188 ? A ASP 185 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 O   ? Q HOH .   ? A HOH 401 ? 1_555 88.8  ? 
9  O   ? Q HOH .   ? A HOH 534 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 O   ? Q HOH .   ? A HOH 401 ? 1_555 78.2  ? 
10 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 O   ? Q HOH .   ? A HOH 401 ? 1_555 86.4  ? 
11 OAG ? M RLT .   ? A RLT 398 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 OAH ? M RLT .   ? A RLT 398 ? 1_555 81.5  ? 
12 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 OAH ? M RLT .   ? A RLT 398 ? 1_555 106.0 ? 
13 O   ? Q HOH .   ? A HOH 534 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 OAH ? M RLT .   ? A RLT 398 ? 1_555 87.0  ? 
14 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 OAH ? M RLT .   ? A RLT 398 ? 1_555 92.1  ? 
15 O   ? Q HOH .   ? A HOH 401 ? 1_555 MG ? K MG . ? A MG 396 ? 1_555 OAH ? M RLT .   ? A RLT 398 ? 1_555 165.1 ? 
16 NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 ND1 ? A HIS 69  ? A HIS 66  ? 1_555 101.8 ? 
17 NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 100.4 ? 
18 ND1 ? A HIS 69  ? A HIS 66  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 116.8 ? 
19 NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96  ? 1_555 109.7 ? 
20 ND1 ? A HIS 69  ? A HIS 66  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96  ? 1_555 105.1 ? 
21 SG  ? A CYS 102 ? A CYS 99  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96  ? 1_555 121.2 ? 
22 OAH ? M RLT .   ? A RLT 398 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 OAE ? M RLT .   ? A RLT 398 ? 1_555 81.2  ? 
23 OAH ? M RLT .   ? A RLT 398 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 93.1  ? 
24 OAE ? M RLT .   ? A RLT 398 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 91.1  ? 
25 OAH ? M RLT .   ? A RLT 398 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 94.3  ? 
26 OAE ? M RLT .   ? A RLT 398 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 174.1 ? 
27 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 85.3  ? 
28 OAH ? M RLT .   ? A RLT 398 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 O   ? Q HOH .   ? A HOH 400 ? 1_555 90.6  ? 
29 OAE ? M RLT .   ? A RLT 398 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 O   ? Q HOH .   ? A HOH 400 ? 1_555 97.3  ? 
30 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 O   ? Q HOH .   ? A HOH 400 ? 1_555 171.3 ? 
31 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 O   ? Q HOH .   ? A HOH 400 ? 1_555 86.6  ? 
32 OAH ? M RLT .   ? A RLT 398 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 156.4 ? 
33 OAE ? M RLT .   ? A RLT 398 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 94.6  ? 
34 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 63.6  ? 
35 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 88.0  ? 
36 O   ? Q HOH .   ? A HOH 400 ? 1_555 MG ? L MG . ? A MG 397 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 113.0 ? 
37 O   ? R HOH .   ? B HOH 396 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 O   ? R HOH .   ? B HOH 395 ? 1_555 90.2  ? 
38 O   ? R HOH .   ? B HOH 396 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 OD1 ? B ASP 188 ? B ASP 185 ? 1_555 81.6  ? 
39 O   ? R HOH .   ? B HOH 395 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 OD1 ? B ASP 188 ? B ASP 185 ? 1_555 171.0 ? 
40 O   ? R HOH .   ? B HOH 396 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 92.6  ? 
41 O   ? R HOH .   ? B HOH 395 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 90.3  ? 
42 OD1 ? B ASP 188 ? B ASP 185 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 93.7  ? 
43 O   ? R HOH .   ? B HOH 396 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 O   ? R HOH .   ? B HOH 433 ? 1_555 157.0 ? 
44 O   ? R HOH .   ? B HOH 395 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 O   ? R HOH .   ? B HOH 433 ? 1_555 96.5  ? 
45 OD1 ? B ASP 188 ? B ASP 185 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 O   ? R HOH .   ? B HOH 433 ? 1_555 89.7  ? 
