data_3OYM
# 
_entry.id   3OYM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3OYM         
NDB   NA0797       
RCSB  RCSB061735   
WWPDB D_1000061735 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3DLR 'Catalytic core domain of PFV integrase'                  unspecified 
PDB 3L2Q 'PFV intasome in apo form'                                unspecified 
PDB 3L2R 'PFV intasome in complex with magnesium'                  unspecified 
PDB 3L2U 'PFV intasome in complex with magnesium and elvitegravir' unspecified 
PDB 3L2V 'PFV intasome in complex with manganese and raltegravir'  unspecified 
PDB 3L2W 'PFV intasome in complex with manganese and elvitegravir' unspecified 
PDB 3OY9 'PFV intasome in complex with manganese'                  unspecified 
PDB 3OYA 'PFV intasome in complex with magnesium and raltegravir'  unspecified 
PDB 3OYB 'PFV intasome in complex with magnesium and MK2048'       unspecified 
PDB 3OYC 'PFV intasome in complex with magnesium and PICA'         unspecified 
PDB 3OYD 'PFV intasome in complex with magnesium and GS9160'       unspecified 
PDB 3OYE 'PFV intasome in complex with magnesium and COMPOUND2'    unspecified 
PDB 3OYF 'PFV intasome in complex with magnesium and L870810'      unspecified 
PDB 3OYG 'PFV intasome in complex with magnesium and COMPOUND G'   unspecified 
PDB 3OYH 'PFV intasome in complex with magnesium and MK0536'       unspecified 
PDB 3OYI 'S217Q PFV intasome in complex with manganese'            unspecified 
PDB 3OYJ 'S217Q PFV intasome in complex with magnesium and MK2048' unspecified 
PDB 3OYK 'S217H PFV intasome in complex with manganese'            unspecified 
PDB 3OYL 'S217H PFV intasome in complex with magnesium and MK2048' unspecified 
PDB 3OYN 'N224H PFV intasome in complex with magnesium and MK2048' unspecified 
# 
_pdbx_database_status.entry_id                        3OYM 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-23 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hare, S.'       1 
'Cherepanov, P.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            107 
_citation.page_first                20057 
_citation.page_last                 20062 
_citation.year                      2010 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21030679 
_citation.pdbx_database_id_DOI      10.1073/pnas.1010246107 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hare, S.'       1 
primary 'Vos, A.M.'      2 
primary 'Clayton, R.F.'  3 
primary 'Thuring, J.W.'  4 
primary 'Cummings, M.D.' 5 
primary 'Cherepanov, P.' 6 
# 
_cell.entry_id           3OYM 
_cell.length_a           158.050 
_cell.length_b           158.050 
_cell.length_c           122.160 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3OYM 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'PFV integrase'                                                           44480.738 2   ? ? 
'UNP residues 752 to 1143' ?                                                                   
2  polymer     syn 
;DNA (5'-D(*AP*TP*TP*GP*TP*CP*AP*TP*GP*GP*AP*AP*TP*TP*TP*CP*GP*CP*A)-3')
;
5834.794  1   ? ? ?                          '19 nucleotide preprocessed PFV donor DNA (non-transferred strand)' 
3  polymer     syn 
;DNA (5'-D(*TP*GP*CP*GP*AP*AP*AP*TP*TP*CP*CP*AP*TP*GP*AP*CP*A)-3')
;
5195.399  1   ? ? ?                          '17 nucleotide preprocessed PFV donor DNA (transferred strand)'     
4  non-polymer syn 'ZINC ION'                                                                65.409    1   ? ? ? ? 
5  non-polymer syn 'MANGANESE (II) ION'                                                      54.938    3   ? ? ? ? 
6  non-polymer syn 'SULFATE ION'                                                             96.063    3   ? ? ? ? 
7  non-polymer syn GLYCEROL                                                                  92.094    5   ? ? ? ? 
8  non-polymer syn 'AMMONIUM ION'                                                            18.038    1   ? ? ? ? 
9  non-polymer syn HEXANE-1,6-DIOL                                                           118.174   1   ? ? ? ? 
10 water       nat water                                                                     18.015    596 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        p42In 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKHSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
A,B ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DT)(DG)(DT)(DC)(DA)(DT)(DG)(DG)(DA)(DA)(DT)(DT)(DT)(DC)(DG)(DC)(DA)' ATTGTCATGGAATTTCGCA 
C   ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DG)(DA)(DA)(DA)(DT)(DT)(DC)(DC)(DA)(DT)(DG)(DA)(DC)(DA)' TGCGAAATTCCATGACA D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   CYS n 
1 5   ASN n 
1 6   THR n 
1 7   LYS n 
1 8   LYS n 
1 9   PRO n 
1 10  ASN n 
1 11  LEU n 
1 12  ASP n 
1 13  ALA n 
1 14  GLU n 
1 15  LEU n 
1 16  ASP n 
1 17  GLN n 
1 18  LEU n 
1 19  LEU n 
1 20  GLN n 
1 21  GLY n 
1 22  HIS n 
1 23  TYR n 
1 24  ILE n 
1 25  LYS n 
1 26  GLY n 
1 27  TYR n 
1 28  PRO n 
1 29  LYS n 
1 30  GLN n 
1 31  TYR n 
1 32  THR n 
1 33  TYR n 
1 34  PHE n 
1 35  LEU n 
1 36  GLU n 
1 37  ASP n 
1 38  GLY n 
1 39  LYS n 
1 40  VAL n 
1 41  LYS n 
1 42  VAL n 
1 43  SER n 
1 44  ARG n 
1 45  PRO n 
1 46  GLU n 
1 47  GLY n 
1 48  VAL n 
1 49  LYS n 
1 50  ILE n 
1 51  ILE n 
1 52  PRO n 
1 53  PRO n 
1 54  GLN n 
1 55  SER n 
1 56  ASP n 
1 57  ARG n 
1 58  GLN n 
1 59  LYS n 
1 60  ILE n 
1 61  VAL n 
1 62  LEU n 
1 63  GLN n 
1 64  ALA n 
1 65  HIS n 
1 66  ASN n 
1 67  LEU n 
1 68  ALA n 
1 69  HIS n 
1 70  THR n 
1 71  GLY n 
1 72  ARG n 
1 73  GLU n 
1 74  ALA n 
1 75  THR n 
1 76  LEU n 
1 77  LEU n 
1 78  LYS n 
1 79  ILE n 
1 80  ALA n 
1 81  ASN n 
1 82  LEU n 
1 83  TYR n 
1 84  TRP n 
1 85  TRP n 
1 86  PRO n 
1 87  ASN n 
1 88  MET n 
1 89  ARG n 
1 90  LYS n 
1 91  ASP n 
1 92  VAL n 
1 93  VAL n 
1 94  LYS n 
1 95  GLN n 
1 96  LEU n 
1 97  GLY n 
1 98  ARG n 
1 99  CYS n 
1 100 GLN n 
1 101 GLN n 
1 102 CYS n 
1 103 LEU n 
1 104 ILE n 
1 105 THR n 
1 106 ASN n 
1 107 ALA n 
1 108 SER n 
1 109 ASN n 
1 110 LYS n 
1 111 ALA n 
1 112 SER n 
1 113 GLY n 
1 114 PRO n 
1 115 ILE n 
1 116 LEU n 
1 117 ARG n 
1 118 PRO n 
1 119 ASP n 
1 120 ARG n 
1 121 PRO n 
1 122 GLN n 
1 123 LYS n 
1 124 PRO n 
1 125 PHE n 
1 126 ASP n 
1 127 LYS n 
1 128 PHE n 
1 129 PHE n 
1 130 ILE n 
1 131 ASP n 
1 132 TYR n 
1 133 ILE n 
1 134 GLY n 
1 135 PRO n 
1 136 LEU n 
1 137 PRO n 
1 138 PRO n 
1 139 SER n 
1 140 GLN n 
1 141 GLY n 
1 142 TYR n 
1 143 LEU n 
1 144 TYR n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 VAL n 
1 149 VAL n 
1 150 ASP n 
1 151 GLY n 
1 152 MET n 
1 153 THR n 
1 154 GLY n 
1 155 PHE n 
1 156 THR n 
1 157 TRP n 
1 158 LEU n 
1 159 TYR n 
1 160 PRO n 
1 161 THR n 
1 162 LYS n 
1 163 ALA n 
1 164 PRO n 
1 165 SER n 
1 166 THR n 
1 167 SER n 
1 168 ALA n 
1 169 THR n 
1 170 VAL n 
1 171 LYS n 
1 172 SER n 
1 173 LEU n 
1 174 ASN n 
1 175 VAL n 
1 176 LEU n 
1 177 THR n 
1 178 SER n 
1 179 ILE n 
1 180 ALA n 
1 181 ILE n 
1 182 PRO n 
1 183 LYS n 
1 184 VAL n 
1 185 ILE n 
1 186 HIS n 
1 187 SER n 
1 188 ASP n 
1 189 GLN n 
1 190 GLY n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 THR n 
1 195 SER n 
1 196 SER n 
1 197 THR n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 TRP n 
1 202 ALA n 
1 203 LYS n 
1 204 GLU n 
1 205 ARG n 
1 206 GLY n 
1 207 ILE n 
1 208 HIS n 
1 209 LEU n 
1 210 GLU n 
1 211 PHE n 
1 212 SER n 
1 213 THR n 
1 214 PRO n 
1 215 TYR n 
1 216 HIS n 
1 217 PRO n 
1 218 GLN n 
1 219 SER n 
1 220 SER n 
1 221 GLY n 
1 222 LYS n 
1 223 VAL n 
1 224 GLU n 
1 225 ARG n 
1 226 LYS n 
1 227 HIS n 
1 228 SER n 
1 229 ASP n 
1 230 ILE n 
1 231 LYS n 
1 232 ARG n 
1 233 LEU n 
1 234 LEU n 
1 235 THR n 
1 236 LYS n 
1 237 LEU n 
1 238 LEU n 
1 239 VAL n 
1 240 GLY n 
1 241 ARG n 
1 242 PRO n 
1 243 THR n 
1 244 LYS n 
1 245 TRP n 
1 246 TYR n 
1 247 ASP n 
1 248 LEU n 
1 249 LEU n 
1 250 PRO n 
1 251 VAL n 
1 252 VAL n 
1 253 GLN n 
1 254 LEU n 
1 255 ALA n 
1 256 LEU n 
1 257 ASN n 
1 258 ASN n 
1 259 THR n 
1 260 TYR n 
1 261 SER n 
1 262 PRO n 
1 263 VAL n 
1 264 LEU n 
1 265 LYS n 
1 266 TYR n 
1 267 THR n 
1 268 PRO n 
1 269 HIS n 
1 270 GLN n 
1 271 LEU n 
1 272 LEU n 
1 273 PHE n 
1 274 GLY n 
1 275 ILE n 
1 276 ASP n 
1 277 SER n 
1 278 ASN n 
1 279 THR n 
1 280 PRO n 
1 281 PHE n 
1 282 ALA n 
1 283 ASN n 
1 284 GLN n 
1 285 ASP n 
1 286 THR n 
1 287 LEU n 
1 288 ASP n 
1 289 LEU n 
1 290 THR n 
1 291 ARG n 
1 292 GLU n 
1 293 GLU n 
1 294 GLU n 
1 295 LEU n 
1 296 SER n 
1 297 LEU n 
1 298 LEU n 
1 299 GLN n 
1 300 GLU n 
1 301 ILE n 
1 302 ARG n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 TYR n 
1 307 HIS n 
1 308 PRO n 
1 309 SER n 
1 310 THR n 
1 311 PRO n 
1 312 PRO n 
1 313 ALA n 
1 314 SER n 
1 315 SER n 
1 316 ARG n 
1 317 SER n 
1 318 TRP n 
1 319 SER n 
1 320 PRO n 
1 321 VAL n 
1 322 VAL n 
1 323 GLY n 
1 324 GLN n 
1 325 LEU n 
1 326 VAL n 
1 327 GLN n 
1 328 GLU n 
1 329 ARG n 
1 330 VAL n 
1 331 ALA n 
1 332 ARG n 
1 333 PRO n 
1 334 ALA n 
1 335 SER n 
1 336 LEU n 
1 337 ARG n 
1 338 PRO n 
1 339 ARG n 
1 340 TRP n 
1 341 HIS n 
1 342 LYS n 
1 343 PRO n 
1 344 SER n 
1 345 THR n 
1 346 VAL n 
1 347 LEU n 
1 348 LYS n 
1 349 VAL n 
1 350 LEU n 
1 351 ASN n 
1 352 PRO n 
1 353 ARG n 
1 354 THR n 
1 355 VAL n 
1 356 VAL n 
1 357 ILE n 
1 358 LEU n 
1 359 ASP n 
1 360 HIS n 
1 361 LEU n 
1 362 GLY n 
1 363 ASN n 
1 364 ASN n 
1 365 ARG n 
1 366 THR n 
1 367 VAL n 
1 368 SER n 
1 369 ILE n 
1 370 ASP n 
1 371 ASN n 
1 372 LEU n 
1 373 LYS n 
1 374 PRO n 
1 375 THR n 
1 376 SER n 
1 377 HIS n 
1 378 GLN n 
1 379 ASN n 
1 380 GLY n 
1 381 THR n 
1 382 THR n 
1 383 ASN n 
1 384 ASP n 
1 385 THR n 
1 386 ALA n 
1 387 THR n 
1 388 MET n 
1 389 ASP n 
1 390 HIS n 
1 391 LEU n 
1 392 GLU n 
1 393 LYS n 
1 394 ASN n 
1 395 GLU n 
2 1   DA  n 
2 2   DT  n 
2 3   DT  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
2 9   DG  n 
2 10  DG  n 
2 11  DA  n 
2 12  DA  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DC  n 
2 17  DG  n 
2 18  DC  n 
2 19  DA  n 
3 1   DT  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DA  n 
3 6   DA  n 
3 7   DA  n 
3 8   DT  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DA  n 
3 13  DT  n 
3 14  DG  n 
3 15  DA  n 
3 16  DC  n 
3 17  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'SFVcpz(hu)' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 POL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    HSRV2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human spumaretrovirus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11963 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               PC2 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pSSH6P-PFV-INFL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'Donor DNA non-transferred strand' 
3 1 sample ? ? ? ? ? 'Donor DNA transferred strand'     
# 
loop_
_struct_ref.id 
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 POL_FOAMV UNP 1 P14350 752 
;CNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLY
WWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKA
PSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPT
KWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVG
QLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
? 
2 3OYM      PDB 2 3OYM   1   ATTGTCATGGAATTTCGCA ? 
3 3OYM      PDB 3 3OYM   1   TGCGAAATTCCATGACA ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3OYM A 4 ? 395 ? P14350 752 ? 1143 ? 1 392 
2 1 3OYM B 4 ? 360 ? P14350 752 ? 1143 ? 1 357 
3 2 3OYM C 1 ? 19  ? 3OYM   1   ? 19   ? 1 19  
4 3 3OYM D 1 ? 17  ? 3OYM   1   ? 17   ? 1 17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3OYM GLY A 1   ? UNP P14350 ?   ?   'EXPRESSION TAG'      -2  1  
1 3OYM PRO A 2   ? UNP P14350 ?   ?   'EXPRESSION TAG'      -1  2  
1 3OYM GLY A 3   ? UNP P14350 ?   ?   'EXPRESSION TAG'      0   3  
1 3OYM SER A 220 ? UNP P14350 GLY 968 VARIANT               217 4  
1 3OYM GLY A 221 ? UNP P14350 SER 969 VARIANT               218 5  
1 3OYM HIS A 227 ? UNP P14350 ASN 975 'ENGINEERED MUTATION' 224 6  
2 3OYM GLY B 1   ? UNP P14350 ?   ?   'EXPRESSION TAG'      -2  7  
2 3OYM PRO B 2   ? UNP P14350 ?   ?   'EXPRESSION TAG'      -1  8  
2 3OYM GLY B 3   ? UNP P14350 ?   ?   'EXPRESSION TAG'      0   9  
2 3OYM SER B 220 ? UNP P14350 GLY 968 VARIANT               217 10 
2 3OYM GLY B 221 ? UNP P14350 SER 969 VARIANT               218 11 
2 3OYM HIS B 227 ? UNP P14350 ASN 975 'ENGINEERED MUTATION' 224 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HEZ non-polymer         . HEXANE-1,6-DIOL                      ?                               'C6 H14 O2'       118.174 
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ?                               'Mn 2'            54.938  
NH4 non-polymer         . 'AMMONIUM ION'                       ?                               'H4 N 1'          18.038  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ?                               'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ?                               'Zn 2'            65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3OYM 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.81 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   67.76 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
;1.35 M ammonium sulfate, 25% (v/v) glycerol, 4.8% (v/v) 1,6-hexanediol, 50 mM Mes-NaOH, 1mM EDTA, pH 6.5, vapor diffusion, hanging drop, temperature 291K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2010-06-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97630 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_wavelength_list        0.97630 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
# 
_reflns.entry_id                     3OYM 
_reflns.d_resolution_high            2.020 
_reflns.d_resolution_low             39.894 
_reflns.number_all                   ? 
_reflns.number_obs                   99967 
_reflns.pdbx_netI_over_sigmaI        8.700 
_reflns.pdbx_Rsym_value              0.106 
_reflns.pdbx_redundancy              4.800 
_reflns.percent_possible_obs         98.900 
_reflns.observed_criterion_sigma_F   -3 
_reflns.observed_criterion_sigma_I   -3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.020 2.130  ? 70146 ? 0.761 1.6  0.761 ? 4.900 ? 14403 98.800 ? 1  
2.130 2.260  ? 66553 ? 0.468 2.5  0.468 ? 4.900 ? 13721 99.200 ? 2  
2.260 2.410  ? 62340 ? 0.317 3.6  0.317 ? 4.800 ? 12909 99.400 ? 3  
2.410 2.610  ? 58313 ? 0.212 5.1  0.212 ? 4.800 ? 12098 99.500 ? 4  
2.610 2.860  ? 53382 ? 0.143 7.6  0.143 ? 4.800 ? 11162 99.400 ? 5  
2.860 3.190  ? 48210 ? 0.095 10.7 0.095 ? 4.800 ? 10110 99.400 ? 6  
3.190 3.690  ? 42248 ? 0.073 14.4 0.073 ? 4.700 ? 8925  98.900 ? 7  
3.690 4.520  ? 35201 ? 0.078 17.9 0.078 ? 4.700 ? 7480  97.500 ? 8  
4.520 6.390  ? 26253 ? 0.082 24.2 0.082 ? 4.500 ? 5875  98.200 ? 9  
6.390 39.894 ? 15347 ? 0.034 31.5 0.034 ? 4.700 ? 3284  95.800 ? 10 
# 
_refine.entry_id                                 3OYM 
_refine.ls_d_res_high                            2.0200 
_refine.ls_d_res_low                             39.8900 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.5200 
_refine.ls_number_reflns_obs                     99745 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.20 
_refine.ls_R_factor_obs                          0.1987 
_refine.ls_R_factor_R_work                       0.1972 
_refine.ls_wR_factor_R_work                      0.1995 
_refine.ls_R_factor_R_free                       0.2276 
_refine.ls_wR_factor_R_free                      0.2317 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  5025 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               37.6561 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            1.0900 
_refine.aniso_B[2][2]                            1.0900 
_refine.aniso_B[3][3]                            -2.1700 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9580 
_refine.correlation_coeff_Fo_to_Fc_free          0.9430 
_refine.overall_SU_R_Cruickshank_DPI             0.1159 
_refine.overall_SU_R_free                        0.1160 
_refine.pdbx_overall_ESU_R_Free                  0.1170 
_refine.overall_SU_ML                            0.0880 
_refine.overall_SU_B                             3.2920 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8528 
_refine.B_iso_max                                98.810 
_refine.B_iso_min                                18.680 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.300 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_starting_model                      'PDB entry 3OY9' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4388 
_refine_hist.pdbx_number_atoms_nucleic_acid   732 
_refine_hist.pdbx_number_atoms_ligand         58 
_refine_hist.number_atoms_solvent             596 
_refine_hist.number_atoms_total               5774 
_refine_hist.d_res_high                       2.0200 
_refine_hist.d_res_low                        39.8900 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       5428 0.010  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    7550 1.353  2.150  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 566  5.810  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 192  34.347 23.594 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 771  14.050 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 28   14.443 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         850  0.078  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   3826 0.006  0.021  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            2801 0.662  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           4590 1.259  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            2627 1.773  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           2952 2.877  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.0200 
_refine_ls_shell.d_res_low                        2.0720 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.6700 
_refine_ls_shell.number_reflns_R_work             6905 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3350 
_refine_ls_shell.R_factor_R_free                  0.3250 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             367 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                7272 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3OYM 
_struct.title                     'Crystal structure of the PFV N224H mutant intasome bound to manganese' 
_struct.pdbx_descriptor           'PFV integrase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3OYM 
_struct_keywords.text            
;PROTEIN-DNA COMPLEX, TETRAMER, DNA INTEGRATION, ENDONUCLEASE, METAL-BINDING, MULTIFUNCTIONAL ENZYME, NUCLEASE, NUCLEOTIDYLTRANSFERASE, NUCLEUS, TRANSFERASE, VIRAL NUCLEOPROTEIN, VIRION, DNA-BINDING, ZINC BINDING, HHCC MOTIF, VIRAL PROTEIN, RECOMBINATION, INHIBITOR, DNA-BINDING PROTEIN-DNA complex, VIRAL PROTEIN-DNA complex
;
_struct_keywords.pdbx_keywords   'RECOMBINATION,VIRAL PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 6  ? 
K N N 7  ? 
L N N 5  ? 
M N N 7  ? 
N N N 5  ? 
O N N 7  ? 
P N N 6  ? 
Q N N 9  ? 
R N N 7  ? 
S N N 10 ? 
T N N 10 ? 
U N N 10 ? 
V N N 10 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 11  ? GLN A 20  ? LEU A 8   GLN A 17  1 ? 10 
HELX_P HELX_P2  2  PRO A 53  ? SER A 55  ? PRO A 50  SER A 52  5 ? 3  
HELX_P HELX_P3  3  ASP A 56  ? LEU A 67  ? ASP A 53  LEU A 64  1 ? 12 
HELX_P HELX_P4  4  GLY A 71  ? ASN A 81  ? GLY A 68  ASN A 78  1 ? 11 
HELX_P HELX_P5  5  ASN A 87  ? GLY A 97  ? ASN A 84  GLY A 94  1 ? 11 
HELX_P HELX_P6  6  CYS A 99  ? ASN A 106 ? CYS A 96  ASN A 103 1 ? 8  
HELX_P HELX_P7  7  SER A 165 ? THR A 177 ? SER A 162 THR A 174 1 ? 13 
HELX_P HELX_P8  8  GLY A 190 ? SER A 195 ? GLY A 187 SER A 192 1 ? 6  
HELX_P HELX_P9  9  SER A 195 ? ARG A 205 ? SER A 192 ARG A 202 1 ? 11 
HELX_P HELX_P10 10 HIS A 216 ? SER A 219 ? HIS A 213 SER A 216 5 ? 4  
HELX_P HELX_P11 11 SER A 220 ? VAL A 239 ? SER A 217 VAL A 236 1 ? 20 
HELX_P HELX_P12 12 TRP A 245 ? ASP A 247 ? TRP A 242 ASP A 244 5 ? 3  
HELX_P HELX_P13 13 LEU A 248 ? ASN A 258 ? LEU A 245 ASN A 255 1 ? 11 
HELX_P HELX_P14 14 THR A 267 ? GLY A 274 ? THR A 264 GLY A 271 1 ? 8  
HELX_P HELX_P15 15 THR A 290 ? SER A 304 ? THR A 287 SER A 301 1 ? 15 
HELX_P HELX_P16 16 SER B 165 ? THR B 177 ? SER B 162 THR B 174 1 ? 13 
HELX_P HELX_P17 17 GLY B 190 ? SER B 195 ? GLY B 187 SER B 192 1 ? 6  
HELX_P HELX_P18 18 SER B 195 ? ARG B 205 ? SER B 192 ARG B 202 1 ? 11 
HELX_P HELX_P19 19 SER B 220 ? LEU B 238 ? SER B 217 LEU B 235 1 ? 19 
HELX_P HELX_P20 20 LYS B 244 ? ASN B 258 ? LYS B 241 ASN B 255 1 ? 15 
HELX_P HELX_P21 21 THR B 267 ? GLY B 274 ? THR B 264 GLY B 271 1 ? 8  
HELX_P HELX_P22 22 THR B 290 ? ARG B 302 ? THR B 287 ARG B 299 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 65  NE2 ? ? ? 1_555 E ZN  .  ZN ? ? A HIS 62  A ZN  393 1_555 ? ? ? ? ? ? ?            2.015 ? 
metalc2  metalc ? ? L MN  .   MN  ? ? ? 1_555 T HOH .  O  ? ? B MN  393 B HOH 511 1_555 ? ? ? ? ? ? ?            2.017 ? 
metalc3  metalc ? ? A HIS 69  ND1 ? ? ? 1_555 E ZN  .  ZN ? ? A HIS 66  A ZN  393 1_555 ? ? ? ? ? ? ?            2.027 ? 
metalc4  metalc ? ? F MN  .   MN  ? ? ? 1_555 S HOH .  O  ? ? A MN  394 A HOH 589 1_555 ? ? ? ? ? ? ?            2.111 ? 
metalc5  metalc ? ? B GLU 224 OE1 ? ? ? 1_555 N MN  .  MN ? ? B GLU 221 B MN  394 1_555 ? ? ? ? ? ? ?            2.111 ? 
metalc6  metalc ? ? B ASP 188 OD1 ? ? ? 1_555 L MN  .  MN ? ? B ASP 185 B MN  393 1_555 ? ? ? ? ? ? ?            2.130 ? 
metalc7  metalc ? ? A ASP 131 OD1 ? ? ? 1_555 F MN  .  MN ? ? A ASP 128 A MN  394 1_555 ? ? ? ? ? ? ?            2.137 ? 
metalc8  metalc ? ? A ASP 188 OD1 ? ? ? 1_555 F MN  .  MN ? ? A ASP 185 A MN  394 1_555 ? ? ? ? ? ? ?            2.163 ? 
metalc9  metalc ? ? L MN  .   MN  ? ? ? 1_555 T HOH .  O  ? ? B MN  393 B HOH 415 1_555 ? ? ? ? ? ? ?            2.202 ? 
metalc10 metalc ? ? B ASP 131 OD1 ? ? ? 1_555 L MN  .  MN ? ? B ASP 128 B MN  393 1_555 ? ? ? ? ? ? ?            2.241 ? 
metalc11 metalc ? ? F MN  .   MN  ? ? ? 1_555 S HOH .  O  ? ? A MN  394 A HOH 588 1_555 ? ? ? ? ? ? ?            2.255 ? 
metalc12 metalc ? ? F MN  .   MN  ? ? ? 1_555 S HOH .  O  ? ? A MN  394 A HOH 399 1_555 ? ? ? ? ? ? ?            2.291 ? 
metalc13 metalc ? ? N MN  .   MN  ? ? ? 1_555 T HOH .  O  ? ? B MN  394 B HOH 417 1_555 ? ? ? ? ? ? ?            2.296 ? 
metalc14 metalc ? ? A CYS 99  SG  ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 96  A ZN  393 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc15 metalc ? ? A CYS 102 SG  ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 99  A ZN  393 1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc16 metalc ? ? N MN  .   MN  ? ? ? 1_555 T HOH .  O  ? ? B MN  394 B HOH 416 1_555 ? ? ? ? ? ? ?            2.323 ? 
metalc17 metalc ? ? F MN  .   MN  ? ? ? 1_555 S HOH .  O  ? ? A MN  394 A HOH 400 1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc18 metalc ? ? L MN  .   MN  ? ? ? 1_555 T HOH .  O  ? ? B MN  393 B HOH 514 1_555 ? ? ? ? ? ? ?            2.368 ? 
metalc19 metalc ? ? B HIS 227 ND1 ? ? ? 1_555 N MN  .  MN ? ? B HIS 224 B MN  394 1_555 ? ? ? ? ? ? ?            2.377 ? 
metalc20 metalc ? ? N MN  .   MN  ? ? ? 1_555 T HOH .  O  ? ? B MN  394 B HOH 418 1_555 ? ? ? ? ? ? ?            2.462 ? 
hydrog1  hydrog ? ? C DG  4   N1  ? ? ? 1_555 D DC  16 N3 ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  4   N2  ? ? ? 1_555 D DC  16 O2 ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  4   O6  ? ? ? 1_555 D DC  16 N4 ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DT  5   N3  ? ? ? 1_555 D DA  15 N1 ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DT  5   O4  ? ? ? 1_555 D DA  15 N6 ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DC  6   N3  ? ? ? 1_555 D DG  14 N1 ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DC  6   N4  ? ? ? 1_555 D DG  14 O6 ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DC  6   O2  ? ? ? 1_555 D DG  14 N2 ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DA  7   N1  ? ? ? 1_555 D DT  13 N3 ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DA  7   N6  ? ? ? 1_555 D DT  13 O4 ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DT  8   N3  ? ? ? 1_555 D DA  12 N1 ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DT  8   O4  ? ? ? 1_555 D DA  12 N6 ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DG  9   N1  ? ? ? 1_555 D DC  11 N3 ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DG  9   N2  ? ? ? 1_555 D DC  11 O2 ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DG  9   O6  ? ? ? 1_555 D DC  11 N4 ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DG  10  N1  ? ? ? 1_555 D DC  10 N3 ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DG  10  N2  ? ? ? 1_555 D DC  10 O2 ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  10  O6  ? ? ? 1_555 D DC  10 N4 ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DA  11  N1  ? ? ? 1_555 D DT  9  N3 ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DA  11  N6  ? ? ? 1_555 D DT  9  O4 ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DA  12  N1  ? ? ? 1_555 D DT  8  N3 ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DA  12  N6  ? ? ? 1_555 D DT  8  O4 ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DT  13  N3  ? ? ? 1_555 D DA  7  N1 ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DT  13  O4  ? ? ? 1_555 D DA  7  N6 ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DT  14  N3  ? ? ? 1_555 D DA  6  N1 ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DT  14  O4  ? ? ? 1_555 D DA  6  N6 ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DT  15  N3  ? ? ? 1_555 D DA  5  N1 ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DT  15  O4  ? ? ? 1_555 D DA  5  N6 ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DC  16  N3  ? ? ? 1_555 D DG  4  N1 ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DC  16  N4  ? ? ? 1_555 D DG  4  O6 ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DC  16  O2  ? ? ? 1_555 D DG  4  N2 ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DG  17  N1  ? ? ? 1_555 D DC  3  N3 ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DG  17  N2  ? ? ? 1_555 D DC  3  O2 ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DG  17  O6  ? ? ? 1_555 D DC  3  N4 ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DC  18  N3  ? ? ? 1_555 D DG  2  N1 ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DC  18  N4  ? ? ? 1_555 D DG  2  O6 ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DC  18  O2  ? ? ? 1_555 D DG  2  N2 ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DA  19  N1  ? ? ? 1_555 D DT  1  N3 ? ? C DA  19  D DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DA  19  N6  ? ? ? 1_555 D DT  1  O4 ? ? C DA  19  D DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 134 A . ? GLY 131 A PRO 135 A ? PRO 132 A 1 2.81 
2 GLY 134 B . ? GLY 131 B PRO 135 B ? PRO 132 B 1 4.71 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 5 ? 
D ? 5 ? 
E ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 33  ? GLU A 36  ? TYR A 30  GLU A 33  
A 2 LYS A 39  ? ARG A 44  ? LYS A 36  ARG A 41  
A 3 GLY A 47  ? ILE A 50  ? GLY A 44  ILE A 47  
B 1 ALA A 111 ? SER A 112 ? ALA A 108 SER A 109 
B 2 SER A 317 ? TRP A 318 ? SER A 314 TRP A 315 
C 1 THR A 156 ? THR A 161 ? THR A 153 THR A 158 
C 2 TYR A 144 ? ASP A 150 ? TYR A 141 ASP A 147 
C 3 LYS A 127 ? ILE A 133 ? LYS A 124 ILE A 130 
C 4 VAL A 184 ? SER A 187 ? VAL A 181 SER A 184 
C 5 HIS A 208 ? PHE A 211 ? HIS A 205 PHE A 208 
D 1 ASN A 364 ? SER A 368 ? ASN A 361 SER A 365 
D 2 THR A 354 ? LEU A 358 ? THR A 351 LEU A 355 
D 3 SER A 344 ? ASN A 351 ? SER A 341 ASN A 348 
D 4 LEU A 325 ? GLU A 328 ? LEU A 322 GLU A 325 
D 5 LEU A 372 ? PRO A 374 ? LEU A 369 PRO A 371 
E 1 THR B 156 ? THR B 161 ? THR B 153 THR B 158 
E 2 TYR B 144 ? ASP B 150 ? TYR B 141 ASP B 147 
E 3 LYS B 127 ? ILE B 133 ? LYS B 124 ILE B 130 
E 4 VAL B 184 ? SER B 187 ? VAL B 181 SER B 184 
E 5 HIS B 208 ? PHE B 211 ? HIS B 205 PHE B 208 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 34  ? N PHE A 31  O LYS A 41  ? O LYS A 38  
A 2 3 N ARG A 44  ? N ARG A 41  O GLY A 47  ? O GLY A 44  
B 1 2 N ALA A 111 ? N ALA A 108 O TRP A 318 ? O TRP A 315 
C 1 2 O TYR A 159 ? O TYR A 156 N LEU A 146 ? N LEU A 143 
C 2 3 O VAL A 147 ? O VAL A 144 N ASP A 131 ? N ASP A 128 
C 3 4 N PHE A 128 ? N PHE A 125 O HIS A 186 ? O HIS A 183 
C 4 5 N ILE A 185 ? N ILE A 182 O GLU A 210 ? O GLU A 207 
D 1 2 O ARG A 365 ? O ARG A 362 N ILE A 357 ? N ILE A 354 
D 2 3 O VAL A 356 ? O VAL A 353 N LYS A 348 ? N LYS A 345 
D 3 4 O SER A 344 ? O SER A 341 N VAL A 326 ? N VAL A 323 
D 4 5 N GLN A 327 ? N GLN A 324 O LYS A 373 ? O LYS A 370 
E 1 2 O TYR B 159 ? O TYR B 156 N LEU B 146 ? N LEU B 143 
E 2 3 O VAL B 147 ? O VAL B 144 N ASP B 131 ? N ASP B 128 
E 3 4 N PHE B 128 ? N PHE B 125 O HIS B 186 ? O HIS B 183 
E 4 5 N ILE B 185 ? N ILE B 182 O GLU B 210 ? O GLU B 207 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 393'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN A 394'  
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 395' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 801' 
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE NH4 A 396' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 397' 
AC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL A 398' 
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN B 393'  
AC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL B 803' 
BC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN B 394'  
BC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL B 395' 
BC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 B 396' 
BC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE HEZ B 397' 
BC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL C 20'  
1   ?        ? ? ? ? ? ?                                    
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 65  ? HIS A 62  . ? 1_555 ? 
2  AC1 4 HIS A 69  ? HIS A 66  . ? 1_555 ? 
3  AC1 4 CYS A 99  ? CYS A 96  . ? 1_555 ? 
4  AC1 4 CYS A 102 ? CYS A 99  . ? 1_555 ? 
5  AC2 6 ASP A 131 ? ASP A 128 . ? 1_555 ? 
6  AC2 6 ASP A 188 ? ASP A 185 . ? 1_555 ? 
7  AC2 6 HOH S .   ? HOH A 399 . ? 1_555 ? 
8  AC2 6 HOH S .   ? HOH A 400 . ? 1_555 ? 
9  AC2 6 HOH S .   ? HOH A 588 . ? 1_555 ? 
10 AC2 6 HOH S .   ? HOH A 589 . ? 1_555 ? 
11 AC3 3 HIS A 341 ? HIS A 338 . ? 1_555 ? 
12 AC3 3 LYS A 342 ? LYS A 339 . ? 1_555 ? 
13 AC3 3 HIS A 360 ? HIS A 357 . ? 1_555 ? 
14 AC4 4 SER A 165 ? SER A 162 . ? 1_555 ? 
15 AC4 4 THR A 166 ? THR A 163 . ? 1_555 ? 
16 AC4 4 SER A 167 ? SER A 164 . ? 1_555 ? 
17 AC4 4 HOH S .   ? HOH A 455 . ? 1_555 ? 
18 AC5 1 ASP A 119 ? ASP A 116 . ? 1_555 ? 
19 AC6 6 LYS A 231 ? LYS A 228 . ? 8_554 ? 
20 AC6 6 SER A 335 ? SER A 332 . ? 1_555 ? 
21 AC6 6 ARG A 339 ? ARG A 336 . ? 1_555 ? 
22 AC6 6 HOH S .   ? HOH A 428 . ? 1_555 ? 
23 AC6 6 HOH S .   ? HOH A 562 . ? 1_555 ? 
24 AC6 6 HOH V .   ? HOH D 506 . ? 8_554 ? 
25 AC7 3 SER A 139 ? SER A 136 . ? 1_555 ? 
26 AC7 3 GLN A 140 ? GLN A 137 . ? 1_555 ? 
27 AC7 3 LYS A 244 ? LYS A 241 . ? 1_555 ? 
28 AC8 6 ASP B 131 ? ASP B 128 . ? 1_555 ? 
29 AC8 6 ASP B 188 ? ASP B 185 . ? 1_555 ? 
30 AC8 6 HOH T .   ? HOH B 415 . ? 1_555 ? 
31 AC8 6 HOH T .   ? HOH B 511 . ? 1_555 ? 
32 AC8 6 HOH T .   ? HOH B 514 . ? 1_555 ? 
33 AC8 6 DA  C 19  ? DA  C 19  . ? 3_555 ? 
34 AC9 6 GLN A 299 ? GLN A 296 . ? 1_555 ? 
35 AC9 6 HOH S .   ? HOH A 672 . ? 1_555 ? 
36 AC9 6 TYR B 266 ? TYR B 263 . ? 1_555 ? 
37 AC9 6 GLN B 270 ? GLN B 267 . ? 1_555 ? 
38 AC9 6 GLY B 274 ? GLY B 271 . ? 1_555 ? 
39 AC9 6 ASP B 276 ? ASP B 273 . ? 1_555 ? 
40 BC1 6 GLU B 224 ? GLU B 221 . ? 1_555 ? 
41 BC1 6 HIS B 227 ? HIS B 224 . ? 1_555 ? 
42 BC1 6 ASP B 288 ? ASP B 285 . ? 8_555 ? 
43 BC1 6 HOH T .   ? HOH B 416 . ? 1_555 ? 
44 BC1 6 HOH T .   ? HOH B 417 . ? 1_555 ? 
45 BC1 6 HOH T .   ? HOH B 418 . ? 1_555 ? 
46 BC2 7 ILE B 130 ? ILE B 127 . ? 1_555 ? 
47 BC2 7 HIS B 186 ? HIS B 183 . ? 1_555 ? 
48 BC2 7 PRO B 217 ? PRO B 214 . ? 1_555 ? 
49 BC2 7 SER B 219 ? SER B 216 . ? 1_555 ? 
50 BC2 7 SER B 220 ? SER B 217 . ? 1_555 ? 
51 BC2 7 VAL B 223 ? VAL B 220 . ? 1_555 ? 
52 BC2 7 GLU B 224 ? GLU B 221 . ? 1_555 ? 
53 BC3 7 LYS B 222 ? LYS B 219 . ? 1_555 ? 
54 BC3 7 ARG B 225 ? ARG B 222 . ? 1_555 ? 
55 BC3 7 SER B 261 ? SER B 258 . ? 1_555 ? 
56 BC3 7 PRO B 262 ? PRO B 259 . ? 1_555 ? 
57 BC3 7 VAL B 263 ? VAL B 260 . ? 1_555 ? 
58 BC3 7 HOH T .   ? HOH B 419 . ? 1_555 ? 
59 BC3 7 HOH T .   ? HOH B 421 . ? 1_555 ? 
60 BC4 3 LEU B 136 ? LEU B 133 . ? 1_555 ? 
61 BC4 3 LYS B 231 ? LYS B 228 . ? 1_555 ? 
62 BC4 3 THR B 235 ? THR B 232 . ? 1_555 ? 
63 BC5 6 DC  C 6   ? DC  C 6   . ? 1_555 ? 
64 BC5 6 DA  C 7   ? DA  C 7   . ? 1_555 ? 
65 BC5 6 DT  C 8   ? DT  C 8   . ? 1_555 ? 
66 BC5 6 HOH U .   ? HOH C 22  . ? 1_555 ? 
67 BC5 6 HOH U .   ? HOH C 302 . ? 1_555 ? 
68 BC5 6 DC  D 11  ? DC  D 11  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3OYM 
_atom_sites.fract_transf_matrix[1][1]   0.006327 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006327 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008186 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LEU A 1  11  ? -75.656 17.337 -57.683 1.00 82.87 ? 8   LEU A N     1 
ATOM   2    C  CA    . LEU A 1  11  ? -77.121 17.360 -57.988 1.00 83.15 ? 8   LEU A CA    1 
ATOM   3    C  C     . LEU A 1  11  ? -77.439 17.816 -59.421 1.00 83.03 ? 8   LEU A C     1 
ATOM   4    O  O     . LEU A 1  11  ? -77.527 19.019 -59.696 1.00 83.08 ? 8   LEU A O     1 
ATOM   5    C  CB    . LEU A 1  11  ? -77.877 18.227 -56.965 1.00 83.25 ? 8   LEU A CB    1 
ATOM   6    N  N     . ASP A 1  12  ? -77.609 16.847 -60.324 1.00 82.90 ? 9   ASP A N     1 
ATOM   7    C  CA    . ASP A 1  12  ? -78.060 17.120 -61.699 1.00 82.61 ? 9   ASP A CA    1 
ATOM   8    C  C     . ASP A 1  12  ? -79.564 17.409 -61.774 1.00 82.12 ? 9   ASP A C     1 
ATOM   9    O  O     . ASP A 1  12  ? -80.016 18.105 -62.689 1.00 82.08 ? 9   ASP A O     1 
ATOM   10   C  CB    . ASP A 1  12  ? -77.697 15.969 -62.645 1.00 82.86 ? 9   ASP A CB    1 
ATOM   11   C  CG    . ASP A 1  12  ? -76.275 16.074 -63.180 1.00 83.69 ? 9   ASP A CG    1 
ATOM   12   O  OD1   . ASP A 1  12  ? -75.946 17.098 -63.827 1.00 84.22 ? 9   ASP A OD1   1 
ATOM   13   O  OD2   . ASP A 1  12  ? -75.487 15.123 -62.963 1.00 84.54 ? 9   ASP A OD2   1 
ATOM   14   N  N     . ALA A 1  13  ? -80.326 16.870 -60.818 1.00 81.33 ? 10  ALA A N     1 
ATOM   15   C  CA    . ALA A 1  13  ? -81.760 17.134 -60.713 1.00 80.60 ? 10  ALA A CA    1 
ATOM   16   C  C     . ALA A 1  13  ? -82.026 18.624 -60.469 1.00 80.14 ? 10  ALA A C     1 
ATOM   17   O  O     . ALA A 1  13  ? -82.892 19.223 -61.114 1.00 80.09 ? 10  ALA A O     1 
ATOM   18   C  CB    . ALA A 1  13  ? -82.381 16.283 -59.612 1.00 80.56 ? 10  ALA A CB    1 
ATOM   19   N  N     . GLU A 1  14  ? -81.265 19.211 -59.545 1.00 79.41 ? 11  GLU A N     1 
ATOM   20   C  CA    . GLU A 1  14  ? -81.331 20.644 -59.248 1.00 78.56 ? 11  GLU A CA    1 
ATOM   21   C  C     . GLU A 1  14  ? -80.981 21.483 -60.479 1.00 78.04 ? 11  GLU A C     1 
ATOM   22   O  O     . GLU A 1  14  ? -81.679 22.450 -60.802 1.00 77.81 ? 11  GLU A O     1 
ATOM   23   C  CB    . GLU A 1  14  ? -80.392 20.980 -58.084 1.00 78.61 ? 11  GLU A CB    1 
ATOM   24   C  CG    . GLU A 1  14  ? -80.404 22.441 -57.654 1.00 78.65 ? 11  GLU A CG    1 
ATOM   25   C  CD    . GLU A 1  14  ? -79.440 22.724 -56.514 1.00 78.93 ? 11  GLU A CD    1 
ATOM   26   O  OE1   . GLU A 1  14  ? -78.205 22.718 -56.741 1.00 78.15 ? 11  GLU A OE1   1 
ATOM   27   O  OE2   . GLU A 1  14  ? -79.926 22.963 -55.388 1.00 78.93 ? 11  GLU A OE2   1 
ATOM   28   N  N     . LEU A 1  15  ? -79.902 21.095 -61.158 1.00 77.45 ? 12  LEU A N     1 
ATOM   29   C  CA    . LEU A 1  15  ? -79.446 21.758 -62.382 1.00 76.97 ? 12  LEU A CA    1 
ATOM   30   C  C     . LEU A 1  15  ? -80.398 21.515 -63.564 1.00 76.90 ? 12  LEU A C     1 
ATOM   31   O  O     . LEU A 1  15  ? -80.372 22.248 -64.559 1.00 76.70 ? 12  LEU A O     1 
ATOM   32   C  CB    . LEU A 1  15  ? -78.022 21.299 -62.735 1.00 76.76 ? 12  LEU A CB    1 
ATOM   33   C  CG    . LEU A 1  15  ? -76.781 22.076 -62.266 1.00 76.04 ? 12  LEU A CG    1 
ATOM   34   C  CD1   . LEU A 1  15  ? -76.891 22.591 -60.838 1.00 75.42 ? 12  LEU A CD1   1 
ATOM   35   C  CD2   . LEU A 1  15  ? -75.532 21.220 -62.431 1.00 74.50 ? 12  LEU A CD2   1 
ATOM   36   N  N     . ASP A 1  16  ? -81.234 20.484 -63.443 1.00 76.74 ? 13  ASP A N     1 
ATOM   37   C  CA    . ASP A 1  16  ? -82.228 20.171 -64.458 1.00 76.60 ? 13  ASP A CA    1 
ATOM   38   C  C     . ASP A 1  16  ? -83.320 21.234 -64.506 1.00 76.27 ? 13  ASP A C     1 
ATOM   39   O  O     . ASP A 1  16  ? -83.598 21.783 -65.575 1.00 76.16 ? 13  ASP A O     1 
ATOM   40   C  CB    . ASP A 1  16  ? -82.838 18.790 -64.208 1.00 76.81 ? 13  ASP A CB    1 
ATOM   41   C  CG    . ASP A 1  16  ? -83.343 18.131 -65.479 1.00 77.23 ? 13  ASP A CG    1 
ATOM   42   O  OD1   . ASP A 1  16  ? -83.574 18.835 -66.490 1.00 77.62 ? 13  ASP A OD1   1 
ATOM   43   O  OD2   . ASP A 1  16  ? -83.507 16.894 -65.464 1.00 77.83 ? 13  ASP A OD2   1 
ATOM   44   N  N     . GLN A 1  17  ? -83.921 21.532 -63.353 1.00 76.00 ? 14  GLN A N     1 
ATOM   45   C  CA    . GLN A 1  17  ? -84.991 22.538 -63.277 1.00 75.96 ? 14  GLN A CA    1 
ATOM   46   C  C     . GLN A 1  17  ? -84.524 23.892 -63.787 1.00 75.43 ? 14  GLN A C     1 
ATOM   47   O  O     . GLN A 1  17  ? -85.279 24.625 -64.435 1.00 75.48 ? 14  GLN A O     1 
ATOM   48   C  CB    . GLN A 1  17  ? -85.519 22.689 -61.847 1.00 76.19 ? 14  GLN A CB    1 
ATOM   49   C  CG    . GLN A 1  17  ? -86.608 21.699 -61.458 1.00 77.49 ? 14  GLN A CG    1 
ATOM   50   C  CD    . GLN A 1  17  ? -86.068 20.521 -60.668 1.00 79.22 ? 14  GLN A CD    1 
ATOM   51   O  OE1   . GLN A 1  17  ? -85.553 20.683 -59.558 1.00 79.74 ? 14  GLN A OE1   1 
ATOM   52   N  NE2   . GLN A 1  17  ? -86.194 19.325 -61.232 1.00 79.81 ? 14  GLN A NE2   1 
ATOM   53   N  N     . LEU A 1  18  ? -83.267 24.197 -63.484 1.00 74.86 ? 15  LEU A N     1 
ATOM   54   C  CA    . LEU A 1  18  ? -82.624 25.449 -63.841 1.00 74.19 ? 15  LEU A CA    1 
ATOM   55   C  C     . LEU A 1  18  ? -82.553 25.619 -65.351 1.00 73.87 ? 15  LEU A C     1 
ATOM   56   O  O     . LEU A 1  18  ? -82.805 26.710 -65.874 1.00 73.73 ? 15  LEU A O     1 
ATOM   57   C  CB    . LEU A 1  18  ? -81.216 25.469 -63.243 1.00 74.16 ? 15  LEU A CB    1 
ATOM   58   C  CG    . LEU A 1  18  ? -80.512 26.790 -62.952 1.00 73.83 ? 15  LEU A CG    1 
ATOM   59   C  CD1   . LEU A 1  18  ? -81.165 27.517 -61.793 1.00 73.38 ? 15  LEU A CD1   1 
ATOM   60   C  CD2   . LEU A 1  18  ? -79.061 26.505 -62.634 1.00 74.13 ? 15  LEU A CD2   1 
ATOM   61   N  N     . LEU A 1  19  ? -82.211 24.531 -66.042 1.00 73.47 ? 16  LEU A N     1 
ATOM   62   C  CA    . LEU A 1  19  ? -82.081 24.533 -67.498 1.00 73.14 ? 16  LEU A CA    1 
ATOM   63   C  C     . LEU A 1  19  ? -83.409 24.808 -68.213 1.00 72.98 ? 16  LEU A C     1 
ATOM   64   O  O     . LEU A 1  19  ? -83.440 25.511 -69.231 1.00 73.00 ? 16  LEU A O     1 
ATOM   65   C  CB    . LEU A 1  19  ? -81.465 23.218 -67.982 1.00 73.09 ? 16  LEU A CB    1 
ATOM   66   C  CG    . LEU A 1  19  ? -79.951 23.075 -67.821 1.00 72.80 ? 16  LEU A CG    1 
ATOM   67   C  CD1   . LEU A 1  19  ? -79.527 21.620 -67.973 1.00 72.44 ? 16  LEU A CD1   1 
ATOM   68   C  CD2   . LEU A 1  19  ? -79.213 23.968 -68.807 1.00 72.22 ? 16  LEU A CD2   1 
ATOM   69   N  N     . GLN A 1  20  ? -84.496 24.260 -67.668 1.00 72.48 ? 17  GLN A N     1 
ATOM   70   C  CA    . GLN A 1  20  ? -85.837 24.478 -68.214 1.00 72.23 ? 17  GLN A CA    1 
ATOM   71   C  C     . GLN A 1  20  ? -86.547 25.713 -67.626 1.00 71.74 ? 17  GLN A C     1 
ATOM   72   O  O     . GLN A 1  20  ? -87.778 25.823 -67.687 1.00 71.81 ? 17  GLN A O     1 
ATOM   73   C  CB    . GLN A 1  20  ? -86.696 23.210 -68.081 1.00 72.39 ? 17  GLN A CB    1 
ATOM   74   C  CG    . GLN A 1  20  ? -86.616 22.523 -66.724 1.00 72.95 ? 17  GLN A CG    1 
ATOM   75   C  CD    . GLN A 1  20  ? -86.863 21.025 -66.805 1.00 74.09 ? 17  GLN A CD    1 
ATOM   76   O  OE1   . GLN A 1  20  ? -87.659 20.474 -66.042 1.00 74.75 ? 17  GLN A OE1   1 
ATOM   77   N  NE2   . GLN A 1  20  ? -86.181 20.358 -67.733 1.00 74.15 ? 17  GLN A NE2   1 
ATOM   78   N  N     . GLY A 1  21  ? -85.761 26.628 -67.056 1.00 70.95 ? 18  GLY A N     1 
ATOM   79   C  CA    . GLY A 1  21  ? -86.239 27.958 -66.678 1.00 69.90 ? 18  GLY A CA    1 
ATOM   80   C  C     . GLY A 1  21  ? -86.907 28.135 -65.325 1.00 69.20 ? 18  GLY A C     1 
ATOM   81   O  O     . GLY A 1  21  ? -87.313 29.249 -64.993 1.00 69.27 ? 18  GLY A O     1 
ATOM   82   N  N     . HIS A 1  22  ? -87.020 27.061 -64.540 1.00 68.45 ? 19  HIS A N     1 
ATOM   83   C  CA    . HIS A 1  22  ? -87.653 27.141 -63.212 1.00 67.88 ? 19  HIS A CA    1 
ATOM   84   C  C     . HIS A 1  22  ? -86.725 27.773 -62.168 1.00 67.07 ? 19  HIS A C     1 
ATOM   85   O  O     . HIS A 1  22  ? -85.502 27.826 -62.360 1.00 67.06 ? 19  HIS A O     1 
ATOM   86   C  CB    . HIS A 1  22  ? -88.122 25.765 -62.724 1.00 68.24 ? 19  HIS A CB    1 
ATOM   87   C  CG    . HIS A 1  22  ? -88.909 24.992 -63.740 1.00 69.99 ? 19  HIS A CG    1 
ATOM   88   N  ND1   . HIS A 1  22  ? -89.806 25.588 -64.605 1.00 70.84 ? 19  HIS A ND1   1 
ATOM   89   C  CD2   . HIS A 1  22  ? -88.946 23.665 -64.016 1.00 71.10 ? 19  HIS A CD2   1 
ATOM   90   C  CE1   . HIS A 1  22  ? -90.348 24.665 -65.380 1.00 71.50 ? 19  HIS A CE1   1 
ATOM   91   N  NE2   . HIS A 1  22  ? -89.845 23.489 -65.042 1.00 71.92 ? 19  HIS A NE2   1 
ATOM   92   N  N     . TYR A 1  23  ? -87.309 28.244 -61.066 1.00 65.64 ? 20  TYR A N     1 
ATOM   93   C  CA    . TYR A 1  23  ? -86.544 28.924 -60.031 1.00 64.23 ? 20  TYR A CA    1 
ATOM   94   C  C     . TYR A 1  23  ? -86.042 27.978 -58.954 1.00 63.55 ? 20  TYR A C     1 
ATOM   95   O  O     . TYR A 1  23  ? -86.819 27.221 -58.358 1.00 63.45 ? 20  TYR A O     1 
ATOM   96   C  CB    . TYR A 1  23  ? -87.359 30.051 -59.383 1.00 64.29 ? 20  TYR A CB    1 
ATOM   97   C  CG    . TYR A 1  23  ? -86.696 30.663 -58.158 1.00 63.64 ? 20  TYR A CG    1 
ATOM   98   C  CD1   . TYR A 1  23  ? -85.590 31.506 -58.290 1.00 63.32 ? 20  TYR A CD1   1 
ATOM   99   C  CD2   . TYR A 1  23  ? -87.168 30.391 -56.870 1.00 62.82 ? 20  TYR A CD2   1 
ATOM   100  C  CE1   . TYR A 1  23  ? -84.973 32.070 -57.177 1.00 63.52 ? 20  TYR A CE1   1 
ATOM   101  C  CE2   . TYR A 1  23  ? -86.554 30.947 -55.746 1.00 62.79 ? 20  TYR A CE2   1 
ATOM   102  C  CZ    . TYR A 1  23  ? -85.459 31.790 -55.909 1.00 63.52 ? 20  TYR A CZ    1 
ATOM   103  O  OH    . TYR A 1  23  ? -84.835 32.353 -54.815 1.00 63.45 ? 20  TYR A OH    1 
ATOM   104  N  N     . ILE A 1  24  ? -84.738 28.038 -58.697 1.00 62.27 ? 21  ILE A N     1 
ATOM   105  C  CA    . ILE A 1  24  ? -84.155 27.348 -57.554 1.00 61.23 ? 21  ILE A CA    1 
ATOM   106  C  C     . ILE A 1  24  ? -83.499 28.401 -56.676 1.00 60.37 ? 21  ILE A C     1 
ATOM   107  O  O     . ILE A 1  24  ? -82.785 29.276 -57.184 1.00 60.15 ? 21  ILE A O     1 
ATOM   108  C  CB    . ILE A 1  24  ? -83.142 26.248 -57.973 1.00 61.37 ? 21  ILE A CB    1 
ATOM   109  C  CG1   . ILE A 1  24  ? -83.828 25.175 -58.826 1.00 61.89 ? 21  ILE A CG1   1 
ATOM   110  C  CG2   . ILE A 1  24  ? -82.509 25.584 -56.750 1.00 61.14 ? 21  ILE A CG2   1 
ATOM   111  C  CD1   . ILE A 1  24  ? -83.835 25.476 -60.312 1.00 62.58 ? 21  ILE A CD1   1 
ATOM   112  N  N     . LYS A 1  25  ? -83.771 28.324 -55.371 1.00 59.23 ? 22  LYS A N     1 
ATOM   113  C  CA    . LYS A 1  25  ? -83.233 29.269 -54.393 1.00 58.39 ? 22  LYS A CA    1 
ATOM   114  C  C     . LYS A 1  25  ? -81.706 29.283 -54.416 1.00 57.63 ? 22  LYS A C     1 
ATOM   115  O  O     . LYS A 1  25  ? -81.061 28.229 -54.364 1.00 57.48 ? 22  LYS A O     1 
ATOM   116  C  CB    . LYS A 1  25  ? -83.733 28.944 -52.979 1.00 58.54 ? 22  LYS A CB    1 
ATOM   117  C  CG    . LYS A 1  25  ? -83.333 29.977 -51.928 1.00 58.82 ? 22  LYS A CG    1 
ATOM   118  C  CD    . LYS A 1  25  ? -83.691 29.513 -50.534 1.00 60.68 ? 22  LYS A CD    1 
ATOM   119  C  CE    . LYS A 1  25  ? -83.261 30.526 -49.492 1.00 62.00 ? 22  LYS A CE    1 
ATOM   120  N  NZ    . LYS A 1  25  ? -83.664 30.093 -48.120 1.00 62.94 ? 22  LYS A NZ    1 
ATOM   121  N  N     . GLY A 1  26  ? -81.144 30.484 -54.501 1.00 56.71 ? 23  GLY A N     1 
ATOM   122  C  CA    . GLY A 1  26  ? -79.701 30.663 -54.527 1.00 55.64 ? 23  GLY A CA    1 
ATOM   123  C  C     . GLY A 1  26  ? -79.202 31.006 -55.913 1.00 54.96 ? 23  GLY A C     1 
ATOM   124  O  O     . GLY A 1  26  ? -78.116 31.563 -56.064 1.00 54.97 ? 23  GLY A O     1 
ATOM   125  N  N     . TYR A 1  27  ? -79.990 30.673 -56.929 1.00 54.08 ? 24  TYR A N     1 
ATOM   126  C  CA    . TYR A 1  27  ? -79.609 30.957 -58.300 1.00 53.67 ? 24  TYR A CA    1 
ATOM   127  C  C     . TYR A 1  27  ? -80.342 32.196 -58.777 1.00 54.25 ? 24  TYR A C     1 
ATOM   128  O  O     . TYR A 1  27  ? -81.534 32.135 -59.074 1.00 54.13 ? 24  TYR A O     1 
ATOM   129  C  CB    . TYR A 1  27  ? -79.894 29.760 -59.211 1.00 52.82 ? 24  TYR A CB    1 
ATOM   130  C  CG    . TYR A 1  27  ? -79.112 28.519 -58.850 1.00 50.77 ? 24  TYR A CG    1 
ATOM   131  C  CD1   . TYR A 1  27  ? -77.929 28.196 -59.517 1.00 49.40 ? 24  TYR A CD1   1 
ATOM   132  C  CD2   . TYR A 1  27  ? -79.549 27.669 -57.840 1.00 49.55 ? 24  TYR A CD2   1 
ATOM   133  C  CE1   . TYR A 1  27  ? -77.204 27.052 -59.185 1.00 47.54 ? 24  TYR A CE1   1 
ATOM   134  C  CE2   . TYR A 1  27  ? -78.833 26.526 -57.501 1.00 48.48 ? 24  TYR A CE2   1 
ATOM   135  C  CZ    . TYR A 1  27  ? -77.662 26.225 -58.176 1.00 47.92 ? 24  TYR A CZ    1 
ATOM   136  O  OH    . TYR A 1  27  ? -76.963 25.084 -57.840 1.00 47.70 ? 24  TYR A OH    1 
ATOM   137  N  N     . PRO A 1  28  ? -79.636 33.337 -58.840 1.00 54.89 ? 25  PRO A N     1 
ATOM   138  C  CA    . PRO A 1  28  ? -80.328 34.567 -59.229 1.00 55.64 ? 25  PRO A CA    1 
ATOM   139  C  C     . PRO A 1  28  ? -81.088 34.369 -60.543 1.00 56.56 ? 25  PRO A C     1 
ATOM   140  O  O     . PRO A 1  28  ? -80.522 33.882 -61.524 1.00 56.48 ? 25  PRO A O     1 
ATOM   141  C  CB    . PRO A 1  28  ? -79.199 35.601 -59.366 1.00 55.34 ? 25  PRO A CB    1 
ATOM   142  C  CG    . PRO A 1  28  ? -77.931 34.833 -59.311 1.00 55.02 ? 25  PRO A CG    1 
ATOM   143  C  CD    . PRO A 1  28  ? -78.210 33.565 -58.564 1.00 54.68 ? 25  PRO A CD    1 
ATOM   144  N  N     . LYS A 1  29  ? -82.370 34.734 -60.538 1.00 57.88 ? 26  LYS A N     1 
ATOM   145  C  CA    . LYS A 1  29  ? -83.282 34.431 -61.648 1.00 58.83 ? 26  LYS A CA    1 
ATOM   146  C  C     . LYS A 1  29  ? -83.029 35.285 -62.894 1.00 59.19 ? 26  LYS A C     1 
ATOM   147  O  O     . LYS A 1  29  ? -83.447 34.922 -63.991 1.00 59.45 ? 26  LYS A O     1 
ATOM   148  C  CB    . LYS A 1  29  ? -84.740 34.545 -61.178 1.00 58.93 ? 26  LYS A CB    1 
ATOM   149  C  CG    . LYS A 1  29  ? -85.796 34.022 -62.150 1.00 59.97 ? 26  LYS A CG    1 
ATOM   150  C  CD    . LYS A 1  29  ? -85.681 32.515 -62.374 1.00 62.02 ? 26  LYS A CD    1 
ATOM   151  C  CE    . LYS A 1  29  ? -86.938 31.957 -63.038 1.00 63.63 ? 26  LYS A CE    1 
ATOM   152  N  NZ    . LYS A 1  29  ? -87.215 32.576 -64.368 1.00 63.81 ? 26  LYS A NZ    1 
ATOM   153  N  N     . GLN A 1  30  ? -82.325 36.399 -62.722 1.00 59.75 ? 27  GLN A N     1 
ATOM   154  C  CA    . GLN A 1  30  ? -82.042 37.330 -63.815 1.00 60.49 ? 27  GLN A CA    1 
ATOM   155  C  C     . GLN A 1  30  ? -80.936 36.884 -64.777 1.00 60.71 ? 27  GLN A C     1 
ATOM   156  O  O     . GLN A 1  30  ? -80.524 37.662 -65.636 1.00 60.82 ? 27  GLN A O     1 
ATOM   157  C  CB    . GLN A 1  30  ? -81.699 38.711 -63.250 1.00 60.62 ? 27  GLN A CB    1 
ATOM   158  C  CG    . GLN A 1  30  ? -80.562 38.699 -62.230 1.00 61.99 ? 27  GLN A CG    1 
ATOM   159  C  CD    . GLN A 1  30  ? -80.154 40.092 -61.795 1.00 63.86 ? 27  GLN A CD    1 
ATOM   160  O  OE1   . GLN A 1  30  ? -80.999 40.920 -61.447 1.00 65.92 ? 27  GLN A OE1   1 
ATOM   161  N  NE2   . GLN A 1  30  ? -78.856 40.360 -61.811 1.00 64.22 ? 27  GLN A NE2   1 
ATOM   162  N  N     . TYR A 1  31  ? -80.442 35.655 -64.629 1.00 61.18 ? 28  TYR A N     1 
ATOM   163  C  CA    . TYR A 1  31  ? -79.356 35.148 -65.485 1.00 61.54 ? 28  TYR A CA    1 
ATOM   164  C  C     . TYR A 1  31  ? -79.808 33.993 -66.363 1.00 62.12 ? 28  TYR A C     1 
ATOM   165  O  O     . TYR A 1  31  ? -80.719 33.248 -65.988 1.00 62.28 ? 28  TYR A O     1 
ATOM   166  C  CB    . TYR A 1  31  ? -78.150 34.703 -64.645 1.00 61.34 ? 28  TYR A CB    1 
ATOM   167  C  CG    . TYR A 1  31  ? -77.397 35.849 -64.020 1.00 60.22 ? 28  TYR A CG    1 
ATOM   168  C  CD1   . TYR A 1  31  ? -76.519 36.622 -64.775 1.00 58.99 ? 28  TYR A CD1   1 
ATOM   169  C  CD2   . TYR A 1  31  ? -77.572 36.167 -62.674 1.00 59.51 ? 28  TYR A CD2   1 
ATOM   170  C  CE1   . TYR A 1  31  ? -75.831 37.688 -64.206 1.00 58.80 ? 28  TYR A CE1   1 
ATOM   171  C  CE2   . TYR A 1  31  ? -76.891 37.230 -62.090 1.00 59.00 ? 28  TYR A CE2   1 
ATOM   172  C  CZ    . TYR A 1  31  ? -76.022 37.983 -62.862 1.00 59.03 ? 28  TYR A CZ    1 
ATOM   173  O  OH    . TYR A 1  31  ? -75.345 39.030 -62.294 1.00 57.92 ? 28  TYR A OH    1 
ATOM   174  N  N     . THR A 1  32  ? -79.160 33.838 -67.518 1.00 62.57 ? 29  THR A N     1 
ATOM   175  C  CA    . THR A 1  32  ? -79.461 32.727 -68.433 1.00 63.36 ? 29  THR A CA    1 
ATOM   176  C  C     . THR A 1  32  ? -78.533 31.524 -68.211 1.00 63.24 ? 29  THR A C     1 
ATOM   177  O  O     . THR A 1  32  ? -77.320 31.609 -68.432 1.00 63.05 ? 29  THR A O     1 
ATOM   178  C  CB    . THR A 1  32  ? -79.442 33.169 -69.922 1.00 63.60 ? 29  THR A CB    1 
ATOM   179  O  OG1   . THR A 1  32  ? -78.166 33.747 -70.237 1.00 64.75 ? 29  THR A OG1   1 
ATOM   180  C  CG2   . THR A 1  32  ? -80.566 34.198 -70.211 1.00 63.94 ? 29  THR A CG2   1 
ATOM   181  N  N     . TYR A 1  33  ? -79.133 30.413 -67.776 1.00 63.26 ? 30  TYR A N     1 
ATOM   182  C  CA    . TYR A 1  33  ? -78.431 29.172 -67.459 1.00 63.40 ? 30  TYR A CA    1 
