data_3OYG
# 
_entry.id   3OYG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OYG         
NDB   NA0791       
RCSB  RCSB061729   
WWPDB D_1000061729 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3DLR 'Catalytic core domain of PFV integrase'                  unspecified 
PDB 3L2Q 'PFV intasome in apo form'                                unspecified 
PDB 3L2R 'PFV intasome in complex with magnesium'                  unspecified 
PDB 3L2U 'PFV intasome in complex with magnesium and elvitegravir' unspecified 
PDB 3L2V 'PFV intasome in complex with manganese and raltegravir'  unspecified 
PDB 3L2W 'PFV intasome in complex with manganese and elvitegravir' unspecified 
PDB 3OY9 'PFV intasome in complex with manganese'                  unspecified 
PDB 3OYA 'PFV intasome in complex with magnesium and raltegravir'  unspecified 
PDB 3OYB 'PFV intasome in complex with magnesium and MK2048'       unspecified 
PDB 3OYC 'PFV intasome in complex with magnesium and PICA'         unspecified 
PDB 3OYD 'PFV intasome in complex with magnesium and GS9160'       unspecified 
PDB 3OYE 'PFV intasome in complex with magnesium and COMPOUND2'    unspecified 
PDB 3OYF 'PFV intasome in complex with magnesium and L870810'      unspecified 
PDB 3OYG 'PFV intasome in complex with magnesium and COMPOUND G'   unspecified 
PDB 3OYH 'PFV intasome in complex with magnesium and MK0536'       unspecified 
PDB 3OYI 'S217Q PFV intasome in complex with manganese'            unspecified 
PDB 3OYJ 'S217Q PFV intasome in complex with magnesium and MK2048' unspecified 
PDB 3OYK 'S217H PFV intasome in complex with manganese'            unspecified 
PDB 3OYL 'S217H PFV intasome in complex with magnesium and MK2048' unspecified 
PDB 3OYM 'N224H PFV intasome in complex with manganese'            unspecified 
PDB 3OYN 'N224H PFV intasome in complex with magnesium and MK2048' unspecified 
# 
_pdbx_database_status.entry_id                        3OYG 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-23 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hare, S.'       1 
'Cherepanov, P.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            107 
_citation.page_first                20057 
_citation.page_last                 20062 
_citation.year                      2010 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21030679 
_citation.pdbx_database_id_DOI      10.1073/pnas.1010246107 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hare, S.'       1 
primary 'Vos, A.M.'      2 
primary 'Clayton, R.F.'  3 
primary 'Thuring, J.W.'  4 
primary 'Cummings, M.D.' 5 
primary 'Cherepanov, P.' 6 
# 
_cell.length_a           160.060 
_cell.length_b           160.060 
_cell.length_c           123.510 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3OYG 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.entry_id                         3OYG 
_symmetry.Int_Tables_number                92 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'PFV integrase' 44456.695 2   ? ? 'UNP residues 752 to 1143' ? 
2  polymer     syn 
;DNA (5'-D(*AP*TP*TP*GP*TP*CP*AP*TP*GP*GP*AP*AP*TP*TP*TP*CP*GP*CP*A)-3')
;
5834.794  1   ? ? ?                          '19 nucleotide preprocessed PFV donor DNA (non-transferred strand)' 
3  polymer     syn 
;DNA (5'-D(*TP*GP*CP*GP*AP*AP*AP*TP*TP*CP*CP*AP*TP*GP*AP*CP*A)-3')
;
5195.399  1   ? ? ?                          '17 nucleotide preprocessed PFV donor DNA (transferred strand)'     
4  non-polymer syn 'ZINC ION' 65.409    1   ? ? ?                          ? 
5  non-polymer syn 'SULFATE ION' 96.063    2   ? ? ?                          ? 
6  non-polymer syn GLYCEROL 92.094    4   ? ? ?                          ? 
7  non-polymer syn 'AMMONIUM ION' 18.038    1   ? ? ?                          ? 
8  non-polymer syn 'MAGNESIUM ION' 24.305    3   ? ? ?                          ? 
9  non-polymer syn 
;(6S)-2-(3-chloro-4-fluorobenzyl)-8-ethyl-10-hydroxy-6-methyl-4-(5-methyl-1,1-dioxido-1,2,5-thiadiazolidin-2-yl)-7,8-dihydropyrazino[1',2':1,5]pyrrolo[2,3-d]pyridazine-1,9(2H,6H)-dione
;
538.980   1   ? ? ?                          ?                                                                   
10 water       nat water 18.015    240 ? ? ?                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        p42In 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
A,B ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DT)(DG)(DT)(DC)(DA)(DT)(DG)(DG)(DA)(DA)(DT)(DT)(DT)(DC)(DG)(DC)(DA)' ATTGTCATGGAATTTCGCA 
C   ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DG)(DA)(DA)(DA)(DT)(DT)(DC)(DC)(DA)(DT)(DG)(DA)(DC)(DA)' TGCGAAATTCCATGACA D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   CYS n 
1 5   ASN n 
1 6   THR n 
1 7   LYS n 
1 8   LYS n 
1 9   PRO n 
1 10  ASN n 
1 11  LEU n 
1 12  ASP n 
1 13  ALA n 
1 14  GLU n 
1 15  LEU n 
1 16  ASP n 
1 17  GLN n 
1 18  LEU n 
1 19  LEU n 
1 20  GLN n 
1 21  GLY n 
1 22  HIS n 
1 23  TYR n 
1 24  ILE n 
1 25  LYS n 
1 26  GLY n 
1 27  TYR n 
1 28  PRO n 
1 29  LYS n 
1 30  GLN n 
1 31  TYR n 
1 32  THR n 
1 33  TYR n 
1 34  PHE n 
1 35  LEU n 
1 36  GLU n 
1 37  ASP n 
1 38  GLY n 
1 39  LYS n 
1 40  VAL n 
1 41  LYS n 
1 42  VAL n 
1 43  SER n 
1 44  ARG n 
1 45  PRO n 
1 46  GLU n 
1 47  GLY n 
1 48  VAL n 
1 49  LYS n 
1 50  ILE n 
1 51  ILE n 
1 52  PRO n 
1 53  PRO n 
1 54  GLN n 
1 55  SER n 
1 56  ASP n 
1 57  ARG n 
1 58  GLN n 
1 59  LYS n 
1 60  ILE n 
1 61  VAL n 
1 62  LEU n 
1 63  GLN n 
1 64  ALA n 
1 65  HIS n 
1 66  ASN n 
1 67  LEU n 
1 68  ALA n 
1 69  HIS n 
1 70  THR n 
1 71  GLY n 
1 72  ARG n 
1 73  GLU n 
1 74  ALA n 
1 75  THR n 
1 76  LEU n 
1 77  LEU n 
1 78  LYS n 
1 79  ILE n 
1 80  ALA n 
1 81  ASN n 
1 82  LEU n 
1 83  TYR n 
1 84  TRP n 
1 85  TRP n 
1 86  PRO n 
1 87  ASN n 
1 88  MET n 
1 89  ARG n 
1 90  LYS n 
1 91  ASP n 
1 92  VAL n 
1 93  VAL n 
1 94  LYS n 
1 95  GLN n 
1 96  LEU n 
1 97  GLY n 
1 98  ARG n 
1 99  CYS n 
1 100 GLN n 
1 101 GLN n 
1 102 CYS n 
1 103 LEU n 
1 104 ILE n 
1 105 THR n 
1 106 ASN n 
1 107 ALA n 
1 108 SER n 
1 109 ASN n 
1 110 LYS n 
1 111 ALA n 
1 112 SER n 
1 113 GLY n 
1 114 PRO n 
1 115 ILE n 
1 116 LEU n 
1 117 ARG n 
1 118 PRO n 
1 119 ASP n 
1 120 ARG n 
1 121 PRO n 
1 122 GLN n 
1 123 LYS n 
1 124 PRO n 
1 125 PHE n 
1 126 ASP n 
1 127 LYS n 
1 128 PHE n 
1 129 PHE n 
1 130 ILE n 
1 131 ASP n 
1 132 TYR n 
1 133 ILE n 
1 134 GLY n 
1 135 PRO n 
1 136 LEU n 
1 137 PRO n 
1 138 PRO n 
1 139 SER n 
1 140 GLN n 
1 141 GLY n 
1 142 TYR n 
1 143 LEU n 
1 144 TYR n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 VAL n 
1 149 VAL n 
1 150 ASP n 
1 151 GLY n 
1 152 MET n 
1 153 THR n 
1 154 GLY n 
1 155 PHE n 
1 156 THR n 
1 157 TRP n 
1 158 LEU n 
1 159 TYR n 
1 160 PRO n 
1 161 THR n 
1 162 LYS n 
1 163 ALA n 
1 164 PRO n 
1 165 SER n 
1 166 THR n 
1 167 SER n 
1 168 ALA n 
1 169 THR n 
1 170 VAL n 
1 171 LYS n 
1 172 SER n 
1 173 LEU n 
1 174 ASN n 
1 175 VAL n 
1 176 LEU n 
1 177 THR n 
1 178 SER n 
1 179 ILE n 
1 180 ALA n 
1 181 ILE n 
1 182 PRO n 
1 183 LYS n 
1 184 VAL n 
1 185 ILE n 
1 186 HIS n 
1 187 SER n 
1 188 ASP n 
1 189 GLN n 
1 190 GLY n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 THR n 
1 195 SER n 
1 196 SER n 
1 197 THR n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 TRP n 
1 202 ALA n 
1 203 LYS n 
1 204 GLU n 
1 205 ARG n 
1 206 GLY n 
1 207 ILE n 
1 208 HIS n 
1 209 LEU n 
1 210 GLU n 
1 211 PHE n 
1 212 SER n 
1 213 THR n 
1 214 PRO n 
1 215 TYR n 
1 216 HIS n 
1 217 PRO n 
1 218 GLN n 
1 219 SER n 
1 220 SER n 
1 221 GLY n 
1 222 LYS n 
1 223 VAL n 
1 224 GLU n 
1 225 ARG n 
1 226 LYS n 
1 227 ASN n 
1 228 SER n 
1 229 ASP n 
1 230 ILE n 
1 231 LYS n 
1 232 ARG n 
1 233 LEU n 
1 234 LEU n 
1 235 THR n 
1 236 LYS n 
1 237 LEU n 
1 238 LEU n 
1 239 VAL n 
1 240 GLY n 
1 241 ARG n 
1 242 PRO n 
1 243 THR n 
1 244 LYS n 
1 245 TRP n 
1 246 TYR n 
1 247 ASP n 
1 248 LEU n 
1 249 LEU n 
1 250 PRO n 
1 251 VAL n 
1 252 VAL n 
1 253 GLN n 
1 254 LEU n 
1 255 ALA n 
1 256 LEU n 
1 257 ASN n 
1 258 ASN n 
1 259 THR n 
1 260 TYR n 
1 261 SER n 
1 262 PRO n 
1 263 VAL n 
1 264 LEU n 
1 265 LYS n 
1 266 TYR n 
1 267 THR n 
1 268 PRO n 
1 269 HIS n 
1 270 GLN n 
1 271 LEU n 
1 272 LEU n 
1 273 PHE n 
1 274 GLY n 
1 275 ILE n 
1 276 ASP n 
1 277 SER n 
1 278 ASN n 
1 279 THR n 
1 280 PRO n 
1 281 PHE n 
1 282 ALA n 
1 283 ASN n 
1 284 GLN n 
1 285 ASP n 
1 286 THR n 
1 287 LEU n 
1 288 ASP n 
1 289 LEU n 
1 290 THR n 
1 291 ARG n 
1 292 GLU n 
1 293 GLU n 
1 294 GLU n 
1 295 LEU n 
1 296 SER n 
1 297 LEU n 
1 298 LEU n 
1 299 GLN n 
1 300 GLU n 
1 301 ILE n 
1 302 ARG n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 TYR n 
1 307 HIS n 
1 308 PRO n 
1 309 SER n 
1 310 THR n 
1 311 PRO n 
1 312 PRO n 
1 313 ALA n 
1 314 SER n 
1 315 SER n 
1 316 ARG n 
1 317 SER n 
1 318 TRP n 
1 319 SER n 
1 320 PRO n 
1 321 VAL n 
1 322 VAL n 
1 323 GLY n 
1 324 GLN n 
1 325 LEU n 
1 326 VAL n 
1 327 GLN n 
1 328 GLU n 
1 329 ARG n 
1 330 VAL n 
1 331 ALA n 
1 332 ARG n 
1 333 PRO n 
1 334 ALA n 
1 335 SER n 
1 336 LEU n 
1 337 ARG n 
1 338 PRO n 
1 339 ARG n 
1 340 TRP n 
1 341 HIS n 
1 342 LYS n 
1 343 PRO n 
1 344 SER n 
1 345 THR n 
1 346 VAL n 
1 347 LEU n 
1 348 LYS n 
1 349 VAL n 
1 350 LEU n 
1 351 ASN n 
1 352 PRO n 
1 353 ARG n 
1 354 THR n 
1 355 VAL n 
1 356 VAL n 
1 357 ILE n 
1 358 LEU n 
1 359 ASP n 
1 360 HIS n 
1 361 LEU n 
1 362 GLY n 
1 363 ASN n 
1 364 ASN n 
1 365 ARG n 
1 366 THR n 
1 367 VAL n 
1 368 SER n 
1 369 ILE n 
1 370 ASP n 
1 371 ASN n 
1 372 LEU n 
1 373 LYS n 
1 374 PRO n 
1 375 THR n 
1 376 SER n 
1 377 HIS n 
1 378 GLN n 
1 379 ASN n 
1 380 GLY n 
1 381 THR n 
1 382 THR n 
1 383 ASN n 
1 384 ASP n 
1 385 THR n 
1 386 ALA n 
1 387 THR n 
1 388 MET n 
1 389 ASP n 
1 390 HIS n 
1 391 LEU n 
1 392 GLU n 
1 393 LYS n 
1 394 ASN n 
1 395 GLU n 
2 1   DA  n 
2 2   DT  n 
2 3   DT  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
2 9   DG  n 
2 10  DG  n 
2 11  DA  n 
2 12  DA  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DC  n 
2 17  DG  n 
2 18  DC  n 
2 19  DA  n 
3 1   DT  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DA  n 
3 6   DA  n 
3 7   DA  n 
3 8   DT  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DA  n 
3 13  DT  n 
3 14  DG  n 
3 15  DA  n 
3 16  DC  n 
3 17  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'SFVcpz(hu)' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 POL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    HSRV2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human spumaretrovirus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11963 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               PC2 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pSSH6P-PFV-INFL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'Donor DNA non-transferred strand' 
3 1 sample ? ? ? ? ? 'Donor DNA transferred strand'     
# 
loop_
_struct_ref.id 
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 POL_FOAMV UNP 1 P14350 752 
;CNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLY
WWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKA
PSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPT
KWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVG
QLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
? 
2 3OYG      PDB 2 3OYG   ?   ? ? 
3 3OYG      PDB 3 3OYG   ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3OYG A 4 ? 395 ? P14350 752 ? 1143 ? 1 392 
2 1 3OYG B 4 ? 395 ? P14350 752 ? 1143 ? 1 392 
3 2 3OYG C 1 ? 19  ? 3OYG   1   ? 19   ? 1 19  
4 3 3OYG D 1 ? 17  ? 3OYG   1   ? 17   ? 1 17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3OYG GLY A 1   ? UNP P14350 ?   ?   'EXPRESSION TAG' -2  1  
1 3OYG PRO A 2   ? UNP P14350 ?   ?   'EXPRESSION TAG' -1  2  
1 3OYG GLY A 3   ? UNP P14350 ?   ?   'EXPRESSION TAG' 0   3  
1 3OYG SER A 220 ? UNP P14350 GLY 968 VARIANT          217 4  
1 3OYG GLY A 221 ? UNP P14350 SER 969 VARIANT          218 5  
2 3OYG GLY B 1   ? UNP P14350 ?   ?   'EXPRESSION TAG' -2  6  
2 3OYG PRO B 2   ? UNP P14350 ?   ?   'EXPRESSION TAG' -1  7  
2 3OYG GLY B 3   ? UNP P14350 ?   ?   'EXPRESSION TAG' 0   8  
2 3OYG SER B 220 ? UNP P14350 GLY 968 VARIANT          217 9  
2 3OYG GLY B 221 ? UNP P14350 SER 969 VARIANT          218 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'           133.103 
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'         121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'      331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?                               'C9 H14 N3 O7 P'       307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'      347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?                               'C10 H15 N2 O8 P'      322.208 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'           75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'             92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'       156.162 
HOH non-polymer         . WATER ?                               'H2 O'                 18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'        149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                               'Mg 2'                 24.305  
NH4 non-polymer         . 'AMMONIUM ION' ?                               'H4 N 1'               18.038  
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'           115.130 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'           105.093 
SO4 non-polymer         . 'SULFATE ION' ?                               'O4 S -2'              96.063  
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'           119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'          181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'          117.146 
ZN  non-polymer         . 'ZINC ION' ?                               'Zn 2'                 65.409  
ZYO non-polymer         . 
;(6S)-2-(3-chloro-4-fluorobenzyl)-8-ethyl-10-hydroxy-6-methyl-4-(5-methyl-1,1-dioxido-1,2,5-thiadiazolidin-2-yl)-7,8-dihydropyrazino[1',2':1,5]pyrrolo[2,3-d]pyridazine-1,9(2H,6H)-dione
;
?                               'C22 H24 Cl F N6 O5 S' 538.980 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3OYG 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.96 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   68.92 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
;1.35 M ammonium sulfate, 25% (v/v) glycerol, 4.8% (v/v) 1,6-hexanediol, 50 mM Mes-NaOH, 1mM EDTA, pH 6.5, vapor diffusion, hanging drop, temperature 291K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   2010-06-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98011 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 1' 
_diffrn_source.pdbx_wavelength_list        0.98011 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 1' 
# 
_reflns.entry_id                     3OYG 
_reflns.d_resolution_high            2.560 
_reflns.d_resolution_low             39.147 
_reflns.number_all                   ? 
_reflns.number_obs                   50408 
_reflns.pdbx_netI_over_sigmaI        9.700 
_reflns.pdbx_Rsym_value              0.089 
_reflns.pdbx_redundancy              3.900 
_reflns.percent_possible_obs         97.000 
_reflns.observed_criterion_sigma_F   -3 
_reflns.observed_criterion_sigma_I   -3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.560 2.700  ? 24927 ? 0.696 1.6  0.696 ? 3.600 ? 6899 92.600 ? 1  
2.700 2.860  ? 24295 ? 0.460 2.4  0.460 ? 3.600 ? 6702 94.700 ? 2  
2.860 3.060  ? 23449 ? 0.282 3.8  0.282 ? 3.700 ? 6366 95.900 ? 3  
3.060 3.300  ? 22527 ? 0.178 5.9  0.178 ? 3.700 ? 6061 97.500 ? 4  
3.300 3.620  ? 21382 ? 0.116 9.4  0.116 ? 3.800 ? 5689 99.000 ? 5  
3.620 4.050  ? 20292 ? 0.088 12.9 0.088 ? 3.900 ? 5227 99.600 ? 6  
4.050 4.670  ? 19719 ? 0.067 17.4 0.067 ? 4.300 ? 4638 99.800 ? 7  
4.670 5.720  ? 17763 ? 0.064 18.2 0.064 ? 4.500 ? 3974 99.800 ? 8  
5.720 8.100  ? 13221 ? 0.058 22.3 0.058 ? 4.200 ? 3122 99.600 ? 9  
8.100 39.147 ? 7391  ? 0.030 35.0 0.030 ? 4.300 ? 1730 95.400 ? 10 
# 
_refine.entry_id                                 3OYG 
_refine.ls_d_res_high                            2.5600 
_refine.ls_d_res_low                             39.1500 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    96.3900 
_refine.ls_number_reflns_obs                     50238 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.21 
_refine.ls_R_factor_obs                          0.2063 
_refine.ls_R_factor_R_work                       0.2052 
_refine.ls_wR_factor_R_work                      0.2099 
_refine.ls_R_factor_R_free                       0.2266 
_refine.ls_wR_factor_R_free                      0.2363 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  2528 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               56.1964 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            1.1400 
_refine.aniso_B[2][2]                            1.1400 
_refine.aniso_B[3][3]                            -2.2800 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9460 
_refine.correlation_coeff_Fo_to_Fc_free          0.9340 
_refine.overall_SU_R_Cruickshank_DPI             0.2469 
_refine.overall_SU_R_free                        0.2014 
_refine.pdbx_overall_ESU_R_Free                  0.2010 
_refine.overall_SU_ML                            0.1530 
_refine.overall_SU_B                             7.2200 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8501 
_refine.B_iso_max                                142.960 
_refine.B_iso_min                                16.040 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_starting_model                      'PDB entry 3OYB' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4352 
_refine_hist.pdbx_number_atoms_nucleic_acid   732 
_refine_hist.pdbx_number_atoms_ligand         75 
_refine_hist.number_atoms_solvent             240 
_refine_hist.number_atoms_total               5399 
_refine_hist.d_res_high                       2.5600 
_refine_hist.d_res_low                        39.1500 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       5384 0.011  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    7504 1.486  2.160  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 550  5.951  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 185  33.111 23.730 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 727  15.748 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 25   17.834 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         844  0.080  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   3807 0.006  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            2777 0.702  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           4532 1.351  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            2607 1.695  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           2972 2.898  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.5600 
_refine_ls_shell.d_res_low                        2.6260 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               91.1300 
_refine_ls_shell.number_reflns_R_work             3284 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3640 
_refine_ls_shell.R_factor_R_free                  0.3820 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             167 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                3451 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3OYG 
_struct.title                     
'Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium and the INSTI Compound1 (CompoundG)' 
_struct.pdbx_descriptor           'PFV integrase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OYG 
_struct_keywords.text            
;PROTEIN-DNA COMPLEX, TETRAMER, DNA INTEGRATION, ENDONUCLEASE, METAL-BINDING, MULTIFUNCTIONAL ENZYME, NUCLEASE, NUCLEOTIDYLTRANSFERASE, NUCLEUS, TRANSFERASE, VIRAL NUCLEOPROTEIN, VIRION, DNA-BINDING, ZINC BINDING, HHCC MOTIF, VIRAL PROTEIN, RECOMBINATION, INHIBITOR, DNA-BINDING PROTEIN-DNA complex, VIRAL PROTEIN-DNA complex
;
_struct_keywords.pdbx_keywords   'RECOMBINATION,VIRAL PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 6  ? 
I N N 6  ? 
J N N 6  ? 
K N N 7  ? 
L N N 8  ? 
M N N 8  ? 
N N N 9  ? 
O N N 5  ? 
P N N 8  ? 
Q N N 10 ? 
R N N 10 ? 
S N N 10 ? 
T N N 10 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 11  ? GLN A 20  ? LEU A 8   GLN A 17  1 ? 10 
HELX_P HELX_P2  2  PRO A 53  ? LEU A 67  ? PRO A 50  LEU A 64  1 ? 15 
HELX_P HELX_P3  3  GLY A 71  ? ASN A 81  ? GLY A 68  ASN A 78  1 ? 11 
HELX_P HELX_P4  4  ASN A 87  ? GLY A 97  ? ASN A 84  GLY A 94  1 ? 11 
HELX_P HELX_P5  5  CYS A 99  ? ASN A 106 ? CYS A 96  ASN A 103 1 ? 8  
HELX_P HELX_P6  6  SER A 165 ? SER A 178 ? SER A 162 SER A 175 1 ? 14 
HELX_P HELX_P7  7  GLY A 190 ? SER A 195 ? GLY A 187 SER A 192 1 ? 6  
HELX_P HELX_P8  8  SER A 195 ? GLU A 204 ? SER A 192 GLU A 201 1 ? 10 
HELX_P HELX_P9  9  SER A 220 ? VAL A 239 ? SER A 217 VAL A 236 1 ? 20 
HELX_P HELX_P10 10 TRP A 245 ? ASP A 247 ? TRP A 242 ASP A 244 5 ? 3  
HELX_P HELX_P11 11 LEU A 248 ? ASN A 258 ? LEU A 245 ASN A 255 1 ? 11 
HELX_P HELX_P12 12 THR A 267 ? GLY A 274 ? THR A 264 GLY A 271 1 ? 8  
HELX_P HELX_P13 13 THR A 290 ? SER A 304 ? THR A 287 SER A 301 1 ? 15 
HELX_P HELX_P14 14 SER B 165 ? THR B 177 ? SER B 162 THR B 174 1 ? 13 
HELX_P HELX_P15 15 GLY B 190 ? SER B 195 ? GLY B 187 SER B 192 1 ? 6  
HELX_P HELX_P16 16 SER B 195 ? ARG B 205 ? SER B 192 ARG B 202 1 ? 11 
HELX_P HELX_P17 17 SER B 220 ? VAL B 239 ? SER B 217 VAL B 236 1 ? 20 
HELX_P HELX_P18 18 LYS B 244 ? ASN B 258 ? LYS B 241 ASN B 255 1 ? 15 
HELX_P HELX_P19 19 THR B 267 ? GLY B 274 ? THR B 264 GLY B 271 1 ? 8  
HELX_P HELX_P20 20 THR B 290 ? SER B 296 ? THR B 287 SER B 293 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? L MG  .   MG  ? ? ? 1_555 Q HOH .  O   ? ? A MG  396 A HOH 534 1_555 ? ? ? ? ? ? ?            1.853 ? 
metalc2  metalc ? ? A HIS 65  NE2 ? ? ? 1_555 E ZN  .  ZN  ? ? A HIS 62  A ZN  393 1_555 ? ? ? ? ? ? ?            1.970 ? 
metalc3  metalc ? ? M MG  .   MG  ? ? ? 1_555 N ZYO .  OAE ? ? A MG  397 A ZYO 398 1_555 ? ? ? ? ? ? ?            1.979 ? 
metalc4  metalc ? ? A GLU 224 OE2 ? ? ? 1_555 M MG  .  MG  ? ? A GLU 221 A MG  397 1_555 ? ? ? ? ? ? ?            1.998 ? 
metalc5  metalc ? ? M MG  .   MG  ? ? ? 1_555 T HOH .  O   ? ? A MG  397 D HOH 26  1_555 ? ? ? ? ? ? ?            2.031 ? 
metalc6  metalc ? ? L MG  .   MG  ? ? ? 1_555 N ZYO .  OAD ? ? A MG  396 A ZYO 398 1_555 ? ? ? ? ? ? ?            2.071 ? 
metalc7  metalc ? ? A HIS 69  ND1 ? ? ? 1_555 E ZN  .  ZN  ? ? A HIS 66  A ZN  393 1_555 ? ? ? ? ? ? ?            2.085 ? 
metalc8  metalc ? ? A GLU 224 OE1 ? ? ? 1_555 M MG  .  MG  ? ? A GLU 221 A MG  397 1_555 ? ? ? ? ? ? ?            2.108 ? 
metalc9  metalc ? ? A ASP 131 OD2 ? ? ? 1_555 M MG  .  MG  ? ? A ASP 128 A MG  397 1_555 ? ? ? ? ? ? ?            2.116 ? 
metalc10 metalc ? ? L MG  .   MG  ? ? ? 1_555 N ZYO .  OAH ? ? A MG  396 A ZYO 398 1_555 ? ? ? ? ? ? ?            2.118 ? 
metalc11 metalc ? ? A ASP 188 OD1 ? ? ? 1_555 L MG  .  MG  ? ? A ASP 185 A MG  396 1_555 ? ? ? ? ? ? ?            2.152 ? 
metalc12 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 L MG  .  MG  ? ? A ASP 128 A MG  396 1_555 ? ? ? ? ? ? ?            2.164 ? 
metalc13 metalc ? ? L MG  .   MG  ? ? ? 1_555 Q HOH .  O   ? ? A MG  396 A HOH 399 1_555 ? ? ? ? ? ? ?            2.174 ? 
metalc14 metalc ? ? A CYS 99  SG  ? ? ? 1_555 E ZN  .  ZN  ? ? A CYS 96  A ZN  393 1_555 ? ? ? ? ? ? ?            2.182 ? 
metalc15 metalc ? ? M MG  .   MG  ? ? ? 1_555 N ZYO .  OAH ? ? A MG  397 A ZYO 398 1_555 ? ? ? ? ? ? ?            2.188 ? 
metalc16 metalc ? ? B ASP 188 OD1 ? ? ? 1_555 P MG  .  MG  ? ? B ASP 185 B MG  394 1_555 ? ? ? ? ? ? ?            2.188 ? 
metalc17 metalc ? ? P MG  .   MG  ? ? ? 1_555 R HOH .  O   ? ? B MG  394 B HOH 395 1_555 ? ? ? ? ? ? ?            2.264 ? 
metalc18 metalc ? ? A CYS 102 SG  ? ? ? 1_555 E ZN  .  ZN  ? ? A CYS 99  A ZN  393 1_555 ? ? ? ? ? ? ?            2.270 ? 
metalc19 metalc ? ? P MG  .   MG  ? ? ? 1_555 R HOH .  O   ? ? B MG  394 B HOH 435 1_555 ? ? ? ? ? ? ?            2.376 ? 
metalc20 metalc ? ? B ASP 131 OD1 ? ? ? 1_555 P MG  .  MG  ? ? B ASP 128 B MG  394 1_555 ? ? ? ? ? ? ?            2.509 ? 
hydrog1  hydrog ? ? C DG  4   N1  ? ? ? 1_555 D DC  16 N3  ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  4   N2  ? ? ? 1_555 D DC  16 O2  ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  4   O6  ? ? ? 1_555 D DC  16 N4  ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DT  5   N3  ? ? ? 1_555 D DA  15 N1  ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DT  5   O4  ? ? ? 1_555 D DA  15 N6  ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DC  6   N3  ? ? ? 1_555 D DG  14 N1  ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DC  6   N4  ? ? ? 1_555 D DG  14 O6  ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DC  6   O2  ? ? ? 1_555 D DG  14 N2  ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DA  7   N1  ? ? ? 1_555 D DT  13 N3  ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DA  7   N6  ? ? ? 1_555 D DT  13 O4  ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DT  8   N3  ? ? ? 1_555 D DA  12 N1  ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DT  8   O4  ? ? ? 1_555 D DA  12 N6  ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DG  9   N1  ? ? ? 1_555 D DC  11 N3  ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DG  9   N2  ? ? ? 1_555 D DC  11 O2  ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DG  9   O6  ? ? ? 1_555 D DC  11 N4  ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DG  10  N1  ? ? ? 1_555 D DC  10 N3  ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DG  10  N2  ? ? ? 1_555 D DC  10 O2  ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  10  O6  ? ? ? 1_555 D DC  10 N4  ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DA  11  N1  ? ? ? 1_555 D DT  9  N3  ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DA  11  N6  ? ? ? 1_555 D DT  9  O4  ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DA  12  N1  ? ? ? 1_555 D DT  8  N3  ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DA  12  N6  ? ? ? 1_555 D DT  8  O4  ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DT  13  N3  ? ? ? 1_555 D DA  7  N1  ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DT  13  O4  ? ? ? 1_555 D DA  7  N6  ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DT  14  N3  ? ? ? 1_555 D DA  6  N1  ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DT  14  O4  ? ? ? 1_555 D DA  6  N6  ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DT  15  N3  ? ? ? 1_555 D DA  5  N1  ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DT  15  O4  ? ? ? 1_555 D DA  5  N6  ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DC  16  N3  ? ? ? 1_555 D DG  4  N1  ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DC  16  N4  ? ? ? 1_555 D DG  4  O6  ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DC  16  O2  ? ? ? 1_555 D DG  4  N2  ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DG  17  N1  ? ? ? 1_555 D DC  3  N3  ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DG  17  N2  ? ? ? 1_555 D DC  3  O2  ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DG  17  O6  ? ? ? 1_555 D DC  3  N4  ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DC  18  N3  ? ? ? 1_555 D DG  2  N1  ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DC  18  N4  ? ? ? 1_555 D DG  2  O6  ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DC  18  O2  ? ? ? 1_555 D DG  2  N2  ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DA  19  N1  ? ? ? 1_555 D DT  1  N3  ? ? C DA  19  D DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DA  19  N6  ? ? ? 1_555 D DT  1  O4  ? ? C DA  19  D DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 134 A . ? GLY 131 A PRO 135 A ? PRO 132 A 1 0.04  
2 LEU 361 A . ? LEU 358 A GLY 362 A ? GLY 359 A 1 -3.06 
3 GLY 134 B . ? GLY 131 B PRO 135 B ? PRO 132 B 1 6.83  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 5 ? 
D ? 5 ? 
E ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 33  ? GLU A 36  ? TYR A 30  GLU A 33  
A 2 LYS A 39  ? ARG A 44  ? LYS A 36  ARG A 41  
A 3 GLY A 47  ? ILE A 50  ? GLY A 44  ILE A 47  
B 1 ALA A 111 ? SER A 112 ? ALA A 108 SER A 109 
B 2 SER A 317 ? TRP A 318 ? SER A 314 TRP A 315 
C 1 THR A 156 ? THR A 161 ? THR A 153 THR A 158 
C 2 TYR A 144 ? ASP A 150 ? TYR A 141 ASP A 147 
C 3 LYS A 127 ? ILE A 133 ? LYS A 124 ILE A 130 
C 4 VAL A 184 ? SER A 187 ? VAL A 181 SER A 184 
C 5 HIS A 208 ? PHE A 211 ? HIS A 205 PHE A 208 
D 1 ASN A 364 ? SER A 368 ? ASN A 361 SER A 365 
D 2 THR A 354 ? LEU A 358 ? THR A 351 LEU A 355 
D 3 SER A 344 ? ASN A 351 ? SER A 341 ASN A 348 
D 4 LEU A 325 ? GLU A 328 ? LEU A 322 GLU A 325 
D 5 LEU A 372 ? PRO A 374 ? LEU A 369 PRO A 371 
E 1 THR B 156 ? THR B 161 ? THR B 153 THR B 158 
E 2 TYR B 144 ? ASP B 150 ? TYR B 141 ASP B 147 
E 3 LYS B 127 ? ILE B 133 ? LYS B 124 ILE B 130 
E 4 VAL B 184 ? SER B 187 ? VAL B 181 SER B 184 
E 5 HIS B 208 ? PHE B 211 ? HIS B 205 PHE B 208 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 34  ? N PHE A 31  O LYS A 41  ? O LYS A 38  
A 2 3 N ARG A 44  ? N ARG A 41  O GLY A 47  ? O GLY A 44  
B 1 2 N ALA A 111 ? N ALA A 108 O TRP A 318 ? O TRP A 315 
C 1 2 O TYR A 159 ? O TYR A 156 N LEU A 146 ? N LEU A 143 
C 2 3 O VAL A 149 ? O VAL A 146 N PHE A 129 ? N PHE A 126 
C 3 4 N PHE A 128 ? N PHE A 125 O HIS A 186 ? O HIS A 183 
C 4 5 N ILE A 185 ? N ILE A 182 O GLU A 210 ? O GLU A 207 
D 1 2 O VAL A 367 ? O VAL A 364 N VAL A 355 ? N VAL A 352 
D 2 3 O VAL A 356 ? O VAL A 353 N LEU A 347 ? N LEU A 344 
D 3 4 O SER A 344 ? O SER A 341 N VAL A 326 ? N VAL A 323 
D 4 5 N GLN A 327 ? N GLN A 324 O LYS A 373 ? O LYS A 370 
E 1 2 O TYR B 159 ? O TYR B 156 N LEU B 146 ? N LEU B 143 
E 2 3 O VAL B 147 ? O VAL B 144 N ASP B 131 ? N ASP B 128 
E 3 4 N PHE B 128 ? N PHE B 125 O VAL B 184 ? O VAL B 181 
E 4 5 N SER B 187 ? N SER B 184 O GLU B 210 ? O GLU B 207 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 393'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 393' 
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 A 394' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE GOL A 801' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 802' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 803' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL A 805' 
AC8 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NH4 A 395' 
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 396'  
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 397'  
BC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG B 394'  
BC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ZYO A 398' 
1   ?        ? ? ? ? ?  ?                                    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HIS A 65  ? HIS A 62  . ? 1_555 ? 
2  AC1 4  HIS A 69  ? HIS A 66  . ? 1_555 ? 
3  AC1 4  CYS A 99  ? CYS A 96  . ? 1_555 ? 
4  AC1 4  CYS A 102 ? CYS A 99  . ? 1_555 ? 
5  AC2 5  LYS B 222 ? LYS B 219 . ? 1_555 ? 
6  AC2 5  ARG B 225 ? ARG B 222 . ? 1_555 ? 
7  AC2 5  SER B 261 ? SER B 258 . ? 1_555 ? 
8  AC2 5  PRO B 262 ? PRO B 259 . ? 1_555 ? 
9  AC2 5  VAL B 263 ? VAL B 260 . ? 1_555 ? 
10 AC3 3  HIS A 341 ? HIS A 338 . ? 1_555 ? 
11 AC3 3  LYS A 342 ? LYS A 339 . ? 1_555 ? 
12 AC3 3  HIS A 360 ? HIS A 357 . ? 1_555 ? 
13 AC4 3  SER A 165 ? SER A 162 . ? 1_555 ? 
14 AC4 3  THR A 166 ? THR A 163 . ? 1_555 ? 
15 AC4 3  SER A 167 ? SER A 164 . ? 1_555 ? 
16 AC5 4  PRO A 138 ? PRO A 135 . ? 1_555 ? 
17 AC5 4  SER A 139 ? SER A 136 . ? 1_555 ? 
18 AC5 4  GLN A 140 ? GLN A 137 . ? 1_555 ? 
19 AC5 4  LYS A 244 ? LYS A 241 . ? 1_555 ? 
20 AC6 4  LEU A 295 ? LEU A 292 . ? 1_555 ? 
21 AC6 4  GLN A 299 ? GLN A 296 . ? 1_555 ? 
22 AC6 4  TYR B 266 ? TYR B 263 . ? 1_555 ? 
23 AC6 4  ASP B 276 ? ASP B 273 . ? 1_555 ? 
24 AC7 4  GLN A 63  ? GLN A 60  . ? 1_555 ? 
25 AC7 4  TYR A 83  ? TYR A 80  . ? 1_555 ? 
26 AC7 4  PRO A 280 ? PRO A 277 . ? 8_554 ? 
27 AC7 4  PHE A 281 ? PHE A 278 . ? 8_554 ? 
28 AC8 1  ASP A 119 ? ASP A 116 . ? 1_555 ? 
29 AC9 3  ASP A 131 ? ASP A 128 . ? 1_555 ? 
30 AC9 3  ASP A 188 ? ASP A 185 . ? 1_555 ? 
31 AC9 3  ZYO N .   ? ZYO A 398 . ? 1_555 ? 
32 BC1 4  ASP A 131 ? ASP A 128 . ? 1_555 ? 
33 BC1 4  GLU A 224 ? GLU A 221 . ? 1_555 ? 
34 BC1 4  ASN A 227 ? ASN A 224 . ? 1_555 ? 
35 BC1 4  ZYO N .   ? ZYO A 398 . ? 1_555 ? 
36 BC2 3  ASP B 131 ? ASP B 128 . ? 1_555 ? 
37 BC2 3  ASP B 188 ? ASP B 185 . ? 1_555 ? 
38 BC2 3  DA  C 19  ? DA  C 19  . ? 3_555 ? 
39 BC3 11 ASP A 131 ? ASP A 128 . ? 1_555 ? 
40 BC3 11 ASP A 188 ? ASP A 185 . ? 1_555 ? 
41 BC3 11 TYR A 215 ? TYR A 212 . ? 1_555 ? 
42 BC3 11 PRO A 217 ? PRO A 214 . ? 1_555 ? 
43 BC3 11 GLN A 218 ? GLN A 215 . ? 1_555 ? 
44 BC3 11 GLU A 224 ? GLU A 221 . ? 1_555 ? 
45 BC3 11 MG  L .   ? MG  A 396 . ? 1_555 ? 
46 BC3 11 MG  M .   ? MG  A 397 . ? 1_555 ? 
47 BC3 11 DG  C 4   ? DG  C 4   . ? 1_555 ? 
48 BC3 11 DC  D 16  ? DC  D 16  . ? 1_555 ? 
49 BC3 11 DA  D 17  ? DA  D 17  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3OYG 
_atom_sites.fract_transf_matrix[1][1]   0.006248 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006248 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008097 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
F  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LEU A 1  11  ? -78.429 17.888 -56.273 1.00 115.98 ? 8   LEU A N     1 
ATOM   2    C  CA    . LEU A 1  11  ? -77.625 17.371 -57.424 1.00 115.89 ? 8   LEU A CA    1 
ATOM   3    C  C     . LEU A 1  11  ? -78.376 17.554 -58.759 1.00 115.79 ? 8   LEU A C     1 
ATOM   4    O  O     . LEU A 1  11  ? -78.888 18.646 -59.031 1.00 115.74 ? 8   LEU A O     1 
ATOM   5    C  CB    . LEU A 1  11  ? -77.208 15.910 -57.186 1.00 115.87 ? 8   LEU A CB    1 
ATOM   6    N  N     . ASP A 1  12  ? -78.433 16.495 -59.578 1.00 115.64 ? 9   ASP A N     1 
ATOM   7    C  CA    . ASP A 1  12  ? -79.117 16.515 -60.891 1.00 115.33 ? 9   ASP A CA    1 
ATOM   8    C  C     . ASP A 1  12  ? -80.618 16.762 -60.732 1.00 114.77 ? 9   ASP A C     1 
ATOM   9    O  O     . ASP A 1  12  ? -81.276 17.236 -61.659 1.00 114.73 ? 9   ASP A O     1 
ATOM   10   C  CB    . ASP A 1  12  ? -78.899 15.202 -61.674 1.00 115.58 ? 9   ASP A CB    1 
ATOM   11   C  CG    . ASP A 1  12  ? -77.477 14.648 -61.542 1.00 116.19 ? 9   ASP A CG    1 
ATOM   12   O  OD1   . ASP A 1  12  ? -76.504 15.423 -61.702 1.00 116.27 ? 9   ASP A OD1   1 
ATOM   13   O  OD2   . ASP A 1  12  ? -77.341 13.427 -61.286 1.00 116.39 ? 9   ASP A OD2   1 
ATOM   14   N  N     . ALA A 1  13  ? -81.144 16.422 -59.555 1.00 114.05 ? 10  ALA A N     1 
ATOM   15   C  CA    . ALA A 1  13  ? -82.522 16.714 -59.186 1.00 113.25 ? 10  ALA A CA    1 
ATOM   16   C  C     . ALA A 1  13  ? -82.785 18.219 -59.266 1.00 112.66 ? 10  ALA A C     1 
ATOM   17   O  O     . ALA A 1  13  ? -83.544 18.671 -60.128 1.00 112.60 ? 10  ALA A O     1 
ATOM   18   C  CB    . ALA A 1  13  ? -82.816 16.180 -57.785 1.00 113.35 ? 10  ALA A CB    1 
ATOM   19   N  N     . GLU A 1  14  ? -82.135 18.980 -58.381 1.00 111.91 ? 11  GLU A N     1 
ATOM   20   C  CA    . GLU A 1  14  ? -82.239 20.447 -58.337 1.00 111.14 ? 11  GLU A CA    1 
ATOM   21   C  C     . GLU A 1  14  ? -82.024 21.111 -59.693 1.00 110.39 ? 11  GLU A C     1 
ATOM   22   O  O     . GLU A 1  14  ? -82.795 21.975 -60.100 1.00 110.11 ? 11  GLU A O     1 
ATOM   23   C  CB    . GLU A 1  14  ? -81.228 21.027 -57.343 1.00 111.25 ? 11  GLU A CB    1 
ATOM   24   C  CG    . GLU A 1  14  ? -81.794 21.427 -55.987 1.00 111.55 ? 11  GLU A CG    1 
ATOM   25   C  CD    . GLU A 1  14  ? -80.809 22.248 -55.161 1.00 112.11 ? 11  GLU A CD    1 
ATOM   26   O  OE1   . GLU A 1  14  ? -79.588 22.176 -55.421 1.00 112.67 ? 11  GLU A OE1   1 
ATOM   27   O  OE2   . GLU A 1  14  ? -81.254 22.970 -54.245 1.00 112.03 ? 11  GLU A OE2   1 
ATOM   28   N  N     . LEU A 1  15  ? -80.965 20.692 -60.376 1.00 109.76 ? 12  LEU A N     1 
ATOM   29   C  CA    . LEU A 1  15  ? -80.533 21.304 -61.628 1.00 109.22 ? 12  LEU A CA    1 
ATOM   30   C  C     . LEU A 1  15  ? -81.489 21.059 -62.795 1.00 108.95 ? 12  LEU A C     1 
ATOM   31   O  O     . LEU A 1  15  ? -81.550 21.867 -63.724 1.00 108.78 ? 12  LEU A O     1 
ATOM   32   C  CB    . LEU A 1  15  ? -79.115 20.834 -61.983 1.00 109.20 ? 12  LEU A CB    1 
ATOM   33   C  CG    . LEU A 1  15  ? -77.883 21.617 -61.496 1.00 108.76 ? 12  LEU A CG    1 
ATOM   34   C  CD1   . LEU A 1  15  ? -77.924 21.983 -60.012 1.00 108.17 ? 12  LEU A CD1   1 
ATOM   35   C  CD2   . LEU A 1  15  ? -76.619 20.829 -61.814 1.00 108.25 ? 12  LEU A CD2   1 
ATOM   36   N  N     . ASP A 1  16  ? -82.226 19.948 -62.748 1.00 108.63 ? 13  ASP A N     1 
ATOM   37   C  CA    . ASP A 1  16  ? -83.226 19.652 -63.772 1.00 108.27 ? 13  ASP A CA    1 
ATOM   38   C  C     . ASP A 1  16  ? -84.347 20.684 -63.673 1.00 107.90 ? 13  ASP A C     1 
ATOM   39   O  O     . ASP A 1  16  ? -84.611 21.390 -64.650 1.00 107.71 ? 13  ASP A O     1 
ATOM   40   C  CB    . ASP A 1  16  ? -83.763 18.212 -63.655 1.00 108.46 ? 13  ASP A CB    1 
ATOM   41   C  CG    . ASP A 1  16  ? -83.857 17.492 -65.016 1.00 108.58 ? 13  ASP A CG    1 
ATOM   42   O  OD1   . ASP A 1  16  ? -84.519 18.008 -65.946 1.00 108.31 ? 13  ASP A OD1   1 
ATOM   43   O  OD2   . ASP A 1  16  ? -83.272 16.393 -65.148 1.00 108.56 ? 13  ASP A OD2   1 
ATOM   44   N  N     . GLN A 1  17  ? -84.963 20.802 -62.489 1.00 107.58 ? 14  GLN A N     1 
ATOM   45   C  CA    . GLN A 1  17  ? -86.033 21.793 -62.244 1.00 107.35 ? 14  GLN A CA    1 
ATOM   46   C  C     . GLN A 1  17  ? -85.655 23.184 -62.731 1.00 107.09 ? 14  GLN A C     1 
ATOM   47   O  O     . GLN A 1  17  ? -86.490 23.923 -63.263 1.00 107.15 ? 14  GLN A O     1 
ATOM   48   C  CB    . GLN A 1  17  ? -86.405 21.880 -60.762 1.00 107.35 ? 14  GLN A CB    1 
ATOM   49   C  CG    . GLN A 1  17  ? -87.559 20.996 -60.332 1.00 107.71 ? 14  GLN A CG    1 
ATOM   50   C  CD    . GLN A 1  17  ? -87.090 19.772 -59.570 1.00 108.46 ? 14  GLN A CD    1 
ATOM   51   O  OE1   . GLN A 1  17  ? -86.370 19.886 -58.576 1.00 108.56 ? 14  GLN A OE1   1 
ATOM   52   N  NE2   . GLN A 1  17  ? -87.502 18.593 -60.026 1.00 108.54 ? 14  GLN A NE2   1 
ATOM   53   N  N     . LEU A 1  18  ? -84.382 23.519 -62.550 1.00 106.73 ? 15  LEU A N     1 
ATOM   54   C  CA    . LEU A 1  18  ? -83.848 24.819 -62.917 1.00 106.32 ? 15  LEU A CA    1 
ATOM   55   C  C     . LEU A 1  18  ? -83.847 25.050 -64.424 1.00 106.12 ? 15  LEU A C     1 
ATOM   56   O  O     . LEU A 1  18  ? -84.215 26.131 -64.881 1.00 106.14 ? 15  LEU A O     1 
ATOM   57   C  CB    . LEU A 1  18  ? -82.433 24.973 -62.356 1.00 106.25 ? 15  LEU A CB    1 
ATOM   58   C  CG    . LEU A 1  18  ? -81.850 26.379 -62.266 1.00 105.73 ? 15  LEU A CG    1 
ATOM   59   C  CD1   . LEU A 1  18  ? -82.506 27.178 -61.139 1.00 105.39 ? 15  LEU A CD1   1 
ATOM   60   C  CD2   . LEU A 1  18  ? -80.362 26.265 -62.059 1.00 105.05 ? 15  LEU A CD2   1 
ATOM   61   N  N     . LEU A 1  19  ? -83.436 24.038 -65.185 1.00 105.93 ? 16  LEU A N     1 
ATOM   62   C  CA    . LEU A 1  19  ? -83.342 24.149 -66.641 1.00 105.82 ? 16  LEU A CA    1 
ATOM   63   C  C     . LEU A 1  19  ? -84.687 24.441 -67.300 1.00 105.76 ? 16  LEU A C     1 
ATOM   64   O  O     . LEU A 1  19  ? -84.775 25.275 -68.208 1.00 105.70 ? 16  LEU A O     1 
ATOM   65   C  CB    . LEU A 1  19  ? -82.718 22.891 -67.246 1.00 105.89 ? 16  LEU A CB    1 
ATOM   66   C  CG    . LEU A 1  19  ? -81.196 22.859 -67.416 1.00 105.82 ? 16  LEU A CG    1 
ATOM   67   C  CD1   . LEU A 1  19  ? -80.727 21.438 -67.684 1.00 105.61 ? 16  LEU A CD1   1 
ATOM   68   C  CD2   . LEU A 1  19  ? -80.749 23.795 -68.535 1.00 105.83 ? 16  LEU A CD2   1 
ATOM   69   N  N     . GLN A 1  20  ? -85.734 23.765 -66.826 1.00 105.56 ? 17  GLN A N     1 
ATOM   70   C  CA    . GLN A 1  20  ? -87.079 23.956 -67.369 1.00 105.39 ? 17  GLN A CA    1 
ATOM   71   C  C     . GLN A 1  20  ? -87.799 25.200 -66.802 1.00 104.98 ? 17  GLN A C     1 
ATOM   72   O  O     . GLN A 1  20  ? -89.033 25.224 -66.710 1.00 105.23 ? 17  GLN A O     1 
ATOM   73   C  CB    . GLN A 1  20  ? -87.922 22.674 -67.220 1.00 105.47 ? 17  GLN A CB    1 
ATOM   74   C  CG    . GLN A 1  20  ? -88.189 22.236 -65.783 1.00 106.18 ? 17  GLN A CG    1 
ATOM   75   C  CD    . GLN A 1  20  ? -88.915 20.901 -65.694 1.00 107.34 ? 17  GLN A CD    1 
ATOM   76   O  OE1   . GLN A 1  20  ? -90.071 20.836 -65.261 1.00 108.05 ? 17  GLN A OE1   1 
ATOM   77   N  NE2   . GLN A 1  20  ? -88.239 19.827 -66.102 1.00 107.04 ? 17  GLN A NE2   1 
ATOM   78   N  N     . GLY A 1  21  ? -87.020 26.219 -66.424 1.00 104.30 ? 18  GLY A N     1 
ATOM   79   C  CA    . GLY A 1  21  ? -87.543 27.540 -66.039 1.00 103.19 ? 18  GLY A CA    1 
ATOM   80   C  C     . GLY A 1  21  ? -88.179 27.736 -64.668 1.00 102.47 ? 18  GLY A C     1 
ATOM   81   O  O     . GLY A 1  21  ? -88.502 28.869 -64.314 1.00 102.17 ? 18  GLY A O     1 
ATOM   82   N  N     . HIS A 1  22  ? -88.374 26.650 -63.910 1.00 101.94 ? 19  HIS A N     1 
ATOM   83   C  CA    . HIS A 1  22  ? -88.882 26.708 -62.521 1.00 101.68 ? 19  HIS A CA    1 
ATOM   84   C  C     . HIS A 1  22  ? -87.929 27.496 -61.591 1.00 100.78 ? 19  HIS A C     1 
ATOM   85   O  O     . HIS A 1  22  ? -86.735 27.628 -61.889 1.00 100.84 ? 19  HIS A O     1 
ATOM   86   C  CB    . HIS A 1  22  ? -89.076 25.292 -61.951 1.00 102.17 ? 19  HIS A CB    1 
ATOM   87   C  CG    . HIS A 1  22  ? -90.312 24.583 -62.433 1.00 104.40 ? 19  HIS A CG    1 
ATOM   88   N  ND1   . HIS A 1  22  ? -90.440 24.088 -63.718 1.00 105.83 ? 19  HIS A ND1   1 
ATOM   89   C  CD2   . HIS A 1  22  ? -91.455 24.242 -61.783 1.00 105.69 ? 19  HIS A CD2   1 
ATOM   90   C  CE1   . HIS A 1  22  ? -91.616 23.496 -63.846 1.00 105.92 ? 19  HIS A CE1   1 
ATOM   91   N  NE2   . HIS A 1  22  ? -92.251 23.576 -62.686 1.00 106.14 ? 19  HIS A NE2   1 
ATOM   92   N  N     . TYR A 1  23  ? -88.448 28.002 -60.468 1.00 99.48  ? 20  TYR A N     1 
ATOM   93   C  CA    . TYR A 1  23  ? -87.629 28.742 -59.488 1.00 98.09  ? 20  TYR A CA    1 
ATOM   94   C  C     . TYR A 1  23  ? -87.152 27.870 -58.322 1.00 97.22  ? 20  TYR A C     1 
ATOM   95   O  O     . TYR A 1  23  ? -87.956 27.154 -57.720 1.00 97.11  ? 20  TYR A O     1 
ATOM   96   C  CB    . TYR A 1  23  ? -88.400 29.945 -58.929 1.00 98.11  ? 20  TYR A CB    1 
ATOM   97   C  CG    . TYR A 1  23  ? -87.803 30.519 -57.654 1.00 98.09  ? 20  TYR A CG    1 
ATOM   98   C  CD1   . TYR A 1  23  ? -86.773 31.462 -57.708 1.00 98.44  ? 20  TYR A CD1   1 
ATOM   99   C  CD2   . TYR A 1  23  ? -88.254 30.106 -56.391 1.00 97.62  ? 20  TYR A CD2   1 
ATOM   100  C  CE1   . TYR A 1  23  ? -86.210 31.991 -56.538 1.00 98.16  ? 20  TYR A CE1   1 
ATOM   101  C  CE2   . TYR A 1  23  ? -87.693 30.626 -55.213 1.00 97.64  ? 20  TYR A CE2   1 
ATOM   102  C  CZ    . TYR A 1  23  ? -86.673 31.571 -55.299 1.00 97.68  ? 20  TYR A CZ    1 
ATOM   103  O  OH    . TYR A 1  23  ? -86.109 32.101 -54.162 1.00 96.63  ? 20  TYR A OH    1 
ATOM   104  N  N     . ILE A 1  24  ? -85.858 27.958 -57.989 1.00 95.96  ? 21  ILE A N     1 
ATOM   105  C  CA    . ILE A 1  24  ? -85.295 27.283 -56.798 1.00 94.60  ? 21  ILE A CA    1 
ATOM   106  C  C     . ILE A 1  24  ? -84.651 28.301 -55.853 1.00 93.45  ? 21  ILE A C     1 
ATOM   107  O  O     . ILE A 1  24  ? -83.973 29.217 -56.314 1.00 93.34  ? 21  ILE A O     1 
ATOM   108  C  CB    . ILE A 1  24  ? -84.288 26.155 -57.178 1.00 94.66  ? 21  ILE A CB    1 
ATOM   109  C  CG1   . ILE A 1  24  ? -85.025 24.913 -57.699 1.00 94.96  ? 21  ILE A CG1   1 
ATOM   110  C  CG2   . ILE A 1  24  ? -83.456 25.736 -55.976 1.00 94.62  ? 21  ILE A CG2   1 
ATOM   111  C  CD1   . ILE A 1  24  ? -85.440 24.975 -59.161 1.00 95.48  ? 21  ILE A CD1   1 
ATOM   112  N  N     . LYS A 1  25  ? -84.871 28.151 -54.545 1.00 92.06  ? 22  LYS A N     1 
ATOM   113  C  CA    . LYS A 1  25  ? -84.343 29.117 -53.573 1.00 90.80  ? 22  LYS A CA    1 
ATOM   114  C  C     . LYS A 1  25  ? -82.823 29.192 -53.605 1.00 89.77  ? 22  LYS A C     1 
ATOM   115  O  O     . LYS A 1  25  ? -82.133 28.180 -53.460 1.00 89.59  ? 22  LYS A O     1 
ATOM   116  C  CB    . LYS A 1  25  ? -84.803 28.819 -52.145 1.00 90.97  ? 22  LYS A CB    1 
ATOM   117  C  CG    . LYS A 1  25  ? -84.624 30.014 -51.207 1.00 91.22  ? 22  LYS A CG    1 
ATOM   118  C  CD    . LYS A 1  25  ? -84.334 29.614 -49.763 1.00 92.20  ? 22  LYS A CD    1 
ATOM   119  C  CE    . LYS A 1  25  ? -84.347 30.852 -48.861 1.00 92.70  ? 22  LYS A CE    1 
ATOM   120  N  NZ    . LYS A 1  25  ? -83.865 30.589 -47.474 1.00 92.62  ? 22  LYS A NZ    1 
ATOM   121  N  N     . GLY A 1  26  ? -82.318 30.406 -53.788 1.00 88.51  ? 23  GLY A N     1 
ATOM   122  C  CA    . GLY A 1  26  ? -80.886 30.643 -53.836 1.00 87.03  ? 23  GLY A CA    1 
ATOM   123  C  C     . GLY A 1  26  ? -80.380 30.921 -55.239 1.00 85.95  ? 23  GLY A C     1 
ATOM   124  O  O     . GLY A 1  26  ? -79.314 31.512 -55.405 1.00 85.97  ? 23  GLY A O     1 
ATOM   125  N  N     . TYR A 1  27  ? -81.136 30.484 -56.245 1.00 84.65  ? 24  TYR A N     1 
ATOM   126  C  CA    . TYR A 1  27  ? -80.784 30.713 -57.644 1.00 83.27  ? 24  TYR A CA    1 
ATOM   127  C  C     . TYR A 1  27  ? -81.659 31.829 -58.192 1.00 83.34  ? 24  TYR A C     1 
ATOM   128  O  O     . TYR A 1  27  ? -82.807 31.582 -58.563 1.00 83.44  ? 24  TYR A O     1 
ATOM   129  C  CB    . TYR A 1  27  ? -80.991 29.442 -58.480 1.00 82.56  ? 24  TYR A CB    1 
ATOM   130  C  CG    . TYR A 1  27  ? -80.157 28.233 -58.088 1.00 79.60  ? 24  TYR A CG    1 
ATOM   131  C  CD1   . TYR A 1  27  ? -79.045 27.849 -58.843 1.00 77.09  ? 24  TYR A CD1   1 
ATOM   132  C  CD2   . TYR A 1  27  ? -80.493 27.460 -56.986 1.00 77.31  ? 24  TYR A CD2   1 
ATOM   133  C  CE1   . TYR A 1  27  ? -78.285 26.734 -58.495 1.00 75.22  ? 24  TYR A CE1   1 
ATOM   134  C  CE2   . TYR A 1  27  ? -79.742 26.341 -56.630 1.00 76.36  ? 24  TYR A CE2   1 
ATOM   135  C  CZ    . TYR A 1  27  ? -78.642 25.985 -57.388 1.00 75.48  ? 24  TYR A CZ    1 
ATOM   136  O  OH    . TYR A 1  27  ? -77.909 24.879 -57.022 1.00 75.00  ? 24  TYR A OH    1 
ATOM   137  N  N     . PRO A 1  28  ? -81.129 33.066 -58.245 1.00 83.38  ? 25  PRO A N     1 
ATOM   138  C  CA    . PRO A 1  28  ? -81.923 34.222 -58.694 1.00 83.44  ? 25  PRO A CA    1 
ATOM   139  C  C     . PRO A 1  28  ? -82.606 33.972 -60.038 1.00 83.65  ? 25  PRO A C     1 
ATOM   140  O  O     . PRO A 1  28  ? -81.960 33.491 -60.970 1.00 83.31  ? 25  PRO A O     1 
ATOM   141  C  CB    . PRO A 1  28  ? -80.887 35.351 -58.812 1.00 83.33  ? 25  PRO A CB    1 
ATOM   142  C  CG    . PRO A 1  28  ? -79.542 34.713 -58.616 1.00 83.15  ? 25  PRO A CG    1 
ATOM   143  C  CD    . PRO A 1  28  ? -79.757 33.448 -57.870 1.00 83.25  ? 25  PRO A CD    1 
ATOM   144  N  N     . LYS A 1  29  ? -83.901 34.289 -60.121 1.00 84.25  ? 26  LYS A N     1 
ATOM   145  C  CA    . LYS A 1  29  ? -84.725 33.987 -61.310 1.00 84.85  ? 26  LYS A CA    1 
ATOM   146  C  C     . LYS A 1  29  ? -84.399 34.849 -62.533 1.00 85.18  ? 26  LYS A C     1 
ATOM   147  O  O     . LYS A 1  29  ? -84.642 34.430 -63.669 1.00 85.08  ? 26  LYS A O     1 
ATOM   148  C  CB    . LYS A 1  29  ? -86.230 34.052 -60.994 1.00 84.57  ? 26  LYS A CB    1 
ATOM   149  N  N     . GLN A 1  30  ? -83.829 36.031 -62.294 1.00 85.76  ? 27  GLN A N     1 
ATOM   150  C  CA    . GLN A 1  30  ? -83.533 36.994 -63.365 1.00 86.31  ? 27  GLN A CA    1 
ATOM   151  C  C     . GLN A 1  30  ? -82.396 36.597 -64.325 1.00 86.63  ? 27  GLN A C     1 
ATOM   152  O  O     . GLN A 1  30  ? -82.199 37.245 -65.350 1.00 86.58  ? 27  GLN A O     1 
ATOM   153  C  CB    . GLN A 1  30  ? -83.294 38.397 -62.791 1.00 86.23  ? 27  GLN A CB    1 
ATOM   154  C  CG    . GLN A 1  30  ? -82.116 38.515 -61.842 1.00 86.40  ? 27  GLN A CG    1 
ATOM   155  C  CD    . GLN A 1  30  ? -81.633 39.952 -61.685 1.00 87.07  ? 27  GLN A CD    1 
ATOM   156  O  OE1   . GLN A 1  30  ? -81.718 40.528 -60.602 1.00 87.53  ? 27  GLN A OE1   1 
ATOM   157  N  NE2   . GLN A 1  30  ? -81.125 40.536 -62.768 1.00 87.56  ? 27  GLN A NE2   1 
ATOM   158  N  N     . TYR A 1  31  ? -81.647 35.550 -63.995 1.00 87.22  ? 28  TYR A N     1 
ATOM   159  C  CA    . TYR A 1  31  ? -80.582 35.076 -64.878 1.00 87.78  ? 28  TYR A CA    1 
ATOM   160  C  C     . TYR A 1  31  ? -81.042 33.871 -65.668 1.00 88.00  ? 28  TYR A C     1 
ATOM   161  O  O     . TYR A 1  31  ? -81.773 33.030 -65.147 1.00 87.97  ? 28  TYR A O     1 
ATOM   162  C  CB    . TYR A 1  31  ? -79.324 34.714 -64.082 1.00 87.99  ? 28  TYR A CB    1 
ATOM   163  C  CG    . TYR A 1  31  ? -78.735 35.874 -63.325 1.00 88.17  ? 28  TYR A CG    1 
ATOM   164  C  CD1   . TYR A 1  31  ? -78.039 36.885 -63.989 1.00 88.97  ? 28  TYR A CD1   1 
ATOM   165  C  CD2   . TYR A 1  31  ? -78.877 35.963 -61.947 1.00 87.94  ? 28  TYR A CD2   1 
ATOM   166  C  CE1   . TYR A 1  31  ? -77.507 37.962 -63.293 1.00 89.53  ? 28  TYR A CE1   1 
ATOM   167  C  CE2   . TYR A 1  31  ? -78.350 37.027 -61.242 1.00 88.59  ? 28  TYR A CE2   1 
ATOM   168  C  CZ    . TYR A 1  31  ? -77.670 38.024 -61.919 1.00 89.14  ? 28  TYR A CZ    1 
ATOM   169  O  OH    . TYR A 1  31  ? -77.148 39.077 -61.216 1.00 89.20  ? 28  TYR A OH    1 
ATOM   170  N  N     . THR A 1  32  ? -80.607 33.779 -66.922 1.00 88.39  ? 29  THR A N     1 
ATOM   171  C  CA    . THR A 1  32  ? -80.963 32.619 -67.754 1.00 88.71  ? 29  THR A CA    1 
ATOM   172  C  C     . THR A 1  32  ? -79.973 31.450 -67.576 1.00 88.31  ? 29  THR A C     1 
ATOM   173  O  O     . THR A 1  32  ? -78.767 31.585 -67.826 1.00 88.32  ? 29  THR A O     1 
ATOM   174  C  CB    . THR A 1  32  ? -81.176 32.987 -69.269 1.00 88.97  ? 29  THR A CB    1 
ATOM   175  O  OG1   . THR A 1  32  ? -80.004 33.629 -69.792 1.00 89.68  ? 29  THR A OG1   1 
ATOM   176  C  CG2   . THR A 1  32  ? -82.404 33.914 -69.463 1.00 89.30  ? 29  THR A CG2   1 
ATOM   177  N  N     . TYR A 1  33  ? -80.508 30.316 -67.124 1.00 87.80  ? 30  TYR A N     1 
ATOM   178  C  CA    . TYR A 1  33  ? -79.747 29.078 -66.930 1.00 87.32  ? 30  TYR A CA    1 
ATOM   179  C  C     . TYR A 1  33  ? -79.917 28.129 -68.128 1.00 86.90  ? 30  TYR A C     1 
ATOM   180  O  O     . TYR A 1  33  ? -81.037 27.852 -68.544 1.00 86.88  ? 30  TYR A O     1 
ATOM   181  C  CB    . TYR A 1  33  ? -80.208 28.378 -65.641 1.00 87.27  ? 30  TYR A CB    1 
ATOM   182  C  CG    . TYR A 1  33  ? -80.196 29.257 -64.401 1.00 87.68  ? 30  TYR A CG    1 
ATOM   183  C  CD1   . TYR A 1  33  ? -79.062 29.335 -63.589 1.00 87.72  ? 30  TYR A CD1   1 
ATOM   184  C  CD2   . TYR A 1  33  ? -81.318 30.004 -64.032 1.00 87.65  ? 30  TYR A CD2   1 
ATOM   185  C  CE1   . TYR A 1  33  ? -79.040 30.139 -62.444 1.00 87.24  ? 30  TYR A CE1   1 
ATOM   186  C  CE2   . TYR A 1  33  ? -81.306 30.809 -62.884 1.00 87.66  ? 30  TYR A CE2   1 
ATOM   187  C  CZ    . TYR A 1  33  ? -80.160 30.874 -62.098 1.00 87.44  ? 30  TYR A CZ    1 
ATOM   188  O  OH    . TYR A 1  33  ? -80.135 31.667 -60.968 1.00 87.24  ? 30  TYR A OH    1 
ATOM   189  N  N     . PHE A 1  34  ? -78.817 27.619 -68.675 1.00 86.55  ? 31  PHE A N     1 
ATOM   190  C  CA    . PHE A 1  34  ? -78.904 26.742 -69.841 1.00 86.18  ? 31  PHE A CA    1 
ATOM   191  C  C     . PHE A 1  34  ? -77.995 25.517 -69.818 1.00 86.16  ? 31  PHE A C     1 
ATOM   192  O  O     . PHE A 1  34  ? -77.147 25.390 -68.941 1.00 86.35  ? 31  PHE A O     1 
ATOM   193  C  CB    . PHE A 1  34  ? -78.697 27.541 -71.123 1.00 86.10  ? 31  PHE A CB    1 
ATOM   194  C  CG    . PHE A 1  34  ? -77.382 28.265 -71.205 1.00 85.81  ? 31  PHE A CG    1 
ATOM   195  C  CD1   . PHE A 1  34  ? -76.301 27.697 -71.878 1.00 85.44  ? 31  PHE A CD1   1 
ATOM   196  C  CD2   . PHE A 1  34  ? -77.238 29.541 -70.667 1.00 85.77  ? 31  PHE A CD2   1 
ATOM   197  C  CE1   . PHE A 1  34  ? -75.087 28.378 -71.990 1.00 84.76  ? 31  PHE A CE1   1 
ATOM   198  C  CE2   . PHE A 1  34  ? -76.026 30.230 -70.773 1.00 85.27  ? 31  PHE A CE2   1 
ATOM   199  C  CZ    . PHE A 1  34  ? -74.950 29.646 -71.437 1.00 84.69  ? 31  PHE A CZ    1 
ATOM   200  N  N     . LEU A 1  35  ? -78.199 24.608 -70.775 1.00 86.06  ? 32  LEU A N     1 
ATOM   201  C  CA    . LEU A 1  35  ? -77.304 23.461 -70.977 1.00 85.87  ? 32  LEU A CA    1 
ATOM   202  C  C     . LEU A 1  35  ? -76.354 23.719 -72.155 1.00 85.52  ? 32  LEU A C     1 
ATOM   203  O  O     . LEU A 1  35  ? -76.713 24.395 -73.119 1.00 85.58  ? 32  LEU A O     1 
ATOM   204  C  CB    . LEU A 1  35  ? -78.098 22.161 -71.176 1.00 86.05  ? 32  LEU A CB    1 
ATOM   205  C  CG    . LEU A 1  35  ? -77.437 20.796 -70.880 1.00 86.91  ? 32  LEU A CG    1 
ATOM   206  C  CD1   . LEU A 1  35  ? -78.466 19.789 -70.353 1.00 86.95  ? 32  LEU A CD1   1 
ATOM   207  C  CD2   . LEU A 1  35  ? -76.679 20.203 -72.088 1.00 87.51  ? 32  LEU A CD2   1 
ATOM   208  N  N     . GLU A 1  36  ? -75.138 23.189 -72.043 1.00 85.21  ? 33  GLU A N     1 
ATOM   209  C  CA    . GLU A 1  36  ? -74.069 23.340 -73.033 1.00 84.89  ? 33  GLU A CA    1 
ATOM   210  C  C     . GLU A 1  36  ? -72.964 22.372 -72.618 1.00 84.65  ? 33  GLU A C     1 
ATOM   211  O  O     . GLU A 1  36  ? -72.659 22.253 -71.432 1.00 84.35  ? 33  GLU A O     1 
ATOM   212  C  CB    . GLU A 1  36  ? -73.554 24.786 -73.058 1.00 84.78  ? 33  GLU A CB    1 
ATOM   213  C  CG    . GLU A 1  36  ? -72.554 25.135 -74.160 1.00 85.47  ? 33  GLU A CG    1 
ATOM   214  C  CD    . GLU A 1  36  ? -72.204 26.639 -74.197 1.00 87.00  ? 33  GLU A CD    1 
ATOM   215  O  OE1   . GLU A 1  36  ? -71.037 27.005 -73.924 1.00 86.73  ? 33  GLU A OE1   1 
ATOM   216  O  OE2   . GLU A 1  36  ? -73.097 27.465 -74.495 1.00 87.32  ? 33  GLU A OE2   1 
ATOM   217  N  N     . ASP A 1  37  ? -72.397 21.660 -73.591 1.00 84.55  ? 34  ASP A N     1 
ATOM   218  C  CA    . ASP A 1  37  ? -71.321 20.674 -73.359 1.00 84.43  ? 34  ASP A CA    1 
ATOM   219  C  C     . ASP A 1  37  ? -71.649 19.665 -72.244 1.00 83.77  ? 34  ASP A C     1 
ATOM   220  O  O     . ASP A 1  37  ? -70.745 19.113 -71.601 1.00 83.83  ? 34  ASP A O     1 
ATOM   221  C  CB    . ASP A 1  37  ? -69.955 21.362 -73.086 1.00 84.90  ? 34  ASP A CB    1 
ATOM   222  C  CG    . ASP A 1  37  ? -69.470 22.257 -74.252 1.00 86.25  ? 34  ASP A CG    1 
ATOM   223  O  OD1   . ASP A 1  37  ? -68.653 23.175 -73.993 1.00 87.25  ? 34  ASP A OD1   1 
ATOM   224  O  OD2   . ASP A 1  37  ? -69.888 22.055 -75.417 1.00 86.98  ? 34  ASP A OD2   1 
ATOM   225  N  N     . GLY A 1  38  ? -72.940 19.431 -72.016 1.00 82.96  ? 35  GLY A N     1 
ATOM   226  C  CA    . GLY A 1  38  ? -73.386 18.492 -70.980 1.00 82.02  ? 35  GLY A CA    1 
ATOM   227  C  C     . GLY A 1  38  ? -73.291 19.038 -69.562 1.00 81.26  ? 35  GLY A C     1 
ATOM   228  O  O     . GLY A 1  38  ? -73.185 18.272 -68.600 1.00 81.38  ? 35  GLY A O     1 
ATOM   229  N  N     . LYS A 1  39  ? -73.347 20.364 -69.433 1.00 80.34  ? 36  LYS A N     1 
ATOM   230  C  CA    . LYS A 1  39  ? -73.166 21.043 -68.149 1.00 79.09  ? 36  LYS A CA    1 
ATOM   231  C  C     . LYS A 1  39  ? -74.108 22.239 -68.010 1.00 77.92  ? 36  LYS A C     1 
ATOM   232  O  O     . LYS A 1  39  ? -74.261 23.025 -68.948 1.00 77.58  ? 36  LYS A O     1 
ATOM   233  C  CB    . LYS A 1  39  ? -71.705 21.491 -68.005 1.00 79.33  ? 36  LYS A CB    1 
ATOM   234  C  CG    . LYS A 1  39  ? -70.786 20.420 -67.410 1.00 80.84  ? 36  LYS A CG    1 
ATOM   235  C  CD    . LYS A 1  39  ? -69.497 20.223 -68.217 1.00 83.11  ? 36  LYS A CD    1 
ATOM   236  C  CE    . LYS A 1  39  ? -68.556 21.417 -68.125 1.00 84.08  ? 36  LYS A CE    1 
ATOM   237  N  NZ    . LYS A 1  39  ? -67.257 21.093 -68.776 1.00 85.00  ? 36  LYS A NZ    1 
ATOM   238  N  N     . VAL A 1  40  ? -74.739 22.366 -66.842 1.00 76.52  ? 37  VAL A N     1 
ATOM   239  C  CA    . VAL A 1  40  ? -75.602 23.512 -66.543 1.00 75.18  ? 37  VAL A CA    1 
ATOM   240  C  C     . VAL A 1  40  ? -74.771 24.779 -66.391 1.00 74.61  ? 37  VAL A C     1 
ATOM   241  O  O     . VAL A 1  40  ? -73.887 24.847 -65.542 1.00 74.32  ? 37  VAL A O     1 
ATOM   242  C  CB    . VAL A 1  40  ? -76.401 23.297 -65.250 1.00 75.14  ? 37  VAL A CB    1 
ATOM   243  C  CG1   . VAL A 1  40  ? -77.388 24.442 -65.025 1.00 74.30  ? 37  VAL A CG1   1 
ATOM   244  C  CG2   . VAL A 1  40  ? -77.117 21.968 -65.296 1.00 74.90  ? 37  VAL A CG2   1 
ATOM   245  N  N     . LYS A 1  41  ? -75.055 25.774 -67.223 1.00 73.96  ? 38  LYS A N     1 
ATOM   246  C  CA    . LYS A 1  41  ? -74.337 27.038 -67.186 1.00 73.48  ? 38  LYS A CA    1 
ATOM   247  C  C     . LYS A 1  41  ? -75.285 28.180 -66.825 1.00 73.89  ? 38  LYS A C     1 
ATOM   248  O  O     . LYS A 1  41  ? -76.499 28.013 -66.854 1.00 73.96  ? 38  LYS A O     1 
ATOM   249  C  CB    . LYS A 1  41  ? -73.625 27.296 -68.521 1.00 73.06  ? 38  LYS A CB    1 
ATOM   250  C  CG    . LYS A 1  41  ? -72.545 26.263 -68.858 1.00 71.69  ? 38  LYS A CG    1 
ATOM   251  C  CD    . LYS A 1  41  ? -71.634 26.676 -70.009 1.00 69.67  ? 38  LYS A CD    1 
ATOM   252  C  CE    . LYS A 1  41  ? -70.615 25.565 -70.299 1.00 70.08  ? 38  LYS A CE    1 
ATOM   253  N  NZ    . LYS A 1  41  ? -69.567 25.935 -71.303 1.00 69.42  ? 38  LYS A NZ    1 
ATOM   254  N  N     . VAL A 1  42  ? -74.723 29.326 -66.449 1.00 74.44  ? 39  VAL A N     1 
ATOM   255  C  CA    . VAL A 1  42  ? -75.503 30.538 -66.176 1.00 74.82  ? 39  VAL A CA    1 
ATOM   256  C  C     . VAL A 1  42  ? -74.754 31.766 -66.696 1.00 75.16  ? 39  VAL A C     1 
ATOM   257  O  O     . VAL A 1  42  ? -73.525 31.764 -66.781 1.00 74.79  ? 39  VAL A O     1 
ATOM   258  C  CB    . VAL A 1  42  ? -75.877 30.687 -64.664 1.00 74.82  ? 39  VAL A CB    1 
ATOM   259  C  CG1   . VAL A 1  42  ? -74.640 30.637 -63.767 1.00 74.83  ? 39  VAL A CG1   1 
ATOM   260  C  CG2   . VAL A 1  42  ? -76.691 31.967 -64.409 1.00 74.85  ? 39  VAL A CG2   1 
ATOM   261  N  N     . SER A 1  43  ? -75.511 32.797 -67.058 1.00 76.06  ? 40  SER A N     1 
ATOM   262  C  CA    . SER A 1  43  ? -74.948 34.016 -67.622 1.00 77.11  ? 40  SER A CA    1 
ATOM   263  C  C     . SER A 1  43  ? -74.878 35.136 -66.583 1.00 77.60  ? 40  SER A C     1 
ATOM   264  O  O     . SER A 1  43  ? -75.876 35.802 -66.290 1.00 78.06  ? 40  SER A O     1 
ATOM   265  C  CB    . SER A 1  43  ? -75.754 34.454 -68.838 1.00 77.00  ? 40  SER A CB    1 
ATOM   266  O  OG    . SER A 1  43  ? -75.013 35.399 -69.576 1.00 77.52  ? 40  SER A OG    1 
ATOM   267  N  N     . ARG A 1  44  ? -73.691 35.332 -66.023 1.00 78.03  ? 41  ARG A N     1 
ATOM   268  C  CA    . ARG A 1  44  ? -73.510 36.283 -64.936 1.00 78.63  ? 41  ARG A CA    1 
ATOM   269  C  C     . ARG A 1  44  ? -72.814 37.553 -65.419 1.00 79.03  ? 41  ARG A C     1 
ATOM   270  O  O     . ARG A 1  44  ? -72.098 37.517 -66.428 1.00 79.28  ? 41  ARG A O     1 
ATOM   271  C  CB    . ARG A 1  44  ? -72.748 35.626 -63.781 1.00 78.60  ? 41  ARG A CB    1 
ATOM   272  C  CG    . ARG A 1  44  ? -73.581 34.583 -63.040 1.00 79.05  ? 41  ARG A CG    1 
ATOM   273  C  CD    . ARG A 1  44  ? -73.198 34.443 -61.578 1.00 79.73  ? 41  ARG A CD    1 
ATOM   274  N  NE    . ARG A 1  44  ? -73.460 35.650 -60.791 1.00 80.97  ? 41  ARG A NE    1 
ATOM   275  C  CZ    . ARG A 1  44  ? -74.629 35.953 -60.228 1.00 81.60  ? 41  ARG A CZ    1 
ATOM   276  N  NH1   . ARG A 1  44  ? -75.676 35.150 -60.359 1.00 83.00  ? 41  ARG A NH1   1 
ATOM   277  N  NH2   . ARG A 1  44  ? -74.758 37.073 -59.531 1.00 81.43  ? 41  ARG A NH2   1 
ATOM   278  N  N     . PRO A 1  45  ? -73.033 38.690 -64.720 1.00 79.29  ? 42  PRO A N     1 
ATOM   279  C  CA    . PRO A 1  45  ? -72.330 39.911 -65.143 1.00 79.26  ? 42  PRO A CA    1 
ATOM   280  C  C     . PRO A 1  45  ? -70.835 39.662 -65.462 1.00 79.26  ? 42  PRO A C     1 
ATOM   281  O  O     . PRO A 1  45  ? -70.335 40.154 -66.480 1.00 79.26  ? 42  PRO A O     1 
ATOM   282  C  CB    . PRO A 1  45  ? -72.502 40.850 -63.940 1.00 79.40  ? 42  PRO A CB    1 
ATOM   283  C  CG    . PRO A 1  45  ? -73.798 40.407 -63.285 1.00 79.09  ? 42  PRO A CG    1 
ATOM   284  C  CD    . PRO A 1  45  ? -73.972 38.937 -63.599 1.00 79.21  ? 42  PRO A CD    1 
ATOM   285  N  N     . GLU A 1  46  ? -70.152 38.873 -64.626 1.00 78.95  ? 43  GLU A N     1 
ATOM   286  C  CA    . GLU A 1  46  ? -68.712 38.590 -64.788 1.00 78.80  ? 43  GLU A CA    1 
ATOM   287  C  C     . GLU A 1  46  ? -68.399 37.642 -65.961 1.00 77.79  ? 43  GLU A C     1 
ATOM   288  O  O     . GLU A 1  46  ? -67.229 37.444 -66.323 1.00 77.92  ? 43  GLU A O     1 
ATOM   289  C  CB    . GLU A 1  46  ? -68.108 38.018 -63.493 1.00 79.23  ? 43  GLU A CB    1 
ATOM   290  C  CG    . GLU A 1  46  ? -68.700 38.568 -62.192 1.00 81.85  ? 43  GLU A CG    1 
ATOM   291  C  CD    . GLU A 1  46  ? -70.011 37.878 -61.798 1.00 85.85  ? 43  GLU A CD    1 
ATOM   292  O  OE1   . GLU A 1  46  ? -70.184 36.678 -62.136 1.00 86.73  ? 43  GLU A OE1   1 
ATOM   293  O  OE2   . GLU A 1  46  ? -70.861 38.535 -61.143 1.00 87.23  ? 43  GLU A OE2   1 
ATOM   294  N  N     . GLY A 1  47  ? -69.443 37.053 -66.544 1.00 76.36  ? 44  GLY A N     1 
ATOM   295  C  CA    . GLY A 1  47  ? -69.280 36.079 -67.623 1.00 74.20  ? 44  GLY A CA    1 
ATOM   296  C  C     . GLY A 1  47  ? -70.094 34.828 -67.366 1.00 72.57  ? 44  GLY A C     1 
ATOM   297  O  O     . GLY A 1  47  ? -70.965 34.813 -66.500 1.00 72.82  ? 44  GLY A O     1 
ATOM   298  N  N     . VAL A 1  48  ? -69.805 33.772 -68.116 1.00 70.68  ? 45  VAL A N     1 
ATOM   299  C  CA    . VAL A 1  48  ? -70.571 32.538 -68.026 1.00 68.53  ? 45  VAL A CA    1 
ATOM   300  C  C     . VAL A 1  48  ? -69.842 31.546 -67.146 1.00 67.17  ? 45  VAL A C     1 
ATOM   301  O  O     . VAL A 1  48  ? -68.705 31.182 -67.427 1.00 66.96  ? 45  VAL A O     1 
ATOM   302  C  CB    . VAL A 1  48  ? -70.801 31.924 -69.425 1.00 68.62  ? 45  VAL A CB    1 
ATOM   303  C  CG1   . VAL A 1  48  ? -71.594 30.619 -69.332 1.00 68.17  ? 45  VAL A CG1   1 
ATOM   304  C  CG2   . VAL A 1  48  ? -71.502 32.919 -70.325 1.00 68.30  ? 45  VAL A CG2   1 
ATOM   305  N  N     . LYS A 1  49  ? -70.505 31.106 -66.085 1.00 65.73  ? 46  LYS A N     1 
ATOM   306  C  CA    . LYS A 1  49  ? -69.924 30.137 -65.165 1.00 64.38  ? 46  LYS A CA    1 
ATOM   307  C  C     . LYS A 1  49  ? -70.680 28.817 -65.216 1.00 63.85  ? 46  LYS A C     1 
ATOM   308  O  O     . LYS A 1  49  ? -71.856 28.786 -65.561 1.00 63.83  ? 46  LYS A O     1 
ATOM   309  C  CB    . LYS A 1  49  ? -69.910 30.690 -63.736 1.00 64.10  ? 46  LYS A CB    1 
ATOM   310  C  CG    . LYS A 1  49  ? -69.342 32.100 -63.600 1.00 63.04  ? 46  LYS A CG    1 
ATOM   311  C  CD    . LYS A 1  49  ? -67.879 32.151 -63.982 1.00 61.73  ? 46  LYS A CD    1 
ATOM   312  C  CE    . LYS A 1  49  ? -67.392 33.572 -64.093 1.00 62.20  ? 46  LYS A CE    1 
ATOM   313  N  NZ    . LYS A 1  49  ? -65.927 33.602 -64.389 1.00 64.50  ? 46  LYS A NZ    1 
ATOM   314  N  N     . ILE A 1  50  ? -69.997 27.729 -64.882 1.00 62.91  ? 47  ILE A N     1 
ATOM   315  C  CA    . ILE A 1  50  ? -70.631 26.431 -64.764 1.00 62.18  ? 47  ILE A CA    1 
ATOM   316  C  C     . ILE A 1  50  ? -71.254 26.312 -63.377 1.00 62.25  ? 47  ILE A C     1 
ATOM   317  O  O     . ILE A 1  50  ? -70.616 26.676 -62.381 1.00 62.52  ? 47  ILE A O     1 
ATOM   318  C  CB    . ILE A 1  50  ? -69.596 25.304 -64.942 1.00 61.98  ? 47  ILE A CB    1 
ATOM   319  C  CG1   . ILE A 1  50  ? -69.122 25.229 -66.395 1.00 61.64  ? 47  ILE A CG1   1 
ATOM   320  C  CG2   . ILE A 1  50  ? -70.149 23.972 -64.467 1.00 61.39  ? 47  ILE A CG2   1 
ATOM   321  C  CD1   . ILE A 1  50  ? -67.704 24.693 -66.555 1.00 61.57  ? 47  ILE A CD1   1 
ATOM   322  N  N     . ILE A 1  51  ? -72.493 25.821 -63.306 1.00 61.79  ? 48  ILE A N     1 
ATOM   323  C  CA    . ILE A 1  51  ? -73.081 25.460 -62.025 1.00 61.52  ? 48  ILE A CA    1 
ATOM   324  C  C     . ILE A 1  51  ? -72.924 23.974 -61.845 1.00 62.29  ? 48  ILE A C     1 
ATOM   325  O  O     . ILE A 1  51  ? -73.616 23.204 -62.493 1.00 62.76  ? 48  ILE A O     1 
ATOM   326  C  CB    . ILE A 1  51  ? -74.571 25.776 -61.915 1.00 60.97  ? 48  ILE A CB    1 
ATOM   327  C  CG1   . ILE A 1  51  ? -74.843 27.242 -62.213 1.00 60.12  ? 48  ILE A CG1   1 
ATOM   328  C  CG2   . ILE A 1  51  ? -75.078 25.421 -60.517 1.00 60.50  ? 48  ILE A CG2   1 
ATOM   329  C  CD1   . ILE A 1  51  ? -76.292 27.569 -62.307 1.00 58.58  ? 48  ILE A CD1   1 
ATOM   330  N  N     . PRO A 1  52  ? -72.016 23.557 -60.956 1.00 62.94  ? 49  PRO A N     1 
ATOM   331  C  CA    . PRO A 1  52  ? -71.936 22.137 -60.698 1.00 63.47  ? 49  PRO A CA    1 
ATOM   332  C  C     . PRO A 1  52  ? -73.083 21.656 -59.798 1.00 63.98  ? 49  PRO A C     1 
ATOM   333  O  O     . PRO A 1  52  ? -73.624 22.436 -59.013 1.00 63.70  ? 49  PRO A O     1 
ATOM   334  C  CB    . PRO A 1  52  ? -70.580 21.990 -59.992 1.00 63.61  ? 49  PRO A CB    1 
ATOM   335  C  CG    . PRO A 1  52  ? -70.359 23.288 -59.322 1.00 62.89  ? 49  PRO A CG    1 
ATOM   336  C  CD    . PRO A 1  52  ? -71.053 24.329 -60.147 1.00 62.98  ? 49  PRO A CD    1 
ATOM   337  N  N     . PRO A 1  53  ? -73.460 20.372 -59.921 1.00 64.81  ? 50  PRO A N     1 
ATOM   338  C  CA    . PRO A 1  53  ? -74.433 19.784 -58.993 1.00 65.12  ? 50  PRO A CA    1 
ATOM   339  C  C     . PRO A 1  53  ? -73.890 19.808 -57.577 1.00 65.38  ? 50  PRO A C     1 
ATOM   340  O  O     . PRO A 1  53  ? -72.686 19.669 -57.385 1.00 65.27  ? 50  PRO A O     1 
ATOM   341  C  CB    . PRO A 1  53  ? -74.539 18.327 -59.471 1.00 65.31  ? 50  PRO A CB    1 
ATOM   342  C  CG    . PRO A 1  53  ? -73.285 18.063 -60.274 1.00 64.89  ? 50  PRO A CG    1 
ATOM   343  C  CD    . PRO A 1  53  ? -72.991 19.392 -60.927 1.00 65.03  ? 50  PRO A CD    1 
ATOM   344  N  N     . GLN A 1  54  ? -74.776 19.960 -56.603 1.00 65.82  ? 51  GLN A N     1 
ATOM   345  C  CA    . GLN A 1  54  ? -74.396 19.996 -55.197 1.00 66.54  ? 51  GLN A CA    1 
ATOM   346  C  C     . GLN A 1  54  ? -73.451 18.869 -54.793 1.00 66.44  ? 51  GLN A C     1 
ATOM   347  O  O     . GLN A 1  54  ? -72.573 19.067 -53.946 1.00 66.96  ? 51  GLN A O     1 
ATOM   348  C  CB    . GLN A 1  54  ? -75.642 19.975 -54.316 1.00 67.00  ? 51  GLN A CB    1 
ATOM   349  C  CG    . GLN A 1  54  ? -75.452 20.554 -52.921 1.00 70.38  ? 51  GLN A CG    1 
ATOM   350  C  CD    . GLN A 1  54  ? -76.747 21.117 -52.335 1.00 75.45  ? 51  GLN A CD    1 
ATOM   351  O  OE1   . GLN A 1  54  ? -77.781 21.206 -53.022 1.00 77.64  ? 51  GLN A OE1   1 
ATOM   352  N  NE2   . GLN A 1  54  ? -76.697 21.506 -51.059 1.00 76.64  ? 51  GLN A NE2   1 
ATOM   353  N  N     . SER A 1  55  ? -73.615 17.695 -55.397 1.00 66.27  ? 52  SER A N     1 
ATOM   354  C  CA    . SER A 1  55  ? -72.802 16.523 -55.036 1.00 66.05  ? 52  SER A CA    1 
ATOM   355  C  C     . SER A 1  55  ? -71.360 16.617 -55.534 1.00 65.51  ? 52  SER A C     1 
ATOM   356  O  O     . SER A 1  55  ? -70.547 15.744 -55.260 1.00 65.49  ? 52  SER A O     1 
ATOM   357  C  CB    . SER A 1  55  ? -73.442 15.243 -55.568 1.00 66.21  ? 52  SER A CB    1 
ATOM   358  O  OG    . SER A 1  55  ? -73.441 15.252 -56.986 1.00 67.14  ? 52  SER A OG    1 
ATOM   359  N  N     . ASP A 1  56  ? -71.069 17.676 -56.276 1.00 65.04  ? 53  ASP A N     1 
ATOM   360  C  CA    . ASP A 1  56  ? -69.746 17.935 -56.817 1.00 64.84  ? 53  ASP A CA    1 
ATOM   361  C  C     . ASP A 1  56  ? -68.966 19.002 -56.035 1.00 64.15  ? 53  ASP A C     1 
ATOM   362  O  O     . ASP A 1  56  ? -67.739 19.026 -56.061 1.00 63.79  ? 53  ASP A O     1 
ATOM   363  C  CB    . ASP A 1  56  ? -69.896 18.422 -58.258 1.00 65.46  ? 53  ASP A CB    1 
ATOM   364  C  CG    . ASP A 1  56  ? -69.809 17.309 -59.268 1.00 66.55  ? 53  ASP A CG    1 
ATOM   365  O  OD1   . ASP A 1  56  ? -69.529 16.157 -58.871 1.00 67.78  ? 53  ASP A OD1   1 
ATOM   366  O  OD2   . ASP A 1  56  ? -70.002 17.605 -60.467 1.00 68.14  ? 53  ASP A OD2   1 
ATOM   367  N  N     . ARG A 1  57  ? -69.697 19.877 -55.351 1.00 63.44  ? 54  ARG A N     1 
ATOM   368  C  CA    . ARG A 1  57  ? -69.168 21.139 -54.832 1.00 62.85  ? 54  ARG A CA    1 
ATOM   369  C  C     . ARG A 1  57  ? -68.050 21.004 -53.793 1.00 62.76  ? 54  ARG A C     1 
ATOM   370  O  O     . ARG A 1  57  ? -67.001 21.643 -53.906 1.00 63.11  ? 54  ARG A O     1 
ATOM   371  C  CB    . ARG A 1  57  ? -70.316 22.018 -54.331 1.00 62.54  ? 54  ARG A CB    1 
ATOM   372  C  CG    . ARG A 1  57  ? -71.213 22.455 -55.478 1.00 61.21  ? 54  ARG A CG    1 
ATOM   373  C  CD    . ARG A 1  57  ? -72.452 23.161 -55.023 1.00 59.90  ? 54  ARG A CD    1 
ATOM   374  N  NE    . ARG A 1  57  ? -73.372 23.317 -56.145 1.00 59.82  ? 54  ARG A NE    1 
ATOM   375  C  CZ    . ARG A 1  57  ? -74.597 23.830 -56.059 1.00 60.29  ? 54  ARG A CZ    1 
ATOM   376  N  NH1   . ARG A 1  57  ? -75.076 24.258 -54.897 1.00 60.39  ? 54  ARG A NH1   1 
ATOM   377  N  NH2   . ARG A 1  57  ? -75.350 23.913 -57.144 1.00 60.37  ? 54  ARG A NH2   1 
ATOM   378  N  N     . GLN A 1  58  ? -68.266 20.150 -52.809 1.00 62.11  ? 55  GLN A N     1 
ATOM   379  C  CA    . GLN A 1  58  ? -67.240 19.841 -51.842 1.00 61.56  ? 55  GLN A CA    1 
ATOM   380  C  C     . GLN A 1  58  ? -65.901 19.524 -52.509 1.00 60.61  ? 55  GLN A C     1 
ATOM   381  O  O     . GLN A 1  58  ? -64.889 20.115 -52.158 1.00 61.59  ? 55  GLN A O     1 
ATOM   382  C  CB    . GLN A 1  58  ? -67.705 18.702 -50.937 1.00 61.81  ? 55  GLN A CB    1 
ATOM   383  C  CG    . GLN A 1  58  ? -66.584 17.864 -50.347 1.00 64.58  ? 55  GLN A CG    1 
ATOM   384  C  CD    . GLN A 1  58  ? -66.935 17.288 -48.988 1.00 67.97  ? 55  GLN A CD    1 
ATOM   385  O  OE1   . GLN A 1  58  ? -67.967 17.630 -48.396 1.00 69.49  ? 55  GLN A OE1   1 
ATOM   386  N  NE2   . GLN A 1  58  ? -66.071 16.415 -48.479 1.00 68.63  ? 55  GLN A NE2   1 
ATOM   387  N  N     . LYS A 1  59  ? -65.901 18.616 -53.478 1.00 59.42  ? 56  LYS A N     1 
ATOM   388  C  CA    . LYS A 1  59  ? -64.669 18.152 -54.149 1.00 57.92  ? 56  LYS A CA    1 
ATOM   389  C  C     . LYS A 1  59  ? -63.980 19.299 -54.907 1.00 56.35  ? 56  LYS A C     1 
ATOM   390  O  O     . LYS A 1  59  ? -62.758 19.357 -55.003 1.00 56.10  ? 56  LYS A O     1 
ATOM   391  C  CB    . LYS A 1  59  ? -65.005 16.980 -55.095 1.00 58.14  ? 56  LYS A CB    1 
ATOM   392  C  CG    . LYS A 1  59  ? -63.817 16.291 -55.758 1.00 60.45  ? 56  LYS A CG    1 
ATOM   393  C  CD    . LYS A 1  59  ? -64.220 15.569 -57.056 1.00 64.98  ? 56  LYS A CD    1 
ATOM   394  C  CE    . LYS A 1  59  ? -63.058 14.718 -57.623 1.00 67.11  ? 56  LYS A CE    1 
ATOM   395  N  NZ    . LYS A 1  59  ? -63.463 13.930 -58.839 1.00 68.37  ? 56  LYS A NZ    1 
ATOM   396  N  N     . ILE A 1  60  ? -64.787 20.208 -55.439 1.00 54.55  ? 57  ILE A N     1 
ATOM   397  C  CA    . ILE A 1  60  ? -64.298 21.366 -56.144 1.00 52.64  ? 57  ILE A CA    1 
ATOM   398  C  C     . ILE A 1  60  ? -63.601 22.323 -55.174 1.00 51.84  ? 57  ILE A C     1 
ATOM   399  O  O     . ILE A 1  60  ? -62.458 22.736 -55.424 1.00 51.78  ? 57  ILE A O     1 
ATOM   400  C  CB    . ILE A 1  60  ? -65.440 22.052 -56.907 1.00 52.55  ? 57  ILE A CB    1 
ATOM   401  C  CG1   . ILE A 1  60  ? -65.884 21.147 -58.076 1.00 52.51  ? 57  ILE A CG1   1 
ATOM   402  C  CG2   . ILE A 1  60  ? -65.027 23.452 -57.376 1.00 52.20  ? 57  ILE A CG2   1 
ATOM   403  C  CD1   . ILE A 1  60  ? -66.970 21.724 -58.988 1.00 50.99  ? 57  ILE A CD1   1 
ATOM   404  N  N     . VAL A 1  61  ? -64.274 22.656 -54.069 1.00 50.49  ? 58  VAL A N     1 
ATOM   405  C  CA    . VAL A 1  61  ? -63.728 23.591 -53.071 1.00 49.11  ? 58  VAL A CA    1 
ATOM   406  C  C     . VAL A 1  61  ? -62.388 23.061 -52.559 1.00 49.24  ? 58  VAL A C     1 
ATOM   407  O  O     . VAL A 1  61  ? -61.418 23.798 -52.399 1.00 48.97  ? 58  VAL A O     1 
ATOM   408  C  CB    . VAL A 1  61  ? -64.685 23.810 -51.878 1.00 48.28  ? 58  VAL A CB    1 
ATOM   409  C  CG1   . VAL A 1  61  ? -64.032 24.681 -50.833 1.00 47.36  ? 58  VAL A CG1   1 
ATOM   410  C  CG2   . VAL A 1  61  ? -65.959 24.441 -52.326 1.00 46.74  ? 58  VAL A CG2   1 
ATOM   411  N  N     . LEU A 1  62  ? -62.344 21.763 -52.336 1.00 49.28  ? 59  LEU A N     1 
ATOM   412  C  CA    . LEU A 1  62  ? -61.166 21.127 -51.847 1.00 49.96  ? 59  LEU A CA    1 
ATOM   413  C  C     . LEU A 1  62  ? -60.004 21.252 -52.848 1.00 50.38  ? 59  LEU A C     1 
ATOM   414  O  O     . LEU A 1  62  ? -58.856 21.539 -52.460 1.00 50.37  ? 59  LEU A O     1 
ATOM   415  C  CB    . LEU A 1  62  ? -61.500 19.670 -51.570 1.00 50.15  ? 59  LEU A CB    1 
ATOM   416  C  CG    . LEU A 1  62  ? -60.567 18.951 -50.604 1.00 52.53  ? 59  LEU A CG    1 
ATOM   417  C  CD1   . LEU A 1  62  ? -60.661 19.552 -49.164 1.00 52.52  ? 59  LEU A CD1   1 
ATOM   418  C  CD2   . LEU A 1  62  ? -60.840 17.436 -50.648 1.00 53.15  ? 59  LEU A CD2   1 
ATOM   419  N  N     . GLN A 1  63  ? -60.303 21.045 -54.131 1.00 50.26  ? 60  GLN A N     1 
ATOM   420  C  CA    . GLN A 1  63  ? -59.298 21.173 -55.168 1.00 50.57  ? 60  GLN A CA    1 
ATOM   421  C  C     . GLN A 1  63  ? -58.764 22.595 -55.251 1.00 49.54  ? 60  GLN A C     1 
ATOM   422  O  O     . GLN A 1  63  ? -57.556 22.811 -55.358 1.00 49.62  ? 60  GLN A O     1 
ATOM   423  C  CB    . GLN A 1  63  ? -59.837 20.701 -56.512 1.00 51.07  ? 60  GLN A CB    1 
ATOM   424  C  CG    . GLN A 1  63  ? -59.427 19.264 -56.790 1.00 56.83  ? 60  GLN A CG    1 
ATOM   425  C  CD    . GLN A 1  63  ? -60.340 18.497 -57.781 1.00 63.95  ? 60  GLN A CD    1 
ATOM   426  O  OE1   . GLN A 1  63  ? -60.306 17.254 -57.816 1.00 65.64  ? 60  GLN A OE1   1 
ATOM   427  N  NE2   . GLN A 1  63  ? -61.142 19.228 -58.585 1.00 64.96  ? 60  GLN A NE2   1 
ATOM   428  N  N     . ALA A 1  64  ? -59.665 23.562 -55.203 1.00 48.30  ? 61  ALA A N     1 
ATOM   429  C  CA    . ALA A 1  64  ? -59.265 24.948 -55.189 1.00 47.34  ? 61  ALA A CA    1 
ATOM   430  C  C     . ALA A 1  64  ? -58.367 25.235 -53.973 1.00 46.79  ? 61  ALA A C     1 
ATOM   431  O  O     . ALA A 1  64  ? -57.258 25.776 -54.115 1.00 46.73  ? 61  ALA A O     1 
ATOM   432  C  CB    . ALA A 1  64  ? -60.489 25.842 -55.181 1.00 47.44  ? 61  ALA A CB    1 
ATOM   433  N  N     . HIS A 1  65  ? -58.839 24.848 -52.791 1.00 45.49  ? 62  HIS A N     1 
ATOM   434  C  CA    . HIS A 1  65  ? -58.118 25.122 -51.570 1.00 44.52  ? 62  HIS A CA    1 
ATOM   435  C  C     . HIS A 1  65  ? -56.750 24.482 -51.579 1.00 44.15  ? 62  HIS A C     1 
ATOM   436  O  O     . HIS A 1  65  ? -55.792 25.091 -51.129 1.00 43.61  ? 62  HIS A O     1 
ATOM   437  C  CB    . HIS A 1  65  ? -58.903 24.669 -50.325 1.00 44.20  ? 62  HIS A CB    1 
ATOM   438  C  CG    . HIS A 1  65  ? -58.115 24.773 -49.050 1.00 43.65  ? 62  HIS A CG    1 
ATOM   439  N  ND1   . HIS A 1  65  ? -57.883 25.976 -48.415 1.00 42.16  ? 62  HIS A ND1   1 
ATOM   440  C  CD2   . HIS A 1  65  ? -57.474 23.828 -48.312 1.00 42.24  ? 62  HIS A CD2   1 
ATOM   441  C  CE1   . HIS A 1  65  ? -57.151 25.761 -47.332 1.00 43.08  ? 62  HIS A CE1   1 
ATOM   442  N  NE2   . HIS A 1  65  ? -56.894 24.468 -47.242 1.00 40.21  ? 62  HIS A NE2   1 
ATOM   443  N  N     . ASN A 1  66  ? -56.650 23.258 -52.088 1.00 44.39  ? 63  ASN A N     1 
ATOM   444  C  CA    . ASN A 1  66  ? -55.412 22.486 -51.929 1.00 44.35  ? 63  ASN A CA    1 
ATOM   445  C  C     . ASN A 1  66  ? -54.263 22.912 -52.808 1.00 43.78  ? 63  ASN A C     1 
ATOM   446  O  O     . ASN A 1  66  ? -53.138 22.465 -52.598 1.00 43.99  ? 63  ASN A O     1 
ATOM   447  C  CB    . ASN A 1  66  ? -55.651 20.986 -52.103 1.00 44.86  ? 63  ASN A CB    1 
ATOM   448  C  CG    . ASN A 1  66  ? -56.247 20.346 -50.868 1.00 46.96  ? 63  ASN A CG    1 
ATOM   449  O  OD1   . ASN A 1  66  ? -56.242 20.932 -49.782 1.00 49.67  ? 63  ASN A OD1   1 
ATOM   450  N  ND2   . ASN A 1  66  ? -56.770 19.143 -51.026 1.00 47.82  ? 63  ASN A ND2   1 
ATOM   451  N  N     . LEU A 1  67  ? -54.536 23.762 -53.796 1.00 43.12  ? 64  LEU A N     1 
ATOM   452  C  CA    . LEU A 1  67  ? -53.484 24.226 -54.693 1.00 42.42  ? 64  LEU A CA    1 