46 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 O   ? R HOH .   ? B HOH 433 ? 1_555 109.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-10-20 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .       ?               package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk    'data reduction'  
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/   ?          ? 
2 SCALA       3.3.16  2010/01/06      other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html   Fortran_77 ? 
3 PHASER      .       ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
4 REFMAC      .       ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
5 PDB_EXTRACT 3.10    'June 10, 2010' package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
6 ADSC        Quantum ?               ?       ?                    ?                           'data collection' ? ?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 461 ? ? O A HOH 521 ? ? 1.88 
2 1 O   A HOH 527 ? ? O A HOH 528 ? ? 1.99 
3 1 O   A HOH 528 ? ? O A HOH 529 ? ? 2.05 
4 1 O   C HOH 118 ? ? O C HOH 207 ? ? 2.07 
5 1 OE1 A GLN 98  ? ? O A HOH 448 ? ? 2.08 
6 1 O   B SER 258 ? ? O B LEU 261 ? ? 2.10 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     427 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     533 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   8_554 
_pdbx_validate_symm_contact.dist              2.15 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_1             16 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            "C3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_2             16 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.363 
_pdbx_validate_rmsd_bond.bond_target_value         1.419 
_pdbx_validate_rmsd_bond.bond_deviation            -0.056 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C3'" C DA 1  ? ? "O3'" C DA 1  ? ? P  C DT 2  ? ? 129.21 119.70 9.51  1.20 Y 
2  1 "O4'" C DT 3  ? ? "C1'" C DT 3  ? ? N1 C DT 3  ? ? 113.22 108.30 4.92  0.30 N 
3  1 "O4'" C DG 4  ? ? "C1'" C DG 4  ? ? N9 C DG 4  ? ? 111.87 108.30 3.57  0.30 N 
4  1 "O4'" C DC 6  ? ? "C1'" C DC 6  ? ? N1 C DC 6  ? ? 110.41 108.30 2.11  0.30 N 
5  1 "O4'" C DA 11 ? ? "C1'" C DA 11 ? ? N9 C DA 11 ? ? 103.31 108.00 -4.69 0.70 N 
6  1 "O4'" C DT 13 ? ? "C1'" C DT 13 ? ? N1 C DT 13 ? ? 103.48 108.00 -4.52 0.70 N 
7  1 "O4'" C DG 17 ? ? "C1'" C DG 17 ? ? N9 C DG 17 ? ? 103.72 108.00 -4.28 0.70 N 
8  1 "O4'" D DT 1  ? ? "C1'" D DT 1  ? ? N1 D DT 1  ? ? 110.31 108.30 2.01  0.30 N 
9  1 "C3'" D DT 1  ? ? "O3'" D DT 1  ? ? P  D DG 2  ? ? 127.48 119.70 7.78  1.20 Y 
10 1 "O4'" D DC 11 ? ? "C1'" D DC 11 ? ? N1 D DC 11 ? ? 111.69 108.30 3.39  0.30 N 
11 1 "O4'" D DA 12 ? ? "C1'" D DA 12 ? ? N9 D DA 12 ? ? 101.64 108.00 -6.36 0.70 N 
12 1 "O4'" D DA 15 ? ? "C1'" D DA 15 ? ? N9 D DA 15 ? ? 112.78 108.30 4.48  0.30 N 
13 1 "O4'" D DA 17 ? A "C1'" D DA 17 ? A N9 D DA 17 ? A 110.13 108.30 1.83  0.30 N 
14 1 N7    D DA 17 ? A C8    D DA 17 ? A N9 D DA 17 ? A 116.90 113.80 3.10  0.50 N 
15 1 C8    D DA 17 ? A N9    D DA 17 ? A C4 D DA 17 ? A 102.30 105.80 -3.50 0.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 33  ? ? -172.89 128.44  
2  1 PHE A 122 ? ? 77.20   -4.66   
3  1 GLU A 201 ? ? -39.64  -31.60  
4  1 HIS A 357 ? ? 76.53   -16.84  
5  1 PHE B 122 ? ? 77.37   -1.74   
6  1 GLN B 186 ? ? -98.67  41.30   
7  1 TYR B 212 ? ? 66.93   -9.83   
8  1 HIS B 213 ? ? -118.94 76.83   
9  1 SER B 216 ? ? -110.63 -107.03 
10 1 LEU B 284 ? ? 66.22   -12.94  
11 1 ILE B 298 ? ? -95.58  34.22   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 8   ? CG  ? A LEU 11  CG  
2  1 Y 1 A LEU 8   ? CD1 ? A LEU 11  CD1 
3  1 Y 1 A LEU 8   ? CD2 ? A LEU 11  CD2 
4  1 Y 1 A LYS 26  ? CG  ? A LYS 29  CG  
5  1 Y 1 A LYS 26  ? CD  ? A LYS 29  CD  
6  1 Y 1 A LYS 26  ? CE  ? A LYS 29  CE  
7  1 Y 1 A LYS 26  ? NZ  ? A LYS 29  NZ  
8  1 Y 1 A LYS 241 ? CG  ? A LYS 244 CG  
9  1 Y 1 A LYS 241 ? CD  ? A LYS 244 CD  
10 1 Y 1 A LYS 241 ? CE  ? A LYS 244 CE  