ATOM   183  C  C     . TYR A 1  33  ? -78.542 28.134 -68.589 1.00 63.59 ? 30  TYR A C     1 
ATOM   184  O  O     . TYR A 1  33  ? -79.520 27.379 -68.654 1.00 63.78 ? 30  TYR A O     1 
ATOM   185  C  CB    . TYR A 1  33  ? -78.978 28.588 -66.151 1.00 63.34 ? 30  TYR A CB    1 
ATOM   186  C  CG    . TYR A 1  33  ? -78.882 29.530 -64.965 1.00 64.36 ? 30  TYR A CG    1 
ATOM   187  C  CD1   . TYR A 1  33  ? -77.720 29.590 -64.190 1.00 64.56 ? 30  TYR A CD1   1 
ATOM   188  C  CD2   . TYR A 1  33  ? -79.950 30.365 -64.617 1.00 64.80 ? 30  TYR A CD2   1 
ATOM   189  C  CE1   . TYR A 1  33  ? -77.619 30.452 -63.101 1.00 64.02 ? 30  TYR A CE1   1 
ATOM   190  C  CE2   . TYR A 1  33  ? -79.859 31.234 -63.525 1.00 64.64 ? 30  TYR A CE2   1 
ATOM   191  C  CZ    . TYR A 1  33  ? -78.685 31.272 -62.775 1.00 64.24 ? 30  TYR A CZ    1 
ATOM   192  O  OH    . TYR A 1  33  ? -78.578 32.117 -61.697 1.00 62.65 ? 30  TYR A OH    1 
ATOM   193  N  N     . PHE A 1  34  ? -77.535 28.087 -69.461 1.00 63.45 ? 31  PHE A N     1 
ATOM   194  C  CA    . PHE A 1  34  ? -77.568 27.211 -70.635 1.00 63.26 ? 31  PHE A CA    1 
ATOM   195  C  C     . PHE A 1  34  ? -76.707 25.954 -70.501 1.00 63.43 ? 31  PHE A C     1 
ATOM   196  O  O     . PHE A 1  34  ? -75.940 25.815 -69.549 1.00 63.43 ? 31  PHE A O     1 
ATOM   197  C  CB    . PHE A 1  34  ? -77.200 27.987 -71.904 1.00 63.25 ? 31  PHE A CB    1 
ATOM   198  C  CG    . PHE A 1  34  ? -75.797 28.531 -71.915 1.00 63.21 ? 31  PHE A CG    1 
ATOM   199  C  CD1   . PHE A 1  34  ? -74.781 27.848 -72.577 1.00 63.21 ? 31  PHE A CD1   1 
ATOM   200  C  CD2   . PHE A 1  34  ? -75.495 29.738 -71.287 1.00 62.86 ? 31  PHE A CD2   1 
ATOM   201  C  CE1   . PHE A 1  34  ? -73.482 28.355 -72.604 1.00 63.10 ? 31  PHE A CE1   1 
ATOM   202  C  CE2   . PHE A 1  34  ? -74.204 30.253 -71.309 1.00 62.33 ? 31  PHE A CE2   1 
ATOM   203  C  CZ    . PHE A 1  34  ? -73.195 29.563 -71.966 1.00 62.68 ? 31  PHE A CZ    1 
ATOM   204  N  N     . LEU A 1  35  ? -76.859 25.035 -71.454 1.00 63.32 ? 32  LEU A N     1 
ATOM   205  C  CA    . LEU A 1  35  ? -76.041 23.828 -71.508 1.00 63.14 ? 32  LEU A CA    1 
ATOM   206  C  C     . LEU A 1  35  ? -75.100 23.903 -72.701 1.00 62.92 ? 32  LEU A C     1 
ATOM   207  O  O     . LEU A 1  35  ? -75.470 24.397 -73.766 1.00 62.79 ? 32  LEU A O     1 
ATOM   208  C  CB    . LEU A 1  35  ? -76.913 22.571 -71.571 1.00 63.23 ? 32  LEU A CB    1 
ATOM   209  C  CG    . LEU A 1  35  ? -76.250 21.204 -71.342 1.00 64.42 ? 32  LEU A CG    1 
ATOM   210  C  CD1   . LEU A 1  35  ? -77.203 20.240 -70.645 1.00 65.53 ? 32  LEU A CD1   1 
ATOM   211  C  CD2   . LEU A 1  35  ? -75.746 20.589 -72.648 1.00 65.58 ? 32  LEU A CD2   1 
ATOM   212  N  N     . GLU A 1  36  ? -73.879 23.419 -72.503 1.00 62.66 ? 33  GLU A N     1 
ATOM   213  C  CA    . GLU A 1  36  ? -72.850 23.430 -73.532 1.00 62.66 ? 33  GLU A CA    1 
ATOM   214  C  C     . GLU A 1  36  ? -71.767 22.431 -73.136 1.00 62.43 ? 33  GLU A C     1 
ATOM   215  O  O     . GLU A 1  36  ? -71.318 22.417 -71.985 1.00 62.22 ? 33  GLU A O     1 
ATOM   216  C  CB    . GLU A 1  36  ? -72.272 24.836 -73.679 1.00 62.69 ? 33  GLU A CB    1 
ATOM   217  C  CG    . GLU A 1  36  ? -71.320 25.025 -74.837 1.00 64.28 ? 33  GLU A CG    1 
ATOM   218  C  CD    . GLU A 1  36  ? -70.843 26.466 -74.959 1.00 66.40 ? 33  GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1  36  ? -70.196 26.972 -74.016 1.00 67.51 ? 33  GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1  36  ? -71.108 27.095 -76.003 1.00 67.69 ? 33  GLU A OE2   1 
ATOM   221  N  N     . ASP A 1  37  ? -71.369 21.591 -74.092 1.00 62.10 ? 34  ASP A N     1 
ATOM   222  C  CA    . ASP A 1  37  ? -70.371 20.529 -73.880 1.00 61.72 ? 34  ASP A CA    1 
ATOM   223  C  C     . ASP A 1  37  ? -70.750 19.597 -72.728 1.00 60.87 ? 34  ASP A C     1 
ATOM   224  O  O     . ASP A 1  37  ? -69.881 19.060 -72.036 1.00 60.94 ? 34  ASP A O     1 
ATOM   225  C  CB    . ASP A 1  37  ? -68.967 21.108 -73.653 1.00 62.18 ? 34  ASP A CB    1 
ATOM   226  C  CG    . ASP A 1  37  ? -68.603 22.193 -74.658 1.00 63.96 ? 34  ASP A CG    1 
ATOM   227  O  OD1   . ASP A 1  37  ? -68.023 23.213 -74.230 1.00 66.39 ? 34  ASP A OD1   1 
ATOM   228  O  OD2   . ASP A 1  37  ? -68.892 22.036 -75.867 1.00 65.49 ? 34  ASP A OD2   1 
ATOM   229  N  N     . GLY A 1  38  ? -72.051 19.412 -72.528 1.00 60.06 ? 35  GLY A N     1 
ATOM   230  C  CA    . GLY A 1  38  ? -72.555 18.553 -71.454 1.00 59.17 ? 35  GLY A CA    1 
ATOM   231  C  C     . GLY A 1  38  ? -72.394 19.171 -70.074 1.00 58.40 ? 35  GLY A C     1 
ATOM   232  O  O     . GLY A 1  38  ? -72.540 18.487 -69.059 1.00 58.59 ? 35  GLY A O     1 
ATOM   233  N  N     . LYS A 1  39  ? -72.091 20.467 -70.049 1.00 57.43 ? 36  LYS A N     1 
ATOM   234  C  CA    . LYS A 1  39  ? -71.919 21.221 -68.811 1.00 56.55 ? 36  LYS A CA    1 
ATOM   235  C  C     . LYS A 1  39  ? -72.964 22.318 -68.687 1.00 55.22 ? 36  LYS A C     1 
ATOM   236  O  O     . LYS A 1  39  ? -73.270 22.996 -69.663 1.00 55.18 ? 36  LYS A O     1 
ATOM   237  C  CB    . LYS A 1  39  ? -70.520 21.847 -68.751 1.00 56.76 ? 36  LYS A CB    1 
ATOM   238  C  CG    . LYS A 1  39  ? -69.527 21.072 -67.895 1.00 58.54 ? 36  LYS A CG    1 
ATOM   239  C  CD    . LYS A 1  39  ? -68.523 20.283 -68.708 1.00 60.67 ? 36  LYS A CD    1 
ATOM   240  C  CE    . LYS A 1  39  ? -67.332 21.153 -69.085 1.00 61.85 ? 36  LYS A CE    1 
ATOM   241  N  NZ    . LYS A 1  39  ? -66.209 20.332 -69.623 1.00 62.83 ? 36  LYS A NZ    1 
ATOM   242  N  N     . VAL A 1  40  ? -73.517 22.481 -67.487 1.00 53.91 ? 37  VAL A N     1 
ATOM   243  C  CA    . VAL A 1  40  ? -74.360 23.639 -67.186 1.00 52.60 ? 37  VAL A CA    1 
ATOM   244  C  C     . VAL A 1  40  ? -73.458 24.861 -67.047 1.00 51.91 ? 37  VAL A C     1 
ATOM   245  O  O     . VAL A 1  40  ? -72.426 24.806 -66.373 1.00 51.59 ? 37  VAL A O     1 
ATOM   246  C  CB    . VAL A 1  40  ? -75.190 23.437 -65.903 1.00 52.68 ? 37  VAL A CB    1 
ATOM   247  C  CG1   . VAL A 1  40  ? -75.996 24.697 -65.571 1.00 51.86 ? 37  VAL A CG1   1 
ATOM   248  C  CG2   . VAL A 1  40  ? -76.111 22.241 -66.057 1.00 52.47 ? 37  VAL A CG2   1 
ATOM   249  N  N     . LYS A 1  41  ? -73.836 25.944 -67.712 1.00 50.91 ? 38  LYS A N     1 
ATOM   250  C  CA    . LYS A 1  41  ? -73.074 27.173 -67.674 1.00 50.32 ? 38  LYS A CA    1 
ATOM   251  C  C     . LYS A 1  41  ? -73.959 28.368 -67.373 1.00 50.44 ? 38  LYS A C     1 
ATOM   252  O  O     . LYS A 1  41  ? -75.178 28.324 -67.553 1.00 50.44 ? 38  LYS A O     1 
ATOM   253  C  CB    . LYS A 1  41  ? -72.319 27.389 -68.985 1.00 50.17 ? 38  LYS A CB    1 
ATOM   254  C  CG    . LYS A 1  41  ? -71.171 26.421 -69.178 1.00 49.56 ? 38  LYS A CG    1 
ATOM   255  C  CD    . LYS A 1  41  ? -70.461 26.632 -70.493 1.00 49.13 ? 38  LYS A CD    1 
ATOM   256  C  CE    . LYS A 1  41  ? -69.435 25.535 -70.714 1.00 49.89 ? 38  LYS A CE    1 
ATOM   257  N  NZ    . LYS A 1  41  ? -68.706 25.757 -71.983 1.00 50.69 ? 38  LYS A NZ    1 
ATOM   258  N  N     . VAL A 1  42  ? -73.336 29.431 -66.884 1.00 50.19 ? 39  VAL A N     1 
ATOM   259  C  CA    . VAL A 1  42  ? -74.029 30.692 -66.700 1.00 50.11 ? 39  VAL A CA    1 
ATOM   260  C  C     . VAL A 1  42  ? -73.166 31.795 -67.270 1.00 50.46 ? 39  VAL A C     1 
ATOM   261  O  O     . VAL A 1  42  ? -71.938 31.720 -67.223 1.00 50.47 ? 39  VAL A O     1 
ATOM   262  C  CB    . VAL A 1  42  ? -74.409 30.960 -65.208 1.00 50.16 ? 39  VAL A CB    1 
ATOM   263  C  CG1   . VAL A 1  42  ? -73.184 30.902 -64.295 1.00 48.96 ? 39  VAL A CG1   1 
ATOM   264  C  CG2   . VAL A 1  42  ? -75.150 32.293 -65.060 1.00 49.09 ? 39  VAL A CG2   1 
ATOM   265  N  N     . SER A 1  43  ? -73.823 32.801 -67.834 1.00 51.30 ? 40  SER A N     1 
ATOM   266  C  CA    . SER A 1  43  ? -73.141 33.970 -68.345 1.00 51.79 ? 40  SER A CA    1 
ATOM   267  C  C     . SER A 1  43  ? -73.202 35.046 -67.275 1.00 52.21 ? 40  SER A C     1 
ATOM   268  O  O     . SER A 1  43  ? -74.222 35.719 -67.109 1.00 52.54 ? 40  SER A O     1 
ATOM   269  C  CB    . SER A 1  43  ? -73.794 34.443 -69.640 1.00 51.91 ? 40  SER A CB    1 
ATOM   270  O  OG    . SER A 1  43  ? -73.027 35.474 -70.225 1.00 52.32 ? 40  SER A OG    1 
ATOM   271  N  N     . ARG A 1  44  ? -72.111 35.179 -66.530 1.00 52.42 ? 41  ARG A N     1 
ATOM   272  C  CA    . ARG A 1  44  ? -72.040 36.143 -65.441 1.00 52.66 ? 41  ARG A CA    1 
ATOM   273  C  C     . ARG A 1  44  ? -71.257 37.377 -65.887 1.00 52.75 ? 41  ARG A C     1 
ATOM   274  O  O     . ARG A 1  44  ? -70.529 37.311 -66.879 1.00 52.67 ? 41  ARG A O     1 
ATOM   275  C  CB    . ARG A 1  44  ? -71.451 35.482 -64.181 1.00 52.67 ? 41  ARG A CB    1 
ATOM   276  C  CG    . ARG A 1  44  ? -72.481 34.570 -63.488 1.00 52.77 ? 41  ARG A CG    1 
ATOM   277  C  CD    . ARG A 1  44  ? -72.261 34.405 -62.003 1.00 51.18 ? 41  ARG A CD    1 
ATOM   278  N  NE    . ARG A 1  44  ? -72.205 35.672 -61.276 1.00 51.72 ? 41  ARG A NE    1 
ATOM   279  C  CZ    . ARG A 1  44  ? -73.207 36.199 -60.578 1.00 51.42 ? 41  ARG A CZ    1 
ATOM   280  N  NH1   . ARG A 1  44  ? -74.382 35.592 -60.499 1.00 51.18 ? 41  ARG A NH1   1 
ATOM   281  N  NH2   . ARG A 1  44  ? -73.028 37.348 -59.952 1.00 51.69 ? 41  ARG A NH2   1 
ATOM   282  N  N     . PRO A 1  45  ? -71.405 38.508 -65.164 1.00 53.07 ? 42  PRO A N     1 
ATOM   283  C  CA    . PRO A 1  45  ? -70.795 39.770 -65.604 1.00 53.30 ? 42  PRO A CA    1 
ATOM   284  C  C     . PRO A 1  45  ? -69.315 39.644 -65.958 1.00 53.55 ? 42  PRO A C     1 
ATOM   285  O  O     . PRO A 1  45  ? -68.838 40.340 -66.856 1.00 53.74 ? 42  PRO A O     1 
ATOM   286  C  CB    . PRO A 1  45  ? -70.971 40.684 -64.391 1.00 53.28 ? 42  PRO A CB    1 
ATOM   287  C  CG    . PRO A 1  45  ? -72.194 40.171 -63.712 1.00 53.30 ? 42  PRO A CG    1 
ATOM   288  C  CD    . PRO A 1  45  ? -72.153 38.676 -63.900 1.00 53.07 ? 42  PRO A CD    1 
ATOM   289  N  N     . GLU A 1  46  ? -68.612 38.748 -65.264 1.00 53.50 ? 43  GLU A N     1 
ATOM   290  C  CA    . GLU A 1  46  ? -67.173 38.532 -65.452 1.00 53.35 ? 43  GLU A CA    1 
ATOM   291  C  C     . GLU A 1  46  ? -66.870 37.638 -66.654 1.00 52.39 ? 43  GLU A C     1 
ATOM   292  O  O     . GLU A 1  46  ? -65.716 37.543 -67.088 1.00 52.71 ? 43  GLU A O     1 
ATOM   293  C  CB    . GLU A 1  46  ? -66.554 37.887 -64.199 1.00 53.71 ? 43  GLU A CB    1 
ATOM   294  C  CG    . GLU A 1  46  ? -67.006 38.465 -62.857 1.00 56.66 ? 43  GLU A CG    1 
ATOM   295  C  CD    . GLU A 1  46  ? -68.324 37.876 -62.364 1.00 59.67 ? 43  GLU A CD    1 
ATOM   296  O  OE1   . GLU A 1  46  ? -68.579 36.678 -62.623 1.00 62.12 ? 43  GLU A OE1   1 
ATOM   297  O  OE2   . GLU A 1  46  ? -69.104 38.610 -61.710 1.00 60.46 ? 43  GLU A OE2   1 
ATOM   298  N  N     . GLY A 1  47  ? -67.897 36.967 -67.174 1.00 51.01 ? 44  GLY A N     1 
ATOM   299  C  CA    . GLY A 1  47  ? -67.705 35.964 -68.212 1.00 48.87 ? 44  GLY A CA    1 
ATOM   300  C  C     . GLY A 1  47  ? -68.470 34.693 -67.904 1.00 47.64 ? 44  GLY A C     1 
ATOM   301  O  O     . GLY A 1  47  ? -69.152 34.598 -66.880 1.00 47.35 ? 44  GLY A O     1 
ATOM   302  N  N     . VAL A 1  48  ? -68.352 33.715 -68.803 1.00 46.15 ? 45  VAL A N     1 
ATOM   303  C  CA    . VAL A 1  48  ? -69.092 32.456 -68.711 1.00 44.49 ? 45  VAL A CA    1 
ATOM   304  C  C     . VAL A 1  48  ? -68.433 31.506 -67.706 1.00 43.00 ? 45  VAL A C     1 
ATOM   305  O  O     . VAL A 1  48  ? -67.237 31.277 -67.768 1.00 42.45 ? 45  VAL A O     1 
ATOM   306  C  CB    . VAL A 1  48  ? -69.196 31.766 -70.108 1.00 44.80 ? 45  VAL A CB    1 
ATOM   307  C  CG1   . VAL A 1  48  ? -69.882 30.400 -70.013 1.00 44.30 ? 45  VAL A CG1   1 
ATOM   308  C  CG2   . VAL A 1  48  ? -69.919 32.669 -71.100 1.00 45.00 ? 45  VAL A CG2   1 
ATOM   309  N  N     . LYS A 1  49  ? -69.225 30.947 -66.796 1.00 41.53 ? 46  LYS A N     1 
ATOM   310  C  CA    . LYS A 1  49  ? -68.708 30.007 -65.806 1.00 40.24 ? 46  LYS A CA    1 
ATOM   311  C  C     . LYS A 1  49  ? -69.473 28.697 -65.834 1.00 39.97 ? 46  LYS A C     1 
ATOM   312  O  O     . LYS A 1  49  ? -70.670 28.672 -66.142 1.00 40.07 ? 46  LYS A O     1 
ATOM   313  C  CB    . LYS A 1  49  ? -68.788 30.601 -64.387 1.00 39.85 ? 46  LYS A CB    1 
ATOM   314  C  CG    . LYS A 1  49  ? -68.202 32.005 -64.232 1.00 39.09 ? 46  LYS A CG    1 
ATOM   315  C  CD    . LYS A 1  49  ? -66.680 32.007 -64.325 1.00 37.22 ? 46  LYS A CD    1 
ATOM   316  C  CE    . LYS A 1  49  ? -66.162 33.428 -64.379 1.00 37.12 ? 46  LYS A CE    1 
ATOM   317  N  NZ    . LYS A 1  49  ? -64.700 33.449 -64.333 1.00 36.07 ? 46  LYS A NZ    1 
ATOM   318  N  N     . ILE A 1  50  ? -68.782 27.620 -65.489 1.00 39.08 ? 47  ILE A N     1 
ATOM   319  C  CA    . ILE A 1  50  ? -69.404 26.319 -65.303 1.00 39.03 ? 47  ILE A CA    1 
ATOM   320  C  C     . ILE A 1  50  ? -70.025 26.245 -63.908 1.00 39.41 ? 47  ILE A C     1 
ATOM   321  O  O     . ILE A 1  50  ? -69.393 26.608 -62.920 1.00 39.55 ? 47  ILE A O     1 
ATOM   322  C  CB    . ILE A 1  50  ? -68.368 25.173 -65.492 1.00 38.42 ? 47  ILE A CB    1 
ATOM   323  C  CG1   . ILE A 1  50  ? -67.838 25.157 -66.937 1.00 38.45 ? 47  ILE A CG1   1 
ATOM   324  C  CG2   . ILE A 1  50  ? -68.949 23.820 -65.081 1.00 37.57 ? 47  ILE A CG2   1 
ATOM   325  C  CD1   . ILE A 1  50  ? -66.517 24.366 -67.126 1.00 36.81 ? 47  ILE A CD1   1 
ATOM   326  N  N     . ILE A 1  51  ? -71.268 25.785 -63.838 1.00 39.56 ? 48  ILE A N     1 
ATOM   327  C  CA    . ILE A 1  51  ? -71.899 25.465 -62.574 1.00 39.88 ? 48  ILE A CA    1 
ATOM   328  C  C     . ILE A 1  51  ? -71.810 23.965 -62.407 1.00 40.37 ? 48  ILE A C     1 
ATOM   329  O  O     . ILE A 1  51  ? -72.491 23.230 -63.118 1.00 41.08 ? 48  ILE A O     1 
ATOM   330  C  CB    . ILE A 1  51  ? -73.379 25.900 -62.539 1.00 39.75 ? 48  ILE A CB    1 
ATOM   331  C  CG1   . ILE A 1  51  ? -73.509 27.371 -62.949 1.00 40.11 ? 48  ILE A CG1   1 
ATOM   332  C  CG2   . ILE A 1  51  ? -73.981 25.639 -61.165 1.00 39.06 ? 48  ILE A CG2   1 
ATOM   333  C  CD1   . ILE A 1  51  ? -74.914 27.911 -62.867 1.00 40.24 ? 48  ILE A CD1   1 
ATOM   334  N  N     . PRO A 1  52  ? -70.954 23.492 -61.484 1.00 40.99 ? 49  PRO A N     1 
ATOM   335  C  CA    . PRO A 1  52  ? -70.869 22.041 -61.276 1.00 41.18 ? 49  PRO A CA    1 
ATOM   336  C  C     . PRO A 1  52  ? -72.023 21.546 -60.416 1.00 41.88 ? 49  PRO A C     1 
ATOM   337  O  O     . PRO A 1  52  ? -72.598 22.335 -59.667 1.00 42.12 ? 49  PRO A O     1 
ATOM   338  C  CB    . PRO A 1  52  ? -69.543 21.861 -60.522 1.00 41.30 ? 49  PRO A CB    1 
ATOM   339  C  CG    . PRO A 1  52  ? -69.043 23.248 -60.204 1.00 40.77 ? 49  PRO A CG    1 
ATOM   340  C  CD    . PRO A 1  52  ? -70.109 24.237 -60.537 1.00 40.54 ? 49  PRO A CD    1 
ATOM   341  N  N     . PRO A 1  53  ? -72.379 20.250 -60.526 1.00 42.66 ? 50  PRO A N     1 
ATOM   342  C  CA    . PRO A 1  53  ? -73.394 19.719 -59.613 1.00 43.16 ? 50  PRO A CA    1 
ATOM   343  C  C     . PRO A 1  53  ? -72.908 19.726 -58.169 1.00 43.63 ? 50  PRO A C     1 
ATOM   344  O  O     . PRO A 1  53  ? -71.709 19.602 -57.917 1.00 43.96 ? 50  PRO A O     1 
ATOM   345  C  CB    . PRO A 1  53  ? -73.587 18.272 -60.097 1.00 43.06 ? 50  PRO A CB    1 
ATOM   346  C  CG    . PRO A 1  53  ? -72.361 17.962 -60.918 1.00 43.02 ? 50  PRO A CG    1 
ATOM   347  C  CD    . PRO A 1  53  ? -72.009 19.264 -61.561 1.00 42.57 ? 50  PRO A CD    1 
ATOM   348  N  N     . GLN A 1  54  ? -73.846 19.858 -57.240 1.00 44.26 ? 51  GLN A N     1 
ATOM   349  C  CA    . GLN A 1  54  ? -73.574 19.823 -55.813 1.00 45.12 ? 51  GLN A CA    1 
ATOM   350  C  C     . GLN A 1  54  ? -72.483 18.797 -55.469 1.00 44.96 ? 51  GLN A C     1 
ATOM   351  O  O     . GLN A 1  54  ? -71.517 19.124 -54.785 1.00 44.97 ? 51  GLN A O     1 
ATOM   352  C  CB    . GLN A 1  54  ? -74.867 19.481 -55.059 1.00 45.45 ? 51  GLN A CB    1 
ATOM   353  C  CG    . GLN A 1  54  ? -75.285 20.454 -53.972 1.00 49.28 ? 51  GLN A CG    1 
ATOM   354  C  CD    . GLN A 1  54  ? -74.213 20.681 -52.911 1.00 53.25 ? 51  GLN A CD    1 
ATOM   355  O  OE1   . GLN A 1  54  ? -73.682 19.735 -52.324 1.00 56.27 ? 51  GLN A OE1   1 
ATOM   356  N  NE2   . GLN A 1  54  ? -73.898 21.945 -52.657 1.00 53.35 ? 51  GLN A NE2   1 
ATOM   357  N  N     . SER A 1  55  ? -72.639 17.566 -55.964 1.00 44.64 ? 52  SER A N     1 
ATOM   358  C  CA    . SER A 1  55  ? -71.771 16.437 -55.591 1.00 44.50 ? 52  SER A CA    1 
ATOM   359  C  C     . SER A 1  55  ? -70.331 16.557 -56.087 1.00 43.75 ? 52  SER A C     1 
ATOM   360  O  O     . SER A 1  55  ? -69.469 15.786 -55.672 1.00 44.26 ? 52  SER A O     1 
ATOM   361  C  CB    . SER A 1  55  ? -72.368 15.124 -56.102 1.00 44.47 ? 52  SER A CB    1 
ATOM   362  O  OG    . SER A 1  55  ? -72.466 15.154 -57.520 1.00 45.37 ? 52  SER A OG    1 
ATOM   363  N  N     . ASP A 1  56  ? -70.081 17.506 -56.979 1.00 43.13 ? 53  ASP A N     1 
ATOM   364  C  CA    . ASP A 1  56  ? -68.741 17.761 -57.507 1.00 42.62 ? 53  ASP A CA    1 
ATOM   365  C  C     . ASP A 1  56  ? -67.967 18.828 -56.712 1.00 41.98 ? 53  ASP A C     1 
ATOM   366  O  O     . ASP A 1  56  ? -66.733 18.911 -56.806 1.00 41.73 ? 53  ASP A O     1 
ATOM   367  C  CB    . ASP A 1  56  ? -68.843 18.222 -58.962 1.00 43.32 ? 53  ASP A CB    1 
ATOM   368  C  CG    . ASP A 1  56  ? -68.861 17.065 -59.963 1.00 44.45 ? 53  ASP A CG    1 
ATOM   369  O  OD1   . ASP A 1  56  ? -68.757 15.890 -59.569 1.00 47.43 ? 53  ASP A OD1   1 
ATOM   370  O  OD2   . ASP A 1  56  ? -68.958 17.345 -61.166 1.00 46.13 ? 53  ASP A OD2   1 
ATOM   371  N  N     . ARG A 1  57  ? -68.697 19.628 -55.937 1.00 40.72 ? 54  ARG A N     1 
ATOM   372  C  CA    . ARG A 1  57  ? -68.188 20.884 -55.393 1.00 40.22 ? 54  ARG A CA    1 
ATOM   373  C  C     . ARG A 1  57  ? -67.118 20.756 -54.307 1.00 39.87 ? 54  ARG A C     1 
ATOM   374  O  O     . ARG A 1  57  ? -66.146 21.510 -54.310 1.00 39.88 ? 54  ARG A O     1 
ATOM   375  C  CB    . ARG A 1  57  ? -69.346 21.776 -54.926 1.00 39.87 ? 54  ARG A CB    1 
ATOM   376  C  CG    . ARG A 1  57  ? -70.150 22.332 -56.089 1.00 40.02 ? 54  ARG A CG    1 
ATOM   377  C  CD    . ARG A 1  57  ? -71.410 23.025 -55.640 1.00 38.45 ? 54  ARG A CD    1 
ATOM   378  N  NE    . ARG A 1  57  ? -72.347 23.192 -56.745 1.00 37.48 ? 54  ARG A NE    1 
ATOM   379  C  CZ    . ARG A 1  57  ? -73.544 23.773 -56.640 1.00 36.77 ? 54  ARG A CZ    1 
ATOM   380  N  NH1   . ARG A 1  57  ? -73.950 24.246 -55.472 1.00 33.96 ? 54  ARG A NH1   1 
ATOM   381  N  NH2   . ARG A 1  57  ? -74.331 23.887 -57.706 1.00 35.26 ? 54  ARG A NH2   1 
ATOM   382  N  N     . GLN A 1  58  ? -67.278 19.797 -53.404 1.00 39.60 ? 55  GLN A N     1 
ATOM   383  C  CA    . GLN A 1  58  ? -66.288 19.564 -52.354 1.00 40.13 ? 55  GLN A CA    1 
ATOM   384  C  C     . GLN A 1  58  ? -64.936 19.181 -52.952 1.00 39.30 ? 55  GLN A C     1 
ATOM   385  O  O     . GLN A 1  58  ? -63.887 19.609 -52.463 1.00 39.22 ? 55  GLN A O     1 
ATOM   386  C  CB    . GLN A 1  58  ? -66.771 18.492 -51.372 1.00 40.35 ? 55  GLN A CB    1 
ATOM   387  C  CG    . GLN A 1  58  ? -65.765 18.145 -50.283 1.00 44.49 ? 55  GLN A CG    1 
ATOM   388  C  CD    . GLN A 1  58  ? -66.243 17.018 -49.356 1.00 50.03 ? 55  GLN A CD    1 
ATOM   389  O  OE1   . GLN A 1  58  ? -67.450 16.813 -49.169 1.00 53.47 ? 55  GLN A OE1   1 
ATOM   390  N  NE2   . GLN A 1  58  ? -65.296 16.289 -48.775 1.00 50.69 ? 55  GLN A NE2   1 
ATOM   391  N  N     . LYS A 1  59  ? -64.973 18.383 -54.016 1.00 38.43 ? 56  LYS A N     1 
ATOM   392  C  CA    . LYS A 1  59  ? -63.766 17.950 -54.716 1.00 37.48 ? 56  LYS A CA    1 
ATOM   393  C  C     . LYS A 1  59  ? -63.063 19.136 -55.388 1.00 35.92 ? 56  LYS A C     1 
ATOM   394  O  O     . LYS A 1  59  ? -61.848 19.251 -55.341 1.00 35.93 ? 56  LYS A O     1 
ATOM   395  C  CB    . LYS A 1  59  ? -64.105 16.867 -55.747 1.00 37.98 ? 56  LYS A CB    1 
ATOM   396  C  CG    . LYS A 1  59  ? -62.897 16.048 -56.200 1.00 41.93 ? 56  LYS A CG    1 
ATOM   397  C  CD    . LYS A 1  59  ? -63.246 15.027 -57.300 1.00 46.67 ? 56  LYS A CD    1 
ATOM   398  C  CE    . LYS A 1  59  ? -61.968 14.380 -57.854 1.00 49.42 ? 56  LYS A CE    1 
ATOM   399  N  NZ    . LYS A 1  59  ? -62.264 13.282 -58.828 1.00 52.17 ? 56  LYS A NZ    1 
ATOM   400  N  N     . ILE A 1  60  ? -63.834 20.019 -56.001 1.00 34.15 ? 57  ILE A N     1 
ATOM   401  C  CA    . ILE A 1  60  ? -63.283 21.185 -56.673 1.00 32.95 ? 57  ILE A CA    1 
ATOM   402  C  C     . ILE A 1  60  ? -62.583 22.149 -55.673 1.00 32.39 ? 57  ILE A C     1 
ATOM   403  O  O     . ILE A 1  60  ? -61.463 22.625 -55.921 1.00 31.92 ? 57  ILE A O     1 
ATOM   404  C  CB    . ILE A 1  60  ? -64.379 21.901 -57.496 1.00 32.50 ? 57  ILE A CB    1 
ATOM   405  C  CG1   . ILE A 1  60  ? -64.685 21.093 -58.769 1.00 33.55 ? 57  ILE A CG1   1 
ATOM   406  C  CG2   . ILE A 1  60  ? -63.965 23.315 -57.846 1.00 30.60 ? 57  ILE A CG2   1 
ATOM   407  C  CD1   . ILE A 1  60  ? -65.968 21.517 -59.479 1.00 34.82 ? 57  ILE A CD1   1 
ATOM   408  N  N     . VAL A 1  61  ? -63.247 22.400 -54.549 1.00 31.23 ? 58  VAL A N     1 
ATOM   409  C  CA    . VAL A 1  61  ? -62.717 23.234 -53.475 1.00 30.46 ? 58  VAL A CA    1 
ATOM   410  C  C     . VAL A 1  61  ? -61.406 22.654 -52.950 1.00 30.62 ? 58  VAL A C     1 
ATOM   411  O  O     . VAL A 1  61  ? -60.398 23.357 -52.849 1.00 30.24 ? 58  VAL A O     1 
ATOM   412  C  CB    . VAL A 1  61  ? -63.757 23.374 -52.324 1.00 30.40 ? 58  VAL A CB    1 
ATOM   413  C  CG1   . VAL A 1  61  ? -63.157 24.109 -51.136 1.00 28.23 ? 58  VAL A CG1   1 
ATOM   414  C  CG2   . VAL A 1  61  ? -65.001 24.084 -52.830 1.00 29.41 ? 58  VAL A CG2   1 
ATOM   415  N  N     . LEU A 1  62  ? -61.432 21.361 -52.646 1.00 30.73 ? 59  LEU A N     1 
ATOM   416  C  CA    . LEU A 1  62  ? -60.261 20.640 -52.208 1.00 31.93 ? 59  LEU A CA    1 
ATOM   417  C  C     . LEU A 1  62  ? -59.094 20.780 -53.185 1.00 31.69 ? 59  LEU A C     1 
ATOM   418  O  O     . LEU A 1  62  ? -57.972 21.043 -52.770 1.00 32.05 ? 59  LEU A O     1 
ATOM   419  C  CB    . LEU A 1  62  ? -60.598 19.163 -52.003 1.00 32.76 ? 59  LEU A CB    1 
ATOM   420  C  CG    . LEU A 1  62  ? -59.522 18.381 -51.252 1.00 36.55 ? 59  LEU A CG    1 
ATOM   421  C  CD1   . LEU A 1  62  ? -59.250 19.012 -49.847 1.00 39.44 ? 59  LEU A CD1   1 
ATOM   422  C  CD2   . LEU A 1  62  ? -59.845 16.862 -51.157 1.00 40.80 ? 59  LEU A CD2   1 
ATOM   423  N  N     . GLN A 1  63  ? -59.360 20.621 -54.479 1.00 31.01 ? 60  GLN A N     1 
ATOM   424  C  CA    . GLN A 1  63  ? -58.306 20.702 -55.486 1.00 30.75 ? 60  GLN A CA    1 
ATOM   425  C  C     . GLN A 1  63  ? -57.712 22.112 -55.580 1.00 29.01 ? 60  GLN A C     1 
ATOM   426  O  O     . GLN A 1  63  ? -56.491 22.268 -55.633 1.00 28.62 ? 60  GLN A O     1 
ATOM   427  C  CB    . GLN A 1  63  ? -58.809 20.225 -56.861 1.00 31.48 ? 60  GLN A CB    1 
ATOM   428  C  CG    . GLN A 1  63  ? -59.227 18.740 -56.884 1.00 36.61 ? 60  GLN A CG    1 
ATOM   429  C  CD    . GLN A 1  63  ? -59.827 18.282 -58.227 1.00 43.40 ? 60  GLN A CD    1 
ATOM   430  O  OE1   . GLN A 1  63  ? -59.852 17.081 -58.530 1.00 46.84 ? 60  GLN A OE1   1 
ATOM   431  N  NE2   . GLN A 1  63  ? -60.309 19.235 -59.030 1.00 45.28 ? 60  GLN A NE2   1 
ATOM   432  N  N     . ALA A 1  64  ? -58.561 23.131 -55.601 1.00 27.30 ? 61  ALA A N     1 
ATOM   433  C  CA    . ALA A 1  64  ? -58.056 24.497 -55.633 1.00 26.79 ? 61  ALA A CA    1 
ATOM   434  C  C     . ALA A 1  64  ? -57.250 24.804 -54.361 1.00 26.43 ? 61  ALA A C     1 
ATOM   435  O  O     . ALA A 1  64  ? -56.143 25.334 -54.461 1.00 25.89 ? 61  ALA A O     1 
ATOM   436  C  CB    . ALA A 1  64  ? -59.165 25.502 -55.825 1.00 25.89 ? 61  ALA A CB    1 
ATOM   437  N  N     . HIS A 1  65  ? -57.799 24.454 -53.191 1.00 26.09 ? 62  HIS A N     1 
ATOM   438  C  CA    . HIS A 1  65  ? -57.120 24.702 -51.914 1.00 26.02 ? 62  HIS A CA    1 
ATOM   439  C  C     . HIS A 1  65  ? -55.772 24.017 -51.837 1.00 26.38 ? 62  HIS A C     1 
ATOM   440  O  O     . HIS A 1  65  ? -54.806 24.631 -51.398 1.00 26.19 ? 62  HIS A O     1 
ATOM   441  C  CB    . HIS A 1  65  ? -57.949 24.300 -50.667 1.00 26.02 ? 62  HIS A CB    1 
ATOM   442  C  CG    . HIS A 1  65  ? -57.155 24.356 -49.388 1.00 25.19 ? 62  HIS A CG    1 
ATOM   443  N  ND1   . HIS A 1  65  ? -56.856 25.543 -48.753 1.00 23.36 ? 62  HIS A ND1   1 
ATOM   444  C  CD2   . HIS A 1  65  ? -56.538 23.383 -48.669 1.00 24.05 ? 62  HIS A CD2   1 
ATOM   445  C  CE1   . HIS A 1  65  ? -56.131 25.298 -47.676 1.00 23.68 ? 62  HIS A CE1   1 
ATOM   446  N  NE2   . HIS A 1  65  ? -55.933 23.994 -47.592 1.00 24.46 ? 62  HIS A NE2   1 
ATOM   447  N  N     . ASN A 1  66  ? -55.713 22.750 -52.249 1.00 26.80 ? 63  ASN A N     1 
ATOM   448  C  CA    . ASN A 1  66  ? -54.489 21.957 -52.134 1.00 27.33 ? 63  ASN A CA    1 
ATOM   449  C  C     . ASN A 1  66  ? -53.306 22.408 -53.012 1.00 27.43 ? 63  ASN A C     1 
ATOM   450  O  O     . ASN A 1  66  ? -52.164 22.015 -52.752 1.00 27.80 ? 63  ASN A O     1 
ATOM   451  C  CB    . ASN A 1  66  ? -54.781 20.468 -52.376 1.00 27.67 ? 63  ASN A CB    1 
ATOM   452  C  CG    . ASN A 1  66  ? -55.467 19.791 -51.182 1.00 30.57 ? 63  ASN A CG    1 
ATOM   453  O  OD1   . ASN A 1  66  ? -55.582 20.365 -50.093 1.00 30.22 ? 63  ASN A OD1   1 
ATOM   454  N  ND2   . ASN A 1  66  ? -55.922 18.557 -51.388 1.00 30.25 ? 63  ASN A ND2   1 
ATOM   455  N  N     . LEU A 1  67  ? -53.549 23.224 -54.033 1.00 27.15 ? 64  LEU A N     1 
ATOM   456  C  CA    . LEU A 1  67  ? -52.443 23.682 -54.898 1.00 27.27 ? 64  LEU A CA    1 
ATOM   457  C  C     . LEU A 1  67  ? -51.307 24.311 -54.076 1.00 27.17 ? 64  LEU A C     1 
ATOM   458  O  O     . LEU A 1  67  ? -50.137 23.961 -54.249 1.00 27.63 ? 64  LEU A O     1 
ATOM   459  C  CB    . LEU A 1  67  ? -52.924 24.685 -55.957 1.00 26.53 ? 64  LEU A CB    1 
ATOM   460  C  CG    . LEU A 1  67  ? -54.026 24.249 -56.934 1.00 27.87 ? 64  LEU A CG    1 
ATOM   461  C  CD1   . LEU A 1  67  ? -54.450 25.456 -57.773 1.00 25.91 ? 64  LEU A CD1   1 
ATOM   462  C  CD2   . LEU A 1  67  ? -53.583 23.051 -57.813 1.00 27.53 ? 64  LEU A CD2   1 
ATOM   463  N  N     . ALA A 1  68  ? -51.663 25.239 -53.187 1.00 26.22 ? 65  ALA A N     1 
ATOM   464  C  CA    . ALA A 1  68  ? -50.681 25.855 -52.316 1.00 25.70 ? 65  ALA A CA    1 
ATOM   465  C  C     . ALA A 1  68  ? -51.159 25.973 -50.854 1.00 25.50 ? 65  ALA A C     1 
ATOM   466  O  O     . ALA A 1  68  ? -50.546 26.697 -50.054 1.00 24.08 ? 65  ALA A O     1 
ATOM   467  C  CB    . ALA A 1  68  ? -50.256 27.219 -52.877 1.00 25.38 ? 65  ALA A CB    1 
ATOM   468  N  N     . HIS A 1  69  ? -52.226 25.238 -50.520 1.00 25.20 ? 66  HIS A N     1 
ATOM   469  C  CA    . HIS A 1  69  ? -52.843 25.282 -49.176 1.00 25.74 ? 66  HIS A CA    1 
ATOM   470  C  C     . HIS A 1  69  ? -53.135 26.720 -48.748 1.00 25.96 ? 66  HIS A C     1 
ATOM   471  O  O     . HIS A 1  69  ? -52.711 27.171 -47.689 1.00 26.90 ? 66  HIS A O     1 
ATOM   472  C  CB    . HIS A 1  69  ? -51.994 24.533 -48.138 1.00 25.25 ? 66  HIS A CB    1 
ATOM   473  C  CG    . HIS A 1  69  ? -52.180 23.047 -48.177 1.00 24.88 ? 66  HIS A CG    1 
ATOM   474  N  ND1   . HIS A 1  69  ? -53.146 22.395 -47.431 1.00 24.33 ? 66  HIS A ND1   1 
ATOM   475  C  CD2   . HIS A 1  69  ? -51.556 22.092 -48.905 1.00 24.97 ? 66  HIS A CD2   1 
ATOM   476  C  CE1   . HIS A 1  69  ? -53.098 21.100 -47.692 1.00 24.79 ? 66  HIS A CE1   1 
ATOM   477  N  NE2   . HIS A 1  69  ? -52.138 20.888 -48.577 1.00 26.36 ? 66  HIS A NE2   1 
ATOM   478  N  N     . THR A 1  70  ? -53.894 27.405 -49.590 1.00 25.84 ? 67  THR A N     1 
ATOM   479  C  CA    . THR A 1  70  ? -54.188 28.823 -49.471 1.00 25.82 ? 67  THR A CA    1 
ATOM   480  C  C     . THR A 1  70  ? -55.409 29.099 -48.586 1.00 26.00 ? 67  THR A C     1 
ATOM   481  O  O     . THR A 1  70  ? -56.283 28.238 -48.421 1.00 25.65 ? 67  THR A O     1 
ATOM   482  C  CB    . THR A 1  70  ? -54.468 29.407 -50.882 1.00 26.00 ? 67  THR A CB    1 
ATOM   483  O  OG1   . THR A 1  70  ? -55.281 28.482 -51.609 1.00 25.34 ? 67  THR A OG1   1 
ATOM   484  C  CG2   . THR A 1  70  ? -53.177 29.639 -51.662 1.00 26.08 ? 67  THR A CG2   1 
ATOM   485  N  N     . GLY A 1  71  ? -55.469 30.308 -48.042 1.00 25.90 ? 68  GLY A N     1 
ATOM   486  C  CA    . GLY A 1  71  ? -56.619 30.762 -47.265 1.00 26.54 ? 68  GLY A CA    1 
ATOM   487  C  C     . GLY A 1  71  ? -57.839 31.017 -48.129 1.00 27.44 ? 68  GLY A C     1 
ATOM   488  O  O     . GLY A 1  71  ? -57.895 30.592 -49.303 1.00 27.39 ? 68  GLY A O     1 
ATOM   489  N  N     . ARG A 1  72  ? -58.815 31.706 -47.538 1.00 27.52 ? 69  ARG A N     1 
ATOM   490  C  CA    . ARG A 1  72  ? -60.137 31.908 -48.118 1.00 27.46 ? 69  ARG A CA    1 
ATOM   491  C  C     . ARG A 1  72  ? -60.118 32.577 -49.495 1.00 27.67 ? 69  ARG A C     1 
ATOM   492  O  O     . ARG A 1  72  ? -60.575 31.977 -50.481 1.00 27.00 ? 69  ARG A O     1 
ATOM   493  C  CB    . ARG A 1  72  ? -61.033 32.723 -47.165 1.00 27.22 ? 69  ARG A CB    1 
ATOM   494  C  CG    . ARG A 1  72  ? -62.518 32.798 -47.593 1.00 28.73 ? 69  ARG A CG    1 
ATOM   495  C  CD    . ARG A 1  72  ? -63.073 34.250 -47.496 1.00 31.82 ? 69  ARG A CD    1 
ATOM   496  N  NE    . ARG A 1  72  ? -63.017 34.651 -46.120 1.00 34.36 ? 69  ARG A NE    1 
ATOM   497  C  CZ    . ARG A 1  72  ? -62.683 35.838 -45.618 1.00 31.74 ? 69  ARG A CZ    1 
ATOM   498  N  NH1   . ARG A 1  72  ? -62.399 36.913 -46.355 1.00 27.81 ? 69  ARG A NH1   1 
ATOM   499  N  NH2   . ARG A 1  72  ? -62.681 35.918 -44.308 1.00 30.38 ? 69  ARG A NH2   1 
ATOM   500  N  N     . GLU A 1  73  ? -59.638 33.823 -49.544 1.00 26.81 ? 70  GLU A N     1 
ATOM   501  C  CA    . GLU A 1  73  ? -59.682 34.607 -50.767 1.00 26.86 ? 70  GLU A CA    1 
ATOM   502  C  C     . GLU A 1  73  ? -58.813 34.016 -51.890 1.00 26.37 ? 70  GLU A C     1 
ATOM   503  O  O     . GLU A 1  73  ? -59.248 33.961 -53.042 1.00 26.37 ? 70  GLU A O     1 
ATOM   504  C  CB    . GLU A 1  73  ? -59.359 36.085 -50.498 1.00 26.51 ? 70  GLU A CB    1 
ATOM   505  C  CG    . GLU A 1  73  ? -60.451 36.808 -49.655 1.00 27.78 ? 70  GLU A CG    1 
ATOM   506  C  CD    . GLU A 1  73  ? -61.877 36.654 -50.249 1.00 30.75 ? 70  GLU A CD    1 
ATOM   507  O  OE1   . GLU A 1  73  ? -62.097 36.993 -51.435 1.00 30.09 ? 70  GLU A OE1   1 
ATOM   508  O  OE2   . GLU A 1  73  ? -62.784 36.202 -49.524 1.00 30.21 ? 70  GLU A OE2   1 
ATOM   509  N  N     . ALA A 1  74  ? -57.599 33.585 -51.556 1.00 26.09 ? 71  ALA A N     1 
ATOM   510  C  CA    . ALA A 1  74  ? -56.702 32.995 -52.544 1.00 25.79 ? 71  ALA A CA    1 
ATOM   511  C  C     . ALA A 1  74  ? -57.276 31.697 -53.137 1.00 26.14 ? 71  ALA A C     1 
ATOM   512  O  O     . ALA A 1  74  ? -57.131 31.451 -54.327 1.00 25.42 ? 71  ALA A O     1 
ATOM   513  C  CB    . ALA A 1  74  ? -55.320 32.776 -51.955 1.00 25.20 ? 71  ALA A CB    1 
ATOM   514  N  N     . THR A 1  75  ? -57.928 30.885 -52.304 1.00 26.81 ? 72  THR A N     1 
ATOM   515  C  CA    . THR A 1  75  ? -58.588 29.665 -52.761 1.00 27.97 ? 72  THR A CA    1 
ATOM   516  C  C     . THR A 1  75  ? -59.763 30.014 -53.676 1.00 28.53 ? 72  THR A C     1 
ATOM   517  O  O     . THR A 1  75  ? -59.878 29.471 -54.789 1.00 29.45 ? 72  THR A O     1 
ATOM   518  C  CB    . THR A 1  75  ? -59.050 28.804 -51.583 1.00 27.94 ? 72  THR A CB    1 
ATOM   519  O  OG1   . THR A 1  75  ? -57.893 28.366 -50.861 1.00 29.54 ? 72  THR A OG1   1 
ATOM   520  C  CG2   . THR A 1  75  ? -59.853 27.548 -52.057 1.00 27.72 ? 72  THR A CG2   1 
ATOM   521  N  N     . LEU A 1  76  ? -60.590 30.953 -53.231 1.00 28.42 ? 73  LEU A N     1 
ATOM   522  C  CA    . LEU A 1  76  ? -61.724 31.411 -54.013 1.00 28.72 ? 73  LEU A CA    1 
ATOM   523  C  C     . LEU A 1  76  ? -61.363 31.954 -55.407 1.00 29.03 ? 73  LEU A C     1 
ATOM   524  O  O     . LEU A 1  76  ? -62.056 31.638 -56.383 1.00 27.88 ? 73  LEU A O     1 
ATOM   525  C  CB    . LEU A 1  76  ? -62.555 32.449 -53.254 1.00 29.14 ? 73  LEU A CB    1 
ATOM   526  C  CG    . LEU A 1  76  ? -63.760 32.756 -54.163 1.00 31.11 ? 73  LEU A CG    1 
ATOM   527  C  CD1   . LEU A 1  76  ? -65.008 31.969 -53.789 1.00 31.34 ? 73  LEU A CD1   1 
ATOM   528  C  CD2   . LEU A 1  76  ? -64.018 34.218 -54.277 1.00 32.69 ? 73  LEU A CD2   1 
ATOM   529  N  N     . LEU A 1  77  ? -60.309 32.782 -55.488 1.00 28.92 ? 74  LEU A N     1 
ATOM   530  C  CA    . LEU A 1  77  ? -59.874 33.357 -56.761 1.00 29.24 ? 74  LEU A CA    1 
ATOM   531  C  C     . LEU A 1  77  ? -59.519 32.281 -57.788 1.00 29.48 ? 74  LEU A C     1 
ATOM   532  O  O     . LEU A 1  77  ? -59.803 32.439 -58.979 1.00 29.46 ? 74  LEU A O     1 
ATOM   533  C  CB    . LEU A 1  77  ? -58.704 34.336 -56.574 1.00 29.03 ? 74  LEU A CB    1 
ATOM   534  C  CG    . LEU A 1  77  ? -59.108 35.693 -55.979 1.00 29.81 ? 74  LEU A CG    1 
ATOM   535  C  CD1   . LEU A 1  77  ? -57.928 36.403 -55.264 1.00 29.13 ? 74  LEU A CD1   1 
ATOM   536  C  CD2   . LEU A 1  77  ? -59.756 36.616 -57.026 1.00 30.08 ? 74  LEU A CD2   1 
ATOM   537  N  N     . LYS A 1  78  ? -58.919 31.182 -57.336 1.00 29.28 ? 75  LYS A N     1 
ATOM   538  C  CA    . LYS A 1  78  ? -58.650 30.069 -58.255 1.00 29.50 ? 75  LYS A CA    1 
ATOM   539  C  C     . LYS A 1  78  ? -59.945 29.471 -58.802 1.00 29.85 ? 75  LYS A C     1 
ATOM   540  O  O     . LYS A 1  78  ? -60.133 29.381 -60.019 1.00 29.75 ? 75  LYS A O     1 
ATOM   541  C  CB    . LYS A 1  78  ? -57.803 28.978 -57.598 1.00 29.20 ? 75  LYS A CB    1 
ATOM   542  C  CG    . LYS A 1  78  ? -56.325 29.289 -57.583 1.00 30.03 ? 75  LYS A CG    1 
ATOM   543  C  CD    . LYS A 1  78  ? -55.721 29.337 -59.017 1.00 29.82 ? 75  LYS A CD    1 
ATOM   544  C  CE    . LYS A 1  78  ? -54.213 29.407 -58.951 1.00 29.44 ? 75  LYS A CE    1 
ATOM   545  N  NZ    . LYS A 1  78  ? -53.593 29.799 -60.243 1.00 29.54 ? 75  LYS A NZ    1 
ATOM   546  N  N     . ILE A 1  79  ? -60.834 29.068 -57.893 1.00 29.85 ? 76  ILE A N     1 
ATOM   547  C  CA    . ILE A 1  79  ? -62.088 28.416 -58.261 1.00 29.52 ? 76  ILE A CA    1 
ATOM   548  C  C     . ILE A 1  79  ? -62.901 29.270 -59.238 1.00 30.27 ? 76  ILE A C     1 
ATOM   549  O  O     . ILE A 1  79  ? -63.445 28.754 -60.238 1.00 30.63 ? 76  ILE A O     1 
ATOM   550  C  CB    . ILE A 1  79  ? -62.946 28.095 -57.011 1.00 29.35 ? 76  ILE A CB    1 
ATOM   551  C  CG1   . ILE A 1  79  ? -62.170 27.207 -56.028 1.00 27.55 ? 76  ILE A CG1   1 
ATOM   552  C  CG2   . ILE A 1  79  ? -64.268 27.452 -57.418 1.00 29.52 ? 76  ILE A CG2   1 
ATOM   553  C  CD1   . ILE A 1  79  ? -62.823 27.066 -54.630 1.00 24.85 ? 76  ILE A CD1   1 
ATOM   554  N  N     . ALA A 1  80  ? -62.962 30.572 -58.960 1.00 29.95 ? 77  ALA A N     1 
ATOM   555  C  CA    . ALA A 1  80  ? -63.817 31.481 -59.706 1.00 30.49 ? 77  ALA A CA    1 
ATOM   556  C  C     . ALA A 1  80  ? -63.304 31.694 -61.124 1.00 30.94 ? 77  ALA A C     1 
ATOM   557  O  O     . ALA A 1  80  ? -64.035 32.202 -61.970 1.00 31.22 ? 77  ALA A O     1 
ATOM   558  C  CB    . ALA A 1  80  ? -63.973 32.831 -58.978 1.00 30.29 ? 77  ALA A CB    1 
ATOM   559  N  N     . ASN A 1  81  ? -62.056 31.309 -61.387 1.00 30.43 ? 78  ASN A N     1 
ATOM   560  C  CA    . ASN A 1  81  ? -61.573 31.296 -62.757 1.00 31.23 ? 78  ASN A CA    1 
ATOM   561  C  C     . ASN A 1  81  ? -62.417 30.412 -63.688 1.00 31.41 ? 78  ASN A C     1 
ATOM   562  O  O     . ASN A 1  81  ? -62.622 30.766 -64.845 1.00 32.19 ? 78  ASN A O     1 
ATOM   563  C  CB    . ASN A 1  81  ? -60.092 30.905 -62.825 1.00 30.33 ? 78  ASN A CB    1 
ATOM   564  C  CG    . ASN A 1  81  ? -59.179 32.046 -62.438 1.00 30.07 ? 78  ASN A CG    1 
ATOM   565  O  OD1   . ASN A 1  81  ? -59.557 33.225 -62.518 1.00 29.96 ? 78  ASN A OD1   1 
ATOM   566  N  ND2   . ASN A 1  81  ? -57.981 31.713 -62.017 1.00 28.07 ? 78  ASN A ND2   1 
ATOM   567  N  N     . LEU A 1  82  ? -62.920 29.290 -63.171 1.00 31.70 ? 79  LEU A N     1 
ATOM   568  C  CA    . LEU A 1  82  ? -63.655 28.321 -63.990 1.00 32.27 ? 79  LEU A CA    1 
ATOM   569  C  C     . LEU A 1  82  ? -65.136 28.228 -63.629 1.00 32.63 ? 79  LEU A C     1 
ATOM   570  O  O     . LEU A 1  82  ? -65.990 28.084 -64.511 1.00 32.84 ? 79  LEU A O     1 
ATOM   571  C  CB    . LEU A 1  82  ? -63.025 26.923 -63.862 1.00 32.01 ? 79  LEU A CB    1 
ATOM   572  C  CG    . LEU A 1  82  ? -61.557 26.738 -64.287 1.00 32.45 ? 79  LEU A CG    1 
ATOM   573  C  CD1   . LEU A 1  82  ? -61.123 25.278 -64.163 1.00 30.59 ? 79  LEU A CD1   1 
ATOM   574  C  CD2   . LEU A 1  82  ? -61.309 27.249 -65.692 1.00 33.70 ? 79  LEU A CD2   1 
ATOM   575  N  N     . TYR A 1  83  ? -65.433 28.315 -62.334 1.00 32.46 ? 80  TYR A N     1 
ATOM   576  C  CA    . TYR A 1  83  ? -66.725 27.904 -61.832 1.00 32.66 ? 80  TYR A CA    1 
ATOM   577  C  C     . TYR A 1  83  ? -67.495 29.000 -61.154 1.00 32.95 ? 80  TYR A C     1 
ATOM   578  O  O     . TYR A 1  83  ? -66.921 29.967 -60.669 1.00 32.28 ? 80  TYR A O     1 
ATOM   579  C  CB    . TYR A 1  83  ? -66.567 26.759 -60.846 1.00 32.34 ? 80  TYR A CB    1 
ATOM   580  C  CG    . TYR A 1  83  ? -65.864 25.567 -61.424 1.00 33.33 ? 80  TYR A CG    1 
ATOM   581  C  CD1   . TYR A 1  83  ? -66.480 24.780 -62.403 1.00 33.51 ? 80  TYR A CD1   1 
ATOM   582  C  CD2   . TYR A 1  83  ? -64.586 25.213 -60.990 1.00 32.66 ? 80  TYR A CD2   1 
ATOM   583  C  CE1   . TYR A 1  83  ? -65.836 23.681 -62.947 1.00 34.21 ? 80  TYR A CE1   1 
ATOM   584  C  CE2   . TYR A 1  83  ? -63.932 24.118 -61.517 1.00 33.80 ? 80  TYR A CE2   1 
ATOM   585  C  CZ    . TYR A 1  83  ? -64.562 23.357 -62.503 1.00 34.00 ? 80  TYR A CZ    1 
ATOM   586  O  OH    . TYR A 1  83  ? -63.927 22.266 -63.026 1.00 32.40 ? 80  TYR A OH    1 
ATOM   587  N  N     . TRP A 1  84  ? -68.811 28.828 -61.133 1.00 33.45 ? 81  TRP A N     1 
ATOM   588  C  CA    . TRP A 1  84  ? -69.682 29.623 -60.275 1.00 34.43 ? 81  TRP A CA    1 
ATOM   589  C  C     . TRP A 1  84  ? -70.746 28.714 -59.696 1.00 34.47 ? 81  TRP A C     1 
ATOM   590  O  O     . TRP A 1  84  ? -71.250 27.818 -60.385 1.00 34.91 ? 81  TRP A O     1 
ATOM   591  C  CB    . TRP A 1  84  ? -70.331 30.790 -61.020 1.00 34.28 ? 81  TRP A CB    1 
ATOM   592  C  CG    . TRP A 1  84  ? -71.182 31.615 -60.112 1.00 36.23 ? 81  TRP A CG    1 
ATOM   593  C  CD1   . TRP A 1  84  ? -70.804 32.741 -59.440 1.00 36.63 ? 81  TRP A CD1   1 
ATOM   594  C  CD2   . TRP A 1  84  ? -72.556 31.369 -59.743 1.00 38.06 ? 81  TRP A CD2   1 
ATOM   595  N  NE1   . TRP A 1  84  ? -71.848 33.210 -58.680 1.00 37.39 ? 81  TRP A NE1   1 
ATOM   596  C  CE2   . TRP A 1  84  ? -72.934 32.390 -58.846 1.00 37.49 ? 81  TRP A CE2   1 
ATOM   597  C  CE3   . TRP A 1  84  ? -73.498 30.383 -60.084 1.00 38.93 ? 81  TRP A CE3   1 
ATOM   598  C  CZ2   . TRP A 1  84  ? -74.220 32.465 -58.287 1.00 38.14 ? 81  TRP A CZ2   1 
ATOM   599  C  CZ3   . TRP A 1  84  ? -74.778 30.450 -59.518 1.00 39.88 ? 81  TRP A CZ3   1 
ATOM   600  C  CH2   . TRP A 1  84  ? -75.122 31.485 -58.626 1.00 39.24 ? 81  TRP A CH2   1 
ATOM   601  N  N     . TRP A 1  85  ? -71.048 28.929 -58.416 1.00 34.43 ? 82  TRP A N     1 
ATOM   602  C  CA    . TRP A 1  85  ? -72.221 28.346 -57.756 1.00 34.21 ? 82  TRP A CA    1 
ATOM   603  C  C     . TRP A 1  85  ? -72.667 29.216 -56.555 1.00 34.56 ? 82  TRP A C     1 
ATOM   604  O  O     . TRP A 1  85  ? -72.002 30.216 -56.238 1.00 34.51 ? 82  TRP A O     1 
ATOM   605  C  CB    . TRP A 1  85  ? -72.001 26.869 -57.408 1.00 34.05 ? 82  TRP A CB    1 
ATOM   606  C  CG    . TRP A 1  85  ? -71.012 26.550 -56.314 1.00 34.69 ? 82  TRP A CG    1 
ATOM   607  C  CD1   . TRP A 1  85  ? -71.248 26.545 -54.958 1.00 34.32 ? 82  TRP A CD1   1 
ATOM   608  C  CD2   . TRP A 1  85  ? -69.653 26.128 -56.482 1.00 32.21 ? 82  TRP A CD2   1 
ATOM   609  N  NE1   . TRP A 1  85  ? -70.120 26.160 -54.285 1.00 33.81 ? 82  TRP A NE1   1 
ATOM   610  C  CE2   . TRP A 1  85  ? -69.124 25.897 -55.193 1.00 33.65 ? 82  TRP A CE2   1 
ATOM   611  C  CE3   . TRP A 1  85  ? -68.831 25.925 -57.597 1.00 32.74 ? 82  TRP A CE3   1 
ATOM   612  C  CZ2   . TRP A 1  85  ? -67.800 25.473 -54.985 1.00 32.93 ? 82  TRP A CZ2   1 
ATOM   613  C  CZ3   . TRP A 1  85  ? -67.515 25.502 -57.392 1.00 32.06 ? 82  TRP A CZ3   1 
ATOM   614  C  CH2   . TRP A 1  85  ? -67.013 25.285 -56.094 1.00 32.36 ? 82  TRP A CH2   1 
ATOM   615  N  N     . PRO A 1  86  ? -73.816 28.888 -55.917 1.00 34.43 ? 83  PRO A N     1 
ATOM   616  C  CA    . PRO A 1  86  ? -74.251 29.795 -54.852 1.00 34.14 ? 83  PRO A CA    1 
ATOM   617  C  C     . PRO A 1  86  ? -73.381 29.670 -53.620 1.00 33.37 ? 83  PRO A C     1 
ATOM   618  O  O     . PRO A 1  86  ? -73.043 28.564 -53.223 1.00 33.61 ? 83  PRO A O     1 
ATOM   619  C  CB    . PRO A 1  86  ? -75.692 29.324 -54.547 1.00 34.18 ? 83  PRO A CB    1 
ATOM   620  C  CG    . PRO A 1  86  ? -76.145 28.678 -55.822 1.00 34.45 ? 83  PRO A CG    1 
ATOM   621  C  CD    . PRO A 1  86  ? -74.896 27.957 -56.306 1.00 34.50 ? 83  PRO A CD    1 
ATOM   622  N  N     . ASN A 1  87  ? -73.011 30.807 -53.034 1.00 33.25 ? 84  ASN A N     1 
ATOM   623  C  CA    . ASN A 1  87  ? -72.273 30.835 -51.766 1.00 32.91 ? 84  ASN A CA    1 
ATOM   624  C  C     . ASN A 1  87  ? -70.974 30.038 -51.770 1.00 31.94 ? 84  ASN A C     1 
ATOM   625  O  O     . ASN A 1  87  ? -70.729 29.228 -50.879 1.00 32.00 ? 84  ASN A O     1 
ATOM   626  C  CB    . ASN A 1  87  ? -73.181 30.375 -50.611 1.00 33.27 ? 84  ASN A CB    1 
ATOM   627  C  CG    . ASN A 1  87  ? -74.406 31.245 -50.466 1.00 35.69 ? 84  ASN A CG    1 
ATOM   628  O  OD1   . ASN A 1  87  ? -74.374 32.432 -50.784 1.00 40.74 ? 84  ASN A OD1   1 
ATOM   629  N  ND2   . ASN A 1  87  ? -75.501 30.660 -50.021 1.00 38.38 ? 84  ASN A ND2   1 
ATOM   630  N  N     . MET A 1  88  ? -70.140 30.272 -52.772 1.00 31.52 ? 85  MET A N     1 
ATOM   631  C  CA    . MET A 1  88  ? -68.876 29.541 -52.899 1.00 31.00 ? 85  MET A CA    1 
ATOM   632  C  C     . MET A 1  88  ? -67.958 29.659 -51.665 1.00 30.58 ? 85  MET A C     1 
ATOM   633  O  O     . MET A 1  88  ? -67.350 28.677 -51.252 1.00 30.46 ? 85  MET A O     1 
ATOM   634  C  CB    . MET A 1  88  ? -68.139 29.971 -54.173 1.00 31.14 ? 85  MET A CB    1 
ATOM   635  C  CG    . MET A 1  88  ? -68.844 29.584 -55.483 1.00 31.57 ? 85  MET A CG    1 
ATOM   636  S  SD    . MET A 1  88  ? -68.275 30.569 -56.875 1.00 36.91 ? 85  MET A SD    1 
ATOM   637  C  CE    . MET A 1  88  ? -66.797 29.685 -57.263 1.00 33.08 ? 85  MET A CE    1 
ATOM   638  N  N     . ARG A 1  89  ? -67.868 30.843 -51.063 1.00 30.91 ? 86  ARG A N     1 
ATOM   639  C  CA    . ARG A 1  89  ? -67.005 31.002 -49.876 1.00 31.20 ? 86  ARG A CA    1 
ATOM   640  C  C     . ARG A 1  89  ? -67.428 30.135 -48.699 1.00 31.78 ? 86  ARG A C     1 
ATOM   641  O  O     . ARG A 1  89  ? -66.572 29.682 -47.933 1.00 30.95 ? 86  ARG A O     1 
ATOM   642  C  CB    . ARG A 1  89  ? -66.840 32.468 -49.459 1.00 30.57 ? 86  ARG A CB    1 
ATOM   643  C  CG    . ARG A 1  89  ? -65.880 33.249 -50.354 1.00 30.15 ? 86  ARG A CG    1 
ATOM   644  C  CD    . ARG A 1  89  ? -65.947 34.724 -50.011 1.00 30.68 ? 86  ARG A CD    1 
ATOM   645  N  NE    . ARG A 1  89  ? -65.102 35.599 -50.826 1.00 28.84 ? 86  ARG A NE    1 
ATOM   646  C  CZ    . ARG A 1  89  ? -65.461 36.115 -51.997 1.00 29.99 ? 86  ARG A CZ    1 
ATOM   647  N  NH1   . ARG A 1  89  ? -66.635 35.800 -52.541 1.00 30.57 ? 86  ARG A NH1   1 
ATOM   648  N  NH2   . ARG A 1  89  ? -64.634 36.932 -52.643 1.00 27.60 ? 86  ARG A NH2   1 
ATOM   649  N  N     . LYS A 1  90  ? -68.736 29.876 -48.569 1.00 32.70 ? 87  LYS A N     1 
ATOM   650  C  CA    . LYS A 1  90  ? -69.225 28.982 -47.508 1.00 33.63 ? 87  LYS A CA    1 
ATOM   651  C  C     . LYS A 1  90  ? -68.600 27.611 -47.661 1.00 32.60 ? 87  LYS A C     1 
ATOM   652  O  O     . LYS A 1  90  ? -68.192 27.017 -46.676 1.00 32.97 ? 87  LYS A O     1 
ATOM   653  C  CB    . LYS A 1  90  ? -70.765 28.884 -47.469 1.00 34.29 ? 87  LYS A CB    1 
ATOM   654  C  CG    . LYS A 1  90  ? -71.437 30.200 -47.046 1.00 38.73 ? 87  LYS A CG    1 
ATOM   655  C  CD    . LYS A 1  90  ? -72.935 30.060 -46.744 1.00 44.73 ? 87  LYS A CD    1 
ATOM   656  C  CE    . LYS A 1  90  ? -73.527 31.426 -46.363 1.00 48.26 ? 87  LYS A CE    1 
ATOM   657  N  NZ    . LYS A 1  90  ? -75.036 31.419 -46.306 1.00 50.85 ? 87  LYS A NZ    1 
ATOM   658  N  N     . ASP A 1  91  ? -68.492 27.125 -48.898 1.00 32.03 ? 88  ASP A N     1 
ATOM   659  C  CA    . ASP A 1  91  ? -67.844 25.837 -49.143 1.00 31.34 ? 88  ASP A CA    1 
ATOM   660  C  C     . ASP A 1  91  ? -66.340 25.919 -48.940 1.00 30.54 ? 88  ASP A C     1 
ATOM   661  O  O     . ASP A 1  91  ? -65.731 24.977 -48.448 1.00 29.80 ? 88  ASP A O     1 
ATOM   662  C  CB    . ASP A 1  91  ? -68.143 25.322 -50.557 1.00 32.19 ? 88  ASP A CB    1 
ATOM   663  C  CG    . ASP A 1  91  ? -69.620 24.964 -50.751 1.00 34.01 ? 88  ASP A CG    1 
ATOM   664  O  OD1   . ASP A 1  91  ? -70.238 24.426 -49.808 1.00 37.15 ? 88  ASP A OD1   1 
ATOM   665  O  OD2   . ASP A 1  91  ? -70.161 25.226 -51.839 1.00 34.67 ? 88  ASP A OD2   1 
ATOM   666  N  N     . VAL A 1  92  ? -65.740 27.037 -49.344 1.00 30.08 ? 89  VAL A N     1 
ATOM   667  C  CA    . VAL A 1  92  ? -64.295 27.238 -49.144 1.00 29.98 ? 89  VAL A CA    1 
ATOM   668  C  C     . VAL A 1  92  ? -63.943 27.150 -47.649 1.00 30.08 ? 89  VAL A C     1 
ATOM   669  O  O     . VAL A 1  92  ? -63.047 26.416 -47.258 1.00 29.79 ? 89  VAL A O     1 
ATOM   670  C  CB    . VAL A 1  92  ? -63.815 28.591 -49.731 1.00 29.69 ? 89  VAL A CB    1 
ATOM   671  C  CG1   . VAL A 1  92  ? -62.364 28.893 -49.314 1.00 29.28 ? 89  VAL A CG1   1 
ATOM   672  C  CG2   . VAL A 1  92  ? -63.957 28.592 -51.259 1.00 28.64 ? 89  VAL A CG2   1 
ATOM   673  N  N     . VAL A 1  93  ? -64.671 27.894 -46.830 1.00 30.74 ? 90  VAL A N     1 
ATOM   674  C  CA    . VAL A 1  93  ? -64.416 27.958 -45.389 1.00 31.51 ? 90  VAL A CA    1 
ATOM   675  C  C     . VAL A 1  93  ? -64.643 26.599 -44.716 1.00 32.05 ? 90  VAL A C     1 
ATOM   676  O  O     . VAL A 1  93  ? -63.862 26.201 -43.851 1.00 31.46 ? 90  VAL A O     1 
ATOM   677  C  CB    . VAL A 1  93  ? -65.223 29.112 -44.734 1.00 32.09 ? 90  VAL A CB    1 
ATOM   678  C  CG1   . VAL A 1  93  ? -65.173 29.060 -43.211 1.00 33.27 ? 90  VAL A CG1   1 
ATOM   679  C  CG2   . VAL A 1  93  ? -64.684 30.456 -45.225 1.00 31.47 ? 90  VAL A CG2   1 
ATOM   680  N  N     . LYS A 1  94  ? -65.674 25.865 -45.147 1.00 32.24 ? 91  LYS A N     1 
ATOM   681  C  CA    . LYS A 1  94  ? -65.893 24.494 -44.660 1.00 33.08 ? 91  LYS A CA    1 
ATOM   682  C  C     . LYS A 1  94  ? -64.649 23.607 -44.833 1.00 32.29 ? 91  LYS A C     1 
ATOM   683  O  O     . LYS A 1  94  ? -64.255 22.893 -43.902 1.00 32.62 ? 91  LYS A O     1 
ATOM   684  C  CB    . LYS A 1  94  ? -67.127 23.862 -45.348 1.00 33.83 ? 91  LYS A CB    1 
ATOM   685  C  CG    . LYS A 1  94  ? -67.698 22.632 -44.647 1.00 38.23 ? 91  LYS A CG    1 
ATOM   686  C  CD    . LYS A 1  94  ? -68.957 22.090 -45.355 1.00 43.41 ? 91  LYS A CD    1 
ATOM   687  C  CE    . LYS A 1  94  ? -70.199 22.931 -44.996 1.00 48.00 ? 91  LYS A CE    1 
ATOM   688  N  NZ    . LYS A 1  94  ? -71.472 22.303 -45.501 1.00 51.44 ? 91  LYS A NZ    1 
ATOM   689  N  N     . GLN A 1  95  ? -64.029 23.643 -46.012 1.00 31.65 ? 92  GLN A N     1 
ATOM   690  C  CA    A GLN A 1  95  ? -62.823 22.843 -46.228 0.50 31.28 ? 92  GLN A CA    1 
ATOM   691  C  CA    B GLN A 1  95  ? -62.801 22.887 -46.287 0.50 31.25 ? 92  GLN A CA    1 
ATOM   692  C  C     . GLN A 1  95  ? -61.588 23.413 -45.502 1.00 30.99 ? 92  GLN A C     1 
ATOM   693  O  O     . GLN A 1  95  ? -60.755 22.640 -45.032 1.00 30.73 ? 92  GLN A O     1 
ATOM   694  C  CB    A GLN A 1  95  ? -62.547 22.596 -47.720 0.50 31.37 ? 92  GLN A CB    1 
ATOM   695  C  CB    B GLN A 1  95  ? -62.494 22.899 -47.792 0.50 31.38 ? 92  GLN A CB    1 
ATOM   696  C  CG    A GLN A 1  95  ? -63.576 21.691 -48.429 0.50 32.36 ? 92  GLN A CG    1 
ATOM   697  C  CG    B GLN A 1  95  ? -61.293 22.051 -48.183 0.50 31.91 ? 92  GLN A CG    1 
ATOM   698  C  CD    A GLN A 1  95  ? -64.049 20.512 -47.585 0.50 32.08 ? 92  GLN A CD    1 
ATOM   699  C  CD    B GLN A 1  95  ? -61.385 20.643 -47.623 0.50 34.59 ? 92  GLN A CD    1 
ATOM   700  O  OE1   A GLN A 1  95  ? -63.268 19.632 -47.237 0.50 33.12 ? 92  GLN A OE1   1 
ATOM   701  O  OE1   B GLN A 1  95  ? -62.152 19.822 -48.125 0.50 34.42 ? 92  GLN A OE1   1 
ATOM   702  N  NE2   A GLN A 1  95  ? -65.340 20.489 -47.269 0.50 31.63 ? 92  GLN A NE2   1 
ATOM   703  N  NE2   B GLN A 1  95  ? -60.603 20.357 -46.571 0.50 33.79 ? 92  GLN A NE2   1 
ATOM   704  N  N     . LEU A 1  96  ? -61.471 24.740 -45.378 1.00 30.10 ? 93  LEU A N     1 
ATOM   705  C  CA    . LEU A 1  96  ? -60.347 25.313 -44.586 1.00 30.11 ? 93  LEU A CA    1 
ATOM   706  C  C     . LEU A 1  96  ? -60.404 24.852 -43.128 1.00 30.51 ? 93  LEU A C     1 
ATOM   707  O  O     . LEU A 1  96  ? -59.369 24.590 -42.502 1.00 29.87 ? 93  LEU A O     1 
ATOM   708  C  CB    . LEU A 1  96  ? -60.315 26.851 -44.629 1.00 29.81 ? 93  LEU A CB    1 
ATOM   709  C  CG    . LEU A 1  96  ? -60.226 27.584 -45.974 1.00 28.99 ? 93  LEU A CG    1 
ATOM   710  C  CD1   . LEU A 1  96  ? -60.214 29.077 -45.763 1.00 29.55 ? 93  LEU A CD1   1 
ATOM   711  C  CD2   . LEU A 1  96  ? -59.021 27.154 -46.772 1.00 29.55 ? 93  LEU A CD2   1 
ATOM   712  N  N     . GLY A 1  97  ? -61.628 24.759 -42.603 1.00 31.02 ? 94  GLY A N     1 
ATOM   713  C  CA    . GLY A 1  97  ? -61.866 24.302 -41.239 1.00 32.30 ? 94  GLY A CA    1 
ATOM   714  C  C     . GLY A 1  97  ? -61.600 22.821 -41.065 1.00 33.25 ? 94  GLY A C     1 
ATOM   715  O  O     . GLY A 1  97  ? -61.508 22.348 -39.945 1.00 33.70 ? 94  GLY A O     1 
ATOM   716  N  N     . ARG A 1  98  ? -61.469 22.091 -42.173 1.00 34.20 ? 95  ARG A N     1 
ATOM   717  C  CA    . ARG A 1  98  ? -61.230 20.647 -42.119 1.00 35.46 ? 95  ARG A CA    1 
ATOM   718  C  C     . ARG A 1  98  ? -59.835 20.268 -42.582 1.00 34.56 ? 95  ARG A C     1 
ATOM   719  O  O     . ARG A 1  98  ? -59.458 19.101 -42.506 1.00 34.97 ? 95  ARG A O     1 
ATOM   720  C  CB    . ARG A 1  98  ? -62.250 19.883 -42.975 1.00 36.32 ? 95  ARG A CB    1 
ATOM   721  C  CG    . ARG A 1  98  ? -63.690 19.950 -42.472 1.00 41.19 ? 95  ARG A CG    1 
ATOM   722  C  CD    . ARG A 1  98  ? -64.604 19.111 -43.370 1.00 47.98 ? 95  ARG A CD    1 