ATOM   453  C  C     . LEU A 1  67  ? -52.372 24.825 -53.867 1.00 42.17  ? 64  LEU A C     1 
ATOM   454  O  O     . LEU A 1  67  ? -51.231 24.418 -53.988 1.00 42.65  ? 64  LEU A O     1 
ATOM   455  C  CB    . LEU A 1  67  ? -54.023 25.219 -55.716 1.00 42.32  ? 64  LEU A CB    1 
ATOM   456  C  CG    . LEU A 1  67  ? -55.128 24.667 -56.625 1.00 41.86  ? 64  LEU A CG    1 
ATOM   457  C  CD1   . LEU A 1  67  ? -55.668 25.770 -57.494 1.00 41.57  ? 64  LEU A CD1   1 
ATOM   458  C  CD2   . LEU A 1  67  ? -54.658 23.472 -57.477 1.00 40.22  ? 64  LEU A CD2   1 
ATOM   459  N  N     . ALA A 1  68  ? -52.711 25.745 -52.974 1.00 41.87  ? 65  ALA A N     1 
ATOM   460  C  CA    . ALA A 1  68  ? -51.705 26.317 -52.062 1.00 41.67  ? 65  ALA A CA    1 
ATOM   461  C  C     . ALA A 1  68  ? -52.198 26.502 -50.620 1.00 41.00  ? 65  ALA A C     1 
ATOM   462  O  O     . ALA A 1  68  ? -51.617 27.246 -49.863 1.00 40.97  ? 65  ALA A O     1 
ATOM   463  C  CB    . ALA A 1  68  ? -51.134 27.652 -52.636 1.00 41.14  ? 65  ALA A CB    1 
ATOM   464  N  N     . HIS A 1  69  ? -53.265 25.808 -50.250 1.00 40.96  ? 66  HIS A N     1 
ATOM   465  C  CA    . HIS A 1  69  ? -53.838 25.889 -48.897 1.00 40.39  ? 66  HIS A CA    1 
ATOM   466  C  C     . HIS A 1  69  ? -54.156 27.321 -48.529 1.00 40.77  ? 66  HIS A C     1 
ATOM   467  O  O     . HIS A 1  69  ? -53.716 27.844 -47.499 1.00 40.73  ? 66  HIS A O     1 
ATOM   468  C  CB    . HIS A 1  69  ? -52.942 25.200 -47.887 1.00 39.85  ? 66  HIS A CB    1 
ATOM   469  C  CG    . HIS A 1  69  ? -53.042 23.715 -47.941 1.00 39.38  ? 66  HIS A CG    1 
ATOM   470  N  ND1   . HIS A 1  69  ? -54.047 23.014 -47.306 1.00 38.55  ? 66  HIS A ND1   1 
ATOM   471  C  CD2   . HIS A 1  69  ? -52.290 22.796 -48.592 1.00 38.30  ? 66  HIS A CD2   1 
ATOM   472  C  CE1   . HIS A 1  69  ? -53.897 21.725 -47.548 1.00 38.56  ? 66  HIS A CE1   1 
ATOM   473  N  NE2   . HIS A 1  69  ? -52.837 21.566 -48.324 1.00 38.89  ? 66  HIS A NE2   1 
ATOM   474  N  N     . THR A 1  70  ? -54.914 27.934 -49.433 1.00 40.94  ? 67  THR A N     1 
ATOM   475  C  CA    . THR A 1  70  ? -55.322 29.319 -49.370 1.00 41.26  ? 67  THR A CA    1 
ATOM   476  C  C     . THR A 1  70  ? -56.538 29.477 -48.469 1.00 41.31  ? 67  THR A C     1 
ATOM   477  O  O     . THR A 1  70  ? -57.315 28.544 -48.282 1.00 41.18  ? 67  THR A O     1 
ATOM   478  C  CB    . THR A 1  70  ? -55.667 29.826 -50.785 1.00 41.43  ? 67  THR A CB    1 
ATOM   479  O  OG1   . THR A 1  70  ? -56.442 28.836 -51.461 1.00 41.89  ? 67  THR A OG1   1 
ATOM   480  C  CG2   . THR A 1  70  ? -54.411 30.038 -51.595 1.00 41.18  ? 67  THR A CG2   1 
ATOM   481  N  N     . GLY A 1  71  ? -56.673 30.669 -47.903 1.00 41.49  ? 68  GLY A N     1 
ATOM   482  C  CA    . GLY A 1  71  ? -57.810 31.037 -47.060 1.00 41.32  ? 68  GLY A CA    1 
ATOM   483  C  C     . GLY A 1  71  ? -59.046 31.384 -47.871 1.00 41.21  ? 68  GLY A C     1 
ATOM   484  O  O     . GLY A 1  71  ? -59.185 30.951 -49.009 1.00 41.58  ? 68  GLY A O     1 
ATOM   485  N  N     . ARG A 1  72  ? -59.931 32.190 -47.295 1.00 41.08  ? 69  ARG A N     1 
ATOM   486  C  CA    . ARG A 1  72  ? -61.276 32.348 -47.829 1.00 41.08  ? 69  ARG A CA    1 
ATOM   487  C  C     . ARG A 1  72  ? -61.287 32.963 -49.222 1.00 41.61  ? 69  ARG A C     1 
ATOM   488  O  O     . ARG A 1  72  ? -61.754 32.340 -50.165 1.00 41.68  ? 69  ARG A O     1 
ATOM   489  C  CB    . ARG A 1  72  ? -62.147 33.169 -46.880 1.00 40.79  ? 69  ARG A CB    1 
ATOM   490  C  CG    . ARG A 1  72  ? -63.617 33.214 -47.303 1.00 40.40  ? 69  ARG A CG    1 
ATOM   491  C  CD    . ARG A 1  72  ? -64.249 34.572 -47.061 1.00 40.20  ? 69  ARG A CD    1 
ATOM   492  N  NE    . ARG A 1  72  ? -63.890 35.050 -45.737 1.00 43.07  ? 69  ARG A NE    1 
ATOM   493  C  CZ    . ARG A 1  72  ? -63.669 36.318 -45.406 1.00 42.99  ? 69  ARG A CZ    1 
ATOM   494  N  NH1   . ARG A 1  72  ? -63.796 37.300 -46.292 1.00 41.22  ? 69  ARG A NH1   1 
ATOM   495  N  NH2   . ARG A 1  72  ? -63.321 36.591 -44.157 1.00 44.35  ? 69  ARG A NH2   1 
ATOM   496  N  N     . GLU A 1  73  ? -60.755 34.177 -49.344 1.00 41.75  ? 70  GLU A N     1 
ATOM   497  C  CA    . GLU A 1  73  ? -60.853 34.930 -50.577 1.00 41.66  ? 70  GLU A CA    1 
ATOM   498  C  C     . GLU A 1  73  ? -59.992 34.355 -51.692 1.00 41.60  ? 70  GLU A C     1 
ATOM   499  O  O     . GLU A 1  73  ? -60.444 34.266 -52.845 1.00 42.06  ? 70  GLU A O     1 
ATOM   500  C  CB    . GLU A 1  73  ? -60.550 36.407 -50.331 1.00 42.02  ? 70  GLU A CB    1 
ATOM   501  C  CG    . GLU A 1  73  ? -61.557 37.064 -49.401 1.00 43.80  ? 70  GLU A CG    1 
ATOM   502  C  CD    . GLU A 1  73  ? -62.981 37.046 -49.963 1.00 46.28  ? 70  GLU A CD    1 
ATOM   503  O  OE1   . GLU A 1  73  ? -63.167 37.454 -51.134 1.00 47.04  ? 70  GLU A OE1   1 
ATOM   504  O  OE2   . GLU A 1  73  ? -63.914 36.637 -49.236 1.00 46.17  ? 70  GLU A OE2   1 
ATOM   505  N  N     . ALA A 1  74  ? -58.768 33.952 -51.373 1.00 40.96  ? 71  ALA A N     1 
ATOM   506  C  CA    . ALA A 1  74  ? -57.902 33.394 -52.405 1.00 40.88  ? 71  ALA A CA    1 
ATOM   507  C  C     . ALA A 1  74  ? -58.442 32.057 -52.960 1.00 41.09  ? 71  ALA A C     1 
ATOM   508  O  O     . ALA A 1  74  ? -58.202 31.712 -54.120 1.00 41.09  ? 71  ALA A O     1 
ATOM   509  C  CB    . ALA A 1  74  ? -56.491 33.237 -51.898 1.00 40.34  ? 71  ALA A CB    1 
ATOM   510  N  N     . THR A 1  75  ? -59.157 31.310 -52.129 1.00 41.27  ? 72  THR A N     1 
ATOM   511  C  CA    . THR A 1  75  ? -59.743 30.055 -52.553 1.00 41.83  ? 72  THR A CA    1 
ATOM   512  C  C     . THR A 1  75  ? -60.956 30.383 -53.398 1.00 42.17  ? 72  THR A C     1 
ATOM   513  O  O     . THR A 1  75  ? -61.114 29.876 -54.513 1.00 42.24  ? 72  THR A O     1 
ATOM   514  C  CB    . THR A 1  75  ? -60.116 29.171 -51.345 1.00 41.96  ? 72  THR A CB    1 
ATOM   515  O  OG1   . THR A 1  75  ? -58.924 28.861 -50.603 1.00 41.16  ? 72  THR A OG1   1 
ATOM   516  C  CG2   . THR A 1  75  ? -60.763 27.871 -51.804 1.00 42.46  ? 72  THR A CG2   1 
ATOM   517  N  N     . LEU A 1  76  ? -61.785 31.286 -52.895 1.00 42.68  ? 73  LEU A N     1 
ATOM   518  C  CA    . LEU A 1  76  ? -62.943 31.707 -53.655 1.00 43.06  ? 73  LEU A CA    1 
ATOM   519  C  C     . LEU A 1  76  ? -62.563 32.228 -55.051 1.00 43.26  ? 73  LEU A C     1 
ATOM   520  O  O     . LEU A 1  76  ? -63.183 31.837 -56.051 1.00 43.69  ? 73  LEU A O     1 
ATOM   521  C  CB    . LEU A 1  76  ? -63.780 32.727 -52.898 1.00 42.70  ? 73  LEU A CB    1 
ATOM   522  C  CG    . LEU A 1  76  ? -64.929 33.101 -53.830 1.00 44.23  ? 73  LEU A CG    1 
ATOM   523  C  CD1   . LEU A 1  76  ? -66.231 32.382 -53.468 1.00 44.52  ? 73  LEU A CD1   1 
ATOM   524  C  CD2   . LEU A 1  76  ? -65.096 34.580 -53.873 1.00 43.84  ? 73  LEU A CD2   1 
ATOM   525  N  N     . LEU A 1  77  ? -61.556 33.093 -55.129 1.00 42.85  ? 74  LEU A N     1 
ATOM   526  C  CA    . LEU A 1  77  ? -61.156 33.640 -56.427 1.00 42.60  ? 74  LEU A CA    1 
ATOM   527  C  C     . LEU A 1  77  ? -60.804 32.555 -57.423 1.00 42.87  ? 74  LEU A C     1 
ATOM   528  O  O     . LEU A 1  77  ? -61.095 32.689 -58.608 1.00 43.73  ? 74  LEU A O     1 
ATOM   529  C  CB    . LEU A 1  77  ? -59.993 34.624 -56.297 1.00 42.44  ? 74  LEU A CB    1 
ATOM   530  C  CG    . LEU A 1  77  ? -60.424 35.961 -55.685 1.00 40.81  ? 74  LEU A CG    1 
ATOM   531  C  CD1   . LEU A 1  77  ? -59.270 36.608 -54.955 1.00 39.18  ? 74  LEU A CD1   1 
ATOM   532  C  CD2   . LEU A 1  77  ? -61.009 36.878 -56.724 1.00 37.37  ? 74  LEU A CD2   1 
ATOM   533  N  N     . LYS A 1  78  ? -60.206 31.464 -56.964 1.00 42.68  ? 75  LYS A N     1 
ATOM   534  C  CA    . LYS A 1  78  ? -59.959 30.368 -57.885 1.00 42.53  ? 75  LYS A CA    1 
ATOM   535  C  C     . LYS A 1  78  ? -61.267 29.782 -58.400 1.00 42.83  ? 75  LYS A C     1 
ATOM   536  O  O     . LYS A 1  78  ? -61.455 29.684 -59.605 1.00 42.90  ? 75  LYS A O     1 
ATOM   537  C  CB    . LYS A 1  78  ? -59.076 29.299 -57.265 1.00 42.06  ? 75  LYS A CB    1 
ATOM   538  C  CG    . LYS A 1  78  ? -57.610 29.649 -57.274 1.00 41.93  ? 75  LYS A CG    1 
ATOM   539  C  CD    . LYS A 1  78  ? -57.034 29.682 -58.665 1.00 39.99  ? 75  LYS A CD    1 
ATOM   540  C  CE    . LYS A 1  78  ? -55.608 30.110 -58.640 1.00 39.68  ? 75  LYS A CE    1 
ATOM   541  N  NZ    . LYS A 1  78  ? -54.987 30.115 -60.025 1.00 42.34  ? 75  LYS A NZ    1 
ATOM   542  N  N     . ILE A 1  79  ? -62.173 29.415 -57.494 1.00 42.90  ? 76  ILE A N     1 
ATOM   543  C  CA    . ILE A 1  79  ? -63.412 28.754 -57.884 1.00 43.53  ? 76  ILE A CA    1 
ATOM   544  C  C     . ILE A 1  79  ? -64.220 29.646 -58.826 1.00 44.35  ? 76  ILE A C     1 
ATOM   545  O  O     . ILE A 1  79  ? -64.679 29.195 -59.885 1.00 44.38  ? 76  ILE A O     1 
ATOM   546  C  CB    . ILE A 1  79  ? -64.255 28.353 -56.655 1.00 43.83  ? 76  ILE A CB    1 
ATOM   547  C  CG1   . ILE A 1  79  ? -63.372 27.601 -55.647 1.00 44.38  ? 76  ILE A CG1   1 
ATOM   548  C  CG2   . ILE A 1  79  ? -65.471 27.504 -57.066 1.00 42.85  ? 76  ILE A CG2   1 
ATOM   549  C  CD1   . ILE A 1  79  ? -63.988 27.393 -54.286 1.00 43.44  ? 76  ILE A CD1   1 
ATOM   550  N  N     . ALA A 1  80  ? -64.356 30.919 -58.457 1.00 44.68  ? 77  ALA A N     1 
ATOM   551  C  CA    . ALA A 1  80  ? -65.107 31.864 -59.256 1.00 45.22  ? 77  ALA A CA    1 
ATOM   552  C  C     . ALA A 1  80  ? -64.613 31.944 -60.706 1.00 45.86  ? 77  ALA A C     1 
ATOM   553  O  O     . ALA A 1  80  ? -65.369 32.342 -61.587 1.00 46.32  ? 77  ALA A O     1 
ATOM   554  C  CB    . ALA A 1  80  ? -65.100 33.235 -58.610 1.00 45.03  ? 77  ALA A CB    1 
ATOM   555  N  N     . ASN A 1  81  ? -63.364 31.579 -60.964 1.00 46.36  ? 78  ASN A N     1 
ATOM   556  C  CA    . ASN A 1  81  ? -62.894 31.536 -62.340 1.00 47.39  ? 78  ASN A CA    1 
ATOM   557  C  C     . ASN A 1  81  ? -63.755 30.684 -63.277 1.00 48.28  ? 78  ASN A C     1 
ATOM   558  O  O     . ASN A 1  81  ? -64.008 31.087 -64.414 1.00 48.32  ? 78  ASN A O     1 
ATOM   559  C  CB    . ASN A 1  81  ? -61.432 31.101 -62.429 1.00 47.15  ? 78  ASN A CB    1 
ATOM   560  C  CG    . ASN A 1  81  ? -60.468 32.233 -62.151 1.00 46.83  ? 78  ASN A CG    1 
ATOM   561  O  OD1   . ASN A 1  81  ? -60.783 33.402 -62.330 1.00 47.02  ? 78  ASN A OD1   1 
ATOM   562  N  ND2   . ASN A 1  81  ? -59.284 31.886 -61.709 1.00 47.44  ? 78  ASN A ND2   1 
ATOM   563  N  N     . LEU A 1  82  ? -64.210 29.531 -62.782 1.00 49.34  ? 79  LEU A N     1 
ATOM   564  C  CA    . LEU A 1  82  ? -64.961 28.554 -63.572 1.00 50.50  ? 79  LEU A CA    1 
ATOM   565  C  C     . LEU A 1  82  ? -66.410 28.378 -63.134 1.00 51.97  ? 79  LEU A C     1 
ATOM   566  O  O     . LEU A 1  82  ? -67.304 28.147 -63.970 1.00 52.73  ? 79  LEU A O     1 
ATOM   567  C  CB    . LEU A 1  82  ? -64.286 27.188 -63.518 1.00 50.04  ? 79  LEU A CB    1 
ATOM   568  C  CG    . LEU A 1  82  ? -62.863 27.122 -64.074 1.00 50.43  ? 79  LEU A CG    1 
ATOM   569  C  CD1   . LEU A 1  82  ? -62.360 25.681 -64.121 1.00 49.34  ? 79  LEU A CD1   1 
ATOM   570  C  CD2   . LEU A 1  82  ? -62.760 27.793 -65.438 1.00 49.72  ? 79  LEU A CD2   1 
ATOM   571  N  N     . TYR A 1  83  ? -66.654 28.475 -61.832 1.00 52.88  ? 80  TYR A N     1 
ATOM   572  C  CA    . TYR A 1  83  ? -67.941 28.060 -61.302 1.00 53.70  ? 80  TYR A CA    1 
ATOM   573  C  C     . TYR A 1  83  ? -68.747 29.174 -60.688 1.00 54.13  ? 80  TYR A C     1 
ATOM   574  O  O     . TYR A 1  83  ? -68.206 30.220 -60.325 1.00 54.87  ? 80  TYR A O     1 
ATOM   575  C  CB    . TYR A 1  83  ? -67.746 26.943 -60.283 1.00 53.55  ? 80  TYR A CB    1 
ATOM   576  C  CG    . TYR A 1  83  ? -66.997 25.767 -60.854 1.00 54.80  ? 80  TYR A CG    1 
ATOM   577  C  CD1   . TYR A 1  83  ? -67.600 24.926 -61.791 1.00 55.43  ? 80  TYR A CD1   1 
ATOM   578  C  CD2   . TYR A 1  83  ? -65.678 25.501 -60.469 1.00 54.88  ? 80  TYR A CD2   1 
ATOM   579  C  CE1   . TYR A 1  83  ? -66.920 23.840 -62.320 1.00 56.15  ? 80  TYR A CE1   1 
ATOM   580  C  CE2   . TYR A 1  83  ? -64.985 24.424 -60.984 1.00 55.59  ? 80  TYR A CE2   1 
ATOM   581  C  CZ    . TYR A 1  83  ? -65.611 23.593 -61.915 1.00 57.84  ? 80  TYR A CZ    1 
ATOM   582  O  OH    . TYR A 1  83  ? -64.930 22.515 -62.445 1.00 58.66  ? 80  TYR A OH    1 
ATOM   583  N  N     . TRP A 1  84  ? -70.055 28.951 -60.613 1.00 54.52  ? 81  TRP A N     1 
ATOM   584  C  CA    . TRP A 1  84  ? -70.918 29.712 -59.732 1.00 55.09  ? 81  TRP A CA    1 
ATOM   585  C  C     . TRP A 1  84  ? -71.926 28.765 -59.116 1.00 54.83  ? 81  TRP A C     1 
ATOM   586  O  O     . TRP A 1  84  ? -72.348 27.807 -59.758 1.00 54.75  ? 81  TRP A O     1 
ATOM   587  C  CB    . TRP A 1  84  ? -71.623 30.858 -60.454 1.00 55.46  ? 81  TRP A CB    1 
ATOM   588  C  CG    . TRP A 1  84  ? -72.469 31.691 -59.517 1.00 58.86  ? 81  TRP A CG    1 
ATOM   589  C  CD1   . TRP A 1  84  ? -72.093 32.837 -58.864 1.00 60.52  ? 81  TRP A CD1   1 
ATOM   590  C  CD2   . TRP A 1  84  ? -73.827 31.431 -59.114 1.00 61.56  ? 81  TRP A CD2   1 
ATOM   591  N  NE1   . TRP A 1  84  ? -73.133 33.308 -58.095 1.00 61.23  ? 81  TRP A NE1   1 
ATOM   592  C  CE2   . TRP A 1  84  ? -74.203 32.461 -58.222 1.00 61.99  ? 81  TRP A CE2   1 
ATOM   593  C  CE3   . TRP A 1  84  ? -74.764 30.430 -59.427 1.00 62.85  ? 81  TRP A CE3   1 
ATOM   594  C  CZ2   . TRP A 1  84  ? -75.474 32.515 -57.631 1.00 63.47  ? 81  TRP A CZ2   1 
ATOM   595  C  CZ3   . TRP A 1  84  ? -76.029 30.482 -58.833 1.00 63.57  ? 81  TRP A CZ3   1 
ATOM   596  C  CH2   . TRP A 1  84  ? -76.369 31.520 -57.950 1.00 64.24  ? 81  TRP A CH2   1 
ATOM   597  N  N     . TRP A 1  85  ? -72.257 29.016 -57.853 1.00 54.55  ? 82  TRP A N     1 
ATOM   598  C  CA    . TRP A 1  85  ? -73.418 28.430 -57.201 1.00 54.80  ? 82  TRP A CA    1 
ATOM   599  C  C     . TRP A 1  85  ? -73.837 29.315 -56.004 1.00 55.51  ? 82  TRP A C     1 
ATOM   600  O  O     . TRP A 1  85  ? -73.072 30.189 -55.616 1.00 56.15  ? 82  TRP A O     1 
ATOM   601  C  CB    . TRP A 1  85  ? -73.170 26.974 -56.823 1.00 54.07  ? 82  TRP A CB    1 
ATOM   602  C  CG    . TRP A 1  85  ? -72.184 26.722 -55.730 1.00 52.43  ? 82  TRP A CG    1 
ATOM   603  C  CD1   . TRP A 1  85  ? -72.406 26.808 -54.381 1.00 51.21  ? 82  TRP A CD1   1 
ATOM   604  C  CD2   . TRP A 1  85  ? -70.840 26.266 -55.883 1.00 50.83  ? 82  TRP A CD2   1 
ATOM   605  N  NE1   . TRP A 1  85  ? -71.279 26.451 -53.688 1.00 48.83  ? 82  TRP A NE1   1 
ATOM   606  C  CE2   . TRP A 1  85  ? -70.298 26.118 -54.585 1.00 50.24  ? 82  TRP A CE2   1 
ATOM   607  C  CE3   . TRP A 1  85  ? -70.029 25.980 -56.991 1.00 49.91  ? 82  TRP A CE3   1 
ATOM   608  C  CZ2   . TRP A 1  85  ? -68.978 25.694 -54.368 1.00 49.37  ? 82  TRP A CZ2   1 
ATOM   609  C  CZ3   . TRP A 1  85  ? -68.727 25.553 -56.773 1.00 48.95  ? 82  TRP A CZ3   1 
ATOM   610  C  CH2   . TRP A 1  85  ? -68.216 25.412 -55.470 1.00 48.45  ? 82  TRP A CH2   1 
ATOM   611  N  N     . PRO A 1  86  ? -75.055 29.128 -55.442 1.00 55.76  ? 83  PRO A N     1 
ATOM   612  C  CA    . PRO A 1  86  ? -75.459 29.982 -54.312 1.00 55.74  ? 83  PRO A CA    1 
ATOM   613  C  C     . PRO A 1  86  ? -74.541 29.795 -53.121 1.00 55.75  ? 83  PRO A C     1 
ATOM   614  O  O     . PRO A 1  86  ? -74.178 28.649 -52.814 1.00 55.78  ? 83  PRO A O     1 
ATOM   615  C  CB    . PRO A 1  86  ? -76.849 29.451 -53.933 1.00 55.35  ? 83  PRO A CB    1 
ATOM   616  C  CG    . PRO A 1  86  ? -77.309 28.704 -55.102 1.00 56.10  ? 83  PRO A CG    1 
ATOM   617  C  CD    . PRO A 1  86  ? -76.089 28.128 -55.757 1.00 55.88  ? 83  PRO A CD    1 
ATOM   618  N  N     . ASN A 1  87  ? -74.165 30.911 -52.481 1.00 55.72  ? 84  ASN A N     1 
ATOM   619  C  CA    . ASN A 1  87  ? -73.434 30.912 -51.203 1.00 55.69  ? 84  ASN A CA    1 
ATOM   620  C  C     . ASN A 1  87  ? -72.101 30.155 -51.233 1.00 55.50  ? 84  ASN A C     1 
ATOM   621  O  O     . ASN A 1  87  ? -71.835 29.290 -50.393 1.00 55.77  ? 84  ASN A O     1 
ATOM   622  C  CB    . ASN A 1  87  ? -74.334 30.379 -50.072 1.00 55.62  ? 84  ASN A CB    1 
ATOM   623  C  CG    . ASN A 1  87  ? -75.624 31.192 -49.907 1.00 56.96  ? 84  ASN A CG    1 
ATOM   624  O  OD1   . ASN A 1  87  ? -75.636 32.427 -50.051 1.00 57.20  ? 84  ASN A OD1   1 
ATOM   625  N  ND2   . ASN A 1  87  ? -76.718 30.496 -49.597 1.00 57.91  ? 84  ASN A ND2   1 
ATOM   626  N  N     . MET A 1  88  ? -71.265 30.478 -52.208 1.00 55.10  ? 85  MET A N     1 
ATOM   627  C  CA    . MET A 1  88  ? -70.002 29.771 -52.375 1.00 54.91  ? 85  MET A CA    1 
ATOM   628  C  C     . MET A 1  88  ? -69.064 29.869 -51.156 1.00 54.64  ? 85  MET A C     1 
ATOM   629  O  O     . MET A 1  88  ? -68.435 28.880 -50.750 1.00 54.33  ? 85  MET A O     1 
ATOM   630  C  CB    . MET A 1  88  ? -69.305 30.252 -53.643 1.00 55.11  ? 85  MET A CB    1 
ATOM   631  C  CG    . MET A 1  88  ? -69.978 29.799 -54.917 1.00 55.13  ? 85  MET A CG    1 
ATOM   632  S  SD    . MET A 1  88  ? -69.364 30.705 -56.344 1.00 55.26  ? 85  MET A SD    1 
ATOM   633  C  CE    . MET A 1  88  ? -67.915 29.732 -56.728 1.00 55.10  ? 85  MET A CE    1 
ATOM   634  N  N     . ARG A 1  89  ? -68.982 31.052 -50.561 1.00 54.18  ? 86  ARG A N     1 
ATOM   635  C  CA    . ARG A 1  89  ? -68.109 31.209 -49.412 1.00 54.23  ? 86  ARG A CA    1 
ATOM   636  C  C     . ARG A 1  89  ? -68.489 30.322 -48.224 1.00 54.58  ? 86  ARG A C     1 
ATOM   637  O  O     . ARG A 1  89  ? -67.601 29.850 -47.515 1.00 54.54  ? 86  ARG A O     1 
ATOM   638  C  CB    . ARG A 1  89  ? -67.967 32.680 -49.010 1.00 53.83  ? 86  ARG A CB    1 
ATOM   639  C  CG    . ARG A 1  89  ? -67.101 33.471 -49.967 1.00 52.18  ? 86  ARG A CG    1 
ATOM   640  C  CD    . ARG A 1  89  ? -67.406 34.913 -49.848 1.00 50.76  ? 86  ARG A CD    1 
ATOM   641  N  NE    . ARG A 1  89  ? -66.398 35.799 -50.422 1.00 48.70  ? 86  ARG A NE    1 
ATOM   642  C  CZ    . ARG A 1  89  ? -66.530 36.432 -51.581 1.00 47.55  ? 86  ARG A CZ    1 
ATOM   643  N  NH1   . ARG A 1  89  ? -67.606 36.256 -52.332 1.00 46.25  ? 86  ARG A NH1   1 
ATOM   644  N  NH2   . ARG A 1  89  ? -65.577 37.248 -51.994 1.00 47.65  ? 86  ARG A NH2   1 
ATOM   645  N  N     . LYS A 1  90  ? -69.782 30.056 -48.018 1.00 54.96  ? 87  LYS A N     1 
ATOM   646  C  CA    . LYS A 1  90  ? -70.160 29.149 -46.926 1.00 55.51  ? 87  LYS A CA    1 
ATOM   647  C  C     . LYS A 1  90  ? -69.505 27.804 -47.133 1.00 54.97  ? 87  LYS A C     1 
ATOM   648  O  O     . LYS A 1  90  ? -68.971 27.219 -46.196 1.00 55.21  ? 87  LYS A O     1 
ATOM   649  C  CB    . LYS A 1  90  ? -71.671 29.025 -46.743 1.00 55.90  ? 87  LYS A CB    1 
ATOM   650  C  CG    . LYS A 1  90  ? -72.296 30.287 -46.137 1.00 59.86  ? 87  LYS A CG    1 
ATOM   651  C  CD    . LYS A 1  90  ? -73.841 30.249 -46.120 1.00 66.76  ? 87  LYS A CD    1 
ATOM   652  C  CE    . LYS A 1  90  ? -74.429 31.464 -45.342 1.00 70.49  ? 87  LYS A CE    1 
ATOM   653  N  NZ    . LYS A 1  90  ? -75.803 31.888 -45.826 1.00 71.91  ? 87  LYS A NZ    1 
ATOM   654  N  N     . ASP A 1  91  ? -69.485 27.342 -48.373 1.00 54.62  ? 88  ASP A N     1 
ATOM   655  C  CA    . ASP A 1  91  ? -68.848 26.074 -48.683 1.00 54.32  ? 88  ASP A CA    1 
ATOM   656  C  C     . ASP A 1  91  ? -67.336 26.156 -48.585 1.00 53.73  ? 88  ASP A C     1 
ATOM   657  O  O     . ASP A 1  91  ? -66.679 25.166 -48.232 1.00 53.57  ? 88  ASP A O     1 
ATOM   658  C  CB    . ASP A 1  91  ? -69.247 25.607 -50.078 1.00 55.13  ? 88  ASP A CB    1 
ATOM   659  C  CG    . ASP A 1  91  ? -70.678 25.130 -50.142 1.00 56.62  ? 88  ASP A CG    1 
ATOM   660  O  OD1   . ASP A 1  91  ? -71.115 24.401 -49.225 1.00 58.70  ? 88  ASP A OD1   1 
ATOM   661  O  OD2   . ASP A 1  91  ? -71.360 25.490 -51.115 1.00 59.88  ? 88  ASP A OD2   1 
ATOM   662  N  N     . VAL A 1  92  ? -66.785 27.325 -48.916 1.00 52.71  ? 89  VAL A N     1 
ATOM   663  C  CA    . VAL A 1  92  ? -65.361 27.548 -48.781 1.00 51.63  ? 89  VAL A CA    1 
ATOM   664  C  C     . VAL A 1  92  ? -64.982 27.476 -47.299 1.00 51.19  ? 89  VAL A C     1 
ATOM   665  O  O     . VAL A 1  92  ? -64.112 26.682 -46.905 1.00 50.75  ? 89  VAL A O     1 
ATOM   666  C  CB    . VAL A 1  92  ? -64.937 28.892 -49.422 1.00 52.09  ? 89  VAL A CB    1 
ATOM   667  C  CG1   . VAL A 1  92  ? -63.511 29.275 -49.002 1.00 52.05  ? 89  VAL A CG1   1 
ATOM   668  C  CG2   . VAL A 1  92  ? -65.027 28.803 -50.930 1.00 51.07  ? 89  VAL A CG2   1 
ATOM   669  N  N     . VAL A 1  93  ? -65.667 28.276 -46.483 1.00 50.58  ? 90  VAL A N     1 
ATOM   670  C  CA    . VAL A 1  93  ? -65.418 28.316 -45.043 1.00 50.77  ? 90  VAL A CA    1 
ATOM   671  C  C     . VAL A 1  93  ? -65.621 26.961 -44.365 1.00 51.64  ? 90  VAL A C     1 
ATOM   672  O  O     . VAL A 1  93  ? -64.843 26.580 -43.494 1.00 51.39  ? 90  VAL A O     1 
ATOM   673  C  CB    . VAL A 1  93  ? -66.243 29.416 -44.359 1.00 50.54  ? 90  VAL A CB    1 
ATOM   674  C  CG1   . VAL A 1  93  ? -66.176 29.290 -42.867 1.00 49.19  ? 90  VAL A CG1   1 
ATOM   675  C  CG2   . VAL A 1  93  ? -65.741 30.794 -44.792 1.00 50.68  ? 90  VAL A CG2   1 
ATOM   676  N  N     . LYS A 1  94  ? -66.640 26.217 -44.792 1.00 52.79  ? 91  LYS A N     1 
ATOM   677  C  CA    . LYS A 1  94  ? -66.845 24.855 -44.308 1.00 54.04  ? 91  LYS A CA    1 
ATOM   678  C  C     . LYS A 1  94  ? -65.558 24.039 -44.460 1.00 53.87  ? 91  LYS A C     1 
ATOM   679  O  O     . LYS A 1  94  ? -65.131 23.375 -43.521 1.00 54.06  ? 91  LYS A O     1 
ATOM   680  C  CB    . LYS A 1  94  ? -68.015 24.187 -45.045 1.00 54.89  ? 91  LYS A CB    1 
ATOM   681  C  CG    . LYS A 1  94  ? -68.683 23.008 -44.319 1.00 58.22  ? 91  LYS A CG    1 
ATOM   682  C  CD    . LYS A 1  94  ? -69.834 22.355 -45.158 1.00 64.47  ? 91  LYS A CD    1 
ATOM   683  C  CE    . LYS A 1  94  ? -70.691 21.364 -44.295 1.00 68.05  ? 91  LYS A CE    1 
ATOM   684  N  NZ    . LYS A 1  94  ? -71.441 20.290 -45.046 1.00 68.58  ? 91  LYS A NZ    1 
ATOM   685  N  N     . GLN A 1  95  ? -64.913 24.115 -45.619 1.00 53.76  ? 92  GLN A N     1 
ATOM   686  C  CA    . GLN A 1  95  ? -63.717 23.307 -45.834 1.00 54.00  ? 92  GLN A CA    1 
ATOM   687  C  C     . GLN A 1  95  ? -62.513 23.792 -45.052 1.00 53.42  ? 92  GLN A C     1 
ATOM   688  O  O     . GLN A 1  95  ? -61.733 22.961 -44.563 1.00 53.30  ? 92  GLN A O     1 
ATOM   689  C  CB    . GLN A 1  95  ? -63.374 23.160 -47.311 1.00 54.24  ? 92  GLN A CB    1 
ATOM   690  C  CG    . GLN A 1  95  ? -64.252 22.125 -48.011 1.00 58.82  ? 92  GLN A CG    1 
ATOM   691  C  CD    . GLN A 1  95  ? -64.085 20.724 -47.427 1.00 62.44  ? 92  GLN A CD    1 
ATOM   692  O  OE1   . GLN A 1  95  ? -62.964 20.201 -47.374 1.00 65.22  ? 92  GLN A OE1   1 
ATOM   693  N  NE2   . GLN A 1  95  ? -65.194 20.117 -46.984 1.00 60.84  ? 92  GLN A NE2   1 
ATOM   694  N  N     . LEU A 1  96  ? -62.364 25.118 -44.928 1.00 52.54  ? 93  LEU A N     1 
ATOM   695  C  CA    . LEU A 1  96  ? -61.244 25.697 -44.181 1.00 51.59  ? 93  LEU A CA    1 
ATOM   696  C  C     . LEU A 1  96  ? -61.257 25.203 -42.729 1.00 51.83  ? 93  LEU A C     1 
ATOM   697  O  O     . LEU A 1  96  ? -60.233 24.774 -42.210 1.00 51.73  ? 93  LEU A O     1 
ATOM   698  C  CB    . LEU A 1  96  ? -61.260 27.224 -44.243 1.00 50.94  ? 93  LEU A CB    1 
ATOM   699  C  CG    . LEU A 1  96  ? -61.272 27.929 -45.608 1.00 50.67  ? 93  LEU A CG    1 
ATOM   700  C  CD1   . LEU A 1  96  ? -61.294 29.444 -45.438 1.00 48.59  ? 93  LEU A CD1   1 
ATOM   701  C  CD2   . LEU A 1  96  ? -60.116 27.499 -46.527 1.00 48.53  ? 93  LEU A CD2   1 
ATOM   702  N  N     . GLY A 1  97  ? -62.435 25.222 -42.102 1.00 51.79  ? 94  GLY A N     1 
ATOM   703  C  CA    . GLY A 1  97  ? -62.613 24.708 -40.755 1.00 51.86  ? 94  GLY A CA    1 
ATOM   704  C  C     . GLY A 1  97  ? -62.308 23.228 -40.575 1.00 52.29  ? 94  GLY A C     1 
ATOM   705  O  O     . GLY A 1  97  ? -62.221 22.754 -39.441 1.00 52.17  ? 94  GLY A O     1 
ATOM   706  N  N     . ARG A 1  98  ? -62.135 22.502 -41.682 1.00 52.45  ? 95  ARG A N     1 
ATOM   707  C  CA    . ARG A 1  98  ? -61.838 21.065 -41.641 1.00 52.95  ? 95  ARG A CA    1 
ATOM   708  C  C     . ARG A 1  98  ? -60.446 20.732 -42.189 1.00 52.20  ? 95  ARG A C     1 
ATOM   709  O  O     . ARG A 1  98  ? -60.106 19.558 -42.345 1.00 51.89  ? 95  ARG A O     1 
ATOM   710  C  CB    . ARG A 1  98  ? -62.869 20.260 -42.448 1.00 53.78  ? 95  ARG A CB    1 
ATOM   711  C  CG    . ARG A 1  98  ? -64.345 20.580 -42.201 1.00 58.16  ? 95  ARG A CG    1 
ATOM   712  C  CD    . ARG A 1  98  ? -65.246 19.450 -42.765 1.00 66.66  ? 95  ARG A CD    1 
ATOM   713  N  NE    . ARG A 1  98  ? -66.673 19.801 -42.817 1.00 72.59  ? 95  ARG A NE    1 
ATOM   714  C  CZ    . ARG A 1  98  ? -67.494 19.834 -41.763 1.00 76.25  ? 95  ARG A CZ    1 
ATOM   715  N  NH1   . ARG A 1  98  ? -67.044 19.533 -40.543 1.00 78.08  ? 95  ARG A NH1   1 
ATOM   716  N  NH2   . ARG A 1  98  ? -68.773 20.171 -41.926 1.00 77.57  ? 95  ARG A NH2   1 
ATOM   717  N  N     . CYS A 1  99  ? -59.653 21.744 -42.532 1.00 51.54  ? 96  CYS A N     1 
ATOM   718  C  CA    . CYS A 1  99  ? -58.310 21.462 -43.035 1.00 50.87  ? 96  CYS A CA    1 
ATOM   719  C  C     . CYS A 1  99  ? -57.342 21.450 -41.853 1.00 50.59  ? 96  CYS A C     1 
ATOM   720  O  O     . CYS A 1  99  ? -57.017 22.483 -41.281 1.00 50.66  ? 96  CYS A O     1 
ATOM   721  C  CB    . CYS A 1  99  ? -57.896 22.415 -44.161 1.00 50.09  ? 96  CYS A CB    1 
ATOM   722  S  SG    . CYS A 1  99  ? -56.249 22.059 -44.819 1.00 50.69  ? 96  CYS A SG    1 
ATOM   723  N  N     . GLN A 1  100 ? -56.929 20.257 -41.456 1.00 50.69  ? 97  GLN A N     1 
ATOM   724  C  CA    . GLN A 1  100 ? -56.112 20.089 -40.265 1.00 51.05  ? 97  GLN A CA    1 
ATOM   725  C  C     . GLN A 1  100 ? -54.826 20.880 -40.469 1.00 49.86  ? 97  GLN A C     1 
ATOM   726  O  O     . GLN A 1  100 ? -54.424 21.652 -39.600 1.00 50.04  ? 97  GLN A O     1 
ATOM   727  C  CB    . GLN A 1  100 ? -55.826 18.601 -40.031 1.00 51.95  ? 97  GLN A CB    1 
ATOM   728  C  CG    . GLN A 1  100 ? -55.386 18.205 -38.607 1.00 57.75  ? 97  GLN A CG    1 
ATOM   729  C  CD    . GLN A 1  100 ? -56.544 18.194 -37.595 1.00 65.39  ? 97  GLN A CD    1 
ATOM   730  O  OE1   . GLN A 1  100 ? -56.362 17.814 -36.425 1.00 68.44  ? 97  GLN A OE1   1 
ATOM   731  N  NE2   . GLN A 1  100 ? -57.746 18.609 -38.046 1.00 67.11  ? 97  GLN A NE2   1 
ATOM   732  N  N     . GLN A 1  101 ? -54.224 20.723 -41.648 1.00 48.18  ? 98  GLN A N     1 
ATOM   733  C  CA    . GLN A 1  101 ? -52.984 21.396 -41.989 1.00 46.98  ? 98  GLN A CA    1 
ATOM   734  C  C     . GLN A 1  101 ? -53.062 22.926 -41.933 1.00 45.62  ? 98  GLN A C     1 
ATOM   735  O  O     . GLN A 1  101 ? -52.174 23.554 -41.389 1.00 45.74  ? 98  GLN A O     1 
ATOM   736  C  CB    . GLN A 1  101 ? -52.514 20.942 -43.349 1.00 47.42  ? 98  GLN A CB    1 
ATOM   737  C  CG    . GLN A 1  101 ? -52.108 19.502 -43.405 1.00 48.57  ? 98  GLN A CG    1 
ATOM   738  C  CD    . GLN A 1  101 ? -52.602 18.849 -44.669 1.00 51.66  ? 98  GLN A CD    1 
ATOM   739  O  OE1   . GLN A 1  101 ? -53.787 18.583 -44.789 1.00 51.09  ? 98  GLN A OE1   1 
ATOM   740  N  NE2   . GLN A 1  101 ? -51.698 18.598 -45.631 1.00 53.40  ? 98  GLN A NE2   1 
ATOM   741  N  N     . CYS A 1  102 ? -54.119 23.524 -42.460 1.00 44.10  ? 99  CYS A N     1 
ATOM   742  C  CA    . CYS A 1  102 ? -54.295 24.961 -42.307 1.00 43.04  ? 99  CYS A CA    1 
ATOM   743  C  C     . CYS A 1  102 ? -54.504 25.387 -40.859 1.00 43.20  ? 99  CYS A C     1 
ATOM   744  O  O     . CYS A 1  102 ? -53.925 26.387 -40.430 1.00 43.20  ? 99  CYS A O     1 
ATOM   745  C  CB    . CYS A 1  102 ? -55.416 25.505 -43.189 1.00 42.70  ? 99  CYS A CB    1 
ATOM   746  S  SG    . CYS A 1  102 ? -54.929 25.614 -44.918 1.00 40.35  ? 99  CYS A SG    1 
ATOM   747  N  N     . LEU A 1  103 ? -55.309 24.636 -40.105 1.00 42.74  ? 100 LEU A N     1 
ATOM   748  C  CA    . LEU A 1  103 ? -55.655 25.032 -38.733 1.00 42.35  ? 100 LEU A CA    1 
ATOM   749  C  C     . LEU A 1  103 ? -54.445 25.054 -37.784 1.00 42.27  ? 100 LEU A C     1 
ATOM   750  O  O     . LEU A 1  103 ? -54.340 25.922 -36.904 1.00 42.33  ? 100 LEU A O     1 
ATOM   751  C  CB    . LEU A 1  103 ? -56.738 24.123 -38.159 1.00 41.88  ? 100 LEU A CB    1 
ATOM   752  C  CG    . LEU A 1  103 ? -58.132 24.148 -38.776 1.00 41.91  ? 100 LEU A CG    1 
ATOM   753  C  CD1   . LEU A 1  103 ? -58.922 23.019 -38.124 1.00 41.85  ? 100 LEU A CD1   1 
ATOM   754  C  CD2   . LEU A 1  103 ? -58.870 25.499 -38.636 1.00 38.49  ? 100 LEU A CD2   1 
ATOM   755  N  N     . ILE A 1  104 ? -53.535 24.107 -37.982 1.00 41.50  ? 101 ILE A N     1 
ATOM   756  C  CA    . ILE A 1  104 ? -52.375 23.969 -37.125 1.00 41.12  ? 101 ILE A CA    1 
ATOM   757  C  C     . ILE A 1  104 ? -51.121 24.725 -37.609 1.00 41.30  ? 101 ILE A C     1 
ATOM   758  O  O     . ILE A 1  104 ? -50.153 24.860 -36.851 1.00 41.49  ? 101 ILE A O     1 
ATOM   759  C  CB    . ILE A 1  104 ? -52.061 22.470 -36.874 1.00 41.26  ? 101 ILE A CB    1 
ATOM   760  C  CG1   . ILE A 1  104 ? -51.559 21.776 -38.138 1.00 40.20  ? 101 ILE A CG1   1 
ATOM   761  C  CG2   . ILE A 1  104 ? -53.304 21.758 -36.342 1.00 40.35  ? 101 ILE A CG2   1 
ATOM   762  C  CD1   . ILE A 1  104 ? -51.065 20.344 -37.866 1.00 40.37  ? 101 ILE A CD1   1 
ATOM   763  N  N     . THR A 1  105 ? -51.149 25.226 -38.854 1.00 41.15  ? 102 THR A N     1 
ATOM   764  C  CA    . THR A 1  105 ? -50.025 25.958 -39.447 1.00 40.36  ? 102 THR A CA    1 
ATOM   765  C  C     . THR A 1  105 ? -50.242 27.471 -39.553 1.00 40.26  ? 102 THR A C     1 
ATOM   766  O  O     . THR A 1  105 ? -49.300 28.233 -39.335 1.00 40.12  ? 102 THR A O     1 
ATOM   767  C  CB    . THR A 1  105 ? -49.658 25.415 -40.838 1.00 40.80  ? 102 THR A CB    1 
ATOM   768  O  OG1   . THR A 1  105 ? -49.423 23.997 -40.770 1.00 40.75  ? 102 THR A OG1   1 
ATOM   769  C  CG2   . THR A 1  105 ? -48.416 26.104 -41.369 1.00 40.45  ? 102 THR A CG2   1 
ATOM   770  N  N     . ASN A 1  106 ? -51.457 27.916 -39.890 1.00 39.99  ? 103 ASN A N     1 
ATOM   771  C  CA    . ASN A 1  106 ? -51.709 29.357 -40.056 1.00 40.46  ? 103 ASN A CA    1 
ATOM   772  C  C     . ASN A 1  106 ? -51.489 30.133 -38.768 1.00 40.97  ? 103 ASN A C     1 
ATOM   773  O  O     . ASN A 1  106 ? -51.504 29.575 -37.674 1.00 41.88  ? 103 ASN A O     1 
ATOM   774  C  CB    . ASN A 1  106 ? -53.116 29.657 -40.605 1.00 40.43  ? 103 ASN A CB    1 
ATOM   775  C  CG    . ASN A 1  106 ? -53.288 29.252 -42.081 1.00 40.52  ? 103 ASN A CG    1 
ATOM   776  O  OD1   . ASN A 1  106 ? -52.311 28.910 -42.773 1.00 38.98  ? 103 ASN A OD1   1 
ATOM   777  N  ND2   . ASN A 1  106 ? -54.541 29.295 -42.565 1.00 36.33  ? 103 ASN A ND2   1 
ATOM   778  N  N     . ALA A 1  107 ? -51.274 31.428 -38.900 1.00 40.99  ? 104 ALA A N     1 
ATOM   779  C  CA    . ALA A 1  107 ? -51.080 32.270 -37.752 1.00 40.93  ? 104 ALA A CA    1 
ATOM   780  C  C     . ALA A 1  107 ? -52.451 32.753 -37.287 1.00 41.46  ? 104 ALA A C     1 
ATOM   781  O  O     . ALA A 1  107 ? -53.430 32.679 -38.017 1.00 41.22  ? 104 ALA A O     1 
ATOM   782  C  CB    . ALA A 1  107 ? -50.184 33.448 -38.118 1.00 40.50  ? 104 ALA A CB    1 
ATOM   783  N  N     . SER A 1  108 ? -52.519 33.242 -36.060 1.00 42.05  ? 105 SER A N     1 
ATOM   784  C  CA    . SER A 1  108 ? -53.718 33.867 -35.583 1.00 43.03  ? 105 SER A CA    1 
ATOM   785  C  C     . SER A 1  108 ? -53.730 35.273 -36.106 1.00 43.37  ? 105 SER A C     1 
ATOM   786  O  O     . SER A 1  108 ? -52.689 35.844 -36.385 1.00 43.60  ? 105 SER A O     1 
ATOM   787  C  CB    . SER A 1  108 ? -53.720 33.919 -34.057 1.00 43.09  ? 105 SER A CB    1 
ATOM   788  O  OG    . SER A 1  108 ? -54.894 34.559 -33.584 1.00 43.76  ? 105 SER A OG    1 
ATOM   789  N  N     . ASN A 1  109 ? -54.915 35.836 -36.231 1.00 44.14  ? 106 ASN A N     1 
ATOM   790  C  CA    . ASN A 1  109 ? -55.024 37.241 -36.524 1.00 45.18  ? 106 ASN A CA    1 
ATOM   791  C  C     . ASN A 1  109 ? -55.917 37.950 -35.509 1.00 45.39  ? 106 ASN A C     1 
ATOM   792  O  O     . ASN A 1  109 ? -56.521 38.974 -35.804 1.00 45.76  ? 106 ASN A O     1 
ATOM   793  C  CB    . ASN A 1  109 ? -55.442 37.480 -37.984 1.00 45.34  ? 106 ASN A CB    1 
ATOM   794  C  CG    . ASN A 1  109 ? -56.819 36.933 -38.313 1.00 47.06  ? 106 ASN A CG    1 
ATOM   795  O  OD1   . ASN A 1  109 ? -57.496 36.337 -37.471 1.00 49.68  ? 106 ASN A OD1   1 
ATOM   796  N  ND2   . ASN A 1  109 ? -57.237 37.121 -39.568 1.00 49.09  ? 106 ASN A ND2   1 
ATOM   797  N  N     . LYS A 1  110 ? -55.978 37.397 -34.305 1.00 45.78  ? 107 LYS A N     1 
ATOM   798  C  CA    . LYS A 1  110 ? -56.688 38.047 -33.204 1.00 46.83  ? 107 LYS A CA    1 
ATOM   799  C  C     . LYS A 1  110 ? -55.757 38.197 -31.987 1.00 46.19  ? 107 LYS A C     1 
ATOM   800  O  O     . LYS A 1  110 ? -55.033 37.265 -31.642 1.00 45.63  ? 107 LYS A O     1 
ATOM   801  C  CB    . LYS A 1  110 ? -58.017 37.326 -32.857 1.00 47.52  ? 107 LYS A CB    1 
ATOM   802  C  CG    . LYS A 1  110 ? -59.156 37.485 -33.923 1.00 49.85  ? 107 LYS A CG    1 
ATOM   803  C  CD    . LYS A 1  110 ? -59.403 36.167 -34.671 1.00 56.34  ? 107 LYS A CD    1 
ATOM   804  C  CE    . LYS A 1  110 ? -60.527 36.280 -35.718 1.00 60.91  ? 107 LYS A CE    1 
ATOM   805  N  NZ    . LYS A 1  110 ? -60.256 37.159 -36.954 1.00 62.52  ? 107 LYS A NZ    1 
ATOM   806  N  N     . ALA A 1  111 ? -55.758 39.384 -31.372 1.00 45.56  ? 108 ALA A N     1 
ATOM   807  C  CA    . ALA A 1  111 ? -54.866 39.667 -30.246 1.00 45.06  ? 108 ALA A CA    1 
ATOM   808  C  C     . ALA A 1  111 ? -55.505 39.171 -28.970 1.00 44.55  ? 108 ALA A C     1 
ATOM   809  O  O     . ALA A 1  111 ? -56.727 39.130 -28.881 1.00 45.07  ? 108 ALA A O     1 
ATOM   810  C  CB    . ALA A 1  111 ? -54.597 41.167 -30.141 1.00 44.97  ? 108 ALA A CB    1 
ATOM   811  N  N     . SER A 1  112 ? -54.689 38.804 -27.986 1.00 43.67  ? 109 SER A N     1 
ATOM   812  C  CA    . SER A 1  112 ? -55.164 38.554 -26.624 1.00 42.93  ? 109 SER A CA    1 
ATOM   813  C  C     . SER A 1  112 ? -55.852 39.759 -25.991 1.00 42.68  ? 109 SER A C     1 
ATOM   814  O  O     . SER A 1  112 ? -55.603 40.914 -26.368 1.00 42.49  ? 109 SER A O     1 
ATOM   815  C  CB    . SER A 1  112 ? -53.991 38.210 -25.754 1.00 42.55  ? 109 SER A CB    1 
ATOM   816  O  OG    . SER A 1  112 ? -53.340 37.083 -26.268 1.00 44.41  ? 109 SER A OG    1 
ATOM   817  N  N     . GLY A 1  113 ? -56.705 39.491 -25.007 1.00 42.27  ? 110 GLY A N     1 
ATOM   818  C  CA    . GLY A 1  113 ? -57.324 40.561 -24.231 1.00 41.59  ? 110 GLY A CA    1 
ATOM   819  C  C     . GLY A 1  113 ? -56.239 41.228 -23.420 1.00 41.56  ? 110 GLY A C     1 
ATOM   820  O  O     . GLY A 1  113 ? -55.174 40.630 -23.190 1.00 41.53  ? 110 GLY A O     1 
ATOM   821  N  N     . PRO A 1  114 ? -56.504 42.453 -22.959 1.00 41.47  ? 111 PRO A N     1 
ATOM   822  C  CA    . PRO A 1  114 ? -55.562 43.280 -22.205 1.00 41.83  ? 111 PRO A CA    1 
ATOM   823  C  C     . PRO A 1  114 ? -55.119 42.611 -20.905 1.00 42.35  ? 111 PRO A C     1 
ATOM   824  O  O     . PRO A 1  114 ? -55.924 41.919 -20.264 1.00 42.03  ? 111 PRO A O     1 
ATOM   825  C  CB    . PRO A 1  114 ? -56.368 44.549 -21.908 1.00 42.60  ? 111 PRO A CB    1 
ATOM   826  C  CG    . PRO A 1  114 ? -57.821 44.141 -22.022 1.00 41.72  ? 111 PRO A CG    1 
ATOM   827  C  CD    . PRO A 1  114 ? -57.856 43.035 -23.016 1.00 41.73  ? 111 PRO A CD    1 
ATOM   828  N  N     . ILE A 1  115 ? -53.851 42.814 -20.538 1.00 42.44  ? 112 ILE A N     1 
ATOM   829  C  CA    . ILE A 1  115 ? -53.208 42.110 -19.419 1.00 42.45  ? 112 ILE A CA    1 
ATOM   830  C  C     . ILE A 1  115 ? -53.877 42.392 -18.064 1.00 42.99  ? 112 ILE A C     1 
ATOM   831  O  O     . ILE A 1  115 ? -54.552 43.407 -17.891 1.00 42.88  ? 112 ILE A O     1 
ATOM   832  C  CB    . ILE A 1  115 ? -51.668 42.447 -19.295 1.00 42.31  ? 112 ILE A CB    1 
ATOM   833  C  CG1   . ILE A 1  115 ? -51.437 43.963 -19.233 1.00 42.13  ? 112 ILE A CG1   1 
ATOM   834  C  CG2   . ILE A 1  115 ? -50.857 41.784 -20.386 1.00 40.55  ? 112 ILE A CG2   1 
ATOM   835  C  CD1   . ILE A 1  115 ? -50.066 44.351 -18.819 1.00 41.51  ? 112 ILE A CD1   1 
ATOM   836  N  N     . LEU A 1  116 ? -53.676 41.496 -17.103 1.00 43.37  ? 113 LEU A N     1 
ATOM   837  C  CA    . LEU A 1  116 ? -54.094 41.771 -15.731 1.00 44.15  ? 113 LEU A CA    1 
ATOM   838  C  C     . LEU A 1  116 ? -52.951 42.443 -14.983 1.00 44.19  ? 113 LEU A C     1 
ATOM   839  O  O     . LEU A 1  116 ? -51.779 42.171 -15.254 1.00 44.82  ? 113 LEU A O     1 
ATOM   840  C  CB    . LEU A 1  116 ? -54.513 40.482 -15.007 1.00 44.00  ? 113 LEU A CB    1 
ATOM   841  C  CG    . LEU A 1  116 ? -55.840 39.881 -15.494 1.00 45.18  ? 113 LEU A CG    1 
ATOM   842  C  CD1   . LEU A 1  116 ? -56.027 38.471 -14.950 1.00 45.81  ? 113 LEU A CD1   1 
ATOM   843  C  CD2   . LEU A 1  116 ? -57.052 40.771 -15.166 1.00 44.53  ? 113 LEU A CD2   1 
ATOM   844  N  N     . ARG A 1  117 ? -53.276 43.335 -14.061 1.00 43.83  ? 114 ARG A N     1 
ATOM   845  C  CA    . ARG A 1  117 ? -52.248 43.842 -13.174 1.00 43.54  ? 114 ARG A CA    1 
ATOM   846  C  C     . ARG A 1  117 ? -52.558 43.333 -11.786 1.00 43.71  ? 114 ARG A C     1 
ATOM   847  O  O     . ARG A 1  117 ? -53.243 44.008 -11.038 1.00 44.53  ? 114 ARG A O     1 
ATOM   848  C  CB    . ARG A 1  117 ? -52.201 45.368 -13.195 1.00 43.05  ? 114 ARG A CB    1 
ATOM   849  C  CG    . ARG A 1  117 ? -52.060 46.005 -14.580 1.00 42.56  ? 114 ARG A CG    1 
ATOM   850  C  CD    . ARG A 1  117 ? -50.960 45.374 -15.458 1.00 41.81  ? 114 ARG A CD    1 
ATOM   851  N  NE    . ARG A 1  117 ? -49.644 45.295 -14.815 1.00 40.40  ? 114 ARG A NE    1 
ATOM   852  C  CZ    . ARG A 1  117 ? -48.743 46.271 -14.790 1.00 38.58  ? 114 ARG A CZ    1 
ATOM   853  N  NH1   . ARG A 1  117 ? -48.986 47.436 -15.367 1.00 38.41  ? 114 ARG A NH1   1 
ATOM   854  N  NH2   . ARG A 1  117 ? -47.586 46.071 -14.183 1.00 38.77  ? 114 ARG A NH2   1 
ATOM   855  N  N     . PRO A 1  118 ? -52.087 42.124 -11.437 1.00 43.89  ? 115 PRO A N     1 
ATOM   856  C  CA    . PRO A 1  118 ? -52.429 41.517 -10.132 1.00 44.24  ? 115 PRO A CA    1 
ATOM   857  C  C     . PRO A 1  118 ? -52.075 42.423 -8.955  1.00 44.76  ? 115 PRO A C     1 
ATOM   858  O  O     . PRO A 1  118 ? -51.078 43.148 -9.010  1.00 45.08  ? 115 PRO A O     1 
ATOM   859  C  CB    . PRO A 1  118 ? -51.551 40.270 -10.084 1.00 44.33  ? 115 PRO A CB    1 
ATOM   860  C  CG    . PRO A 1  118 ? -51.189 39.993 -11.471 1.00 43.89  ? 115 PRO A CG    1 
ATOM   861  C  CD    . PRO A 1  118 ? -51.156 41.290 -12.203 1.00 43.49  ? 115 PRO A CD    1 
ATOM   862  N  N     . ASP A 1  119 ? -52.881 42.394 -7.900  1.00 45.39  ? 116 ASP A N     1 
ATOM   863  C  CA    . ASP A 1  119 ? -52.564 43.164 -6.695  1.00 45.89  ? 116 ASP A CA    1 
ATOM   864  C  C     . ASP A 1  119 ? -51.175 42.847 -6.176  1.00 45.19  ? 116 ASP A C     1 
ATOM   865  O  O     . ASP A 1  119 ? -50.791 41.679 -6.109  1.00 45.24  ? 116 ASP A O     1 
ATOM   866  C  CB    . ASP A 1  119 ? -53.563 42.865 -5.588  1.00 46.58  ? 116 ASP A CB    1 
ATOM   867  C  CG    . ASP A 1  119 ? -54.878 43.600 -5.763  1.00 50.33  ? 116 ASP A CG    1 
ATOM   868  O  OD1   . ASP A 1  119 ? -54.901 44.768 -6.264  1.00 52.89  ? 116 ASP A OD1   1 
ATOM   869  O  OD2   . ASP A 1  119 ? -55.899 42.990 -5.370  1.00 54.84  ? 116 ASP A OD2   1 
ATOM   870  N  N     . ARG A 1  120 ? -50.435 43.893 -5.817  1.00 44.59  ? 117 ARG A N     1 
ATOM   871  C  CA    . ARG A 1  120 ? -49.137 43.760 -5.185  1.00 44.12  ? 117 ARG A CA    1 
ATOM   872  C  C     . ARG A 1  120 ? -49.343 43.002 -3.898  1.00 44.28  ? 117 ARG A C     1 
ATOM   873  O  O     . ARG A 1  120 ? -50.234 43.356 -3.150  1.00 45.17  ? 117 ARG A O     1 
ATOM   874  C  CB    . ARG A 1  120 ? -48.583 45.156 -4.865  1.00 44.06  ? 117 ARG A CB    1 
ATOM   875  C  CG    . ARG A 1  120 ? -47.260 45.171 -4.104  1.00 42.71  ? 117 ARG A CG    1 
ATOM   876  C  CD    . ARG A 1  120 ? -46.783 46.581 -3.826  1.00 41.03  ? 117 ARG A CD    1 
ATOM   877  N  NE    . ARG A 1  120 ? -46.523 47.325 -5.053  1.00 41.71  ? 117 ARG A NE    1 
ATOM   878  C  CZ    . ARG A 1  120 ? -45.351 47.372 -5.685  1.00 41.38  ? 117 ARG A CZ    1 
ATOM   879  N  NH1   . ARG A 1  120 ? -44.300 46.704 -5.211  1.00 40.97  ? 117 ARG A NH1   1 
ATOM   880  N  NH2   . ARG A 1  120 ? -45.238 48.080 -6.805  1.00 41.25  ? 117 ARG A NH2   1 
ATOM   881  N  N     . PRO A 1  121 ? -48.534 41.958 -3.618  1.00 44.79  ? 118 PRO A N     1 
ATOM   882  C  CA    . PRO A 1  121 ? -48.692 41.279 -2.315  1.00 45.10  ? 118 PRO A CA    1 
ATOM   883  C  C     . PRO A 1  121 ? -48.672 42.297 -1.175  1.00 45.67  ? 118 PRO A C     1 
ATOM   884  O  O     . PRO A 1  121 ? -47.952 43.294 -1.240  1.00 45.49  ? 118 PRO A O     1 
ATOM   885  C  CB    . PRO A 1  121 ? -47.465 40.377 -2.241  1.00 44.94  ? 118 PRO A CB    1 
ATOM   886  C  CG    . PRO A 1  121 ? -47.097 40.143 -3.676  1.00 44.72  ? 118 PRO A CG    1 
ATOM   887  C  CD    . PRO A 1  121 ? -47.388 41.421 -4.376  1.00 44.47  ? 118 PRO A CD    1 
ATOM   888  N  N     . GLN A 1  122 ? -49.478 42.061 -0.151  1.00 46.70  ? 119 GLN A N     1 
ATOM   889  C  CA    . GLN A 1  122 ? -49.654 43.044 0.924   1.00 47.79  ? 119 GLN A CA    1 
ATOM   890  C  C     . GLN A 1  122 ? -48.427 43.222 1.841   1.00 47.57  ? 119 GLN A C     1 
ATOM   891  O  O     . GLN A 1  122 ? -48.132 44.344 2.293   1.00 47.42  ? 119 GLN A O     1 
ATOM   892  C  CB    . GLN A 1  122 ? -50.885 42.696 1.748   1.00 48.22  ? 119 GLN A CB    1 
ATOM   893  C  CG    . GLN A 1  122 ? -52.215 42.976 1.036   1.00 52.77  ? 119 GLN A CG    1 
ATOM   894  C  CD    . GLN A 1  122 ? -53.413 42.592 1.907   1.00 60.59  ? 119 GLN A CD    1 
ATOM   895  O  OE1   . GLN A 1  122 ? -53.248 42.233 3.086   1.00 64.07  ? 119 GLN A OE1   1 
ATOM   896  N  NE2   . GLN A 1  122 ? -54.617 42.669 1.339   1.00 61.43  ? 119 GLN A NE2   1 
ATOM   897  N  N     . LYS A 1  123 ? -47.709 42.126 2.090   1.00 46.85  ? 120 LYS A N     1 
ATOM   898  C  CA    . LYS A 1  123 ? -46.602 42.146 3.028   1.00 46.84  ? 120 LYS A CA    1 
ATOM   899  C  C     . LYS A 1  123 ? -45.298 41.630 2.422   1.00 45.59  ? 120 LYS A C     1 
ATOM   900  O  O     . LYS A 1  123 ? -45.322 40.772 1.539   1.00 45.63  ? 120 LYS A O     1 
ATOM   901  C  CB    . LYS A 1  123 ? -46.940 41.286 4.269   1.00 47.65  ? 120 LYS A CB    1 
ATOM   902  C  CG    . LYS A 1  123 ? -48.138 41.757 5.093   1.00 49.95  ? 120 LYS A CG    1 
ATOM   903  C  CD    . LYS A 1  123 ? -48.286 40.870 6.301   1.00 56.39  ? 120 LYS A CD    1 
ATOM   904  C  CE    . LYS A 1  123 ? -49.733 40.794 6.794   1.00 60.23  ? 120 LYS A CE    1 
ATOM   905  N  NZ    . LYS A 1  123 ? -49.840 39.768 7.891   1.00 62.38  ? 120 LYS A NZ    1 
ATOM   906  N  N     . PRO A 1  124 ? -44.143 42.112 2.934   1.00 44.24  ? 121 PRO A N     1 
ATOM   907  C  CA    . PRO A 1  124 ? -42.918 41.396 2.586   1.00 42.82  ? 121 PRO A CA    1 
ATOM   908  C  C     . PRO A 1  124 ? -43.076 39.954 3.008   1.00 42.06  ? 121 PRO A C     1 
ATOM   909  O  O     . PRO A 1  124 ? -43.707 39.672 4.018   1.00 42.03  ? 121 PRO A O     1 
ATOM   910  C  CB    . PRO A 1  124 ? -41.841 42.067 3.439   1.00 42.67  ? 121 PRO A CB    1 
ATOM   911  C  CG    . PRO A 1  124 ? -42.455 43.263 4.051   1.00 43.00  ? 121 PRO A CG    1 
ATOM   912  C  CD    . PRO A 1  124 ? -43.893 43.353 3.690   1.00 43.53  ? 121 PRO A CD    1 
ATOM   913  N  N     . PHE A 1  125 ? -42.503 39.054 2.232   1.00 41.39  ? 122 PHE A N     1 
ATOM   914  C  CA    . PHE A 1  125 ? -42.547 37.616 2.488   1.00 40.78  ? 122 PHE A CA    1 
ATOM   915  C  C     . PHE A 1  125 ? -43.872 36.911 2.201   1.00 40.98  ? 122 PHE A C     1 
ATOM   916  O  O     . PHE A 1  125 ? -43.941 35.684 2.310   1.00 41.16  ? 122 PHE A O     1 
ATOM   917  C  CB    . PHE A 1  125 ? -41.992 37.259 3.873   1.00 40.68  ? 122 PHE A CB    1 
ATOM   918  C  CG    . PHE A 1  125 ? -40.630 37.824 4.128   1.00 38.32  ? 122 PHE A CG    1 
ATOM   919  C  CD1   . PHE A 1  125 ? -40.466 38.871 5.012   1.00 35.64  ? 122 PHE A CD1   1 
ATOM   920  C  CD2   . PHE A 1  125 ? -39.516 37.314 3.462   1.00 37.66  ? 122 PHE A CD2   1 
ATOM   921  C  CE1   . PHE A 1  125 ? -39.207 39.410 5.250   1.00 37.62  ? 122 PHE A CE1   1 
ATOM   922  C  CE2   . PHE A 1  125 ? -38.233 37.845 3.667   1.00 37.07  ? 122 PHE A CE2   1 
ATOM   923  C  CZ    . PHE A 1  125 ? -38.073 38.897 4.564   1.00 37.25  ? 122 PHE A CZ    1 
ATOM   924  N  N     . ASP A 1  126 ? -44.904 37.647 1.788   1.00 41.28  ? 123 ASP A N     1 
ATOM   925  C  CA    . ASP A 1  126 ? -46.109 36.981 1.252   1.00 41.66  ? 123 ASP A CA    1 
ATOM   926  C  C     . ASP A 1  126 ? -45.787 36.143 0.022   1.00 41.66  ? 123 ASP A C     1 
ATOM   927  O  O     . ASP A 1  126 ? -46.163 34.976 -0.043  1.00 41.71  ? 123 ASP A O     1 
ATOM   928  C  CB    . ASP A 1  126 ? -47.220 37.979 0.912   1.00 41.72  ? 123 ASP A CB    1 
ATOM   929  C  CG    . ASP A 1  126 ? -47.876 38.580 2.153   1.00 43.87  ? 123 ASP A CG    1 
ATOM   930  O  OD1   . ASP A 1  126 ? -47.666 38.055 3.277   1.00 45.05  ? 123 ASP A OD1   1 
ATOM   931  O  OD2   . ASP A 1  126 ? -48.600 39.599 2.007   1.00 45.99  ? 123 ASP A OD2   1 
ATOM   932  N  N     . LYS A 1  127 ? -45.093 36.736 -0.957  1.00 41.89  ? 124 LYS A N     1 
ATOM   933  C  CA    . LYS A 1  127 ? -44.801 36.033 -2.225  1.00 42.19  ? 124 LYS A CA    1 
ATOM   934  C  C     . LYS A 1  127 ? -43.405 36.289 -2.732  1.00 42.43  ? 124 LYS A C     1 
ATOM   935  O  O     . LYS A 1  127 ? -42.968 37.434 -2.821  1.00 43.38  ? 124 LYS A O     1 
ATOM   936  C  CB    . LYS A 1  127 ? -45.789 36.404 -3.337  1.00 41.92  ? 124 LYS A CB    1 
ATOM   937  C  CG    . LYS A 1  127 ? -46.033 35.243 -4.282  1.00 42.62  ? 124 LYS A CG    1 
ATOM   938  C  CD    . LYS A 1  127 ? -46.981 35.574 -5.426  1.00 43.32  ? 124 LYS A CD    1 
ATOM   939  C  CE    . LYS A 1  127 ? -48.431 35.509 -5.004  1.00 43.51  ? 124 LYS A CE    1 
ATOM   940  N  NZ    . LYS A 1  127 ? -49.249 35.312 -6.196  1.00 44.18  ? 124 LYS A NZ    1 
ATOM   941  N  N     . PHE A 1  128 ? -42.712 35.217 -3.072  1.00 41.77  ? 125 PHE A N     1 
ATOM   942  C  CA    . PHE A 1  128 ? -41.420 35.325 -3.703  1.00 41.11  ? 125 PHE A CA    1 
ATOM   943  C  C     . PHE A 1  128 ? -41.571 34.927 -5.150  1.00 40.86  ? 125 PHE A C     1 
ATOM   944  O  O     . PHE A 1  128 ? -42.260 33.947 -5.451  1.00 40.73  ? 125 PHE A O     1 
ATOM   945  C  CB    . PHE A 1  128 ? -40.465 34.341 -3.062  1.00 41.12  ? 125 PHE A CB    1 
ATOM   946  C  CG    . PHE A 1  128 ? -39.796 34.860 -1.849  1.00 40.53  ? 125 PHE A CG    1 
ATOM   947  C  CD1   . PHE A 1  128 ? -40.186 36.078 -1.284  1.00 40.26  ? 125 PHE A CD1   1 
ATOM   948  C  CD2   . PHE A 1  128 ? -38.786 34.117 -1.244  1.00 37.83  ? 125 PHE A CD2   1 
ATOM   949  C  CE1   . PHE A 1  128 ? -39.537 36.562 -0.141  1.00 38.71  ? 125 PHE A CE1   1 
ATOM   950  C  CE2   . PHE A 1  128 ? -38.158 34.583 -0.117  1.00 37.13  ? 125 PHE A CE2   1 
ATOM   951  C  CZ    . PHE A 1  128 ? -38.527 35.811 0.430   1.00 38.00  ? 125 PHE A CZ    1 
ATOM   952  N  N     . PHE A 1  129 ? -40.923 35.679 -6.038  1.00 40.12  ? 126 PHE A N     1 
ATOM   953  C  CA    . PHE A 1  129 ? -40.805 35.305 -7.441  1.00 39.44  ? 126 PHE A CA    1 
ATOM   954  C  C     . PHE A 1  129 ? -39.373 34.889 -7.690  1.00 39.67  ? 126 PHE A C     1 
ATOM   955  O  O     . PHE A 1  129 ? -38.441 35.621 -7.342  1.00 40.53  ? 126 PHE A O     1 
ATOM   956  C  CB    . PHE A 1  129 ? -41.192 36.483 -8.329  1.00 39.14  ? 126 PHE A CB    1 
ATOM   957  C  CG    . PHE A 1  129 ? -42.643 36.810 -8.268  1.00 38.41  ? 126 PHE A CG    1 
ATOM   958  C  CD1   . PHE A 1  129 ? -43.522 36.263 -9.190  1.00 37.64  ? 126 PHE A CD1   1 
ATOM   959  C  CD2   . PHE A 1  129 ? -43.143 37.613 -7.252  1.00 37.76  ? 126 PHE A CD2   1 
ATOM   960  C  CE1   . PHE A 1  129 ? -44.892 36.531 -9.123  1.00 40.19  ? 126 PHE A CE1   1 
ATOM   961  C  CE2   . PHE A 1  129 ? -44.508 37.891 -7.167  1.00 39.54  ? 126 PHE A CE2   1 
ATOM   962  C  CZ    . PHE A 1  129 ? -45.394 37.350 -8.111  1.00 39.81  ? 126 PHE A CZ    1 
ATOM   963  N  N     . ILE A 1  130 ? -39.180 33.707 -8.258  1.00 39.36  ? 127 ILE A N     1 
ATOM   964  C  CA    . ILE A 1  130 ? -37.828 33.225 -8.508  1.00 39.36  ? 127 ILE A CA    1 
ATOM   965  C  C     . ILE A 1  130 ? -37.617 32.792 -9.950  1.00 39.56  ? 127 ILE A C     1 
ATOM   966  O  O     . ILE A 1  130 ? -38.568 32.496 -10.668 1.00 39.62  ? 127 ILE A O     1 
ATOM   967  C  CB    . ILE A 1  130 ? -37.443 32.095 -7.570  1.00 39.36  ? 127 ILE A CB    1 
ATOM   968  C  CG1   . ILE A 1  130 ? -38.315 30.864 -7.830  1.00 39.99  ? 127 ILE A CG1   1 
ATOM   969  C  CG2   . ILE A 1  130 ? -37.584 32.545 -6.129  1.00 39.73  ? 127 ILE A CG2   1 
ATOM   970  C  CD1   . ILE A 1  130 ? -37.800 29.606 -7.132  1.00 40.50  ? 127 ILE A CD1   1 
ATOM   971  N  N     . ASP A 1  131 ? -36.355 32.777 -10.364 1.00 39.56  ? 128 ASP A N     1 
ATOM   972  C  CA    . ASP A 1  131 ? -35.981 32.477 -11.734 1.00 39.22  ? 128 ASP A CA    1 
ATOM   973  C  C     . ASP A 1  131 ? -34.488 32.291 -11.882 1.00 39.38  ? 128 ASP A C     1 
ATOM   974  O  O     . ASP A 1  131 ? -33.688 32.794 -11.064 1.00 39.34  ? 128 ASP A O     1 
ATOM   975  C  CB    . ASP A 1  131 ? -36.392 33.619 -12.637 1.00 39.18  ? 128 ASP A CB    1 
ATOM   976  C  CG    . ASP A 1  131 ? -36.502 33.205 -14.080 1.00 40.15  ? 128 ASP A CG    1 
ATOM   977  O  OD1   . ASP A 1  131 ? -36.453 31.995 -14.375 1.00 41.78  ? 128 ASP A OD1   1 
ATOM   978  O  OD2   . ASP A 1  131 ? -36.656 34.093 -14.935 1.00 41.49  ? 128 ASP A OD2   1 
ATOM   979  N  N     . TYR A 1  132 ? -34.107 31.583 -12.946 1.00 39.50  ? 129 TYR A N     1 
ATOM   980  C  CA    . TYR A 1  132 ? -32.714 31.545 -13.359 1.00 39.45  ? 129 TYR A CA    1 
ATOM   981  C  C     . TYR A 1  132 ? -32.399 32.464 -14.521 1.00 39.79  ? 129 TYR A C     1 
ATOM   982  O  O     . TYR A 1  132 ? -33.221 32.666 -15.431 1.00 39.59  ? 129 TYR A O     1 
ATOM   983  C  CB    . TYR A 1  132 ? -32.290 30.138 -13.680 1.00 39.06  ? 129 TYR A CB    1 
ATOM   984  C  CG    . TYR A 1  132 ? -31.907 29.391 -12.447 1.00 40.18  ? 129 TYR A CG    1 
ATOM   985  C  CD1   . TYR A 1  132 ? -32.745 28.402 -11.919 1.00 41.61  ? 129 TYR A CD1   1 
ATOM   986  C  CD2   . TYR A 1  132 ? -30.724 29.693 -11.773 1.00 42.13  ? 129 TYR A CD2   1 
ATOM   987  C  CE1   . TYR A 1  132 ? -32.407 27.709 -10.768 1.00 42.79  ? 129 TYR A CE1   1 
ATOM   988  C  CE2   . TYR A 1  132 ? -30.361 28.998 -10.623 1.00 45.04  ? 129 TYR A CE2   1 
ATOM   989  C  CZ    . TYR A 1  132 ? -31.219 28.007 -10.121 1.00 45.88  ? 129 TYR A CZ    1 
ATOM   990  O  OH    . TYR A 1  132 ? -30.882 27.330 -8.966  1.00 48.56  ? 129 TYR A OH    1 
ATOM   991  N  N     . ILE A 1  133 ? -31.209 33.047 -14.442 1.00 40.45  ? 130 ILE A N     1 
ATOM   992  C  CA    . ILE A 1  133 ? -30.565 33.707 -15.554 1.00 41.46  ? 130 ILE A CA    1 
ATOM   993  C  C     . ILE A 1  133 ? -29.358 32.853 -15.909 1.00 42.48  ? 130 ILE A C     1 
ATOM   994  O  O     . ILE A 1  133 ? -28.658 32.377 -15.006 1.00 43.08  ? 130 ILE A O     1 
ATOM   995  C  CB    . ILE A 1  133 ? -30.018 35.052 -15.149 1.00 41.19  ? 130 ILE A CB    1 
ATOM   996  C  CG1   . ILE A 1  133 ? -31.130 36.022 -14.808 1.00 42.40  ? 130 ILE A CG1   1 
ATOM   997  C  CG2   . ILE A 1  133 ? -29.238 35.637 -16.272 1.00 41.71  ? 130 ILE A CG2   1 
ATOM   998  C  CD1   . ILE A 1  133 ? -30.561 37.294 -14.152 1.00 44.13  ? 130 ILE A CD1   1 
ATOM   999  N  N     . GLY A 1  134 ? -29.098 32.687 -17.211 1.00 43.38  ? 131 GLY A N     1 
ATOM   1000 C  CA    . GLY A 1  134 ? -27.927 31.963 -17.699 1.00 43.96  ? 131 GLY A CA    1 
ATOM   1001 C  C     . GLY A 1  134 ? -28.249 31.041 -18.863 1.00 44.78  ? 131 GLY A C     1 
ATOM   1002 O  O     . GLY A 1  134 ? -29.400 30.931 -19.289 1.00 45.55  ? 131 GLY A O     1 
ATOM   1003 N  N     . PRO A 1  135 ? -27.235 30.358 -19.389 1.00 45.28  ? 132 PRO A N     1 
ATOM   1004 C  CA    . PRO A 1  135 ? -25.839 30.434 -18.924 1.00 45.75  ? 132 PRO A CA    1 
ATOM   1005 C  C     . PRO A 1  135 ? -25.199 31.792 -19.217 1.00 46.63  ? 132 PRO A C     1 
ATOM   1006 O  O     . PRO A 1  135 ? -25.504 32.438 -20.227 1.00 46.51  ? 132 PRO A O     1 
ATOM   1007 C  CB    . PRO A 1  135 ? -25.140 29.328 -19.722 1.00 45.07  ? 132 PRO A CB    1 
ATOM   1008 C  CG    . PRO A 1  135 ? -25.967 29.143 -20.922 1.00 44.53  ? 132 PRO A CG    1 
ATOM   1009 C  CD    . PRO A 1  135 ? -27.393 29.446 -20.534 1.00 45.07  ? 132 PRO A CD    1 
ATOM   1010 N  N     . LEU A 1  136 ? -24.356 32.230 -18.300 1.00 47.70  ? 133 LEU A N     1 
ATOM   1011 C  CA    . LEU A 1  136 ? -23.514 33.391 -18.505 1.00 48.89  ? 133 LEU A CA    1 
ATOM   1012 C  C     . LEU A 1  136 ? -22.101 32.882 -18.848 1.00 50.18  ? 133 LEU A C     1 
ATOM   1013 O  O     . LEU A 1  136 ? -21.851 31.663 -18.769 1.00 50.58  ? 133 LEU A O     1 
ATOM   1014 C  CB    . LEU A 1  136 ? -23.474 34.229 -17.232 1.00 48.58  ? 133 LEU A CB    1 
ATOM   1015 C  CG    . LEU A 1  136 ? -24.765 34.762 -16.610 1.00 47.40  ? 133 LEU A CG    1 
ATOM   1016 C  CD1   . LEU A 1  136 ? -24.402 35.554 -15.381 1.00 45.25  ? 133 LEU A CD1   1 
ATOM   1017 C  CD2   . LEU A 1  136 ? -25.569 35.623 -17.569 1.00 46.86  ? 133 LEU A CD2   1 
ATOM   1018 N  N     . PRO A 1  137 ? -21.174 33.787 -19.256 1.00 50.95  ? 134 PRO A N     1 
ATOM   1019 C  CA    . PRO A 1  137 ? -19.802 33.292 -19.431 1.00 51.48  ? 134 PRO A CA    1 
ATOM   1020 C  C     . PRO A 1  137 ? -19.320 32.734 -18.100 1.00 52.23  ? 134 PRO A C     1 
ATOM   1021 O  O     . PRO A 1  137 ? -19.659 33.290 -17.062 1.00 52.95  ? 134 PRO A O     1 
ATOM   1022 C  CB    . PRO A 1  137 ? -19.003 34.558 -19.787 1.00 51.28  ? 134 PRO A CB    1 
ATOM   1023 C  CG    . PRO A 1  137 ? -19.988 35.515 -20.309 1.00 51.15  ? 134 PRO A CG    1 
ATOM   1024 C  CD    . PRO A 1  137 ? -21.312 35.203 -19.658 1.00 51.13  ? 134 PRO A CD    1 
ATOM   1025 N  N     . PRO A 1  138 ? -18.549 31.637 -18.111 1.00 52.95  ? 135 PRO A N     1 
ATOM   1026 C  CA    . PRO A 1  138 ? -18.071 31.111 -16.829 1.00 53.02  ? 135 PRO A CA    1 
ATOM   1027 C  C     . PRO A 1  138 ? -17.366 32.181 -16.012 1.00 53.39  ? 135 PRO A C     1 
ATOM   1028 O  O     . PRO A 1  138 ? -16.586 32.948 -16.554 1.00 53.33  ? 135 PRO A O     1 
ATOM   1029 C  CB    . PRO A 1  138 ? -17.061 30.046 -17.244 1.00 52.89  ? 135 PRO A CB    1 
ATOM   1030 C  CG    . PRO A 1  138 ? -17.509 29.606 -18.585 1.00 52.99  ? 135 PRO A CG    1 
ATOM   1031 C  CD    . PRO A 1  138 ? -18.062 30.838 -19.251 1.00 53.01  ? 135 PRO A CD    1 
ATOM   1032 N  N     . SER A 1  139 ? -17.684 32.248 -14.725 1.00 54.08  ? 136 SER A N     1 
ATOM   1033 C  CA    . SER A 1  139 ? -16.925 33.047 -13.773 1.00 54.54  ? 136 SER A CA    1 
ATOM   1034 C  C     . SER A 1  139 ? -16.755 32.214 -12.510 1.00 55.18  ? 136 SER A C     1 
ATOM   1035 O  O     . SER A 1  139 ? -17.737 31.706 -11.966 1.00 55.37  ? 136 SER A O     1 
ATOM   1036 C  CB    . SER A 1  139 ? -17.641 34.357 -13.467 1.00 54.45  ? 136 SER A CB    1 
ATOM   1037 O  OG    . SER A 1  139 ? -16.829 35.185 -12.660 1.00 54.53  ? 136 SER A OG    1 
ATOM   1038 N  N     . GLN A 1  140 ? -15.508 32.052 -12.068 1.00 55.82  ? 137 GLN A N     1 
ATOM   1039 C  CA    . GLN A 1  140 ? -15.168 31.170 -10.944 1.00 56.48  ? 137 GLN A CA    1 
ATOM   1040 C  C     . GLN A 1  140 ? -15.798 29.782 -11.063 1.00 55.94  ? 137 GLN A C     1 
ATOM   1041 O  O     . GLN A 1  140 ? -15.979 29.092 -10.058 1.00 56.47  ? 137 GLN A O     1 
ATOM   1042 C  CB    . GLN A 1  140 ? -15.564 31.798 -9.596  1.00 57.04  ? 137 GLN A CB    1 
ATOM   1043 C  CG    . GLN A 1  140 ? -14.852 33.093 -9.238  1.00 60.70  ? 137 GLN A CG    1 
ATOM   1044 C  CD    . GLN A 1  140 ? -13.349 32.937 -9.183  1.00 66.23  ? 137 GLN A CD    1 
ATOM   1045 O  OE1   . GLN A 1  140 ? -12.603 33.704 -9.810  1.00 68.78  ? 137 GLN A OE1   1 
ATOM   1046 N  NE2   . GLN A 1  140 ? -12.888 31.927 -8.448  1.00 68.75  ? 137 GLN A NE2   1 
ATOM   1047 N  N     . GLY A 1  141 ? -16.142 29.368 -12.276 1.00 55.26  ? 138 GLY A N     1 
ATOM   1048 C  CA    . GLY A 1  141 ? -16.775 28.062 -12.467 1.00 54.68  ? 138 GLY A CA    1 
ATOM   1049 C  C     . GLY A 1  141 ? -18.290 28.075 -12.298 1.00 54.33  ? 138 GLY A C     1 
ATOM   1050 O  O     . GLY A 1  141 ? -18.942 27.012 -12.316 1.00 54.32  ? 138 GLY A O     1 
ATOM   1051 N  N     . TYR A 1  142 ? -18.844 29.278 -12.127 1.00 53.41  ? 139 TYR A N     1 
ATOM   1052 C  CA    . TYR A 1  142 ? -20.287 29.491 -12.057 1.00 52.42  ? 139 TYR A CA    1 
ATOM   1053 C  C     . TYR A 1  142 ? -20.845 29.941 -13.408 1.00 51.75  ? 139 TYR A C     1 
ATOM   1054 O  O     . TYR A 1  142 ? -20.150 30.621 -14.182 1.00 51.20  ? 139 TYR A O     1 
ATOM   1055 C  CB    . TYR A 1  142 ? -20.607 30.511 -10.967 1.00 52.30  ? 139 TYR A CB    1 
ATOM   1056 C  CG    . TYR A 1  142 ? -20.336 29.941 -9.613  1.00 53.23  ? 139 TYR A CG    1 
ATOM   1057 C  CD1   . TYR A 1  142 ? -21.332 29.240 -8.920  1.00 52.88  ? 139 TYR A CD1   1 
ATOM   1058 C  CD2   . TYR A 1  142 ? -19.071 30.054 -9.033  1.00 54.04  ? 139 TYR A CD2   1 
ATOM   1059 C  CE1   . TYR A 1  142 ? -21.083 28.683 -7.679  1.00 52.96  ? 139 TYR A CE1   1 
ATOM   1060 C  CE2   . TYR A 1  142 ? -18.810 29.498 -7.782  1.00 54.88  ? 139 TYR A CE2   1 
ATOM   1061 C  CZ    . TYR A 1  142 ? -19.821 28.811 -7.118  1.00 54.65  ? 139 TYR A CZ    1 
ATOM   1062 O  OH    . TYR A 1  142 ? -19.556 28.259 -5.896  1.00 55.43  ? 139 TYR A OH    1 
ATOM   1063 N  N     . LEU A 1  143 ? -22.100 29.574 -13.671 1.00 50.64  ? 140 LEU A N     1 
ATOM   1064 C  CA    . LEU A 1  143 ? -22.691 29.770 -14.981 1.00 50.00  ? 140 LEU A CA    1 
ATOM   1065 C  C     . LEU A 1  143 ? -24.085 30.373 -14.921 1.00 49.50  ? 140 LEU A C     1 
ATOM   1066 O  O     . LEU A 1  143 ? -24.560 30.947 -15.903 1.00 49.81  ? 140 LEU A O     1 
ATOM   1067 C  CB    . LEU A 1  143 ? -22.736 28.439 -15.742 1.00 50.51  ? 140 LEU A CB    1 
ATOM   1068 C  CG    . LEU A 1  143 ? -21.413 27.804 -16.205 1.00 51.18  ? 140 LEU A CG    1 
ATOM   1069 C  CD1   . LEU A 1  143 ? -21.598 26.357 -16.588 1.00 51.19  ? 140 LEU A CD1   1 
ATOM   1070 C  CD2   . LEU A 1  143 ? -20.846 28.576 -17.378 1.00 51.98  ? 140 LEU A CD2   1 
ATOM   1071 N  N     . TYR A 1  144 ? -24.756 30.232 -13.780 1.00 48.29  ? 141 TYR A N     1 
ATOM   1072 C  CA    . TYR A 1  144 ? -26.123 30.738 -13.646 1.00 46.54  ? 141 TYR A CA    1 
ATOM   1073 C  C     . TYR A 1  144 ? -26.294 31.639 -12.426 1.00 45.79  ? 141 TYR A C     1 
ATOM   1074 O  O     . TYR A 1  144 ? -25.434 31.677 -11.553 1.00 45.48  ? 141 TYR A O     1 
ATOM   1075 C  CB    . TYR A 1  144 ? -27.105 29.578 -13.594 1.00 46.17  ? 141 TYR A CB    1 
ATOM   1076 C  CG    . TYR A 1  144 ? -27.147 28.775 -14.860 1.00 45.42  ? 141 TYR A CG    1 
ATOM   1077 C  CD1   . TYR A 1  144 ? -28.193 28.926 -15.767 1.00 45.66  ? 141 TYR A CD1   1 
ATOM   1078 C  CD2   . TYR A 1  144 ? -26.150 27.859 -15.154 1.00 46.11  ? 141 TYR A CD2   1 
ATOM   1079 C  CE1   . TYR A 1  144 ? -28.242 28.185 -16.939 1.00 45.93  ? 141 TYR A CE1   1 
ATOM   1080 C  CE2   . TYR A 1  144 ? -26.177 27.113 -16.328 1.00 47.44  ? 141 TYR A CE2   1 
ATOM   1081 C  CZ    . TYR A 1  144 ? -27.229 27.282 -17.214 1.00 47.11  ? 141 TYR A CZ    1 
ATOM   1082 O  OH    . TYR A 1  144 ? -27.257 26.554 -18.372 1.00 47.33  ? 141 TYR A OH    1 
ATOM   1083 N  N     . VAL A 1  145 ? -27.381 32.402 -12.395 1.00 44.67  ? 142 VAL A N     1 
ATOM   1084 C  CA    . VAL A 1  145 ? -27.719 33.177 -11.211 1.00 43.69  ? 142 VAL A CA    1 
ATOM   1085 C  C     . VAL A 1  145 ? -29.144 32.836 -10.827 1.00 43.00  ? 142 VAL A C     1 
ATOM   1086 O  O     . VAL A 1  145 ? -30.034 32.856 -11.683 1.00 43.05  ? 142 VAL A O     1 
ATOM   1087 C  CB    . VAL A 1  145 ? -27.574 34.698 -11.434 1.00 43.85  ? 142 VAL A CB    1 
ATOM   1088 C  CG1   . VAL A 1  145 ? -28.076 35.463 -10.221 1.00 43.96  ? 142 VAL A CG1   1 
ATOM   1089 C  CG2   . VAL A 1  145 ? -26.137 35.062 -11.674 1.00 43.50  ? 142 VAL A CG2   1 
ATOM   1090 N  N     . LEU A 1  146 ? -29.346 32.456 -9.563  1.00 42.00  ? 143 LEU A N     1 
ATOM   1091 C  CA    . LEU A 1  146 ? -30.694 32.330 -9.008  1.00 41.07  ? 143 LEU A CA    1 
ATOM   1092 C  C     . LEU A 1  146 ? -31.104 33.696 -8.485  1.00 40.43  ? 143 LEU A C     1 
ATOM   1093 O  O     . LEU A 1  146 ? -30.393 34.289 -7.659  1.00 40.20  ? 143 LEU A O     1 
ATOM   1094 C  CB    . LEU A 1  146 ? -30.774 31.293 -7.882  1.00 40.96  ? 143 LEU A CB    1 
ATOM   1095 C  CG    . LEU A 1  146 ? -32.178 31.156 -7.262  1.00 40.62  ? 143 LEU A CG    1 
ATOM   1096 C  CD1   . LEU A 1  146 ? -33.186 30.497 -8.215  1.00 40.23  ? 143 LEU A CD1   1 
ATOM   1097 C  CD2   . LEU A 1  146 ? -32.135 30.400 -5.975  1.00 39.96  ? 143 LEU A CD2   1 
ATOM   1098 N  N     . VAL A 1  147 ? -32.237 34.187 -8.985  1.00 39.50  ? 144 VAL A N     1 
ATOM   1099 C  CA    . VAL A 1  147 ? -32.729 35.503 -8.630  1.00 38.91  ? 144 VAL A CA    1 
ATOM   1100 C  C     . VAL A 1  147 ? -34.043 35.330 -7.884  1.00 39.09  ? 144 VAL A C     1 
ATOM   1101 O  O     . VAL A 1  147 ? -34.981 34.715 -8.395  1.00 39.00  ? 144 VAL A O     1 
ATOM   1102 C  CB    . VAL A 1  147 ? -32.933 36.378 -9.889  1.00 38.91  ? 144 VAL A CB    1 
ATOM   1103 C  CG1   . VAL A 1  147 ? -33.433 37.779 -9.527  1.00 37.64  ? 144 VAL A CG1   1 
ATOM   1104 C  CG2   . VAL A 1  147 ? -31.655 36.463 -10.691 1.00 38.09  ? 144 VAL A CG2   1 
ATOM   1105 N  N     . VAL A 1  148 ? -34.100 35.869 -6.669  1.00 39.06  ? 145 VAL A N     1 
ATOM   1106 C  CA    . VAL A 1  148 ? -35.284 35.754 -5.818  1.00 38.69  ? 145 VAL A CA    1 
ATOM   1107 C  C     . VAL A 1  148 ? -35.756 37.159 -5.505  1.00 39.30  ? 145 VAL A C     1 
ATOM   1108 O  O     . VAL A 1  148 ? -34.971 37.972 -4.971  1.00 39.69  ? 145 VAL A O     1 
ATOM   1109 C  CB    . VAL A 1  148 ? -34.944 35.085 -4.481  1.00 38.41  ? 145 VAL A CB    1 
ATOM   1110 C  CG1   . VAL A 1  148 ? -36.182 34.941 -3.663  1.00 37.91  ? 145 VAL A CG1   1 
ATOM   1111 C  CG2   . VAL A 1  148 ? -34.262 33.733 -4.694  1.00 37.28  ? 145 VAL A CG2   1 
ATOM   1112 N  N     . VAL A 1  149 ? -37.016 37.447 -5.824  1.00 38.82  ? 146 VAL A N     1 
ATOM   1113 C  CA    . VAL A 1  149 ? -37.542 38.787 -5.660  1.00 39.19  ? 146 VAL A CA    1 
ATOM   1114 C  C     . VAL A 1  149 ? -38.798 38.774 -4.779  1.00 39.79  ? 146 VAL A C     1 
ATOM   1115 O  O     . VAL A 1  149 ? -39.780 38.089 -5.071  1.00 40.08  ? 146 VAL A O     1 
ATOM   1116 C  CB    . VAL A 1  149 ? -37.838 39.430 -7.043  1.00 39.48  ? 146 VAL A CB    1 
ATOM   1117 C  CG1   . VAL A 1  149 ? -38.652 40.722 -6.916  1.00 38.23  ? 146 VAL A CG1   1 
ATOM   1118 C  CG2   . VAL A 1  149 ? -36.536 39.702 -7.792  1.00 39.54  ? 146 VAL A CG2   1 
ATOM   1119 N  N     . ASP A 1  150 ? -38.762 39.530 -3.694  1.00 39.48  ? 147 ASP A N     1 
ATOM   1120 C  CA    . ASP A 1  150 ? -39.931 39.656 -2.865  1.00 39.50  ? 147 ASP A CA    1 
ATOM   1121 C  C     . ASP A 1  150 ? -40.988 40.502 -3.565  1.00 39.43  ? 147 ASP A C     1 
ATOM   1122 O  O     . ASP A 1  150 ? -40.718 41.601 -3.998  1.00 39.97  ? 147 ASP A O     1 
ATOM   1123 C  CB    . ASP A 1  150 ? -39.567 40.285 -1.518  1.00 39.85  ? 147 ASP A CB    1 
ATOM   1124 C  CG    . ASP A 1  150 ? -40.785 40.563 -0.677  1.00 39.61  ? 147 ASP A CG    1 
ATOM   1125 O  OD1   . ASP A 1  150 ? -41.448 39.574 -0.302  1.00 39.31  ? 147 ASP A OD1   1 
ATOM   1126 O  OD2   . ASP A 1  150 ? -41.096 41.752 -0.436  1.00 38.84  ? 147 ASP A OD2   1 
ATOM   1127 N  N     . GLY A 1  151 ? -42.209 40.003 -3.623  1.00 39.42  ? 148 GLY A N     1 
ATOM   1128 C  CA    . GLY A 1  151 ? -43.244 40.628 -4.415  1.00 39.23  ? 148 GLY A CA    1 
ATOM   1129 C  C     . GLY A 1  151 ? -43.661 41.992 -3.929  1.00 39.16  ? 148 GLY A C     1 
ATOM   1130 O  O     . GLY A 1  151 ? -43.962 42.876 -4.732  1.00 39.61  ? 148 GLY A O     1 
ATOM   1131 N  N     . MET A 1  152 ? -43.698 42.175 -2.616  1.00 39.01  ? 149 MET A N     1 
ATOM   1132 C  CA    . MET A 1  152 ? -44.207 43.434 -2.075  1.00 38.94  ? 149 MET A CA    1 
ATOM   1133 C  C     . MET A 1  152 ? -43.147 44.512 -2.179  1.00 38.61  ? 149 MET A C     1 
ATOM   1134 O  O     . MET A 1  152 ? -43.441 45.632 -2.572  1.00 38.19  ? 149 MET A O     1 
ATOM   1135 C  CB    . MET A 1  152 ? -44.698 43.269 -0.631  1.00 38.96  ? 149 MET A CB    1 
ATOM   1136 C  CG    . MET A 1  152 ? -45.388 44.507 -0.060  1.00 40.03  ? 149 MET A CG    1 
ATOM   1137 S  SD    . MET A 1  152 ? -44.254 45.770 0.575   1.00 41.29  ? 149 MET A SD    1 
ATOM   1138 C  CE    . MET A 1  152 ? -44.912 47.242 -0.194  1.00 37.92  ? 149 MET A CE    1 
ATOM   1139 N  N     . THR A 1  153 ? -41.908 44.153 -1.856  1.00 38.66  ? 150 THR A N     1 
ATOM   1140 C  CA    . THR A 1  153 ? -40.846 45.150 -1.731  1.00 39.04  ? 150 THR A CA    1 
ATOM   1141 C  C     . THR A 1  153 ? -40.004 45.318 -2.991  1.00 39.24  ? 150 THR A C     1 
ATOM   1142 O  O     . THR A 1  153 ? -39.448 46.395 -3.217  1.00 39.94  ? 150 THR A O     1 
ATOM   1143 C  CB    . THR A 1  153 ? -39.911 44.860 -0.515  1.00 38.72  ? 150 THR A CB    1 
ATOM   1144 O  OG1   . THR A 1  153 ? -39.291 43.581 -0.678  1.00 38.19  ? 150 THR A OG1   1 
ATOM   1145 C  CG2   . THR A 1  153 ? -40.710 44.845 0.781   1.00 39.01  ? 150 THR A CG2   1 
ATOM   1146 N  N     . GLY A 1  154 ? -39.902 44.264 -3.798  1.00 38.98  ? 151 GLY A N     1 
ATOM   1147 C  CA    . GLY A 1  154 ? -38.963 44.247 -4.908  1.00 38.64  ? 151 GLY A CA    1 
ATOM   1148 C  C     . GLY A 1  154 ? -37.542 43.944 -4.437  1.00 39.01  ? 151 GLY A C     1 
ATOM   1149 O  O     . GLY A 1  154 ? -36.603 43.858 -5.248  1.00 39.52  ? 151 GLY A O     1 
ATOM   1150 N  N     . PHE A 1  155 ? -37.370 43.770 -3.128  1.00 38.35  ? 152 PHE A N     1 
ATOM   1151 C  CA    . PHE A 1  155 ? -36.078 43.413 -2.568  1.00 37.42  ? 152 PHE A CA    1 
ATOM   1152 C  C     . PHE A 1  155 ? -35.590 42.105 -3.172  1.00 38.03  ? 152 PHE A C     1 
ATOM   1153 O  O     . PHE A 1  155 ? -36.355 41.161 -3.301  1.00 38.97  ? 152 PHE A O     1 
ATOM   1154 C  CB    . PHE A 1  155 ? -36.190 43.273 -1.056  1.00 36.80  ? 152 PHE A CB    1 
ATOM   1155 C  CG    . PHE A 1  155 ? -34.879 43.351 -0.353  1.00 33.90  ? 152 PHE A CG    1 
ATOM   1156 C  CD1   . PHE A 1  155 ? -34.411 44.564 0.105   1.00 29.75  ? 152 PHE A CD1   1 
ATOM   1157 C  CD2   . PHE A 1  155 ? -34.100 42.191 -0.161  1.00 31.42  ? 152 PHE A CD2   1 
ATOM   1158 C  CE1   . PHE A 1  155 ? -33.200 44.641 0.739   1.00 29.42  ? 152 PHE A CE1   1 
ATOM   1159 C  CE2   . PHE A 1  155 ? -32.881 42.258 0.477   1.00 29.01  ? 152 PHE A CE2   1 
ATOM   1160 C  CZ    . PHE A 1  155 ? -32.427 43.483 0.935   1.00 30.23  ? 152 PHE A CZ    1 
ATOM   1161 N  N     . THR A 1  156 ? -34.307 42.039 -3.502  1.00 38.48  ? 153 THR A N     1 
ATOM   1162 C  CA    . THR A 1  156 ? -33.778 40.959 -4.321  1.00 39.12  ? 153 THR A CA    1 
ATOM   1163 C  C     . THR A 1  156 ? -32.588 40.245 -3.698  1.00 39.86  ? 153 THR A C     1 
ATOM   1164 O  O     . THR A 1  156 ? -31.703 40.881 -3.095  1.00 39.90  ? 153 THR A O     1 
ATOM   1165 C  CB    . THR A 1  156 ? -33.385 41.508 -5.750  1.00 39.25  ? 153 THR A CB    1 
ATOM   1166 O  OG1   . THR A 1  156 ? -34.533 42.143 -6.343  1.00 39.76  ? 153 THR A OG1   1 
ATOM   1167 C  CG2   . THR A 1  156 ? -32.913 40.396 -6.663  1.00 37.05  ? 153 THR A CG2   1 
ATOM   1168 N  N     . TRP A 1  157 ? -32.557 38.926 -3.868  1.00 40.32  ? 154 TRP A N     1 
ATOM   1169 C  CA    . TRP A 1  157 ? -31.409 38.126 -3.466  1.00 41.38  ? 154 TRP A CA    1 
ATOM   1170 C  C     . TRP A 1  157 ? -30.764 37.446 -4.680  1.00 42.02  ? 154 TRP A C     1 
ATOM   1171 O  O     . TRP A 1  157 ? -31.461 36.910 -5.539  1.00 42.71  ? 154 TRP A O     1 
ATOM   1172 C  CB    . TRP A 1  157 ? -31.836 37.066 -2.440  1.00 41.23  ? 154 TRP A CB    1 
ATOM   1173 C  CG    . TRP A 1  157 ? -32.213 37.603 -1.059  1.00 42.48  ? 154 TRP A CG    1 
ATOM   1174 C  CD1   . TRP A 1  157 ? -31.396 37.692 0.042   1.00 42.97  ? 154 TRP A CD1   1 
ATOM   1175 C  CD2   . TRP A 1  157 ? -33.505 38.077 -0.630  1.00 42.47  ? 154 TRP A CD2   1 
ATOM   1176 N  NE1   . TRP A 1  157 ? -32.093 38.212 1.112   1.00 42.93  ? 154 TRP A NE1   1 
ATOM   1177 C  CE2   . TRP A 1  157 ? -33.384 38.455 0.731   1.00 42.09  ? 154 TRP A CE2   1 
ATOM   1178 C  CE3   . TRP A 1  157 ? -34.750 38.209 -1.260  1.00 42.88  ? 154 TRP A CE3   1 
ATOM   1179 C  CZ2   . TRP A 1  157 ? -34.452 38.965 1.465   1.00 42.16  ? 154 TRP A CZ2   1 
ATOM   1180 C  CZ3   . TRP A 1  157 ? -35.817 38.735 -0.535  1.00 43.55  ? 154 TRP A CZ3   1 
ATOM   1181 C  CH2   . TRP A 1  157 ? -35.660 39.105 0.817   1.00 43.93  ? 154 TRP A CH2   1 
ATOM   1182 N  N     . LEU A 1  158 ? -29.441 37.434 -4.739  1.00 42.66  ? 155 LEU A N     1 
ATOM   1183 C  CA    . LEU A 1  158 ? -28.753 36.821 -5.863  1.00 43.51  ? 155 LEU A CA    1 
ATOM   1184 C  C     . LEU A 1  158 ? -27.839 35.706 -5.400  1.00 44.51  ? 155 LEU A C     1 
ATOM   1185 O  O     . LEU A 1  158 ? -27.102 35.859 -4.424  1.00 44.96  ? 155 LEU A O     1 
ATOM   1186 C  CB    . LEU A 1  158 ? -27.942 37.868 -6.644  1.00 43.24  ? 155 LEU A CB    1 
ATOM   1187 C  CG    . LEU A 1  158 ? -28.693 39.138 -7.081  1.00 42.61  ? 155 LEU A CG    1 
ATOM   1188 C  CD1   . LEU A 1  158 ? -27.780 40.116 -7.812  1.00 41.25  ? 155 LEU A CD1   1 
ATOM   1189 C  CD2   . LEU A 1  158 ? -29.892 38.788 -7.926  1.00 40.88  ? 155 LEU A CD2   1 
ATOM   1190 N  N     . TYR A 1  159 ? -27.883 34.586 -6.113  1.00 45.20  ? 156 TYR A N     1 
ATOM   1191 C  CA    . TYR A 1  159 ? -27.036 33.446 -5.806  1.00 45.83  ? 156 TYR A CA    1 
ATOM   1192 C  C     . TYR A 1  159 ? -26.457 32.876 -7.096  1.00 46.25  ? 156 TYR A C     1 
ATOM   1193 O  O     . TYR A 1  159 ? -27.202 32.531 -8.018  1.00 45.91  ? 156 TYR A O     1 
ATOM   1194 C  CB    . TYR A 1  159 ? -27.829 32.369 -5.060  1.00 46.17  ? 156 TYR A CB    1 
ATOM   1195 C  CG    . TYR A 1  159 ? -28.440 32.853 -3.760  1.00 47.69  ? 156 TYR A CG    1 
ATOM   1196 C  CD1   . TYR A 1  159 ? -27.696 32.875 -2.581  1.00 49.26  ? 156 TYR A CD1   1 
ATOM   1197 C  CD2   . TYR A 1  159 ? -29.762 33.292 -3.712  1.00 49.26  ? 156 TYR A CD2   1 
ATOM   1198 C  CE1   . TYR A 1  159 ? -28.257 33.334 -1.384  1.00 51.97  ? 156 TYR A CE1   1 
ATOM   1199 C  CE2   . TYR A 1  159 ? -30.336 33.754 -2.525  1.00 51.69  ? 156 TYR A CE2   1 
ATOM   1200 C  CZ    . TYR A 1  159 ? -29.582 33.771 -1.361  1.00 52.45  ? 156 TYR A CZ    1 
ATOM   1201 O  OH    . TYR A 1  159 ? -30.149 34.224 -0.185  1.00 53.19  ? 156 TYR A OH    1 
ATOM   1202 N  N     . PRO A 1  160 ? -25.119 32.782 -7.170  1.00 46.70  ? 157 PRO A N     1 
ATOM   1203 C  CA    . PRO A 1  160 ? -24.454 32.190 -8.332  1.00 46.97  ? 157 PRO A CA    1 
ATOM   1204 C  C     . PRO A 1  160 ? -24.548 30.676 -8.249  1.00 47.70  ? 157 PRO A C     1 
ATOM   1205 O  O     . PRO A 1  160 ? -24.353 30.111 -7.174  1.00 47.99  ? 157 PRO A O     1 
ATOM   1206 C  CB    . PRO A 1  160 ? -23.005 32.617 -8.149  1.00 46.93  ? 157 PRO A CB    1 
ATOM   1207 C  CG    . PRO A 1  160 ? -22.846 32.744 -6.646  1.00 47.03  ? 157 PRO A CG    1 
ATOM   1208 C  CD    . PRO A 1  160 ? -24.173 33.160 -6.102  1.00 46.42  ? 157 PRO A CD    1 
ATOM   1209 N  N     . THR A 1  161 ? -24.856 30.013 -9.355  1.00 48.35  ? 158 THR A N     1 
ATOM   1210 C  CA    . THR A 1  161 ? -24.862 28.559 -9.359  1.00 49.04  ? 158 THR A CA    1 
ATOM   1211 C  C     . THR A 1  161 ? -24.155 28.001 -10.582 1.00 49.78  ? 158 THR A C     1 
ATOM   1212 O  O     . THR A 1  161 ? -24.003 28.697 -11.603 1.00 49.92  ? 158 THR A O     1 
ATOM   1213 C  CB    . THR A 1  161 ? -26.282 27.959 -9.292  1.00 48.99  ? 158 THR A CB    1 
ATOM   1214 O  OG1   . THR A 1  161 ? -26.870 27.977 -10.594 1.00 49.03  ? 158 THR A OG1   1 
ATOM   1215 C  CG2   . THR A 1  161 ? -27.175 28.704 -8.285  1.00 48.57  ? 158 THR A CG2   1 
ATOM   1216 N  N     . LYS A 1  162 ? -23.737 26.737 -10.467 1.00 50.45  ? 159 LYS A N     1 
ATOM   1217 C  CA    . LYS A 1  162 ? -23.124 26.009 -11.568 1.00 50.92  ? 159 LYS A CA    1 
ATOM   1218 C  C     . LYS A 1  162 ? -24.154 25.461 -12.542 1.00 50.96  ? 159 LYS A C     1 
ATOM   1219 O  O     . LYS A 1  162 ? -23.830 25.221 -13.707 1.00 51.86  ? 159 LYS A O     1 
ATOM   1220 C  CB    . LYS A 1  162 ? -22.232 24.896 -11.038 1.00 51.22  ? 159 LYS A CB    1 
ATOM   1221 C  CG    . LYS A 1  162 ? -21.038 25.434 -10.282 1.00 53.96  ? 159 LYS A CG    1 
ATOM   1222 C  CD    . LYS A 1  162 ? -20.055 24.355 -9.862  1.00 57.56  ? 159 LYS A CD    1 
ATOM   1223 C  CE    . LYS A 1  162 ? -18.784 24.996 -9.276  1.00 59.66  ? 159 LYS A CE    1 
ATOM   1224 N  NZ    . LYS A 1  162 ? -17.942 24.015 -8.519  1.00 61.00  ? 159 LYS A NZ    1 
ATOM   1225 N  N     . ALA A 1  163 ? -25.394 25.284 -12.084 1.00 50.66  ? 160 ALA A N     1 
ATOM   1226 C  CA    . ALA A 1  163 ? -26.470 24.765 -12.930 1.00 50.60  ? 160 ALA A CA    1 
ATOM   1227 C  C     . ALA A 1  163 ? -27.845 25.226 -12.429 1.00 50.64  ? 160 ALA A C     1 
ATOM   1228 O  O     . ALA A 1  163 ? -28.015 25.457 -11.243 1.00 50.82  ? 160 ALA A O     1 
ATOM   1229 C  CB    . ALA A 1  163 ? -26.406 23.226 -12.992 1.00 50.46  ? 160 ALA A CB    1 
ATOM   1230 N  N     . PRO A 1  164 ? -28.836 25.353 -13.330 1.00 50.65  ? 161 PRO A N     1 
ATOM   1231 C  CA    . PRO A 1  164 ? -30.170 25.725 -12.881 1.00 50.65  ? 161 PRO A CA    1 
ATOM   1232 C  C     . PRO A 1  164 ? -30.895 24.516 -12.278 1.00 50.94  ? 161 PRO A C     1 
ATOM   1233 O  O     . PRO A 1  164 ? -31.949 24.103 -12.783 1.00 50.59  ? 161 PRO A O     1 
ATOM   1234 C  CB    . PRO A 1  164 ? -30.844 26.166 -14.178 1.00 50.71  ? 161 PRO A CB    1 
ATOM   1235 C  CG    . PRO A 1  164 ? -30.200 25.296 -15.222 1.00 50.22  ? 161 PRO A CG    1 
ATOM   1236 C  CD    . PRO A 1  164 ? -28.776 25.195 -14.799 1.00 50.54  ? 161 PRO A CD    1 
ATOM   1237 N  N     . SER A 1  165 ? -30.327 23.976 -11.197 1.00 51.21  ? 162 SER A N     1 
ATOM   1238 C  CA    . SER A 1  165 ? -30.782 22.722 -10.561 1.00 51.33  ? 162 SER A CA    1 
ATOM   1239 C  C     . SER A 1  165 ? -31.542 22.861 -9.220  1.00 52.12  ? 162 SER A C     1 
ATOM   1240 O  O     . SER A 1  165 ? -31.365 23.821 -8.457  1.00 52.12  ? 162 SER A O     1 
ATOM   1241 C  CB    . SER A 1  165 ? -29.578 21.835 -10.314 1.00 51.09  ? 162 SER A CB    1 
ATOM   1242 O  OG    . SER A 1  165 ? -28.690 22.454 -9.404  1.00 49.65  ? 162 SER A OG    1 
ATOM   1243 N  N     . THR A 1  166 ? -32.377 21.869 -8.928  1.00 52.85  ? 163 THR A N     1 
ATOM   1244 C  CA    . THR A 1  166 ? -33.081 21.821 -7.662  1.00 53.07  ? 163 THR A CA    1 
ATOM   1245 C  C     . THR A 1  166 ? -32.076 21.918 -6.531  1.00 53.62  ? 163 THR A C     1 
ATOM   1246 O  O     . THR A 1  166 ? -32.226 22.761 -5.635  1.00 54.50  ? 163 THR A O     1 
ATOM   1247 C  CB    . THR A 1  166 ? -33.908 20.547 -7.524  1.00 52.94  ? 163 THR A CB    1 
ATOM   1248 O  OG1   . THR A 1  166 ? -34.934 20.556 -8.528  1.00 53.56  ? 163 THR A OG1   1 
ATOM   1249 C  CG2   . THR A 1  166 ? -34.544 20.461 -6.135  1.00 51.90  ? 163 THR A CG2   1 
ATOM   1250 N  N     . SER A 1  167 ? -31.029 21.100 -6.583  1.00 53.34  ? 164 SER A N     1 
ATOM   1251 C  CA    . SER A 1  167 ? -30.130 21.035 -5.449  1.00 53.27  ? 164 SER A CA    1 
ATOM   1252 C  C     . SER A 1  167 ? -29.473 22.385 -5.179  1.00 53.08  ? 164 SER A C     1 
ATOM   1253 O  O     . SER A 1  167 ? -29.326 22.784 -4.014  1.00 53.74  ? 164 SER A O     1 
ATOM   1254 C  CB    . SER A 1  167 ? -29.115 19.913 -5.603  1.00 53.17  ? 164 SER A CB    1 
ATOM   1255 O  OG    . SER A 1  167 ? -28.135 20.266 -6.540  1.00 54.77  ? 164 SER A OG    1 
ATOM   1256 N  N     . ALA A 1  168 ? -29.121 23.115 -6.238  1.00 52.42  ? 165 ALA A N     1 
ATOM   1257 C  CA    . ALA A 1  168 ? -28.529 24.439 -6.049  1.00 51.66  ? 165 ALA A CA    1 
ATOM   1258 C  C     . ALA A 1  168 ? -29.581 25.459 -5.587  1.00 51.39  ? 165 ALA A C     1 
ATOM   1259 O  O     . ALA A 1  168 ? -29.266 26.392 -4.823  1.00 51.04  ? 165 ALA A O     1 