11 1 Y 1 A LYS 241 ? NZ  ? A LYS 244 NZ  
12 1 Y 1 A ARG 329 ? CG  ? A ARG 332 CG  
13 1 Y 1 A ARG 329 ? CD  ? A ARG 332 CD  
14 1 Y 1 A ARG 329 ? NE  ? A ARG 332 NE  
15 1 Y 1 A ARG 329 ? CZ  ? A ARG 332 CZ  
16 1 Y 1 A ARG 329 ? NH1 ? A ARG 332 NH1 
17 1 Y 1 A ARG 329 ? NH2 ? A ARG 332 NH2 
18 1 Y 1 B LYS 241 ? CG  ? B LYS 244 CG  
19 1 Y 1 B LYS 241 ? CD  ? B LYS 244 CD  
20 1 Y 1 B LYS 241 ? CE  ? B LYS 244 CE  
21 1 Y 1 B LYS 241 ? NZ  ? B LYS 244 NZ  
22 1 Y 1 B LYS 262 ? CG  ? B LYS 265 CG  
23 1 Y 1 B LYS 262 ? CD  ? B LYS 265 CD  
24 1 Y 1 B LYS 262 ? CE  ? B LYS 265 CE  
25 1 Y 1 B LYS 262 ? NZ  ? B LYS 265 NZ  
26 1 Y 1 B GLN 281 ? CG  ? B GLN 284 CG  
27 1 Y 1 B GLN 281 ? CD  ? B GLN 284 CD  
28 1 Y 1 B GLN 281 ? OE1 ? B GLN 284 OE1 
29 1 Y 1 B GLN 281 ? NE2 ? B GLN 284 NE2 
30 1 Y 1 B LEU 292 ? CG  ? B LEU 295 CG  
31 1 Y 1 B LEU 292 ? CD1 ? B LEU 295 CD1 
32 1 Y 1 B LEU 292 ? CD2 ? B LEU 295 CD2 
33 1 Y 1 B LEU 294 ? CG  ? B LEU 297 CG  
34 1 Y 1 B LEU 294 ? CD1 ? B LEU 297 CD1 
35 1 Y 1 B LEU 294 ? CD2 ? B LEU 297 CD2 
36 1 Y 1 B GLN 296 ? CG  ? B GLN 299 CG  
37 1 Y 1 B GLN 296 ? CD  ? B GLN 299 CD  
38 1 Y 1 B GLN 296 ? OE1 ? B GLN 299 OE1 
39 1 Y 1 B GLN 296 ? NE2 ? B GLN 299 NE2 
40 1 Y 1 B ARG 299 ? CG  ? B ARG 302 CG  
41 1 Y 1 B ARG 299 ? CD  ? B ARG 302 CD  
42 1 Y 1 B ARG 299 ? NE  ? B ARG 302 NE  
43 1 Y 1 B ARG 299 ? CZ  ? B ARG 302 CZ  
44 1 Y 1 B ARG 299 ? NH1 ? B ARG 302 NH1 
45 1 Y 1 B ARG 299 ? NH2 ? B ARG 302 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY -2  ? A GLY 1   
2   1 Y 1 A PRO -1  ? A PRO 2   
3   1 Y 1 A GLY 0   ? A GLY 3   
4   1 Y 1 A CYS 1   ? A CYS 4   
5   1 Y 1 A ASN 2   ? A ASN 5   
6   1 Y 1 A THR 3   ? A THR 6   
7   1 Y 1 A LYS 4   ? A LYS 7   
8   1 Y 1 A LYS 5   ? A LYS 8   
9   1 Y 1 A PRO 6   ? A PRO 9   
10  1 Y 1 A ASN 7   ? A ASN 10  
11  1 Y 1 A ASN 376 ? A ASN 379 
12  1 Y 1 A GLY 377 ? A GLY 380 
13  1 Y 1 A THR 378 ? A THR 381 
14  1 Y 1 A THR 379 ? A THR 382 
15  1 Y 1 A ASN 380 ? A ASN 383 
16  1 Y 1 A ASP 381 ? A ASP 384 
17  1 Y 1 A THR 382 ? A THR 385 
18  1 Y 1 A ALA 383 ? A ALA 386 
19  1 Y 1 A THR 384 ? A THR 387 
20  1 Y 1 A MET 385 ? A MET 388 
21  1 Y 1 A ASP 386 ? A ASP 389 
22  1 Y 1 A HIS 387 ? A HIS 390 
23  1 Y 1 A LEU 388 ? A LEU 391 
24  1 Y 1 A GLU 389 ? A GLU 392 
25  1 Y 1 A LYS 390 ? A LYS 393 
26  1 Y 1 A ASN 391 ? A ASN 394 
27  1 Y 1 A GLU 392 ? A GLU 395 
28  1 Y 1 B GLY -2  ? B GLY 1   
29  1 Y 1 B PRO -1  ? B PRO 2   
30  1 Y 1 B GLY 0   ? B GLY 3   
31  1 Y 1 B CYS 1   ? B CYS 4   
32  1 Y 1 B ASN 2   ? B ASN 5   
33  1 Y 1 B THR 3   ? B THR 6   
34  1 Y 1 B LYS 4   ? B LYS 7   
35  1 Y 1 B LYS 5   ? B LYS 8   
36  1 Y 1 B PRO 6   ? B PRO 9   
37  1 Y 1 B ASN 7   ? B ASN 10  
38  1 Y 1 B LEU 8   ? B LEU 11  
39  1 Y 1 B ASP 9   ? B ASP 12  
40  1 Y 1 B ALA 10  ? B ALA 13  
41  1 Y 1 B GLU 11  ? B GLU 14  
42  1 Y 1 B LEU 12  ? B LEU 15  
43  1 Y 1 B ASP 13  ? B ASP 16  
44  1 Y 1 B GLN 14  ? B GLN 17  
45  1 Y 1 B LEU 15  ? B LEU 18  
46  1 Y 1 B LEU 16  ? B LEU 19  
47  1 Y 1 B GLN 17  ? B GLN 20  
48  1 Y 1 B GLY 18  ? B GLY 21  
49  1 Y 1 B HIS 19  ? B HIS 22  
50  1 Y 1 B TYR 20  ? B TYR 23  
51  1 Y 1 B ILE 21  ? B ILE 24  
52  1 Y 1 B LYS 22  ? B LYS 25  
53  1 Y 1 B GLY 23  ? B GLY 26  
54  1 Y 1 B TYR 24  ? B TYR 27  
55  1 Y 1 B PRO 25  ? B PRO 28  
56  1 Y 1 B LYS 26  ? B LYS 29  
57  1 Y 1 B GLN 27  ? B GLN 30  
58  1 Y 1 B TYR 28  ? B TYR 31  
59  1 Y 1 B THR 29  ? B THR 32  
60  1 Y 1 B TYR 30  ? B TYR 33  
61  1 Y 1 B PHE 31  ? B PHE 34  
62  1 Y 1 B LEU 32  ? B LEU 35  
63  1 Y 1 B GLU 33  ? B GLU 36  
64  1 Y 1 B ASP 34  ? B ASP 37  
65  1 Y 1 B GLY 35  ? B GLY 38  
66  1 Y 1 B LYS 36  ? B LYS 39  
67  1 Y 1 B VAL 37  ? B VAL 40  
68  1 Y 1 B LYS 38  ? B LYS 41  
69  1 Y 1 B VAL 39  ? B VAL 42  
70  1 Y 1 B SER 40  ? B SER 43  
71  1 Y 1 B ARG 41  ? B ARG 44  
72  1 Y 1 B PRO 42  ? B PRO 45  
73  1 Y 1 B GLU 43  ? B GLU 46  
74  1 Y 1 B GLY 44  ? B GLY 47  
75  1 Y 1 B VAL 45  ? B VAL 48  
76  1 Y 1 B LYS 46  ? B LYS 49  