ATOM   723  N  NE    . ARG A 1  98  ? -66.000 19.558 -43.333 1.00 54.68 ? 95  ARG A NE    1 
ATOM   724  C  CZ    . ARG A 1  98  ? -66.897 19.205 -42.412 1.00 57.39 ? 95  ARG A CZ    1 
ATOM   725  N  NH1   . ARG A 1  98  ? -66.561 18.392 -41.413 1.00 59.55 ? 95  ARG A NH1   1 
ATOM   726  N  NH2   . ARG A 1  98  ? -68.138 19.675 -42.485 1.00 58.28 ? 95  ARG A NH2   1 
ATOM   727  N  N     . CYS A 1  99  ? -59.064 21.226 -43.080 1.00 33.38 ? 96  CYS A N     1 
ATOM   728  C  CA    . CYS A 1  99  ? -57.723 20.888 -43.522 1.00 32.63 ? 96  CYS A CA    1 
ATOM   729  C  C     . CYS A 1  99  ? -56.764 20.913 -42.332 1.00 32.87 ? 96  CYS A C     1 
ATOM   730  O  O     . CYS A 1  99  ? -56.373 22.002 -41.849 1.00 32.57 ? 96  CYS A O     1 
ATOM   731  C  CB    . CYS A 1  99  ? -57.251 21.820 -44.639 1.00 32.42 ? 96  CYS A CB    1 
ATOM   732  S  SG    . CYS A 1  99  ? -55.569 21.451 -45.139 1.00 32.04 ? 96  CYS A SG    1 
ATOM   733  N  N     . GLN A 1  100 ? -56.371 19.718 -41.877 1.00 32.73 ? 97  GLN A N     1 
ATOM   734  C  CA    A GLN A 1  100 ? -55.533 19.579 -40.680 0.50 32.62 ? 97  GLN A CA    1 
ATOM   735  C  CA    B GLN A 1  100 ? -55.545 19.589 -40.673 0.50 32.52 ? 97  GLN A CA    1 
ATOM   736  C  C     . GLN A 1  100 ? -54.163 20.223 -40.869 1.00 32.34 ? 97  GLN A C     1 
ATOM   737  O  O     . GLN A 1  100 ? -53.646 20.879 -39.964 1.00 31.93 ? 97  GLN A O     1 
ATOM   738  C  CB    A GLN A 1  100 ? -55.371 18.106 -40.281 0.50 33.03 ? 97  GLN A CB    1 
ATOM   739  C  CB    B GLN A 1  100 ? -55.415 18.120 -40.238 0.50 32.86 ? 97  GLN A CB    1 
ATOM   740  C  CG    A GLN A 1  100 ? -54.314 17.873 -39.203 0.50 34.07 ? 97  GLN A CG    1 
ATOM   741  C  CG    B GLN A 1  100 ? -56.698 17.501 -39.660 0.50 33.49 ? 97  GLN A CG    1 
ATOM   742  C  CD    A GLN A 1  100 ? -54.620 16.680 -38.324 0.50 36.77 ? 97  GLN A CD    1 
ATOM   743  C  CD    B GLN A 1  100 ? -57.076 18.056 -38.287 0.50 34.67 ? 97  GLN A CD    1 
ATOM   744  O  OE1   A GLN A 1  100 ? -55.781 16.326 -38.119 0.50 37.78 ? 97  GLN A OE1   1 
ATOM   745  O  OE1   B GLN A 1  100 ? -56.216 18.295 -37.437 0.50 35.58 ? 97  GLN A OE1   1 
ATOM   746  N  NE2   A GLN A 1  100 ? -53.577 16.059 -37.794 0.50 37.75 ? 97  GLN A NE2   1 
ATOM   747  N  NE2   B GLN A 1  100 ? -58.370 18.251 -38.066 0.50 34.51 ? 97  GLN A NE2   1 
ATOM   748  N  N     . GLN A 1  101 ? -53.588 20.026 -42.055 1.00 31.25 ? 98  GLN A N     1 
ATOM   749  C  CA    . GLN A 1  101 ? -52.288 20.566 -42.402 1.00 30.52 ? 98  GLN A CA    1 
ATOM   750  C  C     . GLN A 1  101 ? -52.231 22.083 -42.204 1.00 29.61 ? 98  GLN A C     1 
ATOM   751  O  O     . GLN A 1  101 ? -51.283 22.582 -41.614 1.00 28.48 ? 98  GLN A O     1 
ATOM   752  C  CB    . GLN A 1  101 ? -51.923 20.194 -43.846 1.00 31.04 ? 98  GLN A CB    1 
ATOM   753  C  CG    . GLN A 1  101 ? -51.225 18.843 -43.981 1.00 33.63 ? 98  GLN A CG    1 
ATOM   754  C  CD    . GLN A 1  101 ? -51.588 18.116 -45.287 1.00 40.93 ? 98  GLN A CD    1 
ATOM   755  O  OE1   . GLN A 1  101 ? -52.733 17.715 -45.469 1.00 39.61 ? 98  GLN A OE1   1 
ATOM   756  N  NE2   . GLN A 1  101 ? -50.598 17.933 -46.194 1.00 42.21 ? 98  GLN A NE2   1 
ATOM   757  N  N     . CYS A 1  102 ? -53.249 22.794 -42.693 1.00 28.51 ? 99  CYS A N     1 
ATOM   758  C  CA    . CYS A 1  102 ? -53.348 24.234 -42.510 1.00 28.48 ? 99  CYS A CA    1 
ATOM   759  C  C     . CYS A 1  102 ? -53.598 24.631 -41.034 1.00 28.48 ? 99  CYS A C     1 
ATOM   760  O  O     . CYS A 1  102 ? -52.952 25.543 -40.497 1.00 28.75 ? 99  CYS A O     1 
ATOM   761  C  CB    . CYS A 1  102 ? -54.444 24.807 -43.414 1.00 28.05 ? 99  CYS A CB    1 
ATOM   762  S  SG    . CYS A 1  102 ? -53.918 25.084 -45.129 1.00 28.46 ? 99  CYS A SG    1 
ATOM   763  N  N     . LEU A 1  103 ? -54.539 23.957 -40.385 1.00 28.19 ? 100 LEU A N     1 
ATOM   764  C  CA    . LEU A 1  103 ? -54.834 24.240 -38.974 1.00 28.18 ? 100 LEU A CA    1 
ATOM   765  C  C     . LEU A 1  103 ? -53.596 24.179 -38.058 1.00 27.69 ? 100 LEU A C     1 
ATOM   766  O  O     . LEU A 1  103 ? -53.412 25.048 -37.207 1.00 27.48 ? 100 LEU A O     1 
ATOM   767  C  CB    . LEU A 1  103 ? -55.939 23.317 -38.453 1.00 28.40 ? 100 LEU A CB    1 
ATOM   768  C  CG    . LEU A 1  103 ? -57.347 23.430 -39.069 1.00 29.84 ? 100 LEU A CG    1 
ATOM   769  C  CD1   . LEU A 1  103 ? -58.299 22.429 -38.399 1.00 31.21 ? 100 LEU A CD1   1 
ATOM   770  C  CD2   . LEU A 1  103 ? -57.945 24.849 -39.021 1.00 29.99 ? 100 LEU A CD2   1 
ATOM   771  N  N     . ILE A 1  104 ? -52.752 23.166 -38.235 1.00 27.12 ? 101 ILE A N     1 
ATOM   772  C  CA    . ILE A 1  104 ? -51.582 23.001 -37.378 1.00 27.09 ? 101 ILE A CA    1 
ATOM   773  C  C     . ILE A 1  104 ? -50.329 23.783 -37.822 1.00 27.12 ? 101 ILE A C     1 
ATOM   774  O  O     . ILE A 1  104 ? -49.376 23.895 -37.053 1.00 26.37 ? 101 ILE A O     1 
ATOM   775  C  CB    . ILE A 1  104 ? -51.224 21.509 -37.149 1.00 26.89 ? 101 ILE A CB    1 
ATOM   776  C  CG1   . ILE A 1  104 ? -50.706 20.849 -38.435 1.00 26.81 ? 101 ILE A CG1   1 
ATOM   777  C  CG2   . ILE A 1  104 ? -52.425 20.756 -36.531 1.00 27.28 ? 101 ILE A CG2   1 
ATOM   778  C  CD1   . ILE A 1  104 ? -50.425 19.346 -38.293 1.00 26.37 ? 101 ILE A CD1   1 
ATOM   779  N  N     . THR A 1  105 ? -50.344 24.327 -39.043 1.00 26.84 ? 102 THR A N     1 
ATOM   780  C  CA    . THR A 1  105 ? -49.181 25.044 -39.583 1.00 26.92 ? 102 THR A CA    1 
ATOM   781  C  C     . THR A 1  105 ? -49.347 26.566 -39.595 1.00 26.91 ? 102 THR A C     1 
ATOM   782  O  O     . THR A 1  105 ? -48.382 27.288 -39.337 1.00 27.15 ? 102 THR A O     1 
ATOM   783  C  CB    . THR A 1  105 ? -48.818 24.531 -40.996 1.00 26.72 ? 102 THR A CB    1 
ATOM   784  O  OG1   . THR A 1  105 ? -48.591 23.119 -40.936 1.00 27.36 ? 102 THR A OG1   1 
ATOM   785  C  CG2   . THR A 1  105 ? -47.562 25.197 -41.543 1.00 26.71 ? 102 THR A CG2   1 
ATOM   786  N  N     . ASN A 1  106 ? -50.547 27.051 -39.915 1.00 26.67 ? 103 ASN A N     1 
ATOM   787  C  CA    . ASN A 1  106 ? -50.773 28.488 -40.061 1.00 27.05 ? 103 ASN A CA    1 
ATOM   788  C  C     . ASN A 1  106 ? -50.628 29.236 -38.725 1.00 27.56 ? 103 ASN A C     1 
ATOM   789  O  O     . ASN A 1  106 ? -50.858 28.664 -37.660 1.00 26.96 ? 103 ASN A O     1 
ATOM   790  C  CB    . ASN A 1  106 ? -52.167 28.773 -40.667 1.00 26.56 ? 103 ASN A CB    1 
ATOM   791  C  CG    . ASN A 1  106 ? -52.241 28.466 -42.165 1.00 26.72 ? 103 ASN A CG    1 
ATOM   792  O  OD1   . ASN A 1  106 ? -51.215 28.254 -42.828 1.00 28.21 ? 103 ASN A OD1   1 
ATOM   793  N  ND2   . ASN A 1  106 ? -53.447 28.457 -42.703 1.00 24.72 ? 103 ASN A ND2   1 
ATOM   794  N  N     . ALA A 1  107 ? -50.270 30.515 -38.809 1.00 27.70 ? 104 ALA A N     1 
ATOM   795  C  CA    . ALA A 1  107 ? -50.157 31.362 -37.633 1.00 28.21 ? 104 ALA A CA    1 
ATOM   796  C  C     . ALA A 1  107 ? -51.516 31.936 -37.275 1.00 28.25 ? 104 ALA A C     1 
ATOM   797  O  O     . ALA A 1  107 ? -52.378 32.097 -38.132 1.00 29.18 ? 104 ALA A O     1 
ATOM   798  C  CB    . ALA A 1  107 ? -49.160 32.481 -37.893 1.00 27.83 ? 104 ALA A CB    1 
ATOM   799  N  N     . SER A 1  108 ? -51.709 32.255 -36.004 1.00 28.40 ? 105 SER A N     1 
ATOM   800  C  CA    . SER A 1  108 ? -52.906 32.946 -35.565 1.00 28.14 ? 105 SER A CA    1 
ATOM   801  C  C     . SER A 1  108 ? -52.861 34.406 -35.988 1.00 27.77 ? 105 SER A C     1 
ATOM   802  O  O     . SER A 1  108 ? -51.794 34.988 -36.093 1.00 28.10 ? 105 SER A O     1 
ATOM   803  C  CB    . SER A 1  108 ? -52.995 32.892 -34.040 1.00 28.89 ? 105 SER A CB    1 
ATOM   804  O  OG    . SER A 1  108 ? -54.114 33.649 -33.611 1.00 29.43 ? 105 SER A OG    1 
ATOM   805  N  N     . ASN A 1  109 ? -54.020 34.998 -36.239 1.00 27.82 ? 106 ASN A N     1 
ATOM   806  C  CA    . ASN A 1  109 ? -54.092 36.425 -36.430 1.00 28.33 ? 106 ASN A CA    1 
ATOM   807  C  C     . ASN A 1  109 ? -54.945 37.114 -35.360 1.00 29.09 ? 106 ASN A C     1 
ATOM   808  O  O     . ASN A 1  109 ? -55.400 38.248 -35.540 1.00 29.31 ? 106 ASN A O     1 
ATOM   809  C  CB    . ASN A 1  109 ? -54.528 36.789 -37.870 1.00 28.13 ? 106 ASN A CB    1 
ATOM   810  C  CG    . ASN A 1  109 ? -55.948 36.306 -38.221 1.00 28.33 ? 106 ASN A CG    1 
ATOM   811  O  OD1   . ASN A 1  109 ? -56.671 35.762 -37.378 1.00 27.27 ? 106 ASN A OD1   1 
ATOM   812  N  ND2   . ASN A 1  109 ? -56.349 36.524 -39.484 1.00 26.46 ? 106 ASN A ND2   1 
ATOM   813  N  N     . LYS A 1  110 ? -55.167 36.430 -34.242 1.00 29.60 ? 107 LYS A N     1 
ATOM   814  C  CA    . LYS A 1  110 ? -55.870 37.053 -33.124 1.00 30.43 ? 107 LYS A CA    1 
ATOM   815  C  C     . LYS A 1  110 ? -54.902 37.185 -31.945 1.00 30.03 ? 107 LYS A C     1 
ATOM   816  O  O     . LYS A 1  110 ? -54.222 36.233 -31.606 1.00 30.17 ? 107 LYS A O     1 
ATOM   817  C  CB    . LYS A 1  110 ? -57.140 36.264 -32.737 1.00 30.99 ? 107 LYS A CB    1 
ATOM   818  C  CG    . LYS A 1  110 ? -58.322 36.347 -33.768 1.00 33.39 ? 107 LYS A CG    1 
ATOM   819  C  CD    . LYS A 1  110 ? -58.417 35.034 -34.565 1.00 39.37 ? 107 LYS A CD    1 
ATOM   820  C  CE    . LYS A 1  110 ? -59.420 35.062 -35.741 1.00 40.35 ? 107 LYS A CE    1 
ATOM   821  N  NZ    . LYS A 1  110 ? -59.342 36.240 -36.717 1.00 42.21 ? 107 LYS A NZ    1 
ATOM   822  N  N     . ALA A 1  111 ? -54.822 38.376 -31.350 1.00 29.94 ? 108 ALA A N     1 
ATOM   823  C  CA    . ALA A 1  111 ? -53.999 38.582 -30.166 1.00 29.36 ? 108 ALA A CA    1 
ATOM   824  C  C     . ALA A 1  111 ? -54.649 38.018 -28.877 1.00 28.88 ? 108 ALA A C     1 
ATOM   825  O  O     . ALA A 1  111 ? -55.874 37.998 -28.742 1.00 28.51 ? 108 ALA A O     1 
ATOM   826  C  CB    . ALA A 1  111 ? -53.668 40.062 -30.005 1.00 28.75 ? 108 ALA A CB    1 
ATOM   827  N  N     . SER A 1  112 ? -53.816 37.561 -27.941 1.00 28.43 ? 109 SER A N     1 
ATOM   828  C  CA    . SER A 1  112 ? -54.256 37.261 -26.563 1.00 28.28 ? 109 SER A CA    1 
ATOM   829  C  C     . SER A 1  112 ? -54.933 38.457 -25.916 1.00 27.45 ? 109 SER A C     1 
ATOM   830  O  O     . SER A 1  112 ? -54.576 39.614 -26.185 1.00 27.31 ? 109 SER A O     1 
ATOM   831  C  CB    . SER A 1  112 ? -53.058 36.910 -25.693 1.00 28.02 ? 109 SER A CB    1 
ATOM   832  O  OG    . SER A 1  112 ? -52.493 35.703 -26.134 1.00 30.78 ? 109 SER A OG    1 
ATOM   833  N  N     . GLY A 1  113 ? -55.886 38.168 -25.039 1.00 27.19 ? 110 GLY A N     1 
ATOM   834  C  CA    . GLY A 1  113 ? -56.514 39.192 -24.211 1.00 27.12 ? 110 GLY A CA    1 
ATOM   835  C  C     . GLY A 1  113 ? -55.499 39.821 -23.273 1.00 27.06 ? 110 GLY A C     1 
ATOM   836  O  O     . GLY A 1  113 ? -54.393 39.270 -23.065 1.00 26.86 ? 110 GLY A O     1 
ATOM   837  N  N     . PRO A 1  114 ? -55.854 40.979 -22.700 1.00 27.03 ? 111 PRO A N     1 
ATOM   838  C  CA    . PRO A 1  114 ? -54.865 41.802 -21.983 1.00 26.89 ? 111 PRO A CA    1 
ATOM   839  C  C     . PRO A 1  114 ? -54.381 41.156 -20.684 1.00 26.73 ? 111 PRO A C     1 
ATOM   840  O  O     . PRO A 1  114 ? -55.138 40.440 -20.020 1.00 27.22 ? 111 PRO A O     1 
ATOM   841  C  CB    . PRO A 1  114 ? -55.613 43.126 -21.723 1.00 26.44 ? 111 PRO A CB    1 
ATOM   842  C  CG    . PRO A 1  114 ? -57.076 42.767 -21.750 1.00 26.87 ? 111 PRO A CG    1 
ATOM   843  C  CD    . PRO A 1  114 ? -57.231 41.508 -22.583 1.00 26.84 ? 111 PRO A CD    1 
ATOM   844  N  N     . ILE A 1  115 ? -53.112 41.387 -20.346 1.00 26.81 ? 112 ILE A N     1 
ATOM   845  C  CA    . ILE A 1  115 ? -52.498 40.753 -19.188 1.00 26.85 ? 112 ILE A CA    1 
ATOM   846  C  C     . ILE A 1  115 ? -53.184 41.079 -17.846 1.00 26.47 ? 112 ILE A C     1 
ATOM   847  O  O     . ILE A 1  115 ? -53.776 42.139 -17.659 1.00 25.86 ? 112 ILE A O     1 
ATOM   848  C  CB    . ILE A 1  115 ? -51.002 41.104 -19.064 1.00 26.84 ? 112 ILE A CB    1 
ATOM   849  C  CG1   . ILE A 1  115 ? -50.821 42.623 -18.977 1.00 26.18 ? 112 ILE A CG1   1 
ATOM   850  C  CG2   . ILE A 1  115 ? -50.182 40.463 -20.227 1.00 27.43 ? 112 ILE A CG2   1 
ATOM   851  C  CD1   . ILE A 1  115 ? -49.400 43.037 -18.735 1.00 26.77 ? 112 ILE A CD1   1 
ATOM   852  N  N     . LEU A 1  116 ? -53.071 40.147 -16.918 1.00 26.74 ? 113 LEU A N     1 
ATOM   853  C  CA    . LEU A 1  116 ? -53.475 40.391 -15.538 1.00 27.55 ? 113 LEU A CA    1 
ATOM   854  C  C     . LEU A 1  116 ? -52.328 41.090 -14.799 1.00 28.06 ? 113 LEU A C     1 
ATOM   855  O  O     . LEU A 1  116 ? -51.164 40.924 -15.166 1.00 28.21 ? 113 LEU A O     1 
ATOM   856  C  CB    . LEU A 1  116 ? -53.851 39.070 -14.869 1.00 27.05 ? 113 LEU A CB    1 
ATOM   857  C  CG    . LEU A 1  116 ? -55.130 38.387 -15.374 1.00 28.15 ? 113 LEU A CG    1 
ATOM   858  C  CD1   . LEU A 1  116 ? -55.162 36.920 -14.933 1.00 27.17 ? 113 LEU A CD1   1 
ATOM   859  C  CD2   . LEU A 1  116 ? -56.360 39.135 -14.878 1.00 29.74 ? 113 LEU A CD2   1 
ATOM   860  N  N     . ARG A 1  117 ? -52.655 41.910 -13.801 1.00 28.31 ? 114 ARG A N     1 
ATOM   861  C  CA    . ARG A 1  117 ? -51.639 42.391 -12.874 1.00 28.76 ? 114 ARG A CA    1 
ATOM   862  C  C     . ARG A 1  117 ? -52.006 41.896 -11.460 1.00 29.14 ? 114 ARG A C     1 
ATOM   863  O  O     . ARG A 1  117 ? -52.747 42.542 -10.754 1.00 29.32 ? 114 ARG A O     1 
ATOM   864  C  CB    . ARG A 1  117 ? -51.512 43.924 -12.931 1.00 29.02 ? 114 ARG A CB    1 
ATOM   865  C  CG    . ARG A 1  117 ? -51.421 44.572 -14.335 1.00 28.73 ? 114 ARG A CG    1 
ATOM   866  C  CD    . ARG A 1  117 ? -50.296 43.991 -15.192 1.00 28.44 ? 114 ARG A CD    1 
ATOM   867  N  NE    . ARG A 1  117 ? -49.025 43.982 -14.482 1.00 27.85 ? 114 ARG A NE    1 
ATOM   868  C  CZ    . ARG A 1  117 ? -48.111 44.947 -14.553 1.00 27.72 ? 114 ARG A CZ    1 
ATOM   869  N  NH1   . ARG A 1  117 ? -48.319 46.022 -15.296 1.00 26.51 ? 114 ARG A NH1   1 
ATOM   870  N  NH2   . ARG A 1  117 ? -46.994 44.846 -13.841 1.00 27.63 ? 114 ARG A NH2   1 
ATOM   871  N  N     . PRO A 1  118 ? -51.514 40.716 -11.067 1.00 30.08 ? 115 PRO A N     1 
ATOM   872  C  CA    . PRO A 1  118 ? -51.882 40.122 -9.764  1.00 30.71 ? 115 PRO A CA    1 
ATOM   873  C  C     . PRO A 1  118 ? -51.477 41.027 -8.584  1.00 31.13 ? 115 PRO A C     1 
ATOM   874  O  O     . PRO A 1  118 ? -50.445 41.707 -8.655  1.00 30.69 ? 115 PRO A O     1 
ATOM   875  C  CB    . PRO A 1  118 ? -51.077 38.819 -9.727  1.00 30.42 ? 115 PRO A CB    1 
ATOM   876  C  CG    . PRO A 1  118 ? -50.695 38.536 -11.194 1.00 30.77 ? 115 PRO A CG    1 
ATOM   877  C  CD    . PRO A 1  118 ? -50.564 39.881 -11.831 1.00 30.02 ? 115 PRO A CD    1 
ATOM   878  N  N     . ASP A 1  119 ? -52.278 41.041 -7.514  1.00 31.91 ? 116 ASP A N     1 
ATOM   879  C  CA    . ASP A 1  119 ? -51.946 41.854 -6.324  1.00 32.16 ? 116 ASP A CA    1 
ATOM   880  C  C     . ASP A 1  119 ? -50.562 41.505 -5.850  1.00 31.16 ? 116 ASP A C     1 
ATOM   881  O  O     . ASP A 1  119 ? -50.186 40.339 -5.833  1.00 30.59 ? 116 ASP A O     1 
ATOM   882  C  CB    . ASP A 1  119 ? -52.890 41.574 -5.154  1.00 33.35 ? 116 ASP A CB    1 
ATOM   883  C  CG    . ASP A 1  119 ? -54.318 41.953 -5.436  1.00 37.10 ? 116 ASP A CG    1 
ATOM   884  O  OD1   . ASP A 1  119 ? -54.573 42.936 -6.174  1.00 41.49 ? 116 ASP A OD1   1 
ATOM   885  O  OD2   . ASP A 1  119 ? -55.197 41.256 -4.887  1.00 43.60 ? 116 ASP A OD2   1 
ATOM   886  N  N     . ARG A 1  120 ? -49.807 42.519 -5.457  1.00 30.67 ? 117 ARG A N     1 
ATOM   887  C  CA    . ARG A 1  120 ? -48.543 42.313 -4.741  1.00 30.46 ? 117 ARG A CA    1 
ATOM   888  C  C     . ARG A 1  120 ? -48.856 41.457 -3.513  1.00 29.82 ? 117 ARG A C     1 
ATOM   889  O  O     . ARG A 1  120 ? -49.876 41.673 -2.877  1.00 29.92 ? 117 ARG A O     1 
ATOM   890  C  CB    . ARG A 1  120 ? -48.006 43.669 -4.310  1.00 30.04 ? 117 ARG A CB    1 
ATOM   891  C  CG    . ARG A 1  120 ? -46.688 43.646 -3.576  1.00 30.82 ? 117 ARG A CG    1 
ATOM   892  C  CD    . ARG A 1  120 ? -46.249 45.059 -3.243  1.00 31.72 ? 117 ARG A CD    1 
ATOM   893  N  NE    . ARG A 1  120 ? -46.036 45.875 -4.438  1.00 32.81 ? 117 ARG A NE    1 
ATOM   894  C  CZ    . ARG A 1  120 ? -44.890 45.947 -5.116  1.00 35.67 ? 117 ARG A CZ    1 
ATOM   895  N  NH1   . ARG A 1  120 ? -43.806 45.257 -4.726  1.00 34.23 ? 117 ARG A NH1   1 
ATOM   896  N  NH2   . ARG A 1  120 ? -44.827 46.719 -6.200  1.00 36.59 ? 117 ARG A NH2   1 
ATOM   897  N  N     . PRO A 1  121 ? -48.013 40.465 -3.196  1.00 29.92 ? 118 PRO A N     1 
ATOM   898  C  CA    . PRO A 1  121 ? -48.215 39.715 -1.945  1.00 30.58 ? 118 PRO A CA    1 
ATOM   899  C  C     . PRO A 1  121 ? -48.295 40.670 -0.738  1.00 30.97 ? 118 PRO A C     1 
ATOM   900  O  O     . PRO A 1  121 ? -47.652 41.716 -0.745  1.00 30.54 ? 118 PRO A O     1 
ATOM   901  C  CB    . PRO A 1  121 ? -46.965 38.830 -1.866  1.00 30.08 ? 118 PRO A CB    1 
ATOM   902  C  CG    . PRO A 1  121 ? -46.547 38.657 -3.291  1.00 30.42 ? 118 PRO A CG    1 
ATOM   903  C  CD    . PRO A 1  121 ? -46.839 39.981 -3.947  1.00 29.94 ? 118 PRO A CD    1 
ATOM   904  N  N     . GLN A 1  122 ? -49.106 40.342 0.263   1.00 32.23 ? 119 GLN A N     1 
ATOM   905  C  CA    . GLN A 1  122 ? -49.316 41.276 1.386   1.00 33.38 ? 119 GLN A CA    1 
ATOM   906  C  C     . GLN A 1  122 ? -48.079 41.586 2.240   1.00 32.43 ? 119 GLN A C     1 
ATOM   907  O  O     . GLN A 1  122 ? -47.849 42.743 2.598   1.00 32.21 ? 119 GLN A O     1 
ATOM   908  C  CB    . GLN A 1  122 ? -50.456 40.803 2.283   1.00 34.43 ? 119 GLN A CB    1 
ATOM   909  C  CG    . GLN A 1  122 ? -51.846 41.151 1.732   1.00 40.20 ? 119 GLN A CG    1 
ATOM   910  C  CD    . GLN A 1  122 ? -52.957 40.892 2.742   1.00 47.06 ? 119 GLN A CD    1 
ATOM   911  O  OE1   . GLN A 1  122 ? -52.835 41.227 3.932   1.00 49.70 ? 119 GLN A OE1   1 
ATOM   912  N  NE2   . GLN A 1  122 ? -54.050 40.292 2.274   1.00 48.93 ? 119 GLN A NE2   1 
ATOM   913  N  N     . LYS A 1  123 ? -47.294 40.557 2.551   1.00 31.25 ? 120 LYS A N     1 
ATOM   914  C  CA    . LYS A 1  123 ? -46.201 40.674 3.514   1.00 31.04 ? 120 LYS A CA    1 
ATOM   915  C  C     . LYS A 1  123 ? -44.916 40.066 2.966   1.00 30.07 ? 120 LYS A C     1 
ATOM   916  O  O     . LYS A 1  123 ? -44.975 39.139 2.140   1.00 29.39 ? 120 LYS A O     1 
ATOM   917  C  CB    . LYS A 1  123 ? -46.546 39.909 4.807   1.00 31.20 ? 120 LYS A CB    1 
ATOM   918  C  CG    . LYS A 1  123 ? -47.848 40.304 5.511   1.00 34.62 ? 120 LYS A CG    1 
ATOM   919  C  CD    . LYS A 1  123 ? -48.162 39.268 6.593   1.00 39.49 ? 120 LYS A CD    1 
ATOM   920  C  CE    . LYS A 1  123 ? -49.435 39.605 7.354   1.00 43.24 ? 120 LYS A CE    1 
ATOM   921  N  NZ    . LYS A 1  123 ? -49.757 38.574 8.396   1.00 45.93 ? 120 LYS A NZ    1 
ATOM   922  N  N     . PRO A 1  124 ? -43.748 40.536 3.468   1.00 29.23 ? 121 PRO A N     1 
ATOM   923  C  CA    . PRO A 1  124 ? -42.489 39.861 3.149   1.00 28.80 ? 121 PRO A CA    1 
ATOM   924  C  C     . PRO A 1  124 ? -42.635 38.415 3.541   1.00 28.65 ? 121 PRO A C     1 
ATOM   925  O  O     . PRO A 1  124 ? -43.325 38.125 4.530   1.00 28.36 ? 121 PRO A O     1 
ATOM   926  C  CB    . PRO A 1  124 ? -41.482 40.540 4.087   1.00 29.11 ? 121 PRO A CB    1 
ATOM   927  C  CG    . PRO A 1  124 ? -42.029 41.927 4.260   1.00 28.80 ? 121 PRO A CG    1 
ATOM   928  C  CD    . PRO A 1  124 ? -43.532 41.755 4.272   1.00 29.28 ? 121 PRO A CD    1 
ATOM   929  N  N     . PHE A 1  125 ? -42.013 37.526 2.765   1.00 27.82 ? 122 PHE A N     1 
ATOM   930  C  CA    . PHE A 1  125 ? -42.031 36.088 3.002   1.00 27.11 ? 122 PHE A CA    1 
ATOM   931  C  C     . PHE A 1  125 ? -43.381 35.394 2.703   1.00 27.15 ? 122 PHE A C     1 
ATOM   932  O  O     . PHE A 1  125 ? -43.473 34.189 2.827   1.00 26.78 ? 122 PHE A O     1 
ATOM   933  C  CB    . PHE A 1  125 ? -41.486 35.738 4.415   1.00 27.83 ? 122 PHE A CB    1 
ATOM   934  C  CG    . PHE A 1  125 ? -40.131 36.355 4.716   1.00 26.55 ? 122 PHE A CG    1 
ATOM   935  C  CD1   . PHE A 1  125 ? -40.015 37.416 5.622   1.00 26.76 ? 122 PHE A CD1   1 
ATOM   936  C  CD2   . PHE A 1  125 ? -38.989 35.915 4.055   1.00 23.96 ? 122 PHE A CD2   1 
ATOM   937  C  CE1   . PHE A 1  125 ? -38.770 38.015 5.891   1.00 23.91 ? 122 PHE A CE1   1 
ATOM   938  C  CE2   . PHE A 1  125 ? -37.746 36.506 4.302   1.00 24.81 ? 122 PHE A CE2   1 
ATOM   939  C  CZ    . PHE A 1  125 ? -37.635 37.556 5.227   1.00 23.76 ? 122 PHE A CZ    1 
ATOM   940  N  N     . ASP A 1  126 ? -44.413 36.127 2.281   1.00 27.73 ? 123 ASP A N     1 
ATOM   941  C  CA    . ASP A 1  126 ? -45.619 35.452 1.743   1.00 28.92 ? 123 ASP A CA    1 
ATOM   942  C  C     . ASP A 1  126 ? -45.330 34.620 0.475   1.00 28.88 ? 123 ASP A C     1 
ATOM   943  O  O     . ASP A 1  126 ? -45.820 33.488 0.354   1.00 28.92 ? 123 ASP A O     1 
ATOM   944  C  CB    . ASP A 1  126 ? -46.751 36.439 1.448   1.00 29.48 ? 123 ASP A CB    1 
ATOM   945  C  CG    . ASP A 1  126 ? -47.498 36.876 2.704   1.00 31.49 ? 123 ASP A CG    1 
ATOM   946  O  OD1   . ASP A 1  126 ? -47.244 36.272 3.767   1.00 32.98 ? 123 ASP A OD1   1 
ATOM   947  O  OD2   . ASP A 1  126 ? -48.320 37.829 2.617   1.00 32.17 ? 123 ASP A OD2   1 
ATOM   948  N  N     . LYS A 1  127 ? -44.541 35.174 -0.457  1.00 28.03 ? 124 LYS A N     1 
ATOM   949  C  CA    . LYS A 1  127 ? -44.239 34.481 -1.715  1.00 28.20 ? 124 LYS A CA    1 
ATOM   950  C  C     . LYS A 1  127 ? -42.875 34.848 -2.290  1.00 28.11 ? 124 LYS A C     1 
ATOM   951  O  O     . LYS A 1  127 ? -42.585 36.029 -2.523  1.00 28.19 ? 124 LYS A O     1 
ATOM   952  C  CB    . LYS A 1  127 ? -45.351 34.718 -2.767  1.00 28.66 ? 124 LYS A CB    1 
ATOM   953  C  CG    . LYS A 1  127 ? -45.153 33.915 -4.085  1.00 28.75 ? 124 LYS A CG    1 
ATOM   954  C  CD    . LYS A 1  127 ? -46.203 34.236 -5.169  1.00 31.61 ? 124 LYS A CD    1 
ATOM   955  C  CE    . LYS A 1  127 ? -47.587 33.673 -4.832  1.00 31.82 ? 124 LYS A CE    1 
ATOM   956  N  NZ    . LYS A 1  127 ? -48.565 33.880 -5.952  1.00 31.99 ? 124 LYS A NZ    1 
ATOM   957  N  N     . PHE A 1  128 ? -42.040 33.827 -2.486  1.00 27.64 ? 125 PHE A N     1 
ATOM   958  C  CA    . PHE A 1  128 ? -40.761 33.954 -3.175  1.00 27.51 ? 125 PHE A CA    1 
ATOM   959  C  C     . PHE A 1  128 ? -40.972 33.532 -4.644  1.00 28.13 ? 125 PHE A C     1 
ATOM   960  O  O     . PHE A 1  128 ? -41.669 32.530 -4.926  1.00 27.88 ? 125 PHE A O     1 
ATOM   961  C  CB    . PHE A 1  128 ? -39.727 32.992 -2.559  1.00 27.85 ? 125 PHE A CB    1 
ATOM   962  C  CG    . PHE A 1  128 ? -39.088 33.465 -1.263  1.00 27.31 ? 125 PHE A CG    1 
ATOM   963  C  CD1   . PHE A 1  128 ? -39.496 34.636 -0.622  1.00 27.07 ? 125 PHE A CD1   1 
ATOM   964  C  CD2   . PHE A 1  128 ? -38.087 32.695 -0.668  1.00 28.23 ? 125 PHE A CD2   1 
ATOM   965  C  CE1   . PHE A 1  128 ? -38.877 35.054 0.567   1.00 27.25 ? 125 PHE A CE1   1 
ATOM   966  C  CE2   . PHE A 1  128 ? -37.472 33.093 0.531   1.00 26.91 ? 125 PHE A CE2   1 
ATOM   967  C  CZ    . PHE A 1  128 ? -37.872 34.273 1.145   1.00 27.04 ? 125 PHE A CZ    1 
ATOM   968  N  N     . PHE A 1  129 ? -40.394 34.293 -5.570  1.00 26.95 ? 126 PHE A N     1 
ATOM   969  C  CA    . PHE A 1  129 ? -40.206 33.828 -6.944  1.00 26.45 ? 126 PHE A CA    1 
ATOM   970  C  C     . PHE A 1  129 ? -38.748 33.443 -7.138  1.00 26.65 ? 126 PHE A C     1 
ATOM   971  O  O     . PHE A 1  129 ? -37.835 34.226 -6.815  1.00 26.37 ? 126 PHE A O     1 
ATOM   972  C  CB    . PHE A 1  129 ? -40.581 34.917 -7.932  1.00 26.38 ? 126 PHE A CB    1 
ATOM   973  C  CG    . PHE A 1  129 ? -42.009 35.310 -7.865  1.00 26.27 ? 126 PHE A CG    1 
ATOM   974  C  CD1   . PHE A 1  129 ? -42.935 34.717 -8.703  1.00 25.87 ? 126 PHE A CD1   1 
ATOM   975  C  CD2   . PHE A 1  129 ? -42.439 36.272 -6.958  1.00 25.93 ? 126 PHE A CD2   1 
ATOM   976  C  CE1   . PHE A 1  129 ? -44.276 35.073 -8.630  1.00 25.67 ? 126 PHE A CE1   1 
ATOM   977  C  CE2   . PHE A 1  129 ? -43.778 36.623 -6.876  1.00 27.30 ? 126 PHE A CE2   1 
ATOM   978  C  CZ    . PHE A 1  129 ? -44.693 36.032 -7.717  1.00 25.63 ? 126 PHE A CZ    1 
ATOM   979  N  N     . ILE A 1  130 ? -38.522 32.239 -7.658  1.00 26.64 ? 127 ILE A N     1 
ATOM   980  C  CA    . ILE A 1  130 ? -37.165 31.732 -7.820  1.00 26.68 ? 127 ILE A CA    1 
ATOM   981  C  C     . ILE A 1  130 ? -36.889 31.332 -9.271  1.00 27.27 ? 127 ILE A C     1 
ATOM   982  O  O     . ILE A 1  130 ? -37.801 30.900 -9.989  1.00 26.14 ? 127 ILE A O     1 
ATOM   983  C  CB    . ILE A 1  130 ? -36.836 30.568 -6.835  1.00 26.55 ? 127 ILE A CB    1 
ATOM   984  C  CG1   . ILE A 1  130 ? -37.652 29.302 -7.146  1.00 27.03 ? 127 ILE A CG1   1 
ATOM   985  C  CG2   . ILE A 1  130 ? -37.087 30.995 -5.396  1.00 26.19 ? 127 ILE A CG2   1 
ATOM   986  C  CD1   . ILE A 1  130 ? -37.117 28.069 -6.402  1.00 30.23 ? 127 ILE A CD1   1 
ATOM   987  N  N     . ASP A 1  131 ? -35.636 31.478 -9.695  1.00 26.93 ? 128 ASP A N     1 
ATOM   988  C  CA    . ASP A 1  131 ? -35.259 31.206 -11.076 1.00 28.48 ? 128 ASP A CA    1 
ATOM   989  C  C     . ASP A 1  131 ? -33.747 31.156 -11.219 1.00 28.74 ? 128 ASP A C     1 
ATOM   990  O  O     . ASP A 1  131 ? -33.023 31.608 -10.329 1.00 28.93 ? 128 ASP A O     1 
ATOM   991  C  CB    . ASP A 1  131 ? -35.816 32.286 -12.034 1.00 28.50 ? 128 ASP A CB    1 
ATOM   992  C  CG    . ASP A 1  131 ? -35.854 31.815 -13.488 1.00 30.27 ? 128 ASP A CG    1 
ATOM   993  O  OD1   . ASP A 1  131 ? -36.181 30.626 -13.728 1.00 30.98 ? 128 ASP A OD1   1 
ATOM   994  O  OD2   . ASP A 1  131 ? -35.568 32.628 -14.392 1.00 30.79 ? 128 ASP A OD2   1 
ATOM   995  N  N     . TYR A 1  132 ? -33.283 30.587 -12.329 1.00 28.73 ? 129 TYR A N     1 
ATOM   996  C  CA    . TYR A 1  132 ? -31.871 30.565 -12.659 1.00 29.18 ? 129 TYR A CA    1 
ATOM   997  C  C     . TYR A 1  132 ? -31.533 31.488 -13.821 1.00 29.87 ? 129 TYR A C     1 
ATOM   998  O  O     . TYR A 1  132 ? -32.284 31.578 -14.809 1.00 29.91 ? 129 TYR A O     1 
ATOM   999  C  CB    . TYR A 1  132 ? -31.412 29.142 -13.009 1.00 29.09 ? 129 TYR A CB    1 
ATOM   1000 C  CG    . TYR A 1  132 ? -31.071 28.341 -11.788 1.00 28.95 ? 129 TYR A CG    1 
ATOM   1001 C  CD1   . TYR A 1  132 ? -31.970 27.405 -11.274 1.00 28.83 ? 129 TYR A CD1   1 
ATOM   1002 C  CD2   . TYR A 1  132 ? -29.865 28.549 -11.114 1.00 27.79 ? 129 TYR A CD2   1 
ATOM   1003 C  CE1   . TYR A 1  132 ? -31.678 26.693 -10.123 1.00 29.18 ? 129 TYR A CE1   1 
ATOM   1004 C  CE2   . TYR A 1  132 ? -29.551 27.827 -9.973  1.00 29.25 ? 129 TYR A CE2   1 
ATOM   1005 C  CZ    . TYR A 1  132 ? -30.466 26.906 -9.476  1.00 30.33 ? 129 TYR A CZ    1 
ATOM   1006 O  OH    . TYR A 1  132 ? -30.166 26.191 -8.332  1.00 32.12 ? 129 TYR A OH    1 
ATOM   1007 N  N     . ILE A 1  133 ? -30.405 32.177 -13.680 1.00 30.38 ? 130 ILE A N     1 
ATOM   1008 C  CA    . ILE A 1  133 ? -29.769 32.876 -14.774 1.00 31.22 ? 130 ILE A CA    1 
ATOM   1009 C  C     . ILE A 1  133 ? -28.600 32.007 -15.218 1.00 31.71 ? 130 ILE A C     1 
ATOM   1010 O  O     . ILE A 1  133 ? -27.915 31.426 -14.380 1.00 31.63 ? 130 ILE A O     1 
ATOM   1011 C  CB    . ILE A 1  133 ? -29.187 34.223 -14.317 1.00 31.53 ? 130 ILE A CB    1 
ATOM   1012 C  CG1   . ILE A 1  133 ? -30.298 35.173 -13.861 1.00 32.44 ? 130 ILE A CG1   1 
ATOM   1013 C  CG2   . ILE A 1  133 ? -28.377 34.863 -15.451 1.00 31.44 ? 130 ILE A CG2   1 
ATOM   1014 C  CD1   . ILE A 1  133 ? -29.759 36.446 -13.161 1.00 33.46 ? 130 ILE A CD1   1 
ATOM   1015 N  N     . GLY A 1  134 ? -28.362 31.920 -16.525 1.00 32.24 ? 131 GLY A N     1 
ATOM   1016 C  CA    . GLY A 1  134 ? -27.184 31.218 -17.030 1.00 32.83 ? 131 GLY A CA    1 
ATOM   1017 C  C     . GLY A 1  134 ? -27.505 30.297 -18.187 1.00 33.23 ? 131 GLY A C     1 
ATOM   1018 O  O     . GLY A 1  134 ? -28.666 30.181 -18.560 1.00 32.97 ? 131 GLY A O     1 
ATOM   1019 N  N     . PRO A 1  135 ? -26.482 29.619 -18.746 1.00 33.91 ? 132 PRO A N     1 
ATOM   1020 C  CA    . PRO A 1  135 ? -25.099 29.664 -18.280 1.00 34.13 ? 132 PRO A CA    1 
ATOM   1021 C  C     . PRO A 1  135 ? -24.405 30.988 -18.586 1.00 34.53 ? 132 PRO A C     1 
ATOM   1022 O  O     . PRO A 1  135 ? -24.686 31.616 -19.607 1.00 34.69 ? 132 PRO A O     1 
ATOM   1023 C  CB    . PRO A 1  135 ? -24.430 28.511 -19.047 1.00 34.78 ? 132 PRO A CB    1 
ATOM   1024 C  CG    . PRO A 1  135 ? -25.211 28.427 -20.350 1.00 34.18 ? 132 PRO A CG    1 
ATOM   1025 C  CD    . PRO A 1  135 ? -26.644 28.720 -19.916 1.00 34.18 ? 132 PRO A CD    1 
ATOM   1026 N  N     . LEU A 1  136 ? -23.532 31.406 -17.675 1.00 34.78 ? 133 LEU A N     1 
ATOM   1027 C  CA    . LEU A 1  136 ? -22.686 32.594 -17.830 1.00 35.42 ? 133 LEU A CA    1 
ATOM   1028 C  C     . LEU A 1  136 ? -21.251 32.127 -18.081 1.00 36.04 ? 133 LEU A C     1 
ATOM   1029 O  O     . LEU A 1  136 ? -20.970 30.937 -17.918 1.00 36.31 ? 133 LEU A O     1 
ATOM   1030 C  CB    . LEU A 1  136 ? -22.731 33.434 -16.551 1.00 35.10 ? 133 LEU A CB    1 
ATOM   1031 C  CG    . LEU A 1  136 ? -24.076 33.991 -16.087 1.00 35.03 ? 133 LEU A CG    1 
ATOM   1032 C  CD1   . LEU A 1  136 ? -23.910 34.607 -14.708 1.00 35.13 ? 133 LEU A CD1   1 
ATOM   1033 C  CD2   . LEU A 1  136 ? -24.609 35.031 -17.070 1.00 35.72 ? 133 LEU A CD2   1 
ATOM   1034 N  N     . PRO A 1  137 ? -20.331 33.049 -18.460 1.00 36.83 ? 134 PRO A N     1 
ATOM   1035 C  CA    . PRO A 1  137 ? -18.929 32.649 -18.556 1.00 37.22 ? 134 PRO A CA    1 
ATOM   1036 C  C     . PRO A 1  137 ? -18.492 32.011 -17.248 1.00 38.00 ? 134 PRO A C     1 
ATOM   1037 O  O     . PRO A 1  137 ? -18.896 32.487 -16.185 1.00 38.46 ? 134 PRO A O     1 
ATOM   1038 C  CB    . PRO A 1  137 ? -18.194 33.979 -18.736 1.00 37.04 ? 134 PRO A CB    1 
ATOM   1039 C  CG    . PRO A 1  137 ? -19.171 34.881 -19.330 1.00 36.90 ? 134 PRO A CG    1 
ATOM   1040 C  CD    . PRO A 1  137 ? -20.518 34.465 -18.830 1.00 36.83 ? 134 PRO A CD    1 
ATOM   1041 N  N     . PRO A 1  138 ? -17.690 30.933 -17.313 1.00 38.31 ? 135 PRO A N     1 
ATOM   1042 C  CA    . PRO A 1  138 ? -17.282 30.286 -16.068 1.00 38.44 ? 135 PRO A CA    1 
ATOM   1043 C  C     . PRO A 1  138 ? -16.554 31.270 -15.164 1.00 38.54 ? 135 PRO A C     1 
ATOM   1044 O  O     . PRO A 1  138 ? -15.726 32.050 -15.639 1.00 38.81 ? 135 PRO A O     1 
ATOM   1045 C  CB    . PRO A 1  138 ? -16.336 29.163 -16.531 1.00 38.70 ? 135 PRO A CB    1 
ATOM   1046 C  CG    . PRO A 1  138 ? -16.644 28.951 -17.976 1.00 38.88 ? 135 PRO A CG    1 
ATOM   1047 C  CD    . PRO A 1  138 ? -17.138 30.265 -18.507 1.00 38.38 ? 135 PRO A CD    1 
ATOM   1048 N  N     . SER A 1  139 ? -16.887 31.259 -13.877 1.00 38.64 ? 136 SER A N     1 
ATOM   1049 C  CA    . SER A 1  139 ? -16.185 32.094 -12.893 1.00 38.99 ? 136 SER A CA    1 
ATOM   1050 C  C     . SER A 1  139 ? -15.974 31.302 -11.600 1.00 39.35 ? 136 SER A C     1 
ATOM   1051 O  O     . SER A 1  139 ? -16.948 30.946 -10.921 1.00 39.36 ? 136 SER A O     1 
ATOM   1052 C  CB    . SER A 1  139 ? -16.959 33.392 -12.629 1.00 38.56 ? 136 SER A CB    1 
ATOM   1053 O  OG    . SER A 1  139 ? -16.156 34.333 -11.928 1.00 38.41 ? 136 SER A OG    1 
ATOM   1054 N  N     . GLN A 1  140 ? -14.704 31.026 -11.276 1.00 39.82 ? 137 GLN A N     1 
ATOM   1055 C  CA    . GLN A 1  140 ? -14.308 30.062 -10.223 1.00 40.44 ? 137 GLN A CA    1 
ATOM   1056 C  C     . GLN A 1  140 ? -15.075 28.739 -10.338 1.00 40.01 ? 137 GLN A C     1 
ATOM   1057 O  O     . GLN A 1  140 ? -15.426 28.132 -9.325  1.00 40.41 ? 137 GLN A O     1 
ATOM   1058 C  CB    . GLN A 1  140 ? -14.542 30.605 -8.811  1.00 40.90 ? 137 GLN A CB    1 
ATOM   1059 C  CG    . GLN A 1  140 ? -14.538 32.100 -8.658  1.00 44.30 ? 137 GLN A CG    1 
ATOM   1060 C  CD    . GLN A 1  140 ? -13.216 32.624 -8.189  1.00 49.87 ? 137 GLN A CD    1 
ATOM   1061 O  OE1   . GLN A 1  140 ? -12.161 32.048 -8.490  1.00 52.70 ? 137 GLN A OE1   1 
ATOM   1062 N  NE2   . GLN A 1  140 ? -13.251 33.729 -7.438  1.00 51.30 ? 137 GLN A NE2   1 
ATOM   1063 N  N     . GLY A 1  141 ? -15.378 28.319 -11.559 1.00 39.56 ? 138 GLY A N     1 
ATOM   1064 C  CA    . GLY A 1  141 ? -16.069 27.052 -11.773 1.00 39.07 ? 138 GLY A CA    1 
ATOM   1065 C  C     . GLY A 1  141 ? -17.580 27.164 -11.709 1.00 38.71 ? 138 GLY A C     1 
ATOM   1066 O  O     . GLY A 1  141 ? -18.288 26.180 -11.924 1.00 39.40 ? 138 GLY A O     1 
ATOM   1067 N  N     . TYR A 1  142 ? -18.083 28.358 -11.409 1.00 37.84 ? 139 TYR A N     1 
ATOM   1068 C  CA    . TYR A 1  142 ? -19.528 28.582 -11.337 1.00 36.81 ? 139 TYR A CA    1 
ATOM   1069 C  C     . TYR A 1  142 ? -20.065 29.116 -12.676 1.00 35.97 ? 139 TYR A C     1 
ATOM   1070 O  O     . TYR A 1  142 ? -19.372 29.851 -13.385 1.00 35.29 ? 139 TYR A O     1 
ATOM   1071 C  CB    . TYR A 1  142 ? -19.865 29.526 -10.170 1.00 36.96 ? 139 TYR A CB    1 
ATOM   1072 C  CG    . TYR A 1  142 ? -19.577 28.919 -8.810  1.00 37.12 ? 139 TYR A CG    1 
ATOM   1073 C  CD1   . TYR A 1  142 ? -20.562 28.206 -8.127  1.00 36.39 ? 139 TYR A CD1   1 
ATOM   1074 C  CD2   . TYR A 1  142 ? -18.318 29.054 -8.212  1.00 37.93 ? 139 TYR A CD2   1 
ATOM   1075 C  CE1   . TYR A 1  142 ? -20.309 27.640 -6.879  1.00 38.68 ? 139 TYR A CE1   1 
ATOM   1076 C  CE2   . TYR A 1  142 ? -18.044 28.487 -6.956  1.00 38.90 ? 139 TYR A CE2   1 
ATOM   1077 C  CZ    . TYR A 1  142 ? -19.051 27.784 -6.299  1.00 39.70 ? 139 TYR A CZ    1 
ATOM   1078 O  OH    . TYR A 1  142 ? -18.811 27.219 -5.072  1.00 41.02 ? 139 TYR A OH    1 
ATOM   1079 N  N     . LEU A 1  143 ? -21.295 28.731 -13.002 1.00 34.86 ? 140 LEU A N     1 
ATOM   1080 C  CA    . LEU A 1  143 ? -21.883 29.011 -14.306 1.00 34.44 ? 140 LEU A CA    1 
ATOM   1081 C  C     . LEU A 1  143 ? -23.282 29.617 -14.216 1.00 33.54 ? 140 LEU A C     1 
ATOM   1082 O  O     . LEU A 1  143 ? -23.760 30.202 -15.187 1.00 33.23 ? 140 LEU A O     1 
ATOM   1083 C  CB    . LEU A 1  143 ? -21.951 27.730 -15.138 1.00 34.88 ? 140 LEU A CB    1 
ATOM   1084 C  CG    . LEU A 1  143 ? -20.618 27.113 -15.575 1.00 36.36 ? 140 LEU A CG    1 
ATOM   1085 C  CD1   . LEU A 1  143 ? -20.813 25.646 -15.900 1.00 39.07 ? 140 LEU A CD1   1 
ATOM   1086 C  CD2   . LEU A 1  143 ? -20.078 27.856 -16.777 1.00 37.34 ? 140 LEU A CD2   1 
ATOM   1087 N  N     . TYR A 1  144 ? -23.934 29.460 -13.064 1.00 32.12 ? 141 TYR A N     1 
ATOM   1088 C  CA    . TYR A 1  144 ? -25.308 29.912 -12.886 1.00 31.34 ? 141 TYR A CA    1 
ATOM   1089 C  C     . TYR A 1  144 ? -25.522 30.732 -11.613 1.00 30.88 ? 141 TYR A C     1 
ATOM   1090 O  O     . TYR A 1  144 ? -24.738 30.655 -10.664 1.00 30.39 ? 141 TYR A O     1 
ATOM   1091 C  CB    . TYR A 1  144 ? -26.268 28.718 -12.875 1.00 31.51 ? 141 TYR A CB    1 
ATOM   1092 C  CG    . TYR A 1  144 ? -26.287 27.924 -14.154 1.00 32.74 ? 141 TYR A CG    1 
ATOM   1093 C  CD1   . TYR A 1  144 ? -27.272 28.150 -15.122 1.00 32.71 ? 141 TYR A CD1   1 
ATOM   1094 C  CD2   . TYR A 1  144 ? -25.331 26.934 -14.396 1.00 33.79 ? 141 TYR A CD2   1 
ATOM   1095 C  CE1   . TYR A 1  144 ? -27.292 27.425 -16.305 1.00 32.87 ? 141 TYR A CE1   1 
ATOM   1096 C  CE2   . TYR A 1  144 ? -25.339 26.203 -15.581 1.00 35.25 ? 141 TYR A CE2   1 
ATOM   1097 C  CZ    . TYR A 1  144 ? -26.323 26.451 -16.522 1.00 35.24 ? 141 TYR A CZ    1 
ATOM   1098 O  OH    . TYR A 1  144 ? -26.326 25.727 -17.681 1.00 38.15 ? 141 TYR A OH    1 
ATOM   1099 N  N     . VAL A 1  145 ? -26.607 31.502 -11.604 1.00 29.51 ? 142 VAL A N     1 
ATOM   1100 C  CA    . VAL A 1  145 ? -27.021 32.261 -10.428 1.00 28.98 ? 142 VAL A CA    1 
ATOM   1101 C  C     . VAL A 1  145 ? -28.457 31.889 -10.109 1.00 28.21 ? 142 VAL A C     1 
ATOM   1102 O  O     . VAL A 1  145 ? -29.327 32.024 -10.972 1.00 27.89 ? 142 VAL A O     1 
ATOM   1103 C  CB    . VAL A 1  145 ? -26.972 33.803 -10.652 1.00 28.67 ? 142 VAL A CB    1 
ATOM   1104 C  CG1   . VAL A 1  145 ? -27.529 34.541 -9.409  1.00 28.14 ? 142 VAL A CG1   1 
ATOM   1105 C  CG2   . VAL A 1  145 ? -25.548 34.260 -10.954 1.00 28.94 ? 142 VAL A CG2   1 
ATOM   1106 N  N     . LEU A 1  146 ? -28.692 31.399 -8.894  1.00 27.49 ? 143 LEU A N     1 
ATOM   1107 C  CA    . LEU A 1  146 ? -30.055 31.245 -8.386  1.00 27.30 ? 143 LEU A CA    1 
ATOM   1108 C  C     . LEU A 1  146 ? -30.476 32.605 -7.861  1.00 26.88 ? 143 LEU A C     1 
ATOM   1109 O  O     . LEU A 1  146 ? -29.768 33.219 -7.057  1.00 26.59 ? 143 LEU A O     1 
ATOM   1110 C  CB    . LEU A 1  146 ? -30.125 30.205 -7.248  1.00 27.30 ? 143 LEU A CB    1 
ATOM   1111 C  CG    . LEU A 1  146 ? -31.506 29.950 -6.605  1.00 29.20 ? 143 LEU A CG    1 
ATOM   1112 C  CD1   . LEU A 1  146 ? -32.467 29.243 -7.552  1.00 26.92 ? 143 LEU A CD1   1 
ATOM   1113 C  CD2   . LEU A 1  146 ? -31.382 29.138 -5.314  1.00 30.00 ? 143 LEU A CD2   1 
ATOM   1114 N  N     . VAL A 1  147 ? -31.641 33.058 -8.303  1.00 26.34 ? 144 VAL A N     1 
ATOM   1115 C  CA    . VAL A 1  147 ? -32.171 34.366 -7.953  1.00 25.58 ? 144 VAL A CA    1 
ATOM   1116 C  C     . VAL A 1  147 ? -33.474 34.158 -7.187  1.00 26.03 ? 144 VAL A C     1 
ATOM   1117 O  O     . VAL A 1  147 ? -34.381 33.483 -7.682  1.00 25.82 ? 144 VAL A O     1 
ATOM   1118 C  CB    . VAL A 1  147 ? -32.476 35.194 -9.220  1.00 25.91 ? 144 VAL A CB    1 
ATOM   1119 C  CG1   . VAL A 1  147 ? -33.046 36.558 -8.850  1.00 24.48 ? 144 VAL A CG1   1 
ATOM   1120 C  CG2   . VAL A 1  147 ? -31.215 35.370 -10.060 1.00 25.56 ? 144 VAL A CG2   1 
ATOM   1121 N  N     . VAL A 1  148 ? -33.551 34.703 -5.972  1.00 25.43 ? 145 VAL A N     1 
ATOM   1122 C  CA    . VAL A 1  148 ? -34.737 34.557 -5.149  1.00 24.81 ? 145 VAL A CA    1 
ATOM   1123 C  C     . VAL A 1  148 ? -35.278 35.947 -4.856  1.00 25.41 ? 145 VAL A C     1 
ATOM   1124 O  O     . VAL A 1  148 ? -34.590 36.774 -4.253  1.00 26.10 ? 145 VAL A O     1 
ATOM   1125 C  CB    . VAL A 1  148 ? -34.431 33.835 -3.808  1.00 25.21 ? 145 VAL A CB    1 
ATOM   1126 C  CG1   . VAL A 1  148 ? -35.719 33.655 -2.997  1.00 24.46 ? 145 VAL A CG1   1 
ATOM   1127 C  CG2   . VAL A 1  148 ? -33.732 32.478 -4.035  1.00 22.97 ? 145 VAL A CG2   1 
ATOM   1128 N  N     . VAL A 1  149 ? -36.506 36.203 -5.272  1.00 24.60 ? 146 VAL A N     1 
ATOM   1129 C  CA    . VAL A 1  149 ? -37.092 37.517 -5.105  1.00 25.04 ? 146 VAL A CA    1 
ATOM   1130 C  C     . VAL A 1  149 ? -38.278 37.420 -4.167  1.00 25.19 ? 146 VAL A C     1 
ATOM   1131 O  O     . VAL A 1  149 ? -39.216 36.666 -4.447  1.00 25.35 ? 146 VAL A O     1 
ATOM   1132 C  CB    . VAL A 1  149 ? -37.546 38.096 -6.461  1.00 25.21 ? 146 VAL A CB    1 
ATOM   1133 C  CG1   . VAL A 1  149 ? -38.163 39.493 -6.292  1.00 25.42 ? 146 VAL A CG1   1 
ATOM   1134 C  CG2   . VAL A 1  149 ? -36.356 38.141 -7.435  1.00 25.90 ? 146 VAL A CG2   1 
ATOM   1135 N  N     . ASP A 1  150 ? -38.242 38.161 -3.055  1.00 24.85 ? 147 ASP A N     1 
ATOM   1136 C  CA    . ASP A 1  150 ? -39.446 38.310 -2.228  1.00 25.31 ? 147 ASP A CA    1 
ATOM   1137 C  C     . ASP A 1  150 ? -40.480 39.131 -2.991  1.00 25.16 ? 147 ASP A C     1 
ATOM   1138 O  O     . ASP A 1  150 ? -40.166 40.228 -3.428  1.00 26.05 ? 147 ASP A O     1 
ATOM   1139 C  CB    . ASP A 1  150 ? -39.151 38.979 -0.872  1.00 24.76 ? 147 ASP A CB    1 
ATOM   1140 C  CG    . ASP A 1  150 ? -40.428 39.261 -0.076  1.00 26.23 ? 147 ASP A CG    1 
ATOM   1141 O  OD1   . ASP A 1  150 ? -41.163 38.294 0.254   1.00 25.97 ? 147 ASP A OD1   1 
ATOM   1142 O  OD2   . ASP A 1  150 ? -40.737 40.445 0.182   1.00 28.83 ? 147 ASP A OD2   1 
ATOM   1143 N  N     . GLY A 1  151 ? -41.714 38.632 -3.111  1.00 25.03 ? 148 GLY A N     1 
ATOM   1144 C  CA    . GLY A 1  151 ? -42.740 39.310 -3.928  1.00 24.48 ? 148 GLY A CA    1 
ATOM   1145 C  C     . GLY A 1  151 ? -43.274 40.634 -3.391  1.00 24.80 ? 148 GLY A C     1 
ATOM   1146 O  O     . GLY A 1  151 ? -43.504 41.574 -4.164  1.00 24.44 ? 148 GLY A O     1 
ATOM   1147 N  N     . MET A 1  152 ? -43.481 40.730 -2.073  1.00 24.57 ? 149 MET A N     1 
ATOM   1148 C  CA    . MET A 1  152 ? -43.889 42.005 -1.463  1.00 24.53 ? 149 MET A CA    1 
ATOM   1149 C  C     . MET A 1  152 ? -42.813 43.087 -1.619  1.00 24.82 ? 149 MET A C     1 
ATOM   1150 O  O     . MET A 1  152 ? -43.092 44.204 -2.081  1.00 25.50 ? 149 MET A O     1 
ATOM   1151 C  CB    . MET A 1  152 ? -44.271 41.808 0.031   1.00 24.76 ? 149 MET A CB    1 
ATOM   1152 C  CG    . MET A 1  152 ? -45.012 43.003 0.691   1.00 25.87 ? 149 MET A CG    1 
ATOM   1153 S  SD    . MET A 1  152 ? -43.856 44.303 1.224   1.00 31.38 ? 149 MET A SD    1 
ATOM   1154 C  CE    . MET A 1  152 ? -44.552 45.744 0.432   1.00 26.96 ? 149 MET A CE    1 
ATOM   1155 N  N     . THR A 1  153 ? -41.581 42.776 -1.225  1.00 25.07 ? 150 THR A N     1 
ATOM   1156 C  CA    . THR A 1  153 ? -40.572 43.838 -1.092  1.00 25.26 ? 150 THR A CA    1 
ATOM   1157 C  C     . THR A 1  153 ? -39.727 44.021 -2.324  1.00 25.61 ? 150 THR A C     1 
ATOM   1158 O  O     . THR A 1  153 ? -39.138 45.086 -2.494  1.00 25.85 ? 150 THR A O     1 
ATOM   1159 C  CB    . THR A 1  153 ? -39.582 43.572 0.062   1.00 25.33 ? 150 THR A CB    1 
ATOM   1160 O  OG1   . THR A 1  153 ? -38.902 42.333 -0.175  1.00 23.53 ? 150 THR A OG1   1 
ATOM   1161 C  CG2   . THR A 1  153 ? -40.305 43.520 1.390   1.00 26.07 ? 150 THR A CG2   1 
ATOM   1162 N  N     . GLY A 1  154 ? -39.642 42.973 -3.151  1.00 24.94 ? 151 GLY A N     1 
ATOM   1163 C  CA    . GLY A 1  154 ? -38.665 42.923 -4.236  1.00 25.22 ? 151 GLY A CA    1 
ATOM   1164 C  C     . GLY A 1  154 ? -37.237 42.637 -3.760  1.00 25.32 ? 151 GLY A C     1 
ATOM   1165 O  O     . GLY A 1  154 ? -36.299 42.666 -4.561  1.00 25.46 ? 151 GLY A O     1 
ATOM   1166 N  N     . PHE A 1  155 ? -37.060 42.361 -2.466  1.00 24.85 ? 152 PHE A N     1 
ATOM   1167 C  CA    . PHE A 1  155 ? -35.737 42.020 -1.933  1.00 24.76 ? 152 PHE A CA    1 
ATOM   1168 C  C     . PHE A 1  155 ? -35.279 40.694 -2.556  1.00 24.96 ? 152 PHE A C     1 
ATOM   1169 O  O     . PHE A 1  155 ? -36.064 39.755 -2.680  1.00 24.85 ? 152 PHE A O     1 
ATOM   1170 C  CB    . PHE A 1  155 ? -35.763 41.920 -0.389  1.00 23.85 ? 152 PHE A CB    1 
ATOM   1171 C  CG    . PHE A 1  155 ? -34.392 42.006 0.269   1.00 23.22 ? 152 PHE A CG    1 
ATOM   1172 C  CD1   . PHE A 1  155 ? -33.909 43.230 0.731   1.00 22.03 ? 152 PHE A CD1   1 
ATOM   1173 C  CD2   . PHE A 1  155 ? -33.618 40.864 0.471   1.00 22.60 ? 152 PHE A CD2   1 
ATOM   1174 C  CE1   . PHE A 1  155 ? -32.657 43.320 1.349   1.00 22.68 ? 152 PHE A CE1   1 
ATOM   1175 C  CE2   . PHE A 1  155 ? -32.354 40.942 1.097   1.00 20.55 ? 152 PHE A CE2   1 
ATOM   1176 C  CZ    . PHE A 1  155 ? -31.882 42.183 1.534   1.00 22.51 ? 152 PHE A CZ    1 
ATOM   1177 N  N     . THR A 1  156 ? -34.005 40.633 -2.921  1.00 25.22 ? 153 THR A N     1 
ATOM   1178 C  CA    . THR A 1  156 ? -33.510 39.623 -3.830  1.00 25.81 ? 153 THR A CA    1 
ATOM   1179 C  C     . THR A 1  156 ? -32.208 39.038 -3.332  1.00 26.31 ? 153 THR A C     1 
ATOM   1180 O  O     . THR A 1  156 ? -31.258 39.766 -3.055  1.00 26.66 ? 153 THR A O     1 
ATOM   1181 C  CB    . THR A 1  156 ? -33.308 40.234 -5.260  1.00 26.34 ? 153 THR A CB    1 
ATOM   1182 O  OG1   . THR A 1  156 ? -34.578 40.647 -5.775  1.00 25.36 ? 153 THR A OG1   1 
ATOM   1183 C  CG2   . THR A 1  156 ? -32.690 39.245 -6.206  1.00 26.18 ? 153 THR A CG2   1 
ATOM   1184 N  N     . TRP A 1  157 ? -32.162 37.713 -3.239  1.00 26.04 ? 154 TRP A N     1 
ATOM   1185 C  CA    . TRP A 1  157 ? -30.954 37.021 -2.851  1.00 27.07 ? 154 TRP A CA    1 
ATOM   1186 C  C     . TRP A 1  157 ? -30.367 36.318 -4.081  1.00 27.50 ? 154 TRP A C     1 
ATOM   1187 O  O     . TRP A 1  157 ? -31.111 35.750 -4.890  1.00 28.14 ? 154 TRP A O     1 
ATOM   1188 C  CB    . TRP A 1  157 ? -31.275 35.964 -1.775  1.00 26.96 ? 154 TRP A CB    1 
ATOM   1189 C  CG    . TRP A 1  157 ? -31.704 36.501 -0.425  1.00 27.33 ? 154 TRP A CG    1 
ATOM   1190 C  CD1   . TRP A 1  157 ? -30.904 36.693 0.683   1.00 28.95 ? 154 TRP A CD1   1 
ATOM   1191 C  CD2   . TRP A 1  157 ? -33.032 36.872 -0.028  1.00 28.75 ? 154 TRP A CD2   1 
ATOM   1192 N  NE1   . TRP A 1  157 ? -31.656 37.177 1.733   1.00 27.88 ? 154 TRP A NE1   1 
ATOM   1193 C  CE2   . TRP A 1  157 ? -32.965 37.283 1.334   1.00 29.58 ? 154 TRP A CE2   1 
ATOM   1194 C  CE3   . TRP A 1  157 ? -34.275 36.902 -0.687  1.00 30.02 ? 154 TRP A CE3   1 
ATOM   1195 C  CZ2   . TRP A 1  157 ? -34.093 37.732 2.046   1.00 29.24 ? 154 TRP A CZ2   1 
ATOM   1196 C  CZ3   . TRP A 1  157 ? -35.407 37.345 0.022   1.00 30.73 ? 154 TRP A CZ3   1 
ATOM   1197 C  CH2   . TRP A 1  157 ? -35.303 37.749 1.384   1.00 31.33 ? 154 TRP A CH2   1 
ATOM   1198 N  N     . LEU A 1  158 ? -29.043 36.335 -4.195  1.00 27.72 ? 155 LEU A N     1 
ATOM   1199 C  CA    . LEU A 1  158 ? -28.314 35.723 -5.317  1.00 28.62 ? 155 LEU A CA    1 
ATOM   1200 C  C     . LEU A 1  158 ? -27.373 34.649 -4.803  1.00 28.99 ? 155 LEU A C     1 
ATOM   1201 O  O     . LEU A 1  158 ? -26.655 34.879 -3.831  1.00 29.05 ? 155 LEU A O     1 
ATOM   1202 C  CB    . LEU A 1  158 ? -27.479 36.780 -6.030  1.00 27.61 ? 155 LEU A CB    1 
ATOM   1203 C  CG    . LEU A 1  158 ? -28.195 38.050 -6.449  1.00 28.21 ? 155 LEU A CG    1 
ATOM   1204 C  CD1   . LEU A 1  158 ? -27.207 39.081 -7.057  1.00 27.17 ? 155 LEU A CD1   1 
ATOM   1205 C  CD2   . LEU A 1  158 ? -29.302 37.701 -7.439  1.00 27.81 ? 155 LEU A CD2   1 
ATOM   1206 N  N     . TYR A 1  159 ? -27.368 33.494 -5.460  1.00 29.66 ? 156 TYR A N     1 
ATOM   1207 C  CA    . TYR A 1  159 ? -26.459 32.394 -5.119  1.00 30.66 ? 156 TYR A CA    1 
ATOM   1208 C  C     . TYR A 1  159 ? -25.775 31.842 -6.366  1.00 31.37 ? 156 TYR A C     1 
ATOM   1209 O  O     . TYR A 1  159 ? -26.454 31.412 -7.295  1.00 31.69 ? 156 TYR A O     1 
ATOM   1210 C  CB    . TYR A 1  159 ? -27.217 31.260 -4.423  1.00 30.75 ? 156 TYR A CB    1 
ATOM   1211 C  CG    . TYR A 1  159 ? -27.883 31.704 -3.154  1.00 32.36 ? 156 TYR A CG    1 
ATOM   1212 C  CD1   . TYR A 1  159 ? -27.177 31.729 -1.944  1.00 33.28 ? 156 TYR A CD1   1 
ATOM   1213 C  CD2   . TYR A 1  159 ? -29.204 32.142 -3.165  1.00 32.65 ? 156 TYR A CD2   1 
ATOM   1214 C  CE1   . TYR A 1  159 ? -27.783 32.170 -0.775  1.00 35.31 ? 156 TYR A CE1   1 
ATOM   1215 C  CE2   . TYR A 1  159 ? -29.823 32.577 -2.001  1.00 34.86 ? 156 TYR A CE2   1 
ATOM   1216 C  CZ    . TYR A 1  159 ? -29.105 32.588 -0.817  1.00 35.89 ? 156 TYR A CZ    1 
ATOM   1217 O  OH    . TYR A 1  159 ? -29.716 33.026 0.323   1.00 39.60 ? 156 TYR A OH    1 
ATOM   1218 N  N     . PRO A 1  160 ? -24.430 31.840 -6.385  1.00 31.89 ? 157 PRO A N     1 
ATOM   1219 C  CA    . PRO A 1  160 ? -23.704 31.216 -7.490  1.00 32.39 ? 157 PRO A CA    1 
ATOM   1220 C  C     . PRO A 1  160 ? -23.840 29.698 -7.389  1.00 33.19 ? 157 PRO A C     1 
ATOM   1221 O  O     . PRO A 1  160 ? -23.778 29.143 -6.283  1.00 33.35 ? 157 PRO A O     1 
ATOM   1222 C  CB    . PRO A 1  160 ? -22.264 31.626 -7.236  1.00 32.65 ? 157 PRO A CB    1 
ATOM   1223 C  CG    . PRO A 1  160 ? -22.181 31.771 -5.712  1.00 32.48 ? 157 PRO A CG    1 
ATOM   1224 C  CD    . PRO A 1  160 ? -23.546 32.216 -5.263  1.00 31.96 ? 157 PRO A CD    1 
ATOM   1225 N  N     . THR A 1  161 ? -24.066 29.040 -8.521  1.00 33.51 ? 158 THR A N     1 
ATOM   1226 C  CA    . THR A 1  161 ? -24.090 27.580 -8.566  1.00 34.30 ? 158 THR A CA    1 
ATOM   1227 C  C     . THR A 1  161 ? -23.365 27.084 -9.804  1.00 35.27 ? 158 THR A C     1 
ATOM   1228 O  O     . THR A 1  161 ? -23.106 27.856 -10.743 1.00 35.52 ? 158 THR A O     1 
ATOM   1229 C  CB    . THR A 1  161 ? -25.524 26.973 -8.551  1.00 33.57 ? 158 THR A CB    1 
ATOM   1230 O  OG1   . THR A 1  161 ? -26.120 27.089 -9.851  1.00 34.32 ? 158 THR A OG1   1 
ATOM   1231 C  CG2   . THR A 1  161 ? -26.411 27.650 -7.519  1.00 33.82 ? 158 THR A CG2   1 
ATOM   1232 N  N     . LYS A 1  162 ? -23.060 25.788 -9.794  1.00 36.09 ? 159 LYS A N     1 
ATOM   1233 C  CA    . LYS A 1  162 ? -22.369 25.135 -10.889 1.00 36.67 ? 159 LYS A CA    1 
ATOM   1234 C  C     . LYS A 1  162 ? -23.342 24.564 -11.896 1.00 36.67 ? 159 LYS A C     1 
ATOM   1235 O  O     . LYS A 1  162 ? -22.985 24.321 -13.044 1.00 37.14 ? 159 LYS A O     1 
ATOM   1236 C  CB    . LYS A 1  162 ? -21.430 24.058 -10.340 1.00 36.91 ? 159 LYS A CB    1 
ATOM   1237 C  CG    . LYS A 1  162 ? -20.196 24.667 -9.705  1.00 37.91 ? 159 LYS A CG    1 
ATOM   1238 C  CD    . LYS A 1  162 ? -19.373 23.642 -8.969  1.00 42.96 ? 159 LYS A CD    1 
ATOM   1239 C  CE    . LYS A 1  162 ? -18.165 24.308 -8.335  1.00 46.29 ? 159 LYS A CE    1 
ATOM   1240 N  NZ    . LYS A 1  162 ? -17.498 23.409 -7.337  1.00 50.29 ? 159 LYS A NZ    1 
ATOM   1241 N  N     . ALA A 1  163 ? -24.584 24.377 -11.469 1.00 36.54 ? 160 ALA A N     1 
ATOM   1242 C  CA    . ALA A 1  163 ? -25.617 23.799 -12.325 1.00 36.28 ? 160 ALA A CA    1 
ATOM   1243 C  C     . ALA A 1  163 ? -26.990 24.312 -11.882 1.00 35.82 ? 160 ALA A C     1 
ATOM   1244 O  O     . ALA A 1  163 ? -27.167 24.661 -10.718 1.00 35.93 ? 160 ALA A O     1 
ATOM   1245 C  CB    . ALA A 1  163 ? -25.565 22.271 -12.258 1.00 35.79 ? 160 ALA A CB    1 
ATOM   1246 N  N     . PRO A 1  164 ? -27.963 24.368 -12.806 1.00 35.52 ? 161 PRO A N     1 
ATOM   1247 C  CA    . PRO A 1  164 ? -29.305 24.751 -12.388 1.00 35.37 ? 161 PRO A CA    1 
ATOM   1248 C  C     . PRO A 1  164 ? -30.060 23.530 -11.842 1.00 35.37 ? 161 PRO A C     1 
ATOM   1249 O  O     . PRO A 1  164 ? -31.088 23.140 -12.393 1.00 35.80 ? 161 PRO A O     1 
ATOM   1250 C  CB    . PRO A 1  164 ? -29.927 25.254 -13.692 1.00 35.41 ? 161 PRO A CB    1 
ATOM   1251 C  CG    . PRO A 1  164 ? -29.301 24.364 -14.746 1.00 35.13 ? 161 PRO A CG    1 
ATOM   1252 C  CD    . PRO A 1  164 ? -27.907 24.044 -14.250 1.00 35.40 ? 161 PRO A CD    1 
ATOM   1253 N  N     . SER A 1  165 ? -29.541 22.940 -10.765 1.00 35.08 ? 162 SER A N     1 
ATOM   1254 C  CA    . SER A 1  165 ? -30.038 21.667 -10.234 1.00 35.26 ? 162 SER A CA    1 
ATOM   1255 C  C     . SER A 1  165 ? -30.820 21.791 -8.930  1.00 35.14 ? 162 SER A C     1 
ATOM   1256 O  O     . SER A 1  165 ? -30.717 22.793 -8.221  1.00 34.71 ? 162 SER A O     1 
ATOM   1257 C  CB    . SER A 1  165 ? -28.868 20.712 -9.998  1.00 35.26 ? 162 SER A CB    1 
ATOM   1258 O  OG    . SER A 1  165 ? -28.041 21.186 -8.949  1.00 35.92 ? 162 SER A OG    1 
ATOM   1259 N  N     . THR A 1  166 ? -31.585 20.748 -8.617  1.00 35.26 ? 163 THR A N     1 
ATOM   1260 C  CA    . THR A 1  166 ? -32.273 20.646 -7.335  1.00 35.37 ? 163 THR A CA    1 
ATOM   1261 C  C     . THR A 1  166 ? -31.292 20.707 -6.152  1.00 35.82 ? 163 THR A C     1 