ATOM   1260 C  CB    . ALA A 1  168 ? -27.833 24.900 -7.290  1.00 51.45  ? 165 ALA A CB    1 
ATOM   1261 N  N     . THR A 1  169 ? -30.825 25.265 -6.034  1.00 50.86  ? 166 THR A N     1 
ATOM   1262 C  CA    . THR A 1  169 ? -31.933 26.125 -5.627  1.00 50.41  ? 166 THR A CA    1 
ATOM   1263 C  C     . THR A 1  169 ? -32.174 25.923 -4.140  1.00 50.57  ? 166 THR A C     1 
ATOM   1264 O  O     . THR A 1  169 ? -32.288 26.894 -3.375  1.00 50.64  ? 166 THR A O     1 
ATOM   1265 C  CB    . THR A 1  169 ? -33.214 25.818 -6.416  1.00 50.42  ? 166 THR A CB    1 
ATOM   1266 O  OG1   . THR A 1  169 ? -32.936 25.871 -7.819  1.00 49.59  ? 166 THR A OG1   1 
ATOM   1267 C  CG2   . THR A 1  169 ? -34.298 26.822 -6.096  1.00 49.99  ? 166 THR A CG2   1 
ATOM   1268 N  N     . VAL A 1  170 ? -32.208 24.656 -3.736  1.00 50.51  ? 167 VAL A N     1 
ATOM   1269 C  CA    . VAL A 1  170 ? -32.365 24.280 -2.334  1.00 50.49  ? 167 VAL A CA    1 
ATOM   1270 C  C     . VAL A 1  170 ? -31.248 24.830 -1.405  1.00 50.48  ? 167 VAL A C     1 
ATOM   1271 O  O     . VAL A 1  170 ? -31.548 25.402 -0.353  1.00 50.03  ? 167 VAL A O     1 
ATOM   1272 C  CB    . VAL A 1  170 ? -32.557 22.740 -2.192  1.00 50.73  ? 167 VAL A CB    1 
ATOM   1273 C  CG1   . VAL A 1  170 ? -32.210 22.267 -0.784  1.00 50.06  ? 167 VAL A CG1   1 
ATOM   1274 C  CG2   . VAL A 1  170 ? -33.995 22.343 -2.578  1.00 49.83  ? 167 VAL A CG2   1 
ATOM   1275 N  N     . LYS A 1  171 ? -29.982 24.685 -1.794  1.00 50.44  ? 168 LYS A N     1 
ATOM   1276 C  CA    . LYS A 1  171 ? -28.893 25.263 -0.996  1.00 51.03  ? 168 LYS A CA    1 
ATOM   1277 C  C     . LYS A 1  171 ? -29.071 26.771 -0.814  1.00 50.61  ? 168 LYS A C     1 
ATOM   1278 O  O     . LYS A 1  171 ? -28.858 27.294 0.272   1.00 51.08  ? 168 LYS A O     1 
ATOM   1279 C  CB    . LYS A 1  171 ? -27.521 24.996 -1.617  1.00 51.51  ? 168 LYS A CB    1 
ATOM   1280 C  CG    . LYS A 1  171 ? -27.108 23.530 -1.720  1.00 54.46  ? 168 LYS A CG    1 
ATOM   1281 C  CD    . LYS A 1  171 ? -25.607 23.443 -1.991  1.00 59.44  ? 168 LYS A CD    1 
ATOM   1282 C  CE    . LYS A 1  171 ? -25.221 22.168 -2.761  1.00 62.02  ? 168 LYS A CE    1 
ATOM   1283 N  NZ    . LYS A 1  171 ? -24.807 21.059 -1.850  1.00 63.37  ? 168 LYS A NZ    1 
ATOM   1284 N  N     . SER A 1  172 ? -29.456 27.464 -1.881  1.00 50.11  ? 169 SER A N     1 
ATOM   1285 C  CA    . SER A 1  172 ? -29.577 28.922 -1.850  1.00 49.39  ? 169 SER A CA    1 
ATOM   1286 C  C     . SER A 1  172 ? -30.764 29.345 -1.000  1.00 48.76  ? 169 SER A C     1 
ATOM   1287 O  O     . SER A 1  172 ? -30.655 30.269 -0.191  1.00 48.92  ? 169 SER A O     1 
ATOM   1288 C  CB    . SER A 1  172 ? -29.702 29.507 -3.269  1.00 49.40  ? 169 SER A CB    1 
ATOM   1289 O  OG    . SER A 1  172 ? -28.568 29.186 -4.046  1.00 49.39  ? 169 SER A OG    1 
ATOM   1290 N  N     . LEU A 1  173 ? -31.895 28.674 -1.188  1.00 47.75  ? 170 LEU A N     1 
ATOM   1291 C  CA    . LEU A 1  173 ? -33.093 29.015 -0.435  1.00 47.08  ? 170 LEU A CA    1 
ATOM   1292 C  C     . LEU A 1  173 ? -32.962 28.725 1.067   1.00 47.26  ? 170 LEU A C     1 
ATOM   1293 O  O     . LEU A 1  173 ? -33.538 29.440 1.896   1.00 47.34  ? 170 LEU A O     1 
ATOM   1294 C  CB    . LEU A 1  173 ? -34.323 28.366 -1.050  1.00 46.43  ? 170 LEU A CB    1 
ATOM   1295 C  CG    . LEU A 1  173 ? -34.712 28.984 -2.393  1.00 45.25  ? 170 LEU A CG    1 
ATOM   1296 C  CD1   . LEU A 1  173 ? -36.045 28.438 -2.867  1.00 43.46  ? 170 LEU A CD1   1 
ATOM   1297 C  CD2   . LEU A 1  173 ? -34.756 30.515 -2.311  1.00 43.21  ? 170 LEU A CD2   1 
ATOM   1298 N  N     . ASN A 1  174 ? -32.177 27.708 1.411   1.00 46.98  ? 171 ASN A N     1 
ATOM   1299 C  CA    . ASN A 1  174 ? -31.848 27.462 2.798   1.00 46.99  ? 171 ASN A CA    1 
ATOM   1300 C  C     . ASN A 1  174 ? -31.082 28.620 3.401   1.00 47.30  ? 171 ASN A C     1 
ATOM   1301 O  O     . ASN A 1  174 ? -31.296 28.946 4.570   1.00 47.73  ? 171 ASN A O     1 
ATOM   1302 C  CB    . ASN A 1  174 ? -31.066 26.162 2.967   1.00 47.04  ? 171 ASN A CB    1 
ATOM   1303 C  CG    . ASN A 1  174 ? -31.957 24.936 2.909   1.00 47.07  ? 171 ASN A CG    1 
ATOM   1304 O  OD1   . ASN A 1  174 ? -33.185 25.047 2.974   1.00 48.64  ? 171 ASN A OD1   1 
ATOM   1305 N  ND2   . ASN A 1  174 ? -31.348 23.761 2.763   1.00 46.02  ? 171 ASN A ND2   1 
ATOM   1306 N  N     . VAL A 1  175 ? -30.206 29.256 2.621   1.00 46.98  ? 172 VAL A N     1 
ATOM   1307 C  CA    . VAL A 1  175 ? -29.489 30.422 3.138   1.00 46.92  ? 172 VAL A CA    1 
ATOM   1308 C  C     . VAL A 1  175 ? -30.461 31.576 3.288   1.00 47.17  ? 172 VAL A C     1 
ATOM   1309 O  O     . VAL A 1  175 ? -30.457 32.273 4.298   1.00 47.79  ? 172 VAL A O     1 
ATOM   1310 C  CB    . VAL A 1  175 ? -28.240 30.825 2.281   1.00 46.94  ? 172 VAL A CB    1 
ATOM   1311 C  CG1   . VAL A 1  175 ? -27.784 32.245 2.601   1.00 46.55  ? 172 VAL A CG1   1 
ATOM   1312 C  CG2   . VAL A 1  175 ? -27.089 29.873 2.529   1.00 46.20  ? 172 VAL A CG2   1 
ATOM   1313 N  N     . LEU A 1  176 ? -31.307 31.767 2.288   1.00 47.28  ? 173 LEU A N     1 
ATOM   1314 C  CA    . LEU A 1  176 ? -32.198 32.908 2.283   1.00 47.49  ? 173 LEU A CA    1 
ATOM   1315 C  C     . LEU A 1  176 ? -33.210 32.789 3.397   1.00 47.88  ? 173 LEU A C     1 
ATOM   1316 O  O     . LEU A 1  176 ? -33.387 33.748 4.149   1.00 47.60  ? 173 LEU A O     1 
ATOM   1317 C  CB    . LEU A 1  176 ? -32.904 33.037 0.930   1.00 47.57  ? 173 LEU A CB    1 
ATOM   1318 C  CG    . LEU A 1  176 ? -34.052 34.007 0.602   1.00 47.53  ? 173 LEU A CG    1 
ATOM   1319 C  CD1   . LEU A 1  176 ? -34.039 35.294 1.373   1.00 46.49  ? 173 LEU A CD1   1 
ATOM   1320 C  CD2   . LEU A 1  176 ? -33.991 34.294 -0.888  1.00 47.53  ? 173 LEU A CD2   1 
ATOM   1321 N  N     . THR A 1  177 ? -33.848 31.612 3.503   1.00 47.92  ? 174 THR A N     1 
ATOM   1322 C  CA    . THR A 1  177 ? -34.979 31.418 4.402   1.00 47.84  ? 174 THR A CA    1 
ATOM   1323 C  C     . THR A 1  177 ? -34.567 31.447 5.855   1.00 47.72  ? 174 THR A C     1 
ATOM   1324 O  O     . THR A 1  177 ? -35.428 31.563 6.720   1.00 48.45  ? 174 THR A O     1 
ATOM   1325 C  CB    . THR A 1  177 ? -35.749 30.129 4.132   1.00 47.96  ? 174 THR A CB    1 
ATOM   1326 O  OG1   . THR A 1  177 ? -34.838 29.029 4.081   1.00 50.22  ? 174 THR A OG1   1 
ATOM   1327 C  CG2   . THR A 1  177 ? -36.490 30.214 2.834   1.00 48.57  ? 174 THR A CG2   1 
ATOM   1328 N  N     . SER A 1  178 ? -33.265 31.357 6.122   1.00 47.14  ? 175 SER A N     1 
ATOM   1329 C  CA    . SER A 1  178 ? -32.693 31.761 7.415   1.00 46.75  ? 175 SER A CA    1 
ATOM   1330 C  C     . SER A 1  178 ? -33.200 33.094 7.935   1.00 46.59  ? 175 SER A C     1 
ATOM   1331 O  O     . SER A 1  178 ? -33.289 33.255 9.144   1.00 47.51  ? 175 SER A O     1 
ATOM   1332 C  CB    . SER A 1  178 ? -31.173 31.877 7.349   1.00 46.66  ? 175 SER A CB    1 
ATOM   1333 O  OG    . SER A 1  178 ? -30.575 30.630 7.075   1.00 47.74  ? 175 SER A OG    1 
ATOM   1334 N  N     . ILE A 1  179 ? -33.482 34.054 7.051   1.00 45.84  ? 176 ILE A N     1 
ATOM   1335 C  CA    . ILE A 1  179 ? -33.949 35.377 7.470   1.00 45.81  ? 176 ILE A CA    1 
ATOM   1336 C  C     . ILE A 1  179 ? -35.442 35.317 7.779   1.00 45.28  ? 176 ILE A C     1 
ATOM   1337 O  O     . ILE A 1  179 ? -35.904 35.866 8.785   1.00 45.21  ? 176 ILE A O     1 
ATOM   1338 C  CB    . ILE A 1  179 ? -33.674 36.503 6.403   1.00 46.17  ? 176 ILE A CB    1 
ATOM   1339 C  CG1   . ILE A 1  179 ? -32.227 36.462 5.865   1.00 49.99  ? 176 ILE A CG1   1 
ATOM   1340 C  CG2   . ILE A 1  179 ? -33.956 37.897 6.947   1.00 45.26  ? 176 ILE A CG2   1 
ATOM   1341 C  CD1   . ILE A 1  179 ? -31.072 36.624 6.899   1.00 53.57  ? 176 ILE A CD1   1 
ATOM   1342 N  N     . ALA A 1  180 ? -36.191 34.645 6.909   1.00 44.47  ? 177 ALA A N     1 
ATOM   1343 C  CA    . ALA A 1  180 ? -37.647 34.607 6.991   1.00 43.66  ? 177 ALA A CA    1 
ATOM   1344 C  C     . ALA A 1  180 ? -38.148 33.598 5.995   1.00 43.52  ? 177 ALA A C     1 
ATOM   1345 O  O     . ALA A 1  180 ? -37.510 33.346 4.982   1.00 43.92  ? 177 ALA A O     1 
ATOM   1346 C  CB    . ALA A 1  180 ? -38.253 35.978 6.718   1.00 42.38  ? 177 ALA A CB    1 
ATOM   1347 N  N     . ILE A 1  181 ? -39.295 33.017 6.295   1.00 43.57  ? 178 ILE A N     1 
ATOM   1348 C  CA    . ILE A 1  181 ? -39.942 32.068 5.410   1.00 43.29  ? 178 ILE A CA    1 
ATOM   1349 C  C     . ILE A 1  181 ? -41.122 32.762 4.737   1.00 43.21  ? 178 ILE A C     1 
ATOM   1350 O  O     . ILE A 1  181 ? -41.927 33.393 5.424   1.00 43.45  ? 178 ILE A O     1 
ATOM   1351 C  CB    . ILE A 1  181 ? -40.445 30.870 6.226   1.00 43.48  ? 178 ILE A CB    1 
ATOM   1352 C  CG1   . ILE A 1  181 ? -39.252 30.023 6.693   1.00 44.15  ? 178 ILE A CG1   1 
ATOM   1353 C  CG2   . ILE A 1  181 ? -41.500 30.069 5.462   1.00 42.06  ? 178 ILE A CG2   1 
ATOM   1354 C  CD1   . ILE A 1  181 ? -39.164 28.657 6.047   1.00 46.53  ? 178 ILE A CD1   1 
ATOM   1355 N  N     . PRO A 1  182 ? -41.228 32.657 3.395   1.00 42.68  ? 179 PRO A N     1 
ATOM   1356 C  CA    . PRO A 1  182 ? -42.331 33.260 2.649   1.00 42.38  ? 179 PRO A CA    1 
ATOM   1357 C  C     . PRO A 1  182 ? -43.557 32.351 2.665   1.00 42.69  ? 179 PRO A C     1 
ATOM   1358 O  O     . PRO A 1  182 ? -43.393 31.131 2.804   1.00 43.36  ? 179 PRO A O     1 
ATOM   1359 C  CB    . PRO A 1  182 ? -41.768 33.291 1.236   1.00 42.53  ? 179 PRO A CB    1 
ATOM   1360 C  CG    . PRO A 1  182 ? -41.005 32.004 1.155   1.00 41.75  ? 179 PRO A CG    1 
ATOM   1361 C  CD    . PRO A 1  182 ? -40.290 31.956 2.497   1.00 42.25  ? 179 PRO A CD    1 
ATOM   1362 N  N     . LYS A 1  183 ? -44.763 32.899 2.502   1.00 42.45  ? 180 LYS A N     1 
ATOM   1363 C  CA    . LYS A 1  183 ? -45.962 32.042 2.367   1.00 42.86  ? 180 LYS A CA    1 
ATOM   1364 C  C     . LYS A 1  183 ? -45.956 31.269 1.041   1.00 43.42  ? 180 LYS A C     1 
ATOM   1365 O  O     . LYS A 1  183 ? -46.207 30.049 1.000   1.00 43.93  ? 180 LYS A O     1 
ATOM   1366 C  CB    . LYS A 1  183 ? -47.266 32.849 2.428   1.00 42.46  ? 180 LYS A CB    1 
ATOM   1367 C  CG    . LYS A 1  183 ? -47.609 33.485 3.743   1.00 42.84  ? 180 LYS A CG    1 
ATOM   1368 C  CD    . LYS A 1  183 ? -48.889 34.308 3.580   1.00 45.18  ? 180 LYS A CD    1 
ATOM   1369 C  CE    . LYS A 1  183 ? -49.370 34.931 4.885   1.00 45.70  ? 180 LYS A CE    1 
ATOM   1370 N  NZ    . LYS A 1  183 ? -48.518 36.044 5.355   1.00 46.42  ? 180 LYS A NZ    1 
ATOM   1371 N  N     . VAL A 1  184 ? -45.689 32.001 -0.042  1.00 43.43  ? 181 VAL A N     1 
ATOM   1372 C  CA    . VAL A 1  184 ? -45.743 31.460 -1.394  1.00 43.12  ? 181 VAL A CA    1 
ATOM   1373 C  C     . VAL A 1  184 ? -44.431 31.752 -2.144  1.00 42.96  ? 181 VAL A C     1 
ATOM   1374 O  O     . VAL A 1  184 ? -43.850 32.853 -2.035  1.00 43.37  ? 181 VAL A O     1 
ATOM   1375 C  CB    . VAL A 1  184 ? -46.923 32.086 -2.189  1.00 43.36  ? 181 VAL A CB    1 
ATOM   1376 C  CG1   . VAL A 1  184 ? -47.001 31.508 -3.611  1.00 43.27  ? 181 VAL A CG1   1 
ATOM   1377 C  CG2   . VAL A 1  184 ? -48.254 31.910 -1.450  1.00 42.53  ? 181 VAL A CG2   1 
ATOM   1378 N  N     . ILE A 1  185 ? -43.965 30.759 -2.890  1.00 41.81  ? 182 ILE A N     1 
ATOM   1379 C  CA    . ILE A 1  185 ? -42.939 30.967 -3.879  1.00 41.19  ? 182 ILE A CA    1 
ATOM   1380 C  C     . ILE A 1  185 ? -43.543 30.763 -5.274  1.00 41.80  ? 182 ILE A C     1 
ATOM   1381 O  O     . ILE A 1  185 ? -44.132 29.702 -5.570  1.00 42.44  ? 182 ILE A O     1 
ATOM   1382 C  CB    . ILE A 1  185 ? -41.778 30.025 -3.665  1.00 40.85  ? 182 ILE A CB    1 
ATOM   1383 C  CG1   . ILE A 1  185 ? -40.961 30.499 -2.467  1.00 40.00  ? 182 ILE A CG1   1 
ATOM   1384 C  CG2   . ILE A 1  185 ? -40.899 29.987 -4.906  1.00 41.24  ? 182 ILE A CG2   1 
ATOM   1385 C  CD1   . ILE A 1  185 ? -39.818 29.616 -2.099  1.00 36.91  ? 182 ILE A CD1   1 
ATOM   1386 N  N     . HIS A 1  186 ? -43.419 31.784 -6.125  1.00 41.57  ? 183 HIS A N     1 
ATOM   1387 C  CA    . HIS A 1  186 ? -43.868 31.694 -7.511  1.00 41.34  ? 183 HIS A CA    1 
ATOM   1388 C  C     . HIS A 1  186 ? -42.691 31.490 -8.465  1.00 41.26  ? 183 HIS A C     1 
ATOM   1389 O  O     . HIS A 1  186 ? -41.687 32.195 -8.378  1.00 41.43  ? 183 HIS A O     1 
ATOM   1390 C  CB    . HIS A 1  186 ? -44.633 32.945 -7.908  1.00 41.30  ? 183 HIS A CB    1 
ATOM   1391 C  CG    . HIS A 1  186 ? -45.224 32.866 -9.277  1.00 42.56  ? 183 HIS A CG    1 
ATOM   1392 N  ND1   . HIS A 1  186 ? -46.582 32.898 -9.504  1.00 43.95  ? 183 HIS A ND1   1 
ATOM   1393 C  CD2   . HIS A 1  186 ? -44.642 32.718 -10.491 1.00 42.40  ? 183 HIS A CD2   1 
ATOM   1394 C  CE1   . HIS A 1  186 ? -46.812 32.794 -10.801 1.00 43.91  ? 183 HIS A CE1   1 
ATOM   1395 N  NE2   . HIS A 1  186 ? -45.651 32.676 -11.420 1.00 44.45  ? 183 HIS A NE2   1 
ATOM   1396 N  N     . SER A 1  187 ? -42.831 30.541 -9.384  1.00 40.86  ? 184 SER A N     1 
ATOM   1397 C  CA    . SER A 1  187 ? -41.812 30.279 -10.380 1.00 41.16  ? 184 SER A CA    1 
ATOM   1398 C  C     . SER A 1  187 ? -42.423 29.773 -11.673 1.00 41.65  ? 184 SER A C     1 
ATOM   1399 O  O     . SER A 1  187 ? -43.563 29.333 -11.692 1.00 41.58  ? 184 SER A O     1 
ATOM   1400 C  CB    . SER A 1  187 ? -40.815 29.256 -9.866  1.00 41.17  ? 184 SER A CB    1 
ATOM   1401 O  OG    . SER A 1  187 ? -41.276 27.939 -10.090 1.00 41.51  ? 184 SER A OG    1 
ATOM   1402 N  N     . ASP A 1  188 ? -41.666 29.857 -12.766 1.00 42.03  ? 185 ASP A N     1 
ATOM   1403 C  CA    . ASP A 1  188 ? -42.091 29.252 -14.027 1.00 41.86  ? 185 ASP A CA    1 
ATOM   1404 C  C     . ASP A 1  188 ? -41.909 27.742 -13.863 1.00 42.11  ? 185 ASP A C     1 
ATOM   1405 O  O     . ASP A 1  188 ? -41.568 27.283 -12.768 1.00 41.99  ? 185 ASP A O     1 
ATOM   1406 C  CB    . ASP A 1  188 ? -41.298 29.816 -15.228 1.00 41.70  ? 185 ASP A CB    1 
ATOM   1407 C  CG    . ASP A 1  188 ? -39.770 29.588 -15.118 1.00 41.42  ? 185 ASP A CG    1 
ATOM   1408 O  OD1   . ASP A 1  188 ? -38.983 30.462 -15.577 1.00 41.00  ? 185 ASP A OD1   1 
ATOM   1409 O  OD2   . ASP A 1  188 ? -39.345 28.543 -14.587 1.00 41.09  ? 185 ASP A OD2   1 
ATOM   1410 N  N     . GLN A 1  189 ? -42.110 26.977 -14.932 1.00 42.23  ? 186 GLN A N     1 
ATOM   1411 C  CA    . GLN A 1  189 ? -42.043 25.525 -14.840 1.00 42.75  ? 186 GLN A CA    1 
ATOM   1412 C  C     . GLN A 1  189 ? -40.699 24.946 -15.247 1.00 43.18  ? 186 GLN A C     1 
ATOM   1413 O  O     . GLN A 1  189 ? -40.629 23.866 -15.818 1.00 42.81  ? 186 GLN A O     1 
ATOM   1414 C  CB    . GLN A 1  189 ? -43.184 24.881 -15.626 1.00 42.83  ? 186 GLN A CB    1 
ATOM   1415 C  CG    . GLN A 1  189 ? -44.571 25.330 -15.145 1.00 43.92  ? 186 GLN A CG    1 
ATOM   1416 C  CD    . GLN A 1  189 ? -45.701 24.557 -15.790 1.00 45.98  ? 186 GLN A CD    1 
ATOM   1417 O  OE1   . GLN A 1  189 ? -45.526 23.421 -16.234 1.00 49.02  ? 186 GLN A OE1   1 
ATOM   1418 N  NE2   . GLN A 1  189 ? -46.870 25.169 -15.851 1.00 46.96  ? 186 GLN A NE2   1 
ATOM   1419 N  N     . GLY A 1  190 ? -39.618 25.645 -14.933 1.00 44.29  ? 187 GLY A N     1 
ATOM   1420 C  CA    . GLY A 1  190 ? -38.284 25.093 -15.189 1.00 45.76  ? 187 GLY A CA    1 
ATOM   1421 C  C     . GLY A 1  190 ? -38.089 23.808 -14.401 1.00 46.73  ? 187 GLY A C     1 
ATOM   1422 O  O     . GLY A 1  190 ? -38.711 23.622 -13.355 1.00 47.16  ? 187 GLY A O     1 
ATOM   1423 N  N     . ALA A 1  191 ? -37.214 22.927 -14.878 1.00 47.78  ? 188 ALA A N     1 
ATOM   1424 C  CA    . ALA A 1  191 ? -36.954 21.655 -14.188 1.00 48.41  ? 188 ALA A CA    1 
ATOM   1425 C  C     . ALA A 1  191 ? -36.576 21.817 -12.705 1.00 48.96  ? 188 ALA A C     1 
ATOM   1426 O  O     . ALA A 1  191 ? -37.053 21.050 -11.868 1.00 49.59  ? 188 ALA A O     1 
ATOM   1427 C  CB    . ALA A 1  191 ? -35.905 20.816 -14.938 1.00 48.20  ? 188 ALA A CB    1 
ATOM   1428 N  N     . ALA A 1  192 ? -35.763 22.825 -12.373 1.00 49.39  ? 189 ALA A N     1 
ATOM   1429 C  CA    . ALA A 1  192 ? -35.338 23.055 -10.972 1.00 49.55  ? 189 ALA A CA    1 
ATOM   1430 C  C     . ALA A 1  192 ? -36.499 23.165 -9.977  1.00 49.94  ? 189 ALA A C     1 
ATOM   1431 O  O     . ALA A 1  192 ? -36.379 22.673 -8.855  1.00 50.03  ? 189 ALA A O     1 
ATOM   1432 C  CB    . ALA A 1  192 ? -34.459 24.268 -10.865 1.00 48.94  ? 189 ALA A CB    1 
ATOM   1433 N  N     . PHE A 1  193 ? -37.611 23.777 -10.399 1.00 49.87  ? 190 PHE A N     1 
ATOM   1434 C  CA    . PHE A 1  193 ? -38.722 24.123 -9.507  1.00 49.62  ? 190 PHE A CA    1 
ATOM   1435 C  C     . PHE A 1  193 ? -39.901 23.140 -9.553  1.00 50.72  ? 190 PHE A C     1 
ATOM   1436 O  O     . PHE A 1  193 ? -40.807 23.194 -8.695  1.00 50.92  ? 190 PHE A O     1 
ATOM   1437 C  CB    . PHE A 1  193 ? -39.249 25.525 -9.837  1.00 49.22  ? 190 PHE A CB    1 
ATOM   1438 C  CG    . PHE A 1  193 ? -38.175 26.545 -10.092 1.00 47.49  ? 190 PHE A CG    1 
ATOM   1439 C  CD1   . PHE A 1  193 ? -37.132 26.732 -9.193  1.00 47.68  ? 190 PHE A CD1   1 
ATOM   1440 C  CD2   . PHE A 1  193 ? -38.212 27.330 -11.216 1.00 46.32  ? 190 PHE A CD2   1 
ATOM   1441 C  CE1   . PHE A 1  193 ? -36.138 27.677 -9.422  1.00 46.41  ? 190 PHE A CE1   1 
ATOM   1442 C  CE2   . PHE A 1  193 ? -37.212 28.285 -11.452 1.00 46.38  ? 190 PHE A CE2   1 
ATOM   1443 C  CZ    . PHE A 1  193 ? -36.180 28.452 -10.552 1.00 45.32  ? 190 PHE A CZ    1 
ATOM   1444 N  N     . THR A 1  194 ? -39.920 22.258 -10.555 1.00 51.11  ? 191 THR A N     1 
ATOM   1445 C  CA    . THR A 1  194 ? -41.076 21.357 -10.730 1.00 51.09  ? 191 THR A CA    1 
ATOM   1446 C  C     . THR A 1  194 ? -40.771 19.962 -10.217 1.00 51.49  ? 191 THR A C     1 
ATOM   1447 O  O     . THR A 1  194 ? -41.661 19.118 -10.169 1.00 51.64  ? 191 THR A O     1 
ATOM   1448 C  CB    . THR A 1  194 ? -41.539 21.233 -12.215 1.00 51.02  ? 191 THR A CB    1 
ATOM   1449 O  OG1   . THR A 1  194 ? -40.410 20.941 -13.054 1.00 49.89  ? 191 THR A OG1   1 
ATOM   1450 C  CG2   . THR A 1  194 ? -42.237 22.491 -12.681 1.00 49.40  ? 191 THR A CG2   1 
ATOM   1451 N  N     . SER A 1  195 ? -39.512 19.720 -9.865  1.00 51.80  ? 192 SER A N     1 
ATOM   1452 C  CA    . SER A 1  195 ? -39.093 18.421 -9.360  1.00 52.81  ? 192 SER A CA    1 
ATOM   1453 C  C     . SER A 1  195 ? -39.780 18.162 -8.035  1.00 53.52  ? 192 SER A C     1 
ATOM   1454 O  O     . SER A 1  195 ? -40.110 19.105 -7.292  1.00 53.68  ? 192 SER A O     1 
ATOM   1455 C  CB    . SER A 1  195 ? -37.568 18.346 -9.177  1.00 52.82  ? 192 SER A CB    1 
ATOM   1456 O  OG    . SER A 1  195 ? -37.130 19.107 -8.054  1.00 53.05  ? 192 SER A OG    1 
ATOM   1457 N  N     . SER A 1  196 ? -39.993 16.885 -7.735  1.00 53.97  ? 193 SER A N     1 
ATOM   1458 C  CA    . SER A 1  196 ? -40.648 16.518 -6.487  1.00 54.12  ? 193 SER A CA    1 
ATOM   1459 C  C     . SER A 1  196 ? -39.722 16.781 -5.301  1.00 53.88  ? 193 SER A C     1 
ATOM   1460 O  O     . SER A 1  196 ? -40.212 17.098 -4.212  1.00 53.80  ? 193 SER A O     1 
ATOM   1461 C  CB    . SER A 1  196 ? -41.142 15.077 -6.522  1.00 53.94  ? 193 SER A CB    1 
ATOM   1462 O  OG    . SER A 1  196 ? -40.138 14.238 -7.055  1.00 55.51  ? 193 SER A OG    1 
ATOM   1463 N  N     . THR A 1  197 ? -38.399 16.706 -5.519  1.00 53.39  ? 194 THR A N     1 
ATOM   1464 C  CA    . THR A 1  197 ? -37.444 17.077 -4.460  1.00 53.20  ? 194 THR A CA    1 
ATOM   1465 C  C     . THR A 1  197 ? -37.684 18.504 -3.973  1.00 53.15  ? 194 THR A C     1 
ATOM   1466 O  O     . THR A 1  197 ? -37.516 18.807 -2.786  1.00 53.19  ? 194 THR A O     1 
ATOM   1467 C  CB    . THR A 1  197 ? -35.981 16.953 -4.900  1.00 53.01  ? 194 THR A CB    1 
ATOM   1468 O  OG1   . THR A 1  197 ? -35.669 15.583 -5.120  1.00 54.73  ? 194 THR A OG1   1 
ATOM   1469 C  CG2   . THR A 1  197 ? -35.051 17.435 -3.819  1.00 52.16  ? 194 THR A CG2   1 
ATOM   1470 N  N     . PHE A 1  198 ? -38.077 19.376 -4.894  1.00 52.95  ? 195 PHE A N     1 
ATOM   1471 C  CA    . PHE A 1  198 ? -38.288 20.764 -4.550  1.00 52.51  ? 195 PHE A CA    1 
ATOM   1472 C  C     . PHE A 1  198 ? -39.626 20.932 -3.858  1.00 53.15  ? 195 PHE A C     1 
ATOM   1473 O  O     . PHE A 1  198 ? -39.755 21.714 -2.926  1.00 53.16  ? 195 PHE A O     1 
ATOM   1474 C  CB    . PHE A 1  198 ? -38.172 21.657 -5.788  1.00 51.91  ? 195 PHE A CB    1 
ATOM   1475 C  CG    . PHE A 1  198 ? -38.178 23.121 -5.471  1.00 48.78  ? 195 PHE A CG    1 
ATOM   1476 C  CD1   . PHE A 1  198 ? -37.194 23.677 -4.661  1.00 46.68  ? 195 PHE A CD1   1 
ATOM   1477 C  CD2   . PHE A 1  198 ? -39.165 23.938 -5.963  1.00 45.73  ? 195 PHE A CD2   1 
ATOM   1478 C  CE1   . PHE A 1  198 ? -37.208 25.024 -4.354  1.00 44.29  ? 195 PHE A CE1   1 
ATOM   1479 C  CE2   . PHE A 1  198 ? -39.176 25.282 -5.664  1.00 44.72  ? 195 PHE A CE2   1 
ATOM   1480 C  CZ    . PHE A 1  198 ? -38.200 25.824 -4.863  1.00 43.93  ? 195 PHE A CZ    1 
ATOM   1481 N  N     . ALA A 1  199 ? -40.617 20.174 -4.309  1.00 54.53  ? 196 ALA A N     1 
ATOM   1482 C  CA    . ALA A 1  199 ? -41.933 20.138 -3.664  1.00 55.39  ? 196 ALA A CA    1 
ATOM   1483 C  C     . ALA A 1  199 ? -41.817 19.687 -2.203  1.00 56.35  ? 196 ALA A C     1 
ATOM   1484 O  O     . ALA A 1  199 ? -42.400 20.307 -1.312  1.00 56.40  ? 196 ALA A O     1 
ATOM   1485 C  CB    . ALA A 1  199 ? -42.864 19.234 -4.431  1.00 54.70  ? 196 ALA A CB    1 
ATOM   1486 N  N     . GLU A 1  200 ? -41.055 18.616 -1.971  1.00 57.48  ? 197 GLU A N     1 
ATOM   1487 C  CA    . GLU A 1  200 ? -40.817 18.118 -0.625  1.00 59.03  ? 197 GLU A CA    1 
ATOM   1488 C  C     . GLU A 1  200 ? -40.162 19.198 0.219   1.00 58.73  ? 197 GLU A C     1 
ATOM   1489 O  O     . GLU A 1  200 ? -40.614 19.457 1.338   1.00 59.25  ? 197 GLU A O     1 
ATOM   1490 C  CB    . GLU A 1  200 ? -39.931 16.874 -0.630  1.00 59.86  ? 197 GLU A CB    1 
ATOM   1491 C  CG    . GLU A 1  200 ? -40.674 15.523 -0.648  1.00 65.07  ? 197 GLU A CG    1 
ATOM   1492 C  CD    . GLU A 1  200 ? -39.769 14.362 -1.138  1.00 71.83  ? 197 GLU A CD    1 
ATOM   1493 O  OE1   . GLU A 1  200 ? -38.605 14.253 -0.650  1.00 73.69  ? 197 GLU A OE1   1 
ATOM   1494 O  OE2   . GLU A 1  200 ? -40.220 13.574 -2.022  1.00 73.42  ? 197 GLU A OE2   1 
ATOM   1495 N  N     . TRP A 1  201 ? -39.110 19.827 -0.317  1.00 57.99  ? 198 TRP A N     1 
ATOM   1496 C  CA    . TRP A 1  201 ? -38.407 20.896 0.389   1.00 57.13  ? 198 TRP A CA    1 
ATOM   1497 C  C     . TRP A 1  201 ? -39.383 22.004 0.819   1.00 57.28  ? 198 TRP A C     1 
ATOM   1498 O  O     . TRP A 1  201 ? -39.267 22.554 1.914   1.00 57.11  ? 198 TRP A O     1 
ATOM   1499 C  CB    . TRP A 1  201 ? -37.253 21.458 -0.459  1.00 56.85  ? 198 TRP A CB    1 
ATOM   1500 C  CG    . TRP A 1  201 ? -36.576 22.649 0.185   1.00 55.33  ? 198 TRP A CG    1 
ATOM   1501 C  CD1   . TRP A 1  201 ? -35.503 22.623 1.019   1.00 54.61  ? 198 TRP A CD1   1 
ATOM   1502 C  CD2   . TRP A 1  201 ? -36.958 24.030 0.064   1.00 52.45  ? 198 TRP A CD2   1 
ATOM   1503 N  NE1   . TRP A 1  201 ? -35.196 23.899 1.438   1.00 53.84  ? 198 TRP A NE1   1 
ATOM   1504 C  CE2   . TRP A 1  201 ? -36.077 24.779 0.868   1.00 52.47  ? 198 TRP A CE2   1 
ATOM   1505 C  CE3   . TRP A 1  201 ? -37.968 24.698 -0.633  1.00 52.26  ? 198 TRP A CE3   1 
ATOM   1506 C  CZ2   . TRP A 1  201 ? -36.163 26.170 0.986   1.00 52.63  ? 198 TRP A CZ2   1 
ATOM   1507 C  CZ3   . TRP A 1  201 ? -38.063 26.084 -0.514  1.00 52.96  ? 198 TRP A CZ3   1 
ATOM   1508 C  CH2   . TRP A 1  201 ? -37.163 26.806 0.296   1.00 52.31  ? 198 TRP A CH2   1 
ATOM   1509 N  N     . ALA A 1  202 ? -40.348 22.307 -0.040  1.00 57.38  ? 199 ALA A N     1 
ATOM   1510 C  CA    . ALA A 1  202 ? -41.290 23.388 0.208   1.00 57.90  ? 199 ALA A CA    1 
ATOM   1511 C  C     . ALA A 1  202 ? -42.334 23.026 1.254   1.00 58.24  ? 199 ALA A C     1 
ATOM   1512 O  O     . ALA A 1  202 ? -42.663 23.846 2.119   1.00 58.52  ? 199 ALA A O     1 
ATOM   1513 C  CB    . ALA A 1  202 ? -41.976 23.779 -1.082  1.00 57.91  ? 199 ALA A CB    1 
ATOM   1514 N  N     . LYS A 1  203 ? -42.859 21.803 1.149   1.00 58.44  ? 200 LYS A N     1 
ATOM   1515 C  CA    . LYS A 1  203 ? -43.901 21.292 2.036   1.00 58.48  ? 200 LYS A CA    1 
ATOM   1516 C  C     . LYS A 1  203 ? -43.374 21.223 3.461   1.00 57.83  ? 200 LYS A C     1 
ATOM   1517 O  O     . LYS A 1  203 ? -44.065 21.609 4.405   1.00 57.63  ? 200 LYS A O     1 
ATOM   1518 C  CB    . LYS A 1  203 ? -44.356 19.903 1.581   1.00 58.91  ? 200 LYS A CB    1 
ATOM   1519 C  CG    . LYS A 1  203 ? -45.816 19.634 1.875   1.00 61.40  ? 200 LYS A CG    1 
ATOM   1520 C  CD    . LYS A 1  203 ? -46.150 18.144 1.856   1.00 66.33  ? 200 LYS A CD    1 
ATOM   1521 C  CE    . LYS A 1  203 ? -47.643 17.932 2.181   1.00 68.77  ? 200 LYS A CE    1 
ATOM   1522 N  NZ    . LYS A 1  203 ? -48.144 16.582 1.757   1.00 70.24  ? 200 LYS A NZ    1 
ATOM   1523 N  N     . GLU A 1  204 ? -42.134 20.751 3.587   1.00 56.96  ? 201 GLU A N     1 
ATOM   1524 C  CA    . GLU A 1  204 ? -41.421 20.711 4.847   1.00 56.82  ? 201 GLU A CA    1 
ATOM   1525 C  C     . GLU A 1  204 ? -41.397 22.036 5.574   1.00 56.17  ? 201 GLU A C     1 
ATOM   1526 O  O     . GLU A 1  204 ? -41.124 22.050 6.765   1.00 56.71  ? 201 GLU A O     1 
ATOM   1527 C  CB    . GLU A 1  204 ? -39.977 20.273 4.639   1.00 56.80  ? 201 GLU A CB    1 
ATOM   1528 C  CG    . GLU A 1  204 ? -39.793 18.787 4.573   1.00 60.91  ? 201 GLU A CG    1 
ATOM   1529 C  CD    . GLU A 1  204 ? -38.351 18.363 4.247   1.00 65.55  ? 201 GLU A CD    1 
ATOM   1530 O  OE1   . GLU A 1  204 ? -37.440 19.237 4.223   1.00 66.87  ? 201 GLU A OE1   1 
ATOM   1531 O  OE2   . GLU A 1  204 ? -38.140 17.143 4.012   1.00 65.77  ? 201 GLU A OE2   1 
ATOM   1532 N  N     . ARG A 1  205 ? -41.651 23.146 4.880   1.00 55.02  ? 202 ARG A N     1 
ATOM   1533 C  CA    . ARG A 1  205 ? -41.498 24.465 5.496   1.00 53.83  ? 202 ARG A CA    1 
ATOM   1534 C  C     . ARG A 1  205 ? -42.770 25.265 5.465   1.00 53.50  ? 202 ARG A C     1 
ATOM   1535 O  O     . ARG A 1  205 ? -42.779 26.438 5.857   1.00 53.40  ? 202 ARG A O     1 
ATOM   1536 C  CB    . ARG A 1  205 ? -40.392 25.250 4.814   1.00 53.58  ? 202 ARG A CB    1 
ATOM   1537 C  CG    . ARG A 1  205 ? -39.049 24.672 5.058   1.00 52.39  ? 202 ARG A CG    1 
ATOM   1538 C  CD    . ARG A 1  205 ? -38.040 25.070 4.003   1.00 49.35  ? 202 ARG A CD    1 
ATOM   1539 N  NE    . ARG A 1  205 ? -36.713 24.598 4.399   1.00 48.61  ? 202 ARG A NE    1 
ATOM   1540 C  CZ    . ARG A 1  205 ? -36.337 23.325 4.342   1.00 47.33  ? 202 ARG A CZ    1 
ATOM   1541 N  NH1   . ARG A 1  205 ? -37.178 22.401 3.883   1.00 48.70  ? 202 ARG A NH1   1 
ATOM   1542 N  NH2   . ARG A 1  205 ? -35.129 22.974 4.729   1.00 45.30  ? 202 ARG A NH2   1 
ATOM   1543 N  N     . GLY A 1  206 ? -43.842 24.632 5.002   1.00 53.00  ? 203 GLY A N     1 
ATOM   1544 C  CA    . GLY A 1  206 ? -45.146 25.281 4.940   1.00 52.99  ? 203 GLY A CA    1 
ATOM   1545 C  C     . GLY A 1  206 ? -45.269 26.308 3.833   1.00 53.13  ? 203 GLY A C     1 
ATOM   1546 O  O     . GLY A 1  206 ? -46.207 27.096 3.834   1.00 53.43  ? 203 GLY A O     1 
ATOM   1547 N  N     . ILE A 1  207 ? -44.326 26.295 2.887   1.00 52.96  ? 204 ILE A N     1 
ATOM   1548 C  CA    . ILE A 1  207 ? -44.330 27.201 1.730   1.00 52.51  ? 204 ILE A CA    1 
ATOM   1549 C  C     . ILE A 1  207 ? -45.161 26.575 0.595   1.00 52.47  ? 204 ILE A C     1 
ATOM   1550 O  O     . ILE A 1  207 ? -44.935 25.421 0.207   1.00 52.70  ? 204 ILE A O     1 
ATOM   1551 C  CB    . ILE A 1  207 ? -42.872 27.479 1.201   1.00 52.68  ? 204 ILE A CB    1 
ATOM   1552 C  CG1   . ILE A 1  207 ? -41.973 28.082 2.287   1.00 51.75  ? 204 ILE A CG1   1 
ATOM   1553 C  CG2   . ILE A 1  207 ? -42.884 28.369 -0.057  1.00 52.11  ? 204 ILE A CG2   1 
ATOM   1554 C  CD1   . ILE A 1  207 ? -40.487 27.750 2.109   1.00 49.34  ? 204 ILE A CD1   1 
ATOM   1555 N  N     . HIS A 1  208 ? -46.116 27.339 0.073   1.00 51.93  ? 205 HIS A N     1 
ATOM   1556 C  CA    . HIS A 1  208 ? -46.914 26.916 -1.069  1.00 51.72  ? 205 HIS A CA    1 
ATOM   1557 C  C     . HIS A 1  208 ? -46.227 27.310 -2.412  1.00 51.03  ? 205 HIS A C     1 
ATOM   1558 O  O     . HIS A 1  208 ? -45.878 28.479 -2.624  1.00 51.51  ? 205 HIS A O     1 
ATOM   1559 C  CB    . HIS A 1  208 ? -48.322 27.525 -0.971  1.00 51.88  ? 205 HIS A CB    1 
ATOM   1560 C  CG    . HIS A 1  208 ? -49.177 27.263 -2.174  1.00 54.67  ? 205 HIS A CG    1 
ATOM   1561 N  ND1   . HIS A 1  208 ? -49.480 25.989 -2.610  1.00 56.65  ? 205 HIS A ND1   1 
ATOM   1562 C  CD2   . HIS A 1  208 ? -49.782 28.109 -3.041  1.00 57.08  ? 205 HIS A CD2   1 
ATOM   1563 C  CE1   . HIS A 1  208 ? -50.238 26.062 -3.690  1.00 57.52  ? 205 HIS A CE1   1 
ATOM   1564 N  NE2   . HIS A 1  208 ? -50.434 27.337 -3.974  1.00 58.80  ? 205 HIS A NE2   1 
ATOM   1565 N  N     . LEU A 1  209 ? -46.026 26.336 -3.301  1.00 49.55  ? 206 LEU A N     1 
ATOM   1566 C  CA    . LEU A 1  209 ? -45.490 26.596 -4.633  1.00 47.93  ? 206 LEU A CA    1 
ATOM   1567 C  C     . LEU A 1  209 ? -46.626 26.983 -5.568  1.00 47.98  ? 206 LEU A C     1 
ATOM   1568 O  O     . LEU A 1  209 ? -47.699 26.383 -5.554  1.00 48.36  ? 206 LEU A O     1 
ATOM   1569 C  CB    . LEU A 1  209 ? -44.755 25.382 -5.195  1.00 47.05  ? 206 LEU A CB    1 
ATOM   1570 C  CG    . LEU A 1  209 ? -43.580 24.816 -4.406  1.00 44.78  ? 206 LEU A CG    1 
ATOM   1571 C  CD1   . LEU A 1  209 ? -42.938 23.671 -5.158  1.00 42.04  ? 206 LEU A CD1   1 
ATOM   1572 C  CD2   . LEU A 1  209 ? -42.545 25.871 -4.075  1.00 43.62  ? 206 LEU A CD2   1 
ATOM   1573 N  N     . GLU A 1  210 ? -46.391 28.017 -6.362  1.00 47.55  ? 207 GLU A N     1 
ATOM   1574 C  CA    . GLU A 1  210 ? -47.374 28.496 -7.319  1.00 47.17  ? 207 GLU A CA    1 
ATOM   1575 C  C     . GLU A 1  210 ? -46.587 28.665 -8.605  1.00 46.68  ? 207 GLU A C     1 
ATOM   1576 O  O     . GLU A 1  210 ? -45.538 29.317 -8.600  1.00 47.36  ? 207 GLU A O     1 
ATOM   1577 C  CB    . GLU A 1  210 ? -47.947 29.817 -6.826  1.00 46.87  ? 207 GLU A CB    1 
ATOM   1578 C  CG    . GLU A 1  210 ? -48.752 30.588 -7.803  1.00 48.15  ? 207 GLU A CG    1 
ATOM   1579 C  CD    . GLU A 1  210 ? -49.172 31.923 -7.226  1.00 51.38  ? 207 GLU A CD    1 
ATOM   1580 O  OE1   . GLU A 1  210 ? -50.327 32.031 -6.764  1.00 53.68  ? 207 GLU A OE1   1 
ATOM   1581 O  OE2   . GLU A 1  210 ? -48.350 32.866 -7.206  1.00 52.61  ? 207 GLU A OE2   1 
ATOM   1582 N  N     . PHE A 1  211 ? -47.063 28.035 -9.679  1.00 45.65  ? 208 PHE A N     1 
ATOM   1583 C  CA    . PHE A 1  211 ? -46.342 27.997 -10.968 1.00 44.24  ? 208 PHE A CA    1 
ATOM   1584 C  C     . PHE A 1  211 ? -47.011 28.812 -12.029 1.00 43.55  ? 208 PHE A C     1 
ATOM   1585 O  O     . PHE A 1  211 ? -48.238 28.845 -12.119 1.00 43.03  ? 208 PHE A O     1 
ATOM   1586 C  CB    . PHE A 1  211 ? -46.195 26.580 -11.480 1.00 43.29  ? 208 PHE A CB    1 
ATOM   1587 C  CG    . PHE A 1  211 ? -45.437 25.702 -10.558 1.00 43.17  ? 208 PHE A CG    1 
ATOM   1588 C  CD1   . PHE A 1  211 ? -44.035 25.672 -10.604 1.00 42.43  ? 208 PHE A CD1   1 
ATOM   1589 C  CD2   . PHE A 1  211 ? -46.110 24.901 -9.628  1.00 40.08  ? 208 PHE A CD2   1 
ATOM   1590 C  CE1   . PHE A 1  211 ? -43.305 24.836 -9.737  1.00 42.47  ? 208 PHE A CE1   1 
ATOM   1591 C  CE2   . PHE A 1  211 ? -45.396 24.070 -8.755  1.00 40.21  ? 208 PHE A CE2   1 
ATOM   1592 C  CZ    . PHE A 1  211 ? -43.986 24.034 -8.804  1.00 41.07  ? 208 PHE A CZ    1 
ATOM   1593 N  N     . SER A 1  212 ? -46.183 29.482 -12.821 1.00 43.64  ? 209 SER A N     1 
ATOM   1594 C  CA    . SER A 1  212 ? -46.648 30.222 -13.994 1.00 43.58  ? 209 SER A CA    1 
ATOM   1595 C  C     . SER A 1  212 ? -47.226 29.248 -14.989 1.00 43.26  ? 209 SER A C     1 
ATOM   1596 O  O     . SER A 1  212 ? -46.821 28.074 -15.016 1.00 42.89  ? 209 SER A O     1 
ATOM   1597 C  CB    . SER A 1  212 ? -45.479 30.954 -14.645 1.00 43.54  ? 209 SER A CB    1 
ATOM   1598 O  OG    . SER A 1  212 ? -45.141 32.111 -13.910 1.00 44.09  ? 209 SER A OG    1 
ATOM   1599 N  N     . THR A 1  213 ? -48.176 29.710 -15.798 1.00 42.91  ? 210 THR A N     1 
ATOM   1600 C  CA    . THR A 1  213 ? -48.554 28.922 -16.967 1.00 43.29  ? 210 THR A CA    1 
ATOM   1601 C  C     . THR A 1  213 ? -47.298 28.730 -17.834 1.00 43.33  ? 210 THR A C     1 
ATOM   1602 O  O     . THR A 1  213 ? -46.409 29.588 -17.838 1.00 43.49  ? 210 THR A O     1 
ATOM   1603 C  CB    . THR A 1  213 ? -49.651 29.588 -17.762 1.00 43.35  ? 210 THR A CB    1 
ATOM   1604 O  OG1   . THR A 1  213 ? -49.330 30.975 -17.938 1.00 44.45  ? 210 THR A OG1   1 
ATOM   1605 C  CG2   . THR A 1  213 ? -50.953 29.471 -17.015 1.00 42.68  ? 210 THR A CG2   1 
ATOM   1606 N  N     . PRO A 1  214 ? -47.195 27.594 -18.547 1.00 43.23  ? 211 PRO A N     1 
ATOM   1607 C  CA    . PRO A 1  214 ? -45.900 27.288 -19.177 1.00 42.83  ? 211 PRO A CA    1 
ATOM   1608 C  C     . PRO A 1  214 ? -45.552 28.244 -20.322 1.00 42.37  ? 211 PRO A C     1 
ATOM   1609 O  O     . PRO A 1  214 ? -46.446 28.694 -21.051 1.00 41.83  ? 211 PRO A O     1 
ATOM   1610 C  CB    . PRO A 1  214 ? -46.103 25.867 -19.702 1.00 42.67  ? 211 PRO A CB    1 
ATOM   1611 C  CG    . PRO A 1  214 ? -47.586 25.777 -19.945 1.00 42.53  ? 211 PRO A CG    1 
ATOM   1612 C  CD    . PRO A 1  214 ? -48.222 26.580 -18.864 1.00 43.18  ? 211 PRO A CD    1 
ATOM   1613 N  N     . TYR A 1  215 ? -44.259 28.557 -20.444 1.00 42.14  ? 212 TYR A N     1 
ATOM   1614 C  CA    . TYR A 1  215 ? -43.738 29.403 -21.524 1.00 42.01  ? 212 TYR A CA    1 
ATOM   1615 C  C     . TYR A 1  215 ? -44.420 30.759 -21.580 1.00 41.55  ? 212 TYR A C     1 
ATOM   1616 O  O     . TYR A 1  215 ? -44.908 31.169 -22.642 1.00 42.02  ? 212 TYR A O     1 
ATOM   1617 C  CB    . TYR A 1  215 ? -43.866 28.687 -22.876 1.00 42.04  ? 212 TYR A CB    1 
ATOM   1618 C  CG    . TYR A 1  215 ? -42.910 27.541 -22.964 1.00 43.67  ? 212 TYR A CG    1 
ATOM   1619 C  CD1   . TYR A 1  215 ? -41.582 27.763 -23.358 1.00 45.46  ? 212 TYR A CD1   1 
ATOM   1620 C  CD2   . TYR A 1  215 ? -43.298 26.238 -22.611 1.00 42.68  ? 212 TYR A CD2   1 
ATOM   1621 C  CE1   . TYR A 1  215 ? -40.664 26.723 -23.425 1.00 45.80  ? 212 TYR A CE1   1 
ATOM   1622 C  CE2   . TYR A 1  215 ? -42.381 25.185 -22.663 1.00 43.92  ? 212 TYR A CE2   1 
ATOM   1623 C  CZ    . TYR A 1  215 ? -41.066 25.441 -23.074 1.00 45.78  ? 212 TYR A CZ    1 
ATOM   1624 O  OH    . TYR A 1  215 ? -40.144 24.414 -23.160 1.00 49.53  ? 212 TYR A OH    1 
ATOM   1625 N  N     . HIS A 1  216 ? -44.481 31.427 -20.428 1.00 40.34  ? 213 HIS A N     1 
ATOM   1626 C  CA    . HIS A 1  216 ? -45.154 32.710 -20.312 1.00 39.10  ? 213 HIS A CA    1 
ATOM   1627 C  C     . HIS A 1  216 ? -44.519 33.519 -19.196 1.00 39.34  ? 213 HIS A C     1 
ATOM   1628 O  O     . HIS A 1  216 ? -45.150 33.788 -18.166 1.00 39.58  ? 213 HIS A O     1 
ATOM   1629 C  CB    . HIS A 1  216 ? -46.643 32.535 -20.064 1.00 37.90  ? 213 HIS A CB    1 
ATOM   1630 C  CG    . HIS A 1  216 ? -47.422 33.794 -20.225 1.00 35.07  ? 213 HIS A CG    1 
ATOM   1631 N  ND1   . HIS A 1  216 ? -47.923 34.494 -19.153 1.00 32.01  ? 213 HIS A ND1   1 
ATOM   1632 C  CD2   . HIS A 1  216 ? -47.773 34.489 -21.334 1.00 33.09  ? 213 HIS A CD2   1 
ATOM   1633 C  CE1   . HIS A 1  216 ? -48.574 35.557 -19.592 1.00 32.51  ? 213 HIS A CE1   1 
ATOM   1634 N  NE2   . HIS A 1  216 ? -48.500 35.575 -20.914 1.00 33.70  ? 213 HIS A NE2   1 
ATOM   1635 N  N     . PRO A 1  217 ? -43.270 33.945 -19.418 1.00 39.25  ? 214 PRO A N     1 
ATOM   1636 C  CA    . PRO A 1  217 ? -42.468 34.605 -18.400 1.00 39.05  ? 214 PRO A CA    1 
ATOM   1637 C  C     . PRO A 1  217 ? -43.059 35.925 -17.922 1.00 38.87  ? 214 PRO A C     1 
ATOM   1638 O  O     . PRO A 1  217 ? -42.653 36.420 -16.881 1.00 38.75  ? 214 PRO A O     1 
ATOM   1639 C  CB    . PRO A 1  217 ? -41.125 34.804 -19.090 1.00 39.34  ? 214 PRO A CB    1 
ATOM   1640 C  CG    . PRO A 1  217 ? -41.447 34.766 -20.575 1.00 39.01  ? 214 PRO A CG    1 
ATOM   1641 C  CD    . PRO A 1  217 ? -42.547 33.797 -20.696 1.00 39.25  ? 214 PRO A CD    1 
ATOM   1642 N  N     . GLN A 1  218 ? -44.031 36.474 -18.639 1.00 38.88  ? 215 GLN A N     1 
ATOM   1643 C  CA    . GLN A 1  218 ? -44.784 37.612 -18.111 1.00 39.39  ? 215 GLN A CA    1 
ATOM   1644 C  C     . GLN A 1  218 ? -45.415 37.315 -16.743 1.00 39.63  ? 215 GLN A C     1 
ATOM   1645 O  O     . GLN A 1  218 ? -45.520 38.193 -15.877 1.00 39.87  ? 215 GLN A O     1 
ATOM   1646 C  CB    . GLN A 1  218 ? -45.869 38.036 -19.082 1.00 39.54  ? 215 GLN A CB    1 
ATOM   1647 C  CG    . GLN A 1  218 ? -45.339 38.544 -20.410 1.00 41.37  ? 215 GLN A CG    1 
ATOM   1648 C  CD    . GLN A 1  218 ? -45.343 37.474 -21.490 1.00 44.32  ? 215 GLN A CD    1 
ATOM   1649 O  OE1   . GLN A 1  218 ? -44.852 36.339 -21.304 1.00 43.49  ? 215 GLN A OE1   1 
ATOM   1650 N  NE2   . GLN A 1  218 ? -45.903 37.835 -22.640 1.00 46.19  ? 215 GLN A NE2   1 
ATOM   1651 N  N     . SER A 1  219 ? -45.831 36.065 -16.552 1.00 39.51  ? 216 SER A N     1 
ATOM   1652 C  CA    . SER A 1  219 ? -46.452 35.653 -15.308 1.00 38.89  ? 216 SER A CA    1 
ATOM   1653 C  C     . SER A 1  219 ? -45.442 35.787 -14.162 1.00 39.46  ? 216 SER A C     1 
ATOM   1654 O  O     . SER A 1  219 ? -45.811 36.194 -13.060 1.00 40.00  ? 216 SER A O     1 
ATOM   1655 C  CB    . SER A 1  219 ? -46.980 34.232 -15.426 1.00 38.45  ? 216 SER A CB    1 
ATOM   1656 O  OG    . SER A 1  219 ? -48.021 34.150 -16.374 1.00 36.69  ? 216 SER A OG    1 
ATOM   1657 N  N     . SER A 1  220 ? -44.173 35.467 -14.418 1.00 39.25  ? 217 SER A N     1 
ATOM   1658 C  CA    . SER A 1  220 ? -43.115 35.773 -13.453 1.00 39.14  ? 217 SER A CA    1 
ATOM   1659 C  C     . SER A 1  220 ? -42.540 37.189 -13.651 1.00 39.30  ? 217 SER A C     1 
ATOM   1660 O  O     . SER A 1  220 ? -41.371 37.443 -13.322 1.00 39.28  ? 217 SER A O     1 
ATOM   1661 C  CB    . SER A 1  220 ? -41.997 34.732 -13.523 1.00 38.68  ? 217 SER A CB    1 
ATOM   1662 O  OG    . SER A 1  220 ? -42.439 33.484 -13.044 1.00 36.84  ? 217 SER A OG    1 
ATOM   1663 N  N     . GLY A 1  221 ? -43.361 38.092 -14.194 1.00 39.26  ? 218 GLY A N     1 
ATOM   1664 C  CA    . GLY A 1  221 ? -42.936 39.462 -14.523 1.00 39.74  ? 218 GLY A CA    1 
ATOM   1665 C  C     . GLY A 1  221 ? -42.064 40.187 -13.499 1.00 40.22  ? 218 GLY A C     1 
ATOM   1666 O  O     . GLY A 1  221 ? -41.007 40.746 -13.854 1.00 40.50  ? 218 GLY A O     1 
ATOM   1667 N  N     . LYS A 1  222 ? -42.504 40.177 -12.236 1.00 39.64  ? 219 LYS A N     1 
ATOM   1668 C  CA    . LYS A 1  222 ? -41.728 40.721 -11.127 1.00 39.49  ? 219 LYS A CA    1 
ATOM   1669 C  C     . LYS A 1  222 ? -40.247 40.316 -11.172 1.00 38.83  ? 219 LYS A C     1 
ATOM   1670 O  O     . LYS A 1  222 ? -39.366 41.173 -11.105 1.00 38.79  ? 219 LYS A O     1 
ATOM   1671 C  CB    . LYS A 1  222 ? -42.359 40.348 -9.768  1.00 39.92  ? 219 LYS A CB    1 
ATOM   1672 C  CG    . LYS A 1  222 ? -43.352 41.394 -9.218  1.00 41.79  ? 219 LYS A CG    1 
ATOM   1673 C  CD    . LYS A 1  222 ? -42.631 42.419 -8.329  1.00 45.01  ? 219 LYS A CD    1 
ATOM   1674 C  CE    . LYS A 1  222 ? -43.529 43.597 -7.843  1.00 46.20  ? 219 LYS A CE    1 
ATOM   1675 N  NZ    . LYS A 1  222 ? -44.981 43.305 -7.767  1.00 44.80  ? 219 LYS A NZ    1 
ATOM   1676 N  N     . VAL A 1  223 ? -39.954 39.030 -11.290 1.00 37.92  ? 220 VAL A N     1 
ATOM   1677 C  CA    . VAL A 1  223 ? -38.553 38.631 -11.238 1.00 37.40  ? 220 VAL A CA    1 
ATOM   1678 C  C     . VAL A 1  223 ? -37.895 38.846 -12.605 1.00 37.54  ? 220 VAL A C     1 
ATOM   1679 O  O     . VAL A 1  223 ? -36.713 39.218 -12.687 1.00 36.80  ? 220 VAL A O     1 
ATOM   1680 C  CB    . VAL A 1  223 ? -38.368 37.181 -10.700 1.00 37.36  ? 220 VAL A CB    1 
ATOM   1681 C  CG1   . VAL A 1  223 ? -39.188 36.195 -11.503 1.00 36.85  ? 220 VAL A CG1   1 
ATOM   1682 C  CG2   . VAL A 1  223 ? -36.896 36.771 -10.667 1.00 35.54  ? 220 VAL A CG2   1 
ATOM   1683 N  N     . GLU A 1  224 ? -38.672 38.624 -13.674 1.00 37.68  ? 221 GLU A N     1 
ATOM   1684 C  CA    . GLU A 1  224 ? -38.139 38.753 -15.033 1.00 37.51  ? 221 GLU A CA    1 
ATOM   1685 C  C     . GLU A 1  224 ? -37.609 40.187 -15.207 1.00 37.39  ? 221 GLU A C     1 
ATOM   1686 O  O     . GLU A 1  224 ? -36.464 40.378 -15.647 1.00 37.36  ? 221 GLU A O     1 
ATOM   1687 C  CB    . GLU A 1  224 ? -39.185 38.406 -16.109 1.00 37.47  ? 221 GLU A CB    1 
ATOM   1688 C  CG    . GLU A 1  224 ? -39.575 36.929 -16.257 1.00 37.60  ? 221 GLU A CG    1 
ATOM   1689 C  CD    . GLU A 1  224 ? -38.404 35.985 -16.502 1.00 39.96  ? 221 GLU A CD    1 
ATOM   1690 O  OE1   . GLU A 1  224 ? -37.229 36.431 -16.524 1.00 41.50  ? 221 GLU A OE1   1 
ATOM   1691 O  OE2   . GLU A 1  224 ? -38.641 34.763 -16.668 1.00 38.49  ? 221 GLU A OE2   1 
ATOM   1692 N  N     . ARG A 1  225 ? -38.413 41.168 -14.786 1.00 36.53  ? 222 ARG A N     1 
ATOM   1693 C  CA    . ARG A 1  225 ? -38.031 42.565 -14.886 1.00 36.58  ? 222 ARG A CA    1 
ATOM   1694 C  C     . ARG A 1  225 ? -36.782 42.909 -14.087 1.00 36.98  ? 222 ARG A C     1 
ATOM   1695 O  O     . ARG A 1  225 ? -35.961 43.707 -14.527 1.00 37.93  ? 222 ARG A O     1 
ATOM   1696 C  CB    . ARG A 1  225 ? -39.179 43.493 -14.511 1.00 35.98  ? 222 ARG A CB    1 
ATOM   1697 C  CG    . ARG A 1  225 ? -38.830 44.947 -14.672 1.00 34.17  ? 222 ARG A CG    1 
ATOM   1698 C  CD    . ARG A 1  225 ? -38.373 45.278 -16.095 1.00 33.94  ? 222 ARG A CD    1 
ATOM   1699 N  NE    . ARG A 1  225 ? -38.409 46.721 -16.262 1.00 33.02  ? 222 ARG A NE    1 
ATOM   1700 C  CZ    . ARG A 1  225 ? -37.418 47.540 -15.914 1.00 32.39  ? 222 ARG A CZ    1 
ATOM   1701 N  NH1   . ARG A 1  225 ? -36.282 47.046 -15.419 1.00 29.71  ? 222 ARG A NH1   1 
ATOM   1702 N  NH2   . ARG A 1  225 ? -37.573 48.857 -16.060 1.00 31.08  ? 222 ARG A NH2   1 
ATOM   1703 N  N     . LYS A 1  226 ? -36.628 42.294 -12.929 1.00 37.27  ? 223 LYS A N     1 
ATOM   1704 C  CA    . LYS A 1  226 ? -35.421 42.476 -12.150 1.00 37.26  ? 223 LYS A CA    1 
ATOM   1705 C  C     . LYS A 1  226 ? -34.188 41.848 -12.846 1.00 37.61  ? 223 LYS A C     1 
ATOM   1706 O  O     . LYS A 1  226 ? -33.079 42.377 -12.729 1.00 37.40  ? 223 LYS A O     1 
ATOM   1707 C  CB    . LYS A 1  226 ? -35.637 41.925 -10.731 1.00 37.00  ? 223 LYS A CB    1 
ATOM   1708 C  CG    . LYS A 1  226 ? -34.543 42.272 -9.728  1.00 36.44  ? 223 LYS A CG    1 
ATOM   1709 C  CD    . LYS A 1  226 ? -34.533 43.733 -9.340  1.00 36.64  ? 223 LYS A CD    1 
ATOM   1710 C  CE    . LYS A 1  226 ? -35.856 44.171 -8.697  1.00 37.32  ? 223 LYS A CE    1 
ATOM   1711 N  NZ    . LYS A 1  226 ? -35.642 45.464 -7.984  1.00 37.87  ? 223 LYS A NZ    1 
ATOM   1712 N  N     . ASN A 1  227 ? -34.375 40.723 -13.550 1.00 38.08  ? 224 ASN A N     1 
ATOM   1713 C  CA    . ASN A 1  227 ? -33.300 40.130 -14.370 1.00 38.92  ? 224 ASN A CA    1 
ATOM   1714 C  C     . ASN A 1  227 ? -32.655 41.177 -15.309 1.00 39.54  ? 224 ASN A C     1 
ATOM   1715 O  O     . ASN A 1  227 ? -31.422 41.315 -15.393 1.00 39.52  ? 224 ASN A O     1 
ATOM   1716 C  CB    . ASN A 1  227 ? -33.838 38.964 -15.196 1.00 38.55  ? 224 ASN A CB    1 
ATOM   1717 C  CG    . ASN A 1  227 ? -34.173 37.739 -14.344 1.00 40.03  ? 224 ASN A CG    1 
ATOM   1718 O  OD1   . ASN A 1  227 ? -33.858 37.692 -13.147 1.00 40.15  ? 224 ASN A OD1   1 
ATOM   1719 N  ND2   . ASN A 1  227 ? -34.817 36.740 -14.961 1.00 37.62  ? 224 ASN A ND2   1 
ATOM   1720 N  N     . SER A 1  228 ? -33.514 41.930 -15.990 1.00 39.84  ? 225 SER A N     1 
ATOM   1721 C  CA    . SER A 1  228 ? -33.090 42.968 -16.894 1.00 40.13  ? 225 SER A CA    1 
ATOM   1722 C  C     . SER A 1  228 ? -32.167 43.932 -16.157 1.00 40.32  ? 225 SER A C     1 
ATOM   1723 O  O     . SER A 1  228 ? -31.028 44.090 -16.561 1.00 40.74  ? 225 SER A O     1 
ATOM   1724 C  CB    . SER A 1  228 ? -34.314 43.662 -17.504 1.00 40.40  ? 225 SER A CB    1 
ATOM   1725 O  OG    . SER A 1  228 ? -33.945 44.720 -18.376 1.00 40.92  ? 225 SER A OG    1 
ATOM   1726 N  N     . ASP A 1  229 ? -32.628 44.533 -15.061 1.00 40.41  ? 226 ASP A N     1 
ATOM   1727 C  CA    . ASP A 1  229 ? -31.792 45.445 -14.290 1.00 40.67  ? 226 ASP A CA    1 
ATOM   1728 C  C     . ASP A 1  229 ? -30.478 44.810 -13.834 1.00 40.48  ? 226 ASP A C     1 
ATOM   1729 O  O     . ASP A 1  229 ? -29.430 45.475 -13.794 1.00 40.22  ? 226 ASP A O     1 
ATOM   1730 C  CB    . ASP A 1  229 ? -32.542 45.978 -13.065 1.00 41.45  ? 226 ASP A CB    1 
ATOM   1731 C  CG    . ASP A 1  229 ? -33.680 46.919 -13.434 1.00 43.76  ? 226 ASP A CG    1 
ATOM   1732 O  OD1   . ASP A 1  229 ? -33.682 47.423 -14.575 1.00 46.19  ? 226 ASP A OD1   1 
ATOM   1733 O  OD2   . ASP A 1  229 ? -34.566 47.170 -12.586 1.00 44.41  ? 226 ASP A OD2   1 
ATOM   1734 N  N     . ILE A 1  230 ? -30.537 43.533 -13.471 1.00 40.07  ? 227 ILE A N     1 
ATOM   1735 C  CA    . ILE A 1  230 ? -29.361 42.853 -12.982 1.00 39.90  ? 227 ILE A CA    1 
ATOM   1736 C  C     . ILE A 1  230 ? -28.320 42.788 -14.109 1.00 40.80  ? 227 ILE A C     1 
ATOM   1737 O  O     . ILE A 1  230 ? -27.160 43.169 -13.925 1.00 40.88  ? 227 ILE A O     1 
ATOM   1738 C  CB    . ILE A 1  230 ? -29.703 41.452 -12.456 1.00 39.44  ? 227 ILE A CB    1 
ATOM   1739 C  CG1   . ILE A 1  230 ? -30.536 41.561 -11.182 1.00 39.23  ? 227 ILE A CG1   1 
ATOM   1740 C  CG2   . ILE A 1  230 ? -28.432 40.663 -12.156 1.00 38.44  ? 227 ILE A CG2   1 
ATOM   1741 C  CD1   . ILE A 1  230 ? -31.195 40.273 -10.762 1.00 37.79  ? 227 ILE A CD1   1 
ATOM   1742 N  N     . LYS A 1  231 ? -28.743 42.314 -15.280 1.00 41.19  ? 228 LYS A N     1 
ATOM   1743 C  CA    . LYS A 1  231 ? -27.855 42.232 -16.433 1.00 41.02  ? 228 LYS A CA    1 
ATOM   1744 C  C     . LYS A 1  231 ? -27.383 43.617 -16.869 1.00 40.55  ? 228 LYS A C     1 
ATOM   1745 O  O     . LYS A 1  231 ? -26.192 43.808 -17.135 1.00 40.16  ? 228 LYS A O     1 
ATOM   1746 C  CB    . LYS A 1  231 ? -28.541 41.491 -17.583 1.00 41.15  ? 228 LYS A CB    1 
ATOM   1747 C  CG    . LYS A 1  231 ? -28.469 39.987 -17.444 1.00 42.08  ? 228 LYS A CG    1 
ATOM   1748 C  CD    . LYS A 1  231 ? -29.203 39.330 -18.573 1.00 44.56  ? 228 LYS A CD    1 
ATOM   1749 C  CE    . LYS A 1  231 ? -28.490 38.105 -19.051 1.00 45.13  ? 228 LYS A CE    1 
ATOM   1750 N  NZ    . LYS A 1  231 ? -29.311 37.455 -20.099 1.00 46.02  ? 228 LYS A NZ    1 
ATOM   1751 N  N     . ARG A 1  232 ? -28.307 44.578 -16.911 1.00 40.14  ? 229 ARG A N     1 
ATOM   1752 C  CA    . ARG A 1  232 ? -27.972 45.943 -17.321 1.00 40.46  ? 229 ARG A CA    1 
ATOM   1753 C  C     . ARG A 1  232 ? -26.830 46.528 -16.448 1.00 41.28  ? 229 ARG A C     1 
ATOM   1754 O  O     . ARG A 1  232 ? -25.842 47.061 -16.985 1.00 41.16  ? 229 ARG A O     1 
ATOM   1755 C  CB    . ARG A 1  232 ? -29.211 46.842 -17.348 1.00 39.84  ? 229 ARG A CB    1 
ATOM   1756 C  CG    . ARG A 1  232 ? -28.946 48.270 -17.812 1.00 40.14  ? 229 ARG A CG    1 
ATOM   1757 C  CD    . ARG A 1  232 ? -30.210 49.001 -18.257 1.00 39.75  ? 229 ARG A CD    1 
ATOM   1758 N  NE    . ARG A 1  232 ? -31.194 49.108 -17.179 1.00 41.48  ? 229 ARG A NE    1 
ATOM   1759 C  CZ    . ARG A 1  232 ? -31.402 50.195 -16.429 1.00 42.35  ? 229 ARG A CZ    1 
ATOM   1760 N  NH1   . ARG A 1  232 ? -30.700 51.313 -16.629 1.00 40.48  ? 229 ARG A NH1   1 
ATOM   1761 N  NH2   . ARG A 1  232 ? -32.327 50.162 -15.466 1.00 42.06  ? 229 ARG A NH2   1 
ATOM   1762 N  N     . LEU A 1  233 ? -26.944 46.376 -15.120 1.00 41.74  ? 230 LEU A N     1 
ATOM   1763 C  CA    . LEU A 1  233 ? -25.916 46.859 -14.196 1.00 41.68  ? 230 LEU A CA    1 
ATOM   1764 C  C     . LEU A 1  233 ? -24.640 46.056 -14.333 1.00 41.66  ? 230 LEU A C     1 
ATOM   1765 O  O     . LEU A 1  233 ? -23.550 46.637 -14.293 1.00 42.34  ? 230 LEU A O     1 
ATOM   1766 C  CB    . LEU A 1  233 ? -26.385 46.865 -12.735 1.00 41.69  ? 230 LEU A CB    1 
ATOM   1767 C  CG    . LEU A 1  233 ? -25.400 47.507 -11.731 1.00 42.05  ? 230 LEU A CG    1 
ATOM   1768 C  CD1   . LEU A 1  233 ? -24.895 48.832 -12.229 1.00 42.44  ? 230 LEU A CD1   1 
ATOM   1769 C  CD2   . LEU A 1  233 ? -25.998 47.698 -10.349 1.00 41.35  ? 230 LEU A CD2   1 
ATOM   1770 N  N     . LEU A 1  234 ? -24.752 44.741 -14.498 1.00 40.91  ? 231 LEU A N     1 
ATOM   1771 C  CA    . LEU A 1  234 ? -23.553 43.931 -14.681 1.00 40.96  ? 231 LEU A CA    1 
ATOM   1772 C  C     . LEU A 1  234 ? -22.776 44.390 -15.923 1.00 41.18  ? 231 LEU A C     1 
ATOM   1773 O  O     . LEU A 1  234 ? -21.550 44.588 -15.888 1.00 40.54  ? 231 LEU A O     1 
ATOM   1774 C  CB    . LEU A 1  234 ? -23.889 42.444 -14.763 1.00 40.86  ? 231 LEU A CB    1 
ATOM   1775 C  CG    . LEU A 1  234 ? -24.125 41.770 -13.411 1.00 41.66  ? 231 LEU A CG    1 
ATOM   1776 C  CD1   . LEU A 1  234 ? -24.721 40.378 -13.572 1.00 41.93  ? 231 LEU A CD1   1 
ATOM   1777 C  CD2   . LEU A 1  234 ? -22.832 41.692 -12.609 1.00 43.54  ? 231 LEU A CD2   1 
ATOM   1778 N  N     . THR A 1  235 ? -23.516 44.580 -17.013 1.00 41.50  ? 232 THR A N     1 
ATOM   1779 C  CA    . THR A 1  235 ? -22.950 45.051 -18.266 1.00 41.16  ? 232 THR A CA    1 
ATOM   1780 C  C     . THR A 1  235 ? -22.150 46.362 -18.071 1.00 41.42  ? 232 THR A C     1 
ATOM   1781 O  O     . THR A 1  235 ? -20.946 46.422 -18.384 1.00 41.52  ? 232 THR A O     1 
ATOM   1782 C  CB    . THR A 1  235 ? -24.069 45.228 -19.312 1.00 41.25  ? 232 THR A CB    1 
ATOM   1783 O  OG1   . THR A 1  235 ? -24.606 43.941 -19.641 1.00 38.91  ? 232 THR A OG1   1 
ATOM   1784 C  CG2   . THR A 1  235 ? -23.530 45.925 -20.569 1.00 40.60  ? 232 THR A CG2   1 
ATOM   1785 N  N     . LYS A 1  236 ? -22.811 47.388 -17.532 1.00 40.83  ? 233 LYS A N     1 
ATOM   1786 C  CA    . LYS A 1  236 ? -22.164 48.678 -17.296 1.00 40.62  ? 233 LYS A CA    1 
ATOM   1787 C  C     . LYS A 1  236 ? -20.859 48.507 -16.514 1.00 41.58  ? 233 LYS A C     1 
ATOM   1788 O  O     . LYS A 1  236 ? -19.853 49.107 -16.847 1.00 42.61  ? 233 LYS A O     1 
ATOM   1789 C  CB    . LYS A 1  236 ? -23.113 49.638 -16.580 1.00 39.43  ? 233 LYS A CB    1 
ATOM   1790 C  CG    . LYS A 1  236 ? -24.369 49.952 -17.376 1.00 37.19  ? 233 LYS A CG    1 
ATOM   1791 C  CD    . LYS A 1  236 ? -25.268 50.928 -16.652 1.00 34.50  ? 233 LYS A CD    1 
ATOM   1792 C  CE    . LYS A 1  236 ? -26.476 51.332 -17.495 1.00 32.88  ? 233 LYS A CE    1 
ATOM   1793 N  NZ    . LYS A 1  236 ? -27.513 52.014 -16.633 1.00 32.17  ? 233 LYS A NZ    1 
ATOM   1794 N  N     . LEU A 1  237 ? -20.872 47.656 -15.496 1.00 42.34  ? 234 LEU A N     1 
ATOM   1795 C  CA    . LEU A 1  237 ? -19.738 47.490 -14.612 1.00 43.01  ? 234 LEU A CA    1 
ATOM   1796 C  C     . LEU A 1  237 ? -18.591 46.720 -15.250 1.00 43.99  ? 234 LEU A C     1 
ATOM   1797 O  O     . LEU A 1  237 ? -17.451 46.807 -14.782 1.00 44.59  ? 234 LEU A O     1 
ATOM   1798 C  CB    . LEU A 1  237 ? -20.179 46.797 -13.319 1.00 42.24  ? 234 LEU A CB    1 
ATOM   1799 C  CG    . LEU A 1  237 ? -20.970 47.641 -12.318 1.00 41.85  ? 234 LEU A CG    1 
ATOM   1800 C  CD1   . LEU A 1  237 ? -21.136 46.872 -11.029 1.00 40.18  ? 234 LEU A CD1   1 
ATOM   1801 C  CD2   . LEU A 1  237 ? -20.308 48.990 -12.037 1.00 39.61  ? 234 LEU A CD2   1 
ATOM   1802 N  N     . LEU A 1  238 ? -18.892 45.975 -16.310 1.00 44.70  ? 235 LEU A N     1 
ATOM   1803 C  CA    . LEU A 1  238 ? -17.910 45.099 -16.936 1.00 45.61  ? 235 LEU A CA    1 
ATOM   1804 C  C     . LEU A 1  238 ? -17.320 45.686 -18.245 1.00 46.51  ? 235 LEU A C     1 
ATOM   1805 O  O     . LEU A 1  238 ? -16.396 45.114 -18.836 1.00 46.32  ? 235 LEU A O     1 
ATOM   1806 C  CB    . LEU A 1  238 ? -18.522 43.706 -17.158 1.00 45.24  ? 235 LEU A CB    1 
ATOM   1807 C  CG    . LEU A 1  238 ? -18.871 42.867 -15.916 1.00 45.56  ? 235 LEU A CG    1 
ATOM   1808 C  CD1   . LEU A 1  238 ? -19.680 41.605 -16.265 1.00 43.70  ? 235 LEU A CD1   1 
ATOM   1809 C  CD2   . LEU A 1  238 ? -17.624 42.484 -15.108 1.00 45.88  ? 235 LEU A CD2   1 
ATOM   1810 N  N     . VAL A 1  239 ? -17.855 46.827 -18.688 1.00 47.88  ? 236 VAL A N     1 
ATOM   1811 C  CA    . VAL A 1  239 ? -17.356 47.538 -19.879 1.00 48.94  ? 236 VAL A CA    1 
ATOM   1812 C  C     . VAL A 1  239 ? -15.829 47.657 -19.835 1.00 50.37  ? 236 VAL A C     1 
ATOM   1813 O  O     . VAL A 1  239 ? -15.262 48.120 -18.840 1.00 49.93  ? 236 VAL A O     1 
ATOM   1814 C  CB    . VAL A 1  239 ? -17.987 48.954 -20.003 1.00 48.89  ? 236 VAL A CB    1 
ATOM   1815 C  CG1   . VAL A 1  239 ? -17.186 49.854 -20.966 1.00 47.62  ? 236 VAL A CG1   1 
ATOM   1816 C  CG2   . VAL A 1  239 ? -19.448 48.860 -20.411 1.00 47.73  ? 236 VAL A CG2   1 
ATOM   1817 N  N     . GLY A 1  240 ? -15.176 47.194 -20.904 1.00 51.89  ? 237 GLY A N     1 
ATOM   1818 C  CA    . GLY A 1  240 ? -13.719 47.262 -21.015 1.00 53.17  ? 237 GLY A CA    1 
ATOM   1819 C  C     . GLY A 1  240 ? -12.951 46.257 -20.171 1.00 54.40  ? 237 GLY A C     1 
ATOM   1820 O  O     . GLY A 1  240 ? -11.724 46.238 -20.207 1.00 55.64  ? 237 GLY A O     1 
ATOM   1821 N  N     . ARG A 1  241 ? -13.650 45.415 -19.412 1.00 54.72  ? 238 ARG A N     1 
ATOM   1822 C  CA    . ARG A 1  241 ? -13.002 44.381 -18.603 1.00 54.65  ? 238 ARG A CA    1 
ATOM   1823 C  C     . ARG A 1  241 ? -13.487 42.996 -19.009 1.00 54.34  ? 238 ARG A C     1 
ATOM   1824 O  O     . ARG A 1  241 ? -14.507 42.856 -19.686 1.00 54.36  ? 238 ARG A O     1 
ATOM   1825 C  CB    . ARG A 1  241 ? -13.321 44.587 -17.132 1.00 55.31  ? 238 ARG A CB    1 
ATOM   1826 C  CG    . ARG A 1  241 ? -12.996 45.961 -16.577 1.00 58.39  ? 238 ARG A CG    1 
ATOM   1827 C  CD    . ARG A 1  241 ? -13.359 46.023 -15.105 1.00 63.55  ? 238 ARG A CD    1 
ATOM   1828 N  NE    . ARG A 1  241 ? -12.575 47.055 -14.444 1.00 69.09  ? 238 ARG A NE    1 
ATOM   1829 C  CZ    . ARG A 1  241 ? -12.944 48.330 -14.343 1.00 72.45  ? 238 ARG A CZ    1 
ATOM   1830 N  NH1   . ARG A 1  241 ? -14.110 48.742 -14.844 1.00 73.86  ? 238 ARG A NH1   1 
ATOM   1831 N  NH2   . ARG A 1  241 ? -12.148 49.195 -13.730 1.00 73.69  ? 238 ARG A NH2   1 
ATOM   1832 N  N     . PRO A 1  242 ? -12.758 41.952 -18.605 1.00 54.18  ? 239 PRO A N     1 
ATOM   1833 C  CA    . PRO A 1  242 ? -13.311 40.626 -18.871 1.00 54.16  ? 239 PRO A CA    1 
ATOM   1834 C  C     . PRO A 1  242 ? -14.526 40.329 -17.966 1.00 54.22  ? 239 PRO A C     1 
ATOM   1835 O  O     . PRO A 1  242 ? -14.657 40.905 -16.877 1.00 54.41  ? 239 PRO A O     1 
ATOM   1836 C  CB    . PRO A 1  242 ? -12.136 39.689 -18.578 1.00 53.95  ? 239 PRO A CB    1 
ATOM   1837 C  CG    . PRO A 1  242 ? -11.242 40.455 -17.679 1.00 53.97  ? 239 PRO A CG    1 
ATOM   1838 C  CD    . PRO A 1  242 ? -11.416 41.897 -17.994 1.00 53.95  ? 239 PRO A CD    1 
ATOM   1839 N  N     . THR A 1  243 ? -15.409 39.442 -18.414 1.00 54.11  ? 240 THR A N     1 
ATOM   1840 C  CA    . THR A 1  243 ? -16.716 39.279 -17.763 1.00 53.69  ? 240 THR A CA    1 
ATOM   1841 C  C     . THR A 1  243 ? -16.671 38.468 -16.465 1.00 53.34  ? 240 THR A C     1 
ATOM   1842 O  O     . THR A 1  243 ? -17.305 37.429 -16.345 1.00 53.07  ? 240 THR A O     1 
ATOM   1843 C  CB    . THR A 1  243 ? -17.766 38.712 -18.733 1.00 53.74  ? 240 THR A CB    1 
ATOM   1844 O  OG1   . THR A 1  243 ? -17.357 37.409 -19.191 1.00 54.53  ? 240 THR A OG1   1 
ATOM   1845 C  CG2   . THR A 1  243 ? -17.946 39.654 -19.910 1.00 52.56  ? 240 THR A CG2   1 
ATOM   1846 N  N     . LYS A 1  244 ? -15.914 38.978 -15.500 1.00 53.39  ? 241 LYS A N     1 
ATOM   1847 C  CA    . LYS A 1  244 ? -15.762 38.372 -14.183 1.00 53.06  ? 241 LYS A CA    1 
ATOM   1848 C  C     . LYS A 1  244 ? -16.903 38.870 -13.289 1.00 52.74  ? 241 LYS A C     1 
ATOM   1849 O  O     . LYS A 1  244 ? -16.726 39.796 -12.485 1.00 53.30  ? 241 LYS A O     1 
ATOM   1850 C  CB    . LYS A 1  244 ? -14.375 38.727 -13.593 1.00 52.96  ? 241 LYS A CB    1 
ATOM   1851 N  N     . TRP A 1  245 ? -18.074 38.252 -13.442 1.00 51.91  ? 242 TRP A N     1 
ATOM   1852 C  CA    . TRP A 1  245 ? -19.294 38.714 -12.772 1.00 51.24  ? 242 TRP A CA    1 
ATOM   1853 C  C     . TRP A 1  245 ? -19.516 38.142 -11.366 1.00 51.11  ? 242 TRP A C     1 
ATOM   1854 O  O     . TRP A 1  245 ? -20.208 38.752 -10.558 1.00 51.21  ? 242 TRP A O     1 
ATOM   1855 C  CB    . TRP A 1  245 ? -20.532 38.474 -13.648 1.00 50.57  ? 242 TRP A CB    1 
ATOM   1856 C  CG    . TRP A 1  245 ? -20.715 37.051 -14.044 1.00 50.23  ? 242 TRP A CG    1 
ATOM   1857 C  CD1   . TRP A 1  245 ? -20.285 36.471 -15.190 1.00 50.39  ? 242 TRP A CD1   1 
ATOM   1858 C  CD2   . TRP A 1  245 ? -21.366 36.016 -13.290 1.00 50.53  ? 242 TRP A CD2   1 
ATOM   1859 N  NE1   . TRP A 1  245 ? -20.633 35.141 -15.213 1.00 50.80  ? 242 TRP A NE1   1 
ATOM   1860 C  CE2   . TRP A 1  245 ? -21.294 34.837 -14.055 1.00 50.26  ? 242 TRP A CE2   1 
ATOM   1861 C  CE3   . TRP A 1  245 ? -21.992 35.971 -12.037 1.00 50.51  ? 242 TRP A CE3   1 
ATOM   1862 C  CZ2   . TRP A 1  245 ? -21.823 33.627 -13.614 1.00 50.83  ? 242 TRP A CZ2   1 
ATOM   1863 C  CZ3   . TRP A 1  245 ? -22.520 34.769 -11.600 1.00 49.87  ? 242 TRP A CZ3   1 
ATOM   1864 C  CH2   . TRP A 1  245 ? -22.438 33.615 -12.387 1.00 50.55  ? 242 TRP A CH2   1 
ATOM   1865 N  N     . TYR A 1  246 ? -18.952 36.970 -11.089 1.00 50.90  ? 243 TYR A N     1 
ATOM   1866 C  CA    . TYR A 1  246 ? -19.099 36.327 -9.792  1.00 50.81  ? 243 TYR A CA    1 
ATOM   1867 C  C     . TYR A 1  246 ? -18.905 37.295 -8.612  1.00 50.92  ? 243 TYR A C     1 
ATOM   1868 O  O     . TYR A 1  246 ? -19.801 37.466 -7.789  1.00 51.55  ? 243 TYR A O     1 
ATOM   1869 C  CB    . TYR A 1  246 ? -18.138 35.147 -9.682  1.00 50.84  ? 243 TYR A CB    1 
ATOM   1870 C  CG    . TYR A 1  246 ? -18.248 34.415 -8.378  1.00 51.68  ? 243 TYR A CG    1 
ATOM   1871 C  CD1   . TYR A 1  246 ? -19.204 33.416 -8.197  1.00 52.53  ? 243 TYR A CD1   1 
ATOM   1872 C  CD2   . TYR A 1  246 ? -17.417 34.737 -7.305  1.00 51.78  ? 243 TYR A CD2   1 
ATOM   1873 C  CE1   . TYR A 1  246 ? -19.323 32.758 -6.982  1.00 52.31  ? 243 TYR A CE1   1 
ATOM   1874 C  CE2   . TYR A 1  246 ? -17.526 34.085 -6.099  1.00 51.34  ? 243 TYR A CE2   1 
ATOM   1875 C  CZ    . TYR A 1  246 ? -18.479 33.099 -5.947  1.00 52.27  ? 243 TYR A CZ    1 
ATOM   1876 O  OH    . TYR A 1  246 ? -18.581 32.445 -4.751  1.00 54.43  ? 243 TYR A OH    1 
ATOM   1877 N  N     . ASP A 1  247 ? -17.749 37.941 -8.550  1.00 50.79  ? 244 ASP A N     1 
ATOM   1878 C  CA    . ASP A 1  247 ? -17.431 38.850 -7.468  1.00 50.60  ? 244 ASP A CA    1 
ATOM   1879 C  C     . ASP A 1  247 ? -18.307 40.095 -7.474  1.00 49.74  ? 244 ASP A C     1 
ATOM   1880 O  O     . ASP A 1  247 ? -18.293 40.876 -6.508  1.00 50.08  ? 244 ASP A O     1 
ATOM   1881 C  CB    . ASP A 1  247 ? -15.955 39.264 -7.539  1.00 51.60  ? 244 ASP A CB    1 
ATOM   1882 C  CG    . ASP A 1  247 ? -15.003 38.190 -7.007  1.00 55.08  ? 244 ASP A CG    1 
ATOM   1883 O  OD1   . ASP A 1  247 ? -15.460 37.101 -6.563  1.00 58.39  ? 244 ASP A OD1   1 
ATOM   1884 O  OD2   . ASP A 1  247 ? -13.775 38.446 -7.030  1.00 58.72  ? 244 ASP A OD2   1 
ATOM   1885 N  N     . LEU A 1  248 ? -19.065 40.305 -8.547  1.00 48.24  ? 245 LEU A N     1 
ATOM   1886 C  CA    . LEU A 1  248 ? -19.941 41.487 -8.611  1.00 46.58  ? 245 LEU A CA    1 
ATOM   1887 C  C     . LEU A 1  248 ? -21.355 41.263 -8.078  1.00 45.86  ? 245 LEU A C     1 
ATOM   1888 O  O     . LEU A 1  248 ? -22.008 42.220 -7.656  1.00 45.91  ? 245 LEU A O     1 
ATOM   1889 C  CB    . LEU A 1  248 ? -20.000 42.075 -10.017 1.00 46.12  ? 245 LEU A CB    1 
ATOM   1890 C  CG    . LEU A 1  248 ? -18.740 42.759 -10.547 1.00 45.48  ? 245 LEU A CG    1 
ATOM   1891 C  CD1   . LEU A 1  248 ? -19.013 43.324 -11.943 1.00 41.37  ? 245 LEU A CD1   1 
ATOM   1892 C  CD2   . LEU A 1  248 ? -18.204 43.843 -9.581  1.00 42.43  ? 245 LEU A CD2   1 
ATOM   1893 N  N     . LEU A 1  249 ? -21.831 40.024 -8.071  1.00 44.81  ? 246 LEU A N     1 
ATOM   1894 C  CA    . LEU A 1  249 ? -23.191 39.778 -7.588  1.00 44.66  ? 246 LEU A CA    1 
ATOM   1895 C  C     . LEU A 1  249 ? -23.547 40.499 -6.279  1.00 44.48  ? 246 LEU A C     1 
ATOM   1896 O  O     . LEU A 1  249 ? -24.585 41.171 -6.219  1.00 45.01  ? 246 LEU A O     1 
ATOM   1897 C  CB    . LEU A 1  249 ? -23.491 38.292 -7.473  1.00 44.71  ? 246 LEU A CB    1 
ATOM   1898 C  CG    . LEU A 1  249 ? -23.629 37.525 -8.779  1.00 44.41  ? 246 LEU A CG    1 
ATOM   1899 C  CD1   . LEU A 1  249 ? -24.119 36.157 -8.444  1.00 44.65  ? 246 LEU A CD1   1 
ATOM   1900 C  CD2   . LEU A 1  249 ? -24.625 38.220 -9.681  1.00 44.65  ? 246 LEU A CD2   1 
ATOM   1901 N  N     . PRO A 1  250 ? -22.693 40.388 -5.237  1.00 44.15  ? 247 PRO A N     1 
ATOM   1902 C  CA    . PRO A 1  250 ? -23.036 41.105 -3.997  1.00 43.60  ? 247 PRO A CA    1 
ATOM   1903 C  C     . PRO A 1  250 ? -23.228 42.607 -4.200  1.00 43.24  ? 247 PRO A C     1 
ATOM   1904 O  O     . PRO A 1  250 ? -24.213 43.169 -3.726  1.00 44.00  ? 247 PRO A O     1 
ATOM   1905 C  CB    . PRO A 1  250 ? -21.839 40.819 -3.083  1.00 43.80  ? 247 PRO A CB    1 
ATOM   1906 C  CG    . PRO A 1  250 ? -21.294 39.493 -3.581  1.00 43.53  ? 247 PRO A CG    1 
ATOM   1907 C  CD    . PRO A 1  250 ? -21.477 39.552 -5.072  1.00 44.11  ? 247 PRO A CD    1 
ATOM   1908 N  N     . VAL A 1  251 ? -22.317 43.246 -4.918  1.00 42.84  ? 248 VAL A N     1 
ATOM   1909 C  CA    . VAL A 1  251 ? -22.402 44.677 -5.210  1.00 42.09  ? 248 VAL A CA    1 
ATOM   1910 C  C     . VAL A 1  251 ? -23.688 45.032 -5.953  1.00 41.07  ? 248 VAL A C     1 
ATOM   1911 O  O     . VAL A 1  251 ? -24.349 46.024 -5.635  1.00 40.68  ? 248 VAL A O     1 
ATOM   1912 C  CB    . VAL A 1  251 ? -21.209 45.156 -6.068  1.00 42.75  ? 248 VAL A CB    1 
ATOM   1913 C  CG1   . VAL A 1  251 ? -21.108 46.669 -6.020  1.00 43.94  ? 248 VAL A CG1   1 
ATOM   1914 C  CG2   . VAL A 1  251 ? -19.896 44.536 -5.576  1.00 43.61  ? 248 VAL A CG2   1 
ATOM   1915 N  N     . VAL A 1  252 ? -24.039 44.221 -6.941  1.00 39.96  ? 249 VAL A N     1 
ATOM   1916 C  CA    . VAL A 1  252 ? -25.238 44.463 -7.719  1.00 38.92  ? 249 VAL A CA    1 
ATOM   1917 C  C     . VAL A 1  252 ? -26.465 44.330 -6.820  1.00 38.95  ? 249 VAL A C     1 
ATOM   1918 O  O     . VAL A 1  252 ? -27.307 45.250 -6.759  1.00 39.04  ? 249 VAL A O     1 
ATOM   1919 C  CB    . VAL A 1  252 ? -25.303 43.551 -8.978  1.00 38.71  ? 249 VAL A CB    1 
ATOM   1920 C  CG1   . VAL A 1  252 ? -26.593 43.754 -9.763  1.00 37.59  ? 249 VAL A CG1   1 
ATOM   1921 C  CG2   . VAL A 1  252 ? -24.164 43.876 -9.872  1.00 38.64  ? 249 VAL A CG2   1 
ATOM   1922 N  N     . GLN A 1  253 ? -26.564 43.206 -6.109  1.00 38.62  ? 250 GLN A N     1 
ATOM   1923 C  CA    . GLN A 1  253 ? -27.646 43.030 -5.135  1.00 38.64  ? 250 GLN A CA    1 
ATOM   1924 C  C     . GLN A 1  253 ? -27.851 44.297 -4.302  1.00 38.63  ? 250 GLN A C     1 
ATOM   1925 O  O     . GLN A 1  253 ? -28.924 44.883 -4.305  1.00 38.63  ? 250 GLN A O     1 
ATOM   1926 C  CB    . GLN A 1  253 ? -27.348 41.840 -4.226  1.00 38.84  ? 250 GLN A CB    1 
ATOM   1927 C  CG    . GLN A 1  253 ? -28.442 41.500 -3.228  1.00 38.42  ? 250 GLN A CG    1 
ATOM   1928 C  CD    . GLN A 1  253 ? -28.050 40.322 -2.371  1.00 39.44  ? 250 GLN A CD    1 
ATOM   1929 O  OE1   . GLN A 1  253 ? -28.158 39.167 -2.783  1.00 39.05  ? 250 GLN A OE1   1 
ATOM   1930 N  NE2   . GLN A 1  253 ? -27.571 40.608 -1.171  1.00 40.85  ? 250 GLN A NE2   1 
ATOM   1931 N  N     . LEU A 1  254 ? -26.804 44.724 -3.610  1.00 38.71  ? 251 LEU A N     1 
ATOM   1932 C  CA    . LEU A 1  254 ? -26.892 45.888 -2.743  1.00 39.38  ? 251 LEU A CA    1 
ATOM   1933 C  C     . LEU A 1  254 ? -27.291 47.143 -3.524  1.00 39.61  ? 251 LEU A C     1 
ATOM   1934 O  O     . LEU A 1  254 ? -28.121 47.949 -3.055  1.00 40.51  ? 251 LEU A O     1 
ATOM   1935 C  CB    . LEU A 1  254 ? -25.542 46.113 -2.031  1.00 39.80  ? 251 LEU A CB    1 
ATOM   1936 C  CG    . LEU A 1  254 ? -25.435 47.279 -1.030  1.00 39.30  ? 251 LEU A CG    1 
ATOM   1937 C  CD1   . LEU A 1  254 ? -26.340 47.060 0.174   1.00 37.81  ? 251 LEU A CD1   1 
ATOM   1938 C  CD2   . LEU A 1  254 ? -23.986 47.507 -0.598  1.00 36.20  ? 251 LEU A CD2   1 
ATOM   1939 N  N     . ALA A 1  255 ? -26.697 47.313 -4.708  1.00 38.77  ? 252 ALA A N     1 
ATOM   1940 C  CA    . ALA A 1  255 ? -26.940 48.511 -5.511  1.00 37.74  ? 252 ALA A CA    1 
ATOM   1941 C  C     . ALA A 1  255 ? -28.403 48.599 -5.906  1.00 37.41  ? 252 ALA A C     1 
ATOM   1942 O  O     . ALA A 1  255 ? -29.033 49.636 -5.730  1.00 36.72  ? 252 ALA A O     1 
ATOM   1943 C  CB    . ALA A 1  255 ? -26.047 48.529 -6.726  1.00 37.02  ? 252 ALA A CB    1 
ATOM   1944 N  N     . LEU A 1  256 ? -28.947 47.491 -6.411  1.00 37.65  ? 253 LEU A N     1 
ATOM   1945 C  CA    . LEU A 1  256 ? -30.345 47.465 -6.842  1.00 37.98  ? 253 LEU A CA    1 
ATOM   1946 C  C     . LEU A 1  256 ? -31.361 47.595 -5.679  1.00 38.70  ? 253 LEU A C     1 
ATOM   1947 O  O     . LEU A 1  256 ? -32.362 48.323 -5.804  1.00 38.41  ? 253 LEU A O     1 
ATOM   1948 C  CB    . LEU A 1  256 ? -30.620 46.238 -7.713  1.00 37.42  ? 253 LEU A CB    1 
ATOM   1949 C  CG    . LEU A 1  256 ? -29.858 46.208 -9.051  1.00 37.20  ? 253 LEU A CG    1 
ATOM   1950 C  CD1   . LEU A 1  256 ? -30.316 45.067 -9.950  1.00 35.13  ? 253 LEU A CD1   1 
ATOM   1951 C  CD2   . LEU A 1  256 ? -29.956 47.539 -9.801  1.00 35.28  ? 253 LEU A CD2   1 
ATOM   1952 N  N     . ASN A 1  257 ? -31.096 46.921 -4.550  1.00 38.89  ? 254 ASN A N     1 
ATOM   1953 C  CA    . ASN A 1  257 ? -32.019 46.965 -3.406  1.00 39.35  ? 254 ASN A CA    1 
ATOM   1954 C  C     . ASN A 1  257 ? -32.102 48.364 -2.806  1.00 39.67  ? 254 ASN A C     1 
ATOM   1955 O  O     . ASN A 1  257 ? -33.052 48.670 -2.102  1.00 39.79  ? 254 ASN A O     1 
ATOM   1956 C  CB    . ASN A 1  257 ? -31.619 45.961 -2.316  1.00 39.31  ? 254 ASN A CB    1 
ATOM   1957 C  CG    . ASN A 1  257 ? -31.899 44.527 -2.700  1.00 39.23  ? 254 ASN A CG    1 
ATOM   1958 O  OD1   . ASN A 1  257 ? -32.836 44.241 -3.438  1.00 40.24  ? 254 ASN A OD1   1 
ATOM   1959 N  ND2   . ASN A 1  257 ? -31.089 43.609 -2.186  1.00 38.59  ? 254 ASN A ND2   1 
ATOM   1960 N  N     . ASN A 1  258 ? -31.104 49.199 -3.098  1.00 39.74  ? 255 ASN A N     1 
ATOM   1961 C  CA    . ASN A 1  258 ? -31.058 50.570 -2.606  1.00 40.16  ? 255 ASN A CA    1 
ATOM   1962 C  C     . ASN A 1  258 ? -31.271 51.658 -3.671  1.00 40.42  ? 255 ASN A C     1 
ATOM   1963 O  O     . ASN A 1  258 ? -30.998 52.846 -3.423  1.00 40.39  ? 255 ASN A O     1 
ATOM   1964 C  CB    . ASN A 1  258 ? -29.744 50.808 -1.868  1.00 40.41  ? 255 ASN A CB    1 
ATOM   1965 C  CG    . ASN A 1  258 ? -29.705 50.097 -0.522  1.00 40.99  ? 255 ASN A CG    1 
ATOM   1966 O  OD1   . ASN A 1  258 ? -30.353 50.527 0.438   1.00 39.42  ? 255 ASN A OD1   1 
ATOM   1967 N  ND2   . ASN A 1  258 ? -28.954 49.000 -0.451  1.00 40.00  ? 255 ASN A ND2   1 
ATOM   1968 N  N     . THR A 1  259 ? -31.780 51.250 -4.836  1.00 40.11  ? 256 THR A N     1 
ATOM   1969 C  CA    . THR A 1  259 ? -32.147 52.170 -5.921  1.00 39.80  ? 256 THR A CA    1 
ATOM   1970 C  C     . THR A 1  259 ? -33.634 52.542 -5.902  1.00 39.81  ? 256 THR A C     1 
ATOM   1971 O  O     . THR A 1  259 ? -34.510 51.681 -5.760  1.00 39.58  ? 256 THR A O     1 
ATOM   1972 C  CB    . THR A 1  259 ? -31.781 51.544 -7.264  1.00 39.71  ? 256 THR A CB    1 
ATOM   1973 O  OG1   . THR A 1  259 ? -30.358 51.478 -7.346  1.00 41.75  ? 256 THR A OG1   1 
ATOM   1974 C  CG2   . THR A 1  259 ? -32.313 52.332 -8.431  1.00 38.35  ? 256 THR A CG2   1 
ATOM   1975 N  N     . TYR A 1  260 ? -33.903 53.834 -6.039  1.00 39.43  ? 257 TYR A N     1 
ATOM   1976 C  CA    . TYR A 1  260 ? -35.258 54.337 -6.037  1.00 39.59  ? 257 TYR A CA    1 
ATOM   1977 C  C     . TYR A 1  260 ? -36.029 53.879 -7.276  1.00 39.99  ? 257 TYR A C     1 
ATOM   1978 O  O     . TYR A 1  260 ? -35.456 53.720 -8.355  1.00 40.68  ? 257 TYR A O     1 
ATOM   1979 C  CB    . TYR A 1  260 ? -35.229 55.864 -5.975  1.00 39.34  ? 257 TYR A CB    1 
ATOM   1980 C  CG    . TYR A 1  260 ? -35.019 56.422 -4.577  1.00 39.84  ? 257 TYR A CG    1 
ATOM   1981 C  CD1   . TYR A 1  260 ? -36.116 56.669 -3.748  1.00 38.38  ? 257 TYR A CD1   1 
ATOM   1982 C  CD2   . TYR A 1  260 ? -33.720 56.706 -4.080  1.00 38.83  ? 257 TYR A CD2   1 
ATOM   1983 C  CE1   . TYR A 1  260 ? -35.938 57.152 -2.479  1.00 39.14  ? 257 TYR A CE1   1 
ATOM   1984 C  CE2   . TYR A 1  260 ? -33.539 57.207 -2.797  1.00 36.06  ? 257 TYR A CE2   1 
ATOM   1985 C  CZ    . TYR A 1  260 ? -34.656 57.415 -2.010  1.00 38.00  ? 257 TYR A CZ    1 
ATOM   1986 O  OH    . TYR A 1  260 ? -34.556 57.916 -0.744  1.00 40.92  ? 257 TYR A OH    1 
ATOM   1987 N  N     . SER A 1  261 ? -37.325 53.656 -7.116  1.00 39.52  ? 258 SER A N     1 
ATOM   1988 C  CA    . SER A 1  261 ? -38.203 53.532 -8.247  1.00 38.86  ? 258 SER A CA    1 
ATOM   1989 C  C     . SER A 1  261 ? -38.880 54.875 -8.356  1.00 39.20  ? 258 SER A C     1 
ATOM   1990 O  O     . SER A 1  261 ? -39.614 55.288 -7.451  1.00 38.50  ? 258 SER A O     1 
ATOM   1991 C  CB    . SER A 1  261 ? -39.233 52.460 -7.994  1.00 38.98  ? 258 SER A CB    1 
ATOM   1992 O  OG    . SER A 1  261 ? -40.293 52.592 -8.911  1.00 39.71  ? 258 SER A OG    1 
ATOM   1993 N  N     . PRO A 1  262 ? -38.619 55.596 -9.453  1.00 39.89  ? 259 PRO A N     1 
ATOM   1994 C  CA    . PRO A 1  262 ? -39.234 56.924 -9.574  1.00 39.91  ? 259 PRO A CA    1 
ATOM   1995 C  C     . PRO A 1  262 ? -40.753 56.951 -9.381  1.00 40.19  ? 259 PRO A C     1 
ATOM   1996 O  O     . PRO A 1  262 ? -41.268 57.942 -8.874  1.00 40.95  ? 259 PRO A O     1 
ATOM   1997 C  CB    . PRO A 1  262 ? -38.848 57.349 -10.978 1.00 39.84  ? 259 PRO A CB    1 
ATOM   1998 C  CG    . PRO A 1  262 ? -37.498 56.701 -11.180 1.00 39.21  ? 259 PRO A CG    1 
ATOM   1999 C  CD    . PRO A 1  262 ? -37.526 55.400 -10.428 1.00 39.46  ? 259 PRO A CD    1 
ATOM   2000 N  N     . VAL A 1  263 ? -41.472 55.895 -9.754  1.00 39.78  ? 260 VAL A N     1 
ATOM   2001 C  CA    . VAL A 1  263 ? -42.934 55.921 -9.591  1.00 39.86  ? 260 VAL A CA    1 
ATOM   2002 C  C     . VAL A 1  263 ? -43.361 55.742 -8.131  1.00 40.55  ? 260 VAL A C     1 
ATOM   2003 O  O     . VAL A 1  263 ? -44.384 56.276 -7.686  1.00 40.76  ? 260 VAL A O     1 
ATOM   2004 C  CB    . VAL A 1  263 ? -43.674 54.904 -10.521 1.00 39.73  ? 260 VAL A CB    1 
ATOM   2005 C  CG1   . VAL A 1  263 ? -43.427 53.473 -10.072 1.00 38.39  ? 260 VAL A CG1   1 
ATOM   2006 C  CG2   . VAL A 1  263 ? -45.160 55.221 -10.579 1.00 37.63  ? 260 VAL A CG2   1 
ATOM   2007 N  N     . LEU A 1  264 ? -42.559 54.978 -7.400  1.00 41.33  ? 261 LEU A N     1 
ATOM   2008 C  CA    . LEU A 1  264 ? -42.840 54.647 -6.028  1.00 41.20  ? 261 LEU A CA    1 
ATOM   2009 C  C     . LEU A 1  264 ? -42.280 55.700 -5.100  1.00 42.15  ? 261 LEU A C     1 
ATOM   2010 O  O     . LEU A 1  264 ? -42.913 56.030 -4.107  1.00 43.06  ? 261 LEU A O     1 
ATOM   2011 C  CB    . LEU A 1  264 ? -42.263 53.277 -5.693  1.00 40.35  ? 261 LEU A CB    1 
ATOM   2012 C  CG    . LEU A 1  264 ? -42.914 52.044 -6.340  1.00 38.70  ? 261 LEU A CG    1 
ATOM   2013 C  CD1   . LEU A 1  264 ? -42.471 50.812 -5.609  1.00 33.79  ? 261 LEU A CD1   1 
ATOM   2014 C  CD2   . LEU A 1  264 ? -44.460 52.118 -6.380  1.00 36.79  ? 261 LEU A CD2   1 
ATOM   2015 N  N     . LYS A 1  265 ? -41.106 56.241 -5.433  1.00 42.74  ? 262 LYS A N     1 
ATOM   2016 C  CA    . LYS A 1  265 ? -40.355 57.153 -4.546  1.00 43.24  ? 262 LYS A CA    1 
ATOM   2017 C  C     . LYS A 1  265 ? -39.728 56.445 -3.361  1.00 43.04  ? 262 LYS A C     1 
ATOM   2018 O  O     . LYS A 1  265 ? -39.397 57.077 -2.361  1.00 43.20  ? 262 LYS A O     1 
ATOM   2019 C  CB    . LYS A 1  265 ? -41.236 58.283 -4.027  1.00 43.68  ? 262 LYS A CB    1 
ATOM   2020 C  CG    . LYS A 1  265 ? -41.974 59.012 -5.100  1.00 45.91  ? 262 LYS A CG    1 
ATOM   2021 C  CD    . LYS A 1  265 ? -41.147 60.106 -5.720  1.00 46.46  ? 262 LYS A CD    1 
ATOM   2022 C  CE    . LYS A 1  265 ? -42.114 61.036 -6.389  1.00 48.69  ? 262 LYS A CE    1 
ATOM   2023 N  NZ    . LYS A 1  265 ? -43.139 61.533 -5.405  1.00 49.54  ? 262 LYS A NZ    1 
ATOM   2024 N  N     . TYR A 1  266 ? -39.575 55.132 -3.476  1.00 43.31  ? 263 TYR A N     1 
ATOM   2025 C  CA    . TYR A 1  266 ? -38.937 54.335 -2.450  1.00 43.49  ? 263 TYR A CA    1 
ATOM   2026 C  C     . TYR A 1  266 ? -37.977 53.356 -3.070  1.00 43.16  ? 263 TYR A C     1 
ATOM   2027 O  O     . TYR A 1  266 ? -38.128 52.999 -4.239  1.00 43.72  ? 263 TYR A O     1 
ATOM   2028 C  CB    . TYR A 1  266 ? -39.997 53.622 -1.607  1.00 43.98  ? 263 TYR A CB    1 
ATOM   2029 C  CG    . TYR A 1  266 ? -40.819 54.618 -0.841  1.00 45.79  ? 263 TYR A CG    1 
ATOM   2030 C  CD1   . TYR A 1  266 ? -40.281 55.279 0.265   1.00 47.90  ? 263 TYR A CD1   1 
ATOM   2031 C  CD2   . TYR A 1  266 ? -42.103 54.961 -1.257  1.00 46.96  ? 263 TYR A CD2   1 
ATOM   2032 C  CE1   . TYR A 1  266 ? -41.011 56.231 0.952   1.00 49.90  ? 263 TYR A CE1   1 
ATOM   2033 C  CE2   . TYR A 1  266 ? -42.848 55.913 -0.569  1.00 48.85  ? 263 TYR A CE2   1 
ATOM   2034 C  CZ    . TYR A 1  266 ? -42.297 56.536 0.538   1.00 50.23  ? 263 TYR A CZ    1 
ATOM   2035 O  OH    . TYR A 1  266 ? -43.016 57.483 1.233   1.00 52.65  ? 263 TYR A OH    1 
ATOM   2036 N  N     . THR A 1  267 ? -36.975 52.953 -2.295  1.00 42.16  ? 264 THR A N     1 
ATOM   2037 C  CA    . THR A 1  267 ? -36.078 51.884 -2.679  1.00 41.50  ? 264 THR A CA    1 
ATOM   2038 C  C     . THR A 1  267 ? -36.648 50.596 -2.108  1.00 41.78  ? 264 THR A C     1 
ATOM   2039 O  O     . THR A 1  267 ? -37.435 50.632 -1.167  1.00 41.36  ? 264 THR A O     1 
ATOM   2040 C  CB    . THR A 1  267 ? -34.665 52.082 -2.095  1.00 41.73  ? 264 THR A CB    1 
ATOM   2041 O  OG1   . THR A 1  267 ? -34.687 51.816 -0.678  1.00 39.85  ? 264 THR A OG1   1 
ATOM   2042 C  CG2   . THR A 1  267 ? -34.148 53.516 -2.379  1.00 40.60  ? 264 THR A CG2   1 
ATOM   2043 N  N     . PRO A 1  268 ? -36.245 49.443 -2.658  1.00 42.05  ? 265 PRO A N     1 
ATOM   2044 C  CA    . PRO A 1  268 ? -36.846 48.239 -2.101  1.00 42.48  ? 265 PRO A CA    1 
ATOM   2045 C  C     . PRO A 1  268 ? -36.420 47.976 -0.657  1.00 42.73  ? 265 PRO A C     1 
ATOM   2046 O  O     . PRO A 1  268 ? -37.154 47.350 0.107   1.00 43.47  ? 265 PRO A O     1 
ATOM   2047 C  CB    . PRO A 1  268 ? -36.363 47.138 -3.054  1.00 42.62  ? 265 PRO A CB    1 
ATOM   2048 C  CG    . PRO A 1  268 ? -36.173 47.879 -4.350  1.00 42.30  ? 265 PRO A CG    1 
ATOM   2049 C  CD    . PRO A 1  268 ? -35.540 49.165 -3.919  1.00 41.55  ? 265 PRO A CD    1 
ATOM   2050 N  N     . HIS A 1  269 ? -35.252 48.471 -0.286  1.00 42.67  ? 266 HIS A N     1 
ATOM   2051 C  CA    . HIS A 1  269 ? -34.764 48.340 1.077   1.00 42.15  ? 266 HIS A CA    1 
ATOM   2052 C  C     . HIS A 1  269 ? -35.691 49.107 2.025   1.00 42.11  ? 266 HIS A C     1 
ATOM   2053 O  O     . HIS A 1  269 ? -36.095 48.592 3.081   1.00 41.75  ? 266 HIS A O     1 
ATOM   2054 C  CB    . HIS A 1  269 ? -33.348 48.885 1.139   1.00 41.89  ? 266 HIS A CB    1 
ATOM   2055 C  CG    . HIS A 1  269 ? -32.805 49.015 2.520   1.00 42.38  ? 266 HIS A CG    1 
ATOM   2056 N  ND1   . HIS A 1  269 ? -31.997 48.055 3.094   1.00 42.30  ? 266 HIS A ND1   1 
ATOM   2057 C  CD2   . HIS A 1  269 ? -32.925 50.007 3.431   1.00 41.46  ? 266 HIS A CD2   1 
ATOM   2058 C  CE1   . HIS A 1  269 ? -31.646 48.450 4.302   1.00 42.53  ? 266 HIS A CE1   1 
ATOM   2059 N  NE2   . HIS A 1  269 ? -32.206 49.627 4.535   1.00 43.21  ? 266 HIS A NE2   1 
ATOM   2060 N  N     . GLN A 1  270 ? -36.030 50.334 1.631   1.00 41.63  ? 267 GLN A N     1 
ATOM   2061 C  CA    . GLN A 1  270 ? -36.940 51.163 2.395   1.00 41.14  ? 267 GLN A CA    1 
ATOM   2062 C  C     . GLN A 1  270 ? -38.292 50.503 2.595   1.00 41.17  ? 267 GLN A C     1 
ATOM   2063 O  O     . GLN A 1  270 ? -38.794 50.455 3.703   1.00 41.58  ? 267 GLN A O     1 
ATOM   2064 C  CB    . GLN A 1  270 ? -37.088 52.514 1.740   1.00 40.93  ? 267 GLN A CB    1 
ATOM   2065 C  CG    . GLN A 1  270 ? -35.833 53.354 1.900   1.00 41.97  ? 267 GLN A CG    1 
ATOM   2066 C  CD    . GLN A 1  270 ? -35.721 54.466 0.888   1.00 42.71  ? 267 GLN A CD    1 
ATOM   2067 O  OE1   . GLN A 1  270 ? -36.523 54.559 -0.040  1.00 44.10  ? 267 GLN A OE1   1 