77  1 Y 1 B ILE 47  ? B ILE 50  
78  1 Y 1 B ILE 48  ? B ILE 51  
79  1 Y 1 B PRO 49  ? B PRO 52  
80  1 Y 1 B PRO 50  ? B PRO 53  
81  1 Y 1 B GLN 51  ? B GLN 54  
82  1 Y 1 B SER 52  ? B SER 55  
83  1 Y 1 B ASP 53  ? B ASP 56  
84  1 Y 1 B ARG 54  ? B ARG 57  
85  1 Y 1 B GLN 55  ? B GLN 58  
86  1 Y 1 B LYS 56  ? B LYS 59  
87  1 Y 1 B ILE 57  ? B ILE 60  
88  1 Y 1 B VAL 58  ? B VAL 61  
89  1 Y 1 B LEU 59  ? B LEU 62  
90  1 Y 1 B GLN 60  ? B GLN 63  
91  1 Y 1 B ALA 61  ? B ALA 64  
92  1 Y 1 B HIS 62  ? B HIS 65  
93  1 Y 1 B ASN 63  ? B ASN 66  
94  1 Y 1 B LEU 64  ? B LEU 67  
95  1 Y 1 B ALA 65  ? B ALA 68  
96  1 Y 1 B HIS 66  ? B HIS 69  
97  1 Y 1 B THR 67  ? B THR 70  
98  1 Y 1 B GLY 68  ? B GLY 71  
99  1 Y 1 B ARG 69  ? B ARG 72  
100 1 Y 1 B GLU 70  ? B GLU 73  
101 1 Y 1 B ALA 71  ? B ALA 74  
102 1 Y 1 B THR 72  ? B THR 75  
103 1 Y 1 B LEU 73  ? B LEU 76  
104 1 Y 1 B LEU 74  ? B LEU 77  
105 1 Y 1 B LYS 75  ? B LYS 78  
106 1 Y 1 B ILE 76  ? B ILE 79  
107 1 Y 1 B ALA 77  ? B ALA 80  
108 1 Y 1 B ASN 78  ? B ASN 81  
109 1 Y 1 B LEU 79  ? B LEU 82  
110 1 Y 1 B TYR 80  ? B TYR 83  
111 1 Y 1 B TRP 81  ? B TRP 84  
112 1 Y 1 B TRP 82  ? B TRP 85  
113 1 Y 1 B PRO 83  ? B PRO 86  
114 1 Y 1 B ASN 84  ? B ASN 87  
115 1 Y 1 B MET 85  ? B MET 88  
116 1 Y 1 B ARG 86  ? B ARG 89  
117 1 Y 1 B LYS 87  ? B LYS 90  
118 1 Y 1 B ASP 88  ? B ASP 91  
119 1 Y 1 B VAL 89  ? B VAL 92  
120 1 Y 1 B VAL 90  ? B VAL 93  
121 1 Y 1 B LYS 91  ? B LYS 94  
122 1 Y 1 B GLN 92  ? B GLN 95  
123 1 Y 1 B LEU 93  ? B LEU 96  
124 1 Y 1 B GLY 94  ? B GLY 97  
125 1 Y 1 B ARG 95  ? B ARG 98  
126 1 Y 1 B CYS 96  ? B CYS 99  
127 1 Y 1 B GLN 97  ? B GLN 100 
128 1 Y 1 B GLN 98  ? B GLN 101 
129 1 Y 1 B CYS 99  ? B CYS 102 
130 1 Y 1 B LEU 100 ? B LEU 103 
131 1 Y 1 B ILE 101 ? B ILE 104 
132 1 Y 1 B THR 102 ? B THR 105 
133 1 Y 1 B ASN 103 ? B ASN 106 
134 1 Y 1 B ALA 104 ? B ALA 107 
135 1 Y 1 B SER 105 ? B SER 108 
136 1 Y 1 B ASN 106 ? B ASN 109 
137 1 Y 1 B LYS 107 ? B LYS 110 
138 1 Y 1 B ALA 108 ? B ALA 111 
139 1 Y 1 B SER 109 ? B SER 112 
140 1 Y 1 B GLY 110 ? B GLY 113 
141 1 Y 1 B PRO 111 ? B PRO 114 
142 1 Y 1 B ILE 112 ? B ILE 115 
143 1 Y 1 B LEU 113 ? B LEU 116 
144 1 Y 1 B ARG 114 ? B ARG 117 
145 1 Y 1 B PRO 115 ? B PRO 118 
146 1 Y 1 B THR 300 ? B THR 303 
147 1 Y 1 B SER 301 ? B SER 304 
148 1 Y 1 B LEU 302 ? B LEU 305 
149 1 Y 1 B TYR 303 ? B TYR 306 
150 1 Y 1 B HIS 304 ? B HIS 307 
151 1 Y 1 B PRO 305 ? B PRO 308 
152 1 Y 1 B SER 306 ? B SER 309 
153 1 Y 1 B THR 307 ? B THR 310 
154 1 Y 1 B PRO 308 ? B PRO 311 
155 1 Y 1 B PRO 309 ? B PRO 312 
156 1 Y 1 B ALA 310 ? B ALA 313 
157 1 Y 1 B SER 311 ? B SER 314 
158 1 Y 1 B SER 312 ? B SER 315 
159 1 Y 1 B ARG 313 ? B ARG 316 
160 1 Y 1 B SER 314 ? B SER 317 
161 1 Y 1 B TRP 315 ? B TRP 318 
162 1 Y 1 B SER 316 ? B SER 319 
163 1 Y 1 B PRO 317 ? B PRO 320 
164 1 Y 1 B VAL 318 ? B VAL 321 
165 1 Y 1 B VAL 319 ? B VAL 322 
166 1 Y 1 B GLY 320 ? B GLY 323 
167 1 Y 1 B GLN 321 ? B GLN 324 
168 1 Y 1 B LEU 322 ? B LEU 325 
169 1 Y 1 B VAL 323 ? B VAL 326 
170 1 Y 1 B GLN 324 ? B GLN 327 
171 1 Y 1 B GLU 325 ? B GLU 328 
172 1 Y 1 B ARG 326 ? B ARG 329 
173 1 Y 1 B VAL 327 ? B VAL 330 
174 1 Y 1 B ALA 328 ? B ALA 331 
175 1 Y 1 B ARG 329 ? B ARG 332 
176 1 Y 1 B PRO 330 ? B PRO 333 
177 1 Y 1 B ALA 331 ? B ALA 334 
178 1 Y 1 B SER 332 ? B SER 335 
179 1 Y 1 B LEU 333 ? B LEU 336 
180 1 Y 1 B ARG 334 ? B ARG 337 
181 1 Y 1 B PRO 335 ? B PRO 338 
182 1 Y 1 B ARG 336 ? B ARG 339 
183 1 Y 1 B TRP 337 ? B TRP 340 
184 1 Y 1 B HIS 338 ? B HIS 341 
185 1 Y 1 B LYS 339 ? B LYS 342 
186 1 Y 1 B PRO 340 ? B PRO 343 
187 1 Y 1 B SER 341 ? B SER 344 
188 1 Y 1 B THR 342 ? B THR 345 
189 1 Y 1 B VAL 343 ? B VAL 346 
190 1 Y 1 B LEU 344 ? B LEU 347 
191 1 Y 1 B LYS 345 ? B LYS 348 
192 1 Y 1 B VAL 346 ? B VAL 349 
193 1 Y 1 B LEU 347 ? B LEU 350 
194 1 Y 1 B ASN 348 ? B ASN 351 
195 1 Y 1 B PRO 349 ? B PRO 352 
196 1 Y 1 B ARG 350 ? B ARG 353 
197 1 Y 1 B THR 351 ? B THR 354 
198 1 Y 1 B VAL 352 ? B VAL 355 