ATOM   1262 O  O     . THR A 1  166 ? -31.498 21.479 -5.211  1.00 35.95 ? 163 THR A O     1 
ATOM   1263 C  CB    . THR A 1  166 ? -33.096 19.359 -7.247  1.00 35.22 ? 163 THR A CB    1 
ATOM   1264 O  OG1   . THR A 1  166 ? -34.084 19.353 -8.284  1.00 33.70 ? 163 THR A OG1   1 
ATOM   1265 C  CG2   . THR A 1  166 ? -33.775 19.238 -5.884  1.00 34.58 ? 163 THR A CG2   1 
ATOM   1266 N  N     . SER A 1  167 ? -30.219 19.920 -6.203  1.00 35.52 ? 164 SER A N     1 
ATOM   1267 C  CA    . SER A 1  167 ? -29.316 19.873 -5.062  1.00 35.91 ? 164 SER A CA    1 
ATOM   1268 C  C     . SER A 1  167 ? -28.745 21.258 -4.724  1.00 35.53 ? 164 SER A C     1 
ATOM   1269 O  O     . SER A 1  167 ? -28.724 21.638 -3.550  1.00 34.92 ? 164 SER A O     1 
ATOM   1270 C  CB    . SER A 1  167 ? -28.213 18.831 -5.252  1.00 35.84 ? 164 SER A CB    1 
ATOM   1271 O  OG    . SER A 1  167 ? -27.427 19.146 -6.374  1.00 38.23 ? 164 SER A OG    1 
ATOM   1272 N  N     . ALA A 1  168 ? -28.333 22.014 -5.753  1.00 34.68 ? 165 ALA A N     1 
ATOM   1273 C  CA    . ALA A 1  168 ? -27.833 23.385 -5.577  1.00 33.64 ? 165 ALA A CA    1 
ATOM   1274 C  C     . ALA A 1  168 ? -28.934 24.341 -5.120  1.00 33.44 ? 165 ALA A C     1 
ATOM   1275 O  O     . ALA A 1  168 ? -28.660 25.283 -4.374  1.00 33.66 ? 165 ALA A O     1 
ATOM   1276 C  CB    . ALA A 1  168 ? -27.197 23.905 -6.866  1.00 33.22 ? 165 ALA A CB    1 
ATOM   1277 N  N     . THR A 1  169 ? -30.165 24.117 -5.584  1.00 32.79 ? 166 THR A N     1 
ATOM   1278 C  CA    . THR A 1  169 ? -31.294 24.931 -5.171  1.00 32.58 ? 166 THR A CA    1 
ATOM   1279 C  C     . THR A 1  169 ? -31.544 24.708 -3.671  1.00 32.70 ? 166 THR A C     1 
ATOM   1280 O  O     . THR A 1  169 ? -31.717 25.657 -2.909  1.00 31.65 ? 166 THR A O     1 
ATOM   1281 C  CB    . THR A 1  169 ? -32.563 24.577 -5.974  1.00 32.78 ? 166 THR A CB    1 
ATOM   1282 O  OG1   . THR A 1  169 ? -32.307 24.726 -7.375  1.00 33.68 ? 166 THR A OG1   1 
ATOM   1283 C  CG2   . THR A 1  169 ? -33.718 25.490 -5.593  1.00 32.38 ? 166 THR A CG2   1 
ATOM   1284 N  N     . VAL A 1  170 ? -31.550 23.434 -3.277  1.00 32.99 ? 167 VAL A N     1 
ATOM   1285 C  CA    . VAL A 1  170 ? -31.748 23.026 -1.890  1.00 33.66 ? 167 VAL A CA    1 
ATOM   1286 C  C     . VAL A 1  170 ? -30.654 23.608 -0.978  1.00 33.74 ? 167 VAL A C     1 
ATOM   1287 O  O     . VAL A 1  170 ? -30.962 24.180 0.062   1.00 33.81 ? 167 VAL A O     1 
ATOM   1288 C  CB    . VAL A 1  170 ? -31.866 21.473 -1.781  1.00 33.70 ? 167 VAL A CB    1 
ATOM   1289 C  CG1   . VAL A 1  170 ? -31.640 20.977 -0.344  1.00 34.84 ? 167 VAL A CG1   1 
ATOM   1290 C  CG2   . VAL A 1  170 ? -33.224 21.020 -2.291  1.00 33.04 ? 167 VAL A CG2   1 
ATOM   1291 N  N     . LYS A 1  171 ? -29.391 23.495 -1.385  1.00 33.92 ? 168 LYS A N     1 
ATOM   1292 C  CA    . LYS A 1  171 ? -28.296 24.036 -0.589  1.00 34.16 ? 168 LYS A CA    1 
ATOM   1293 C  C     . LYS A 1  171 ? -28.475 25.529 -0.338  1.00 33.51 ? 168 LYS A C     1 
ATOM   1294 O  O     . LYS A 1  171 ? -28.353 25.991 0.811   1.00 32.53 ? 168 LYS A O     1 
ATOM   1295 C  CB    . LYS A 1  171 ? -26.941 23.813 -1.250  1.00 35.04 ? 168 LYS A CB    1 
ATOM   1296 C  CG    . LYS A 1  171 ? -26.452 22.391 -1.270  1.00 38.50 ? 168 LYS A CG    1 
ATOM   1297 C  CD    . LYS A 1  171 ? -24.935 22.387 -1.437  1.00 44.33 ? 168 LYS A CD    1 
ATOM   1298 C  CE    . LYS A 1  171 ? -24.439 21.170 -2.216  1.00 47.53 ? 168 LYS A CE    1 
ATOM   1299 N  NZ    . LYS A 1  171 ? -25.092 19.904 -1.762  1.00 51.12 ? 168 LYS A NZ    1 
ATOM   1300 N  N     . SER A 1  172 ? -28.753 26.272 -1.413  1.00 31.95 ? 169 SER A N     1 
ATOM   1301 C  CA    . SER A 1  172 ? -28.914 27.730 -1.324  1.00 31.82 ? 169 SER A CA    1 
ATOM   1302 C  C     . SER A 1  172 ? -30.102 28.095 -0.464  1.00 31.04 ? 169 SER A C     1 
ATOM   1303 O  O     . SER A 1  172 ? -30.031 29.015 0.338   1.00 31.55 ? 169 SER A O     1 
ATOM   1304 C  CB    . SER A 1  172 ? -29.122 28.348 -2.702  1.00 31.36 ? 169 SER A CB    1 
ATOM   1305 O  OG    . SER A 1  172 ? -28.102 27.966 -3.590  1.00 33.08 ? 169 SER A OG    1 
ATOM   1306 N  N     . LEU A 1  173 ? -31.199 27.372 -0.632  1.00 30.77 ? 170 LEU A N     1 
ATOM   1307 C  CA    . LEU A 1  173 ? -32.408 27.703 0.104   1.00 31.03 ? 170 LEU A CA    1 
ATOM   1308 C  C     . LEU A 1  173 ? -32.338 27.319 1.596   1.00 31.37 ? 170 LEU A C     1 
ATOM   1309 O  O     . LEU A 1  173 ? -32.960 27.978 2.424   1.00 31.40 ? 170 LEU A O     1 
ATOM   1310 C  CB    . LEU A 1  173 ? -33.662 27.152 -0.584  1.00 30.23 ? 170 LEU A CB    1 
ATOM   1311 C  CG    . LEU A 1  173 ? -34.045 27.812 -1.918  1.00 30.40 ? 170 LEU A CG    1 
ATOM   1312 C  CD1   . LEU A 1  173 ? -35.236 27.104 -2.534  1.00 29.54 ? 170 LEU A CD1   1 
ATOM   1313 C  CD2   . LEU A 1  173 ? -34.345 29.309 -1.768  1.00 30.44 ? 170 LEU A CD2   1 
ATOM   1314 N  N     . ASN A 1  174 ? -31.583 26.276 1.932   1.00 31.74 ? 171 ASN A N     1 
ATOM   1315 C  CA    . ASN A 1  174 ? -31.305 25.986 3.344   1.00 32.41 ? 171 ASN A CA    1 
ATOM   1316 C  C     . ASN A 1  174 ? -30.572 27.163 4.016   1.00 32.63 ? 171 ASN A C     1 
ATOM   1317 O  O     . ASN A 1  174 ? -30.869 27.515 5.168   1.00 32.57 ? 171 ASN A O     1 
ATOM   1318 C  CB    . ASN A 1  174 ? -30.527 24.678 3.513   1.00 32.08 ? 171 ASN A CB    1 
ATOM   1319 C  CG    . ASN A 1  174 ? -31.418 23.445 3.363   1.00 32.67 ? 171 ASN A CG    1 
ATOM   1320 O  OD1   . ASN A 1  174 ? -32.643 23.513 3.530   1.00 34.14 ? 171 ASN A OD1   1 
ATOM   1321 N  ND2   . ASN A 1  174 ? -30.804 22.315 3.042   1.00 32.25 ? 171 ASN A ND2   1 
ATOM   1322 N  N     . VAL A 1  175 ? -29.657 27.794 3.282   1.00 32.46 ? 172 VAL A N     1 
ATOM   1323 C  CA    . VAL A 1  175 ? -29.014 29.003 3.788   1.00 32.69 ? 172 VAL A CA    1 
ATOM   1324 C  C     . VAL A 1  175 ? -30.019 30.157 3.934   1.00 32.53 ? 172 VAL A C     1 
ATOM   1325 O  O     . VAL A 1  175 ? -30.116 30.761 4.997   1.00 32.12 ? 172 VAL A O     1 
ATOM   1326 C  CB    . VAL A 1  175 ? -27.798 29.450 2.934   1.00 32.82 ? 172 VAL A CB    1 
ATOM   1327 C  CG1   . VAL A 1  175 ? -27.311 30.826 3.381   1.00 32.66 ? 172 VAL A CG1   1 
ATOM   1328 C  CG2   . VAL A 1  175 ? -26.649 28.429 3.022   1.00 33.47 ? 172 VAL A CG2   1 
ATOM   1329 N  N     . LEU A 1  176 ? -30.762 30.470 2.872   1.00 32.75 ? 173 LEU A N     1 
ATOM   1330 C  CA    . LEU A 1  176 ? -31.705 31.596 2.911   1.00 32.26 ? 173 LEU A CA    1 
ATOM   1331 C  C     . LEU A 1  176 ? -32.769 31.425 3.984   1.00 32.55 ? 173 LEU A C     1 
ATOM   1332 O  O     . LEU A 1  176 ? -33.030 32.354 4.756   1.00 32.89 ? 173 LEU A O     1 
ATOM   1333 C  CB    . LEU A 1  176 ? -32.361 31.814 1.539   1.00 32.47 ? 173 LEU A CB    1 
ATOM   1334 C  CG    . LEU A 1  176 ? -33.493 32.835 1.297   1.00 32.39 ? 173 LEU A CG    1 
ATOM   1335 C  CD1   . LEU A 1  176 ? -33.439 34.058 2.160   1.00 32.28 ? 173 LEU A CD1   1 
ATOM   1336 C  CD2   . LEU A 1  176 ? -33.488 33.254 -0.171  1.00 33.66 ? 173 LEU A CD2   1 
ATOM   1337 N  N     . THR A 1  177 ? -33.371 30.242 4.055   1.00 32.15 ? 174 THR A N     1 
ATOM   1338 C  CA    . THR A 1  177 ? -34.484 30.035 4.978   1.00 32.50 ? 174 THR A CA    1 
ATOM   1339 C  C     . THR A 1  177 ? -34.061 29.933 6.446   1.00 32.37 ? 174 THR A C     1 
ATOM   1340 O  O     . THR A 1  177 ? -34.917 29.755 7.329   1.00 32.26 ? 174 THR A O     1 
ATOM   1341 C  CB    . THR A 1  177 ? -35.348 28.819 4.606   1.00 32.38 ? 174 THR A CB    1 
ATOM   1342 O  OG1   . THR A 1  177 ? -34.533 27.641 4.583   1.00 32.53 ? 174 THR A OG1   1 
ATOM   1343 C  CG2   . THR A 1  177 ? -35.975 29.031 3.264   1.00 33.04 ? 174 THR A CG2   1 
ATOM   1344 N  N     . SER A 1  178 ? -32.752 30.040 6.690   1.00 31.49 ? 175 SER A N     1 
ATOM   1345 C  CA    . SER A 1  178 ? -32.230 30.271 8.029   1.00 31.60 ? 175 SER A CA    1 
ATOM   1346 C  C     . SER A 1  178 ? -32.777 31.577 8.577   1.00 30.76 ? 175 SER A C     1 
ATOM   1347 O  O     . SER A 1  178 ? -32.914 31.720 9.784   1.00 30.42 ? 175 SER A O     1 
ATOM   1348 C  CB    . SER A 1  178 ? -30.706 30.398 8.012   1.00 31.38 ? 175 SER A CB    1 
ATOM   1349 O  OG    . SER A 1  178 ? -30.106 29.131 7.862   1.00 34.54 ? 175 SER A OG    1 
ATOM   1350 N  N     . ILE A 1  179 ? -33.018 32.540 7.688   1.00 29.85 ? 176 ILE A N     1 
ATOM   1351 C  CA    . ILE A 1  179 ? -33.507 33.850 8.082   1.00 29.63 ? 176 ILE A CA    1 
ATOM   1352 C  C     . ILE A 1  179 ? -35.013 33.771 8.342   1.00 28.60 ? 176 ILE A C     1 
ATOM   1353 O  O     . ILE A 1  179 ? -35.488 34.286 9.338   1.00 27.59 ? 176 ILE A O     1 
ATOM   1354 C  CB    . ILE A 1  179 ? -33.206 34.934 7.010   1.00 30.04 ? 176 ILE A CB    1 
ATOM   1355 C  CG1   . ILE A 1  179 ? -31.710 35.010 6.685   1.00 31.79 ? 176 ILE A CG1   1 
ATOM   1356 C  CG2   . ILE A 1  179 ? -33.779 36.305 7.412   1.00 30.49 ? 176 ILE A CG2   1 
ATOM   1357 C  CD1   . ILE A 1  179 ? -30.751 35.153 7.885   1.00 35.32 ? 176 ILE A CD1   1 
ATOM   1358 N  N     . ALA A 1  180 ? -35.753 33.136 7.430   1.00 28.10 ? 177 ALA A N     1 
ATOM   1359 C  CA    . ALA A 1  180 ? -37.210 32.982 7.560   1.00 28.03 ? 177 ALA A CA    1 
ATOM   1360 C  C     . ALA A 1  180 ? -37.753 32.004 6.514   1.00 28.30 ? 177 ALA A C     1 
ATOM   1361 O  O     . ALA A 1  180 ? -37.154 31.820 5.456   1.00 28.49 ? 177 ALA A O     1 
ATOM   1362 C  CB    . ALA A 1  180 ? -37.902 34.328 7.419   1.00 27.16 ? 177 ALA A CB    1 
ATOM   1363 N  N     . ILE A 1  181 ? -38.908 31.417 6.795   1.00 28.82 ? 178 ILE A N     1 
ATOM   1364 C  CA    . ILE A 1  181 ? -39.555 30.472 5.882   1.00 29.54 ? 178 ILE A CA    1 
ATOM   1365 C  C     . ILE A 1  181 ? -40.717 31.173 5.164   1.00 29.50 ? 178 ILE A C     1 
ATOM   1366 O  O     . ILE A 1  181 ? -41.554 31.794 5.826   1.00 29.07 ? 178 ILE A O     1 
ATOM   1367 C  CB    . ILE A 1  181 ? -40.103 29.246 6.663   1.00 30.14 ? 178 ILE A CB    1 
ATOM   1368 C  CG1   . ILE A 1  181 ? -38.982 28.490 7.416   1.00 31.04 ? 178 ILE A CG1   1 
ATOM   1369 C  CG2   . ILE A 1  181 ? -40.996 28.361 5.778   1.00 29.85 ? 178 ILE A CG2   1 
ATOM   1370 C  CD1   . ILE A 1  181 ? -38.067 27.644 6.582   1.00 34.35 ? 178 ILE A CD1   1 
ATOM   1371 N  N     . PRO A 1  182 ? -40.774 31.084 3.806   1.00 29.29 ? 179 PRO A N     1 
ATOM   1372 C  CA    . PRO A 1  182 ? -41.881 31.700 3.045   1.00 29.20 ? 179 PRO A CA    1 
ATOM   1373 C  C     . PRO A 1  182 ? -43.123 30.820 3.053   1.00 29.09 ? 179 PRO A C     1 
ATOM   1374 O  O     . PRO A 1  182 ? -43.004 29.618 3.209   1.00 28.71 ? 179 PRO A O     1 
ATOM   1375 C  CB    . PRO A 1  182 ? -41.318 31.771 1.613   1.00 29.62 ? 179 PRO A CB    1 
ATOM   1376 C  CG    . PRO A 1  182 ? -40.436 30.550 1.515   1.00 29.15 ? 179 PRO A CG    1 
ATOM   1377 C  CD    . PRO A 1  182 ? -39.787 30.441 2.918   1.00 29.29 ? 179 PRO A CD    1 
ATOM   1378 N  N     . LYS A 1  183 ? -44.305 31.403 2.876   1.00 29.52 ? 180 LYS A N     1 
ATOM   1379 C  CA    . LYS A 1  183 ? -45.518 30.598 2.734   1.00 29.23 ? 180 LYS A CA    1 
ATOM   1380 C  C     . LYS A 1  183 ? -45.482 29.809 1.434   1.00 29.59 ? 180 LYS A C     1 
ATOM   1381 O  O     . LYS A 1  183 ? -45.806 28.605 1.416   1.00 29.40 ? 180 LYS A O     1 
ATOM   1382 C  CB    . LYS A 1  183 ? -46.761 31.475 2.738   1.00 29.96 ? 180 LYS A CB    1 
ATOM   1383 C  CG    . LYS A 1  183 ? -47.139 32.052 4.086   1.00 31.08 ? 180 LYS A CG    1 
ATOM   1384 C  CD    . LYS A 1  183 ? -48.318 33.011 3.909   1.00 32.77 ? 180 LYS A CD    1 
ATOM   1385 C  CE    . LYS A 1  183 ? -48.934 33.396 5.248   1.00 34.66 ? 180 LYS A CE    1 
ATOM   1386 N  NZ    . LYS A 1  183 ? -48.220 34.528 5.874   1.00 35.21 ? 180 LYS A NZ    1 
ATOM   1387 N  N     . VAL A 1  184 ? -45.065 30.489 0.356   1.00 28.99 ? 181 VAL A N     1 
ATOM   1388 C  CA    . VAL A 1  184 ? -45.175 29.986 -1.019  1.00 28.69 ? 181 VAL A CA    1 
ATOM   1389 C  C     . VAL A 1  184 ? -43.878 30.258 -1.797  1.00 28.74 ? 181 VAL A C     1 
ATOM   1390 O  O     . VAL A 1  184 ? -43.285 31.350 -1.706  1.00 28.45 ? 181 VAL A O     1 
ATOM   1391 C  CB    . VAL A 1  184 ? -46.355 30.688 -1.786  1.00 29.41 ? 181 VAL A CB    1 
ATOM   1392 C  CG1   . VAL A 1  184 ? -46.424 30.250 -3.270  1.00 29.16 ? 181 VAL A CG1   1 
ATOM   1393 C  CG2   . VAL A 1  184 ? -47.703 30.447 -1.098  1.00 28.80 ? 181 VAL A CG2   1 
ATOM   1394 N  N     . ILE A 1  185 ? -43.446 29.256 -2.556  1.00 27.80 ? 182 ILE A N     1 
ATOM   1395 C  CA    . ILE A 1  185 ? -42.412 29.449 -3.550  1.00 28.16 ? 182 ILE A CA    1 
ATOM   1396 C  C     . ILE A 1  185 ? -42.978 29.269 -4.970  1.00 28.37 ? 182 ILE A C     1 
ATOM   1397 O  O     . ILE A 1  185 ? -43.478 28.182 -5.320  1.00 28.36 ? 182 ILE A O     1 
ATOM   1398 C  CB    . ILE A 1  185 ? -41.217 28.518 -3.311  1.00 27.94 ? 182 ILE A CB    1 
ATOM   1399 C  CG1   . ILE A 1  185 ? -40.422 28.995 -2.084  1.00 28.01 ? 182 ILE A CG1   1 
ATOM   1400 C  CG2   . ILE A 1  185 ? -40.319 28.474 -4.552  1.00 27.54 ? 182 ILE A CG2   1 
ATOM   1401 C  CD1   . ILE A 1  185 ? -39.349 28.036 -1.646  1.00 25.19 ? 182 ILE A CD1   1 
ATOM   1402 N  N     . HIS A 1  186 ? -42.911 30.333 -5.775  1.00 27.79 ? 183 HIS A N     1 
ATOM   1403 C  CA    . HIS A 1  186 ? -43.352 30.268 -7.173  1.00 27.77 ? 183 HIS A CA    1 
ATOM   1404 C  C     . HIS A 1  186 ? -42.162 30.104 -8.112  1.00 28.07 ? 183 HIS A C     1 
ATOM   1405 O  O     . HIS A 1  186 ? -41.197 30.885 -8.060  1.00 28.00 ? 183 HIS A O     1 
ATOM   1406 C  CB    . HIS A 1  186 ? -44.151 31.513 -7.573  1.00 27.51 ? 183 HIS A CB    1 
ATOM   1407 C  CG    . HIS A 1  186 ? -44.679 31.448 -8.974  1.00 28.27 ? 183 HIS A CG    1 
ATOM   1408 N  ND1   . HIS A 1  186 ? -46.028 31.367 -9.260  1.00 27.47 ? 183 HIS A ND1   1 
ATOM   1409 C  CD2   . HIS A 1  186 ? -44.035 31.417 -10.169 1.00 27.38 ? 183 HIS A CD2   1 
ATOM   1410 C  CE1   . HIS A 1  186 ? -46.190 31.299 -10.570 1.00 27.48 ? 183 HIS A CE1   1 
ATOM   1411 N  NE2   . HIS A 1  186 ? -44.996 31.312 -11.143 1.00 27.23 ? 183 HIS A NE2   1 
ATOM   1412 N  N     . SER A 1  187 ? -42.216 29.083 -8.964  1.00 28.55 ? 184 SER A N     1 
ATOM   1413 C  CA    . SER A 1  187 ? -41.166 28.892 -9.960  1.00 29.04 ? 184 SER A CA    1 
ATOM   1414 C  C     . SER A 1  187 ? -41.738 28.473 -11.308 1.00 29.50 ? 184 SER A C     1 
ATOM   1415 O  O     . SER A 1  187 ? -42.933 28.193 -11.421 1.00 29.25 ? 184 SER A O     1 
ATOM   1416 C  CB    . SER A 1  187 ? -40.158 27.868 -9.474  1.00 29.18 ? 184 SER A CB    1 
ATOM   1417 O  OG    . SER A 1  187 ? -40.699 26.560 -9.531  1.00 29.69 ? 184 SER A OG    1 
ATOM   1418 N  N     . ASP A 1  188 ? -40.883 28.441 -12.325 1.00 30.10 ? 185 ASP A N     1 
ATOM   1419 C  CA    . ASP A 1  188 ? -41.279 27.890 -13.614 1.00 31.44 ? 185 ASP A CA    1 
ATOM   1420 C  C     . ASP A 1  188 ? -41.115 26.371 -13.564 1.00 32.34 ? 185 ASP A C     1 
ATOM   1421 O  O     . ASP A 1  188 ? -40.887 25.789 -12.486 1.00 32.08 ? 185 ASP A O     1 
ATOM   1422 C  CB    . ASP A 1  188 ? -40.535 28.548 -14.797 1.00 30.56 ? 185 ASP A CB    1 
ATOM   1423 C  CG    . ASP A 1  188 ? -39.033 28.341 -14.761 1.00 31.49 ? 185 ASP A CG    1 
ATOM   1424 O  OD1   . ASP A 1  188 ? -38.316 29.256 -15.238 1.00 31.94 ? 185 ASP A OD1   1 
ATOM   1425 O  OD2   . ASP A 1  188 ? -38.547 27.299 -14.262 1.00 31.38 ? 185 ASP A OD2   1 
ATOM   1426 N  N     . GLN A 1  189 ? -41.223 25.717 -14.713 1.00 33.20 ? 186 GLN A N     1 
ATOM   1427 C  CA    . GLN A 1  189 ? -41.201 24.267 -14.701 1.00 33.62 ? 186 GLN A CA    1 
ATOM   1428 C  C     . GLN A 1  189 ? -39.838 23.678 -15.041 1.00 33.46 ? 186 GLN A C     1 
ATOM   1429 O  O     . GLN A 1  189 ? -39.742 22.554 -15.514 1.00 33.57 ? 186 GLN A O     1 
ATOM   1430 C  CB    . GLN A 1  189 ? -42.365 23.691 -15.523 1.00 34.26 ? 186 GLN A CB    1 
ATOM   1431 C  CG    . GLN A 1  189 ? -43.724 23.960 -14.832 1.00 35.19 ? 186 GLN A CG    1 
ATOM   1432 C  CD    . GLN A 1  189 ? -44.905 23.300 -15.513 1.00 36.19 ? 186 GLN A CD    1 
ATOM   1433 O  OE1   . GLN A 1  189 ? -44.801 22.190 -16.017 1.00 37.22 ? 186 GLN A OE1   1 
ATOM   1434 N  NE2   . GLN A 1  189 ? -46.044 23.975 -15.508 1.00 36.02 ? 186 GLN A NE2   1 
ATOM   1435 N  N     . GLY A 1  190 ? -38.784 24.446 -14.777 1.00 33.24 ? 187 GLY A N     1 
ATOM   1436 C  CA    . GLY A 1  190 ? -37.423 23.948 -14.910 1.00 33.28 ? 187 GLY A CA    1 
ATOM   1437 C  C     . GLY A 1  190 ? -37.222 22.721 -14.038 1.00 33.51 ? 187 GLY A C     1 
ATOM   1438 O  O     . GLY A 1  190 ? -37.887 22.562 -12.998 1.00 33.43 ? 187 GLY A O     1 
ATOM   1439 N  N     . ALA A 1  191 ? -36.299 21.856 -14.454 1.00 33.40 ? 188 ALA A N     1 
ATOM   1440 C  CA    . ALA A 1  191 ? -36.090 20.560 -13.796 1.00 33.49 ? 188 ALA A CA    1 
ATOM   1441 C  C     . ALA A 1  191 ? -35.713 20.680 -12.318 1.00 33.39 ? 188 ALA A C     1 
ATOM   1442 O  O     . ALA A 1  191 ? -36.152 19.872 -11.493 1.00 34.07 ? 188 ALA A O     1 
ATOM   1443 C  CB    . ALA A 1  191 ? -35.054 19.706 -14.567 1.00 33.19 ? 188 ALA A CB    1 
ATOM   1444 N  N     . ALA A 1  192 ? -34.920 21.689 -11.975 1.00 33.01 ? 189 ALA A N     1 
ATOM   1445 C  CA    . ALA A 1  192 ? -34.511 21.885 -10.581 1.00 32.52 ? 189 ALA A CA    1 
ATOM   1446 C  C     . ALA A 1  192 ? -35.718 21.946 -9.643  1.00 32.12 ? 189 ALA A C     1 
ATOM   1447 O  O     . ALA A 1  192 ? -35.668 21.447 -8.518  1.00 31.79 ? 189 ALA A O     1 
ATOM   1448 C  CB    . ALA A 1  192 ? -33.659 23.147 -10.442 1.00 32.44 ? 189 ALA A CB    1 
ATOM   1449 N  N     . PHE A 1  193 ? -36.811 22.528 -10.125 1.00 31.80 ? 190 PHE A N     1 
ATOM   1450 C  CA    . PHE A 1  193 ? -37.951 22.859 -9.271  1.00 31.75 ? 190 PHE A CA    1 
ATOM   1451 C  C     . PHE A 1  193 ? -39.088 21.850 -9.278  1.00 32.37 ? 190 PHE A C     1 
ATOM   1452 O  O     . PHE A 1  193 ? -39.932 21.849 -8.367  1.00 31.91 ? 190 PHE A O     1 
ATOM   1453 C  CB    . PHE A 1  193 ? -38.493 24.250 -9.646  1.00 31.26 ? 190 PHE A CB    1 
ATOM   1454 C  CG    . PHE A 1  193 ? -37.417 25.292 -9.808  1.00 30.67 ? 190 PHE A CG    1 
ATOM   1455 C  CD1   . PHE A 1  193 ? -36.482 25.511 -8.802  1.00 31.12 ? 190 PHE A CD1   1 
ATOM   1456 C  CD2   . PHE A 1  193 ? -37.346 26.057 -10.964 1.00 30.53 ? 190 PHE A CD2   1 
ATOM   1457 C  CE1   . PHE A 1  193 ? -35.479 26.471 -8.956  1.00 31.00 ? 190 PHE A CE1   1 
ATOM   1458 C  CE2   . PHE A 1  193 ? -36.365 27.021 -11.119 1.00 29.82 ? 190 PHE A CE2   1 
ATOM   1459 C  CZ    . PHE A 1  193 ? -35.429 27.226 -10.121 1.00 30.65 ? 190 PHE A CZ    1 
ATOM   1460 N  N     . THR A 1  194 ? -39.131 20.998 -10.298 1.00 33.16 ? 191 THR A N     1 
ATOM   1461 C  CA    . THR A 1  194 ? -40.253 20.066 -10.445 1.00 33.82 ? 191 THR A CA    1 
ATOM   1462 C  C     . THR A 1  194 ? -39.909 18.649 -9.960  1.00 34.69 ? 191 THR A C     1 
ATOM   1463 O  O     . THR A 1  194 ? -40.754 17.761 -10.009 1.00 34.82 ? 191 THR A O     1 
ATOM   1464 C  CB    . THR A 1  194 ? -40.791 19.989 -11.907 1.00 33.97 ? 191 THR A CB    1 
ATOM   1465 O  OG1   . THR A 1  194 ? -39.794 19.410 -12.746 1.00 33.72 ? 191 THR A OG1   1 
ATOM   1466 C  CG2   . THR A 1  194 ? -41.174 21.369 -12.446 1.00 33.99 ? 191 THR A CG2   1 
ATOM   1467 N  N     . SER A 1  195 ? -38.680 18.442 -9.492  1.00 35.59 ? 192 SER A N     1 
ATOM   1468 C  CA    . SER A 1  195 ? -38.252 17.125 -9.014  1.00 36.59 ? 192 SER A CA    1 
ATOM   1469 C  C     . SER A 1  195 ? -38.976 16.729 -7.714  1.00 37.36 ? 192 SER A C     1 
ATOM   1470 O  O     . SER A 1  195 ? -39.451 17.592 -6.959  1.00 37.34 ? 192 SER A O     1 
ATOM   1471 C  CB    . SER A 1  195 ? -36.743 17.099 -8.805  1.00 36.43 ? 192 SER A CB    1 
ATOM   1472 O  OG    . SER A 1  195 ? -36.368 17.987 -7.762  1.00 37.27 ? 192 SER A OG    1 
ATOM   1473 N  N     . SER A 1  196 ? -39.073 15.425 -7.456  1.00 37.64 ? 193 SER A N     1 
ATOM   1474 C  CA    . SER A 1  196 ? -39.702 14.969 -6.217  1.00 37.91 ? 193 SER A CA    1 
ATOM   1475 C  C     . SER A 1  196 ? -38.857 15.356 -4.996  1.00 37.49 ? 193 SER A C     1 
ATOM   1476 O  O     . SER A 1  196 ? -39.412 15.645 -3.947  1.00 37.33 ? 193 SER A O     1 
ATOM   1477 C  CB    . SER A 1  196 ? -39.980 13.471 -6.254  1.00 38.09 ? 193 SER A CB    1 
ATOM   1478 O  OG    . SER A 1  196 ? -38.771 12.757 -6.398  1.00 39.57 ? 193 SER A OG    1 
ATOM   1479 N  N     . THR A 1  197 ? -37.529 15.394 -5.160  1.00 37.31 ? 194 THR A N     1 
ATOM   1480 C  CA    . THR A 1  197 ? -36.608 15.842 -4.117  1.00 37.32 ? 194 THR A CA    1 
ATOM   1481 C  C     . THR A 1  197 ? -36.886 17.290 -3.656  1.00 36.96 ? 194 THR A C     1 
ATOM   1482 O  O     . THR A 1  197 ? -36.820 17.589 -2.465  1.00 36.78 ? 194 THR A O     1 
ATOM   1483 C  CB    . THR A 1  197 ? -35.144 15.730 -4.570  1.00 37.52 ? 194 THR A CB    1 
ATOM   1484 O  OG1   . THR A 1  197 ? -34.830 14.360 -4.814  1.00 39.15 ? 194 THR A OG1   1 
ATOM   1485 C  CG2   . THR A 1  197 ? -34.208 16.235 -3.496  1.00 37.75 ? 194 THR A CG2   1 
ATOM   1486 N  N     . PHE A 1  198 ? -37.203 18.176 -4.596  1.00 36.10 ? 195 PHE A N     1 
ATOM   1487 C  CA    . PHE A 1  198 ? -37.544 19.540 -4.239  1.00 35.19 ? 195 PHE A CA    1 
ATOM   1488 C  C     . PHE A 1  198 ? -38.918 19.609 -3.592  1.00 34.97 ? 195 PHE A C     1 
ATOM   1489 O  O     . PHE A 1  198 ? -39.108 20.332 -2.618  1.00 34.32 ? 195 PHE A O     1 
ATOM   1490 C  CB    . PHE A 1  198 ? -37.466 20.470 -5.454  1.00 35.26 ? 195 PHE A CB    1 
ATOM   1491 C  CG    . PHE A 1  198 ? -37.474 21.925 -5.093  1.00 33.67 ? 195 PHE A CG    1 
ATOM   1492 C  CD1   . PHE A 1  198 ? -36.448 22.470 -4.312  1.00 33.79 ? 195 PHE A CD1   1 
ATOM   1493 C  CD2   . PHE A 1  198 ? -38.497 22.750 -5.527  1.00 32.40 ? 195 PHE A CD2   1 
ATOM   1494 C  CE1   . PHE A 1  198 ? -36.450 23.834 -3.967  1.00 32.99 ? 195 PHE A CE1   1 
ATOM   1495 C  CE2   . PHE A 1  198 ? -38.507 24.114 -5.201  1.00 32.39 ? 195 PHE A CE2   1 
ATOM   1496 C  CZ    . PHE A 1  198 ? -37.485 24.655 -4.417  1.00 31.89 ? 195 PHE A CZ    1 
ATOM   1497 N  N     . ALA A 1  199 ? -39.867 18.836 -4.112  1.00 35.16 ? 196 ALA A N     1 
ATOM   1498 C  CA    . ALA A 1  199 ? -41.190 18.727 -3.485  1.00 35.71 ? 196 ALA A CA    1 
ATOM   1499 C  C     . ALA A 1  199 ? -41.111 18.272 -2.019  1.00 36.21 ? 196 ALA A C     1 
ATOM   1500 O  O     . ALA A 1  199 ? -41.839 18.795 -1.183  1.00 36.41 ? 196 ALA A O     1 
ATOM   1501 C  CB    . ALA A 1  199 ? -42.103 17.811 -4.295  1.00 35.37 ? 196 ALA A CB    1 
ATOM   1502 N  N     . GLU A 1  200 ? -40.214 17.322 -1.722  1.00 37.06 ? 197 GLU A N     1 
ATOM   1503 C  CA    . GLU A 1  200 ? -40.026 16.778 -0.370  1.00 38.24 ? 197 GLU A CA    1 
ATOM   1504 C  C     . GLU A 1  200 ? -39.451 17.847 0.548   1.00 37.62 ? 197 GLU A C     1 
ATOM   1505 O  O     . GLU A 1  200 ? -39.943 18.052 1.668   1.00 37.81 ? 197 GLU A O     1 
ATOM   1506 C  CB    . GLU A 1  200 ? -39.060 15.575 -0.372  1.00 39.11 ? 197 GLU A CB    1 
ATOM   1507 C  CG    . GLU A 1  200 ? -39.575 14.270 -0.982  1.00 43.98 ? 197 GLU A CG    1 
ATOM   1508 C  CD    . GLU A 1  200 ? -38.485 13.169 -1.000  1.00 51.97 ? 197 GLU A CD    1 
ATOM   1509 O  OE1   . GLU A 1  200 ? -37.948 12.841 0.093   1.00 53.95 ? 197 GLU A OE1   1 
ATOM   1510 O  OE2   . GLU A 1  200 ? -38.167 12.630 -2.102  1.00 54.05 ? 197 GLU A OE2   1 
ATOM   1511 N  N     . TRP A 1  201 ? -38.397 18.507 0.065   1.00 36.98 ? 198 TRP A N     1 
ATOM   1512 C  CA    . TRP A 1  201 ? -37.744 19.619 0.758   1.00 35.82 ? 198 TRP A CA    1 
ATOM   1513 C  C     . TRP A 1  201 ? -38.749 20.672 1.211   1.00 35.96 ? 198 TRP A C     1 
ATOM   1514 O  O     . TRP A 1  201 ? -38.743 21.086 2.379   1.00 36.00 ? 198 TRP A O     1 
ATOM   1515 C  CB    . TRP A 1  201 ? -36.673 20.254 -0.140  1.00 35.48 ? 198 TRP A CB    1 
ATOM   1516 C  CG    . TRP A 1  201 ? -35.990 21.399 0.513   1.00 33.57 ? 198 TRP A CG    1 
ATOM   1517 C  CD1   . TRP A 1  201 ? -34.899 21.336 1.320   1.00 31.43 ? 198 TRP A CD1   1 
ATOM   1518 C  CD2   . TRP A 1  201 ? -36.361 22.785 0.439   1.00 31.69 ? 198 TRP A CD2   1 
ATOM   1519 N  NE1   . TRP A 1  201 ? -34.563 22.596 1.759   1.00 32.70 ? 198 TRP A NE1   1 
ATOM   1520 C  CE2   . TRP A 1  201 ? -35.443 23.503 1.230   1.00 30.94 ? 198 TRP A CE2   1 
ATOM   1521 C  CE3   . TRP A 1  201 ? -37.382 23.485 -0.218  1.00 30.84 ? 198 TRP A CE3   1 
ATOM   1522 C  CZ2   . TRP A 1  201 ? -35.513 24.887 1.391   1.00 28.96 ? 198 TRP A CZ2   1 
ATOM   1523 C  CZ3   . TRP A 1  201 ? -37.449 24.864 -0.066  1.00 30.47 ? 198 TRP A CZ3   1 
ATOM   1524 C  CH2   . TRP A 1  201 ? -36.521 25.547 0.736   1.00 29.21 ? 198 TRP A CH2   1 
ATOM   1525 N  N     . ALA A 1  202 ? -39.614 21.086 0.290   1.00 35.61 ? 199 ALA A N     1 
ATOM   1526 C  CA    . ALA A 1  202 ? -40.647 22.086 0.564   1.00 35.94 ? 199 ALA A CA    1 
ATOM   1527 C  C     . ALA A 1  202 ? -41.693 21.583 1.566   1.00 36.35 ? 199 ALA A C     1 
ATOM   1528 O  O     . ALA A 1  202 ? -42.120 22.331 2.456   1.00 35.54 ? 199 ALA A O     1 
ATOM   1529 C  CB    . ALA A 1  202 ? -41.324 22.496 -0.716  1.00 35.57 ? 199 ALA A CB    1 
ATOM   1530 N  N     . LYS A 1  203 ? -42.102 20.325 1.396   1.00 36.81 ? 200 LYS A N     1 
ATOM   1531 C  CA    . LYS A 1  203 ? -43.103 19.701 2.261   1.00 37.86 ? 200 LYS A CA    1 
ATOM   1532 C  C     . LYS A 1  203 ? -42.601 19.597 3.710   1.00 37.30 ? 200 LYS A C     1 
ATOM   1533 O  O     . LYS A 1  203 ? -43.334 19.907 4.626   1.00 37.54 ? 200 LYS A O     1 
ATOM   1534 C  CB    . LYS A 1  203 ? -43.502 18.325 1.723   1.00 38.18 ? 200 LYS A CB    1 
ATOM   1535 C  CG    . LYS A 1  203 ? -44.822 17.812 2.246   1.00 41.20 ? 200 LYS A CG    1 
ATOM   1536 C  CD    . LYS A 1  203 ? -44.901 16.288 2.094   1.00 46.50 ? 200 LYS A CD    1 
ATOM   1537 C  CE    . LYS A 1  203 ? -46.281 15.748 2.502   1.00 49.37 ? 200 LYS A CE    1 
ATOM   1538 N  NZ    . LYS A 1  203 ? -46.260 14.251 2.686   1.00 50.35 ? 200 LYS A NZ    1 
ATOM   1539 N  N     . GLU A 1  204 ? -41.346 19.203 3.898   1.00 37.11 ? 201 GLU A N     1 
ATOM   1540 C  CA    . GLU A 1  204 ? -40.735 19.185 5.222   1.00 37.94 ? 201 GLU A CA    1 
ATOM   1541 C  C     . GLU A 1  204 ? -40.862 20.529 5.938   1.00 37.32 ? 201 GLU A C     1 
ATOM   1542 O  O     . GLU A 1  204 ? -41.001 20.575 7.161   1.00 37.44 ? 201 GLU A O     1 
ATOM   1543 C  CB    . GLU A 1  204 ? -39.256 18.841 5.126   1.00 38.41 ? 201 GLU A CB    1 
ATOM   1544 C  CG    . GLU A 1  204 ? -38.959 17.370 4.953   1.00 42.98 ? 201 GLU A CG    1 
ATOM   1545 C  CD    . GLU A 1  204 ? -37.537 17.117 4.466   1.00 49.61 ? 201 GLU A CD    1 
ATOM   1546 O  OE1   . GLU A 1  204 ? -36.761 18.097 4.301   1.00 51.95 ? 201 GLU A OE1   1 
ATOM   1547 O  OE2   . GLU A 1  204 ? -37.193 15.932 4.241   1.00 52.29 ? 201 GLU A OE2   1 
ATOM   1548 N  N     . ARG A 1  205 ? -40.799 21.615 5.173   1.00 35.78 ? 202 ARG A N     1 
ATOM   1549 C  CA    . ARG A 1  205 ? -40.738 22.944 5.744   1.00 35.03 ? 202 ARG A CA    1 
ATOM   1550 C  C     . ARG A 1  205 ? -42.077 23.667 5.765   1.00 34.71 ? 202 ARG A C     1 
ATOM   1551 O  O     . ARG A 1  205 ? -42.144 24.816 6.196   1.00 35.63 ? 202 ARG A O     1 
ATOM   1552 C  CB    . ARG A 1  205 ? -39.667 23.772 5.028   1.00 34.46 ? 202 ARG A CB    1 
ATOM   1553 C  CG    . ARG A 1  205 ? -38.269 23.376 5.461   1.00 34.70 ? 202 ARG A CG    1 
ATOM   1554 C  CD    . ARG A 1  205 ? -37.234 23.567 4.379   1.00 33.53 ? 202 ARG A CD    1 
ATOM   1555 N  NE    . ARG A 1  205 ? -35.960 23.010 4.801   1.00 34.08 ? 202 ARG A NE    1 
ATOM   1556 C  CZ    . ARG A 1  205 ? -35.635 21.727 4.679   1.00 33.97 ? 202 ARG A CZ    1 
ATOM   1557 N  NH1   . ARG A 1  205 ? -36.502 20.862 4.158   1.00 34.79 ? 202 ARG A NH1   1 
ATOM   1558 N  NH2   . ARG A 1  205 ? -34.457 21.302 5.097   1.00 32.09 ? 202 ARG A NH2   1 
ATOM   1559 N  N     . GLY A 1  206 ? -43.141 23.009 5.315   1.00 34.03 ? 203 GLY A N     1 
ATOM   1560 C  CA    . GLY A 1  206 ? -44.462 23.655 5.256   1.00 33.36 ? 203 GLY A CA    1 
ATOM   1561 C  C     . GLY A 1  206 ? -44.561 24.706 4.150   1.00 33.48 ? 203 GLY A C     1 
ATOM   1562 O  O     . GLY A 1  206 ? -45.401 25.621 4.206   1.00 33.37 ? 203 GLY A O     1 
ATOM   1563 N  N     . ILE A 1  207 ? -43.696 24.594 3.144   1.00 32.78 ? 204 ILE A N     1 
ATOM   1564 C  CA    . ILE A 1  207 ? -43.708 25.545 2.027   1.00 32.77 ? 204 ILE A CA    1 
ATOM   1565 C  C     . ILE A 1  207 ? -44.577 25.012 0.878   1.00 32.84 ? 204 ILE A C     1 
ATOM   1566 O  O     . ILE A 1  207 ? -44.345 23.908 0.388   1.00 32.38 ? 204 ILE A O     1 
ATOM   1567 C  CB    . ILE A 1  207 ? -42.277 25.830 1.484   1.00 32.63 ? 204 ILE A CB    1 
ATOM   1568 C  CG1   . ILE A 1  207 ? -41.383 26.374 2.599   1.00 32.27 ? 204 ILE A CG1   1 
ATOM   1569 C  CG2   . ILE A 1  207 ? -42.343 26.767 0.256   1.00 31.58 ? 204 ILE A CG2   1 
ATOM   1570 C  CD1   . ILE A 1  207 ? -39.894 26.472 2.246   1.00 31.27 ? 204 ILE A CD1   1 
ATOM   1571 N  N     . HIS A 1  208 ? -45.571 25.794 0.465   1.00 32.98 ? 205 HIS A N     1 
ATOM   1572 C  CA    . HIS A 1  208 ? -46.349 25.463 -0.726  1.00 33.84 ? 205 HIS A CA    1 
ATOM   1573 C  C     . HIS A 1  208 ? -45.621 25.839 -2.046  1.00 33.30 ? 205 HIS A C     1 
ATOM   1574 O  O     . HIS A 1  208 ? -45.218 26.997 -2.228  1.00 33.01 ? 205 HIS A O     1 
ATOM   1575 C  CB    . HIS A 1  208 ? -47.727 26.122 -0.666  1.00 33.69 ? 205 HIS A CB    1 
ATOM   1576 C  CG    . HIS A 1  208 ? -48.552 25.876 -1.890  1.00 36.85 ? 205 HIS A CG    1 
ATOM   1577 N  ND1   . HIS A 1  208 ? -48.954 24.612 -2.273  1.00 39.57 ? 205 HIS A ND1   1 
ATOM   1578 C  CD2   . HIS A 1  208 ? -49.041 26.726 -2.827  1.00 38.47 ? 205 HIS A CD2   1 
ATOM   1579 C  CE1   . HIS A 1  208 ? -49.660 24.693 -3.389  1.00 39.99 ? 205 HIS A CE1   1 
ATOM   1580 N  NE2   . HIS A 1  208 ? -49.728 25.965 -3.746  1.00 40.68 ? 205 HIS A NE2   1 
ATOM   1581 N  N     . LEU A 1  209 ? -45.449 24.861 -2.942  1.00 32.99 ? 206 LEU A N     1 
ATOM   1582 C  CA    . LEU A 1  209 ? -44.859 25.096 -4.273  1.00 33.00 ? 206 LEU A CA    1 
ATOM   1583 C  C     . LEU A 1  209 ? -45.915 25.463 -5.306  1.00 33.13 ? 206 LEU A C     1 
ATOM   1584 O  O     . LEU A 1  209 ? -46.958 24.806 -5.411  1.00 32.90 ? 206 LEU A O     1 
ATOM   1585 C  CB    . LEU A 1  209 ? -44.034 23.903 -4.776  1.00 32.25 ? 206 LEU A CB    1 
ATOM   1586 C  CG    . LEU A 1  209 ? -42.817 23.506 -3.949  1.00 32.20 ? 206 LEU A CG    1 
ATOM   1587 C  CD1   . LEU A 1  209 ? -42.065 22.320 -4.586  1.00 31.01 ? 206 LEU A CD1   1 
ATOM   1588 C  CD2   . LEU A 1  209 ? -41.879 24.684 -3.713  1.00 31.56 ? 206 LEU A CD2   1 
ATOM   1589 N  N     . GLU A 1  210 ? -45.627 26.522 -6.059  1.00 32.86 ? 207 GLU A N     1 
ATOM   1590 C  CA    . GLU A 1  210 ? -46.543 27.058 -7.061  1.00 32.70 ? 207 GLU A CA    1 
ATOM   1591 C  C     . GLU A 1  210 ? -45.788 27.128 -8.394  1.00 32.13 ? 207 GLU A C     1 
ATOM   1592 O  O     . GLU A 1  210 ? -44.644 27.577 -8.429  1.00 32.18 ? 207 GLU A O     1 
ATOM   1593 C  CB    . GLU A 1  210 ? -47.009 28.456 -6.626  1.00 33.34 ? 207 GLU A CB    1 
ATOM   1594 C  CG    . GLU A 1  210 ? -48.167 29.007 -7.432  1.00 35.30 ? 207 GLU A CG    1 
ATOM   1595 C  CD    . GLU A 1  210 ? -48.553 30.417 -7.043  1.00 37.45 ? 207 GLU A CD    1 
ATOM   1596 O  OE1   . GLU A 1  210 ? -49.686 30.599 -6.570  1.00 38.28 ? 207 GLU A OE1   1 
ATOM   1597 O  OE2   . GLU A 1  210 ? -47.742 31.350 -7.215  1.00 38.22 ? 207 GLU A OE2   1 
ATOM   1598 N  N     . PHE A 1  211 ? -46.410 26.667 -9.479  1.00 31.17 ? 208 PHE A N     1 
ATOM   1599 C  CA    . PHE A 1  211 ? -45.713 26.525 -10.755 1.00 30.45 ? 208 PHE A CA    1 
ATOM   1600 C  C     . PHE A 1  211 ? -46.346 27.364 -11.861 1.00 30.15 ? 208 PHE A C     1 
ATOM   1601 O  O     . PHE A 1  211 ? -47.559 27.365 -12.012 1.00 29.51 ? 208 PHE A O     1 
ATOM   1602 C  CB    . PHE A 1  211 ? -45.658 25.059 -11.173 1.00 30.55 ? 208 PHE A CB    1 
ATOM   1603 C  CG    . PHE A 1  211 ? -44.813 24.215 -10.270 1.00 30.55 ? 208 PHE A CG    1 
ATOM   1604 C  CD1   . PHE A 1  211 ? -43.430 24.219 -10.396 1.00 30.11 ? 208 PHE A CD1   1 
ATOM   1605 C  CD2   . PHE A 1  211 ? -45.398 23.422 -9.290  1.00 31.70 ? 208 PHE A CD2   1 
ATOM   1606 C  CE1   . PHE A 1  211 ? -42.637 23.457 -9.563  1.00 31.31 ? 208 PHE A CE1   1 
ATOM   1607 C  CE2   . PHE A 1  211 ? -44.605 22.633 -8.442  1.00 31.39 ? 208 PHE A CE2   1 
ATOM   1608 C  CZ    . PHE A 1  211 ? -43.222 22.657 -8.582  1.00 31.48 ? 208 PHE A CZ    1 
ATOM   1609 N  N     . SER A 1  212 ? -45.521 28.102 -12.605 1.00 29.37 ? 209 SER A N     1 
ATOM   1610 C  CA    . SER A 1  212 ? -45.998 28.775 -13.825 1.00 29.29 ? 209 SER A CA    1 
ATOM   1611 C  C     . SER A 1  212 ? -46.608 27.760 -14.801 1.00 28.49 ? 209 SER A C     1 
ATOM   1612 O  O     . SER A 1  212 ? -46.178 26.600 -14.833 1.00 27.28 ? 209 SER A O     1 
ATOM   1613 C  CB    . SER A 1  212 ? -44.832 29.472 -14.527 1.00 28.90 ? 209 SER A CB    1 
ATOM   1614 O  OG    . SER A 1  212 ? -44.312 30.542 -13.753 1.00 29.77 ? 209 SER A OG    1 
ATOM   1615 N  N     . THR A 1  213 ? -47.573 28.197 -15.611 1.00 28.28 ? 210 THR A N     1 
ATOM   1616 C  CA    . THR A 1  213 ? -47.969 27.430 -16.813 1.00 28.63 ? 210 THR A CA    1 
ATOM   1617 C  C     . THR A 1  213 ? -46.721 27.275 -17.686 1.00 28.87 ? 210 THR A C     1 
ATOM   1618 O  O     . THR A 1  213 ? -45.822 28.099 -17.615 1.00 29.28 ? 210 THR A O     1 
ATOM   1619 C  CB    . THR A 1  213 ? -49.072 28.134 -17.620 1.00 28.66 ? 210 THR A CB    1 
ATOM   1620 O  OG1   . THR A 1  213 ? -48.721 29.513 -17.786 1.00 29.46 ? 210 THR A OG1   1 
ATOM   1621 C  CG2   . THR A 1  213 ? -50.415 28.041 -16.896 1.00 27.76 ? 210 THR A CG2   1 
ATOM   1622 N  N     . PRO A 1  214 ? -46.644 26.203 -18.501 1.00 29.03 ? 211 PRO A N     1 
ATOM   1623 C  CA    . PRO A 1  214 ? -45.375 25.952 -19.216 1.00 28.65 ? 211 PRO A CA    1 
ATOM   1624 C  C     . PRO A 1  214 ? -45.015 27.001 -20.287 1.00 27.79 ? 211 PRO A C     1 
ATOM   1625 O  O     . PRO A 1  214 ? -45.904 27.657 -20.840 1.00 27.09 ? 211 PRO A O     1 
ATOM   1626 C  CB    . PRO A 1  214 ? -45.572 24.560 -19.849 1.00 28.76 ? 211 PRO A CB    1 
ATOM   1627 C  CG    . PRO A 1  214 ? -47.023 24.251 -19.745 1.00 29.28 ? 211 PRO A CG    1 
ATOM   1628 C  CD    . PRO A 1  214 ? -47.691 25.214 -18.807 1.00 28.56 ? 211 PRO A CD    1 
ATOM   1629 N  N     . TYR A 1  215 ? -43.714 27.158 -20.535 1.00 27.29 ? 212 TYR A N     1 
ATOM   1630 C  CA    . TYR A 1  215 ? -43.166 28.087 -21.550 1.00 27.73 ? 212 TYR A CA    1 
ATOM   1631 C  C     . TYR A 1  215 ? -43.827 29.451 -21.526 1.00 27.42 ? 212 TYR A C     1 
ATOM   1632 O  O     . TYR A 1  215 ? -44.273 29.962 -22.559 1.00 27.21 ? 212 TYR A O     1 
ATOM   1633 C  CB    . TYR A 1  215 ? -43.236 27.477 -22.961 1.00 27.82 ? 212 TYR A CB    1 
ATOM   1634 C  CG    . TYR A 1  215 ? -42.686 26.082 -22.967 1.00 29.93 ? 212 TYR A CG    1 
ATOM   1635 C  CD1   . TYR A 1  215 ? -41.312 25.860 -23.000 1.00 31.60 ? 212 TYR A CD1   1 
ATOM   1636 C  CD2   . TYR A 1  215 ? -43.537 24.981 -22.902 1.00 30.93 ? 212 TYR A CD2   1 
ATOM   1637 C  CE1   . TYR A 1  215 ? -40.793 24.565 -22.978 1.00 32.83 ? 212 TYR A CE1   1 
ATOM   1638 C  CE2   . TYR A 1  215 ? -43.026 23.681 -22.873 1.00 33.18 ? 212 TYR A CE2   1 
ATOM   1639 C  CZ    . TYR A 1  215 ? -41.660 23.489 -22.915 1.00 33.72 ? 212 TYR A CZ    1 
ATOM   1640 O  OH    . TYR A 1  215 ? -41.151 22.203 -22.911 1.00 38.49 ? 212 TYR A OH    1 
ATOM   1641 N  N     . HIS A 1  216 ? -43.910 30.026 -20.330 1.00 27.08 ? 213 HIS A N     1 
ATOM   1642 C  CA    . HIS A 1  216 ? -44.523 31.323 -20.157 1.00 26.91 ? 213 HIS A CA    1 
ATOM   1643 C  C     . HIS A 1  216 ? -43.789 32.138 -19.092 1.00 27.64 ? 213 HIS A C     1 
ATOM   1644 O  O     . HIS A 1  216 ? -44.291 32.319 -17.977 1.00 27.23 ? 213 HIS A O     1 
ATOM   1645 C  CB    . HIS A 1  216 ? -45.995 31.169 -19.821 1.00 26.09 ? 213 HIS A CB    1 
ATOM   1646 C  CG    . HIS A 1  216 ? -46.786 32.410 -20.062 1.00 25.49 ? 213 HIS A CG    1 
ATOM   1647 N  ND1   . HIS A 1  216 ? -47.403 33.101 -19.044 1.00 24.00 ? 213 HIS A ND1   1 
ATOM   1648 C  CD2   . HIS A 1  216 ? -47.047 33.096 -21.201 1.00 24.14 ? 213 HIS A CD2   1 
ATOM   1649 C  CE1   . HIS A 1  216 ? -48.022 34.155 -19.544 1.00 23.32 ? 213 HIS A CE1   1 
ATOM   1650 N  NE2   . HIS A 1  216 ? -47.821 34.175 -20.852 1.00 23.82 ? 213 HIS A NE2   1 
ATOM   1651 N  N     . PRO A 1  217 ? -42.594 32.651 -19.445 1.00 28.55 ? 214 PRO A N     1 
ATOM   1652 C  CA    . PRO A 1  217 ? -41.764 33.364 -18.462 1.00 28.67 ? 214 PRO A CA    1 
ATOM   1653 C  C     . PRO A 1  217 ? -42.459 34.566 -17.814 1.00 28.79 ? 214 PRO A C     1 
ATOM   1654 O  O     . PRO A 1  217 ? -42.158 34.893 -16.656 1.00 28.49 ? 214 PRO A O     1 
ATOM   1655 C  CB    . PRO A 1  217 ? -40.547 33.812 -19.279 1.00 29.26 ? 214 PRO A CB    1 
ATOM   1656 C  CG    . PRO A 1  217 ? -40.923 33.611 -20.736 1.00 29.46 ? 214 PRO A CG    1 
ATOM   1657 C  CD    . PRO A 1  217 ? -41.933 32.526 -20.759 1.00 28.23 ? 214 PRO A CD    1 
ATOM   1658 N  N     . GLN A 1  218 ? -43.369 35.219 -18.541 1.00 28.52 ? 215 GLN A N     1 
ATOM   1659 C  CA    . GLN A 1  218 ? -44.157 36.326 -17.984 1.00 28.88 ? 215 GLN A CA    1 
ATOM   1660 C  C     . GLN A 1  218 ? -44.790 35.957 -16.630 1.00 29.30 ? 215 GLN A C     1 
ATOM   1661 O  O     . GLN A 1  218 ? -44.952 36.816 -15.758 1.00 28.52 ? 215 GLN A O     1 
ATOM   1662 C  CB    . GLN A 1  218 ? -45.283 36.749 -18.935 1.00 28.80 ? 215 GLN A CB    1 
ATOM   1663 C  CG    . GLN A 1  218 ? -44.830 37.336 -20.278 1.00 29.65 ? 215 GLN A CG    1 
ATOM   1664 C  CD    . GLN A 1  218 ? -44.854 36.321 -21.397 1.00 29.80 ? 215 GLN A CD    1 
ATOM   1665 O  OE1   . GLN A 1  218 ? -44.356 35.193 -21.261 1.00 28.35 ? 215 GLN A OE1   1 
ATOM   1666 N  NE2   . GLN A 1  218 ? -45.429 36.719 -22.524 1.00 29.43 ? 215 GLN A NE2   1 
ATOM   1667 N  N     . SER A 1  219 ? -45.184 34.685 -16.488 1.00 29.58 ? 216 SER A N     1 
ATOM   1668 C  CA    . SER A 1  219 ? -45.813 34.198 -15.263 1.00 30.21 ? 216 SER A CA    1 
ATOM   1669 C  C     . SER A 1  219 ? -44.877 34.325 -14.052 1.00 30.07 ? 216 SER A C     1 
ATOM   1670 O  O     . SER A 1  219 ? -45.329 34.477 -12.929 1.00 30.87 ? 216 SER A O     1 
ATOM   1671 C  CB    . SER A 1  219 ? -46.311 32.762 -15.434 1.00 29.74 ? 216 SER A CB    1 
ATOM   1672 O  OG    . SER A 1  219 ? -47.501 32.741 -16.208 1.00 30.11 ? 216 SER A OG    1 
ATOM   1673 N  N     . SER A 1  220 ? -43.580 34.253 -14.310 1.00 30.04 ? 217 SER A N     1 
ATOM   1674 C  CA    . SER A 1  220 ? -42.547 34.537 -13.322 1.00 29.76 ? 217 SER A CA    1 
ATOM   1675 C  C     . SER A 1  220 ? -41.900 35.894 -13.583 1.00 28.45 ? 217 SER A C     1 
ATOM   1676 O  O     . SER A 1  220 ? -40.718 36.061 -13.340 1.00 28.28 ? 217 SER A O     1 
ATOM   1677 C  CB    . SER A 1  220 ? -41.467 33.476 -13.407 1.00 29.40 ? 217 SER A CB    1 
ATOM   1678 O  OG    . SER A 1  220 ? -41.974 32.254 -12.943 1.00 32.68 ? 217 SER A OG    1 
ATOM   1679 N  N     . GLY A 1  221 ? -42.680 36.849 -14.068 1.00 28.47 ? 218 GLY A N     1 
ATOM   1680 C  CA    . GLY A 1  221 ? -42.154 38.138 -14.509 1.00 29.28 ? 218 GLY A CA    1 
ATOM   1681 C  C     . GLY A 1  221 ? -41.406 38.907 -13.439 1.00 29.68 ? 218 GLY A C     1 
ATOM   1682 O  O     . GLY A 1  221 ? -40.458 39.642 -13.746 1.00 29.79 ? 218 GLY A O     1 
ATOM   1683 N  N     . LYS A 1  222 ? -41.834 38.738 -12.185 1.00 29.89 ? 219 LYS A N     1 
ATOM   1684 C  CA    . LYS A 1  222 ? -41.190 39.405 -11.050 1.00 30.19 ? 219 LYS A CA    1 
ATOM   1685 C  C     . LYS A 1  222 ? -39.713 39.029 -10.970 1.00 29.09 ? 219 LYS A C     1 
ATOM   1686 O  O     . LYS A 1  222 ? -38.856 39.901 -10.801 1.00 30.21 ? 219 LYS A O     1 
ATOM   1687 C  CB    . LYS A 1  222 ? -41.936 39.118 -9.734  1.00 31.39 ? 219 LYS A CB    1 
ATOM   1688 C  CG    . LYS A 1  222 ? -41.652 40.141 -8.618  1.00 33.64 ? 219 LYS A CG    1 
ATOM   1689 C  CD    . LYS A 1  222 ? -42.944 40.739 -8.040  1.00 38.02 ? 219 LYS A CD    1 
ATOM   1690 C  CE    . LYS A 1  222 ? -42.610 41.948 -7.169  1.00 39.73 ? 219 LYS A CE    1 
ATOM   1691 N  NZ    . LYS A 1  222 ? -43.761 42.884 -7.113  1.00 42.07 ? 219 LYS A NZ    1 
ATOM   1692 N  N     . VAL A 1  223 ? -39.394 37.755 -11.153 1.00 27.17 ? 220 VAL A N     1 
ATOM   1693 C  CA    . VAL A 1  223 ? -38.000 37.334 -11.107 1.00 25.61 ? 220 VAL A CA    1 
ATOM   1694 C  C     . VAL A 1  223 ? -37.278 37.438 -12.470 1.00 25.67 ? 220 VAL A C     1 
ATOM   1695 O  O     . VAL A 1  223 ? -36.101 37.822 -12.519 1.00 25.85 ? 220 VAL A O     1 
ATOM   1696 C  CB    . VAL A 1  223 ? -37.813 35.948 -10.421 1.00 25.30 ? 220 VAL A CB    1 
ATOM   1697 C  CG1   . VAL A 1  223 ? -38.580 34.836 -11.153 1.00 24.72 ? 220 VAL A CG1   1 
ATOM   1698 C  CG2   . VAL A 1  223 ? -36.327 35.606 -10.295 1.00 24.00 ? 220 VAL A CG2   1 
ATOM   1699 N  N     . GLU A 1  224 ? -37.970 37.116 -13.569 1.00 25.47 ? 221 GLU A N     1 
ATOM   1700 C  CA    . GLU A 1  224 ? -37.385 37.281 -14.916 1.00 24.79 ? 221 GLU A CA    1 
ATOM   1701 C  C     . GLU A 1  224 ? -36.897 38.731 -15.098 1.00 24.91 ? 221 GLU A C     1 
ATOM   1702 O  O     . GLU A 1  224 ? -35.802 38.969 -15.609 1.00 24.90 ? 221 GLU A O     1 
ATOM   1703 C  CB    . GLU A 1  224 ? -38.396 36.920 -16.015 1.00 24.98 ? 221 GLU A CB    1 
ATOM   1704 C  CG    . GLU A 1  224 ? -38.853 35.439 -16.044 1.00 24.81 ? 221 GLU A CG    1 
ATOM   1705 C  CD    . GLU A 1  224 ? -37.790 34.484 -16.567 1.00 27.76 ? 221 GLU A CD    1 
ATOM   1706 O  OE1   . GLU A 1  224 ? -36.664 34.894 -16.908 1.00 27.81 ? 221 GLU A OE1   1 
ATOM   1707 O  OE2   . GLU A 1  224 ? -38.085 33.282 -16.661 1.00 32.78 ? 221 GLU A OE2   1 
ATOM   1708 N  N     . ARG A 1  225 ? -37.694 39.692 -14.642 1.00 24.46 ? 222 ARG A N     1 
ATOM   1709 C  CA    . ARG A 1  225 ? -37.349 41.092 -14.809 1.00 24.77 ? 222 ARG A CA    1 
ATOM   1710 C  C     . ARG A 1  225 ? -36.076 41.438 -14.035 1.00 26.06 ? 222 ARG A C     1 
ATOM   1711 O  O     . ARG A 1  225 ? -35.311 42.312 -14.442 1.00 26.10 ? 222 ARG A O     1 
ATOM   1712 C  CB    . ARG A 1  225 ? -38.519 42.003 -14.427 1.00 23.81 ? 222 ARG A CB    1 
ATOM   1713 C  CG    . ARG A 1  225 ? -38.213 43.487 -14.499 1.00 23.62 ? 222 ARG A CG    1 
ATOM   1714 C  CD    . ARG A 1  225 ? -37.737 43.912 -15.895 1.00 23.16 ? 222 ARG A CD    1 
ATOM   1715 N  NE    . ARG A 1  225 ? -37.710 45.365 -15.984 1.00 23.93 ? 222 ARG A NE    1 
ATOM   1716 C  CZ    . ARG A 1  225 ? -36.696 46.110 -15.566 1.00 23.27 ? 222 ARG A CZ    1 
ATOM   1717 N  NH1   . ARG A 1  225 ? -35.620 45.532 -15.047 1.00 22.12 ? 222 ARG A NH1   1 
ATOM   1718 N  NH2   . ARG A 1  225 ? -36.770 47.430 -15.655 1.00 23.87 ? 222 ARG A NH2   1 
ATOM   1719 N  N     . LYS A 1  226 ? -35.846 40.734 -12.931 1.00 26.58 ? 223 LYS A N     1 
ATOM   1720 C  CA    . LYS A 1  226 ? -34.664 40.947 -12.131 1.00 27.60 ? 223 LYS A CA    1 
ATOM   1721 C  C     . LYS A 1  226 ? -33.369 40.542 -12.856 1.00 27.36 ? 223 LYS A C     1 
ATOM   1722 O  O     . LYS A 1  226 ? -32.322 41.139 -12.614 1.00 27.50 ? 223 LYS A O     1 
ATOM   1723 C  CB    . LYS A 1  226 ? -34.821 40.217 -10.799 1.00 27.77 ? 223 LYS A CB    1 
ATOM   1724 C  CG    . LYS A 1  226 ? -34.120 40.856 -9.624  1.00 32.49 ? 223 LYS A CG    1 
ATOM   1725 C  CD    . LYS A 1  226 ? -34.514 42.299 -9.338  1.00 34.90 ? 223 LYS A CD    1 
ATOM   1726 C  CE    . LYS A 1  226 ? -35.811 42.361 -8.587  1.00 39.79 ? 223 LYS A CE    1 
ATOM   1727 N  NZ    . LYS A 1  226 ? -35.848 43.523 -7.643  1.00 41.97 ? 223 LYS A NZ    1 
ATOM   1728 N  N     . HIS A 1  227 ? -33.443 39.556 -13.753 1.00 27.65 ? 224 HIS A N     1 
ATOM   1729 C  CA    . HIS A 1  227 ? -32.273 39.104 -14.532 1.00 28.17 ? 224 HIS A CA    1 
ATOM   1730 C  C     . HIS A 1  227 ? -31.650 40.288 -15.253 1.00 27.29 ? 224 HIS A C     1 
ATOM   1731 O  O     . HIS A 1  227 ? -30.447 40.400 -15.386 1.00 26.95 ? 224 HIS A O     1 
ATOM   1732 C  CB    . HIS A 1  227 ? -32.684 38.127 -15.648 1.00 29.09 ? 224 HIS A CB    1 
ATOM   1733 C  CG    . HIS A 1  227 ? -33.147 36.785 -15.182 1.00 32.11 ? 224 HIS A CG    1 
ATOM   1734 N  ND1   . HIS A 1  227 ? -33.104 35.673 -16.001 1.00 35.63 ? 224 HIS A ND1   1 
ATOM   1735 C  CD2   . HIS A 1  227 ? -33.667 36.365 -14.005 1.00 35.15 ? 224 HIS A CD2   1 
ATOM   1736 C  CE1   . HIS A 1  227 ? -33.581 34.630 -15.347 1.00 35.24 ? 224 HIS A CE1   1 
ATOM   1737 N  NE2   . HIS A 1  227 ? -33.938 35.024 -14.138 1.00 34.58 ? 224 HIS A NE2   1 
ATOM   1738 N  N     . SER A 1  228 ? -32.518 41.148 -15.755 1.00 26.80 ? 225 SER A N     1 
ATOM   1739 C  CA    . SER A 1  228 ? -32.122 42.287 -16.532 1.00 26.54 ? 225 SER A CA    1 
ATOM   1740 C  C     . SER A 1  228 ? -31.291 43.267 -15.678 1.00 26.09 ? 225 SER A C     1 
ATOM   1741 O  O     . SER A 1  228 ? -30.231 43.707 -16.099 1.00 26.10 ? 225 SER A O     1 
ATOM   1742 C  CB    . SER A 1  228 ? -33.391 42.960 -17.036 1.00 26.24 ? 225 SER A CB    1 
ATOM   1743 O  OG    . SER A 1  228 ? -33.048 44.051 -17.806 1.00 28.60 ? 225 SER A OG    1 
ATOM   1744 N  N     . ASP A 1  229 ? -31.773 43.608 -14.484 1.00 25.90 ? 226 ASP A N     1 
ATOM   1745 C  CA    . ASP A 1  229 ? -31.046 44.528 -13.628 1.00 26.37 ? 226 ASP A CA    1 
ATOM   1746 C  C     . ASP A 1  229 ? -29.736 43.906 -13.152 1.00 25.88 ? 226 ASP A C     1 
ATOM   1747 O  O     . ASP A 1  229 ? -28.717 44.591 -13.103 1.00 26.13 ? 226 ASP A O     1 
ATOM   1748 C  CB    . ASP A 1  229 ? -31.887 44.984 -12.426 1.00 27.27 ? 226 ASP A CB    1 
ATOM   1749 C  CG    . ASP A 1  229 ? -33.146 45.774 -12.832 1.00 30.07 ? 226 ASP A CG    1 
ATOM   1750 O  OD1   . ASP A 1  229 ? -33.202 46.373 -13.944 1.00 28.55 ? 226 ASP A OD1   1 
ATOM   1751 O  OD2   . ASP A 1  229 ? -34.105 45.773 -12.020 1.00 34.86 ? 226 ASP A OD2   1 
ATOM   1752 N  N     . ILE A 1  230 ? -29.761 42.612 -12.833 1.00 25.79 ? 227 ILE A N     1 
ATOM   1753 C  CA    . ILE A 1  230 ? -28.563 41.914 -12.380 1.00 26.08 ? 227 ILE A CA    1 
ATOM   1754 C  C     . ILE A 1  230 ? -27.486 41.882 -13.487 1.00 26.74 ? 227 ILE A C     1 
ATOM   1755 O  O     . ILE A 1  230 ? -26.310 42.246 -13.248 1.00 26.47 ? 227 ILE A O     1 
ATOM   1756 C  CB    . ILE A 1  230 ? -28.886 40.474 -11.898 1.00 26.08 ? 227 ILE A CB    1 
ATOM   1757 C  CG1   . ILE A 1  230 ? -29.775 40.514 -10.652 1.00 25.58 ? 227 ILE A CG1   1 
ATOM   1758 C  CG2   . ILE A 1  230 ? -27.589 39.673 -11.632 1.00 25.76 ? 227 ILE A CG2   1 
ATOM   1759 C  CD1   . ILE A 1  230 ? -30.501 39.233 -10.378 1.00 24.18 ? 227 ILE A CD1   1 
ATOM   1760 N  N     . LYS A 1  231 ? -27.884 41.462 -14.691 1.00 26.08 ? 228 LYS A N     1 
ATOM   1761 C  CA    . LYS A 1  231 ? -26.924 41.357 -15.803 1.00 27.12 ? 228 LYS A CA    1 
ATOM   1762 C  C     . LYS A 1  231 ? -26.413 42.738 -16.241 1.00 26.78 ? 228 LYS A C     1 
ATOM   1763 O  O     . LYS A 1  231 ? -25.239 42.897 -16.545 1.00 27.83 ? 228 LYS A O     1 
ATOM   1764 C  CB    . LYS A 1  231 ? -27.531 40.600 -16.990 1.00 26.89 ? 228 LYS A CB    1 
ATOM   1765 C  CG    . LYS A 1  231 ? -27.586 39.072 -16.822 1.00 28.28 ? 228 LYS A CG    1 
ATOM   1766 C  CD    . LYS A 1  231 ? -28.367 38.470 -17.996 1.00 30.38 ? 228 LYS A CD    1 
ATOM   1767 C  CE    . LYS A 1  231 ? -27.802 37.157 -18.434 1.00 32.06 ? 228 LYS A CE    1 
ATOM   1768 N  NZ    . LYS A 1  231 ? -28.497 36.638 -19.663 1.00 31.28 ? 228 LYS A NZ    1 
ATOM   1769 N  N     . ARG A 1  232 ? -27.287 43.734 -16.240 1.00 26.62 ? 229 ARG A N     1 
ATOM   1770 C  CA    . ARG A 1  232 ? -26.894 45.106 -16.597 1.00 27.43 ? 229 ARG A CA    1 
ATOM   1771 C  C     . ARG A 1  232 ? -25.807 45.641 -15.626 1.00 27.07 ? 229 ARG A C     1 
ATOM   1772 O  O     . ARG A 1  232 ? -24.769 46.189 -16.065 1.00 27.32 ? 229 ARG A O     1 
ATOM   1773 C  CB    . ARG A 1  232 ? -28.135 46.005 -16.588 1.00 27.51 ? 229 ARG A CB    1 
ATOM   1774 C  CG    . ARG A 1  232 ? -28.117 47.167 -17.537 1.00 30.94 ? 229 ARG A CG    1 
ATOM   1775 C  CD    . ARG A 1  232 ? -29.519 47.694 -17.909 1.00 33.55 ? 229 ARG A CD    1 
ATOM   1776 N  NE    . ARG A 1  232 ? -30.397 47.745 -16.743 1.00 34.15 ? 229 ARG A NE    1 
ATOM   1777 C  CZ    . ARG A 1  232 ? -30.618 48.809 -15.985 1.00 35.31 ? 229 ARG A CZ    1 
ATOM   1778 N  NH1   . ARG A 1  232 ? -30.061 49.989 -16.265 1.00 34.44 ? 229 ARG A NH1   1 
ATOM   1779 N  NH2   . ARG A 1  232 ? -31.435 48.682 -14.934 1.00 36.17 ? 229 ARG A NH2   1 
ATOM   1780 N  N     . LEU A 1  233 ? -26.013 45.446 -14.319 1.00 25.83 ? 230 LEU A N     1 
ATOM   1781 C  CA    . LEU A 1  233 ? -25.034 45.924 -13.342 1.00 25.65 ? 230 LEU A CA    1 
ATOM   1782 C  C     . LEU A 1  233 ? -23.694 45.177 -13.444 1.00 25.45 ? 230 LEU A C     1 
ATOM   1783 O  O     . LEU A 1  233 ? -22.622 45.802 -13.436 1.00 25.07 ? 230 LEU A O     1 
ATOM   1784 C  CB    . LEU A 1  233 ? -25.594 45.916 -11.903 1.00 25.18 ? 230 LEU A CB    1 
ATOM   1785 C  CG    . LEU A 1  233 ? -24.700 46.544 -10.820 1.00 26.63 ? 230 LEU A CG    1 
ATOM   1786 C  CD1   . LEU A 1  233 ? -24.152 47.957 -11.191 1.00 23.78 ? 230 LEU A CD1   1 
ATOM   1787 C  CD2   . LEU A 1  233 ? -25.428 46.591 -9.455  1.00 24.90 ? 230 LEU A CD2   1 
ATOM   1788 N  N     . LEU A 1  234 ? -23.757 43.855 -13.572 1.00 25.20 ? 231 LEU A N     1 
ATOM   1789 C  CA    . LEU A 1  234 ? -22.555 43.055 -13.779 1.00 25.85 ? 231 LEU A CA    1 
ATOM   1790 C  C     . LEU A 1  234 ? -21.796 43.551 -15.012 1.00 26.54 ? 231 LEU A C     1 
ATOM   1791 O  O     . LEU A 1  234 ? -20.587 43.837 -14.949 1.00 27.44 ? 231 LEU A O     1 
ATOM   1792 C  CB    . LEU A 1  234 ? -22.907 41.560 -13.909 1.00 25.45 ? 231 LEU A CB    1 
ATOM   1793 C  CG    . LEU A 1  234 ? -23.271 40.816 -12.619 1.00 24.95 ? 231 LEU A CG    1 
ATOM   1794 C  CD1   . LEU A 1  234 ? -23.836 39.409 -12.934 1.00 23.36 ? 231 LEU A CD1   1 
ATOM   1795 C  CD2   . LEU A 1  234 ? -22.057 40.736 -11.657 1.00 24.30 ? 231 LEU A CD2   1 
ATOM   1796 N  N     . THR A 1  235 ? -22.520 43.704 -16.119 1.00 26.87 ? 232 THR A N     1 
ATOM   1797 C  CA    . THR A 1  235 ? -21.931 44.232 -17.352 1.00 27.15 ? 232 THR A CA    1 
ATOM   1798 C  C     . THR A 1  235 ? -21.205 45.554 -17.125 1.00 27.31 ? 232 THR A C     1 
ATOM   1799 O  O     . THR A 1  235 ? -20.065 45.706 -17.538 1.00 28.28 ? 232 THR A O     1 
ATOM   1800 C  CB    . THR A 1  235 ? -22.984 44.389 -18.461 1.00 26.44 ? 232 THR A CB    1 
ATOM   1801 O  OG1   . THR A 1  235 ? -23.545 43.107 -18.730 1.00 25.31 ? 232 THR A OG1   1 