ATOM   2068 N  NE2   . GLN A 1  270 ? -34.721 55.327 1.061   1.00 43.19  ? 267 GLN A NE2   1 
ATOM   2069 N  N     . LEU A 1  271 ? -38.868 49.957 1.535   1.00 41.26  ? 268 LEU A N     1 
ATOM   2070 C  CA    . LEU A 1  271 ? -40.104 49.188 1.663   1.00 40.30  ? 268 LEU A CA    1 
ATOM   2071 C  C     . LEU A 1  271 ? -39.927 47.971 2.556   1.00 40.05  ? 268 LEU A C     1 
ATOM   2072 O  O     . LEU A 1  271 ? -40.871 47.557 3.234   1.00 40.42  ? 268 LEU A O     1 
ATOM   2073 C  CB    . LEU A 1  271 ? -40.628 48.769 0.293   1.00 40.18  ? 268 LEU A CB    1 
ATOM   2074 C  CG    . LEU A 1  271 ? -40.946 49.960 -0.623  1.00 40.20  ? 268 LEU A CG    1 
ATOM   2075 C  CD1   . LEU A 1  271 ? -41.293 49.491 -2.017  1.00 39.70  ? 268 LEU A CD1   1 
ATOM   2076 C  CD2   . LEU A 1  271 ? -42.068 50.801 -0.055  1.00 40.54  ? 268 LEU A CD2   1 
ATOM   2077 N  N     . LEU A 1  272 ? -38.730 47.401 2.591   1.00 39.30  ? 269 LEU A N     1 
ATOM   2078 C  CA    . LEU A 1  272 ? -38.517 46.232 3.445   1.00 39.15  ? 269 LEU A CA    1 
ATOM   2079 C  C     . LEU A 1  272 ? -38.289 46.540 4.942   1.00 39.77  ? 269 LEU A C     1 
ATOM   2080 O  O     . LEU A 1  272 ? -38.786 45.816 5.787   1.00 40.31  ? 269 LEU A O     1 
ATOM   2081 C  CB    . LEU A 1  272 ? -37.397 45.337 2.914   1.00 38.33  ? 269 LEU A CB    1 
ATOM   2082 C  CG    . LEU A 1  272 ? -37.205 44.001 3.645   1.00 37.36  ? 269 LEU A CG    1 
ATOM   2083 C  CD1   . LEU A 1  272 ? -38.472 43.153 3.586   1.00 37.71  ? 269 LEU A CD1   1 
ATOM   2084 C  CD2   . LEU A 1  272 ? -36.017 43.199 3.112   1.00 34.49  ? 269 LEU A CD2   1 
ATOM   2085 N  N     . PHE A 1  273 ? -37.541 47.593 5.261   1.00 40.03  ? 270 PHE A N     1 
ATOM   2086 C  CA    . PHE A 1  273 ? -37.101 47.841 6.636   1.00 40.26  ? 270 PHE A CA    1 
ATOM   2087 C  C     . PHE A 1  273 ? -37.604 49.164 7.168   1.00 40.93  ? 270 PHE A C     1 
ATOM   2088 O  O     . PHE A 1  273 ? -37.518 49.412 8.369   1.00 41.55  ? 270 PHE A O     1 
ATOM   2089 C  CB    . PHE A 1  273 ? -35.566 47.900 6.752   1.00 40.21  ? 270 PHE A CB    1 
ATOM   2090 C  CG    . PHE A 1  273 ? -34.854 46.671 6.303   1.00 38.71  ? 270 PHE A CG    1 
ATOM   2091 C  CD1   . PHE A 1  273 ? -34.125 46.679 5.107   1.00 37.61  ? 270 PHE A CD1   1 
ATOM   2092 C  CD2   . PHE A 1  273 ? -34.875 45.517 7.082   1.00 37.52  ? 270 PHE A CD2   1 
ATOM   2093 C  CE1   . PHE A 1  273 ? -33.414 45.548 4.691   1.00 37.16  ? 270 PHE A CE1   1 
ATOM   2094 C  CE2   . PHE A 1  273 ? -34.175 44.372 6.689   1.00 37.56  ? 270 PHE A CE2   1 
ATOM   2095 C  CZ    . PHE A 1  273 ? -33.440 44.383 5.480   1.00 38.27  ? 270 PHE A CZ    1 
ATOM   2096 N  N     . GLY A 1  274 ? -38.069 50.035 6.278   1.00 41.22  ? 271 GLY A N     1 
ATOM   2097 C  CA    . GLY A 1  274 ? -38.596 51.326 6.682   1.00 41.49  ? 271 GLY A CA    1 
ATOM   2098 C  C     . GLY A 1  274 ? -37.512 52.281 7.113   1.00 42.09  ? 271 GLY A C     1 
ATOM   2099 O  O     . GLY A 1  274 ? -37.795 53.357 7.641   1.00 42.56  ? 271 GLY A O     1 
ATOM   2100 N  N     . ILE A 1  275 ? -36.261 51.894 6.891   1.00 42.36  ? 272 ILE A N     1 
ATOM   2101 C  CA    . ILE A 1  275 ? -35.136 52.787 7.175   1.00 41.96  ? 272 ILE A CA    1 
ATOM   2102 C  C     . ILE A 1  275 ? -33.882 52.366 6.412   1.00 41.72  ? 272 ILE A C     1 
ATOM   2103 O  O     . ILE A 1  275 ? -33.537 51.186 6.363   1.00 41.85  ? 272 ILE A O     1 
ATOM   2104 C  CB    . ILE A 1  275 ? -34.836 52.806 8.678   1.00 42.01  ? 272 ILE A CB    1 
ATOM   2105 C  CG1   . ILE A 1  275 ? -33.671 53.748 8.978   1.00 42.35  ? 272 ILE A CG1   1 
ATOM   2106 C  CG2   . ILE A 1  275 ? -34.573 51.405 9.181   1.00 40.17  ? 272 ILE A CG2   1 
ATOM   2107 C  CD1   . ILE A 1  275 ? -33.486 54.036 10.457  1.00 42.82  ? 272 ILE A CD1   1 
ATOM   2108 N  N     . ASP A 1  276 ? -33.197 53.335 5.828   1.00 41.42  ? 273 ASP A N     1 
ATOM   2109 C  CA    . ASP A 1  276 ? -31.932 53.072 5.157   1.00 41.21  ? 273 ASP A CA    1 
ATOM   2110 C  C     . ASP A 1  276 ? -30.898 52.556 6.125   1.00 41.14  ? 273 ASP A C     1 
ATOM   2111 O  O     . ASP A 1  276 ? -30.858 53.000 7.269   1.00 41.53  ? 273 ASP A O     1 
ATOM   2112 C  CB    . ASP A 1  276 ? -31.427 54.341 4.495   1.00 40.89  ? 273 ASP A CB    1 
ATOM   2113 C  CG    . ASP A 1  276 ? -32.124 54.618 3.188   1.00 41.87  ? 273 ASP A CG    1 
ATOM   2114 O  OD1   . ASP A 1  276 ? -32.726 53.674 2.612   1.00 40.82  ? 273 ASP A OD1   1 
ATOM   2115 O  OD2   . ASP A 1  276 ? -32.057 55.777 2.720   1.00 43.90  ? 273 ASP A OD2   1 
ATOM   2116 N  N     . SER A 1  277 ? -30.087 51.600 5.684   1.00 40.82  ? 274 SER A N     1 
ATOM   2117 C  CA    . SER A 1  277 ? -28.898 51.220 6.434   1.00 40.79  ? 274 SER A CA    1 
ATOM   2118 C  C     . SER A 1  277 ? -27.774 52.203 6.102   1.00 40.44  ? 274 SER A C     1 
ATOM   2119 O  O     . SER A 1  277 ? -28.022 53.229 5.502   1.00 40.71  ? 274 SER A O     1 
ATOM   2120 C  CB    . SER A 1  277 ? -28.498 49.744 6.176   1.00 41.06  ? 274 SER A CB    1 
ATOM   2121 O  OG    . SER A 1  277 ? -27.795 49.562 4.955   1.00 41.67  ? 274 SER A OG    1 
ATOM   2122 N  N     . ASN A 1  278 ? -26.547 51.886 6.499   1.00 40.41  ? 275 ASN A N     1 
ATOM   2123 C  CA    . ASN A 1  278 ? -25.388 52.751 6.302   1.00 40.18  ? 275 ASN A CA    1 
ATOM   2124 C  C     . ASN A 1  278 ? -24.846 52.624 4.879   1.00 40.46  ? 275 ASN A C     1 
ATOM   2125 O  O     . ASN A 1  278 ? -23.742 52.113 4.634   1.00 40.04  ? 275 ASN A O     1 
ATOM   2126 C  CB    . ASN A 1  278 ? -24.321 52.418 7.358   1.00 40.11  ? 275 ASN A CB    1 
ATOM   2127 C  CG    . ASN A 1  278 ? -23.102 53.331 7.294   1.00 39.81  ? 275 ASN A CG    1 
ATOM   2128 O  OD1   . ASN A 1  278 ? -23.205 54.506 6.924   1.00 39.13  ? 275 ASN A OD1   1 
ATOM   2129 N  ND2   . ASN A 1  278 ? -21.930 52.785 7.663   1.00 37.67  ? 275 ASN A ND2   1 
ATOM   2130 N  N     . THR A 1  279 ? -25.656 53.064 3.931   1.00 40.76  ? 276 THR A N     1 
ATOM   2131 C  CA    . THR A 1  279 ? -25.224 53.136 2.547   1.00 41.35  ? 276 THR A CA    1 
ATOM   2132 C  C     . THR A 1  279 ? -25.194 54.601 2.129   1.00 42.16  ? 276 THR A C     1 
ATOM   2133 O  O     . THR A 1  279 ? -25.802 55.461 2.798   1.00 42.54  ? 276 THR A O     1 
ATOM   2134 C  CB    . THR A 1  279 ? -26.148 52.336 1.613   1.00 41.34  ? 276 THR A CB    1 
ATOM   2135 O  OG1   . THR A 1  279 ? -27.496 52.749 1.812   1.00 40.61  ? 276 THR A OG1   1 
ATOM   2136 C  CG2   . THR A 1  279 ? -26.043 50.834 1.887   1.00 41.43  ? 276 THR A CG2   1 
ATOM   2137 N  N     . PRO A 1  280 ? -24.488 54.903 1.030   1.00 42.42  ? 277 PRO A N     1 
ATOM   2138 C  CA    . PRO A 1  280 ? -24.366 56.294 0.595   1.00 42.51  ? 277 PRO A CA    1 
ATOM   2139 C  C     . PRO A 1  280 ? -25.712 56.986 0.375   1.00 42.99  ? 277 PRO A C     1 
ATOM   2140 O  O     . PRO A 1  280 ? -26.681 56.359 -0.021  1.00 43.56  ? 277 PRO A O     1 
ATOM   2141 C  CB    . PRO A 1  280 ? -23.583 56.181 -0.713  1.00 42.54  ? 277 PRO A CB    1 
ATOM   2142 C  CG    . PRO A 1  280 ? -22.784 54.909 -0.574  1.00 42.61  ? 277 PRO A CG    1 
ATOM   2143 C  CD    . PRO A 1  280 ? -23.649 53.982 0.232   1.00 42.47  ? 277 PRO A CD    1 
ATOM   2144 N  N     . PHE A 1  281 ? -25.766 58.281 0.652   1.00 43.82  ? 278 PHE A N     1 
ATOM   2145 C  CA    . PHE A 1  281 ? -26.992 59.076 0.521   1.00 44.06  ? 278 PHE A CA    1 
ATOM   2146 C  C     . PHE A 1  281 ? -28.197 58.481 1.243   1.00 44.92  ? 278 PHE A C     1 
ATOM   2147 O  O     . PHE A 1  281 ? -29.307 58.511 0.714   1.00 45.19  ? 278 PHE A O     1 
ATOM   2148 C  CB    . PHE A 1  281 ? -27.314 59.302 -0.956  1.00 43.59  ? 278 PHE A CB    1 
ATOM   2149 C  CG    . PHE A 1  281 ? -26.214 59.961 -1.702  1.00 41.54  ? 278 PHE A CG    1 
ATOM   2150 C  CD1   . PHE A 1  281 ? -26.227 61.332 -1.904  1.00 38.52  ? 278 PHE A CD1   1 
ATOM   2151 C  CD2   . PHE A 1  281 ? -25.145 59.219 -2.181  1.00 40.22  ? 278 PHE A CD2   1 
ATOM   2152 C  CE1   . PHE A 1  281 ? -25.208 61.949 -2.581  1.00 37.51  ? 278 PHE A CE1   1 
ATOM   2153 C  CE2   . PHE A 1  281 ? -24.112 59.830 -2.876  1.00 38.98  ? 278 PHE A CE2   1 
ATOM   2154 C  CZ    . PHE A 1  281 ? -24.145 61.197 -3.073  1.00 38.89  ? 278 PHE A CZ    1 
ATOM   2155 N  N     . ALA A 1  282 ? -27.976 57.939 2.439   1.00 45.85  ? 279 ALA A N     1 
ATOM   2156 C  CA    . ALA A 1  282 ? -29.063 57.411 3.269   1.00 47.06  ? 279 ALA A CA    1 
ATOM   2157 C  C     . ALA A 1  282 ? -30.079 58.489 3.601   1.00 47.85  ? 279 ALA A C     1 
ATOM   2158 O  O     . ALA A 1  282 ? -29.716 59.612 3.956   1.00 48.25  ? 279 ALA A O     1 
ATOM   2159 C  CB    . ALA A 1  282 ? -28.517 56.797 4.551   1.00 46.63  ? 279 ALA A CB    1 
ATOM   2160 N  N     . ASN A 1  283 ? -31.350 58.143 3.482   1.00 49.16  ? 280 ASN A N     1 
ATOM   2161 C  CA    . ASN A 1  283 ? -32.426 59.063 3.795   1.00 50.94  ? 280 ASN A CA    1 
ATOM   2162 C  C     . ASN A 1  283 ? -32.546 59.297 5.295   1.00 52.14  ? 280 ASN A C     1 
ATOM   2163 O  O     . ASN A 1  283 ? -32.566 58.357 6.076   1.00 51.99  ? 280 ASN A O     1 
ATOM   2164 C  CB    . ASN A 1  283 ? -33.741 58.540 3.231   1.00 50.90  ? 280 ASN A CB    1 
ATOM   2165 C  CG    . ASN A 1  283 ? -34.916 59.424 3.583   1.00 51.84  ? 280 ASN A CG    1 
ATOM   2166 O  OD1   . ASN A 1  283 ? -35.386 59.417 4.719   1.00 52.53  ? 280 ASN A OD1   1 
ATOM   2167 N  ND2   . ASN A 1  283 ? -35.405 60.186 2.607   1.00 51.55  ? 280 ASN A ND2   1 
ATOM   2168 N  N     . GLN A 1  284 ? -32.650 60.558 5.693   1.00 54.29  ? 281 GLN A N     1 
ATOM   2169 C  CA    . GLN A 1  284 ? -32.605 60.908 7.117   1.00 56.51  ? 281 GLN A CA    1 
ATOM   2170 C  C     . GLN A 1  284 ? -33.952 61.363 7.703   1.00 56.73  ? 281 GLN A C     1 
ATOM   2171 O  O     . GLN A 1  284 ? -34.059 61.632 8.896   1.00 57.48  ? 281 GLN A O     1 
ATOM   2172 C  CB    . GLN A 1  284 ? -31.488 61.926 7.382   1.00 56.84  ? 281 GLN A CB    1 
ATOM   2173 C  CG    . GLN A 1  284 ? -30.120 61.460 6.870   1.00 61.34  ? 281 GLN A CG    1 
ATOM   2174 C  CD    . GLN A 1  284 ? -29.011 61.566 7.923   1.00 68.28  ? 281 GLN A CD    1 
ATOM   2175 O  OE1   . GLN A 1  284 ? -28.414 62.636 8.120   1.00 69.41  ? 281 GLN A OE1   1 
ATOM   2176 N  NE2   . GLN A 1  284 ? -28.727 60.443 8.603   1.00 70.74  ? 281 GLN A NE2   1 
ATOM   2177 N  N     . ASP A 1  285 ? -34.982 61.397 6.869   1.00 56.97  ? 282 ASP A N     1 
ATOM   2178 C  CA    . ASP A 1  285 ? -36.296 61.899 7.259   1.00 57.28  ? 282 ASP A CA    1 
ATOM   2179 C  C     . ASP A 1  285 ? -36.961 61.346 8.516   1.00 57.16  ? 282 ASP A C     1 
ATOM   2180 O  O     . ASP A 1  285 ? -37.917 61.948 8.973   1.00 57.41  ? 282 ASP A O     1 
ATOM   2181 C  CB    . ASP A 1  285 ? -37.291 61.735 6.105   1.00 57.68  ? 282 ASP A CB    1 
ATOM   2182 C  CG    . ASP A 1  285 ? -36.883 62.492 4.872   1.00 58.64  ? 282 ASP A CG    1 
ATOM   2183 O  OD1   . ASP A 1  285 ? -35.992 63.374 4.963   1.00 59.31  ? 282 ASP A OD1   1 
ATOM   2184 O  OD2   . ASP A 1  285 ? -37.468 62.193 3.811   1.00 59.86  ? 282 ASP A OD2   1 
ATOM   2185 N  N     . THR A 1  286 ? -36.522 60.210 9.054   1.00 56.92  ? 283 THR A N     1 
ATOM   2186 C  CA    . THR A 1  286 ? -37.214 59.638 10.215  1.00 56.85  ? 283 THR A CA    1 
ATOM   2187 C  C     . THR A 1  286 ? -36.295 59.535 11.410  1.00 57.45  ? 283 THR A C     1 
ATOM   2188 O  O     . THR A 1  286 ? -36.544 58.792 12.356  1.00 57.32  ? 283 THR A O     1 
ATOM   2189 C  CB    . THR A 1  286 ? -37.859 58.275 9.920   1.00 56.80  ? 283 THR A CB    1 
ATOM   2190 O  OG1   . THR A 1  286 ? -36.869 57.360 9.427   1.00 56.53  ? 283 THR A OG1   1 
ATOM   2191 C  CG2   . THR A 1  286 ? -38.981 58.429 8.908   1.00 56.43  ? 283 THR A CG2   1 
ATOM   2192 N  N     . LEU A 1  287 ? -35.231 60.320 11.361  1.00 58.40  ? 284 LEU A N     1 
ATOM   2193 C  CA    . LEU A 1  287 ? -34.243 60.365 12.419  1.00 59.38  ? 284 LEU A CA    1 
ATOM   2194 C  C     . LEU A 1  287 ? -34.855 60.627 13.801  1.00 59.91  ? 284 LEU A C     1 
ATOM   2195 O  O     . LEU A 1  287 ? -34.435 60.029 14.785  1.00 60.18  ? 284 LEU A O     1 
ATOM   2196 C  CB    . LEU A 1  287 ? -33.223 61.439 12.081  1.00 59.56  ? 284 LEU A CB    1 
ATOM   2197 C  CG    . LEU A 1  287 ? -31.785 61.179 12.507  1.00 61.12  ? 284 LEU A CG    1 
ATOM   2198 C  CD1   . LEU A 1  287 ? -31.239 59.849 11.934  1.00 61.11  ? 284 LEU A CD1   1 
ATOM   2199 C  CD2   . LEU A 1  287 ? -30.932 62.385 12.101  1.00 61.88  ? 284 LEU A CD2   1 
ATOM   2200 N  N     . ASP A 1  288 ? -35.860 61.505 13.865  1.00 60.52  ? 285 ASP A N     1 
ATOM   2201 C  CA    . ASP A 1  288 ? -36.518 61.858 15.133  1.00 60.44  ? 285 ASP A CA    1 
ATOM   2202 C  C     . ASP A 1  288 ? -37.735 61.008 15.502  1.00 60.21  ? 285 ASP A C     1 
ATOM   2203 O  O     . ASP A 1  288 ? -38.311 61.198 16.575  1.00 60.63  ? 285 ASP A O     1 
ATOM   2204 C  CB    . ASP A 1  288 ? -36.904 63.341 15.154  1.00 60.53  ? 285 ASP A CB    1 
ATOM   2205 C  CG    . ASP A 1  288 ? -35.697 64.259 15.123  1.00 61.69  ? 285 ASP A CG    1 
ATOM   2206 O  OD1   . ASP A 1  288 ? -34.689 63.979 15.812  1.00 63.52  ? 285 ASP A OD1   1 
ATOM   2207 O  OD2   . ASP A 1  288 ? -35.759 65.271 14.406  1.00 62.61  ? 285 ASP A OD2   1 
ATOM   2208 N  N     . LEU A 1  289 ? -38.139 60.080 14.637  1.00 59.39  ? 286 LEU A N     1 
ATOM   2209 C  CA    . LEU A 1  289 ? -39.221 59.171 15.015  1.00 58.58  ? 286 LEU A CA    1 
ATOM   2210 C  C     . LEU A 1  289 ? -38.634 58.040 15.822  1.00 57.87  ? 286 LEU A C     1 
ATOM   2211 O  O     . LEU A 1  289 ? -37.461 57.719 15.675  1.00 57.56  ? 286 LEU A O     1 
ATOM   2212 C  CB    . LEU A 1  289 ? -39.974 58.624 13.801  1.00 58.61  ? 286 LEU A CB    1 
ATOM   2213 C  CG    . LEU A 1  289 ? -40.480 59.623 12.752  1.00 59.45  ? 286 LEU A CG    1 
ATOM   2214 C  CD1   . LEU A 1  289 ? -41.429 58.915 11.808  1.00 60.26  ? 286 LEU A CD1   1 
ATOM   2215 C  CD2   . LEU A 1  289 ? -41.161 60.861 13.357  1.00 58.91  ? 286 LEU A CD2   1 
ATOM   2216 N  N     . THR A 1  290 ? -39.441 57.458 16.699  1.00 57.33  ? 287 THR A N     1 
ATOM   2217 C  CA    . THR A 1  290 ? -39.066 56.209 17.355  1.00 56.84  ? 287 THR A CA    1 
ATOM   2218 C  C     . THR A 1  290 ? -39.207 55.104 16.304  1.00 56.60  ? 287 THR A C     1 
ATOM   2219 O  O     . THR A 1  290 ? -39.849 55.303 15.265  1.00 56.78  ? 287 THR A O     1 
ATOM   2220 C  CB    . THR A 1  290 ? -39.967 55.904 18.587  1.00 56.85  ? 287 THR A CB    1 
ATOM   2221 O  OG1   . THR A 1  290 ? -41.314 55.625 18.163  1.00 57.63  ? 287 THR A OG1   1 
ATOM   2222 C  CG2   . THR A 1  290 ? -39.985 57.076 19.534  1.00 56.00  ? 287 THR A CG2   1 
ATOM   2223 N  N     . ARG A 1  291 ? -38.623 53.944 16.559  1.00 56.09  ? 288 ARG A N     1 
ATOM   2224 C  CA    . ARG A 1  291 ? -38.771 52.847 15.633  1.00 55.93  ? 288 ARG A CA    1 
ATOM   2225 C  C     . ARG A 1  291 ? -40.253 52.566 15.430  1.00 56.68  ? 288 ARG A C     1 
ATOM   2226 O  O     . ARG A 1  291 ? -40.695 52.353 14.302  1.00 56.79  ? 288 ARG A O     1 
ATOM   2227 C  CB    . ARG A 1  291 ? -38.034 51.610 16.141  1.00 55.55  ? 288 ARG A CB    1 
ATOM   2228 C  CG    . ARG A 1  291 ? -38.102 50.384 15.236  1.00 53.53  ? 288 ARG A CG    1 
ATOM   2229 C  CD    . ARG A 1  291 ? -37.849 50.707 13.773  1.00 49.11  ? 288 ARG A CD    1 
ATOM   2230 N  NE    . ARG A 1  291 ? -37.663 49.500 12.975  1.00 47.51  ? 288 ARG A NE    1 
ATOM   2231 C  CZ    . ARG A 1  291 ? -37.524 49.482 11.651  1.00 46.83  ? 288 ARG A CZ    1 
ATOM   2232 N  NH1   . ARG A 1  291 ? -37.574 50.614 10.950  1.00 44.72  ? 288 ARG A NH1   1 
ATOM   2233 N  NH2   . ARG A 1  291 ? -37.348 48.322 11.023  1.00 46.13  ? 288 ARG A NH2   1 
ATOM   2234 N  N     . GLU A 1  292 ? -41.008 52.601 16.526  1.00 57.54  ? 289 GLU A N     1 
ATOM   2235 C  CA    . GLU A 1  292 ? -42.452 52.356 16.523  1.00 58.49  ? 289 GLU A CA    1 
ATOM   2236 C  C     . GLU A 1  292 ? -43.157 53.350 15.628  1.00 58.01  ? 289 GLU A C     1 
ATOM   2237 O  O     . GLU A 1  292 ? -43.963 52.972 14.778  1.00 57.84  ? 289 GLU A O     1 
ATOM   2238 C  CB    . GLU A 1  292 ? -43.020 52.444 17.939  1.00 59.17  ? 289 GLU A CB    1 
ATOM   2239 C  CG    . GLU A 1  292 ? -44.185 51.496 18.216  1.00 63.76  ? 289 GLU A CG    1 
ATOM   2240 C  CD    . GLU A 1  292 ? -44.292 51.087 19.701  1.00 69.99  ? 289 GLU A CD    1 
ATOM   2241 O  OE1   . GLU A 1  292 ? -43.362 50.410 20.220  1.00 70.51  ? 289 GLU A OE1   1 
ATOM   2242 O  OE2   . GLU A 1  292 ? -45.319 51.436 20.340  1.00 72.13  ? 289 GLU A OE2   1 
ATOM   2243 N  N     . GLU A 1  293 ? -42.845 54.625 15.803  1.00 57.70  ? 290 GLU A N     1 
ATOM   2244 C  CA    . GLU A 1  293 ? -43.428 55.629 14.941  1.00 57.51  ? 290 GLU A CA    1 
ATOM   2245 C  C     . GLU A 1  293 ? -43.046 55.349 13.480  1.00 56.73  ? 290 GLU A C     1 
ATOM   2246 O  O     . GLU A 1  293 ? -43.901 55.403 12.587  1.00 56.58  ? 290 GLU A O     1 
ATOM   2247 C  CB    . GLU A 1  293 ? -43.027 57.027 15.408  1.00 58.03  ? 290 GLU A CB    1 
ATOM   2248 C  CG    . GLU A 1  293 ? -43.520 57.313 16.834  1.00 60.07  ? 290 GLU A CG    1 
ATOM   2249 C  CD    . GLU A 1  293 ? -43.067 58.655 17.398  1.00 63.14  ? 290 GLU A CD    1 
ATOM   2250 O  OE1   . GLU A 1  293 ? -41.998 59.179 17.015  1.00 64.21  ? 290 GLU A OE1   1 
ATOM   2251 O  OE2   . GLU A 1  293 ? -43.789 59.187 18.258  1.00 65.10  ? 290 GLU A OE2   1 
ATOM   2252 N  N     . GLU A 1  294 ? -41.775 55.008 13.261  1.00 55.56  ? 291 GLU A N     1 
ATOM   2253 C  CA    . GLU A 1  294 ? -41.242 54.658 11.940  1.00 54.24  ? 291 GLU A CA    1 
ATOM   2254 C  C     . GLU A 1  294 ? -41.982 53.489 11.266  1.00 53.86  ? 291 GLU A C     1 
ATOM   2255 O  O     . GLU A 1  294 ? -42.287 53.550 10.084  1.00 53.34  ? 291 GLU A O     1 
ATOM   2256 C  CB    . GLU A 1  294 ? -39.777 54.295 12.101  1.00 54.21  ? 291 GLU A CB    1 
ATOM   2257 C  CG    . GLU A 1  294 ? -38.894 54.592 10.920  1.00 52.93  ? 291 GLU A CG    1 
ATOM   2258 C  CD    . GLU A 1  294 ? -37.432 54.396 11.265  1.00 51.81  ? 291 GLU A CD    1 
ATOM   2259 O  OE1   . GLU A 1  294 ? -37.051 53.242 11.572  1.00 49.18  ? 291 GLU A OE1   1 
ATOM   2260 O  OE2   . GLU A 1  294 ? -36.674 55.399 11.243  1.00 51.76  ? 291 GLU A OE2   1 
ATOM   2261 N  N     . LEU A 1  295 ? -42.259 52.434 12.034  1.00 53.40  ? 292 LEU A N     1 
ATOM   2262 C  CA    . LEU A 1  295 ? -42.939 51.239 11.544  1.00 53.31  ? 292 LEU A CA    1 
ATOM   2263 C  C     . LEU A 1  295 ? -44.406 51.500 11.258  1.00 53.40  ? 292 LEU A C     1 
ATOM   2264 O  O     . LEU A 1  295 ? -45.075 50.762 10.526  1.00 53.73  ? 292 LEU A O     1 
ATOM   2265 C  CB    . LEU A 1  295 ? -42.819 50.106 12.567  1.00 53.18  ? 292 LEU A CB    1 
ATOM   2266 C  CG    . LEU A 1  295 ? -41.473 49.385 12.749  1.00 53.92  ? 292 LEU A CG    1 
ATOM   2267 C  CD1   . LEU A 1  295 ? -41.631 48.212 13.706  1.00 53.74  ? 292 LEU A CD1   1 
ATOM   2268 C  CD2   . LEU A 1  295 ? -40.902 48.887 11.420  1.00 52.62  ? 292 LEU A CD2   1 
ATOM   2269 N  N     . SER A 1  296 ? -44.906 52.557 11.865  1.00 53.47  ? 293 SER A N     1 
ATOM   2270 C  CA    . SER A 1  296 ? -46.279 52.971 11.696  1.00 53.21  ? 293 SER A CA    1 
ATOM   2271 C  C     . SER A 1  296 ? -46.384 53.720 10.356  1.00 52.87  ? 293 SER A C     1 
ATOM   2272 O  O     . SER A 1  296 ? -47.262 53.432 9.545   1.00 52.49  ? 293 SER A O     1 
ATOM   2273 C  CB    . SER A 1  296 ? -46.692 53.826 12.904  1.00 53.11  ? 293 SER A CB    1 
ATOM   2274 O  OG    . SER A 1  296 ? -47.921 54.479 12.710  1.00 53.33  ? 293 SER A OG    1 
ATOM   2275 N  N     . LEU A 1  297 ? -45.472 54.659 10.124  1.00 52.57  ? 294 LEU A N     1 
ATOM   2276 C  CA    . LEU A 1  297 ? -45.374 55.328 8.832   1.00 52.90  ? 294 LEU A CA    1 
ATOM   2277 C  C     . LEU A 1  297 ? -45.078 54.333 7.683   1.00 53.15  ? 294 LEU A C     1 
ATOM   2278 O  O     . LEU A 1  297 ? -45.647 54.443 6.603   1.00 53.15  ? 294 LEU A O     1 
ATOM   2279 C  CB    . LEU A 1  297 ? -44.317 56.429 8.889   1.00 52.70  ? 294 LEU A CB    1 
ATOM   2280 C  CG    . LEU A 1  297 ? -43.935 57.085 7.569   1.00 52.87  ? 294 LEU A CG    1 
ATOM   2281 C  CD1   . LEU A 1  297 ? -45.128 57.811 6.948   1.00 52.95  ? 294 LEU A CD1   1 
ATOM   2282 C  CD2   . LEU A 1  297 ? -42.763 58.036 7.787   1.00 53.84  ? 294 LEU A CD2   1 
ATOM   2283 N  N     . LEU A 1  298 ? -44.209 53.355 7.928   1.00 53.29  ? 295 LEU A N     1 
ATOM   2284 C  CA    . LEU A 1  298 ? -43.960 52.293 6.961   1.00 53.55  ? 295 LEU A CA    1 
ATOM   2285 C  C     . LEU A 1  298 ? -45.215 51.508 6.536   1.00 54.64  ? 295 LEU A C     1 
ATOM   2286 O  O     . LEU A 1  298 ? -45.436 51.294 5.342   1.00 54.91  ? 295 LEU A O     1 
ATOM   2287 C  CB    . LEU A 1  298 ? -42.901 51.333 7.483   1.00 52.94  ? 295 LEU A CB    1 
ATOM   2288 C  CG    . LEU A 1  298 ? -42.580 50.181 6.535   1.00 51.81  ? 295 LEU A CG    1 
ATOM   2289 C  CD1   . LEU A 1  298 ? -41.829 50.701 5.318   1.00 48.90  ? 295 LEU A CD1   1 
ATOM   2290 C  CD2   . LEU A 1  298 ? -41.812 49.083 7.263   1.00 50.66  ? 295 LEU A CD2   1 
ATOM   2291 N  N     . GLN A 1  299 ? -46.023 51.066 7.503   1.00 55.97  ? 296 GLN A N     1 
ATOM   2292 C  CA    . GLN A 1  299 ? -47.276 50.354 7.203   1.00 56.91  ? 296 GLN A CA    1 
ATOM   2293 C  C     . GLN A 1  299 ? -48.183 51.168 6.321   1.00 56.43  ? 296 GLN A C     1 
ATOM   2294 O  O     . GLN A 1  299 ? -48.865 50.621 5.460   1.00 56.74  ? 296 GLN A O     1 
ATOM   2295 C  CB    . GLN A 1  299 ? -48.024 49.988 8.468   1.00 57.45  ? 296 GLN A CB    1 
ATOM   2296 C  CG    . GLN A 1  299 ? -47.435 48.780 9.198   1.00 62.43  ? 296 GLN A CG    1 
ATOM   2297 C  CD    . GLN A 1  299 ? -48.083 48.564 10.572  1.00 68.38  ? 296 GLN A CD    1 
ATOM   2298 O  OE1   . GLN A 1  299 ? -47.382 48.397 11.591  1.00 69.49  ? 296 GLN A OE1   1 
ATOM   2299 N  NE2   . GLN A 1  299 ? -49.429 48.589 10.608  1.00 68.61  ? 296 GLN A NE2   1 
ATOM   2300 N  N     . GLU A 1  300 ? -48.163 52.475 6.538   1.00 55.93  ? 297 GLU A N     1 
ATOM   2301 C  CA    . GLU A 1  300 ? -48.947 53.411 5.775   1.00 56.13  ? 297 GLU A CA    1 
ATOM   2302 C  C     . GLU A 1  300 ? -48.415 53.533 4.338   1.00 55.32  ? 297 GLU A C     1 
ATOM   2303 O  O     . GLU A 1  300 ? -49.182 53.418 3.387   1.00 55.72  ? 297 GLU A O     1 
ATOM   2304 C  CB    . GLU A 1  300 ? -48.961 54.772 6.500   1.00 56.92  ? 297 GLU A CB    1 
ATOM   2305 C  CG    . GLU A 1  300 ? -49.564 55.951 5.727   1.00 60.10  ? 297 GLU A CG    1 
ATOM   2306 C  CD    . GLU A 1  300 ? -51.059 55.778 5.442   1.00 65.73  ? 297 GLU A CD    1 
ATOM   2307 O  OE1   . GLU A 1  300 ? -51.680 54.836 6.007   1.00 67.30  ? 297 GLU A OE1   1 
ATOM   2308 O  OE2   . GLU A 1  300 ? -51.605 56.584 4.643   1.00 67.84  ? 297 GLU A OE2   1 
ATOM   2309 N  N     . ILE A 1  301 ? -47.115 53.779 4.187   1.00 53.96  ? 298 ILE A N     1 
ATOM   2310 C  CA    . ILE A 1  301 ? -46.478 53.823 2.884   1.00 52.53  ? 298 ILE A CA    1 
ATOM   2311 C  C     . ILE A 1  301 ? -46.777 52.555 2.074   1.00 52.17  ? 298 ILE A C     1 
ATOM   2312 O  O     . ILE A 1  301 ? -47.040 52.629 0.873   1.00 51.68  ? 298 ILE A O     1 
ATOM   2313 C  CB    . ILE A 1  301 ? -44.960 53.973 3.026   1.00 52.65  ? 298 ILE A CB    1 
ATOM   2314 C  CG1   . ILE A 1  301 ? -44.602 55.393 3.454   1.00 51.80  ? 298 ILE A CG1   1 
ATOM   2315 C  CG2   . ILE A 1  301 ? -44.226 53.592 1.721   1.00 51.80  ? 298 ILE A CG2   1 
ATOM   2316 C  CD1   . ILE A 1  301 ? -43.270 55.459 4.225   1.00 51.61  ? 298 ILE A CD1   1 
ATOM   2317 N  N     . ARG A 1  302 ? -46.751 51.401 2.738   1.00 51.62  ? 299 ARG A N     1 
ATOM   2318 C  CA    . ARG A 1  302 ? -46.893 50.120 2.048   1.00 51.40  ? 299 ARG A CA    1 
ATOM   2319 C  C     . ARG A 1  302 ? -48.284 49.930 1.411   1.00 52.27  ? 299 ARG A C     1 
ATOM   2320 O  O     . ARG A 1  302 ? -48.442 49.229 0.400   1.00 52.33  ? 299 ARG A O     1 
ATOM   2321 C  CB    . ARG A 1  302 ? -46.569 48.964 2.994   1.00 50.86  ? 299 ARG A CB    1 
ATOM   2322 C  CG    . ARG A 1  302 ? -45.100 48.771 3.306   1.00 48.53  ? 299 ARG A CG    1 
ATOM   2323 C  CD    . ARG A 1  302 ? -44.880 47.552 4.198   1.00 45.69  ? 299 ARG A CD    1 
ATOM   2324 N  NE    . ARG A 1  302 ? -43.459 47.322 4.427   1.00 46.11  ? 299 ARG A NE    1 
ATOM   2325 C  CZ    . ARG A 1  302 ? -42.928 46.629 5.438   1.00 46.63  ? 299 ARG A CZ    1 
ATOM   2326 N  NH1   . ARG A 1  302 ? -43.692 46.068 6.372   1.00 44.95  ? 299 ARG A NH1   1 
ATOM   2327 N  NH2   . ARG A 1  302 ? -41.602 46.510 5.520   1.00 45.35  ? 299 ARG A NH2   1 
ATOM   2328 N  N     . THR A 1  303 ? -49.291 50.562 1.996   1.00 52.91  ? 300 THR A N     1 
ATOM   2329 C  CA    . THR A 1  303 ? -50.647 50.384 1.512   1.00 53.78  ? 300 THR A CA    1 
ATOM   2330 C  C     . THR A 1  303 ? -51.029 51.442 0.490   1.00 53.80  ? 300 THR A C     1 
ATOM   2331 O  O     . THR A 1  303 ? -51.952 51.234 -0.286  1.00 54.83  ? 300 THR A O     1 
ATOM   2332 C  CB    . THR A 1  303 ? -51.673 50.370 2.662   1.00 53.98  ? 300 THR A CB    1 
ATOM   2333 O  OG1   . THR A 1  303 ? -51.552 51.581 3.406   1.00 54.84  ? 300 THR A OG1   1 
ATOM   2334 C  CG2   . THR A 1  303 ? -51.431 49.176 3.603   1.00 54.66  ? 300 THR A CG2   1 
ATOM   2335 N  N     . SER A 1  304 ? -50.316 52.561 0.463   1.00 53.27  ? 301 SER A N     1 
ATOM   2336 C  CA    . SER A 1  304 ? -50.660 53.627 -0.465  1.00 53.28  ? 301 SER A CA    1 
ATOM   2337 C  C     . SER A 1  304 ? -49.790 53.674 -1.722  1.00 52.78  ? 301 SER A C     1 
ATOM   2338 O  O     . SER A 1  304 ? -49.699 54.712 -2.361  1.00 52.26  ? 301 SER A O     1 
ATOM   2339 C  CB    . SER A 1  304 ? -50.545 54.958 0.245   1.00 53.41  ? 301 SER A CB    1 
ATOM   2340 O  OG    . SER A 1  304 ? -49.169 55.242 0.431   1.00 55.61  ? 301 SER A OG    1 
ATOM   2341 N  N     . LEU A 1  305 ? -49.138 52.569 -2.057  1.00 52.83  ? 302 LEU A N     1 
ATOM   2342 C  CA    . LEU A 1  305 ? -48.241 52.526 -3.210  1.00 52.98  ? 302 LEU A CA    1 
ATOM   2343 C  C     . LEU A 1  305 ? -49.053 52.515 -4.497  1.00 53.96  ? 302 LEU A C     1 
ATOM   2344 O  O     . LEU A 1  305 ? -50.115 51.889 -4.564  1.00 54.33  ? 302 LEU A O     1 
ATOM   2345 C  CB    . LEU A 1  305 ? -47.338 51.291 -3.156  1.00 52.16  ? 302 LEU A CB    1 
ATOM   2346 C  CG    . LEU A 1  305 ? -46.229 51.221 -2.100  1.00 50.60  ? 302 LEU A CG    1 
ATOM   2347 C  CD1   . LEU A 1  305 ? -45.511 49.911 -2.208  1.00 49.54  ? 302 LEU A CD1   1 
ATOM   2348 C  CD2   . LEU A 1  305 ? -45.226 52.340 -2.232  1.00 47.43  ? 302 LEU A CD2   1 
ATOM   2349 N  N     . TYR A 1  306 ? -48.561 53.228 -5.503  1.00 54.88  ? 303 TYR A N     1 
ATOM   2350 C  CA    . TYR A 1  306 ? -49.194 53.295 -6.814  1.00 56.06  ? 303 TYR A CA    1 
ATOM   2351 C  C     . TYR A 1  306 ? -49.461 51.916 -7.375  1.00 56.23  ? 303 TYR A C     1 
ATOM   2352 O  O     . TYR A 1  306 ? -48.558 51.084 -7.431  1.00 56.11  ? 303 TYR A O     1 
ATOM   2353 C  CB    . TYR A 1  306 ? -48.283 54.032 -7.789  1.00 56.55  ? 303 TYR A CB    1 
ATOM   2354 C  CG    . TYR A 1  306 ? -48.618 53.760 -9.241  1.00 59.66  ? 303 TYR A CG    1 
ATOM   2355 C  CD1   . TYR A 1  306 ? -49.682 54.432 -9.855  1.00 61.87  ? 303 TYR A CD1   1 
ATOM   2356 C  CD2   . TYR A 1  306 ? -47.885 52.828 -10.003 1.00 60.49  ? 303 TYR A CD2   1 
ATOM   2357 C  CE1   . TYR A 1  306 ? -50.016 54.203 -11.188 1.00 62.91  ? 303 TYR A CE1   1 
ATOM   2358 C  CE2   . TYR A 1  306 ? -48.212 52.588 -11.342 1.00 62.06  ? 303 TYR A CE2   1 
ATOM   2359 C  CZ    . TYR A 1  306 ? -49.286 53.290 -11.931 1.00 63.82  ? 303 TYR A CZ    1 
ATOM   2360 O  OH    . TYR A 1  306 ? -49.658 53.101 -13.263 1.00 65.49  ? 303 TYR A OH    1 
ATOM   2361 N  N     . HIS A 1  307 ? -50.692 51.681 -7.811  1.00 56.98  ? 304 HIS A N     1 
ATOM   2362 C  CA    . HIS A 1  307 ? -51.002 50.433 -8.510  1.00 58.09  ? 304 HIS A CA    1 
ATOM   2363 C  C     . HIS A 1  307 ? -51.527 50.646 -9.940  1.00 57.55  ? 304 HIS A C     1 
ATOM   2364 O  O     . HIS A 1  307 ? -52.518 51.351 -10.159 1.00 57.35  ? 304 HIS A O     1 
ATOM   2365 C  CB    . HIS A 1  307 ? -51.948 49.534 -7.705  1.00 58.83  ? 304 HIS A CB    1 
ATOM   2366 C  CG    . HIS A 1  307 ? -52.078 48.156 -8.279  1.00 62.17  ? 304 HIS A CG    1 
ATOM   2367 N  ND1   . HIS A 1  307 ? -53.142 47.778 -9.078  1.00 63.29  ? 304 HIS A ND1   1 
ATOM   2368 C  CD2   . HIS A 1  307 ? -51.253 47.077 -8.211  1.00 64.13  ? 304 HIS A CD2   1 
ATOM   2369 C  CE1   . HIS A 1  307 ? -52.977 46.523 -9.459  1.00 64.08  ? 304 HIS A CE1   1 
ATOM   2370 N  NE2   . HIS A 1  307 ? -51.840 46.073 -8.947  1.00 64.61  ? 304 HIS A NE2   1 
ATOM   2371 N  N     . PRO A 1  308 ? -50.858 50.030 -10.924 1.00 57.28  ? 305 PRO A N     1 
ATOM   2372 C  CA    . PRO A 1  308 ? -51.269 50.248 -12.321 1.00 57.14  ? 305 PRO A CA    1 
ATOM   2373 C  C     . PRO A 1  308 ? -52.578 49.537 -12.618 1.00 57.27  ? 305 PRO A C     1 
ATOM   2374 O  O     . PRO A 1  308 ? -52.913 48.560 -11.940 1.00 57.39  ? 305 PRO A O     1 
ATOM   2375 C  CB    . PRO A 1  308 ? -50.130 49.623 -13.117 1.00 56.82  ? 305 PRO A CB    1 
ATOM   2376 C  CG    . PRO A 1  308 ? -49.559 48.572 -12.196 1.00 56.97  ? 305 PRO A CG    1 
ATOM   2377 C  CD    . PRO A 1  308 ? -49.741 49.076 -10.797 1.00 56.67  ? 305 PRO A CD    1 
ATOM   2378 N  N     . SER A 1  309 ? -53.325 50.005 -13.608 1.00 57.64  ? 306 SER A N     1 
ATOM   2379 C  CA    . SER A 1  309 ? -54.543 49.276 -13.986 1.00 58.18  ? 306 SER A CA    1 
ATOM   2380 C  C     . SER A 1  309 ? -54.499 48.677 -15.398 1.00 57.65  ? 306 SER A C     1 
ATOM   2381 O  O     . SER A 1  309 ? -53.738 49.133 -16.252 1.00 57.59  ? 306 SER A O     1 
ATOM   2382 C  CB    . SER A 1  309 ? -55.801 50.132 -13.786 1.00 58.53  ? 306 SER A CB    1 
ATOM   2383 O  OG    . SER A 1  309 ? -55.788 51.224 -14.687 1.00 60.20  ? 306 SER A OG    1 
ATOM   2384 N  N     . THR A 1  310 ? -55.314 47.633 -15.599 1.00 57.43  ? 307 THR A N     1 
ATOM   2385 C  CA    . THR A 1  310 ? -55.545 46.963 -16.889 1.00 56.81  ? 307 THR A CA    1 
ATOM   2386 C  C     . THR A 1  310 ? -55.671 47.969 -18.052 1.00 55.87  ? 307 THR A C     1 
ATOM   2387 O  O     . THR A 1  310 ? -56.469 48.895 -17.980 1.00 56.03  ? 307 THR A O     1 
ATOM   2388 C  CB    . THR A 1  310 ? -56.808 46.072 -16.775 1.00 57.12  ? 307 THR A CB    1 
ATOM   2389 O  OG1   . THR A 1  310 ? -56.771 45.015 -17.741 1.00 57.74  ? 307 THR A OG1   1 
ATOM   2390 C  CG2   . THR A 1  310 ? -58.118 46.907 -16.941 1.00 58.09  ? 307 THR A CG2   1 
ATOM   2391 N  N     . PRO A 1  311 ? -54.848 47.822 -19.106 1.00 55.29  ? 308 PRO A N     1 
ATOM   2392 C  CA    . PRO A 1  311 ? -54.887 48.735 -20.274 1.00 54.79  ? 308 PRO A CA    1 
ATOM   2393 C  C     . PRO A 1  311 ? -56.080 48.505 -21.211 1.00 54.43  ? 308 PRO A C     1 
ATOM   2394 O  O     . PRO A 1  311 ? -56.685 47.435 -21.172 1.00 54.23  ? 308 PRO A O     1 
ATOM   2395 C  CB    . PRO A 1  311 ? -53.598 48.397 -21.020 1.00 54.53  ? 308 PRO A CB    1 
ATOM   2396 C  CG    . PRO A 1  311 ? -53.302 46.998 -20.652 1.00 54.72  ? 308 PRO A CG    1 
ATOM   2397 C  CD    . PRO A 1  311 ? -53.770 46.824 -19.227 1.00 55.08  ? 308 PRO A CD    1 
ATOM   2398 N  N     . PRO A 1  312 ? -56.402 49.490 -22.068 1.00 54.33  ? 309 PRO A N     1 
ATOM   2399 C  CA    . PRO A 1  312 ? -57.484 49.321 -23.052 1.00 54.32  ? 309 PRO A CA    1 
ATOM   2400 C  C     . PRO A 1  312 ? -57.245 48.121 -23.979 1.00 54.11  ? 309 PRO A C     1 
ATOM   2401 O  O     . PRO A 1  312 ? -56.103 47.888 -24.395 1.00 54.19  ? 309 PRO A O     1 
ATOM   2402 C  CB    . PRO A 1  312 ? -57.418 50.619 -23.872 1.00 54.39  ? 309 PRO A CB    1 
ATOM   2403 C  CG    . PRO A 1  312 ? -56.678 51.589 -23.005 1.00 54.35  ? 309 PRO A CG    1 
ATOM   2404 C  CD    . PRO A 1  312 ? -55.679 50.758 -22.278 1.00 54.29  ? 309 PRO A CD    1 
ATOM   2405 N  N     . ALA A 1  313 ? -58.305 47.366 -24.291 1.00 53.70  ? 310 ALA A N     1 
ATOM   2406 C  CA    . ALA A 1  313 ? -58.202 46.205 -25.196 1.00 53.41  ? 310 ALA A CA    1 
ATOM   2407 C  C     . ALA A 1  313 ? -57.820 46.680 -26.580 1.00 53.13  ? 310 ALA A C     1 
ATOM   2408 O  O     . ALA A 1  313 ? -58.158 47.792 -26.958 1.00 53.13  ? 310 ALA A O     1 
ATOM   2409 C  CB    . ALA A 1  313 ? -59.513 45.442 -25.265 1.00 53.05  ? 310 ALA A CB    1 
ATOM   2410 N  N     . SER A 1  314 ? -57.117 45.852 -27.342 1.00 52.85  ? 311 SER A N     1 
ATOM   2411 C  CA    . SER A 1  314 ? -56.918 46.183 -28.741 1.00 52.79  ? 311 SER A CA    1 
ATOM   2412 C  C     . SER A 1  314 ? -58.252 45.955 -29.479 1.00 52.84  ? 311 SER A C     1 
ATOM   2413 O  O     . SER A 1  314 ? -59.124 45.212 -28.994 1.00 52.47  ? 311 SER A O     1 
ATOM   2414 C  CB    . SER A 1  314 ? -55.777 45.364 -29.332 1.00 52.68  ? 311 SER A CB    1 
ATOM   2415 O  OG    . SER A 1  314 ? -56.241 44.120 -29.813 1.00 52.72  ? 311 SER A OG    1 
ATOM   2416 N  N     . SER A 1  315 ? -58.421 46.599 -30.634 1.00 53.02  ? 312 SER A N     1 
ATOM   2417 C  CA    . SER A 1  315 ? -59.688 46.503 -31.389 1.00 53.13  ? 312 SER A CA    1 
ATOM   2418 C  C     . SER A 1  315 ? -60.019 45.091 -31.865 1.00 52.52  ? 312 SER A C     1 
ATOM   2419 O  O     . SER A 1  315 ? -61.172 44.781 -32.139 1.00 52.83  ? 312 SER A O     1 
ATOM   2420 C  CB    . SER A 1  315 ? -59.693 47.460 -32.581 1.00 53.31  ? 312 SER A CB    1 
ATOM   2421 O  OG    . SER A 1  315 ? -58.383 47.595 -33.101 1.00 55.61  ? 312 SER A OG    1 
ATOM   2422 N  N     . ARG A 1  316 ? -59.017 44.231 -31.956 1.00 52.04  ? 313 ARG A N     1 
ATOM   2423 C  CA    . ARG A 1  316 ? -59.261 42.885 -32.425 1.00 51.75  ? 313 ARG A CA    1 
ATOM   2424 C  C     . ARG A 1  316 ? -58.780 41.803 -31.469 1.00 52.11  ? 313 ARG A C     1 
ATOM   2425 O  O     . ARG A 1  316 ? -58.219 40.781 -31.883 1.00 52.28  ? 313 ARG A O     1 
ATOM   2426 C  CB    . ARG A 1  316 ? -58.711 42.729 -33.838 1.00 51.81  ? 313 ARG A CB    1 
ATOM   2427 C  CG    . ARG A 1  316 ? -59.338 43.735 -34.781 1.00 50.04  ? 313 ARG A CG    1 
ATOM   2428 C  CD    . ARG A 1  316 ? -59.464 43.201 -36.145 1.00 48.20  ? 313 ARG A CD    1 
ATOM   2429 N  NE    . ARG A 1  316 ? -59.930 44.222 -37.072 1.00 48.27  ? 313 ARG A NE    1 
ATOM   2430 C  CZ    . ARG A 1  316 ? -59.607 44.243 -38.363 1.00 48.61  ? 313 ARG A CZ    1 
ATOM   2431 N  NH1   . ARG A 1  316 ? -58.799 43.309 -38.865 1.00 48.94  ? 313 ARG A NH1   1 
ATOM   2432 N  NH2   . ARG A 1  316 ? -60.071 45.202 -39.151 1.00 47.66  ? 313 ARG A NH2   1 
ATOM   2433 N  N     . SER A 1  317 ? -59.022 42.037 -30.181 1.00 52.55  ? 314 SER A N     1 
ATOM   2434 C  CA    . SER A 1  317 ? -58.749 41.048 -29.143 1.00 53.29  ? 314 SER A CA    1 
ATOM   2435 C  C     . SER A 1  317 ? -59.843 39.983 -29.106 1.00 53.61  ? 314 SER A C     1 
ATOM   2436 O  O     . SER A 1  317 ? -60.949 40.194 -29.593 1.00 53.35  ? 314 SER A O     1 
ATOM   2437 C  CB    . SER A 1  317 ? -58.645 41.712 -27.776 1.00 53.05  ? 314 SER A CB    1 
ATOM   2438 O  OG    . SER A 1  317 ? -59.859 42.373 -27.477 1.00 53.68  ? 314 SER A OG    1 
ATOM   2439 N  N     . TRP A 1  318 ? -59.518 38.839 -28.522 1.00 54.09  ? 315 TRP A N     1 
ATOM   2440 C  CA    . TRP A 1  318 ? -60.486 37.784 -28.332 1.00 54.86  ? 315 TRP A CA    1 
ATOM   2441 C  C     . TRP A 1  318 ? -60.446 37.357 -26.879 1.00 56.10  ? 315 TRP A C     1 
ATOM   2442 O  O     . TRP A 1  318 ? -59.393 37.437 -26.218 1.00 56.51  ? 315 TRP A O     1 
ATOM   2443 C  CB    . TRP A 1  318 ? -60.165 36.604 -29.228 1.00 54.22  ? 315 TRP A CB    1 
ATOM   2444 C  CG    . TRP A 1  318 ? -58.980 35.811 -28.786 1.00 53.68  ? 315 TRP A CG    1 
ATOM   2445 C  CD1   . TRP A 1  318 ? -57.669 36.125 -28.963 1.00 52.41  ? 315 TRP A CD1   1 
ATOM   2446 C  CD2   . TRP A 1  318 ? -59.000 34.554 -28.105 1.00 54.20  ? 315 TRP A CD2   1 
ATOM   2447 N  NE1   . TRP A 1  318 ? -56.872 35.143 -28.441 1.00 52.43  ? 315 TRP A NE1   1 
ATOM   2448 C  CE2   . TRP A 1  318 ? -57.668 34.168 -27.906 1.00 53.07  ? 315 TRP A CE2   1 
ATOM   2449 C  CE3   . TRP A 1  318 ? -60.023 33.713 -27.644 1.00 54.89  ? 315 TRP A CE3   1 
ATOM   2450 C  CZ2   . TRP A 1  318 ? -57.328 32.989 -27.260 1.00 54.68  ? 315 TRP A CZ2   1 
ATOM   2451 C  CZ3   . TRP A 1  318 ? -59.685 32.542 -27.012 1.00 53.88  ? 315 TRP A CZ3   1 
ATOM   2452 C  CH2   . TRP A 1  318 ? -58.354 32.190 -26.820 1.00 54.65  ? 315 TRP A CH2   1 
ATOM   2453 N  N     . SER A 1  319 ? -61.586 36.923 -26.354 1.00 57.15  ? 316 SER A N     1 
ATOM   2454 C  CA    . SER A 1  319 ? -61.576 36.446 -24.980 1.00 57.79  ? 316 SER A CA    1 
ATOM   2455 C  C     . SER A 1  319 ? -62.263 35.112 -24.853 1.00 57.83  ? 316 SER A C     1 
ATOM   2456 O  O     . SER A 1  319 ? -63.303 34.890 -25.478 1.00 58.05  ? 316 SER A O     1 
ATOM   2457 C  CB    . SER A 1  319 ? -62.101 37.504 -23.993 1.00 58.28  ? 316 SER A CB    1 
ATOM   2458 O  OG    . SER A 1  319 ? -61.020 38.338 -23.548 1.00 58.46  ? 316 SER A OG    1 
ATOM   2459 N  N     . PRO A 1  320 ? -61.661 34.213 -24.047 1.00 57.73  ? 317 PRO A N     1 
ATOM   2460 C  CA    . PRO A 1  320 ? -62.016 32.801 -23.958 1.00 57.73  ? 317 PRO A CA    1 
ATOM   2461 C  C     . PRO A 1  320 ? -63.393 32.568 -23.338 1.00 57.97  ? 317 PRO A C     1 
ATOM   2462 O  O     . PRO A 1  320 ? -63.801 33.284 -22.418 1.00 57.95  ? 317 PRO A O     1 
ATOM   2463 C  CB    . PRO A 1  320 ? -60.926 32.222 -23.055 1.00 57.35  ? 317 PRO A CB    1 
ATOM   2464 C  CG    . PRO A 1  320 ? -60.496 33.337 -22.222 1.00 57.61  ? 317 PRO A CG    1 
ATOM   2465 C  CD    . PRO A 1  320 ? -60.682 34.596 -23.014 1.00 57.60  ? 317 PRO A CD    1 
ATOM   2466 N  N     . VAL A 1  321 ? -64.086 31.564 -23.859 1.00 58.08  ? 318 VAL A N     1 
ATOM   2467 C  CA    . VAL A 1  321 ? -65.443 31.236 -23.457 1.00 58.26  ? 318 VAL A CA    1 
ATOM   2468 C  C     . VAL A 1  321 ? -65.489 29.726 -23.246 1.00 58.38  ? 318 VAL A C     1 
ATOM   2469 O  O     . VAL A 1  321 ? -64.921 28.976 -24.043 1.00 58.65  ? 318 VAL A O     1 
ATOM   2470 C  CB    . VAL A 1  321 ? -66.453 31.730 -24.529 1.00 58.24  ? 318 VAL A CB    1 
ATOM   2471 C  CG1   . VAL A 1  321 ? -67.760 30.931 -24.507 1.00 58.91  ? 318 VAL A CG1   1 
ATOM   2472 C  CG2   . VAL A 1  321 ? -66.713 33.226 -24.348 1.00 57.39  ? 318 VAL A CG2   1 
ATOM   2473 N  N     . VAL A 1  322 ? -66.119 29.276 -22.161 1.00 58.10  ? 319 VAL A N     1 
ATOM   2474 C  CA    . VAL A 1  322 ? -66.164 27.834 -21.873 1.00 57.80  ? 319 VAL A CA    1 
ATOM   2475 C  C     . VAL A 1  322 ? -66.731 27.024 -23.061 1.00 57.36  ? 319 VAL A C     1 
ATOM   2476 O  O     . VAL A 1  322 ? -67.769 27.388 -23.625 1.00 57.13  ? 319 VAL A O     1 
ATOM   2477 C  CB    . VAL A 1  322 ? -66.974 27.540 -20.593 1.00 58.12  ? 319 VAL A CB    1 
ATOM   2478 C  CG1   . VAL A 1  322 ? -66.942 26.043 -20.272 1.00 57.34  ? 319 VAL A CG1   1 
ATOM   2479 C  CG2   . VAL A 1  322 ? -66.454 28.384 -19.420 1.00 57.98  ? 319 VAL A CG2   1 
ATOM   2480 N  N     . GLY A 1  323 ? -66.036 25.948 -23.443 1.00 56.85  ? 320 GLY A N     1 
ATOM   2481 C  CA    . GLY A 1  323 ? -66.477 25.082 -24.560 1.00 56.04  ? 320 GLY A CA    1 
ATOM   2482 C  C     . GLY A 1  323 ? -65.994 25.456 -25.964 1.00 55.56  ? 320 GLY A C     1 
ATOM   2483 O  O     . GLY A 1  323 ? -66.216 24.714 -26.926 1.00 55.62  ? 320 GLY A O     1 
ATOM   2484 N  N     . GLN A 1  324 ? -65.347 26.618 -26.079 1.00 54.73  ? 321 GLN A N     1 
ATOM   2485 C  CA    . GLN A 1  324 ? -64.729 27.100 -27.317 1.00 53.52  ? 321 GLN A CA    1 
ATOM   2486 C  C     . GLN A 1  324 ? -63.534 26.240 -27.734 1.00 52.37  ? 321 GLN A C     1 
ATOM   2487 O  O     . GLN A 1  324 ? -62.779 25.755 -26.885 1.00 52.45  ? 321 GLN A O     1 
ATOM   2488 C  CB    . GLN A 1  324 ? -64.283 28.546 -27.107 1.00 53.77  ? 321 GLN A CB    1 
ATOM   2489 C  CG    . GLN A 1  324 ? -63.714 29.256 -28.308 1.00 54.81  ? 321 GLN A CG    1 
ATOM   2490 C  CD    . GLN A 1  324 ? -63.321 30.693 -28.003 1.00 56.64  ? 321 GLN A CD    1 
ATOM   2491 O  OE1   . GLN A 1  324 ? -62.986 31.041 -26.863 1.00 58.15  ? 321 GLN A OE1   1 
ATOM   2492 N  NE2   . GLN A 1  324 ? -63.349 31.537 -29.027 1.00 56.85  ? 321 GLN A NE2   1 
ATOM   2493 N  N     . LEU A 1  325 ? -63.381 26.045 -29.042 1.00 50.90  ? 322 LEU A N     1 
ATOM   2494 C  CA    . LEU A 1  325 ? -62.237 25.337 -29.596 1.00 49.32  ? 322 LEU A CA    1 
ATOM   2495 C  C     . LEU A 1  325 ? -61.080 26.307 -29.684 1.00 48.27  ? 322 LEU A C     1 
ATOM   2496 O  O     . LEU A 1  325 ? -61.235 27.417 -30.205 1.00 47.85  ? 322 LEU A O     1 
ATOM   2497 C  CB    . LEU A 1  325 ? -62.564 24.803 -30.985 1.00 49.64  ? 322 LEU A CB    1 
ATOM   2498 C  CG    . LEU A 1  325 ? -63.542 23.636 -31.123 1.00 50.05  ? 322 LEU A CG    1 
ATOM   2499 C  CD1   . LEU A 1  325 ? -63.526 23.128 -32.557 1.00 50.28  ? 322 LEU A CD1   1 
ATOM   2500 C  CD2   . LEU A 1  325 ? -63.164 22.509 -30.181 1.00 50.39  ? 322 LEU A CD2   1 
ATOM   2501 N  N     . VAL A 1  326 ? -59.929 25.908 -29.150 1.00 46.60  ? 323 VAL A N     1 
ATOM   2502 C  CA    . VAL A 1  326 ? -58.762 26.790 -29.085 1.00 45.07  ? 323 VAL A CA    1 
ATOM   2503 C  C     . VAL A 1  326 ? -57.529 25.960 -29.365 1.00 44.88  ? 323 VAL A C     1 
ATOM   2504 O  O     . VAL A 1  326 ? -57.581 24.735 -29.305 1.00 45.04  ? 323 VAL A O     1 
ATOM   2505 C  CB    . VAL A 1  326 ? -58.612 27.513 -27.715 1.00 44.67  ? 323 VAL A CB    1 
ATOM   2506 C  CG1   . VAL A 1  326 ? -59.808 28.391 -27.414 1.00 43.41  ? 323 VAL A CG1   1 
ATOM   2507 C  CG2   . VAL A 1  326 ? -58.391 26.535 -26.598 1.00 44.19  ? 323 VAL A CG2   1 
ATOM   2508 N  N     . GLN A 1  327 ? -56.418 26.610 -29.690 1.00 44.10  ? 324 GLN A N     1 
ATOM   2509 C  CA    . GLN A 1  327 ? -55.205 25.863 -29.962 1.00 43.25  ? 324 GLN A CA    1 
ATOM   2510 C  C     . GLN A 1  327 ? -54.030 26.388 -29.163 1.00 43.35  ? 324 GLN A C     1 
ATOM   2511 O  O     . GLN A 1  327 ? -53.766 27.597 -29.135 1.00 43.21  ? 324 GLN A O     1 
ATOM   2512 C  CB    . GLN A 1  327 ? -54.918 25.852 -31.457 1.00 42.72  ? 324 GLN A CB    1 
ATOM   2513 C  CG    . GLN A 1  327 ? -56.008 25.132 -32.201 1.00 43.15  ? 324 GLN A CG    1 
ATOM   2514 C  CD    . GLN A 1  327 ? -55.864 25.150 -33.693 1.00 43.45  ? 324 GLN A CD    1 
ATOM   2515 O  OE1   . GLN A 1  327 ? -56.695 25.729 -34.402 1.00 43.24  ? 324 GLN A OE1   1 
ATOM   2516 N  NE2   . GLN A 1  327 ? -54.827 24.490 -34.193 1.00 43.80  ? 324 GLN A NE2   1 
ATOM   2517 N  N     . GLU A 1  328 ? -53.358 25.472 -28.483 1.00 43.26  ? 325 GLU A N     1 
ATOM   2518 C  CA    . GLU A 1  328 ? -52.151 25.805 -27.771 1.00 44.23  ? 325 GLU A CA    1 
ATOM   2519 C  C     . GLU A 1  328 ? -50.987 25.947 -28.751 1.00 44.85  ? 325 GLU A C     1 
ATOM   2520 O  O     . GLU A 1  328 ? -50.828 25.136 -29.680 1.00 44.46  ? 325 GLU A O     1 
ATOM   2521 C  CB    . GLU A 1  328 ? -51.811 24.748 -26.723 1.00 44.07  ? 325 GLU A CB    1 
ATOM   2522 C  CG    . GLU A 1  328 ? -50.708 25.171 -25.762 1.00 44.73  ? 325 GLU A CG    1 
ATOM   2523 C  CD    . GLU A 1  328 ? -50.358 24.124 -24.714 1.00 47.78  ? 325 GLU A CD    1 
ATOM   2524 O  OE1   . GLU A 1  328 ? -50.876 22.981 -24.799 1.00 49.38  ? 325 GLU A OE1   1 
ATOM   2525 O  OE2   . GLU A 1  328 ? -49.549 24.443 -23.805 1.00 46.76  ? 325 GLU A OE2   1 
ATOM   2526 N  N     . ARG A 1  329 ? -50.188 26.984 -28.518 1.00 45.22  ? 326 ARG A N     1 
ATOM   2527 C  CA    . ARG A 1  329 ? -48.960 27.201 -29.245 1.00 46.54  ? 326 ARG A CA    1 
ATOM   2528 C  C     . ARG A 1  329 ? -47.965 26.075 -28.991 1.00 46.27  ? 326 ARG A C     1 
ATOM   2529 O  O     . ARG A 1  329 ? -47.771 25.673 -27.858 1.00 46.72  ? 326 ARG A O     1 
ATOM   2530 C  CB    . ARG A 1  329 ? -48.360 28.544 -28.825 1.00 47.02  ? 326 ARG A CB    1 
ATOM   2531 C  CG    . ARG A 1  329 ? -47.136 28.962 -29.642 1.00 50.15  ? 326 ARG A CG    1 
ATOM   2532 C  CD    . ARG A 1  329 ? -46.424 30.195 -29.054 1.00 56.33  ? 326 ARG A CD    1 
ATOM   2533 N  NE    . ARG A 1  329 ? -47.288 31.382 -28.944 1.00 59.76  ? 326 ARG A NE    1 
ATOM   2534 C  CZ    . ARG A 1  329 ? -47.624 32.176 -29.964 1.00 61.28  ? 326 ARG A CZ    1 
ATOM   2535 N  NH1   . ARG A 1  329 ? -47.185 31.922 -31.219 1.00 58.53  ? 326 ARG A NH1   1 
ATOM   2536 N  NH2   . ARG A 1  329 ? -48.417 33.219 -29.720 1.00 60.32  ? 326 ARG A NH2   1 
ATOM   2537 N  N     . VAL A 1  330 ? -47.342 25.559 -30.041 1.00 46.50  ? 327 VAL A N     1 
ATOM   2538 C  CA    . VAL A 1  330 ? -46.250 24.594 -29.879 1.00 46.90  ? 327 VAL A CA    1 
ATOM   2539 C  C     . VAL A 1  330 ? -45.021 25.318 -29.290 1.00 47.98  ? 327 VAL A C     1 
ATOM   2540 O  O     . VAL A 1  330 ? -44.649 26.401 -29.745 1.00 48.42  ? 327 VAL A O     1 
ATOM   2541 C  CB    . VAL A 1  330 ? -45.943 23.913 -31.216 1.00 46.40  ? 327 VAL A CB    1 
ATOM   2542 C  CG1   . VAL A 1  330 ? -44.798 22.910 -31.099 1.00 45.27  ? 327 VAL A CG1   1 
ATOM   2543 C  CG2   . VAL A 1  330 ? -47.186 23.239 -31.713 1.00 46.01  ? 327 VAL A CG2   1 
ATOM   2544 N  N     . ALA A 1  331 ? -44.414 24.748 -28.261 1.00 48.84  ? 328 ALA A N     1 
ATOM   2545 C  CA    . ALA A 1  331 ? -43.437 25.504 -27.472 1.00 50.23  ? 328 ALA A CA    1 
ATOM   2546 C  C     . ALA A 1  331 ? -42.094 25.707 -28.194 1.00 51.27  ? 328 ALA A C     1 
ATOM   2547 O  O     . ALA A 1  331 ? -41.579 26.849 -28.271 1.00 52.44  ? 328 ALA A O     1 
ATOM   2548 C  CB    . ALA A 1  331 ? -43.216 24.859 -26.107 1.00 49.76  ? 328 ALA A CB    1 
ATOM   2549 N  N     . ARG A 1  332 ? -41.512 24.617 -28.685 1.00 50.92  ? 329 ARG A N     1 
ATOM   2550 C  CA    . ARG A 1  332 ? -40.216 24.695 -29.324 1.00 51.21  ? 329 ARG A CA    1 
ATOM   2551 C  C     . ARG A 1  332 ? -40.330 23.963 -30.683 1.00 51.12  ? 329 ARG A C     1 
ATOM   2552 O  O     . ARG A 1  332 ? -39.751 22.880 -30.886 1.00 51.60  ? 329 ARG A O     1 
ATOM   2553 C  CB    . ARG A 1  332 ? -39.114 24.136 -28.396 1.00 51.11  ? 329 ARG A CB    1 
ATOM   2554 N  N     . PRO A 1  333 ? -41.086 24.562 -31.619 1.00 50.34  ? 330 PRO A N     1 
ATOM   2555 C  CA    . PRO A 1  333 ? -41.425 23.831 -32.843 1.00 49.68  ? 330 PRO A CA    1 
ATOM   2556 C  C     . PRO A 1  333 ? -40.192 23.598 -33.675 1.00 49.53  ? 330 PRO A C     1 
ATOM   2557 O  O     . PRO A 1  333 ? -39.317 24.469 -33.753 1.00 49.76  ? 330 PRO A O     1 
ATOM   2558 C  CB    . PRO A 1  333 ? -42.385 24.764 -33.575 1.00 49.53  ? 330 PRO A CB    1 
ATOM   2559 C  CG    . PRO A 1  333 ? -42.094 26.155 -33.017 1.00 50.57  ? 330 PRO A CG    1 
ATOM   2560 C  CD    . PRO A 1  333 ? -41.512 25.978 -31.642 1.00 50.28  ? 330 PRO A CD    1 
ATOM   2561 N  N     . ALA A 1  334 ? -40.107 22.415 -34.267 1.00 48.91  ? 331 ALA A N     1 
ATOM   2562 C  CA    . ALA A 1  334 ? -39.017 22.104 -35.176 1.00 48.46  ? 331 ALA A CA    1 
ATOM   2563 C  C     . ALA A 1  334 ? -39.158 22.850 -36.508 1.00 48.07  ? 331 ALA A C     1 
ATOM   2564 O  O     . ALA A 1  334 ? -40.213 23.422 -36.843 1.00 47.62  ? 331 ALA A O     1 
ATOM   2565 C  CB    . ALA A 1  334 ? -38.929 20.598 -35.409 1.00 48.21  ? 331 ALA A CB    1 
ATOM   2566 N  N     . SER A 1  335 ? -38.074 22.838 -37.264 1.00 47.48  ? 332 SER A N     1 
ATOM   2567 C  CA    . SER A 1  335 ? -38.079 23.415 -38.580 1.00 47.00  ? 332 SER A CA    1 
ATOM   2568 C  C     . SER A 1  335 ? -39.132 22.754 -39.479 1.00 46.73  ? 332 SER A C     1 
ATOM   2569 O  O     . SER A 1  335 ? -39.291 21.527 -39.477 1.00 46.91  ? 332 SER A O     1 
ATOM   2570 C  CB    . SER A 1  335 ? -36.716 23.261 -39.199 1.00 46.77  ? 332 SER A CB    1 
ATOM   2571 O  OG    . SER A 1  335 ? -36.659 24.092 -40.316 1.00 47.87  ? 332 SER A OG    1 
ATOM   2572 N  N     . LEU A 1  336 ? -39.845 23.578 -40.239 1.00 45.84  ? 333 LEU A N     1 
ATOM   2573 C  CA    . LEU A 1  336 ? -40.876 23.106 -41.161 1.00 45.16  ? 333 LEU A CA    1 
ATOM   2574 C  C     . LEU A 1  336 ? -41.981 22.302 -40.491 1.00 44.44  ? 333 LEU A C     1 
ATOM   2575 O  O     . LEU A 1  336 ? -42.620 21.471 -41.137 1.00 44.99  ? 333 LEU A O     1 
ATOM   2576 C  CB    . LEU A 1  336 ? -40.261 22.321 -42.351 1.00 44.98  ? 333 LEU A CB    1 
ATOM   2577 C  CG    . LEU A 1  336 ? -39.251 23.077 -43.239 1.00 43.88  ? 333 LEU A CG    1 
ATOM   2578 C  CD1   . LEU A 1  336 ? -38.654 22.186 -44.313 1.00 42.25  ? 333 LEU A CD1   1 
ATOM   2579 C  CD2   . LEU A 1  336 ? -39.883 24.314 -43.868 1.00 43.70  ? 333 LEU A CD2   1 
ATOM   2580 N  N     . ARG A 1  337 ? -42.222 22.559 -39.212 1.00 43.33  ? 334 ARG A N     1 
ATOM   2581 C  CA    . ARG A 1  337 ? -43.288 21.859 -38.483 1.00 42.50  ? 334 ARG A CA    1 
ATOM   2582 C  C     . ARG A 1  337 ? -44.309 22.869 -37.971 1.00 41.95  ? 334 ARG A C     1 
ATOM   2583 O  O     . ARG A 1  337 ? -43.944 24.003 -37.697 1.00 42.12  ? 334 ARG A O     1 
ATOM   2584 C  CB    . ARG A 1  337 ? -42.696 21.048 -37.317 1.00 42.34  ? 334 ARG A CB    1 
ATOM   2585 C  CG    . ARG A 1  337 ? -41.907 19.827 -37.726 1.00 40.97  ? 334 ARG A CG    1 
ATOM   2586 C  CD    . ARG A 1  337 ? -42.752 18.894 -38.559 1.00 42.31  ? 334 ARG A CD    1 
ATOM   2587 N  NE    . ARG A 1  337 ? -42.031 17.657 -38.842 1.00 44.08  ? 334 ARG A NE    1 
ATOM   2588 C  CZ    . ARG A 1  337 ? -42.365 16.793 -39.798 1.00 45.08  ? 334 ARG A CZ    1 
ATOM   2589 N  NH1   . ARG A 1  337 ? -43.406 17.039 -40.592 1.00 45.43  ? 334 ARG A NH1   1 
ATOM   2590 N  NH2   . ARG A 1  337 ? -41.644 15.691 -39.979 1.00 44.21  ? 334 ARG A NH2   1 
ATOM   2591 N  N     . PRO A 1  338 ? -45.584 22.469 -37.826 1.00 41.69  ? 335 PRO A N     1 
ATOM   2592 C  CA    . PRO A 1  338 ? -46.634 23.440 -37.423 1.00 41.98  ? 335 PRO A CA    1 
ATOM   2593 C  C     . PRO A 1  338 ? -46.351 24.163 -36.093 1.00 42.66  ? 335 PRO A C     1 
ATOM   2594 O  O     . PRO A 1  338 ? -45.776 23.583 -35.166 1.00 42.59  ? 335 PRO A O     1 
ATOM   2595 C  CB    . PRO A 1  338 ? -47.895 22.580 -37.297 1.00 42.00  ? 335 PRO A CB    1 
ATOM   2596 C  CG    . PRO A 1  338 ? -47.575 21.301 -38.017 1.00 41.44  ? 335 PRO A CG    1 
ATOM   2597 C  CD    . PRO A 1  338 ? -46.108 21.106 -38.008 1.00 40.90  ? 335 PRO A CD    1 
ATOM   2598 N  N     . ARG A 1  339 ? -46.755 25.422 -36.010 1.00 43.32  ? 336 ARG A N     1 
ATOM   2599 C  CA    . ARG A 1  339 ? -46.548 26.232 -34.812 1.00 44.06  ? 336 ARG A CA    1 
ATOM   2600 C  C     . ARG A 1  339 ? -47.668 26.020 -33.771 1.00 44.46  ? 336 ARG A C     1 
ATOM   2601 O  O     . ARG A 1  339 ? -47.568 26.501 -32.641 1.00 44.48  ? 336 ARG A O     1 
ATOM   2602 C  CB    . ARG A 1  339 ? -46.440 27.723 -35.205 1.00 44.38  ? 336 ARG A CB    1 
ATOM   2603 C  CG    . ARG A 1  339 ? -45.010 28.299 -35.471 1.00 45.73  ? 336 ARG A CG    1 
ATOM   2604 C  CD    . ARG A 1  339 ? -44.136 27.415 -36.393 1.00 49.57  ? 336 ARG A CD    1 
ATOM   2605 N  NE    . ARG A 1  339 ? -42.753 27.894 -36.556 1.00 52.02  ? 336 ARG A NE    1 
ATOM   2606 C  CZ    . ARG A 1  339 ? -41.685 27.110 -36.784 1.00 53.49  ? 336 ARG A CZ    1 
ATOM   2607 N  NH1   . ARG A 1  339 ? -41.813 25.784 -36.861 1.00 52.54  ? 336 ARG A NH1   1 
ATOM   2608 N  NH2   . ARG A 1  339 ? -40.470 27.650 -36.929 1.00 53.52  ? 336 ARG A NH2   1 
ATOM   2609 N  N     . TRP A 1  340 ? -48.731 25.303 -34.147 1.00 44.86  ? 337 TRP A N     1 
ATOM   2610 C  CA    . TRP A 1  340 ? -49.894 25.105 -33.263 1.00 45.10  ? 337 TRP A CA    1 
ATOM   2611 C  C     . TRP A 1  340 ? -50.268 23.641 -33.103 1.00 45.75  ? 337 TRP A C     1 
ATOM   2612 O  O     . TRP A 1  340 ? -50.170 22.863 -34.061 1.00 46.43  ? 337 TRP A O     1 
ATOM   2613 C  CB    . TRP A 1  340 ? -51.104 25.879 -33.774 1.00 44.88  ? 337 TRP A CB    1 
ATOM   2614 C  CG    . TRP A 1  340 ? -50.834 27.350 -33.903 1.00 45.75  ? 337 TRP A CG    1 
ATOM   2615 C  CD1   . TRP A 1  340 ? -50.371 27.999 -35.012 1.00 44.98  ? 337 TRP A CD1   1 
ATOM   2616 C  CD2   . TRP A 1  340 ? -50.992 28.357 -32.880 1.00 45.97  ? 337 TRP A CD2   1 
ATOM   2617 N  NE1   . TRP A 1  340 ? -50.226 29.341 -34.743 1.00 46.17  ? 337 TRP A NE1   1 
ATOM   2618 C  CE2   . TRP A 1  340 ? -50.600 29.590 -33.449 1.00 45.37  ? 337 TRP A CE2   1 
ATOM   2619 C  CE3   . TRP A 1  340 ? -51.426 28.334 -31.544 1.00 44.17  ? 337 TRP A CE3   1 
ATOM   2620 C  CZ2   . TRP A 1  340 ? -50.631 30.787 -32.732 1.00 43.35  ? 337 TRP A CZ2   1 
ATOM   2621 C  CZ3   . TRP A 1  340 ? -51.448 29.511 -30.836 1.00 44.15  ? 337 TRP A CZ3   1 
ATOM   2622 C  CH2   . TRP A 1  340 ? -51.052 30.729 -31.431 1.00 43.91  ? 337 TRP A CH2   1 
ATOM   2623 N  N     . HIS A 1  341 ? -50.679 23.269 -31.886 1.00 46.08  ? 338 HIS A N     1 
ATOM   2624 C  CA    . HIS A 1  341 ? -51.238 21.943 -31.602 1.00 46.11  ? 338 HIS A CA    1 
ATOM   2625 C  C     . HIS A 1  341 ? -52.627 21.818 -32.210 1.00 46.51  ? 338 HIS A C     1 
ATOM   2626 O  O     . HIS A 1  341 ? -53.234 22.837 -32.569 1.00 46.61  ? 338 HIS A O     1 
ATOM   2627 C  CB    . HIS A 1  341 ? -51.309 21.703 -30.087 1.00 46.05  ? 338 HIS A CB    1 
ATOM   2628 C  CG    . HIS A 1  341 ? -49.971 21.502 -29.450 1.00 45.35  ? 338 HIS A CG    1 
ATOM   2629 N  ND1   . HIS A 1  341 ? -49.126 20.471 -29.802 1.00 45.72  ? 338 HIS A ND1   1 
ATOM   2630 C  CD2   . HIS A 1  341 ? -49.324 22.203 -28.490 1.00 45.58  ? 338 HIS A CD2   1 
ATOM   2631 C  CE1   . HIS A 1  341 ? -48.011 20.549 -29.094 1.00 44.90  ? 338 HIS A CE1   1 
ATOM   2632 N  NE2   . HIS A 1  341 ? -48.107 21.588 -28.287 1.00 44.99  ? 338 HIS A NE2   1 
ATOM   2633 N  N     . LYS A 1  342 ? -53.133 20.585 -32.323 1.00 47.02  ? 339 LYS A N     1 
ATOM   2634 C  CA    . LYS A 1  342 ? -54.525 20.334 -32.745 1.00 47.66  ? 339 LYS A CA    1 
ATOM   2635 C  C     . LYS A 1  342 ? -55.514 21.014 -31.799 1.00 46.90  ? 339 LYS A C     1 
ATOM   2636 O  O     . LYS A 1  342 ? -55.173 21.309 -30.661 1.00 46.06  ? 339 LYS A O     1 
ATOM   2637 C  CB    . LYS A 1  342 ? -54.804 18.835 -32.825 1.00 48.57  ? 339 LYS A CB    1 
ATOM   2638 C  CG    . LYS A 1  342 ? -54.183 18.158 -34.051 1.00 52.75  ? 339 LYS A CG    1 
ATOM   2639 C  CD    . LYS A 1  342 ? -54.067 16.644 -33.863 1.00 59.11  ? 339 LYS A CD    1 
ATOM   2640 C  CE    . LYS A 1  342 ? -53.056 16.032 -34.862 1.00 63.16  ? 339 LYS A CE    1 
ATOM   2641 N  NZ    . LYS A 1  342 ? -52.350 14.833 -34.279 1.00 65.12  ? 339 LYS A NZ    1 
ATOM   2642 N  N     . PRO A 1  343 ? -56.730 21.300 -32.279 1.00 47.14  ? 340 PRO A N     1 
ATOM   2643 C  CA    . PRO A 1  343 ? -57.688 22.040 -31.448 1.00 47.61  ? 340 PRO A CA    1 
ATOM   2644 C  C     . PRO A 1  343 ? -58.071 21.340 -30.146 1.00 48.41  ? 340 PRO A C     1 
ATOM   2645 O  O     . PRO A 1  343 ? -58.040 20.112 -30.059 1.00 48.70  ? 340 PRO A O     1 
ATOM   2646 C  CB    . PRO A 1  343 ? -58.907 22.191 -32.362 1.00 47.45  ? 340 PRO A CB    1 
ATOM   2647 C  CG    . PRO A 1  343 ? -58.337 22.152 -33.753 1.00 46.56  ? 340 PRO A CG    1 
ATOM   2648 C  CD    . PRO A 1  343 ? -57.205 21.161 -33.671 1.00 47.04  ? 340 PRO A CD    1 
ATOM   2649 N  N     . SER A 1  344 ? -58.393 22.140 -29.135 1.00 49.03  ? 341 SER A N     1 
ATOM   2650 C  CA    . SER A 1  344 ? -58.800 21.640 -27.842 1.00 49.71  ? 341 SER A CA    1 
ATOM   2651 C  C     . SER A 1  344 ? -59.946 22.465 -27.275 1.00 50.22  ? 341 SER A C     1 
ATOM   2652 O  O     . SER A 1  344 ? -60.402 23.428 -27.902 1.00 50.32  ? 341 SER A O     1 
ATOM   2653 C  CB    . SER A 1  344 ? -57.610 21.549 -26.882 1.00 49.92  ? 341 SER A CB    1 
ATOM   2654 O  OG    . SER A 1  344 ? -56.712 22.623 -27.026 1.00 51.69  ? 341 SER A OG    1 
ATOM   2655 N  N     . THR A 1  345 ? -60.452 22.063 -26.110 1.00 51.15  ? 342 THR A N     1 
ATOM   2656 C  CA    . THR A 1  345 ? -61.666 22.686 -25.576 1.00 51.31  ? 342 THR A CA    1 
ATOM   2657 C  C     . THR A 1  345 ? -61.399 23.371 -24.243 1.00 51.70  ? 342 THR A C     1 
ATOM   2658 O  O     . THR A 1  345 ? -60.758 22.803 -23.345 1.00 51.76  ? 342 THR A O     1 
ATOM   2659 C  CB    . THR A 1  345 ? -62.842 21.670 -25.455 1.00 51.22  ? 342 THR A CB    1 
ATOM   2660 O  OG1   . THR A 1  345 ? -62.784 20.720 -26.533 1.00 51.09  ? 342 THR A OG1   1 
ATOM   2661 C  CG2   . THR A 1  345 ? -64.179 22.392 -25.504 1.00 50.66  ? 342 THR A CG2   1 
ATOM   2662 N  N     . VAL A 1  346 ? -61.868 24.608 -24.149 1.00 52.16  ? 343 VAL A N     1 
ATOM   2663 C  CA    . VAL A 1  346 ? -61.816 25.375 -22.920 1.00 53.14  ? 343 VAL A CA    1 
ATOM   2664 C  C     . VAL A 1  346 ? -62.722 24.700 -21.900 1.00 53.28  ? 343 VAL A C     1 
ATOM   2665 O  O     . VAL A 1  346 ? -63.950 24.698 -22.068 1.00 53.40  ? 343 VAL A O     1 
ATOM   2666 C  CB    . VAL A 1  346 ? -62.311 26.833 -23.162 1.00 53.57  ? 343 VAL A CB    1 
ATOM   2667 C  CG1   . VAL A 1  346 ? -62.247 27.651 -21.877 1.00 54.18  ? 343 VAL A CG1   1 
ATOM   2668 C  CG2   . VAL A 1  346 ? -61.498 27.513 -24.259 1.00 53.84  ? 343 VAL A CG2   1 
ATOM   2669 N  N     . LEU A 1  347 ? -62.120 24.120 -20.863 1.00 53.62  ? 344 LEU A N     1 
ATOM   2670 C  CA    . LEU A 1  347 ? -62.872 23.566 -19.720 1.00 53.91  ? 344 LEU A CA    1 
ATOM   2671 C  C     . LEU A 1  347 ? -63.327 24.668 -18.800 1.00 54.19  ? 344 LEU A C     1 
ATOM   2672 O  O     . LEU A 1  347 ? -64.516 24.896 -18.664 1.00 54.93  ? 344 LEU A O     1 
ATOM   2673 C  CB    . LEU A 1  347 ? -62.045 22.566 -18.921 1.00 53.53  ? 344 LEU A CB    1 
ATOM   2674 C  CG    . LEU A 1  347 ? -61.772 21.244 -19.625 1.00 54.45  ? 344 LEU A CG    1 
ATOM   2675 C  CD1   . LEU A 1  347 ? -61.056 20.279 -18.697 1.00 55.27  ? 344 LEU A CD1   1 
ATOM   2676 C  CD2   . LEU A 1  347 ? -63.084 20.638 -20.140 1.00 56.10  ? 344 LEU A CD2   1 
ATOM   2677 N  N     . LYS A 1  348 ? -62.379 25.361 -18.174 1.00 54.52  ? 345 LYS A N     1 
ATOM   2678 C  CA    . LYS A 1  348 ? -62.713 26.479 -17.307 1.00 54.51  ? 345 LYS A CA    1 
ATOM   2679 C  C     . LYS A 1  348 ? -61.954 27.733 -17.701 1.00 53.74  ? 345 LYS A C     1 
ATOM   2680 O  O     . LYS A 1  348 ? -60.804 27.652 -18.152 1.00 53.66  ? 345 LYS A O     1 
ATOM   2681 C  CB    . LYS A 1  348 ? -62.445 26.140 -15.830 1.00 55.03  ? 345 LYS A CB    1 
ATOM   2682 C  CG    . LYS A 1  348 ? -63.256 27.012 -14.868 1.00 58.00  ? 345 LYS A CG    1 
ATOM   2683 C  CD    . LYS A 1  348 ? -62.876 26.782 -13.404 1.00 63.72  ? 345 LYS A CD    1 
ATOM   2684 C  CE    . LYS A 1  348 ? -63.532 27.842 -12.481 1.00 66.66  ? 345 LYS A CE    1 
ATOM   2685 N  NZ    . LYS A 1  348 ? -64.881 27.433 -11.937 1.00 68.80  ? 345 LYS A NZ    1 
ATOM   2686 N  N     . VAL A 1  349 ? -62.620 28.880 -17.521 1.00 52.81  ? 346 VAL A N     1 
ATOM   2687 C  CA    . VAL A 1  349 ? -62.026 30.204 -17.654 1.00 51.37  ? 346 VAL A CA    1 
ATOM   2688 C  C     . VAL A 1  349 ? -61.661 30.734 -16.260 1.00 51.17  ? 346 VAL A C     1 
ATOM   2689 O  O     . VAL A 1  349 ? -62.476 31.396 -15.604 1.00 51.38  ? 346 VAL A O     1 
ATOM   2690 C  CB    . VAL A 1  349 ? -62.988 31.182 -18.375 1.00 51.18  ? 346 VAL A CB    1 
ATOM   2691 C  CG1   . VAL A 1  349 ? -62.373 32.583 -18.532 1.00 50.45  ? 346 VAL A CG1   1 
ATOM   2692 C  CG2   . VAL A 1  349 ? -63.377 30.635 -19.728 1.00 50.79  ? 346 VAL A CG2   1 
ATOM   2693 N  N     . LEU A 1  350 ? -60.434 30.437 -15.820 1.00 50.50  ? 347 LEU A N     1 
ATOM   2694 C  CA    . LEU A 1  350 ? -59.905 30.895 -14.527 1.00 49.88  ? 347 LEU A CA    1 
ATOM   2695 C  C     . LEU A 1  350 ? -59.970 32.408 -14.346 1.00 49.85  ? 347 LEU A C     1 
ATOM   2696 O  O     . LEU A 1  350 ? -60.364 32.882 -13.285 1.00 50.34  ? 347 LEU A O     1 
ATOM   2697 C  CB    . LEU A 1  350 ? -58.477 30.399 -14.310 1.00 49.40  ? 347 LEU A CB    1 
ATOM   2698 C  CG    . LEU A 1  350 ? -58.284 28.881 -14.345 1.00 50.50  ? 347 LEU A CG    1 
ATOM   2699 C  CD1   . LEU A 1  350 ? -56.941 28.454 -13.756 1.00 48.74  ? 347 LEU A CD1   1 
ATOM   2700 C  CD2   . LEU A 1  350 ? -59.429 28.136 -13.624 1.00 51.68  ? 347 LEU A CD2   1 
ATOM   2701 N  N     . ASN A 1  351 ? -59.564 33.159 -15.369 1.00 49.28  ? 348 ASN A N     1 
ATOM   2702 C  CA    . ASN A 1  351 ? -59.773 34.620 -15.435 1.00 48.88  ? 348 ASN A CA    1 
ATOM   2703 C  C     . ASN A 1  351 ? -59.663 34.993 -16.906 1.00 47.96  ? 348 ASN A C     1 
ATOM   2704 O  O     . ASN A 1  351 ? -59.370 34.114 -17.717 1.00 48.39  ? 348 ASN A O     1 
ATOM   2705 C  CB    . ASN A 1  351 ? -58.776 35.401 -14.564 1.00 48.96  ? 348 ASN A CB    1 
ATOM   2706 C  CG    . ASN A 1  351 ? -57.313 35.136 -14.938 1.00 51.11  ? 348 ASN A CG    1 
ATOM   2707 O  OD1   . ASN A 1  351 ? -56.936 35.136 -16.122 1.00 53.78  ? 348 ASN A OD1   1 
ATOM   2708 N  ND2   . ASN A 1  351 ? -56.477 34.946 -13.925 1.00 49.90  ? 348 ASN A ND2   1 
ATOM   2709 N  N     . PRO A 1  352 ? -59.881 36.270 -17.265 1.00 46.83  ? 349 PRO A N     1 
ATOM   2710 C  CA    . PRO A 1  352 ? -59.928 36.559 -18.694 1.00 46.06  ? 349 PRO A CA    1 
ATOM   2711 C  C     . PRO A 1  352 ? -58.621 36.286 -19.463 1.00 45.57  ? 349 PRO A C     1 
ATOM   2712 O  O     . PRO A 1  352 ? -58.623 36.359 -20.689 1.00 45.63  ? 349 PRO A O     1 
ATOM   2713 C  CB    . PRO A 1  352 ? -60.304 38.048 -18.748 1.00 45.71  ? 349 PRO A CB    1 
ATOM   2714 C  CG    . PRO A 1  352 ? -60.940 38.331 -17.435 1.00 46.51  ? 349 PRO A CG    1 
ATOM   2715 C  CD    . PRO A 1  352 ? -60.189 37.468 -16.463 1.00 47.10  ? 349 PRO A CD    1 
ATOM   2716 N  N     . ARG A 1  353 ? -57.533 35.958 -18.765 1.00 44.98  ? 350 ARG A N     1 
ATOM   2717 C  CA    . ARG A 1  353 ? -56.239 35.746 -19.421 1.00 44.65  ? 350 ARG A CA    1 
ATOM   2718 C  C     . ARG A 1  353 ? -55.672 34.356 -19.184 1.00 45.05  ? 350 ARG A C     1 
ATOM   2719 O  O     . ARG A 1  353 ? -54.538 34.080 -19.578 1.00 45.40  ? 350 ARG A O     1 
ATOM   2720 C  CB    . ARG A 1  353 ? -55.208 36.784 -18.962 1.00 44.19  ? 350 ARG A CB    1 
ATOM   2721 C  CG    . ARG A 1  353 ? -55.603 38.238 -19.182 1.00 43.14  ? 350 ARG A CG    1 
ATOM   2722 C  CD    . ARG A 1  353 ? -54.820 38.840 -20.319 1.00 43.63  ? 350 ARG A CD    1 
ATOM   2723 N  NE    . ARG A 1  353 ? -53.411 38.445 -20.255 1.00 43.60  ? 350 ARG A NE    1 
ATOM   2724 C  CZ    . ARG A 1  353 ? -52.632 38.291 -21.323 1.00 42.57  ? 350 ARG A CZ    1 
ATOM   2725 N  NH1   . ARG A 1  353 ? -53.122 38.502 -22.534 1.00 42.40  ? 350 ARG A NH1   1 
ATOM   2726 N  NH2   . ARG A 1  353 ? -51.370 37.917 -21.189 1.00 39.99  ? 350 ARG A NH2   1 
ATOM   2727 N  N     . THR A 1  354 ? -56.441 33.489 -18.523 1.00 45.47  ? 351 THR A N     1 
ATOM   2728 C  CA    . THR A 1  354 ? -55.960 32.146 -18.149 1.00 45.60  ? 351 THR A CA    1 
ATOM   2729 C  C     . THR A 1  354 ? -57.089 31.141 -18.306 1.00 46.38  ? 351 THR A C     1 
ATOM   2730 O  O     . THR A 1  354 ? -58.223 31.427 -17.908 1.00 46.84  ? 351 THR A O     1 
ATOM   2731 C  CB    . THR A 1  354 ? -55.496 32.090 -16.696 1.00 44.92  ? 351 THR A CB    1 
ATOM   2732 O  OG1   . THR A 1  354 ? -54.907 33.331 -16.340 1.00 44.45  ? 351 THR A OG1   1 
ATOM   2733 C  CG2   . THR A 1  354 ? -54.479 31.001 -16.506 1.00 44.96  ? 351 THR A CG2   1 
ATOM   2734 N  N     . VAL A 1  355 ? -56.793 29.981 -18.892 1.00 46.65  ? 352 VAL A N     1 
ATOM   2735 C  CA    . VAL A 1  355 ? -57.817 28.949 -19.071 1.00 47.03  ? 352 VAL A CA    1 
ATOM   2736 C  C     . VAL A 1  355 ? -57.314 27.534 -18.820 1.00 47.48  ? 352 VAL A C     1 
ATOM   2737 O  O     . VAL A 1  355 ? -56.107 27.274 -18.870 1.00 46.89  ? 352 VAL A O     1 
ATOM   2738 C  CB    . VAL A 1  355 ? -58.492 28.978 -20.482 1.00 46.89  ? 352 VAL A CB    1 
ATOM   2739 C  CG1   . VAL A 1  355 ? -58.825 30.392 -20.913 1.00 46.55  ? 352 VAL A CG1   1 
ATOM   2740 C  CG2   . VAL A 1  355 ? -57.631 28.294 -21.490 1.00 45.62  ? 352 VAL A CG2   1 
ATOM   2741 N  N     . VAL A 1  356 ? -58.264 26.632 -18.543 1.00 48.34  ? 353 VAL A N     1 
ATOM   2742 C  CA    . VAL A 1  356 ? -57.970 25.209 -18.500 1.00 49.27  ? 353 VAL A CA    1 
ATOM   2743 C  C     . VAL A 1  356 ? -58.524 24.580 -19.755 1.00 50.16  ? 353 VAL A C     1 
ATOM   2744 O  O     . VAL A 1  356 ? -59.675 24.799 -20.110 1.00 49.91  ? 353 VAL A O     1 
ATOM   2745 C  CB    . VAL A 1  356 ? -58.552 24.502 -17.267 1.00 49.16  ? 353 VAL A CB    1 
ATOM   2746 C  CG1   . VAL A 1  356 ? -57.954 23.099 -17.132 1.00 48.42  ? 353 VAL A CG1   1 
ATOM   2747 C  CG2   . VAL A 1  356 ? -58.270 25.297 -16.005 1.00 49.34  ? 353 VAL A CG2   1 
ATOM   2748 N  N     . ILE A 1  357 ? -57.688 23.804 -20.430 1.00 51.76  ? 354 ILE A N     1 
ATOM   2749 C  CA    . ILE A 1  357 ? -58.105 23.167 -21.667 1.00 53.67  ? 354 ILE A CA    1 
ATOM   2750 C  C     . ILE A 1  357 ? -57.979 21.650 -21.604 1.00 55.86  ? 354 ILE A C     1 
ATOM   2751 O  O     . ILE A 1  357 ? -57.110 21.123 -20.895 1.00 55.43  ? 354 ILE A O     1 
ATOM   2752 C  CB    . ILE A 1  357 ? -57.320 23.709 -22.915 1.00 53.26  ? 354 ILE A CB    1 
ATOM   2753 C  CG1   . ILE A 1  357 ? -55.833 23.363 -22.816 1.00 52.15  ? 354 ILE A CG1   1 
ATOM   2754 C  CG2   . ILE A 1  357 ? -57.553 25.199 -23.107 1.00 51.12  ? 354 ILE A CG2   1 
ATOM   2755 C  CD1   . ILE A 1  357 ? -55.124 23.392 -24.133 1.00 52.46  ? 354 ILE A CD1   1 
ATOM   2756 N  N     . LEU A 1  358 ? -58.859 20.972 -22.351 1.00 58.73  ? 355 LEU A N     1 
ATOM   2757 C  CA    . LEU A 1  358 ? -58.753 19.531 -22.600 1.00 61.57  ? 355 LEU A CA    1 
ATOM   2758 C  C     . LEU A 1  358 ? -58.214 19.254 -24.005 1.00 63.41  ? 355 LEU A C     1 
ATOM   2759 O  O     . LEU A 1  358 ? -58.857 19.586 -25.003 1.00 63.41  ? 355 LEU A O     1 
ATOM   2760 C  CB    . LEU A 1  358 ? -60.122 18.861 -22.396 1.00 61.83  ? 355 LEU A CB    1 
ATOM   2761 C  CG    . LEU A 1  358 ? -60.298 17.379 -22.774 1.00 61.21  ? 355 LEU A CG    1 
ATOM   2762 C  CD1   . LEU A 1  358 ? -59.388 16.455 -21.956 1.00 59.29  ? 355 LEU A CD1   1 
ATOM   2763 C  CD2   . LEU A 1  358 ? -61.773 17.009 -22.638 1.00 60.72  ? 355 LEU A CD2   1 
ATOM   2764 N  N     . ASP A 1  359 ? -57.064 18.594 -24.067 1.00 66.14  ? 356 ASP A N     1 
ATOM   2765 C  CA    . ASP A 1  359 ? -56.203 18.652 -25.248 1.00 69.03  ? 356 ASP A CA    1 
ATOM   2766 C  C     . ASP A 1  359 ? -56.260 17.519 -26.268 1.00 70.88  ? 356 ASP A C     1 
ATOM   2767 O  O     . ASP A 1  359 ? -55.249 17.330 -26.980 1.00 72.40  ? 356 ASP A O     1 
ATOM   2768 C  CB    . ASP A 1  359 ? -54.727 18.831 -24.829 1.00 68.95  ? 356 ASP A CB    1 
ATOM   2769 C  CG    . ASP A 1  359 ? -54.106 17.545 -24.287 1.00 70.90  ? 356 ASP A CG    1 
ATOM   2770 O  OD1   . ASP A 1  359 ? -54.788 16.502 -24.292 1.00 72.25  ? 356 ASP A OD1   1 
ATOM   2771 O  OD2   . ASP A 1  359 ? -52.937 17.564 -23.842 1.00 74.29  ? 356 ASP A OD2   1 
ATOM   2772 N  N     . HIS A 1  360 ? -57.375 16.775 -26.363 1.00 71.91  ? 357 HIS A N     1 
ATOM   2773 C  CA    . HIS A 1  360 ? -57.509 15.643 -27.340 1.00 72.87  ? 357 HIS A CA    1 
ATOM   2774 C  C     . HIS A 1  360 ? -56.829 14.315 -26.913 1.00 73.27  ? 357 HIS A C     1 
ATOM   2775 O  O     . HIS A 1  360 ? -57.161 13.252 -27.447 1.00 73.18  ? 357 HIS A O     1 
ATOM   2776 C  CB    . HIS A 1  360 ? -57.132 16.049 -28.808 1.00 73.08  ? 357 HIS A CB    1 
ATOM   2777 C  CG    . HIS A 1  360 ? -55.823 15.479 -29.319 1.00 74.67  ? 357 HIS A CG    1 
ATOM   2778 N  ND1   . HIS A 1  360 ? -55.761 14.402 -30.183 1.00 75.83  ? 357 HIS A ND1   1 
ATOM   2779 C  CD2   . HIS A 1  360 ? -54.534 15.860 -29.117 1.00 75.60  ? 357 HIS A CD2   1 
ATOM   2780 C  CE1   . HIS A 1  360 ? -54.497 14.130 -30.469 1.00 75.48  ? 357 HIS A CE1   1 
ATOM   2781 N  NE2   . HIS A 1  360 ? -53.732 15.002 -29.838 1.00 75.22  ? 357 HIS A NE2   1 
ATOM   2782 N  N     . LEU A 1  361 ? -55.893 14.383 -25.959 1.00 73.84  ? 358 LEU A N     1 
ATOM   2783 C  CA    . LEU A 1  361 ? -55.213 13.184 -25.420 1.00 74.07  ? 358 LEU A CA    1 
ATOM   2784 C  C     . LEU A 1  361 ? -56.033 12.310 -24.438 1.00 73.95  ? 358 LEU A C     1 
ATOM   2785 O  O     . LEU A 1  361 ? -55.949 11.080 -24.529 1.00 74.72  ? 358 LEU A O     1 
ATOM   2786 C  CB    . LEU A 1  361 ? -53.822 13.504 -24.835 1.00 74.29  ? 358 LEU A CB    1 
ATOM   2787 C  CG    . LEU A 1  361 ? -52.694 13.820 -25.835 1.00 75.29  ? 358 LEU A CG    1 
ATOM   2788 C  CD1   . LEU A 1  361 ? -51.339 14.120 -25.134 1.00 74.56  ? 358 LEU A CD1   1 
ATOM   2789 C  CD2   . LEU A 1  361 ? -52.556 12.700 -26.892 1.00 75.59  ? 358 LEU A CD2   1 
ATOM   2790 N  N     . GLY A 1  362 ? -56.809 12.880 -23.511 1.00 73.10  ? 359 GLY A N     1 
ATOM   2791 C  CA    . GLY A 1  362 ? -56.933 14.308 -23.267 1.00 72.17  ? 359 GLY A CA    1 
ATOM   2792 C  C     . GLY A 1  362 ? -56.509 14.681 -21.854 1.00 71.33  ? 359 GLY A C     1 
ATOM   2793 O  O     . GLY A 1  362 ? -57.035 14.162 -20.875 1.00 71.16  ? 359 GLY A O     1 
ATOM   2794 N  N     . ASN A 1  363 ? -55.549 15.592 -21.757 1.00 70.33  ? 360 ASN A N     1 
ATOM   2795 C  CA    . ASN A 1  363 ? -55.104 16.097 -20.479 1.00 69.24  ? 360 ASN A CA    1 
ATOM   2796 C  C     . ASN A 1  363 ? -55.689 17.460 -20.165 1.00 67.91  ? 360 ASN A C     1 
ATOM   2797 O  O     . ASN A 1  363 ? -56.094 18.203 -21.068 1.00 67.89  ? 360 ASN A O     1 
ATOM   2798 C  CB    . ASN A 1  363 ? -53.587 16.120 -20.443 1.00 69.85  ? 360 ASN A CB    1 
ATOM   2799 C  CG    . ASN A 1  363 ? -52.994 14.743 -20.667 1.00 71.93  ? 360 ASN A CG    1 
ATOM   2800 O  OD1   . ASN A 1  363 ? -53.727 13.785 -20.928 1.00 74.64  ? 360 ASN A OD1   1 
ATOM   2801 N  ND2   . ASN A 1  363 ? -51.677 14.627 -20.555 1.00 72.43  ? 360 ASN A ND2   1 
ATOM   2802 N  N     . ASN A 1  364 ? -55.785 17.750 -18.872 1.00 66.11  ? 361 ASN A N     1 
ATOM   2803 C  CA    . ASN A 1  364 ? -56.103 19.077 -18.397 1.00 64.41  ? 361 ASN A CA    1 
ATOM   2804 C  C     . ASN A 1  364 ? -54.807 19.850 -18.394 1.00 62.68  ? 361 ASN A C     1 
ATOM   2805 O  O     . ASN A 1  364 ? -53.777 19.332 -17.961 1.00 62.66  ? 361 ASN A O     1 
ATOM   2806 C  CB    . ASN A 1  364 ? -56.705 19.022 -16.993 1.00 64.88  ? 361 ASN A CB    1 
ATOM   2807 C  CG    . ASN A 1  364 ? -58.195 18.712 -17.011 1.00 66.15  ? 361 ASN A CG    1 
ATOM   2808 O  OD1   . ASN A 1  364 ? -58.664 17.924 -17.839 1.00 67.74  ? 361 ASN A OD1   1 
ATOM   2809 N  ND2   . ASN A 1  364 ? -58.952 19.345 -16.108 1.00 66.38  ? 361 ASN A ND2   1 
ATOM   2810 N  N     . ARG A 1  365 ? -54.845 21.065 -18.928 1.00 60.43  ? 362 ARG A N     1 
ATOM   2811 C  CA    . ARG A 1  365 ? -53.655 21.913 -19.004 1.00 58.14  ? 362 ARG A CA    1 
ATOM   2812 C  C     . ARG A 1  365 ? -54.082 23.325 -18.681 1.00 56.36  ? 362 ARG A C     1 
ATOM   2813 O  O     . ARG A 1  365 ? -55.064 23.831 -19.246 1.00 55.45  ? 362 ARG A O     1 
ATOM   2814 C  CB    . ARG A 1  365 ? -53.008 21.855 -20.400 1.00 58.40  ? 362 ARG A CB    1 
ATOM   2815 C  CG    . ARG A 1  365 ? -52.450 20.480 -20.816 1.00 58.80  ? 362 ARG A CG    1 
ATOM   2816 C  CD    . ARG A 1  365 ? -51.718 20.498 -22.178 1.00 60.03  ? 362 ARG A CD    1 
ATOM   2817 N  NE    . ARG A 1  365 ? -50.722 21.575 -22.240 1.00 61.49  ? 362 ARG A NE    1 
ATOM   2818 C  CZ    . ARG A 1  365 ? -49.467 21.491 -21.801 1.00 61.81  ? 362 ARG A CZ    1 
ATOM   2819 N  NH1   . ARG A 1  365 ? -49.008 20.364 -21.269 1.00 62.03  ? 362 ARG A NH1   1 
ATOM   2820 N  NH2   . ARG A 1  365 ? -48.662 22.541 -21.892 1.00 61.38  ? 362 ARG A NH2   1 
ATOM   2821 N  N     . THR A 1  366 ? -53.375 23.941 -17.738 1.00 54.51  ? 363 THR A N     1 
ATOM   2822 C  CA    . THR A 1  366 ? -53.609 25.353 -17.421 1.00 53.12  ? 363 THR A CA    1 
ATOM   2823 C  C     . THR A 1  366 ? -52.651 26.215 -18.239 1.00 51.42  ? 363 THR A C     1 
ATOM   2824 O  O     . THR A 1  366 ? -51.430 26.050 -18.206 1.00 51.66  ? 363 THR A O     1 
ATOM   2825 C  CB    . THR A 1  366 ? -53.493 25.648 -15.914 1.00 53.33  ? 363 THR A CB    1 
ATOM   2826 O  OG1   . THR A 1  366 ? -54.385 24.782 -15.205 1.00 55.02  ? 363 THR A OG1   1 
ATOM   2827 C  CG2   . THR A 1  366 ? -53.887 27.099 -15.611 1.00 53.09  ? 363 THR A CG2   1 
ATOM   2828 N  N     . VAL A 1  367 ? -53.215 27.150 -18.972 1.00 49.20  ? 364 VAL A N     1 
ATOM   2829 C  CA    . VAL A 1  367 ? -52.507 27.716 -20.078 1.00 47.45  ? 364 VAL A CA    1 
ATOM   2830 C  C     . VAL A 1  367 ? -52.787 29.218 -20.176 1.00 46.29  ? 364 VAL A C     1 
ATOM   2831 O  O     . VAL A 1  367 ? -53.889 29.677 -19.833 1.00 45.78  ? 364 VAL A O     1 
ATOM   2832 C  CB    . VAL A 1  367 ? -52.935 26.911 -21.331 1.00 47.54  ? 364 VAL A CB    1 
ATOM   2833 C  CG1   . VAL A 1  367 ? -53.192 27.786 -22.509 1.00 49.02  ? 364 VAL A CG1   1 
ATOM   2834 C  CG2   . VAL A 1  367 ? -51.924 25.813 -21.637 1.00 46.66  ? 364 VAL A CG2   1 
ATOM   2835 N  N     . SER A 1  368 ? -51.792 29.982 -20.632 1.00 45.19  ? 365 SER A N     1 
ATOM   2836 C  CA    . SER A 1  368 ? -51.962 31.428 -20.861 1.00 44.13  ? 365 SER A CA    1 
ATOM   2837 C  C     . SER A 1  368 ? -52.731 31.693 -22.155 1.00 43.71  ? 365 SER A C     1 
ATOM   2838 O  O     . SER A 1  368 ? -52.540 31.014 -23.152 1.00 43.07  ? 365 SER A O     1 
ATOM   2839 C  CB    . SER A 1  368 ? -50.602 32.151 -20.890 1.00 43.95  ? 365 SER A CB    1 
ATOM   2840 O  OG    . SER A 1  368 ? -50.749 33.530 -21.221 1.00 43.23  ? 365 SER A OG    1 
ATOM   2841 N  N     . ILE A 1  369 ? -53.585 32.697 -22.144 1.00 43.49  ? 366 ILE A N     1 
ATOM   2842 C  CA    . ILE A 1  369 ? -54.297 33.073 -23.353 1.00 44.17  ? 366 ILE A CA    1 
ATOM   2843 C  C     . ILE A 1  369 ? -53.308 33.444 -24.488 1.00 44.01  ? 366 ILE A C     1 
ATOM   2844 O  O     . ILE A 1  369 ? -53.581 33.199 -25.662 1.00 44.24  ? 366 ILE A O     1 
ATOM   2845 C  CB    . ILE A 1  369 ? -55.295 34.204 -23.038 1.00 44.54  ? 366 ILE A CB    1 
ATOM   2846 C  CG1   . ILE A 1  369 ? -56.207 34.509 -24.206 1.00 46.27  ? 366 ILE A CG1   1 
ATOM   2847 C  CG2   . ILE A 1  369 ? -54.580 35.481 -22.656 1.00 44.67  ? 366 ILE A CG2   1 
ATOM   2848 C  CD1   . ILE A 1  369 ? -56.938 35.875 -24.010 1.00 48.93  ? 366 ILE A CD1   1 
ATOM   2849 N  N     . ASP A 1  370 ? -52.141 33.985 -24.121 1.00 43.64  ? 367 ASP A N     1 
ATOM   2850 C  CA    . ASP A 1  370 ? -51.115 34.394 -25.081 1.00 42.97  ? 367 ASP A CA    1 
ATOM   2851 C  C     . ASP A 1  370 ? -50.538 33.195 -25.809 1.00 43.53  ? 367 ASP A C     1 
ATOM   2852 O  O     . ASP A 1  370 ? -49.974 33.353 -26.888 1.00 44.58  ? 367 ASP A O     1 
ATOM   2853 C  CB    . ASP A 1  370 ? -49.954 35.137 -24.405 1.00 42.42  ? 367 ASP A CB    1 
ATOM   2854 C  CG    . ASP A 1  370 ? -50.318 36.551 -23.926 1.00 41.20  ? 367 ASP A CG    1 
ATOM   2855 O  OD1   . ASP A 1  370 ? -51.336 37.146 -24.374 1.00 37.17  ? 367 ASP A OD1   1 
ATOM   2856 O  OD2   . ASP A 1  370 ? -49.555 37.064 -23.071 1.00 39.82  ? 367 ASP A OD2   1 
ATOM   2857 N  N     . ASN A 1  371 ? -50.645 32.003 -25.226 1.00 42.97  ? 368 ASN A N     1 
ATOM   2858 C  CA    . ASN A 1  371 ? -50.225 30.810 -25.921 1.00 42.59  ? 368 ASN A CA    1 
ATOM   2859 C  C     . ASN A 1  371 ? -51.391 30.084 -26.592 1.00 43.43  ? 368 ASN A C     1 
ATOM   2860 O  O     . ASN A 1  371 ? -51.298 28.889 -26.908 1.00 43.63  ? 368 ASN A O     1 
ATOM   2861 C  CB    . ASN A 1  371 ? -49.439 29.906 -24.997 1.00 42.12  ? 368 ASN A CB    1 
ATOM   2862 C  CG    . ASN A 1  371 ? -48.099 30.485 -24.649 1.00 42.37  ? 368 ASN A CG    1 
ATOM   2863 O  OD1   . ASN A 1  371 ? -47.441 31.074 -25.501 1.00 44.27  ? 368 ASN A OD1   1 
ATOM   2864 N  ND2   . ASN A 1  371 ? -47.678 30.331 -23.396 1.00 40.19  ? 368 ASN A ND2   1 
ATOM   2865 N  N     . LEU A 1  372 ? -52.477 30.822 -26.826 1.00 43.79  ? 369 LEU A N     1 
ATOM   2866 C  CA    . LEU A 1  372 ? -53.645 30.288 -27.510 1.00 44.72  ? 369 LEU A CA    1 
ATOM   2867 C  C     . LEU A 1  372 ? -54.090 31.121 -28.700 1.00 45.15  ? 369 LEU A C     1 
ATOM   2868 O  O     . LEU A 1  372 ? -53.935 32.331 -28.718 1.00 45.65  ? 369 LEU A O     1 
ATOM   2869 C  CB    . LEU A 1  372 ? -54.844 30.176 -26.554 1.00 44.41  ? 369 LEU A CB    1 
ATOM   2870 C  CG    . LEU A 1  372 ? -54.804 29.177 -25.403 1.00 44.40  ? 369 LEU A CG    1 
ATOM   2871 C  CD1   . LEU A 1  372 ? -56.110 29.267 -24.622 1.00 45.08  ? 369 LEU A CD1   1 
ATOM   2872 C  CD2   . LEU A 1  372 ? -54.575 27.767 -25.887 1.00 43.41  ? 369 LEU A CD2   1 
ATOM   2873 N  N     . LYS A 1  373 ? -54.677 30.452 -29.683 1.00 45.89  ? 370 LYS A N     1 
ATOM   2874 C  CA    . LYS A 1  373 ? -55.546 31.118 -30.654 1.00 45.75  ? 370 LYS A CA    1 