199 1 Y 1 B VAL 353 ? B VAL 356 
200 1 Y 1 B ILE 354 ? B ILE 357 
201 1 Y 1 B LEU 355 ? B LEU 358 
202 1 Y 1 B ASP 356 ? B ASP 359 
203 1 Y 1 B HIS 357 ? B HIS 360 
204 1 Y 1 B LEU 358 ? B LEU 361 
205 1 Y 1 B GLY 359 ? B GLY 362 
206 1 Y 1 B ASN 360 ? B ASN 363 
207 1 Y 1 B ASN 361 ? B ASN 364 
208 1 Y 1 B ARG 362 ? B ARG 365 
209 1 Y 1 B THR 363 ? B THR 366 
210 1 Y 1 B VAL 364 ? B VAL 367 
211 1 Y 1 B SER 365 ? B SER 368 
212 1 Y 1 B ILE 366 ? B ILE 369 
213 1 Y 1 B ASP 367 ? B ASP 370 
214 1 Y 1 B ASN 368 ? B ASN 371 
215 1 Y 1 B LEU 369 ? B LEU 372 
216 1 Y 1 B LYS 370 ? B LYS 373 
217 1 Y 1 B PRO 371 ? B PRO 374 
218 1 Y 1 B THR 372 ? B THR 375 
219 1 Y 1 B SER 373 ? B SER 376 
220 1 Y 1 B HIS 374 ? B HIS 377 
221 1 Y 1 B GLN 375 ? B GLN 378 
222 1 Y 1 B ASN 376 ? B ASN 379 
223 1 Y 1 B GLY 377 ? B GLY 380 
224 1 Y 1 B THR 378 ? B THR 381 
225 1 Y 1 B THR 379 ? B THR 382 
226 1 Y 1 B ASN 380 ? B ASN 383 
227 1 Y 1 B ASP 381 ? B ASP 384 
228 1 Y 1 B THR 382 ? B THR 385 
229 1 Y 1 B ALA 383 ? B ALA 386 
230 1 Y 1 B THR 384 ? B THR 387 
231 1 Y 1 B MET 385 ? B MET 388 
232 1 Y 1 B ASP 386 ? B ASP 389 
233 1 Y 1 B HIS 387 ? B HIS 390 
234 1 Y 1 B LEU 388 ? B LEU 391 
235 1 Y 1 B GLU 389 ? B GLU 392 
236 1 Y 1 B LYS 390 ? B LYS 393 
237 1 Y 1 B ASN 391 ? B ASN 394 
238 1 Y 1 B GLU 392 ? B GLU 395 
# 
_ndb_struct_conf_na.entry_id   3OYA 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 4  1_555 D DC 16 1_555 -0.121 -0.003 -0.719 -34.572 -18.988 -3.844 1  C_DG4:DC16_D  C 4  ? D 16 ? 19 1 
1 C DT 5  1_555 D DA 15 1_555 -0.011 -0.230 0.106  -15.675 -5.231  0.642  2  C_DT5:DA15_D  C 5  ? D 15 ? 20 1 
1 C DC 6  1_555 D DG 14 1_555 0.166  -0.073 -0.059 -0.162  2.449   0.094  3  C_DC6:DG14_D  C 6  ? D 14 ? 19 1 
1 C DA 7  1_555 D DT 13 1_555 -0.079 -0.154 -0.260 -2.280  -15.945 -2.990 4  C_DA7:DT13_D  C 7  ? D 13 ? 20 1 
1 C DT 8  1_555 D DA 12 1_555 0.052  -0.157 0.083  -7.941  -15.571 5.274  5  C_DT8:DA12_D  C 8  ? D 12 ? 20 1 
1 C DG 9  1_555 D DC 11 1_555 0.079  -0.149 0.176  8.408   5.971   -3.637 6  C_DG9:DC11_D  C 9  ? D 11 ? 19 1 
1 C DG 10 1_555 D DC 10 1_555 -0.281 -0.114 0.046  14.680  -8.684  -0.976 7  C_DG10:DC10_D C 10 ? D 10 ? 19 1 
1 C DA 11 1_555 D DT 9  1_555 0.096  -0.177 -0.092 4.225   -10.701 3.637  8  C_DA11:DT9_D  C 11 ? D 9  ? 20 1 
1 C DA 12 1_555 D DT 8  1_555 0.184  -0.096 0.111  -0.930  -12.770 1.626  9  C_DA12:DT8_D  C 12 ? D 8  ? 20 1 
1 C DT 13 1_555 D DA 7  1_555 0.058  -0.242 0.000  -0.489  -15.327 0.875  10 C_DT13:DA7_D  C 13 ? D 7  ? 20 1 
1 C DT 14 1_555 D DA 6  1_555 -0.108 -0.303 -0.160 -3.451  -15.461 -1.395 11 C_DT14:DA6_D  C 14 ? D 6  ? 20 1 
1 C DT 15 1_555 D DA 5  1_555 -0.121 -0.225 -0.184 -2.864  -11.485 -4.349 12 C_DT15:DA5_D  C 15 ? D 5  ? 20 1 
1 C DC 16 1_555 D DG 4  1_555 0.147  -0.041 -0.057 -4.511  -12.603 1.948  13 C_DC16:DG4_D  C 16 ? D 4  ? 19 1 
1 C DG 17 1_555 D DC 3  1_555 -0.067 -0.344 -0.102 -2.822  -11.309 -0.731 14 C_DG17:DC3_D  C 17 ? D 3  ? 19 1 
1 C DC 18 1_555 D DG 2  1_555 -0.181 -0.238 -0.141 5.638   1.002   0.709  15 C_DC18:DG2_D  C 18 ? D 2  ? 19 1 
1 C DA 19 1_555 D DT 1  1_555 -0.152 -0.311 -0.542 -3.616  -9.625  8.935  16 C_DA19:DT1_D  C 19 ? D 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 4  1_555 D DC 16 1_555 C DT 5  1_555 D DA 15 1_555 0.736  0.078  2.881 -5.462 4.430  35.506 -0.415 -1.851 2.731 7.177  
8.850  36.174 1  CC_DG4DT5:DA15DC16_DD  C 4  ? D 16 ? C 5  ? D 15 ? 
1 C DT 5  1_555 D DA 15 1_555 C DC 6  1_555 D DG 14 1_555 0.403  0.750  3.108 0.665  7.470  30.003 -0.012 -0.630 3.205 14.152 
-1.260 30.905 2  CC_DT5DC6:DG14DA15_DD  C 5  ? D 15 ? C 6  ? D 14 ? 
1 C DC 6  1_555 D DG 14 1_555 C DA 7  1_555 D DT 13 1_555 -1.541 0.967  3.405 -1.764 7.827  35.393 0.364  2.207  3.601 12.674 
2.857  36.263 3  CC_DC6DA7:DT13DG14_DD  C 6  ? D 14 ? C 7  ? D 13 ? 
1 C DA 7  1_555 D DT 13 1_555 C DT 8  1_555 D DA 12 1_555 0.556  -0.348 3.348 -1.257 4.542  31.167 -1.498 -1.261 3.242 8.393  
2.323  31.513 4  CC_DA7DT8:DA12DT13_DD  C 7  ? D 13 ? C 8  ? D 12 ? 