ATOM   1802 C  CG2   . THR A 1  235 ? -22.349 44.941 -19.752 1.00 26.49 ? 232 THR A CG2   1 
ATOM   1803 N  N     . LYS A 1  236 ? -21.869 46.496 -16.467 1.00 27.78 ? 233 LYS A N     1 
ATOM   1804 C  CA    . LYS A 1  236 ? -21.285 47.797 -16.208 1.00 28.57 ? 233 LYS A CA    1 
ATOM   1805 C  C     . LYS A 1  236 ? -19.982 47.695 -15.410 1.00 29.82 ? 233 LYS A C     1 
ATOM   1806 O  O     . LYS A 1  236 ? -18.994 48.358 -15.749 1.00 30.62 ? 233 LYS A O     1 
ATOM   1807 C  CB    . LYS A 1  236 ? -22.294 48.710 -15.523 1.00 28.12 ? 233 LYS A CB    1 
ATOM   1808 C  CG    . LYS A 1  236 ? -23.421 49.146 -16.458 1.00 27.33 ? 233 LYS A CG    1 
ATOM   1809 C  CD    . LYS A 1  236 ? -24.484 49.898 -15.718 1.00 25.65 ? 233 LYS A CD    1 
ATOM   1810 C  CE    . LYS A 1  236 ? -25.706 50.119 -16.592 1.00 24.65 ? 233 LYS A CE    1 
ATOM   1811 N  NZ    . LYS A 1  236 ? -26.731 50.938 -15.928 1.00 22.08 ? 233 LYS A NZ    1 
ATOM   1812 N  N     . LEU A 1  237 ? -19.983 46.849 -14.377 1.00 30.26 ? 234 LEU A N     1 
ATOM   1813 C  CA    . LEU A 1  237 ? -18.838 46.706 -13.479 1.00 30.87 ? 234 LEU A CA    1 
ATOM   1814 C  C     . LEU A 1  237 ? -17.693 45.965 -14.163 1.00 31.32 ? 234 LEU A C     1 
ATOM   1815 O  O     . LEU A 1  237 ? -16.519 46.173 -13.818 1.00 31.62 ? 234 LEU A O     1 
ATOM   1816 C  CB    . LEU A 1  237 ? -19.254 46.003 -12.178 1.00 30.92 ? 234 LEU A CB    1 
ATOM   1817 C  CG    . LEU A 1  237 ? -20.315 46.734 -11.330 1.00 30.91 ? 234 LEU A CG    1 
ATOM   1818 C  CD1   . LEU A 1  237 ? -20.789 45.908 -10.128 1.00 29.10 ? 234 LEU A CD1   1 
ATOM   1819 C  CD2   . LEU A 1  237 ? -19.822 48.129 -10.900 1.00 31.23 ? 234 LEU A CD2   1 
ATOM   1820 N  N     . LEU A 1  238 ? -18.030 45.135 -15.156 1.00 31.48 ? 235 LEU A N     1 
ATOM   1821 C  CA    . LEU A 1  238 ? -17.024 44.339 -15.873 1.00 31.42 ? 235 LEU A CA    1 
ATOM   1822 C  C     . LEU A 1  238 ? -16.460 44.987 -17.158 1.00 32.14 ? 235 LEU A C     1 
ATOM   1823 O  O     . LEU A 1  238 ? -15.598 44.405 -17.812 1.00 31.96 ? 235 LEU A O     1 
ATOM   1824 C  CB    . LEU A 1  238 ? -17.532 42.915 -16.136 1.00 30.80 ? 235 LEU A CB    1 
ATOM   1825 C  CG    . LEU A 1  238 ? -17.830 42.068 -14.881 1.00 31.00 ? 235 LEU A CG    1 
ATOM   1826 C  CD1   . LEU A 1  238 ? -18.700 40.845 -15.227 1.00 29.14 ? 235 LEU A CD1   1 
ATOM   1827 C  CD2   . LEU A 1  238 ? -16.539 41.641 -14.156 1.00 29.17 ? 235 LEU A CD2   1 
ATOM   1828 N  N     . VAL A 1  239 ? -16.940 46.179 -17.517 1.00 33.25 ? 236 VAL A N     1 
ATOM   1829 C  CA    . VAL A 1  239 ? -16.464 46.852 -18.720 1.00 34.91 ? 236 VAL A CA    1 
ATOM   1830 C  C     . VAL A 1  239 ? -14.922 46.919 -18.688 1.00 36.61 ? 236 VAL A C     1 
ATOM   1831 O  O     . VAL A 1  239 ? -14.331 47.379 -17.706 1.00 37.05 ? 236 VAL A O     1 
ATOM   1832 C  CB    . VAL A 1  239 ? -17.115 48.257 -18.891 1.00 34.62 ? 236 VAL A CB    1 
ATOM   1833 C  CG1   . VAL A 1  239 ? -16.335 49.117 -19.884 1.00 35.26 ? 236 VAL A CG1   1 
ATOM   1834 C  CG2   . VAL A 1  239 ? -18.561 48.118 -19.357 1.00 33.75 ? 236 VAL A CG2   1 
ATOM   1835 N  N     . GLY A 1  240 ? -14.287 46.403 -19.742 1.00 38.14 ? 237 GLY A N     1 
ATOM   1836 C  CA    . GLY A 1  240 ? -12.838 46.469 -19.889 1.00 39.73 ? 237 GLY A CA    1 
ATOM   1837 C  C     . GLY A 1  240 ? -12.055 45.520 -19.005 1.00 40.96 ? 237 GLY A C     1 
ATOM   1838 O  O     . GLY A 1  240 ? -10.853 45.692 -18.835 1.00 41.76 ? 237 GLY A O     1 
ATOM   1839 N  N     . ARG A 1  241 ? -12.728 44.520 -18.441 1.00 41.68 ? 238 ARG A N     1 
ATOM   1840 C  CA    . ARG A 1  241 ? -12.104 43.542 -17.553 1.00 41.94 ? 238 ARG A CA    1 
ATOM   1841 C  C     . ARG A 1  241 ? -12.569 42.166 -17.971 1.00 41.67 ? 238 ARG A C     1 
ATOM   1842 O  O     . ARG A 1  241 ? -13.616 42.048 -18.602 1.00 41.50 ? 238 ARG A O     1 
ATOM   1843 C  CB    . ARG A 1  241 ? -12.562 43.761 -16.111 1.00 42.75 ? 238 ARG A CB    1 
ATOM   1844 C  CG    . ARG A 1  241 ? -12.153 45.076 -15.486 1.00 45.64 ? 238 ARG A CG    1 
ATOM   1845 C  CD    . ARG A 1  241 ? -12.862 45.246 -14.156 1.00 51.38 ? 238 ARG A CD    1 
ATOM   1846 N  NE    . ARG A 1  241 ? -11.991 45.903 -13.184 1.00 56.95 ? 238 ARG A NE    1 
ATOM   1847 C  CZ    . ARG A 1  241 ? -11.981 47.210 -12.931 1.00 59.20 ? 238 ARG A CZ    1 
ATOM   1848 N  NH1   . ARG A 1  241 ? -12.812 48.034 -13.561 1.00 59.97 ? 238 ARG A NH1   1 
ATOM   1849 N  NH2   . ARG A 1  241 ? -11.136 47.691 -12.029 1.00 61.30 ? 238 ARG A NH2   1 
ATOM   1850 N  N     . PRO A 1  242 ? -11.812 41.114 -17.607 1.00 41.37 ? 239 PRO A N     1 
ATOM   1851 C  CA    . PRO A 1  242 ? -12.376 39.773 -17.773 1.00 41.37 ? 239 PRO A CA    1 
ATOM   1852 C  C     . PRO A 1  242 ? -13.669 39.620 -16.948 1.00 41.39 ? 239 PRO A C     1 
ATOM   1853 O  O     . PRO A 1  242 ? -13.829 40.252 -15.888 1.00 40.90 ? 239 PRO A O     1 
ATOM   1854 C  CB    . PRO A 1  242 ? -11.277 38.836 -17.242 1.00 41.38 ? 239 PRO A CB    1 
ATOM   1855 C  CG    . PRO A 1  242 ? -10.245 39.734 -16.575 1.00 41.92 ? 239 PRO A CG    1 
ATOM   1856 C  CD    . PRO A 1  242 ? -10.411 41.099 -17.147 1.00 41.28 ? 239 PRO A CD    1 
ATOM   1857 N  N     . THR A 1  243 ? -14.576 38.793 -17.445 1.00 41.01 ? 240 THR A N     1 
ATOM   1858 C  CA    . THR A 1  243 ? -15.897 38.640 -16.851 1.00 41.06 ? 240 THR A CA    1 
ATOM   1859 C  C     . THR A 1  243 ? -15.890 37.771 -15.585 1.00 40.84 ? 240 THR A C     1 
ATOM   1860 O  O     . THR A 1  243 ? -16.457 36.688 -15.562 1.00 41.06 ? 240 THR A O     1 
ATOM   1861 C  CB    . THR A 1  243 ? -16.895 38.099 -17.879 1.00 40.97 ? 240 THR A CB    1 
ATOM   1862 O  OG1   . THR A 1  243 ? -16.385 36.887 -18.432 1.00 42.10 ? 240 THR A OG1   1 
ATOM   1863 C  CG2   . THR A 1  243 ? -17.121 39.111 -19.003 1.00 39.98 ? 240 THR A CG2   1 
ATOM   1864 N  N     . LYS A 1  244 ? -15.254 38.278 -14.535 1.00 40.75 ? 241 LYS A N     1 
ATOM   1865 C  CA    . LYS A 1  244 ? -15.131 37.581 -13.252 1.00 40.74 ? 241 LYS A CA    1 
ATOM   1866 C  C     . LYS A 1  244 ? -16.264 38.012 -12.343 1.00 39.18 ? 241 LYS A C     1 
ATOM   1867 O  O     . LYS A 1  244 ? -16.094 38.885 -11.491 1.00 39.70 ? 241 LYS A O     1 
ATOM   1868 C  CB    . LYS A 1  244 ? -13.788 37.921 -12.592 1.00 41.50 ? 241 LYS A CB    1 
ATOM   1869 C  CG    . LYS A 1  244 ? -12.573 37.534 -13.441 1.00 44.51 ? 241 LYS A CG    1 
ATOM   1870 C  CD    . LYS A 1  244 ? -11.261 37.803 -12.712 1.00 48.65 ? 241 LYS A CD    1 
ATOM   1871 C  CE    . LYS A 1  244 ? -10.078 37.456 -13.613 1.00 51.25 ? 241 LYS A CE    1 
ATOM   1872 N  NZ    . LYS A 1  244 ? -8.797  37.767 -12.926 1.00 54.93 ? 241 LYS A NZ    1 
ATOM   1873 N  N     . TRP A 1  245 ? -17.420 37.396 -12.536 1.00 37.34 ? 242 TRP A N     1 
ATOM   1874 C  CA    . TRP A 1  245 ? -18.647 37.866 -11.906 1.00 35.36 ? 242 TRP A CA    1 
ATOM   1875 C  C     . TRP A 1  245 ? -18.894 37.253 -10.525 1.00 35.03 ? 242 TRP A C     1 
ATOM   1876 O  O     . TRP A 1  245 ? -19.653 37.805 -9.729  1.00 34.08 ? 242 TRP A O     1 
ATOM   1877 C  CB    . TRP A 1  245 ? -19.836 37.625 -12.835 1.00 34.59 ? 242 TRP A CB    1 
ATOM   1878 C  CG    . TRP A 1  245 ? -19.987 36.203 -13.247 1.00 33.79 ? 242 TRP A CG    1 
ATOM   1879 C  CD1   . TRP A 1  245 ? -19.501 35.618 -14.382 1.00 32.21 ? 242 TRP A CD1   1 
ATOM   1880 C  CD2   . TRP A 1  245 ? -20.666 35.166 -12.521 1.00 33.79 ? 242 TRP A CD2   1 
ATOM   1881 N  NE1   . TRP A 1  245 ? -19.839 34.291 -14.412 1.00 32.53 ? 242 TRP A NE1   1 
ATOM   1882 C  CE2   . TRP A 1  245 ? -20.552 33.982 -13.283 1.00 33.27 ? 242 TRP A CE2   1 
ATOM   1883 C  CE3   . TRP A 1  245 ? -21.361 35.124 -11.296 1.00 33.79 ? 242 TRP A CE3   1 
ATOM   1884 C  CZ2   . TRP A 1  245 ? -21.105 32.762 -12.865 1.00 34.07 ? 242 TRP A CZ2   1 
ATOM   1885 C  CZ3   . TRP A 1  245 ? -21.909 33.905 -10.879 1.00 32.93 ? 242 TRP A CZ3   1 
ATOM   1886 C  CH2   . TRP A 1  245 ? -21.779 32.745 -11.665 1.00 32.72 ? 242 TRP A CH2   1 
ATOM   1887 N  N     . TYR A 1  246 ? -18.265 36.111 -10.255 1.00 34.98 ? 243 TYR A N     1 
ATOM   1888 C  CA    . TYR A 1  246 ? -18.444 35.414 -8.987  1.00 35.38 ? 243 TYR A CA    1 
ATOM   1889 C  C     . TYR A 1  246 ? -18.238 36.320 -7.780  1.00 35.09 ? 243 TYR A C     1 
ATOM   1890 O  O     . TYR A 1  246 ? -19.070 36.341 -6.889  1.00 34.51 ? 243 TYR A O     1 
ATOM   1891 C  CB    . TYR A 1  246 ? -17.523 34.192 -8.887  1.00 35.60 ? 243 TYR A CB    1 
ATOM   1892 C  CG    . TYR A 1  246 ? -17.646 33.454 -7.569  1.00 36.46 ? 243 TYR A CG    1 
ATOM   1893 C  CD1   . TYR A 1  246 ? -18.615 32.473 -7.389  1.00 37.99 ? 243 TYR A CD1   1 
ATOM   1894 C  CD2   . TYR A 1  246 ? -16.810 33.761 -6.493  1.00 37.78 ? 243 TYR A CD2   1 
ATOM   1895 C  CE1   . TYR A 1  246 ? -18.735 31.797 -6.173  1.00 39.49 ? 243 TYR A CE1   1 
ATOM   1896 C  CE2   . TYR A 1  246 ? -16.923 33.103 -5.277  1.00 39.10 ? 243 TYR A CE2   1 
ATOM   1897 C  CZ    . TYR A 1  246 ? -17.882 32.116 -5.126  1.00 40.43 ? 243 TYR A CZ    1 
ATOM   1898 O  OH    . TYR A 1  246 ? -18.003 31.452 -3.927  1.00 42.76 ? 243 TYR A OH    1 
ATOM   1899 N  N     . ASP A 1  247 ? -17.130 37.060 -7.767  1.00 35.34 ? 244 ASP A N     1 
ATOM   1900 C  CA    . ASP A 1  247 ? -16.776 37.928 -6.651  1.00 35.71 ? 244 ASP A CA    1 
ATOM   1901 C  C     . ASP A 1  247 ? -17.633 39.169 -6.568  1.00 35.19 ? 244 ASP A C     1 
ATOM   1902 O  O     . ASP A 1  247 ? -17.648 39.832 -5.532  1.00 34.89 ? 244 ASP A O     1 
ATOM   1903 C  CB    . ASP A 1  247 ? -15.325 38.380 -6.768  1.00 36.85 ? 244 ASP A CB    1 
ATOM   1904 C  CG    . ASP A 1  247 ? -14.343 37.320 -6.314  1.00 39.40 ? 244 ASP A CG    1 
ATOM   1905 O  OD1   . ASP A 1  247 ? -14.701 36.468 -5.470  1.00 43.30 ? 244 ASP A OD1   1 
ATOM   1906 O  OD2   . ASP A 1  247 ? -13.203 37.346 -6.814  1.00 43.43 ? 244 ASP A OD2   1 
ATOM   1907 N  N     . LEU A 1  248 ? -18.310 39.498 -7.670  1.00 33.66 ? 245 LEU A N     1 
ATOM   1908 C  CA    . LEU A 1  248 ? -19.198 40.655 -7.723  1.00 32.94 ? 245 LEU A CA    1 
ATOM   1909 C  C     . LEU A 1  248 ? -20.629 40.377 -7.284  1.00 31.98 ? 245 LEU A C     1 
ATOM   1910 O  O     . LEU A 1  248 ? -21.377 41.317 -7.011  1.00 31.78 ? 245 LEU A O     1 
ATOM   1911 C  CB    . LEU A 1  248 ? -19.222 41.251 -9.134  1.00 32.57 ? 245 LEU A CB    1 
ATOM   1912 C  CG    . LEU A 1  248 ? -17.925 41.898 -9.622  1.00 33.81 ? 245 LEU A CG    1 
ATOM   1913 C  CD1   . LEU A 1  248 ? -18.125 42.369 -11.046 1.00 33.48 ? 245 LEU A CD1   1 
ATOM   1914 C  CD2   . LEU A 1  248 ? -17.463 43.034 -8.733  1.00 32.76 ? 245 LEU A CD2   1 
ATOM   1915 N  N     . LEU A 1  249 ? -21.030 39.112 -7.229  1.00 31.32 ? 246 LEU A N     1 
ATOM   1916 C  CA    . LEU A 1  249 ? -22.428 38.813 -6.861  1.00 31.48 ? 246 LEU A CA    1 
ATOM   1917 C  C     . LEU A 1  249 ? -22.868 39.462 -5.550  1.00 30.61 ? 246 LEU A C     1 
ATOM   1918 O  O     . LEU A 1  249 ? -23.935 40.071 -5.517  1.00 30.51 ? 246 LEU A O     1 
ATOM   1919 C  CB    . LEU A 1  249 ? -22.732 37.314 -6.800  1.00 31.48 ? 246 LEU A CB    1 
ATOM   1920 C  CG    . LEU A 1  249 ? -23.301 36.571 -8.000  1.00 34.81 ? 246 LEU A CG    1 
ATOM   1921 C  CD1   . LEU A 1  249 ? -23.851 35.231 -7.481  1.00 36.08 ? 246 LEU A CD1   1 
ATOM   1922 C  CD2   . LEU A 1  249 ? -24.395 37.356 -8.763  1.00 35.12 ? 246 LEU A CD2   1 
ATOM   1923 N  N     . PRO A 1  250 ? -22.067 39.325 -4.468  1.00 30.17 ? 247 PRO A N     1 
ATOM   1924 C  CA    . PRO A 1  250 ? -22.526 39.895 -3.189  1.00 29.99 ? 247 PRO A CA    1 
ATOM   1925 C  C     . PRO A 1  250 ? -22.704 41.422 -3.245  1.00 29.60 ? 247 PRO A C     1 
ATOM   1926 O  O     . PRO A 1  250 ? -23.659 41.945 -2.668  1.00 29.22 ? 247 PRO A O     1 
ATOM   1927 C  CB    . PRO A 1  250 ? -21.409 39.507 -2.211  1.00 29.59 ? 247 PRO A CB    1 
ATOM   1928 C  CG    . PRO A 1  250 ? -20.809 38.262 -2.807  1.00 30.87 ? 247 PRO A CG    1 
ATOM   1929 C  CD    . PRO A 1  250 ? -20.825 38.542 -4.295  1.00 30.11 ? 247 PRO A CD    1 
ATOM   1930 N  N     . VAL A 1  251 ? -21.802 42.098 -3.959  1.00 29.52 ? 248 VAL A N     1 
ATOM   1931 C  CA    A VAL A 1  251 ? -21.864 43.547 -4.148  0.50 29.62 ? 248 VAL A CA    1 
ATOM   1932 C  CA    B VAL A 1  251 ? -21.855 43.548 -4.162  0.50 29.63 ? 248 VAL A CA    1 
ATOM   1933 C  C     . VAL A 1  251 ? -23.111 43.922 -4.949  1.00 29.19 ? 248 VAL A C     1 
ATOM   1934 O  O     . VAL A 1  251 ? -23.778 44.916 -4.649  1.00 29.48 ? 248 VAL A O     1 
ATOM   1935 C  CB    A VAL A 1  251 ? -20.564 44.077 -4.845  0.50 30.15 ? 248 VAL A CB    1 
ATOM   1936 C  CB    B VAL A 1  251 ? -20.598 44.077 -4.936  0.50 30.13 ? 248 VAL A CB    1 
ATOM   1937 C  CG1   A VAL A 1  251 ? -20.727 45.517 -5.331  0.50 30.87 ? 248 VAL A CG1   1 
ATOM   1938 C  CG1   B VAL A 1  251 ? -20.518 45.594 -4.863  0.50 30.89 ? 248 VAL A CG1   1 
ATOM   1939 C  CG2   A VAL A 1  251 ? -19.369 43.968 -3.887  0.50 30.82 ? 248 VAL A CG2   1 
ATOM   1940 C  CG2   B VAL A 1  251 ? -19.301 43.457 -4.401  0.50 30.91 ? 248 VAL A CG2   1 
ATOM   1941 N  N     . VAL A 1  252 ? -23.432 43.123 -5.967  1.00 28.31 ? 249 VAL A N     1 
ATOM   1942 C  CA    . VAL A 1  252 ? -24.575 43.419 -6.825  1.00 26.92 ? 249 VAL A CA    1 
ATOM   1943 C  C     . VAL A 1  252 ? -25.892 43.212 -6.052  1.00 26.64 ? 249 VAL A C     1 
ATOM   1944 O  O     . VAL A 1  252 ? -26.841 44.007 -6.174  1.00 26.45 ? 249 VAL A O     1 
ATOM   1945 C  CB    . VAL A 1  252 ? -24.536 42.572 -8.141  1.00 27.18 ? 249 VAL A CB    1 
ATOM   1946 C  CG1   . VAL A 1  252 ? -25.885 42.562 -8.813  1.00 25.61 ? 249 VAL A CG1   1 
ATOM   1947 C  CG2   . VAL A 1  252 ? -23.460 43.127 -9.100  1.00 26.59 ? 249 VAL A CG2   1 
ATOM   1948 N  N     . GLN A 1  253 ? -25.929 42.144 -5.260  1.00 25.69 ? 250 GLN A N     1 
ATOM   1949 C  CA    . GLN A 1  253 ? -27.052 41.876 -4.377  1.00 25.30 ? 250 GLN A CA    1 
ATOM   1950 C  C     . GLN A 1  253 ? -27.338 43.089 -3.476  1.00 24.98 ? 250 GLN A C     1 
ATOM   1951 O  O     . GLN A 1  253 ? -28.471 43.623 -3.444  1.00 23.77 ? 250 GLN A O     1 
ATOM   1952 C  CB    . GLN A 1  253 ? -26.762 40.622 -3.543  1.00 25.47 ? 250 GLN A CB    1 
ATOM   1953 C  CG    . GLN A 1  253 ? -27.836 40.294 -2.496  1.00 24.61 ? 250 GLN A CG    1 
ATOM   1954 C  CD    . GLN A 1  253 ? -27.466 39.061 -1.678  1.00 28.02 ? 250 GLN A CD    1 
ATOM   1955 O  OE1   . GLN A 1  253 ? -27.635 37.934 -2.125  1.00 27.12 ? 250 GLN A OE1   1 
ATOM   1956 N  NE2   . GLN A 1  253 ? -26.945 39.280 -0.478  1.00 28.64 ? 250 GLN A NE2   1 
ATOM   1957 N  N     . LEU A 1  254 ? -26.299 43.533 -2.772  1.00 24.62 ? 251 LEU A N     1 
ATOM   1958 C  CA    . LEU A 1  254 ? -26.433 44.674 -1.852  1.00 24.94 ? 251 LEU A CA    1 
ATOM   1959 C  C     . LEU A 1  254 ? -26.828 45.950 -2.599  1.00 24.93 ? 251 LEU A C     1 
ATOM   1960 O  O     . LEU A 1  254 ? -27.746 46.667 -2.170  1.00 24.86 ? 251 LEU A O     1 
ATOM   1961 C  CB    . LEU A 1  254 ? -25.144 44.880 -1.034  1.00 24.25 ? 251 LEU A CB    1 
ATOM   1962 C  CG    . LEU A 1  254 ? -25.085 46.051 -0.033  1.00 25.13 ? 251 LEU A CG    1 
ATOM   1963 C  CD1   . LEU A 1  254 ? -25.949 45.771 1.213   1.00 24.97 ? 251 LEU A CD1   1 
ATOM   1964 C  CD2   . LEU A 1  254 ? -23.618 46.376 0.339   1.00 22.29 ? 251 LEU A CD2   1 
ATOM   1965 N  N     . ALA A 1  255 ? -26.159 46.221 -3.722  1.00 24.85 ? 252 ALA A N     1 
ATOM   1966 C  CA    . ALA A 1  255 ? -26.436 47.446 -4.494  1.00 24.60 ? 252 ALA A CA    1 
ATOM   1967 C  C     . ALA A 1  255 ? -27.896 47.518 -4.939  1.00 24.22 ? 252 ALA A C     1 
ATOM   1968 O  O     . ALA A 1  255 ? -28.560 48.547 -4.784  1.00 23.83 ? 252 ALA A O     1 
ATOM   1969 C  CB    . ALA A 1  255 ? -25.504 47.550 -5.721  1.00 24.51 ? 252 ALA A CB    1 
ATOM   1970 N  N     . LEU A 1  256 ? -28.389 46.421 -5.501  1.00 24.06 ? 253 LEU A N     1 
ATOM   1971 C  CA    . LEU A 1  256 ? -29.759 46.395 -6.022  1.00 24.28 ? 253 LEU A CA    1 
ATOM   1972 C  C     . LEU A 1  256 ? -30.835 46.444 -4.922  1.00 23.86 ? 253 LEU A C     1 
ATOM   1973 O  O     . LEU A 1  256 ? -31.873 47.086 -5.091  1.00 23.82 ? 253 LEU A O     1 
ATOM   1974 C  CB    . LEU A 1  256 ? -29.952 45.197 -6.955  1.00 23.98 ? 253 LEU A CB    1 
ATOM   1975 C  CG    . LEU A 1  256 ? -29.170 45.186 -8.273  1.00 24.91 ? 253 LEU A CG    1 
ATOM   1976 C  CD1   . LEU A 1  256 ? -29.466 43.895 -9.038  1.00 26.18 ? 253 LEU A CD1   1 
ATOM   1977 C  CD2   . LEU A 1  256 ? -29.473 46.417 -9.121  1.00 24.64 ? 253 LEU A CD2   1 
ATOM   1978 N  N     . ASN A 1  257 ? -30.584 45.769 -3.805  1.00 23.80 ? 254 ASN A N     1 
ATOM   1979 C  CA    . ASN A 1  257 ? -31.504 45.800 -2.658  1.00 23.92 ? 254 ASN A CA    1 
ATOM   1980 C  C     . ASN A 1  257 ? -31.618 47.169 -2.015  1.00 24.03 ? 254 ASN A C     1 
ATOM   1981 O  O     . ASN A 1  257 ? -32.631 47.478 -1.390  1.00 25.28 ? 254 ASN A O     1 
ATOM   1982 C  CB    . ASN A 1  257 ? -31.126 44.729 -1.631  1.00 23.65 ? 254 ASN A CB    1 
ATOM   1983 C  CG    . ASN A 1  257 ? -31.539 43.334 -2.083  1.00 23.86 ? 254 ASN A CG    1 
ATOM   1984 O  OD1   . ASN A 1  257 ? -32.519 43.188 -2.817  1.00 24.49 ? 254 ASN A OD1   1 
ATOM   1985 N  ND2   . ASN A 1  257 ? -30.808 42.303 -1.644  1.00 22.68 ? 254 ASN A ND2   1 
ATOM   1986 N  N     . ASN A 1  258 ? -30.604 48.001 -2.219  1.00 23.83 ? 255 ASN A N     1 
ATOM   1987 C  CA    . ASN A 1  258 ? -30.623 49.372 -1.739  1.00 24.48 ? 255 ASN A CA    1 
ATOM   1988 C  C     . ASN A 1  258 ? -30.848 50.422 -2.832  1.00 24.41 ? 255 ASN A C     1 
ATOM   1989 O  O     . ASN A 1  258 ? -30.596 51.594 -2.635  1.00 24.30 ? 255 ASN A O     1 
ATOM   1990 C  CB    . ASN A 1  258 ? -29.358 49.643 -0.943  1.00 24.29 ? 255 ASN A CB    1 
ATOM   1991 C  CG    . ASN A 1  258 ? -29.369 48.904 0.376   1.00 26.38 ? 255 ASN A CG    1 
ATOM   1992 O  OD1   . ASN A 1  258 ? -30.066 49.323 1.317   1.00 24.36 ? 255 ASN A OD1   1 
ATOM   1993 N  ND2   . ASN A 1  258 ? -28.665 47.753 0.435   1.00 23.59 ? 255 ASN A ND2   1 
ATOM   1994 N  N     . THR A 1  259 ? -31.361 49.991 -3.977  1.00 24.26 ? 256 THR A N     1 
ATOM   1995 C  CA    . THR A 1  259 ? -31.660 50.915 -5.053  1.00 23.50 ? 256 THR A CA    1 
ATOM   1996 C  C     . THR A 1  259 ? -33.132 51.328 -5.023  1.00 23.19 ? 256 THR A C     1 
ATOM   1997 O  O     . THR A 1  259 ? -34.021 50.491 -4.907  1.00 23.73 ? 256 THR A O     1 
ATOM   1998 C  CB    . THR A 1  259 ? -31.284 50.278 -6.411  1.00 23.83 ? 256 THR A CB    1 
ATOM   1999 O  OG1   . THR A 1  259 ? -29.853 50.224 -6.515  1.00 24.01 ? 256 THR A OG1   1 
ATOM   2000 C  CG2   . THR A 1  259 ? -31.877 51.077 -7.593  1.00 23.05 ? 256 THR A CG2   1 
ATOM   2001 N  N     . TYR A 1  260 ? -33.401 52.618 -5.145  1.00 23.40 ? 257 TYR A N     1 
ATOM   2002 C  CA    . TYR A 1  260 ? -34.787 53.068 -5.234  1.00 24.12 ? 257 TYR A CA    1 
ATOM   2003 C  C     . TYR A 1  260 ? -35.453 52.626 -6.562  1.00 24.40 ? 257 TYR A C     1 
ATOM   2004 O  O     . TYR A 1  260 ? -34.852 52.760 -7.629  1.00 24.42 ? 257 TYR A O     1 
ATOM   2005 C  CB    . TYR A 1  260 ? -34.834 54.596 -5.128  1.00 24.01 ? 257 TYR A CB    1 
ATOM   2006 C  CG    . TYR A 1  260 ? -34.644 55.108 -3.719  1.00 25.62 ? 257 TYR A CG    1 
ATOM   2007 C  CD1   . TYR A 1  260 ? -35.745 55.320 -2.880  1.00 25.91 ? 257 TYR A CD1   1 
ATOM   2008 C  CD2   . TYR A 1  260 ? -33.358 55.387 -3.218  1.00 24.43 ? 257 TYR A CD2   1 
ATOM   2009 C  CE1   . TYR A 1  260 ? -35.571 55.795 -1.562  1.00 26.83 ? 257 TYR A CE1   1 
ATOM   2010 C  CE2   . TYR A 1  260 ? -33.174 55.857 -1.915  1.00 26.58 ? 257 TYR A CE2   1 
ATOM   2011 C  CZ    . TYR A 1  260 ? -34.281 56.056 -1.093  1.00 27.16 ? 257 TYR A CZ    1 
ATOM   2012 O  OH    . TYR A 1  260 ? -34.107 56.501 0.197   1.00 29.41 ? 257 TYR A OH    1 
ATOM   2013 N  N     . SER A 1  261 ? -36.687 52.123 -6.495  1.00 24.21 ? 258 SER A N     1 
ATOM   2014 C  CA    . SER A 1  261 ? -37.539 52.064 -7.681  1.00 24.57 ? 258 SER A CA    1 
ATOM   2015 C  C     . SER A 1  261 ? -38.305 53.397 -7.771  1.00 24.81 ? 258 SER A C     1 
ATOM   2016 O  O     . SER A 1  261 ? -39.007 53.780 -6.826  1.00 25.38 ? 258 SER A O     1 
ATOM   2017 C  CB    . SER A 1  261 ? -38.499 50.876 -7.597  1.00 24.13 ? 258 SER A CB    1 
ATOM   2018 O  OG    . SER A 1  261 ? -39.621 51.090 -8.429  1.00 25.15 ? 258 SER A OG    1 
ATOM   2019 N  N     . PRO A 1  262 ? -38.161 54.127 -8.891  1.00 25.14 ? 259 PRO A N     1 
ATOM   2020 C  CA    . PRO A 1  262 ? -38.816 55.449 -8.982  1.00 24.75 ? 259 PRO A CA    1 
ATOM   2021 C  C     . PRO A 1  262 ? -40.339 55.455 -8.835  1.00 24.87 ? 259 PRO A C     1 
ATOM   2022 O  O     . PRO A 1  262 ? -40.880 56.416 -8.288  1.00 24.19 ? 259 PRO A O     1 
ATOM   2023 C  CB    . PRO A 1  262 ? -38.387 55.964 -10.359 1.00 24.72 ? 259 PRO A CB    1 
ATOM   2024 C  CG    . PRO A 1  262 ? -37.045 55.326 -10.565 1.00 24.68 ? 259 PRO A CG    1 
ATOM   2025 C  CD    . PRO A 1  262 ? -37.186 53.926 -9.981  1.00 25.01 ? 259 PRO A CD    1 
ATOM   2026 N  N     . VAL A 1  263 ? -41.034 54.404 -9.275  1.00 25.14 ? 260 VAL A N     1 
ATOM   2027 C  CA    . VAL A 1  263 ? -42.503 54.384 -9.117  1.00 25.51 ? 260 VAL A CA    1 
ATOM   2028 C  C     . VAL A 1  263 ? -42.872 54.116 -7.645  1.00 26.22 ? 260 VAL A C     1 
ATOM   2029 O  O     . VAL A 1  263 ? -43.947 54.501 -7.178  1.00 26.36 ? 260 VAL A O     1 
ATOM   2030 C  CB    . VAL A 1  263 ? -43.204 53.374 -10.089 1.00 25.45 ? 260 VAL A CB    1 
ATOM   2031 C  CG1   . VAL A 1  263 ? -42.892 51.940 -9.718  1.00 24.38 ? 260 VAL A CG1   1 
ATOM   2032 C  CG2   . VAL A 1  263 ? -44.727 53.612 -10.142 1.00 26.03 ? 260 VAL A CG2   1 
ATOM   2033 N  N     . LEU A 1  264 ? -41.972 53.478 -6.907  1.00 25.73 ? 261 LEU A N     1 
ATOM   2034 C  CA    . LEU A 1  264 ? -42.248 53.182 -5.505  1.00 26.71 ? 261 LEU A CA    1 
ATOM   2035 C  C     . LEU A 1  264 ? -41.764 54.273 -4.557  1.00 27.62 ? 261 LEU A C     1 
ATOM   2036 O  O     . LEU A 1  264 ? -42.426 54.576 -3.564  1.00 28.56 ? 261 LEU A O     1 
ATOM   2037 C  CB    . LEU A 1  264 ? -41.647 51.828 -5.114  1.00 25.53 ? 261 LEU A CB    1 
ATOM   2038 C  CG    . LEU A 1  264 ? -42.242 50.633 -5.866  1.00 26.13 ? 261 LEU A CG    1 
ATOM   2039 C  CD1   . LEU A 1  264 ? -41.677 49.333 -5.318  1.00 27.09 ? 261 LEU A CD1   1 
ATOM   2040 C  CD2   . LEU A 1  264 ? -43.785 50.618 -5.822  1.00 25.39 ? 261 LEU A CD2   1 
ATOM   2041 N  N     . LYS A 1  265 ? -40.608 54.847 -4.878  1.00 28.46 ? 262 LYS A N     1 
ATOM   2042 C  CA    . LYS A 1  265 ? -39.874 55.777 -4.008  1.00 29.74 ? 262 LYS A CA    1 
ATOM   2043 C  C     . LYS A 1  265 ? -39.335 55.107 -2.736  1.00 29.50 ? 262 LYS A C     1 
ATOM   2044 O  O     . LYS A 1  265 ? -39.071 55.773 -1.742  1.00 29.82 ? 262 LYS A O     1 
ATOM   2045 C  CB    . LYS A 1  265 ? -40.702 57.036 -3.685  1.00 30.68 ? 262 LYS A CB    1 
ATOM   2046 C  CG    . LYS A 1  265 ? -41.539 57.594 -4.869  1.00 33.90 ? 262 LYS A CG    1 
ATOM   2047 C  CD    . LYS A 1  265 ? -41.107 58.940 -5.358  1.00 36.61 ? 262 LYS A CD    1 
ATOM   2048 C  CE    . LYS A 1  265 ? -41.653 60.050 -4.458  1.00 40.76 ? 262 LYS A CE    1 
ATOM   2049 N  NZ    . LYS A 1  265 ? -43.142 60.090 -4.439  1.00 41.47 ? 262 LYS A NZ    1 
ATOM   2050 N  N     . TYR A 1  266 ? -39.167 53.784 -2.791  1.00 28.90 ? 263 TYR A N     1 
ATOM   2051 C  CA    . TYR A 1  266 ? -38.516 53.007 -1.743  1.00 28.26 ? 263 TYR A CA    1 
ATOM   2052 C  C     . TYR A 1  266 ? -37.586 51.978 -2.365  1.00 27.42 ? 263 TYR A C     1 
ATOM   2053 O  O     . TYR A 1  266 ? -37.733 51.631 -3.545  1.00 26.52 ? 263 TYR A O     1 
ATOM   2054 C  CB    . TYR A 1  266 ? -39.554 52.299 -0.855  1.00 28.47 ? 263 TYR A CB    1 
ATOM   2055 C  CG    . TYR A 1  266 ? -40.482 53.264 -0.181  1.00 30.45 ? 263 TYR A CG    1 
ATOM   2056 C  CD1   . TYR A 1  266 ? -40.074 53.962 0.960   1.00 32.23 ? 263 TYR A CD1   1 
ATOM   2057 C  CD2   . TYR A 1  266 ? -41.759 53.515 -0.700  1.00 31.48 ? 263 TYR A CD2   1 
ATOM   2058 C  CE1   . TYR A 1  266 ? -40.917 54.894 1.576   1.00 34.61 ? 263 TYR A CE1   1 
ATOM   2059 C  CE2   . TYR A 1  266 ? -42.600 54.437 -0.101  1.00 33.94 ? 263 TYR A CE2   1 
ATOM   2060 C  CZ    . TYR A 1  266 ? -42.171 55.118 1.046   1.00 35.23 ? 263 TYR A CZ    1 
ATOM   2061 O  OH    . TYR A 1  266 ? -43.000 56.020 1.664   1.00 37.88 ? 263 TYR A OH    1 
ATOM   2062 N  N     . THR A 1  267 ? -36.627 51.507 -1.562  1.00 25.91 ? 264 THR A N     1 
ATOM   2063 C  CA    . THR A 1  267 ? -35.723 50.439 -1.945  1.00 24.17 ? 264 THR A CA    1 
ATOM   2064 C  C     . THR A 1  267 ? -36.324 49.144 -1.379  1.00 24.26 ? 264 THR A C     1 
ATOM   2065 O  O     . THR A 1  267 ? -37.071 49.203 -0.416  1.00 24.23 ? 264 THR A O     1 
ATOM   2066 C  CB    . THR A 1  267 ? -34.329 50.643 -1.315  1.00 24.36 ? 264 THR A CB    1 
ATOM   2067 O  OG1   . THR A 1  267 ? -34.411 50.458 0.108   1.00 22.00 ? 264 THR A OG1   1 
ATOM   2068 C  CG2   . THR A 1  267 ? -33.789 52.056 -1.613  1.00 21.93 ? 264 THR A CG2   1 
ATOM   2069 N  N     . PRO A 1  268 ? -35.992 47.983 -1.961  1.00 23.53 ? 265 PRO A N     1 
ATOM   2070 C  CA    . PRO A 1  268 ? -36.430 46.714 -1.387  1.00 23.44 ? 265 PRO A CA    1 
ATOM   2071 C  C     . PRO A 1  268 ? -35.997 46.551 0.065   1.00 23.25 ? 265 PRO A C     1 
ATOM   2072 O  O     . PRO A 1  268 ? -36.763 46.033 0.869   1.00 23.38 ? 265 PRO A O     1 
ATOM   2073 C  CB    . PRO A 1  268 ? -35.732 45.659 -2.277  1.00 22.92 ? 265 PRO A CB    1 
ATOM   2074 C  CG    . PRO A 1  268 ? -35.588 46.381 -3.627  1.00 24.02 ? 265 PRO A CG    1 
ATOM   2075 C  CD    . PRO A 1  268 ? -35.253 47.799 -3.235  1.00 24.14 ? 265 PRO A CD    1 
ATOM   2076 N  N     . HIS A 1  269 ? -34.783 46.982 0.391   1.00 23.29 ? 266 HIS A N     1 
ATOM   2077 C  CA    . HIS A 1  269 ? -34.296 46.969 1.798   1.00 23.92 ? 266 HIS A CA    1 
ATOM   2078 C  C     . HIS A 1  269 ? -35.238 47.711 2.745   1.00 23.85 ? 266 HIS A C     1 
ATOM   2079 O  O     . HIS A 1  269 ? -35.600 47.208 3.815   1.00 24.22 ? 266 HIS A O     1 
ATOM   2080 C  CB    . HIS A 1  269 ? -32.889 47.588 1.884   1.00 23.15 ? 266 HIS A CB    1 
ATOM   2081 C  CG    . HIS A 1  269 ? -32.334 47.634 3.272   1.00 23.34 ? 266 HIS A CG    1 
ATOM   2082 N  ND1   . HIS A 1  269 ? -31.384 46.744 3.725   1.00 23.83 ? 266 HIS A ND1   1 
ATOM   2083 C  CD2   . HIS A 1  269 ? -32.600 48.462 4.310   1.00 22.94 ? 266 HIS A CD2   1 
ATOM   2084 C  CE1   . HIS A 1  269 ? -31.087 47.021 4.985   1.00 24.38 ? 266 HIS A CE1   1 
ATOM   2085 N  NE2   . HIS A 1  269 ? -31.819 48.052 5.367   1.00 24.02 ? 266 HIS A NE2   1 
ATOM   2086 N  N     . GLN A 1  270 ? -35.638 48.909 2.348   1.00 24.23 ? 267 GLN A N     1 
ATOM   2087 C  CA    . GLN A 1  270 ? -36.537 49.713 3.174   1.00 24.97 ? 267 GLN A CA    1 
ATOM   2088 C  C     . GLN A 1  270 ? -37.873 49.033 3.339   1.00 25.11 ? 267 GLN A C     1 
ATOM   2089 O  O     . GLN A 1  270 ? -38.481 49.117 4.414   1.00 25.38 ? 267 GLN A O     1 
ATOM   2090 C  CB    . GLN A 1  270 ? -36.738 51.104 2.588   1.00 24.87 ? 267 GLN A CB    1 
ATOM   2091 C  CG    . GLN A 1  270 ? -35.507 51.980 2.697   1.00 25.43 ? 267 GLN A CG    1 
ATOM   2092 C  CD    . GLN A 1  270 ? -35.478 53.098 1.677   1.00 25.96 ? 267 GLN A CD    1 
ATOM   2093 O  OE1   . GLN A 1  270 ? -36.363 53.202 0.820   1.00 25.31 ? 267 GLN A OE1   1 
ATOM   2094 N  NE2   . GLN A 1  270 ? -34.445 53.939 1.752   1.00 25.63 ? 267 GLN A NE2   1 
ATOM   2095 N  N     . LEU A 1  271 ? -38.326 48.341 2.288   1.00 24.80 ? 268 LEU A N     1 
ATOM   2096 C  CA    . LEU A 1  271 ? -39.640 47.694 2.327   1.00 23.98 ? 268 LEU A CA    1 
ATOM   2097 C  C     . LEU A 1  271 ? -39.601 46.473 3.219   1.00 23.68 ? 268 LEU A C     1 
ATOM   2098 O  O     . LEU A 1  271 ? -40.620 46.103 3.816   1.00 23.66 ? 268 LEU A O     1 
ATOM   2099 C  CB    . LEU A 1  271 ? -40.123 47.300 0.925   1.00 23.84 ? 268 LEU A CB    1 
ATOM   2100 C  CG    . LEU A 1  271 ? -40.508 48.460 0.000   1.00 25.15 ? 268 LEU A CG    1 
ATOM   2101 C  CD1   . LEU A 1  271 ? -40.936 47.956 -1.398  1.00 23.24 ? 268 LEU A CD1   1 
ATOM   2102 C  CD2   . LEU A 1  271 ? -41.625 49.298 0.639   1.00 23.04 ? 268 LEU A CD2   1 
ATOM   2103 N  N     . LEU A 1  272 ? -38.433 45.834 3.270   1.00 23.11 ? 269 LEU A N     1 
ATOM   2104 C  CA    . LEU A 1  272 ? -38.220 44.669 4.126   1.00 23.25 ? 269 LEU A CA    1 
ATOM   2105 C  C     . LEU A 1  272 ? -38.008 44.988 5.618   1.00 23.07 ? 269 LEU A C     1 
ATOM   2106 O  O     . LEU A 1  272 ? -38.606 44.338 6.467   1.00 24.10 ? 269 LEU A O     1 
ATOM   2107 C  CB    . LEU A 1  272 ? -37.047 43.828 3.609   1.00 23.02 ? 269 LEU A CB    1 
ATOM   2108 C  CG    . LEU A 1  272 ? -36.765 42.511 4.346   1.00 22.75 ? 269 LEU A CG    1 
ATOM   2109 C  CD1   . LEU A 1  272 ? -38.032 41.623 4.369   1.00 19.93 ? 269 LEU A CD1   1 
ATOM   2110 C  CD2   . LEU A 1  272 ? -35.580 41.764 3.677   1.00 23.96 ? 269 LEU A CD2   1 
ATOM   2111 N  N     . PHE A 1  273 ? -37.169 45.983 5.917   1.00 23.95 ? 270 PHE A N     1 
ATOM   2112 C  CA    . PHE A 1  273 ? -36.699 46.301 7.289   1.00 24.17 ? 270 PHE A CA    1 
ATOM   2113 C  C     . PHE A 1  273 ? -37.265 47.603 7.884   1.00 24.70 ? 270 PHE A C     1 
ATOM   2114 O  O     . PHE A 1  273 ? -37.331 47.760 9.105   1.00 24.64 ? 270 PHE A O     1 
ATOM   2115 C  CB    . PHE A 1  273 ? -35.184 46.431 7.280   1.00 23.00 ? 270 PHE A CB    1 
ATOM   2116 C  CG    . PHE A 1  273 ? -34.467 45.155 6.933   1.00 24.62 ? 270 PHE A CG    1 
ATOM   2117 C  CD1   . PHE A 1  273 ? -33.659 45.085 5.790   1.00 23.89 ? 270 PHE A CD1   1 
ATOM   2118 C  CD2   . PHE A 1  273 ? -34.578 44.035 7.751   1.00 22.84 ? 270 PHE A CD2   1 
ATOM   2119 C  CE1   . PHE A 1  273 ? -32.978 43.920 5.469   1.00 23.30 ? 270 PHE A CE1   1 
ATOM   2120 C  CE2   . PHE A 1  273 ? -33.891 42.874 7.448   1.00 23.81 ? 270 PHE A CE2   1 
ATOM   2121 C  CZ    . PHE A 1  273 ? -33.093 42.812 6.291   1.00 25.31 ? 270 PHE A CZ    1 
ATOM   2122 N  N     . GLY A 1  274 ? -37.628 48.549 7.027   1.00 24.86 ? 271 GLY A N     1 
ATOM   2123 C  CA    . GLY A 1  274 ? -38.270 49.773 7.493   1.00 25.15 ? 271 GLY A CA    1 
ATOM   2124 C  C     . GLY A 1  274 ? -37.262 50.822 7.909   1.00 25.40 ? 271 GLY A C     1 
ATOM   2125 O  O     . GLY A 1  274 ? -37.649 51.888 8.408   1.00 25.62 ? 271 GLY A O     1 
ATOM   2126 N  N     . ILE A 1  275 ? -35.972 50.519 7.702   1.00 25.09 ? 272 ILE A N     1 
ATOM   2127 C  CA    . ILE A 1  275 ? -34.877 51.434 8.014   1.00 25.15 ? 272 ILE A CA    1 
ATOM   2128 C  C     . ILE A 1  275 ? -33.641 50.988 7.236   1.00 25.67 ? 272 ILE A C     1 
ATOM   2129 O  O     . ILE A 1  275 ? -33.384 49.789 7.103   1.00 26.11 ? 272 ILE A O     1 
ATOM   2130 C  CB    . ILE A 1  275 ? -34.561 51.438 9.556   1.00 25.30 ? 272 ILE A CB    1 
ATOM   2131 C  CG1   . ILE A 1  275 ? -33.494 52.493 9.913   1.00 26.46 ? 272 ILE A CG1   1 
ATOM   2132 C  CG2   . ILE A 1  275 ? -34.161 50.029 10.047  1.00 23.89 ? 272 ILE A CG2   1 
ATOM   2133 C  CD1   . ILE A 1  275 ? -33.247 52.649 11.439  1.00 28.24 ? 272 ILE A CD1   1 
ATOM   2134 N  N     . ASP A 1  276 ? -32.884 51.951 6.724   1.00 25.89 ? 273 ASP A N     1 
ATOM   2135 C  CA    . ASP A 1  276 ? -31.639 51.669 6.032   1.00 25.78 ? 273 ASP A CA    1 
ATOM   2136 C  C     . ASP A 1  276 ? -30.593 51.175 7.020   1.00 26.29 ? 273 ASP A C     1 
ATOM   2137 O  O     . ASP A 1  276 ? -30.599 51.597 8.179   1.00 25.69 ? 273 ASP A O     1 
ATOM   2138 C  CB    . ASP A 1  276 ? -31.126 52.935 5.364   1.00 25.75 ? 273 ASP A CB    1 
ATOM   2139 C  CG    . ASP A 1  276 ? -31.754 53.175 4.000   1.00 26.29 ? 273 ASP A CG    1 
ATOM   2140 O  OD1   . ASP A 1  276 ? -32.429 52.271 3.490   1.00 28.37 ? 273 ASP A OD1   1 
ATOM   2141 O  OD2   . ASP A 1  276 ? -31.588 54.283 3.451   1.00 27.55 ? 273 ASP A OD2   1 
ATOM   2142 N  N     . SER A 1  277 ? -29.720 50.276 6.568   1.00 25.64 ? 274 SER A N     1 
ATOM   2143 C  CA    . SER A 1  277 ? -28.565 49.880 7.359   1.00 25.79 ? 274 SER A CA    1 
ATOM   2144 C  C     . SER A 1  277 ? -27.420 50.870 7.079   1.00 25.75 ? 274 SER A C     1 
ATOM   2145 O  O     . SER A 1  277 ? -27.644 51.932 6.483   1.00 25.86 ? 274 SER A O     1 
ATOM   2146 C  CB    . SER A 1  277 ? -28.187 48.397 7.124   1.00 25.31 ? 274 SER A CB    1 
ATOM   2147 O  OG    . SER A 1  277 ? -27.597 48.153 5.854   1.00 25.98 ? 274 SER A OG    1 
ATOM   2148 N  N     . ASN A 1  278 ? -26.215 50.556 7.532   1.00 25.54 ? 275 ASN A N     1 
ATOM   2149 C  CA    . ASN A 1  278 ? -25.069 51.451 7.339   1.00 26.35 ? 275 ASN A CA    1 
ATOM   2150 C  C     . ASN A 1  278 ? -24.485 51.354 5.913   1.00 26.58 ? 275 ASN A C     1 
ATOM   2151 O  O     . ASN A 1  278 ? -23.328 50.891 5.705   1.00 26.40 ? 275 ASN A O     1 
ATOM   2152 C  CB    . ASN A 1  278 ? -23.998 51.153 8.393   1.00 26.15 ? 275 ASN A CB    1 
ATOM   2153 C  CG    . ASN A 1  278 ? -22.811 52.112 8.329   1.00 27.99 ? 275 ASN A CG    1 
ATOM   2154 O  OD1   . ASN A 1  278 ? -22.951 53.273 7.919   1.00 29.59 ? 275 ASN A OD1   1 
ATOM   2155 N  ND2   . ASN A 1  278 ? -21.635 51.630 8.755   1.00 27.54 ? 275 ASN A ND2   1 
ATOM   2156 N  N     . THR A 1  279 ? -25.292 51.776 4.938   1.00 26.59 ? 276 THR A N     1 
ATOM   2157 C  CA    . THR A 1  279 ? -24.862 51.838 3.540   1.00 26.78 ? 276 THR A CA    1 
ATOM   2158 C  C     . THR A 1  279 ? -24.802 53.308 3.099   1.00 26.93 ? 276 THR A C     1 
ATOM   2159 O  O     . THR A 1  279 ? -25.359 54.171 3.764   1.00 26.73 ? 276 THR A O     1 
ATOM   2160 C  CB    . THR A 1  279 ? -25.792 51.018 2.591   1.00 26.91 ? 276 THR A CB    1 
ATOM   2161 O  OG1   . THR A 1  279 ? -27.160 51.314 2.879   1.00 26.18 ? 276 THR A OG1   1 
ATOM   2162 C  CG2   . THR A 1  279 ? -25.551 49.516 2.752   1.00 26.61 ? 276 THR A CG2   1 
ATOM   2163 N  N     . PRO A 1  280 ? -24.110 53.600 1.982   1.00 27.37 ? 277 PRO A N     1 
ATOM   2164 C  CA    . PRO A 1  280 ? -23.996 55.006 1.571   1.00 27.20 ? 277 PRO A CA    1 
ATOM   2165 C  C     . PRO A 1  280 ? -25.353 55.691 1.346   1.00 27.42 ? 277 PRO A C     1 
ATOM   2166 O  O     . PRO A 1  280 ? -26.286 55.065 0.848   1.00 27.43 ? 277 PRO A O     1 
ATOM   2167 C  CB    . PRO A 1  280 ? -23.198 54.923 0.276   1.00 27.12 ? 277 PRO A CB    1 
ATOM   2168 C  CG    . PRO A 1  280 ? -22.373 53.644 0.424   1.00 28.06 ? 277 PRO A CG    1 
ATOM   2169 C  CD    . PRO A 1  280 ? -23.296 52.696 1.136   1.00 26.93 ? 277 PRO A CD    1 
ATOM   2170 N  N     . PHE A 1  281 ? -25.446 56.962 1.724   1.00 27.39 ? 278 PHE A N     1 
ATOM   2171 C  CA    . PHE A 1  281 ? -26.659 57.781 1.540   1.00 28.14 ? 278 PHE A CA    1 
ATOM   2172 C  C     . PHE A 1  281 ? -27.896 57.203 2.231   1.00 29.64 ? 278 PHE A C     1 
ATOM   2173 O  O     . PHE A 1  281 ? -29.017 57.273 1.687   1.00 29.57 ? 278 PHE A O     1 
ATOM   2174 C  CB    . PHE A 1  281 ? -26.959 58.037 0.045   1.00 27.53 ? 278 PHE A CB    1 
ATOM   2175 C  CG    . PHE A 1  281 ? -25.831 58.705 -0.703  1.00 26.67 ? 278 PHE A CG    1 
ATOM   2176 C  CD1   . PHE A 1  281 ? -25.809 60.103 -0.860  1.00 26.11 ? 278 PHE A CD1   1 
ATOM   2177 C  CD2   . PHE A 1  281 ? -24.794 57.952 -1.249  1.00 24.84 ? 278 PHE A CD2   1 
ATOM   2178 C  CE1   . PHE A 1  281 ? -24.768 60.731 -1.531  1.00 23.43 ? 278 PHE A CE1   1 
ATOM   2179 C  CE2   . PHE A 1  281 ? -23.731 58.573 -1.936  1.00 26.20 ? 278 PHE A CE2   1 
ATOM   2180 C  CZ    . PHE A 1  281 ? -23.729 59.977 -2.081  1.00 24.36 ? 278 PHE A CZ    1 
ATOM   2181 N  N     . ALA A 1  282 ? -27.697 56.651 3.429   1.00 30.43 ? 279 ALA A N     1 
ATOM   2182 C  CA    . ALA A 1  282 ? -28.788 56.077 4.207   1.00 31.53 ? 279 ALA A CA    1 
ATOM   2183 C  C     . ALA A 1  282 ? -29.837 57.133 4.535   1.00 32.06 ? 279 ALA A C     1 
ATOM   2184 O  O     . ALA A 1  282 ? -29.502 58.264 4.864   1.00 32.35 ? 279 ALA A O     1 
ATOM   2185 C  CB    . ALA A 1  282 ? -28.243 55.428 5.497   1.00 31.19 ? 279 ALA A CB    1 
ATOM   2186 N  N     . ASN A 1  283 ? -31.106 56.774 4.417   1.00 33.25 ? 280 ASN A N     1 
ATOM   2187 C  CA    . ASN A 1  283 ? -32.174 57.688 4.783   1.00 34.71 ? 280 ASN A CA    1 
ATOM   2188 C  C     . ASN A 1  283 ? -32.245 57.843 6.312   1.00 35.95 ? 280 ASN A C     1 
ATOM   2189 O  O     . ASN A 1  283 ? -32.052 56.880 7.056   1.00 35.89 ? 280 ASN A O     1 
ATOM   2190 C  CB    . ASN A 1  283 ? -33.510 57.225 4.206   1.00 34.07 ? 280 ASN A CB    1 
ATOM   2191 C  CG    . ASN A 1  283 ? -34.667 58.145 4.587   1.00 34.88 ? 280 ASN A CG    1 
ATOM   2192 O  OD1   . ASN A 1  283 ? -35.177 58.088 5.711   1.00 33.51 ? 280 ASN A OD1   1 
ATOM   2193 N  ND2   . ASN A 1  283 ? -35.096 58.989 3.644   1.00 33.62 ? 280 ASN A ND2   1 
ATOM   2194 N  N     . GLN A 1  284 ? -32.529 59.061 6.756   1.00 37.08 ? 281 GLN A N     1 
ATOM   2195 C  CA    . GLN A 1  284 ? -32.497 59.413 8.168   1.00 38.85 ? 281 GLN A CA    1 
ATOM   2196 C  C     . GLN A 1  284 ? -33.820 59.965 8.703   1.00 38.51 ? 281 GLN A C     1 
ATOM   2197 O  O     . GLN A 1  284 ? -33.843 60.535 9.790   1.00 39.31 ? 281 GLN A O     1 
ATOM   2198 C  CB    . GLN A 1  284 ? -31.451 60.498 8.382   1.00 39.38 ? 281 GLN A CB    1 
ATOM   2199 C  CG    . GLN A 1  284 ? -30.026 60.034 8.508   1.00 42.86 ? 281 GLN A CG    1 
ATOM   2200 C  CD    . GLN A 1  284 ? -29.100 61.235 8.611   1.00 47.19 ? 281 GLN A CD    1 
ATOM   2201 O  OE1   . GLN A 1  284 ? -28.488 61.633 7.629   1.00 50.15 ? 281 GLN A OE1   1 
ATOM   2202 N  NE2   . GLN A 1  284 ? -29.045 61.854 9.792   1.00 49.45 ? 281 GLN A NE2   1 
ATOM   2203 N  N     . ASP A 1  285 ? -34.906 59.811 7.959   1.00 38.24 ? 282 ASP A N     1 
ATOM   2204 C  CA    . ASP A 1  285 ? -36.164 60.471 8.313   1.00 38.17 ? 282 ASP A CA    1 
ATOM   2205 C  C     . ASP A 1  285 ? -36.853 59.938 9.562   1.00 37.78 ? 282 ASP A C     1 
ATOM   2206 O  O     . ASP A 1  285 ? -37.736 60.601 10.102  1.00 37.82 ? 282 ASP A O     1 
ATOM   2207 C  CB    . ASP A 1  285 ? -37.146 60.445 7.137   1.00 38.19 ? 282 ASP A CB    1 
ATOM   2208 C  CG    . ASP A 1  285 ? -36.616 61.175 5.912   1.00 39.90 ? 282 ASP A CG    1 
ATOM   2209 O  OD1   . ASP A 1  285 ? -35.621 61.935 6.044   1.00 39.94 ? 282 ASP A OD1   1 
ATOM   2210 O  OD2   . ASP A 1  285 ? -37.188 60.962 4.814   1.00 40.74 ? 282 ASP A OD2   1 
ATOM   2211 N  N     . THR A 1  286 ? -36.475 58.749 10.019  1.00 37.24 ? 283 THR A N     1 
ATOM   2212 C  CA    . THR A 1  286 ? -37.155 58.150 11.173  1.00 36.84 ? 283 THR A CA    1 
ATOM   2213 C  C     . THR A 1  286 ? -36.236 58.018 12.381  1.00 36.79 ? 283 THR A C     1 
ATOM   2214 O  O     . THR A 1  286 ? -36.550 57.314 13.337  1.00 36.19 ? 283 THR A O     1 
ATOM   2215 C  CB    . THR A 1  286 ? -37.753 56.769 10.842  1.00 37.13 ? 283 THR A CB    1 
ATOM   2216 O  OG1   . THR A 1  286 ? -36.689 55.855 10.551  1.00 36.28 ? 283 THR A OG1   1 
ATOM   2217 C  CG2   . THR A 1  286 ? -38.737 56.847 9.671   1.00 36.46 ? 283 THR A CG2   1 
ATOM   2218 N  N     . LEU A 1  287 ? -35.108 58.711 12.328  1.00 37.14 ? 284 LEU A N     1 
ATOM   2219 C  CA    . LEU A 1  287 ? -34.142 58.753 13.427  1.00 38.59 ? 284 LEU A CA    1 
ATOM   2220 C  C     . LEU A 1  287 ? -34.752 59.078 14.809  1.00 38.83 ? 284 LEU A C     1 
ATOM   2221 O  O     . LEU A 1  287 ? -34.333 58.505 15.833  1.00 38.87 ? 284 LEU A O     1 
ATOM   2222 C  CB    . LEU A 1  287 ? -33.082 59.796 13.086  1.00 39.21 ? 284 LEU A CB    1 
ATOM   2223 C  CG    . LEU A 1  287 ? -31.606 59.535 13.343  1.00 41.80 ? 284 LEU A CG    1 
ATOM   2224 C  CD1   . LEU A 1  287 ? -31.163 58.153 12.854  1.00 43.29 ? 284 LEU A CD1   1 
ATOM   2225 C  CD2   . LEU A 1  287 ? -30.828 60.636 12.630  1.00 44.03 ? 284 LEU A CD2   1 
ATOM   2226 N  N     . ASP A 1  288 ? -35.737 59.980 14.840  1.00 38.47 ? 285 ASP A N     1 
ATOM   2227 C  CA    . ASP A 1  288 ? -36.378 60.366 16.105  1.00 39.14 ? 285 ASP A CA    1 
ATOM   2228 C  C     . ASP A 1  288 ? -37.571 59.506 16.506  1.00 38.16 ? 285 ASP A C     1 
ATOM   2229 O  O     . ASP A 1  288 ? -38.100 59.680 17.594  1.00 38.74 ? 285 ASP A O     1 
ATOM   2230 C  CB    . ASP A 1  288 ? -36.792 61.845 16.096  1.00 39.56 ? 285 ASP A CB    1 
ATOM   2231 C  CG    . ASP A 1  288 ? -35.599 62.788 16.011  1.00 42.94 ? 285 ASP A CG    1 
ATOM   2232 O  OD1   . ASP A 1  288 ? -34.529 62.501 16.599  1.00 45.54 ? 285 ASP A OD1   1 
ATOM   2233 O  OD2   . ASP A 1  288 ? -35.737 63.830 15.342  1.00 48.35 ? 285 ASP A OD2   1 
ATOM   2234 N  N     . LEU A 1  289 ? -37.993 58.582 15.645  1.00 37.28 ? 286 LEU A N     1 
ATOM   2235 C  CA    . LEU A 1  289 ? -39.070 57.651 15.996  1.00 35.81 ? 286 LEU A CA    1 
ATOM   2236 C  C     . LEU A 1  289 ? -38.537 56.453 16.773  1.00 34.74 ? 286 LEU A C     1 
ATOM   2237 O  O     . LEU A 1  289 ? -37.378 56.096 16.634  1.00 34.36 ? 286 LEU A O     1 
ATOM   2238 C  CB    . LEU A 1  289 ? -39.795 57.174 14.736  1.00 36.18 ? 286 LEU A CB    1 
ATOM   2239 C  CG    . LEU A 1  289 ? -40.472 58.245 13.874  1.00 37.65 ? 286 LEU A CG    1 
ATOM   2240 C  CD1   . LEU A 1  289 ? -41.112 57.594 12.657  1.00 36.67 ? 286 LEU A CD1   1 
ATOM   2241 C  CD2   . LEU A 1  289 ? -41.509 59.047 14.692  1.00 37.32 ? 286 LEU A CD2   1 
ATOM   2242 N  N     . THR A 1  290 ? -39.375 55.833 17.599  1.00 33.87 ? 287 THR A N     1 
ATOM   2243 C  CA    . THR A 1  290 ? -38.991 54.574 18.236  1.00 33.24 ? 287 THR A CA    1 
ATOM   2244 C  C     . THR A 1  290 ? -39.126 53.462 17.185  1.00 32.85 ? 287 THR A C     1 
ATOM   2245 O  O     . THR A 1  290 ? -39.775 53.656 16.156  1.00 32.43 ? 287 THR A O     1 
ATOM   2246 C  CB    . THR A 1  290 ? -39.915 54.215 19.426  1.00 33.35 ? 287 THR A CB    1 
ATOM   2247 O  OG1   . THR A 1  290 ? -41.256 54.093 18.949  1.00 33.00 ? 287 THR A OG1   1 
ATOM   2248 C  CG2   . THR A 1  290 ? -39.850 55.281 20.546  1.00 32.77 ? 287 THR A CG2   1 
ATOM   2249 N  N     . ARG A 1  291 ? -38.561 52.287 17.453  1.00 32.63 ? 288 ARG A N     1 
ATOM   2250 C  CA    . ARG A 1  291 ? -38.728 51.177 16.519  1.00 32.16 ? 288 ARG A CA    1 
ATOM   2251 C  C     . ARG A 1  291 ? -40.217 50.843 16.294  1.00 32.82 ? 288 ARG A C     1 
ATOM   2252 O  O     . ARG A 1  291 ? -40.640 50.643 15.147  1.00 31.44 ? 288 ARG A O     1 
ATOM   2253 C  CB    . ARG A 1  291 ? -37.920 49.950 16.948  1.00 31.93 ? 288 ARG A CB    1 
ATOM   2254 C  CG    . ARG A 1  291 ? -37.948 48.770 15.959  1.00 29.33 ? 288 ARG A CG    1 
ATOM   2255 C  CD    . ARG A 1  291 ? -37.563 49.172 14.514  1.00 26.64 ? 288 ARG A CD    1 
ATOM   2256 N  NE    . ARG A 1  291 ? -37.438 47.984 13.665  1.00 27.46 ? 288 ARG A NE    1 
ATOM   2257 C  CZ    . ARG A 1  291 ? -37.254 48.006 12.337  1.00 27.40 ? 288 ARG A CZ    1 
ATOM   2258 N  NH1   . ARG A 1  291 ? -37.212 49.164 11.673  1.00 25.21 ? 288 ARG A NH1   1 
ATOM   2259 N  NH2   . ARG A 1  291 ? -37.139 46.864 11.660  1.00 25.11 ? 288 ARG A NH2   1 
ATOM   2260 N  N     . GLU A 1  292 ? -41.009 50.803 17.370  1.00 33.19 ? 289 GLU A N     1 
ATOM   2261 C  CA    . GLU A 1  292 ? -42.454 50.529 17.238  1.00 34.35 ? 289 GLU A CA    1 
ATOM   2262 C  C     . GLU A 1  292 ? -43.177 51.530 16.315  1.00 33.90 ? 289 GLU A C     1 
ATOM   2263 O  O     . GLU A 1  292 ? -44.013 51.135 15.508  1.00 33.30 ? 289 GLU A O     1 
ATOM   2264 C  CB    . GLU A 1  292 ? -43.153 50.390 18.609  1.00 35.03 ? 289 GLU A CB    1 
ATOM   2265 C  CG    . GLU A 1  292 ? -42.625 49.201 19.448  1.00 40.02 ? 289 GLU A CG    1 
ATOM   2266 C  CD    . GLU A 1  292 ? -43.526 48.793 20.628  1.00 47.06 ? 289 GLU A CD    1 
ATOM   2267 O  OE1   . GLU A 1  292 ? -42.968 48.306 21.644  1.00 50.00 ? 289 GLU A OE1   1 
ATOM   2268 O  OE2   . GLU A 1  292 ? -44.775 48.930 20.544  1.00 49.43 ? 289 GLU A OE2   1 
ATOM   2269 N  N     . GLU A 1  293 ? -42.829 52.811 16.416  1.00 33.88 ? 290 GLU A N     1 
ATOM   2270 C  CA    . GLU A 1  293 ? -43.408 53.845 15.545  1.00 34.26 ? 290 GLU A CA    1 
ATOM   2271 C  C     . GLU A 1  293 ? -42.934 53.716 14.085  1.00 33.84 ? 290 GLU A C     1 
ATOM   2272 O  O     . GLU A 1  293 ? -43.712 53.896 13.147  1.00 33.12 ? 290 GLU A O     1 
ATOM   2273 C  CB    . GLU A 1  293 ? -43.081 55.244 16.073  1.00 34.46 ? 290 GLU A CB    1 
ATOM   2274 C  CG    . GLU A 1  293 ? -43.824 55.603 17.374  1.00 35.60 ? 290 GLU A CG    1 
ATOM   2275 C  CD    . GLU A 1  293 ? -43.187 56.754 18.155  1.00 38.51 ? 290 GLU A CD    1 
ATOM   2276 O  OE1   . GLU A 1  293 ? -42.049 57.190 17.855  1.00 36.40 ? 290 GLU A OE1   1 
ATOM   2277 O  OE2   . GLU A 1  293 ? -43.844 57.225 19.103  1.00 41.85 ? 290 GLU A OE2   1 
ATOM   2278 N  N     . GLU A 1  294 ? -41.647 53.421 13.928  1.00 33.34 ? 291 GLU A N     1 
ATOM   2279 C  CA    . GLU A 1  294 ? -41.026 53.162 12.648  1.00 33.13 ? 291 GLU A CA    1 
ATOM   2280 C  C     . GLU A 1  294 ? -41.721 51.971 11.970  1.00 32.86 ? 291 GLU A C     1 
ATOM   2281 O  O     . GLU A 1  294 ? -42.032 52.036 10.785  1.00 32.79 ? 291 GLU A O     1 
ATOM   2282 C  CB    . GLU A 1  294 ? -39.547 52.868 12.890  1.00 33.31 ? 291 GLU A CB    1 
ATOM   2283 C  CG    . GLU A 1  294 ? -38.635 52.973 11.697  1.00 33.39 ? 291 GLU A CG    1 
ATOM   2284 C  CD    . GLU A 1  294 ? -37.175 52.870 12.102  1.00 33.62 ? 291 GLU A CD    1 
ATOM   2285 O  OE1   . GLU A 1  294 ? -36.680 51.742 12.352  1.00 32.33 ? 291 GLU A OE1   1 
ATOM   2286 O  OE2   . GLU A 1  294 ? -36.515 53.923 12.184  1.00 33.66 ? 291 GLU A OE2   1 
ATOM   2287 N  N     . LEU A 1  295 ? -41.988 50.907 12.732  1.00 32.55 ? 292 LEU A N     1 
ATOM   2288 C  CA    . LEU A 1  295 ? -42.648 49.714 12.202  1.00 32.78 ? 292 LEU A CA    1 
ATOM   2289 C  C     . LEU A 1  295 ? -44.097 49.996 11.830  1.00 33.88 ? 292 LEU A C     1 
ATOM   2290 O  O     . LEU A 1  295 ? -44.630 49.448 10.856  1.00 33.91 ? 292 LEU A O     1 
ATOM   2291 C  CB    . LEU A 1  295 ? -42.568 48.556 13.188  1.00 32.33 ? 292 LEU A CB    1 
ATOM   2292 C  CG    . LEU A 1  295 ? -41.201 47.876 13.280  1.00 31.92 ? 292 LEU A CG    1 
ATOM   2293 C  CD1   . LEU A 1  295 ? -41.218 46.742 14.302  1.00 30.11 ? 292 LEU A CD1   1 
ATOM   2294 C  CD2   . LEU A 1  295 ? -40.758 47.360 11.903  1.00 30.29 ? 292 LEU A CD2   1 
ATOM   2295 N  N     . SER A 1  296 ? -44.730 50.869 12.604  1.00 34.10 ? 293 SER A N     1 
ATOM   2296 C  CA    . SER A 1  296 ? -46.083 51.296 12.314  1.00 34.72 ? 293 SER A CA    1 
ATOM   2297 C  C     . SER A 1  296 ? -46.132 52.119 11.009  1.00 34.39 ? 293 SER A C     1 
ATOM   2298 O  O     . SER A 1  296 ? -47.032 51.950 10.183  1.00 33.82 ? 293 SER A O     1 
ATOM   2299 C  CB    . SER A 1  296 ? -46.655 52.049 13.521  1.00 35.05 ? 293 SER A CB    1 
ATOM   2300 O  OG    . SER A 1  296 ? -47.725 52.864 13.135  1.00 37.39 ? 293 SER A OG    1 
ATOM   2301 N  N     . LEU A 1  297 ? -45.144 52.982 10.808  1.00 34.63 ? 294 LEU A N     1 
ATOM   2302 C  CA    . LEU A 1  297 ? -45.024 53.696 9.546   1.00 34.91 ? 294 LEU A CA    1 
ATOM   2303 C  C     . LEU A 1  297 ? -44.808 52.712 8.385   1.00 34.84 ? 294 LEU A C     1 
ATOM   2304 O  O     . LEU A 1  297 ? -45.392 52.873 7.320   1.00 35.09 ? 294 LEU A O     1 
ATOM   2305 C  CB    . LEU A 1  297 ? -43.883 54.711 9.601   1.00 34.52 ? 294 LEU A CB    1 
ATOM   2306 C  CG    . LEU A 1  297 ? -43.633 55.423 8.275   1.00 35.82 ? 294 LEU A CG    1 
ATOM   2307 C  CD1   . LEU A 1  297 ? -44.878 56.223 7.851   1.00 36.82 ? 294 LEU A CD1   1 
ATOM   2308 C  CD2   . LEU A 1  297 ? -42.372 56.304 8.342   1.00 35.92 ? 294 LEU A CD2   1 
ATOM   2309 N  N     . LEU A 1  298 ? -43.988 51.693 8.620   1.00 35.07 ? 295 LEU A N     1 
ATOM   2310 C  CA    . LEU A 1  298 ? -43.692 50.667 7.614   1.00 34.90 ? 295 LEU A CA    1 
ATOM   2311 C  C     . LEU A 1  298 ? -44.940 49.913 7.147   1.00 35.68 ? 295 LEU A C     1 
ATOM   2312 O  O     . LEU A 1  298 ? -45.128 49.740 5.939   1.00 34.84 ? 295 LEU A O     1 
ATOM   2313 C  CB    . LEU A 1  298 ? -42.623 49.697 8.120   1.00 33.89 ? 295 LEU A CB    1 
ATOM   2314 C  CG    . LEU A 1  298 ? -42.268 48.506 7.217   1.00 32.87 ? 295 LEU A CG    1 
ATOM   2315 C  CD1   . LEU A 1  298 ? -41.665 48.977 5.879   1.00 28.93 ? 295 LEU A CD1   1 
ATOM   2316 C  CD2   . LEU A 1  298 ? -41.339 47.558 7.941   1.00 29.24 ? 295 LEU A CD2   1 
ATOM   2317 N  N     . GLN A 1  299 ? -45.767 49.471 8.101   1.00 36.68 ? 296 GLN A N     1 
ATOM   2318 C  CA    A GLN A 1  299 ? -47.008 48.754 7.801   0.70 37.72 ? 296 GLN A CA    1 
ATOM   2319 C  CA    B GLN A 1  299 ? -47.024 48.764 7.810   0.30 37.35 ? 296 GLN A CA    1 
ATOM   2320 C  C     . GLN A 1  299 ? -47.893 49.573 6.851   1.00 37.97 ? 296 GLN A C     1 
ATOM   2321 O  O     . GLN A 1  299 ? -48.498 49.023 5.924   1.00 38.08 ? 296 GLN A O     1 
ATOM   2322 C  CB    A GLN A 1  299 ? -47.758 48.387 9.096   0.70 38.01 ? 296 GLN A CB    1 
ATOM   2323 C  CB    B GLN A 1  299 ? -47.800 48.462 9.104   0.30 37.37 ? 296 GLN A CB    1 
ATOM   2324 C  CG    A GLN A 1  299 ? -46.977 47.428 10.042  0.70 40.05 ? 296 GLN A CG    1 
ATOM   2325 C  CG    B GLN A 1  299 ? -49.040 47.578 8.919   0.30 37.34 ? 296 GLN A CG    1 
ATOM   2326 C  CD    A GLN A 1  299 ? -47.373 47.532 11.537  0.70 42.88 ? 296 GLN A CD    1 
ATOM   2327 C  CD    B GLN A 1  299 ? -49.780 47.277 10.222  0.30 38.06 ? 296 GLN A CD    1 
ATOM   2328 O  OE1   A GLN A 1  299 ? -48.286 48.279 11.910  0.70 44.23 ? 296 GLN A OE1   1 
ATOM   2329 O  OE1   B GLN A 1  299 ? -50.013 48.164 11.045  0.30 37.62 ? 296 GLN A OE1   1 
ATOM   2330 N  NE2   A GLN A 1  299 ? -46.677 46.773 12.389  0.70 42.33 ? 296 GLN A NE2   1 
ATOM   2331 N  NE2   B GLN A 1  299 ? -50.163 46.017 10.403  0.30 37.93 ? 296 GLN A NE2   1 
ATOM   2332 N  N     . GLU A 1  300 ? -47.938 50.884 7.071   1.00 38.66 ? 297 GLU A N     1 
ATOM   2333 C  CA    . GLU A 1  300 ? -48.720 51.801 6.246   1.00 39.62 ? 297 GLU A CA    1 
ATOM   2334 C  C     . GLU A 1  300 ? -48.098 52.010 4.852   1.00 39.01 ? 297 GLU A C     1 
ATOM   2335 O  O     . GLU A 1  300 ? -48.813 52.045 3.849   1.00 39.03 ? 297 GLU A O     1 
ATOM   2336 C  CB    . GLU A 1  300 ? -48.882 53.138 6.983   1.00 40.46 ? 297 GLU A CB    1 
ATOM   2337 C  CG    . GLU A 1  300 ? -49.591 54.258 6.203   1.00 44.66 ? 297 GLU A CG    1 
ATOM   2338 C  CD    . GLU A 1  300 ? -51.056 53.954 5.888   1.00 50.01 ? 297 GLU A CD    1 
ATOM   2339 O  OE1   . GLU A 1  300 ? -51.763 53.355 6.742   1.00 52.17 ? 297 GLU A OE1   1 
ATOM   2340 O  OE2   . GLU A 1  300 ? -51.499 54.321 4.774   1.00 52.48 ? 297 GLU A OE2   1 
ATOM   2341 N  N     . ILE A 1  301 ? -46.775 52.156 4.793   1.00 37.85 ? 298 ILE A N     1 