ATOM   2875 C  C     . LYS A 1  373 ? -56.895 30.413 -30.675 1.00 45.78  ? 370 LYS A C     1 
ATOM   2876 O  O     . LYS A 1  373 ? -56.971 29.201 -30.422 1.00 45.34  ? 370 LYS A O     1 
ATOM   2877 C  CB    . LYS A 1  373 ? -54.926 31.133 -32.056 1.00 45.61  ? 370 LYS A CB    1 
ATOM   2878 C  CG    . LYS A 1  373 ? -54.536 29.784 -32.611 1.00 45.15  ? 370 LYS A CG    1 
ATOM   2879 C  CD    . LYS A 1  373 ? -54.509 29.826 -34.133 1.00 45.94  ? 370 LYS A CD    1 
ATOM   2880 C  CE    . LYS A 1  373 ? -54.079 28.489 -34.731 1.00 46.56  ? 370 LYS A CE    1 
ATOM   2881 N  NZ    . LYS A 1  373 ? -54.084 28.574 -36.218 1.00 48.49  ? 370 LYS A NZ    1 
ATOM   2882 N  N     . PRO A 1  374 ? -57.967 31.171 -30.950 1.00 46.23  ? 371 PRO A N     1 
ATOM   2883 C  CA    . PRO A 1  374 ? -59.265 30.546 -31.176 1.00 46.63  ? 371 PRO A CA    1 
ATOM   2884 C  C     . PRO A 1  374 ? -59.213 29.836 -32.506 1.00 47.28  ? 371 PRO A C     1 
ATOM   2885 O  O     . PRO A 1  374 ? -58.706 30.398 -33.460 1.00 48.21  ? 371 PRO A O     1 
ATOM   2886 C  CB    . PRO A 1  374 ? -60.219 31.742 -31.272 1.00 46.44  ? 371 PRO A CB    1 
ATOM   2887 C  CG    . PRO A 1  374 ? -59.371 32.879 -31.706 1.00 45.90  ? 371 PRO A CG    1 
ATOM   2888 C  CD    . PRO A 1  374 ? -58.040 32.644 -31.041 1.00 46.31  ? 371 PRO A CD    1 
ATOM   2889 N  N     . THR A 1  375 ? -59.707 28.609 -32.570 1.00 47.99  ? 372 THR A N     1 
ATOM   2890 C  CA    . THR A 1  375 ? -59.722 27.860 -33.811 1.00 48.65  ? 372 THR A CA    1 
ATOM   2891 C  C     . THR A 1  375 ? -60.654 28.542 -34.796 1.00 49.36  ? 372 THR A C     1 
ATOM   2892 O  O     . THR A 1  375 ? -61.748 28.966 -34.442 1.00 49.71  ? 372 THR A O     1 
ATOM   2893 C  CB    . THR A 1  375 ? -60.065 26.391 -33.563 1.00 48.65  ? 372 THR A CB    1 
ATOM   2894 O  OG1   . THR A 1  375 ? -59.142 25.861 -32.593 1.00 48.59  ? 372 THR A OG1   1 
ATOM   2895 C  CG2   . THR A 1  375 ? -59.935 25.589 -34.841 1.00 48.70  ? 372 THR A CG2   1 
ATOM   2896 N  N     . SER A 1  376 ? -60.179 28.703 -36.022 1.00 50.21  ? 373 SER A N     1 
ATOM   2897 C  CA    . SER A 1  376 ? -60.874 29.521 -37.007 1.00 51.32  ? 373 SER A CA    1 
ATOM   2898 C  C     . SER A 1  376 ? -62.055 28.819 -37.662 1.00 51.96  ? 373 SER A C     1 
ATOM   2899 O  O     . SER A 1  376 ? -62.087 27.595 -37.748 1.00 51.71  ? 373 SER A O     1 
ATOM   2900 C  CB    . SER A 1  376 ? -59.887 29.975 -38.080 1.00 51.24  ? 373 SER A CB    1 
ATOM   2901 O  OG    . SER A 1  376 ? -59.441 31.277 -37.795 1.00 50.87  ? 373 SER A OG    1 
ATOM   2902 N  N     . HIS A 1  377 ? -63.019 29.605 -38.137 1.00 53.28  ? 374 HIS A N     1 
ATOM   2903 C  CA    . HIS A 1  377 ? -64.174 29.060 -38.877 1.00 54.77  ? 374 HIS A CA    1 
ATOM   2904 C  C     . HIS A 1  377 ? -65.010 28.076 -38.056 1.00 56.26  ? 374 HIS A C     1 
ATOM   2905 O  O     . HIS A 1  377 ? -65.675 27.217 -38.627 1.00 56.59  ? 374 HIS A O     1 
ATOM   2906 C  CB    . HIS A 1  377 ? -63.708 28.345 -40.154 1.00 54.10  ? 374 HIS A CB    1 
ATOM   2907 C  CG    . HIS A 1  377 ? -62.579 29.029 -40.858 1.00 53.07  ? 374 HIS A CG    1 
ATOM   2908 N  ND1   . HIS A 1  377 ? -62.704 30.281 -41.429 1.00 50.82  ? 374 HIS A ND1   1 
ATOM   2909 C  CD2   . HIS A 1  377 ? -61.303 28.631 -41.088 1.00 51.12  ? 374 HIS A CD2   1 
ATOM   2910 C  CE1   . HIS A 1  377 ? -61.552 30.620 -41.981 1.00 50.45  ? 374 HIS A CE1   1 
ATOM   2911 N  NE2   . HIS A 1  377 ? -60.688 29.638 -41.790 1.00 49.76  ? 374 HIS A NE2   1 
ATOM   2912 N  N     . GLN A 1  378 ? -64.950 28.192 -36.723 1.00 58.27  ? 375 GLN A N     1 
ATOM   2913 C  CA    . GLN A 1  378 ? -65.587 27.248 -35.780 1.00 59.54  ? 375 GLN A CA    1 
ATOM   2914 C  C     . GLN A 1  378 ? -65.148 25.788 -35.987 1.00 59.32  ? 375 GLN A C     1 
ATOM   2915 O  O     . GLN A 1  378 ? -64.159 25.330 -35.422 1.00 59.14  ? 375 GLN A O     1 
ATOM   2916 C  CB    . GLN A 1  378 ? -67.109 27.382 -35.875 1.00 59.99  ? 375 GLN A CB    1 
ATOM   2917 C  CG    . GLN A 1  378 ? -67.543 28.830 -35.888 1.00 63.45  ? 375 GLN A CG    1 
ATOM   2918 C  CD    . GLN A 1  378 ? -69.030 28.978 -35.761 1.00 69.90  ? 375 GLN A CD    1 
ATOM   2919 O  OE1   . GLN A 1  378 ? -69.670 28.288 -34.950 1.00 72.75  ? 375 GLN A OE1   1 
ATOM   2920 N  NE2   . GLN A 1  378 ? -69.606 29.886 -36.558 1.00 70.98  ? 375 GLN A NE2   1 
ATOM   2921 N  N     . ASP B 1  119 ? -30.787 63.861 21.864  1.00 78.96  ? 116 ASP B N     1 
ATOM   2922 C  CA    . ASP B 1  119 ? -30.324 62.550 21.316  1.00 78.81  ? 116 ASP B CA    1 
ATOM   2923 C  C     . ASP B 1  119 ? -31.442 61.756 20.595  1.00 77.62  ? 116 ASP B C     1 
ATOM   2924 O  O     . ASP B 1  119 ? -32.548 61.564 21.128  1.00 77.68  ? 116 ASP B O     1 
ATOM   2925 C  CB    . ASP B 1  119 ? -29.669 61.702 22.422  1.00 79.33  ? 116 ASP B CB    1 
ATOM   2926 C  CG    . ASP B 1  119 ? -28.582 60.763 21.881  1.00 81.88  ? 116 ASP B CG    1 
ATOM   2927 O  OD1   . ASP B 1  119 ? -28.268 60.817 20.660  1.00 84.35  ? 116 ASP B OD1   1 
ATOM   2928 O  OD2   . ASP B 1  119 ? -28.026 59.974 22.685  1.00 84.36  ? 116 ASP B OD2   1 
ATOM   2929 N  N     . ARG B 1  120 ? -31.129 61.288 19.388  1.00 75.81  ? 117 ARG B N     1 
ATOM   2930 C  CA    . ARG B 1  120 ? -32.090 60.596 18.518  1.00 73.77  ? 117 ARG B CA    1 
ATOM   2931 C  C     . ARG B 1  120 ? -32.338 59.141 18.957  1.00 71.24  ? 117 ARG B C     1 
ATOM   2932 O  O     . ARG B 1  120 ? -31.435 58.503 19.493  1.00 71.02  ? 117 ARG B O     1 
ATOM   2933 C  CB    . ARG B 1  120 ? -31.604 60.662 17.063  1.00 74.25  ? 117 ARG B CB    1 
ATOM   2934 C  CG    . ARG B 1  120 ? -30.131 60.291 16.889  1.00 77.18  ? 117 ARG B CG    1 
ATOM   2935 C  CD    . ARG B 1  120 ? -29.764 59.997 15.430  1.00 82.16  ? 117 ARG B CD    1 
ATOM   2936 N  NE    . ARG B 1  120 ? -28.618 59.086 15.333  1.00 84.56  ? 117 ARG B NE    1 
ATOM   2937 C  CZ    . ARG B 1  120 ? -28.696 57.768 15.130  1.00 85.98  ? 117 ARG B CZ    1 
ATOM   2938 N  NH1   . ARG B 1  120 ? -29.872 57.150 14.973  1.00 85.35  ? 117 ARG B NH1   1 
ATOM   2939 N  NH2   . ARG B 1  120 ? -27.574 57.060 15.074  1.00 86.90  ? 117 ARG B NH2   1 
ATOM   2940 N  N     . PRO B 1  121 ? -33.562 58.613 18.729  1.00 68.82  ? 118 PRO B N     1 
ATOM   2941 C  CA    . PRO B 1  121 ? -33.883 57.243 19.141  1.00 67.17  ? 118 PRO B CA    1 
ATOM   2942 C  C     . PRO B 1  121 ? -33.081 56.163 18.406  1.00 65.64  ? 118 PRO B C     1 
ATOM   2943 O  O     . PRO B 1  121 ? -32.626 56.372 17.282  1.00 65.46  ? 118 PRO B O     1 
ATOM   2944 C  CB    . PRO B 1  121 ? -35.370 57.103 18.800  1.00 66.95  ? 118 PRO B CB    1 
ATOM   2945 C  CG    . PRO B 1  121 ? -35.854 58.476 18.581  1.00 67.56  ? 118 PRO B CG    1 
ATOM   2946 C  CD    . PRO B 1  121 ? -34.710 59.259 18.075  1.00 68.37  ? 118 PRO B CD    1 
ATOM   2947 N  N     . GLN B 1  122 ? -32.937 55.011 19.054  1.00 63.68  ? 119 GLN B N     1 
ATOM   2948 C  CA    . GLN B 1  122 ? -32.168 53.894 18.538  1.00 61.68  ? 119 GLN B CA    1 
ATOM   2949 C  C     . GLN B 1  122 ? -32.873 53.233 17.352  1.00 59.69  ? 119 GLN B C     1 
ATOM   2950 O  O     . GLN B 1  122 ? -34.096 53.193 17.296  1.00 59.88  ? 119 GLN B O     1 
ATOM   2951 C  CB    . GLN B 1  122 ? -31.967 52.881 19.653  1.00 61.90  ? 119 GLN B CB    1 
ATOM   2952 C  CG    . GLN B 1  122 ? -30.586 52.243 19.655  1.00 65.64  ? 119 GLN B CG    1 
ATOM   2953 C  CD    . GLN B 1  122 ? -30.476 51.064 20.627  1.00 70.23  ? 119 GLN B CD    1 
ATOM   2954 O  OE1   . GLN B 1  122 ? -31.181 51.016 21.659  1.00 71.22  ? 119 GLN B OE1   1 
ATOM   2955 N  NE2   . GLN B 1  122 ? -29.588 50.100 20.302  1.00 70.33  ? 119 GLN B NE2   1 
ATOM   2956 N  N     . LYS B 1  123 ? -32.103 52.689 16.414  1.00 57.04  ? 120 LYS B N     1 
ATOM   2957 C  CA    . LYS B 1  123 ? -32.655 52.183 15.166  1.00 54.13  ? 120 LYS B CA    1 
ATOM   2958 C  C     . LYS B 1  123 ? -31.966 50.916 14.710  1.00 52.66  ? 120 LYS B C     1 
ATOM   2959 O  O     . LYS B 1  123 ? -30.837 50.653 15.108  1.00 52.83  ? 120 LYS B O     1 
ATOM   2960 C  CB    . LYS B 1  123 ? -32.513 53.244 14.079  1.00 53.85  ? 120 LYS B CB    1 
ATOM   2961 C  CG    . LYS B 1  123 ? -33.472 54.416 14.213  1.00 52.34  ? 120 LYS B CG    1 
ATOM   2962 C  CD    . LYS B 1  123 ? -34.920 53.989 14.015  1.00 50.04  ? 120 LYS B CD    1 
ATOM   2963 C  CE    . LYS B 1  123 ? -35.876 55.044 14.523  1.00 49.44  ? 120 LYS B CE    1 
ATOM   2964 N  NZ    . LYS B 1  123 ? -35.741 56.355 13.840  1.00 49.63  ? 120 LYS B NZ    1 
ATOM   2965 N  N     . PRO B 1  124 ? -32.637 50.123 13.860  1.00 51.03  ? 121 PRO B N     1 
ATOM   2966 C  CA    . PRO B 1  124 ? -31.923 49.019 13.226  1.00 49.77  ? 121 PRO B CA    1 
ATOM   2967 C  C     . PRO B 1  124 ? -30.748 49.572 12.445  1.00 48.68  ? 121 PRO B C     1 
ATOM   2968 O  O     . PRO B 1  124 ? -30.816 50.698 11.933  1.00 48.25  ? 121 PRO B O     1 
ATOM   2969 C  CB    . PRO B 1  124 ? -32.941 48.444 12.246  1.00 49.78  ? 121 PRO B CB    1 
ATOM   2970 C  CG    . PRO B 1  124 ? -34.261 48.997 12.650  1.00 49.99  ? 121 PRO B CG    1 
ATOM   2971 C  CD    . PRO B 1  124 ? -34.010 50.281 13.345  1.00 50.89  ? 121 PRO B CD    1 
ATOM   2972 N  N     . PHE B 1  125 ? -29.674 48.791 12.383  1.00 47.73  ? 122 PHE B N     1 
ATOM   2973 C  CA    . PHE B 1  125 ? -28.440 49.135 11.648  1.00 46.81  ? 122 PHE B CA    1 
ATOM   2974 C  C     . PHE B 1  125 ? -27.592 50.200 12.327  1.00 47.08  ? 122 PHE B C     1 
ATOM   2975 O  O     . PHE B 1  125 ? -26.567 50.602 11.793  1.00 47.89  ? 122 PHE B O     1 
ATOM   2976 C  CB    . PHE B 1  125 ? -28.716 49.537 10.179  1.00 45.84  ? 122 PHE B CB    1 
ATOM   2977 C  CG    . PHE B 1  125 ? -29.757 48.695 9.499   1.00 43.67  ? 122 PHE B CG    1 
ATOM   2978 C  CD1   . PHE B 1  125 ? -30.864 49.283 8.905   1.00 40.62  ? 122 PHE B CD1   1 
ATOM   2979 C  CD2   . PHE B 1  125 ? -29.647 47.305 9.469   1.00 41.65  ? 122 PHE B CD2   1 
ATOM   2980 C  CE1   . PHE B 1  125 ? -31.823 48.487 8.265   1.00 39.42  ? 122 PHE B CE1   1 
ATOM   2981 C  CE2   . PHE B 1  125 ? -30.618 46.510 8.842   1.00 39.49  ? 122 PHE B CE2   1 
ATOM   2982 C  CZ    . PHE B 1  125 ? -31.691 47.098 8.234   1.00 37.79  ? 122 PHE B CZ    1 
ATOM   2983 N  N     . ASP B 1  126 ? -28.006 50.669 13.495  1.00 47.44  ? 123 ASP B N     1 
ATOM   2984 C  CA    . ASP B 1  126 ? -27.195 51.612 14.261  1.00 47.19  ? 123 ASP B CA    1 
ATOM   2985 C  C     . ASP B 1  126 ? -25.921 50.940 14.752  1.00 46.67  ? 123 ASP B C     1 
ATOM   2986 O  O     . ASP B 1  126 ? -24.849 51.529 14.709  1.00 46.98  ? 123 ASP B O     1 
ATOM   2987 C  CB    . ASP B 1  126 ? -27.987 52.143 15.446  1.00 47.61  ? 123 ASP B CB    1 
ATOM   2988 C  CG    . ASP B 1  126 ? -28.817 53.364 15.101  1.00 49.36  ? 123 ASP B CG    1 
ATOM   2989 O  OD1   . ASP B 1  126 ? -28.740 53.856 13.955  1.00 53.02  ? 123 ASP B OD1   1 
ATOM   2990 O  OD2   . ASP B 1  126 ? -29.532 53.859 15.995  1.00 50.68  ? 123 ASP B OD2   1 
ATOM   2991 N  N     . LYS B 1  127 ? -26.041 49.694 15.194  1.00 45.95  ? 124 LYS B N     1 
ATOM   2992 C  CA    . LYS B 1  127 ? -24.926 48.984 15.785  1.00 45.49  ? 124 LYS B CA    1 
ATOM   2993 C  C     . LYS B 1  127 ? -25.121 47.483 15.627  1.00 45.01  ? 124 LYS B C     1 
ATOM   2994 O  O     . LYS B 1  127 ? -26.177 46.945 15.979  1.00 44.63  ? 124 LYS B O     1 
ATOM   2995 C  CB    . LYS B 1  127 ? -24.813 49.356 17.272  1.00 46.08  ? 124 LYS B CB    1 
ATOM   2996 C  CG    . LYS B 1  127 ? -23.570 48.813 17.994  1.00 47.20  ? 124 LYS B CG    1 
ATOM   2997 C  CD    . LYS B 1  127 ? -23.337 49.493 19.347  1.00 49.62  ? 124 LYS B CD    1 
ATOM   2998 C  CE    . LYS B 1  127 ? -23.425 51.029 19.265  1.00 51.48  ? 124 LYS B CE    1 
ATOM   2999 N  NZ    . LYS B 1  127 ? -22.467 51.715 20.187  1.00 51.56  ? 124 LYS B NZ    1 
ATOM   3000 N  N     . PHE B 1  128 ? -24.110 46.808 15.090  1.00 44.50  ? 125 PHE B N     1 
ATOM   3001 C  CA    . PHE B 1  128 ? -24.116 45.349 15.052  1.00 44.39  ? 125 PHE B CA    1 
ATOM   3002 C  C     . PHE B 1  128 ? -23.119 44.798 16.073  1.00 44.59  ? 125 PHE B C     1 
ATOM   3003 O  O     . PHE B 1  128 ? -21.998 45.294 16.186  1.00 45.34  ? 125 PHE B O     1 
ATOM   3004 C  CB    . PHE B 1  128 ? -23.748 44.828 13.661  1.00 44.49  ? 125 PHE B CB    1 
ATOM   3005 C  CG    . PHE B 1  128 ? -24.865 44.897 12.650  1.00 43.88  ? 125 PHE B CG    1 
ATOM   3006 C  CD1   . PHE B 1  128 ? -26.128 45.370 12.993  1.00 44.36  ? 125 PHE B CD1   1 
ATOM   3007 C  CD2   . PHE B 1  128 ? -24.655 44.439 11.356  1.00 42.37  ? 125 PHE B CD2   1 
ATOM   3008 C  CE1   . PHE B 1  128 ? -27.150 45.406 12.056  1.00 42.97  ? 125 PHE B CE1   1 
ATOM   3009 C  CE2   . PHE B 1  128 ? -25.650 44.471 10.428  1.00 41.05  ? 125 PHE B CE2   1 
ATOM   3010 C  CZ    . PHE B 1  128 ? -26.898 44.953 10.764  1.00 42.74  ? 125 PHE B CZ    1 
ATOM   3011 N  N     . PHE B 1  129 ? -23.510 43.778 16.820  1.00 44.12  ? 126 PHE B N     1 
ATOM   3012 C  CA    . PHE B 1  129 ? -22.618 43.229 17.819  1.00 44.04  ? 126 PHE B CA    1 
ATOM   3013 C  C     . PHE B 1  129 ? -22.183 41.905 17.295  1.00 44.73  ? 126 PHE B C     1 
ATOM   3014 O  O     . PHE B 1  129 ? -23.024 41.058 16.986  1.00 44.88  ? 126 PHE B O     1 
ATOM   3015 C  CB    . PHE B 1  129 ? -23.323 43.055 19.171  1.00 43.25  ? 126 PHE B CB    1 
ATOM   3016 C  CG    . PHE B 1  129 ? -23.566 44.337 19.886  1.00 41.61  ? 126 PHE B CG    1 
ATOM   3017 C  CD1   . PHE B 1  129 ? -22.637 44.828 20.807  1.00 40.02  ? 126 PHE B CD1   1 
ATOM   3018 C  CD2   . PHE B 1  129 ? -24.722 45.071 19.652  1.00 39.98  ? 126 PHE B CD2   1 
ATOM   3019 C  CE1   . PHE B 1  129 ? -22.854 46.040 21.483  1.00 38.06  ? 126 PHE B CE1   1 
ATOM   3020 C  CE2   . PHE B 1  129 ? -24.943 46.280 20.332  1.00 40.05  ? 126 PHE B CE2   1 
ATOM   3021 C  CZ    . PHE B 1  129 ? -24.003 46.757 21.251  1.00 37.22  ? 126 PHE B CZ    1 
ATOM   3022 N  N     . ILE B 1  130 ? -20.875 41.721 17.170  1.00 45.87  ? 127 ILE B N     1 
ATOM   3023 C  CA    . ILE B 1  130 ? -20.362 40.480 16.596  1.00 47.19  ? 127 ILE B CA    1 
ATOM   3024 C  C     . ILE B 1  130 ? -19.490 39.737 17.583  1.00 48.17  ? 127 ILE B C     1 
ATOM   3025 O  O     . ILE B 1  130 ? -18.928 40.330 18.508  1.00 48.10  ? 127 ILE B O     1 
ATOM   3026 C  CB    . ILE B 1  130 ? -19.605 40.700 15.250  1.00 47.30  ? 127 ILE B CB    1 
ATOM   3027 C  CG1   . ILE B 1  130 ? -18.280 41.444 15.464  1.00 47.62  ? 127 ILE B CG1   1 
ATOM   3028 C  CG2   . ILE B 1  130 ? -20.490 41.456 14.255  1.00 46.90  ? 127 ILE B CG2   1 
ATOM   3029 C  CD1   . ILE B 1  130 ? -17.416 41.538 14.234  1.00 46.84  ? 127 ILE B CD1   1 
ATOM   3030 N  N     . ASP B 1  131 ? -19.400 38.427 17.392  1.00 49.38  ? 128 ASP B N     1 
ATOM   3031 C  CA    . ASP B 1  131 ? -18.550 37.612 18.219  1.00 50.48  ? 128 ASP B CA    1 
ATOM   3032 C  C     . ASP B 1  131 ? -18.448 36.219 17.643  1.00 50.51  ? 128 ASP B C     1 
ATOM   3033 O  O     . ASP B 1  131 ? -19.311 35.819 16.877  1.00 50.62  ? 128 ASP B O     1 
ATOM   3034 C  CB    . ASP B 1  131 ? -19.118 37.561 19.633  1.00 51.36  ? 128 ASP B CB    1 
ATOM   3035 C  CG    . ASP B 1  131 ? -18.086 37.111 20.653  1.00 54.09  ? 128 ASP B CG    1 
ATOM   3036 O  OD1   . ASP B 1  131 ? -16.868 37.155 20.345  1.00 56.21  ? 128 ASP B OD1   1 
ATOM   3037 O  OD2   . ASP B 1  131 ? -18.491 36.705 21.762  1.00 57.35  ? 128 ASP B OD2   1 
ATOM   3038 N  N     . TYR B 1  132 ? -17.394 35.484 17.996  1.00 51.24  ? 129 TYR B N     1 
ATOM   3039 C  CA    . TYR B 1  132 ? -17.261 34.083 17.573  1.00 51.97  ? 129 TYR B CA    1 
ATOM   3040 C  C     . TYR B 1  132 ? -17.730 33.123 18.641  1.00 52.66  ? 129 TYR B C     1 
ATOM   3041 O  O     . TYR B 1  132 ? -17.771 33.470 19.800  1.00 53.44  ? 129 TYR B O     1 
ATOM   3042 C  CB    . TYR B 1  132 ? -15.823 33.754 17.157  1.00 52.01  ? 129 TYR B CB    1 
ATOM   3043 C  CG    . TYR B 1  132 ? -15.540 34.133 15.726  1.00 52.16  ? 129 TYR B CG    1 
ATOM   3044 C  CD1   . TYR B 1  132 ? -14.817 35.273 15.418  1.00 52.64  ? 129 TYR B CD1   1 
ATOM   3045 C  CD2   . TYR B 1  132 ? -16.037 33.364 14.675  1.00 53.16  ? 129 TYR B CD2   1 
ATOM   3046 C  CE1   . TYR B 1  132 ? -14.572 35.631 14.090  1.00 53.57  ? 129 TYR B CE1   1 
ATOM   3047 C  CE2   . TYR B 1  132 ? -15.802 33.706 13.346  1.00 52.50  ? 129 TYR B CE2   1 
ATOM   3048 C  CZ    . TYR B 1  132 ? -15.074 34.837 13.063  1.00 53.00  ? 129 TYR B CZ    1 
ATOM   3049 O  OH    . TYR B 1  132 ? -14.860 35.178 11.754  1.00 51.75  ? 129 TYR B OH    1 
ATOM   3050 N  N     . ILE B 1  133 ? -18.119 31.924 18.241  1.00 53.67  ? 130 ILE B N     1 
ATOM   3051 C  CA    . ILE B 1  133 ? -18.412 30.863 19.181  1.00 54.45  ? 130 ILE B CA    1 
ATOM   3052 C  C     . ILE B 1  133 ? -17.679 29.621 18.698  1.00 55.40  ? 130 ILE B C     1 
ATOM   3053 O  O     . ILE B 1  133 ? -17.791 29.254 17.535  1.00 55.83  ? 130 ILE B O     1 
ATOM   3054 C  CB    . ILE B 1  133 ? -19.929 30.621 19.301  1.00 54.54  ? 130 ILE B CB    1 
ATOM   3055 C  CG1   . ILE B 1  133 ? -20.566 31.729 20.145  1.00 54.35  ? 130 ILE B CG1   1 
ATOM   3056 C  CG2   . ILE B 1  133 ? -20.239 29.238 19.889  1.00 54.17  ? 130 ILE B CG2   1 
ATOM   3057 C  CD1   . ILE B 1  133 ? -22.099 31.725 20.135  1.00 55.22  ? 130 ILE B CD1   1 
ATOM   3058 N  N     . GLY B 1  134 ? -16.896 29.006 19.585  1.00 56.39  ? 131 GLY B N     1 
ATOM   3059 C  CA    . GLY B 1  134 ? -16.174 27.778 19.265  1.00 57.26  ? 131 GLY B CA    1 
ATOM   3060 C  C     . GLY B 1  134 ? -14.792 27.684 19.891  1.00 58.08  ? 131 GLY B C     1 
ATOM   3061 O  O     . GLY B 1  134 ? -14.396 28.557 20.666  1.00 57.58  ? 131 GLY B O     1 
ATOM   3062 N  N     . PRO B 1  135 ? -14.020 26.642 19.523  1.00 59.10  ? 132 PRO B N     1 
ATOM   3063 C  CA    . PRO B 1  135 ? -14.292 25.645 18.479  1.00 60.06  ? 132 PRO B CA    1 
ATOM   3064 C  C     . PRO B 1  135 ? -15.494 24.783 18.800  1.00 60.84  ? 132 PRO B C     1 
ATOM   3065 O  O     . PRO B 1  135 ? -15.815 24.606 19.958  1.00 61.35  ? 132 PRO B O     1 
ATOM   3066 C  CB    . PRO B 1  135 ? -13.036 24.766 18.489  1.00 59.89  ? 132 PRO B CB    1 
ATOM   3067 C  CG    . PRO B 1  135 ? -12.010 25.546 19.214  1.00 59.74  ? 132 PRO B CG    1 
ATOM   3068 C  CD    . PRO B 1  135 ? -12.748 26.369 20.206  1.00 59.33  ? 132 PRO B CD    1 
ATOM   3069 N  N     . LEU B 1  136 ? -16.145 24.257 17.777  1.00 61.95  ? 133 LEU B N     1 
ATOM   3070 C  CA    . LEU B 1  136 ? -17.213 23.292 17.956  1.00 63.45  ? 133 LEU B CA    1 
ATOM   3071 C  C     . LEU B 1  136 ? -16.844 21.952 17.309  1.00 64.83  ? 133 LEU B C     1 
ATOM   3072 O  O     . LEU B 1  136 ? -15.844 21.860 16.582  1.00 64.79  ? 133 LEU B O     1 
ATOM   3073 C  CB    . LEU B 1  136 ? -18.516 23.816 17.353  1.00 63.07  ? 133 LEU B CB    1 
ATOM   3074 C  CG    . LEU B 1  136 ? -19.051 25.152 17.850  1.00 63.35  ? 133 LEU B CG    1 
ATOM   3075 C  CD1   . LEU B 1  136 ? -20.249 25.575 17.006  1.00 62.76  ? 133 LEU B CD1   1 
ATOM   3076 C  CD2   . LEU B 1  136 ? -19.418 25.080 19.333  1.00 62.80  ? 133 LEU B CD2   1 
ATOM   3077 N  N     . PRO B 1  137 ? -17.645 20.903 17.570  1.00 66.17  ? 134 PRO B N     1 
ATOM   3078 C  CA    . PRO B 1  137 ? -17.417 19.679 16.805  1.00 67.15  ? 134 PRO B CA    1 
ATOM   3079 C  C     . PRO B 1  137 ? -17.599 19.998 15.330  1.00 67.89  ? 134 PRO B C     1 
ATOM   3080 O  O     . PRO B 1  137 ? -18.499 20.767 14.990  1.00 68.10  ? 134 PRO B O     1 
ATOM   3081 C  CB    . PRO B 1  137 ? -18.535 18.740 17.279  1.00 67.40  ? 134 PRO B CB    1 
ATOM   3082 C  CG    . PRO B 1  137 ? -18.956 19.277 18.616  1.00 67.25  ? 134 PRO B CG    1 
ATOM   3083 C  CD    . PRO B 1  137 ? -18.732 20.760 18.560  1.00 66.28  ? 134 PRO B CD    1 
ATOM   3084 N  N     . PRO B 1  138 ? -16.744 19.432 14.459  1.00 68.41  ? 135 PRO B N     1 
ATOM   3085 C  CA    . PRO B 1  138 ? -16.809 19.714 13.026  1.00 68.63  ? 135 PRO B CA    1 
ATOM   3086 C  C     . PRO B 1  138 ? -18.182 19.431 12.445  1.00 68.91  ? 135 PRO B C     1 
ATOM   3087 O  O     . PRO B 1  138 ? -18.845 18.487 12.864  1.00 69.08  ? 135 PRO B O     1 
ATOM   3088 C  CB    . PRO B 1  138 ? -15.782 18.747 12.438  1.00 68.75  ? 135 PRO B CB    1 
ATOM   3089 C  CG    . PRO B 1  138 ? -14.797 18.537 13.536  1.00 68.67  ? 135 PRO B CG    1 
ATOM   3090 C  CD    . PRO B 1  138 ? -15.630 18.526 14.787  1.00 68.54  ? 135 PRO B CD    1 
ATOM   3091 N  N     . SER B 1  139 ? -18.608 20.260 11.499  1.00 69.30  ? 136 SER B N     1 
ATOM   3092 C  CA    . SER B 1  139 ? -19.840 20.011 10.753  1.00 69.52  ? 136 SER B CA    1 
ATOM   3093 C  C     . SER B 1  139 ? -19.669 20.535 9.334   1.00 69.76  ? 136 SER B C     1 
ATOM   3094 O  O     . SER B 1  139 ? -19.529 21.739 9.126   1.00 69.81  ? 136 SER B O     1 
ATOM   3095 C  CB    . SER B 1  139 ? -21.027 20.675 11.439  1.00 69.22  ? 136 SER B CB    1 
ATOM   3096 O  OG    . SER B 1  139 ? -22.242 20.239 10.864  1.00 69.53  ? 136 SER B OG    1 
ATOM   3097 N  N     . GLN B 1  140 ? -19.669 19.624 8.364   1.00 70.19  ? 137 GLN B N     1 
ATOM   3098 C  CA    . GLN B 1  140 ? -19.270 19.936 6.987   1.00 70.79  ? 137 GLN B CA    1 
ATOM   3099 C  C     . GLN B 1  140 ? -17.939 20.713 6.970   1.00 70.66  ? 137 GLN B C     1 
ATOM   3100 O  O     . GLN B 1  140 ? -17.757 21.643 6.173   1.00 71.02  ? 137 GLN B O     1 
ATOM   3101 C  CB    . GLN B 1  140 ? -20.355 20.734 6.259   1.00 71.10  ? 137 GLN B CB    1 
ATOM   3102 C  CG    . GLN B 1  140 ? -21.779 20.333 6.604   1.00 73.88  ? 137 GLN B CG    1 
ATOM   3103 C  CD    . GLN B 1  140 ? -22.361 19.297 5.663   1.00 77.38  ? 137 GLN B CD    1 
ATOM   3104 O  OE1   . GLN B 1  140 ? -22.098 19.314 4.451   1.00 79.06  ? 137 GLN B OE1   1 
ATOM   3105 N  NE2   . GLN B 1  140 ? -23.182 18.398 6.212   1.00 78.18  ? 137 GLN B NE2   1 
ATOM   3106 N  N     . GLY B 1  141 ? -17.023 20.343 7.866   1.00 70.16  ? 138 GLY B N     1 
ATOM   3107 C  CA    . GLY B 1  141 ? -15.726 20.996 7.946   1.00 69.56  ? 138 GLY B CA    1 
ATOM   3108 C  C     . GLY B 1  141 ? -15.723 22.387 8.561   1.00 69.36  ? 138 GLY B C     1 
ATOM   3109 O  O     . GLY B 1  141 ? -14.698 23.084 8.509   1.00 69.84  ? 138 GLY B O     1 
ATOM   3110 N  N     . TYR B 1  142 ? -16.852 22.801 9.145   1.00 68.48  ? 139 TYR B N     1 
ATOM   3111 C  CA    . TYR B 1  142 ? -16.927 24.077 9.866   1.00 67.50  ? 139 TYR B CA    1 
ATOM   3112 C  C     . TYR B 1  142 ? -16.760 23.874 11.367  1.00 66.68  ? 139 TYR B C     1 
ATOM   3113 O  O     . TYR B 1  142 ? -17.159 22.831 11.893  1.00 66.59  ? 139 TYR B O     1 
ATOM   3114 C  CB    . TYR B 1  142 ? -18.242 24.788 9.575   1.00 67.66  ? 139 TYR B CB    1 
ATOM   3115 C  CG    . TYR B 1  142 ? -18.345 25.324 8.160   1.00 68.35  ? 139 TYR B CG    1 
ATOM   3116 C  CD1   . TYR B 1  142 ? -17.831 26.574 7.830   1.00 67.97  ? 139 TYR B CD1   1 
ATOM   3117 C  CD2   . TYR B 1  142 ? -18.956 24.577 7.148   1.00 68.65  ? 139 TYR B CD2   1 
ATOM   3118 C  CE1   . TYR B 1  142 ? -17.928 27.070 6.535   1.00 67.91  ? 139 TYR B CE1   1 
ATOM   3119 C  CE2   . TYR B 1  142 ? -19.047 25.066 5.847   1.00 68.05  ? 139 TYR B CE2   1 
ATOM   3120 C  CZ    . TYR B 1  142 ? -18.535 26.314 5.553   1.00 67.53  ? 139 TYR B CZ    1 
ATOM   3121 O  OH    . TYR B 1  142 ? -18.627 26.815 4.277   1.00 66.79  ? 139 TYR B OH    1 
ATOM   3122 N  N     . LEU B 1  143 ? -16.186 24.870 12.048  1.00 65.46  ? 140 LEU B N     1 
ATOM   3123 C  CA    . LEU B 1  143 ? -15.851 24.754 13.472  1.00 64.27  ? 140 LEU B CA    1 
ATOM   3124 C  C     . LEU B 1  143 ? -16.346 25.906 14.354  1.00 63.27  ? 140 LEU B C     1 
ATOM   3125 O  O     . LEU B 1  143 ? -16.463 25.763 15.568  1.00 63.37  ? 140 LEU B O     1 
ATOM   3126 C  CB    . LEU B 1  143 ? -14.336 24.633 13.642  1.00 64.57  ? 140 LEU B CB    1 
ATOM   3127 C  CG    . LEU B 1  143 ? -13.561 23.435 13.086  1.00 65.31  ? 140 LEU B CG    1 
ATOM   3128 C  CD1   . LEU B 1  143 ? -12.048 23.647 13.270  1.00 65.91  ? 140 LEU B CD1   1 
ATOM   3129 C  CD2   . LEU B 1  143 ? -14.001 22.140 13.739  1.00 65.51  ? 140 LEU B CD2   1 
ATOM   3130 N  N     . TYR B 1  144 ? -16.610 27.057 13.752  1.00 61.82  ? 141 TYR B N     1 
ATOM   3131 C  CA    . TYR B 1  144 ? -17.002 28.238 14.513  1.00 60.09  ? 141 TYR B CA    1 
ATOM   3132 C  C     . TYR B 1  144 ? -18.303 28.847 13.996  1.00 58.23  ? 141 TYR B C     1 
ATOM   3133 O  O     . TYR B 1  144 ? -18.746 28.546 12.885  1.00 58.19  ? 141 TYR B O     1 
ATOM   3134 C  CB    . TYR B 1  144 ? -15.887 29.281 14.454  1.00 60.71  ? 141 TYR B CB    1 
ATOM   3135 C  CG    . TYR B 1  144 ? -14.626 28.940 15.230  1.00 62.72  ? 141 TYR B CG    1 
ATOM   3136 C  CD1   . TYR B 1  144 ? -14.343 29.572 16.444  1.00 64.29  ? 141 TYR B CD1   1 
ATOM   3137 C  CD2   . TYR B 1  144 ? -13.705 28.012 14.743  1.00 64.52  ? 141 TYR B CD2   1 
ATOM   3138 C  CE1   . TYR B 1  144 ? -13.187 29.277 17.162  1.00 65.27  ? 141 TYR B CE1   1 
ATOM   3139 C  CE2   . TYR B 1  144 ? -12.535 27.702 15.463  1.00 65.96  ? 141 TYR B CE2   1 
ATOM   3140 C  CZ    . TYR B 1  144 ? -12.289 28.342 16.668  1.00 65.94  ? 141 TYR B CZ    1 
ATOM   3141 O  OH    . TYR B 1  144 ? -11.146 28.062 17.379  1.00 66.57  ? 141 TYR B OH    1 
ATOM   3142 N  N     . VAL B 1  145 ? -18.923 29.700 14.804  1.00 56.04  ? 142 VAL B N     1 
ATOM   3143 C  CA    . VAL B 1  145 ? -20.074 30.474 14.345  1.00 53.76  ? 142 VAL B CA    1 
ATOM   3144 C  C     . VAL B 1  145 ? -19.800 31.936 14.591  1.00 52.51  ? 142 VAL B C     1 
ATOM   3145 O  O     . VAL B 1  145 ? -19.474 32.313 15.707  1.00 52.67  ? 142 VAL B O     1 
ATOM   3146 C  CB    . VAL B 1  145 ? -21.367 30.106 15.084  1.00 53.70  ? 142 VAL B CB    1 
ATOM   3147 C  CG1   . VAL B 1  145 ? -22.485 31.063 14.674  1.00 53.60  ? 142 VAL B CG1   1 
ATOM   3148 C  CG2   . VAL B 1  145 ? -21.761 28.664 14.814  1.00 52.36  ? 142 VAL B CG2   1 
ATOM   3149 N  N     . LEU B 1  146 ? -19.914 32.761 13.560  1.00 50.83  ? 143 LEU B N     1 
ATOM   3150 C  CA    . LEU B 1  146 ? -19.829 34.192 13.759  1.00 49.24  ? 143 LEU B CA    1 
ATOM   3151 C  C     . LEU B 1  146 ? -21.224 34.661 14.058  1.00 48.28  ? 143 LEU B C     1 
ATOM   3152 O  O     . LEU B 1  146 ? -22.137 34.401 13.286  1.00 48.55  ? 143 LEU B O     1 
ATOM   3153 C  CB    . LEU B 1  146 ? -19.302 34.901 12.521  1.00 49.29  ? 143 LEU B CB    1 
ATOM   3154 C  CG    . LEU B 1  146 ? -19.224 36.426 12.657  1.00 48.74  ? 143 LEU B CG    1 
ATOM   3155 C  CD1   . LEU B 1  146 ? -18.136 36.834 13.661  1.00 47.38  ? 143 LEU B CD1   1 
ATOM   3156 C  CD2   . LEU B 1  146 ? -19.006 37.075 11.295  1.00 47.32  ? 143 LEU B CD2   1 
ATOM   3157 N  N     . VAL B 1  147 ? -21.393 35.333 15.187  1.00 46.87  ? 144 VAL B N     1 
ATOM   3158 C  CA    . VAL B 1  147 ? -22.701 35.724 15.649  1.00 45.38  ? 144 VAL B CA    1 
ATOM   3159 C  C     . VAL B 1  147 ? -22.850 37.202 15.415  1.00 45.18  ? 144 VAL B C     1 
ATOM   3160 O  O     . VAL B 1  147 ? -21.954 37.984 15.789  1.00 45.40  ? 144 VAL B O     1 
ATOM   3161 C  CB    . VAL B 1  147 ? -22.854 35.423 17.143  1.00 45.56  ? 144 VAL B CB    1 
ATOM   3162 C  CG1   . VAL B 1  147 ? -24.115 36.069 17.708  1.00 45.01  ? 144 VAL B CG1   1 
ATOM   3163 C  CG2   . VAL B 1  147 ? -22.859 33.932 17.371  1.00 44.58  ? 144 VAL B CG2   1 
ATOM   3164 N  N     . VAL B 1  148 ? -23.951 37.598 14.774  1.00 43.92  ? 145 VAL B N     1 
ATOM   3165 C  CA    . VAL B 1  148 ? -24.202 39.015 14.581  1.00 43.02  ? 145 VAL B CA    1 
ATOM   3166 C  C     . VAL B 1  148 ? -25.589 39.325 15.069  1.00 43.17  ? 145 VAL B C     1 
ATOM   3167 O  O     . VAL B 1  148 ? -26.563 38.645 14.694  1.00 43.18  ? 145 VAL B O     1 
ATOM   3168 C  CB    . VAL B 1  148 ? -24.060 39.492 13.115  1.00 43.33  ? 145 VAL B CB    1 
ATOM   3169 C  CG1   . VAL B 1  148 ? -24.122 41.032 13.068  1.00 42.36  ? 145 VAL B CG1   1 
ATOM   3170 C  CG2   . VAL B 1  148 ? -22.769 38.984 12.483  1.00 41.17  ? 145 VAL B CG2   1 
ATOM   3171 N  N     . VAL B 1  149 ? -25.669 40.341 15.926  1.00 42.43  ? 146 VAL B N     1 
ATOM   3172 C  CA    . VAL B 1  149 ? -26.927 40.724 16.525  1.00 42.03  ? 146 VAL B CA    1 
ATOM   3173 C  C     . VAL B 1  149 ? -27.079 42.208 16.377  1.00 42.01  ? 146 VAL B C     1 
ATOM   3174 O  O     . VAL B 1  149 ? -26.205 42.966 16.813  1.00 42.13  ? 146 VAL B O     1 
ATOM   3175 C  CB    . VAL B 1  149 ? -27.019 40.360 18.039  1.00 42.09  ? 146 VAL B CB    1 
ATOM   3176 C  CG1   . VAL B 1  149 ? -28.231 41.041 18.656  1.00 42.31  ? 146 VAL B CG1   1 
ATOM   3177 C  CG2   . VAL B 1  149 ? -27.137 38.863 18.236  1.00 40.52  ? 146 VAL B CG2   1 
ATOM   3178 N  N     . ASP B 1  150 ? -28.189 42.619 15.774  1.00 41.54  ? 147 ASP B N     1 
ATOM   3179 C  CA    . ASP B 1  150 ? -28.498 44.031 15.662  1.00 41.85  ? 147 ASP B CA    1 
ATOM   3180 C  C     . ASP B 1  150 ? -28.933 44.560 17.037  1.00 42.15  ? 147 ASP B C     1 
ATOM   3181 O  O     . ASP B 1  150 ? -29.724 43.916 17.721  1.00 42.08  ? 147 ASP B O     1 
ATOM   3182 C  CB    . ASP B 1  150 ? -29.593 44.255 14.619  1.00 41.58  ? 147 ASP B CB    1 
ATOM   3183 C  CG    . ASP B 1  150 ? -30.035 45.696 14.554  1.00 41.30  ? 147 ASP B CG    1 
ATOM   3184 O  OD1   . ASP B 1  150 ? -29.196 46.550 14.201  1.00 40.30  ? 147 ASP B OD1   1 
ATOM   3185 O  OD2   . ASP B 1  150 ? -31.217 45.975 14.865  1.00 41.06  ? 147 ASP B OD2   1 
ATOM   3186 N  N     . GLY B 1  151 ? -28.407 45.721 17.434  1.00 42.66  ? 148 GLY B N     1 
ATOM   3187 C  CA    . GLY B 1  151 ? -28.552 46.219 18.804  1.00 43.39  ? 148 GLY B CA    1 
ATOM   3188 C  C     . GLY B 1  151 ? -29.998 46.572 19.101  1.00 44.45  ? 148 GLY B C     1 
ATOM   3189 O  O     . GLY B 1  151 ? -30.594 46.071 20.058  1.00 44.64  ? 148 GLY B O     1 
ATOM   3190 N  N     . MET B 1  152 ? -30.564 47.427 18.255  1.00 44.84  ? 149 MET B N     1 
ATOM   3191 C  CA    . MET B 1  152 ? -31.925 47.909 18.423  1.00 45.19  ? 149 MET B CA    1 
ATOM   3192 C  C     . MET B 1  152 ? -33.000 46.816 18.334  1.00 45.25  ? 149 MET B C     1 
ATOM   3193 O  O     . MET B 1  152 ? -33.877 46.773 19.191  1.00 45.84  ? 149 MET B O     1 
ATOM   3194 C  CB    . MET B 1  152 ? -32.216 49.056 17.445  1.00 45.14  ? 149 MET B CB    1 
ATOM   3195 C  CG    . MET B 1  152 ? -33.521 49.797 17.688  1.00 45.15  ? 149 MET B CG    1 
ATOM   3196 S  SD    . MET B 1  152 ? -34.927 48.889 17.010  1.00 46.45  ? 149 MET B SD    1 
ATOM   3197 C  CE    . MET B 1  152 ? -36.179 49.159 18.283  1.00 47.04  ? 149 MET B CE    1 
ATOM   3198 N  N     . THR B 1  153 ? -32.947 45.946 17.326  1.00 45.08  ? 150 THR B N     1 
ATOM   3199 C  CA    . THR B 1  153 ? -34.028 44.955 17.130  1.00 44.68  ? 150 THR B CA    1 
ATOM   3200 C  C     . THR B 1  153 ? -33.785 43.616 17.826  1.00 44.93  ? 150 THR B C     1 
ATOM   3201 O  O     . THR B 1  153 ? -34.731 42.853 18.043  1.00 45.72  ? 150 THR B O     1 
ATOM   3202 C  CB    . THR B 1  153 ? -34.301 44.648 15.628  1.00 44.40  ? 150 THR B CB    1 
ATOM   3203 O  OG1   . THR B 1  153 ? -33.134 44.060 15.035  1.00 44.15  ? 150 THR B OG1   1 
ATOM   3204 C  CG2   . THR B 1  153 ? -34.668 45.887 14.873  1.00 43.77  ? 150 THR B CG2   1 
ATOM   3205 N  N     . GLY B 1  154 ? -32.528 43.301 18.140  1.00 44.69  ? 151 GLY B N     1 
ATOM   3206 C  CA    . GLY B 1  154 ? -32.192 41.975 18.658  1.00 44.12  ? 151 GLY B CA    1 
ATOM   3207 C  C     . GLY B 1  154 ? -32.157 40.903 17.570  1.00 44.47  ? 151 GLY B C     1 
ATOM   3208 O  O     . GLY B 1  154 ? -32.035 39.698 17.870  1.00 43.86  ? 151 GLY B O     1 
ATOM   3209 N  N     . PHE B 1  155 ? -32.241 41.327 16.298  1.00 44.44  ? 152 PHE B N     1 
ATOM   3210 C  CA    . PHE B 1  155 ? -32.177 40.383 15.178  1.00 44.22  ? 152 PHE B CA    1 
ATOM   3211 C  C     . PHE B 1  155 ? -30.795 39.748 15.088  1.00 44.98  ? 152 PHE B C     1 
ATOM   3212 O  O     . PHE B 1  155 ? -29.773 40.436 15.271  1.00 45.17  ? 152 PHE B O     1 
ATOM   3213 C  CB    . PHE B 1  155 ? -32.542 41.059 13.874  1.00 43.58  ? 152 PHE B CB    1 
ATOM   3214 C  CG    . PHE B 1  155 ? -33.036 40.118 12.827  1.00 42.16  ? 152 PHE B CG    1 
ATOM   3215 C  CD1   . PHE B 1  155 ? -34.395 39.847 12.709  1.00 40.63  ? 152 PHE B CD1   1 
ATOM   3216 C  CD2   . PHE B 1  155 ? -32.150 39.516 11.931  1.00 41.65  ? 152 PHE B CD2   1 
ATOM   3217 C  CE1   . PHE B 1  155 ? -34.869 38.974 11.720  1.00 40.69  ? 152 PHE B CE1   1 
ATOM   3218 C  CE2   . PHE B 1  155 ? -32.618 38.642 10.929  1.00 40.41  ? 152 PHE B CE2   1 
ATOM   3219 C  CZ    . PHE B 1  155 ? -33.976 38.366 10.829  1.00 39.40  ? 152 PHE B CZ    1 
ATOM   3220 N  N     . THR B 1  156 ? -30.778 38.438 14.839  1.00 45.34  ? 153 THR B N     1 
ATOM   3221 C  CA    . THR B 1  156 ? -29.542 37.641 14.807  1.00 45.83  ? 153 THR B CA    1 
ATOM   3222 C  C     . THR B 1  156 ? -29.267 36.997 13.449  1.00 46.21  ? 153 THR B C     1 
ATOM   3223 O  O     . THR B 1  156 ? -30.139 36.355 12.873  1.00 46.09  ? 153 THR B O     1 
ATOM   3224 C  CB    . THR B 1  156 ? -29.597 36.503 15.850  1.00 45.63  ? 153 THR B CB    1 
ATOM   3225 O  OG1   . THR B 1  156 ? -29.762 37.073 17.144  1.00 46.74  ? 153 THR B OG1   1 
ATOM   3226 C  CG2   . THR B 1  156 ? -28.324 35.657 15.831  1.00 45.05  ? 153 THR B CG2   1 
ATOM   3227 N  N     . TRP B 1  157 ? -28.041 37.163 12.963  1.00 46.88  ? 154 TRP B N     1 
ATOM   3228 C  CA    . TRP B 1  157 ? -27.548 36.444 11.797  1.00 47.10  ? 154 TRP B CA    1 
ATOM   3229 C  C     . TRP B 1  157 ? -26.416 35.582 12.271  1.00 47.32  ? 154 TRP B C     1 
ATOM   3230 O  O     . TRP B 1  157 ? -25.587 36.029 13.079  1.00 47.51  ? 154 TRP B O     1 
ATOM   3231 C  CB    . TRP B 1  157 ? -26.983 37.410 10.765  1.00 47.17  ? 154 TRP B CB    1 
ATOM   3232 C  CG    . TRP B 1  157 ? -27.976 38.282 10.079  1.00 48.13  ? 154 TRP B CG    1 
ATOM   3233 C  CD1   . TRP B 1  157 ? -28.621 38.007 8.914   1.00 49.26  ? 154 TRP B CD1   1 
ATOM   3234 C  CD2   . TRP B 1  157 ? -28.416 39.597 10.485  1.00 48.60  ? 154 TRP B CD2   1 
ATOM   3235 N  NE1   . TRP B 1  157 ? -29.445 39.062 8.564   1.00 50.39  ? 154 TRP B NE1   1 
ATOM   3236 C  CE2   . TRP B 1  157 ? -29.339 40.049 9.508   1.00 49.16  ? 154 TRP B CE2   1 
ATOM   3237 C  CE3   . TRP B 1  157 ? -28.123 40.433 11.575  1.00 49.11  ? 154 TRP B CE3   1 
ATOM   3238 C  CZ2   . TRP B 1  157 ? -29.972 41.305 9.582   1.00 49.31  ? 154 TRP B CZ2   1 
ATOM   3239 C  CZ3   . TRP B 1  157 ? -28.754 41.699 11.646  1.00 48.43  ? 154 TRP B CZ3   1 
ATOM   3240 C  CH2   . TRP B 1  157 ? -29.665 42.111 10.656  1.00 49.35  ? 154 TRP B CH2   1 
ATOM   3241 N  N     . LEU B 1  158 ? -26.351 34.364 11.746  1.00 47.71  ? 155 LEU B N     1 
ATOM   3242 C  CA    . LEU B 1  158 ? -25.274 33.429 12.091  1.00 48.33  ? 155 LEU B CA    1 
ATOM   3243 C  C     . LEU B 1  158 ? -24.474 32.985 10.863  1.00 49.15  ? 155 LEU B C     1 
ATOM   3244 O  O     . LEU B 1  158 ? -25.039 32.744 9.794   1.00 49.41  ? 155 LEU B O     1 
ATOM   3245 C  CB    . LEU B 1  158 ? -25.841 32.208 12.831  1.00 47.71  ? 155 LEU B CB    1 
ATOM   3246 C  CG    . LEU B 1  158 ? -26.684 32.497 14.081  1.00 46.76  ? 155 LEU B CG    1 
ATOM   3247 C  CD1   . LEU B 1  158 ? -27.320 31.234 14.631  1.00 46.05  ? 155 LEU B CD1   1 
ATOM   3248 C  CD2   . LEU B 1  158 ? -25.853 33.183 15.155  1.00 45.70  ? 155 LEU B CD2   1 
ATOM   3249 N  N     . TYR B 1  159 ? -23.159 32.877 11.012  1.00 50.12  ? 156 TYR B N     1 
ATOM   3250 C  CA    . TYR B 1  159 ? -22.321 32.422 9.909   1.00 51.00  ? 156 TYR B CA    1 
ATOM   3251 C  C     . TYR B 1  159 ? -21.336 31.382 10.395  1.00 51.57  ? 156 TYR B C     1 
ATOM   3252 O  O     . TYR B 1  159 ? -20.561 31.646 11.314  1.00 51.82  ? 156 TYR B O     1 
ATOM   3253 C  CB    . TYR B 1  159 ? -21.609 33.597 9.196   1.00 51.18  ? 156 TYR B CB    1 
ATOM   3254 C  CG    . TYR B 1  159 ? -22.595 34.583 8.609   1.00 51.65  ? 156 TYR B CG    1 
ATOM   3255 C  CD1   . TYR B 1  159 ? -23.258 34.306 7.411   1.00 52.38  ? 156 TYR B CD1   1 
ATOM   3256 C  CD2   . TYR B 1  159 ? -22.902 35.772 9.272   1.00 51.60  ? 156 TYR B CD2   1 
ATOM   3257 C  CE1   . TYR B 1  159 ? -24.199 35.196 6.889   1.00 53.33  ? 156 TYR B CE1   1 
ATOM   3258 C  CE2   . TYR B 1  159 ? -23.835 36.670 8.754   1.00 52.32  ? 156 TYR B CE2   1 
ATOM   3259 C  CZ    . TYR B 1  159 ? -24.482 36.369 7.570   1.00 53.40  ? 156 TYR B CZ    1 
ATOM   3260 O  OH    . TYR B 1  159 ? -25.422 37.234 7.061   1.00 56.00  ? 156 TYR B OH    1 
ATOM   3261 N  N     . PRO B 1  160 ? -21.380 30.185 9.784   1.00 52.07  ? 157 PRO B N     1 
ATOM   3262 C  CA    . PRO B 1  160 ? -20.392 29.117 9.988   1.00 52.45  ? 157 PRO B CA    1 
ATOM   3263 C  C     . PRO B 1  160 ? -19.046 29.518 9.404   1.00 53.10  ? 157 PRO B C     1 
ATOM   3264 O  O     . PRO B 1  160 ? -18.999 30.009 8.264   1.00 53.04  ? 157 PRO B O     1 
ATOM   3265 C  CB    . PRO B 1  160 ? -20.958 27.969 9.164   1.00 52.50  ? 157 PRO B CB    1 
ATOM   3266 C  CG    . PRO B 1  160 ? -21.792 28.647 8.097   1.00 52.07  ? 157 PRO B CG    1 
ATOM   3267 C  CD    . PRO B 1  160 ? -22.397 29.820 8.781   1.00 51.68  ? 157 PRO B CD    1 
ATOM   3268 N  N     . THR B 1  161 ? -17.974 29.343 10.180  1.00 53.84  ? 158 THR B N     1 
ATOM   3269 C  CA    . THR B 1  161 ? -16.608 29.576 9.690   1.00 54.62  ? 158 THR B CA    1 
ATOM   3270 C  C     . THR B 1  161 ? -15.685 28.404 10.009  1.00 56.11  ? 158 THR B C     1 
ATOM   3271 O  O     . THR B 1  161 ? -16.012 27.546 10.837  1.00 56.37  ? 158 THR B O     1 
ATOM   3272 C  CB    . THR B 1  161 ? -15.972 30.881 10.215  1.00 54.21  ? 158 THR B CB    1 
ATOM   3273 O  OG1   . THR B 1  161 ? -15.554 30.718 11.567  1.00 53.53  ? 158 THR B OG1   1 
ATOM   3274 C  CG2   . THR B 1  161 ? -16.927 32.052 10.123  1.00 54.44  ? 158 THR B CG2   1 
ATOM   3275 N  N     . LYS B 1  162 ? -14.542 28.362 9.326   1.00 57.85  ? 159 LYS B N     1 
ATOM   3276 C  CA    . LYS B 1  162 ? -13.540 27.320 9.543   1.00 59.38  ? 159 LYS B CA    1 
ATOM   3277 C  C     . LYS B 1  162 ? -12.512 27.752 10.588  1.00 59.61  ? 159 LYS B C     1 
ATOM   3278 O  O     . LYS B 1  162 ? -11.708 26.940 11.051  1.00 60.29  ? 159 LYS B O     1 
ATOM   3279 C  CB    . LYS B 1  162 ? -12.842 26.953 8.224   1.00 60.00  ? 159 LYS B CB    1 
ATOM   3280 C  CG    . LYS B 1  162 ? -13.676 26.100 7.244   1.00 63.26  ? 159 LYS B CG    1 
ATOM   3281 C  CD    . LYS B 1  162 ? -12.888 25.830 5.949   1.00 68.82  ? 159 LYS B CD    1 
ATOM   3282 C  CE    . LYS B 1  162 ? -13.790 25.702 4.703   1.00 71.44  ? 159 LYS B CE    1 
ATOM   3283 N  NZ    . LYS B 1  162 ? -14.516 24.395 4.664   1.00 72.70  ? 159 LYS B NZ    1 
ATOM   3284 N  N     . ALA B 1  163 ? -12.547 29.031 10.959  1.00 59.75  ? 160 ALA B N     1 
ATOM   3285 C  CA    . ALA B 1  163 ? -11.605 29.600 11.918  1.00 59.91  ? 160 ALA B CA    1 
ATOM   3286 C  C     . ALA B 1  163 ? -12.057 30.994 12.350  1.00 59.89  ? 160 ALA B C     1 
ATOM   3287 O  O     . ALA B 1  163 ? -12.812 31.650 11.636  1.00 60.12  ? 160 ALA B O     1 
ATOM   3288 C  CB    . ALA B 1  163 ? -10.202 29.664 11.314  1.00 60.03  ? 160 ALA B CB    1 
ATOM   3289 N  N     . PRO B 1  164 ? -11.593 31.458 13.522  1.00 59.76  ? 161 PRO B N     1 
ATOM   3290 C  CA    . PRO B 1  164 ? -11.958 32.803 13.947  1.00 59.24  ? 161 PRO B CA    1 
ATOM   3291 C  C     . PRO B 1  164 ? -10.975 33.838 13.429  1.00 58.55  ? 161 PRO B C     1 
ATOM   3292 O  O     . PRO B 1  164 ? -10.405 34.593 14.235  1.00 58.42  ? 161 PRO B O     1 
ATOM   3293 C  CB    . PRO B 1  164 ? -11.863 32.711 15.474  1.00 59.66  ? 161 PRO B CB    1 
ATOM   3294 C  CG    . PRO B 1  164 ? -10.765 31.727 15.717  1.00 59.99  ? 161 PRO B CG    1 
ATOM   3295 C  CD    . PRO B 1  164 ? -10.850 30.732 14.572  1.00 59.96  ? 161 PRO B CD    1 
ATOM   3296 N  N     . SER B 1  165 ? -10.783 33.881 12.106  1.00 57.50  ? 162 SER B N     1 
ATOM   3297 C  CA    . SER B 1  165 ? -9.738  34.730 11.495  1.00 56.23  ? 162 SER B CA    1 
ATOM   3298 C  C     . SER B 1  165 ? -10.325 35.992 10.918  1.00 55.20  ? 162 SER B C     1 
ATOM   3299 O  O     . SER B 1  165 ? -11.541 36.081 10.753  1.00 54.99  ? 162 SER B O     1 
ATOM   3300 C  CB    . SER B 1  165 ? -8.999  33.969 10.403  1.00 56.14  ? 162 SER B CB    1 
ATOM   3301 O  OG    . SER B 1  165 ? -9.929  33.370 9.518   1.00 57.42  ? 162 SER B OG    1 
ATOM   3302 N  N     . THR B 1  166 ? -9.472  36.971 10.619  1.00 54.09  ? 163 THR B N     1 
ATOM   3303 C  CA    . THR B 1  166 ? -9.929  38.171 9.931   1.00 53.26  ? 163 THR B CA    1 
ATOM   3304 C  C     . THR B 1  166 ? -10.516 37.808 8.577   1.00 53.06  ? 163 THR B C     1 
ATOM   3305 O  O     . THR B 1  166 ? -11.549 38.341 8.175   1.00 53.48  ? 163 THR B O     1 
ATOM   3306 C  CB    . THR B 1  166 ? -8.826  39.167 9.726   1.00 53.26  ? 163 THR B CB    1 
ATOM   3307 O  OG1   . THR B 1  166 ? -8.240  39.472 10.994  1.00 53.32  ? 163 THR B OG1   1 
ATOM   3308 C  CG2   . THR B 1  166 ? -9.389  40.440 9.116   1.00 52.33  ? 163 THR B CG2   1 
ATOM   3309 N  N     . SER B 1  167 ? -9.863  36.873 7.899   1.00 52.26  ? 164 SER B N     1 
ATOM   3310 C  CA    . SER B 1  167 ? -10.297 36.397 6.596   1.00 51.32  ? 164 SER B CA    1 
ATOM   3311 C  C     . SER B 1  167 ? -11.728 35.836 6.640   1.00 50.57  ? 164 SER B C     1 
ATOM   3312 O  O     . SER B 1  167 ? -12.566 36.194 5.809   1.00 49.87  ? 164 SER B O     1 
ATOM   3313 C  CB    . SER B 1  167 ? -9.272  35.382 6.045   1.00 51.09  ? 164 SER B CB    1 
ATOM   3314 O  OG    . SER B 1  167 ? -9.873  34.379 5.252   1.00 51.39  ? 164 SER B OG    1 
ATOM   3315 N  N     . ALA B 1  168 ? -11.999 34.966 7.615   1.00 50.12  ? 165 ALA B N     1 
ATOM   3316 C  CA    . ALA B 1  168 ? -13.319 34.312 7.738   1.00 49.43  ? 165 ALA B CA    1 
ATOM   3317 C  C     . ALA B 1  168 ? -14.385 35.333 8.123   1.00 49.08  ? 165 ALA B C     1 
ATOM   3318 O  O     . ALA B 1  168 ? -15.553 35.212 7.739   1.00 48.98  ? 165 ALA B O     1 
ATOM   3319 C  CB    . ALA B 1  168 ? -13.269 33.181 8.753   1.00 48.75  ? 165 ALA B CB    1 
ATOM   3320 N  N     . THR B 1  169 ? -13.966 36.349 8.872   1.00 48.80  ? 166 THR B N     1 
ATOM   3321 C  CA    . THR B 1  169 ? -14.872 37.366 9.338   1.00 48.97  ? 166 THR B CA    1 
ATOM   3322 C  C     . THR B 1  169 ? -15.259 38.200 8.143   1.00 49.23  ? 166 THR B C     1 
ATOM   3323 O  O     . THR B 1  169 ? -16.444 38.456 7.920   1.00 49.57  ? 166 THR B O     1 
ATOM   3324 C  CB    . THR B 1  169 ? -14.233 38.230 10.450  1.00 49.15  ? 166 THR B CB    1 
ATOM   3325 O  OG1   . THR B 1  169 ? -13.801 37.379 11.513  1.00 49.10  ? 166 THR B OG1   1 
ATOM   3326 C  CG2   . THR B 1  169 ? -15.228 39.260 11.006  1.00 48.77  ? 166 THR B CG2   1 
ATOM   3327 N  N     . VAL B 1  170 ? -14.253 38.609 7.369   1.00 49.42  ? 167 VAL B N     1 
ATOM   3328 C  CA    . VAL B 1  170 ? -14.483 39.415 6.181   1.00 49.42  ? 167 VAL B CA    1 
ATOM   3329 C  C     . VAL B 1  170 ? -15.391 38.693 5.172   1.00 49.97  ? 167 VAL B C     1 
ATOM   3330 O  O     . VAL B 1  170 ? -16.377 39.274 4.715   1.00 50.21  ? 167 VAL B O     1 
ATOM   3331 C  CB    . VAL B 1  170 ? -13.159 39.918 5.553   1.00 49.37  ? 167 VAL B CB    1 
ATOM   3332 C  CG1   . VAL B 1  170 ? -13.376 40.422 4.123   1.00 48.72  ? 167 VAL B CG1   1 
ATOM   3333 C  CG2   . VAL B 1  170 ? -12.548 41.029 6.411   1.00 48.03  ? 167 VAL B CG2   1 
ATOM   3334 N  N     . LYS B 1  171 ? -15.088 37.433 4.857   1.00 50.29  ? 168 LYS B N     1 
ATOM   3335 C  CA    . LYS B 1  171 ? -15.919 36.662 3.925   1.00 51.22  ? 168 LYS B CA    1 
ATOM   3336 C  C     . LYS B 1  171 ? -17.361 36.605 4.377   1.00 50.73  ? 168 LYS B C     1 
ATOM   3337 O  O     . LYS B 1  171 ? -18.257 36.823 3.570   1.00 50.88  ? 168 LYS B O     1 
ATOM   3338 C  CB    . LYS B 1  171 ? -15.342 35.267 3.638   1.00 51.84  ? 168 LYS B CB    1 
ATOM   3339 C  CG    . LYS B 1  171 ? -14.324 35.282 2.447   1.00 56.55  ? 168 LYS B CG    1 
ATOM   3340 C  CD    . LYS B 1  171 ? -13.213 34.201 2.514   1.00 61.97  ? 168 LYS B CD    1 
ATOM   3341 C  CE    . LYS B 1  171 ? -13.759 32.764 2.351   1.00 66.12  ? 168 LYS B CE    1 
ATOM   3342 N  NZ    . LYS B 1  171 ? -12.643 31.733 2.298   1.00 68.07  ? 168 LYS B NZ    1 
ATOM   3343 N  N     . SER B 1  172 ? -17.572 36.374 5.676   1.00 50.47  ? 169 SER B N     1 
ATOM   3344 C  CA    . SER B 1  172 ? -18.919 36.279 6.263   1.00 49.78  ? 169 SER B CA    1 
ATOM   3345 C  C     . SER B 1  172 ? -19.668 37.608 6.280   1.00 48.91  ? 169 SER B C     1 
ATOM   3346 O  O     . SER B 1  172 ? -20.824 37.679 5.866   1.00 49.07  ? 169 SER B O     1 
ATOM   3347 C  CB    . SER B 1  172 ? -18.839 35.724 7.677   1.00 50.10  ? 169 SER B CB    1 
ATOM   3348 O  OG    . SER B 1  172 ? -18.464 34.357 7.680   1.00 51.72  ? 169 SER B OG    1 
ATOM   3349 N  N     . LEU B 1  173 ? -19.017 38.659 6.762   1.00 47.76  ? 170 LEU B N     1 
ATOM   3350 C  CA    . LEU B 1  173 ? -19.649 39.978 6.825   1.00 47.04  ? 170 LEU B CA    1 
ATOM   3351 C  C     . LEU B 1  173 ? -19.934 40.583 5.446   1.00 46.72  ? 170 LEU B C     1 
ATOM   3352 O  O     . LEU B 1  173 ? -20.916 41.321 5.278   1.00 46.79  ? 170 LEU B O     1 
ATOM   3353 C  CB    . LEU B 1  173 ? -18.832 40.947 7.689   1.00 46.93  ? 170 LEU B CB    1 
ATOM   3354 C  CG    . LEU B 1  173 ? -18.799 40.671 9.197   1.00 46.84  ? 170 LEU B CG    1 
ATOM   3355 C  CD1   . LEU B 1  173 ? -18.020 41.739 9.884   1.00 45.88  ? 170 LEU B CD1   1 
ATOM   3356 C  CD2   . LEU B 1  173 ? -20.201 40.580 9.792   1.00 46.42  ? 170 LEU B CD2   1 
ATOM   3357 N  N     . ASN B 1  174 ? -19.083 40.258 4.469   1.00 45.82  ? 171 ASN B N     1 
ATOM   3358 C  CA    . ASN B 1  174 ? -19.336 40.598 3.073   1.00 44.84  ? 171 ASN B CA    1 
ATOM   3359 C  C     . ASN B 1  174 ? -20.719 40.115 2.614   1.00 44.44  ? 171 ASN B C     1 
ATOM   3360 O  O     . ASN B 1  174 ? -21.427 40.847 1.908   1.00 45.38  ? 171 ASN B O     1 
ATOM   3361 C  CB    . ASN B 1  174 ? -18.244 40.040 2.159   1.00 44.32  ? 171 ASN B CB    1 
ATOM   3362 C  CG    . ASN B 1  174 ? -17.090 41.004 1.959   1.00 43.73  ? 171 ASN B CG    1 
ATOM   3363 O  OD1   . ASN B 1  174 ? -17.152 42.197 2.303   1.00 44.11  ? 171 ASN B OD1   1 
ATOM   3364 N  ND2   . ASN B 1  174 ? -16.025 40.495 1.372   1.00 42.57  ? 171 ASN B ND2   1 
ATOM   3365 N  N     . VAL B 1  175 ? -21.101 38.904 3.018   1.00 42.90  ? 172 VAL B N     1 
ATOM   3366 C  CA    . VAL B 1  175 ? -22.434 38.395 2.746   1.00 42.06  ? 172 VAL B CA    1 
ATOM   3367 C  C     . VAL B 1  175 ? -23.501 39.257 3.445   1.00 42.62  ? 172 VAL B C     1 
ATOM   3368 O  O     . VAL B 1  175 ? -24.410 39.772 2.794   1.00 42.48  ? 172 VAL B O     1 
ATOM   3369 C  CB    . VAL B 1  175 ? -22.567 36.920 3.169   1.00 41.96  ? 172 VAL B CB    1 
ATOM   3370 C  CG1   . VAL B 1  175 ? -23.954 36.395 2.878   1.00 40.67  ? 172 VAL B CG1   1 
ATOM   3371 C  CG2   . VAL B 1  175 ? -21.503 36.059 2.477   1.00 40.54  ? 172 VAL B CG2   1 
ATOM   3372 N  N     . LEU B 1  176 ? -23.379 39.435 4.762   1.00 43.13  ? 173 LEU B N     1 
ATOM   3373 C  CA    . LEU B 1  176 ? -24.347 40.233 5.505   1.00 43.33  ? 173 LEU B CA    1 
ATOM   3374 C  C     . LEU B 1  176 ? -24.412 41.679 5.025   1.00 44.10  ? 173 LEU B C     1 
ATOM   3375 O  O     . LEU B 1  176 ? -25.503 42.256 4.944   1.00 44.95  ? 173 LEU B O     1 
ATOM   3376 C  CB    . LEU B 1  176 ? -24.080 40.189 7.027   1.00 43.24  ? 173 LEU B CB    1 
ATOM   3377 C  CG    . LEU B 1  176 ? -24.958 41.082 7.941   1.00 42.64  ? 173 LEU B CG    1 
ATOM   3378 C  CD1   . LEU B 1  176 ? -26.452 40.832 7.737   1.00 39.83  ? 173 LEU B CD1   1 
ATOM   3379 C  CD2   . LEU B 1  176 ? -24.600 40.967 9.421   1.00 40.66  ? 173 LEU B CD2   1 
ATOM   3380 N  N     . THR B 1  177 ? -23.264 42.281 4.734   1.00 44.23  ? 174 THR B N     1 
ATOM   3381 C  CA    . THR B 1  177 ? -23.252 43.697 4.363   1.00 44.60  ? 174 THR B CA    1 
ATOM   3382 C  C     . THR B 1  177 ? -23.662 43.916 2.907   1.00 45.25  ? 174 THR B C     1 
ATOM   3383 O  O     . THR B 1  177 ? -23.758 45.062 2.447   1.00 45.81  ? 174 THR B O     1 
ATOM   3384 C  CB    . THR B 1  177 ? -21.887 44.349 4.614   1.00 44.52  ? 174 THR B CB    1 
ATOM   3385 O  OG1   . THR B 1  177 ? -20.868 43.531 4.034   1.00 44.63  ? 174 THR B OG1   1 
ATOM   3386 C  CG2   . THR B 1  177 ? -21.615 44.498 6.117   1.00 44.74  ? 174 THR B CG2   1 
ATOM   3387 N  N     . SER B 1  178 ? -23.890 42.829 2.174   1.00 45.26  ? 175 SER B N     1 
ATOM   3388 C  CA    . SER B 1  178 ? -24.536 42.934 0.871   1.00 45.85  ? 175 SER B CA    1 
ATOM   3389 C  C     . SER B 1  178 ? -26.069 42.988 1.040   1.00 45.92  ? 175 SER B C     1 
ATOM   3390 O  O     . SER B 1  178 ? -26.810 43.004 0.048   1.00 45.87  ? 175 SER B O     1 
ATOM   3391 C  CB    . SER B 1  178 ? -24.131 41.763 -0.026  1.00 46.06  ? 175 SER B CB    1 
ATOM   3392 O  OG    . SER B 1  178 ? -24.827 40.564 0.326   1.00 47.67  ? 175 SER B OG    1 
ATOM   3393 N  N     . ILE B 1  179 ? -26.534 43.002 2.297   1.00 45.55  ? 176 ILE B N     1 
ATOM   3394 C  CA    . ILE B 1  179 ? -27.964 43.089 2.617   1.00 45.26  ? 176 ILE B CA    1 
ATOM   3395 C  C     . ILE B 1  179 ? -28.236 44.339 3.427   1.00 45.33  ? 176 ILE B C     1 
ATOM   3396 O  O     . ILE B 1  179 ? -29.126 45.118 3.082   1.00 45.77  ? 176 ILE B O     1 
ATOM   3397 C  CB    . ILE B 1  179 ? -28.479 41.842 3.342   1.00 45.05  ? 176 ILE B CB    1 
ATOM   3398 C  CG1   . ILE B 1  179 ? -28.626 40.708 2.344   1.00 46.75  ? 176 ILE B CG1   1 
ATOM   3399 C  CG2   . ILE B 1  179 ? -29.826 42.089 3.990   1.00 44.27  ? 176 ILE B CG2   1 
ATOM   3400 C  CD1   . ILE B 1  179 ? -28.762 39.333 2.998   1.00 51.78  ? 176 ILE B CD1   1 
ATOM   3401 N  N     . ALA B 1  180 ? -27.468 44.545 4.491   1.00 44.92  ? 177 ALA B N     1 
ATOM   3402 C  CA    . ALA B 1  180 ? -27.537 45.810 5.221   1.00 44.85  ? 177 ALA B CA    1 
ATOM   3403 C  C     . ALA B 1  180 ? -26.194 46.161 5.831   1.00 44.45  ? 177 ALA B C     1 
ATOM   3404 O  O     . ALA B 1  180 ? -25.469 45.293 6.298   1.00 44.01  ? 177 ALA B O     1 
ATOM   3405 C  CB    . ALA B 1  180 ? -28.598 45.750 6.301   1.00 45.46  ? 177 ALA B CB    1 
ATOM   3406 N  N     . ILE B 1  181 ? -25.862 47.442 5.817   1.00 44.32  ? 178 ILE B N     1 
ATOM   3407 C  CA    . ILE B 1  181 ? -24.612 47.874 6.396   1.00 44.05  ? 178 ILE B CA    1 
ATOM   3408 C  C     . ILE B 1  181 ? -24.858 48.621 7.713   1.00 44.05  ? 178 ILE B C     1 
ATOM   3409 O  O     . ILE B 1  181 ? -25.641 49.571 7.745   1.00 43.37  ? 178 ILE B O     1 
ATOM   3410 C  CB    . ILE B 1  181 ? -23.819 48.755 5.427   1.00 43.98  ? 178 ILE B CB    1 
ATOM   3411 C  CG1   . ILE B 1  181 ? -23.550 48.013 4.107   1.00 43.62  ? 178 ILE B CG1   1 
ATOM   3412 C  CG2   . ILE B 1  181 ? -22.499 49.174 6.079   1.00 44.77  ? 178 ILE B CG2   1 
ATOM   3413 C  CD1   . ILE B 1  181 ? -22.758 48.852 3.050   1.00 40.51  ? 178 ILE B CD1   1 
ATOM   3414 N  N     . PRO B 1  182 ? -24.188 48.185 8.803   1.00 44.28  ? 179 PRO B N     1 
ATOM   3415 C  CA    . PRO B 1  182 ? -24.271 48.864 10.109  1.00 44.59  ? 179 PRO B CA    1 
ATOM   3416 C  C     . PRO B 1  182 ? -23.473 50.154 10.101  1.00 44.92  ? 179 PRO B C     1 
ATOM   3417 O  O     . PRO B 1  182 ? -22.488 50.239 9.351   1.00 45.49  ? 179 PRO B O     1 
ATOM   3418 C  CB    . PRO B 1  182 ? -23.575 47.882 11.047  1.00 44.66  ? 179 PRO B CB    1 
ATOM   3419 C  CG    . PRO B 1  182 ? -22.584 47.171 10.171  1.00 44.12  ? 179 PRO B CG    1 
ATOM   3420 C  CD    . PRO B 1  182 ? -23.278 47.023 8.846   1.00 44.13  ? 179 PRO B CD    1 
ATOM   3421 N  N     . LYS B 1  183 ? -23.881 51.137 10.907  1.00 44.71  ? 180 LYS B N     1 
ATOM   3422 C  CA    . LYS B 1  183 ? -23.032 52.312 11.186  1.00 44.99  ? 180 LYS B CA    1 
ATOM   3423 C  C     . LYS B 1  183 ? -21.854 51.924 12.067  1.00 45.07  ? 180 LYS B C     1 
ATOM   3424 O  O     . LYS B 1  183 ? -20.736 52.360 11.847  1.00 45.47  ? 180 LYS B O     1 
ATOM   3425 C  CB    . LYS B 1  183 ? -23.814 53.431 11.871  1.00 44.80  ? 180 LYS B CB    1 
ATOM   3426 C  CG    . LYS B 1  183 ? -24.988 53.921 11.052  1.00 46.87  ? 180 LYS B CG    1 
ATOM   3427 C  CD    . LYS B 1  183 ? -25.721 55.102 11.678  1.00 49.03  ? 180 LYS B CD    1 
ATOM   3428 C  CE    . LYS B 1  183 ? -26.837 55.537 10.744  1.00 50.47  ? 180 LYS B CE    1 
ATOM   3429 N  NZ    . LYS B 1  183 ? -27.784 56.450 11.418  1.00 52.67  ? 180 LYS B NZ    1 
ATOM   3430 N  N     . VAL B 1  184 ? -22.110 51.095 13.075  1.00 45.31  ? 181 VAL B N     1 
ATOM   3431 C  CA    . VAL B 1  184 ? -21.071 50.708 14.020  1.00 44.88  ? 181 VAL B CA    1 
ATOM   3432 C  C     . VAL B 1  184 ? -21.045 49.201 14.164  1.00 45.06  ? 181 VAL B C     1 
ATOM   3433 O  O     . VAL B 1  184 ? -22.093 48.545 14.255  1.00 44.78  ? 181 VAL B O     1 
ATOM   3434 C  CB    . VAL B 1  184 ? -21.276 51.392 15.415  1.00 44.85  ? 181 VAL B CB    1 
ATOM   3435 C  CG1   . VAL B 1  184 ? -20.442 50.722 16.485  1.00 44.70  ? 181 VAL B CG1   1 
ATOM   3436 C  CG2   . VAL B 1  184 ? -20.959 52.894 15.340  1.00 43.62  ? 181 VAL B CG2   1 
ATOM   3437 N  N     . ILE B 1  185 ? -19.844 48.644 14.157  1.00 45.18  ? 182 ILE B N     1 
ATOM   3438 C  CA    . ILE B 1  185 ? -19.693 47.277 14.616  1.00 45.80  ? 182 ILE B CA    1 
ATOM   3439 C  C     . ILE B 1  185 ? -19.025 47.321 15.985  1.00 46.20  ? 182 ILE B C     1 
ATOM   3440 O  O     . ILE B 1  185 ? -18.058 48.062 16.177  1.00 46.51  ? 182 ILE B O     1 
ATOM   3441 C  CB    . ILE B 1  185 ? -18.885 46.431 13.650  1.00 45.41  ? 182 ILE B CB    1 
ATOM   3442 C  CG1   . ILE B 1  185 ? -19.741 46.112 12.433  1.00 45.76  ? 182 ILE B CG1   1 
ATOM   3443 C  CG2   . ILE B 1  185 ? -18.393 45.158 14.330  1.00 45.16  ? 182 ILE B CG2   1 
ATOM   3444 C  CD1   . ILE B 1  185 ? -18.977 45.480 11.302  1.00 45.61  ? 182 ILE B CD1   1 
ATOM   3445 N  N     . HIS B 1  186 ? -19.570 46.560 16.931  1.00 46.22  ? 183 HIS B N     1 
ATOM   3446 C  CA    . HIS B 1  186 ? -18.981 46.438 18.246  1.00 46.62  ? 183 HIS B CA    1 
ATOM   3447 C  C     . HIS B 1  186 ? -18.540 45.004 18.462  1.00 46.73  ? 183 HIS B C     1 
ATOM   3448 O  O     . HIS B 1  186 ? -19.277 44.060 18.167  1.00 46.75  ? 183 HIS B O     1 
ATOM   3449 C  CB    . HIS B 1  186 ? -19.955 46.892 19.342  1.00 46.75  ? 183 HIS B CB    1 
ATOM   3450 C  CG    . HIS B 1  186 ? -19.472 46.607 20.729  1.00 47.97  ? 183 HIS B CG    1 
ATOM   3451 N  ND1   . HIS B 1  186 ? -19.086 47.601 21.602  1.00 48.62  ? 183 HIS B ND1   1 
ATOM   3452 C  CD2   . HIS B 1  186 ? -19.280 45.432 21.382  1.00 48.14  ? 183 HIS B CD2   1 
ATOM   3453 C  CE1   . HIS B 1  186 ? -18.679 47.049 22.733  1.00 50.01  ? 183 HIS B CE1   1 
ATOM   3454 N  NE2   . HIS B 1  186 ? -18.786 45.735 22.625  1.00 48.80  ? 183 HIS B NE2   1 
ATOM   3455 N  N     . SER B 1  187 ? -17.325 44.844 18.972  1.00 47.30  ? 184 SER B N     1 
ATOM   3456 C  CA    . SER B 1  187 ? -16.818 43.518 19.337  1.00 47.91  ? 184 SER B CA    1 
ATOM   3457 C  C     . SER B 1  187 ? -15.913 43.644 20.551  1.00 47.87  ? 184 SER B C     1 
ATOM   3458 O  O     . SER B 1  187 ? -15.546 44.765 20.953  1.00 47.32  ? 184 SER B O     1 
ATOM   3459 C  CB    . SER B 1  187 ? -16.018 42.907 18.179  1.00 47.98  ? 184 SER B CB    1 
ATOM   3460 O  OG    . SER B 1  187 ? -14.925 43.765 17.841  1.00 49.09  ? 184 SER B OG    1 
ATOM   3461 N  N     . ASP B 1  188 ? -15.550 42.493 21.116  1.00 47.87  ? 185 ASP B N     1 
ATOM   3462 C  CA    . ASP B 1  188 ? -14.455 42.434 22.072  1.00 48.76  ? 185 ASP B CA    1 
ATOM   3463 C  C     . ASP B 1  188 ? -13.110 42.530 21.296  1.00 48.98  ? 185 ASP B C     1 
ATOM   3464 O  O     . ASP B 1  188 ? -13.103 42.657 20.070  1.00 49.24  ? 185 ASP B O     1 
ATOM   3465 C  CB    . ASP B 1  188 ? -14.536 41.149 22.886  1.00 48.42  ? 185 ASP B CB    1 
ATOM   3466 C  CG    . ASP B 1  188 ? -14.170 39.938 22.079  1.00 50.34  ? 185 ASP B CG    1 
ATOM   3467 O  OD1   . ASP B 1  188 ? -14.577 38.828 22.474  1.00 53.17  ? 185 ASP B OD1   1 
ATOM   3468 O  OD2   . ASP B 1  188 ? -13.484 40.081 21.033  1.00 51.57  ? 185 ASP B OD2   1 
ATOM   3469 N  N     . GLN B 1  189 ? -11.982 42.450 21.988  1.00 49.10  ? 186 GLN B N     1 
ATOM   3470 C  CA    . GLN B 1  189 ? -10.700 42.647 21.319  1.00 49.56  ? 186 GLN B CA    1 
ATOM   3471 C  C     . GLN B 1  189 ? -10.094 41.378 20.749  1.00 49.73  ? 186 GLN B C     1 
ATOM   3472 O  O     . GLN B 1  189 ? -8.887  41.216 20.763  1.00 50.15  ? 186 GLN B O     1 
ATOM   3473 C  CB    . GLN B 1  189 ? -9.711  43.384 22.223  1.00 49.39  ? 186 GLN B CB    1 
ATOM   3474 C  CG    . GLN B 1  189 ? -10.308 44.638 22.834  1.00 50.59  ? 186 GLN B CG    1 
ATOM   3475 C  CD    . GLN B 1  189 ? -9.377  45.818 22.767  1.00 53.50  ? 186 GLN B CD    1 
ATOM   3476 O  OE1   . GLN B 1  189 ? -8.181  45.663 22.514  1.00 55.76  ? 186 GLN B OE1   1 
ATOM   3477 N  NE2   . GLN B 1  189 ? -9.918  47.020 22.983  1.00 53.93  ? 186 GLN B NE2   1 
ATOM   3478 N  N     . GLY B 1  190 ? -10.935 40.488 20.225  1.00 50.41  ? 187 GLY B N     1 
ATOM   3479 C  CA    . GLY B 1  190 ? -10.465 39.295 19.512  1.00 50.69  ? 187 GLY B CA    1 
ATOM   3480 C  C     . GLY B 1  190 ? -9.479  39.669 18.412  1.00 51.42  ? 187 GLY B C     1 
ATOM   3481 O  O     . GLY B 1  190 ? -9.566  40.767 17.818  1.00 51.25  ? 187 GLY B O     1 
ATOM   3482 N  N     . ALA B 1  191 ? -8.528  38.770 18.152  1.00 51.51  ? 188 ALA B N     1 
ATOM   3483 C  CA    . ALA B 1  191 ? -7.517  38.991 17.128  1.00 51.64  ? 188 ALA B CA    1 
ATOM   3484 C  C     . ALA B 1  191 ? -8.151  39.372 15.776  1.00 52.05  ? 188 ALA B C     1 
ATOM   3485 O  O     . ALA B 1  191 ? -7.812  40.419 15.208  1.00 52.33  ? 188 ALA B O     1 
ATOM   3486 C  CB    . ALA B 1  191 ? -6.661  37.771 16.982  1.00 51.80  ? 188 ALA B CB    1 
ATOM   3487 N  N     . ALA B 1  192 ? -9.087  38.543 15.298  1.00 51.66  ? 189 ALA B N     1 
ATOM   3488 C  CA    . ALA B 1  192 ? -9.827  38.779 14.056  1.00 51.44  ? 189 ALA B CA    1 
ATOM   3489 C  C     . ALA B 1  192 ? -10.409 40.179 13.932  1.00 51.73  ? 189 ALA B C     1 
ATOM   3490 O  O     . ALA B 1  192 ? -10.490 40.731 12.826  1.00 52.03  ? 189 ALA B O     1 
ATOM   3491 C  CB    . ALA B 1  192 ? -10.928 37.768 13.910  1.00 51.26  ? 189 ALA B CB    1 
ATOM   3492 N  N     . PHE B 1  193 ? -10.815 40.763 15.052  1.00 51.60  ? 190 PHE B N     1 
ATOM   3493 C  CA    . PHE B 1  193 ? -11.514 42.036 14.996  1.00 51.63  ? 190 PHE B CA    1 
ATOM   3494 C  C     . PHE B 1  193 ? -10.595 43.219 15.165  1.00 52.01  ? 190 PHE B C     1 
ATOM   3495 O  O     . PHE B 1  193 ? -10.980 44.347 14.884  1.00 52.48  ? 190 PHE B O     1 
ATOM   3496 C  CB    . PHE B 1  193 ? -12.655 42.087 16.025  1.00 51.44  ? 190 PHE B CB    1 
ATOM   3497 C  CG    . PHE B 1  193 ? -13.505 40.848 16.049  1.00 50.18  ? 190 PHE B CG    1 
ATOM   3498 C  CD1   . PHE B 1  193 ? -14.031 40.318 14.867  1.00 48.12  ? 190 PHE B CD1   1 
ATOM   3499 C  CD2   . PHE B 1  193 ? -13.788 40.216 17.248  1.00 49.77  ? 190 PHE B CD2   1 
ATOM   3500 C  CE1   . PHE B 1  193 ? -14.807 39.174 14.883  1.00 48.16  ? 190 PHE B CE1   1 
ATOM   3501 C  CE2   . PHE B 1  193 ? -14.573 39.063 17.272  1.00 48.98  ? 190 PHE B CE2   1 
ATOM   3502 C  CZ    . PHE B 1  193 ? -15.080 38.544 16.088  1.00 48.39  ? 190 PHE B CZ    1 
ATOM   3503 N  N     . THR B 1  194 ? -9.381  42.967 15.631  1.00 52.53  ? 191 THR B N     1 
ATOM   3504 C  CA    . THR B 1  194 ? -8.447  44.066 15.918  1.00 52.95  ? 191 THR B CA    1 
ATOM   3505 C  C     . THR B 1  194 ? -7.311  44.191 14.884  1.00 53.02  ? 191 THR B C     1 
ATOM   3506 O  O     . THR B 1  194 ? -6.545  45.158 14.928  1.00 53.14  ? 191 THR B O     1 
ATOM   3507 C  CB    . THR B 1  194 ? -7.889  43.993 17.360  1.00 52.67  ? 191 THR B CB    1 
ATOM   3508 O  OG1   . THR B 1  194 ? -7.396  42.677 17.614  1.00 52.72  ? 191 THR B OG1   1 
ATOM   3509 C  CG2   . THR B 1  194 ? -8.990  44.295 18.360  1.00 52.73  ? 191 THR B CG2   1 
ATOM   3510 N  N     . SER B 1  195 ? -7.232  43.230 13.957  1.00 52.70  ? 192 SER B N     1 
ATOM   3511 C  CA    . SER B 1  195 ? -6.266  43.247 12.853  1.00 52.43  ? 192 SER B CA    1 
ATOM   3512 C  C     . SER B 1  195 ? -6.427  44.493 12.000  1.00 52.57  ? 192 SER B C     1 
ATOM   3513 O  O     . SER B 1  195 ? -7.520  45.039 11.895  1.00 53.32  ? 192 SER B O     1 
ATOM   3514 C  CB    . SER B 1  195 ? -6.440  42.007 11.981  1.00 52.22  ? 192 SER B CB    1 
ATOM   3515 O  OG    . SER B 1  195 ? -7.620  42.072 11.200  1.00 52.08  ? 192 SER B OG    1 
ATOM   3516 N  N     . SER B 1  196 ? -5.351  44.953 11.387  1.00 52.64  ? 193 SER B N     1 
ATOM   3517 C  CA    . SER B 1  196 ? -5.470  46.115 10.496  1.00 53.09  ? 193 SER B CA    1 
ATOM   3518 C  C     . SER B 1  196 ? -6.223  45.826 9.170   1.00 52.60  ? 193 SER B C     1 
ATOM   3519 O  O     . SER B 1  196 ? -6.791  46.737 8.580   1.00 52.21  ? 193 SER B O     1 
ATOM   3520 C  CB    . SER B 1  196 ? -4.101  46.748 10.232  1.00 53.03  ? 193 SER B CB    1 
ATOM   3521 O  OG    . SER B 1  196 ? -3.242  45.786 9.665   1.00 54.08  ? 193 SER B OG    1 
ATOM   3522 N  N     . THR B 1  197 ? -6.217  44.572 8.722   1.00 52.28  ? 194 THR B N     1 
ATOM   3523 C  CA    . THR B 1  197 ? -7.025  44.157 7.589   1.00 52.98  ? 194 THR B CA    1 
ATOM   3524 C  C     . THR B 1  197 ? -8.504  44.423 7.879   1.00 52.98  ? 194 THR B C     1 
ATOM   3525 O  O     . THR B 1  197 ? -9.180  45.098 7.084   1.00 53.17  ? 194 THR B O     1 
ATOM   3526 C  CB    . THR B 1  197 ? -6.870  42.656 7.289   1.00 53.50  ? 194 THR B CB    1 
ATOM   3527 O  OG1   . THR B 1  197 ? -5.537  42.236 7.589   1.00 55.74  ? 194 THR B OG1   1 
ATOM   3528 C  CG2   . THR B 1  197 ? -7.171  42.342 5.848   1.00 53.63  ? 194 THR B CG2   1 
ATOM   3529 N  N     . PHE B 1  198 ? -9.002  43.919 9.018   1.00 52.53  ? 195 PHE B N     1 
ATOM   3530 C  CA    . PHE B 1  198 ? -10.400 44.142 9.384   1.00 51.71  ? 195 PHE B CA    1 
ATOM   3531 C  C     . PHE B 1  198 ? -10.717 45.613 9.491   1.00 51.89  ? 195 PHE B C     1 
ATOM   3532 O  O     . PHE B 1  198 ? -11.818 46.020 9.155   1.00 51.90  ? 195 PHE B O     1 
ATOM   3533 C  CB    . PHE B 1  198 ? -10.800 43.430 10.675  1.00 51.56  ? 195 PHE B CB    1 
ATOM   3534 C  CG    . PHE B 1  198 ? -12.293 43.401 10.906  1.00 50.72  ? 195 PHE B CG    1 
ATOM   3535 C  CD1   . PHE B 1  198 ? -13.130 42.675 10.066  1.00 49.56  ? 195 PHE B CD1   1 
ATOM   3536 C  CD2   . PHE B 1  198 ? -12.868 44.125 11.941  1.00 50.49  ? 195 PHE B CD2   1 
ATOM   3537 C  CE1   . PHE B 1  198 ? -14.499 42.659 10.268  1.00 48.27  ? 195 PHE B CE1   1 
ATOM   3538 C  CE2   . PHE B 1  198 ? -14.248 44.114 12.137  1.00 49.35  ? 195 PHE B CE2   1 
ATOM   3539 C  CZ    . PHE B 1  198 ? -15.058 43.374 11.307  1.00 47.20  ? 195 PHE B CZ    1 
ATOM   3540 N  N     . ALA B 1  199 ? -9.752  46.405 9.955   1.00 52.27  ? 196 ALA B N     1 
ATOM   3541 C  CA    . ALA B 1  199 ? -9.893  47.856 10.015  1.00 52.79  ? 196 ALA B CA    1 
ATOM   3542 C  C     . ALA B 1  199 ? -10.011 48.473 8.621   1.00 53.50  ? 196 ALA B C     1 
ATOM   3543 O  O     . ALA B 1  199 ? -10.827 49.367 8.404   1.00 53.30  ? 196 ALA B O     1 
ATOM   3544 C  CB    . ALA B 1  199 ? -8.728  48.471 10.773  1.00 52.64  ? 196 ALA B CB    1 
ATOM   3545 N  N     . GLU B 1  200 ? -9.204  47.987 7.676   1.00 54.63  ? 197 GLU B N     1 
ATOM   3546 C  CA    . GLU B 1  200 ? -9.264  48.484 6.302   1.00 55.93  ? 197 GLU B CA    1 
ATOM   3547 C  C     . GLU B 1  200 ? -10.664 48.224 5.753   1.00 55.29  ? 197 GLU B C     1 
ATOM   3548 O  O     . GLU B 1  200 ? -11.332 49.141 5.230   1.00 55.15  ? 197 GLU B O     1 
ATOM   3549 C  CB    . GLU B 1  200 ? -8.201  47.823 5.400   1.00 56.84  ? 197 GLU B CB    1 
ATOM   3550 C  CG    . GLU B 1  200 ? -6.765  48.413 5.459   1.00 62.23  ? 197 GLU B CG    1 
ATOM   3551 C  CD    . GLU B 1  200 ? -6.690  49.979 5.357   1.00 70.35  ? 197 GLU B CD    1 
ATOM   3552 O  OE1   . GLU B 1  200 ? -7.520  50.631 4.658   1.00 71.47  ? 197 GLU B OE1   1 
ATOM   3553 O  OE2   . GLU B 1  200 ? -5.764  50.559 5.989   1.00 73.58  ? 197 GLU B OE2   1 
ATOM   3554 N  N     . TRP B 1  201 ? -11.104 46.973 5.911   1.00 54.59  ? 198 TRP B N     1 
ATOM   3555 C  CA    . TRP B 1  201 ? -12.407 46.524 5.450   1.00 53.80  ? 198 TRP B CA    1 
ATOM   3556 C  C     . TRP B 1  201 ? -13.523 47.420 5.966   1.00 53.50  ? 198 TRP B C     1 
ATOM   3557 O  O     . TRP B 1  201 ? -14.402 47.824 5.210   1.00 53.26  ? 198 TRP B O     1 
ATOM   3558 C  CB    . TRP B 1  201 ? -12.633 45.084 5.877   1.00 53.65  ? 198 TRP B CB    1 
ATOM   3559 C  CG    . TRP B 1  201 ? -13.966 44.534 5.482   1.00 54.22  ? 198 TRP B CG    1 
ATOM   3560 C  CD1   . TRP B 1  201 ? -14.267 43.878 4.330   1.00 54.26  ? 198 TRP B CD1   1 
ATOM   3561 C  CD2   . TRP B 1  201 ? -15.177 44.579 6.251   1.00 54.21  ? 198 TRP B CD2   1 
ATOM   3562 N  NE1   . TRP B 1  201 ? -15.589 43.505 4.328   1.00 55.22  ? 198 TRP B NE1   1 
ATOM   3563 C  CE2   . TRP B 1  201 ? -16.173 43.929 5.495   1.00 55.52  ? 198 TRP B CE2   1 
ATOM   3564 C  CE3   . TRP B 1  201 ? -15.514 45.105 7.506   1.00 53.23  ? 198 TRP B CE3   1 
ATOM   3565 C  CZ2   . TRP B 1  201 ? -17.496 43.787 5.956   1.00 55.70  ? 198 TRP B CZ2   1 
ATOM   3566 C  CZ3   . TRP B 1  201 ? -16.819 44.967 7.963   1.00 53.53  ? 198 TRP B CZ3   1 
ATOM   3567 C  CH2   . TRP B 1  201 ? -17.795 44.312 7.190   1.00 54.59  ? 198 TRP B CH2   1 
ATOM   3568 N  N     . ALA B 1  202 ? -13.477 47.741 7.252   1.00 53.25  ? 199 ALA B N     1 
ATOM   3569 C  CA    . ALA B 1  202 ? -14.504 48.575 7.837   1.00 53.32  ? 199 ALA B CA    1 
ATOM   3570 C  C     . ALA B 1  202 ? -14.418 49.987 7.289   1.00 53.60  ? 199 ALA B C     1 
ATOM   3571 O  O     . ALA B 1  202 ? -15.442 50.626 7.054   1.00 53.63  ? 199 ALA B O     1 
ATOM   3572 C  CB    . ALA B 1  202 ? -14.397 48.575 9.341   1.00 52.71  ? 199 ALA B CB    1 
ATOM   3573 N  N     . LYS B 1  203 ? -13.200 50.473 7.086   1.00 54.34  ? 200 LYS B N     1 
ATOM   3574 C  CA    . LYS B 1  203 ? -13.011 51.828 6.586   1.00 55.58  ? 200 LYS B CA    1 
ATOM   3575 C  C     . LYS B 1  203 ? -13.575 51.978 5.166   1.00 55.86  ? 200 LYS B C     1 
ATOM   3576 O  O     . LYS B 1  203 ? -14.245 52.969 4.858   1.00 55.56  ? 200 LYS B O     1 
ATOM   3577 C  CB    . LYS B 1  203 ? -11.536 52.238 6.629   1.00 55.71  ? 200 LYS B CB    1 
ATOM   3578 C  CG    . LYS B 1  203 ? -11.342 53.743 6.687   1.00 57.45  ? 200 LYS B CG    1 
ATOM   3579 C  CD    . LYS B 1  203 ? -9.892  54.140 6.488   1.00 61.41  ? 200 LYS B CD    1 
ATOM   3580 C  CE    . LYS B 1  203 ? -9.723  55.664 6.519   1.00 64.15  ? 200 LYS B CE    1 
ATOM   3581 N  NZ    . LYS B 1  203 ? -8.413  56.081 5.918   1.00 66.25  ? 200 LYS B NZ    1 
ATOM   3582 N  N     . GLU B 1  204 ? -13.318 50.978 4.324   1.00 56.17  ? 201 GLU B N     1 
ATOM   3583 C  CA    . GLU B 1  204 ? -13.823 50.982 2.963   1.00 56.95  ? 201 GLU B CA    1 
ATOM   3584 C  C     . GLU B 1  204 ? -15.327 51.154 2.952   1.00 56.35  ? 201 GLU B C     1 
ATOM   3585 O  O     . GLU B 1  204 ? -15.889 51.743 2.027   1.00 56.60  ? 201 GLU B O     1 
ATOM   3586 C  CB    . GLU B 1  204 ? -13.472 49.681 2.244   1.00 57.48  ? 201 GLU B CB    1 
ATOM   3587 C  CG    . GLU B 1  204 ? -12.057 49.611 1.707   1.00 61.27  ? 201 GLU B CG    1 
ATOM   3588 C  CD    . GLU B 1  204 ? -11.606 48.167 1.398   1.00 66.71  ? 201 GLU B CD    1 
ATOM   3589 O  OE1   . GLU B 1  204 ? -12.407 47.205 1.553   1.00 67.84  ? 201 GLU B OE1   1 
ATOM   3590 O  OE2   . GLU B 1  204 ? -10.431 47.995 1.000   1.00 70.11  ? 201 GLU B OE2   1 
ATOM   3591 N  N     . ARG B 1  205 ? -15.981 50.630 3.980   1.00 55.63  ? 202 ARG B N     1 
ATOM   3592 C  CA    . ARG B 1  205 ? -17.432 50.555 3.986   1.00 54.75  ? 202 ARG B CA    1 
ATOM   3593 C  C     . ARG B 1  205 ? -18.070 51.652 4.828   1.00 54.26  ? 202 ARG B C     1 
ATOM   3594 O  O     . ARG B 1  205 ? -19.294 51.727 4.935   1.00 53.99  ? 202 ARG B O     1 
ATOM   3595 C  CB    . ARG B 1  205 ? -17.870 49.151 4.384   1.00 54.49  ? 202 ARG B CB    1 
ATOM   3596 C  CG    . ARG B 1  205 ? -17.743 48.196 3.216   1.00 55.52  ? 202 ARG B CG    1 
ATOM   3597 C  CD    . ARG B 1  205 ? -17.690 46.749 3.623   1.00 57.86  ? 202 ARG B CD    1 
ATOM   3598 N  NE    . ARG B 1  205 ? -17.135 45.890 2.563   1.00 61.17  ? 202 ARG B NE    1 
ATOM   3599 C  CZ    . ARG B 1  205 ? -15.856 45.880 2.162   1.00 62.03  ? 202 ARG B CZ    1 
ATOM   3600 N  NH1   . ARG B 1  205 ? -14.956 46.699 2.700   1.00 62.14  ? 202 ARG B NH1   1 
ATOM   3601 N  NH2   . ARG B 1  205 ? -15.467 45.043 1.210   1.00 62.24  ? 202 ARG B NH2   1 
ATOM   3602 N  N     . GLY B 1  206 ? -17.228 52.529 5.380   1.00 53.82  ? 203 GLY B N     1 
ATOM   3603 C  CA    . GLY B 1  206 ? -17.684 53.631 6.218   1.00 53.44  ? 203 GLY B CA    1 
ATOM   3604 C  C     . GLY B 1  206 ? -18.283 53.145 7.526   1.00 53.37  ? 203 GLY B C     1 
ATOM   3605 O  O     . GLY B 1  206 ? -19.155 53.801 8.094   1.00 53.35  ? 203 GLY B O     1 
ATOM   3606 N  N     . ILE B 1  207 ? -17.816 51.987 7.998   1.00 53.26  ? 204 ILE B N     1 
ATOM   3607 C  CA    . ILE B 1  207 ? -18.252 51.415 9.276   1.00 53.11  ? 204 ILE B CA    1 
ATOM   3608 C  C     . ILE B 1  207 ? -17.290 51.828 10.394  1.00 53.71  ? 204 ILE B C     1 
ATOM   3609 O  O     . ILE B 1  207 ? -16.088 51.639 10.264  1.00 53.78  ? 204 ILE B O     1 
ATOM   3610 C  CB    . ILE B 1  207 ? -18.290 49.879 9.214   1.00 52.59  ? 204 ILE B CB    1 
ATOM   3611 C  CG1   . ILE B 1  207 ? -19.152 49.403 8.038   1.00 51.18  ? 204 ILE B CG1   1 
ATOM   3612 C  CG2   . ILE B 1  207 ? -18.768 49.293 10.548  1.00 52.35  ? 204 ILE B CG2   1 
ATOM   3613 C  CD1   . ILE B 1  207 ? -19.182 47.886 7.866   1.00 46.63  ? 204 ILE B CD1   1 
ATOM   3614 N  N     . HIS B 1  208 ? -17.808 52.393 11.481  1.00 54.28  ? 205 HIS B N     1 
ATOM   3615 C  CA    . HIS B 1  208 ? -16.972 52.688 12.631  1.00 55.41  ? 205 HIS B CA    1 
ATOM   3616 C  C     . HIS B 1  208 ? -16.866 51.443 13.514  1.00 55.23  ? 205 HIS B C     1 
ATOM   3617 O  O     . HIS B 1  208 ? -17.875 50.789 13.819  1.00 55.56  ? 205 HIS B O     1 
ATOM   3618 C  CB    . HIS B 1  208 ? -17.499 53.902 13.420  1.00 56.46  ? 205 HIS B CB    1 
ATOM   3619 C  CG    . HIS B 1  208 ? -16.861 54.070 14.773  1.00 59.58  ? 205 HIS B CG    1 
ATOM   3620 N  ND1   . HIS B 1  208 ? -15.594 54.598 14.944  1.00 62.11  ? 205 HIS B ND1   1 
ATOM   3621 C  CD2   . HIS B 1  208 ? -17.307 53.760 16.015  1.00 61.16  ? 205 HIS B CD2   1 
ATOM   3622 C  CE1   . HIS B 1  208 ? -15.290 54.606 16.231  1.00 62.26  ? 205 HIS B CE1   1 
ATOM   3623 N  NE2   . HIS B 1  208 ? -16.311 54.102 16.902  1.00 62.99  ? 205 HIS B NE2   1 
ATOM   3624 N  N     . LEU B 1  209 ? -15.638 51.104 13.902  1.00 55.13  ? 206 LEU B N     1 
ATOM   3625 C  CA    . LEU B 1  209 ? -15.393 49.944 14.771  1.00 54.70  ? 206 LEU B CA    1 
ATOM   3626 C  C     . LEU B 1  209 ? -15.321 50.316 16.239  1.00 54.53  ? 206 LEU B C     1 
ATOM   3627 O  O     . LEU B 1  209 ? -14.783 51.364 16.600  1.00 54.67  ? 206 LEU B O     1 
ATOM   3628 C  CB    . LEU B 1  209 ? -14.121 49.206 14.374  1.00 54.42  ? 206 LEU B CB    1 
ATOM   3629 C  CG    . LEU B 1  209 ? -14.107 48.441 13.063  1.00 53.34  ? 206 LEU B CG    1 
ATOM   3630 C  CD1   . LEU B 1  209 ? -12.796 47.677 12.953  1.00 51.94  ? 206 LEU B CD1   1 
ATOM   3631 C  CD2   . LEU B 1  209 ? -15.302 47.503 12.935  1.00 52.16  ? 206 LEU B CD2   1 
ATOM   3632 N  N     . GLU B 1  210 ? -15.864 49.446 17.077  1.00 54.80  ? 207 GLU B N     1 
ATOM   3633 C  CA    . GLU B 1  210 ? -15.988 49.718 18.499  1.00 55.27  ? 207 GLU B CA    1 
ATOM   3634 C  C     . GLU B 1  210 ? -15.576 48.511 19.306  1.00 55.38  ? 207 GLU B C     1 
ATOM   3635 O  O     . GLU B 1  210 ? -16.053 47.392 19.093  1.00 54.87  ? 207 GLU B O     1 
ATOM   3636 C  CB    . GLU B 1  210 ? -17.414 50.120 18.848  1.00 55.42  ? 207 GLU B CB    1 
ATOM   3637 C  CG    . GLU B 1  210 ? -17.546 50.749 20.220  1.00 56.86  ? 207 GLU B CG    1 
ATOM   3638 C  CD    . GLU B 1  210 ? -18.994 51.046 20.594  1.00 57.73  ? 207 GLU B CD    1 
ATOM   3639 O  OE1   . GLU B 1  210 ? -19.371 52.238 20.514  1.00 57.58  ? 207 GLU B OE1   1 
ATOM   3640 O  OE2   . GLU B 1  210 ? -19.739 50.096 20.956  1.00 55.55  ? 207 GLU B OE2   1 
ATOM   3641 N  N     . PHE B 1  211 ? -14.672 48.750 20.243  1.00 56.28  ? 208 PHE B N     1 
ATOM   3642 C  CA    . PHE B 1  211 ? -14.141 47.679 21.060  1.00 57.13  ? 208 PHE B CA    1 
ATOM   3643 C  C     . PHE B 1  211 ? -14.445 47.892 22.530  1.00 58.12  ? 208 PHE B C     1 
ATOM   3644 O  O     . PHE B 1  211 ? -14.371 49.013 23.040  1.00 58.19  ? 208 PHE B O     1 
ATOM   3645 C  CB    . PHE B 1  211 ? -12.640 47.540 20.832  1.00 56.88  ? 208 PHE B CB    1 
ATOM   3646 C  CG    . PHE B 1  211 ? -12.272 47.271 19.405  1.00 56.24  ? 208 PHE B CG    1 
ATOM   3647 C  CD1   . PHE B 1  211 ? -12.463 45.995 18.846  1.00 54.98  ? 208 PHE B CD1   1 
ATOM   3648 C  CD2   . PHE B 1  211 ? -11.743 48.293 18.607  1.00 55.59  ? 208 PHE B CD2   1 
ATOM   3649 C  CE1   . PHE B 1  211 ? -12.129 45.745 17.511  1.00 54.25  ? 208 PHE B CE1   1 
ATOM   3650 C  CE2   . PHE B 1  211 ? -11.408 48.052 17.270  1.00 54.33  ? 208 PHE B CE2   1 
ATOM   3651 C  CZ    . PHE B 1  211 ? -11.594 46.776 16.726  1.00 53.79  ? 208 PHE B CZ    1 
ATOM   3652 N  N     . SER B 1  212 ? -14.829 46.814 23.195  1.00 59.28  ? 209 SER B N     1 
ATOM   3653 C  CA    . SER B 1  212 ? -14.936 46.827 24.629  1.00 61.13  ? 209 SER B CA    1 
ATOM   3654 C  C     . SER B 1  212 ? -13.528 46.657 25.177  1.00 62.42  ? 209 SER B C     1 
ATOM   3655 O  O     . SER B 1  212 ? -12.721 45.928 24.598  1.00 62.89  ? 209 SER B O     1 
ATOM   3656 C  CB    . SER B 1  212 ? -15.850 45.696 25.109  1.00 61.25  ? 209 SER B CB    1 
ATOM   3657 O  OG    . SER B 1  212 ? -15.379 44.414 24.703  1.00 61.91  ? 209 SER B OG    1 
ATOM   3658 N  N     . THR B 1  213 ? -13.224 47.335 26.281  1.00 63.79  ? 210 THR B N     1 
ATOM   3659 C  CA    . THR B 1  213 ? -11.961 47.140 26.995  1.00 64.69  ? 210 THR B CA    1 
ATOM   3660 C  C     . THR B 1  213 ? -11.660 45.648 27.252  1.00 65.53  ? 210 THR B C     1 
ATOM   3661 O  O     . THR B 1  213 ? -12.582 44.852 27.443  1.00 65.10  ? 210 THR B O     1 
ATOM   3662 C  CB    . THR B 1  213 ? -11.978 47.879 28.328  1.00 64.65  ? 210 THR B CB    1 
ATOM   3663 O  OG1   . THR B 1  213 ? -12.929 47.253 29.194  1.00 65.30  ? 210 THR B OG1   1 
ATOM   3664 C  CG2   . THR B 1  213 ? -12.347 49.351 28.122  1.00 64.99  ? 210 THR B CG2   1 
ATOM   3665 N  N     . PRO B 1  214 ? -10.365 45.263 27.237  1.00 66.71  ? 211 PRO B N     1 
ATOM   3666 C  CA    . PRO B 1  214 ? -9.972  43.861 27.486  1.00 67.73  ? 211 PRO B CA    1 
ATOM   3667 C  C     . PRO B 1  214 ? -10.470 43.338 28.821  1.00 69.01  ? 211 PRO B C     1 
ATOM   3668 O  O     . PRO B 1  214 ? -10.437 44.055 29.830  1.00 69.02  ? 211 PRO B O     1 
ATOM   3669 C  CB    . PRO B 1  214 ? -8.442  43.906 27.497  1.00 67.47  ? 211 PRO B CB    1 
ATOM   3670 C  CG    . PRO B 1  214 ? -8.087  45.121 26.727  1.00 67.10  ? 211 PRO B CG    1 
ATOM   3671 C  CD    . PRO B 1  214 ? -9.211  46.107 26.866  1.00 66.52  ? 211 PRO B CD    1 
ATOM   3672 N  N     . TYR B 1  215 ? -10.926 42.089 28.801  1.00 70.58  ? 212 TYR B N     1 
ATOM   3673 C  CA    . TYR B 1  215 ? -11.430 41.373 29.982  1.00 72.38  ? 212 TYR B CA    1 
ATOM   3674 C  C     . TYR B 1  215 ? -12.741 41.929 30.557  1.00 73.66  ? 212 TYR B C     1 
ATOM   3675 O  O     . TYR B 1  215 ? -13.302 41.344 31.491  1.00 74.06  ? 212 TYR B O     1 
ATOM   3676 C  CB    . TYR B 1  215 ? -10.346 41.215 31.068  1.00 72.17  ? 212 TYR B CB    1 
ATOM   3677 C  CG    . TYR B 1  215 ? -9.014  40.730 30.531  1.00 72.39  ? 212 TYR B CG    1 
ATOM   3678 C  CD1   . TYR B 1  215 ? -8.826  39.391 30.154  1.00 72.65  ? 212 TYR B CD1   1 
ATOM   3679 C  CD2   . TYR B 1  215 ? -7.947  41.613 30.382  1.00 72.64  ? 212 TYR B CD2   1 
ATOM   3680 C  CE1   . TYR B 1  215 ? -7.598  38.949 29.632  1.00 72.67  ? 212 TYR B CE1   1 
ATOM   3681 C  CE2   . TYR B 1  215 ? -6.723  41.189 29.871  1.00 72.82  ? 212 TYR B CE2   1 