1 C DT 8  1_555 D DA 12 1_555 C DG 9  1_555 D DC 11 1_555 0.622  1.922  3.003 1.761  4.748  39.583 2.294  -0.717 3.226 6.977  
-2.587 39.893 5  CC_DT8DG9:DC11DA12_DD  C 8  ? D 12 ? C 9  ? D 11 ? 
1 C DG 9  1_555 D DC 11 1_555 C DG 10 1_555 D DC 10 1_555 -0.783 0.510  3.187 0.280  5.636  29.486 -0.160 1.569  3.219 10.947 
-0.544 30.009 6  CC_DG9DG10:DC10DC11_DD C 9  ? D 11 ? C 10 ? D 10 ? 
1 C DG 10 1_555 D DC 10 1_555 C DA 11 1_555 D DT 9  1_555 0.097  -0.098 3.496 1.580  3.215  40.425 -0.524 0.048  3.480 4.641  
-2.281 40.577 7  CC_DG10DA11:DT9DC10_DD C 10 ? D 10 ? C 11 ? D 9  ? 
1 C DA 11 1_555 D DT 9  1_555 C DA 12 1_555 D DT 8  1_555 -0.345 -0.007 3.260 -3.066 -1.975 39.459 0.221  0.150  3.273 -2.917 
4.529  39.621 8  CC_DA11DA12:DT8DT9_DD  C 11 ? D 9  ? C 12 ? D 8  ? 
1 C DA 12 1_555 D DT 8  1_555 C DT 13 1_555 D DA 7  1_555 -0.159 -0.525 3.160 0.535  -2.424 32.750 -0.526 0.371  3.187 -4.291 
-0.946 32.841 9  CC_DA12DT13:DA7DT8_DD  C 12 ? D 8  ? C 13 ? D 7  ? 
1 C DT 13 1_555 D DA 7  1_555 C DT 14 1_555 D DA 6  1_555 -0.065 -0.287 3.265 1.504  -4.414 37.463 0.127  0.295  3.271 -6.840 
-2.330 37.742 10 CC_DT13DT14:DA6DA7_DD  C 13 ? D 7  ? C 14 ? D 6  ? 
1 C DT 14 1_555 D DA 6  1_555 C DT 15 1_555 D DA 5  1_555 0.092  -0.047 3.221 1.178  -3.505 39.686 0.331  0.000  3.214 -5.150 
-1.731 39.851 11 CC_DT14DT15:DA5DA6_DD  C 14 ? D 6  ? C 15 ? D 5  ? 
1 C DT 15 1_555 D DA 5  1_555 C DC 16 1_555 D DG 4  1_555 0.040  -0.089 3.285 -1.507 0.479  35.299 -0.218 -0.289 3.279 0.790  
2.484  35.334 12 CC_DT15DC16:DG4DA5_DD  C 15 ? D 5  ? C 16 ? D 4  ? 
1 C DC 16 1_555 D DG 4  1_555 C DG 17 1_555 D DC 3  1_555 -0.238 0.823  3.354 -1.994 14.370 35.247 -0.711 0.092  3.430 22.585 
3.134  38.028 13 CC_DC16DG17:DC3DG4_DD  C 16 ? D 4  ? C 17 ? D 3  ? 
1 C DG 17 1_555 D DC 3  1_555 C DC 18 1_555 D DG 2  1_555 0.761  -0.253 3.072 -1.338 0.906  28.901 -0.692 -1.798 3.025 1.814  
2.678  28.945 14 CC_DG17DC18:DG2DC3_DD  C 17 ? D 3  ? C 18 ? D 2  ? 
1 C DC 18 1_555 D DG 2  1_555 C DA 19 1_555 D DT 1  1_555 0.704  -0.033 3.669 4.294  13.556 29.473 -2.737 -0.404 3.397 24.901 
-7.888 32.655 15 CC_DC18DA19:DT1DG2_DD  C 18 ? D 2  ? C 19 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4  'ZINC ION' ZN  
5  'SULFATE ION' SO4 
6  GLYCEROL GOL 
7  'AMMONIUM ION' NH4 
8  'MAGNESIUM ION' MG  
9  
;N-(4-fluorobenzyl)-5-hydroxy-1-methyl-2-(1-methyl-1-{[(5-methyl-1,3,4-oxadiazol-2-yl)carbonyl]amino}ethyl)-6-oxo-1,6-dihydropyrimidine-4-carboxamide
;
RLT 
10 water HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4  ZN  1   393 393 ZN  ZN  A . 
F 5  SO4 1   394 2   SO4 SO4 A . 
G 6  GOL 1   801 801 GOL GOL A . 
H 6  GOL 1   802 802 GOL GOL A . 
I 6  GOL 1   805 805 GOL GOL A . 
J 7  NH4 1   395 3   NH4 NH4 A . 
K 8  MG  1   396 1   MG  MG  A . 
L 8  MG  1   397 1   MG  MG  A . 
M 9  RLT 1   398 1   RLT RLT A . 
N 5  SO4 1   393 1   SO4 SO4 B . 
O 6  GOL 1   803 803 GOL GOL B . 
P 8  MG  1   394 1   MG  MG  B . 
Q 10 HOH 1   399 25  HOH HOH A . 
Q 10 HOH 2   400 4   HOH HOH A . 
Q 10 HOH 3   401 5   HOH HOH A . 
Q 10 HOH 4   402 8   HOH HOH A . 
Q 10 HOH 5   403 10  HOH HOH A . 
Q 10 HOH 6   404 11  HOH HOH A . 
Q 10 HOH 7   405 17  HOH HOH A . 
Q 10 HOH 8   406 18  HOH HOH A . 
Q 10 HOH 9   407 20  HOH HOH A . 
Q 10 HOH 10  408 25  HOH HOH A . 
Q 10 HOH 11  409 26  HOH HOH A . 
Q 10 HOH 12  410 28  HOH HOH A . 
Q 10 HOH 13  411 29  HOH HOH A . 
Q 10 HOH 14  412 30  HOH HOH A . 
Q 10 HOH 15  413 31  HOH HOH A . 
Q 10 HOH 16  414 32  HOH HOH A . 
Q 10 HOH 17  415 33  HOH HOH A . 
Q 10 HOH 18  416 34  HOH HOH A . 
Q 10 HOH 19  417 35  HOH HOH A . 
Q 10 HOH 20  418 42  HOH HOH A . 
Q 10 HOH 21  419 43  HOH HOH A . 
Q 10 HOH 22  420 44  HOH HOH A . 
Q 10 HOH 23  421 45  HOH HOH A . 