ATOM   2342 C  CA    . ILE A 1  301 ? -46.072 52.297 3.522   1.00 36.86 ? 298 ILE A CA    1 
ATOM   2343 C  C     . ILE A 1  301 ? -46.299 51.071 2.626   1.00 36.31 ? 298 ILE A C     1 
ATOM   2344 O  O     . ILE A 1  301 ? -46.506 51.203 1.411   1.00 36.12 ? 298 ILE A O     1 
ATOM   2345 C  CB    . ILE A 1  301 ? -44.571 52.539 3.749   1.00 37.14 ? 298 ILE A CB    1 
ATOM   2346 C  CG1   . ILE A 1  301 ? -44.321 53.991 4.157   1.00 36.97 ? 298 ILE A CG1   1 
ATOM   2347 C  CG2   . ILE A 1  301 ? -43.729 52.147 2.502   1.00 37.53 ? 298 ILE A CG2   1 
ATOM   2348 C  CD1   . ILE A 1  301 ? -42.927 54.210 4.780   1.00 37.66 ? 298 ILE A CD1   1 
ATOM   2349 N  N     . ARG A 1  302 ? -46.282 49.891 3.236   1.00 35.25 ? 299 ARG A N     1 
ATOM   2350 C  CA    . ARG A 1  302 ? -46.438 48.641 2.520   1.00 35.05 ? 299 ARG A CA    1 
ATOM   2351 C  C     . ARG A 1  302 ? -47.823 48.487 1.895   1.00 35.88 ? 299 ARG A C     1 
ATOM   2352 O  O     . ARG A 1  302 ? -47.960 47.891 0.828   1.00 35.65 ? 299 ARG A O     1 
ATOM   2353 C  CB    . ARG A 1  302 ? -46.153 47.449 3.436   1.00 33.95 ? 299 ARG A CB    1 
ATOM   2354 C  CG    . ARG A 1  302 ? -44.701 47.272 3.842   1.00 31.95 ? 299 ARG A CG    1 
ATOM   2355 C  CD    . ARG A 1  302 ? -44.569 46.094 4.822   1.00 29.81 ? 299 ARG A CD    1 
ATOM   2356 N  NE    . ARG A 1  302 ? -43.178 45.671 5.015   1.00 27.93 ? 299 ARG A NE    1 
ATOM   2357 C  CZ    . ARG A 1  302 ? -42.717 45.022 6.088   1.00 26.34 ? 299 ARG A CZ    1 
ATOM   2358 N  NH1   . ARG A 1  302 ? -43.535 44.722 7.098   1.00 26.11 ? 299 ARG A NH1   1 
ATOM   2359 N  NH2   . ARG A 1  302 ? -41.424 44.682 6.156   1.00 23.88 ? 299 ARG A NH2   1 
ATOM   2360 N  N     . THR A 1  303 ? -48.852 49.003 2.555   1.00 36.57 ? 300 THR A N     1 
ATOM   2361 C  CA    . THR A 1  303 ? -50.207 48.837 2.039   1.00 37.51 ? 300 THR A CA    1 
ATOM   2362 C  C     . THR A 1  303 ? -50.548 49.871 0.969   1.00 37.69 ? 300 THR A C     1 
ATOM   2363 O  O     . THR A 1  303 ? -51.539 49.723 0.266   1.00 38.61 ? 300 THR A O     1 
ATOM   2364 C  CB    . THR A 1  303 ? -51.262 48.952 3.139   1.00 37.60 ? 300 THR A CB    1 
ATOM   2365 O  OG1   . THR A 1  303 ? -51.083 50.200 3.815   1.00 38.16 ? 300 THR A OG1   1 
ATOM   2366 C  CG2   . THR A 1  303 ? -51.140 47.798 4.121   1.00 38.00 ? 300 THR A CG2   1 
ATOM   2367 N  N     . SER A 1  304 ? -49.746 50.916 0.844   1.00 37.19 ? 301 SER A N     1 
ATOM   2368 C  CA    . SER A 1  304 ? -50.106 51.968 -0.081  1.00 37.55 ? 301 SER A CA    1 
ATOM   2369 C  C     . SER A 1  304 ? -49.230 52.052 -1.343  1.00 37.13 ? 301 SER A C     1 
ATOM   2370 O  O     . SER A 1  304 ? -49.207 53.079 -2.001  1.00 37.04 ? 301 SER A O     1 
ATOM   2371 C  CB    . SER A 1  304 ? -50.107 53.306 0.653   1.00 37.62 ? 301 SER A CB    1 
ATOM   2372 O  OG    . SER A 1  304 ? -48.778 53.730 0.819   1.00 39.80 ? 301 SER A OG    1 
ATOM   2373 N  N     . LEU A 1  305 ? -48.512 50.989 -1.689  1.00 36.95 ? 302 LEU A N     1 
ATOM   2374 C  CA    . LEU A 1  305 ? -47.683 51.021 -2.907  1.00 36.89 ? 302 LEU A CA    1 
ATOM   2375 C  C     . LEU A 1  305 ? -48.554 51.025 -4.170  1.00 37.69 ? 302 LEU A C     1 
ATOM   2376 O  O     . LEU A 1  305 ? -49.634 50.425 -4.187  1.00 37.37 ? 302 LEU A O     1 
ATOM   2377 C  CB    . LEU A 1  305 ? -46.704 49.850 -2.937  1.00 36.01 ? 302 LEU A CB    1 
ATOM   2378 C  CG    . LEU A 1  305 ? -45.680 49.750 -1.794  1.00 34.66 ? 302 LEU A CG    1 
ATOM   2379 C  CD1   . LEU A 1  305 ? -45.074 48.361 -1.803  1.00 30.24 ? 302 LEU A CD1   1 
ATOM   2380 C  CD2   . LEU A 1  305 ? -44.590 50.839 -1.900  1.00 31.77 ? 302 LEU A CD2   1 
ATOM   2381 N  N     . TYR A 1  306 ? -48.096 51.736 -5.200  1.00 38.47 ? 303 TYR A N     1 
ATOM   2382 C  CA    . TYR A 1  306 ? -48.736 51.736 -6.521  1.00 39.88 ? 303 TYR A CA    1 
ATOM   2383 C  C     . TYR A 1  306 ? -49.065 50.314 -6.963  1.00 40.11 ? 303 TYR A C     1 
ATOM   2384 O  O     . TYR A 1  306 ? -48.229 49.424 -6.850  1.00 39.85 ? 303 TYR A O     1 
ATOM   2385 C  CB    . TYR A 1  306 ? -47.799 52.395 -7.551  1.00 40.39 ? 303 TYR A CB    1 
ATOM   2386 C  CG    . TYR A 1  306 ? -48.236 52.297 -9.000  1.00 43.11 ? 303 TYR A CG    1 
ATOM   2387 C  CD1   . TYR A 1  306 ? -49.236 53.132 -9.502  1.00 45.96 ? 303 TYR A CD1   1 
ATOM   2388 C  CD2   . TYR A 1  306 ? -47.639 51.386 -9.875  1.00 44.34 ? 303 TYR A CD2   1 
ATOM   2389 C  CE1   . TYR A 1  306 ? -49.647 53.053 -10.842 1.00 48.13 ? 303 TYR A CE1   1 
ATOM   2390 C  CE2   . TYR A 1  306 ? -48.033 51.300 -11.205 1.00 47.00 ? 303 TYR A CE2   1 
ATOM   2391 C  CZ    . TYR A 1  306 ? -49.044 52.138 -11.688 1.00 48.40 ? 303 TYR A CZ    1 
ATOM   2392 O  OH    . TYR A 1  306 ? -49.462 52.065 -13.015 1.00 50.31 ? 303 TYR A OH    1 
ATOM   2393 N  N     . HIS A 1  307 ? -50.294 50.101 -7.431  1.00 40.48 ? 304 HIS A N     1 
ATOM   2394 C  CA    . HIS A 1  307 ? -50.624 48.872 -8.135  1.00 40.94 ? 304 HIS A CA    1 
ATOM   2395 C  C     . HIS A 1  307 ? -51.057 49.138 -9.572  1.00 40.06 ? 304 HIS A C     1 
ATOM   2396 O  O     . HIS A 1  307 ? -52.031 49.850 -9.797  1.00 39.69 ? 304 HIS A O     1 
ATOM   2397 C  CB    . HIS A 1  307 ? -51.708 48.063 -7.431  1.00 41.60 ? 304 HIS A CB    1 
ATOM   2398 C  CG    . HIS A 1  307 ? -51.985 46.755 -8.110  1.00 45.59 ? 304 HIS A CG    1 
ATOM   2399 N  ND1   . HIS A 1  307 ? -51.013 45.788 -8.284  1.00 48.35 ? 304 HIS A ND1   1 
ATOM   2400 C  CD2   . HIS A 1  307 ? -53.107 46.269 -8.694  1.00 47.74 ? 304 HIS A CD2   1 
ATOM   2401 C  CE1   . HIS A 1  307 ? -51.530 44.759 -8.929  1.00 48.26 ? 304 HIS A CE1   1 
ATOM   2402 N  NE2   . HIS A 1  307 ? -52.796 45.027 -9.192  1.00 48.83 ? 304 HIS A NE2   1 
ATOM   2403 N  N     . PRO A 1  308 ? -50.340 48.558 -10.551 1.00 39.70 ? 305 PRO A N     1 
ATOM   2404 C  CA    . PRO A 1  308 ? -50.745 48.779 -11.948 1.00 39.88 ? 305 PRO A CA    1 
ATOM   2405 C  C     . PRO A 1  308 ? -52.061 48.063 -12.299 1.00 40.03 ? 305 PRO A C     1 
ATOM   2406 O  O     . PRO A 1  308 ? -52.402 47.051 -11.693 1.00 39.30 ? 305 PRO A O     1 
ATOM   2407 C  CB    . PRO A 1  308 ? -49.567 48.217 -12.751 1.00 40.03 ? 305 PRO A CB    1 
ATOM   2408 C  CG    . PRO A 1  308 ? -48.919 47.218 -11.841 1.00 39.17 ? 305 PRO A CG    1 
ATOM   2409 C  CD    . PRO A 1  308 ? -49.131 47.719 -10.440 1.00 39.61 ? 305 PRO A CD    1 
ATOM   2410 N  N     . SER A 1  309 ? -52.811 48.604 -13.246 1.00 40.76 ? 306 SER A N     1 
ATOM   2411 C  CA    . SER A 1  309 ? -54.023 47.927 -13.686 1.00 42.22 ? 306 SER A CA    1 
ATOM   2412 C  C     . SER A 1  309 ? -53.824 47.321 -15.076 1.00 41.73 ? 306 SER A C     1 
ATOM   2413 O  O     . SER A 1  309 ? -52.944 47.746 -15.834 1.00 41.74 ? 306 SER A O     1 
ATOM   2414 C  CB    . SER A 1  309 ? -55.220 48.879 -13.677 1.00 42.80 ? 306 SER A CB    1 
ATOM   2415 O  OG    . SER A 1  309 ? -54.924 50.027 -14.461 1.00 46.27 ? 306 SER A OG    1 
ATOM   2416 N  N     . THR A 1  310 ? -54.624 46.297 -15.356 1.00 41.03 ? 307 THR A N     1 
ATOM   2417 C  CA    . THR A 1  310 ? -54.757 45.686 -16.669 1.00 40.67 ? 307 THR A CA    1 
ATOM   2418 C  C     . THR A 1  310 ? -54.826 46.749 -17.771 1.00 39.75 ? 307 THR A C     1 
ATOM   2419 O  O     . THR A 1  310 ? -55.612 47.689 -17.667 1.00 40.08 ? 307 THR A O     1 
ATOM   2420 C  CB    . THR A 1  310 ? -56.006 44.779 -16.664 1.00 40.97 ? 307 THR A CB    1 
ATOM   2421 O  OG1   . THR A 1  310 ? -55.762 43.687 -15.768 1.00 41.36 ? 307 THR A OG1   1 
ATOM   2422 C  CG2   . THR A 1  310 ? -56.340 44.201 -18.062 1.00 42.08 ? 307 THR A CG2   1 
ATOM   2423 N  N     . PRO A 1  311 ? -53.971 46.626 -18.811 1.00 38.64 ? 308 PRO A N     1 
ATOM   2424 C  CA    . PRO A 1  311 ? -54.033 47.541 -19.949 1.00 37.97 ? 308 PRO A CA    1 
ATOM   2425 C  C     . PRO A 1  311 ? -55.274 47.236 -20.815 1.00 37.34 ? 308 PRO A C     1 
ATOM   2426 O  O     . PRO A 1  311 ? -55.886 46.174 -20.655 1.00 37.60 ? 308 PRO A O     1 
ATOM   2427 C  CB    . PRO A 1  311 ? -52.743 47.229 -20.712 1.00 37.49 ? 308 PRO A CB    1 
ATOM   2428 C  CG    . PRO A 1  311 ? -52.503 45.801 -20.440 1.00 38.18 ? 308 PRO A CG    1 
ATOM   2429 C  CD    . PRO A 1  311 ? -52.986 45.552 -19.029 1.00 38.07 ? 308 PRO A CD    1 
ATOM   2430 N  N     . PRO A 1  312 ? -55.656 48.157 -21.715 1.00 37.00 ? 309 PRO A N     1 
ATOM   2431 C  CA    . PRO A 1  312 ? -56.818 47.834 -22.574 1.00 36.46 ? 309 PRO A CA    1 
ATOM   2432 C  C     . PRO A 1  312 ? -56.526 46.670 -23.533 1.00 35.82 ? 309 PRO A C     1 
ATOM   2433 O  O     . PRO A 1  312 ? -55.377 46.479 -23.940 1.00 35.55 ? 309 PRO A O     1 
ATOM   2434 C  CB    . PRO A 1  312 ? -57.065 49.129 -23.370 1.00 36.17 ? 309 PRO A CB    1 
ATOM   2435 C  CG    . PRO A 1  312 ? -56.191 50.184 -22.725 1.00 37.46 ? 309 PRO A CG    1 
ATOM   2436 C  CD    . PRO A 1  312 ? -55.077 49.482 -22.010 1.00 36.49 ? 309 PRO A CD    1 
ATOM   2437 N  N     . ALA A 1  313 ? -57.559 45.888 -23.851 1.00 35.66 ? 310 ALA A N     1 
ATOM   2438 C  CA    . ALA A 1  313 ? -57.499 44.902 -24.941 1.00 35.88 ? 310 ALA A CA    1 
ATOM   2439 C  C     . ALA A 1  313 ? -57.117 45.570 -26.265 1.00 35.67 ? 310 ALA A C     1 
ATOM   2440 O  O     . ALA A 1  313 ? -57.540 46.693 -26.534 1.00 36.01 ? 310 ALA A O     1 
ATOM   2441 C  CB    . ALA A 1  313 ? -58.828 44.181 -25.082 1.00 35.62 ? 310 ALA A CB    1 
ATOM   2442 N  N     . SER A 1  314 ? -56.290 44.902 -27.068 1.00 35.47 ? 311 SER A N     1 
ATOM   2443 C  CA    . SER A 1  314 ? -56.032 45.342 -28.449 1.00 35.60 ? 311 SER A CA    1 
ATOM   2444 C  C     . SER A 1  314 ? -57.298 45.096 -29.291 1.00 35.83 ? 311 SER A C     1 
ATOM   2445 O  O     . SER A 1  314 ? -58.167 44.320 -28.887 1.00 35.70 ? 311 SER A O     1 
ATOM   2446 C  CB    . SER A 1  314 ? -54.823 44.606 -29.032 1.00 35.68 ? 311 SER A CB    1 
ATOM   2447 O  OG    . SER A 1  314 ? -55.063 43.213 -29.087 1.00 35.56 ? 311 SER A OG    1 
ATOM   2448 N  N     . SER A 1  315 ? -57.432 45.752 -30.445 1.00 36.22 ? 312 SER A N     1 
ATOM   2449 C  CA    . SER A 1  315 ? -58.741 45.718 -31.153 1.00 36.10 ? 312 SER A CA    1 
ATOM   2450 C  C     . SER A 1  315 ? -59.169 44.332 -31.618 1.00 35.03 ? 312 SER A C     1 
ATOM   2451 O  O     . SER A 1  315 ? -60.347 44.092 -31.781 1.00 35.17 ? 312 SER A O     1 
ATOM   2452 C  CB    . SER A 1  315 ? -58.792 46.695 -32.330 1.00 36.73 ? 312 SER A CB    1 
ATOM   2453 O  OG    . SER A 1  315 ? -57.747 46.430 -33.237 1.00 38.47 ? 312 SER A OG    1 
ATOM   2454 N  N     . ARG A 1  316 ? -58.223 43.415 -31.806 1.00 34.14 ? 313 ARG A N     1 
ATOM   2455 C  CA    . ARG A 1  316 ? -58.580 42.053 -32.220 1.00 33.24 ? 313 ARG A CA    1 
ATOM   2456 C  C     . ARG A 1  316 ? -57.986 40.984 -31.318 1.00 33.00 ? 313 ARG A C     1 
ATOM   2457 O  O     . ARG A 1  316 ? -57.263 40.094 -31.775 1.00 33.15 ? 313 ARG A O     1 
ATOM   2458 C  CB    . ARG A 1  316 ? -58.184 41.816 -33.684 1.00 32.84 ? 313 ARG A CB    1 
ATOM   2459 C  CG    . ARG A 1  316 ? -58.867 42.796 -34.656 1.00 31.72 ? 313 ARG A CG    1 
ATOM   2460 C  CD    . ARG A 1  316 ? -58.411 42.536 -36.078 1.00 30.32 ? 313 ARG A CD    1 
ATOM   2461 N  NE    . ARG A 1  316 ? -58.867 43.553 -37.022 1.00 28.45 ? 313 ARG A NE    1 
ATOM   2462 C  CZ    . ARG A 1  316 ? -58.536 43.548 -38.309 1.00 27.57 ? 313 ARG A CZ    1 
ATOM   2463 N  NH1   . ARG A 1  316 ? -57.728 42.604 -38.782 1.00 24.52 ? 313 ARG A NH1   1 
ATOM   2464 N  NH2   . ARG A 1  316 ? -58.992 44.494 -39.114 1.00 25.10 ? 313 ARG A NH2   1 
ATOM   2465 N  N     . SER A 1  317 ? -58.306 41.065 -30.034 1.00 32.25 ? 314 SER A N     1 
ATOM   2466 C  CA    . SER A 1  317 ? -57.890 40.041 -29.082 1.00 32.71 ? 314 SER A CA    1 
ATOM   2467 C  C     . SER A 1  317 ? -58.981 38.978 -28.914 1.00 32.99 ? 314 SER A C     1 
ATOM   2468 O  O     . SER A 1  317 ? -60.123 39.181 -29.318 1.00 33.13 ? 314 SER A O     1 
ATOM   2469 C  CB    . SER A 1  317 ? -57.577 40.685 -27.724 1.00 32.45 ? 314 SER A CB    1 
ATOM   2470 O  OG    . SER A 1  317 ? -58.750 41.252 -27.185 1.00 32.77 ? 314 SER A OG    1 
ATOM   2471 N  N     . TRP A 1  318 ? -58.642 37.855 -28.298 1.00 32.90 ? 315 TRP A N     1 
ATOM   2472 C  CA    . TRP A 1  318 ? -59.651 36.855 -27.968 1.00 33.26 ? 315 TRP A CA    1 
ATOM   2473 C  C     . TRP A 1  318 ? -59.501 36.428 -26.509 1.00 34.23 ? 315 TRP A C     1 
ATOM   2474 O  O     . TRP A 1  318 ? -58.425 36.567 -25.907 1.00 34.19 ? 315 TRP A O     1 
ATOM   2475 C  CB    . TRP A 1  318 ? -59.543 35.645 -28.893 1.00 32.20 ? 315 TRP A CB    1 
ATOM   2476 C  CG    . TRP A 1  318 ? -58.335 34.831 -28.595 1.00 30.44 ? 315 TRP A CG    1 
ATOM   2477 C  CD1   . TRP A 1  318 ? -57.043 35.133 -28.914 1.00 28.58 ? 315 TRP A CD1   1 
ATOM   2478 C  CD2   . TRP A 1  318 ? -58.293 33.586 -27.892 1.00 29.09 ? 315 TRP A CD2   1 
ATOM   2479 N  NE1   . TRP A 1  318 ? -56.200 34.145 -28.466 1.00 26.50 ? 315 TRP A NE1   1 
ATOM   2480 C  CE2   . TRP A 1  318 ? -56.941 33.190 -27.823 1.00 27.44 ? 315 TRP A CE2   1 
ATOM   2481 C  CE3   . TRP A 1  318 ? -59.271 32.758 -27.321 1.00 30.72 ? 315 TRP A CE3   1 
ATOM   2482 C  CZ2   . TRP A 1  318 ? -56.540 32.007 -27.210 1.00 29.24 ? 315 TRP A CZ2   1 
ATOM   2483 C  CZ3   . TRP A 1  318 ? -58.875 31.581 -26.715 1.00 29.44 ? 315 TRP A CZ3   1 
ATOM   2484 C  CH2   . TRP A 1  318 ? -57.516 31.220 -26.657 1.00 30.99 ? 315 TRP A CH2   1 
ATOM   2485 N  N     . SER A 1  319 ? -60.588 35.912 -25.948 1.00 35.20 ? 316 SER A N     1 
ATOM   2486 C  CA    . SER A 1  319 ? -60.589 35.380 -24.588 1.00 36.38 ? 316 SER A CA    1 
ATOM   2487 C  C     . SER A 1  319 ? -61.276 34.025 -24.612 1.00 36.65 ? 316 SER A C     1 
ATOM   2488 O  O     . SER A 1  319 ? -62.241 33.846 -25.351 1.00 36.62 ? 316 SER A O     1 
ATOM   2489 C  CB    . SER A 1  319 ? -61.296 36.328 -23.612 1.00 36.63 ? 316 SER A CB    1 
ATOM   2490 O  OG    . SER A 1  319 ? -60.517 37.497 -23.392 1.00 38.40 ? 316 SER A OG    1 
ATOM   2491 N  N     . PRO A 1  320 ? -60.779 33.074 -23.801 1.00 37.05 ? 317 PRO A N     1 
ATOM   2492 C  CA    . PRO A 1  320 ? -61.240 31.687 -23.859 1.00 37.74 ? 317 PRO A CA    1 
ATOM   2493 C  C     . PRO A 1  320 ? -62.652 31.515 -23.289 1.00 38.46 ? 317 PRO A C     1 
ATOM   2494 O  O     . PRO A 1  320 ? -63.098 32.311 -22.457 1.00 38.54 ? 317 PRO A O     1 
ATOM   2495 C  CB    . PRO A 1  320 ? -60.209 30.946 -23.008 1.00 37.45 ? 317 PRO A CB    1 
ATOM   2496 C  CG    . PRO A 1  320 ? -59.795 31.970 -21.974 1.00 37.63 ? 317 PRO A CG    1 
ATOM   2497 C  CD    . PRO A 1  320 ? -59.855 33.304 -22.673 1.00 36.96 ? 317 PRO A CD    1 
ATOM   2498 N  N     . VAL A 1  321 ? -63.344 30.494 -23.776 1.00 39.33 ? 318 VAL A N     1 
ATOM   2499 C  CA    . VAL A 1  321 ? -64.718 30.180 -23.374 1.00 40.25 ? 318 VAL A CA    1 
ATOM   2500 C  C     . VAL A 1  321 ? -64.760 28.668 -23.230 1.00 39.99 ? 318 VAL A C     1 
ATOM   2501 O  O     . VAL A 1  321 ? -64.167 27.969 -24.047 1.00 40.08 ? 318 VAL A O     1 
ATOM   2502 C  CB    . VAL A 1  321 ? -65.742 30.660 -24.451 1.00 40.62 ? 318 VAL A CB    1 
ATOM   2503 C  CG1   . VAL A 1  321 ? -67.082 29.959 -24.305 1.00 42.33 ? 318 VAL A CG1   1 
ATOM   2504 C  CG2   . VAL A 1  321 ? -65.933 32.161 -24.376 1.00 40.55 ? 318 VAL A CG2   1 
ATOM   2505 N  N     . VAL A 1  322 ? -65.410 28.160 -22.179 1.00 39.98 ? 319 VAL A N     1 
ATOM   2506 C  CA    . VAL A 1  322 ? -65.565 26.700 -22.001 1.00 39.89 ? 319 VAL A CA    1 
ATOM   2507 C  C     . VAL A 1  322 ? -66.165 26.075 -23.265 1.00 39.47 ? 319 VAL A C     1 
ATOM   2508 O  O     . VAL A 1  322 ? -67.121 26.604 -23.824 1.00 39.70 ? 319 VAL A O     1 
ATOM   2509 C  CB    . VAL A 1  322 ? -66.418 26.333 -20.731 1.00 40.26 ? 319 VAL A CB    1 
ATOM   2510 C  CG1   . VAL A 1  322 ? -66.752 24.838 -20.698 1.00 39.58 ? 319 VAL A CG1   1 
ATOM   2511 C  CG2   . VAL A 1  322 ? -65.669 26.726 -19.443 1.00 40.29 ? 319 VAL A CG2   1 
ATOM   2512 N  N     . GLY A 1  323 ? -65.576 24.976 -23.727 1.00 39.32 ? 320 GLY A N     1 
ATOM   2513 C  CA    . GLY A 1  323 ? -66.046 24.294 -24.941 1.00 39.01 ? 320 GLY A CA    1 
ATOM   2514 C  C     . GLY A 1  323 ? -65.419 24.757 -26.255 1.00 38.78 ? 320 GLY A C     1 
ATOM   2515 O  O     . GLY A 1  323 ? -65.563 24.096 -27.280 1.00 38.98 ? 320 GLY A O     1 
ATOM   2516 N  N     . GLN A 1  324 ? -64.728 25.892 -26.230 1.00 38.16 ? 321 GLN A N     1 
ATOM   2517 C  CA    . GLN A 1  324 ? -64.090 26.442 -27.425 1.00 37.37 ? 321 GLN A CA    1 
ATOM   2518 C  C     . GLN A 1  324 ? -62.943 25.545 -27.905 1.00 36.39 ? 321 GLN A C     1 
ATOM   2519 O  O     . GLN A 1  324 ? -62.216 24.978 -27.089 1.00 35.91 ? 321 GLN A O     1 
ATOM   2520 C  CB    . GLN A 1  324 ? -63.581 27.848 -27.110 1.00 37.66 ? 321 GLN A CB    1 
ATOM   2521 C  CG    . GLN A 1  324 ? -62.879 28.606 -28.244 1.00 38.62 ? 321 GLN A CG    1 
ATOM   2522 C  CD    . GLN A 1  324 ? -62.475 30.010 -27.804 1.00 38.91 ? 321 GLN A CD    1 
ATOM   2523 O  OE1   . GLN A 1  324 ? -62.257 30.258 -26.621 1.00 38.31 ? 321 GLN A OE1   1 
ATOM   2524 N  NE2   . GLN A 1  324 ? -62.390 30.930 -28.752 1.00 39.16 ? 321 GLN A NE2   1 
ATOM   2525 N  N     . LEU A 1  325 ? -62.796 25.406 -29.225 1.00 35.33 ? 322 LEU A N     1 
ATOM   2526 C  CA    . LEU A 1  325 ? -61.651 24.678 -29.790 1.00 34.69 ? 322 LEU A CA    1 
ATOM   2527 C  C     . LEU A 1  325 ? -60.430 25.589 -29.897 1.00 33.70 ? 322 LEU A C     1 
ATOM   2528 O  O     . LEU A 1  325 ? -60.477 26.675 -30.492 1.00 33.57 ? 322 LEU A O     1 
ATOM   2529 C  CB    . LEU A 1  325 ? -61.977 24.063 -31.161 1.00 35.11 ? 322 LEU A CB    1 
ATOM   2530 C  CG    . LEU A 1  325 ? -62.918 22.851 -31.180 1.00 37.22 ? 322 LEU A CG    1 
ATOM   2531 C  CD1   . LEU A 1  325 ? -63.466 22.610 -32.596 1.00 37.86 ? 322 LEU A CD1   1 
ATOM   2532 C  CD2   . LEU A 1  325 ? -62.213 21.589 -30.635 1.00 37.36 ? 322 LEU A CD2   1 
ATOM   2533 N  N     . VAL A 1  326 ? -59.339 25.126 -29.315 1.00 32.20 ? 323 VAL A N     1 
ATOM   2534 C  CA    . VAL A 1  326 ? -58.106 25.886 -29.251 1.00 31.60 ? 323 VAL A CA    1 
ATOM   2535 C  C     . VAL A 1  326 ? -56.953 24.954 -29.558 1.00 30.34 ? 323 VAL A C     1 
ATOM   2536 O  O     . VAL A 1  326 ? -57.104 23.743 -29.510 1.00 30.73 ? 323 VAL A O     1 
ATOM   2537 C  CB    . VAL A 1  326 ? -57.908 26.550 -27.853 1.00 31.36 ? 323 VAL A CB    1 
ATOM   2538 C  CG1   . VAL A 1  326 ? -59.029 27.538 -27.572 1.00 31.38 ? 323 VAL A CG1   1 
ATOM   2539 C  CG2   . VAL A 1  326 ? -57.810 25.495 -26.756 1.00 31.12 ? 323 VAL A CG2   1 
ATOM   2540 N  N     . GLN A 1  327 ? -55.802 25.518 -29.882 1.00 29.51 ? 324 GLN A N     1 
ATOM   2541 C  CA    . GLN A 1  327 ? -54.634 24.714 -30.175 1.00 28.62 ? 324 GLN A CA    1 
ATOM   2542 C  C     . GLN A 1  327 ? -53.432 25.233 -29.395 1.00 28.47 ? 324 GLN A C     1 
ATOM   2543 O  O     . GLN A 1  327 ? -53.211 26.439 -29.317 1.00 28.08 ? 324 GLN A O     1 
ATOM   2544 C  CB    . GLN A 1  327 ? -54.335 24.741 -31.677 1.00 28.11 ? 324 GLN A CB    1 
ATOM   2545 C  CG    . GLN A 1  327 ? -55.333 23.958 -32.525 1.00 28.38 ? 324 GLN A CG    1 
ATOM   2546 C  CD    . GLN A 1  327 ? -55.234 24.303 -34.003 1.00 27.15 ? 324 GLN A CD    1 
ATOM   2547 O  OE1   . GLN A 1  327 ? -56.052 25.057 -34.536 1.00 28.62 ? 324 GLN A OE1   1 
ATOM   2548 N  NE2   . GLN A 1  327 ? -54.214 23.781 -34.655 1.00 25.74 ? 324 GLN A NE2   1 
ATOM   2549 N  N     . GLU A 1  328 ? -52.658 24.306 -28.844 1.00 28.69 ? 325 GLU A N     1 
ATOM   2550 C  CA    . GLU A 1  328 ? -51.496 24.628 -28.035 1.00 29.79 ? 325 GLU A CA    1 
ATOM   2551 C  C     . GLU A 1  328 ? -50.258 24.750 -28.908 1.00 29.65 ? 325 GLU A C     1 
ATOM   2552 O  O     . GLU A 1  328 ? -50.021 23.914 -29.779 1.00 29.19 ? 325 GLU A O     1 
ATOM   2553 C  CB    . GLU A 1  328 ? -51.260 23.546 -26.964 1.00 29.44 ? 325 GLU A CB    1 
ATOM   2554 C  CG    . GLU A 1  328 ? -50.279 23.970 -25.850 1.00 31.84 ? 325 GLU A CG    1 
ATOM   2555 C  CD    . GLU A 1  328 ? -49.907 22.843 -24.875 1.00 35.08 ? 325 GLU A CD    1 
ATOM   2556 O  OE1   . GLU A 1  328 ? -50.520 21.750 -24.929 1.00 37.57 ? 325 GLU A OE1   1 
ATOM   2557 O  OE2   . GLU A 1  328 ? -48.989 23.045 -24.052 1.00 34.42 ? 325 GLU A OE2   1 
ATOM   2558 N  N     . ARG A 1  329 ? -49.464 25.784 -28.652 1.00 30.33 ? 326 ARG A N     1 
ATOM   2559 C  CA    . ARG A 1  329 ? -48.192 25.977 -29.346 1.00 31.07 ? 326 ARG A CA    1 
ATOM   2560 C  C     . ARG A 1  329 ? -47.273 24.791 -29.111 1.00 31.25 ? 326 ARG A C     1 
ATOM   2561 O  O     . ARG A 1  329 ? -47.166 24.316 -27.990 1.00 30.59 ? 326 ARG A O     1 
ATOM   2562 C  CB    . ARG A 1  329 ? -47.529 27.273 -28.874 1.00 31.55 ? 326 ARG A CB    1 
ATOM   2563 C  CG    . ARG A 1  329 ? -46.591 27.881 -29.873 1.00 34.48 ? 326 ARG A CG    1 
ATOM   2564 C  CD    . ARG A 1  329 ? -45.749 29.003 -29.274 1.00 39.01 ? 326 ARG A CD    1 
ATOM   2565 N  NE    . ARG A 1  329 ? -46.581 30.136 -28.862 1.00 42.96 ? 326 ARG A NE    1 
ATOM   2566 C  CZ    . ARG A 1  329 ? -47.029 31.084 -29.681 1.00 43.55 ? 326 ARG A CZ    1 
ATOM   2567 N  NH1   . ARG A 1  329 ? -46.723 31.053 -30.988 1.00 42.89 ? 326 ARG A NH1   1 
ATOM   2568 N  NH2   . ARG A 1  329 ? -47.792 32.057 -29.185 1.00 41.36 ? 326 ARG A NH2   1 
ATOM   2569 N  N     . VAL A 1  330 ? -46.640 24.295 -30.173 1.00 32.19 ? 327 VAL A N     1 
ATOM   2570 C  CA    . VAL A 1  330 ? -45.618 23.257 -30.047 1.00 33.23 ? 327 VAL A CA    1 
ATOM   2571 C  C     . VAL A 1  330 ? -44.365 23.874 -29.385 1.00 34.89 ? 327 VAL A C     1 
ATOM   2572 O  O     . VAL A 1  330 ? -43.883 24.937 -29.804 1.00 34.40 ? 327 VAL A O     1 
ATOM   2573 C  CB    . VAL A 1  330 ? -45.298 22.579 -31.419 1.00 33.56 ? 327 VAL A CB    1 
ATOM   2574 C  CG1   . VAL A 1  330 ? -44.094 21.663 -31.307 1.00 32.55 ? 327 VAL A CG1   1 
ATOM   2575 C  CG2   . VAL A 1  330 ? -46.510 21.777 -31.933 1.00 32.11 ? 327 VAL A CG2   1 
ATOM   2576 N  N     . ALA A 1  331 ? -43.861 23.217 -28.339 1.00 36.32 ? 328 ALA A N     1 
ATOM   2577 C  CA    . ALA A 1  331 ? -42.809 23.798 -27.497 1.00 37.79 ? 328 ALA A CA    1 
ATOM   2578 C  C     . ALA A 1  331 ? -41.543 24.107 -28.273 1.00 38.39 ? 328 ALA A C     1 
ATOM   2579 O  O     . ALA A 1  331 ? -41.146 25.282 -28.396 1.00 38.84 ? 328 ALA A O     1 
ATOM   2580 C  CB    . ALA A 1  331 ? -42.480 22.870 -26.300 1.00 38.28 ? 328 ALA A CB    1 
ATOM   2581 N  N     . ARG A 1  332 ? -40.888 23.060 -28.764 1.00 38.25 ? 329 ARG A N     1 
ATOM   2582 C  CA    A ARG A 1  332 ? -39.640 23.219 -29.501 0.70 39.05 ? 329 ARG A CA    1 
ATOM   2583 C  CA    B ARG A 1  332 ? -39.656 23.253 -29.516 0.30 38.23 ? 329 ARG A CA    1 
ATOM   2584 C  C     . ARG A 1  332 ? -39.798 22.585 -30.880 1.00 38.01 ? 329 ARG A C     1 
ATOM   2585 O  O     . ARG A 1  332 ? -39.268 21.499 -31.120 1.00 38.40 ? 329 ARG A O     1 
ATOM   2586 C  CB    A ARG A 1  332 ? -38.471 22.565 -28.737 0.70 39.81 ? 329 ARG A CB    1 
ATOM   2587 C  CB    B ARG A 1  332 ? -38.427 22.779 -28.719 0.30 38.43 ? 329 ARG A CB    1 
ATOM   2588 C  CG    A ARG A 1  332 ? -38.187 23.165 -27.346 0.70 42.89 ? 329 ARG A CG    1 
ATOM   2589 C  CG    B ARG A 1  332 ? -38.160 23.615 -27.449 0.30 38.53 ? 329 ARG A CG    1 
ATOM   2590 C  CD    A ARG A 1  332 ? -37.288 22.253 -26.483 0.70 47.47 ? 329 ARG A CD    1 
ATOM   2591 C  CD    B ARG A 1  332 ? -36.922 23.142 -26.686 0.30 38.65 ? 329 ARG A CD    1 
ATOM   2592 N  NE    A ARG A 1  332 ? -35.929 22.109 -27.021 0.70 50.82 ? 329 ARG A NE    1 
ATOM   2593 N  NE    B ARG A 1  332 ? -36.860 23.679 -25.327 0.30 37.88 ? 329 ARG A NE    1 
ATOM   2594 C  CZ    A ARG A 1  332 ? -35.428 20.978 -27.525 0.70 53.12 ? 329 ARG A CZ    1 
ATOM   2595 C  CZ    B ARG A 1  332 ? -37.240 23.011 -24.241 0.30 37.51 ? 329 ARG A CZ    1 
ATOM   2596 N  NH1   A ARG A 1  332 ? -36.162 19.869 -27.555 0.70 54.01 ? 329 ARG A NH1   1 
ATOM   2597 N  NH1   B ARG A 1  332 ? -37.717 21.778 -24.350 0.30 37.26 ? 329 ARG A NH1   1 
ATOM   2598 N  NH2   A ARG A 1  332 ? -34.185 20.949 -27.995 0.70 53.37 ? 329 ARG A NH2   1 
ATOM   2599 N  NH2   B ARG A 1  332 ? -37.147 23.574 -23.046 0.30 37.40 ? 329 ARG A NH2   1 
ATOM   2600 N  N     . PRO A 1  333 ? -40.545 23.249 -31.791 1.00 37.02 ? 330 PRO A N     1 
ATOM   2601 C  CA    . PRO A 1  333 ? -40.839 22.607 -33.087 1.00 36.05 ? 330 PRO A CA    1 
ATOM   2602 C  C     . PRO A 1  333 ? -39.583 22.369 -33.929 1.00 34.99 ? 330 PRO A C     1 
ATOM   2603 O  O     . PRO A 1  333 ? -38.726 23.236 -34.016 1.00 34.80 ? 330 PRO A O     1 
ATOM   2604 C  CB    . PRO A 1  333 ? -41.790 23.599 -33.762 1.00 35.69 ? 330 PRO A CB    1 
ATOM   2605 C  CG    . PRO A 1  333 ? -41.435 24.915 -33.183 1.00 36.38 ? 330 PRO A CG    1 
ATOM   2606 C  CD    . PRO A 1  333 ? -41.036 24.640 -31.747 1.00 36.70 ? 330 PRO A CD    1 
ATOM   2607 N  N     . ALA A 1  334 ? -39.476 21.178 -34.507 1.00 34.00 ? 331 ALA A N     1 
ATOM   2608 C  CA    . ALA A 1  334 ? -38.402 20.839 -35.430 1.00 32.94 ? 331 ALA A CA    1 
ATOM   2609 C  C     . ALA A 1  334 ? -38.507 21.621 -36.767 1.00 32.65 ? 331 ALA A C     1 
ATOM   2610 O  O     . ALA A 1  334 ? -39.555 22.184 -37.117 1.00 32.12 ? 331 ALA A O     1 
ATOM   2611 C  CB    . ALA A 1  334 ? -38.396 19.337 -35.680 1.00 32.90 ? 331 ALA A CB    1 
ATOM   2612 N  N     . SER A 1  335 ? -37.398 21.670 -37.491 1.00 32.27 ? 332 SER A N     1 
ATOM   2613 C  CA    . SER A 1  335 ? -37.336 22.361 -38.769 1.00 31.97 ? 332 SER A CA    1 
ATOM   2614 C  C     . SER A 1  335 ? -38.351 21.730 -39.732 1.00 31.53 ? 332 SER A C     1 
ATOM   2615 O  O     . SER A 1  335 ? -38.402 20.496 -39.867 1.00 31.09 ? 332 SER A O     1 
ATOM   2616 C  CB    . SER A 1  335 ? -35.920 22.291 -39.323 1.00 31.62 ? 332 SER A CB    1 
ATOM   2617 O  OG    . SER A 1  335 ? -35.856 22.954 -40.564 1.00 34.34 ? 332 SER A OG    1 
ATOM   2618 N  N     . LEU A 1  336 ? -39.180 22.581 -40.349 1.00 30.68 ? 333 LEU A N     1 
ATOM   2619 C  CA    . LEU A 1  336 ? -40.224 22.170 -41.322 1.00 30.48 ? 333 LEU A CA    1 
ATOM   2620 C  C     . LEU A 1  336 ? -41.360 21.320 -40.708 1.00 30.45 ? 333 LEU A C     1 
ATOM   2621 O  O     . LEU A 1  336 ? -42.014 20.516 -41.402 1.00 30.26 ? 333 LEU A O     1 
ATOM   2622 C  CB    . LEU A 1  336 ? -39.605 21.482 -42.562 1.00 30.05 ? 333 LEU A CB    1 
ATOM   2623 C  CG    . LEU A 1  336 ? -38.502 22.213 -43.354 1.00 30.06 ? 333 LEU A CG    1 
ATOM   2624 C  CD1   . LEU A 1  336 ? -37.963 21.311 -44.478 1.00 30.32 ? 333 LEU A CD1   1 
ATOM   2625 C  CD2   . LEU A 1  336 ? -38.992 23.551 -43.939 1.00 26.78 ? 333 LEU A CD2   1 
ATOM   2626 N  N     . ARG A 1  337 ? -41.583 21.509 -39.407 1.00 29.95 ? 334 ARG A N     1 
ATOM   2627 C  CA    . ARG A 1  337 ? -42.656 20.840 -38.682 1.00 29.50 ? 334 ARG A CA    1 
ATOM   2628 C  C     . ARG A 1  337 ? -43.629 21.889 -38.152 1.00 28.72 ? 334 ARG A C     1 
ATOM   2629 O  O     . ARG A 1  337 ? -43.247 23.035 -37.938 1.00 28.75 ? 334 ARG A O     1 
ATOM   2630 C  CB    . ARG A 1  337 ? -42.097 19.978 -37.542 1.00 29.97 ? 334 ARG A CB    1 
ATOM   2631 C  CG    . ARG A 1  337 ? -41.263 18.764 -37.998 1.00 31.41 ? 334 ARG A CG    1 
ATOM   2632 C  CD    . ARG A 1  337 ? -42.047 17.859 -38.954 1.00 33.39 ? 334 ARG A CD    1 
ATOM   2633 N  NE    . ARG A 1  337 ? -41.330 16.615 -39.228 1.00 34.95 ? 334 ARG A NE    1 
ATOM   2634 C  CZ    . ARG A 1  337 ? -41.650 15.734 -40.177 1.00 35.53 ? 334 ARG A CZ    1 
ATOM   2635 N  NH1   . ARG A 1  337 ? -42.672 15.951 -41.007 1.00 34.08 ? 334 ARG A NH1   1 
ATOM   2636 N  NH2   . ARG A 1  337 ? -40.920 14.634 -40.307 1.00 32.67 ? 334 ARG A NH2   1 
ATOM   2637 N  N     . PRO A 1  338 ? -44.895 21.507 -37.957 1.00 28.34 ? 335 PRO A N     1 
ATOM   2638 C  CA    . PRO A 1  338 ? -45.912 22.477 -37.555 1.00 28.83 ? 335 PRO A CA    1 
ATOM   2639 C  C     . PRO A 1  338 ? -45.629 23.135 -36.200 1.00 29.38 ? 335 PRO A C     1 
ATOM   2640 O  O     . PRO A 1  338 ? -45.051 22.501 -35.302 1.00 28.97 ? 335 PRO A O     1 
ATOM   2641 C  CB    . PRO A 1  338 ? -47.186 21.625 -37.470 1.00 29.05 ? 335 PRO A CB    1 
ATOM   2642 C  CG    . PRO A 1  338 ? -46.922 20.467 -38.430 1.00 28.51 ? 335 PRO A CG    1 
ATOM   2643 C  CD    . PRO A 1  338 ? -45.469 20.173 -38.226 1.00 27.77 ? 335 PRO A CD    1 
ATOM   2644 N  N     . ARG A 1  339 ? -46.071 24.384 -36.068 1.00 29.52 ? 336 ARG A N     1 
ATOM   2645 C  CA    . ARG A 1  339 ? -45.888 25.168 -34.849 1.00 29.87 ? 336 ARG A CA    1 
ATOM   2646 C  C     . ARG A 1  339 ? -47.035 24.973 -33.858 1.00 29.75 ? 336 ARG A C     1 
ATOM   2647 O  O     . ARG A 1  339 ? -46.970 25.475 -32.728 1.00 29.76 ? 336 ARG A O     1 
ATOM   2648 C  CB    . ARG A 1  339 ? -45.738 26.661 -35.192 1.00 30.33 ? 336 ARG A CB    1 
ATOM   2649 C  CG    . ARG A 1  339 ? -44.301 27.155 -35.338 1.00 30.82 ? 336 ARG A CG    1 
ATOM   2650 C  CD    . ARG A 1  339 ? -43.484 26.384 -36.361 1.00 32.70 ? 336 ARG A CD    1 
ATOM   2651 N  NE    . ARG A 1  339 ? -42.107 26.877 -36.352 1.00 35.59 ? 336 ARG A NE    1 
ATOM   2652 C  CZ    . ARG A 1  339 ? -41.021 26.174 -36.680 1.00 35.41 ? 336 ARG A CZ    1 
ATOM   2653 N  NH1   . ARG A 1  339 ? -41.103 24.898 -37.072 1.00 33.21 ? 336 ARG A NH1   1 
ATOM   2654 N  NH2   . ARG A 1  339 ? -39.837 26.763 -36.599 1.00 34.38 ? 336 ARG A NH2   1 
ATOM   2655 N  N     . TRP A 1  340 ? -48.073 24.249 -34.275 1.00 29.09 ? 337 TRP A N     1 
ATOM   2656 C  CA    . TRP A 1  340 ? -49.247 24.031 -33.421 1.00 29.58 ? 337 TRP A CA    1 
ATOM   2657 C  C     . TRP A 1  340 ? -49.648 22.573 -33.304 1.00 30.08 ? 337 TRP A C     1 
ATOM   2658 O  O     . TRP A 1  340 ? -49.533 21.800 -34.263 1.00 29.98 ? 337 TRP A O     1 
ATOM   2659 C  CB    . TRP A 1  340 ? -50.449 24.859 -33.898 1.00 29.32 ? 337 TRP A CB    1 
ATOM   2660 C  CG    . TRP A 1  340 ? -50.127 26.327 -33.967 1.00 30.31 ? 337 TRP A CG    1 
ATOM   2661 C  CD1   . TRP A 1  340 ? -49.627 27.004 -35.043 1.00 30.19 ? 337 TRP A CD1   1 
ATOM   2662 C  CD2   . TRP A 1  340 ? -50.235 27.288 -32.905 1.00 29.79 ? 337 TRP A CD2   1 
ATOM   2663 N  NE1   . TRP A 1  340 ? -49.429 28.319 -34.725 1.00 29.75 ? 337 TRP A NE1   1 
ATOM   2664 C  CE2   . TRP A 1  340 ? -49.792 28.527 -33.420 1.00 30.45 ? 337 TRP A CE2   1 
ATOM   2665 C  CE3   . TRP A 1  340 ? -50.668 27.224 -31.572 1.00 28.86 ? 337 TRP A CE3   1 
ATOM   2666 C  CZ2   . TRP A 1  340 ? -49.773 29.700 -32.651 1.00 29.44 ? 337 TRP A CZ2   1 
ATOM   2667 C  CZ3   . TRP A 1  340 ? -50.658 28.397 -30.808 1.00 29.44 ? 337 TRP A CZ3   1 
ATOM   2668 C  CH2   . TRP A 1  340 ? -50.210 29.620 -31.356 1.00 28.30 ? 337 TRP A CH2   1 
ATOM   2669 N  N     . HIS A 1  341 ? -50.114 22.205 -32.111 1.00 30.37 ? 338 HIS A N     1 
ATOM   2670 C  CA    . HIS A 1  341 ? -50.725 20.908 -31.865 1.00 30.88 ? 338 HIS A CA    1 
ATOM   2671 C  C     . HIS A 1  341 ? -52.122 20.856 -32.490 1.00 31.12 ? 338 HIS A C     1 
ATOM   2672 O  O     . HIS A 1  341 ? -52.694 21.888 -32.886 1.00 30.46 ? 338 HIS A O     1 
ATOM   2673 C  CB    . HIS A 1  341 ? -50.795 20.620 -30.348 1.00 30.94 ? 338 HIS A CB    1 
ATOM   2674 C  CG    . HIS A 1  341 ? -49.460 20.342 -29.721 1.00 31.45 ? 338 HIS A CG    1 
ATOM   2675 N  ND1   . HIS A 1  341 ? -48.752 19.180 -29.957 1.00 31.68 ? 338 HIS A ND1   1 
ATOM   2676 C  CD2   . HIS A 1  341 ? -48.696 21.082 -28.877 1.00 30.59 ? 338 HIS A CD2   1 
ATOM   2677 C  CE1   . HIS A 1  341 ? -47.615 19.213 -29.280 1.00 32.17 ? 338 HIS A CE1   1 
ATOM   2678 N  NE2   . HIS A 1  341 ? -47.553 20.358 -28.621 1.00 31.25 ? 338 HIS A NE2   1 
ATOM   2679 N  N     . LYS A 1  342 ? -52.668 19.649 -32.560 1.00 32.01 ? 339 LYS A N     1 
ATOM   2680 C  CA    . LYS A 1  342 ? -54.040 19.428 -33.020 1.00 33.70 ? 339 LYS A CA    1 
ATOM   2681 C  C     . LYS A 1  342 ? -55.037 20.090 -32.087 1.00 33.55 ? 339 LYS A C     1 
ATOM   2682 O  O     . LYS A 1  342 ? -54.737 20.296 -30.904 1.00 32.95 ? 339 LYS A O     1 
ATOM   2683 C  CB    . LYS A 1  342 ? -54.339 17.924 -33.130 1.00 34.44 ? 339 LYS A CB    1 
ATOM   2684 C  CG    . LYS A 1  342 ? -53.634 17.301 -34.319 1.00 38.59 ? 339 LYS A CG    1 
ATOM   2685 C  CD    . LYS A 1  342 ? -53.525 15.780 -34.219 1.00 45.25 ? 339 LYS A CD    1 
ATOM   2686 C  CE    . LYS A 1  342 ? -52.537 15.264 -35.271 1.00 47.25 ? 339 LYS A CE    1 
ATOM   2687 N  NZ    . LYS A 1  342 ? -52.326 13.784 -35.207 1.00 51.26 ? 339 LYS A NZ    1 
ATOM   2688 N  N     . PRO A 1  343 ? -56.223 20.431 -32.614 1.00 33.67 ? 340 PRO A N     1 
ATOM   2689 C  CA    . PRO A 1  343 ? -57.222 21.103 -31.801 1.00 34.47 ? 340 PRO A CA    1 
ATOM   2690 C  C     . PRO A 1  343 ? -57.545 20.362 -30.494 1.00 35.53 ? 340 PRO A C     1 
ATOM   2691 O  O     . PRO A 1  343 ? -57.460 19.134 -30.427 1.00 35.37 ? 340 PRO A O     1 
ATOM   2692 C  CB    . PRO A 1  343 ? -58.431 21.172 -32.734 1.00 34.29 ? 340 PRO A CB    1 
ATOM   2693 C  CG    . PRO A 1  343 ? -57.812 21.282 -34.091 1.00 33.53 ? 340 PRO A CG    1 
ATOM   2694 C  CD    . PRO A 1  343 ? -56.613 20.391 -34.036 1.00 33.63 ? 340 PRO A CD    1 
ATOM   2695 N  N     . SER A 1  344 ? -57.853 21.131 -29.458 1.00 35.92 ? 341 SER A N     1 
ATOM   2696 C  CA    . SER A 1  344 ? -58.319 20.581 -28.203 1.00 36.60 ? 341 SER A CA    1 
ATOM   2697 C  C     . SER A 1  344 ? -59.395 21.502 -27.667 1.00 36.71 ? 341 SER A C     1 
ATOM   2698 O  O     . SER A 1  344 ? -59.669 22.547 -28.266 1.00 36.96 ? 341 SER A O     1 
ATOM   2699 C  CB    . SER A 1  344 ? -57.168 20.371 -27.219 1.00 36.96 ? 341 SER A CB    1 
ATOM   2700 O  OG    . SER A 1  344 ? -56.295 21.475 -27.170 1.00 39.21 ? 341 SER A OG    1 
ATOM   2701 N  N     . THR A 1  345 ? -60.037 21.098 -26.575 1.00 36.75 ? 342 THR A N     1 
ATOM   2702 C  CA    . THR A 1  345 ? -61.215 21.797 -26.071 1.00 37.01 ? 342 THR A CA    1 
ATOM   2703 C  C     . THR A 1  345 ? -60.884 22.446 -24.734 1.00 36.54 ? 342 THR A C     1 
ATOM   2704 O  O     . THR A 1  345 ? -60.190 21.856 -23.914 1.00 36.80 ? 342 THR A O     1 
ATOM   2705 C  CB    . THR A 1  345 ? -62.397 20.801 -25.896 1.00 37.18 ? 342 THR A CB    1 
ATOM   2706 O  OG1   . THR A 1  345 ? -62.623 20.110 -27.132 1.00 38.70 ? 342 THR A OG1   1 
ATOM   2707 C  CG2   . THR A 1  345 ? -63.672 21.524 -25.492 1.00 37.49 ? 342 THR A CG2   1 
ATOM   2708 N  N     . VAL A 1  346 ? -61.370 23.661 -24.527 1.00 36.58 ? 343 VAL A N     1 
ATOM   2709 C  CA    . VAL A 1  346 ? -61.251 24.316 -23.232 1.00 37.00 ? 343 VAL A CA    1 
ATOM   2710 C  C     . VAL A 1  346 ? -62.255 23.686 -22.248 1.00 37.64 ? 343 VAL A C     1 
ATOM   2711 O  O     . VAL A 1  346 ? -63.476 23.801 -22.445 1.00 37.46 ? 343 VAL A O     1 
ATOM   2712 C  CB    . VAL A 1  346 ? -61.505 25.852 -23.335 1.00 36.96 ? 343 VAL A CB    1 
ATOM   2713 C  CG1   . VAL A 1  346 ? -61.458 26.508 -21.944 1.00 36.58 ? 343 VAL A CG1   1 
ATOM   2714 C  CG2   . VAL A 1  346 ? -60.494 26.513 -24.272 1.00 36.60 ? 343 VAL A CG2   1 
ATOM   2715 N  N     . LEU A 1  347 ? -61.732 23.035 -21.209 1.00 38.54 ? 344 LEU A N     1 
ATOM   2716 C  CA    . LEU A 1  347 ? -62.548 22.474 -20.119 1.00 39.70 ? 344 LEU A CA    1 
ATOM   2717 C  C     . LEU A 1  347 ? -62.892 23.505 -19.067 1.00 39.83 ? 344 LEU A C     1 
ATOM   2718 O  O     . LEU A 1  347 ? -64.044 23.592 -18.630 1.00 40.07 ? 344 LEU A O     1 
ATOM   2719 C  CB    . LEU A 1  347 ? -61.825 21.328 -19.424 1.00 39.80 ? 344 LEU A CB    1 
ATOM   2720 C  CG    . LEU A 1  347 ? -61.314 20.193 -20.303 1.00 41.87 ? 344 LEU A CG    1 
ATOM   2721 C  CD1   . LEU A 1  347 ? -60.487 19.233 -19.455 1.00 43.17 ? 344 LEU A CD1   1 
ATOM   2722 C  CD2   . LEU A 1  347 ? -62.468 19.472 -21.020 1.00 43.02 ? 344 LEU A CD2   1 
ATOM   2723 N  N     . LYS A 1  348 ? -61.894 24.288 -18.661 1.00 39.75 ? 345 LYS A N     1 
ATOM   2724 C  CA    . LYS A 1  348 ? -62.070 25.239 -17.570 1.00 39.62 ? 345 LYS A CA    1 
ATOM   2725 C  C     . LYS A 1  348 ? -61.318 26.535 -17.837 1.00 39.14 ? 345 LYS A C     1 
ATOM   2726 O  O     . LYS A 1  348 ? -60.145 26.504 -18.219 1.00 38.90 ? 345 LYS A O     1 
ATOM   2727 C  CB    . LYS A 1  348 ? -61.584 24.603 -16.262 1.00 39.83 ? 345 LYS A CB    1 
ATOM   2728 C  CG    . LYS A 1  348 ? -62.035 25.315 -14.994 1.00 41.74 ? 345 LYS A CG    1 
ATOM   2729 C  CD    . LYS A 1  348 ? -61.946 24.366 -13.787 1.00 44.11 ? 345 LYS A CD    1 
ATOM   2730 C  CE    . LYS A 1  348 ? -62.070 25.105 -12.449 1.00 46.32 ? 345 LYS A CE    1 
ATOM   2731 N  NZ    . LYS A 1  348 ? -63.385 25.799 -12.291 1.00 46.21 ? 345 LYS A NZ    1 
ATOM   2732 N  N     . VAL A 1  349 ? -62.008 27.658 -17.652 1.00 38.59 ? 346 VAL A N     1 
ATOM   2733 C  CA    . VAL A 1  349 ? -61.387 28.980 -17.649 1.00 38.50 ? 346 VAL A CA    1 
ATOM   2734 C  C     . VAL A 1  349 ? -61.011 29.345 -16.203 1.00 38.39 ? 346 VAL A C     1 
ATOM   2735 O  O     . VAL A 1  349 ? -61.878 29.738 -15.427 1.00 38.56 ? 346 VAL A O     1 
ATOM   2736 C  CB    . VAL A 1  349 ? -62.336 30.051 -18.255 1.00 38.41 ? 346 VAL A CB    1 
ATOM   2737 C  CG1   . VAL A 1  349 ? -61.741 31.460 -18.138 1.00 38.12 ? 346 VAL A CG1   1 
ATOM   2738 C  CG2   . VAL A 1  349 ? -62.655 29.725 -19.724 1.00 38.64 ? 346 VAL A CG2   1 
ATOM   2739 N  N     . LEU A 1  350 ? -59.731 29.197 -15.841 1.00 37.88 ? 347 LEU A N     1 
ATOM   2740 C  CA    . LEU A 1  350 ? -59.276 29.506 -14.475 1.00 37.34 ? 347 LEU A CA    1 
ATOM   2741 C  C     . LEU A 1  350 ? -59.332 30.994 -14.202 1.00 37.22 ? 347 LEU A C     1 
ATOM   2742 O  O     . LEU A 1  350 ? -59.801 31.431 -13.143 1.00 37.23 ? 347 LEU A O     1 
ATOM   2743 C  CB    . LEU A 1  350 ? -57.877 28.968 -14.205 1.00 37.02 ? 347 LEU A CB    1 
ATOM   2744 C  CG    . LEU A 1  350 ? -57.703 27.463 -14.340 1.00 36.72 ? 347 LEU A CG    1 
ATOM   2745 C  CD1   . LEU A 1  350 ? -56.295 27.108 -13.948 1.00 38.01 ? 347 LEU A CD1   1 
ATOM   2746 C  CD2   . LEU A 1  350 ? -58.724 26.687 -13.494 1.00 36.70 ? 347 LEU A CD2   1 
ATOM   2747 N  N     . ASN A 1  351 ? -58.855 31.761 -15.178 1.00 36.78 ? 348 ASN A N     1 
ATOM   2748 C  CA    . ASN A 1  351 ? -59.070 33.207 -15.260 1.00 35.93 ? 348 ASN A CA    1 
ATOM   2749 C  C     . ASN A 1  351 ? -58.983 33.540 -16.744 1.00 35.30 ? 348 ASN A C     1 
ATOM   2750 O  O     . ASN A 1  351 ? -58.613 32.663 -17.533 1.00 35.34 ? 348 ASN A O     1 
ATOM   2751 C  CB    . ASN A 1  351 ? -58.047 34.000 -14.405 1.00 35.75 ? 348 ASN A CB    1 
ATOM   2752 C  CG    . ASN A 1  351 ? -56.571 33.702 -14.771 1.00 36.33 ? 348 ASN A CG    1 
ATOM   2753 O  OD1   . ASN A 1  351 ? -56.154 33.751 -15.949 1.00 34.35 ? 348 ASN A OD1   1 
ATOM   2754 N  ND2   . ASN A 1  351 ? -55.777 33.421 -13.750 1.00 34.38 ? 348 ASN A ND2   1 
ATOM   2755 N  N     . PRO A 1  352 ? -59.297 34.794 -17.138 1.00 34.80 ? 349 PRO A N     1 
ATOM   2756 C  CA    . PRO A 1  352 ? -59.276 35.134 -18.576 1.00 33.89 ? 349 PRO A CA    1 
ATOM   2757 C  C     . PRO A 1  352 ? -57.955 34.855 -19.332 1.00 32.83 ? 349 PRO A C     1 
ATOM   2758 O  O     . PRO A 1  352 ? -57.953 34.904 -20.559 1.00 32.67 ? 349 PRO A O     1 
ATOM   2759 C  CB    . PRO A 1  352 ? -59.580 36.635 -18.584 1.00 34.20 ? 349 PRO A CB    1 
ATOM   2760 C  CG    . PRO A 1  352 ? -60.249 36.906 -17.237 1.00 34.56 ? 349 PRO A CG    1 
ATOM   2761 C  CD    . PRO A 1  352 ? -59.585 35.978 -16.295 1.00 34.50 ? 349 PRO A CD    1 
ATOM   2762 N  N     . ARG A 1  353 ? -56.866 34.549 -18.623 1.00 31.58 ? 350 ARG A N     1 
ATOM   2763 C  CA    . ARG A 1  353 ? -55.550 34.352 -19.251 1.00 30.63 ? 350 ARG A CA    1 
ATOM   2764 C  C     . ARG A 1  353 ? -55.019 32.935 -19.095 1.00 30.69 ? 350 ARG A C     1 
ATOM   2765 O  O     . ARG A 1  353 ? -53.918 32.619 -19.556 1.00 30.52 ? 350 ARG A O     1 
ATOM   2766 C  CB    . ARG A 1  353 ? -54.537 35.336 -18.660 1.00 30.53 ? 350 ARG A CB    1 
ATOM   2767 C  CG    . ARG A 1  353 ? -54.852 36.819 -18.901 1.00 29.07 ? 350 ARG A CG    1 
ATOM   2768 C  CD    . ARG A 1  353 ? -54.150 37.360 -20.154 1.00 26.73 ? 350 ARG A CD    1 
ATOM   2769 N  NE    . ARG A 1  353 ? -52.723 37.066 -20.108 1.00 26.48 ? 350 ARG A NE    1 
ATOM   2770 C  CZ    . ARG A 1  353 ? -51.918 37.015 -21.160 1.00 25.86 ? 350 ARG A CZ    1 
ATOM   2771 N  NH1   . ARG A 1  353 ? -52.398 37.267 -22.382 1.00 24.83 ? 350 ARG A NH1   1 
ATOM   2772 N  NH2   . ARG A 1  353 ? -50.627 36.701 -20.986 1.00 23.70 ? 350 ARG A NH2   1 
ATOM   2773 N  N     . THR A 1  354 ? -55.793 32.072 -18.437 1.00 30.73 ? 351 THR A N     1 
ATOM   2774 C  CA    . THR A 1  354 ? -55.297 30.750 -18.061 1.00 30.78 ? 351 THR A CA    1 
ATOM   2775 C  C     . THR A 1  354 ? -56.428 29.756 -18.137 1.00 31.30 ? 351 THR A C     1 
ATOM   2776 O  O     . THR A 1  354 ? -57.519 30.003 -17.595 1.00 31.35 ? 351 THR A O     1 
ATOM   2777 C  CB    . THR A 1  354 ? -54.748 30.733 -16.607 1.00 30.53 ? 351 THR A CB    1 
ATOM   2778 O  OG1   . THR A 1  354 ? -54.189 32.008 -16.286 1.00 30.31 ? 351 THR A OG1   1 
ATOM   2779 C  CG2   . THR A 1  354 ? -53.699 29.658 -16.438 1.00 30.38 ? 351 THR A CG2   1 
ATOM   2780 N  N     . VAL A 1  355 ? -56.177 28.633 -18.803 1.00 31.31 ? 352 VAL A N     1 
ATOM   2781 C  CA    . VAL A 1  355 ? -57.233 27.651 -19.015 1.00 31.75 ? 352 VAL A CA    1 
ATOM   2782 C  C     . VAL A 1  355 ? -56.740 26.231 -18.820 1.00 32.49 ? 352 VAL A C     1 
ATOM   2783 O  O     . VAL A 1  355 ? -55.529 25.965 -18.850 1.00 32.68 ? 352 VAL A O     1 
ATOM   2784 C  CB    . VAL A 1  355 ? -57.894 27.776 -20.420 1.00 31.53 ? 352 VAL A CB    1 
ATOM   2785 C  CG1   . VAL A 1  355 ? -58.402 29.159 -20.650 1.00 31.78 ? 352 VAL A CG1   1 
ATOM   2786 C  CG2   . VAL A 1  355 ? -56.925 27.404 -21.509 1.00 32.12 ? 352 VAL A CG2   1 
ATOM   2787 N  N     . VAL A 1  356 ? -57.686 25.323 -18.598 1.00 33.36 ? 353 VAL A N     1 
ATOM   2788 C  CA    . VAL A 1  356 ? -57.378 23.908 -18.621 1.00 34.31 ? 353 VAL A CA    1 
ATOM   2789 C  C     . VAL A 1  356 ? -57.915 23.361 -19.926 1.00 35.40 ? 353 VAL A C     1 
ATOM   2790 O  O     . VAL A 1  356 ? -59.066 23.599 -20.287 1.00 34.69 ? 353 VAL A O     1 
ATOM   2791 C  CB    . VAL A 1  356 ? -58.018 23.131 -17.442 1.00 34.40 ? 353 VAL A CB    1 
ATOM   2792 C  CG1   . VAL A 1  356 ? -57.628 21.652 -17.506 1.00 32.92 ? 353 VAL A CG1   1 
ATOM   2793 C  CG2   . VAL A 1  356 ? -57.613 23.758 -16.097 1.00 33.78 ? 353 VAL A CG2   1 
ATOM   2794 N  N     . ILE A 1  357 ? -57.073 22.628 -20.633 1.00 37.43 ? 354 ILE A N     1 
ATOM   2795 C  CA    . ILE A 1  357 ? -57.491 22.016 -21.885 1.00 39.89 ? 354 ILE A CA    1 
ATOM   2796 C  C     . ILE A 1  357 ? -57.417 20.511 -21.816 1.00 42.14 ? 354 ILE A C     1 
ATOM   2797 O  O     . ILE A 1  357 ? -56.604 19.952 -21.077 1.00 42.18 ? 354 ILE A O     1 
ATOM   2798 C  CB    . ILE A 1  357 ? -56.645 22.508 -23.102 1.00 39.01 ? 354 ILE A CB    1 
ATOM   2799 C  CG1   . ILE A 1  357 ? -55.154 22.202 -22.898 1.00 38.88 ? 354 ILE A CG1   1 
ATOM   2800 C  CG2   . ILE A 1  357 ? -56.916 23.978 -23.374 1.00 38.08 ? 354 ILE A CG2   1 
ATOM   2801 C  CD1   . ILE A 1  357 ? -54.281 22.417 -24.149 1.00 38.33 ? 354 ILE A CD1   1 
ATOM   2802 N  N     . LEU A 1  358 ? -58.271 19.870 -22.605 1.00 45.43 ? 355 LEU A N     1 
ATOM   2803 C  CA    . LEU A 1  358 ? -58.173 18.445 -22.875 1.00 48.95 ? 355 LEU A CA    1 
ATOM   2804 C  C     . LEU A 1  358 ? -57.587 18.234 -24.267 1.00 51.02 ? 355 LEU A C     1 
ATOM   2805 O  O     . LEU A 1  358 ? -58.180 18.691 -25.247 1.00 51.37 ? 355 LEU A O     1 
ATOM   2806 C  CB    . LEU A 1  358 ? -59.573 17.827 -22.822 1.00 49.17 ? 355 LEU A CB    1 
ATOM   2807 C  CG    . LEU A 1  358 ? -59.752 16.317 -23.005 1.00 50.36 ? 355 LEU A CG    1 
ATOM   2808 C  CD1   . LEU A 1  358 ? -59.336 15.585 -21.746 1.00 51.11 ? 355 LEU A CD1   1 
ATOM   2809 C  CD2   . LEU A 1  358 ? -61.212 16.013 -23.349 1.00 51.41 ? 355 LEU A CD2   1 
ATOM   2810 N  N     . ASP A 1  359 ? -56.438 17.555 -24.357 1.00 53.72 ? 356 ASP A N     1 
ATOM   2811 C  CA    . ASP A 1  359 ? -55.882 17.105 -25.654 1.00 56.44 ? 356 ASP A CA    1 
ATOM   2812 C  C     . ASP A 1  359 ? -56.829 16.140 -26.382 1.00 57.90 ? 356 ASP A C     1 
ATOM   2813 O  O     . ASP A 1  359 ? -57.835 15.686 -25.819 1.00 58.22 ? 356 ASP A O     1 
ATOM   2814 C  CB    . ASP A 1  359 ? -54.554 16.349 -25.477 1.00 56.48 ? 356 ASP A CB    1 
ATOM   2815 C  CG    . ASP A 1  359 ? -53.595 17.041 -24.556 1.00 58.38 ? 356 ASP A CG    1 
ATOM   2816 O  OD1   . ASP A 1  359 ? -52.632 16.372 -24.122 1.00 59.83 ? 356 ASP A OD1   1 
ATOM   2817 O  OD2   . ASP A 1  359 ? -53.799 18.239 -24.258 1.00 60.42 ? 356 ASP A OD2   1 
ATOM   2818 N  N     . HIS A 1  360 ? -56.474 15.811 -27.627 1.00 59.61 ? 357 HIS A N     1 
ATOM   2819 C  CA    . HIS A 1  360 ? -57.105 14.711 -28.364 1.00 61.11 ? 357 HIS A CA    1 
ATOM   2820 C  C     . HIS A 1  360 ? -56.703 13.367 -27.737 1.00 61.55 ? 357 HIS A C     1 
ATOM   2821 O  O     . HIS A 1  360 ? -57.414 12.371 -27.874 1.00 61.84 ? 357 HIS A O     1 
ATOM   2822 C  CB    . HIS A 1  360 ? -56.733 14.763 -29.860 1.00 61.40 ? 357 HIS A CB    1 
ATOM   2823 C  CG    . HIS A 1  360 ? -55.325 14.340 -30.159 1.00 62.80 ? 357 HIS A CG    1 
ATOM   2824 N  ND1   . HIS A 1  360 ? -54.227 14.908 -29.548 1.00 64.77 ? 357 HIS A ND1   1 
ATOM   2825 C  CD2   . HIS A 1  360 ? -54.837 13.405 -31.010 1.00 63.93 ? 357 HIS A CD2   1 
ATOM   2826 C  CE1   . HIS A 1  360 ? -53.124 14.337 -30.002 1.00 64.97 ? 357 HIS A CE1   1 
ATOM   2827 N  NE2   . HIS A 1  360 ? -53.467 13.422 -30.891 1.00 65.22 ? 357 HIS A NE2   1 
ATOM   2828 N  N     . LEU A 1  361 ? -55.564 13.361 -27.045 1.00 62.08 ? 358 LEU A N     1 
ATOM   2829 C  CA    . LEU A 1  361 ? -55.091 12.186 -26.306 1.00 62.57 ? 358 LEU A CA    1 
ATOM   2830 C  C     . LEU A 1  361 ? -55.475 12.205 -24.815 1.00 62.43 ? 358 LEU A C     1 
ATOM   2831 O  O     . LEU A 1  361 ? -54.771 11.631 -23.977 1.00 63.13 ? 358 LEU A O     1 
ATOM   2832 C  CB    . LEU A 1  361 ? -53.573 12.000 -26.479 1.00 62.84 ? 358 LEU A CB    1 
ATOM   2833 C  CG    . LEU A 1  361 ? -53.115 10.981 -27.533 1.00 63.60 ? 358 LEU A CG    1 
ATOM   2834 C  CD1   . LEU A 1  361 ? -51.719 11.318 -28.034 1.00 64.61 ? 358 LEU A CD1   1 
ATOM   2835 C  CD2   . LEU A 1  361 ? -53.168 9.537  -26.994 1.00 64.58 ? 358 LEU A CD2   1 
ATOM   2836 N  N     . GLY A 1  362 ? -56.580 12.881 -24.495 1.00 61.74 ? 359 GLY A N     1 
ATOM   2837 C  CA    . GLY A 1  362 ? -57.220 12.778 -23.176 1.00 60.46 ? 359 GLY A CA    1 
ATOM   2838 C  C     . GLY A 1  362 ? -56.577 13.416 -21.949 1.00 59.37 ? 359 GLY A C     1 
ATOM   2839 O  O     . GLY A 1  362 ? -57.109 13.281 -20.848 1.00 59.70 ? 359 GLY A O     1 
ATOM   2840 N  N     . ASN A 1  363 ? -55.456 14.114 -22.119 1.00 57.96 ? 360 ASN A N     1 
ATOM   2841 C  CA    . ASN A 1  363 ? -54.770 14.750 -20.990 1.00 56.39 ? 360 ASN A CA    1 
ATOM   2842 C  C     . ASN A 1  363 ? -55.264 16.142 -20.608 1.00 54.83 ? 360 ASN A C     1 
ATOM   2843 O  O     . ASN A 1  363 ? -55.581 16.956 -21.488 1.00 55.23 ? 360 ASN A O     1 
ATOM   2844 C  CB    . ASN A 1  363 ? -53.273 14.790 -21.249 1.00 56.99 ? 360 ASN A CB    1 
ATOM   2845 C  CG    . ASN A 1  363 ? -52.641 13.427 -21.138 1.00 58.38 ? 360 ASN A CG    1 
ATOM   2846 O  OD1   . ASN A 1  363 ? -53.307 12.410 -21.335 1.00 60.20 ? 360 ASN A OD1   1 
ATOM   2847 N  ND2   . ASN A 1  363 ? -51.354 13.392 -20.809 1.00 58.99 ? 360 ASN A ND2   1 
ATOM   2848 N  N     . ASN A 1  364 ? -55.327 16.400 -19.297 1.00 52.24 ? 361 ASN A N     1 
ATOM   2849 C  CA    . ASN A 1  364 ? -55.648 17.723 -18.758 1.00 49.92 ? 361 ASN A CA    1 
ATOM   2850 C  C     . ASN A 1  364 ? -54.389 18.552 -18.610 1.00 47.95 ? 361 ASN A C     1 
ATOM   2851 O  O     . ASN A 1  364 ? -53.442 18.132 -17.940 1.00 47.58 ? 361 ASN A O     1 
ATOM   2852 C  CB    . ASN A 1  364 ? -56.352 17.623 -17.403 1.00 50.39 ? 361 ASN A CB    1 
ATOM   2853 C  CG    . ASN A 1  364 ? -57.845 17.362 -17.539 1.00 51.52 ? 361 ASN A CG    1 
ATOM   2854 O  OD1   . ASN A 1  364 ? -58.296 16.800 -18.534 1.00 54.62 ? 361 ASN A OD1   1 
ATOM   2855 N  ND2   . ASN A 1  364 ? -58.616 17.783 -16.547 1.00 52.08 ? 361 ASN A ND2   1 
ATOM   2856 N  N     . ARG A 1  365 ? -54.379 19.723 -19.242 1.00 45.09 ? 362 ARG A N     1 
ATOM   2857 C  CA    . ARG A 1  365 ? -53.211 20.602 -19.207 1.00 42.91 ? 362 ARG A CA    1 
ATOM   2858 C  C     . ARG A 1  365 ? -53.623 22.014 -18.854 1.00 40.17 ? 362 ARG A C     1 
ATOM   2859 O  O     . ARG A 1  365 ? -54.583 22.541 -19.419 1.00 39.91 ? 362 ARG A O     1 
ATOM   2860 C  CB    . ARG A 1  365 ? -52.498 20.608 -20.559 1.00 43.50 ? 362 ARG A CB    1 
ATOM   2861 C  CG    . ARG A 1  365 ? -51.662 19.378 -20.826 1.00 45.68 ? 362 ARG A CG    1 
ATOM   2862 C  CD    . ARG A 1  365 ? -50.991 19.451 -22.215 1.00 49.02 ? 362 ARG A CD    1 
ATOM   2863 N  NE    . ARG A 1  365 ? -49.993 20.523 -22.290 1.00 48.20 ? 362 ARG A NE    1 
ATOM   2864 C  CZ    . ARG A 1  365 ? -48.791 20.477 -21.727 1.00 47.97 ? 362 ARG A CZ    1 
ATOM   2865 N  NH1   . ARG A 1  365 ? -48.410 19.414 -21.032 1.00 48.73 ? 362 ARG A NH1   1 
ATOM   2866 N  NH2   . ARG A 1  365 ? -47.965 21.501 -21.854 1.00 47.73 ? 362 ARG A NH2   1 
ATOM   2867 N  N     . THR A 1  366 ? -52.910 22.608 -17.903 1.00 37.44 ? 363 THR A N     1 
ATOM   2868 C  CA    . THR A 1  366 ? -53.132 24.010 -17.524 1.00 35.32 ? 363 THR A CA    1 
ATOM   2869 C  C     . THR A 1  366 ? -52.127 24.861 -18.290 1.00 33.46 ? 363 THR A C     1 
ATOM   2870 O  O     . THR A 1  366 ? -50.915 24.668 -18.174 1.00 32.75 ? 363 THR A O     1 
ATOM   2871 C  CB    . THR A 1  366 ? -52.976 24.220 -16.006 1.00 35.43 ? 363 THR A CB    1 
ATOM   2872 O  OG1   . THR A 1  366 ? -53.906 23.371 -15.324 1.00 37.14 ? 363 THR A OG1   1 
ATOM   2873 C  CG2   . THR A 1  366 ? -53.250 25.693 -15.614 1.00 34.36 ? 363 THR A CG2   1 
ATOM   2874 N  N     . VAL A 1  367 ? -52.639 25.785 -19.095 1.00 31.80 ? 364 VAL A N     1 
ATOM   2875 C  CA    . VAL A 1  367 ? -51.800 26.501 -20.047 1.00 29.77 ? 364 VAL A CA    1 
ATOM   2876 C  C     . VAL A 1  367 ? -52.160 27.982 -20.095 1.00 28.80 ? 364 VAL A C     1 
ATOM   2877 O  O     . VAL A 1  367 ? -53.275 28.353 -19.790 1.00 29.07 ? 364 VAL A O     1 
ATOM   2878 C  CB    . VAL A 1  367 ? -51.903 25.898 -21.492 1.00 29.96 ? 364 VAL A CB    1 
ATOM   2879 C  CG1   . VAL A 1  367 ? -51.388 24.460 -21.550 1.00 29.85 ? 364 VAL A CG1   1 
ATOM   2880 C  CG2   . VAL A 1  367 ? -53.326 26.005 -22.034 1.00 28.20 ? 364 VAL A CG2   1 
ATOM   2881 N  N     . SER A 1  368 ? -51.195 28.812 -20.486 1.00 27.87 ? 365 SER A N     1 