ATOM   3682 C  CZ    . TYR B 1  215 ? -6.549  39.861 29.496  1.00 73.47  ? 212 TYR B CZ    1 
ATOM   3683 O  OH    . TYR B 1  215 ? -5.318  39.460 28.998  1.00 74.51  ? 212 TYR B OH    1 
ATOM   3684 N  N     . HIS B 1  216 ? -13.236 43.028 29.980  1.00 75.10  ? 213 HIS B N     1 
ATOM   3685 C  CA    . HIS B 1  216 ? -14.504 43.648 30.409  1.00 76.73  ? 213 HIS B CA    1 
ATOM   3686 C  C     . HIS B 1  216 ? -15.515 43.825 29.259  1.00 76.74  ? 213 HIS B C     1 
ATOM   3687 O  O     . HIS B 1  216 ? -15.786 44.967 28.844  1.00 76.43  ? 213 HIS B O     1 
ATOM   3688 C  CB    . HIS B 1  216 ? -14.253 45.000 31.108  1.00 77.30  ? 213 HIS B CB    1 
ATOM   3689 C  CG    . HIS B 1  216 ? -13.415 44.905 32.353  1.00 81.42  ? 213 HIS B CG    1 
ATOM   3690 N  ND1   . HIS B 1  216 ? -13.650 43.972 33.348  1.00 84.29  ? 213 HIS B ND1   1 
ATOM   3691 C  CD2   . HIS B 1  216 ? -12.359 45.647 32.776  1.00 84.07  ? 213 HIS B CD2   1 
ATOM   3692 C  CE1   . HIS B 1  216 ? -12.765 44.133 34.319  1.00 85.35  ? 213 HIS B CE1   1 
ATOM   3693 N  NE2   . HIS B 1  216 ? -11.971 45.143 33.997  1.00 85.93  ? 213 HIS B NE2   1 
ATOM   3694 N  N     . PRO B 1  217 ? -16.094 42.703 28.756  1.00 77.06  ? 214 PRO B N     1 
ATOM   3695 C  CA    . PRO B 1  217 ? -17.044 42.762 27.628  1.00 77.35  ? 214 PRO B CA    1 
ATOM   3696 C  C     . PRO B 1  217 ? -18.387 43.417 28.004  1.00 77.50  ? 214 PRO B C     1 
ATOM   3697 O  O     . PRO B 1  217 ? -18.947 43.113 29.063  1.00 77.97  ? 214 PRO B O     1 
ATOM   3698 C  CB    . PRO B 1  217 ? -17.250 41.278 27.235  1.00 77.37  ? 214 PRO B CB    1 
ATOM   3699 C  CG    . PRO B 1  217 ? -16.394 40.458 28.158  1.00 77.40  ? 214 PRO B CG    1 
ATOM   3700 C  CD    . PRO B 1  217 ? -16.016 41.342 29.323  1.00 77.26  ? 214 PRO B CD    1 
ATOM   3701 N  N     . GLN B 1  218 ? -18.886 44.315 27.155  1.00 77.28  ? 215 GLN B N     1 
ATOM   3702 C  CA    . GLN B 1  218 ? -20.137 45.020 27.425  1.00 77.41  ? 215 GLN B CA    1 
ATOM   3703 C  C     . GLN B 1  218 ? -20.954 45.166 26.142  1.00 76.27  ? 215 GLN B C     1 
ATOM   3704 O  O     . GLN B 1  218 ? -20.407 45.426 25.074  1.00 76.56  ? 215 GLN B O     1 
ATOM   3705 C  CB    . GLN B 1  218 ? -19.869 46.400 28.043  1.00 77.86  ? 215 GLN B CB    1 
ATOM   3706 C  CG    . GLN B 1  218 ? -19.541 47.468 26.987  1.00 81.46  ? 215 GLN B CG    1 
ATOM   3707 C  CD    . GLN B 1  218 ? -19.108 48.811 27.561  1.00 85.34  ? 215 GLN B CD    1 
ATOM   3708 O  OE1   . GLN B 1  218 ? -19.185 49.055 28.777  1.00 86.33  ? 215 GLN B OE1   1 
ATOM   3709 N  NE2   . GLN B 1  218 ? -18.644 49.698 26.674  1.00 85.82  ? 215 GLN B NE2   1 
ATOM   3710 N  N     . SER B 1  219 ? -22.266 45.007 26.259  1.00 74.84  ? 216 SER B N     1 
ATOM   3711 C  CA    . SER B 1  219 ? -23.167 45.118 25.120  1.00 73.10  ? 216 SER B CA    1 
ATOM   3712 C  C     . SER B 1  219 ? -24.279 46.071 25.510  1.00 71.85  ? 216 SER B C     1 
ATOM   3713 O  O     . SER B 1  219 ? -24.073 47.274 25.650  1.00 71.62  ? 216 SER B O     1 
ATOM   3714 C  CB    . SER B 1  219 ? -23.770 43.747 24.785  1.00 73.06  ? 216 SER B CB    1 
ATOM   3715 O  OG    . SER B 1  219 ? -22.798 42.718 24.824  1.00 73.43  ? 216 SER B OG    1 
ATOM   3716 N  N     . SER B 1  220 ? -25.466 45.498 25.658  1.00 70.30  ? 217 SER B N     1 
ATOM   3717 C  CA    . SER B 1  220 ? -26.575 46.093 26.365  1.00 68.81  ? 217 SER B CA    1 
ATOM   3718 C  C     . SER B 1  220 ? -27.292 44.873 26.948  1.00 67.86  ? 217 SER B C     1 
ATOM   3719 O  O     . SER B 1  220 ? -26.936 43.728 26.611  1.00 67.72  ? 217 SER B O     1 
ATOM   3720 C  CB    . SER B 1  220 ? -27.470 46.878 25.410  1.00 68.65  ? 217 SER B CB    1 
ATOM   3721 O  OG    . SER B 1  220 ? -27.893 46.067 24.320  1.00 68.88  ? 217 SER B OG    1 
ATOM   3722 N  N     . GLY B 1  221 ? -28.269 45.110 27.829  1.00 66.35  ? 218 GLY B N     1 
ATOM   3723 C  CA    . GLY B 1  221 ? -29.085 44.043 28.400  1.00 63.94  ? 218 GLY B CA    1 
ATOM   3724 C  C     . GLY B 1  221 ? -29.634 43.104 27.350  1.00 62.58  ? 218 GLY B C     1 
ATOM   3725 O  O     . GLY B 1  221 ? -29.449 41.888 27.444  1.00 62.47  ? 218 GLY B O     1 
ATOM   3726 N  N     . LYS B 1  222 ? -30.289 43.681 26.339  1.00 61.47  ? 219 LYS B N     1 
ATOM   3727 C  CA    . LYS B 1  222 ? -30.883 42.943 25.213  1.00 60.29  ? 219 LYS B CA    1 
ATOM   3728 C  C     . LYS B 1  222 ? -29.899 41.990 24.510  1.00 59.51  ? 219 LYS B C     1 
ATOM   3729 O  O     . LYS B 1  222 ? -30.181 40.793 24.335  1.00 58.57  ? 219 LYS B O     1 
ATOM   3730 C  CB    . LYS B 1  222 ? -31.477 43.940 24.219  1.00 60.45  ? 219 LYS B CB    1 
ATOM   3731 C  CG    . LYS B 1  222 ? -32.429 43.338 23.175  1.00 61.74  ? 219 LYS B CG    1 
ATOM   3732 C  CD    . LYS B 1  222 ? -33.272 44.444 22.525  1.00 63.31  ? 219 LYS B CD    1 
ATOM   3733 C  CE    . LYS B 1  222 ? -34.211 43.918 21.426  1.00 65.77  ? 219 LYS B CE    1 
ATOM   3734 N  NZ    . LYS B 1  222 ? -35.130 42.758 21.744  1.00 65.59  ? 219 LYS B NZ    1 
ATOM   3735 N  N     . VAL B 1  223 ? -28.736 42.527 24.138  1.00 58.75  ? 220 VAL B N     1 
ATOM   3736 C  CA    . VAL B 1  223 ? -27.724 41.759 23.413  1.00 58.02  ? 220 VAL B CA    1 
ATOM   3737 C  C     . VAL B 1  223 ? -27.122 40.674 24.303  1.00 58.23  ? 220 VAL B C     1 
ATOM   3738 O  O     . VAL B 1  223 ? -26.947 39.529 23.869  1.00 58.11  ? 220 VAL B O     1 
ATOM   3739 C  CB    . VAL B 1  223 ? -26.637 42.685 22.792  1.00 57.65  ? 220 VAL B CB    1 
ATOM   3740 C  CG1   . VAL B 1  223 ? -25.546 41.889 22.155  1.00 56.63  ? 220 VAL B CG1   1 
ATOM   3741 C  CG2   . VAL B 1  223 ? -27.255 43.593 21.766  1.00 56.77  ? 220 VAL B CG2   1 
ATOM   3742 N  N     . GLU B 1  224 ? -26.824 41.026 25.550  1.00 58.52  ? 221 GLU B N     1 
ATOM   3743 C  CA    . GLU B 1  224 ? -26.323 40.056 26.511  1.00 59.21  ? 221 GLU B CA    1 
ATOM   3744 C  C     . GLU B 1  224 ? -27.265 38.865 26.641  1.00 58.41  ? 221 GLU B C     1 
ATOM   3745 O  O     . GLU B 1  224 ? -26.825 37.705 26.568  1.00 58.14  ? 221 GLU B O     1 
ATOM   3746 C  CB    . GLU B 1  224 ? -26.126 40.710 27.870  1.00 60.25  ? 221 GLU B CB    1 
ATOM   3747 C  CG    . GLU B 1  224 ? -24.797 41.430 28.032  1.00 65.03  ? 221 GLU B CG    1 
ATOM   3748 C  CD    . GLU B 1  224 ? -24.601 41.968 29.445  1.00 72.37  ? 221 GLU B CD    1 
ATOM   3749 O  OE1   . GLU B 1  224 ? -24.414 43.206 29.591  1.00 75.25  ? 221 GLU B OE1   1 
ATOM   3750 O  OE2   . GLU B 1  224 ? -24.647 41.155 30.411  1.00 75.93  ? 221 GLU B OE2   1 
ATOM   3751 N  N     . ARG B 1  225 ? -28.556 39.165 26.814  1.00 57.60  ? 222 ARG B N     1 
ATOM   3752 C  CA    . ARG B 1  225 ? -29.605 38.137 26.911  1.00 57.18  ? 222 ARG B CA    1 
ATOM   3753 C  C     . ARG B 1  225 ? -29.749 37.279 25.640  1.00 56.58  ? 222 ARG B C     1 
ATOM   3754 O  O     . ARG B 1  225 ? -29.930 36.057 25.719  1.00 56.36  ? 222 ARG B O     1 
ATOM   3755 C  CB    . ARG B 1  225 ? -30.950 38.765 27.322  1.00 57.03  ? 222 ARG B CB    1 
ATOM   3756 C  CG    . ARG B 1  225 ? -30.930 39.316 28.754  1.00 58.31  ? 222 ARG B CG    1 
ATOM   3757 C  CD    . ARG B 1  225 ? -32.306 39.689 29.292  1.00 58.33  ? 222 ARG B CD    1 
ATOM   3758 N  NE    . ARG B 1  225 ? -32.782 40.974 28.778  1.00 58.24  ? 222 ARG B NE    1 
ATOM   3759 C  CZ    . ARG B 1  225 ? -32.352 42.164 29.191  1.00 59.26  ? 222 ARG B CZ    1 
ATOM   3760 N  NH1   . ARG B 1  225 ? -31.407 42.255 30.123  1.00 61.82  ? 222 ARG B NH1   1 
ATOM   3761 N  NH2   . ARG B 1  225 ? -32.858 43.275 28.672  1.00 58.09  ? 222 ARG B NH2   1 
ATOM   3762 N  N     . LYS B 1  226 ? -29.675 37.933 24.479  1.00 55.81  ? 223 LYS B N     1 
ATOM   3763 C  CA    . LYS B 1  226 ? -29.751 37.263 23.190  1.00 54.88  ? 223 LYS B CA    1 
ATOM   3764 C  C     . LYS B 1  226 ? -28.569 36.319 22.994  1.00 55.02  ? 223 LYS B C     1 
ATOM   3765 O  O     . LYS B 1  226 ? -28.754 35.183 22.588  1.00 54.48  ? 223 LYS B O     1 
ATOM   3766 C  CB    . LYS B 1  226 ? -29.837 38.300 22.057  1.00 54.76  ? 223 LYS B CB    1 
ATOM   3767 C  CG    . LYS B 1  226 ? -30.126 37.741 20.690  1.00 51.46  ? 223 LYS B CG    1 
ATOM   3768 C  CD    . LYS B 1  226 ? -31.325 36.847 20.702  1.00 47.97  ? 223 LYS B CD    1 
ATOM   3769 C  CE    . LYS B 1  226 ? -32.613 37.628 20.709  1.00 47.33  ? 223 LYS B CE    1 
ATOM   3770 N  NZ    . LYS B 1  226 ? -33.727 36.653 20.535  1.00 45.90  ? 223 LYS B NZ    1 
ATOM   3771 N  N     . ASN B 1  227 ? -27.364 36.786 23.315  1.00 55.77  ? 224 ASN B N     1 
ATOM   3772 C  CA    . ASN B 1  227 ? -26.154 35.948 23.218  1.00 56.80  ? 224 ASN B CA    1 
ATOM   3773 C  C     . ASN B 1  227 ? -26.200 34.753 24.139  1.00 57.28  ? 224 ASN B C     1 
ATOM   3774 O  O     . ASN B 1  227 ? -25.683 33.666 23.803  1.00 57.34  ? 224 ASN B O     1 
ATOM   3775 C  CB    . ASN B 1  227 ? -24.889 36.758 23.484  1.00 56.81  ? 224 ASN B CB    1 
ATOM   3776 C  CG    . ASN B 1  227 ? -24.340 37.398 22.220  1.00 58.37  ? 224 ASN B CG    1 
ATOM   3777 O  OD1   . ASN B 1  227 ? -23.783 36.711 21.352  1.00 60.16  ? 224 ASN B OD1   1 
ATOM   3778 N  ND2   . ASN B 1  227 ? -24.498 38.718 22.103  1.00 58.11  ? 224 ASN B ND2   1 
ATOM   3779 N  N     . SER B 1  228 ? -26.829 34.961 25.296  1.00 57.40  ? 225 SER B N     1 
ATOM   3780 C  CA    . SER B 1  228 ? -27.046 33.889 26.243  1.00 57.91  ? 225 SER B CA    1 
ATOM   3781 C  C     . SER B 1  228 ? -27.943 32.810 25.622  1.00 57.91  ? 225 SER B C     1 
ATOM   3782 O  O     . SER B 1  228 ? -27.580 31.632 25.624  1.00 57.89  ? 225 SER B O     1 
ATOM   3783 C  CB    . SER B 1  228 ? -27.633 34.445 27.546  1.00 58.21  ? 225 SER B CB    1 
ATOM   3784 O  OG    . SER B 1  228 ? -28.135 33.403 28.363  1.00 58.30  ? 225 SER B OG    1 
ATOM   3785 N  N     . ASP B 1  229 ? -29.086 33.220 25.069  1.00 57.84  ? 226 ASP B N     1 
ATOM   3786 C  CA    . ASP B 1  229 ? -29.994 32.295 24.399  1.00 58.41  ? 226 ASP B CA    1 
ATOM   3787 C  C     . ASP B 1  229 ? -29.283 31.527 23.292  1.00 58.86  ? 226 ASP B C     1 
ATOM   3788 O  O     . ASP B 1  229 ? -29.396 30.300 23.211  1.00 58.35  ? 226 ASP B O     1 
ATOM   3789 C  CB    . ASP B 1  229 ? -31.196 33.028 23.798  1.00 58.53  ? 226 ASP B CB    1 
ATOM   3790 C  CG    . ASP B 1  229 ? -32.031 33.770 24.834  1.00 59.56  ? 226 ASP B CG    1 
ATOM   3791 O  OD1   . ASP B 1  229 ? -31.819 33.590 26.054  1.00 60.85  ? 226 ASP B OD1   1 
ATOM   3792 O  OD2   . ASP B 1  229 ? -32.917 34.550 24.414  1.00 60.43  ? 226 ASP B OD2   1 
ATOM   3793 N  N     . ILE B 1  230 ? -28.544 32.259 22.451  1.00 59.67  ? 227 ILE B N     1 
ATOM   3794 C  CA    . ILE B 1  230 ? -27.837 31.662 21.321  1.00 60.49  ? 227 ILE B CA    1 
ATOM   3795 C  C     . ILE B 1  230 ? -26.953 30.527 21.808  1.00 61.69  ? 227 ILE B C     1 
ATOM   3796 O  O     . ILE B 1  230 ? -27.108 29.396 21.346  1.00 61.83  ? 227 ILE B O     1 
ATOM   3797 C  CB    . ILE B 1  230 ? -27.017 32.687 20.494  1.00 60.14  ? 227 ILE B CB    1 
ATOM   3798 C  CG1   . ILE B 1  230 ? -27.944 33.678 19.785  1.00 59.66  ? 227 ILE B CG1   1 
ATOM   3799 C  CG2   . ILE B 1  230 ? -26.172 31.966 19.457  1.00 59.28  ? 227 ILE B CG2   1 
ATOM   3800 C  CD1   . ILE B 1  230 ? -27.305 35.024 19.465  1.00 58.99  ? 227 ILE B CD1   1 
ATOM   3801 N  N     . LYS B 1  231 ? -26.055 30.814 22.751  1.00 63.17  ? 228 LYS B N     1 
ATOM   3802 C  CA    . LYS B 1  231 ? -25.183 29.762 23.303  1.00 64.96  ? 228 LYS B CA    1 
ATOM   3803 C  C     . LYS B 1  231 ? -26.009 28.597 23.869  1.00 65.52  ? 228 LYS B C     1 
ATOM   3804 O  O     . LYS B 1  231 ? -25.785 27.446 23.493  1.00 65.83  ? 228 LYS B O     1 
ATOM   3805 C  CB    . LYS B 1  231 ? -24.169 30.296 24.341  1.00 65.10  ? 228 LYS B CB    1 
ATOM   3806 C  CG    . LYS B 1  231 ? -23.253 31.423 23.832  1.00 66.79  ? 228 LYS B CG    1 
ATOM   3807 C  CD    . LYS B 1  231 ? -22.037 31.654 24.749  1.00 70.51  ? 228 LYS B CD    1 
ATOM   3808 C  CE    . LYS B 1  231 ? -21.738 33.161 24.981  1.00 71.70  ? 228 LYS B CE    1 
ATOM   3809 N  NZ    . LYS B 1  231 ? -22.539 33.720 26.132  1.00 71.08  ? 228 LYS B NZ    1 
ATOM   3810 N  N     . ARG B 1  232 ? -26.991 28.898 24.718  1.00 66.20  ? 229 ARG B N     1 
ATOM   3811 C  CA    . ARG B 1  232 ? -27.832 27.856 25.298  1.00 67.16  ? 229 ARG B CA    1 
ATOM   3812 C  C     . ARG B 1  232 ? -28.586 27.042 24.247  1.00 67.56  ? 229 ARG B C     1 
ATOM   3813 O  O     . ARG B 1  232 ? -28.591 25.814 24.309  1.00 67.69  ? 229 ARG B O     1 
ATOM   3814 C  CB    . ARG B 1  232 ? -28.796 28.437 26.337  1.00 67.54  ? 229 ARG B CB    1 
ATOM   3815 C  CG    . ARG B 1  232 ? -28.092 29.030 27.555  1.00 68.74  ? 229 ARG B CG    1 
ATOM   3816 C  CD    . ARG B 1  232 ? -28.869 28.812 28.839  1.00 71.58  ? 229 ARG B CD    1 
ATOM   3817 N  NE    . ARG B 1  232 ? -30.086 29.621 28.901  1.00 73.86  ? 229 ARG B NE    1 
ATOM   3818 C  CZ    . ARG B 1  232 ? -31.245 29.193 29.403  1.00 75.09  ? 229 ARG B CZ    1 
ATOM   3819 N  NH1   . ARG B 1  232 ? -31.366 27.952 29.881  1.00 75.20  ? 229 ARG B NH1   1 
ATOM   3820 N  NH2   . ARG B 1  232 ? -32.292 30.007 29.416  1.00 75.92  ? 229 ARG B NH2   1 
ATOM   3821 N  N     . LEU B 1  233 ? -29.203 27.717 23.280  1.00 68.22  ? 230 LEU B N     1 
ATOM   3822 C  CA    . LEU B 1  233 ? -29.938 27.029 22.211  1.00 69.29  ? 230 LEU B CA    1 
ATOM   3823 C  C     . LEU B 1  233 ? -29.041 26.123 21.343  1.00 70.54  ? 230 LEU B C     1 
ATOM   3824 O  O     . LEU B 1  233 ? -29.454 25.039 20.927  1.00 70.43  ? 230 LEU B O     1 
ATOM   3825 C  CB    . LEU B 1  233 ? -30.727 28.028 21.362  1.00 68.91  ? 230 LEU B CB    1 
ATOM   3826 C  CG    . LEU B 1  233 ? -31.588 27.580 20.179  1.00 68.44  ? 230 LEU B CG    1 
ATOM   3827 C  CD1   . LEU B 1  233 ? -32.469 26.380 20.490  1.00 68.29  ? 230 LEU B CD1   1 
ATOM   3828 C  CD2   . LEU B 1  233 ? -32.439 28.740 19.725  1.00 67.79  ? 230 LEU B CD2   1 
ATOM   3829 N  N     . LEU B 1  234 ? -27.809 26.560 21.098  1.00 72.15  ? 231 LEU B N     1 
ATOM   3830 C  CA    . LEU B 1  234 ? -26.840 25.739 20.374  1.00 73.69  ? 231 LEU B CA    1 
ATOM   3831 C  C     . LEU B 1  234 ? -26.479 24.484 21.155  1.00 75.05  ? 231 LEU B C     1 
ATOM   3832 O  O     . LEU B 1  234 ? -26.538 23.371 20.606  1.00 75.19  ? 231 LEU B O     1 
ATOM   3833 C  CB    . LEU B 1  234 ? -25.582 26.542 20.020  1.00 73.54  ? 231 LEU B CB    1 
ATOM   3834 C  CG    . LEU B 1  234 ? -25.726 27.493 18.823  1.00 73.12  ? 231 LEU B CG    1 
ATOM   3835 C  CD1   . LEU B 1  234 ? -24.468 28.317 18.600  1.00 73.03  ? 231 LEU B CD1   1 
ATOM   3836 C  CD2   . LEU B 1  234 ? -26.084 26.724 17.577  1.00 72.03  ? 231 LEU B CD2   1 
ATOM   3837 N  N     . THR B 1  235 ? -26.128 24.667 22.435  1.00 76.69  ? 232 THR B N     1 
ATOM   3838 C  CA    . THR B 1  235 ? -25.760 23.554 23.319  1.00 78.18  ? 232 THR B CA    1 
ATOM   3839 C  C     . THR B 1  235 ? -26.879 22.520 23.349  1.00 79.31  ? 232 THR B C     1 
ATOM   3840 O  O     . THR B 1  235 ? -26.617 21.319 23.299  1.00 79.14  ? 232 THR B O     1 
ATOM   3841 C  CB    . THR B 1  235 ? -25.453 24.001 24.774  1.00 78.15  ? 232 THR B CB    1 
ATOM   3842 O  OG1   . THR B 1  235 ? -24.709 25.222 24.778  1.00 78.29  ? 232 THR B OG1   1 
ATOM   3843 C  CG2   . THR B 1  235 ? -24.642 22.936 25.503  1.00 78.19  ? 232 THR B CG2   1 
ATOM   3844 N  N     . LYS B 1  236 ? -28.123 22.996 23.402  1.00 80.90  ? 233 LYS B N     1 
ATOM   3845 C  CA    . LYS B 1  236 ? -29.269 22.106 23.500  1.00 82.69  ? 233 LYS B CA    1 
ATOM   3846 C  C     . LYS B 1  236 ? -29.432 21.253 22.256  1.00 83.93  ? 233 LYS B C     1 
ATOM   3847 O  O     . LYS B 1  236 ? -29.812 20.086 22.352  1.00 84.28  ? 233 LYS B O     1 
ATOM   3848 C  CB    . LYS B 1  236 ? -30.571 22.866 23.803  1.00 82.64  ? 233 LYS B CB    1 
ATOM   3849 C  CG    . LYS B 1  236 ? -31.763 21.929 24.084  1.00 83.29  ? 233 LYS B CG    1 
ATOM   3850 C  CD    . LYS B 1  236 ? -33.005 22.651 24.607  1.00 84.01  ? 233 LYS B CD    1 
ATOM   3851 C  CE    . LYS B 1  236 ? -34.247 21.735 24.606  1.00 84.58  ? 233 LYS B CE    1 
ATOM   3852 N  NZ    . LYS B 1  236 ? -34.133 20.495 25.452  1.00 84.56  ? 233 LYS B NZ    1 
ATOM   3853 N  N     . LEU B 1  237 ? -29.152 21.816 21.086  1.00 85.67  ? 234 LEU B N     1 
ATOM   3854 C  CA    . LEU B 1  237 ? -29.408 21.057 19.856  1.00 86.96  ? 234 LEU B CA    1 
ATOM   3855 C  C     . LEU B 1  237 ? -28.195 20.257 19.360  1.00 87.53  ? 234 LEU B C     1 
ATOM   3856 O  O     . LEU B 1  237 ? -28.365 19.232 18.691  1.00 87.64  ? 234 LEU B O     1 
ATOM   3857 C  CB    . LEU B 1  237 ? -30.114 21.898 18.768  1.00 87.00  ? 234 LEU B CB    1 
ATOM   3858 C  CG    . LEU B 1  237 ? -31.579 22.306 19.106  1.00 87.62  ? 234 LEU B CG    1 
ATOM   3859 C  CD1   . LEU B 1  237 ? -32.300 23.024 17.940  1.00 87.62  ? 234 LEU B CD1   1 
ATOM   3860 C  CD2   . LEU B 1  237 ? -32.439 21.127 19.625  1.00 88.02  ? 234 LEU B CD2   1 
ATOM   3861 N  N     . LEU B 1  238 ? -26.990 20.693 19.728  1.00 88.21  ? 235 LEU B N     1 
ATOM   3862 C  CA    . LEU B 1  238 ? -25.802 19.900 19.415  1.00 89.29  ? 235 LEU B CA    1 
ATOM   3863 C  C     . LEU B 1  238 ? -25.751 18.532 20.146  1.00 89.80  ? 235 LEU B C     1 
ATOM   3864 O  O     . LEU B 1  238 ? -25.518 17.515 19.502  1.00 90.15  ? 235 LEU B O     1 
ATOM   3865 C  CB    . LEU B 1  238 ? -24.485 20.707 19.514  1.00 89.35  ? 235 LEU B CB    1 
ATOM   3866 C  CG    . LEU B 1  238 ? -23.838 21.269 20.790  1.00 90.17  ? 235 LEU B CG    1 
ATOM   3867 C  CD1   . LEU B 1  238 ? -23.223 20.178 21.694  1.00 90.16  ? 235 LEU B CD1   1 
ATOM   3868 C  CD2   . LEU B 1  238 ? -22.774 22.323 20.413  1.00 89.15  ? 235 LEU B CD2   1 
ATOM   3869 N  N     . VAL B 1  239 ? -25.998 18.486 21.458  1.00 90.18  ? 236 VAL B N     1 
ATOM   3870 C  CA    . VAL B 1  239 ? -26.064 17.185 22.169  1.00 90.17  ? 236 VAL B CA    1 
ATOM   3871 C  C     . VAL B 1  239 ? -27.093 16.252 21.506  1.00 90.12  ? 236 VAL B C     1 
ATOM   3872 O  O     . VAL B 1  239 ? -28.207 16.675 21.179  1.00 90.22  ? 236 VAL B O     1 
ATOM   3873 C  CB    . VAL B 1  239 ? -26.342 17.321 23.709  1.00 90.35  ? 236 VAL B CB    1 
ATOM   3874 C  CG1   . VAL B 1  239 ? -25.240 18.140 24.406  1.00 90.14  ? 236 VAL B CG1   1 
ATOM   3875 C  CG2   . VAL B 1  239 ? -27.742 17.897 23.995  1.00 89.85  ? 236 VAL B CG2   1 
ATOM   3876 N  N     . GLY B 1  240 ? -26.706 14.998 21.281  1.00 89.94  ? 237 GLY B N     1 
ATOM   3877 C  CA    . GLY B 1  240 ? -27.550 14.057 20.533  1.00 89.66  ? 237 GLY B CA    1 
ATOM   3878 C  C     . GLY B 1  240 ? -27.233 14.003 19.038  1.00 89.39  ? 237 GLY B C     1 
ATOM   3879 O  O     . GLY B 1  240 ? -27.439 12.965 18.386  1.00 89.64  ? 237 GLY B O     1 
ATOM   3880 N  N     . ARG B 1  241 ? -26.742 15.122 18.494  1.00 88.57  ? 238 ARG B N     1 
ATOM   3881 C  CA    . ARG B 1  241 ? -26.274 15.208 17.097  1.00 87.52  ? 238 ARG B CA    1 
ATOM   3882 C  C     . ARG B 1  241 ? -25.193 16.306 16.945  1.00 86.53  ? 238 ARG B C     1 
ATOM   3883 O  O     . ARG B 1  241 ? -25.387 17.265 16.178  1.00 86.60  ? 238 ARG B O     1 
ATOM   3884 C  CB    . ARG B 1  241 ? -27.461 15.443 16.133  1.00 87.68  ? 238 ARG B CB    1 
ATOM   3885 C  CG    . ARG B 1  241 ? -28.390 16.602 16.532  1.00 87.70  ? 238 ARG B CG    1 
ATOM   3886 C  CD    . ARG B 1  241 ? -29.709 16.615 15.769  1.00 87.69  ? 238 ARG B CD    1 
ATOM   3887 N  NE    . ARG B 1  241 ? -30.636 17.546 16.412  1.00 88.70  ? 238 ARG B NE    1 
ATOM   3888 C  CZ    . ARG B 1  241 ? -31.852 17.861 15.966  1.00 89.45  ? 238 ARG B CZ    1 
ATOM   3889 N  NH1   . ARG B 1  241 ? -32.325 17.327 14.844  1.00 89.44  ? 238 ARG B NH1   1 
ATOM   3890 N  NH2   . ARG B 1  241 ? -32.598 18.726 16.649  1.00 89.29  ? 238 ARG B NH2   1 
ATOM   3891 N  N     . PRO B 1  242 ? -24.047 16.165 17.668  1.00 85.22  ? 239 PRO B N     1 
ATOM   3892 C  CA    . PRO B 1  242 ? -23.036 17.248 17.776  1.00 84.10  ? 239 PRO B CA    1 
ATOM   3893 C  C     . PRO B 1  242 ? -22.398 17.662 16.448  1.00 82.95  ? 239 PRO B C     1 
ATOM   3894 O  O     . PRO B 1  242 ? -21.627 18.624 16.391  1.00 82.85  ? 239 PRO B O     1 
ATOM   3895 C  CB    . PRO B 1  242 ? -21.978 16.659 18.720  1.00 84.23  ? 239 PRO B CB    1 
ATOM   3896 C  CG    . PRO B 1  242 ? -22.167 15.180 18.645  1.00 84.75  ? 239 PRO B CG    1 
ATOM   3897 C  CD    . PRO B 1  242 ? -23.630 14.955 18.404  1.00 84.98  ? 239 PRO B CD    1 
ATOM   3898 N  N     . THR B 1  243 ? -22.759 16.945 15.392  1.00 81.49  ? 240 THR B N     1 
ATOM   3899 C  CA    . THR B 1  243 ? -22.113 17.054 14.104  1.00 80.08  ? 240 THR B CA    1 
ATOM   3900 C  C     . THR B 1  243 ? -23.092 17.524 13.018  1.00 79.01  ? 240 THR B C     1 
ATOM   3901 O  O     . THR B 1  243 ? -22.685 17.836 11.890  1.00 78.95  ? 240 THR B O     1 
ATOM   3902 C  CB    . THR B 1  243 ? -21.449 15.697 13.715  1.00 80.14  ? 240 THR B CB    1 
ATOM   3903 O  OG1   . THR B 1  243 ? -20.663 15.864 12.533  1.00 80.05  ? 240 THR B OG1   1 
ATOM   3904 C  CG2   . THR B 1  243 ? -22.502 14.595 13.486  1.00 80.19  ? 240 THR B CG2   1 
ATOM   3905 N  N     . LYS B 1  244 ? -24.377 17.582 13.357  1.00 77.30  ? 241 LYS B N     1 
ATOM   3906 C  CA    . LYS B 1  244 ? -25.385 17.985 12.381  1.00 75.64  ? 241 LYS B CA    1 
ATOM   3907 C  C     . LYS B 1  244 ? -25.715 19.482 12.430  1.00 74.15  ? 241 LYS B C     1 
ATOM   3908 O  O     . LYS B 1  244 ? -26.613 19.924 11.728  1.00 74.33  ? 241 LYS B O     1 
ATOM   3909 C  CB    . LYS B 1  244 ? -26.654 17.124 12.516  1.00 75.52  ? 241 LYS B CB    1 
ATOM   3910 N  N     . TRP B 1  245 ? -24.973 20.263 13.216  1.00 72.48  ? 242 TRP B N     1 
ATOM   3911 C  CA    . TRP B 1  245 ? -25.334 21.684 13.458  1.00 71.13  ? 242 TRP B CA    1 
ATOM   3912 C  C     . TRP B 1  245 ? -25.298 22.653 12.265  1.00 70.34  ? 242 TRP B C     1 
ATOM   3913 O  O     . TRP B 1  245 ? -26.094 23.598 12.201  1.00 70.30  ? 242 TRP B O     1 
ATOM   3914 C  CB    . TRP B 1  245 ? -24.576 22.288 14.649  1.00 70.79  ? 242 TRP B CB    1 
ATOM   3915 C  CG    . TRP B 1  245 ? -23.093 22.395 14.503  1.00 69.86  ? 242 TRP B CG    1 
ATOM   3916 C  CD1   . TRP B 1  245 ? -22.175 21.509 14.965  1.00 70.00  ? 242 TRP B CD1   1 
ATOM   3917 C  CD2   . TRP B 1  245 ? -22.345 23.464 13.897  1.00 69.00  ? 242 TRP B CD2   1 
ATOM   3918 N  NE1   . TRP B 1  245 ? -20.903 21.945 14.682  1.00 69.46  ? 242 TRP B NE1   1 
ATOM   3919 C  CE2   . TRP B 1  245 ? -20.977 23.141 14.026  1.00 68.75  ? 242 TRP B CE2   1 
ATOM   3920 C  CE3   . TRP B 1  245 ? -22.696 24.656 13.256  1.00 68.87  ? 242 TRP B CE3   1 
ATOM   3921 C  CZ2   . TRP B 1  245 ? -19.958 23.960 13.530  1.00 68.25  ? 242 TRP B CZ2   1 
ATOM   3922 C  CZ3   . TRP B 1  245 ? -21.677 25.475 12.764  1.00 68.97  ? 242 TRP B CZ3   1 
ATOM   3923 C  CH2   . TRP B 1  245 ? -20.325 25.119 12.906  1.00 68.26  ? 242 TRP B CH2   1 
ATOM   3924 N  N     . TYR B 1  246 ? -24.377 22.436 11.333  1.00 69.38  ? 243 TYR B N     1 
ATOM   3925 C  CA    . TYR B 1  246 ? -24.325 23.252 10.121  1.00 68.19  ? 243 TYR B CA    1 
ATOM   3926 C  C     . TYR B 1  246 ? -25.706 23.389 9.479   1.00 67.38  ? 243 TYR B C     1 
ATOM   3927 O  O     . TYR B 1  246 ? -26.110 24.489 9.128   1.00 67.47  ? 243 TYR B O     1 
ATOM   3928 C  CB    . TYR B 1  246 ? -23.325 22.681 9.105   1.00 68.21  ? 243 TYR B CB    1 
ATOM   3929 C  CG    . TYR B 1  246 ? -23.332 23.427 7.792   1.00 67.85  ? 243 TYR B CG    1 
ATOM   3930 C  CD1   . TYR B 1  246 ? -22.439 24.468 7.562   1.00 67.45  ? 243 TYR B CD1   1 
ATOM   3931 C  CD2   . TYR B 1  246 ? -24.250 23.104 6.788   1.00 68.01  ? 243 TYR B CD2   1 
ATOM   3932 C  CE1   . TYR B 1  246 ? -22.452 25.166 6.377   1.00 67.95  ? 243 TYR B CE1   1 
ATOM   3933 C  CE2   . TYR B 1  246 ? -24.281 23.802 5.596   1.00 68.59  ? 243 TYR B CE2   1 
ATOM   3934 C  CZ    . TYR B 1  246 ? -23.373 24.832 5.392   1.00 68.92  ? 243 TYR B CZ    1 
ATOM   3935 O  OH    . TYR B 1  246 ? -23.378 25.526 4.200   1.00 69.16  ? 243 TYR B OH    1 
ATOM   3936 N  N     . ASP B 1  247 ? -26.417 22.269 9.330   1.00 66.60  ? 244 ASP B N     1 
ATOM   3937 C  CA    . ASP B 1  247 ? -27.737 22.249 8.693   1.00 65.81  ? 244 ASP B CA    1 
ATOM   3938 C  C     . ASP B 1  247 ? -28.792 22.947 9.532   1.00 64.75  ? 244 ASP B C     1 
ATOM   3939 O  O     . ASP B 1  247 ? -29.796 23.436 9.002   1.00 64.48  ? 244 ASP B O     1 
ATOM   3940 C  CB    . ASP B 1  247 ? -28.202 20.810 8.436   1.00 66.51  ? 244 ASP B CB    1 
ATOM   3941 C  CG    . ASP B 1  247 ? -27.352 20.080 7.396   1.00 68.57  ? 244 ASP B CG    1 
ATOM   3942 O  OD1   . ASP B 1  247 ? -26.789 20.739 6.481   1.00 69.50  ? 244 ASP B OD1   1 
ATOM   3943 O  OD2   . ASP B 1  247 ? -27.263 18.831 7.500   1.00 70.58  ? 244 ASP B OD2   1 
ATOM   3944 N  N     . LEU B 1  248 ? -28.565 22.987 10.844  1.00 63.39  ? 245 LEU B N     1 
ATOM   3945 C  CA    . LEU B 1  248 ? -29.560 23.511 11.768  1.00 62.00  ? 245 LEU B CA    1 
ATOM   3946 C  C     . LEU B 1  248 ? -29.542 25.019 11.922  1.00 60.87  ? 245 LEU B C     1 
ATOM   3947 O  O     . LEU B 1  248 ? -30.527 25.601 12.394  1.00 60.83  ? 245 LEU B O     1 
ATOM   3948 C  CB    . LEU B 1  248 ? -29.479 22.804 13.121  1.00 62.18  ? 245 LEU B CB    1 
ATOM   3949 C  CG    . LEU B 1  248 ? -30.015 21.366 13.030  1.00 63.50  ? 245 LEU B CG    1 
ATOM   3950 C  CD1   . LEU B 1  248 ? -29.788 20.605 14.334  1.00 63.69  ? 245 LEU B CD1   1 
ATOM   3951 C  CD2   . LEU B 1  248 ? -31.503 21.321 12.587  1.00 63.09  ? 245 LEU B CD2   1 
ATOM   3952 N  N     . LEU B 1  249 ? -28.450 25.654 11.502  1.00 59.12  ? 246 LEU B N     1 
ATOM   3953 C  CA    . LEU B 1  249 ? -28.356 27.107 11.578  1.00 58.11  ? 246 LEU B CA    1 
ATOM   3954 C  C     . LEU B 1  249 ? -29.586 27.881 11.069  1.00 56.73  ? 246 LEU B C     1 
ATOM   3955 O  O     . LEU B 1  249 ? -30.081 28.763 11.770  1.00 56.66  ? 246 LEU B O     1 
ATOM   3956 C  CB    . LEU B 1  249 ? -27.064 27.617 10.934  1.00 58.56  ? 246 LEU B CB    1 
ATOM   3957 C  CG    . LEU B 1  249 ? -25.803 27.281 11.734  1.00 59.54  ? 246 LEU B CG    1 
ATOM   3958 C  CD1   . LEU B 1  249 ? -24.575 27.724 10.975  1.00 60.00  ? 246 LEU B CD1   1 
ATOM   3959 C  CD2   . LEU B 1  249 ? -25.834 27.922 13.116  1.00 60.38  ? 246 LEU B CD2   1 
ATOM   3960 N  N     . PRO B 1  250 ? -30.101 27.556 9.869   1.00 55.63  ? 247 PRO B N     1 
ATOM   3961 C  CA    . PRO B 1  250 ? -31.323 28.289 9.462   1.00 54.96  ? 247 PRO B CA    1 
ATOM   3962 C  C     . PRO B 1  250 ? -32.454 28.278 10.516  1.00 54.39  ? 247 PRO B C     1 
ATOM   3963 O  O     . PRO B 1  250 ? -32.968 29.339 10.870  1.00 54.44  ? 247 PRO B O     1 
ATOM   3964 C  CB    . PRO B 1  250 ? -31.757 27.578 8.173   1.00 54.45  ? 247 PRO B CB    1 
ATOM   3965 C  CG    . PRO B 1  250 ? -30.508 27.011 7.629   1.00 54.92  ? 247 PRO B CG    1 
ATOM   3966 C  CD    . PRO B 1  250 ? -29.610 26.672 8.799   1.00 55.27  ? 247 PRO B CD    1 
ATOM   3967 N  N     . VAL B 1  251 ? -32.821 27.101 11.028  1.00 53.62  ? 248 VAL B N     1 
ATOM   3968 C  CA    . VAL B 1  251 ? -33.892 27.022 12.024  1.00 52.26  ? 248 VAL B CA    1 
ATOM   3969 C  C     . VAL B 1  251 ? -33.526 27.664 13.379  1.00 51.30  ? 248 VAL B C     1 
ATOM   3970 O  O     . VAL B 1  251 ? -34.347 28.354 13.976  1.00 51.22  ? 248 VAL B O     1 
ATOM   3971 C  CB    . VAL B 1  251 ? -34.481 25.591 12.155  1.00 52.38  ? 248 VAL B CB    1 
ATOM   3972 C  CG1   . VAL B 1  251 ? -33.446 24.593 12.687  1.00 52.04  ? 248 VAL B CG1   1 
ATOM   3973 C  CG2   . VAL B 1  251 ? -35.747 25.602 13.011  1.00 52.11  ? 248 VAL B CG2   1 
ATOM   3974 N  N     . VAL B 1  252 ? -32.299 27.483 13.844  1.00 50.32  ? 249 VAL B N     1 
ATOM   3975 C  CA    . VAL B 1  252 ? -31.828 28.244 15.008  1.00 49.66  ? 249 VAL B CA    1 
ATOM   3976 C  C     . VAL B 1  252 ? -32.130 29.745 14.856  1.00 49.95  ? 249 VAL B C     1 
ATOM   3977 O  O     . VAL B 1  252 ? -32.654 30.361 15.778  1.00 49.77  ? 249 VAL B O     1 
ATOM   3978 C  CB    . VAL B 1  252 ? -30.314 28.070 15.245  1.00 49.64  ? 249 VAL B CB    1 
ATOM   3979 C  CG1   . VAL B 1  252 ? -29.840 28.920 16.413  1.00 47.98  ? 249 VAL B CG1   1 
ATOM   3980 C  CG2   . VAL B 1  252 ? -29.950 26.592 15.450  1.00 49.33  ? 249 VAL B CG2   1 
ATOM   3981 N  N     . GLN B 1  253 ? -31.806 30.332 13.701  1.00 50.12  ? 250 GLN B N     1 
ATOM   3982 C  CA    . GLN B 1  253 ? -32.039 31.770 13.493  1.00 50.26  ? 250 GLN B CA    1 
ATOM   3983 C  C     . GLN B 1  253 ? -33.523 32.149 13.493  1.00 50.13  ? 250 GLN B C     1 
ATOM   3984 O  O     . GLN B 1  253 ? -33.908 33.172 14.075  1.00 49.96  ? 250 GLN B O     1 
ATOM   3985 C  CB    . GLN B 1  253 ? -31.401 32.259 12.196  1.00 50.50  ? 250 GLN B CB    1 
ATOM   3986 C  CG    . GLN B 1  253 ? -29.953 32.605 12.308  1.00 51.88  ? 250 GLN B CG    1 
ATOM   3987 C  CD    . GLN B 1  253 ? -29.306 32.801 10.951  1.00 53.53  ? 250 GLN B CD    1 
ATOM   3988 O  OE1   . GLN B 1  253 ? -29.172 33.922 10.469  1.00 54.95  ? 250 GLN B OE1   1 
ATOM   3989 N  NE2   . GLN B 1  253 ? -28.924 31.702 10.316  1.00 54.28  ? 250 GLN B NE2   1 
ATOM   3990 N  N     . LEU B 1  254 ? -34.351 31.343 12.827  1.00 49.82  ? 251 LEU B N     1 
ATOM   3991 C  CA    . LEU B 1  254 ? -35.786 31.637 12.780  1.00 49.94  ? 251 LEU B CA    1 
ATOM   3992 C  C     . LEU B 1  254 ? -36.356 31.637 14.184  1.00 49.48  ? 251 LEU B C     1 
ATOM   3993 O  O     . LEU B 1  254 ? -37.153 32.513 14.517  1.00 49.43  ? 251 LEU B O     1 
ATOM   3994 C  CB    . LEU B 1  254 ? -36.551 30.660 11.883  1.00 50.06  ? 251 LEU B CB    1 
ATOM   3995 C  CG    . LEU B 1  254 ? -36.262 30.812 10.387  1.00 51.11  ? 251 LEU B CG    1 
ATOM   3996 C  CD1   . LEU B 1  254 ? -36.553 29.526 9.613   1.00 50.77  ? 251 LEU B CD1   1 
ATOM   3997 C  CD2   . LEU B 1  254 ? -37.021 32.011 9.805   1.00 51.05  ? 251 LEU B CD2   1 
ATOM   3998 N  N     . ALA B 1  255 ? -35.910 30.670 14.996  1.00 48.82  ? 252 ALA B N     1 
ATOM   3999 C  CA    . ALA B 1  255 ? -36.293 30.569 16.402  1.00 48.24  ? 252 ALA B CA    1 
ATOM   4000 C  C     . ALA B 1  255 ? -35.894 31.865 17.091  1.00 48.21  ? 252 ALA B C     1 
ATOM   4001 O  O     . ALA B 1  255 ? -36.757 32.629 17.529  1.00 48.08  ? 252 ALA B O     1 
ATOM   4002 C  CB    . ALA B 1  255 ? -35.639 29.369 17.063  1.00 47.16  ? 252 ALA B CB    1 
ATOM   4003 N  N     . LEU B 1  256 ? -34.596 32.145 17.129  1.00 48.09  ? 253 LEU B N     1 
ATOM   4004 C  CA    . LEU B 1  256 ? -34.115 33.349 17.770  1.00 48.57  ? 253 LEU B CA    1 
ATOM   4005 C  C     . LEU B 1  256 ? -34.875 34.604 17.338  1.00 49.55  ? 253 LEU B C     1 
ATOM   4006 O  O     . LEU B 1  256 ? -35.248 35.426 18.179  1.00 49.88  ? 253 LEU B O     1 
ATOM   4007 C  CB    . LEU B 1  256 ? -32.633 33.519 17.528  1.00 48.08  ? 253 LEU B CB    1 
ATOM   4008 C  CG    . LEU B 1  256 ? -31.852 32.366 18.146  1.00 48.22  ? 253 LEU B CG    1 
ATOM   4009 C  CD1   . LEU B 1  256 ? -30.436 32.278 17.565  1.00 46.86  ? 253 LEU B CD1   1 
ATOM   4010 C  CD2   . LEU B 1  256 ? -31.844 32.476 19.683  1.00 47.04  ? 253 LEU B CD2   1 
ATOM   4011 N  N     . ASN B 1  257 ? -35.125 34.746 16.041  1.00 50.41  ? 254 ASN B N     1 
ATOM   4012 C  CA    . ASN B 1  257 ? -35.688 35.989 15.529  1.00 51.23  ? 254 ASN B CA    1 
ATOM   4013 C  C     . ASN B 1  257 ? -37.205 36.062 15.674  1.00 52.08  ? 254 ASN B C     1 
ATOM   4014 O  O     . ASN B 1  257 ? -37.788 37.141 15.592  1.00 51.42  ? 254 ASN B O     1 
ATOM   4015 C  CB    . ASN B 1  257 ? -35.209 36.264 14.094  1.00 50.70  ? 254 ASN B CB    1 
ATOM   4016 C  CG    . ASN B 1  257 ? -33.712 36.595 14.028  1.00 50.22  ? 254 ASN B CG    1 
ATOM   4017 O  OD1   . ASN B 1  257 ? -33.196 37.381 14.823  1.00 49.75  ? 254 ASN B OD1   1 
ATOM   4018 N  ND2   . ASN B 1  257 ? -33.019 35.999 13.076  1.00 49.27  ? 254 ASN B ND2   1 
ATOM   4019 N  N     . ASN B 1  258 ? -37.832 34.913 15.914  1.00 53.76  ? 255 ASN B N     1 
ATOM   4020 C  CA    . ASN B 1  258 ? -39.266 34.879 16.161  1.00 56.18  ? 255 ASN B CA    1 
ATOM   4021 C  C     . ASN B 1  258 ? -39.600 34.582 17.625  1.00 58.61  ? 255 ASN B C     1 
ATOM   4022 O  O     . ASN B 1  258 ? -40.703 34.144 17.959  1.00 59.25  ? 255 ASN B O     1 
ATOM   4023 C  CB    . ASN B 1  258 ? -39.943 33.903 15.220  1.00 55.40  ? 255 ASN B CB    1 
ATOM   4024 C  CG    . ASN B 1  258 ? -39.870 34.354 13.788  1.00 55.12  ? 255 ASN B CG    1 
ATOM   4025 O  OD1   . ASN B 1  258 ? -40.613 35.246 13.363  1.00 54.26  ? 255 ASN B OD1   1 
ATOM   4026 N  ND2   . ASN B 1  258 ? -38.962 33.753 13.031  1.00 52.82  ? 255 ASN B ND2   1 
ATOM   4027 N  N     . THR B 1  259 ? -38.619 34.826 18.485  1.00 61.38  ? 256 THR B N     1 
ATOM   4028 C  CA    . THR B 1  259 ? -38.772 34.727 19.913  1.00 64.25  ? 256 THR B CA    1 
ATOM   4029 C  C     . THR B 1  259 ? -39.211 36.086 20.450  1.00 66.38  ? 256 THR B C     1 
ATOM   4030 O  O     . THR B 1  259 ? -38.580 37.120 20.188  1.00 66.56  ? 256 THR B O     1 
ATOM   4031 C  CB    . THR B 1  259 ? -37.444 34.310 20.559  1.00 64.19  ? 256 THR B CB    1 
ATOM   4032 O  OG1   . THR B 1  259 ? -37.156 32.966 20.172  1.00 64.55  ? 256 THR B OG1   1 
ATOM   4033 C  CG2   . THR B 1  259 ? -37.491 34.418 22.091  1.00 63.65  ? 256 THR B CG2   1 
ATOM   4034 N  N     . TYR B 1  260 ? -40.305 36.057 21.205  1.00 68.91  ? 257 TYR B N     1 
ATOM   4035 C  CA    . TYR B 1  260 ? -40.887 37.250 21.807  1.00 71.50  ? 257 TYR B CA    1 
ATOM   4036 C  C     . TYR B 1  260 ? -39.952 37.888 22.875  1.00 72.04  ? 257 TYR B C     1 
ATOM   4037 O  O     . TYR B 1  260 ? -39.278 37.184 23.641  1.00 72.19  ? 257 TYR B O     1 
ATOM   4038 C  CB    . TYR B 1  260 ? -42.302 36.894 22.316  1.00 72.19  ? 257 TYR B CB    1 
ATOM   4039 C  CG    . TYR B 1  260 ? -42.960 37.894 23.232  1.00 75.57  ? 257 TYR B CG    1 
ATOM   4040 C  CD1   . TYR B 1  260 ? -43.394 39.132 22.752  1.00 78.19  ? 257 TYR B CD1   1 
ATOM   4041 C  CD2   . TYR B 1  260 ? -43.176 37.590 24.594  1.00 78.71  ? 257 TYR B CD2   1 
ATOM   4042 C  CE1   . TYR B 1  260 ? -44.010 40.060 23.611  1.00 80.82  ? 257 TYR B CE1   1 
ATOM   4043 C  CE2   . TYR B 1  260 ? -43.796 38.508 25.458  1.00 80.53  ? 257 TYR B CE2   1 
ATOM   4044 C  CZ    . TYR B 1  260 ? -44.209 39.741 24.954  1.00 81.76  ? 257 TYR B CZ    1 
ATOM   4045 O  OH    . TYR B 1  260 ? -44.818 40.663 25.781  1.00 84.04  ? 257 TYR B OH    1 
ATOM   4046 N  N     . SER B 1  261 ? -39.878 39.222 22.866  1.00 72.92  ? 258 SER B N     1 
ATOM   4047 C  CA    . SER B 1  261 ? -39.064 40.000 23.814  1.00 73.46  ? 258 SER B CA    1 
ATOM   4048 C  C     . SER B 1  261 ? -39.903 40.406 25.040  1.00 74.16  ? 258 SER B C     1 
ATOM   4049 O  O     . SER B 1  261 ? -40.894 41.154 24.906  1.00 74.21  ? 258 SER B O     1 
ATOM   4050 C  CB    . SER B 1  261 ? -38.485 41.240 23.117  1.00 73.39  ? 258 SER B CB    1 
ATOM   4051 O  OG    . SER B 1  261 ? -38.051 42.246 24.025  1.00 73.90  ? 258 SER B OG    1 
ATOM   4052 N  N     . PRO B 1  262 ? -39.533 39.896 26.239  1.00 74.53  ? 259 PRO B N     1 
ATOM   4053 C  CA    . PRO B 1  262 ? -40.248 40.337 27.455  1.00 74.52  ? 259 PRO B CA    1 
ATOM   4054 C  C     . PRO B 1  262 ? -40.307 41.877 27.576  1.00 74.29  ? 259 PRO B C     1 
ATOM   4055 O  O     . PRO B 1  262 ? -41.403 42.430 27.729  1.00 74.20  ? 259 PRO B O     1 
ATOM   4056 C  CB    . PRO B 1  262 ? -39.434 39.708 28.589  1.00 74.96  ? 259 PRO B CB    1 
ATOM   4057 C  CG    . PRO B 1  262 ? -38.793 38.448 27.948  1.00 74.97  ? 259 PRO B CG    1 
ATOM   4058 C  CD    . PRO B 1  262 ? -38.556 38.812 26.505  1.00 74.52  ? 259 PRO B CD    1 
ATOM   4059 N  N     . VAL B 1  263 ? -39.149 42.539 27.445  1.00 73.80  ? 260 VAL B N     1 
ATOM   4060 C  CA    . VAL B 1  263 ? -38.994 44.011 27.586  1.00 73.05  ? 260 VAL B CA    1 
ATOM   4061 C  C     . VAL B 1  263 ? -39.785 44.852 26.553  1.00 72.66  ? 260 VAL B C     1 
ATOM   4062 O  O     . VAL B 1  263 ? -40.553 45.751 26.943  1.00 72.74  ? 260 VAL B O     1 
ATOM   4063 C  CB    . VAL B 1  263 ? -37.476 44.433 27.658  1.00 73.14  ? 260 VAL B CB    1 
ATOM   4064 C  CG1   . VAL B 1  263 ? -37.292 45.960 27.639  1.00 72.51  ? 260 VAL B CG1   1 
ATOM   4065 C  CG2   . VAL B 1  263 ? -36.807 43.822 28.900  1.00 72.86  ? 260 VAL B CG2   1 
ATOM   4066 N  N     . LEU B 1  264 ? -39.600 44.581 25.257  1.00 71.65  ? 261 LEU B N     1 
ATOM   4067 C  CA    . LEU B 1  264 ? -40.492 45.168 24.238  1.00 70.62  ? 261 LEU B CA    1 
ATOM   4068 C  C     . LEU B 1  264 ? -41.628 44.169 23.928  1.00 69.48  ? 261 LEU B C     1 
ATOM   4069 O  O     . LEU B 1  264 ? -41.529 42.978 24.239  1.00 69.45  ? 261 LEU B O     1 
ATOM   4070 C  CB    . LEU B 1  264 ? -39.732 45.609 22.967  1.00 70.94  ? 261 LEU B CB    1 
ATOM   4071 C  CG    . LEU B 1  264 ? -38.442 46.468 23.034  1.00 71.74  ? 261 LEU B CG    1 
ATOM   4072 C  CD1   . LEU B 1  264 ? -37.202 45.633 22.698  1.00 71.88  ? 261 LEU B CD1   1 
ATOM   4073 C  CD2   . LEU B 1  264 ? -38.486 47.723 22.121  1.00 71.98  ? 261 LEU B CD2   1 
ATOM   4074 N  N     . LYS B 1  265 ? -42.722 44.636 23.348  1.00 67.75  ? 262 LYS B N     1 
ATOM   4075 C  CA    . LYS B 1  265 ? -43.837 43.724 23.115  1.00 66.24  ? 262 LYS B CA    1 
ATOM   4076 C  C     . LYS B 1  265 ? -43.652 42.870 21.838  1.00 64.81  ? 262 LYS B C     1 
ATOM   4077 O  O     . LYS B 1  265 ? -44.572 42.129 21.438  1.00 65.02  ? 262 LYS B O     1 
ATOM   4078 C  CB    . LYS B 1  265 ? -45.176 44.497 23.088  1.00 66.70  ? 262 LYS B CB    1 
ATOM   4079 N  N     . TYR B 1  266 ? -42.473 42.958 21.213  1.00 62.27  ? 263 TYR B N     1 
ATOM   4080 C  CA    . TYR B 1  266 ? -42.288 42.457 19.847  1.00 59.81  ? 263 TYR B CA    1 
ATOM   4081 C  C     . TYR B 1  266 ? -41.073 41.582 19.657  1.00 57.77  ? 263 TYR B C     1 
ATOM   4082 O  O     . TYR B 1  266 ? -40.070 41.783 20.339  1.00 57.66  ? 263 TYR B O     1 
ATOM   4083 C  CB    . TYR B 1  266 ? -42.158 43.641 18.908  1.00 60.19  ? 263 TYR B CB    1 
ATOM   4084 C  CG    . TYR B 1  266 ? -43.347 44.564 18.937  1.00 62.02  ? 263 TYR B CG    1 
ATOM   4085 C  CD1   . TYR B 1  266 ? -44.586 44.137 18.444  1.00 63.46  ? 263 TYR B CD1   1 
ATOM   4086 C  CD2   . TYR B 1  266 ? -43.247 45.863 19.456  1.00 63.09  ? 263 TYR B CD2   1 
ATOM   4087 C  CE1   . TYR B 1  266 ? -45.698 44.968 18.468  1.00 64.63  ? 263 TYR B CE1   1 
ATOM   4088 C  CE2   . TYR B 1  266 ? -44.363 46.716 19.475  1.00 64.95  ? 263 TYR B CE2   1 
ATOM   4089 C  CZ    . TYR B 1  266 ? -45.586 46.249 18.978  1.00 65.37  ? 263 TYR B CZ    1 
ATOM   4090 O  OH    . TYR B 1  266 ? -46.710 47.041 18.965  1.00 67.44  ? 263 TYR B OH    1 
ATOM   4091 N  N     . THR B 1  267 ? -41.162 40.634 18.718  1.00 55.11  ? 264 THR B N     1 
ATOM   4092 C  CA    . THR B 1  267 ? -40.003 39.847 18.251  1.00 52.64  ? 264 THR B CA    1 
ATOM   4093 C  C     . THR B 1  267 ? -39.053 40.713 17.379  1.00 51.29  ? 264 THR B C     1 
ATOM   4094 O  O     . THR B 1  267 ? -39.457 41.767 16.872  1.00 50.99  ? 264 THR B O     1 
ATOM   4095 C  CB    . THR B 1  267 ? -40.430 38.610 17.423  1.00 52.31  ? 264 THR B CB    1 
ATOM   4096 O  OG1   . THR B 1  267 ? -41.031 39.036 16.203  1.00 52.15  ? 264 THR B OG1   1 
ATOM   4097 C  CG2   . THR B 1  267 ? -41.418 37.754 18.159  1.00 51.30  ? 264 THR B CG2   1 
ATOM   4098 N  N     . PRO B 1  268 ? -37.787 40.287 17.216  1.00 49.80  ? 265 PRO B N     1 
ATOM   4099 C  CA    . PRO B 1  268 ? -36.873 40.973 16.281  1.00 49.02  ? 265 PRO B CA    1 
ATOM   4100 C  C     . PRO B 1  268 ? -37.414 41.050 14.838  1.00 47.77  ? 265 PRO B C     1 
ATOM   4101 O  O     . PRO B 1  268 ? -37.341 42.109 14.195  1.00 47.56  ? 265 PRO B O     1 
ATOM   4102 C  CB    . PRO B 1  268 ? -35.613 40.108 16.318  1.00 49.01  ? 265 PRO B CB    1 
ATOM   4103 C  CG    . PRO B 1  268 ? -35.654 39.438 17.651  1.00 49.90  ? 265 PRO B CG    1 
ATOM   4104 C  CD    . PRO B 1  268 ? -37.106 39.224 17.979  1.00 50.11  ? 265 PRO B CD    1 
ATOM   4105 N  N     . HIS B 1  269 ? -37.959 39.944 14.348  1.00 46.31  ? 266 HIS B N     1 
ATOM   4106 C  CA    . HIS B 1  269 ? -38.631 39.942 13.070  1.00 45.51  ? 266 HIS B CA    1 
ATOM   4107 C  C     . HIS B 1  269 ? -39.630 41.095 12.979  1.00 45.42  ? 266 HIS B C     1 
ATOM   4108 O  O     . HIS B 1  269 ? -39.623 41.857 12.004  1.00 45.22  ? 266 HIS B O     1 
ATOM   4109 C  CB    . HIS B 1  269 ? -39.313 38.603 12.813  1.00 45.12  ? 266 HIS B CB    1 
ATOM   4110 C  CG    . HIS B 1  269 ? -40.105 38.561 11.541  1.00 45.03  ? 266 HIS B CG    1 
ATOM   4111 N  ND1   . HIS B 1  269 ? -39.742 37.783 10.457  1.00 44.55  ? 266 HIS B ND1   1 
ATOM   4112 C  CD2   . HIS B 1  269 ? -41.251 39.190 11.184  1.00 42.87  ? 266 HIS B CD2   1 
ATOM   4113 C  CE1   . HIS B 1  269 ? -40.637 37.926 9.497   1.00 43.49  ? 266 HIS B CE1   1 
ATOM   4114 N  NE2   . HIS B 1  269 ? -41.556 38.783 9.909   1.00 43.58  ? 266 HIS B NE2   1 
ATOM   4115 N  N     . GLN B 1  270 ? -40.471 41.252 13.989  1.00 45.06  ? 267 GLN B N     1 
ATOM   4116 C  CA    . GLN B 1  270 ? -41.477 42.295 13.915  1.00 45.65  ? 267 GLN B CA    1 
ATOM   4117 C  C     . GLN B 1  270 ? -40.855 43.673 13.879  1.00 45.54  ? 267 GLN B C     1 
ATOM   4118 O  O     . GLN B 1  270 ? -41.350 44.567 13.206  1.00 45.82  ? 267 GLN B O     1 
ATOM   4119 C  CB    . GLN B 1  270 ? -42.433 42.200 15.076  1.00 45.72  ? 267 GLN B CB    1 
ATOM   4120 C  CG    . GLN B 1  270 ? -43.262 40.961 15.025  1.00 48.91  ? 267 GLN B CG    1 
ATOM   4121 C  CD    . GLN B 1  270 ? -44.135 40.796 16.248  1.00 51.34  ? 267 GLN B CD    1 
ATOM   4122 O  OE1   . GLN B 1  270 ? -43.634 40.607 17.362  1.00 52.73  ? 267 GLN B OE1   1 
ATOM   4123 N  NE2   . GLN B 1  270 ? -45.449 40.863 16.047  1.00 51.18  ? 267 GLN B NE2   1 
ATOM   4124 N  N     . LEU B 1  271 ? -39.757 43.832 14.601  1.00 45.48  ? 268 LEU B N     1 
ATOM   4125 C  CA    . LEU B 1  271 ? -39.107 45.115 14.754  1.00 45.17  ? 268 LEU B CA    1 
ATOM   4126 C  C     . LEU B 1  271 ? -38.245 45.477 13.548  1.00 44.84  ? 268 LEU B C     1 
ATOM   4127 O  O     . LEU B 1  271 ? -38.051 46.665 13.235  1.00 44.84  ? 268 LEU B O     1 
ATOM   4128 C  CB    . LEU B 1  271 ? -38.247 45.078 16.010  1.00 45.57  ? 268 LEU B CB    1 
ATOM   4129 C  CG    . LEU B 1  271 ? -39.018 45.169 17.325  1.00 47.04  ? 268 LEU B CG    1 
ATOM   4130 C  CD1   . LEU B 1  271 ? -38.074 44.858 18.459  1.00 48.65  ? 268 LEU B CD1   1 
ATOM   4131 C  CD2   . LEU B 1  271 ? -39.660 46.568 17.529  1.00 48.46  ? 268 LEU B CD2   1 
ATOM   4132 N  N     . LEU B 1  272 ? -37.709 44.453 12.884  1.00 43.83  ? 269 LEU B N     1 
ATOM   4133 C  CA    . LEU B 1  272 ? -36.957 44.673 11.670  1.00 42.89  ? 269 LEU B CA    1 
ATOM   4134 C  C     . LEU B 1  272 ? -37.875 44.943 10.467  1.00 42.99  ? 269 LEU B C     1 
ATOM   4135 O  O     . LEU B 1  272 ? -37.605 45.850 9.694   1.00 43.60  ? 269 LEU B O     1 
ATOM   4136 C  CB    . LEU B 1  272 ? -36.036 43.488 11.397  1.00 42.74  ? 269 LEU B CB    1 
ATOM   4137 C  CG    . LEU B 1  272 ? -34.967 43.695 10.323  1.00 41.53  ? 269 LEU B CG    1 
ATOM   4138 C  CD1   . LEU B 1  272 ? -34.188 45.003 10.549  1.00 38.53  ? 269 LEU B CD1   1 
ATOM   4139 C  CD2   . LEU B 1  272 ? -34.033 42.489 10.293  1.00 39.76  ? 269 LEU B CD2   1 
ATOM   4140 N  N     . PHE B 1  273 ? -38.964 44.189 10.328  1.00 42.35  ? 270 PHE B N     1 
ATOM   4141 C  CA    . PHE B 1  273 ? -39.762 44.240 9.112   1.00 42.59  ? 270 PHE B CA    1 
ATOM   4142 C  C     . PHE B 1  273 ? -41.109 44.943 9.243   1.00 43.49  ? 270 PHE B C     1 
ATOM   4143 O  O     . PHE B 1  273 ? -41.748 45.239 8.224   1.00 44.18  ? 270 PHE B O     1 
ATOM   4144 C  CB    . PHE B 1  273 ? -39.989 42.834 8.557   1.00 41.87  ? 270 PHE B CB    1 
ATOM   4145 C  CG    . PHE B 1  273 ? -38.719 42.082 8.266   1.00 40.93  ? 270 PHE B CG    1 
ATOM   4146 C  CD1   . PHE B 1  273 ? -38.407 40.927 8.974   1.00 38.17  ? 270 PHE B CD1   1 
ATOM   4147 C  CD2   . PHE B 1  273 ? -37.842 42.513 7.265   1.00 39.37  ? 270 PHE B CD2   1 
ATOM   4148 C  CE1   . PHE B 1  273 ? -37.231 40.223 8.712   1.00 37.99  ? 270 PHE B CE1   1 
ATOM   4149 C  CE2   . PHE B 1  273 ? -36.660 41.807 6.997   1.00 38.69  ? 270 PHE B CE2   1 
ATOM   4150 C  CZ    . PHE B 1  273 ? -36.358 40.655 7.723   1.00 37.70  ? 270 PHE B CZ    1 
ATOM   4151 N  N     . GLY B 1  274 ? -41.549 45.183 10.478  1.00 43.69  ? 271 GLY B N     1 
ATOM   4152 C  CA    . GLY B 1  274 ? -42.839 45.805 10.737  1.00 44.10  ? 271 GLY B CA    1 
ATOM   4153 C  C     . GLY B 1  274 ? -44.029 44.909 10.445  1.00 44.85  ? 271 GLY B C     1 
ATOM   4154 O  O     . GLY B 1  274 ? -45.116 45.403 10.169  1.00 44.76  ? 271 GLY B O     1 
ATOM   4155 N  N     . ILE B 1  275 ? -43.838 43.594 10.504  1.00 45.84  ? 272 ILE B N     1 
ATOM   4156 C  CA    . ILE B 1  275 ? -44.936 42.648 10.244  1.00 47.21  ? 272 ILE B CA    1 
ATOM   4157 C  C     . ILE B 1  275 ? -44.849 41.405 11.115  1.00 48.29  ? 272 ILE B C     1 
ATOM   4158 O  O     . ILE B 1  275 ? -43.809 41.128 11.700  1.00 48.19  ? 272 ILE B O     1 
ATOM   4159 C  CB    . ILE B 1  275 ? -44.955 42.137 8.761   1.00 46.95  ? 272 ILE B CB    1 
ATOM   4160 C  CG1   . ILE B 1  275 ? -43.624 41.456 8.430   1.00 47.42  ? 272 ILE B CG1   1 
ATOM   4161 C  CG2   . ILE B 1  275 ? -45.362 43.247 7.776   1.00 45.85  ? 272 ILE B CG2   1 
ATOM   4162 C  CD1   . ILE B 1  275 ? -43.588 40.693 7.142   1.00 49.08  ? 272 ILE B CD1   1 
ATOM   4163 N  N     . ASP B 1  276 ? -45.939 40.644 11.167  1.00 49.89  ? 273 ASP B N     1 
ATOM   4164 C  CA    . ASP B 1  276 ? -45.912 39.315 11.759  1.00 52.13  ? 273 ASP B CA    1 
ATOM   4165 C  C     . ASP B 1  276 ? -45.138 38.383 10.852  1.00 53.00  ? 273 ASP B C     1 
ATOM   4166 O  O     . ASP B 1  276 ? -45.085 38.585 9.644   1.00 53.94  ? 273 ASP B O     1 
ATOM   4167 C  CB    . ASP B 1  276 ? -47.327 38.760 11.946  1.00 52.81  ? 273 ASP B CB    1 
ATOM   4168 C  CG    . ASP B 1  276 ? -48.111 39.437 13.097  1.00 54.97  ? 273 ASP B CG    1 
ATOM   4169 O  OD1   . ASP B 1  276 ? -47.581 40.326 13.822  1.00 56.22  ? 273 ASP B OD1   1 
ATOM   4170 O  OD2   . ASP B 1  276 ? -49.296 39.063 13.255  1.00 56.93  ? 273 ASP B OD2   1 
ATOM   4171 N  N     . SER B 1  277 ? -44.542 37.356 11.436  1.00 54.16  ? 274 SER B N     1 
ATOM   4172 C  CA    . SER B 1  277 ? -43.779 36.371 10.695  1.00 55.21  ? 274 SER B CA    1 
ATOM   4173 C  C     . SER B 1  277 ? -44.676 35.236 10.242  1.00 56.56  ? 274 SER B C     1 
ATOM   4174 O  O     . SER B 1  277 ? -45.728 35.035 10.819  1.00 57.95  ? 274 SER B O     1 
ATOM   4175 C  CB    . SER B 1  277 ? -42.699 35.840 11.603  1.00 54.82  ? 274 SER B CB    1 
ATOM   4176 O  OG    . SER B 1  277 ? -42.295 34.556 11.208  1.00 55.38  ? 274 SER B OG    1 
ATOM   4177 N  N     . ASN B 1  278 ? -44.278 34.492 9.219   1.00 57.95  ? 275 ASN B N     1 
ATOM   4178 C  CA    . ASN B 1  278 ? -45.039 33.326 8.784   1.00 59.57  ? 275 ASN B CA    1 
ATOM   4179 C  C     . ASN B 1  278 ? -44.616 32.066 9.529   1.00 61.73  ? 275 ASN B C     1 
ATOM   4180 O  O     . ASN B 1  278 ? -45.129 30.971 9.291   1.00 61.75  ? 275 ASN B O     1 
ATOM   4181 C  CB    . ASN B 1  278 ? -44.906 33.123 7.277   1.00 58.92  ? 275 ASN B CB    1 
ATOM   4182 C  CG    . ASN B 1  278 ? -45.402 34.304 6.493   1.00 57.87  ? 275 ASN B CG    1 
ATOM   4183 O  OD1   . ASN B 1  278 ? -46.504 34.800 6.722   1.00 56.57  ? 275 ASN B OD1   1 
ATOM   4184 N  ND2   . ASN B 1  278 ? -44.590 34.768 5.558   1.00 56.20  ? 275 ASN B ND2   1 
ATOM   4185 N  N     . THR B 1  279 ? -43.651 32.221 10.418  1.00 64.69  ? 276 THR B N     1 
ATOM   4186 C  CA    . THR B 1  279 ? -43.273 31.147 11.308  1.00 67.85  ? 276 THR B CA    1 
ATOM   4187 C  C     . THR B 1  279 ? -43.308 31.674 12.734  1.00 70.78  ? 276 THR B C     1 
ATOM   4188 O  O     . THR B 1  279 ? -42.276 32.059 13.283  1.00 70.71  ? 276 THR B O     1 
ATOM   4189 C  CB    . THR B 1  279 ? -41.875 30.585 10.991  1.00 67.79  ? 276 THR B CB    1 
ATOM   4190 O  OG1   . THR B 1  279 ? -40.891 31.622 11.134  1.00 66.98  ? 276 THR B OG1   1 
ATOM   4191 C  CG2   . THR B 1  279 ? -41.832 29.995 9.588   1.00 66.96  ? 276 THR B CG2   1 
ATOM   4192 N  N     . PRO B 1  280 ? -44.506 31.710 13.341  1.00 74.07  ? 277 PRO B N     1 
ATOM   4193 C  CA    . PRO B 1  280 ? -44.506 32.111 14.747  1.00 76.59  ? 277 PRO B CA    1 
ATOM   4194 C  C     . PRO B 1  280 ? -44.007 30.928 15.588  1.00 79.22  ? 277 PRO B C     1 
ATOM   4195 O  O     . PRO B 1  280 ? -44.471 29.796 15.399  1.00 79.29  ? 277 PRO B O     1 
ATOM   4196 C  CB    . PRO B 1  280 ? -45.989 32.428 15.031  1.00 76.47  ? 277 PRO B CB    1 
ATOM   4197 C  CG    . PRO B 1  280 ? -46.793 31.924 13.794  1.00 75.58  ? 277 PRO B CG    1 
ATOM   4198 C  CD    . PRO B 1  280 ? -45.823 31.195 12.899  1.00 74.31  ? 277 PRO B CD    1 
ATOM   4199 N  N     . PHE B 1  281 ? -43.035 31.164 16.462  1.00 82.53  ? 278 PHE B N     1 
ATOM   4200 C  CA    . PHE B 1  281 ? -42.617 30.107 17.376  1.00 86.05  ? 278 PHE B CA    1 
ATOM   4201 C  C     . PHE B 1  281 ? -43.368 30.295 18.688  1.00 88.63  ? 278 PHE B C     1 
ATOM   4202 O  O     . PHE B 1  281 ? -42.815 30.786 19.678  1.00 88.79  ? 278 PHE B O     1 
ATOM   4203 C  CB    . PHE B 1  281 ? -41.099 30.075 17.559  1.00 85.95  ? 278 PHE B CB    1 
ATOM   4204 C  CG    . PHE B 1  281 ? -40.369 29.286 16.488  1.00 86.51  ? 278 PHE B CG    1 
ATOM   4205 C  CD1   . PHE B 1  281 ? -39.753 28.070 16.799  1.00 86.84  ? 278 PHE B CD1   1 
ATOM   4206 C  CD2   . PHE B 1  281 ? -40.295 29.757 15.170  1.00 85.96  ? 278 PHE B CD2   1 
ATOM   4207 C  CE1   . PHE B 1  281 ? -39.073 27.339 15.813  1.00 86.66  ? 278 PHE B CE1   1 
ATOM   4208 C  CE2   . PHE B 1  281 ? -39.624 29.038 14.186  1.00 85.46  ? 278 PHE B CE2   1 
ATOM   4209 C  CZ    . PHE B 1  281 ? -39.013 27.827 14.505  1.00 85.98  ? 278 PHE B CZ    1 
ATOM   4210 N  N     . ALA B 1  282 ? -44.653 29.916 18.644  1.00 91.97  ? 279 ALA B N     1 
ATOM   4211 C  CA    . ALA B 1  282 ? -45.622 30.104 19.732  1.00 94.98  ? 279 ALA B CA    1 
ATOM   4212 C  C     . ALA B 1  282 ? -45.380 29.117 20.881  1.00 97.26  ? 279 ALA B C     1 
ATOM   4213 O  O     . ALA B 1  282 ? -45.894 29.309 21.991  1.00 97.59  ? 279 ALA B O     1 
ATOM   4214 C  CB    . ALA B 1  282 ? -47.056 29.993 19.195  1.00 94.55  ? 279 ALA B CB    1 
ATOM   4215 N  N     . ASN B 1  283 ? -44.597 28.070 20.592  1.00 100.09 ? 280 ASN B N     1 
ATOM   4216 C  CA    . ASN B 1  283 ? -44.061 27.144 21.598  1.00 102.75 ? 280 ASN B CA    1 
ATOM   4217 C  C     . ASN B 1  283 ? -42.684 27.596 22.122  1.00 104.35 ? 280 ASN B C     1 
ATOM   4218 O  O     . ASN B 1  283 ? -41.647 27.039 21.719  1.00 104.57 ? 280 ASN B O     1 
ATOM   4219 C  CB    . ASN B 1  283 ? -43.951 25.713 21.028  1.00 102.86 ? 280 ASN B CB    1 
ATOM   4220 C  CG    . ASN B 1  283 ? -45.310 25.035 20.828  1.00 104.09 ? 280 ASN B CG    1 
ATOM   4221 O  OD1   . ASN B 1  283 ? -46.269 25.274 21.574  1.00 105.02 ? 280 ASN B OD1   1 
ATOM   4222 N  ND2   . ASN B 1  283 ? -45.387 24.169 19.820  1.00 104.31 ? 280 ASN B ND2   1 
ATOM   4223 N  N     . GLN B 1  284 ? -42.675 28.609 22.999  1.00 106.29 ? 281 GLN B N     1 
ATOM   4224 C  CA    . GLN B 1  284 ? -41.460 29.008 23.724  1.00 108.04 ? 281 GLN B CA    1 
ATOM   4225 C  C     . GLN B 1  284 ? -40.891 27.761 24.419  1.00 109.39 ? 281 GLN B C     1 
ATOM   4226 O  O     . GLN B 1  284 ? -41.581 27.132 25.232  1.00 109.59 ? 281 GLN B O     1 
ATOM   4227 C  CB    . GLN B 1  284 ? -41.759 30.124 24.737  1.00 107.79 ? 281 GLN B CB    1 
ATOM   4228 N  N     . ASP B 1  285 ? -39.653 27.396 24.069  1.00 110.94 ? 282 ASP B N     1 
ATOM   4229 C  CA    . ASP B 1  285 ? -39.041 26.130 24.511  1.00 112.37 ? 282 ASP B CA    1 
ATOM   4230 C  C     . ASP B 1  285 ? -38.497 26.177 25.948  1.00 113.24 ? 282 ASP B C     1 
ATOM   4231 O  O     . ASP B 1  285 ? -38.410 27.258 26.543  1.00 113.34 ? 282 ASP B O     1 
ATOM   4232 C  CB    . ASP B 1  285 ? -37.935 25.700 23.537  1.00 112.34 ? 282 ASP B CB    1 
ATOM   4233 C  CG    . ASP B 1  285 ? -37.643 24.204 23.602  1.00 112.80 ? 282 ASP B CG    1 
ATOM   4234 O  OD1   . ASP B 1  285 ? -38.503 23.431 24.090  1.00 112.27 ? 282 ASP B OD1   1 
ATOM   4235 O  OD2   . ASP B 1  285 ? -36.546 23.802 23.161  1.00 113.38 ? 282 ASP B OD2   1 
ATOM   4236 N  N     . THR B 1  286 ? -38.146 25.010 26.502  1.00 114.30 ? 283 THR B N     1 
ATOM   4237 C  CA    . THR B 1  286 ? -37.527 24.938 27.838  1.00 115.31 ? 283 THR B CA    1 
ATOM   4238 C  C     . THR B 1  286 ? -36.126 25.553 27.825  1.00 115.82 ? 283 THR B C     1 
ATOM   4239 O  O     . THR B 1  286 ? -35.775 26.328 28.724  1.00 115.80 ? 283 THR B O     1 
ATOM   4240 C  CB    . THR B 1  286 ? -37.452 23.487 28.415  1.00 115.40 ? 283 THR B CB    1 
ATOM   4241 O  OG1   . THR B 1  286 ? -36.631 22.663 27.574  1.00 115.53 ? 283 THR B OG1   1 
ATOM   4242 C  CG2   . THR B 1  286 ? -38.854 22.866 28.575  1.00 115.51 ? 283 THR B CG2   1 
ATOM   4243 N  N     . LEU B 1  287 ? -35.347 25.202 26.798  1.00 116.45 ? 284 LEU B N     1 
ATOM   4244 C  CA    . LEU B 1  287 ? -33.977 25.691 26.609  1.00 117.14 ? 284 LEU B CA    1 
ATOM   4245 C  C     . LEU B 1  287 ? -33.027 25.083 27.637  1.00 117.91 ? 284 LEU B C     1 
ATOM   4246 O  O     . LEU B 1  287 ? -31.811 25.269 27.565  1.00 117.91 ? 284 LEU B O     1 
ATOM   4247 C  CB    . LEU B 1  287 ? -33.926 27.226 26.647  1.00 116.99 ? 284 LEU B CB    1 
ATOM   4248 C  CG    . LEU B 1  287 ? -32.903 27.974 25.792  1.00 116.30 ? 284 LEU B CG    1 
ATOM   4249 C  CD1   . LEU B 1  287 ? -33.117 27.686 24.320  1.00 115.70 ? 284 LEU B CD1   1 
ATOM   4250 C  CD2   . LEU B 1  287 ? -33.009 29.462 26.059  1.00 115.68 ? 284 LEU B CD2   1 
ATOM   4251 N  N     . ASP B 1  288 ? -33.597 24.355 28.591  1.00 119.03 ? 285 ASP B N     1 
ATOM   4252 C  CA    . ASP B 1  288 ? -32.826 23.626 29.584  1.00 120.18 ? 285 ASP B CA    1 
ATOM   4253 C  C     . ASP B 1  288 ? -32.601 22.195 29.114  1.00 121.03 ? 285 ASP B C     1 
ATOM   4254 O  O     . ASP B 1  288 ? -33.228 21.733 28.159  1.00 121.06 ? 285 ASP B O     1 
ATOM   4255 C  CB    . ASP B 1  288 ? -33.535 23.635 30.945  1.00 120.15 ? 285 ASP B CB    1 
ATOM   4256 C  CG    . ASP B 1  288 ? -33.460 24.983 31.635  1.00 120.07 ? 285 ASP B CG    1 
ATOM   4257 O  OD1   . ASP B 1  288 ? -32.395 25.313 32.201  1.00 119.41 ? 285 ASP B OD1   1 
ATOM   4258 O  OD2   . ASP B 1  288 ? -34.475 25.709 31.619  1.00 120.22 ? 285 ASP B OD2   1 
ATOM   4259 N  N     . LEU B 1  289 ? -31.699 21.506 29.803  1.00 122.23 ? 286 LEU B N     1 
ATOM   4260 C  CA    . LEU B 1  289 ? -31.329 20.137 29.478  1.00 123.41 ? 286 LEU B CA    1 
ATOM   4261 C  C     . LEU B 1  289 ? -32.145 19.137 30.320  1.00 124.35 ? 286 LEU B C     1 
ATOM   4262 O  O     . LEU B 1  289 ? -32.263 19.298 31.542  1.00 124.42 ? 286 LEU B O     1 
ATOM   4263 C  CB    . LEU B 1  289 ? -29.821 19.947 29.721  1.00 123.35 ? 286 LEU B CB    1 
ATOM   4264 C  CG    . LEU B 1  289 ? -28.847 21.068 29.314  1.00 123.18 ? 286 LEU B CG    1 
ATOM   4265 C  CD1   . LEU B 1  289 ? -27.640 21.159 30.252  1.00 122.90 ? 286 LEU B CD1   1 
ATOM   4266 C  CD2   . LEU B 1  289 ? -28.401 20.919 27.867  1.00 122.97 ? 286 LEU B CD2   1 
ATOM   4267 N  N     . THR B 1  290 ? -32.716 18.122 29.663  1.00 125.53 ? 287 THR B N     1 
ATOM   4268 C  CA    . THR B 1  290 ? -33.403 17.018 30.357  1.00 126.64 ? 287 THR B CA    1 
ATOM   4269 C  C     . THR B 1  290 ? -32.363 16.107 31.011  1.00 127.50 ? 287 THR B C     1 
ATOM   4270 O  O     . THR B 1  290 ? -31.190 16.138 30.625  1.00 127.47 ? 287 THR B O     1 
ATOM   4271 C  CB    . THR B 1  290 ? -34.309 16.181 29.405  1.00 126.56 ? 287 THR B CB    1 
ATOM   4272 O  OG1   . THR B 1  290 ? -33.535 15.676 28.309  1.00 126.45 ? 287 THR B OG1   1 
ATOM   4273 C  CG2   . THR B 1  290 ? -35.479 17.016 28.871  1.00 126.54 ? 287 THR B CG2   1 
ATOM   4274 N  N     . ARG B 1  291 ? -32.778 15.303 31.995  1.00 128.68 ? 288 ARG B N     1 
ATOM   4275 C  CA    . ARG B 1  291 ? -31.832 14.407 32.685  1.00 129.82 ? 288 ARG B CA    1 
ATOM   4276 C  C     . ARG B 1  291 ? -31.154 13.440 31.697  1.00 130.48 ? 288 ARG B C     1 
ATOM   4277 O  O     . ARG B 1  291 ? -30.036 12.969 31.942  1.00 130.58 ? 288 ARG B O     1 
ATOM   4278 C  CB    . ARG B 1  291 ? -32.475 13.665 33.872  1.00 129.79 ? 288 ARG B CB    1 
ATOM   4279 C  CG    . ARG B 1  291 ? -31.474 13.376 35.009  1.00 130.23 ? 288 ARG B CG    1 
ATOM   4280 C  CD    . ARG B 1  291 ? -32.111 12.760 36.262  1.00 130.52 ? 288 ARG B CD    1 
ATOM   4281 N  NE    . ARG B 1  291 ? -31.214 12.820 37.426  1.00 130.29 ? 288 ARG B NE    1 
ATOM   4282 C  CZ    . ARG B 1  291 ? -30.312 11.890 37.751  1.00 130.16 ? 288 ARG B CZ    1 
ATOM   4283 N  NH1   . ARG B 1  291 ? -30.160 10.799 37.007  1.00 129.87 ? 288 ARG B NH1   1 
ATOM   4284 N  NH2   . ARG B 1  291 ? -29.552 12.053 38.828  1.00 129.90 ? 288 ARG B NH2   1 
ATOM   4285 N  N     . GLU B 1  292 ? -31.836 13.172 30.580  1.00 131.28 ? 289 GLU B N     1 
ATOM   4286 C  CA    . GLU B 1  292 ? -31.248 12.466 29.437  1.00 131.96 ? 289 GLU B CA    1 
ATOM   4287 C  C     . GLU B 1  292 ? -30.060 13.248 28.857  1.00 132.44 ? 289 GLU B C     1 
ATOM   4288 O  O     . GLU B 1  292 ? -28.938 12.735 28.806  1.00 132.48 ? 289 GLU B O     1 
ATOM   4289 C  CB    . GLU B 1  292 ? -32.300 12.217 28.343  1.00 131.92 ? 289 GLU B CB    1 
ATOM   4290 C  CG    . GLU B 1  292 ? -33.187 10.990 28.561  1.00 131.71 ? 289 GLU B CG    1 
ATOM   4291 C  CD    . GLU B 1  292 ? -33.689 10.376 27.253  1.00 131.18 ? 289 GLU B CD    1 
ATOM   4292 O  OE1   . GLU B 1  292 ? -34.061 11.131 26.327  1.00 130.73 ? 289 GLU B OE1   1 
ATOM   4293 O  OE2   . GLU B 1  292 ? -33.714 9.130  27.156  1.00 130.60 ? 289 GLU B OE2   1 
ATOM   4294 N  N     . GLU B 1  293 ? -30.321 14.491 28.444  1.00 132.99 ? 290 GLU B N     1 
ATOM   4295 C  CA    . GLU B 1  293 ? -29.324 15.353 27.795  1.00 133.51 ? 290 GLU B CA    1 
ATOM   4296 C  C     . GLU B 1  293 ? -28.138 15.731 28.697  1.00 133.94 ? 290 GLU B C     1 
ATOM   4297 O  O     . GLU B 1  293 ? -27.048 16.009 28.199  1.00 133.92 ? 290 GLU B O     1 
ATOM   4298 C  CB    . GLU B 1  293 ? -29.996 16.613 27.230  1.00 133.38 ? 290 GLU B CB    1 
ATOM   4299 C  CG    . GLU B 1  293 ? -30.995 16.342 26.103  1.00 133.61 ? 290 GLU B CG    1 
ATOM   4300 C  CD    . GLU B 1  293 ? -32.036 17.449 25.931  1.00 134.05 ? 290 GLU B CD    1 
ATOM   4301 O  OE1   . GLU B 1  293 ? -31.704 18.638 26.137  1.00 134.05 ? 290 GLU B OE1   1 
ATOM   4302 O  OE2   . GLU B 1  293 ? -33.193 17.124 25.579  1.00 134.09 ? 290 GLU B OE2   1 
ATOM   4303 N  N     . GLU B 1  294 ? -28.353 15.736 30.012  1.00 134.56 ? 291 GLU B N     1 
ATOM   4304 C  CA    . GLU B 1  294 ? -27.302 16.083 30.977  1.00 135.14 ? 291 GLU B CA    1 
ATOM   4305 C  C     . GLU B 1  294 ? -26.252 14.982 31.137  1.00 135.72 ? 291 GLU B C     1 
ATOM   4306 O  O     . GLU B 1  294 ? -25.049 15.243 31.044  1.00 135.71 ? 291 GLU B O     1 
ATOM   4307 C  CB    . GLU B 1  294 ? -27.910 16.428 32.340  1.00 134.99 ? 291 GLU B CB    1 
ATOM   4308 C  CG    . GLU B 1  294 ? -28.446 17.845 32.442  1.00 134.61 ? 291 GLU B CG    1 
ATOM   4309 C  CD    . GLU B 1  294 ? -28.848 18.227 33.854  1.00 134.11 ? 291 GLU B CD    1 
ATOM   4310 O  OE1   . GLU B 1  294 ? -28.319 17.626 34.812  1.00 133.74 ? 291 GLU B OE1   1 
ATOM   4311 O  OE2   . GLU B 1  294 ? -29.693 19.135 34.006  1.00 133.69 ? 291 GLU B OE2   1 
ATOM   4312 N  N     . LEU B 1  295 ? -26.722 13.758 31.380  1.00 136.49 ? 292 LEU B N     1 
ATOM   4313 C  CA    . LEU B 1  295 ? -25.849 12.603 31.616  1.00 137.18 ? 292 LEU B CA    1 
ATOM   4314 C  C     . LEU B 1  295 ? -25.215 12.058 30.330  1.00 137.68 ? 292 LEU B C     1 
ATOM   4315 O  O     . LEU B 1  295 ? -24.176 11.389 30.385  1.00 137.78 ? 292 LEU B O     1 
ATOM   4316 C  CB    . LEU B 1  295 ? -26.611 11.493 32.350  1.00 137.03 ? 292 LEU B CB    1 
ATOM   4317 N  N     . SER B 1  296 ? -25.841 12.342 29.186  1.00 138.28 ? 293 SER B N     1 
ATOM   4318 C  CA    . SER B 1  296 ? -25.304 11.938 27.880  1.00 138.86 ? 293 SER B CA    1 
ATOM   4319 C  C     . SER B 1  296 ? -24.507 13.054 27.172  1.00 139.23 ? 293 SER B C     1 
ATOM   4320 O  O     . SER B 1  296 ? -23.951 12.839 26.090  1.00 139.20 ? 293 SER B O     1 
ATOM   4321 C  CB    . SER B 1  296 ? -26.405 11.359 26.976  1.00 138.84 ? 293 SER B CB    1 
ATOM   4322 O  OG    . SER B 1  296 ? -27.468 12.274 26.792  1.00 138.76 ? 293 SER B OG    1 
ATOM   4323 N  N     . LEU B 1  297 ? -24.461 14.236 27.792  1.00 139.75 ? 294 LEU B N     1 
ATOM   4324 C  CA    . LEU B 1  297 ? -23.520 15.295 27.406  1.00 140.27 ? 294 LEU B CA    1 
ATOM   4325 C  C     . LEU B 1  297 ? -22.225 15.172 28.213  1.00 140.66 ? 294 LEU B C     1 
ATOM   4326 O  O     . LEU B 1  297 ? -21.151 15.549 27.735  1.00 140.67 ? 294 LEU B O     1 
ATOM   4327 C  CB    . LEU B 1  297 ? -24.129 16.686 27.601  1.00 140.11 ? 294 LEU B CB    1 
ATOM   4328 N  N     . LEU B 1  298 ? -22.341 14.645 29.436  1.00 141.20 ? 295 LEU B N     1 
ATOM   4329 C  CA    . LEU B 1  298 ? -21.188 14.346 30.295  1.00 141.67 ? 295 LEU B CA    1 
ATOM   4330 C  C     . LEU B 1  298 ? -20.448 13.059 29.866  1.00 142.04 ? 295 LEU B C     1 
ATOM   4331 O  O     . LEU B 1  298 ? -19.299 12.834 30.265  1.00 142.16 ? 295 LEU B O     1 
ATOM   4332 C  CB    . LEU B 1  298 ? -21.614 14.275 31.769  1.00 141.50 ? 295 LEU B CB    1 
ATOM   4333 N  N     . GLN B 1  299 ? -21.111 12.227 29.057  1.00 142.41 ? 296 GLN B N     1 
ATOM   4334 C  CA    . GLN B 1  299 ? -20.482 11.046 28.442  1.00 142.68 ? 296 GLN B CA    1 
ATOM   4335 C  C     . GLN B 1  299 ? -20.201 11.235 26.933  1.00 142.85 ? 296 GLN B C     1 
ATOM   4336 O  O     . GLN B 1  299 ? -19.842 10.273 26.243  1.00 142.96 ? 296 GLN B O     1 
ATOM   4337 C  CB    . GLN B 1  299 ? -21.315 9.778  28.695  1.00 142.55 ? 296 GLN B CB    1 
ATOM   4338 N  N     . GLU B 1  300 ? -20.358 12.470 26.436  1.00 142.91 ? 297 GLU B N     1 
ATOM   4339 C  CA    . GLU B 1  300 ? -20.023 12.828 25.043  1.00 142.87 ? 297 GLU B CA    1 
ATOM   4340 C  C     . GLU B 1  300 ? -18.564 13.287 24.917  1.00 142.88 ? 297 GLU B C     1 
ATOM   4341 O  O     . GLU B 1  300 ? -17.813 12.759 24.092  1.00 142.88 ? 297 GLU B O     1 
ATOM   4342 C  CB    . GLU B 1  300 ? -20.982 13.892 24.487  1.00 142.76 ? 297 GLU B CB    1 
ATOM   4343 N  N     . ILE B 1  301 ? -18.175 14.272 25.729  1.00 142.87 ? 298 ILE B N     1 
ATOM   4344 C  CA    . ILE B 1  301 ? -16.769 14.656 25.873  1.00 142.80 ? 298 ILE B CA    1 
ATOM   4345 C  C     . ILE B 1  301 ? -16.191 13.914 27.078  1.00 142.78 ? 298 ILE B C     1 
ATOM   4346 O  O     . ILE B 1  301 ? -15.933 14.514 28.125  1.00 142.77 ? 298 ILE B O     1 
ATOM   4347 C  CB    . ILE B 1  301 ? -16.595 16.185 26.041  1.00 142.69 ? 298 ILE B CB    1 
ATOM   4348 N  N     . ARG B 1  302 ? -16.018 12.599 26.921  1.00 142.70 ? 299 ARG B N     1 
ATOM   4349 C  CA    . ARG B 1  302 ? -15.532 11.717 27.987  1.00 142.60 ? 299 ARG B CA    1 
ATOM   4350 C  C     . ARG B 1  302 ? -14.849 10.478 27.417  1.00 142.51 ? 299 ARG B C     1 
ATOM   4351 O  O     . ARG B 1  302 ? -14.097 10.562 26.448  1.00 142.42 ? 299 ARG B O     1 
ATOM   4352 C  CB    . ARG B 1  302 ? -16.680 11.290 28.906  1.00 142.55 ? 299 ARG B CB    1 
ATOM   4353 O  "O5'" . DA  C 2  1   ? -53.818 25.278 -6.325  1.00 104.88 ? 1   DA  C "O5'" 1 
ATOM   4354 C  "C5'" . DA  C 2  1   ? -54.781 25.436 -7.378  1.00 104.35 ? 1   DA  C "C5'" 1 
ATOM   4355 C  "C4'" . DA  C 2  1   ? -54.102 25.335 -8.739  1.00 104.26 ? 1   DA  C "C4'" 1 
ATOM   4356 O  "O4'" . DA  C 2  1   ? -54.572 24.164 -9.465  1.00 105.74 ? 1   DA  C "O4'" 1 
ATOM   4357 C  "C3'" . DA  C 2  1   ? -54.331 26.512 -9.691  1.00 102.47 ? 1   DA  C "C3'" 1 
ATOM   4358 O  "O3'" . DA  C 2  1   ? -53.437 27.619 -9.388  1.00 98.43  ? 1   DA  C "O3'" 1 
ATOM   4359 C  "C2'" . DA  C 2  1   ? -54.175 25.890 -11.089 1.00 103.29 ? 1   DA  C "C2'" 1 
ATOM   4360 C  "C1'" . DA  C 2  1   ? -54.566 24.418 -10.866 1.00 105.16 ? 1   DA  C "C1'" 1 
ATOM   4361 N  N9    . DA  C 2  1   ? -55.871 23.986 -11.394 1.00 105.29 ? 1   DA  C N9    1 
ATOM   4362 C  C8    . DA  C 2  1   ? -56.077 22.927 -12.240 1.00 104.94 ? 1   DA  C C8    1 
ATOM   4363 N  N7    . DA  C 2  1   ? -57.338 22.745 -12.557 1.00 104.92 ? 1   DA  C N7    1 
ATOM   4364 C  C5    . DA  C 2  1   ? -58.022 23.741 -11.869 1.00 105.13 ? 1   DA  C C5    1 
ATOM   4365 C  C6    . DA  C 2  1   ? -59.402 24.091 -11.781 1.00 104.85 ? 1   DA  C C6    1 
ATOM   4366 N  N6    . DA  C 2  1   ? -60.384 23.444 -12.423 1.00 103.30 ? 1   DA  C N6    1 
ATOM   4367 N  N1    . DA  C 2  1   ? -59.743 25.147 -10.996 1.00 105.48 ? 1   DA  C N1    1 
ATOM   4368 C  C2    . DA  C 2  1   ? -58.768 25.808 -10.339 1.00 106.02 ? 1   DA  C C2    1 
ATOM   4369 N  N3    . DA  C 2  1   ? -57.447 25.568 -10.346 1.00 105.69 ? 1   DA  C N3    1 
ATOM   4370 C  C4    . DA  C 2  1   ? -57.127 24.516 -11.136 1.00 105.24 ? 1   DA  C C4    1 
ATOM   4371 P  P     . DT  C 2  2   ? -51.815 27.603 -9.397  1.00 95.63  ? 2   DT  C P     1 
ATOM   4372 O  OP1   . DT  C 2  2   ? -51.276 26.314 -9.922  1.00 94.98  ? 2   DT  C OP1   1 
ATOM   4373 O  OP2   . DT  C 2  2   ? -51.353 28.117 -8.079  1.00 94.39  ? 2   DT  C OP2   1 
ATOM   4374 O  "O5'" . DT  C 2  2   ? -51.544 28.761 -10.491 1.00 90.60  ? 2   DT  C "O5'" 1 
ATOM   4375 C  "C5'" . DT  C 2  2   ? -51.624 28.503 -11.905 1.00 81.34  ? 2   DT  C "C5'" 1 
ATOM   4376 C  "C4'" . DT  C 2  2   ? -52.219 29.668 -12.673 1.00 73.95  ? 2   DT  C "C4'" 1 
ATOM   4377 O  "O4'" . DT  C 2  2   ? -53.605 29.850 -12.321 1.00 73.47  ? 2   DT  C "O4'" 1 
ATOM   4378 C  "C3'" . DT  C 2  2   ? -51.545 31.013 -12.454 1.00 69.01  ? 2   DT  C "C3'" 1 
ATOM   4379 O  "O3'" . DT  C 2  2   ? -51.282 31.568 -13.725 1.00 59.20  ? 2   DT  C "O3'" 1 
ATOM   4380 C  "C2'" . DT  C 2  2   ? -52.584 31.837 -11.696 1.00 71.80  ? 2   DT  C "C2'" 1 
ATOM   4381 C  "C1'" . DT  C 2  2   ? -53.883 31.230 -12.189 1.00 75.25  ? 2   DT  C "C1'" 1 
ATOM   4382 N  N1    . DT  C 2  2   ? -55.090 31.422 -11.297 1.00 79.49  ? 2   DT  C N1    1 
ATOM   4383 C  C2    . DT  C 2  2   ? -55.697 32.666 -11.129 1.00 82.72  ? 2   DT  C C2    1 
ATOM   4384 O  O2    . DT  C 2  2   ? -55.317 33.701 -11.648 1.00 84.12  ? 2   DT  C O2    1 
ATOM   4385 N  N3    . DT  C 2  2   ? -56.802 32.678 -10.301 1.00 84.51  ? 2   DT  C N3    1 
ATOM   4386 C  C4    . DT  C 2  2   ? -57.360 31.589 -9.631  1.00 84.80  ? 2   DT  C C4    1 
ATOM   4387 O  O4    . DT  C 2  2   ? -58.352 31.721 -8.909  1.00 84.78  ? 2   DT  C O4    1 
ATOM   4388 C  C5    . DT  C 2  2   ? -56.677 30.313 -9.842  1.00 83.95  ? 2   DT  C C5    1 
ATOM   4389 C  C7    . DT  C 2  2   ? -57.136 29.032 -9.193  1.00 83.28  ? 2   DT  C C7    1 
ATOM   4390 C  C6    . DT  C 2  2   ? -55.602 30.309 -10.652 1.00 81.92  ? 2   DT  C C6    1 
ATOM   4391 P  P     . DT  C 2  3   ? -50.097 32.591 -14.047 1.00 50.09  ? 3   DT  C P     1 
ATOM   4392 O  OP1   . DT  C 2  3   ? -49.522 32.085 -15.314 1.00 50.65  ? 3   DT  C OP1   1 
ATOM   4393 O  OP2   . DT  C 2  3   ? -49.207 32.882 -12.905 1.00 46.70  ? 3   DT  C OP2   1 
ATOM   4394 O  "O5'" . DT  C 2  3   ? -50.941 33.899 -14.298 1.00 47.20  ? 3   DT  C "O5'" 1 
ATOM   4395 C  "C5'" . DT  C 2  3   ? -51.935 33.936 -15.291 1.00 44.29  ? 3   DT  C "C5'" 1 
ATOM   4396 C  "C4'" . DT  C 2  3   ? -52.491 35.341 -15.308 1.00 43.86  ? 3   DT  C "C4'" 1 
ATOM   4397 O  "O4'" . DT  C 2  3   ? -53.197 35.526 -14.056 1.00 45.34  ? 3   DT  C "O4'" 1 
ATOM   4398 C  "C3'" . DT  C 2  3   ? -51.461 36.471 -15.369 1.00 43.11  ? 3   DT  C "C3'" 1 
ATOM   4399 O  "O3'" . DT  C 2  3   ? -51.997 37.610 -16.043 1.00 41.91  ? 3   DT  C "O3'" 1 
ATOM   4400 C  "C2'" . DT  C 2  3   ? -51.246 36.818 -13.900 1.00 43.28  ? 3   DT  C "C2'" 1 
ATOM   4401 C  "C1'" . DT  C 2  3   ? -52.659 36.633 -13.357 1.00 44.00  ? 3   DT  C "C1'" 1 
ATOM   4402 N  N1    . DT  C 2  3   ? -52.650 36.390 -11.892 1.00 43.98  ? 3   DT  C N1    1 
ATOM   4403 C  C2    . DT  C 2  3   ? -53.499 37.112 -11.065 1.00 44.10  ? 3   DT  C C2    1 
ATOM   4404 O  O2    . DT  C 2  3   ? -54.284 37.941 -11.474 1.00 43.44  ? 3   DT  C O2    1 
ATOM   4405 N  N3    . DT  C 2  3   ? -53.388 36.829 -9.721  1.00 44.82  ? 3   DT  C N3    1 
ATOM   4406 C  C4    . DT  C 2  3   ? -52.508 35.900 -9.158  1.00 46.61  ? 3   DT  C C4    1 
ATOM   4407 O  O4    . DT  C 2  3   ? -52.431 35.666 -7.955  1.00 47.73  ? 3   DT  C O4    1 
ATOM   4408 C  C5    . DT  C 2  3   ? -51.650 35.183 -10.069 1.00 45.63  ? 3   DT  C C5    1 
ATOM   4409 C  C7    . DT  C 2  3   ? -50.688 34.176 -9.504  1.00 44.71  ? 3   DT  C C7    1 
ATOM   4410 C  C6    . DT  C 2  3   ? -51.754 35.460 -11.381 1.00 44.78  ? 3   DT  C C6    1 
ATOM   4411 P  P     . DG  C 2  4   ? -51.330 38.211 -17.372 1.00 38.94  ? 4   DG  C P     1 
ATOM   4412 O  OP1   . DG  C 2  4   ? -52.205 39.312 -17.844 1.00 37.22  ? 4   DG  C OP1   1 
ATOM   4413 O  OP2   . DG  C 2  4   ? -50.965 37.093 -18.257 1.00 39.03  ? 4   DG  C OP2   1 
ATOM   4414 O  "O5'" . DG  C 2  4   ? -49.953 38.768 -16.846 1.00 38.48  ? 4   DG  C "O5'" 1 
ATOM   4415 C  "C5'" . DG  C 2  4   ? -49.866 40.105 -16.451 1.00 40.03  ? 4   DG  C "C5'" 1 
ATOM   4416 C  "C4'" . DG  C 2  4   ? -48.535 40.309 -15.750 1.00 40.13  ? 4   DG  C "C4'" 1 
ATOM   4417 O  "O4'" . DG  C 2  4   ? -47.453 40.243 -16.709 1.00 38.57  ? 4   DG  C "O4'" 1 
ATOM   4418 C  "C3'" . DG  C 2  4   ? -48.405 41.636 -15.035 1.00 39.45  ? 4   DG  C "C3'" 1 
ATOM   4419 O  "O3'" . DG  C 2  4   ? -47.876 41.358 -13.751 1.00 39.11  ? 4   DG  C "O3'" 1 
ATOM   4420 C  "C2'" . DG  C 2  4   ? -47.481 42.462 -15.930 1.00 38.39  ? 4   DG  C "C2'" 1 
ATOM   4421 C  "C1'" . DG  C 2  4   ? -46.629 41.376 -16.562 1.00 39.46  ? 4   DG  C "C1'" 1 
ATOM   4422 N  N9    . DG  C 2  4   ? -46.048 41.696 -17.875 1.00 40.13  ? 4   DG  C N9    1 
ATOM   4423 C  C8    . DG  C 2  4   ? -46.688 41.968 -19.060 1.00 39.48  ? 4   DG  C C8    1 
ATOM   4424 N  N7    . DG  C 2  4   ? -45.889 42.197 -20.055 1.00 39.06  ? 4   DG  C N7    1 
ATOM   4425 C  C5    . DG  C 2  4   ? -44.637 42.087 -19.495 1.00 39.15  ? 4   DG  C C5    1 
ATOM   4426 C  C6    . DG  C 2  4   ? -43.372 42.235 -20.089 1.00 39.82  ? 4   DG  C C6    1 
ATOM   4427 O  O6    . DG  C 2  4   ? -43.147 42.496 -21.271 1.00 40.97  ? 4   DG  C O6    1 
ATOM   4428 N  N1    . DG  C 2  4   ? -42.326 42.040 -19.181 1.00 40.81  ? 4   DG  C N1    1 
ATOM   4429 C  C2    . DG  C 2  4   ? -42.503 41.732 -17.839 1.00 40.65  ? 4   DG  C C2    1 
ATOM   4430 N  N2    . DG  C 2  4   ? -41.415 41.554 -17.081 1.00 39.71  ? 4   DG  C N2    1 
ATOM   4431 N  N3    . DG  C 2  4   ? -43.695 41.584 -17.275 1.00 40.32  ? 4   DG  C N3    1 
ATOM   4432 C  C4    . DG  C 2  4   ? -44.711 41.772 -18.161 1.00 39.74  ? 4   DG  C C4    1 
ATOM   4433 P  P     . DT  C 2  5   ? -47.758 42.534 -12.660 1.00 41.02  ? 5   DT  C P     1 
ATOM   4434 O  OP1   . DT  C 2  5   ? -47.538 41.824 -11.381 1.00 40.46  ? 5   DT  C OP1   1 
ATOM   4435 O  OP2   . DT  C 2  5   ? -48.820 43.542 -12.836 1.00 38.17  ? 5   DT  C OP2   1 
ATOM   4436 O  "O5'" . DT  C 2  5   ? -46.414 43.290 -13.107 1.00 41.49  ? 5   DT  C "O5'" 1 
ATOM   4437 C  "C5'" . DT  C 2  5   ? -45.192 42.564 -13.024 1.00 40.49  ? 5   DT  C "C5'" 1 
ATOM   4438 C  "C4'" . DT  C 2  5   ? -44.027 43.500 -13.252 1.00 40.30  ? 5   DT  C "C4'" 1 
ATOM   4439 O  "O4'" . DT  C 2  5   ? -43.698 43.560 -14.660 1.00 38.88  ? 5   DT  C "O4'" 1 
ATOM   4440 C  "C3'" . DT  C 2  5   ? -44.210 44.930 -12.724 1.00 38.77  ? 5   DT  C "C3'" 1 
ATOM   4441 O  "O3'" . DT  C 2  5   ? -43.288 44.994 -11.676 1.00 38.02  ? 5   DT  C "O3'" 1 
ATOM   4442 C  "C2'" . DT  C 2  5   ? -43.792 45.827 -13.883 1.00 39.86  ? 5   DT  C "C2'" 1 
ATOM   4443 C  "C1'" . DT  C 2  5   ? -43.202 44.855 -14.908 1.00 40.17  ? 5   DT  C "C1'" 1 
ATOM   4444 N  N1    . DT  C 2  5   ? -43.556 45.072 -16.325 1.00 41.47  ? 5   DT  C N1    1 
ATOM   4445 C  C2    . DT  C 2  5   ? -42.514 45.108 -17.231 1.00 40.93  ? 5   DT  C C2    1 
ATOM   4446 O  O2    . DT  C 2  5   ? -41.353 45.003 -16.899 1.00 40.65  ? 5   DT  C O2    1 
ATOM   4447 N  N3    . DT  C 2  5   ? -42.887 45.279 -18.535 1.00 40.34  ? 5   DT  C N3    1 
ATOM   4448 C  C4    . DT  C 2  5   ? -44.174 45.416 -19.001 1.00 41.20  ? 5   DT  C C4    1 
ATOM   4449 O  O4    . DT  C 2  5   ? -44.392 45.564 -20.196 1.00 43.03  ? 5   DT  C O4    1 
ATOM   4450 C  C5    . DT  C 2  5   ? -45.230 45.367 -18.008 1.00 41.28  ? 5   DT  C C5    1 
ATOM   4451 C  C7    . DT  C 2  5   ? -46.665 45.506 -18.417 1.00 39.51  ? 5   DT  C C7    1 
ATOM   4452 C  C6    . DT  C 2  5   ? -44.884 45.186 -16.723 1.00 41.44  ? 5   DT  C C6    1 
ATOM   4453 P  P     . DC  C 2  6   ? -43.046 46.214 -10.697 1.00 37.17  ? 6   DC  C P     1 
ATOM   4454 O  OP1   . DC  C 2  6   ? -42.401 45.688 -9.476  1.00 35.22  ? 6   DC  C OP1   1 
ATOM   4455 O  OP2   . DC  C 2  6   ? -44.290 47.012 -10.658 1.00 36.21  ? 6   DC  C OP2   1 
ATOM   4456 O  "O5'" . DC  C 2  6   ? -41.940 47.073 -11.484 1.00 38.40  ? 6   DC  C "O5'" 1 
ATOM   4457 C  "C5'" . DC  C 2  6   ? -40.563 46.742 -11.505 1.00 35.43  ? 6   DC  C "C5'" 1 
ATOM   4458 C  "C4'" . DC  C 2  6   ? -39.900 47.735 -12.434 1.00 36.53  ? 6   DC  C "C4'" 1 
ATOM   4459 O  "O4'" . DC  C 2  6   ? -40.464 47.656 -13.763 1.00 36.62  ? 6   DC  C "O4'" 1 
ATOM   4460 C  "C3'" . DC  C 2  6   ? -40.088 49.193 -12.045 1.00 36.77  ? 6   DC  C "C3'" 1 
ATOM   4461 O  "O3'" . DC  C 2  6   ? -38.887 49.863 -12.414 1.00 36.67  ? 6   DC  C "O3'" 1 
ATOM   4462 C  "C2'" . DC  C 2  6   ? -41.245 49.647 -12.922 1.00 36.48  ? 6   DC  C "C2'" 1 
ATOM   4463 C  "C1'" . DC  C 2  6   ? -40.797 48.967 -14.200 1.00 37.88  ? 6   DC  C "C1'" 1 
ATOM   4464 N  N1    . DC  C 2  6   ? -41.771 48.911 -15.343 1.00 39.44  ? 6   DC  C N1    1 
ATOM   4465 C  C2    . DC  C 2  6   ? -41.281 48.792 -16.650 1.00 41.50  ? 6   DC  C C2    1 
ATOM   4466 O  O2    . DC  C 2  6   ? -40.053 48.759 -16.834 1.00 43.33  ? 6   DC  C O2    1 
ATOM   4467 N  N3    . DC  C 2  6   ? -42.162 48.726 -17.679 1.00 42.04  ? 6   DC  C N3    1 
ATOM   4468 C  C4    . DC  C 2  6   ? -43.478 48.757 -17.446 1.00 42.95  ? 6   DC  C C4    1 
ATOM   4469 N  N4    . DC  C 2  6   ? -44.326 48.692 -18.488 1.00 44.51  ? 6   DC  C N4    1 
ATOM   4470 C  C5    . DC  C 2  6   ? -43.994 48.874 -16.122 1.00 41.67  ? 6   DC  C C5    1 
ATOM   4471 C  C6    . DC  C 2  6   ? -43.114 48.950 -15.120 1.00 40.66  ? 6   DC  C C6    1 
ATOM   4472 P  P     . DA  C 2  7   ? -38.248 50.924 -11.430 1.00 36.76  ? 7   DA  C P     1 
ATOM   4473 O  OP1   . DA  C 2  7   ? -37.737 50.199 -10.246 1.00 37.59  ? 7   DA  C OP1   1 
ATOM   4474 O  OP2   . DA  C 2  7   ? -39.192 52.042 -11.301 1.00 36.33  ? 7   DA  C OP2   1 
ATOM   4475 O  "O5'" . DA  C 2  7   ? -37.032 51.412 -12.310 1.00 36.87  ? 7   DA  C "O5'" 1 
ATOM   4476 C  "C5'" . DA  C 2  7   ? -35.897 50.596 -12.460 1.00 37.39  ? 7   DA  C "C5'" 1 
ATOM   4477 C  "C4'" . DA  C 2  7   ? -35.117 51.079 -13.683 1.00 38.12  ? 7   DA  C "C4'" 1 
ATOM   4478 O  "O4'" . DA  C 2  7   ? -35.941 50.924 -14.853 1.00 38.00  ? 7   DA  C "O4'" 1 
ATOM   4479 C  "C3'" . DA  C 2  7   ? -34.638 52.528 -13.737 1.00 37.62  ? 7   DA  C "C3'" 1 
ATOM   4480 O  "O3'" . DA  C 2  7   ? -33.454 52.526 -14.519 1.00 38.02  ? 7   DA  C "O3'" 1 
ATOM   4481 C  "C2'" . DA  C 2  7   ? -35.794 53.259 -14.414 1.00 36.91  ? 7   DA  C "C2'" 1 
ATOM   4482 C  "C1'" . DA  C 2  7   ? -36.238 52.189 -15.414 1.00 39.16  ? 7   DA  C "C1'" 1 
ATOM   4483 N  N9    . DA  C 2  7   ? -37.660 52.187 -15.754 1.00 38.96  ? 7   DA  C N9    1 
ATOM   4484 C  C8    . DA  C 2  7   ? -38.713 52.247 -14.901 1.00 38.82  ? 7   DA  C C8    1 
ATOM   4485 N  N7    . DA  C 2  7   ? -39.874 52.234 -15.509 1.00 39.15  ? 7   DA  C N7    1 
ATOM   4486 C  C5    . DA  C 2  7   ? -39.562 52.162 -16.846 1.00 38.12  ? 7   DA  C C5    1 
ATOM   4487 C  C6    . DA  C 2  7   ? -40.365 52.100 -18.010 1.00 37.65  ? 7   DA  C C6    1 
ATOM   4488 N  N6    . DA  C 2  7   ? -41.700 52.111 -17.967 1.00 33.48  ? 7   DA  C N6    1 
ATOM   4489 N  N1    . DA  C 2  7   ? -39.735 52.015 -19.209 1.00 37.49  ? 7   DA  C N1    1 