Q 10 HOH 24  422 46  HOH HOH A . 
Q 10 HOH 25  423 47  HOH HOH A . 
Q 10 HOH 26  424 50  HOH HOH A . 
Q 10 HOH 27  425 52  HOH HOH A . 
Q 10 HOH 28  426 56  HOH HOH A . 
Q 10 HOH 29  427 59  HOH HOH A . 
Q 10 HOH 30  428 62  HOH HOH A . 
Q 10 HOH 31  429 63  HOH HOH A . 
Q 10 HOH 32  430 65  HOH HOH A . 
Q 10 HOH 33  431 68  HOH HOH A . 
Q 10 HOH 34  432 70  HOH HOH A . 
Q 10 HOH 35  433 71  HOH HOH A . 
Q 10 HOH 36  434 77  HOH HOH A . 
Q 10 HOH 37  435 78  HOH HOH A . 
Q 10 HOH 38  436 79  HOH HOH A . 
Q 10 HOH 39  437 80  HOH HOH A . 
Q 10 HOH 40  438 81  HOH HOH A . 
Q 10 HOH 41  439 82  HOH HOH A . 
Q 10 HOH 42  440 84  HOH HOH A . 
Q 10 HOH 43  441 86  HOH HOH A . 
Q 10 HOH 44  442 87  HOH HOH A . 
Q 10 HOH 45  443 94  HOH HOH A . 
Q 10 HOH 46  444 95  HOH HOH A . 
Q 10 HOH 47  445 96  HOH HOH A . 
Q 10 HOH 48  446 97  HOH HOH A . 
Q 10 HOH 49  447 98  HOH HOH A . 
Q 10 HOH 50  448 99  HOH HOH A . 
Q 10 HOH 51  449 100 HOH HOH A . 
Q 10 HOH 52  450 102 HOH HOH A . 
Q 10 HOH 53  451 103 HOH HOH A . 
Q 10 HOH 54  452 104 HOH HOH A . 
Q 10 HOH 55  453 105 HOH HOH A . 
Q 10 HOH 56  454 106 HOH HOH A . 
Q 10 HOH 57  455 110 HOH HOH A . 
Q 10 HOH 58  456 112 HOH HOH A . 
Q 10 HOH 59  457 113 HOH HOH A . 
Q 10 HOH 60  458 114 HOH HOH A . 
Q 10 HOH 61  459 115 HOH HOH A . 
Q 10 HOH 62  460 116 HOH HOH A . 
Q 10 HOH 63  461 119 HOH HOH A . 
Q 10 HOH 64  462 121 HOH HOH A . 
Q 10 HOH 65  463 122 HOH HOH A . 
Q 10 HOH 66  464 124 HOH HOH A . 
Q 10 HOH 67  465 127 HOH HOH A . 
Q 10 HOH 68  466 128 HOH HOH A . 
Q 10 HOH 69  467 129 HOH HOH A . 
Q 10 HOH 70  468 131 HOH HOH A . 
Q 10 HOH 71  469 132 HOH HOH A . 
Q 10 HOH 72  470 133 HOH HOH A . 
Q 10 HOH 73  471 134 HOH HOH A . 
Q 10 HOH 74  472 137 HOH HOH A . 
Q 10 HOH 75  473 139 HOH HOH A . 
Q 10 HOH 76  474 140 HOH HOH A . 
Q 10 HOH 77  475 141 HOH HOH A . 
Q 10 HOH 78  476 142 HOH HOH A . 
Q 10 HOH 79  477 151 HOH HOH A . 
Q 10 HOH 80  478 158 HOH HOH A . 
Q 10 HOH 81  479 162 HOH HOH A . 
Q 10 HOH 82  480 165 HOH HOH A . 
Q 10 HOH 83  481 166 HOH HOH A . 
Q 10 HOH 84  482 167 HOH HOH A . 
Q 10 HOH 85  483 168 HOH HOH A . 
Q 10 HOH 86  484 169 HOH HOH A . 
Q 10 HOH 87  485 170 HOH HOH A . 
Q 10 HOH 88  486 171 HOH HOH A . 
Q 10 HOH 89  487 176 HOH HOH A . 
Q 10 HOH 90  488 177 HOH HOH A . 
Q 10 HOH 91  489 181 HOH HOH A . 
Q 10 HOH 92  490 182 HOH HOH A . 
Q 10 HOH 93  491 186 HOH HOH A . 
Q 10 HOH 94  492 188 HOH HOH A . 
Q 10 HOH 95  493 190 HOH HOH A . 
Q 10 HOH 96  494 193 HOH HOH A . 
Q 10 HOH 97  495 194 HOH HOH A . 
Q 10 HOH 98  496 208 HOH HOH A . 
Q 10 HOH 99  497 211 HOH HOH A . 
Q 10 HOH 100 498 212 HOH HOH A . 
Q 10 HOH 101 499 214 HOH HOH A . 
Q 10 HOH 102 500 223 HOH HOH A . 
Q 10 HOH 103 501 227 HOH HOH A . 
Q 10 HOH 104 502 228 HOH HOH A . 
Q 10 HOH 105 503 231 HOH HOH A . 
Q 10 HOH 106 504 232 HOH HOH A . 
Q 10 HOH 107 505 241 HOH HOH A . 
Q 10 HOH 108 506 242 HOH HOH A . 
Q 10 HOH 109 507 243 HOH HOH A . 
Q 10 HOH 110 508 244 HOH HOH A . 
Q 10 HOH 111 509 248 HOH HOH A . 
Q 10 HOH 112 510 249 HOH HOH A . 
Q 10 HOH 113 511 255 HOH HOH A . 
Q 10 HOH 114 512 261 HOH HOH A . 
Q 10 HOH 115 513 262 HOH HOH A . 
Q 10 HOH 116 514 271 HOH HOH A . 
Q 10 HOH 117 515 276 HOH HOH A . 
Q 10 HOH 118 516 278 HOH HOH A . 
Q 10 HOH 119 517 279 HOH HOH A . 
Q 10 HOH 120 518 283 HOH HOH A . 
Q 10 HOH 121 519 284 HOH HOH A . 
Q 10 HOH 122 520 285 HOH HOH A . 
Q 10 HOH 123 521 286 HOH HOH A . 
Q 10 HOH 124 522 290 HOH HOH A . 
Q 10 HOH 125 523 295 HOH HOH A . 
Q 10 HOH 126 524 307 HOH HOH A . 
Q 10 HOH 127 525 309 HOH HOH A . 