ATOM   2882 C  CA    . SER A 1  368 ? -51.415 30.243 -20.695 1.00 26.59 ? 365 SER A CA    1 
ATOM   2883 C  C     . SER A 1  368 ? -52.090 30.462 -22.042 1.00 26.56 ? 365 SER A C     1 
ATOM   2884 O  O     . SER A 1  368 ? -51.758 29.777 -23.014 1.00 25.93 ? 365 SER A O     1 
ATOM   2885 C  CB    . SER A 1  368 ? -50.064 30.974 -20.664 1.00 26.45 ? 365 SER A CB    1 
ATOM   2886 O  OG    . SER A 1  368 ? -50.217 32.313 -21.106 1.00 25.41 ? 365 SER A OG    1 
ATOM   2887 N  N     . ILE A 1  369 ? -53.016 31.419 -22.129 1.00 27.14 ? 366 ILE A N     1 
ATOM   2888 C  CA    . ILE A 1  369 ? -53.593 31.746 -23.441 1.00 27.88 ? 366 ILE A CA    1 
ATOM   2889 C  C     . ILE A 1  369 ? -52.564 32.285 -24.459 1.00 27.56 ? 366 ILE A C     1 
ATOM   2890 O  O     . ILE A 1  369 ? -52.800 32.244 -25.669 1.00 27.58 ? 366 ILE A O     1 
ATOM   2891 C  CB    . ILE A 1  369 ? -54.850 32.665 -23.376 1.00 28.24 ? 366 ILE A CB    1 
ATOM   2892 C  CG1   . ILE A 1  369 ? -54.502 34.118 -23.082 1.00 27.98 ? 366 ILE A CG1   1 
ATOM   2893 C  CG2   . ILE A 1  369 ? -55.902 32.108 -22.408 1.00 30.43 ? 366 ILE A CG2   1 
ATOM   2894 C  CD1   . ILE A 1  369 ? -55.730 35.051 -23.278 1.00 29.29 ? 366 ILE A CD1   1 
ATOM   2895 N  N     . ASP A 1  370 ? -51.424 32.778 -23.979 1.00 27.76 ? 367 ASP A N     1 
ATOM   2896 C  CA    . ASP A 1  370 ? -50.352 33.215 -24.894 1.00 27.72 ? 367 ASP A CA    1 
ATOM   2897 C  C     . ASP A 1  370 ? -49.788 32.064 -25.704 1.00 27.72 ? 367 ASP A C     1 
ATOM   2898 O  O     . ASP A 1  370 ? -49.135 32.291 -26.723 1.00 27.89 ? 367 ASP A O     1 
ATOM   2899 C  CB    . ASP A 1  370 ? -49.194 33.862 -24.147 1.00 27.17 ? 367 ASP A CB    1 
ATOM   2900 C  CG    . ASP A 1  370 ? -49.519 35.223 -23.640 1.00 27.75 ? 367 ASP A CG    1 
ATOM   2901 O  OD1   . ASP A 1  370 ? -50.465 35.870 -24.153 1.00 26.53 ? 367 ASP A OD1   1 
ATOM   2902 O  OD2   . ASP A 1  370 ? -48.813 35.649 -22.704 1.00 29.19 ? 367 ASP A OD2   1 
ATOM   2903 N  N     . ASN A 1  371 ? -50.000 30.842 -25.229 1.00 27.38 ? 368 ASN A N     1 
ATOM   2904 C  CA    . ASN A 1  371 ? -49.519 29.642 -25.930 1.00 27.49 ? 368 ASN A CA    1 
ATOM   2905 C  C     . ASN A 1  371 ? -50.679 28.862 -26.588 1.00 27.29 ? 368 ASN A C     1 
ATOM   2906 O  O     . ASN A 1  371 ? -50.549 27.699 -26.926 1.00 26.98 ? 368 ASN A O     1 
ATOM   2907 C  CB    . ASN A 1  371 ? -48.768 28.745 -24.965 1.00 26.64 ? 368 ASN A CB    1 
ATOM   2908 C  CG    . ASN A 1  371 ? -47.406 29.295 -24.598 1.00 29.34 ? 368 ASN A CG    1 
ATOM   2909 O  OD1   . ASN A 1  371 ? -46.665 29.803 -25.456 1.00 29.74 ? 368 ASN A OD1   1 
ATOM   2910 N  ND2   . ASN A 1  371 ? -47.045 29.170 -23.322 1.00 29.40 ? 368 ASN A ND2   1 
ATOM   2911 N  N     . LEU A 1  372 ? -51.805 29.533 -26.750 1.00 27.45 ? 369 LEU A N     1 
ATOM   2912 C  CA    . LEU A 1  372 ? -52.953 29.006 -27.498 1.00 27.91 ? 369 LEU A CA    1 
ATOM   2913 C  C     . LEU A 1  372 ? -53.326 29.926 -28.668 1.00 28.09 ? 369 LEU A C     1 
ATOM   2914 O  O     . LEU A 1  372 ? -53.113 31.150 -28.615 1.00 27.03 ? 369 LEU A O     1 
ATOM   2915 C  CB    . LEU A 1  372 ? -54.189 28.893 -26.579 1.00 27.64 ? 369 LEU A CB    1 
ATOM   2916 C  CG    . LEU A 1  372 ? -54.165 27.923 -25.396 1.00 27.69 ? 369 LEU A CG    1 
ATOM   2917 C  CD1   . LEU A 1  372 ? -55.431 28.076 -24.552 1.00 30.01 ? 369 LEU A CD1   1 
ATOM   2918 C  CD2   . LEU A 1  372 ? -54.050 26.494 -25.923 1.00 28.63 ? 369 LEU A CD2   1 
ATOM   2919 N  N     . LYS A 1  373 ? -53.880 29.320 -29.719 1.00 28.12 ? 370 LYS A N     1 
ATOM   2920 C  CA    . LYS A 1  373 ? -54.706 30.048 -30.690 1.00 28.42 ? 370 LYS A CA    1 
ATOM   2921 C  C     . LYS A 1  373 ? -56.134 29.454 -30.754 1.00 28.31 ? 370 LYS A C     1 
ATOM   2922 O  O     . LYS A 1  373 ? -56.307 28.241 -30.605 1.00 28.20 ? 370 LYS A O     1 
ATOM   2923 C  CB    . LYS A 1  373 ? -54.047 30.041 -32.078 1.00 28.22 ? 370 LYS A CB    1 
ATOM   2924 C  CG    . LYS A 1  373 ? -53.926 28.672 -32.753 1.00 29.71 ? 370 LYS A CG    1 
ATOM   2925 C  CD    . LYS A 1  373 ? -53.587 28.818 -34.256 1.00 29.88 ? 370 LYS A CD    1 
ATOM   2926 C  CE    . LYS A 1  373 ? -53.379 27.449 -34.911 1.00 30.15 ? 370 LYS A CE    1 
ATOM   2927 N  NZ    . LYS A 1  373 ? -52.869 27.572 -36.323 1.00 31.72 ? 370 LYS A NZ    1 
ATOM   2928 N  N     . PRO A 1  374 ? -57.157 30.299 -30.965 1.00 28.50 ? 371 PRO A N     1 
ATOM   2929 C  CA    . PRO A 1  374 ? -58.480 29.720 -31.215 1.00 28.72 ? 371 PRO A CA    1 
ATOM   2930 C  C     . PRO A 1  374 ? -58.503 29.113 -32.614 1.00 29.29 ? 371 PRO A C     1 
ATOM   2931 O  O     . PRO A 1  374 ? -58.032 29.739 -33.552 1.00 29.27 ? 371 PRO A O     1 
ATOM   2932 C  CB    . PRO A 1  374 ? -59.421 30.925 -31.144 1.00 28.84 ? 371 PRO A CB    1 
ATOM   2933 C  CG    . PRO A 1  374 ? -58.571 32.122 -31.494 1.00 28.93 ? 371 PRO A CG    1 
ATOM   2934 C  CD    . PRO A 1  374 ? -57.143 31.769 -31.087 1.00 28.46 ? 371 PRO A CD    1 
ATOM   2935 N  N     . THR A 1  375 ? -58.993 27.887 -32.746 1.00 29.80 ? 372 THR A N     1 
ATOM   2936 C  CA    . THR A 1  375 ? -59.049 27.226 -34.042 1.00 30.45 ? 372 THR A CA    1 
ATOM   2937 C  C     . THR A 1  375 ? -59.920 28.018 -35.033 1.00 31.05 ? 372 THR A C     1 
ATOM   2938 O  O     . THR A 1  375 ? -61.053 28.407 -34.721 1.00 31.19 ? 372 THR A O     1 
ATOM   2939 C  CB    . THR A 1  375 ? -59.510 25.762 -33.879 1.00 30.58 ? 372 THR A CB    1 
ATOM   2940 O  OG1   . THR A 1  375 ? -58.596 25.088 -33.004 1.00 29.61 ? 372 THR A OG1   1 
ATOM   2941 C  CG2   . THR A 1  375 ? -59.544 25.023 -35.239 1.00 30.12 ? 372 THR A CG2   1 
ATOM   2942 N  N     . SER A 1  376 ? -59.361 28.284 -36.211 1.00 31.64 ? 373 SER A N     1 
ATOM   2943 C  CA    . SER A 1  376 ? -60.046 29.059 -37.261 1.00 32.84 ? 373 SER A CA    1 
ATOM   2944 C  C     . SER A 1  376 ? -61.224 28.348 -37.918 1.00 33.45 ? 373 SER A C     1 
ATOM   2945 O  O     . SER A 1  376 ? -61.274 27.123 -37.941 1.00 32.77 ? 373 SER A O     1 
ATOM   2946 C  CB    . SER A 1  376 ? -59.054 29.426 -38.367 1.00 32.81 ? 373 SER A CB    1 
ATOM   2947 O  OG    . SER A 1  376 ? -58.131 30.370 -37.886 1.00 34.20 ? 373 SER A OG    1 
ATOM   2948 N  N     . HIS A 1  377 ? -62.132 29.146 -38.489 1.00 35.11 ? 374 HIS A N     1 
ATOM   2949 C  CA    . HIS A 1  377 ? -63.260 28.665 -39.311 1.00 37.50 ? 374 HIS A CA    1 
ATOM   2950 C  C     . HIS A 1  377 ? -64.227 27.772 -38.524 1.00 39.54 ? 374 HIS A C     1 
ATOM   2951 O  O     . HIS A 1  377 ? -64.718 26.780 -39.057 1.00 39.62 ? 374 HIS A O     1 
ATOM   2952 C  CB    . HIS A 1  377 ? -62.780 27.925 -40.576 1.00 36.63 ? 374 HIS A CB    1 
ATOM   2953 C  CG    . HIS A 1  377 ? -61.530 28.489 -41.177 1.00 35.65 ? 374 HIS A CG    1 
ATOM   2954 N  ND1   . HIS A 1  377 ? -61.499 29.702 -41.833 1.00 34.25 ? 374 HIS A ND1   1 
ATOM   2955 C  CD2   . HIS A 1  377 ? -60.265 28.008 -41.213 1.00 33.81 ? 374 HIS A CD2   1 
ATOM   2956 C  CE1   . HIS A 1  377 ? -60.269 29.944 -42.251 1.00 33.24 ? 374 HIS A CE1   1 
ATOM   2957 N  NE2   . HIS A 1  377 ? -59.499 28.934 -41.883 1.00 33.79 ? 374 HIS A NE2   1 
ATOM   2958 N  N     . GLN A 1  378 ? -64.459 28.136 -37.260 1.00 41.75 ? 375 GLN A N     1 
ATOM   2959 C  CA    . GLN A 1  378 ? -65.391 27.448 -36.336 1.00 44.32 ? 375 GLN A CA    1 
ATOM   2960 C  C     . GLN A 1  378 ? -65.215 25.929 -36.267 1.00 44.86 ? 375 GLN A C     1 
ATOM   2961 O  O     . GLN A 1  378 ? -64.319 25.424 -35.562 1.00 45.87 ? 375 GLN A O     1 
ATOM   2962 C  CB    . GLN A 1  378 ? -66.853 27.873 -36.591 1.00 44.24 ? 375 GLN A CB    1 
ATOM   2963 C  CG    . GLN A 1  378 ? -67.174 29.208 -35.903 1.00 48.25 ? 375 GLN A CG    1 
ATOM   2964 C  CD    . GLN A 1  378 ? -68.240 30.065 -36.601 1.00 52.99 ? 375 GLN A CD    1 
ATOM   2965 O  OE1   . GLN A 1  378 ? -68.819 29.682 -37.631 1.00 55.20 ? 375 GLN A OE1   1 
ATOM   2966 N  NE2   . GLN A 1  378 ? -68.496 31.248 -36.032 1.00 53.92 ? 375 GLN A NE2   1 
ATOM   2967 N  N     . ASP B 1  119 ? -31.132 61.466 23.712  1.00 53.62 ? 116 ASP B N     1 
ATOM   2968 C  CA    . ASP B 1  119 ? -30.536 60.663 22.599  1.00 53.72 ? 116 ASP B CA    1 
ATOM   2969 C  C     . ASP B 1  119 ? -31.594 59.893 21.780  1.00 52.23 ? 116 ASP B C     1 
ATOM   2970 O  O     . ASP B 1  119 ? -32.732 59.704 22.238  1.00 52.63 ? 116 ASP B O     1 
ATOM   2971 C  CB    . ASP B 1  119 ? -29.464 59.712 23.137  1.00 54.44 ? 116 ASP B CB    1 
ATOM   2972 C  CG    . ASP B 1  119 ? -28.201 59.717 22.278  1.00 57.43 ? 116 ASP B CG    1 
ATOM   2973 O  OD1   . ASP B 1  119 ? -28.283 59.359 21.070  1.00 59.62 ? 116 ASP B OD1   1 
ATOM   2974 O  OD2   . ASP B 1  119 ? -27.123 60.081 22.820  1.00 60.10 ? 116 ASP B OD2   1 
ATOM   2975 N  N     . ARG B 1  120 ? -31.198 59.450 20.582  1.00 50.46 ? 117 ARG B N     1 
ATOM   2976 C  CA    A ARG B 1  120 ? -32.123 58.810 19.636  0.50 49.05 ? 117 ARG B CA    1 
ATOM   2977 C  CA    B ARG B 1  120 ? -32.115 58.812 19.629  0.50 49.04 ? 117 ARG B CA    1 
ATOM   2978 C  C     . ARG B 1  120 ? -32.460 57.368 20.028  1.00 47.69 ? 117 ARG B C     1 
ATOM   2979 O  O     . ARG B 1  120 ? -31.626 56.663 20.596  1.00 47.74 ? 117 ARG B O     1 
ATOM   2980 C  CB    A ARG B 1  120 ? -31.579 58.880 18.199  0.50 49.25 ? 117 ARG B CB    1 
ATOM   2981 C  CB    B ARG B 1  120 ? -31.511 58.866 18.220  0.50 49.23 ? 117 ARG B CB    1 
ATOM   2982 C  CG    A ARG B 1  120 ? -30.300 58.089 17.934  0.50 49.51 ? 117 ARG B CG    1 
ATOM   2983 C  CG    B ARG B 1  120 ? -31.291 60.289 17.699  0.50 49.50 ? 117 ARG B CG    1 
ATOM   2984 C  CD    A ARG B 1  120 ? -29.963 58.105 16.449  0.50 50.81 ? 117 ARG B CD    1 
ATOM   2985 C  CD    B ARG B 1  120 ? -30.015 60.396 16.875  0.50 50.47 ? 117 ARG B CD    1 
ATOM   2986 N  NE    A ARG B 1  120 ? -28.953 57.113 16.083  0.50 51.33 ? 117 ARG B NE    1 
ATOM   2987 N  NE    B ARG B 1  120 ? -29.835 61.724 16.295  0.50 51.03 ? 117 ARG B NE    1 
ATOM   2988 C  CZ    A ARG B 1  120 ? -29.221 55.839 15.811  0.50 51.98 ? 117 ARG B CZ    1 
ATOM   2989 C  CZ    B ARG B 1  120 ? -30.764 62.675 16.297  0.50 52.19 ? 117 ARG B CZ    1 
ATOM   2990 N  NH1   A ARG B 1  120 ? -30.468 55.386 15.873  0.50 51.23 ? 117 ARG B NH1   1 
ATOM   2991 N  NH1   B ARG B 1  120 ? -31.948 62.449 16.849  0.50 52.38 ? 117 ARG B NH1   1 
ATOM   2992 N  NH2   A ARG B 1  120 ? -28.237 55.013 15.481  0.50 52.58 ? 117 ARG B NH2   1 
ATOM   2993 N  NH2   B ARG B 1  120 ? -30.513 63.854 15.745  0.50 52.93 ? 117 ARG B NH2   1 
ATOM   2994 N  N     . PRO B 1  121 ? -33.701 56.925 19.746  1.00 45.63 ? 118 PRO B N     1 
ATOM   2995 C  CA    . PRO B 1  121 ? -34.024 55.535 20.094  1.00 43.71 ? 118 PRO B CA    1 
ATOM   2996 C  C     . PRO B 1  121 ? -33.164 54.489 19.350  1.00 41.90 ? 118 PRO B C     1 
ATOM   2997 O  O     . PRO B 1  121 ? -32.746 54.705 18.209  1.00 41.51 ? 118 PRO B O     1 
ATOM   2998 C  CB    . PRO B 1  121 ? -35.493 55.400 19.684  1.00 43.67 ? 118 PRO B CB    1 
ATOM   2999 C  CG    . PRO B 1  121 ? -36.018 56.807 19.656  1.00 44.28 ? 118 PRO B CG    1 
ATOM   3000 C  CD    . PRO B 1  121 ? -34.872 57.643 19.204  1.00 44.98 ? 118 PRO B CD    1 
ATOM   3001 N  N     . GLN B 1  122 ? -32.918 53.372 20.027  1.00 39.95 ? 119 GLN B N     1 
ATOM   3002 C  CA    . GLN B 1  122 ? -32.173 52.231 19.501  1.00 37.87 ? 119 GLN B CA    1 
ATOM   3003 C  C     . GLN B 1  122 ? -32.871 51.621 18.274  1.00 35.19 ? 119 GLN B C     1 
ATOM   3004 O  O     . GLN B 1  122 ? -34.109 51.565 18.227  1.00 33.50 ? 119 GLN B O     1 
ATOM   3005 C  CB    . GLN B 1  122 ? -32.058 51.181 20.605  1.00 38.37 ? 119 GLN B CB    1 
ATOM   3006 C  CG    . GLN B 1  122 ? -30.894 50.220 20.463  1.00 42.60 ? 119 GLN B CG    1 
ATOM   3007 C  CD    . GLN B 1  122 ? -30.796 49.200 21.611  1.00 48.19 ? 119 GLN B CD    1 
ATOM   3008 O  OE1   . GLN B 1  122 ? -31.561 49.241 22.590  1.00 50.00 ? 119 GLN B OE1   1 
ATOM   3009 N  NE2   . GLN B 1  122 ? -29.850 48.277 21.483  1.00 49.92 ? 119 GLN B NE2   1 
ATOM   3010 N  N     . LYS B 1  123 ? -32.072 51.163 17.303  1.00 32.59 ? 120 LYS B N     1 
ATOM   3011 C  CA    . LYS B 1  123 ? -32.586 50.611 16.032  1.00 30.70 ? 120 LYS B CA    1 
ATOM   3012 C  C     . LYS B 1  123 ? -31.809 49.384 15.549  1.00 29.65 ? 120 LYS B C     1 
ATOM   3013 O  O     . LYS B 1  123 ? -30.614 49.269 15.827  1.00 29.06 ? 120 LYS B O     1 
ATOM   3014 C  CB    . LYS B 1  123 ? -32.529 51.675 14.931  1.00 30.00 ? 120 LYS B CB    1 
ATOM   3015 C  CG    . LYS B 1  123 ? -33.425 52.883 15.137  1.00 29.71 ? 120 LYS B CG    1 
ATOM   3016 C  CD    . LYS B 1  123 ? -34.899 52.500 15.080  1.00 26.89 ? 120 LYS B CD    1 
ATOM   3017 C  CE    . LYS B 1  123 ? -35.813 53.655 15.484  1.00 26.91 ? 120 LYS B CE    1 
ATOM   3018 N  NZ    . LYS B 1  123 ? -35.564 54.931 14.715  1.00 27.18 ? 120 LYS B NZ    1 
ATOM   3019 N  N     . PRO B 1  124 ? -32.472 48.484 14.778  1.00 28.74 ? 121 PRO B N     1 
ATOM   3020 C  CA    . PRO B 1  124 ? -31.710 47.425 14.093  1.00 27.90 ? 121 PRO B CA    1 
ATOM   3021 C  C     . PRO B 1  124 ? -30.554 48.044 13.320  1.00 27.20 ? 121 PRO B C     1 
ATOM   3022 O  O     . PRO B 1  124 ? -30.694 49.161 12.794  1.00 25.95 ? 121 PRO B O     1 
ATOM   3023 C  CB    . PRO B 1  124 ? -32.713 46.827 13.080  1.00 28.65 ? 121 PRO B CB    1 
ATOM   3024 C  CG    . PRO B 1  124 ? -34.048 47.364 13.442  1.00 28.50 ? 121 PRO B CG    1 
ATOM   3025 C  CD    . PRO B 1  124 ? -33.850 48.616 14.260  1.00 28.44 ? 121 PRO B CD    1 
ATOM   3026 N  N     . PHE B 1  125 ? -29.437 47.317 13.267  1.00 26.32 ? 122 PHE B N     1 
ATOM   3027 C  CA    . PHE B 1  125 ? -28.213 47.712 12.549  1.00 26.96 ? 122 PHE B CA    1 
ATOM   3028 C  C     . PHE B 1  125 ? -27.367 48.781 13.242  1.00 26.83 ? 122 PHE B C     1 
ATOM   3029 O  O     . PHE B 1  125 ? -26.289 49.095 12.755  1.00 27.86 ? 122 PHE B O     1 
ATOM   3030 C  CB    . PHE B 1  125 ? -28.468 48.128 11.075  1.00 26.29 ? 122 PHE B CB    1 
ATOM   3031 C  CG    . PHE B 1  125 ? -29.503 47.287 10.354  1.00 25.49 ? 122 PHE B CG    1 
ATOM   3032 C  CD1   . PHE B 1  125 ? -30.581 47.908 9.722   1.00 24.98 ? 122 PHE B CD1   1 
ATOM   3033 C  CD2   . PHE B 1  125 ? -29.397 45.894 10.291  1.00 23.15 ? 122 PHE B CD2   1 
ATOM   3034 C  CE1   . PHE B 1  125 ? -31.544 47.165 9.032   1.00 25.97 ? 122 PHE B CE1   1 
ATOM   3035 C  CE2   . PHE B 1  125 ? -30.354 45.144 9.619   1.00 24.82 ? 122 PHE B CE2   1 
ATOM   3036 C  CZ    . PHE B 1  125 ? -31.433 45.786 8.978   1.00 24.86 ? 122 PHE B CZ    1 
ATOM   3037 N  N     . ASP B 1  126 ? -27.827 49.346 14.356  1.00 27.15 ? 123 ASP B N     1 
ATOM   3038 C  CA    . ASP B 1  126 ? -26.946 50.207 15.175  1.00 27.29 ? 123 ASP B CA    1 
ATOM   3039 C  C     . ASP B 1  126 ? -25.694 49.452 15.624  1.00 26.70 ? 123 ASP B C     1 
ATOM   3040 O  O     . ASP B 1  126 ? -24.586 49.995 15.589  1.00 27.04 ? 123 ASP B O     1 
ATOM   3041 C  CB    . ASP B 1  126 ? -27.657 50.740 16.428  1.00 27.57 ? 123 ASP B CB    1 
ATOM   3042 C  CG    . ASP B 1  126 ? -28.669 51.834 16.118  1.00 30.12 ? 123 ASP B CG    1 
ATOM   3043 O  OD1   . ASP B 1  126 ? -28.654 52.405 15.000  1.00 29.55 ? 123 ASP B OD1   1 
ATOM   3044 O  OD2   . ASP B 1  126 ? -29.499 52.114 17.015  1.00 34.90 ? 123 ASP B OD2   1 
ATOM   3045 N  N     . LYS B 1  127 ? -25.867 48.210 16.075  1.00 25.90 ? 124 LYS B N     1 
ATOM   3046 C  CA    . LYS B 1  127 ? -24.747 47.481 16.661  1.00 25.65 ? 124 LYS B CA    1 
ATOM   3047 C  C     . LYS B 1  127 ? -24.956 45.996 16.532  1.00 24.70 ? 124 LYS B C     1 
ATOM   3048 O  O     . LYS B 1  127 ? -25.991 45.494 16.947  1.00 24.60 ? 124 LYS B O     1 
ATOM   3049 C  CB    . LYS B 1  127 ? -24.565 47.859 18.151  1.00 25.59 ? 124 LYS B CB    1 
ATOM   3050 C  CG    . LYS B 1  127 ? -23.282 47.284 18.789  1.00 28.66 ? 124 LYS B CG    1 
ATOM   3051 C  CD    . LYS B 1  127 ? -23.012 47.803 20.235  1.00 32.22 ? 124 LYS B CD    1 
ATOM   3052 C  CE    . LYS B 1  127 ? -22.893 49.313 20.297  1.00 35.92 ? 124 LYS B CE    1 
ATOM   3053 N  NZ    . LYS B 1  127 ? -22.404 49.768 21.638  1.00 38.60 ? 124 LYS B NZ    1 
ATOM   3054 N  N     . PHE B 1  128 ? -23.963 45.318 15.960  1.00 24.35 ? 125 PHE B N     1 
ATOM   3055 C  CA    . PHE B 1  128 ? -23.885 43.865 15.908  1.00 24.36 ? 125 PHE B CA    1 
ATOM   3056 C  C     . PHE B 1  128 ? -22.849 43.410 16.913  1.00 24.82 ? 125 PHE B C     1 
ATOM   3057 O  O     . PHE B 1  128 ? -21.690 43.869 16.894  1.00 24.61 ? 125 PHE B O     1 
ATOM   3058 C  CB    . PHE B 1  128 ? -23.443 43.375 14.508  1.00 24.48 ? 125 PHE B CB    1 
ATOM   3059 C  CG    . PHE B 1  128 ? -24.538 43.427 13.434  1.00 25.37 ? 125 PHE B CG    1 
ATOM   3060 C  CD1   . PHE B 1  128 ? -25.791 43.975 13.694  1.00 24.15 ? 125 PHE B CD1   1 
ATOM   3061 C  CD2   . PHE B 1  128 ? -24.272 42.957 12.134  1.00 25.46 ? 125 PHE B CD2   1 
ATOM   3062 C  CE1   . PHE B 1  128 ? -26.793 44.014 12.705  1.00 25.72 ? 125 PHE B CE1   1 
ATOM   3063 C  CE2   . PHE B 1  128 ? -25.262 43.012 11.125  1.00 26.46 ? 125 PHE B CE2   1 
ATOM   3064 C  CZ    . PHE B 1  128 ? -26.530 43.532 11.419  1.00 25.11 ? 125 PHE B CZ    1 
ATOM   3065 N  N     . PHE B 1  129 ? -23.250 42.498 17.793  1.00 25.07 ? 126 PHE B N     1 
ATOM   3066 C  CA    . PHE B 1  129 ? -22.304 41.911 18.738  1.00 24.83 ? 126 PHE B CA    1 
ATOM   3067 C  C     . PHE B 1  129 ? -21.879 40.602 18.134  1.00 25.32 ? 126 PHE B C     1 
ATOM   3068 O  O     . PHE B 1  129 ? -22.732 39.768 17.782  1.00 25.87 ? 126 PHE B O     1 
ATOM   3069 C  CB    . PHE B 1  129 ? -22.964 41.651 20.096  1.00 24.04 ? 126 PHE B CB    1 
ATOM   3070 C  CG    . PHE B 1  129 ? -23.334 42.902 20.851  1.00 25.14 ? 126 PHE B CG    1 
ATOM   3071 C  CD1   . PHE B 1  129 ? -22.518 43.366 21.881  1.00 23.85 ? 126 PHE B CD1   1 
ATOM   3072 C  CD2   . PHE B 1  129 ? -24.517 43.593 20.561  1.00 22.99 ? 126 PHE B CD2   1 
ATOM   3073 C  CE1   . PHE B 1  129 ? -22.842 44.522 22.594  1.00 25.72 ? 126 PHE B CE1   1 
ATOM   3074 C  CE2   . PHE B 1  129 ? -24.861 44.742 21.278  1.00 25.90 ? 126 PHE B CE2   1 
ATOM   3075 C  CZ    . PHE B 1  129 ? -24.016 45.211 22.304  1.00 24.14 ? 126 PHE B CZ    1 
ATOM   3076 N  N     . ILE B 1  130 ? -20.569 40.398 18.022  1.00 25.37 ? 127 ILE B N     1 
ATOM   3077 C  CA    . ILE B 1  130 ? -20.052 39.155 17.452  1.00 25.22 ? 127 ILE B CA    1 
ATOM   3078 C  C     . ILE B 1  130 ? -19.152 38.409 18.425  1.00 26.21 ? 127 ILE B C     1 
ATOM   3079 O  O     . ILE B 1  130 ? -18.548 39.015 19.328  1.00 25.76 ? 127 ILE B O     1 
ATOM   3080 C  CB    . ILE B 1  130 ? -19.300 39.392 16.098  1.00 25.63 ? 127 ILE B CB    1 
ATOM   3081 C  CG1   . ILE B 1  130 ? -17.916 40.018 16.339  1.00 25.74 ? 127 ILE B CG1   1 
ATOM   3082 C  CG2   . ILE B 1  130 ? -20.152 40.248 15.137  1.00 24.38 ? 127 ILE B CG2   1 
ATOM   3083 C  CD1   . ILE B 1  130 ? -17.090 40.277 15.047  1.00 26.12 ? 127 ILE B CD1   1 
ATOM   3084 N  N     . ASP B 1  131 ? -19.053 37.095 18.231  1.00 26.74 ? 128 ASP B N     1 
ATOM   3085 C  CA    . ASP B 1  131 ? -18.217 36.250 19.085  1.00 27.95 ? 128 ASP B CA    1 
ATOM   3086 C  C     . ASP B 1  131 ? -18.109 34.866 18.478  1.00 28.51 ? 128 ASP B C     1 
ATOM   3087 O  O     . ASP B 1  131 ? -18.985 34.453 17.707  1.00 28.44 ? 128 ASP B O     1 
ATOM   3088 C  CB    . ASP B 1  131 ? -18.831 36.130 20.499  1.00 27.64 ? 128 ASP B CB    1 
ATOM   3089 C  CG    . ASP B 1  131 ? -17.834 35.604 21.528  1.00 29.78 ? 128 ASP B CG    1 
ATOM   3090 O  OD1   . ASP B 1  131 ? -16.609 35.788 21.327  1.00 26.97 ? 128 ASP B OD1   1 
ATOM   3091 O  OD2   . ASP B 1  131 ? -18.278 35.015 22.540  1.00 31.60 ? 128 ASP B OD2   1 
ATOM   3092 N  N     . TYR B 1  132 ? -17.040 34.148 18.825  1.00 28.98 ? 129 TYR B N     1 
ATOM   3093 C  CA    . TYR B 1  132 ? -16.926 32.751 18.456  1.00 30.05 ? 129 TYR B CA    1 
ATOM   3094 C  C     . TYR B 1  132 ? -17.404 31.807 19.552  1.00 31.40 ? 129 TYR B C     1 
ATOM   3095 O  O     . TYR B 1  132 ? -17.165 32.042 20.740  1.00 31.17 ? 129 TYR B O     1 
ATOM   3096 C  CB    . TYR B 1  132 ? -15.494 32.393 18.034  1.00 29.67 ? 129 TYR B CB    1 
ATOM   3097 C  CG    . TYR B 1  132 ? -15.232 32.754 16.593  1.00 29.75 ? 129 TYR B CG    1 
ATOM   3098 C  CD1   . TYR B 1  132 ? -14.505 33.898 16.258  1.00 28.81 ? 129 TYR B CD1   1 
ATOM   3099 C  CD2   . TYR B 1  132 ? -15.749 31.962 15.554  1.00 31.50 ? 129 TYR B CD2   1 
ATOM   3100 C  CE1   . TYR B 1  132 ? -14.282 34.243 14.916  1.00 28.87 ? 129 TYR B CE1   1 
ATOM   3101 C  CE2   . TYR B 1  132 ? -15.535 32.295 14.211  1.00 30.16 ? 129 TYR B CE2   1 
ATOM   3102 C  CZ    . TYR B 1  132 ? -14.799 33.433 13.901  1.00 30.08 ? 129 TYR B CZ    1 
ATOM   3103 O  OH    . TYR B 1  132 ? -14.585 33.757 12.569  1.00 29.63 ? 129 TYR B OH    1 
ATOM   3104 N  N     . ILE B 1  133 ? -18.083 30.747 19.119  1.00 32.45 ? 130 ILE B N     1 
ATOM   3105 C  CA    . ILE B 1  133 ? -18.391 29.603 19.959  1.00 33.54 ? 130 ILE B CA    1 
ATOM   3106 C  C     . ILE B 1  133 ? -17.668 28.386 19.373  1.00 34.19 ? 130 ILE B C     1 
ATOM   3107 O  O     . ILE B 1  133 ? -17.719 28.150 18.159  1.00 34.34 ? 130 ILE B O     1 
ATOM   3108 C  CB    . ILE B 1  133 ? -19.919 29.403 20.063  1.00 33.26 ? 130 ILE B CB    1 
ATOM   3109 C  CG1   . ILE B 1  133 ? -20.486 30.375 21.090  1.00 33.39 ? 130 ILE B CG1   1 
ATOM   3110 C  CG2   . ILE B 1  133 ? -20.276 27.976 20.437  1.00 34.62 ? 130 ILE B CG2   1 
ATOM   3111 C  CD1   . ILE B 1  133 ? -22.030 30.441 21.106  1.00 36.50 ? 130 ILE B CD1   1 
ATOM   3112 N  N     . GLY B 1  134 ? -16.969 27.641 20.226  1.00 34.89 ? 131 GLY B N     1 
ATOM   3113 C  CA    . GLY B 1  134 ? -16.254 26.439 19.803  1.00 36.25 ? 131 GLY B CA    1 
ATOM   3114 C  C     . GLY B 1  134 ? -14.927 26.289 20.520  1.00 37.64 ? 131 GLY B C     1 
ATOM   3115 O  O     . GLY B 1  134 ? -14.587 27.125 21.350  1.00 38.20 ? 131 GLY B O     1 
ATOM   3116 N  N     . PRO B 1  135 ? -14.137 25.254 20.177  1.00 38.62 ? 132 PRO B N     1 
ATOM   3117 C  CA    . PRO B 1  135 ? -14.377 24.291 19.103  1.00 39.63 ? 132 PRO B CA    1 
ATOM   3118 C  C     . PRO B 1  135 ? -15.485 23.295 19.411  1.00 40.55 ? 132 PRO B C     1 
ATOM   3119 O  O     . PRO B 1  135 ? -15.659 22.888 20.552  1.00 41.32 ? 132 PRO B O     1 
ATOM   3120 C  CB    . PRO B 1  135 ? -13.023 23.572 18.952  1.00 39.52 ? 132 PRO B CB    1 
ATOM   3121 C  CG    . PRO B 1  135 ? -12.344 23.738 20.257  1.00 39.23 ? 132 PRO B CG    1 
ATOM   3122 C  CD    . PRO B 1  135 ? -12.798 25.087 20.775  1.00 39.14 ? 132 PRO B CD    1 
ATOM   3123 N  N     . LEU B 1  136 ? -16.231 22.931 18.378  1.00 41.22 ? 133 LEU B N     1 
ATOM   3124 C  CA    . LEU B 1  136 ? -17.276 21.943 18.462  1.00 41.94 ? 133 LEU B CA    1 
ATOM   3125 C  C     . LEU B 1  136 ? -16.774 20.688 17.749  1.00 42.93 ? 133 LEU B C     1 
ATOM   3126 O  O     . LEU B 1  136 ? -15.771 20.754 17.035  1.00 43.27 ? 133 LEU B O     1 
ATOM   3127 C  CB    . LEU B 1  136 ? -18.538 22.481 17.788  1.00 41.77 ? 133 LEU B CB    1 
ATOM   3128 C  CG    . LEU B 1  136 ? -19.082 23.805 18.348  1.00 41.58 ? 133 LEU B CG    1 
ATOM   3129 C  CD1   . LEU B 1  136 ? -20.156 24.386 17.441  1.00 39.94 ? 133 LEU B CD1   1 
ATOM   3130 C  CD2   . LEU B 1  136 ? -19.599 23.636 19.783  1.00 41.46 ? 133 LEU B CD2   1 
ATOM   3131 N  N     . PRO B 1  137 ? -17.450 19.535 17.946  1.00 43.70 ? 134 PRO B N     1 
ATOM   3132 C  CA    . PRO B 1  137 ? -17.091 18.345 17.174  1.00 44.35 ? 134 PRO B CA    1 
ATOM   3133 C  C     . PRO B 1  137 ? -17.083 18.672 15.674  1.00 44.66 ? 134 PRO B C     1 
ATOM   3134 O  O     . PRO B 1  137 ? -17.931 19.451 15.216  1.00 44.81 ? 134 PRO B O     1 
ATOM   3135 C  CB    . PRO B 1  137 ? -18.234 17.370 17.485  1.00 44.34 ? 134 PRO B CB    1 
ATOM   3136 C  CG    . PRO B 1  137 ? -18.751 17.807 18.806  1.00 43.88 ? 134 PRO B CG    1 
ATOM   3137 C  CD    . PRO B 1  137 ? -18.629 19.295 18.801  1.00 43.94 ? 134 PRO B CD    1 
ATOM   3138 N  N     . PRO B 1  138 ? -16.136 18.092 14.912  1.00 44.81 ? 135 PRO B N     1 
ATOM   3139 C  CA    . PRO B 1  138 ? -16.048 18.418 13.483  1.00 44.75 ? 135 PRO B CA    1 
ATOM   3140 C  C     . PRO B 1  138 ? -17.358 18.128 12.756  1.00 44.50 ? 135 PRO B C     1 
ATOM   3141 O  O     . PRO B 1  138 ? -17.899 17.036 12.885  1.00 44.65 ? 135 PRO B O     1 
ATOM   3142 C  CB    . PRO B 1  138 ? -14.933 17.495 12.972  1.00 44.92 ? 135 PRO B CB    1 
ATOM   3143 C  CG    . PRO B 1  138 ? -14.153 17.113 14.195  1.00 45.28 ? 135 PRO B CG    1 
ATOM   3144 C  CD    . PRO B 1  138 ? -15.142 17.079 15.316  1.00 44.78 ? 135 PRO B CD    1 
ATOM   3145 N  N     . SER B 1  139 ? -17.872 19.116 12.027  1.00 44.15 ? 136 SER B N     1 
ATOM   3146 C  CA    . SER B 1  139 ? -19.088 18.950 11.238  1.00 43.91 ? 136 SER B CA    1 
ATOM   3147 C  C     . SER B 1  139 ? -18.828 19.467 9.832   1.00 44.35 ? 136 SER B C     1 
ATOM   3148 O  O     . SER B 1  139 ? -18.773 20.687 9.592   1.00 43.63 ? 136 SER B O     1 
ATOM   3149 C  CB    . SER B 1  139 ? -20.270 19.684 11.879  1.00 43.97 ? 136 SER B CB    1 
ATOM   3150 O  OG    . SER B 1  139 ? -21.497 19.366 11.242  1.00 43.21 ? 136 SER B OG    1 
ATOM   3151 N  N     . GLN B 1  140 ? -18.643 18.519 8.913   1.00 44.86 ? 137 GLN B N     1 
ATOM   3152 C  CA    . GLN B 1  140 ? -18.358 18.805 7.507   1.00 45.28 ? 137 GLN B CA    1 
ATOM   3153 C  C     . GLN B 1  140 ? -17.146 19.707 7.363   1.00 44.83 ? 137 GLN B C     1 
ATOM   3154 O  O     . GLN B 1  140 ? -17.145 20.645 6.568   1.00 44.75 ? 137 GLN B O     1 
ATOM   3155 C  CB    . GLN B 1  140 ? -19.570 19.430 6.833   1.00 45.46 ? 137 GLN B CB    1 
ATOM   3156 C  CG    . GLN B 1  140 ? -20.752 18.495 6.738   1.00 48.81 ? 137 GLN B CG    1 
ATOM   3157 C  CD    . GLN B 1  140 ? -21.744 18.968 5.703   1.00 53.32 ? 137 GLN B CD    1 
ATOM   3158 O  OE1   . GLN B 1  140 ? -21.377 19.675 4.755   1.00 55.27 ? 137 GLN B OE1   1 
ATOM   3159 N  NE2   . GLN B 1  140 ? -23.008 18.592 5.877   1.00 53.95 ? 137 GLN B NE2   1 
ATOM   3160 N  N     . GLY B 1  141 ? -16.127 19.429 8.164   1.00 44.53 ? 138 GLY B N     1 
ATOM   3161 C  CA    . GLY B 1  141 ? -14.915 20.232 8.165   1.00 44.20 ? 138 GLY B CA    1 
ATOM   3162 C  C     . GLY B 1  141 ? -14.937 21.422 9.111   1.00 43.66 ? 138 GLY B C     1 
ATOM   3163 O  O     . GLY B 1  141 ? -13.885 21.984 9.394   1.00 44.21 ? 138 GLY B O     1 
ATOM   3164 N  N     . TYR B 1  142 ? -16.118 21.800 9.615   1.00 42.53 ? 139 TYR B N     1 
ATOM   3165 C  CA    . TYR B 1  142 ? -16.267 23.022 10.431  1.00 41.19 ? 139 TYR B CA    1 
ATOM   3166 C  C     . TYR B 1  142 ? -16.144 22.765 11.928  1.00 40.25 ? 139 TYR B C     1 
ATOM   3167 O  O     . TYR B 1  142 ? -16.576 21.719 12.414  1.00 40.55 ? 139 TYR B O     1 
ATOM   3168 C  CB    . TYR B 1  142 ? -17.595 23.714 10.130  1.00 41.19 ? 139 TYR B CB    1 
ATOM   3169 C  CG    . TYR B 1  142 ? -17.700 24.197 8.700   1.00 42.18 ? 139 TYR B CG    1 
ATOM   3170 C  CD1   . TYR B 1  142 ? -17.200 25.444 8.328   1.00 42.83 ? 139 TYR B CD1   1 
ATOM   3171 C  CD2   . TYR B 1  142 ? -18.278 23.392 7.712   1.00 42.71 ? 139 TYR B CD2   1 
ATOM   3172 C  CE1   . TYR B 1  142 ? -17.287 25.891 7.006   1.00 43.54 ? 139 TYR B CE1   1 
ATOM   3173 C  CE2   . TYR B 1  142 ? -18.366 23.828 6.388   1.00 43.35 ? 139 TYR B CE2   1 
ATOM   3174 C  CZ    . TYR B 1  142 ? -17.873 25.075 6.049   1.00 43.50 ? 139 TYR B CZ    1 
ATOM   3175 O  OH    . TYR B 1  142 ? -17.953 25.504 4.754   1.00 43.94 ? 139 TYR B OH    1 
ATOM   3176 N  N     . LEU B 1  143 ? -15.574 23.732 12.649  1.00 38.64 ? 140 LEU B N     1 
ATOM   3177 C  CA    . LEU B 1  143 ? -15.273 23.592 14.079  1.00 37.28 ? 140 LEU B CA    1 
ATOM   3178 C  C     . LEU B 1  143 ? -15.816 24.716 14.988  1.00 36.23 ? 140 LEU B C     1 
ATOM   3179 O  O     . LEU B 1  143 ? -15.901 24.539 16.208  1.00 35.67 ? 140 LEU B O     1 
ATOM   3180 C  CB    . LEU B 1  143 ? -13.754 23.469 14.280  1.00 37.73 ? 140 LEU B CB    1 
ATOM   3181 C  CG    . LEU B 1  143 ? -13.002 22.261 13.712  1.00 39.43 ? 140 LEU B CG    1 
ATOM   3182 C  CD1   . LEU B 1  143 ? -11.483 22.488 13.767  1.00 40.81 ? 140 LEU B CD1   1 
ATOM   3183 C  CD2   . LEU B 1  143 ? -13.364 20.997 14.460  1.00 41.44 ? 140 LEU B CD2   1 
ATOM   3184 N  N     . TYR B 1  144 ? -16.162 25.868 14.405  1.00 34.61 ? 141 TYR B N     1 
ATOM   3185 C  CA    . TYR B 1  144 ? -16.633 27.013 15.178  1.00 33.60 ? 141 TYR B CA    1 
ATOM   3186 C  C     . TYR B 1  144 ? -17.897 27.597 14.586  1.00 33.00 ? 141 TYR B C     1 
ATOM   3187 O  O     . TYR B 1  144 ? -18.214 27.368 13.410  1.00 32.34 ? 141 TYR B O     1 
ATOM   3188 C  CB    . TYR B 1  144 ? -15.562 28.104 15.256  1.00 33.58 ? 141 TYR B CB    1 
ATOM   3189 C  CG    . TYR B 1  144 ? -14.296 27.668 15.962  1.00 35.01 ? 141 TYR B CG    1 
ATOM   3190 C  CD1   . TYR B 1  144 ? -14.042 28.050 17.283  1.00 36.65 ? 141 TYR B CD1   1 
ATOM   3191 C  CD2   . TYR B 1  144 ? -13.348 26.872 15.309  1.00 37.23 ? 141 TYR B CD2   1 
ATOM   3192 C  CE1   . TYR B 1  144 ? -12.881 27.645 17.939  1.00 37.85 ? 141 TYR B CE1   1 
ATOM   3193 C  CE2   . TYR B 1  144 ? -12.194 26.452 15.956  1.00 37.99 ? 141 TYR B CE2   1 
ATOM   3194 C  CZ    . TYR B 1  144 ? -11.968 26.843 17.268  1.00 38.69 ? 141 TYR B CZ    1 
ATOM   3195 O  OH    . TYR B 1  144 ? -10.817 26.438 17.898  1.00 40.97 ? 141 TYR B OH    1 
ATOM   3196 N  N     . VAL B 1  145 ? -18.623 28.343 15.414  1.00 31.60 ? 142 VAL B N     1 
ATOM   3197 C  CA    . VAL B 1  145 ? -19.751 29.123 14.950  1.00 30.88 ? 142 VAL B CA    1 
ATOM   3198 C  C     . VAL B 1  145 ? -19.448 30.576 15.288  1.00 30.29 ? 142 VAL B C     1 
ATOM   3199 O  O     . VAL B 1  145 ? -19.167 30.899 16.447  1.00 30.58 ? 142 VAL B O     1 
ATOM   3200 C  CB    . VAL B 1  145 ? -21.072 28.684 15.619  1.00 30.91 ? 142 VAL B CB    1 
ATOM   3201 C  CG1   . VAL B 1  145 ? -22.217 29.573 15.197  1.00 30.68 ? 142 VAL B CG1   1 
ATOM   3202 C  CG2   . VAL B 1  145 ? -21.404 27.221 15.287  1.00 31.17 ? 142 VAL B CG2   1 
ATOM   3203 N  N     . LEU B 1  146 ? -19.464 31.446 14.280  1.00 29.01 ? 143 LEU B N     1 
ATOM   3204 C  CA    . LEU B 1  146 ? -19.432 32.887 14.533  1.00 28.01 ? 143 LEU B CA    1 
ATOM   3205 C  C     . LEU B 1  146 ? -20.874 33.321 14.795  1.00 27.46 ? 143 LEU B C     1 
ATOM   3206 O  O     . LEU B 1  146 ? -21.748 33.117 13.946  1.00 26.79 ? 143 LEU B O     1 
ATOM   3207 C  CB    . LEU B 1  146 ? -18.861 33.661 13.332  1.00 28.27 ? 143 LEU B CB    1 
ATOM   3208 C  CG    . LEU B 1  146 ? -18.926 35.197 13.426  1.00 27.91 ? 143 LEU B CG    1 
ATOM   3209 C  CD1   . LEU B 1  146 ? -17.867 35.733 14.389  1.00 25.68 ? 143 LEU B CD1   1 
ATOM   3210 C  CD2   . LEU B 1  146 ? -18.745 35.836 12.068  1.00 27.01 ? 143 LEU B CD2   1 
ATOM   3211 N  N     . VAL B 1  147 ? -21.110 33.908 15.965  1.00 26.60 ? 144 VAL B N     1 
ATOM   3212 C  CA    . VAL B 1  147 ? -22.438 34.328 16.374  1.00 25.92 ? 144 VAL B CA    1 
ATOM   3213 C  C     . VAL B 1  147 ? -22.556 35.826 16.229  1.00 25.84 ? 144 VAL B C     1 
ATOM   3214 O  O     . VAL B 1  147 ? -21.749 36.566 16.800  1.00 26.51 ? 144 VAL B O     1 
ATOM   3215 C  CB    . VAL B 1  147 ? -22.692 33.963 17.868  1.00 26.66 ? 144 VAL B CB    1 
ATOM   3216 C  CG1   . VAL B 1  147 ? -24.134 34.314 18.273  1.00 25.58 ? 144 VAL B CG1   1 
ATOM   3217 C  CG2   . VAL B 1  147 ? -22.393 32.476 18.125  1.00 25.42 ? 144 VAL B CG2   1 
ATOM   3218 N  N     . VAL B 1  148 ? -23.571 36.284 15.498  1.00 25.11 ? 145 VAL B N     1 
ATOM   3219 C  CA    . VAL B 1  148 ? -23.796 37.706 15.325  1.00 24.72 ? 145 VAL B CA    1 
ATOM   3220 C  C     . VAL B 1  148 ? -25.181 38.030 15.842  1.00 25.13 ? 145 VAL B C     1 
ATOM   3221 O  O     . VAL B 1  148 ? -26.155 37.459 15.355  1.00 25.21 ? 145 VAL B O     1 
ATOM   3222 C  CB    . VAL B 1  148 ? -23.725 38.123 13.825  1.00 24.96 ? 145 VAL B CB    1 
ATOM   3223 C  CG1   . VAL B 1  148 ? -23.998 39.610 13.662  1.00 23.57 ? 145 VAL B CG1   1 
ATOM   3224 C  CG2   . VAL B 1  148 ? -22.363 37.725 13.206  1.00 24.36 ? 145 VAL B CG2   1 
ATOM   3225 N  N     . VAL B 1  149 ? -25.270 38.958 16.796  1.00 24.34 ? 146 VAL B N     1 
ATOM   3226 C  CA    . VAL B 1  149 ? -26.560 39.344 17.369  1.00 24.03 ? 146 VAL B CA    1 
ATOM   3227 C  C     . VAL B 1  149 ? -26.783 40.834 17.164  1.00 24.13 ? 146 VAL B C     1 
ATOM   3228 O  O     . VAL B 1  149 ? -25.942 41.646 17.539  1.00 24.28 ? 146 VAL B O     1 
ATOM   3229 C  CB    . VAL B 1  149 ? -26.654 38.989 18.886  1.00 23.64 ? 146 VAL B CB    1 
ATOM   3230 C  CG1   . VAL B 1  149 ? -28.023 39.392 19.460  1.00 23.63 ? 146 VAL B CG1   1 
ATOM   3231 C  CG2   . VAL B 1  149 ? -26.418 37.498 19.111  1.00 23.12 ? 146 VAL B CG2   1 
ATOM   3232 N  N     . ASP B 1  150 ? -27.921 41.194 16.571  1.00 24.62 ? 147 ASP B N     1 
ATOM   3233 C  CA    . ASP B 1  150 ? -28.281 42.613 16.450  1.00 25.34 ? 147 ASP B CA    1 
ATOM   3234 C  C     . ASP B 1  150 ? -28.721 43.123 17.828  1.00 25.54 ? 147 ASP B C     1 
ATOM   3235 O  O     . ASP B 1  150 ? -29.610 42.542 18.465  1.00 25.42 ? 147 ASP B O     1 
ATOM   3236 C  CB    . ASP B 1  150 ? -29.386 42.832 15.405  1.00 25.21 ? 147 ASP B CB    1 
ATOM   3237 C  CG    . ASP B 1  150 ? -29.891 44.256 15.395  1.00 26.48 ? 147 ASP B CG    1 
ATOM   3238 O  OD1   . ASP B 1  150 ? -29.088 45.166 15.070  1.00 25.94 ? 147 ASP B OD1   1 
ATOM   3239 O  OD2   . ASP B 1  150 ? -31.074 44.472 15.752  1.00 26.92 ? 147 ASP B OD2   1 
ATOM   3240 N  N     . GLY B 1  151 ? -28.087 44.201 18.282  1.00 25.93 ? 148 GLY B N     1 
ATOM   3241 C  CA    . GLY B 1  151 ? -28.294 44.704 19.637  1.00 26.85 ? 148 GLY B CA    1 
ATOM   3242 C  C     . GLY B 1  151 ? -29.738 45.059 19.944  1.00 27.73 ? 148 GLY B C     1 
ATOM   3243 O  O     . GLY B 1  151 ? -30.252 44.709 21.005  1.00 28.45 ? 148 GLY B O     1 
ATOM   3244 N  N     . MET B 1  152 ? -30.406 45.729 19.012  1.00 27.35 ? 149 MET B N     1 
ATOM   3245 C  CA    . MET B 1  152 ? -31.747 46.229 19.285  1.00 27.95 ? 149 MET B CA    1 
ATOM   3246 C  C     . MET B 1  152 ? -32.801 45.141 19.215  1.00 27.72 ? 149 MET B C     1 
ATOM   3247 O  O     . MET B 1  152 ? -33.637 45.051 20.103  1.00 28.68 ? 149 MET B O     1 
ATOM   3248 C  CB    . MET B 1  152 ? -32.105 47.427 18.389  1.00 27.46 ? 149 MET B CB    1 
ATOM   3249 C  CG    . MET B 1  152 ? -33.480 48.048 18.682  1.00 29.37 ? 149 MET B CG    1 
ATOM   3250 S  SD    . MET B 1  152 ? -34.876 47.197 17.854  1.00 31.83 ? 149 MET B SD    1 
ATOM   3251 C  CE    . MET B 1  152 ? -36.229 47.581 18.992  1.00 28.73 ? 149 MET B CE    1 
ATOM   3252 N  N     . THR B 1  153 ? -32.771 44.318 18.170  1.00 27.75 ? 150 THR B N     1 
ATOM   3253 C  CA    . THR B 1  153 ? -33.826 43.333 17.938  1.00 26.37 ? 150 THR B CA    1 
ATOM   3254 C  C     . THR B 1  153 ? -33.546 41.988 18.611  1.00 26.33 ? 150 THR B C     1 
ATOM   3255 O  O     . THR B 1  153 ? -34.461 41.188 18.810  1.00 25.56 ? 150 THR B O     1 
ATOM   3256 C  CB    . THR B 1  153 ? -33.993 43.047 16.411  1.00 27.34 ? 150 THR B CB    1 
ATOM   3257 O  OG1   . THR B 1  153 ? -32.744 42.580 15.887  1.00 27.04 ? 150 THR B OG1   1 
ATOM   3258 C  CG2   . THR B 1  153 ? -34.452 44.300 15.634  1.00 25.07 ? 150 THR B CG2   1 
ATOM   3259 N  N     . GLY B 1  154 ? -32.279 41.706 18.906  1.00 25.58 ? 151 GLY B N     1 
ATOM   3260 C  CA    . GLY B 1  154 ? -31.889 40.361 19.360  1.00 25.67 ? 151 GLY B CA    1 
ATOM   3261 C  C     . GLY B 1  154 ? -31.774 39.303 18.255  1.00 25.81 ? 151 GLY B C     1 
ATOM   3262 O  O     . GLY B 1  154 ? -31.482 38.119 18.532  1.00 25.49 ? 151 GLY B O     1 
ATOM   3263 N  N     . PHE B 1  155 ? -31.984 39.719 16.999  1.00 25.12 ? 152 PHE B N     1 
ATOM   3264 C  CA    . PHE B 1  155 ? -31.958 38.789 15.866  1.00 24.50 ? 152 PHE B CA    1 
ATOM   3265 C  C     . PHE B 1  155 ? -30.563 38.214 15.741  1.00 24.43 ? 152 PHE B C     1 
ATOM   3266 O  O     . PHE B 1  155 ? -29.559 38.947 15.827  1.00 24.32 ? 152 PHE B O     1 
ATOM   3267 C  CB    . PHE B 1  155 ? -32.388 39.503 14.571  1.00 24.40 ? 152 PHE B CB    1 
ATOM   3268 C  CG    . PHE B 1  155 ? -32.858 38.572 13.471  1.00 24.67 ? 152 PHE B CG    1 
ATOM   3269 C  CD1   . PHE B 1  155 ? -34.225 38.330 13.277  1.00 25.23 ? 152 PHE B CD1   1 
ATOM   3270 C  CD2   . PHE B 1  155 ? -31.943 37.989 12.589  1.00 25.78 ? 152 PHE B CD2   1 
ATOM   3271 C  CE1   . PHE B 1  155 ? -34.673 37.481 12.233  1.00 26.81 ? 152 PHE B CE1   1 
ATOM   3272 C  CE2   . PHE B 1  155 ? -32.379 37.133 11.523  1.00 24.57 ? 152 PHE B CE2   1 
ATOM   3273 C  CZ    . PHE B 1  155 ? -33.740 36.884 11.353  1.00 25.49 ? 152 PHE B CZ    1 
ATOM   3274 N  N     . THR B 1  156 ? -30.495 36.899 15.557  1.00 24.38 ? 153 THR B N     1 
ATOM   3275 C  CA    . THR B 1  156 ? -29.214 36.199 15.541  1.00 25.39 ? 153 THR B CA    1 
ATOM   3276 C  C     . THR B 1  156 ? -28.891 35.593 14.162  1.00 26.41 ? 153 THR B C     1 
ATOM   3277 O  O     . THR B 1  156 ? -29.750 34.956 13.535  1.00 25.40 ? 153 THR B O     1 
ATOM   3278 C  CB    . THR B 1  156 ? -29.181 35.062 16.609  1.00 26.00 ? 153 THR B CB    1 
ATOM   3279 O  OG1   . THR B 1  156 ? -29.307 35.637 17.912  1.00 26.59 ? 153 THR B OG1   1 
ATOM   3280 C  CG2   . THR B 1  156 ? -27.851 34.278 16.562  1.00 24.83 ? 153 THR B CG2   1 
ATOM   3281 N  N     . TRP B 1  157 ? -27.644 35.765 13.728  1.00 26.38 ? 154 TRP B N     1 
ATOM   3282 C  CA    . TRP B 1  157 ? -27.139 35.120 12.516  1.00 27.65 ? 154 TRP B CA    1 
ATOM   3283 C  C     . TRP B 1  157 ? -25.979 34.215 12.929  1.00 27.79 ? 154 TRP B C     1 
ATOM   3284 O  O     . TRP B 1  157 ? -25.108 34.639 13.689  1.00 27.67 ? 154 TRP B O     1 
ATOM   3285 C  CB    . TRP B 1  157 ? -26.630 36.161 11.505  1.00 27.62 ? 154 TRP B CB    1 
ATOM   3286 C  CG    . TRP B 1  157 ? -27.672 36.999 10.825  1.00 30.22 ? 154 TRP B CG    1 
ATOM   3287 C  CD1   . TRP B 1  157 ? -28.345 36.684 9.666   1.00 31.77 ? 154 TRP B CD1   1 
ATOM   3288 C  CD2   . TRP B 1  157 ? -28.128 38.321 11.202  1.00 33.07 ? 154 TRP B CD2   1 
ATOM   3289 N  NE1   . TRP B 1  157 ? -29.199 37.716 9.314   1.00 33.97 ? 154 TRP B NE1   1 
ATOM   3290 C  CE2   . TRP B 1  157 ? -29.087 38.729 10.229  1.00 33.03 ? 154 TRP B CE2   1 
ATOM   3291 C  CE3   . TRP B 1  157 ? -27.827 39.196 12.264  1.00 32.70 ? 154 TRP B CE3   1 
ATOM   3292 C  CZ2   . TRP B 1  157 ? -29.755 39.969 10.294  1.00 34.84 ? 154 TRP B CZ2   1 
ATOM   3293 C  CZ3   . TRP B 1  157 ? -28.484 40.437 12.320  1.00 31.61 ? 154 TRP B CZ3   1 
ATOM   3294 C  CH2   . TRP B 1  157 ? -29.437 40.807 11.343  1.00 33.35 ? 154 TRP B CH2   1 
ATOM   3295 N  N     . LEU B 1  158 ? -25.978 32.979 12.427  1.00 28.13 ? 155 LEU B N     1 
ATOM   3296 C  CA    . LEU B 1  158 ? -24.940 31.988 12.746  1.00 29.27 ? 155 LEU B CA    1 
ATOM   3297 C  C     . LEU B 1  158 ? -24.164 31.546 11.502  1.00 30.21 ? 155 LEU B C     1 
ATOM   3298 O  O     . LEU B 1  158 ? -24.769 31.168 10.496  1.00 30.95 ? 155 LEU B O     1 
ATOM   3299 C  CB    . LEU B 1  158 ? -25.575 30.757 13.391  1.00 28.89 ? 155 LEU B CB    1 
ATOM   3300 C  CG    . LEU B 1  158 ? -26.460 30.983 14.612  1.00 29.15 ? 155 LEU B CG    1 
ATOM   3301 C  CD1   . LEU B 1  158 ? -27.072 29.648 15.029  1.00 28.54 ? 155 LEU B CD1   1 
ATOM   3302 C  CD2   . LEU B 1  158 ? -25.657 31.620 15.761  1.00 26.74 ? 155 LEU B CD2   1 
ATOM   3303 N  N     . TYR B 1  159 ? -22.836 31.568 11.581  1.00 30.86 ? 156 TYR B N     1 
ATOM   3304 C  CA    . TYR B 1  159 ? -21.978 31.174 10.464  1.00 31.70 ? 156 TYR B CA    1 
ATOM   3305 C  C     . TYR B 1  159 ? -20.966 30.145 10.914  1.00 31.66 ? 156 TYR B C     1 
ATOM   3306 O  O     . TYR B 1  159 ? -20.205 30.403 11.843  1.00 31.69 ? 156 TYR B O     1 
ATOM   3307 C  CB    . TYR B 1  159 ? -21.257 32.396 9.860   1.00 31.96 ? 156 TYR B CB    1 
ATOM   3308 C  CG    . TYR B 1  159 ? -22.228 33.406 9.303   1.00 33.90 ? 156 TYR B CG    1 
ATOM   3309 C  CD1   . TYR B 1  159 ? -22.815 33.210 8.046   1.00 36.01 ? 156 TYR B CD1   1 
ATOM   3310 C  CD2   . TYR B 1  159 ? -22.594 34.544 10.041  1.00 34.88 ? 156 TYR B CD2   1 
ATOM   3311 C  CE1   . TYR B 1  159 ? -23.737 34.127 7.531   1.00 36.36 ? 156 TYR B CE1   1 
ATOM   3312 C  CE2   . TYR B 1  159 ? -23.511 35.464 9.536   1.00 35.17 ? 156 TYR B CE2   1 
ATOM   3313 C  CZ    . TYR B 1  159 ? -24.075 35.238 8.280   1.00 36.56 ? 156 TYR B CZ    1 
ATOM   3314 O  OH    . TYR B 1  159 ? -24.996 36.103 7.771   1.00 39.68 ? 156 TYR B OH    1 
ATOM   3315 N  N     . PRO B 1  160 ? -20.943 28.972 10.250  1.00 32.10 ? 157 PRO B N     1 
ATOM   3316 C  CA    . PRO B 1  160 ? -19.931 27.960 10.568  1.00 32.32 ? 157 PRO B CA    1 
ATOM   3317 C  C     . PRO B 1  160 ? -18.564 28.347 9.997   1.00 32.79 ? 157 PRO B C     1 
ATOM   3318 O  O     . PRO B 1  160 ? -18.483 28.897 8.900   1.00 32.53 ? 157 PRO B O     1 
ATOM   3319 C  CB    . PRO B 1  160 ? -20.470 26.694 9.898   1.00 32.43 ? 157 PRO B CB    1 
ATOM   3320 C  CG    . PRO B 1  160 ? -21.318 27.208 8.738   1.00 33.19 ? 157 PRO B CG    1 
ATOM   3321 C  CD    . PRO B 1  160 ? -21.870 28.539 9.182   1.00 32.47 ? 157 PRO B CD    1 
ATOM   3322 N  N     . THR B 1  161 ? -17.502 28.102 10.750  1.00 32.99 ? 158 THR B N     1 
ATOM   3323 C  CA    . THR B 1  161 ? -16.149 28.385 10.261  1.00 33.41 ? 158 THR B CA    1 
ATOM   3324 C  C     . THR B 1  161 ? -15.221 27.251 10.655  1.00 34.11 ? 158 THR B C     1 
ATOM   3325 O  O     . THR B 1  161 ? -15.544 26.455 11.547  1.00 33.56 ? 158 THR B O     1 
ATOM   3326 C  CB    . THR B 1  161 ? -15.552 29.715 10.809  1.00 33.24 ? 158 THR B CB    1 
ATOM   3327 O  OG1   . THR B 1  161 ? -15.227 29.565 12.199  1.00 33.85 ? 158 THR B OG1   1 
ATOM   3328 C  CG2   . THR B 1  161 ? -16.495 30.911 10.608  1.00 31.92 ? 158 THR B CG2   1 
ATOM   3329 N  N     . LYS B 1  162 ? -14.058 27.194 10.007  1.00 35.04 ? 159 LYS B N     1 
ATOM   3330 C  CA    . LYS B 1  162 ? -13.084 26.146 10.284  1.00 36.01 ? 159 LYS B CA    1 
ATOM   3331 C  C     . LYS B 1  162 ? -12.113 26.583 11.373  1.00 35.75 ? 159 LYS B C     1 
ATOM   3332 O  O     . LYS B 1  162 ? -11.432 25.752 11.970  1.00 36.43 ? 159 LYS B O     1 
ATOM   3333 C  CB    . LYS B 1  162 ? -12.311 25.779 9.006   1.00 36.84 ? 159 LYS B CB    1 
ATOM   3334 C  CG    . LYS B 1  162 ? -13.167 25.154 7.900   1.00 40.25 ? 159 LYS B CG    1 
ATOM   3335 C  CD    . LYS B 1  162 ? -12.402 25.131 6.565   1.00 46.72 ? 159 LYS B CD    1 
ATOM   3336 C  CE    . LYS B 1  162 ? -13.339 25.102 5.349   1.00 49.18 ? 159 LYS B CE    1 
ATOM   3337 N  NZ    . LYS B 1  162 ? -14.091 23.818 5.232   1.00 52.00 ? 159 LYS B NZ    1 
ATOM   3338 N  N     . ALA B 1  163 ? -12.068 27.885 11.635  1.00 35.07 ? 160 ALA B N     1 
ATOM   3339 C  CA    . ALA B 1  163 ? -11.128 28.473 12.580  1.00 34.45 ? 160 ALA B CA    1 
ATOM   3340 C  C     . ALA B 1  163 ? -11.680 29.793 13.108  1.00 33.69 ? 160 ALA B C     1 
ATOM   3341 O  O     . ALA B 1  163 ? -12.463 30.441 12.422  1.00 33.71 ? 160 ALA B O     1 
ATOM   3342 C  CB    . ALA B 1  163 ? -9.761  28.706 11.894  1.00 34.49 ? 160 ALA B CB    1 
ATOM   3343 N  N     . PRO B 1  164 ? -11.263 30.206 14.324  1.00 33.22 ? 161 PRO B N     1 
ATOM   3344 C  CA    . PRO B 1  164 ? -11.627 31.529 14.843  1.00 32.49 ? 161 PRO B CA    1 
ATOM   3345 C  C     . PRO B 1  164 ? -10.633 32.584 14.380  1.00 32.25 ? 161 PRO B C     1 
ATOM   3346 O  O     . PRO B 1  164 ? -9.994  33.255 15.205  1.00 32.09 ? 161 PRO B O     1 
ATOM   3347 C  CB    . PRO B 1  164 ? -11.547 31.339 16.361  1.00 33.00 ? 161 PRO B CB    1 
ATOM   3348 C  CG    . PRO B 1  164 ? -10.505 30.276 16.563  1.00 33.11 ? 161 PRO B CG    1 
ATOM   3349 C  CD    . PRO B 1  164 ? -10.485 29.420 15.305  1.00 33.10 ? 161 PRO B CD    1 
ATOM   3350 N  N     . SER B 1  165 ? -10.499 32.723 13.060  1.00 31.55 ? 162 SER B N     1 
ATOM   3351 C  CA    . SER B 1  165 ? -9.445  33.544 12.472  1.00 31.10 ? 162 SER B CA    1 
ATOM   3352 C  C     . SER B 1  165 ? -10.017 34.804 11.825  1.00 30.71 ? 162 SER B C     1 
ATOM   3353 O  O     . SER B 1  165 ? -11.213 34.878 11.551  1.00 29.99 ? 162 SER B O     1 
ATOM   3354 C  CB    . SER B 1  165 ? -8.688  32.730 11.424  1.00 31.37 ? 162 SER B CB    1 
ATOM   3355 O  OG    . SER B 1  165 ? -9.571  32.271 10.410  1.00 31.56 ? 162 SER B OG    1 
ATOM   3356 N  N     . THR B 1  166 ? -9.160  35.794 11.599  1.00 29.91 ? 163 THR B N     1 
ATOM   3357 C  CA    . THR B 1  166 ? -9.569  36.983 10.859  1.00 30.72 ? 163 THR B CA    1 
ATOM   3358 C  C     . THR B 1  166 ? -10.179 36.649 9.479   1.00 30.81 ? 163 THR B C     1 
ATOM   3359 O  O     . THR B 1  166 ? -11.250 37.167 9.143   1.00 30.94 ? 163 THR B O     1 
ATOM   3360 C  CB    . THR B 1  166 ? -8.415  38.004 10.697  1.00 30.50 ? 163 THR B CB    1 
ATOM   3361 O  OG1   . THR B 1  166 ? -8.078  38.551 11.981  1.00 30.57 ? 163 THR B OG1   1 
ATOM   3362 C  CG2   . THR B 1  166 ? -8.836  39.144 9.788   1.00 29.90 ? 163 THR B CG2   1 
ATOM   3363 N  N     . SER B 1  167 ? -9.532  35.778 8.703   1.00 30.77 ? 164 SER B N     1 
ATOM   3364 C  CA    . SER B 1  167 ? -10.064 35.451 7.365   1.00 31.49 ? 164 SER B CA    1 
ATOM   3365 C  C     . SER B 1  167 ? -11.423 34.744 7.407   1.00 30.68 ? 164 SER B C     1 
ATOM   3366 O  O     . SER B 1  167 ? -12.295 35.068 6.609   1.00 30.71 ? 164 SER B O     1 
ATOM   3367 C  CB    . SER B 1  167 ? -9.054  34.694 6.489   1.00 31.44 ? 164 SER B CB    1 
ATOM   3368 O  OG    . SER B 1  167 ? -8.772  33.415 7.029   1.00 35.32 ? 164 SER B OG    1 
ATOM   3369 N  N     . ALA B 1  168 ? -11.614 33.805 8.340   1.00 30.32 ? 165 ALA B N     1 
ATOM   3370 C  CA    . ALA B 1  168 ? -12.948 33.192 8.546   1.00 30.03 ? 165 ALA B CA    1 
ATOM   3371 C  C     . ALA B 1  168 ? -14.035 34.197 8.929   1.00 29.99 ? 165 ALA B C     1 
ATOM   3372 O  O     . ALA B 1  168 ? -15.187 34.056 8.515   1.00 30.49 ? 165 ALA B O     1 
ATOM   3373 C  CB    . ALA B 1  168 ? -12.892 32.116 9.583   1.00 30.42 ? 165 ALA B CB    1 
ATOM   3374 N  N     . THR B 1  169 ? -13.663 35.179 9.748   1.00 29.61 ? 166 THR B N     1 
ATOM   3375 C  CA    . THR B 1  169 ? -14.562 36.214 10.220  1.00 29.34 ? 166 THR B CA    1 
ATOM   3376 C  C     . THR B 1  169 ? -14.965 37.113 9.055   1.00 29.63 ? 166 THR B C     1 
ATOM   3377 O  O     . THR B 1  169 ? -16.147 37.388 8.855   1.00 29.63 ? 166 THR B O     1 
ATOM   3378 C  CB    . THR B 1  169 ? -13.885 37.040 11.343  1.00 29.47 ? 166 THR B CB    1 
ATOM   3379 O  OG1   . THR B 1  169 ? -13.415 36.148 12.364  1.00 29.89 ? 166 THR B OG1   1 
ATOM   3380 C  CG2   . THR B 1  169 ? -14.843 38.028 11.953  1.00 28.27 ? 166 THR B CG2   1 
ATOM   3381 N  N     . VAL B 1  170 ? -13.973 37.558 8.289   1.00 29.31 ? 167 VAL B N     1 
ATOM   3382 C  CA    . VAL B 1  170 ? -14.196 38.394 7.108   1.00 29.36 ? 167 VAL B CA    1 
ATOM   3383 C  C     . VAL B 1  170 ? -15.083 37.710 6.055   1.00 29.83 ? 167 VAL B C     1 
ATOM   3384 O  O     . VAL B 1  170 ? -15.998 38.335 5.510   1.00 29.56 ? 167 VAL B O     1 
ATOM   3385 C  CB    . VAL B 1  170 ? -12.847 38.846 6.502   1.00 28.94 ? 167 VAL B CB    1 
ATOM   3386 C  CG1   . VAL B 1  170 ? -12.992 39.231 5.010   1.00 28.72 ? 167 VAL B CG1   1 
ATOM   3387 C  CG2   . VAL B 1  170 ? -12.250 39.982 7.337   1.00 28.76 ? 167 VAL B CG2   1 
ATOM   3388 N  N     . LYS B 1  171 ? -14.831 36.428 5.802   1.00 30.42 ? 168 LYS B N     1 
ATOM   3389 C  CA    . LYS B 1  171 ? -15.612 35.661 4.840   1.00 31.78 ? 168 LYS B CA    1 
ATOM   3390 C  C     . LYS B 1  171 ? -17.062 35.517 5.268   1.00 31.32 ? 168 LYS B C     1 
ATOM   3391 O  O     . LYS B 1  171 ? -17.973 35.713 4.453   1.00 31.03 ? 168 LYS B O     1 
ATOM   3392 C  CB    . LYS B 1  171 ? -14.985 34.283 4.600   1.00 32.33 ? 168 LYS B CB    1 
ATOM   3393 C  CG    . LYS B 1  171 ? -13.762 34.372 3.704   1.00 37.26 ? 168 LYS B CG    1 
ATOM   3394 C  CD    . LYS B 1  171 ? -12.967 33.059 3.617   1.00 42.49 ? 168 LYS B CD    1 
ATOM   3395 C  CE    . LYS B 1  171 ? -11.705 33.268 2.749   1.00 45.11 ? 168 LYS B CE    1 
ATOM   3396 N  NZ    . LYS B 1  171 ? -10.730 32.136 2.876   1.00 46.71 ? 168 LYS B NZ    1 
ATOM   3397 N  N     . SER B 1  172 ? -17.276 35.172 6.541   1.00 30.11 ? 169 SER B N     1 
ATOM   3398 C  CA    . SER B 1  172 ? -18.626 35.081 7.092   1.00 28.53 ? 169 SER B CA    1 
ATOM   3399 C  C     . SER B 1  172 ? -19.318 36.436 7.070   1.00 28.02 ? 169 SER B C     1 
ATOM   3400 O  O     . SER B 1  172 ? -20.480 36.540 6.671   1.00 26.43 ? 169 SER B O     1 
ATOM   3401 C  CB    . SER B 1  172 ? -18.583 34.557 8.529   1.00 29.14 ? 169 SER B CB    1 
ATOM   3402 O  OG    . SER B 1  172 ? -18.015 33.258 8.568   1.00 29.47 ? 169 SER B OG    1 
ATOM   3403 N  N     . LEU B 1  173 ? -18.606 37.474 7.509   1.00 27.35 ? 170 LEU B N     1 
ATOM   3404 C  CA    . LEU B 1  173 ? -19.207 38.803 7.579   1.00 27.31 ? 170 LEU B CA    1 
ATOM   3405 C  C     . LEU B 1  173 ? -19.428 39.447 6.198   1.00 27.30 ? 170 LEU B C     1 
ATOM   3406 O  O     . LEU B 1  173 ? -20.294 40.320 6.053   1.00 27.78 ? 170 LEU B O     1 
ATOM   3407 C  CB    . LEU B 1  173 ? -18.437 39.736 8.536   1.00 26.69 ? 170 LEU B CB    1 
ATOM   3408 C  CG    . LEU B 1  173 ? -18.477 39.418 10.053  1.00 27.07 ? 170 LEU B CG    1 
ATOM   3409 C  CD1   . LEU B 1  173 ? -17.770 40.511 10.869  1.00 25.04 ? 170 LEU B CD1   1 
ATOM   3410 C  CD2   . LEU B 1  173 ? -19.896 39.218 10.574  1.00 27.32 ? 170 LEU B CD2   1 
ATOM   3411 N  N     . ASN B 1  174 ? -18.654 39.028 5.195   1.00 27.36 ? 171 ASN B N     1 
ATOM   3412 C  CA    . ASN B 1  174 ? -18.939 39.416 3.793   1.00 27.03 ? 171 ASN B CA    1 
ATOM   3413 C  C     . ASN B 1  174 ? -20.301 38.887 3.328   1.00 26.80 ? 171 ASN B C     1 
ATOM   3414 O  O     . ASN B 1  174 ? -21.038 39.566 2.599   1.00 26.88 ? 171 ASN B O     1 
ATOM   3415 C  CB    . ASN B 1  174 ? -17.801 39.011 2.840   1.00 26.35 ? 171 ASN B CB    1 
ATOM   3416 C  CG    . ASN B 1  174 ? -16.659 39.998 2.884   1.00 26.79 ? 171 ASN B CG    1 
ATOM   3417 O  OD1   . ASN B 1  174 ? -16.855 41.137 3.313   1.00 27.37 ? 171 ASN B OD1   1 
ATOM   3418 N  ND2   . ASN B 1  174 ? -15.464 39.583 2.453   1.00 25.01 ? 171 ASN B ND2   1 
ATOM   3419 N  N     . VAL B 1  175 ? -20.662 37.703 3.805   1.00 26.49 ? 172 VAL B N     1 
ATOM   3420 C  CA    . VAL B 1  175 ? -21.995 37.175 3.530   1.00 26.41 ? 172 VAL B CA    1 