ATOM   4490 C  C2    . DA  C 2  7   ? -38.394 51.986 -19.220 1.00 37.67  ? 7   DA  C C2    1 
ATOM   4491 N  N3    . DA  C 2  7   ? -37.544 52.037 -18.182 1.00 38.37  ? 7   DA  C N3    1 
ATOM   4492 C  C4    . DA  C 2  7   ? -38.199 52.120 -17.014 1.00 38.14  ? 7   DA  C C4    1 
ATOM   4493 P  P     . DT  C 2  8   ? -32.519 53.822 -14.628 1.00 40.17  ? 8   DT  C P     1 
ATOM   4494 O  OP1   . DT  C 2  8   ? -31.156 53.377 -14.892 1.00 38.38  ? 8   DT  C OP1   1 
ATOM   4495 O  OP2   . DT  C 2  8   ? -32.768 54.760 -13.506 1.00 39.97  ? 8   DT  C OP2   1 
ATOM   4496 O  "O5'" . DT  C 2  8   ? -33.157 54.533 -15.905 1.00 40.17  ? 8   DT  C "O5'" 1 
ATOM   4497 C  "C5'" . DT  C 2  8   ? -32.922 54.084 -17.242 1.00 39.08  ? 8   DT  C "C5'" 1 
ATOM   4498 C  "C4'" . DT  C 2  8   ? -33.805 54.837 -18.224 1.00 38.47  ? 8   DT  C "C4'" 1 
ATOM   4499 O  "O4'" . DT  C 2  8   ? -35.182 54.551 -17.951 1.00 37.56  ? 8   DT  C "O4'" 1 
ATOM   4500 C  "C3'" . DT  C 2  8   ? -33.780 56.337 -18.070 1.00 40.72  ? 8   DT  C "C3'" 1 
ATOM   4501 O  "O3'" . DT  C 2  8   ? -32.723 56.900 -18.835 1.00 46.33  ? 8   DT  C "O3'" 1 
ATOM   4502 C  "C2'" . DT  C 2  8   ? -35.132 56.815 -18.561 1.00 38.70  ? 8   DT  C "C2'" 1 
ATOM   4503 C  "C1'" . DT  C 2  8   ? -35.936 55.537 -18.608 1.00 38.44  ? 8   DT  C "C1'" 1 
ATOM   4504 N  N1    . DT  C 2  8   ? -37.303 55.546 -18.007 1.00 38.17  ? 8   DT  C N1    1 
ATOM   4505 C  C2    . DT  C 2  8   ? -38.381 55.434 -18.850 1.00 37.95  ? 8   DT  C C2    1 
ATOM   4506 O  O2    . DT  C 2  8   ? -38.262 55.377 -20.056 1.00 36.07  ? 8   DT  C O2    1 
ATOM   4507 N  N3    . DT  C 2  8   ? -39.610 55.407 -18.238 1.00 39.04  ? 8   DT  C N3    1 
ATOM   4508 C  C4    . DT  C 2  8   ? -39.869 55.465 -16.884 1.00 40.27  ? 8   DT  C C4    1 
ATOM   4509 O  O4    . DT  C 2  8   ? -41.020 55.446 -16.438 1.00 41.37  ? 8   DT  C O4    1 
ATOM   4510 C  C5    . DT  C 2  8   ? -38.687 55.580 -16.052 1.00 40.53  ? 8   DT  C C5    1 
ATOM   4511 C  C7    . DT  C 2  8   ? -38.802 55.684 -14.557 1.00 40.12  ? 8   DT  C C7    1 
ATOM   4512 C  C6    . DT  C 2  8   ? -37.483 55.623 -16.646 1.00 39.45  ? 8   DT  C C6    1 
ATOM   4513 P  P     . DG  C 2  9   ? -32.190 58.405 -18.545 1.00 48.89  ? 9   DG  C P     1 
ATOM   4514 O  OP1   . DG  C 2  9   ? -30.707 58.315 -18.665 1.00 48.03  ? 9   DG  C OP1   1 
ATOM   4515 O  OP2   . DG  C 2  9   ? -32.756 59.006 -17.300 1.00 44.74  ? 9   DG  C OP2   1 
ATOM   4516 O  "O5'" . DG  C 2  9   ? -32.881 59.166 -19.782 1.00 46.06  ? 9   DG  C "O5'" 1 
ATOM   4517 C  "C5'" . DG  C 2  9   ? -33.141 58.629 -21.079 1.00 43.37  ? 9   DG  C "C5'" 1 
ATOM   4518 C  "C4'" . DG  C 2  9   ? -34.006 59.639 -21.824 1.00 43.03  ? 9   DG  C "C4'" 1 
ATOM   4519 O  "O4'" . DG  C 2  9   ? -35.366 59.474 -21.376 1.00 44.38  ? 9   DG  C "O4'" 1 
ATOM   4520 C  "C3'" . DG  C 2  9   ? -33.736 61.128 -21.582 1.00 43.45  ? 9   DG  C "C3'" 1 
ATOM   4521 O  "O3'" . DG  C 2  9   ? -34.279 61.966 -22.610 1.00 45.89  ? 9   DG  C "O3'" 1 
ATOM   4522 C  "C2'" . DG  C 2  9   ? -34.503 61.396 -20.300 1.00 42.74  ? 9   DG  C "C2'" 1 
ATOM   4523 C  "C1'" . DG  C 2  9   ? -35.758 60.574 -20.567 1.00 44.17  ? 9   DG  C "C1'" 1 
ATOM   4524 N  N9    . DG  C 2  9   ? -36.438 60.107 -19.355 1.00 44.22  ? 9   DG  C N9    1 
ATOM   4525 C  C8    . DG  C 2  9   ? -35.933 59.995 -18.084 1.00 43.46  ? 9   DG  C C8    1 
ATOM   4526 N  N7    . DG  C 2  9   ? -36.799 59.573 -17.204 1.00 44.11  ? 9   DG  C N7    1 
ATOM   4527 C  C5    . DG  C 2  9   ? -37.966 59.397 -17.933 1.00 44.92  ? 9   DG  C C5    1 
ATOM   4528 C  C6    . DG  C 2  9   ? -39.263 58.948 -17.536 1.00 45.16  ? 9   DG  C C6    1 
ATOM   4529 O  O6    . DG  C 2  9   ? -39.658 58.613 -16.405 1.00 43.47  ? 9   DG  C O6    1 
ATOM   4530 N  N1    . DG  C 2  9   ? -40.165 58.918 -18.611 1.00 44.24  ? 9   DG  C N1    1 
ATOM   4531 C  C2    . DG  C 2  9   ? -39.849 59.267 -19.897 1.00 44.30  ? 9   DG  C C2    1 
ATOM   4532 N  N2    . DG  C 2  9   ? -40.829 59.175 -20.799 1.00 44.17  ? 9   DG  C N2    1 
ATOM   4533 N  N3    . DG  C 2  9   ? -38.646 59.684 -20.276 1.00 45.25  ? 9   DG  C N3    1 
ATOM   4534 C  C4    . DG  C 2  9   ? -37.756 59.724 -19.257 1.00 44.91  ? 9   DG  C C4    1 
ATOM   4535 P  P     . DG  C 2  10  ? -33.465 62.316 -23.953 1.00 46.41  ? 10  DG  C P     1 
ATOM   4536 O  OP1   . DG  C 2  10  ? -33.086 61.084 -24.659 1.00 44.69  ? 10  DG  C OP1   1 
ATOM   4537 O  OP2   . DG  C 2  10  ? -32.375 63.244 -23.568 1.00 47.74  ? 10  DG  C OP2   1 
ATOM   4538 O  "O5'" . DG  C 2  10  ? -34.593 63.018 -24.840 1.00 43.92  ? 10  DG  C "O5'" 1 
ATOM   4539 C  "C5'" . DG  C 2  10  ? -35.174 64.228 -24.493 1.00 45.77  ? 10  DG  C "C5'" 1 
ATOM   4540 C  "C4'" . DG  C 2  10  ? -36.635 64.140 -24.862 1.00 47.06  ? 10  DG  C "C4'" 1 
ATOM   4541 O  "O4'" . DG  C 2  10  ? -37.255 63.309 -23.847 1.00 48.12  ? 10  DG  C "O4'" 1 
ATOM   4542 C  "C3'" . DG  C 2  10  ? -37.404 65.458 -24.852 1.00 48.33  ? 10  DG  C "C3'" 1 
ATOM   4543 O  "O3'" . DG  C 2  10  ? -38.464 65.448 -25.818 1.00 51.45  ? 10  DG  C "O3'" 1 
ATOM   4544 C  "C2'" . DG  C 2  10  ? -38.014 65.475 -23.458 1.00 47.83  ? 10  DG  C "C2'" 1 
ATOM   4545 C  "C1'" . DG  C 2  10  ? -38.344 64.002 -23.256 1.00 47.40  ? 10  DG  C "C1'" 1 
ATOM   4546 N  N9    . DG  C 2  10  ? -38.413 63.653 -21.843 1.00 46.78  ? 10  DG  C N9    1 
ATOM   4547 C  C8    . DG  C 2  10  ? -37.389 63.782 -20.950 1.00 47.46  ? 10  DG  C C8    1 
ATOM   4548 N  N7    . DG  C 2  10  ? -37.690 63.418 -19.745 1.00 47.07  ? 10  DG  C N7    1 
ATOM   4549 C  C5    . DG  C 2  10  ? -38.998 63.000 -19.841 1.00 47.13  ? 10  DG  C C5    1 
ATOM   4550 C  C6    . DG  C 2  10  ? -39.847 62.479 -18.838 1.00 47.21  ? 10  DG  C C6    1 
ATOM   4551 O  O6    . DG  C 2  10  ? -39.589 62.292 -17.646 1.00 47.68  ? 10  DG  C O6    1 
ATOM   4552 N  N1    . DG  C 2  10  ? -41.108 62.174 -19.331 1.00 47.48  ? 10  DG  C N1    1 
ATOM   4553 C  C2    . DG  C 2  10  ? -41.481 62.347 -20.646 1.00 46.71  ? 10  DG  C C2    1 
ATOM   4554 N  N2    . DG  C 2  10  ? -42.733 62.002 -20.958 1.00 44.43  ? 10  DG  C N2    1 
ATOM   4555 N  N3    . DG  C 2  10  ? -40.682 62.825 -21.593 1.00 47.26  ? 10  DG  C N3    1 
ATOM   4556 C  C4    . DG  C 2  10  ? -39.458 63.134 -21.125 1.00 46.30  ? 10  DG  C C4    1 
ATOM   4557 P  P     . DA  C 2  11  ? -39.260 66.790 -26.208 1.00 53.69  ? 11  DA  C P     1 
ATOM   4558 O  OP1   . DA  C 2  11  ? -38.952 67.005 -27.634 1.00 55.88  ? 11  DA  C OP1   1 
ATOM   4559 O  OP2   . DA  C 2  11  ? -38.997 67.874 -25.232 1.00 53.76  ? 11  DA  C OP2   1 
ATOM   4560 O  "O5'" . DA  C 2  11  ? -40.805 66.443 -26.069 1.00 52.74  ? 11  DA  C "O5'" 1 
ATOM   4561 C  "C5'" . DA  C 2  11  ? -41.225 65.250 -25.502 1.00 53.63  ? 11  DA  C "C5'" 1 
ATOM   4562 C  "C4'" . DA  C 2  11  ? -42.628 65.418 -24.969 1.00 54.51  ? 11  DA  C "C4'" 1 
ATOM   4563 O  "O4'" . DA  C 2  11  ? -42.637 65.118 -23.550 1.00 54.78  ? 11  DA  C "O4'" 1 
ATOM   4564 C  "C3'" . DA  C 2  11  ? -43.257 66.801 -25.099 1.00 55.62  ? 11  DA  C "C3'" 1 
ATOM   4565 O  "O3'" . DA  C 2  11  ? -44.659 66.566 -25.342 1.00 57.75  ? 11  DA  C "O3'" 1 
ATOM   4566 C  "C2'" . DA  C 2  11  ? -42.933 67.459 -23.746 1.00 54.33  ? 11  DA  C "C2'" 1 
ATOM   4567 C  "C1'" . DA  C 2  11  ? -42.985 66.266 -22.788 1.00 52.69  ? 11  DA  C "C1'" 1 
ATOM   4568 N  N9    . DA  C 2  11  ? -42.051 66.270 -21.665 1.00 49.97  ? 11  DA  C N9    1 
ATOM   4569 C  C8    . DA  C 2  11  ? -40.762 66.709 -21.660 1.00 49.49  ? 11  DA  C C8    1 
ATOM   4570 N  N7    . DA  C 2  11  ? -40.156 66.569 -20.507 1.00 47.92  ? 11  DA  C N7    1 
ATOM   4571 C  C5    . DA  C 2  11  ? -41.109 65.980 -19.696 1.00 47.40  ? 11  DA  C C5    1 
ATOM   4572 C  C6    . DA  C 2  11  ? -41.097 65.559 -18.339 1.00 46.68  ? 11  DA  C C6    1 
ATOM   4573 N  N6    . DA  C 2  11  ? -40.031 65.681 -17.534 1.00 44.31  ? 11  DA  C N6    1 
ATOM   4574 N  N1    . DA  C 2  11  ? -42.232 65.012 -17.827 1.00 46.57  ? 11  DA  C N1    1 
ATOM   4575 C  C2    . DA  C 2  11  ? -43.304 64.891 -18.621 1.00 48.47  ? 11  DA  C C2    1 
ATOM   4576 N  N3    . DA  C 2  11  ? -43.420 65.240 -19.915 1.00 50.22  ? 11  DA  C N3    1 
ATOM   4577 C  C4    . DA  C 2  11  ? -42.279 65.779 -20.400 1.00 48.66  ? 11  DA  C C4    1 
ATOM   4578 P  P     . DA  C 2  12  ? -45.804 67.688 -25.244 1.00 59.88  ? 12  DA  C P     1 
ATOM   4579 O  OP1   . DA  C 2  12  ? -46.899 67.276 -26.145 1.00 59.58  ? 12  DA  C OP1   1 
ATOM   4580 O  OP2   . DA  C 2  12  ? -45.183 69.025 -25.344 1.00 59.08  ? 12  DA  C OP2   1 
ATOM   4581 O  "O5'" . DA  C 2  12  ? -46.353 67.540 -23.752 1.00 59.55  ? 12  DA  C "O5'" 1 
ATOM   4582 C  "C5'" . DA  C 2  12  ? -47.029 66.353 -23.362 1.00 58.05  ? 12  DA  C "C5'" 1 
ATOM   4583 C  "C4'" . DA  C 2  12  ? -47.705 66.530 -22.013 1.00 57.09  ? 12  DA  C "C4'" 1 
ATOM   4584 O  "O4'" . DA  C 2  12  ? -46.742 66.625 -20.922 1.00 57.32  ? 12  DA  C "O4'" 1 
ATOM   4585 C  "C3'" . DA  C 2  12  ? -48.571 67.763 -21.899 1.00 56.64  ? 12  DA  C "C3'" 1 
ATOM   4586 O  "O3'" . DA  C 2  12  ? -49.765 67.291 -21.307 1.00 58.39  ? 12  DA  C "O3'" 1 
ATOM   4587 C  "C2'" . DA  C 2  12  ? -47.750 68.741 -21.040 1.00 55.28  ? 12  DA  C "C2'" 1 
ATOM   4588 C  "C1'" . DA  C 2  12  ? -46.883 67.831 -20.182 1.00 54.40  ? 12  DA  C "C1'" 1 
ATOM   4589 N  N9    . DA  C 2  12  ? -45.500 68.231 -19.912 1.00 52.19  ? 12  DA  C N9    1 
ATOM   4590 C  C8    . DA  C 2  12  ? -44.592 68.769 -20.788 1.00 51.62  ? 12  DA  C C8    1 
ATOM   4591 N  N7    . DA  C 2  12  ? -43.399 68.986 -20.268 1.00 50.69  ? 12  DA  C N7    1 
ATOM   4592 C  C5    . DA  C 2  12  ? -43.530 68.556 -18.950 1.00 49.48  ? 12  DA  C C5    1 
ATOM   4593 C  C6    . DA  C 2  12  ? -42.637 68.514 -17.847 1.00 48.35  ? 12  DA  C C6    1 
ATOM   4594 N  N6    . DA  C 2  12  ? -41.365 68.928 -17.885 1.00 46.32  ? 12  DA  C N6    1 
ATOM   4595 N  N1    . DA  C 2  12  ? -43.097 68.019 -16.676 1.00 47.85  ? 12  DA  C N1    1 
ATOM   4596 C  C2    . DA  C 2  12  ? -44.361 67.596 -16.607 1.00 47.40  ? 12  DA  C C2    1 
ATOM   4597 N  N3    . DA  C 2  12  ? -45.282 67.591 -17.566 1.00 48.99  ? 12  DA  C N3    1 
ATOM   4598 C  C4    . DA  C 2  12  ? -44.812 68.081 -18.723 1.00 50.20  ? 12  DA  C C4    1 
ATOM   4599 P  P     . DT  C 2  13  ? -50.885 68.287 -20.745 1.00 61.14  ? 13  DT  C P     1 
ATOM   4600 O  OP1   . DT  C 2  13  ? -52.148 67.524 -20.761 1.00 59.77  ? 13  DT  C OP1   1 
ATOM   4601 O  OP2   . DT  C 2  13  ? -50.777 69.596 -21.441 1.00 60.15  ? 13  DT  C OP2   1 
ATOM   4602 O  "O5'" . DT  C 2  13  ? -50.422 68.565 -19.228 1.00 60.54  ? 13  DT  C "O5'" 1 
ATOM   4603 C  "C5'" . DT  C 2  13  ? -50.510 67.574 -18.212 1.00 58.83  ? 13  DT  C "C5'" 1 
ATOM   4604 C  "C4'" . DT  C 2  13  ? -50.017 68.132 -16.894 1.00 57.82  ? 13  DT  C "C4'" 1 
ATOM   4605 O  "O4'" . DT  C 2  13  ? -48.647 68.580 -17.008 1.00 57.11  ? 13  DT  C "O4'" 1 
ATOM   4606 C  "C3'" . DT  C 2  13  ? -50.799 69.330 -16.392 1.00 58.03  ? 13  DT  C "C3'" 1 
ATOM   4607 O  "O3'" . DT  C 2  13  ? -51.378 68.899 -15.198 1.00 60.14  ? 13  DT  C "O3'" 1 
ATOM   4608 C  "C2'" . DT  C 2  13  ? -49.765 70.440 -16.179 1.00 57.83  ? 13  DT  C "C2'" 1 
ATOM   4609 C  "C1'" . DT  C 2  13  ? -48.458 69.666 -16.123 1.00 56.29  ? 13  DT  C "C1'" 1 
ATOM   4610 N  N1    . DT  C 2  13  ? -47.210 70.314 -16.614 1.00 55.13  ? 13  DT  C N1    1 
ATOM   4611 C  C2    . DT  C 2  13  ? -46.079 70.292 -15.816 1.00 54.98  ? 13  DT  C C2    1 
ATOM   4612 O  O2    . DT  C 2  13  ? -46.035 69.817 -14.696 1.00 54.90  ? 13  DT  C O2    1 
ATOM   4613 N  N3    . DT  C 2  13  ? -44.965 70.871 -16.370 1.00 55.00  ? 13  DT  C N3    1 
ATOM   4614 C  C4    . DT  C 2  13  ? -44.857 71.454 -17.618 1.00 54.48  ? 13  DT  C C4    1 
ATOM   4615 O  O4    . DT  C 2  13  ? -43.790 71.930 -18.001 1.00 54.49  ? 13  DT  C O4    1 
ATOM   4616 C  C5    . DT  C 2  13  ? -46.070 71.443 -18.412 1.00 53.75  ? 13  DT  C C5    1 
ATOM   4617 C  C7    . DT  C 2  13  ? -46.099 72.038 -19.787 1.00 51.40  ? 13  DT  C C7    1 
ATOM   4618 C  C6    . DT  C 2  13  ? -47.166 70.869 -17.882 1.00 54.84  ? 13  DT  C C6    1 
ATOM   4619 P  P     . DT  C 2  14  ? -52.130 69.888 -14.191 1.00 62.54  ? 14  DT  C P     1 
ATOM   4620 O  OP1   . DT  C 2  14  ? -53.112 69.051 -13.459 1.00 59.50  ? 14  DT  C OP1   1 
ATOM   4621 O  OP2   . DT  C 2  14  ? -52.503 71.151 -14.881 1.00 60.19  ? 14  DT  C OP2   1 
ATOM   4622 O  "O5'" . DT  C 2  14  ? -50.935 70.248 -13.186 1.00 61.30  ? 14  DT  C "O5'" 1 
ATOM   4623 C  "C5'" . DT  C 2  14  ? -50.318 69.187 -12.481 1.00 59.72  ? 14  DT  C "C5'" 1 
ATOM   4624 C  "C4'" . DT  C 2  14  ? -49.401 69.759 -11.432 1.00 58.73  ? 14  DT  C "C4'" 1 
ATOM   4625 O  "O4'" . DT  C 2  14  ? -48.233 70.351 -12.055 1.00 59.36  ? 14  DT  C "O4'" 1 
ATOM   4626 C  "C3'" . DT  C 2  14  ? -50.021 70.848 -10.580 1.00 58.06  ? 14  DT  C "C3'" 1 
ATOM   4627 O  "O3'" . DT  C 2  14  ? -49.616 70.476 -9.304  1.00 58.56  ? 14  DT  C "O3'" 1 
ATOM   4628 C  "C2'" . DT  C 2  14  ? -49.386 72.160 -11.077 1.00 57.87  ? 14  DT  C "C2'" 1 
ATOM   4629 C  "C1'" . DT  C 2  14  ? -48.039 71.694 -11.620 1.00 56.88  ? 14  DT  C "C1'" 1 
ATOM   4630 N  N1    . DT  C 2  14  ? -47.407 72.415 -12.792 1.00 53.94  ? 14  DT  C N1    1 
ATOM   4631 C  C2    . DT  C 2  14  ? -46.049 72.657 -12.729 1.00 53.13  ? 14  DT  C C2    1 
ATOM   4632 O  O2    . DT  C 2  14  ? -45.352 72.357 -11.780 1.00 53.70  ? 14  DT  C O2    1 
ATOM   4633 N  N3    . DT  C 2  14  ? -45.504 73.296 -13.810 1.00 52.15  ? 14  DT  C N3    1 
ATOM   4634 C  C4    . DT  C 2  14  ? -46.156 73.698 -14.956 1.00 52.29  ? 14  DT  C C4    1 
ATOM   4635 O  O4    . DT  C 2  14  ? -45.519 74.245 -15.856 1.00 52.96  ? 14  DT  C O4    1 
ATOM   4636 C  C5    . DT  C 2  14  ? -47.588 73.414 -14.987 1.00 51.68  ? 14  DT  C C5    1 
ATOM   4637 C  C7    . DT  C 2  14  ? -48.432 73.801 -16.168 1.00 47.91  ? 14  DT  C C7    1 
ATOM   4638 C  C6    . DT  C 2  14  ? -48.133 72.790 -13.914 1.00 52.93  ? 14  DT  C C6    1 
ATOM   4639 P  P     . DT  C 2  15  ? -49.941 71.338 -8.008  1.00 60.34  ? 15  DT  C P     1 
ATOM   4640 O  OP1   . DT  C 2  15  ? -50.108 70.395 -6.879  1.00 60.01  ? 15  DT  C OP1   1 
ATOM   4641 O  OP2   . DT  C 2  15  ? -50.969 72.351 -8.364  1.00 60.04  ? 15  DT  C OP2   1 
ATOM   4642 O  "O5'" . DT  C 2  15  ? -48.562 72.093 -7.781  1.00 59.78  ? 15  DT  C "O5'" 1 
ATOM   4643 C  "C5'" . DT  C 2  15  ? -47.401 71.285 -7.619  1.00 59.48  ? 15  DT  C "C5'" 1 
ATOM   4644 C  "C4'" . DT  C 2  15  ? -46.211 72.174 -7.348  1.00 58.09  ? 15  DT  C "C4'" 1 
ATOM   4645 O  "O4'" . DT  C 2  15  ? -45.810 72.882 -8.557  1.00 57.99  ? 15  DT  C "O4'" 1 
ATOM   4646 C  "C3'" . DT  C 2  15  ? -46.460 73.245 -6.300  1.00 57.71  ? 15  DT  C "C3'" 1 
ATOM   4647 O  "O3'" . DT  C 2  15  ? -45.293 73.215 -5.530  1.00 57.20  ? 15  DT  C "O3'" 1 
ATOM   4648 C  "C2'" . DT  C 2  15  ? -46.668 74.533 -7.127  1.00 57.17  ? 15  DT  C "C2'" 1 
ATOM   4649 C  "C1'" . DT  C 2  15  ? -45.725 74.283 -8.302  1.00 56.35  ? 15  DT  C "C1'" 1 
ATOM   4650 N  N1    . DT  C 2  15  ? -45.987 74.970 -9.610  1.00 53.38  ? 15  DT  C N1    1 
ATOM   4651 C  C2    . DT  C 2  15  ? -44.910 75.464 -10.318 1.00 52.33  ? 15  DT  C C2    1 
ATOM   4652 O  O2    . DT  C 2  15  ? -43.748 75.406 -9.942  1.00 51.20  ? 15  DT  C O2    1 
ATOM   4653 N  N3    . DT  C 2  15  ? -45.248 76.052 -11.506 1.00 51.75  ? 15  DT  C N3    1 
ATOM   4654 C  C4    . DT  C 2  15  ? -46.508 76.180 -12.052 1.00 52.12  ? 15  DT  C C4    1 
ATOM   4655 O  O4    . DT  C 2  15  ? -46.664 76.714 -13.145 1.00 53.25  ? 15  DT  C O4    1 
ATOM   4656 C  C5    . DT  C 2  15  ? -47.592 75.635 -11.266 1.00 51.26  ? 15  DT  C C5    1 
ATOM   4657 C  C7    . DT  C 2  15  ? -49.019 75.705 -11.736 1.00 50.60  ? 15  DT  C C7    1 
ATOM   4658 C  C6    . DT  C 2  15  ? -47.273 75.059 -10.105 1.00 52.39  ? 15  DT  C C6    1 
ATOM   4659 P  P     . DC  C 2  16  ? -45.058 74.154 -4.271  1.00 60.03  ? 16  DC  C P     1 
ATOM   4660 O  OP1   . DC  C 2  16  ? -44.488 73.279 -3.217  1.00 60.48  ? 16  DC  C OP1   1 
ATOM   4661 O  OP2   . DC  C 2  16  ? -46.258 74.996 -4.004  1.00 58.95  ? 16  DC  C OP2   1 
ATOM   4662 O  "O5'" . DC  C 2  16  ? -43.900 75.110 -4.778  1.00 58.85  ? 16  DC  C "O5'" 1 
ATOM   4663 C  "C5'" . DC  C 2  16  ? -42.680 74.619 -5.273  1.00 59.35  ? 16  DC  C "C5'" 1 
ATOM   4664 C  "C4'" . DC  C 2  16  ? -41.916 75.825 -5.768  1.00 60.11  ? 16  DC  C "C4'" 1 
ATOM   4665 O  "O4'" . DC  C 2  16  ? -42.520 76.352 -6.976  1.00 58.69  ? 16  DC  C "O4'" 1 
ATOM   4666 C  "C3'" . DC  C 2  16  ? -41.907 76.997 -4.796  1.00 61.21  ? 16  DC  C "C3'" 1 
ATOM   4667 O  "O3'" . DC  C 2  16  ? -40.578 77.469 -4.786  1.00 64.68  ? 16  DC  C "O3'" 1 
ATOM   4668 C  "C2'" . DC  C 2  16  ? -42.870 78.022 -5.393  1.00 59.52  ? 16  DC  C "C2'" 1 
ATOM   4669 C  "C1'" . DC  C 2  16  ? -42.632 77.760 -6.874  1.00 58.04  ? 16  DC  C "C1'" 1 
ATOM   4670 N  N1    . DC  C 2  16  ? -43.702 78.152 -7.851  1.00 56.60  ? 16  DC  C N1    1 
ATOM   4671 C  C2    . DC  C 2  16  ? -43.349 78.737 -9.080  1.00 54.64  ? 16  DC  C C2    1 
ATOM   4672 O  O2    . DC  C 2  16  ? -42.159 78.962 -9.369  1.00 53.12  ? 16  DC  C O2    1 
ATOM   4673 N  N3    . DC  C 2  16  ? -44.354 79.047 -9.937  1.00 55.05  ? 16  DC  C N3    1 
ATOM   4674 C  C4    . DC  C 2  16  ? -45.639 78.791 -9.642  1.00 55.48  ? 16  DC  C C4    1 
ATOM   4675 N  N4    . DC  C 2  16  ? -46.582 79.108 -10.544 1.00 54.61  ? 16  DC  C N4    1 
ATOM   4676 C  C5    . DC  C 2  16  ? -46.010 78.190 -8.403  1.00 55.89  ? 16  DC  C C5    1 
ATOM   4677 C  C6    . DC  C 2  16  ? -45.015 77.889 -7.558  1.00 56.97  ? 16  DC  C C6    1 
ATOM   4678 P  P     . DG  C 2  17  ? -39.929 78.112 -3.472  1.00 67.17  ? 17  DG  C P     1 
ATOM   4679 O  OP1   . DG  C 2  17  ? -38.612 77.415 -3.221  1.00 64.38  ? 17  DG  C OP1   1 
ATOM   4680 O  OP2   . DG  C 2  17  ? -40.981 78.290 -2.430  1.00 64.10  ? 17  DG  C OP2   1 
ATOM   4681 O  "O5'" . DG  C 2  17  ? -39.663 79.583 -4.054  1.00 65.48  ? 17  DG  C "O5'" 1 
ATOM   4682 C  "C5'" . DG  C 2  17  ? -38.581 79.797 -4.968  1.00 63.16  ? 17  DG  C "C5'" 1 
ATOM   4683 C  "C4'" . DG  C 2  17  ? -38.718 81.174 -5.581  1.00 60.41  ? 17  DG  C "C4'" 1 
ATOM   4684 O  "O4'" . DG  C 2  17  ? -39.912 81.229 -6.387  1.00 58.95  ? 17  DG  C "O4'" 1 
ATOM   4685 C  "C3'" . DG  C 2  17  ? -38.837 82.304 -4.572  1.00 60.05  ? 17  DG  C "C3'" 1 
ATOM   4686 O  "O3'" . DG  C 2  17  ? -37.764 83.173 -4.886  1.00 60.96  ? 17  DG  C "O3'" 1 
ATOM   4687 C  "C2'" . DG  C 2  17  ? -40.236 82.895 -4.778  1.00 57.97  ? 17  DG  C "C2'" 1 
ATOM   4688 C  "C1'" . DG  C 2  17  ? -40.568 82.451 -6.198  1.00 56.87  ? 17  DG  C "C1'" 1 
ATOM   4689 N  N9    . DG  C 2  17  ? -41.959 82.180 -6.546  1.00 54.41  ? 17  DG  C N9    1 
ATOM   4690 C  C8    . DG  C 2  17  ? -42.900 81.493 -5.826  1.00 54.25  ? 17  DG  C C8    1 
ATOM   4691 N  N7    . DG  C 2  17  ? -44.056 81.412 -6.431  1.00 54.89  ? 17  DG  C N7    1 
ATOM   4692 C  C5    . DG  C 2  17  ? -43.866 82.078 -7.639  1.00 53.62  ? 17  DG  C C5    1 
ATOM   4693 C  C6    . DG  C 2  17  ? -44.756 82.322 -8.722  1.00 53.03  ? 17  DG  C C6    1 
ATOM   4694 O  O6    . DG  C 2  17  ? -45.937 81.986 -8.851  1.00 51.82  ? 17  DG  C O6    1 
ATOM   4695 N  N1    . DG  C 2  17  ? -44.154 83.033 -9.762  1.00 53.49  ? 17  DG  C N1    1 
ATOM   4696 C  C2    . DG  C 2  17  ? -42.848 83.463 -9.750  1.00 54.31  ? 17  DG  C C2    1 
ATOM   4697 N  N2    . DG  C 2  17  ? -42.454 84.135 -10.834 1.00 54.85  ? 17  DG  C N2    1 
ATOM   4698 N  N3    . DG  C 2  17  ? -41.995 83.248 -8.747  1.00 54.45  ? 17  DG  C N3    1 
ATOM   4699 C  C4    . DG  C 2  17  ? -42.572 82.552 -7.723  1.00 54.23  ? 17  DG  C C4    1 
ATOM   4700 P  P     . DC  C 2  18  ? -37.362 84.416 -3.976  1.00 61.05  ? 18  DC  C P     1 
ATOM   4701 O  OP1   . DC  C 2  18  ? -35.931 84.662 -4.267  1.00 58.92  ? 18  DC  C OP1   1 
ATOM   4702 O  OP2   . DC  C 2  18  ? -37.799 84.178 -2.573  1.00 61.21  ? 18  DC  C OP2   1 
ATOM   4703 O  "O5'" . DC  C 2  18  ? -38.320 85.543 -4.600  1.00 59.05  ? 18  DC  C "O5'" 1 
ATOM   4704 C  "C5'" . DC  C 2  18  ? -38.250 85.873 -5.981  1.00 58.25  ? 18  DC  C "C5'" 1 
ATOM   4705 C  "C4'" . DC  C 2  18  ? -39.418 86.739 -6.440  1.00 58.63  ? 18  DC  C "C4'" 1 
ATOM   4706 O  "O4'" . DC  C 2  18  ? -40.623 85.963 -6.621  1.00 58.37  ? 18  DC  C "O4'" 1 
ATOM   4707 C  "C3'" . DC  C 2  18  ? -39.824 87.922 -5.545  1.00 58.77  ? 18  DC  C "C3'" 1 
ATOM   4708 O  "O3'" . DC  C 2  18  ? -39.377 89.126 -6.197  1.00 58.09  ? 18  DC  C "O3'" 1 
ATOM   4709 C  "C2'" . DC  C 2  18  ? -41.352 87.851 -5.420  1.00 57.52  ? 18  DC  C "C2'" 1 
ATOM   4710 C  "C1'" . DC  C 2  18  ? -41.724 86.843 -6.501  1.00 57.91  ? 18  DC  C "C1'" 1 
ATOM   4711 N  N1    . DC  C 2  18  ? -42.913 85.990 -6.213  1.00 57.35  ? 18  DC  C N1    1 
ATOM   4712 C  C2    . DC  C 2  18  ? -43.891 85.890 -7.200  1.00 57.99  ? 18  DC  C C2    1 
ATOM   4713 O  O2    . DC  C 2  18  ? -43.733 86.512 -8.243  1.00 59.70  ? 18  DC  C O2    1 
ATOM   4714 N  N3    . DC  C 2  18  ? -44.991 85.122 -6.992  1.00 59.19  ? 18  DC  C N3    1 
ATOM   4715 C  C4    . DC  C 2  18  ? -45.115 84.461 -5.834  1.00 58.13  ? 18  DC  C C4    1 
ATOM   4716 N  N4    . DC  C 2  18  ? -46.212 83.723 -5.693  1.00 57.03  ? 18  DC  C N4    1 
ATOM   4717 C  C5    . DC  C 2  18  ? -44.128 84.542 -4.793  1.00 57.06  ? 18  DC  C C5    1 
ATOM   4718 C  C6    . DC  C 2  18  ? -43.049 85.308 -5.026  1.00 56.73  ? 18  DC  C C6    1 
ATOM   4719 P  P     . DA  C 2  19  ? -39.565 90.597 -5.615  1.00 56.97  ? 19  DA  C P     1 
ATOM   4720 O  OP1   . DA  C 2  19  ? -38.398 91.354 -6.126  1.00 56.02  ? 19  DA  C OP1   1 
ATOM   4721 O  OP2   . DA  C 2  19  ? -39.830 90.549 -4.146  1.00 56.69  ? 19  DA  C OP2   1 
ATOM   4722 O  "O5'" . DA  C 2  19  ? -40.940 91.079 -6.279  1.00 56.62  ? 19  DA  C "O5'" 1 
ATOM   4723 C  "C5'" . DA  C 2  19  ? -41.162 91.044 -7.657  1.00 58.35  ? 19  DA  C "C5'" 1 
ATOM   4724 C  "C4'" . DA  C 2  19  ? -42.624 91.280 -7.978  1.00 60.01  ? 19  DA  C "C4'" 1 
ATOM   4725 O  "O4'" . DA  C 2  19  ? -43.387 90.105 -7.613  1.00 61.06  ? 19  DA  C "O4'" 1 
ATOM   4726 C  "C3'" . DA  C 2  19  ? -43.287 92.457 -7.257  1.00 61.20  ? 19  DA  C "C3'" 1 
ATOM   4727 O  "O3'" . DA  C 2  19  ? -44.170 93.161 -8.144  1.00 61.71  ? 19  DA  C "O3'" 1 
ATOM   4728 C  "C2'" . DA  C 2  19  ? -44.093 91.780 -6.168  1.00 61.88  ? 19  DA  C "C2'" 1 
ATOM   4729 C  "C1'" . DA  C 2  19  ? -44.549 90.563 -6.960  1.00 62.69  ? 19  DA  C "C1'" 1 
ATOM   4730 N  N9    . DA  C 2  19  ? -45.101 89.500 -6.134  1.00 64.65  ? 19  DA  C N9    1 
ATOM   4731 C  C8    . DA  C 2  19  ? -44.601 88.965 -4.963  1.00 65.42  ? 19  DA  C C8    1 
ATOM   4732 N  N7    . DA  C 2  19  ? -45.344 88.012 -4.452  1.00 65.37  ? 19  DA  C N7    1 
ATOM   4733 C  C5    . DA  C 2  19  ? -46.403 87.930 -5.359  1.00 66.34  ? 19  DA  C C5    1 
ATOM   4734 C  C6    . DA  C 2  19  ? -47.558 87.115 -5.416  1.00 67.56  ? 19  DA  C C6    1 
ATOM   4735 N  N6    . DA  C 2  19  ? -47.823 86.194 -4.477  1.00 68.33  ? 19  DA  C N6    1 
ATOM   4736 N  N1    . DA  C 2  19  ? -48.428 87.283 -6.455  1.00 67.64  ? 19  DA  C N1    1 
ATOM   4737 C  C2    . DA  C 2  19  ? -48.161 88.218 -7.390  1.00 68.21  ? 19  DA  C C2    1 
ATOM   4738 N  N3    . DA  C 2  19  ? -47.108 89.050 -7.441  1.00 67.78  ? 19  DA  C N3    1 
ATOM   4739 C  C4    . DA  C 2  19  ? -46.271 88.846 -6.393  1.00 65.96  ? 19  DA  C C4    1 
ATOM   4740 O  "O5'" . DT  D 3  1   ? -55.009 90.662 -7.979  1.00 101.70 ? 1   DT  D "O5'" 1 
ATOM   4741 C  "C5'" . DT  D 3  1   ? -54.753 89.252 -7.965  1.00 101.60 ? 1   DT  D "C5'" 1 
ATOM   4742 C  "C4'" . DT  D 3  1   ? -54.606 88.620 -9.357  1.00 100.73 ? 1   DT  D "C4'" 1 
ATOM   4743 O  "O4'" . DT  D 3  1   ? -53.308 87.977 -9.453  1.00 100.62 ? 1   DT  D "O4'" 1 
ATOM   4744 C  "C3'" . DT  D 3  1   ? -55.583 87.486 -9.707  1.00 99.47  ? 1   DT  D "C3'" 1 
ATOM   4745 O  "O3'" . DT  D 3  1   ? -55.852 87.362 -11.147 1.00 96.55  ? 1   DT  D "O3'" 1 
ATOM   4746 C  "C2'" . DT  D 3  1   ? -54.936 86.260 -9.057  1.00 99.80  ? 1   DT  D "C2'" 1 
ATOM   4747 C  "C1'" . DT  D 3  1   ? -53.440 86.589 -9.172  1.00 100.57 ? 1   DT  D "C1'" 1 
ATOM   4748 N  N1    . DT  D 3  1   ? -52.588 86.203 -7.983  1.00 101.20 ? 1   DT  D N1    1 
ATOM   4749 C  C2    . DT  D 3  1   ? -51.517 86.994 -7.572  1.00 100.95 ? 1   DT  D C2    1 
ATOM   4750 O  O2    . DT  D 3  1   ? -51.182 88.054 -8.085  1.00 100.26 ? 1   DT  D O2    1 
ATOM   4751 N  N3    . DT  D 3  1   ? -50.837 86.481 -6.492  1.00 100.84 ? 1   DT  D N3    1 
ATOM   4752 C  C4    . DT  D 3  1   ? -51.092 85.301 -5.806  1.00 101.21 ? 1   DT  D C4    1 
ATOM   4753 O  O4    . DT  D 3  1   ? -50.405 84.949 -4.851  1.00 100.77 ? 1   DT  D O4    1 
ATOM   4754 C  C5    . DT  D 3  1   ? -52.215 84.520 -6.289  1.00 101.72 ? 1   DT  D C5    1 
ATOM   4755 C  C7    . DT  D 3  1   ? -52.605 83.218 -5.636  1.00 101.99 ? 1   DT  D C7    1 
ATOM   4756 C  C6    . DT  D 3  1   ? -52.890 85.005 -7.341  1.00 101.65 ? 1   DT  D C6    1 
ATOM   4757 P  P     . DG  D 3  2   ? -54.994 86.576 -12.275 1.00 94.13  ? 2   DG  D P     1 
ATOM   4758 O  OP1   . DG  D 3  2   ? -55.689 86.776 -13.574 1.00 94.00  ? 2   DG  D OP1   1 
ATOM   4759 O  OP2   . DG  D 3  2   ? -54.693 85.190 -11.828 1.00 94.06  ? 2   DG  D OP2   1 
ATOM   4760 O  "O5'" . DG  D 3  2   ? -53.624 87.404 -12.307 1.00 88.94  ? 2   DG  D "O5'" 1 
ATOM   4761 C  "C5'" . DG  D 3  2   ? -53.213 88.106 -13.472 1.00 80.84  ? 2   DG  D "C5'" 1 
ATOM   4762 C  "C4'" . DG  D 3  2   ? -51.756 87.794 -13.758 1.00 74.79  ? 2   DG  D "C4'" 1 
ATOM   4763 O  "O4'" . DG  D 3  2   ? -51.027 87.441 -12.549 1.00 72.98  ? 2   DG  D "O4'" 1 
ATOM   4764 C  "C3'" . DG  D 3  2   ? -51.526 86.629 -14.699 1.00 71.82  ? 2   DG  D "C3'" 1 
ATOM   4765 O  "O3'" . DG  D 3  2   ? -50.467 87.012 -15.539 1.00 69.13  ? 2   DG  D "O3'" 1 
ATOM   4766 C  "C2'" . DG  D 3  2   ? -51.098 85.490 -13.779 1.00 69.81  ? 2   DG  D "C2'" 1 
ATOM   4767 C  "C1'" . DG  D 3  2   ? -50.270 86.269 -12.770 1.00 68.88  ? 2   DG  D "C1'" 1 
ATOM   4768 N  N9    . DG  D 3  2   ? -50.035 85.557 -11.513 1.00 65.96  ? 2   DG  D N9    1 
ATOM   4769 C  C8    . DG  D 3  2   ? -50.906 84.693 -10.874 1.00 64.97  ? 2   DG  D C8    1 
ATOM   4770 N  N7    . DG  D 3  2   ? -50.419 84.188 -9.768  1.00 64.09  ? 2   DG  D N7    1 
ATOM   4771 C  C5    . DG  D 3  2   ? -49.150 84.749 -9.666  1.00 62.26  ? 2   DG  D C5    1 
ATOM   4772 C  C6    . DG  D 3  2   ? -48.158 84.568 -8.676  1.00 61.40  ? 2   DG  D C6    1 
ATOM   4773 O  O6    . DG  D 3  2   ? -48.186 83.873 -7.663  1.00 61.58  ? 2   DG  D O6    1 
ATOM   4774 N  N1    . DG  D 3  2   ? -47.017 85.306 -8.922  1.00 61.48  ? 2   DG  D N1    1 
ATOM   4775 C  C2    . DG  D 3  2   ? -46.856 86.122 -10.011 1.00 61.47  ? 2   DG  D C2    1 
ATOM   4776 N  N2    . DG  D 3  2   ? -45.671 86.733 -10.050 1.00 60.66  ? 2   DG  D N2    1 
ATOM   4777 N  N3    . DG  D 3  2   ? -47.771 86.309 -10.967 1.00 61.29  ? 2   DG  D N3    1 
ATOM   4778 C  C4    . DG  D 3  2   ? -48.896 85.592 -10.729 1.00 62.92  ? 2   DG  D C4    1 
ATOM   4779 P  P     . DC  D 3  3   ? -50.400 86.497 -17.042 1.00 65.88  ? 3   DC  D P     1 
ATOM   4780 O  OP1   . DC  D 3  3   ? -50.941 87.558 -17.907 1.00 66.20  ? 3   DC  D OP1   1 
ATOM   4781 O  OP2   . DC  D 3  3   ? -51.006 85.148 -17.120 1.00 67.59  ? 3   DC  D OP2   1 
ATOM   4782 O  "O5'" . DC  D 3  3   ? -48.826 86.324 -17.193 1.00 63.47  ? 3   DC  D "O5'" 1 
ATOM   4783 C  "C5'" . DC  D 3  3   ? -48.000 87.438 -17.012 1.00 62.08  ? 3   DC  D "C5'" 1 
ATOM   4784 C  "C4'" . DC  D 3  3   ? -46.653 87.024 -16.458 1.00 60.41  ? 3   DC  D "C4'" 1 
ATOM   4785 O  "O4'" . DC  D 3  3   ? -46.803 86.522 -15.109 1.00 59.70  ? 3   DC  D "O4'" 1 
ATOM   4786 C  "C3'" . DC  D 3  3   ? -45.939 85.952 -17.254 1.00 58.57  ? 3   DC  D "C3'" 1 
ATOM   4787 O  "O3'" . DC  D 3  3   ? -44.882 86.550 -17.996 1.00 56.30  ? 3   DC  D "O3'" 1 
ATOM   4788 C  "C2'" . DC  D 3  3   ? -45.395 84.997 -16.183 1.00 60.88  ? 3   DC  D "C2'" 1 
ATOM   4789 C  "C1'" . DC  D 3  3   ? -45.748 85.627 -14.839 1.00 59.67  ? 3   DC  D "C1'" 1 
ATOM   4790 N  N1    . DC  D 3  3   ? -46.226 84.640 -13.799 1.00 59.08  ? 3   DC  D N1    1 
ATOM   4791 C  C2    . DC  D 3  3   ? -45.451 84.396 -12.647 1.00 59.31  ? 3   DC  D C2    1 
ATOM   4792 O  O2    . DC  D 3  3   ? -44.370 84.973 -12.470 1.00 58.91  ? 3   DC  D O2    1 
ATOM   4793 N  N3    . DC  D 3  3   ? -45.925 83.509 -11.729 1.00 58.92  ? 3   DC  D N3    1 
ATOM   4794 C  C4    . DC  D 3  3   ? -47.104 82.904 -11.914 1.00 57.74  ? 3   DC  D C4    1 
ATOM   4795 N  N4    . DC  D 3  3   ? -47.503 82.063 -10.961 1.00 57.80  ? 3   DC  D N4    1 
ATOM   4796 C  C5    . DC  D 3  3   ? -47.912 83.137 -13.064 1.00 56.46  ? 3   DC  D C5    1 
ATOM   4797 C  C6    . DC  D 3  3   ? -47.436 84.001 -13.966 1.00 57.70  ? 3   DC  D C6    1 
ATOM   4798 P  P     . DG  D 3  4   ? -44.088 85.716 -19.118 1.00 54.22  ? 4   DG  D P     1 
ATOM   4799 O  OP1   . DG  D 3  4   ? -43.369 86.684 -19.977 1.00 54.79  ? 4   DG  D OP1   1 
ATOM   4800 O  OP2   . DG  D 3  4   ? -45.062 84.775 -19.731 1.00 55.02  ? 4   DG  D OP2   1 
ATOM   4801 O  "O5'" . DG  D 3  4   ? -42.998 84.899 -18.294 1.00 52.28  ? 4   DG  D "O5'" 1 
ATOM   4802 C  "C5'" . DG  D 3  4   ? -41.862 85.630 -17.933 1.00 52.92  ? 4   DG  D "C5'" 1 
ATOM   4803 C  "C4'" . DG  D 3  4   ? -40.807 84.738 -17.348 1.00 52.77  ? 4   DG  D "C4'" 1 
ATOM   4804 O  "O4'" . DG  D 3  4   ? -41.410 84.054 -16.233 1.00 54.78  ? 4   DG  D "O4'" 1 
ATOM   4805 C  "C3'" . DG  D 3  4   ? -40.275 83.651 -18.265 1.00 52.87  ? 4   DG  D "C3'" 1 
ATOM   4806 O  "O3'" . DG  D 3  4   ? -38.906 83.585 -17.987 1.00 54.02  ? 4   DG  D "O3'" 1 
ATOM   4807 C  "C2'" . DG  D 3  4   ? -41.032 82.381 -17.867 1.00 52.40  ? 4   DG  D "C2'" 1 
ATOM   4808 C  "C1'" . DG  D 3  4   ? -41.329 82.638 -16.394 1.00 52.72  ? 4   DG  D "C1'" 1 
ATOM   4809 N  N9    . DG  D 3  4   ? -42.590 82.098 -15.872 1.00 50.55  ? 4   DG  D N9    1 
ATOM   4810 C  C8    . DG  D 3  4   ? -43.811 82.004 -16.492 1.00 49.11  ? 4   DG  D C8    1 
ATOM   4811 N  N7    . DG  D 3  4   ? -44.747 81.484 -15.746 1.00 48.16  ? 4   DG  D N7    1 
ATOM   4812 C  C5    . DG  D 3  4   ? -44.101 81.226 -14.539 1.00 48.51  ? 4   DG  D C5    1 
ATOM   4813 C  C6    . DG  D 3  4   ? -44.596 80.666 -13.331 1.00 47.86  ? 4   DG  D C6    1 
ATOM   4814 O  O6    . DG  D 3  4   ? -45.752 80.277 -13.118 1.00 49.65  ? 4   DG  D O6    1 
ATOM   4815 N  N1    . DG  D 3  4   ? -43.619 80.574 -12.335 1.00 46.33  ? 4   DG  D N1    1 
ATOM   4816 C  C2    . DG  D 3  4   ? -42.304 80.984 -12.502 1.00 48.09  ? 4   DG  D C2    1 
ATOM   4817 N  N2    . DG  D 3  4   ? -41.463 80.832 -11.463 1.00 47.90  ? 4   DG  D N2    1 
ATOM   4818 N  N3    . DG  D 3  4   ? -41.823 81.508 -13.628 1.00 48.60  ? 4   DG  D N3    1 
ATOM   4819 C  C4    . DG  D 3  4   ? -42.777 81.608 -14.598 1.00 49.49  ? 4   DG  D C4    1 
ATOM   4820 P  P     . DA  D 3  5   ? -37.966 82.424 -18.555 1.00 56.42  ? 5   DA  D P     1 
ATOM   4821 O  OP1   . DA  D 3  5   ? -36.591 82.947 -18.772 1.00 55.12  ? 5   DA  D OP1   1 
ATOM   4822 O  OP2   . DA  D 3  5   ? -38.747 81.696 -19.577 1.00 57.35  ? 5   DA  D OP2   1 
ATOM   4823 O  "O5'" . DA  D 3  5   ? -37.889 81.423 -17.342 1.00 57.76  ? 5   DA  D "O5'" 1 
ATOM   4824 C  "C5'" . DA  D 3  5   ? -37.094 81.734 -16.234 1.00 59.55  ? 5   DA  D "C5'" 1 
ATOM   4825 C  "C4'" . DA  D 3  5   ? -37.256 80.547 -15.324 1.00 60.22  ? 5   DA  D "C4'" 1 
ATOM   4826 O  "O4'" . DA  D 3  5   ? -38.667 80.283 -15.098 1.00 59.00  ? 5   DA  D "O4'" 1 
ATOM   4827 C  "C3'" . DA  D 3  5   ? -36.661 79.280 -15.918 1.00 61.16  ? 5   DA  D "C3'" 1 
ATOM   4828 O  "O3'" . DA  D 3  5   ? -35.820 78.854 -14.873 1.00 65.79  ? 5   DA  D "O3'" 1 
ATOM   4829 C  "C2'" . DA  D 3  5   ? -37.868 78.375 -16.194 1.00 58.13  ? 5   DA  D "C2'" 1 
ATOM   4830 C  "C1'" . DA  D 3  5   ? -38.852 78.882 -15.140 1.00 55.56  ? 5   DA  D "C1'" 1 
ATOM   4831 N  N9    . DA  D 3  5   ? -40.274 78.660 -15.364 1.00 50.90  ? 5   DA  D N9    1 
ATOM   4832 C  C8    . DA  D 3  5   ? -40.990 78.847 -16.512 1.00 49.76  ? 5   DA  D C8    1 
ATOM   4833 N  N7    . DA  D 3  5   ? -42.271 78.573 -16.403 1.00 47.45  ? 5   DA  D N7    1 
ATOM   4834 C  C5    . DA  D 3  5   ? -42.403 78.186 -15.081 1.00 47.01  ? 5   DA  D C5    1 
ATOM   4835 C  C6    . DA  D 3  5   ? -43.512 77.754 -14.325 1.00 45.99  ? 5   DA  D C6    1 
ATOM   4836 N  N6    . DA  D 3  5   ? -44.758 77.647 -14.809 1.00 44.16  ? 5   DA  D N6    1 
ATOM   4837 N  N1    . DA  D 3  5   ? -43.289 77.438 -13.033 1.00 45.74  ? 5   DA  D N1    1 
ATOM   4838 C  C2    . DA  D 3  5   ? -42.052 77.535 -12.526 1.00 46.30  ? 5   DA  D C2    1 
ATOM   4839 N  N3    . DA  D 3  5   ? -40.931 77.915 -13.133 1.00 48.39  ? 5   DA  D N3    1 
ATOM   4840 C  C4    . DA  D 3  5   ? -41.183 78.238 -14.422 1.00 48.76  ? 5   DA  D C4    1 
ATOM   4841 P  P     . DA  D 3  6   ? -34.790 77.627 -14.967 1.00 69.56  ? 6   DA  D P     1 
ATOM   4842 O  OP1   . DA  D 3  6   ? -33.458 78.223 -14.689 1.00 69.08  ? 6   DA  D OP1   1 
ATOM   4843 O  OP2   . DA  D 3  6   ? -35.069 76.704 -16.117 1.00 66.24  ? 6   DA  D OP2   1 
ATOM   4844 O  "O5'" . DA  D 3  6   ? -35.217 76.837 -13.640 1.00 67.16  ? 6   DA  D "O5'" 1 
ATOM   4845 C  "C5'" . DA  D 3  6   ? -35.493 77.466 -12.385 1.00 61.15  ? 6   DA  D "C5'" 1 
ATOM   4846 C  "C4'" . DA  D 3  6   ? -36.252 76.460 -11.541 1.00 56.29  ? 6   DA  D "C4'" 1 
ATOM   4847 O  "O4'" . DA  D 3  6   ? -37.605 76.323 -12.038 1.00 55.23  ? 6   DA  D "O4'" 1 
ATOM   4848 C  "C3'" . DA  D 3  6   ? -35.668 75.048 -11.527 1.00 54.75  ? 6   DA  D "C3'" 1 
ATOM   4849 O  "O3'" . DA  D 3  6   ? -35.674 74.638 -10.156 1.00 53.40  ? 6   DA  D "O3'" 1 
ATOM   4850 C  "C2'" . DA  D 3  6   ? -36.600 74.247 -12.441 1.00 54.33  ? 6   DA  D "C2'" 1 
ATOM   4851 C  "C1'" . DA  D 3  6   ? -37.937 74.951 -12.190 1.00 54.51  ? 6   DA  D "C1'" 1 
ATOM   4852 N  N9    . DA  D 3  6   ? -38.922 74.927 -13.271 1.00 52.62  ? 6   DA  D N9    1 
ATOM   4853 C  C8    . DA  D 3  6   ? -38.665 75.217 -14.576 1.00 51.96  ? 6   DA  D C8    1 
ATOM   4854 N  N7    . DA  D 3  6   ? -39.714 75.162 -15.351 1.00 51.86  ? 6   DA  D N7    1 
ATOM   4855 C  C5    . DA  D 3  6   ? -40.745 74.814 -14.500 1.00 51.16  ? 6   DA  D C5    1 
ATOM   4856 C  C6    . DA  D 3  6   ? -42.128 74.597 -14.728 1.00 50.72  ? 6   DA  D C6    1 
ATOM   4857 N  N6    . DA  D 3  6   ? -42.689 74.712 -15.941 1.00 48.39  ? 6   DA  D N6    1 
ATOM   4858 N  N1    . DA  D 3  6   ? -42.902 74.256 -13.663 1.00 50.30  ? 6   DA  D N1    1 
ATOM   4859 C  C2    . DA  D 3  6   ? -42.312 74.139 -12.461 1.00 50.82  ? 6   DA  D C2    1 
ATOM   4860 N  N3    . DA  D 3  6   ? -41.023 74.332 -12.133 1.00 51.73  ? 6   DA  D N3    1 
ATOM   4861 C  C4    . DA  D 3  6   ? -40.278 74.672 -13.205 1.00 51.59  ? 6   DA  D C4    1 
ATOM   4862 P  P     . DA  D 3  7   ? -35.190 73.203 -9.644  1.00 49.52  ? 7   DA  D P     1 
ATOM   4863 O  OP1   . DA  D 3  7   ? -34.674 73.274 -8.263  1.00 49.37  ? 7   DA  D OP1   1 
ATOM   4864 O  OP2   . DA  D 3  7   ? -34.343 72.627 -10.712 1.00 48.49  ? 7   DA  D OP2   1 
ATOM   4865 O  "O5'" . DA  D 3  7   ? -36.612 72.523 -9.547  1.00 47.34  ? 7   DA  D "O5'" 1 
ATOM   4866 C  "C5'" . DA  D 3  7   ? -37.520 72.966 -8.601  1.00 46.29  ? 7   DA  D "C5'" 1 
ATOM   4867 C  "C4'" . DA  D 3  7   ? -38.667 71.968 -8.563  1.00 48.43  ? 7   DA  D "C4'" 1 
ATOM   4868 O  "O4'" . DA  D 3  7   ? -39.493 72.066 -9.759  1.00 49.43  ? 7   DA  D "O4'" 1 
ATOM   4869 C  "C3'" . DA  D 3  7   ? -38.257 70.504 -8.430  1.00 47.26  ? 7   DA  D "C3'" 1 
ATOM   4870 O  "O3'" . DA  D 3  7   ? -38.966 70.016 -7.289  1.00 48.28  ? 7   DA  D "O3'" 1 
ATOM   4871 C  "C2'" . DA  D 3  7   ? -38.663 69.873 -9.764  1.00 46.67  ? 7   DA  D "C2'" 1 
ATOM   4872 C  "C1'" . DA  D 3  7   ? -39.780 70.776 -10.287 1.00 48.28  ? 7   DA  D "C1'" 1 
ATOM   4873 N  N9    . DA  D 3  7   ? -39.912 70.948 -11.751 1.00 47.60  ? 7   DA  D N9    1 
ATOM   4874 C  C8    . DA  D 3  7   ? -38.898 71.220 -12.640 1.00 47.10  ? 7   DA  D C8    1 
ATOM   4875 N  N7    . DA  D 3  7   ? -39.297 71.347 -13.888 1.00 46.60  ? 7   DA  D N7    1 
ATOM   4876 C  C5    . DA  D 3  7   ? -40.677 71.179 -13.822 1.00 45.97  ? 7   DA  D C5    1 
ATOM   4877 C  C6    . DA  D 3  7   ? -41.694 71.202 -14.817 1.00 45.89  ? 7   DA  D C6    1 
ATOM   4878 N  N6    . DA  D 3  7   ? -41.445 71.427 -16.120 1.00 45.27  ? 7   DA  D N6    1 
ATOM   4879 N  N1    . DA  D 3  7   ? -42.973 70.976 -14.441 1.00 43.38  ? 7   DA  D N1    1 
ATOM   4880 C  C2    . DA  D 3  7   ? -43.205 70.758 -13.143 1.00 46.49  ? 7   DA  D C2    1 
ATOM   4881 N  N3    . DA  D 3  7   ? -42.340 70.721 -12.114 1.00 47.62  ? 7   DA  D N3    1 
ATOM   4882 C  C4    . DA  D 3  7   ? -41.070 70.930 -12.519 1.00 46.62  ? 7   DA  D C4    1 
ATOM   4883 P  P     . DT  D 3  8   ? -39.046 68.467 -6.900  1.00 49.00  ? 8   DT  D P     1 
ATOM   4884 O  OP1   . DT  D 3  8   ? -39.416 68.369 -5.481  1.00 47.58  ? 8   DT  D OP1   1 
ATOM   4885 O  OP2   . DT  D 3  8   ? -37.808 67.799 -7.405  1.00 46.70  ? 8   DT  D OP2   1 
ATOM   4886 O  "O5'" . DT  D 3  8   ? -40.302 68.010 -7.773  1.00 46.40  ? 8   DT  D "O5'" 1 
ATOM   4887 C  "C5'" . DT  D 3  8   ? -41.613 68.391 -7.424  1.00 45.62  ? 8   DT  D "C5'" 1 
ATOM   4888 C  "C4'" . DT  D 3  8   ? -42.557 67.771 -8.443  1.00 46.70  ? 8   DT  D "C4'" 1 
ATOM   4889 O  "O4'" . DT  D 3  8   ? -42.176 68.105 -9.804  1.00 47.78  ? 8   DT  D "O4'" 1 
ATOM   4890 C  "C3'" . DT  D 3  8   ? -42.570 66.254 -8.431  1.00 47.39  ? 8   DT  D "C3'" 1 
ATOM   4891 O  "O3'" . DT  D 3  8   ? -43.879 65.944 -8.050  1.00 49.77  ? 8   DT  D "O3'" 1 
ATOM   4892 C  "C2'" . DT  D 3  8   ? -42.215 65.799 -9.857  1.00 46.60  ? 8   DT  D "C2'" 1 
ATOM   4893 C  "C1'" . DT  D 3  8   ? -42.511 67.044 -10.678 1.00 46.22  ? 8   DT  D "C1'" 1 
ATOM   4894 N  N1    . DT  D 3  8   ? -41.772 67.298 -11.982 1.00 44.99  ? 8   DT  D N1    1 
ATOM   4895 C  C2    . DT  D 3  8   ? -42.487 67.447 -13.140 1.00 44.57  ? 8   DT  D C2    1 
ATOM   4896 O  O2    . DT  D 3  8   ? -43.692 67.345 -13.191 1.00 48.16  ? 8   DT  D O2    1 
ATOM   4897 N  N3    . DT  D 3  8   ? -41.768 67.716 -14.266 1.00 43.54  ? 8   DT  D N3    1 
ATOM   4898 C  C4    . DT  D 3  8   ? -40.404 67.848 -14.376 1.00 44.02  ? 8   DT  D C4    1 
ATOM   4899 O  O4    . DT  D 3  8   ? -39.874 68.088 -15.465 1.00 42.93  ? 8   DT  D O4    1 
ATOM   4900 C  C5    . DT  D 3  8   ? -39.685 67.690 -13.125 1.00 43.99  ? 8   DT  D C5    1 
ATOM   4901 C  C7    . DT  D 3  8   ? -38.187 67.812 -13.050 1.00 41.69  ? 8   DT  D C7    1 
ATOM   4902 C  C6    . DT  D 3  8   ? -40.402 67.436 -12.015 1.00 45.23  ? 8   DT  D C6    1 
ATOM   4903 P  P     . DT  D 3  9   ? -44.360 64.450 -7.793  1.00 50.35  ? 9   DT  D P     1 
ATOM   4904 O  OP1   . DT  D 3  9   ? -45.367 64.528 -6.723  1.00 50.60  ? 9   DT  D OP1   1 
ATOM   4905 O  OP2   . DT  D 3  9   ? -43.201 63.559 -7.648  1.00 50.20  ? 9   DT  D OP2   1 
ATOM   4906 O  "O5'" . DT  D 3  9   ? -45.059 64.158 -9.191  1.00 49.75  ? 9   DT  D "O5'" 1 
ATOM   4907 C  "C5'" . DT  D 3  9   ? -46.122 65.002 -9.597  1.00 49.76  ? 9   DT  D "C5'" 1 
ATOM   4908 C  "C4'" . DT  D 3  9   ? -46.565 64.655 -11.005 1.00 50.54  ? 9   DT  D "C4'" 1 
ATOM   4909 O  "O4'" . DT  D 3  9   ? -45.514 64.980 -11.954 1.00 49.70  ? 9   DT  D "O4'" 1 
ATOM   4910 C  "C3'" . DT  D 3  9   ? -46.887 63.182 -11.204 1.00 50.85  ? 9   DT  D "C3'" 1 
ATOM   4911 O  "O3'" . DT  D 3  9   ? -48.182 63.124 -11.801 1.00 53.01  ? 9   DT  D "O3'" 1 
ATOM   4912 C  "C2'" . DT  D 3  9   ? -45.730 62.651 -12.061 1.00 49.04  ? 9   DT  D "C2'" 1 
ATOM   4913 C  "C1'" . DT  D 3  9   ? -45.368 63.903 -12.858 1.00 49.29  ? 9   DT  D "C1'" 1 
ATOM   4914 N  N1    . DT  D 3  9   ? -43.979 64.022 -13.459 1.00 48.13  ? 9   DT  D N1    1 
ATOM   4915 C  C2    . DT  D 3  9   ? -43.860 64.377 -14.789 1.00 46.92  ? 9   DT  D C2    1 
ATOM   4916 O  O2    . DT  D 3  9   ? -44.815 64.580 -15.530 1.00 48.55  ? 9   DT  D O2    1 
ATOM   4917 N  N3    . DT  D 3  9   ? -42.577 64.473 -15.235 1.00 43.94  ? 9   DT  D N3    1 
ATOM   4918 C  C4    . DT  D 3  9   ? -41.421 64.274 -14.526 1.00 45.03  ? 9   DT  D C4    1 
ATOM   4919 O  O4    . DT  D 3  9   ? -40.304 64.397 -15.039 1.00 46.74  ? 9   DT  D O4    1 
ATOM   4920 C  C5    . DT  D 3  9   ? -41.606 63.911 -13.145 1.00 46.20  ? 9   DT  D C5    1 
ATOM   4921 C  C7    . DT  D 3  9   ? -40.415 63.650 -12.266 1.00 45.16  ? 9   DT  D C7    1 
ATOM   4922 C  C6    . DT  D 3  9   ? -42.859 63.809 -12.682 1.00 46.81  ? 9   DT  D C6    1 
ATOM   4923 P  P     . DC  D 3  10  ? -48.861 61.729 -12.246 1.00 54.70  ? 10  DC  D P     1 
ATOM   4924 O  OP1   . DC  D 3  10  ? -50.323 61.909 -12.126 1.00 54.46  ? 10  DC  D OP1   1 
ATOM   4925 O  OP2   . DC  D 3  10  ? -48.170 60.571 -11.619 1.00 53.20  ? 10  DC  D OP2   1 
ATOM   4926 O  "O5'" . DC  D 3  10  ? -48.499 61.738 -13.797 1.00 53.24  ? 10  DC  D "O5'" 1 
ATOM   4927 C  "C5'" . DC  D 3  10  ? -49.025 62.764 -14.609 1.00 50.42  ? 10  DC  D "C5'" 1 
ATOM   4928 C  "C4'" . DC  D 3  10  ? -48.651 62.422 -16.029 1.00 49.97  ? 10  DC  D "C4'" 1 
ATOM   4929 O  "O4'" . DC  D 3  10  ? -47.211 62.533 -16.188 1.00 50.50  ? 10  DC  D "O4'" 1 
ATOM   4930 C  "C3'" . DC  D 3  10  ? -49.020 61.015 -16.466 1.00 49.26  ? 10  DC  D "C3'" 1 
ATOM   4931 O  "O3'" . DC  D 3  10  ? -49.610 61.175 -17.718 1.00 50.36  ? 10  DC  D "O3'" 1 
ATOM   4932 C  "C2'" . DC  D 3  10  ? -47.678 60.292 -16.583 1.00 49.84  ? 10  DC  D "C2'" 1 
ATOM   4933 C  "C1'" . DC  D 3  10  ? -46.740 61.438 -16.949 1.00 48.36  ? 10  DC  D "C1'" 1 
ATOM   4934 N  N1    . DC  D 3  10  ? -45.295 61.324 -16.572 1.00 46.95  ? 10  DC  D N1    1 
ATOM   4935 C  C2    . DC  D 3  10  ? -44.291 61.558 -17.535 1.00 46.26  ? 10  DC  D C2    1 
ATOM   4936 O  O2    . DC  D 3  10  ? -44.613 61.817 -18.703 1.00 45.13  ? 10  DC  D O2    1 
ATOM   4937 N  N3    . DC  D 3  10  ? -42.977 61.503 -17.154 1.00 45.62  ? 10  DC  D N3    1 
ATOM   4938 C  C4    . DC  D 3  10  ? -42.648 61.228 -15.877 1.00 44.63  ? 10  DC  D C4    1 
ATOM   4939 N  N4    . DC  D 3  10  ? -41.351 61.154 -15.544 1.00 41.16  ? 10  DC  D N4    1 
ATOM   4940 C  C5    . DC  D 3  10  ? -43.661 60.993 -14.894 1.00 44.87  ? 10  DC  D C5    1 
ATOM   4941 C  C6    . DC  D 3  10  ? -44.947 61.065 -15.276 1.00 45.96  ? 10  DC  D C6    1 
ATOM   4942 P  P     . DC  D 3  11  ? -50.547 60.079 -18.418 1.00 50.79  ? 11  DC  D P     1 
ATOM   4943 O  OP1   . DC  D 3  11  ? -51.412 60.873 -19.331 1.00 49.68  ? 11  DC  D OP1   1 
ATOM   4944 O  OP2   . DC  D 3  11  ? -51.058 59.173 -17.362 1.00 49.70  ? 11  DC  D OP2   1 
ATOM   4945 O  "O5'" . DC  D 3  11  ? -49.525 59.222 -19.316 1.00 48.83  ? 11  DC  D "O5'" 1 
ATOM   4946 C  "C5'" . DC  D 3  11  ? -48.785 59.840 -20.378 1.00 47.03  ? 11  DC  D "C5'" 1 
ATOM   4947 C  "C4'" . DC  D 3  11  ? -47.821 58.840 -21.001 1.00 46.53  ? 11  DC  D "C4'" 1 
ATOM   4948 O  "O4'" . DC  D 3  11  ? -46.511 58.969 -20.386 1.00 45.78  ? 11  DC  D "O4'" 1 
ATOM   4949 C  "C3'" . DC  D 3  11  ? -48.206 57.371 -20.828 1.00 45.67  ? 11  DC  D "C3'" 1 
ATOM   4950 O  "O3'" . DC  D 3  11  ? -47.784 56.629 -21.960 1.00 45.98  ? 11  DC  D "O3'" 1 
ATOM   4951 C  "C2'" . DC  D 3  11  ? -47.414 56.974 -19.598 1.00 44.26  ? 11  DC  D "C2'" 1 
ATOM   4952 C  "C1'" . DC  D 3  11  ? -46.124 57.709 -19.906 1.00 45.30  ? 11  DC  D "C1'" 1 
ATOM   4953 N  N1    . DC  D 3  11  ? -45.139 57.829 -18.774 1.00 47.13  ? 11  DC  D N1    1 
ATOM   4954 C  C2    . DC  D 3  11  ? -43.793 58.087 -19.065 1.00 46.55  ? 11  DC  D C2    1 
ATOM   4955 O  O2    . DC  D 3  11  ? -43.451 58.239 -20.235 1.00 47.17  ? 11  DC  D O2    1 
ATOM   4956 N  N3    . DC  D 3  11  ? -42.902 58.170 -18.046 1.00 46.87  ? 11  DC  D N3    1 
ATOM   4957 C  C4    . DC  D 3  11  ? -43.305 58.008 -16.779 1.00 46.15  ? 11  DC  D C4    1 
ATOM   4958 N  N4    . DC  D 3  11  ? -42.391 58.090 -15.817 1.00 45.32  ? 11  DC  D N4    1 
ATOM   4959 C  C5    . DC  D 3  11  ? -44.661 57.737 -16.450 1.00 46.17  ? 11  DC  D C5    1 
ATOM   4960 C  C6    . DC  D 3  11  ? -45.529 57.650 -17.467 1.00 47.11  ? 11  DC  D C6    1 
ATOM   4961 P  P     . DA  D 3  12  ? -48.815 56.193 -23.093 1.00 43.91  ? 12  DA  D P     1 
ATOM   4962 O  OP1   . DA  D 3  12  ? -49.734 57.315 -23.323 1.00 44.40  ? 12  DA  D OP1   1 
ATOM   4963 O  OP2   . DA  D 3  12  ? -49.299 54.870 -22.678 1.00 46.25  ? 12  DA  D OP2   1 
ATOM   4964 O  "O5'" . DA  D 3  12  ? -47.945 55.941 -24.414 1.00 44.56  ? 12  DA  D "O5'" 1 
ATOM   4965 C  "C5'" . DA  D 3  12  ? -47.432 56.993 -25.187 1.00 44.74  ? 12  DA  D "C5'" 1 
ATOM   4966 C  "C4'" . DA  D 3  12  ? -46.049 56.584 -25.647 1.00 46.90  ? 12  DA  D "C4'" 1 
ATOM   4967 O  "O4'" . DA  D 3  12  ? -45.140 56.488 -24.525 1.00 47.18  ? 12  DA  D "O4'" 1 
ATOM   4968 C  "C3'" . DA  D 3  12  ? -45.897 55.254 -26.365 1.00 48.25  ? 12  DA  D "C3'" 1 
ATOM   4969 O  "O3'" . DA  D 3  12  ? -44.932 55.531 -27.379 1.00 51.33  ? 12  DA  D "O3'" 1 
ATOM   4970 C  "C2'" . DA  D 3  12  ? -45.373 54.287 -25.302 1.00 46.57  ? 12  DA  D "C2'" 1 
ATOM   4971 C  "C1'" . DA  D 3  12  ? -44.519 55.213 -24.438 1.00 47.38  ? 12  DA  D "C1'" 1 
ATOM   4972 N  N9    . DA  D 3  12  ? -44.479 55.000 -22.983 1.00 47.11  ? 12  DA  D N9    1 
ATOM   4973 C  C8    . DA  D 3  12  ? -45.540 54.723 -22.186 1.00 45.69  ? 12  DA  D C8    1 
ATOM   4974 N  N7    . DA  D 3  12  ? -45.229 54.627 -20.922 1.00 47.62  ? 12  DA  D N7    1 
ATOM   4975 C  C5    . DA  D 3  12  ? -43.875 54.873 -20.867 1.00 46.20  ? 12  DA  D C5    1 
ATOM   4976 C  C6    . DA  D 3  12  ? -42.954 54.935 -19.798 1.00 45.18  ? 12  DA  D C6    1 
ATOM   4977 N  N6    . DA  D 3  12  ? -43.304 54.727 -18.535 1.00 42.06  ? 12  DA  D N6    1 
ATOM   4978 N  N1    . DA  D 3  12  ? -41.656 55.227 -20.082 1.00 45.04  ? 12  DA  D N1    1 
ATOM   4979 C  C2    . DA  D 3  12  ? -41.307 55.444 -21.357 1.00 43.72  ? 12  DA  D C2    1 
ATOM   4980 N  N3    . DA  D 3  12  ? -42.095 55.410 -22.435 1.00 45.87  ? 12  DA  D N3    1 
ATOM   4981 C  C4    . DA  D 3  12  ? -43.386 55.124 -22.132 1.00 46.85  ? 12  DA  D C4    1 
ATOM   4982 P  P     . DT  D 3  13  ? -44.533 54.449 -28.499 1.00 53.15  ? 13  DT  D P     1 
ATOM   4983 O  OP1   . DT  D 3  13  ? -44.195 55.267 -29.694 1.00 54.33  ? 13  DT  D OP1   1 
ATOM   4984 O  OP2   . DT  D 3  13  ? -45.535 53.358 -28.539 1.00 52.92  ? 13  DT  D OP2   1 
ATOM   4985 O  "O5'" . DT  D 3  13  ? -43.197 53.787 -27.928 1.00 49.96  ? 13  DT  D "O5'" 1 
ATOM   4986 C  "C5'" . DT  D 3  13  ? -42.092 54.603 -27.616 1.00 46.33  ? 13  DT  D "C5'" 1 
ATOM   4987 C  "C4'" . DT  D 3  13  ? -40.969 53.757 -27.073 1.00 43.49  ? 13  DT  D "C4'" 1 
ATOM   4988 O  "O4'" . DT  D 3  13  ? -41.198 53.618 -25.674 1.00 43.61  ? 13  DT  D "O4'" 1 
ATOM   4989 C  "C3'" . DT  D 3  13  ? -40.881 52.343 -27.622 1.00 43.36  ? 13  DT  D "C3'" 1 
ATOM   4990 O  "O3'" . DT  D 3  13  ? -39.608 52.262 -28.166 1.00 44.30  ? 13  DT  D "O3'" 1 
ATOM   4991 C  "C2'" . DT  D 3  13  ? -41.034 51.432 -26.411 1.00 41.64  ? 13  DT  D "C2'" 1 
ATOM   4992 C  "C1'" . DT  D 3  13  ? -40.690 52.378 -25.277 1.00 42.75  ? 13  DT  D "C1'" 1 
ATOM   4993 N  N1    . DT  D 3  13  ? -41.337 52.140 -23.987 1.00 42.83  ? 13  DT  D N1    1 
ATOM   4994 C  C2    . DT  D 3  13  ? -40.584 52.283 -22.829 1.00 44.76  ? 13  DT  D C2    1 
ATOM   4995 O  O2    . DT  D 3  13  ? -39.398 52.598 -22.807 1.00 44.08  ? 13  DT  D O2    1 
ATOM   4996 N  N3    . DT  D 3  13  ? -41.272 52.024 -21.663 1.00 45.72  ? 13  DT  D N3    1 
ATOM   4997 C  C4    . DT  D 3  13  ? -42.615 51.702 -21.545 1.00 44.87  ? 13  DT  D C4    1 
ATOM   4998 O  O4    . DT  D 3  13  ? -43.125 51.527 -20.447 1.00 44.23  ? 13  DT  D O4    1 
ATOM   4999 C  C5    . DT  D 3  13  ? -43.340 51.576 -22.802 1.00 44.82  ? 13  DT  D C5    1 
ATOM   5000 C  C7    . DT  D 3  13  ? -44.791 51.205 -22.826 1.00 43.26  ? 13  DT  D C7    1 
ATOM   5001 C  C6    . DT  D 3  13  ? -42.675 51.808 -23.945 1.00 43.33  ? 13  DT  D C6    1 
ATOM   5002 P  P     . DG  D 3  14  ? -39.184 51.027 -29.075 1.00 48.06  ? 14  DG  D P     1 
ATOM   5003 O  OP1   . DG  D 3  14  ? -38.074 51.477 -29.954 1.00 50.87  ? 14  DG  D OP1   1 
ATOM   5004 O  OP2   . DG  D 3  14  ? -40.407 50.440 -29.685 1.00 46.08  ? 14  DG  D OP2   1 
ATOM   5005 O  "O5'" . DG  D 3  14  ? -38.461 50.037 -28.045 1.00 45.28  ? 14  DG  D "O5'" 1 
ATOM   5006 C  "C5'" . DG  D 3  14  ? -37.372 50.497 -27.269 1.00 43.25  ? 14  DG  D "C5'" 1 
ATOM   5007 C  "C4'" . DG  D 3  14  ? -37.113 49.554 -26.119 1.00 43.94  ? 14  DG  D "C4'" 1 
ATOM   5008 O  "O4'" . DG  D 3  14  ? -38.223 49.580 -25.182 1.00 43.40  ? 14  DG  D "O4'" 1 
ATOM   5009 C  "C3'" . DG  D 3  14  ? -36.960 48.087 -26.501 1.00 45.21  ? 14  DG  D "C3'" 1 
ATOM   5010 O  "O3'" . DG  D 3  14  ? -35.795 47.592 -25.861 1.00 48.34  ? 14  DG  D "O3'" 1 
ATOM   5011 C  "C2'" . DG  D 3  14  ? -38.237 47.420 -25.979 1.00 43.13  ? 14  DG  D "C2'" 1 
ATOM   5012 C  "C1'" . DG  D 3  14  ? -38.470 48.268 -24.728 1.00 42.71  ? 14  DG  D "C1'" 1 
ATOM   5013 N  N9    . DG  D 3  14  ? -39.811 48.311 -24.142 1.00 43.11  ? 14  DG  D N9    1 
ATOM   5014 C  C8    . DG  D 3  14  ? -41.028 48.300 -24.785 1.00 40.59  ? 14  DG  D C8    1 
ATOM   5015 N  N7    . DG  D 3  14  ? -42.047 48.379 -23.974 1.00 40.58  ? 14  DG  D N7    1 
ATOM   5016 C  C5    . DG  D 3  14  ? -41.482 48.462 -22.704 1.00 42.47  ? 14  DG  D C5    1 
ATOM   5017 C  C6    . DG  D 3  14  ? -42.077 48.561 -21.409 1.00 42.32  ? 14  DG  D C6    1 
ATOM   5018 O  O6    . DG  D 3  14  ? -43.263 48.614 -21.079 1.00 41.89  ? 14  DG  D O6    1 
ATOM   5019 N  N1    . DG  D 3  14  ? -41.144 48.615 -20.390 1.00 43.87  ? 14  DG  D N1    1 
ATOM   5020 C  C2    . DG  D 3  14  ? -39.783 48.577 -20.569 1.00 44.40  ? 14  DG  D C2    1 
ATOM   5021 N  N2    . DG  D 3  14  ? -39.053 48.647 -19.440 1.00 43.36  ? 14  DG  D N2    1 
ATOM   5022 N  N3    . DG  D 3  14  ? -39.200 48.477 -21.774 1.00 44.47  ? 14  DG  D N3    1 
ATOM   5023 C  C4    . DG  D 3  14  ? -40.104 48.419 -22.795 1.00 43.69  ? 14  DG  D C4    1 
ATOM   5024 P  P     . DA  D 3  15  ? -35.077 46.324 -26.522 1.00 53.26  ? 15  DA  D P     1 
ATOM   5025 O  OP1   . DA  D 3  15  ? -33.860 46.859 -27.156 1.00 50.74  ? 15  DA  D OP1   1 
ATOM   5026 O  OP2   . DA  D 3  15  ? -36.108 45.498 -27.234 1.00 51.07  ? 15  DA  D OP2   1 
ATOM   5027 O  "O5'" . DA  D 3  15  ? -34.624 45.364 -25.319 1.00 49.36  ? 15  DA  D "O5'" 1 
ATOM   5028 C  "C5'" . DA  D 3  15  ? -33.868 45.808 -24.235 1.00 47.42  ? 15  DA  D "C5'" 1 
ATOM   5029 C  "C4'" . DA  D 3  15  ? -34.236 44.909 -23.078 1.00 45.76  ? 15  DA  D "C4'" 1 
ATOM   5030 O  "O4'" . DA  D 3  15  ? -35.586 45.264 -22.661 1.00 44.64  ? 15  DA  D "O4'" 1 
ATOM   5031 C  "C3'" . DA  D 3  15  ? -34.213 43.427 -23.459 1.00 44.26  ? 15  DA  D "C3'" 1 
ATOM   5032 O  "O3'" . DA  D 3  15  ? -33.465 42.672 -22.516 1.00 44.03  ? 15  DA  D "O3'" 1 
ATOM   5033 C  "C2'" . DA  D 3  15  ? -35.687 43.036 -23.509 1.00 44.18  ? 15  DA  D "C2'" 1 
ATOM   5034 C  "C1'" . DA  D 3  15  ? -36.329 44.063 -22.565 1.00 43.78  ? 15  DA  D "C1'" 1 
ATOM   5035 N  N9    . DA  D 3  15  ? -37.742 44.343 -22.815 1.00 40.91  ? 15  DA  D N9    1 
ATOM   5036 C  C8    . DA  D 3  15  ? -38.454 44.296 -23.980 1.00 39.60  ? 15  DA  D C8    1 
ATOM   5037 N  N7    . DA  D 3  15  ? -39.730 44.609 -23.840 1.00 40.26  ? 15  DA  D N7    1 
ATOM   5038 C  C5    . DA  D 3  15  ? -39.863 44.861 -22.485 1.00 39.96  ? 15  DA  D C5    1 
ATOM   5039 C  C6    . DA  D 3  15  ? -40.951 45.228 -21.653 1.00 40.27  ? 15  DA  D C6    1 
ATOM   5040 N  N6    . DA  D 3  15  ? -42.199 45.443 -22.083 1.00 37.32  ? 15  DA  D N6    1 
ATOM   5041 N  N1    . DA  D 3  15  ? -40.702 45.397 -20.328 1.00 39.11  ? 15  DA  D N1    1 
ATOM   5042 C  C2    . DA  D 3  15  ? -39.466 45.193 -19.870 1.00 38.12  ? 15  DA  D C2    1 
ATOM   5043 N  N3    . DA  D 3  15  ? -38.375 44.840 -20.544 1.00 38.95  ? 15  DA  D N3    1 
ATOM   5044 C  C4    . DA  D 3  15  ? -38.641 44.698 -21.849 1.00 40.21  ? 15  DA  D C4    1 
ATOM   5045 P  P     . DC  D 3  16  ? -33.092 41.128 -22.821 1.00 46.92  ? 16  DC  D P     1 
ATOM   5046 O  OP1   . DC  D 3  16  ? -31.630 40.960 -22.933 1.00 45.67  ? 16  DC  D OP1   1 
ATOM   5047 O  OP2   . DC  D 3  16  ? -34.004 40.620 -23.880 1.00 44.43  ? 16  DC  D OP2   1 
ATOM   5048 O  "O5'" . DC  D 3  16  ? -33.482 40.329 -21.473 1.00 45.46  ? 16  DC  D "O5'" 1 
ATOM   5049 C  "C5'" . DC  D 3  16  ? -33.186 40.737 -20.122 1.00 43.04  ? 16  DC  D "C5'" 1 
ATOM   5050 C  "C4'" . DC  D 3  16  ? -34.260 40.239 -19.165 1.00 41.65  ? 16  DC  D "C4'" 1 
ATOM   5051 O  "O4'" . DC  D 3  16  ? -35.415 41.056 -19.389 1.00 41.29  ? 16  DC  D "O4'" 1 
ATOM   5052 C  "C3'" . DC  D 3  16  ? -34.852 38.853 -19.379 1.00 41.27  ? 16  DC  D "C3'" 1 
ATOM   5053 O  "O3'" . DC  D 3  16  ? -34.082 37.920 -18.704 1.00 43.44  ? 16  DC  D "O3'" 1 
ATOM   5054 C  "C2'" . DC  D 3  16  ? -36.221 38.970 -18.718 1.00 39.48  ? 16  DC  D "C2'" 1 
ATOM   5055 C  "C1'" . DC  D 3  16  ? -36.551 40.446 -18.840 1.00 38.41  ? 16  DC  D "C1'" 1 
ATOM   5056 N  N1    . DC  D 3  16  ? -37.612 40.799 -19.790 1.00 39.06  ? 16  DC  D N1    1 
ATOM   5057 C  C2    . DC  D 3  16  ? -38.738 41.522 -19.369 1.00 37.54  ? 16  DC  D C2    1 
ATOM   5058 O  O2    . DC  D 3  16  ? -38.844 41.846 -18.187 1.00 38.20  ? 16  DC  D O2    1 
ATOM   5059 N  N3    . DC  D 3  16  ? -39.700 41.828 -20.273 1.00 37.15  ? 16  DC  D N3    1 
ATOM   5060 C  C4    . DC  D 3  16  ? -39.568 41.445 -21.548 1.00 36.88  ? 16  DC  D C4    1 
ATOM   5061 N  N4    . DC  D 3  16  ? -40.519 41.771 -22.409 1.00 36.59  ? 16  DC  D N4    1 
ATOM   5062 C  C5    . DC  D 3  16  ? -38.442 40.720 -22.006 1.00 37.45  ? 16  DC  D C5    1 
ATOM   5063 C  C6    . DC  D 3  16  ? -37.487 40.428 -21.108 1.00 39.57  ? 16  DC  D C6    1 
ATOM   5064 P  P     A DA  D 3  17  ? -33.041 36.946 -19.421 0.50 45.00  ? 17  DA  D P     1 
ATOM   5065 P  P     B DA  D 3  17  ? -33.270 36.802 -19.510 0.50 47.01  ? 17  DA  D P     1 
ATOM   5066 O  OP1   A DA  D 3  17  ? -32.888 35.710 -18.609 0.50 44.85  ? 17  DA  D OP1   1 
ATOM   5067 O  OP1   B DA  D 3  17  ? -34.217 36.174 -20.457 0.50 48.48  ? 17  DA  D OP1   1 
ATOM   5068 O  OP2   A DA  D 3  17  ? -31.828 37.742 -19.688 0.50 44.51  ? 17  DA  D OP2   1 
ATOM   5069 O  OP2   B DA  D 3  17  ? -32.527 35.969 -18.537 0.50 47.24  ? 17  DA  D OP2   1 
ATOM   5070 O  "O5'" A DA  D 3  17  ? -33.843 36.508 -20.748 0.50 46.73  ? 17  DA  D "O5'" 1 
ATOM   5071 O  "O5'" B DA  D 3  17  ? -32.228 37.571 -20.431 0.50 48.31  ? 17  DA  D "O5'" 1 
ATOM   5072 C  "C5'" A DA  D 3  17  ? -33.537 36.951 -22.063 0.50 48.53  ? 17  DA  D "C5'" 1 
ATOM   5073 C  "C5'" B DA  D 3  17  ? -32.552 37.794 -21.823 0.50 49.49  ? 17  DA  D "C5'" 1 
ATOM   5074 C  "C4'" A DA  D 3  17  ? -33.196 35.799 -23.001 0.50 49.62  ? 17  DA  D "C4'" 1 
ATOM   5075 C  "C4'" B DA  D 3  17  ? -32.716 36.555 -22.691 0.50 48.99  ? 17  DA  D "C4'" 1 
ATOM   5076 O  "O4'" A DA  D 3  17  ? -33.175 34.521 -22.308 0.50 49.05  ? 17  DA  D "O4'" 1 
ATOM   5077 O  "O4'" B DA  D 3  17  ? -34.105 36.400 -23.122 0.50 48.23  ? 17  DA  D "O4'" 1 
ATOM   5078 C  "C3'" A DA  D 3  17  ? -34.145 35.632 -24.203 0.50 50.38  ? 17  DA  D "C3'" 1 
ATOM   5079 C  "C3'" B DA  D 3  17  ? -31.871 36.635 -23.964 0.50 48.53  ? 17  DA  D "C3'" 1 
ATOM   5080 O  "O3'" A DA  D 3  17  ? -33.410 35.542 -25.429 0.50 51.08  ? 17  DA  D "O3'" 1 
ATOM   5081 O  "O3'" B DA  D 3  17  ? -30.950 35.561 -23.971 0.50 49.36  ? 17  DA  D "O3'" 1 
ATOM   5082 C  "C2'" A DA  D 3  17  ? -34.838 34.307 -23.917 0.50 50.23  ? 17  DA  D "C2'" 1 
ATOM   5083 C  "C2'" B DA  D 3  17  ? -32.877 36.517 -25.110 0.50 48.17  ? 17  DA  D "C2'" 1 
ATOM   5084 C  "C1'" A DA  D 3  17  ? -33.639 33.613 -23.286 0.50 49.58  ? 17  DA  D "C1'" 1 
ATOM   5085 C  "C1'" B DA  D 3  17  ? -34.083 35.853 -24.433 0.50 47.44  ? 17  DA  D "C1'" 1 
ATOM   5086 N  N9    A DA  D 3  17  ? -33.904 32.283 -22.763 0.50 48.31  ? 17  DA  D N9    1 
ATOM   5087 N  N9    B DA  D 3  17  ? -35.352 36.072 -25.138 0.50 45.20  ? 17  DA  D N9    1 
ATOM   5088 C  C8    A DA  D 3  17  ? -34.264 31.198 -23.519 0.50 48.44  ? 17  DA  D C8    1 
ATOM   5089 C  C8    B DA  D 3  17  ? -36.011 35.186 -25.958 0.50 44.70  ? 17  DA  D C8    1 
ATOM   5090 N  N7    A DA  D 3  17  ? -34.420 30.108 -22.809 0.50 48.94  ? 17  DA  D N7    1 
ATOM   5091 N  N7    B DA  D 3  17  ? -37.131 35.672 -26.468 0.50 44.03  ? 17  DA  D N7    1 
ATOM   5092 C  C5    A DA  D 3  17  ? -34.142 30.515 -21.502 0.50 48.02  ? 17  DA  D C5    1 
ATOM   5093 C  C5    B DA  D 3  17  ? -37.201 36.960 -25.957 0.50 43.30  ? 17  DA  D C5    1 
ATOM   5094 C  C6    A DA  D 3  17  ? -34.133 29.829 -20.266 0.50 47.19  ? 17  DA  D C6    1 
ATOM   5095 C  C6    B DA  D 3  17  ? -38.149 37.998 -26.119 0.50 43.04  ? 17  DA  D C6    1 
ATOM   5096 N  N6    A DA  D 3  17  ? -34.417 28.527 -20.137 0.50 44.67  ? 17  DA  D N6    1 
ATOM   5097 N  N6    B DA  D 3  17  ? -39.248 37.869 -26.875 0.50 42.51  ? 17  DA  D N6    1 
ATOM   5098 N  N1    A DA  D 3  17  ? -33.809 30.544 -19.169 0.50 46.39  ? 17  DA  D N1    1 
ATOM   5099 N  N1    B DA  D 3  17  ? -37.921 39.168 -25.468 0.50 41.71  ? 17  DA  D N1    1 
ATOM   5100 C  C2    A DA  D 3  17  ? -33.507 31.834 -19.308 0.50 45.59  ? 17  DA  D C2    1 
ATOM   5101 C  C2    B DA  D 3  17  ? -36.819 39.276 -24.701 0.50 41.51  ? 17  DA  D C2    1 
ATOM   5102 N  N3    A DA  D 3  17  ? -33.486 32.577 -20.405 0.50 46.05  ? 17  DA  D N3    1 
ATOM   5103 N  N3    B DA  D 3  17  ? -35.859 38.379 -24.467 0.50 42.46  ? 17  DA  D N3    1 
ATOM   5104 C  C4    A DA  D 3  17  ? -33.814 31.855 -21.468 0.50 46.92  ? 17  DA  D C4    1 
ATOM   5105 C  C4    B DA  D 3  17  ? -36.111 37.229 -25.136 0.50 43.98  ? 17  DA  D C4    1 
HETATM 5106 ZN ZN    . ZN  E 4  .   ? -55.531 23.728 -46.028 1.00 48.04  ? 393 ZN  A ZN    1 
HETATM 5107 S  S     . SO4 F 5  .   ? -50.850 17.759 -31.603 1.00 71.96  ? 394 SO4 A S     1 
HETATM 5108 O  O1    . SO4 F 5  .   ? -49.486 18.073 -31.178 1.00 69.95  ? 394 SO4 A O1    1 
HETATM 5109 O  O2    . SO4 F 5  .   ? -51.250 16.424 -31.167 1.00 73.62  ? 394 SO4 A O2    1 
HETATM 5110 O  O3    . SO4 F 5  .   ? -51.778 18.724 -31.020 1.00 72.52  ? 394 SO4 A O3    1 
HETATM 5111 O  O4    . SO4 F 5  .   ? -50.947 17.758 -33.061 1.00 72.81  ? 394 SO4 A O4    1 
HETATM 5112 C  C1    . GOL G 6  .   ? -29.618 18.209 -10.335 1.00 82.93  ? 801 GOL A C1    1 
HETATM 5113 O  O1    . GOL G 6  .   ? -28.904 18.122 -9.120  1.00 81.94  ? 801 GOL A O1    1 
HETATM 5114 C  C2    . GOL G 6  .   ? -31.031 18.635 -9.962  1.00 83.33  ? 801 GOL A C2    1 
HETATM 5115 O  O2    . GOL G 6  .   ? -31.281 18.036 -8.707  1.00 83.35  ? 801 GOL A O2    1 
HETATM 5116 C  C3    . GOL G 6  .   ? -32.067 18.242 -11.032 1.00 83.15  ? 801 GOL A C3    1 
HETATM 5117 O  O3    . GOL G 6  .   ? -33.117 19.191 -11.128 1.00 80.23  ? 801 GOL A O3    1 
HETATM 5118 C  C1    . GOL H 6  .   ? -12.602 34.755 -13.374 1.00 75.57  ? 802 GOL A C1    1 
HETATM 5119 O  O1    . GOL H 6  .   ? -13.800 35.412 -13.080 1.00 73.06  ? 802 GOL A O1    1 
HETATM 5120 C  C2    . GOL H 6  .   ? -12.978 33.323 -13.721 1.00 77.69  ? 802 GOL A C2    1 
HETATM 5121 O  O2    . GOL H 6  .   ? -11.968 32.436 -13.283 1.00 79.04  ? 802 GOL A O2    1 
HETATM 5122 C  C3    . GOL H 6  .   ? -13.180 33.181 -15.233 1.00 79.52  ? 802 GOL A C3    1 
HETATM 5123 O  O3    . GOL H 6  .   ? -13.789 31.934 -15.541 1.00 79.64  ? 802 GOL A O3    1 
HETATM 5124 C  C1    . GOL I 6  .   ? -45.739 44.214 13.974  1.00 61.50  ? 803 GOL A C1    1 
HETATM 5125 O  O1    . GOL I 6  .   ? -47.096 43.973 13.649  1.00 59.15  ? 803 GOL A O1    1 
HETATM 5126 C  C2    . GOL I 6  .   ? -45.621 45.608 14.580  1.00 62.71  ? 803 GOL A C2    1 
HETATM 5127 O  O2    . GOL I 6  .   ? -45.836 46.610 13.608  1.00 65.40  ? 803 GOL A O2    1 
HETATM 5128 C  C3    . GOL I 6  .   ? -44.271 45.854 15.228  1.00 62.80  ? 803 GOL A C3    1 
HETATM 5129 O  O3    . GOL I 6  .   ? -44.255 47.182 15.732  1.00 63.34  ? 803 GOL A O3    1 
HETATM 5130 C  C1    . GOL J 6  .   ? -61.335 21.382 -61.083 1.00 80.15  ? 805 GOL A C1    1 
HETATM 5131 O  O1    . GOL J 6  .   ? -62.719 21.152 -60.947 1.00 80.86  ? 805 GOL A O1    1 
HETATM 5132 C  C2    . GOL J 6  .   ? -61.125 22.173 -62.359 1.00 78.90  ? 805 GOL A C2    1 
HETATM 5133 O  O2    . GOL J 6  .   ? -61.700 21.412 -63.388 1.00 79.72  ? 805 GOL A O2    1 
HETATM 5134 C  C3    . GOL J 6  .   ? -59.635 22.299 -62.635 1.00 78.45  ? 805 GOL A C3    1 
HETATM 5135 O  O3    . GOL J 6  .   ? -59.436 23.362 -63.534 1.00 76.52  ? 805 GOL A O3    1 
HETATM 5136 N  N     . NH4 K 7  .   ? -55.174 40.054 -7.730  1.00 30.54  ? 395 NH4 A N     1 
HETATM 5137 MG MG    . MG  L 8  .   ? -36.907 30.734 -16.074 1.00 35.37  ? 396 MG  A MG    1 
HETATM 5138 MG MG    . MG  M 8  .   ? -36.699 34.452 -17.020 1.00 39.76  ? 397 MG  A MG    1 
HETATM 5139 N  NE    . ZYO N 9  .   ? -40.520 31.548 -24.946 1.00 53.80  ? 398 ZYO A NE    1 
HETATM 5140 N  NF    . ZYO N 9  .   ? -38.619 28.371 -19.107 1.00 40.71  ? 398 ZYO A NF    1 
HETATM 5141 N  NG    . ZYO N 9  .   ? -38.954 32.298 -23.139 1.00 49.39  ? 398 ZYO A NG    1 
HETATM 5142 N  NH    . ZYO N 9  .   ? -37.689 34.783 -21.116 1.00 39.14  ? 398 ZYO A NH    1 
HETATM 5143 N  NI    . ZYO N 9  .   ? -38.384 30.823 -20.420 1.00 40.76  ? 398 ZYO A NI    1 
HETATM 5144 C  CAA   . ZYO N 9  .   ? -37.634 26.088 -19.347 1.00 36.53  ? 398 ZYO A CAA   1 
HETATM 5145 C  CAB   . ZYO N 9  .   ? -37.552 29.062 -21.788 1.00 38.42  ? 398 ZYO A CAB   1 
HETATM 5146 C  CAC   . ZYO N 9  .   ? -40.262 30.096 -25.053 1.00 56.73  ? 398 ZYO A CAC   1 
HETATM 5147 O  OAD   . ZYO N 9  .   ? -37.274 29.234 -17.454 1.00 35.13  ? 398 ZYO A OAD   1 
HETATM 5148 O  OAE   . ZYO N 9  .   ? -36.949 34.831 -18.946 1.00 41.87  ? 398 ZYO A OAE   1 
HETATM 5149 O  OAF   . ZYO N 9  .   ? -41.035 30.974 -22.502 1.00 52.61  ? 398 ZYO A OAF   1 
HETATM 5150 O  OAG   . ZYO N 9  .   ? -41.348 33.248 -23.530 1.00 52.06  ? 398 ZYO A OAG   1 
HETATM 5151 O  OAH   . ZYO N 9  .   ? -37.012 32.332 -17.460 1.00 40.40  ? 398 ZYO A OAH   1 
HETATM 5152 F  FAI   . ZYO N 9  .   ? -42.154 39.078 -21.700 1.00 37.67  ? 398 ZYO A FAI   1 
HETATM 5153 CL CLAJ  . ZYO N 9  .   ? -41.223 38.828 -19.034 1.00 41.61  ? 398 ZYO A CLAJ  1 
HETATM 5154 C  CAK   . ZYO N 9  .   ? -40.464 37.854 -22.820 1.00 31.43  ? 398 ZYO A CAK   1 
HETATM 5155 C  CAL   . ZYO N 9  .   ? -39.286 37.132 -22.702 1.00 30.46  ? 398 ZYO A CAL   1 
HETATM 5156 C  CAM   . ZYO N 9  .   ? -39.267 37.476 -20.267 1.00 36.10  ? 398 ZYO A CAM   1 
HETATM 5157 C  CAN   . ZYO N 9  .   ? -38.572 26.992 -18.535 1.00 40.08  ? 398 ZYO A CAN   1 
HETATM 5158 C  CAO   . ZYO N 9  .   ? -39.401 32.395 -25.443 1.00 52.04  ? 398 ZYO A CAO   1 
HETATM 5159 C  CAP   . ZYO N 9  .   ? -38.267 32.200 -24.424 1.00 50.18  ? 398 ZYO A CAP   1 
HETATM 5160 C  CAQ   . ZYO N 9  .   ? -37.427 36.183 -21.320 1.00 35.80  ? 398 ZYO A CAQ   1 
HETATM 5161 C  CAR   . ZYO N 9  .   ? -39.471 28.612 -20.303 1.00 39.83  ? 398 ZYO A CAR   1 
HETATM 5162 N  NAS   . ZYO N 9  .   ? -38.146 34.142 -22.061 1.00 41.91  ? 398 ZYO A NAS   1 
HETATM 5163 C  CAT   . ZYO N 9  .   ? -37.978 29.449 -18.451 1.00 38.94  ? 398 ZYO A CAT   1 
HETATM 5164 C  CAU   . ZYO N 9  .   ? -41.030 38.359 -21.656 1.00 35.26  ? 398 ZYO A CAU   1 
HETATM 5165 C  CAV   . ZYO N 9  .   ? -38.711 36.950 -21.444 1.00 35.20  ? 398 ZYO A CAV   1 
HETATM 5166 C  CAW   . ZYO N 9  .   ? -40.444 38.176 -20.410 1.00 36.47  ? 398 ZYO A CAW   1 
HETATM 5167 C  CAX   . ZYO N 9  .   ? -37.514 31.964 -18.693 1.00 41.46  ? 398 ZYO A CAX   1 
HETATM 5168 C  CAY   . ZYO N 9  .   ? -38.440 32.829 -22.014 1.00 44.15  ? 398 ZYO A CAY   1 
HETATM 5169 C  CAZ   . ZYO N 9  .   ? -37.964 30.698 -19.074 1.00 40.13  ? 398 ZYO A CAZ   1 
HETATM 5170 C  CBA   . ZYO N 9  .   ? -37.415 34.188 -19.888 1.00 40.57  ? 398 ZYO A CBA   1 
HETATM 5171 C  CBB   . ZYO N 9  .   ? -37.679 32.839 -19.751 1.00 40.89  ? 398 ZYO A CBB   1 
HETATM 5172 C  CBC   . ZYO N 9  .   ? -38.209 32.141 -20.826 1.00 40.92  ? 398 ZYO A CBC   1 
HETATM 5173 C  CBD   . ZYO N 9  .   ? -38.838 29.657 -21.184 1.00 40.63  ? 398 ZYO A CBD   1 
HETATM 5174 S  SBJ   . ZYO N 9  .   ? -40.526 31.993 -23.445 1.00 52.00  ? 398 ZYO A SBJ   1 
HETATM 5175 S  S     . SO4 O 5  .   ? -35.112 41.141 26.104  1.00 99.95  ? 393 SO4 B S     1 
HETATM 5176 O  O1    . SO4 O 5  .   ? -35.753 41.037 24.796  1.00 100.63 ? 393 SO4 B O1    1 
HETATM 5177 O  O2    . SO4 O 5  .   ? -36.156 41.093 27.124  1.00 100.96 ? 393 SO4 B O2    1 
HETATM 5178 O  O3    . SO4 O 5  .   ? -34.216 40.002 26.316  1.00 99.67  ? 393 SO4 B O3    1 
HETATM 5179 O  O4    . SO4 O 5  .   ? -34.392 42.412 26.179  1.00 98.88  ? 393 SO4 B O4    1 
HETATM 5180 MG MG    . MG  P 8  .   ? -15.051 36.740 22.024  1.00 93.89  ? 394 MG  B MG    1 
HETATM 5181 O  O     . HOH Q 10 .   ? -36.435 29.044 -14.790 1.00 37.87  ? 399 HOH A O     1 
HETATM 5182 O  O     . HOH Q 10 .   ? -28.492 34.692 -20.590 1.00 54.02  ? 400 HOH A O     1 
HETATM 5183 O  O     . HOH Q 10 .   ? -44.073 39.834 -0.891  1.00 34.13  ? 401 HOH A O     1 
HETATM 5184 O  O     . HOH Q 10 .   ? -45.471 37.755 5.025   1.00 47.43  ? 402 HOH A O     1 
HETATM 5185 O  O     . HOH Q 10 .   ? -29.274 44.630 -0.405  1.00 45.42  ? 403 HOH A O     1 
HETATM 5186 O  O     . HOH Q 10 .   ? -29.263 50.902 3.165   1.00 37.94  ? 404 HOH A O     1 
HETATM 5187 O  O     . HOH Q 10 .   ? -38.772 44.049 -10.753 1.00 47.72  ? 405 HOH A O     1 
HETATM 5188 O  O     . HOH Q 10 .   ? -33.735 44.933 -6.098  1.00 37.83  ? 406 HOH A O     1 
HETATM 5189 O  O     . HOH Q 10 .   ? -40.638 54.374 -11.954 1.00 43.43  ? 407 HOH A O     1 
HETATM 5190 O  O     . HOH Q 10 .   ? -44.776 38.542 -11.662 1.00 36.64  ? 408 HOH A O     1 
HETATM 5191 O  O     . HOH Q 10 .   ? -48.418 42.577 -8.831  1.00 41.80  ? 409 HOH A O     1 
HETATM 5192 O  O     . HOH Q 10 .   ? -46.993 44.941 -7.945  1.00 37.45  ? 410 HOH A O     1 
HETATM 5193 O  O     . HOH Q 10 .   ? -20.856 36.259 -5.235  1.00 52.44  ? 411 HOH A O     1 
HETATM 5194 O  O     . HOH Q 10 .   ? -27.338 36.894 -1.712  1.00 48.34  ? 412 HOH A O     1 
HETATM 5195 O  O     . HOH Q 10 .   ? -24.136 25.076 -7.469  1.00 37.01  ? 413 HOH A O     1 
HETATM 5196 O  O     . HOH Q 10 .   ? -42.060 21.106 -7.450  1.00 49.30  ? 414 HOH A O     1 
HETATM 5197 O  O     . HOH Q 10 .   ? -45.028 21.114 -34.516 1.00 53.57  ? 415 HOH A O     1 
HETATM 5198 O  O     . HOH Q 10 .   ? -42.168 20.658 -33.829 1.00 52.37  ? 416 HOH A O     1 
HETATM 5199 O  O     . HOH Q 10 .   ? -32.972 46.967 -17.031 1.00 46.44  ? 417 HOH A O     1 
HETATM 5200 O  O     . HOH Q 10 .   ? -36.012 46.039 -19.179 1.00 43.98  ? 418 HOH A O     1 
HETATM 5201 O  O     . HOH Q 10 .   ? -51.097 48.003 -17.129 1.00 51.43  ? 419 HOH A O     1 
HETATM 5202 O  O     . HOH Q 10 .   ? -34.897 26.597 6.094   1.00 56.60  ? 420 HOH A O     1 
HETATM 5203 O  O     . HOH Q 10 .   ? -62.232 39.108 -53.019 1.00 43.77  ? 421 HOH A O     1 
HETATM 5204 O  O     . HOH Q 10 .   ? -60.875 48.255 -23.446 1.00 56.19  ? 422 HOH A O     1 
HETATM 5205 O  O     . HOH Q 10 .   ? -36.820 15.192 -7.931  1.00 58.04  ? 423 HOH A O     1 
HETATM 5206 O  O     . HOH Q 10 .   ? -38.862 14.870 -9.800  1.00 59.21  ? 424 HOH A O     1 
HETATM 5207 O  O     . HOH Q 10 .   ? -31.735 49.781 -12.419 1.00 49.40  ? 425 HOH A O     1 
HETATM 5208 O  O     . HOH Q 10 .   ? -48.526 48.687 -5.618  1.00 38.45  ? 426 HOH A O     1 
HETATM 5209 O  O     . HOH Q 10 .   ? -34.512 58.175 8.724   1.00 61.88  ? 427 HOH A O     1 
HETATM 5210 O  O     . HOH Q 10 .   ? -39.628 26.492 -40.002 1.00 37.48  ? 428 HOH A O     1 
HETATM 5211 O  O     . HOH Q 10 .   ? -36.709 53.814 18.528  1.00 41.43  ? 429 HOH A O     1 
HETATM 5212 O  O     . HOH Q 10 .   ? -49.215 20.275 -34.212 1.00 41.39  ? 430 HOH A O     1 
HETATM 5213 O  O     . HOH Q 10 .   ? -54.438 22.736 -28.432 1.00 43.08  ? 431 HOH A O     1 
HETATM 5214 O  O     . HOH Q 10 .   ? -34.616 34.770 10.822  1.00 39.75  ? 432 HOH A O     1 
HETATM 5215 O  O     . HOH Q 10 .   ? -61.849 34.920 -60.021 1.00 54.95  ? 433 HOH A O     1 
HETATM 5216 O  O     . HOH Q 10 .   ? -47.018 26.878 -38.471 1.00 34.78  ? 434 HOH A O     1 
HETATM 5217 O  O     . HOH Q 10 .   ? -39.884 32.139 -12.858 1.00 39.44  ? 435 HOH A O     1 
HETATM 5218 O  O     . HOH Q 10 .   ? -42.963 32.627 -15.828 1.00 58.37  ? 436 HOH A O     1 
HETATM 5219 O  O     . HOH Q 10 .   ? -48.187 40.414 -22.695 1.00 63.72  ? 437 HOH A O     1 
HETATM 5220 O  O     . HOH Q 10 .   ? -52.400 44.022 -22.664 1.00 41.95  ? 438 HOH A O     1 
HETATM 5221 O  O     . HOH Q 10 .   ? -58.245 40.619 -20.461 1.00 47.36  ? 439 HOH A O     1 
HETATM 5222 O  O     . HOH Q 10 .   ? -58.809 38.613 -22.160 1.00 54.59  ? 440 HOH A O     1 
HETATM 5223 O  O     . HOH Q 10 .   ? -65.217 26.992 -30.684 1.00 50.34  ? 441 HOH A O     1 
HETATM 5224 O  O     . HOH Q 10 .   ? -30.702 20.859 -14.439 1.00 51.52  ? 442 HOH A O     1 
HETATM 5225 O  O     . HOH Q 10 .   ? -31.627 55.623 -6.719  1.00 33.91  ? 443 HOH A O     1 
HETATM 5226 O  O     . HOH Q 10 .   ? -29.409 54.002 -6.680  1.00 27.81  ? 444 HOH A O     1 
HETATM 5227 O  O     . HOH Q 10 .   ? -28.090 52.005 -4.931  1.00 32.94  ? 445 HOH A O     1 
HETATM 5228 O  O     . HOH Q 10 .   ? -52.112 18.845 -49.321 1.00 47.57  ? 446 HOH A O     1 
HETATM 5229 O  O     . HOH Q 10 .   ? -57.173 20.044 -47.269 1.00 44.01  ? 447 HOH A O     1 
HETATM 5230 O  O     . HOH Q 10 .   ? -55.299 18.554 -43.329 1.00 54.61  ? 448 HOH A O     1 
HETATM 5231 O  O     . HOH Q 10 .   ? -57.947 18.447 -43.848 1.00 72.16  ? 449 HOH A O     1 
HETATM 5232 O  O     . HOH Q 10 .   ? -16.502 46.320 -23.242 1.00 51.71  ? 450 HOH A O     1 
HETATM 5233 O  O     . HOH Q 10 .   ? -44.679 19.629 -41.186 1.00 45.32  ? 451 HOH A O     1 
HETATM 5234 O  O     . HOH Q 10 .   ? -44.676 27.798 -39.916 1.00 41.13  ? 452 HOH A O     1 
HETATM 5235 O  O     . HOH Q 10 .   ? -43.429 29.931 -40.701 1.00 46.97  ? 453 HOH A O     1 
HETATM 5236 O  O     . HOH Q 10 .   ? -48.009 30.480 -38.430 1.00 36.63  ? 454 HOH A O     1 
HETATM 5237 O  O     . HOH Q 10 .   ? -57.305 28.524 -44.350 1.00 45.98  ? 455 HOH A O     1 
HETATM 5238 O  O     . HOH Q 10 .   ? -41.710 50.319 -9.107  1.00 44.45  ? 456 HOH A O     1 
HETATM 5239 O  O     . HOH Q 10 .   ? -40.329 32.875 -15.777 1.00 41.19  ? 457 HOH A O     1 
HETATM 5240 O  O     . HOH Q 10 .   ? -34.281 24.415 -14.427 1.00 43.49  ? 458 HOH A O     1 
HETATM 5241 O  O     . HOH Q 10 .   ? -26.164 21.950 -9.345  1.00 65.54  ? 459 HOH A O     1 
HETATM 5242 O  O     . HOH Q 10 .   ? -25.479 22.293 -6.134  1.00 63.30  ? 460 HOH A O     1 
HETATM 5243 O  O     . HOH Q 10 .   ? -16.585 26.316 -6.151  1.00 80.56  ? 461 HOH A O     1 
HETATM 5244 O  O     . HOH Q 10 .   ? -47.414 50.089 -16.592 1.00 42.48  ? 462 HOH A O     1 
HETATM 5245 O  O     . HOH Q 10 .   ? -58.432 20.187 -59.681 1.00 60.02  ? 463 HOH A O     1 
HETATM 5246 O  O     . HOH Q 10 .   ? -49.012 37.317 -10.414 1.00 37.50  ? 464 HOH A O     1 
HETATM 5247 O  O     . HOH Q 10 .   ? -42.663 27.700 -7.279  1.00 58.58  ? 465 HOH A O     1 
HETATM 5248 O  O     . HOH Q 10 .   ? -33.432 57.596 14.827  1.00 54.02  ? 466 HOH A O     1 
HETATM 5249 O  O     . HOH Q 10 .   ? -33.897 56.089 6.147   1.00 51.71  ? 467 HOH A O     1 
HETATM 5250 O  O     . HOH Q 10 .   ? -32.174 52.465 0.228   1.00 36.86  ? 468 HOH A O     1 
HETATM 5251 O  O     . HOH Q 10 .   ? -48.964 27.064 -23.088 1.00 41.22  ? 469 HOH A O     1 
HETATM 5252 O  O     . HOH Q 10 .   ? -49.198 28.852 -21.323 1.00 38.85  ? 470 HOH A O     1 
HETATM 5253 O  O     . HOH Q 10 .   ? -49.458 37.650 -7.794  1.00 38.70  ? 471 HOH A O     1 
HETATM 5254 O  O     . HOH Q 10 .   ? -40.803 60.522 -9.958  1.00 47.99  ? 472 HOH A O     1 
HETATM 5255 O  O     . HOH Q 10 .   ? -39.484 47.710 -5.495  1.00 36.58  ? 473 HOH A O     1 
HETATM 5256 O  O     . HOH Q 10 .   ? -36.526 50.342 -7.405  1.00 44.73  ? 474 HOH A O     1 
HETATM 5257 O  O     . HOH Q 10 .   ? -27.823 50.233 -14.375 1.00 37.31  ? 475 HOH A O     1 
HETATM 5258 O  O     . HOH Q 10 .   ? -30.063 48.200 -13.827 1.00 51.84  ? 476 HOH A O     1 
HETATM 5259 O  O     . HOH Q 10 .   ? -50.622 39.016 4.155   1.00 60.62  ? 477 HOH A O     1 
HETATM 5260 O  O     . HOH Q 10 .   ? -38.328 46.195 -7.539  1.00 41.07  ? 478 HOH A O     1 
HETATM 5261 O  O     . HOH Q 10 .   ? -92.158 28.157 -61.273 1.00 60.20  ? 479 HOH A O     1 
HETATM 5262 O  O     . HOH Q 10 .   ? -42.431 22.597 -28.391 1.00 63.63  ? 480 HOH A O     1 
HETATM 5263 O  O     . HOH Q 10 .   ? -45.888 22.501 -26.935 1.00 51.07  ? 481 HOH A O     1 
HETATM 5264 O  O     . HOH Q 10 .   ? -50.643 22.598 -16.667 1.00 56.90  ? 482 HOH A O     1 
HETATM 5265 O  O     . HOH Q 10 .   ? -50.011 25.469 -15.890 1.00 60.05  ? 483 HOH A O     1 
HETATM 5266 O  O     . HOH Q 10 .   ? -44.644 34.602 -23.994 1.00 62.04  ? 484 HOH A O     1 
HETATM 5267 O  O     . HOH Q 10 .   ? -24.880 37.746 -3.732  1.00 55.34  ? 485 HOH A O     1 
HETATM 5268 O  O     . HOH Q 10 .   ? -53.506 53.875 -4.723  1.00 54.16  ? 486 HOH A O     1 
HETATM 5269 O  O     . HOH Q 10 .   ? -55.056 27.211 -53.498 1.00 36.30  ? 487 HOH A O     1 
HETATM 5270 O  O     . HOH Q 10 .   ? -64.752 31.018 -35.347 1.00 49.59  ? 488 HOH A O     1 
HETATM 5271 O  O     . HOH Q 10 .   ? -52.140 54.080 -13.581 1.00 63.71  ? 489 HOH A O     1 
HETATM 5272 O  O     . HOH Q 10 .   ? -52.654 21.722 -26.411 1.00 47.39  ? 490 HOH A O     1 
HETATM 5273 O  O     . HOH Q 10 .   ? -50.584 39.336 0.019   1.00 46.93  ? 491 HOH A O     1 
HETATM 5274 O  O     . HOH Q 10 .   ? -36.675 45.785 -11.617 1.00 42.68  ? 492 HOH A O     1 
HETATM 5275 O  O     . HOH Q 10 .   ? -57.079 41.092 -37.175 1.00 49.70  ? 493 HOH A O     1 
HETATM 5276 O  O     . HOH Q 10 .   ? -56.149 43.461 -25.918 1.00 51.60  ? 494 HOH A O     1 
HETATM 5277 O  O     . HOH Q 10 .   ? -49.863 33.317 -34.773 1.00 37.46  ? 495 HOH A O     1 
HETATM 5278 O  O     . HOH Q 10 .   ? -46.490 55.435 -5.566  1.00 52.48  ? 496 HOH A O     1 
HETATM 5279 O  O     . HOH Q 10 .   ? -43.932 30.264 -17.860 1.00 45.00  ? 497 HOH A O     1 
HETATM 5280 O  O     . HOH Q 10 .   ? -27.443 54.035 -0.809  1.00 37.37  ? 498 HOH A O     1 
HETATM 5281 O  O     . HOH Q 10 .   ? -71.977 32.512 -54.616 1.00 37.41  ? 499 HOH A O     1 
HETATM 5282 O  O     . HOH Q 10 .   ? -32.965 62.606 3.948   1.00 61.77  ? 500 HOH A O     1 
HETATM 5283 O  O     . HOH Q 10 .   ? -66.162 23.011 -40.774 1.00 69.45  ? 501 HOH A O     1 
HETATM 5284 O  O     . HOH Q 10 .   ? -64.374 35.967 -63.529 1.00 63.49  ? 502 HOH A O     1 
HETATM 5285 O  O     . HOH Q 10 .   ? -33.562 48.517 -10.424 1.00 29.52  ? 503 HOH A O     1 
HETATM 5286 O  O     . HOH Q 10 .   ? -40.409 21.114 -15.789 1.00 50.41  ? 504 HOH A O     1 
HETATM 5287 O  O     . HOH Q 10 .   ? -37.568 58.312 0.752   1.00 69.00  ? 505 HOH A O     1 
HETATM 5288 O  O     . HOH Q 10 .   ? -38.372 55.652 4.417   1.00 44.95  ? 506 HOH A O     1 
HETATM 5289 O  O     . HOH Q 10 .   ? -35.548 22.561 -35.842 1.00 58.86  ? 507 HOH A O     1 
HETATM 5290 O  O     . HOH Q 10 .   ? -21.941 31.654 -22.378 1.00 56.18  ? 508 HOH A O     1 
HETATM 5291 O  O     . HOH Q 10 .   ? -45.531 56.319 -3.312  1.00 44.48  ? 509 HOH A O     1 
HETATM 5292 O  O     . HOH Q 10 .   ? -63.004 28.853 -31.570 1.00 38.90  ? 510 HOH A O     1 
HETATM 5293 O  O     . HOH Q 10 .   ? -59.092 19.725 -36.473 1.00 55.57  ? 511 HOH A O     1 
HETATM 5294 O  O     . HOH Q 10 .   ? -61.832 20.610 -36.420 1.00 47.73  ? 512 HOH A O     1 
HETATM 5295 O  O     . HOH Q 10 .   ? -37.467 26.645 -36.784 1.00 76.56  ? 513 HOH A O     1 
HETATM 5296 O  O     . HOH Q 10 .   ? -51.913 38.374 -28.766 1.00 65.40  ? 514 HOH A O     1 