Q 10 HOH 128 526 310 HOH HOH A . 
Q 10 HOH 129 527 311 HOH HOH A . 
Q 10 HOH 130 528 312 HOH HOH A . 
Q 10 HOH 131 529 313 HOH HOH A . 
Q 10 HOH 132 530 315 HOH HOH A . 
Q 10 HOH 133 531 318 HOH HOH A . 
Q 10 HOH 134 532 320 HOH HOH A . 
Q 10 HOH 135 533 324 HOH HOH A . 
Q 10 HOH 136 534 325 HOH HOH A . 
Q 10 HOH 137 535 327 HOH HOH A . 
Q 10 HOH 138 536 329 HOH HOH A . 
Q 10 HOH 139 537 330 HOH HOH A . 
Q 10 HOH 140 538 334 HOH HOH A . 
Q 10 HOH 141 539 337 HOH HOH A . 
R 10 HOH 1   395 2   HOH HOH B . 
R 10 HOH 2   396 3   HOH HOH B . 
R 10 HOH 3   397 12  HOH HOH B . 
R 10 HOH 4   398 13  HOH HOH B . 
R 10 HOH 5   399 14  HOH HOH B . 
R 10 HOH 6   400 15  HOH HOH B . 
R 10 HOH 7   401 16  HOH HOH B . 
R 10 HOH 8   402 51  HOH HOH B . 
R 10 HOH 9   403 53  HOH HOH B . 
R 10 HOH 10  404 66  HOH HOH B . 
R 10 HOH 11  405 67  HOH HOH B . 
R 10 HOH 12  406 73  HOH HOH B . 
R 10 HOH 13  407 74  HOH HOH B . 
R 10 HOH 14  408 75  HOH HOH B . 
R 10 HOH 15  409 76  HOH HOH B . 
R 10 HOH 16  410 111 HOH HOH B . 
R 10 HOH 17  411 117 HOH HOH B . 
R 10 HOH 18  412 153 HOH HOH B . 
R 10 HOH 19  413 161 HOH HOH B . 
R 10 HOH 20  414 172 HOH HOH B . 
R 10 HOH 21  415 179 HOH HOH B . 
R 10 HOH 22  416 180 HOH HOH B . 
R 10 HOH 23  417 189 HOH HOH B . 
R 10 HOH 24  418 210 HOH HOH B . 
R 10 HOH 25  419 213 HOH HOH B . 
R 10 HOH 26  420 217 HOH HOH B . 
R 10 HOH 27  421 219 HOH HOH B . 
R 10 HOH 28  422 222 HOH HOH B . 
R 10 HOH 29  423 236 HOH HOH B . 
R 10 HOH 30  424 247 HOH HOH B . 
R 10 HOH 31  425 252 HOH HOH B . 
R 10 HOH 32  426 256 HOH HOH B . 
R 10 HOH 33  427 257 HOH HOH B . 
R 10 HOH 34  428 260 HOH HOH B . 
R 10 HOH 35  429 272 HOH HOH B . 
R 10 HOH 36  430 274 HOH HOH B . 
R 10 HOH 37  431 314 HOH HOH B . 
R 10 HOH 38  432 323 HOH HOH B . 
R 10 HOH 39  433 331 HOH HOH B . 
R 10 HOH 40  434 332 HOH HOH B . 
R 10 HOH 41  435 333 HOH HOH B . 
S 10 HOH 1   21  21  HOH HOH C . 
S 10 HOH 2   22  22  HOH HOH C . 
S 10 HOH 3   23  23  HOH HOH C . 
S 10 HOH 4   27  27  HOH HOH C . 
S 10 HOH 5   39  39  HOH HOH C . 
S 10 HOH 6   40  40  HOH HOH C . 
S 10 HOH 7   41  41  HOH HOH C . 
S 10 HOH 8   48  48  HOH HOH C . 
S 10 HOH 9   54  54  HOH HOH C . 
S 10 HOH 10  58  58  HOH HOH C . 
S 10 HOH 11  64  64  HOH HOH C . 
S 10 HOH 12  90  90  HOH HOH C . 
S 10 HOH 13  91  91  HOH HOH C . 
S 10 HOH 14  92  92  HOH HOH C . 
S 10 HOH 15  93  93  HOH HOH C . 
S 10 HOH 16  118 118 HOH HOH C . 
S 10 HOH 17  120 120 HOH HOH C . 
S 10 HOH 18  125 125 HOH HOH C . 
S 10 HOH 19  145 145 HOH HOH C . 
S 10 HOH 20  147 147 HOH HOH C . 
S 10 HOH 21  155 155 HOH HOH C . 
S 10 HOH 22  157 157 HOH HOH C . 
S 10 HOH 23  159 159 HOH HOH C . 
S 10 HOH 24  191 191 HOH HOH C . 
S 10 HOH 25  192 192 HOH HOH C . 
S 10 HOH 26  207 207 HOH HOH C . 
S 10 HOH 27  253 253 HOH HOH C . 
S 10 HOH 28  254 254 HOH HOH C . 
S 10 HOH 29  277 277 HOH HOH C . 
S 10 HOH 30  291 291 HOH HOH C . 
S 10 HOH 31  304 304 HOH HOH C . 
S 10 HOH 32  317 317 HOH HOH C . 
S 10 HOH 33  319 319 HOH HOH C . 
S 10 HOH 34  328 328 HOH HOH C . 
S 10 HOH 35  335 335 HOH HOH C . 
S 10 HOH 36  336 336 HOH HOH C . 
T 10 HOH 1   36  36  HOH HOH D . 
T 10 HOH 2   37  37  HOH HOH D . 
T 10 HOH 3   38  38  HOH HOH D . 
T 10 HOH 4   60  60  HOH HOH D . 
T 10 HOH 5   136 136 HOH HOH D . 
T 10 HOH 6   143 143 HOH HOH D . 
T 10 HOH 7   184 184 HOH HOH D . 
T 10 HOH 8   196 196 HOH HOH D . 
T 10 HOH 9   205 205 HOH HOH D . 
T 10 HOH 10  235 235 HOH HOH D . 
T 10 HOH 11  259 259 HOH HOH D . 
T 10 HOH 12  265 265 HOH HOH D . 
T 10 HOH 13  266 266 HOH HOH D . 
T 10 HOH 14  289 289 HOH HOH D . 
T 10 HOH 15  302 302 HOH HOH D . 
T 10 HOH 16  322 322 HOH HOH D . 
#