HETATM 5297 O  O     . HOH Q 10 .   ? -41.768 30.100 -36.353 1.00 54.74  ? 515 HOH A O     1 
HETATM 5298 O  O     . HOH Q 10 .   ? -52.930 53.831 -7.588  1.00 46.56  ? 516 HOH A O     1 
HETATM 5299 O  O     . HOH Q 10 .   ? -28.259 36.198 1.974   1.00 64.46  ? 517 HOH A O     1 
HETATM 5300 O  O     . HOH Q 10 .   ? -50.790 17.620 -20.271 1.00 57.15  ? 518 HOH A O     1 
HETATM 5301 O  O     . HOH Q 10 .   ? -55.609 47.906 -31.912 1.00 64.55  ? 519 HOH A O     1 
HETATM 5302 O  O     . HOH Q 10 .   ? -34.501 48.059 -7.815  1.00 38.78  ? 520 HOH A O     1 
HETATM 5303 O  O     . HOH Q 10 .   ? -47.704 51.414 -15.428 1.00 44.20  ? 521 HOH A O     1 
HETATM 5304 O  O     . HOH Q 10 .   ? -52.035 34.572 -4.490  1.00 63.39  ? 522 HOH A O     1 
HETATM 5305 O  O     . HOH Q 10 .   ? -35.867 18.119 1.220   1.00 69.54  ? 523 HOH A O     1 
HETATM 5306 O  O     . HOH Q 10 .   ? -48.441 21.926 -17.207 1.00 60.02  ? 524 HOH A O     1 
HETATM 5307 O  O     . HOH Q 10 .   ? -57.481 27.866 -36.117 1.00 43.03  ? 525 HOH A O     1 
HETATM 5308 O  O     . HOH Q 10 .   ? -63.523 39.872 -54.765 1.00 46.53  ? 526 HOH A O     1 
HETATM 5309 O  O     . HOH Q 10 .   ? -26.363 52.112 -2.544  1.00 34.00  ? 527 HOH A O     1 
HETATM 5310 O  O     . HOH Q 10 .   ? -24.798 50.625 -2.328  1.00 46.26  ? 528 HOH A O     1 
HETATM 5311 O  O     . HOH Q 10 .   ? -23.327 50.250 -3.987  1.00 53.41  ? 529 HOH A O     1 
HETATM 5312 O  O     . HOH Q 10 .   ? -47.053 46.543 6.657   1.00 59.30  ? 530 HOH A O     1 
HETATM 5313 O  O     . HOH Q 10 .   ? -45.132 27.959 -31.896 1.00 53.68  ? 531 HOH A O     1 
HETATM 5314 O  O     . HOH Q 10 .   ? -69.628 34.104 -55.018 1.00 53.74  ? 532 HOH A O     1 
HETATM 5315 O  O     . HOH Q 10 .   ? -26.932 37.606 -22.110 1.00 43.80  ? 533 HOH A O     1 
HETATM 5316 O  O     . HOH Q 10 .   ? -35.090 30.707 -16.439 1.00 39.07  ? 534 HOH A O     1 
HETATM 5317 O  O     . HOH Q 10 .   ? -64.837 38.015 -56.618 1.00 54.87  ? 535 HOH A O     1 
HETATM 5318 O  O     . HOH Q 10 .   ? -21.603 56.573 3.895   1.00 55.29  ? 536 HOH A O     1 
HETATM 5319 O  O     . HOH Q 10 .   ? -69.878 35.179 -57.095 1.00 51.94  ? 537 HOH A O     1 
HETATM 5320 O  O     . HOH Q 10 .   ? -44.739 31.454 -41.959 1.00 43.93  ? 538 HOH A O     1 
HETATM 5321 O  O     . HOH Q 10 .   ? -44.036 20.726 -27.337 1.00 68.48  ? 539 HOH A O     1 
HETATM 5322 O  O     . HOH Q 10 .   ? -43.103 36.482 -25.174 1.00 54.57  ? 540 HOH A O     1 
HETATM 5323 O  O     . HOH Q 10 .   ? -42.335 27.790 -17.990 1.00 16.04  ? 541 HOH A O     1 
HETATM 5324 O  O     . HOH Q 10 .   ? -47.786 37.154 -26.578 1.00 57.44  ? 542 HOH A O     1 
HETATM 5325 O  O     . HOH Q 10 .   ? -32.753 28.288 -17.127 1.00 41.78  ? 543 HOH A O     1 
HETATM 5326 O  O     . HOH Q 10 .   ? -34.774 26.817 -15.866 1.00 38.57  ? 544 HOH A O     1 
HETATM 5327 O  O     . HOH R 10 .   ? -15.255 34.800 20.874  1.00 58.88  ? 395 HOH B O     1 
HETATM 5328 O  O     . HOH R 10 .   ? -48.506 41.715 10.064  1.00 52.88  ? 396 HOH B O     1 
HETATM 5329 O  O     . HOH R 10 .   ? -44.834 39.152 19.970  1.00 55.68  ? 397 HOH B O     1 
HETATM 5330 O  O     . HOH R 10 .   ? -32.547 37.209 17.503  1.00 43.07  ? 398 HOH B O     1 
HETATM 5331 O  O     . HOH R 10 .   ? -28.978 48.622 15.889  1.00 47.27  ? 399 HOH B O     1 
HETATM 5332 O  O     . HOH R 10 .   ? -29.648 47.082 1.376   1.00 50.94  ? 400 HOH B O     1 
HETATM 5333 O  O     . HOH R 10 .   ? -14.401 30.293 6.634   1.00 48.40  ? 401 HOH B O     1 
HETATM 5334 O  O     . HOH R 10 .   ? -34.631 54.603 21.698  1.00 54.62  ? 402 HOH B O     1 
HETATM 5335 O  O     . HOH R 10 .   ? -41.959 34.814 7.805   1.00 29.07  ? 403 HOH B O     1 
HETATM 5336 O  O     . HOH R 10 .   ? -38.291 35.479 10.296  1.00 41.02  ? 404 HOH B O     1 
HETATM 5337 O  O     . HOH R 10 .   ? -34.437 34.257 22.032  1.00 45.62  ? 405 HOH B O     1 
HETATM 5338 O  O     . HOH R 10 .   ? -29.079 47.853 28.697  1.00 50.80  ? 406 HOH B O     1 
HETATM 5339 O  O     . HOH R 10 .   ? -30.535 47.366 26.617  1.00 61.75  ? 407 HOH B O     1 
HETATM 5340 O  O     . HOH R 10 .   ? -31.410 46.246 30.378  1.00 65.49  ? 408 HOH B O     1 
HETATM 5341 O  O     . HOH R 10 .   ? -17.010 39.981 20.517  1.00 44.00  ? 409 HOH B O     1 
HETATM 5342 O  O     . HOH R 10 .   ? -40.004 33.842 9.230   1.00 51.76  ? 410 HOH B O     1 
HETATM 5343 O  O     . HOH R 10 .   ? -15.991 47.820 28.414  1.00 76.03  ? 411 HOH B O     1 
HETATM 5344 O  O     . HOH R 10 .   ? -13.486 53.121 13.336  1.00 57.34  ? 412 HOH B O     1 
HETATM 5345 O  O     . HOH R 10 .   ? -24.362 37.968 -1.262  1.00 56.37  ? 413 HOH B O     1 
HETATM 5346 O  O     . HOH R 10 .   ? -15.783 53.870 19.693  1.00 70.76  ? 414 HOH B O     1 
HETATM 5347 O  O     . HOH R 10 .   ? -5.172  40.121 9.282   1.00 55.27  ? 415 HOH B O     1 
HETATM 5348 O  O     . HOH R 10 .   ? -45.292 36.836 14.357  1.00 59.50  ? 416 HOH B O     1 
HETATM 5349 O  O     . HOH R 10 .   ? -9.713  36.597 16.857  1.00 49.91  ? 417 HOH B O     1 
HETATM 5350 O  O     . HOH R 10 .   ? -13.843 51.160 20.879  1.00 70.59  ? 418 HOH B O     1 
HETATM 5351 O  O     . HOH R 10 .   ? -20.788 43.657 -0.604  1.00 47.86  ? 419 HOH B O     1 
HETATM 5352 O  O     . HOH R 10 .   ? -10.048 44.940 2.933   1.00 69.81  ? 420 HOH B O     1 
HETATM 5353 O  O     . HOH R 10 .   ? -13.328 42.563 0.767   1.00 55.85  ? 421 HOH B O     1 
HETATM 5354 O  O     . HOH R 10 .   ? -15.941 38.025 0.473   1.00 46.45  ? 422 HOH B O     1 
HETATM 5355 O  O     . HOH R 10 .   ? -20.202 38.109 -0.680  1.00 45.59  ? 423 HOH B O     1 
HETATM 5356 O  O     . HOH R 10 .   ? -43.498 28.194 13.017  1.00 53.73  ? 424 HOH B O     1 
HETATM 5357 O  O     . HOH R 10 .   ? -5.457  47.981 13.972  1.00 65.80  ? 425 HOH B O     1 
HETATM 5358 O  O     . HOH R 10 .   ? -22.073 48.985 23.909  1.00 59.24  ? 426 HOH B O     1 
HETATM 5359 O  O     . HOH R 10 .   ? -20.997 51.373 24.571  1.00 66.38  ? 427 HOH B O     1 
HETATM 5360 O  O     . HOH R 10 .   ? -11.823 31.976 5.121   1.00 57.87  ? 428 HOH B O     1 
HETATM 5361 O  O     . HOH R 10 .   ? -17.876 22.628 3.300   1.00 66.46  ? 429 HOH B O     1 
HETATM 5362 O  O     . HOH R 10 .   ? -22.373 38.970 19.731  1.00 66.27  ? 430 HOH B O     1 
HETATM 5363 O  O     . HOH R 10 .   ? -36.218 38.300 21.408  1.00 49.24  ? 431 HOH B O     1 
HETATM 5364 O  O     . HOH R 10 .   ? -21.362 52.309 3.340   1.00 56.96  ? 432 HOH B O     1 
HETATM 5365 O  O     . HOH R 10 .   ? -19.770 44.920 1.574   1.00 50.76  ? 433 HOH B O     1 
HETATM 5366 O  O     . HOH R 10 .   ? -12.717 33.540 19.814  1.00 55.07  ? 434 HOH B O     1 
HETATM 5367 O  O     . HOH R 10 .   ? -13.764 37.267 20.098  1.00 65.09  ? 435 HOH B O     1 
HETATM 5368 O  O     . HOH R 10 .   ? -17.262 31.401 5.706   1.00 49.33  ? 436 HOH B O     1 
HETATM 5369 O  O     . HOH R 10 .   ? -20.151 32.263 5.641   1.00 51.91  ? 437 HOH B O     1 
HETATM 5370 O  O     . HOH R 10 .   ? -20.963 23.367 2.272   1.00 60.17  ? 438 HOH B O     1 
HETATM 5371 O  O     . HOH R 10 .   ? -19.800 42.090 21.180  1.00 53.96  ? 439 HOH B O     1 
HETATM 5372 O  O     . HOH S 10 .   ? -29.235 54.761 -16.420 1.00 34.81  ? 21  HOH C O     1 
HETATM 5373 O  O     . HOH S 10 .   ? -42.533 54.826 -14.301 1.00 28.56  ? 23  HOH C O     1 
HETATM 5374 O  O     . HOH S 10 .   ? -32.537 50.916 -20.104 1.00 38.56  ? 39  HOH C O     1 
HETATM 5375 O  O     . HOH S 10 .   ? -34.752 51.298 -19.002 1.00 42.37  ? 40  HOH C O     1 
HETATM 5376 O  O     . HOH S 10 .   ? -40.280 59.862 -23.857 1.00 44.69  ? 48  HOH C O     1 
HETATM 5377 O  O     . HOH S 10 .   ? -60.651 21.910 -14.270 1.00 59.83  ? 54  HOH C O     1 
HETATM 5378 O  O     . HOH S 10 .   ? -40.918 74.574 -8.903  1.00 51.10  ? 58  HOH C O     1 
HETATM 5379 O  O     . HOH S 10 .   ? -35.726 59.010 -14.510 1.00 32.59  ? 64  HOH C O     1 
HETATM 5380 O  O     . HOH S 10 .   ? -45.773 70.325 -23.432 1.00 53.70  ? 91  HOH C O     1 
HETATM 5381 O  O     . HOH S 10 .   ? -30.973 56.763 -20.564 1.00 41.08  ? 92  HOH C O     1 
HETATM 5382 O  O     . HOH S 10 .   ? -34.167 57.238 -13.206 1.00 53.78  ? 93  HOH C O     1 
HETATM 5383 O  O     . HOH S 10 .   ? -44.888 52.866 -14.311 1.00 41.76  ? 118 HOH C O     1 
HETATM 5384 O  O     . HOH S 10 .   ? -47.469 49.465 -19.174 1.00 56.64  ? 120 HOH C O     1 
HETATM 5385 O  O     . HOH S 10 .   ? -46.950 39.449 -10.189 1.00 41.98  ? 125 HOH C O     1 
HETATM 5386 O  O     . HOH S 10 .   ? -51.520 34.743 -18.972 1.00 37.85  ? 133 HOH C O     1 
HETATM 5387 O  O     . HOH S 10 .   ? -46.165 68.775 -10.033 1.00 49.54  ? 145 HOH C O     1 
HETATM 5388 O  O     . HOH S 10 .   ? -47.508 40.233 -7.596  1.00 43.39  ? 155 HOH C O     1 
HETATM 5389 O  O     . HOH S 10 .   ? -40.151 44.713 -8.562  1.00 40.32  ? 157 HOH C O     1 
HETATM 5390 O  O     . HOH S 10 .   ? -49.401 45.361 -11.031 1.00 54.73  ? 191 HOH C O     1 
HETATM 5391 O  O     . HOH S 10 .   ? -47.471 46.590 -9.871  1.00 43.64  ? 192 HOH C O     1 
HETATM 5392 O  O     . HOH S 10 .   ? -42.852 52.388 -14.890 1.00 38.80  ? 207 HOH C O     1 
HETATM 5393 O  O     . HOH S 10 .   ? -44.635 41.490 -23.500 1.00 53.32  ? 253 HOH C O     1 
HETATM 5394 O  O     . HOH S 10 .   ? -30.189 51.656 -12.720 1.00 48.88  ? 254 HOH C O     1 
HETATM 5395 O  O     . HOH S 10 .   ? -47.446 43.455 -22.289 1.00 51.88  ? 277 HOH C O     1 
HETATM 5396 O  O     . HOH S 10 .   ? -46.209 63.859 -20.266 1.00 45.97  ? 291 HOH C O     1 
HETATM 5397 O  O     . HOH S 10 .   ? -34.765 84.213 -6.224  1.00 76.66  ? 304 HOH C O     1 
HETATM 5398 O  O     . HOH S 10 .   ? -38.254 59.043 -13.901 1.00 47.94  ? 317 HOH C O     1 
HETATM 5399 O  O     . HOH S 10 .   ? -48.512 35.344 -12.248 1.00 43.46  ? 318 HOH C O     1 
HETATM 5400 O  O     . HOH S 10 .   ? -57.895 20.987 -14.131 1.00 54.17  ? 319 HOH C O     1 
HETATM 5401 O  O     . HOH S 10 .   ? -43.515 40.087 -25.388 1.00 48.42  ? 328 HOH C O     1 
HETATM 5402 O  O     . HOH S 10 .   ? -44.104 70.881 -9.591  1.00 51.02  ? 334 HOH C O     1 
HETATM 5403 O  O     . HOH T 10 .   ? -30.862 33.971 -19.132 1.00 57.96  ? 25  HOH D O     1 
HETATM 5404 O  O     . HOH T 10 .   ? -34.686 34.262 -17.216 1.00 33.58  ? 26  HOH D O     1 
HETATM 5405 O  O     . HOH T 10 .   ? -36.393 49.097 -21.868 1.00 52.16  ? 37  HOH D O     1 
HETATM 5406 O  O     . HOH T 10 .   ? -36.890 51.819 -22.863 1.00 37.21  ? 38  HOH D O     1 
HETATM 5407 O  O     . HOH T 10 .   ? -35.654 48.742 -19.142 1.00 48.09  ? 41  HOH D O     1 
HETATM 5408 O  O     . HOH T 10 .   ? -45.957 53.890 -17.769 1.00 48.75  ? 55  HOH D O     1 
HETATM 5409 O  O     . HOH T 10 .   ? -44.811 51.231 -26.751 1.00 45.03  ? 60  HOH D O     1 
HETATM 5410 O  O     . HOH T 10 .   ? -40.854 59.882 -12.848 1.00 36.31  ? 136 HOH D O     1 
HETATM 5411 O  O     . HOH T 10 .   ? -48.414 66.517 -14.048 1.00 55.15  ? 147 HOH D O     1 
HETATM 5412 O  O     . HOH T 10 .   ? -31.215 48.182 -25.689 1.00 42.08  ? 184 HOH D O     1 
HETATM 5413 O  O     . HOH T 10 .   ? -44.132 87.274 -22.670 1.00 57.42  ? 196 HOH D O     1 
HETATM 5414 O  O     . HOH T 10 .   ? -45.749 59.390 -9.326  1.00 62.57  ? 205 HOH D O     1 
HETATM 5415 O  O     . HOH T 10 .   ? -37.237 71.921 -15.891 1.00 58.66  ? 235 HOH D O     1 
HETATM 5416 O  O     . HOH T 10 .   ? -46.166 51.705 -19.130 1.00 50.06  ? 259 HOH D O     1 
HETATM 5417 O  O     . HOH T 10 .   ? -43.182 61.818 -9.933  1.00 49.25  ? 265 HOH D O     1 
HETATM 5418 O  O     . HOH T 10 .   ? -40.442 75.589 -18.157 1.00 57.56  ? 294 HOH D O     1 
HETATM 5419 O  O     . HOH T 10 .   ? -42.237 57.532 -13.107 1.00 42.29  ? 302 HOH D O     1 
HETATM 5420 O  O     . HOH T 10 .   ? -46.638 67.735 -12.553 1.00 53.55  ? 333 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   PRO 2   -1  ?   ?   ?   A . n 
A 1 3   GLY 3   0   ?   ?   ?   A . n 
A 1 4   CYS 4   1   ?   ?   ?   A . n 
A 1 5   ASN 5   2   ?   ?   ?   A . n 
A 1 6   THR 6   3   ?   ?   ?   A . n 
A 1 7   LYS 7   4   ?   ?   ?   A . n 
A 1 8   LYS 8   5   ?   ?   ?   A . n 
A 1 9   PRO 9   6   ?   ?   ?   A . n 
A 1 10  ASN 10  7   ?   ?   ?   A . n 
A 1 11  LEU 11  8   8   LEU LEU A . n 
A 1 12  ASP 12  9   9   ASP ASP A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  GLU 14  11  11  GLU GLU A . n 
A 1 15  LEU 15  12  12  LEU LEU A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  GLN 17  14  14  GLN GLN A . n 
A 1 18  LEU 18  15  15  LEU LEU A . n 
A 1 19  LEU 19  16  16  LEU LEU A . n 
A 1 20  GLN 20  17  17  GLN GLN A . n 
A 1 21  GLY 21  18  18  GLY GLY A . n 
A 1 22  HIS 22  19  19  HIS HIS A . n 
A 1 23  TYR 23  20  20  TYR TYR A . n 
A 1 24  ILE 24  21  21  ILE ILE A . n 
A 1 25  LYS 25  22  22  LYS LYS A . n 
A 1 26  GLY 26  23  23  GLY GLY A . n 
A 1 27  TYR 27  24  24  TYR TYR A . n 
A 1 28  PRO 28  25  25  PRO PRO A . n 
A 1 29  LYS 29  26  26  LYS LYS A . n 
A 1 30  GLN 30  27  27  GLN GLN A . n 
A 1 31  TYR 31  28  28  TYR TYR A . n 
A 1 32  THR 32  29  29  THR THR A . n 
A 1 33  TYR 33  30  30  TYR TYR A . n 
A 1 34  PHE 34  31  31  PHE PHE A . n 
A 1 35  LEU 35  32  32  LEU LEU A . n 
A 1 36  GLU 36  33  33  GLU GLU A . n 
A 1 37  ASP 37  34  34  ASP ASP A . n 
A 1 38  GLY 38  35  35  GLY GLY A . n 
A 1 39  LYS 39  36  36  LYS LYS A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  LYS 41  38  38  LYS LYS A . n 
A 1 42  VAL 42  39  39  VAL VAL A . n 
A 1 43  SER 43  40  40  SER SER A . n 
A 1 44  ARG 44  41  41  ARG ARG A . n 
A 1 45  PRO 45  42  42  PRO PRO A . n 
A 1 46  GLU 46  43  43  GLU GLU A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  VAL 48  45  45  VAL VAL A . n 
A 1 49  LYS 49  46  46  LYS LYS A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  PRO 52  49  49  PRO PRO A . n 
A 1 53  PRO 53  50  50  PRO PRO A . n 
A 1 54  GLN 54  51  51  GLN GLN A . n 
A 1 55  SER 55  52  52  SER SER A . n 
A 1 56  ASP 56  53  53  ASP ASP A . n 
A 1 57  ARG 57  54  54  ARG ARG A . n 
A 1 58  GLN 58  55  55  GLN GLN A . n 
A 1 59  LYS 59  56  56  LYS LYS A . n 
A 1 60  ILE 60  57  57  ILE ILE A . n 
A 1 61  VAL 61  58  58  VAL VAL A . n 
A 1 62  LEU 62  59  59  LEU LEU A . n 
A 1 63  GLN 63  60  60  GLN GLN A . n 
A 1 64  ALA 64  61  61  ALA ALA A . n 
A 1 65  HIS 65  62  62  HIS HIS A . n 
A 1 66  ASN 66  63  63  ASN ASN A . n 
A 1 67  LEU 67  64  64  LEU LEU A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  HIS 69  66  66  HIS HIS A . n 
A 1 70  THR 70  67  67  THR THR A . n 
A 1 71  GLY 71  68  68  GLY GLY A . n 
A 1 72  ARG 72  69  69  ARG ARG A . n 
A 1 73  GLU 73  70  70  GLU GLU A . n 
A 1 74  ALA 74  71  71  ALA ALA A . n 
A 1 75  THR 75  72  72  THR THR A . n 
A 1 76  LEU 76  73  73  LEU LEU A . n 
A 1 77  LEU 77  74  74  LEU LEU A . n 
A 1 78  LYS 78  75  75  LYS LYS A . n 
A 1 79  ILE 79  76  76  ILE ILE A . n 
A 1 80  ALA 80  77  77  ALA ALA A . n 
A 1 81  ASN 81  78  78  ASN ASN A . n 
A 1 82  LEU 82  79  79  LEU LEU A . n 
A 1 83  TYR 83  80  80  TYR TYR A . n 
A 1 84  TRP 84  81  81  TRP TRP A . n 
A 1 85  TRP 85  82  82  TRP TRP A . n 
A 1 86  PRO 86  83  83  PRO PRO A . n 
A 1 87  ASN 87  84  84  ASN ASN A . n 
A 1 88  MET 88  85  85  MET MET A . n 
A 1 89  ARG 89  86  86  ARG ARG A . n 
A 1 90  LYS 90  87  87  LYS LYS A . n 
A 1 91  ASP 91  88  88  ASP ASP A . n 
A 1 92  VAL 92  89  89  VAL VAL A . n 
A 1 93  VAL 93  90  90  VAL VAL A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  GLN 95  92  92  GLN GLN A . n 
A 1 96  LEU 96  93  93  LEU LEU A . n 
A 1 97  GLY 97  94  94  GLY GLY A . n 
A 1 98  ARG 98  95  95  ARG ARG A . n 
A 1 99  CYS 99  96  96  CYS CYS A . n 
A 1 100 GLN 100 97  97  GLN GLN A . n 
A 1 101 GLN 101 98  98  GLN GLN A . n 
A 1 102 CYS 102 99  99  CYS CYS A . n 
A 1 103 LEU 103 100 100 LEU LEU A . n 
A 1 104 ILE 104 101 101 ILE ILE A . n 
A 1 105 THR 105 102 102 THR THR A . n 
A 1 106 ASN 106 103 103 ASN ASN A . n 
A 1 107 ALA 107 104 104 ALA ALA A . n 
A 1 108 SER 108 105 105 SER SER A . n 
A 1 109 ASN 109 106 106 ASN ASN A . n 
A 1 110 LYS 110 107 107 LYS LYS A . n 
A 1 111 ALA 111 108 108 ALA ALA A . n 
A 1 112 SER 112 109 109 SER SER A . n 
A 1 113 GLY 113 110 110 GLY GLY A . n 
A 1 114 PRO 114 111 111 PRO PRO A . n 
A 1 115 ILE 115 112 112 ILE ILE A . n 
A 1 116 LEU 116 113 113 LEU LEU A . n 
A 1 117 ARG 117 114 114 ARG ARG A . n 
A 1 118 PRO 118 115 115 PRO PRO A . n 
A 1 119 ASP 119 116 116 ASP ASP A . n 
A 1 120 ARG 120 117 117 ARG ARG A . n 
A 1 121 PRO 121 118 118 PRO PRO A . n 
A 1 122 GLN 122 119 119 GLN GLN A . n 
A 1 123 LYS 123 120 120 LYS LYS A . n 
A 1 124 PRO 124 121 121 PRO PRO A . n 
A 1 125 PHE 125 122 122 PHE PHE A . n 
A 1 126 ASP 126 123 123 ASP ASP A . n 
A 1 127 LYS 127 124 124 LYS LYS A . n 
A 1 128 PHE 128 125 125 PHE PHE A . n 
A 1 129 PHE 129 126 126 PHE PHE A . n 
A 1 130 ILE 130 127 127 ILE ILE A . n 
A 1 131 ASP 131 128 128 ASP ASP A . n 
A 1 132 TYR 132 129 129 TYR TYR A . n 
A 1 133 ILE 133 130 130 ILE ILE A . n 
A 1 134 GLY 134 131 131 GLY GLY A . n 
A 1 135 PRO 135 132 132 PRO PRO A . n 
A 1 136 LEU 136 133 133 LEU LEU A . n 
A 1 137 PRO 137 134 134 PRO PRO A . n 
A 1 138 PRO 138 135 135 PRO PRO A . n 
A 1 139 SER 139 136 136 SER SER A . n 
A 1 140 GLN 140 137 137 GLN GLN A . n 
A 1 141 GLY 141 138 138 GLY GLY A . n 
A 1 142 TYR 142 139 139 TYR TYR A . n 
A 1 143 LEU 143 140 140 LEU LEU A . n 
A 1 144 TYR 144 141 141 TYR TYR A . n 
A 1 145 VAL 145 142 142 VAL VAL A . n 
A 1 146 LEU 146 143 143 LEU LEU A . n 
A 1 147 VAL 147 144 144 VAL VAL A . n 
A 1 148 VAL 148 145 145 VAL VAL A . n 
A 1 149 VAL 149 146 146 VAL VAL A . n 
A 1 150 ASP 150 147 147 ASP ASP A . n 
A 1 151 GLY 151 148 148 GLY GLY A . n 
A 1 152 MET 152 149 149 MET MET A . n 
A 1 153 THR 153 150 150 THR THR A . n 
A 1 154 GLY 154 151 151 GLY GLY A . n 
A 1 155 PHE 155 152 152 PHE PHE A . n 
A 1 156 THR 156 153 153 THR THR A . n 
A 1 157 TRP 157 154 154 TRP TRP A . n 
A 1 158 LEU 158 155 155 LEU LEU A . n 
A 1 159 TYR 159 156 156 TYR TYR A . n 
A 1 160 PRO 160 157 157 PRO PRO A . n 
A 1 161 THR 161 158 158 THR THR A . n 
A 1 162 LYS 162 159 159 LYS LYS A . n 
A 1 163 ALA 163 160 160 ALA ALA A . n 
A 1 164 PRO 164 161 161 PRO PRO A . n 
A 1 165 SER 165 162 162 SER SER A . n 
A 1 166 THR 166 163 163 THR THR A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ALA 168 165 165 ALA ALA A . n 
A 1 169 THR 169 166 166 THR THR A . n 
A 1 170 VAL 170 167 167 VAL VAL A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 SER 172 169 169 SER SER A . n 
A 1 173 LEU 173 170 170 LEU LEU A . n 
A 1 174 ASN 174 171 171 ASN ASN A . n 
A 1 175 VAL 175 172 172 VAL VAL A . n 
A 1 176 LEU 176 173 173 LEU LEU A . n 
A 1 177 THR 177 174 174 THR THR A . n 
A 1 178 SER 178 175 175 SER SER A . n 
A 1 179 ILE 179 176 176 ILE ILE A . n 
A 1 180 ALA 180 177 177 ALA ALA A . n 
A 1 181 ILE 181 178 178 ILE ILE A . n 
A 1 182 PRO 182 179 179 PRO PRO A . n 
A 1 183 LYS 183 180 180 LYS LYS A . n 
A 1 184 VAL 184 181 181 VAL VAL A . n 
A 1 185 ILE 185 182 182 ILE ILE A . n 
A 1 186 HIS 186 183 183 HIS HIS A . n 
A 1 187 SER 187 184 184 SER SER A . n 
A 1 188 ASP 188 185 185 ASP ASP A . n 
A 1 189 GLN 189 186 186 GLN GLN A . n 
A 1 190 GLY 190 187 187 GLY GLY A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 SER 195 192 192 SER SER A . n 
A 1 196 SER 196 193 193 SER SER A . n 
A 1 197 THR 197 194 194 THR THR A . n 
A 1 198 PHE 198 195 195 PHE PHE A . n 
A 1 199 ALA 199 196 196 ALA ALA A . n 
A 1 200 GLU 200 197 197 GLU GLU A . n 
A 1 201 TRP 201 198 198 TRP TRP A . n 
A 1 202 ALA 202 199 199 ALA ALA A . n 
A 1 203 LYS 203 200 200 LYS LYS A . n 
A 1 204 GLU 204 201 201 GLU GLU A . n 
A 1 205 ARG 205 202 202 ARG ARG A . n 
A 1 206 GLY 206 203 203 GLY GLY A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 HIS 208 205 205 HIS HIS A . n 
A 1 209 LEU 209 206 206 LEU LEU A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 PHE 211 208 208 PHE PHE A . n 
A 1 212 SER 212 209 209 SER SER A . n 
A 1 213 THR 213 210 210 THR THR A . n 
A 1 214 PRO 214 211 211 PRO PRO A . n 
A 1 215 TYR 215 212 212 TYR TYR A . n 
A 1 216 HIS 216 213 213 HIS HIS A . n 
A 1 217 PRO 217 214 214 PRO PRO A . n 
A 1 218 GLN 218 215 215 GLN GLN A . n 
A 1 219 SER 219 216 216 SER SER A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 GLY 221 218 218 GLY GLY A . n 
A 1 222 LYS 222 219 219 LYS LYS A . n 
A 1 223 VAL 223 220 220 VAL VAL A . n 
A 1 224 GLU 224 221 221 GLU GLU A . n 
A 1 225 ARG 225 222 222 ARG ARG A . n 
A 1 226 LYS 226 223 223 LYS LYS A . n 
A 1 227 ASN 227 224 224 ASN ASN A . n 
A 1 228 SER 228 225 225 SER SER A . n 
A 1 229 ASP 229 226 226 ASP ASP A . n 
A 1 230 ILE 230 227 227 ILE ILE A . n 
A 1 231 LYS 231 228 228 LYS LYS A . n 
A 1 232 ARG 232 229 229 ARG ARG A . n 
A 1 233 LEU 233 230 230 LEU LEU A . n 
A 1 234 LEU 234 231 231 LEU LEU A . n 
A 1 235 THR 235 232 232 THR THR A . n 
A 1 236 LYS 236 233 233 LYS LYS A . n 
A 1 237 LEU 237 234 234 LEU LEU A . n 
A 1 238 LEU 238 235 235 LEU LEU A . n 
A 1 239 VAL 239 236 236 VAL VAL A . n 
A 1 240 GLY 240 237 237 GLY GLY A . n 
A 1 241 ARG 241 238 238 ARG ARG A . n 
A 1 242 PRO 242 239 239 PRO PRO A . n 
A 1 243 THR 243 240 240 THR THR A . n 
A 1 244 LYS 244 241 241 LYS LYS A . n 
A 1 245 TRP 245 242 242 TRP TRP A . n 
A 1 246 TYR 246 243 243 TYR TYR A . n 
A 1 247 ASP 247 244 244 ASP ASP A . n 
A 1 248 LEU 248 245 245 LEU LEU A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PRO 250 247 247 PRO PRO A . n 
A 1 251 VAL 251 248 248 VAL VAL A . n 
A 1 252 VAL 252 249 249 VAL VAL A . n 
A 1 253 GLN 253 250 250 GLN GLN A . n 
A 1 254 LEU 254 251 251 LEU LEU A . n 
A 1 255 ALA 255 252 252 ALA ALA A . n 
A 1 256 LEU 256 253 253 LEU LEU A . n 
A 1 257 ASN 257 254 254 ASN ASN A . n 
A 1 258 ASN 258 255 255 ASN ASN A . n 
A 1 259 THR 259 256 256 THR THR A . n 
A 1 260 TYR 260 257 257 TYR TYR A . n 
A 1 261 SER 261 258 258 SER SER A . n 
A 1 262 PRO 262 259 259 PRO PRO A . n 
A 1 263 VAL 263 260 260 VAL VAL A . n 
A 1 264 LEU 264 261 261 LEU LEU A . n 
A 1 265 LYS 265 262 262 LYS LYS A . n 
A 1 266 TYR 266 263 263 TYR TYR A . n 
A 1 267 THR 267 264 264 THR THR A . n 
A 1 268 PRO 268 265 265 PRO PRO A . n 
A 1 269 HIS 269 266 266 HIS HIS A . n 
A 1 270 GLN 270 267 267 GLN GLN A . n 
A 1 271 LEU 271 268 268 LEU LEU A . n 
A 1 272 LEU 272 269 269 LEU LEU A . n 
A 1 273 PHE 273 270 270 PHE PHE A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 ASP 276 273 273 ASP ASP A . n 
A 1 277 SER 277 274 274 SER SER A . n 
A 1 278 ASN 278 275 275 ASN ASN A . n 
A 1 279 THR 279 276 276 THR THR A . n 
A 1 280 PRO 280 277 277 PRO PRO A . n 
A 1 281 PHE 281 278 278 PHE PHE A . n 
A 1 282 ALA 282 279 279 ALA ALA A . n 
A 1 283 ASN 283 280 280 ASN ASN A . n 
A 1 284 GLN 284 281 281 GLN GLN A . n 
A 1 285 ASP 285 282 282 ASP ASP A . n 
A 1 286 THR 286 283 283 THR THR A . n 
A 1 287 LEU 287 284 284 LEU LEU A . n 
A 1 288 ASP 288 285 285 ASP ASP A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 THR 290 287 287 THR THR A . n 
A 1 291 ARG 291 288 288 ARG ARG A . n 
A 1 292 GLU 292 289 289 GLU GLU A . n 
A 1 293 GLU 293 290 290 GLU GLU A . n 
A 1 294 GLU 294 291 291 GLU GLU A . n 
A 1 295 LEU 295 292 292 LEU LEU A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 LEU 297 294 294 LEU LEU A . n 
A 1 298 LEU 298 295 295 LEU LEU A . n 
A 1 299 GLN 299 296 296 GLN GLN A . n 
A 1 300 GLU 300 297 297 GLU GLU A . n 
A 1 301 ILE 301 298 298 ILE ILE A . n 
A 1 302 ARG 302 299 299 ARG ARG A . n 
A 1 303 THR 303 300 300 THR THR A . n 
A 1 304 SER 304 301 301 SER SER A . n 
A 1 305 LEU 305 302 302 LEU LEU A . n 
A 1 306 TYR 306 303 303 TYR TYR A . n 
A 1 307 HIS 307 304 304 HIS HIS A . n 
A 1 308 PRO 308 305 305 PRO PRO A . n 
A 1 309 SER 309 306 306 SER SER A . n 
A 1 310 THR 310 307 307 THR THR A . n 
A 1 311 PRO 311 308 308 PRO PRO A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 ALA 313 310 310 ALA ALA A . n 
A 1 314 SER 314 311 311 SER SER A . n 
A 1 315 SER 315 312 312 SER SER A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 SER 317 314 314 SER SER A . n 
A 1 318 TRP 318 315 315 TRP TRP A . n 
A 1 319 SER 319 316 316 SER SER A . n 
A 1 320 PRO 320 317 317 PRO PRO A . n 
A 1 321 VAL 321 318 318 VAL VAL A . n 
A 1 322 VAL 322 319 319 VAL VAL A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 GLN 324 321 321 GLN GLN A . n 
A 1 325 LEU 325 322 322 LEU LEU A . n 
A 1 326 VAL 326 323 323 VAL VAL A . n 
A 1 327 GLN 327 324 324 GLN GLN A . n 
A 1 328 GLU 328 325 325 GLU GLU A . n 
A 1 329 ARG 329 326 326 ARG ARG A . n 
A 1 330 VAL 330 327 327 VAL VAL A . n 
A 1 331 ALA 331 328 328 ALA ALA A . n 
A 1 332 ARG 332 329 329 ARG ARG A . n 
A 1 333 PRO 333 330 330 PRO PRO A . n 
A 1 334 ALA 334 331 331 ALA ALA A . n 
A 1 335 SER 335 332 332 SER SER A . n 
A 1 336 LEU 336 333 333 LEU LEU A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 PRO 338 335 335 PRO PRO A . n 
A 1 339 ARG 339 336 336 ARG ARG A . n 
A 1 340 TRP 340 337 337 TRP TRP A . n 
A 1 341 HIS 341 338 338 HIS HIS A . n 
A 1 342 LYS 342 339 339 LYS LYS A . n 
A 1 343 PRO 343 340 340 PRO PRO A . n 
A 1 344 SER 344 341 341 SER SER A . n 
A 1 345 THR 345 342 342 THR THR A . n 
A 1 346 VAL 346 343 343 VAL VAL A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 LYS 348 345 345 LYS LYS A . n 
A 1 349 VAL 349 346 346 VAL VAL A . n 
A 1 350 LEU 350 347 347 LEU LEU A . n 
A 1 351 ASN 351 348 348 ASN ASN A . n 
A 1 352 PRO 352 349 349 PRO PRO A . n 
A 1 353 ARG 353 350 350 ARG ARG A . n 
A 1 354 THR 354 351 351 THR THR A . n 
A 1 355 VAL 355 352 352 VAL VAL A . n 
A 1 356 VAL 356 353 353 VAL VAL A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 LEU 358 355 355 LEU LEU A . n 
A 1 359 ASP 359 356 356 ASP ASP A . n 
A 1 360 HIS 360 357 357 HIS HIS A . n 
A 1 361 LEU 361 358 358 LEU LEU A . n 
A 1 362 GLY 362 359 359 GLY GLY A . n 
A 1 363 ASN 363 360 360 ASN ASN A . n 
A 1 364 ASN 364 361 361 ASN ASN A . n 
A 1 365 ARG 365 362 362 ARG ARG A . n 
A 1 366 THR 366 363 363 THR THR A . n 
A 1 367 VAL 367 364 364 VAL VAL A . n 
A 1 368 SER 368 365 365 SER SER A . n 
A 1 369 ILE 369 366 366 ILE ILE A . n 
A 1 370 ASP 370 367 367 ASP ASP A . n 
A 1 371 ASN 371 368 368 ASN ASN A . n 
A 1 372 LEU 372 369 369 LEU LEU A . n 
A 1 373 LYS 373 370 370 LYS LYS A . n 
A 1 374 PRO 374 371 371 PRO PRO A . n 
A 1 375 THR 375 372 372 THR THR A . n 
A 1 376 SER 376 373 373 SER SER A . n 
A 1 377 HIS 377 374 374 HIS HIS A . n 
A 1 378 GLN 378 375 375 GLN GLN A . n 
A 1 379 ASN 379 376 ?   ?   ?   A . n 
A 1 380 GLY 380 377 ?   ?   ?   A . n 
A 1 381 THR 381 378 ?   ?   ?   A . n 
A 1 382 THR 382 379 ?   ?   ?   A . n 
A 1 383 ASN 383 380 ?   ?   ?   A . n 
A 1 384 ASP 384 381 ?   ?   ?   A . n 
A 1 385 THR 385 382 ?   ?   ?   A . n 
A 1 386 ALA 386 383 ?   ?   ?   A . n 
A 1 387 THR 387 384 ?   ?   ?   A . n 
A 1 388 MET 388 385 ?   ?   ?   A . n 
A 1 389 ASP 389 386 ?   ?   ?   A . n 
A 1 390 HIS 390 387 ?   ?   ?   A . n 
A 1 391 LEU 391 388 ?   ?   ?   A . n 
A 1 392 GLU 392 389 ?   ?   ?   A . n 
A 1 393 LYS 393 390 ?   ?   ?   A . n 
A 1 394 ASN 394 391 ?   ?   ?   A . n 
A 1 395 GLU 395 392 ?   ?   ?   A . n 
B 1 1   GLY 1   -2  ?   ?   ?   B . n 
B 1 2   PRO 2   -1  ?   ?   ?   B . n 
B 1 3   GLY 3   0   ?   ?   ?   B . n 
B 1 4   CYS 4   1   ?   ?   ?   B . n 
B 1 5   ASN 5   2   ?   ?   ?   B . n 
B 1 6   THR 6   3   ?   ?   ?   B . n 
B 1 7   LYS 7   4   ?   ?   ?   B . n 
B 1 8   LYS 8   5   ?   ?   ?   B . n 
B 1 9   PRO 9   6   ?   ?   ?   B . n 
B 1 10  ASN 10  7   ?   ?   ?   B . n 
B 1 11  LEU 11  8   ?   ?   ?   B . n 
B 1 12  ASP 12  9   ?   ?   ?   B . n 
B 1 13  ALA 13  10  ?   ?   ?   B . n 
B 1 14  GLU 14  11  ?   ?   ?   B . n 
B 1 15  LEU 15  12  ?   ?   ?   B . n 
B 1 16  ASP 16  13  ?   ?   ?   B . n 
B 1 17  GLN 17  14  ?   ?   ?   B . n 
B 1 18  LEU 18  15  ?   ?   ?   B . n 
B 1 19  LEU 19  16  ?   ?   ?   B . n 
B 1 20  GLN 20  17  ?   ?   ?   B . n 
B 1 21  GLY 21  18  ?   ?   ?   B . n 
B 1 22  HIS 22  19  ?   ?   ?   B . n 
B 1 23  TYR 23  20  ?   ?   ?   B . n 
B 1 24  ILE 24  21  ?   ?   ?   B . n 
B 1 25  LYS 25  22  ?   ?   ?   B . n 
B 1 26  GLY 26  23  ?   ?   ?   B . n 
B 1 27  TYR 27  24  ?   ?   ?   B . n 
B 1 28  PRO 28  25  ?   ?   ?   B . n 
B 1 29  LYS 29  26  ?   ?   ?   B . n 
B 1 30  GLN 30  27  ?   ?   ?   B . n 
B 1 31  TYR 31  28  ?   ?   ?   B . n 
B 1 32  THR 32  29  ?   ?   ?   B . n 
B 1 33  TYR 33  30  ?   ?   ?   B . n 
B 1 34  PHE 34  31  ?   ?   ?   B . n 
B 1 35  LEU 35  32  ?   ?   ?   B . n 
B 1 36  GLU 36  33  ?   ?   ?   B . n 
B 1 37  ASP 37  34  ?   ?   ?   B . n 
B 1 38  GLY 38  35  ?   ?   ?   B . n 
B 1 39  LYS 39  36  ?   ?   ?   B . n 
B 1 40  VAL 40  37  ?   ?   ?   B . n 
B 1 41  LYS 41  38  ?   ?   ?   B . n 
B 1 42  VAL 42  39  ?   ?   ?   B . n 
B 1 43  SER 43  40  ?   ?   ?   B . n 
B 1 44  ARG 44  41  ?   ?   ?   B . n 
B 1 45  PRO 45  42  ?   ?   ?   B . n 
B 1 46  GLU 46  43  ?   ?   ?   B . n 
B 1 47  GLY 47  44  ?   ?   ?   B . n 
B 1 48  VAL 48  45  ?   ?   ?   B . n 
B 1 49  LYS 49  46  ?   ?   ?   B . n 
B 1 50  ILE 50  47  ?   ?   ?   B . n 
B 1 51  ILE 51  48  ?   ?   ?   B . n 
B 1 52  PRO 52  49  ?   ?   ?   B . n 
B 1 53  PRO 53  50  ?   ?   ?   B . n 
B 1 54  GLN 54  51  ?   ?   ?   B . n 
B 1 55  SER 55  52  ?   ?   ?   B . n 
B 1 56  ASP 56  53  ?   ?   ?   B . n 
B 1 57  ARG 57  54  ?   ?   ?   B . n 
B 1 58  GLN 58  55  ?   ?   ?   B . n 
B 1 59  LYS 59  56  ?   ?   ?   B . n 
B 1 60  ILE 60  57  ?   ?   ?   B . n 
B 1 61  VAL 61  58  ?   ?   ?   B . n 
B 1 62  LEU 62  59  ?   ?   ?   B . n 
B 1 63  GLN 63  60  ?   ?   ?   B . n 
B 1 64  ALA 64  61  ?   ?   ?   B . n 
B 1 65  HIS 65  62  ?   ?   ?   B . n 
B 1 66  ASN 66  63  ?   ?   ?   B . n 
B 1 67  LEU 67  64  ?   ?   ?   B . n 
B 1 68  ALA 68  65  ?   ?   ?   B . n 
B 1 69  HIS 69  66  ?   ?   ?   B . n 
B 1 70  THR 70  67  ?   ?   ?   B . n 
B 1 71  GLY 71  68  ?   ?   ?   B . n 
B 1 72  ARG 72  69  ?   ?   ?   B . n 
B 1 73  GLU 73  70  ?   ?   ?   B . n 
B 1 74  ALA 74  71  ?   ?   ?   B . n 
B 1 75  THR 75  72  ?   ?   ?   B . n 
B 1 76  LEU 76  73  ?   ?   ?   B . n 
B 1 77  LEU 77  74  ?   ?   ?   B . n 
B 1 78  LYS 78  75  ?   ?   ?   B . n 
B 1 79  ILE 79  76  ?   ?   ?   B . n 
B 1 80  ALA 80  77  ?   ?   ?   B . n 
B 1 81  ASN 81  78  ?   ?   ?   B . n 
B 1 82  LEU 82  79  ?   ?   ?   B . n 
B 1 83  TYR 83  80  ?   ?   ?   B . n 
B 1 84  TRP 84  81  ?   ?   ?   B . n 
B 1 85  TRP 85  82  ?   ?   ?   B . n 
B 1 86  PRO 86  83  ?   ?   ?   B . n 
B 1 87  ASN 87  84  ?   ?   ?   B . n 
B 1 88  MET 88  85  ?   ?   ?   B . n 
B 1 89  ARG 89  86  ?   ?   ?   B . n 
B 1 90  LYS 90  87  ?   ?   ?   B . n 
B 1 91  ASP 91  88  ?   ?   ?   B . n 
B 1 92  VAL 92  89  ?   ?   ?   B . n 
B 1 93  VAL 93  90  ?   ?   ?   B . n 
B 1 94  LYS 94  91  ?   ?   ?   B . n 
B 1 95  GLN 95  92  ?   ?   ?   B . n 
B 1 96  LEU 96  93  ?   ?   ?   B . n 
B 1 97  GLY 97  94  ?   ?   ?   B . n 
B 1 98  ARG 98  95  ?   ?   ?   B . n 
B 1 99  CYS 99  96  ?   ?   ?   B . n 
B 1 100 GLN 100 97  ?   ?   ?   B . n 
B 1 101 GLN 101 98  ?   ?   ?   B . n 
B 1 102 CYS 102 99  ?   ?   ?   B . n 
B 1 103 LEU 103 100 ?   ?   ?   B . n 
B 1 104 ILE 104 101 ?   ?   ?   B . n 
B 1 105 THR 105 102 ?   ?   ?   B . n 
B 1 106 ASN 106 103 ?   ?   ?   B . n 
B 1 107 ALA 107 104 ?   ?   ?   B . n 
B 1 108 SER 108 105 ?   ?   ?   B . n 
B 1 109 ASN 109 106 ?   ?   ?   B . n 
B 1 110 LYS 110 107 ?   ?   ?   B . n 
B 1 111 ALA 111 108 ?   ?   ?   B . n 
B 1 112 SER 112 109 ?   ?   ?   B . n 
B 1 113 GLY 113 110 ?   ?   ?   B . n 
B 1 114 PRO 114 111 ?   ?   ?   B . n 
B 1 115 ILE 115 112 ?   ?   ?   B . n 
B 1 116 LEU 116 113 ?   ?   ?   B . n 
B 1 117 ARG 117 114 ?   ?   ?   B . n 
B 1 118 PRO 118 115 ?   ?   ?   B . n 
B 1 119 ASP 119 116 116 ASP ASP B . n 
B 1 120 ARG 120 117 117 ARG ARG B . n 
B 1 121 PRO 121 118 118 PRO PRO B . n 
B 1 122 GLN 122 119 119 GLN GLN B . n 
B 1 123 LYS 123 120 120 LYS LYS B . n 
B 1 124 PRO 124 121 121 PRO PRO B . n 
B 1 125 PHE 125 122 122 PHE PHE B . n 
B 1 126 ASP 126 123 123 ASP ASP B . n 
B 1 127 LYS 127 124 124 LYS LYS B . n 
B 1 128 PHE 128 125 125 PHE PHE B . n 
B 1 129 PHE 129 126 126 PHE PHE B . n 
B 1 130 ILE 130 127 127 ILE ILE B . n 
B 1 131 ASP 131 128 128 ASP ASP B . n 
B 1 132 TYR 132 129 129 TYR TYR B . n 
B 1 133 ILE 133 130 130 ILE ILE B . n 
B 1 134 GLY 134 131 131 GLY GLY B . n 
B 1 135 PRO 135 132 132 PRO PRO B . n 
B 1 136 LEU 136 133 133 LEU LEU B . n 
B 1 137 PRO 137 134 134 PRO PRO B . n 
B 1 138 PRO 138 135 135 PRO PRO B . n 
B 1 139 SER 139 136 136 SER SER B . n 
B 1 140 GLN 140 137 137 GLN GLN B . n 
B 1 141 GLY 141 138 138 GLY GLY B . n 
B 1 142 TYR 142 139 139 TYR TYR B . n 
B 1 143 LEU 143 140 140 LEU LEU B . n 
B 1 144 TYR 144 141 141 TYR TYR B . n 
B 1 145 VAL 145 142 142 VAL VAL B . n 
B 1 146 LEU 146 143 143 LEU LEU B . n 
B 1 147 VAL 147 144 144 VAL VAL B . n 
B 1 148 VAL 148 145 145 VAL VAL B . n 
B 1 149 VAL 149 146 146 VAL VAL B . n 
B 1 150 ASP 150 147 147 ASP ASP B . n 
B 1 151 GLY 151 148 148 GLY GLY B . n 
B 1 152 MET 152 149 149 MET MET B . n 
B 1 153 THR 153 150 150 THR THR B . n 
B 1 154 GLY 154 151 151 GLY GLY B . n 
B 1 155 PHE 155 152 152 PHE PHE B . n 
B 1 156 THR 156 153 153 THR THR B . n 
B 1 157 TRP 157 154 154 TRP TRP B . n 
B 1 158 LEU 158 155 155 LEU LEU B . n 
B 1 159 TYR 159 156 156 TYR TYR B . n 
B 1 160 PRO 160 157 157 PRO PRO B . n 
B 1 161 THR 161 158 158 THR THR B . n 
B 1 162 LYS 162 159 159 LYS LYS B . n 
B 1 163 ALA 163 160 160 ALA ALA B . n 
B 1 164 PRO 164 161 161 PRO PRO B . n 
B 1 165 SER 165 162 162 SER SER B . n 
B 1 166 THR 166 163 163 THR THR B . n 
B 1 167 SER 167 164 164 SER SER B . n 
B 1 168 ALA 168 165 165 ALA ALA B . n 
B 1 169 THR 169 166 166 THR THR B . n 
B 1 170 VAL 170 167 167 VAL VAL B . n 
B 1 171 LYS 171 168 168 LYS LYS B . n 
B 1 172 SER 172 169 169 SER SER B . n 
B 1 173 LEU 173 170 170 LEU LEU B . n 
B 1 174 ASN 174 171 171 ASN ASN B . n 
B 1 175 VAL 175 172 172 VAL VAL B . n 
B 1 176 LEU 176 173 173 LEU LEU B . n 
B 1 177 THR 177 174 174 THR THR B . n 
B 1 178 SER 178 175 175 SER SER B . n 
B 1 179 ILE 179 176 176 ILE ILE B . n 
B 1 180 ALA 180 177 177 ALA ALA B . n 
B 1 181 ILE 181 178 178 ILE ILE B . n 
B 1 182 PRO 182 179 179 PRO PRO B . n 
B 1 183 LYS 183 180 180 LYS LYS B . n 
B 1 184 VAL 184 181 181 VAL VAL B . n 
B 1 185 ILE 185 182 182 ILE ILE B . n 
B 1 186 HIS 186 183 183 HIS HIS B . n 
B 1 187 SER 187 184 184 SER SER B . n 
B 1 188 ASP 188 185 185 ASP ASP B . n 
B 1 189 GLN 189 186 186 GLN GLN B . n 
B 1 190 GLY 190 187 187 GLY GLY B . n 
B 1 191 ALA 191 188 188 ALA ALA B . n 
B 1 192 ALA 192 189 189 ALA ALA B . n 
B 1 193 PHE 193 190 190 PHE PHE B . n 
B 1 194 THR 194 191 191 THR THR B . n 
B 1 195 SER 195 192 192 SER SER B . n 
B 1 196 SER 196 193 193 SER SER B . n 
B 1 197 THR 197 194 194 THR THR B . n 
B 1 198 PHE 198 195 195 PHE PHE B . n 
B 1 199 ALA 199 196 196 ALA ALA B . n 
B 1 200 GLU 200 197 197 GLU GLU B . n 
B 1 201 TRP 201 198 198 TRP TRP B . n 
B 1 202 ALA 202 199 199 ALA ALA B . n 
B 1 203 LYS 203 200 200 LYS LYS B . n 
B 1 204 GLU 204 201 201 GLU GLU B . n 
B 1 205 ARG 205 202 202 ARG ARG B . n 
B 1 206 GLY 206 203 203 GLY GLY B . n 
B 1 207 ILE 207 204 204 ILE ILE B . n 
B 1 208 HIS 208 205 205 HIS HIS B . n 
B 1 209 LEU 209 206 206 LEU LEU B . n 
B 1 210 GLU 210 207 207 GLU GLU B . n 
B 1 211 PHE 211 208 208 PHE PHE B . n 
B 1 212 SER 212 209 209 SER SER B . n 
B 1 213 THR 213 210 210 THR THR B . n 
B 1 214 PRO 214 211 211 PRO PRO B . n 
B 1 215 TYR 215 212 212 TYR TYR B . n 
B 1 216 HIS 216 213 213 HIS HIS B . n 
B 1 217 PRO 217 214 214 PRO PRO B . n 
B 1 218 GLN 218 215 215 GLN GLN B . n 
B 1 219 SER 219 216 216 SER SER B . n 
B 1 220 SER 220 217 217 SER SER B . n 
B 1 221 GLY 221 218 218 GLY GLY B . n 
B 1 222 LYS 222 219 219 LYS LYS B . n 
B 1 223 VAL 223 220 220 VAL VAL B . n 
B 1 224 GLU 224 221 221 GLU GLU B . n 
B 1 225 ARG 225 222 222 ARG ARG B . n 
B 1 226 LYS 226 223 223 LYS LYS B . n 
B 1 227 ASN 227 224 224 ASN ASN B . n 
B 1 228 SER 228 225 225 SER SER B . n 
B 1 229 ASP 229 226 226 ASP ASP B . n 
B 1 230 ILE 230 227 227 ILE ILE B . n 
B 1 231 LYS 231 228 228 LYS LYS B . n 
B 1 232 ARG 232 229 229 ARG ARG B . n 
B 1 233 LEU 233 230 230 LEU LEU B . n 
B 1 234 LEU 234 231 231 LEU LEU B . n 
B 1 235 THR 235 232 232 THR THR B . n 
B 1 236 LYS 236 233 233 LYS LYS B . n 
B 1 237 LEU 237 234 234 LEU LEU B . n 
B 1 238 LEU 238 235 235 LEU LEU B . n 
B 1 239 VAL 239 236 236 VAL VAL B . n 
B 1 240 GLY 240 237 237 GLY GLY B . n 
B 1 241 ARG 241 238 238 ARG ARG B . n 
B 1 242 PRO 242 239 239 PRO PRO B . n 
B 1 243 THR 243 240 240 THR THR B . n 
B 1 244 LYS 244 241 241 LYS LYS B . n 
B 1 245 TRP 245 242 242 TRP TRP B . n 
B 1 246 TYR 246 243 243 TYR TYR B . n 
B 1 247 ASP 247 244 244 ASP ASP B . n 
B 1 248 LEU 248 245 245 LEU LEU B . n 
B 1 249 LEU 249 246 246 LEU LEU B . n 
B 1 250 PRO 250 247 247 PRO PRO B . n 
B 1 251 VAL 251 248 248 VAL VAL B . n 
B 1 252 VAL 252 249 249 VAL VAL B . n 
B 1 253 GLN 253 250 250 GLN GLN B . n 
B 1 254 LEU 254 251 251 LEU LEU B . n 
B 1 255 ALA 255 252 252 ALA ALA B . n 
B 1 256 LEU 256 253 253 LEU LEU B . n 
B 1 257 ASN 257 254 254 ASN ASN B . n 
B 1 258 ASN 258 255 255 ASN ASN B . n 
B 1 259 THR 259 256 256 THR THR B . n 
B 1 260 TYR 260 257 257 TYR TYR B . n 
B 1 261 SER 261 258 258 SER SER B . n 
B 1 262 PRO 262 259 259 PRO PRO B . n 
B 1 263 VAL 263 260 260 VAL VAL B . n 
B 1 264 LEU 264 261 261 LEU LEU B . n 
B 1 265 LYS 265 262 262 LYS LYS B . n 
B 1 266 TYR 266 263 263 TYR TYR B . n 
B 1 267 THR 267 264 264 THR THR B . n 
B 1 268 PRO 268 265 265 PRO PRO B . n 
B 1 269 HIS 269 266 266 HIS HIS B . n 
B 1 270 GLN 270 267 267 GLN GLN B . n 
B 1 271 LEU 271 268 268 LEU LEU B . n 
B 1 272 LEU 272 269 269 LEU LEU B . n 
B 1 273 PHE 273 270 270 PHE PHE B . n 
B 1 274 GLY 274 271 271 GLY GLY B . n 
B 1 275 ILE 275 272 272 ILE ILE B . n 
B 1 276 ASP 276 273 273 ASP ASP B . n 
B 1 277 SER 277 274 274 SER SER B . n 
B 1 278 ASN 278 275 275 ASN ASN B . n 
B 1 279 THR 279 276 276 THR THR B . n 
B 1 280 PRO 280 277 277 PRO PRO B . n 
B 1 281 PHE 281 278 278 PHE PHE B . n 
B 1 282 ALA 282 279 279 ALA ALA B . n 
B 1 283 ASN 283 280 280 ASN ASN B . n 
B 1 284 GLN 284 281 281 GLN GLN B . n 
B 1 285 ASP 285 282 282 ASP ASP B . n 
B 1 286 THR 286 283 283 THR THR B . n 
B 1 287 LEU 287 284 284 LEU LEU B . n 
B 1 288 ASP 288 285 285 ASP ASP B . n 
B 1 289 LEU 289 286 286 LEU LEU B . n 
B 1 290 THR 290 287 287 THR THR B . n 
B 1 291 ARG 291 288 288 ARG ARG B . n 
B 1 292 GLU 292 289 289 GLU GLU B . n 
B 1 293 GLU 293 290 290 GLU GLU B . n 
B 1 294 GLU 294 291 291 GLU GLU B . n 
B 1 295 LEU 295 292 292 LEU LEU B . n 
B 1 296 SER 296 293 293 SER SER B . n 
B 1 297 LEU 297 294 294 LEU LEU B . n 
B 1 298 LEU 298 295 295 LEU LEU B . n 
B 1 299 GLN 299 296 296 GLN GLN B . n 
B 1 300 GLU 300 297 297 GLU GLU B . n 
B 1 301 ILE 301 298 298 ILE ILE B . n 
B 1 302 ARG 302 299 299 ARG ARG B . n 
B 1 303 THR 303 300 ?   ?   ?   B . n 
B 1 304 SER 304 301 ?   ?   ?   B . n 
B 1 305 LEU 305 302 ?   ?   ?   B . n 
B 1 306 TYR 306 303 ?   ?   ?   B . n 
B 1 307 HIS 307 304 ?   ?   ?   B . n 
B 1 308 PRO 308 305 ?   ?   ?   B . n 
B 1 309 SER 309 306 ?   ?   ?   B . n 
B 1 310 THR 310 307 ?   ?   ?   B . n 
B 1 311 PRO 311 308 ?   ?   ?   B . n 
B 1 312 PRO 312 309 ?   ?   ?   B . n 
B 1 313 ALA 313 310 ?   ?   ?   B . n 
B 1 314 SER 314 311 ?   ?   ?   B . n 
B 1 315 SER 315 312 ?   ?   ?   B . n 
B 1 316 ARG 316 313 ?   ?   ?   B . n 
B 1 317 SER 317 314 ?   ?   ?   B . n 
B 1 318 TRP 318 315 ?   ?   ?   B . n 
B 1 319 SER 319 316 ?   ?   ?   B . n 
B 1 320 PRO 320 317 ?   ?   ?   B . n 
B 1 321 VAL 321 318 ?   ?   ?   B . n 
B 1 322 VAL 322 319 ?   ?   ?   B . n 
B 1 323 GLY 323 320 ?   ?   ?   B . n 
B 1 324 GLN 324 321 ?   ?   ?   B . n 
B 1 325 LEU 325 322 ?   ?   ?   B . n 
B 1 326 VAL 326 323 ?   ?   ?   B . n 
B 1 327 GLN 327 324 ?   ?   ?   B . n 
B 1 328 GLU 328 325 ?   ?   ?   B . n 
B 1 329 ARG 329 326 ?   ?   ?   B . n 
B 1 330 VAL 330 327 ?   ?   ?   B . n 
B 1 331 ALA 331 328 ?   ?   ?   B . n 
B 1 332 ARG 332 329 ?   ?   ?   B . n 
B 1 333 PRO 333 330 ?   ?   ?   B . n 
B 1 334 ALA 334 331 ?   ?   ?   B . n 
B 1 335 SER 335 332 ?   ?   ?   B . n 
B 1 336 LEU 336 333 ?   ?   ?   B . n 
B 1 337 ARG 337 334 ?   ?   ?   B . n 
B 1 338 PRO 338 335 ?   ?   ?   B . n 
B 1 339 ARG 339 336 ?   ?   ?   B . n 
B 1 340 TRP 340 337 ?   ?   ?   B . n 
B 1 341 HIS 341 338 ?   ?   ?   B . n 
B 1 342 LYS 342 339 ?   ?   ?   B . n 
B 1 343 PRO 343 340 ?   ?   ?   B . n 
B 1 344 SER 344 341 ?   ?   ?   B . n 
B 1 345 THR 345 342 ?   ?   ?   B . n 
B 1 346 VAL 346 343 ?   ?   ?   B . n 
B 1 347 LEU 347 344 ?   ?   ?   B . n 
B 1 348 LYS 348 345 ?   ?   ?   B . n 
B 1 349 VAL 349 346 ?   ?   ?   B . n 
B 1 350 LEU 350 347 ?   ?   ?   B . n 
B 1 351 ASN 351 348 ?   ?   ?   B . n 
B 1 352 PRO 352 349 ?   ?   ?   B . n 
B 1 353 ARG 353 350 ?   ?   ?   B . n 
B 1 354 THR 354 351 ?   ?   ?   B . n 
B 1 355 VAL 355 352 ?   ?   ?   B . n 
B 1 356 VAL 356 353 ?   ?   ?   B . n 
B 1 357 ILE 357 354 ?   ?   ?   B . n 
B 1 358 LEU 358 355 ?   ?   ?   B . n 
B 1 359 ASP 359 356 ?   ?   ?   B . n 
B 1 360 HIS 360 357 ?   ?   ?   B . n 
B 1 361 LEU 361 358 ?   ?   ?   B . n 
B 1 362 GLY 362 359 ?   ?   ?   B . n 
B 1 363 ASN 363 360 ?   ?   ?   B . n 
B 1 364 ASN 364 361 ?   ?   ?   B . n 
B 1 365 ARG 365 362 ?   ?   ?   B . n 
B 1 366 THR 366 363 ?   ?   ?   B . n 
B 1 367 VAL 367 364 ?   ?   ?   B . n 
B 1 368 SER 368 365 ?   ?   ?   B . n 
B 1 369 ILE 369 366 ?   ?   ?   B . n 
B 1 370 ASP 370 367 ?   ?   ?   B . n 
B 1 371 ASN 371 368 ?   ?   ?   B . n 
B 1 372 LEU 372 369 ?   ?   ?   B . n 
B 1 373 LYS 373 370 ?   ?   ?   B . n 
B 1 374 PRO 374 371 ?   ?   ?   B . n 
B 1 375 THR 375 372 ?   ?   ?   B . n 
B 1 376 SER 376 373 ?   ?   ?   B . n 
B 1 377 HIS 377 374 ?   ?   ?   B . n 
B 1 378 GLN 378 375 ?   ?   ?   B . n 
B 1 379 ASN 379 376 ?   ?   ?   B . n 
B 1 380 GLY 380 377 ?   ?   ?   B . n 
B 1 381 THR 381 378 ?   ?   ?   B . n 
B 1 382 THR 382 379 ?   ?   ?   B . n 
B 1 383 ASN 383 380 ?   ?   ?   B . n 
B 1 384 ASP 384 381 ?   ?   ?   B . n 
B 1 385 THR 385 382 ?   ?   ?   B . n 
B 1 386 ALA 386 383 ?   ?   ?   B . n 
B 1 387 THR 387 384 ?   ?   ?   B . n 
B 1 388 MET 388 385 ?   ?   ?   B . n 
B 1 389 ASP 389 386 ?   ?   ?   B . n 
B 1 390 HIS 390 387 ?   ?   ?   B . n 
B 1 391 LEU 391 388 ?   ?   ?   B . n 
B 1 392 GLU 392 389 ?   ?   ?   B . n 
B 1 393 LYS 393 390 ?   ?   ?   B . n 
B 1 394 ASN 394 391 ?   ?   ?   B . n 
B 1 395 GLU 395 392 ?   ?   ?   B . n 
C 2 1   DA  1   1   1   DA  DA  C . n 
C 2 2   DT  2   2   2   DT  DT  C . n 
C 2 3   DT  3   3   3   DT  DT  C . n 
C 2 4   DG  4   4   4   DG  DG  C . n 
C 2 5   DT  5   5   5   DT  DT  C . n 
C 2 6   DC  6   6   6   DC  DC  C . n 
C 2 7   DA  7   7   7   DA  DA  C . n 
C 2 8   DT  8   8   8   DT  DT  C . n 
C 2 9   DG  9   9   9   DG  DG  C . n 
C 2 10  DG  10  10  10  DG  DG  C . n 
C 2 11  DA  11  11  11  DA  DA  C . n 
C 2 12  DA  12  12  12  DA  DA  C . n 
C 2 13  DT  13  13  13  DT  DT  C . n 
C 2 14  DT  14  14  14  DT  DT  C . n 
C 2 15  DT  15  15  15  DT  DT  C . n 
C 2 16  DC  16  16  16  DC  DC  C . n 
C 2 17  DG  17  17  17  DG  DG  C . n 
C 2 18  DC  18  18  18  DC  DC  C . n 
C 2 19  DA  19  19  19  DA  DA  C . n 
D 3 1   DT  1   1   1   DT  DT  D . n 
D 3 2   DG  2   2   2   DG  DG  D . n 
D 3 3   DC  3   3   3   DC  DC  D . n 
D 3 4   DG  4   4   4   DG  DG  D . n 
D 3 5   DA  5   5   5   DA  DA  D . n 
D 3 6   DA  6   6   6   DA  DA  D . n 
D 3 7   DA  7   7   7   DA  DA  D . n 
D 3 8   DT  8   8   8   DT  DT  D . n 
D 3 9   DT  9   9   9   DT  DT  D . n 
D 3 10  DC  10  10  10  DC  DC  D . n 
D 3 11  DC  11  11  11  DC  DC  D . n 
D 3 12  DA  12  12  12  DA  DA  D . n 
D 3 13  DT  13  13  13  DT  DT  D . n 
D 3 14  DG  14  14  14  DG  DG  D . n 
D 3 15  DA  15  15  15  DA  DA  D . n 
D 3 16  DC  16  16  16  DC  DC  D . n 
D 3 17  DA  17  17  17  DA  DA  D . n 
# 
_struct_site_keywords.site_id   1 
_struct_site_keywords.text      'OUTSIDE BINDER' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 27830 ? 
1 MORE         -251  ? 
1 'SSA (A^2)'  57300 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -61.7550000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? Q HOH .   ? A HOH 534 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 OAD ? N ZYO .   ? A ZYO 398 ? 1_555 91.8  ? 
2  O   ? Q HOH .   ? A HOH 534 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 OAH ? N ZYO .   ? A ZYO 398 ? 1_555 86.0  ? 
3  OAD ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 OAH ? N ZYO .   ? A ZYO 398 ? 1_555 95.8  ? 
4  O   ? Q HOH .   ? A HOH 534 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 171.6 ? 
5  OAD ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 83.8  ? 
6  OAH ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 101.5 ? 
7  O   ? Q HOH .   ? A HOH 534 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 87.6  ? 
8  OAD ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 169.2 ? 
9  OAH ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 94.8  ? 
10 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 95.4  ? 
11 O   ? Q HOH .   ? A HOH 534 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 O   ? Q HOH .   ? A HOH 399 ? 1_555 83.8  ? 
12 OAD ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 O   ? Q HOH .   ? A HOH 399 ? 1_555 82.5  ? 
13 OAH ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 O   ? Q HOH .   ? A HOH 399 ? 1_555 169.6 ? 
14 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 O   ? Q HOH .   ? A HOH 399 ? 1_555 88.6  ? 
15 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? L MG . ? A MG 396 ? 1_555 O   ? Q HOH .   ? A HOH 399 ? 1_555 86.8  ? 
16 NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 ND1 ? A HIS 69  ? A HIS 66  ? 1_555 104.1 ? 
17 NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96  ? 1_555 113.6 ? 
18 ND1 ? A HIS 69  ? A HIS 66  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96  ? 1_555 108.2 ? 
19 NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 100.0 ? 
20 ND1 ? A HIS 69  ? A HIS 66  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 113.3 ? 
21 SG  ? A CYS 99  ? A CYS 96  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 116.9 ? 
22 OAE ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 91.1  ? 
23 OAE ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 O   ? T HOH .   ? D HOH 26  ? 1_555 92.8  ? 
24 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 O   ? T HOH .   ? D HOH 26  ? 1_555 174.1 ? 
25 OAE ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 91.0  ? 
26 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 64.4  ? 
27 O   ? T HOH .   ? D HOH 26  ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 111.1 ? 
28 OAE ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 173.8 ? 
29 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 82.7  ? 
30 O   ? T HOH .   ? D HOH 26  ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 93.4  ? 
31 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 86.1  ? 
32 OAE ? N ZYO .   ? A ZYO 398 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OAH ? N ZYO .   ? A ZYO 398 ? 1_555 88.4  ? 
33 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OAH ? N ZYO .   ? A ZYO 398 ? 1_555 92.7  ? 
34 O   ? T HOH .   ? D HOH 26  ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OAH ? N ZYO .   ? A ZYO 398 ? 1_555 91.8  ? 
35 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OAH ? N ZYO .   ? A ZYO 398 ? 1_555 157.1 ? 
36 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? M MG . ? A MG 397 ? 1_555 OAH ? N ZYO .   ? A ZYO 398 ? 1_555 92.1  ? 
37 OD1 ? B ASP 188 ? B ASP 185 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 O   ? R HOH .   ? B HOH 395 ? 1_555 160.3 ? 
38 OD1 ? B ASP 188 ? B ASP 185 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 O   ? R HOH .   ? B HOH 435 ? 1_555 80.7  ? 
39 O   ? R HOH .   ? B HOH 395 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 O   ? R HOH .   ? B HOH 435 ? 1_555 80.0  ? 
40 OD1 ? B ASP 188 ? B ASP 185 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 97.9  ? 
41 O   ? R HOH .   ? B HOH 395 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 74.7  ? 
42 O   ? R HOH .   ? B HOH 435 ? 1_555 MG ? P MG . ? B MG 394 ? 1_555 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 79.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-11-17 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .       ?               package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk    'data reduction'  
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/   ?          ? 
2 SCALA       3.3.16  2010/01/06      other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html   Fortran_77 ? 
3 PHASER      .       ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
4 REFMAC      .       ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
5 PDB_EXTRACT 3.10    'June 10, 2010' package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
6 ADSC        Quantum ?               ?       ?                    ?                           'data collection' ? ?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 462 ? ? O A HOH 521 ? ? 1.79 
2 1 O   B SER 258 ? ? O B LEU 261 ? ? 2.04 
3 1 OE1 A GLN 98  ? ? O A HOH 448 ? ? 2.10 
4 1 O   A HOH 527 ? ? O A HOH 528 ? ? 2.17 
5 1 O   C HOH 118 ? ? O C HOH 207 ? ? 2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     428 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     533 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   8_554 
_pdbx_validate_symm_contact.dist              2.10 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C3'" C DA 1  ? ? "O3'" C DA 1  ? ? P     C DT 2  ? ? 127.29 119.70 7.59  1.20 Y 
2  1 "O4'" C DT 3  ? ? "C1'" C DT 3  ? ? N1    C DT 3  ? ? 111.19 108.30 2.89  0.30 N 
3  1 N3    C DT 3  ? ? C4    C DT 3  ? ? O4    C DT 3  ? ? 124.10 119.90 4.20  0.60 N 
4  1 C5    C DT 3  ? ? C4    C DT 3  ? ? O4    C DT 3  ? ? 119.13 124.90 -5.77 0.70 N 
5  1 "O4'" C DT 5  ? ? "C1'" C DT 5  ? ? N1    C DT 5  ? ? 102.69 108.00 -5.31 0.70 N 
6  1 "C3'" C DC 6  ? ? "C2'" C DC 6  ? ? "C1'" C DC 6  ? ? 97.32  102.40 -5.08 0.80 N 
7  1 "O4'" C DC 6  ? ? "C1'" C DC 6  ? ? N1    C DC 6  ? ? 110.57 108.30 2.27  0.30 N 
8  1 "O4'" C DT 8  ? ? "C4'" C DT 8  ? ? "C3'" C DT 8  ? ? 101.25 104.50 -3.25 0.40 N 
9  1 "O4'" C DG 9  ? ? "C1'" C DG 9  ? ? N9    C DG 9  ? ? 110.62 108.30 2.32  0.30 N 
10 1 "O4'" C DA 12 ? ? "C1'" C DA 12 ? ? N9    C DA 12 ? ? 103.53 108.00 -4.47 0.70 N 
11 1 "O4'" D DT 1  ? ? "C1'" D DT 1  ? ? N1    D DT 1  ? ? 110.61 108.30 2.31  0.30 N 
12 1 "C3'" D DT 1  ? ? "O3'" D DT 1  ? ? P     D DG 2  ? ? 128.74 119.70 9.04  1.20 Y 
13 1 "O4'" D DG 2  ? ? "C1'" D DG 2  ? ? N9    D DG 2  ? ? 110.81 108.30 2.51  0.30 N 
14 1 "O5'" D DA 5  ? ? "C5'" D DA 5  ? ? "C4'" D DA 5  ? ? 104.04 109.40 -5.36 0.80 N 
15 1 "O4'" D DC 11 ? ? "C1'" D DC 11 ? ? N1    D DC 11 ? ? 111.48 108.30 3.18  0.30 N 
16 1 "O4'" D DA 12 ? ? "C1'" D DA 12 ? ? N9    D DA 12 ? ? 101.68 108.00 -6.32 0.70 N 
17 1 "O4'" D DT 13 ? ? "C1'" D DT 13 ? ? N1    D DT 13 ? ? 103.54 108.00 -4.46 0.70 N 
18 1 "O4'" D DC 16 ? ? "C4'" D DC 16 ? ? "C3'" D DC 16 ? ? 100.59 104.50 -3.91 0.40 N 
19 1 "O4'" D DC 16 ? ? "C1'" D DC 16 ? ? N1    D DC 16 ? ? 103.17 108.00 -4.83 0.70 N 
20 1 "C1'" D DA 17 ? A "O4'" D DA 17 ? A "C4'" D DA 17 ? A 103.31 110.10 -6.79 1.00 N 
21 1 "C3'" D DA 17 ? A "C2'" D DA 17 ? A "C1'" D DA 17 ? A 96.67  102.40 -5.73 0.80 N 
22 1 "O4'" D DA 17 ? A "C1'" D DA 17 ? A N9    D DA 17 ? A 113.51 108.30 5.21  0.30 N 
23 1 "O4'" D DA 17 ? B "C1'" D DA 17 ? B N9    D DA 17 ? B 111.86 108.30 3.56  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 122 ? ? 74.43   -2.37   
2  1 GLN A 137 ? ? 48.42   22.97   
3  1 GLN A 186 ? ? -96.79  36.02   
4  1 HIS A 213 ? ? -152.12 68.42   
5  1 HIS A 357 ? ? 79.51   -18.73  
6  1 GLN B 186 ? ? -89.21  36.76   
7  1 TYR B 212 ? ? 67.48   -3.54   
8  1 SER B 216 ? ? -129.45 -110.85 
9  1 ARG B 238 ? ? -152.74 60.68   
10 1 LEU B 284 ? ? 71.07   -6.97   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 8   ? CG  ? A LEU 11  CG  
2  1 Y 1 A LEU 8   ? CD1 ? A LEU 11  CD1 
3  1 Y 1 A LEU 8   ? CD2 ? A LEU 11  CD2 
4  1 Y 1 A LYS 26  ? CG  ? A LYS 29  CG  
5  1 Y 1 A LYS 26  ? CD  ? A LYS 29  CD  
6  1 Y 1 A LYS 26  ? CE  ? A LYS 29  CE  
7  1 Y 1 A LYS 26  ? NZ  ? A LYS 29  NZ  
8  1 Y 1 A LYS 241 ? CG  ? A LYS 244 CG  
9  1 Y 1 A LYS 241 ? CD  ? A LYS 244 CD  
10 1 Y 1 A LYS 241 ? CE  ? A LYS 244 CE  
11 1 Y 1 A LYS 241 ? NZ  ? A LYS 244 NZ  
12 1 Y 1 A ARG 329 ? CG  ? A ARG 332 CG  
13 1 Y 1 A ARG 329 ? CD  ? A ARG 332 CD  
14 1 Y 1 A ARG 329 ? NE  ? A ARG 332 NE  
15 1 Y 1 A ARG 329 ? CZ  ? A ARG 332 CZ  
16 1 Y 1 A ARG 329 ? NH1 ? A ARG 332 NH1 
17 1 Y 1 A ARG 329 ? NH2 ? A ARG 332 NH2 
18 1 Y 1 B LYS 241 ? CG  ? B LYS 244 CG  
19 1 Y 1 B LYS 241 ? CD  ? B LYS 244 CD  
20 1 Y 1 B LYS 241 ? CE  ? B LYS 244 CE  
21 1 Y 1 B LYS 241 ? NZ  ? B LYS 244 NZ  
22 1 Y 1 B LYS 262 ? CG  ? B LYS 265 CG  
23 1 Y 1 B LYS 262 ? CD  ? B LYS 265 CD  
24 1 Y 1 B LYS 262 ? CE  ? B LYS 265 CE  
25 1 Y 1 B LYS 262 ? NZ  ? B LYS 265 NZ  
26 1 Y 1 B GLN 281 ? CG  ? B GLN 284 CG  
27 1 Y 1 B GLN 281 ? CD  ? B GLN 284 CD  
28 1 Y 1 B GLN 281 ? OE1 ? B GLN 284 OE1 
29 1 Y 1 B GLN 281 ? NE2 ? B GLN 284 NE2 
30 1 Y 1 B LEU 292 ? CG  ? B LEU 295 CG  
31 1 Y 1 B LEU 292 ? CD1 ? B LEU 295 CD1 
32 1 Y 1 B LEU 292 ? CD2 ? B LEU 295 CD2 
33 1 Y 1 B LEU 294 ? CG  ? B LEU 297 CG  
34 1 Y 1 B LEU 294 ? CD1 ? B LEU 297 CD1 
35 1 Y 1 B LEU 294 ? CD2 ? B LEU 297 CD2 
36 1 Y 1 B LEU 295 ? CG  ? B LEU 298 CG  
37 1 Y 1 B LEU 295 ? CD1 ? B LEU 298 CD1 
38 1 Y 1 B LEU 295 ? CD2 ? B LEU 298 CD2 
39 1 Y 1 B GLN 296 ? CG  ? B GLN 299 CG  
40 1 Y 1 B GLN 296 ? CD  ? B GLN 299 CD  
41 1 Y 1 B GLN 296 ? OE1 ? B GLN 299 OE1 
42 1 Y 1 B GLN 296 ? NE2 ? B GLN 299 NE2 
43 1 Y 1 B GLU 297 ? CG  ? B GLU 300 CG  
44 1 Y 1 B GLU 297 ? CD  ? B GLU 300 CD  
45 1 Y 1 B GLU 297 ? OE1 ? B GLU 300 OE1 
46 1 Y 1 B GLU 297 ? OE2 ? B GLU 300 OE2 
47 1 Y 1 B ILE 298 ? CG1 ? B ILE 301 CG1 
48 1 Y 1 B ILE 298 ? CG2 ? B ILE 301 CG2 
49 1 Y 1 B ILE 298 ? CD1 ? B ILE 301 CD1 
50 1 Y 1 B ARG 299 ? CG  ? B ARG 302 CG  
51 1 Y 1 B ARG 299 ? CD  ? B ARG 302 CD  
52 1 Y 1 B ARG 299 ? NE  ? B ARG 302 NE  
53 1 Y 1 B ARG 299 ? CZ  ? B ARG 302 CZ  
54 1 Y 1 B ARG 299 ? NH1 ? B ARG 302 NH1 
55 1 Y 1 B ARG 299 ? NH2 ? B ARG 302 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY -2  ? A GLY 1   
2   1 Y 1 A PRO -1  ? A PRO 2   
3   1 Y 1 A GLY 0   ? A GLY 3   
4   1 Y 1 A CYS 1   ? A CYS 4   
5   1 Y 1 A ASN 2   ? A ASN 5   
6   1 Y 1 A THR 3   ? A THR 6   
7   1 Y 1 A LYS 4   ? A LYS 7   
8   1 Y 1 A LYS 5   ? A LYS 8   
9   1 Y 1 A PRO 6   ? A PRO 9   
10  1 Y 1 A ASN 7   ? A ASN 10  
11  1 Y 1 A ASN 376 ? A ASN 379 
12  1 Y 1 A GLY 377 ? A GLY 380 
13  1 Y 1 A THR 378 ? A THR 381 
14  1 Y 1 A THR 379 ? A THR 382 
15  1 Y 1 A ASN 380 ? A ASN 383 
16  1 Y 1 A ASP 381 ? A ASP 384 
17  1 Y 1 A THR 382 ? A THR 385 
18  1 Y 1 A ALA 383 ? A ALA 386 
19  1 Y 1 A THR 384 ? A THR 387 
20  1 Y 1 A MET 385 ? A MET 388 
21  1 Y 1 A ASP 386 ? A ASP 389 
22  1 Y 1 A HIS 387 ? A HIS 390 
23  1 Y 1 A LEU 388 ? A LEU 391 
24  1 Y 1 A GLU 389 ? A GLU 392 
25  1 Y 1 A LYS 390 ? A LYS 393 
26  1 Y 1 A ASN 391 ? A ASN 394 
27  1 Y 1 A GLU 392 ? A GLU 395 
28  1 Y 1 B GLY -2  ? B GLY 1   
29  1 Y 1 B PRO -1  ? B PRO 2   
30  1 Y 1 B GLY 0   ? B GLY 3   
31  1 Y 1 B CYS 1   ? B CYS 4   
32  1 Y 1 B ASN 2   ? B ASN 5   
33  1 Y 1 B THR 3   ? B THR 6   
34  1 Y 1 B LYS 4   ? B LYS 7   
35  1 Y 1 B LYS 5   ? B LYS 8   
36  1 Y 1 B PRO 6   ? B PRO 9   
37  1 Y 1 B ASN 7   ? B ASN 10  
38  1 Y 1 B LEU 8   ? B LEU 11  
39  1 Y 1 B ASP 9   ? B ASP 12  
40  1 Y 1 B ALA 10  ? B ALA 13  
41  1 Y 1 B GLU 11  ? B GLU 14  
42  1 Y 1 B LEU 12  ? B LEU 15  
43  1 Y 1 B ASP 13  ? B ASP 16  
44  1 Y 1 B GLN 14  ? B GLN 17  
45  1 Y 1 B LEU 15  ? B LEU 18  
46  1 Y 1 B LEU 16  ? B LEU 19  
47  1 Y 1 B GLN 17  ? B GLN 20  
48  1 Y 1 B GLY 18  ? B GLY 21  
49  1 Y 1 B HIS 19  ? B HIS 22  
50  1 Y 1 B TYR 20  ? B TYR 23  
51  1 Y 1 B ILE 21  ? B ILE 24  
52  1 Y 1 B LYS 22  ? B LYS 25  
53  1 Y 1 B GLY 23  ? B GLY 26  
54  1 Y 1 B TYR 24  ? B TYR 27  
55  1 Y 1 B PRO 25  ? B PRO 28  
56  1 Y 1 B LYS 26  ? B LYS 29  
57  1 Y 1 B GLN 27  ? B GLN 30  
58  1 Y 1 B TYR 28  ? B TYR 31  
59  1 Y 1 B THR 29  ? B THR 32  
60  1 Y 1 B TYR 30  ? B TYR 33  
61  1 Y 1 B PHE 31  ? B PHE 34  
62  1 Y 1 B LEU 32  ? B LEU 35  
63  1 Y 1 B GLU 33  ? B GLU 36  
64  1 Y 1 B ASP 34  ? B ASP 37  
65  1 Y 1 B GLY 35  ? B GLY 38  
66  1 Y 1 B LYS 36  ? B LYS 39  
67  1 Y 1 B VAL 37  ? B VAL 40  
68  1 Y 1 B LYS 38  ? B LYS 41  
69  1 Y 1 B VAL 39  ? B VAL 42  
70  1 Y 1 B SER 40  ? B SER 43  
71  1 Y 1 B ARG 41  ? B ARG 44  
72  1 Y 1 B PRO 42  ? B PRO 45  
73  1 Y 1 B GLU 43  ? B GLU 46  
74  1 Y 1 B GLY 44  ? B GLY 47  
75  1 Y 1 B VAL 45  ? B VAL 48  
76  1 Y 1 B LYS 46  ? B LYS 49  
77  1 Y 1 B ILE 47  ? B ILE 50  
78  1 Y 1 B ILE 48  ? B ILE 51  
79  1 Y 1 B PRO 49  ? B PRO 52  
80  1 Y 1 B PRO 50  ? B PRO 53  
81  1 Y 1 B GLN 51  ? B GLN 54  
82  1 Y 1 B SER 52  ? B SER 55  
83  1 Y 1 B ASP 53  ? B ASP 56  
84  1 Y 1 B ARG 54  ? B ARG 57  
85  1 Y 1 B GLN 55  ? B GLN 58  
86  1 Y 1 B LYS 56  ? B LYS 59  
87  1 Y 1 B ILE 57  ? B ILE 60  
88  1 Y 1 B VAL 58  ? B VAL 61  
89  1 Y 1 B LEU 59  ? B LEU 62  
90  1 Y 1 B GLN 60  ? B GLN 63  
91  1 Y 1 B ALA 61  ? B ALA 64  
92  1 Y 1 B HIS 62  ? B HIS 65  
93  1 Y 1 B ASN 63  ? B ASN 66  
94  1 Y 1 B LEU 64  ? B LEU 67  
95  1 Y 1 B ALA 65  ? B ALA 68  
96  1 Y 1 B HIS 66  ? B HIS 69  
97  1 Y 1 B THR 67  ? B THR 70  
98  1 Y 1 B GLY 68  ? B GLY 71  
99  1 Y 1 B ARG 69  ? B ARG 72  
100 1 Y 1 B GLU 70  ? B GLU 73  
101 1 Y 1 B ALA 71  ? B ALA 74  
102 1 Y 1 B THR 72  ? B THR 75  
103 1 Y 1 B LEU 73  ? B LEU 76  
104 1 Y 1 B LEU 74  ? B LEU 77  
105 1 Y 1 B LYS 75  ? B LYS 78  
106 1 Y 1 B ILE 76  ? B ILE 79  
107 1 Y 1 B ALA 77  ? B ALA 80  
108 1 Y 1 B ASN 78  ? B ASN 81  
109 1 Y 1 B LEU 79  ? B LEU 82  
110 1 Y 1 B TYR 80  ? B TYR 83  
111 1 Y 1 B TRP 81  ? B TRP 84  
112 1 Y 1 B TRP 82  ? B TRP 85  
113 1 Y 1 B PRO 83  ? B PRO 86  
114 1 Y 1 B ASN 84  ? B ASN 87  
115 1 Y 1 B MET 85  ? B MET 88  
116 1 Y 1 B ARG 86  ? B ARG 89  
117 1 Y 1 B LYS 87  ? B LYS 90  
118 1 Y 1 B ASP 88  ? B ASP 91  
119 1 Y 1 B VAL 89  ? B VAL 92  
120 1 Y 1 B VAL 90  ? B VAL 93  
121 1 Y 1 B LYS 91  ? B LYS 94  
122 1 Y 1 B GLN 92  ? B GLN 95  
123 1 Y 1 B LEU 93  ? B LEU 96  
124 1 Y 1 B GLY 94  ? B GLY 97  
125 1 Y 1 B ARG 95  ? B ARG 98  
126 1 Y 1 B CYS 96  ? B CYS 99  
127 1 Y 1 B GLN 97  ? B GLN 100 
128 1 Y 1 B GLN 98  ? B GLN 101 
129 1 Y 1 B CYS 99  ? B CYS 102 
130 1 Y 1 B LEU 100 ? B LEU 103 
131 1 Y 1 B ILE 101 ? B ILE 104 
132 1 Y 1 B THR 102 ? B THR 105 
133 1 Y 1 B ASN 103 ? B ASN 106 
134 1 Y 1 B ALA 104 ? B ALA 107 
135 1 Y 1 B SER 105 ? B SER 108 
136 1 Y 1 B ASN 106 ? B ASN 109 
137 1 Y 1 B LYS 107 ? B LYS 110 
138 1 Y 1 B ALA 108 ? B ALA 111 
139 1 Y 1 B SER 109 ? B SER 112 
140 1 Y 1 B GLY 110 ? B GLY 113 
141 1 Y 1 B PRO 111 ? B PRO 114 
142 1 Y 1 B ILE 112 ? B ILE 115 
143 1 Y 1 B LEU 113 ? B LEU 116 
144 1 Y 1 B ARG 114 ? B ARG 117 
145 1 Y 1 B PRO 115 ? B PRO 118 
146 1 Y 1 B THR 300 ? B THR 303 
147 1 Y 1 B SER 301 ? B SER 304 
148 1 Y 1 B LEU 302 ? B LEU 305 
149 1 Y 1 B TYR 303 ? B TYR 306 
150 1 Y 1 B HIS 304 ? B HIS 307 
151 1 Y 1 B PRO 305 ? B PRO 308 
152 1 Y 1 B SER 306 ? B SER 309 
153 1 Y 1 B THR 307 ? B THR 310 
154 1 Y 1 B PRO 308 ? B PRO 311 
155 1 Y 1 B PRO 309 ? B PRO 312 
156 1 Y 1 B ALA 310 ? B ALA 313 
157 1 Y 1 B SER 311 ? B SER 314 
158 1 Y 1 B SER 312 ? B SER 315 
159 1 Y 1 B ARG 313 ? B ARG 316 
160 1 Y 1 B SER 314 ? B SER 317 
161 1 Y 1 B TRP 315 ? B TRP 318 
162 1 Y 1 B SER 316 ? B SER 319 
163 1 Y 1 B PRO 317 ? B PRO 320 
164 1 Y 1 B VAL 318 ? B VAL 321 
165 1 Y 1 B VAL 319 ? B VAL 322 
166 1 Y 1 B GLY 320 ? B GLY 323 
167 1 Y 1 B GLN 321 ? B GLN 324 
168 1 Y 1 B LEU 322 ? B LEU 325 
169 1 Y 1 B VAL 323 ? B VAL 326 
170 1 Y 1 B GLN 324 ? B GLN 327 
171 1 Y 1 B GLU 325 ? B GLU 328 
172 1 Y 1 B ARG 326 ? B ARG 329 
173 1 Y 1 B VAL 327 ? B VAL 330 
174 1 Y 1 B ALA 328 ? B ALA 331 
175 1 Y 1 B ARG 329 ? B ARG 332 
176 1 Y 1 B PRO 330 ? B PRO 333 
177 1 Y 1 B ALA 331 ? B ALA 334 
178 1 Y 1 B SER 332 ? B SER 335 
179 1 Y 1 B LEU 333 ? B LEU 336 
180 1 Y 1 B ARG 334 ? B ARG 337 
181 1 Y 1 B PRO 335 ? B PRO 338 
182 1 Y 1 B ARG 336 ? B ARG 339 
183 1 Y 1 B TRP 337 ? B TRP 340 
184 1 Y 1 B HIS 338 ? B HIS 341 
185 1 Y 1 B LYS 339 ? B LYS 342 
186 1 Y 1 B PRO 340 ? B PRO 343 
187 1 Y 1 B SER 341 ? B SER 344 
188 1 Y 1 B THR 342 ? B THR 345 
189 1 Y 1 B VAL 343 ? B VAL 346 
190 1 Y 1 B LEU 344 ? B LEU 347 
191 1 Y 1 B LYS 345 ? B LYS 348 
192 1 Y 1 B VAL 346 ? B VAL 349 
193 1 Y 1 B LEU 347 ? B LEU 350 
194 1 Y 1 B ASN 348 ? B ASN 351 
195 1 Y 1 B PRO 349 ? B PRO 352 
196 1 Y 1 B ARG 350 ? B ARG 353 
197 1 Y 1 B THR 351 ? B THR 354 
198 1 Y 1 B VAL 352 ? B VAL 355 
199 1 Y 1 B VAL 353 ? B VAL 356 
200 1 Y 1 B ILE 354 ? B ILE 357 
201 1 Y 1 B LEU 355 ? B LEU 358 
202 1 Y 1 B ASP 356 ? B ASP 359 
203 1 Y 1 B HIS 357 ? B HIS 360 
204 1 Y 1 B LEU 358 ? B LEU 361 
205 1 Y 1 B GLY 359 ? B GLY 362 
206 1 Y 1 B ASN 360 ? B ASN 363 
207 1 Y 1 B ASN 361 ? B ASN 364 
208 1 Y 1 B ARG 362 ? B ARG 365 
209 1 Y 1 B THR 363 ? B THR 366 
210 1 Y 1 B VAL 364 ? B VAL 367 
211 1 Y 1 B SER 365 ? B SER 368 
212 1 Y 1 B ILE 366 ? B ILE 369 
213 1 Y 1 B ASP 367 ? B ASP 370 
214 1 Y 1 B ASN 368 ? B ASN 371 
215 1 Y 1 B LEU 369 ? B LEU 372 
216 1 Y 1 B LYS 370 ? B LYS 373 
217 1 Y 1 B PRO 371 ? B PRO 374 
218 1 Y 1 B THR 372 ? B THR 375 
219 1 Y 1 B SER 373 ? B SER 376 
220 1 Y 1 B HIS 374 ? B HIS 377 
221 1 Y 1 B GLN 375 ? B GLN 378 
222 1 Y 1 B ASN 376 ? B ASN 379 
223 1 Y 1 B GLY 377 ? B GLY 380 
224 1 Y 1 B THR 378 ? B THR 381 
225 1 Y 1 B THR 379 ? B THR 382 
226 1 Y 1 B ASN 380 ? B ASN 383 
227 1 Y 1 B ASP 381 ? B ASP 384 
228 1 Y 1 B THR 382 ? B THR 385 
229 1 Y 1 B ALA 383 ? B ALA 386 
230 1 Y 1 B THR 384 ? B THR 387 
231 1 Y 1 B MET 385 ? B MET 388 
232 1 Y 1 B ASP 386 ? B ASP 389 
233 1 Y 1 B HIS 387 ? B HIS 390 
234 1 Y 1 B LEU 388 ? B LEU 391 
235 1 Y 1 B GLU 389 ? B GLU 392 
236 1 Y 1 B LYS 390 ? B LYS 393 
237 1 Y 1 B ASN 391 ? B ASN 394 
238 1 Y 1 B GLU 392 ? B GLU 395 
# 
_ndb_struct_conf_na.entry_id   3OYG 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 4  1_555 D DC 16 1_555 -0.302 -0.068 -0.732 -33.442 -18.480 1.037  1  C_DG4:DC16_D  C 4  ? D 16 ? 19 1 
1 C DT 5  1_555 D DA 15 1_555 0.046  -0.124 -0.131 -17.601 -3.727  0.662  2  C_DT5:DA15_D  C 5  ? D 15 ? 20 1 
1 C DC 6  1_555 D DG 14 1_555 0.102  -0.125 -0.137 0.512   0.602   -1.723 3  C_DC6:DG14_D  C 6  ? D 14 ? 19 1 
1 C DA 7  1_555 D DT 13 1_555 0.035  -0.080 -0.086 -0.384  -16.416 -3.632 4  C_DA7:DT13_D  C 7  ? D 13 ? 20 1 
1 C DT 8  1_555 D DA 12 1_555 0.102  -0.132 0.109  -0.865  -12.457 6.231  5  C_DT8:DA12_D  C 8  ? D 12 ? 20 1 
1 C DG 9  1_555 D DC 11 1_555 -0.065 -0.113 0.064  5.757   6.530   -1.251 6  C_DG9:DC11_D  C 9  ? D 11 ? 19 1 
1 C DG 10 1_555 D DC 10 1_555 -0.389 -0.109 0.168  14.118  -9.657  -1.252 7  C_DG10:DC10_D C 10 ? D 10 ? 19 1 
1 C DA 11 1_555 D DT 9  1_555 0.147  -0.280 0.010  6.290   -18.216 0.199  8  C_DA11:DT9_D  C 11 ? D 9  ? 20 1 
1 C DA 12 1_555 D DT 8  1_555 0.246  -0.144 0.124  0.150   -13.414 2.843  9  C_DA12:DT8_D  C 12 ? D 8  ? 20 1 
1 C DT 13 1_555 D DA 7  1_555 0.284  -0.174 -0.079 -0.168  -17.127 3.689  10 C_DT13:DA7_D  C 13 ? D 7  ? 20 1 
1 C DT 14 1_555 D DA 6  1_555 -0.193 -0.176 -0.308 -1.938  -14.652 0.599  11 C_DT14:DA6_D  C 14 ? D 6  ? 20 1 
1 C DT 15 1_555 D DA 5  1_555 -0.244 -0.186 -0.255 -6.036  -11.139 -4.747 12 C_DT15:DA5_D  C 15 ? D 5  ? 20 1 
1 C DC 16 1_555 D DG 4  1_555 0.181  -0.109 -0.234 -3.927  -9.850  -0.214 13 C_DC16:DG4_D  C 16 ? D 4  ? 19 1 
1 C DG 17 1_555 D DC 3  1_555 -0.366 -0.388 -0.054 -0.288  -12.237 -1.502 14 C_DG17:DC3_D  C 17 ? D 3  ? 19 1 
1 C DC 18 1_555 D DG 2  1_555 0.247  -0.204 -0.228 8.497   -3.068  0.050  15 C_DC18:DG2_D  C 18 ? D 2  ? 19 1 
1 C DA 19 1_555 D DT 1  1_555 -0.006 -0.473 -0.894 -8.537  -10.114 7.482  16 C_DA19:DT1_D  C 19 ? D 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 4  1_555 D DC 16 1_555 C DT 5  1_555 D DA 15 1_555 0.434  0.069  2.904 -4.344 4.562  36.130 -0.442 -1.215 2.822 7.287  
6.939   36.657 1  CC_DG4DT5:DA15DC16_DD  C 4  ? D 16 ? C 5  ? D 15 ? 
1 C DT 5  1_555 D DA 15 1_555 C DC 6  1_555 D DG 14 1_555 0.338  0.873  3.025 -0.225 7.625  29.254 0.192  -0.693 3.145 14.782 
0.437   30.211 2  CC_DT5DC6:DG14DA15_DD  C 5  ? D 15 ? C 6  ? D 14 ? 
1 C DC 6  1_555 D DG 14 1_555 C DA 7  1_555 D DT 13 1_555 -1.545 0.881  3.367 -3.396 7.939  35.816 0.229  1.947  3.601 12.683 
5.425   36.809 3  CC_DC6DA7:DT13DG14_DD  C 6  ? D 14 ? C 7  ? D 13 ? 
1 C DA 7  1_555 D DT 13 1_555 C DT 8  1_555 D DA 12 1_555 0.720  -0.426 3.233 -0.964 1.614  31.679 -1.070 -1.491 3.185 2.953  
1.764   31.733 4  CC_DA7DT8:DA12DT13_DD  C 7  ? D 13 ? C 8  ? D 12 ? 
1 C DT 8  1_555 D DA 12 1_555 C DG 9  1_555 D DC 11 1_555 0.630  1.905  3.284 3.938  7.394  38.160 1.898  -0.436 3.622 11.145 
-5.936  39.035 5  CC_DT8DG9:DC11DA12_DD  C 8  ? D 12 ? C 9  ? D 11 ? 
1 C DG 9  1_555 D DC 11 1_555 C DG 10 1_555 D DC 10 1_555 -0.889 0.552  3.138 -1.371 5.386  30.044 -0.001 1.420  3.222 10.279 
2.616   30.542 6  CC_DG9DG10:DC10DC11_DD C 9  ? D 11 ? C 10 ? D 10 ? 
1 C DG 10 1_555 D DC 10 1_555 C DA 11 1_555 D DT 9  1_555 -0.024 -0.252 3.390 2.467  2.478  41.367 -0.627 0.305  3.363 3.500  
-3.485  41.508 7  CC_DG10DA11:DT9DC10_DD C 10 ? D 10 ? C 11 ? D 9  ? 
1 C DA 11 1_555 D DT 9  1_555 C DA 12 1_555 D DT 8  1_555 -0.105 0.032  3.281 -2.883 -1.678 39.673 0.242  -0.181 3.276 -2.468 
4.239   39.808 8  CC_DA11DA12:DT8DT9_DD  C 11 ? D 9  ? C 12 ? D 8  ? 
1 C DA 12 1_555 D DT 8  1_555 C DT 13 1_555 D DA 7  1_555 -0.171 -0.368 3.210 1.684  -2.109 33.114 -0.297 0.576  3.214 -3.692 
-2.949  33.221 9  CC_DA12DT13:DA7DT8_DD  C 12 ? D 8  ? C 13 ? D 7  ? 
1 C DT 13 1_555 D DA 7  1_555 C DT 14 1_555 D DA 6  1_555 -0.138 -0.206 3.217 0.915  -1.693 35.290 -0.093 0.360  3.218 -2.790 
-1.508  35.341 10 CC_DT13DT14:DA6DA7_DD  C 13 ? D 7  ? C 14 ? D 6  ? 
1 C DT 14 1_555 D DA 6  1_555 C DT 15 1_555 D DA 5  1_555 0.026  0.075  3.340 0.326  -4.354 40.268 0.605  -0.001 3.315 -6.301 
-0.472  40.494 11 CC_DT14DT15:DA5DA6_DD  C 14 ? D 6  ? C 15 ? D 5  ? 
1 C DT 15 1_555 D DA 5  1_555 C DC 16 1_555 D DG 4  1_555 -0.010 -0.058 3.170 -0.851 0.744  35.918 -0.197 -0.102 3.167 1.207  
1.380   35.935 12 CC_DT15DC16:DG4DA5_DD  C 15 ? D 5  ? C 16 ? D 4  ? 
1 C DC 16 1_555 D DG 4  1_555 C DG 17 1_555 D DC 3  1_555 -0.107 0.812  3.377 -4.356 13.764 32.892 -0.829 -0.506 3.423 22.979 
7.273   35.841 13 CC_DC16DG17:DC3DG4_DD  C 16 ? D 4  ? C 17 ? D 3  ? 
1 C DG 17 1_555 D DC 3  1_555 C DC 18 1_555 D DG 2  1_555 0.794  -0.056 3.022 1.626  3.096  33.357 -0.569 -1.127 3.039 5.375  
-2.823  33.535 14 CC_DG17DC18:DG2DC3_DD  C 17 ? D 3  ? C 18 ? D 2  ? 
1 C DC 18 1_555 D DG 2  1_555 C DA 19 1_555 D DT 1  1_555 0.570  0.053  3.899 6.287  13.622 27.774 -3.004 0.381  3.582 26.106 
-12.048 31.497 15 CC_DC18DA19:DT1DG2_DD  C 18 ? D 2  ? C 19 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4  'ZINC ION' ZN  
5  'SULFATE ION' SO4 
6  GLYCEROL GOL 
7  'AMMONIUM ION' NH4 
8  'MAGNESIUM ION' MG  
9  
;(6S)-2-(3-chloro-4-fluorobenzyl)-8-ethyl-10-hydroxy-6-methyl-4-(5-methyl-1,1-dioxido-1,2,5-thiadiazolidin-2-yl)-7,8-dihydropyrazino[1',2':1,5]pyrrolo[2,3-d]pyridazine-1,9(2H,6H)-dione
;
ZYO 
10 water HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4  ZN  1   393 393 ZN  ZN  A . 
F 5  SO4 1   394 2   SO4 SO4 A . 
G 6  GOL 1   801 801 GOL GOL A . 
H 6  GOL 1   802 802 GOL GOL A . 
I 6  GOL 1   803 803 GOL GOL A . 
J 6  GOL 1   805 805 GOL GOL A . 
K 7  NH4 1   395 3   NH4 NH4 A . 
L 8  MG  1   396 1   MG  MG  A . 
M 8  MG  1   397 1   MG  MG  A . 
N 9  ZYO 1   398 1   ZYO ZYO A . 
O 5  SO4 1   393 1   SO4 SO4 B . 
P 8  MG  1   394 1   MG  MG  B . 
Q 10 HOH 1   399 5   HOH HOH A . 
Q 10 HOH 2   400 8   HOH HOH A . 
Q 10 HOH 3   401 10  HOH HOH A . 
Q 10 HOH 4   402 11  HOH HOH A . 
Q 10 HOH 5   403 17  HOH HOH A . 
Q 10 HOH 6   404 18  HOH HOH A . 
Q 10 HOH 7   405 19  HOH HOH A . 
Q 10 HOH 8   406 20  HOH HOH A . 
Q 10 HOH 9   407 22  HOH HOH A . 
Q 10 HOH 10  408 25  HOH HOH A . 
Q 10 HOH 11  409 27  HOH HOH A . 
Q 10 HOH 12  410 28  HOH HOH A . 
Q 10 HOH 13  411 29  HOH HOH A . 
Q 10 HOH 14  412 30  HOH HOH A . 
Q 10 HOH 15  413 31  HOH HOH A . 
Q 10 HOH 16  414 32  HOH HOH A . 
Q 10 HOH 17  415 33  HOH HOH A . 
Q 10 HOH 18  416 34  HOH HOH A . 
Q 10 HOH 19  417 35  HOH HOH A . 
Q 10 HOH 20  418 36  HOH HOH A . 
Q 10 HOH 21  419 42  HOH HOH A . 
Q 10 HOH 22  420 43  HOH HOH A . 
Q 10 HOH 23  421 44  HOH HOH A . 
Q 10 HOH 24  422 45  HOH HOH A . 
Q 10 HOH 25  423 46  HOH HOH A . 
Q 10 HOH 26  424 47  HOH HOH A . 
Q 10 HOH 27  425 50  HOH HOH A . 
Q 10 HOH 28  426 52  HOH HOH A . 
Q 10 HOH 29  427 56  HOH HOH A . 
Q 10 HOH 30  428 59  HOH HOH A . 
Q 10 HOH 31  429 62  HOH HOH A . 
Q 10 HOH 32  430 63  HOH HOH A . 
Q 10 HOH 33  431 65  HOH HOH A . 
Q 10 HOH 34  432 68  HOH HOH A . 
Q 10 HOH 35  433 70  HOH HOH A . 
Q 10 HOH 36  434 71  HOH HOH A . 
Q 10 HOH 37  435 77  HOH HOH A . 
Q 10 HOH 38  436 78  HOH HOH A . 
Q 10 HOH 39  437 79  HOH HOH A . 
Q 10 HOH 40  438 80  HOH HOH A . 
Q 10 HOH 41  439 81  HOH HOH A . 
Q 10 HOH 42  440 82  HOH HOH A . 
Q 10 HOH 43  441 84  HOH HOH A . 
Q 10 HOH 44  442 86  HOH HOH A . 
Q 10 HOH 45  443 94  HOH HOH A . 
Q 10 HOH 46  444 95  HOH HOH A . 
Q 10 HOH 47  445 96  HOH HOH A . 
Q 10 HOH 48  446 97  HOH HOH A . 
Q 10 HOH 49  447 98  HOH HOH A . 
Q 10 HOH 50  448 99  HOH HOH A . 
Q 10 HOH 51  449 100 HOH HOH A . 
Q 10 HOH 52  450 102 HOH HOH A . 
Q 10 HOH 53  451 103 HOH HOH A . 
Q 10 HOH 54  452 104 HOH HOH A . 
Q 10 HOH 55  453 105 HOH HOH A . 
Q 10 HOH 56  454 106 HOH HOH A . 
Q 10 HOH 57  455 107 HOH HOH A . 
Q 10 HOH 58  456 110 HOH HOH A . 
Q 10 HOH 59  457 112 HOH HOH A . 
Q 10 HOH 60  458 113 HOH HOH A . 
Q 10 HOH 61  459 114 HOH HOH A . 
Q 10 HOH 62  460 115 HOH HOH A . 
Q 10 HOH 63  461 116 HOH HOH A . 
Q 10 HOH 64  462 119 HOH HOH A . 
Q 10 HOH 65  463 121 HOH HOH A . 
Q 10 HOH 66  464 124 HOH HOH A . 
Q 10 HOH 67  465 126 HOH HOH A . 
Q 10 HOH 68  466 127 HOH HOH A . 
Q 10 HOH 69  467 128 HOH HOH A . 
Q 10 HOH 70  468 129 HOH HOH A . 
Q 10 HOH 71  469 131 HOH HOH A . 
Q 10 HOH 72  470 132 HOH HOH A . 
Q 10 HOH 73  471 134 HOH HOH A . 
Q 10 HOH 74  472 137 HOH HOH A . 
Q 10 HOH 75  473 139 HOH HOH A . 
Q 10 HOH 76  474 140 HOH HOH A . 
Q 10 HOH 77  475 141 HOH HOH A . 
Q 10 HOH 78  476 142 HOH HOH A . 
Q 10 HOH 79  477 151 HOH HOH A . 
Q 10 HOH 80  478 158 HOH HOH A . 
Q 10 HOH 81  479 162 HOH HOH A . 
Q 10 HOH 82  480 165 HOH HOH A . 
Q 10 HOH 83  481 166 HOH HOH A . 
Q 10 HOH 84  482 167 HOH HOH A . 
Q 10 HOH 85  483 168 HOH HOH A . 
Q 10 HOH 86  484 169 HOH HOH A . 
Q 10 HOH 87  485 171 HOH HOH A . 
Q 10 HOH 88  486 177 HOH HOH A . 
Q 10 HOH 89  487 181 HOH HOH A . 
Q 10 HOH 90  488 182 HOH HOH A . 
Q 10 HOH 91  489 186 HOH HOH A . 
Q 10 HOH 92  490 187 HOH HOH A . 
Q 10 HOH 93  491 188 HOH HOH A . 
Q 10 HOH 94  492 190 HOH HOH A . 
Q 10 HOH 95  493 193 HOH HOH A . 
Q 10 HOH 96  494 194 HOH HOH A . 
Q 10 HOH 97  495 208 HOH HOH A . 
Q 10 HOH 98  496 211 HOH HOH A . 
Q 10 HOH 99  497 212 HOH HOH A . 
Q 10 HOH 100 498 214 HOH HOH A . 
Q 10 HOH 101 499 223 HOH HOH A . 
Q 10 HOH 102 500 227 HOH HOH A . 
Q 10 HOH 103 501 228 HOH HOH A . 
Q 10 HOH 104 502 231 HOH HOH A . 
Q 10 HOH 105 503 232 HOH HOH A . 
Q 10 HOH 106 504 239 HOH HOH A . 
Q 10 HOH 107 505 241 HOH HOH A . 
Q 10 HOH 108 506 242 HOH HOH A . 
Q 10 HOH 109 507 243 HOH HOH A . 
Q 10 HOH 110 508 244 HOH HOH A . 
Q 10 HOH 111 509 249 HOH HOH A . 
Q 10 HOH 112 510 255 HOH HOH A . 
Q 10 HOH 113 511 261 HOH HOH A . 
Q 10 HOH 114 512 262 HOH HOH A . 
Q 10 HOH 115 513 267 HOH HOH A . 
Q 10 HOH 116 514 271 HOH HOH A . 
Q 10 HOH 117 515 276 HOH HOH A . 
Q 10 HOH 118 516 278 HOH HOH A . 
Q 10 HOH 119 517 279 HOH HOH A . 
Q 10 HOH 120 518 281 HOH HOH A . 
Q 10 HOH 121 519 283 HOH HOH A . 
Q 10 HOH 122 520 284 HOH HOH A . 
Q 10 HOH 123 521 286 HOH HOH A . 
Q 10 HOH 124 522 290 HOH HOH A . 
Q 10 HOH 125 523 295 HOH HOH A . 
Q 10 HOH 126 524 307 HOH HOH A . 
Q 10 HOH 127 525 309 HOH HOH A . 
Q 10 HOH 128 526 310 HOH HOH A . 
Q 10 HOH 129 527 311 HOH HOH A . 
Q 10 HOH 130 528 312 HOH HOH A . 
Q 10 HOH 131 529 313 HOH HOH A . 
Q 10 HOH 132 530 315 HOH HOH A . 
Q 10 HOH 133 531 316 HOH HOH A . 
Q 10 HOH 134 532 320 HOH HOH A . 
Q 10 HOH 135 533 324 HOH HOH A . 
Q 10 HOH 136 534 325 HOH HOH A . 
Q 10 HOH 137 535 327 HOH HOH A . 
Q 10 HOH 138 536 329 HOH HOH A . 
Q 10 HOH 139 537 330 HOH HOH A . 
Q 10 HOH 140 538 332 HOH HOH A . 
Q 10 HOH 141 539 335 HOH HOH A . 
Q 10 HOH 142 540 336 HOH HOH A . 
Q 10 HOH 143 541 337 HOH HOH A . 
Q 10 HOH 144 542 341 HOH HOH A . 
Q 10 HOH 145 543 289 HOH HOH A . 
Q 10 HOH 146 544 322 HOH HOH A . 
R 10 HOH 1   395 2   HOH HOH B . 
R 10 HOH 2   396 12  HOH HOH B . 
R 10 HOH 3   397 13  HOH HOH B . 
R 10 HOH 4   398 14  HOH HOH B . 
R 10 HOH 5   399 15  HOH HOH B . 
R 10 HOH 6   400 16  HOH HOH B . 
R 10 HOH 7   401 51  HOH HOH B . 
R 10 HOH 8   402 53  HOH HOH B . 
R 10 HOH 9   403 66  HOH HOH B . 
R 10 HOH 10  404 67  HOH HOH B . 
R 10 HOH 11  405 69  HOH HOH B . 
R 10 HOH 12  406 73  HOH HOH B . 
R 10 HOH 13  407 74  HOH HOH B . 
R 10 HOH 14  408 75  HOH HOH B . 
R 10 HOH 15  409 76  HOH HOH B . 
R 10 HOH 16  410 111 HOH HOH B . 
R 10 HOH 17  411 153 HOH HOH B . 
R 10 HOH 18  412 161 HOH HOH B . 
R 10 HOH 19  413 172 HOH HOH B . 
R 10 HOH 20  414 179 HOH HOH B . 
R 10 HOH 21  415 180 HOH HOH B . 
R 10 HOH 22  416 189 HOH HOH B . 
R 10 HOH 23  417 210 HOH HOH B . 
R 10 HOH 24  418 213 HOH HOH B . 
R 10 HOH 25  419 217 HOH HOH B . 
R 10 HOH 26  420 219 HOH HOH B . 
R 10 HOH 27  421 222 HOH HOH B . 
R 10 HOH 28  422 236 HOH HOH B . 
R 10 HOH 29  423 237 HOH HOH B . 
R 10 HOH 30  424 247 HOH HOH B . 
R 10 HOH 31  425 251 HOH HOH B . 
R 10 HOH 32  426 256 HOH HOH B . 
R 10 HOH 33  427 257 HOH HOH B . 
R 10 HOH 34  428 260 HOH HOH B . 
R 10 HOH 35  429 268 HOH HOH B . 
R 10 HOH 36  430 272 HOH HOH B . 
R 10 HOH 37  431 274 HOH HOH B . 
R 10 HOH 38  432 285 HOH HOH B . 
R 10 HOH 39  433 314 HOH HOH B . 
R 10 HOH 40  434 323 HOH HOH B . 
R 10 HOH 41  435 331 HOH HOH B . 
R 10 HOH 42  436 338 HOH HOH B . 
R 10 HOH 43  437 339 HOH HOH B . 
R 10 HOH 44  438 340 HOH HOH B . 
R 10 HOH 45  439 342 HOH HOH B . 
S 10 HOH 1   21  21  HOH HOH C . 
S 10 HOH 2   23  23  HOH HOH C . 
S 10 HOH 3   39  39  HOH HOH C . 
S 10 HOH 4   40  40  HOH HOH C . 
S 10 HOH 5   48  48  HOH HOH C . 
S 10 HOH 6   54  54  HOH HOH C . 
S 10 HOH 7   58  58  HOH HOH C . 
S 10 HOH 8   64  64  HOH HOH C . 
S 10 HOH 9   91  91  HOH HOH C . 
S 10 HOH 10  92  92  HOH HOH C . 
S 10 HOH 11  93  93  HOH HOH C . 
S 10 HOH 12  118 118 HOH HOH C . 
S 10 HOH 13  120 120 HOH HOH C . 
S 10 HOH 14  125 125 HOH HOH C . 
S 10 HOH 15  133 133 HOH HOH C . 
S 10 HOH 16  145 145 HOH HOH C . 
S 10 HOH 17  155 155 HOH HOH C . 
S 10 HOH 18  157 157 HOH HOH C . 
S 10 HOH 19  191 191 HOH HOH C . 
S 10 HOH 20  192 192 HOH HOH C . 
S 10 HOH 21  207 207 HOH HOH C . 
S 10 HOH 22  253 253 HOH HOH C . 
S 10 HOH 23  254 254 HOH HOH C . 
S 10 HOH 24  277 277 HOH HOH C . 
S 10 HOH 25  291 291 HOH HOH C . 
S 10 HOH 26  304 304 HOH HOH C . 
S 10 HOH 27  317 317 HOH HOH C . 
S 10 HOH 28  318 318 HOH HOH C . 
S 10 HOH 29  319 319 HOH HOH C . 
S 10 HOH 30  328 328 HOH HOH C . 
S 10 HOH 31  334 334 HOH HOH C . 
T 10 HOH 1   25  25  HOH HOH D . 
T 10 HOH 2   26  4   HOH HOH D . 
T 10 HOH 3   37  37  HOH HOH D . 
T 10 HOH 4   38  38  HOH HOH D . 
T 10 HOH 5   41  41  HOH HOH D . 
T 10 HOH 6   55  55  HOH HOH D . 
T 10 HOH 7   60  60  HOH HOH D . 
T 10 HOH 8   136 136 HOH HOH D . 
T 10 HOH 9   147 147 HOH HOH D . 
T 10 HOH 10  184 184 HOH HOH D . 
T 10 HOH 11  196 196 HOH HOH D . 
T 10 HOH 12  205 205 HOH HOH D . 
T 10 HOH 13  235 235 HOH HOH D . 
T 10 HOH 14  259 259 HOH HOH D . 
T 10 HOH 15  265 265 HOH HOH D . 
T 10 HOH 16  294 294 HOH HOH D . 
T 10 HOH 17  302 302 HOH HOH D . 
T 10 HOH 18  333 333 HOH HOH D . 
#