ATOM   3421 C  C     . VAL B 1  175 ? -23.042 38.038 4.242   1.00 26.56 ? 172 VAL B C     1 
ATOM   3422 O  O     . VAL B 1  175 ? -23.927 38.590 3.584   1.00 26.99 ? 172 VAL B O     1 
ATOM   3423 C  CB    . VAL B 1  175 ? -22.119 35.706 3.936   1.00 26.50 ? 172 VAL B CB    1 
ATOM   3424 C  CG1   . VAL B 1  175 ? -23.551 35.180 3.682   1.00 26.29 ? 172 VAL B CG1   1 
ATOM   3425 C  CG2   . VAL B 1  175 ? -21.066 34.869 3.202   1.00 26.21 ? 172 VAL B CG2   1 
ATOM   3426 N  N     . LEU B 1  176 ? -22.949 38.170 5.571   1.00 25.73 ? 173 LEU B N     1 
ATOM   3427 C  CA    . LEU B 1  176 ? -23.910 39.002 6.299   1.00 25.77 ? 173 LEU B CA    1 
ATOM   3428 C  C     . LEU B 1  176 ? -24.000 40.444 5.766   1.00 25.55 ? 173 LEU B C     1 
ATOM   3429 O  O     . LEU B 1  176 ? -25.106 40.991 5.608   1.00 24.80 ? 173 LEU B O     1 
ATOM   3430 C  CB    . LEU B 1  176 ? -23.608 39.019 7.816   1.00 25.89 ? 173 LEU B CB    1 
ATOM   3431 C  CG    . LEU B 1  176 ? -24.602 39.802 8.702   1.00 27.36 ? 173 LEU B CG    1 
ATOM   3432 C  CD1   . LEU B 1  176 ? -26.061 39.382 8.459   1.00 28.88 ? 173 LEU B CD1   1 
ATOM   3433 C  CD2   . LEU B 1  176 ? -24.275 39.643 10.187  1.00 27.08 ? 173 LEU B CD2   1 
ATOM   3434 N  N     . THR B 1  177 ? -22.850 41.084 5.522   1.00 25.37 ? 174 THR B N     1 
ATOM   3435 C  CA    . THR B 1  177 ? -22.888 42.497 5.096   1.00 25.50 ? 174 THR B CA    1 
ATOM   3436 C  C     . THR B 1  177 ? -23.323 42.701 3.617   1.00 25.98 ? 174 THR B C     1 
ATOM   3437 O  O     . THR B 1  177 ? -23.381 43.844 3.141   1.00 25.49 ? 174 THR B O     1 
ATOM   3438 C  CB    . THR B 1  177 ? -21.568 43.294 5.422   1.00 26.04 ? 174 THR B CB    1 
ATOM   3439 O  OG1   . THR B 1  177 ? -20.454 42.663 4.789   1.00 26.81 ? 174 THR B OG1   1 
ATOM   3440 C  CG2   . THR B 1  177 ? -21.301 43.357 6.947   1.00 25.27 ? 174 THR B CG2   1 
ATOM   3441 N  N     . SER B 1  178 ? -23.619 41.606 2.904   1.00 26.02 ? 175 SER B N     1 
ATOM   3442 C  CA    A SER B 1  178 ? -24.269 41.710 1.592   0.50 26.76 ? 175 SER B CA    1 
ATOM   3443 C  CA    B SER B 1  178 ? -24.266 41.674 1.583   0.50 26.43 ? 175 SER B CA    1 
ATOM   3444 C  C     . SER B 1  178 ? -25.780 41.846 1.748   1.00 26.90 ? 175 SER B C     1 
ATOM   3445 O  O     . SER B 1  178 ? -26.504 42.061 0.771   1.00 26.72 ? 175 SER B O     1 
ATOM   3446 C  CB    A SER B 1  178 ? -23.930 40.507 0.719   0.50 26.68 ? 175 SER B CB    1 
ATOM   3447 C  CB    B SER B 1  178 ? -23.959 40.419 0.742   0.50 26.26 ? 175 SER B CB    1 
ATOM   3448 O  OG    A SER B 1  178 ? -22.582 40.597 0.320   0.50 27.44 ? 175 SER B OG    1 
ATOM   3449 O  OG    B SER B 1  178 ? -24.678 39.277 1.190   0.50 25.00 ? 175 SER B OG    1 
ATOM   3450 N  N     . ILE B 1  179 ? -26.242 41.733 2.990   1.00 27.16 ? 176 ILE B N     1 
ATOM   3451 C  CA    . ILE B 1  179 ? -27.642 41.886 3.336   1.00 28.40 ? 176 ILE B CA    1 
ATOM   3452 C  C     . ILE B 1  179 ? -27.814 43.143 4.175   1.00 28.42 ? 176 ILE B C     1 
ATOM   3453 O  O     . ILE B 1  179 ? -28.673 43.951 3.880   1.00 29.30 ? 176 ILE B O     1 
ATOM   3454 C  CB    . ILE B 1  179 ? -28.186 40.627 4.084   1.00 29.04 ? 176 ILE B CB    1 
ATOM   3455 C  CG1   . ILE B 1  179 ? -28.317 39.458 3.105   1.00 30.66 ? 176 ILE B CG1   1 
ATOM   3456 C  CG2   . ILE B 1  179 ? -29.541 40.912 4.746   1.00 27.70 ? 176 ILE B CG2   1 
ATOM   3457 C  CD1   . ILE B 1  179 ? -27.763 38.178 3.669   1.00 37.49 ? 176 ILE B CD1   1 
ATOM   3458 N  N     . ALA B 1  180 ? -26.986 43.320 5.208   1.00 28.41 ? 177 ALA B N     1 
ATOM   3459 C  CA    . ALA B 1  180 ? -27.085 44.504 6.058   1.00 28.04 ? 177 ALA B CA    1 
ATOM   3460 C  C     . ALA B 1  180 ? -25.785 44.853 6.736   1.00 27.66 ? 177 ALA B C     1 
ATOM   3461 O  O     . ALA B 1  180 ? -25.076 43.981 7.244   1.00 27.29 ? 177 ALA B O     1 
ATOM   3462 C  CB    . ALA B 1  180 ? -28.184 44.345 7.098   1.00 28.38 ? 177 ALA B CB    1 
ATOM   3463 N  N     . ILE B 1  181 ? -25.481 46.144 6.749   1.00 27.00 ? 178 ILE B N     1 
ATOM   3464 C  CA    . ILE B 1  181 ? -24.233 46.612 7.323   1.00 27.36 ? 178 ILE B CA    1 
ATOM   3465 C  C     . ILE B 1  181 ? -24.519 47.325 8.651   1.00 27.39 ? 178 ILE B C     1 
ATOM   3466 O  O     . ILE B 1  181 ? -25.358 48.245 8.707   1.00 26.82 ? 178 ILE B O     1 
ATOM   3467 C  CB    . ILE B 1  181 ? -23.456 47.573 6.370   1.00 27.23 ? 178 ILE B CB    1 
ATOM   3468 C  CG1   . ILE B 1  181 ? -23.337 46.971 4.961   1.00 27.83 ? 178 ILE B CG1   1 
ATOM   3469 C  CG2   . ILE B 1  181 ? -22.066 47.893 6.950   1.00 26.31 ? 178 ILE B CG2   1 
ATOM   3470 C  CD1   . ILE B 1  181 ? -22.451 47.796 3.996   1.00 29.03 ? 178 ILE B CD1   1 
ATOM   3471 N  N     . PRO B 1  182 ? -23.827 46.901 9.721   1.00 27.00 ? 179 PRO B N     1 
ATOM   3472 C  CA    . PRO B 1  182 ? -23.992 47.590 10.999  1.00 26.87 ? 179 PRO B CA    1 
ATOM   3473 C  C     . PRO B 1  182 ? -23.195 48.893 11.053  1.00 26.97 ? 179 PRO B C     1 
ATOM   3474 O  O     . PRO B 1  182 ? -22.191 49.029 10.348  1.00 27.02 ? 179 PRO B O     1 
ATOM   3475 C  CB    . PRO B 1  182 ? -23.425 46.586 12.006  1.00 26.09 ? 179 PRO B CB    1 
ATOM   3476 C  CG    . PRO B 1  182 ? -22.380 45.854 11.257  1.00 26.30 ? 179 PRO B CG    1 
ATOM   3477 C  CD    . PRO B 1  182 ? -22.911 45.743 9.827   1.00 27.04 ? 179 PRO B CD    1 
ATOM   3478 N  N     . LYS B 1  183 ? -23.622 49.825 11.900  1.00 27.45 ? 180 LYS B N     1 
ATOM   3479 C  CA    . LYS B 1  183 ? -22.824 51.027 12.187  1.00 28.70 ? 180 LYS B CA    1 
ATOM   3480 C  C     . LYS B 1  183 ? -21.620 50.677 13.057  1.00 28.62 ? 180 LYS B C     1 
ATOM   3481 O  O     . LYS B 1  183 ? -20.514 51.220 12.886  1.00 28.52 ? 180 LYS B O     1 
ATOM   3482 C  CB    . LYS B 1  183 ? -23.661 52.080 12.917  1.00 29.75 ? 180 LYS B CB    1 
ATOM   3483 C  CG    . LYS B 1  183 ? -24.844 52.601 12.136  1.00 32.27 ? 180 LYS B CG    1 
ATOM   3484 C  CD    . LYS B 1  183 ? -25.336 53.925 12.747  1.00 37.83 ? 180 LYS B CD    1 
ATOM   3485 C  CE    . LYS B 1  183 ? -26.733 54.235 12.248  1.00 39.68 ? 180 LYS B CE    1 
ATOM   3486 N  NZ    . LYS B 1  183 ? -27.201 55.590 12.663  1.00 42.32 ? 180 LYS B NZ    1 
ATOM   3487 N  N     . VAL B 1  184 ? -21.858 49.778 14.008  1.00 27.58 ? 181 VAL B N     1 
ATOM   3488 C  CA    . VAL B 1  184 ? -20.860 49.407 14.983  1.00 26.92 ? 181 VAL B CA    1 
ATOM   3489 C  C     . VAL B 1  184 ? -20.851 47.892 15.099  1.00 26.26 ? 181 VAL B C     1 
ATOM   3490 O  O     . VAL B 1  184 ? -21.908 47.244 15.128  1.00 25.92 ? 181 VAL B O     1 
ATOM   3491 C  CB    . VAL B 1  184 ? -21.179 50.017 16.383  1.00 27.05 ? 181 VAL B CB    1 
ATOM   3492 C  CG1   . VAL B 1  184 ? -20.118 49.574 17.421  1.00 27.96 ? 181 VAL B CG1   1 
ATOM   3493 C  CG2   . VAL B 1  184 ? -21.265 51.541 16.326  1.00 26.07 ? 181 VAL B CG2   1 
ATOM   3494 N  N     . ILE B 1  185 ? -19.654 47.330 15.153  1.00 25.57 ? 182 ILE B N     1 
ATOM   3495 C  CA    . ILE B 1  185 ? -19.482 45.971 15.594  1.00 25.55 ? 182 ILE B CA    1 
ATOM   3496 C  C     . ILE B 1  185 ? -18.801 45.988 16.963  1.00 26.40 ? 182 ILE B C     1 
ATOM   3497 O  O     . ILE B 1  185 ? -17.790 46.687 17.164  1.00 26.87 ? 182 ILE B O     1 
ATOM   3498 C  CB    . ILE B 1  185 ? -18.641 45.150 14.585  1.00 25.92 ? 182 ILE B CB    1 
ATOM   3499 C  CG1   . ILE B 1  185 ? -19.439 44.878 13.306  1.00 24.97 ? 182 ILE B CG1   1 
ATOM   3500 C  CG2   . ILE B 1  185 ? -18.159 43.841 15.205  1.00 24.67 ? 182 ILE B CG2   1 
ATOM   3501 C  CD1   . ILE B 1  185 ? -18.591 44.211 12.203  1.00 24.95 ? 182 ILE B CD1   1 
ATOM   3502 N  N     . HIS B 1  186 ? -19.349 45.198 17.889  1.00 26.68 ? 183 HIS B N     1 
ATOM   3503 C  CA    . HIS B 1  186 ? -18.803 45.044 19.238  1.00 26.96 ? 183 HIS B CA    1 
ATOM   3504 C  C     . HIS B 1  186 ? -18.305 43.628 19.410  1.00 26.86 ? 183 HIS B C     1 
ATOM   3505 O  O     . HIS B 1  186 ? -19.005 42.673 19.053  1.00 27.64 ? 183 HIS B O     1 
ATOM   3506 C  CB    . HIS B 1  186 ? -19.884 45.334 20.295  1.00 26.67 ? 183 HIS B CB    1 
ATOM   3507 C  CG    . HIS B 1  186 ? -19.366 45.307 21.704  1.00 27.23 ? 183 HIS B CG    1 
ATOM   3508 N  ND1   . HIS B 1  186 ? -19.091 46.456 22.412  1.00 27.41 ? 183 HIS B ND1   1 
ATOM   3509 C  CD2   . HIS B 1  186 ? -19.038 44.276 22.517  1.00 27.24 ? 183 HIS B CD2   1 
ATOM   3510 C  CE1   . HIS B 1  186 ? -18.623 46.136 23.605  1.00 28.17 ? 183 HIS B CE1   1 
ATOM   3511 N  NE2   . HIS B 1  186 ? -18.583 44.820 23.696  1.00 28.96 ? 183 HIS B NE2   1 
ATOM   3512 N  N     . SER B 1  187 ? -17.113 43.481 19.978  1.00 26.82 ? 184 SER B N     1 
ATOM   3513 C  CA    . SER B 1  187 ? -16.546 42.158 20.255  1.00 27.00 ? 184 SER B CA    1 
ATOM   3514 C  C     . SER B 1  187 ? -15.644 42.180 21.498  1.00 27.37 ? 184 SER B C     1 
ATOM   3515 O  O     . SER B 1  187 ? -15.328 43.240 22.016  1.00 27.36 ? 184 SER B O     1 
ATOM   3516 C  CB    . SER B 1  187 ? -15.714 41.676 19.059  1.00 27.47 ? 184 SER B CB    1 
ATOM   3517 O  OG    . SER B 1  187 ? -14.514 42.420 18.933  1.00 26.23 ? 184 SER B OG    1 
ATOM   3518 N  N     . ASP B 1  188 ? -15.207 41.009 21.945  1.00 27.98 ? 185 ASP B N     1 
ATOM   3519 C  CA    . ASP B 1  188 ? -14.136 40.933 22.949  1.00 28.98 ? 185 ASP B CA    1 
ATOM   3520 C  C     . ASP B 1  188 ? -12.787 41.136 22.243  1.00 29.94 ? 185 ASP B C     1 
ATOM   3521 O  O     . ASP B 1  188 ? -12.755 41.534 21.063  1.00 29.63 ? 185 ASP B O     1 
ATOM   3522 C  CB    . ASP B 1  188 ? -14.210 39.625 23.753  1.00 28.58 ? 185 ASP B CB    1 
ATOM   3523 C  CG    . ASP B 1  188 ? -14.049 38.387 22.892  1.00 29.86 ? 185 ASP B CG    1 
ATOM   3524 O  OD1   . ASP B 1  188 ? -14.629 37.341 23.240  1.00 29.19 ? 185 ASP B OD1   1 
ATOM   3525 O  OD2   . ASP B 1  188 ? -13.346 38.444 21.864  1.00 32.11 ? 185 ASP B OD2   1 
ATOM   3526 N  N     . GLN B 1  189 ? -11.673 40.911 22.942  1.00 30.58 ? 186 GLN B N     1 
ATOM   3527 C  CA    . GLN B 1  189 ? -10.368 41.157 22.310  1.00 31.17 ? 186 GLN B CA    1 
ATOM   3528 C  C     . GLN B 1  189 ? -9.759  39.898 21.684  1.00 31.13 ? 186 GLN B C     1 
ATOM   3529 O  O     . GLN B 1  189 ? -8.531  39.757 21.613  1.00 31.70 ? 186 GLN B O     1 
ATOM   3530 C  CB    . GLN B 1  189 ? -9.396  41.819 23.295  1.00 31.34 ? 186 GLN B CB    1 
ATOM   3531 C  CG    . GLN B 1  189 ? -9.978  43.064 23.956  1.00 33.85 ? 186 GLN B CG    1 
ATOM   3532 C  CD    . GLN B 1  189 ? -9.219  44.321 23.628  1.00 34.80 ? 186 GLN B CD    1 
ATOM   3533 O  OE1   . GLN B 1  189 ? -8.130  44.265 23.073  1.00 37.21 ? 186 GLN B OE1   1 
ATOM   3534 N  NE2   . GLN B 1  189 ? -9.773  45.467 24.003  1.00 34.74 ? 186 GLN B NE2   1 
ATOM   3535 N  N     . GLY B 1  190 ? -10.603 38.983 21.223  1.00 30.43 ? 187 GLY B N     1 
ATOM   3536 C  CA    . GLY B 1  190 ? -10.111 37.841 20.458  1.00 30.41 ? 187 GLY B CA    1 
ATOM   3537 C  C     . GLY B 1  190 ? -9.207  38.302 19.319  1.00 30.72 ? 187 GLY B C     1 
ATOM   3538 O  O     . GLY B 1  190 ? -9.474  39.322 18.675  1.00 30.98 ? 187 GLY B O     1 
ATOM   3539 N  N     . ALA B 1  191 ? -8.130  37.559 19.089  1.00 30.89 ? 188 ALA B N     1 
ATOM   3540 C  CA    . ALA B 1  191 ? -7.131  37.875 18.060  1.00 31.13 ? 188 ALA B CA    1 
ATOM   3541 C  C     . ALA B 1  191 ? -7.753  38.118 16.683  1.00 30.94 ? 188 ALA B C     1 
ATOM   3542 O  O     . ALA B 1  191 ? -7.330  39.031 15.969  1.00 30.81 ? 188 ALA B O     1 
ATOM   3543 C  CB    . ALA B 1  191 ? -6.093  36.746 17.967  1.00 30.85 ? 188 ALA B CB    1 
ATOM   3544 N  N     . ALA B 1  192 ? -8.751  37.309 16.325  1.00 30.52 ? 189 ALA B N     1 
ATOM   3545 C  CA    . ALA B 1  192 ? -9.433  37.449 15.029  1.00 30.79 ? 189 ALA B CA    1 
ATOM   3546 C  C     . ALA B 1  192 ? -10.027 38.835 14.853  1.00 30.81 ? 189 ALA B C     1 
ATOM   3547 O  O     . ALA B 1  192 ? -10.109 39.334 13.725  1.00 31.58 ? 189 ALA B O     1 
ATOM   3548 C  CB    . ALA B 1  192 ? -10.533 36.402 14.876  1.00 30.64 ? 189 ALA B CB    1 
ATOM   3549 N  N     . PHE B 1  193 ? -10.449 39.451 15.960  1.00 30.17 ? 190 PHE B N     1 
ATOM   3550 C  CA    . PHE B 1  193 ? -11.150 40.729 15.901  1.00 29.30 ? 190 PHE B CA    1 
ATOM   3551 C  C     . PHE B 1  193 ? -10.237 41.930 16.088  1.00 29.61 ? 190 PHE B C     1 
ATOM   3552 O  O     . PHE B 1  193 ? -10.611 43.056 15.702  1.00 29.81 ? 190 PHE B O     1 
ATOM   3553 C  CB    . PHE B 1  193 ? -12.325 40.796 16.920  1.00 29.11 ? 190 PHE B CB    1 
ATOM   3554 C  CG    . PHE B 1  193 ? -13.224 39.574 16.925  1.00 28.04 ? 190 PHE B CG    1 
ATOM   3555 C  CD1   . PHE B 1  193 ? -13.742 39.055 15.745  1.00 25.23 ? 190 PHE B CD1   1 
ATOM   3556 C  CD2   . PHE B 1  193 ? -13.576 38.955 18.132  1.00 27.73 ? 190 PHE B CD2   1 
ATOM   3557 C  CE1   . PHE B 1  193 ? -14.556 37.925 15.756  1.00 26.45 ? 190 PHE B CE1   1 
ATOM   3558 C  CE2   . PHE B 1  193 ? -14.407 37.828 18.150  1.00 27.60 ? 190 PHE B CE2   1 
ATOM   3559 C  CZ    . PHE B 1  193 ? -14.904 37.317 16.961  1.00 27.39 ? 190 PHE B CZ    1 
ATOM   3560 N  N     . THR B 1  194 ? -9.063  41.725 16.686  1.00 29.97 ? 191 THR B N     1 
ATOM   3561 C  CA    . THR B 1  194 ? -8.157  42.858 16.975  1.00 31.03 ? 191 THR B CA    1 
ATOM   3562 C  C     . THR B 1  194 ? -7.001  43.027 15.955  1.00 31.56 ? 191 THR B C     1 
ATOM   3563 O  O     . THR B 1  194 ? -6.190  43.945 16.086  1.00 32.13 ? 191 THR B O     1 
ATOM   3564 C  CB    . THR B 1  194 ? -7.580  42.809 18.433  1.00 31.36 ? 191 THR B CB    1 
ATOM   3565 O  OG1   . THR B 1  194 ? -6.803  41.622 18.610  1.00 30.64 ? 191 THR B OG1   1 
ATOM   3566 C  CG2   . THR B 1  194 ? -8.706  42.820 19.470  1.00 30.71 ? 191 THR B CG2   1 
ATOM   3567 N  N     . SER B 1  195 ? -6.943  42.143 14.957  1.00 31.56 ? 192 SER B N     1 
ATOM   3568 C  CA    . SER B 1  195 ? -5.939  42.183 13.888  1.00 31.58 ? 192 SER B CA    1 
ATOM   3569 C  C     . SER B 1  195 ? -6.057  43.450 13.042  1.00 32.22 ? 192 SER B C     1 
ATOM   3570 O  O     . SER B 1  195 ? -7.129  44.071 12.968  1.00 32.30 ? 192 SER B O     1 
ATOM   3571 C  CB    . SER B 1  195 ? -6.088  40.948 13.004  1.00 31.53 ? 192 SER B CB    1 
ATOM   3572 O  OG    . SER B 1  195 ? -7.256  41.044 12.206  1.00 30.91 ? 192 SER B OG    1 
ATOM   3573 N  N     . SER B 1  196 ? -4.963  43.854 12.397  1.00 33.01 ? 193 SER B N     1 
ATOM   3574 C  CA    . SER B 1  196 ? -5.015  45.058 11.554  1.00 33.20 ? 193 SER B CA    1 
ATOM   3575 C  C     . SER B 1  196 ? -5.835  44.793 10.288  1.00 32.40 ? 193 SER B C     1 
ATOM   3576 O  O     . SER B 1  196 ? -6.486  45.695 9.768   1.00 32.46 ? 193 SER B O     1 
ATOM   3577 C  CB    . SER B 1  196 ? -3.611  45.542 11.195  1.00 33.18 ? 193 SER B CB    1 
ATOM   3578 O  OG    . SER B 1  196 ? -2.894  44.470 10.647  1.00 35.58 ? 193 SER B OG    1 
ATOM   3579 N  N     . THR B 1  197 ? -5.814  43.549 9.821   1.00 32.27 ? 194 THR B N     1 
ATOM   3580 C  CA    . THR B 1  197 ? -6.632  43.123 8.687   1.00 32.60 ? 194 THR B CA    1 
ATOM   3581 C  C     . THR B 1  197 ? -8.125  43.323 8.966   1.00 32.21 ? 194 THR B C     1 
ATOM   3582 O  O     . THR B 1  197 ? -8.855  43.886 8.131   1.00 32.27 ? 194 THR B O     1 
ATOM   3583 C  CB    . THR B 1  197 ? -6.335  41.668 8.296   1.00 32.50 ? 194 THR B CB    1 
ATOM   3584 O  OG1   . THR B 1  197 ? -4.978  41.578 7.867   1.00 35.25 ? 194 THR B OG1   1 
ATOM   3585 C  CG2   . THR B 1  197 ? -7.212  41.207 7.125   1.00 33.95 ? 194 THR B CG2   1 
ATOM   3586 N  N     . PHE B 1  198 ? -8.588  42.899 10.143  1.00 31.43 ? 195 PHE B N     1 
ATOM   3587 C  CA    . PHE B 1  198 ? -10.009 43.087 10.459  1.00 30.76 ? 195 PHE B CA    1 
ATOM   3588 C  C     . PHE B 1  198 ? -10.342 44.559 10.596  1.00 30.47 ? 195 PHE B C     1 
ATOM   3589 O  O     . PHE B 1  198 ? -11.439 45.001 10.188  1.00 30.17 ? 195 PHE B O     1 
ATOM   3590 C  CB    . PHE B 1  198 ? -10.438 42.310 11.709  1.00 30.78 ? 195 PHE B CB    1 
ATOM   3591 C  CG    . PHE B 1  198 ? -11.925 42.232 11.879  1.00 30.88 ? 195 PHE B CG    1 
ATOM   3592 C  CD1   . PHE B 1  198 ? -12.718 41.611 10.912  1.00 29.56 ? 195 PHE B CD1   1 
ATOM   3593 C  CD2   . PHE B 1  198 ? -12.542 42.805 12.987  1.00 30.90 ? 195 PHE B CD2   1 
ATOM   3594 C  CE1   . PHE B 1  198 ? -14.108 41.548 11.060  1.00 29.01 ? 195 PHE B CE1   1 
ATOM   3595 C  CE2   . PHE B 1  198 ? -13.939 42.734 13.142  1.00 30.49 ? 195 PHE B CE2   1 
ATOM   3596 C  CZ    . PHE B 1  198 ? -14.712 42.102 12.176  1.00 28.82 ? 195 PHE B CZ    1 
ATOM   3597 N  N     . ALA B 1  199 ? -9.402  45.326 11.148  1.00 30.02 ? 196 ALA B N     1 
ATOM   3598 C  CA    . ALA B 1  199 ? -9.582  46.782 11.264  1.00 30.87 ? 196 ALA B CA    1 
ATOM   3599 C  C     . ALA B 1  199 ? -9.740  47.437 9.885   1.00 31.62 ? 196 ALA B C     1 
ATOM   3600 O  O     . ALA B 1  199 ? -10.596 48.320 9.711   1.00 31.25 ? 196 ALA B O     1 
ATOM   3601 C  CB    . ALA B 1  199 ? -8.435  47.429 12.031  1.00 30.12 ? 196 ALA B CB    1 
ATOM   3602 N  N     . GLU B 1  200 ? -8.917  47.006 8.921   1.00 32.37 ? 197 GLU B N     1 
ATOM   3603 C  CA    A GLU B 1  200 ? -9.002  47.567 7.569   0.50 32.93 ? 197 GLU B CA    1 
ATOM   3604 C  CA    B GLU B 1  200 ? -8.960  47.510 7.536   0.50 33.11 ? 197 GLU B CA    1 
ATOM   3605 C  C     . GLU B 1  200 ? -10.287 47.157 6.861   1.00 32.75 ? 197 GLU B C     1 
ATOM   3606 O  O     . GLU B 1  200 ? -10.892 47.977 6.175   1.00 32.74 ? 197 GLU B O     1 
ATOM   3607 C  CB    A GLU B 1  200 ? -7.764  47.245 6.726   0.50 33.26 ? 197 GLU B CB    1 
ATOM   3608 C  CB    B GLU B 1  200 ? -7.769  46.959 6.722   0.50 33.46 ? 197 GLU B CB    1 
ATOM   3609 C  CG    A GLU B 1  200 ? -6.569  48.124 7.090   0.50 34.81 ? 197 GLU B CG    1 
ATOM   3610 C  CG    B GLU B 1  200 ? -6.435  47.634 7.077   0.50 36.02 ? 197 GLU B CG    1 
ATOM   3611 C  CD    A GLU B 1  200 ? -6.957  49.583 7.300   0.50 36.44 ? 197 GLU B CD    1 
ATOM   3612 C  CD    B GLU B 1  200 ? -5.198  46.973 6.467   0.50 39.09 ? 197 GLU B CD    1 
ATOM   3613 O  OE1   A GLU B 1  200 ? -7.303  50.247 6.293   0.50 36.49 ? 197 GLU B OE1   1 
ATOM   3614 O  OE1   B GLU B 1  200 ? -5.321  45.943 5.763   0.50 39.97 ? 197 GLU B OE1   1 
ATOM   3615 O  OE2   A GLU B 1  200 ? -6.914  50.062 8.469   0.50 35.92 ? 197 GLU B OE2   1 
ATOM   3616 O  OE2   B GLU B 1  200 ? -4.087  47.501 6.704   0.50 40.10 ? 197 GLU B OE2   1 
ATOM   3617 N  N     . TRP B 1  201 ? -10.711 45.911 7.063   1.00 32.69 ? 198 TRP B N     1 
ATOM   3618 C  CA    . TRP B 1  201 ? -11.990 45.408 6.552   1.00 32.60 ? 198 TRP B CA    1 
ATOM   3619 C  C     . TRP B 1  201 ? -13.137 46.303 7.039   1.00 32.93 ? 198 TRP B C     1 
ATOM   3620 O  O     . TRP B 1  201 ? -13.981 46.757 6.254   1.00 32.83 ? 198 TRP B O     1 
ATOM   3621 C  CB    . TRP B 1  201 ? -12.199 43.942 6.969   1.00 32.09 ? 198 TRP B CB    1 
ATOM   3622 C  CG    . TRP B 1  201 ? -13.525 43.410 6.539   1.00 33.19 ? 198 TRP B CG    1 
ATOM   3623 C  CD1   . TRP B 1  201 ? -13.813 42.790 5.362   1.00 32.09 ? 198 TRP B CD1   1 
ATOM   3624 C  CD2   . TRP B 1  201 ? -14.767 43.490 7.269   1.00 33.53 ? 198 TRP B CD2   1 
ATOM   3625 N  NE1   . TRP B 1  201 ? -15.149 42.470 5.309   1.00 33.46 ? 198 TRP B NE1   1 
ATOM   3626 C  CE2   . TRP B 1  201 ? -15.760 42.895 6.463   1.00 33.39 ? 198 TRP B CE2   1 
ATOM   3627 C  CE3   . TRP B 1  201 ? -15.130 44.001 8.530   1.00 31.73 ? 198 TRP B CE3   1 
ATOM   3628 C  CZ2   . TRP B 1  201 ? -17.099 42.786 6.875   1.00 33.28 ? 198 TRP B CZ2   1 
ATOM   3629 C  CZ3   . TRP B 1  201 ? -16.456 43.900 8.935   1.00 32.40 ? 198 TRP B CZ3   1 
ATOM   3630 C  CH2   . TRP B 1  201 ? -17.425 43.294 8.110   1.00 33.18 ? 198 TRP B CH2   1 
ATOM   3631 N  N     . ALA B 1  202 ? -13.144 46.588 8.338   1.00 33.07 ? 199 ALA B N     1 
ATOM   3632 C  CA    . ALA B 1  202 ? -14.194 47.402 8.931   1.00 33.53 ? 199 ALA B CA    1 
ATOM   3633 C  C     . ALA B 1  202 ? -14.153 48.817 8.372   1.00 34.38 ? 199 ALA B C     1 
ATOM   3634 O  O     . ALA B 1  202 ? -15.198 49.396 8.036   1.00 33.50 ? 199 ALA B O     1 
ATOM   3635 C  CB    . ALA B 1  202 ? -14.060 47.421 10.457  1.00 32.80 ? 199 ALA B CB    1 
ATOM   3636 N  N     . LYS B 1  203 ? -12.938 49.360 8.268   1.00 35.56 ? 200 LYS B N     1 
ATOM   3637 C  CA    . LYS B 1  203 ? -12.749 50.727 7.796   1.00 37.21 ? 200 LYS B CA    1 
ATOM   3638 C  C     . LYS B 1  203 ? -13.251 50.893 6.360   1.00 37.66 ? 200 LYS B C     1 
ATOM   3639 O  O     . LYS B 1  203 ? -13.926 51.876 6.051   1.00 37.85 ? 200 LYS B O     1 
ATOM   3640 C  CB    . LYS B 1  203 ? -11.285 51.161 7.921   1.00 37.49 ? 200 LYS B CB    1 
ATOM   3641 C  CG    . LYS B 1  203 ? -11.051 52.631 7.631   1.00 40.37 ? 200 LYS B CG    1 
ATOM   3642 C  CD    . LYS B 1  203 ? -9.566  52.936 7.570   1.00 45.27 ? 200 LYS B CD    1 
ATOM   3643 C  CE    . LYS B 1  203 ? -9.315  54.446 7.556   1.00 49.08 ? 200 LYS B CE    1 
ATOM   3644 N  NZ    . LYS B 1  203 ? -7.906  54.751 7.150   1.00 51.69 ? 200 LYS B NZ    1 
ATOM   3645 N  N     . GLU B 1  204 ? -12.956 49.915 5.506   1.00 38.11 ? 201 GLU B N     1 
ATOM   3646 C  CA    . GLU B 1  204 ? -13.455 49.905 4.121   1.00 38.90 ? 201 GLU B CA    1 
ATOM   3647 C  C     . GLU B 1  204 ? -14.978 50.053 4.039   1.00 38.49 ? 201 GLU B C     1 
ATOM   3648 O  O     . GLU B 1  204 ? -15.496 50.607 3.073   1.00 38.72 ? 201 GLU B O     1 
ATOM   3649 C  CB    . GLU B 1  204 ? -13.049 48.610 3.409   1.00 39.32 ? 201 GLU B CB    1 
ATOM   3650 C  CG    . GLU B 1  204 ? -11.612 48.574 2.898   1.00 43.10 ? 201 GLU B CG    1 
ATOM   3651 C  CD    . GLU B 1  204 ? -11.111 47.153 2.593   1.00 48.69 ? 201 GLU B CD    1 
ATOM   3652 O  OE1   . GLU B 1  204 ? -11.925 46.192 2.580   1.00 50.91 ? 201 GLU B OE1   1 
ATOM   3653 O  OE2   . GLU B 1  204 ? -9.888  46.990 2.379   1.00 51.66 ? 201 GLU B OE2   1 
ATOM   3654 N  N     . ARG B 1  205 ? -15.692 49.544 5.047   1.00 37.56 ? 202 ARG B N     1 
ATOM   3655 C  CA    . ARG B 1  205 ? -17.148 49.494 5.020   1.00 36.11 ? 202 ARG B CA    1 
ATOM   3656 C  C     . ARG B 1  205 ? -17.806 50.546 5.894   1.00 35.50 ? 202 ARG B C     1 
ATOM   3657 O  O     . ARG B 1  205 ? -19.024 50.536 6.045   1.00 35.93 ? 202 ARG B O     1 
ATOM   3658 C  CB    . ARG B 1  205 ? -17.640 48.099 5.412   1.00 35.91 ? 202 ARG B CB    1 
ATOM   3659 C  CG    . ARG B 1  205 ? -17.477 47.094 4.295   1.00 36.24 ? 202 ARG B CG    1 
ATOM   3660 C  CD    . ARG B 1  205 ? -17.128 45.716 4.799   1.00 34.58 ? 202 ARG B CD    1 
ATOM   3661 N  NE    . ARG B 1  205 ? -16.811 44.850 3.674   1.00 34.36 ? 202 ARG B NE    1 
ATOM   3662 C  CZ    . ARG B 1  205 ? -15.617 44.779 3.083   1.00 35.43 ? 202 ARG B CZ    1 
ATOM   3663 N  NH1   . ARG B 1  205 ? -14.587 45.507 3.529   1.00 33.62 ? 202 ARG B NH1   1 
ATOM   3664 N  NH2   . ARG B 1  205 ? -15.446 43.959 2.046   1.00 32.31 ? 202 ARG B NH2   1 
ATOM   3665 N  N     . GLY B 1  206 ? -17.008 51.449 6.462   1.00 34.37 ? 203 GLY B N     1 
ATOM   3666 C  CA    . GLY B 1  206 ? -17.522 52.470 7.368   1.00 33.75 ? 203 GLY B CA    1 
ATOM   3667 C  C     . GLY B 1  206 ? -18.100 51.912 8.664   1.00 33.11 ? 203 GLY B C     1 
ATOM   3668 O  O     . GLY B 1  206 ? -18.989 52.519 9.262   1.00 32.81 ? 203 GLY B O     1 
ATOM   3669 N  N     . ILE B 1  207 ? -17.614 50.747 9.092   1.00 32.61 ? 204 ILE B N     1 
ATOM   3670 C  CA    . ILE B 1  207 ? -18.052 50.156 10.356  1.00 32.23 ? 204 ILE B CA    1 
ATOM   3671 C  C     . ILE B 1  207 ? -17.079 50.538 11.482  1.00 32.17 ? 204 ILE B C     1 
ATOM   3672 O  O     . ILE B 1  207 ? -15.880 50.323 11.356  1.00 31.44 ? 204 ILE B O     1 
ATOM   3673 C  CB    . ILE B 1  207 ? -18.146 48.609 10.285  1.00 32.33 ? 204 ILE B CB    1 
ATOM   3674 C  CG1   . ILE B 1  207 ? -19.108 48.159 9.174   1.00 31.65 ? 204 ILE B CG1   1 
ATOM   3675 C  CG2   . ILE B 1  207 ? -18.590 48.037 11.653  1.00 31.74 ? 204 ILE B CG2   1 
ATOM   3676 C  CD1   . ILE B 1  207 ? -18.855 46.722 8.710   1.00 29.07 ? 204 ILE B CD1   1 
ATOM   3677 N  N     . HIS B 1  208 ? -17.612 51.094 12.569  1.00 32.10 ? 205 HIS B N     1 
ATOM   3678 C  CA    . HIS B 1  208 ? -16.820 51.381 13.759  1.00 32.42 ? 205 HIS B CA    1 
ATOM   3679 C  C     . HIS B 1  208 ? -16.674 50.113 14.609  1.00 31.75 ? 205 HIS B C     1 
ATOM   3680 O  O     . HIS B 1  208 ? -17.668 49.437 14.889  1.00 31.27 ? 205 HIS B O     1 
ATOM   3681 C  CB    . HIS B 1  208 ? -17.463 52.512 14.564  1.00 33.19 ? 205 HIS B CB    1 
ATOM   3682 C  CG    . HIS B 1  208 ? -16.760 52.803 15.855  1.00 36.83 ? 205 HIS B CG    1 
ATOM   3683 N  ND1   . HIS B 1  208 ? -15.512 53.392 15.908  1.00 39.90 ? 205 HIS B ND1   1 
ATOM   3684 C  CD2   . HIS B 1  208 ? -17.119 52.565 17.141  1.00 39.50 ? 205 HIS B CD2   1 
ATOM   3685 C  CE1   . HIS B 1  208 ? -15.134 53.509 17.170  1.00 39.68 ? 205 HIS B CE1   1 
ATOM   3686 N  NE2   . HIS B 1  208 ? -16.088 53.010 17.938  1.00 41.06 ? 205 HIS B NE2   1 
ATOM   3687 N  N     . LEU B 1  209 ? -15.436 49.765 14.977  1.00 31.03 ? 206 LEU B N     1 
ATOM   3688 C  CA    . LEU B 1  209 ? -15.194 48.610 15.848  1.00 30.62 ? 206 LEU B CA    1 
ATOM   3689 C  C     . LEU B 1  209 ? -15.099 49.057 17.293  1.00 30.70 ? 206 LEU B C     1 
ATOM   3690 O  O     . LEU B 1  209 ? -14.369 49.976 17.612  1.00 30.49 ? 206 LEU B O     1 
ATOM   3691 C  CB    . LEU B 1  209 ? -13.932 47.832 15.461  1.00 30.19 ? 206 LEU B CB    1 
ATOM   3692 C  CG    . LEU B 1  209 ? -13.889 47.160 14.079  1.00 31.00 ? 206 LEU B CG    1 
ATOM   3693 C  CD1   . LEU B 1  209 ? -12.597 46.361 13.867  1.00 27.21 ? 206 LEU B CD1   1 
ATOM   3694 C  CD2   . LEU B 1  209 ? -15.134 46.282 13.804  1.00 29.18 ? 206 LEU B CD2   1 
ATOM   3695 N  N     . GLU B 1  210 ? -15.852 48.389 18.154  1.00 31.22 ? 207 GLU B N     1 
ATOM   3696 C  CA    . GLU B 1  210 ? -15.884 48.680 19.572  1.00 32.25 ? 207 GLU B CA    1 
ATOM   3697 C  C     . GLU B 1  210 ? -15.478 47.412 20.312  1.00 32.56 ? 207 GLU B C     1 
ATOM   3698 O  O     . GLU B 1  210 ? -15.885 46.303 19.953  1.00 32.74 ? 207 GLU B O     1 
ATOM   3699 C  CB    . GLU B 1  210 ? -17.297 49.160 19.953  1.00 32.92 ? 207 GLU B CB    1 
ATOM   3700 C  CG    . GLU B 1  210 ? -17.626 49.228 21.434  1.00 35.15 ? 207 GLU B CG    1 
ATOM   3701 C  CD    . GLU B 1  210 ? -19.065 49.651 21.655  1.00 37.58 ? 207 GLU B CD    1 
ATOM   3702 O  OE1   . GLU B 1  210 ? -19.346 50.840 21.458  1.00 40.88 ? 207 GLU B OE1   1 
ATOM   3703 O  OE2   . GLU B 1  210 ? -19.916 48.802 22.006  1.00 37.10 ? 207 GLU B OE2   1 
ATOM   3704 N  N     . PHE B 1  211 ? -14.643 47.565 21.336  1.00 32.59 ? 208 PHE B N     1 
ATOM   3705 C  CA    . PHE B 1  211 ? -14.099 46.408 22.016  1.00 32.50 ? 208 PHE B CA    1 
ATOM   3706 C  C     . PHE B 1  211 ? -14.363 46.498 23.499  1.00 32.55 ? 208 PHE B C     1 
ATOM   3707 O  O     . PHE B 1  211 ? -14.223 47.549 24.079  1.00 32.00 ? 208 PHE B O     1 
ATOM   3708 C  CB    . PHE B 1  211 ? -12.585 46.304 21.791  1.00 32.21 ? 208 PHE B CB    1 
ATOM   3709 C  CG    . PHE B 1  211 ? -12.185 46.078 20.352  1.00 32.04 ? 208 PHE B CG    1 
ATOM   3710 C  CD1   . PHE B 1  211 ? -12.185 44.805 19.810  1.00 30.73 ? 208 PHE B CD1   1 
ATOM   3711 C  CD2   . PHE B 1  211 ? -11.780 47.145 19.557  1.00 33.13 ? 208 PHE B CD2   1 
ATOM   3712 C  CE1   . PHE B 1  211 ? -11.797 44.583 18.478  1.00 30.37 ? 208 PHE B CE1   1 
ATOM   3713 C  CE2   . PHE B 1  211 ? -11.388 46.942 18.226  1.00 33.29 ? 208 PHE B CE2   1 
ATOM   3714 C  CZ    . PHE B 1  211 ? -11.396 45.645 17.692  1.00 31.46 ? 208 PHE B CZ    1 
ATOM   3715 N  N     . SER B 1  212 ? -14.729 45.381 24.111  1.00 33.51 ? 209 SER B N     1 
ATOM   3716 C  CA    . SER B 1  212 ? -14.758 45.322 25.569  1.00 34.67 ? 209 SER B CA    1 
ATOM   3717 C  C     . SER B 1  212 ? -13.317 45.227 26.076  1.00 35.37 ? 209 SER B C     1 
ATOM   3718 O  O     . SER B 1  212 ? -12.421 44.719 25.375  1.00 35.39 ? 209 SER B O     1 
ATOM   3719 C  CB    . SER B 1  212 ? -15.588 44.133 26.043  1.00 34.08 ? 209 SER B CB    1 
ATOM   3720 O  OG    . SER B 1  212 ? -15.066 42.929 25.514  1.00 34.78 ? 209 SER B OG    1 
ATOM   3721 N  N     . THR B 1  213 ? -13.090 45.724 27.287  1.00 36.45 ? 210 THR B N     1 
ATOM   3722 C  CA    . THR B 1  213 ? -11.760 45.708 27.897  1.00 37.13 ? 210 THR B CA    1 
ATOM   3723 C  C     . THR B 1  213 ? -11.326 44.256 28.174  1.00 37.21 ? 210 THR B C     1 
ATOM   3724 O  O     . THR B 1  213 ? -12.174 43.407 28.485  1.00 37.00 ? 210 THR B O     1 
ATOM   3725 C  CB    . THR B 1  213 ? -11.734 46.554 29.193  1.00 37.76 ? 210 THR B CB    1 
ATOM   3726 O  OG1   . THR B 1  213 ? -12.441 45.861 30.229  1.00 39.87 ? 210 THR B OG1   1 
ATOM   3727 C  CG2   . THR B 1  213 ? -12.379 47.933 28.968  1.00 37.38 ? 210 THR B CG2   1 
ATOM   3728 N  N     . PRO B 1  214 ? -10.010 43.955 28.057  1.00 37.59 ? 211 PRO B N     1 
ATOM   3729 C  CA    . PRO B 1  214 ? -9.566  42.573 28.296  1.00 38.11 ? 211 PRO B CA    1 
ATOM   3730 C  C     . PRO B 1  214 ? -10.024 42.069 29.670  1.00 38.97 ? 211 PRO B C     1 
ATOM   3731 O  O     . PRO B 1  214 ? -10.084 42.845 30.627  1.00 38.44 ? 211 PRO B O     1 
ATOM   3732 C  CB    . PRO B 1  214 ? -8.032  42.673 28.252  1.00 38.18 ? 211 PRO B CB    1 
ATOM   3733 C  CG    . PRO B 1  214 ? -7.744  43.889 27.469  1.00 37.86 ? 211 PRO B CG    1 
ATOM   3734 C  CD    . PRO B 1  214 ? -8.873  44.852 27.775  1.00 37.56 ? 211 PRO B CD    1 
ATOM   3735 N  N     . TYR B 1  215 ? -10.351 40.779 29.737  1.00 39.96 ? 212 TYR B N     1 
ATOM   3736 C  CA    . TYR B 1  215 ? -10.878 40.114 30.942  1.00 41.66 ? 212 TYR B CA    1 
ATOM   3737 C  C     . TYR B 1  215 ? -12.281 40.558 31.382  1.00 42.53 ? 212 TYR B C     1 
ATOM   3738 O  O     . TYR B 1  215 ? -12.784 40.081 32.390  1.00 42.97 ? 212 TYR B O     1 
ATOM   3739 C  CB    . TYR B 1  215 ? -9.848  40.095 32.104  1.00 41.82 ? 212 TYR B CB    1 
ATOM   3740 C  CG    . TYR B 1  215 ? -8.465  39.731 31.602  1.00 43.14 ? 212 TYR B CG    1 
ATOM   3741 C  CD1   . TYR B 1  215 ? -8.137  38.413 31.275  1.00 43.63 ? 212 TYR B CD1   1 
ATOM   3742 C  CD2   . TYR B 1  215 ? -7.510  40.722 31.382  1.00 45.04 ? 212 TYR B CD2   1 
ATOM   3743 C  CE1   . TYR B 1  215 ? -6.864  38.090 30.767  1.00 46.16 ? 212 TYR B CE1   1 
ATOM   3744 C  CE2   . TYR B 1  215 ? -6.249  40.415 30.875  1.00 46.87 ? 212 TYR B CE2   1 
ATOM   3745 C  CZ    . TYR B 1  215 ? -5.928  39.103 30.572  1.00 47.12 ? 212 TYR B CZ    1 
ATOM   3746 O  OH    . TYR B 1  215 ? -4.664  38.828 30.077  1.00 49.90 ? 212 TYR B OH    1 
ATOM   3747 N  N     . HIS B 1  216 ? -12.919 41.442 30.612  1.00 43.52 ? 213 HIS B N     1 
ATOM   3748 C  CA    . HIS B 1  216 ? -14.355 41.712 30.780  1.00 44.60 ? 213 HIS B CA    1 
ATOM   3749 C  C     . HIS B 1  216 ? -15.111 41.472 29.462  1.00 44.25 ? 213 HIS B C     1 
ATOM   3750 O  O     . HIS B 1  216 ? -15.747 42.390 28.936  1.00 43.70 ? 213 HIS B O     1 
ATOM   3751 C  CB    . HIS B 1  216 ? -14.593 43.130 31.315  1.00 45.31 ? 213 HIS B CB    1 
ATOM   3752 C  CG    . HIS B 1  216 ? -13.863 43.414 32.590  1.00 49.31 ? 213 HIS B CG    1 
ATOM   3753 N  ND1   . HIS B 1  216 ? -14.244 42.874 33.802  1.00 52.51 ? 213 HIS B ND1   1 
ATOM   3754 C  CD2   . HIS B 1  216 ? -12.759 44.159 32.841  1.00 51.59 ? 213 HIS B CD2   1 
ATOM   3755 C  CE1   . HIS B 1  216 ? -13.410 43.280 34.744  1.00 52.37 ? 213 HIS B CE1   1 
ATOM   3756 N  NE2   . HIS B 1  216 ? -12.502 44.062 34.188  1.00 52.24 ? 213 HIS B NE2   1 
ATOM   3757 N  N     . PRO B 1  217 ? -15.039 40.231 28.929  1.00 44.43 ? 214 PRO B N     1 
ATOM   3758 C  CA    . PRO B 1  217 ? -15.524 39.959 27.566  1.00 44.88 ? 214 PRO B CA    1 
ATOM   3759 C  C     . PRO B 1  217 ? -17.048 39.998 27.404  1.00 45.48 ? 214 PRO B C     1 
ATOM   3760 O  O     . PRO B 1  217 ? -17.547 39.973 26.272  1.00 45.67 ? 214 PRO B O     1 
ATOM   3761 C  CB    . PRO B 1  217 ? -14.978 38.556 27.262  1.00 44.65 ? 214 PRO B CB    1 
ATOM   3762 C  CG    . PRO B 1  217 ? -14.723 37.931 28.583  1.00 44.46 ? 214 PRO B CG    1 
ATOM   3763 C  CD    . PRO B 1  217 ? -14.457 39.027 29.563  1.00 44.39 ? 214 PRO B CD    1 
ATOM   3764 N  N     . GLN B 1  218 ? -17.770 40.055 28.519  1.00 45.90 ? 215 GLN B N     1 
ATOM   3765 C  CA    . GLN B 1  218 ? -19.231 40.050 28.495  1.00 46.65 ? 215 GLN B CA    1 
ATOM   3766 C  C     . GLN B 1  218 ? -19.783 41.457 28.698  1.00 46.82 ? 215 GLN B C     1 
ATOM   3767 O  O     . GLN B 1  218 ? -19.646 42.032 29.775  1.00 47.05 ? 215 GLN B O     1 
ATOM   3768 C  CB    . GLN B 1  218 ? -19.775 39.060 29.533  1.00 46.46 ? 215 GLN B CB    1 
ATOM   3769 C  CG    . GLN B 1  218 ? -19.335 37.618 29.240  1.00 47.60 ? 215 GLN B CG    1 
ATOM   3770 C  CD    . GLN B 1  218 ? -19.796 36.597 30.282  1.00 49.13 ? 215 GLN B CD    1 
ATOM   3771 O  OE1   . GLN B 1  218 ? -19.446 36.690 31.463  1.00 50.38 ? 215 GLN B OE1   1 
ATOM   3772 N  NE2   . GLN B 1  218 ? -20.557 35.602 29.837  1.00 48.53 ? 215 GLN B NE2   1 
ATOM   3773 N  N     . SER B 1  219 ? -20.408 42.009 27.657  1.00 46.84 ? 216 SER B N     1 
ATOM   3774 C  CA    . SER B 1  219 ? -20.903 43.392 27.706  1.00 46.75 ? 216 SER B CA    1 
ATOM   3775 C  C     . SER B 1  219 ? -22.428 43.555 27.766  1.00 46.20 ? 216 SER B C     1 
ATOM   3776 O  O     . SER B 1  219 ? -22.924 44.444 28.463  1.00 46.48 ? 216 SER B O     1 
ATOM   3777 C  CB    . SER B 1  219 ? -20.351 44.190 26.527  1.00 46.76 ? 216 SER B CB    1 
ATOM   3778 O  OG    . SER B 1  219 ? -18.942 44.301 26.645  1.00 48.05 ? 216 SER B OG    1 
ATOM   3779 N  N     . SER B 1  220 ? -23.162 42.732 27.019  1.00 44.80 ? 217 SER B N     1 
ATOM   3780 C  CA    . SER B 1  220 ? -24.614 42.863 26.944  1.00 43.82 ? 217 SER B CA    1 
ATOM   3781 C  C     . SER B 1  220 ? -25.306 41.571 27.397  1.00 42.52 ? 217 SER B C     1 
ATOM   3782 O  O     . SER B 1  220 ? -25.039 40.500 26.853  1.00 42.08 ? 217 SER B O     1 
ATOM   3783 C  CB    . SER B 1  220 ? -25.037 43.243 25.521  1.00 43.83 ? 217 SER B CB    1 
ATOM   3784 O  OG    . SER B 1  220 ? -26.447 43.159 25.367  1.00 44.05 ? 217 SER B OG    1 
ATOM   3785 N  N     . GLY B 1  221 ? -26.185 41.681 28.393  1.00 41.31 ? 218 GLY B N     1 
ATOM   3786 C  CA    . GLY B 1  221 ? -26.900 40.509 28.947  1.00 39.84 ? 218 GLY B CA    1 
ATOM   3787 C  C     . GLY B 1  221 ? -27.854 39.851 27.956  1.00 38.68 ? 218 GLY B C     1 
ATOM   3788 O  O     . GLY B 1  221 ? -27.945 38.617 27.867  1.00 38.45 ? 218 GLY B O     1 
ATOM   3789 N  N     . LYS B 1  222 ? -28.568 40.691 27.220  1.00 38.15 ? 219 LYS B N     1 
ATOM   3790 C  CA    . LYS B 1  222 ? -29.418 40.293 26.095  1.00 37.83 ? 219 LYS B CA    1 
ATOM   3791 C  C     . LYS B 1  222 ? -28.633 39.389 25.147  1.00 36.57 ? 219 LYS B C     1 
ATOM   3792 O  O     . LYS B 1  222 ? -29.101 38.308 24.785  1.00 35.97 ? 219 LYS B O     1 
ATOM   3793 C  CB    . LYS B 1  222 ? -29.880 41.557 25.367  1.00 38.81 ? 219 LYS B CB    1 
ATOM   3794 C  CG    . LYS B 1  222 ? -30.879 41.377 24.243  1.00 42.17 ? 219 LYS B CG    1 
ATOM   3795 C  CD    . LYS B 1  222 ? -31.430 42.764 23.855  1.00 48.14 ? 219 LYS B CD    1 
ATOM   3796 C  CE    . LYS B 1  222 ? -32.350 42.713 22.661  1.00 49.70 ? 219 LYS B CE    1 
ATOM   3797 N  NZ    . LYS B 1  222 ? -33.439 41.717 22.891  1.00 53.35 ? 219 LYS B NZ    1 
ATOM   3798 N  N     . VAL B 1  223 ? -27.417 39.818 24.792  1.00 34.83 ? 220 VAL B N     1 
ATOM   3799 C  CA    . VAL B 1  223 ? -26.535 39.013 23.956  1.00 33.34 ? 220 VAL B CA    1 
ATOM   3800 C  C     . VAL B 1  223 ? -26.077 37.734 24.659  1.00 32.80 ? 220 VAL B C     1 
ATOM   3801 O  O     . VAL B 1  223 ? -26.128 36.649 24.065  1.00 31.88 ? 220 VAL B O     1 
ATOM   3802 C  CB    . VAL B 1  223 ? -25.322 39.825 23.415  1.00 33.27 ? 220 VAL B CB    1 
ATOM   3803 C  CG1   . VAL B 1  223 ? -24.378 38.929 22.613  1.00 32.15 ? 220 VAL B CG1   1 
ATOM   3804 C  CG2   . VAL B 1  223 ? -25.816 40.989 22.567  1.00 32.01 ? 220 VAL B CG2   1 
ATOM   3805 N  N     . GLU B 1  224 ? -25.625 37.849 25.911  1.00 32.41 ? 221 GLU B N     1 
ATOM   3806 C  CA    . GLU B 1  224 ? -25.156 36.650 26.628  1.00 32.10 ? 221 GLU B CA    1 
ATOM   3807 C  C     . GLU B 1  224 ? -26.273 35.603 26.800  1.00 31.45 ? 221 GLU B C     1 
ATOM   3808 O  O     . GLU B 1  224 ? -26.016 34.405 26.702  1.00 31.36 ? 221 GLU B O     1 
ATOM   3809 C  CB    . GLU B 1  224 ? -24.477 36.994 27.970  1.00 32.42 ? 221 GLU B CB    1 
ATOM   3810 C  CG    . GLU B 1  224 ? -23.202 37.871 27.865  1.00 33.07 ? 221 GLU B CG    1 
ATOM   3811 C  CD    . GLU B 1  224 ? -22.058 37.249 27.025  1.00 34.87 ? 221 GLU B CD    1 
ATOM   3812 O  OE1   . GLU B 1  224 ? -21.965 36.014 26.894  1.00 31.29 ? 221 GLU B OE1   1 
ATOM   3813 O  OE2   . GLU B 1  224 ? -21.223 38.020 26.494  1.00 35.84 ? 221 GLU B OE2   1 
ATOM   3814 N  N     . ARG B 1  225 ? -27.505 36.051 27.017  1.00 31.46 ? 222 ARG B N     1 
ATOM   3815 C  CA    . ARG B 1  225 ? -28.646 35.132 27.083  1.00 32.67 ? 222 ARG B CA    1 
ATOM   3816 C  C     . ARG B 1  225 ? -28.766 34.365 25.767  1.00 31.50 ? 222 ARG B C     1 
ATOM   3817 O  O     . ARG B 1  225 ? -29.022 33.159 25.774  1.00 30.77 ? 222 ARG B O     1 
ATOM   3818 C  CB    . ARG B 1  225 ? -29.968 35.872 27.374  1.00 32.99 ? 222 ARG B CB    1 
ATOM   3819 C  CG    . ARG B 1  225 ? -30.501 35.785 28.814  1.00 39.04 ? 222 ARG B CG    1 
ATOM   3820 C  CD    . ARG B 1  225 ? -31.813 36.648 29.026  1.00 46.16 ? 222 ARG B CD    1 
ATOM   3821 N  NE    . ARG B 1  225 ? -31.640 38.064 28.638  1.00 50.45 ? 222 ARG B NE    1 
ATOM   3822 C  CZ    . ARG B 1  225 ? -31.751 39.109 29.468  1.00 54.48 ? 222 ARG B CZ    1 
ATOM   3823 N  NH1   . ARG B 1  225 ? -32.077 38.923 30.749  1.00 56.25 ? 222 ARG B NH1   1 
ATOM   3824 N  NH2   . ARG B 1  225 ? -31.561 40.354 29.016  1.00 53.54 ? 222 ARG B NH2   1 
ATOM   3825 N  N     . LYS B 1  226 ? -28.580 35.072 24.642  1.00 31.04 ? 223 LYS B N     1 
ATOM   3826 C  CA    . LYS B 1  226 ? -28.617 34.420 23.328  1.00 30.53 ? 223 LYS B CA    1 
ATOM   3827 C  C     . LYS B 1  226 ? -27.504 33.396 23.221  1.00 30.41 ? 223 LYS B C     1 
ATOM   3828 O  O     . LYS B 1  226 ? -27.730 32.307 22.714  1.00 30.00 ? 223 LYS B O     1 
ATOM   3829 C  CB    . LYS B 1  226 ? -28.559 35.416 22.153  1.00 30.30 ? 223 LYS B CB    1 
ATOM   3830 C  CG    . LYS B 1  226 ? -29.868 36.170 21.859  1.00 29.53 ? 223 LYS B CG    1 
ATOM   3831 C  CD    . LYS B 1  226 ? -31.044 35.267 21.444  1.00 27.62 ? 223 LYS B CD    1 
ATOM   3832 C  CE    . LYS B 1  226 ? -32.351 36.088 21.388  1.00 27.29 ? 223 LYS B CE    1 
ATOM   3833 N  NZ    . LYS B 1  226 ? -33.575 35.274 20.999  1.00 28.16 ? 223 LYS B NZ    1 
ATOM   3834 N  N     . HIS B 1  227 ? -26.305 33.738 23.712  1.00 30.77 ? 224 HIS B N     1 
ATOM   3835 C  CA    . HIS B 1  227 ? -25.191 32.787 23.679  1.00 30.90 ? 224 HIS B CA    1 
ATOM   3836 C  C     . HIS B 1  227 ? -25.544 31.487 24.421  1.00 31.07 ? 224 HIS B C     1 
ATOM   3837 O  O     . HIS B 1  227 ? -25.295 30.391 23.908  1.00 31.20 ? 224 HIS B O     1 
ATOM   3838 C  CB    . HIS B 1  227 ? -23.908 33.390 24.255  1.00 31.08 ? 224 HIS B CB    1 
ATOM   3839 C  CG    . HIS B 1  227 ? -23.308 34.478 23.413  1.00 32.03 ? 224 HIS B CG    1 
ATOM   3840 N  ND1   . HIS B 1  227 ? -22.191 35.179 23.804  1.00 32.05 ? 224 HIS B ND1   1 
ATOM   3841 C  CD2   . HIS B 1  227 ? -23.674 34.993 22.211  1.00 32.09 ? 224 HIS B CD2   1 
ATOM   3842 C  CE1   . HIS B 1  227 ? -21.886 36.076 22.879  1.00 32.63 ? 224 HIS B CE1   1 
ATOM   3843 N  NE2   . HIS B 1  227 ? -22.775 35.988 21.903  1.00 31.02 ? 224 HIS B NE2   1 
ATOM   3844 N  N     . SER B 1  228 ? -26.126 31.592 25.614  1.00 31.16 ? 225 SER B N     1 
ATOM   3845 C  CA    . SER B 1  228 ? -26.464 30.357 26.347  1.00 32.04 ? 225 SER B CA    1 
ATOM   3846 C  C     . SER B 1  228 ? -27.663 29.633 25.736  1.00 32.02 ? 225 SER B C     1 
ATOM   3847 O  O     . SER B 1  228 ? -27.723 28.405 25.790  1.00 31.42 ? 225 SER B O     1 
ATOM   3848 C  CB    . SER B 1  228 ? -26.621 30.581 27.861  1.00 32.42 ? 225 SER B CB    1 
ATOM   3849 O  OG    . SER B 1  228 ? -27.613 31.537 28.131  1.00 34.87 ? 225 SER B OG    1 
ATOM   3850 N  N     . ASP B 1  229 ? -28.594 30.382 25.131  1.00 32.09 ? 226 ASP B N     1 
ATOM   3851 C  CA    . ASP B 1  229 ? -29.676 29.762 24.360  1.00 32.92 ? 226 ASP B CA    1 
ATOM   3852 C  C     . ASP B 1  229 ? -29.115 28.891 23.235  1.00 33.04 ? 226 ASP B C     1 
ATOM   3853 O  O     . ASP B 1  229 ? -29.549 27.742 23.052  1.00 32.26 ? 226 ASP B O     1 
ATOM   3854 C  CB    . ASP B 1  229 ? -30.620 30.805 23.762  1.00 32.99 ? 226 ASP B CB    1 
ATOM   3855 C  CG    . ASP B 1  229 ? -31.462 31.526 24.809  1.00 35.21 ? 226 ASP B CG    1 
ATOM   3856 O  OD1   . ASP B 1  229 ? -31.494 31.087 25.983  1.00 35.45 ? 226 ASP B OD1   1 
ATOM   3857 O  OD2   . ASP B 1  229 ? -32.105 32.551 24.443  1.00 35.91 ? 226 ASP B OD2   1 
ATOM   3858 N  N     . ILE B 1  230 ? -28.137 29.438 22.505  1.00 33.55 ? 227 ILE B N     1 
ATOM   3859 C  CA    . ILE B 1  230 ? -27.469 28.711 21.413  1.00 34.08 ? 227 ILE B CA    1 
ATOM   3860 C  C     . ILE B 1  230 ? -26.783 27.440 21.918  1.00 34.05 ? 227 ILE B C     1 
ATOM   3861 O  O     . ILE B 1  230 ? -26.984 26.354 21.370  1.00 33.76 ? 227 ILE B O     1 
ATOM   3862 C  CB    . ILE B 1  230 ? -26.424 29.601 20.684  1.00 34.06 ? 227 ILE B CB    1 
ATOM   3863 C  CG1   . ILE B 1  230 ? -27.118 30.735 19.931  1.00 34.23 ? 227 ILE B CG1   1 
ATOM   3864 C  CG2   . ILE B 1  230 ? -25.592 28.770 19.723  1.00 34.45 ? 227 ILE B CG2   1 
ATOM   3865 C  CD1   . ILE B 1  230 ? -26.230 31.939 19.645  1.00 33.68 ? 227 ILE B CD1   1 
ATOM   3866 N  N     . LYS B 1  231 ? -25.964 27.585 22.958  1.00 34.72 ? 228 LYS B N     1 
ATOM   3867 C  CA    . LYS B 1  231 ? -25.257 26.443 23.545  1.00 35.08 ? 228 LYS B CA    1 
ATOM   3868 C  C     . LYS B 1  231 ? -26.237 25.372 24.022  1.00 35.56 ? 228 LYS B C     1 
ATOM   3869 O  O     . LYS B 1  231 ? -26.024 24.162 23.806  1.00 35.07 ? 228 LYS B O     1 
ATOM   3870 C  CB    . LYS B 1  231 ? -24.360 26.909 24.685  1.00 35.48 ? 228 LYS B CB    1 
ATOM   3871 C  CG    . LYS B 1  231 ? -23.206 27.787 24.233  1.00 35.43 ? 228 LYS B CG    1 
ATOM   3872 C  CD    . LYS B 1  231 ? -22.458 28.383 25.405  1.00 36.30 ? 228 LYS B CD    1 
ATOM   3873 C  CE    . LYS B 1  231 ? -21.350 29.311 24.924  1.00 37.46 ? 228 LYS B CE    1 
ATOM   3874 N  NZ    . LYS B 1  231 ? -20.576 29.946 26.033  1.00 37.21 ? 228 LYS B NZ    1 
ATOM   3875 N  N     . ARG B 1  232 ? -27.339 25.817 24.620  1.00 36.11 ? 229 ARG B N     1 
ATOM   3876 C  CA    . ARG B 1  232 ? -28.342 24.879 25.109  1.00 37.04 ? 229 ARG B CA    1 
ATOM   3877 C  C     . ARG B 1  232 ? -29.094 24.185 23.969  1.00 37.20 ? 229 ARG B C     1 
ATOM   3878 O  O     . ARG B 1  232 ? -29.285 22.972 23.997  1.00 36.94 ? 229 ARG B O     1 
ATOM   3879 C  CB    . ARG B 1  232 ? -29.310 25.550 26.087  1.00 37.00 ? 229 ARG B CB    1 
ATOM   3880 C  CG    . ARG B 1  232 ? -30.304 24.563 26.716  1.00 37.37 ? 229 ARG B CG    1 
ATOM   3881 C  CD    . ARG B 1  232 ? -31.219 25.226 27.757  1.00 38.40 ? 229 ARG B CD    1 
ATOM   3882 N  NE    . ARG B 1  232 ? -31.960 26.354 27.199  1.00 39.95 ? 229 ARG B NE    1 
ATOM   3883 C  CZ    . ARG B 1  232 ? -31.632 27.634 27.374  1.00 39.07 ? 229 ARG B CZ    1 
ATOM   3884 N  NH1   . ARG B 1  232 ? -30.565 27.968 28.090  1.00 39.30 ? 229 ARG B NH1   1 
ATOM   3885 N  NH2   . ARG B 1  232 ? -32.365 28.582 26.815  1.00 38.50 ? 229 ARG B NH2   1 
ATOM   3886 N  N     . LEU B 1  233 ? -29.503 24.956 22.967  1.00 37.67 ? 230 LEU B N     1 
ATOM   3887 C  CA    . LEU B 1  233 ? -30.208 24.394 21.816  1.00 38.21 ? 230 LEU B CA    1 
ATOM   3888 C  C     . LEU B 1  233 ? -29.334 23.377 21.057  1.00 38.14 ? 230 LEU B C     1 
ATOM   3889 O  O     . LEU B 1  233 ? -29.806 22.288 20.682  1.00 37.40 ? 230 LEU B O     1 
ATOM   3890 C  CB    . LEU B 1  233 ? -30.670 25.522 20.888  1.00 38.40 ? 230 LEU B CB    1 
ATOM   3891 C  CG    . LEU B 1  233 ? -32.136 25.952 20.792  1.00 40.48 ? 230 LEU B CG    1 
ATOM   3892 C  CD1   . LEU B 1  233 ? -32.819 26.138 22.127  1.00 42.46 ? 230 LEU B CD1   1 
ATOM   3893 C  CD2   . LEU B 1  233 ? -32.229 27.244 19.982  1.00 43.14 ? 230 LEU B CD2   1 
ATOM   3894 N  N     . LEU B 1  234 ? -28.065 23.728 20.841  1.00 38.20 ? 231 LEU B N     1 
ATOM   3895 C  CA    . LEU B 1  234 ? -27.116 22.795 20.222  1.00 38.86 ? 231 LEU B CA    1 
ATOM   3896 C  C     . LEU B 1  234 ? -27.000 21.492 21.016  1.00 39.02 ? 231 LEU B C     1 
ATOM   3897 O  O     . LEU B 1  234 ? -27.105 20.401 20.437  1.00 39.10 ? 231 LEU B O     1 
ATOM   3898 C  CB    . LEU B 1  234 ? -25.732 23.439 20.011  1.00 39.11 ? 231 LEU B CB    1 
ATOM   3899 C  CG    . LEU B 1  234 ? -25.616 24.573 18.962  1.00 39.76 ? 231 LEU B CG    1 
ATOM   3900 C  CD1   . LEU B 1  234 ? -24.282 25.295 19.084  1.00 39.58 ? 231 LEU B CD1   1 
ATOM   3901 C  CD2   . LEU B 1  234 ? -25.837 24.080 17.522  1.00 38.12 ? 231 LEU B CD2   1 
ATOM   3902 N  N     . THR B 1  235 ? -26.798 21.602 22.331  1.00 39.03 ? 232 THR B N     1 
ATOM   3903 C  CA    . THR B 1  235 ? -26.699 20.420 23.198  1.00 39.27 ? 232 THR B CA    1 
ATOM   3904 C  C     . THR B 1  235 ? -27.944 19.529 23.044  1.00 39.54 ? 232 THR B C     1 
ATOM   3905 O  O     . THR B 1  235 ? -27.825 18.332 22.799  1.00 39.65 ? 232 THR B O     1 
ATOM   3906 C  CB    . THR B 1  235 ? -26.444 20.798 24.686  1.00 39.30 ? 232 THR B CB    1 
ATOM   3907 O  OG1   . THR B 1  235 ? -25.278 21.630 24.788  1.00 39.35 ? 232 THR B OG1   1 
ATOM   3908 C  CG2   . THR B 1  235 ? -26.222 19.550 25.533  1.00 38.89 ? 232 THR B CG2   1 
ATOM   3909 N  N     . LYS B 1  236 ? -29.132 20.117 23.127  1.00 39.81 ? 233 LYS B N     1 
ATOM   3910 C  CA    . LYS B 1  236 ? -30.359 19.338 22.970  1.00 40.72 ? 233 LYS B CA    1 
ATOM   3911 C  C     . LYS B 1  236 ? -30.450 18.639 21.601  1.00 41.94 ? 233 LYS B C     1 
ATOM   3912 O  O     . LYS B 1  236 ? -30.794 17.447 21.523  1.00 42.25 ? 233 LYS B O     1 
ATOM   3913 C  CB    . LYS B 1  236 ? -31.598 20.209 23.207  1.00 40.62 ? 233 LYS B CB    1 
ATOM   3914 C  CG    . LYS B 1  236 ? -31.751 20.727 24.637  1.00 40.11 ? 233 LYS B CG    1 
ATOM   3915 C  CD    . LYS B 1  236 ? -32.977 21.614 24.756  1.00 40.25 ? 233 LYS B CD    1 
ATOM   3916 C  CE    . LYS B 1  236 ? -33.297 21.940 26.212  1.00 40.81 ? 233 LYS B CE    1 
ATOM   3917 N  NZ    . LYS B 1  236 ? -33.608 20.717 27.006  1.00 38.98 ? 233 LYS B NZ    1 
ATOM   3918 N  N     . LEU B 1  237 ? -30.134 19.370 20.531  1.00 42.40 ? 234 LEU B N     1 
ATOM   3919 C  CA    . LEU B 1  237 ? -30.280 18.843 19.169  1.00 43.48 ? 234 LEU B CA    1 
ATOM   3920 C  C     . LEU B 1  237 ? -29.209 17.811 18.799  1.00 43.91 ? 234 LEU B C     1 
ATOM   3921 O  O     . LEU B 1  237 ? -29.467 16.911 18.006  1.00 44.02 ? 234 LEU B O     1 
ATOM   3922 C  CB    . LEU B 1  237 ? -30.326 19.980 18.131  1.00 43.37 ? 234 LEU B CB    1 
ATOM   3923 C  CG    . LEU B 1  237 ? -31.642 20.782 18.088  1.00 44.16 ? 234 LEU B CG    1 
ATOM   3924 C  CD1   . LEU B 1  237 ? -31.535 21.990 17.189  1.00 44.60 ? 234 LEU B CD1   1 
ATOM   3925 C  CD2   . LEU B 1  237 ? -32.809 19.925 17.652  1.00 45.48 ? 234 LEU B CD2   1 
ATOM   3926 N  N     . LEU B 1  238 ? -28.023 17.933 19.386  1.00 44.51 ? 235 LEU B N     1 
ATOM   3927 C  CA    . LEU B 1  238 ? -26.898 17.103 18.971  1.00 45.42 ? 235 LEU B CA    1 
ATOM   3928 C  C     . LEU B 1  238 ? -26.793 15.750 19.678  1.00 46.17 ? 235 LEU B C     1 
ATOM   3929 O  O     . LEU B 1  238 ? -25.807 15.027 19.478  1.00 46.21 ? 235 LEU B O     1 
ATOM   3930 C  CB    . LEU B 1  238 ? -25.590 17.876 19.102  1.00 45.26 ? 235 LEU B CB    1 
ATOM   3931 C  CG    . LEU B 1  238 ? -25.474 19.092 18.178  1.00 45.85 ? 235 LEU B CG    1 
ATOM   3932 C  CD1   . LEU B 1  238 ? -24.107 19.754 18.355  1.00 46.29 ? 235 LEU B CD1   1 
ATOM   3933 C  CD2   . LEU B 1  238 ? -25.702 18.695 16.729  1.00 46.50 ? 235 LEU B CD2   1 
ATOM   3934 N  N     . VAL B 1  239 ? -27.798 15.416 20.496  1.00 46.79 ? 236 VAL B N     1 
ATOM   3935 C  CA    . VAL B 1  239 ? -27.827 14.140 21.222  1.00 47.66 ? 236 VAL B CA    1 
ATOM   3936 C  C     . VAL B 1  239 ? -27.794 12.998 20.214  1.00 48.04 ? 236 VAL B C     1 
ATOM   3937 O  O     . VAL B 1  239 ? -28.665 12.899 19.345  1.00 48.47 ? 236 VAL B O     1 
ATOM   3938 C  CB    . VAL B 1  239 ? -29.070 14.018 22.169  1.00 47.70 ? 236 VAL B CB    1 
ATOM   3939 C  CG1   . VAL B 1  239 ? -29.188 12.610 22.748  1.00 48.22 ? 236 VAL B CG1   1 
ATOM   3940 C  CG2   . VAL B 1  239 ? -28.982 15.030 23.307  1.00 47.64 ? 236 VAL B CG2   1 
ATOM   3941 N  N     . GLY B 1  240 ? -26.764 12.164 20.318  1.00 48.51 ? 237 GLY B N     1 
ATOM   3942 C  CA    . GLY B 1  240 ? -26.587 11.024 19.419  1.00 48.85 ? 237 GLY B CA    1 
ATOM   3943 C  C     . GLY B 1  240 ? -26.096 11.368 18.018  1.00 49.05 ? 237 GLY B C     1 
ATOM   3944 O  O     . GLY B 1  240 ? -25.913 10.472 17.187  1.00 49.69 ? 237 GLY B O     1 
ATOM   3945 N  N     . ARG B 1  241 ? -25.884 12.652 17.742  1.00 48.53 ? 238 ARG B N     1 
ATOM   3946 C  CA    . ARG B 1  241 ? -25.417 13.081 16.422  1.00 48.03 ? 238 ARG B CA    1 
ATOM   3947 C  C     . ARG B 1  241 ? -24.546 14.339 16.510  1.00 47.78 ? 238 ARG B C     1 
ATOM   3948 O  O     . ARG B 1  241 ? -24.904 15.380 15.949  1.00 48.31 ? 238 ARG B O     1 
ATOM   3949 C  CB    . ARG B 1  241 ? -26.604 13.290 15.475  1.00 47.98 ? 238 ARG B CB    1 
ATOM   3950 C  CG    . ARG B 1  241 ? -27.702 14.168 16.038  1.00 48.27 ? 238 ARG B CG    1 
ATOM   3951 C  CD    . ARG B 1  241 ? -28.807 14.442 15.038  1.00 48.34 ? 238 ARG B CD    1 
ATOM   3952 N  NE    . ARG B 1  241 ? -29.784 15.357 15.618  1.00 48.39 ? 238 ARG B NE    1 
ATOM   3953 C  CZ    . ARG B 1  241 ? -30.919 15.728 15.037  1.00 49.72 ? 238 ARG B CZ    1 
ATOM   3954 N  NH1   . ARG B 1  241 ? -31.239 15.266 13.834  1.00 50.36 ? 238 ARG B NH1   1 
ATOM   3955 N  NH2   . ARG B 1  241 ? -31.735 16.570 15.662  1.00 49.02 ? 238 ARG B NH2   1 
ATOM   3956 N  N     . PRO B 1  242 ? -23.396 14.240 17.208  1.00 47.22 ? 239 PRO B N     1 
ATOM   3957 C  CA    . PRO B 1  242 ? -22.554 15.397 17.513  1.00 46.77 ? 239 PRO B CA    1 
ATOM   3958 C  C     . PRO B 1  242 ? -21.892 16.040 16.293  1.00 46.44 ? 239 PRO B C     1 
ATOM   3959 O  O     . PRO B 1  242 ? -21.513 17.205 16.355  1.00 46.53 ? 239 PRO B O     1 
ATOM   3960 C  CB    . PRO B 1  242 ? -21.477 14.818 18.446  1.00 46.84 ? 239 PRO B CB    1 
ATOM   3961 C  CG    . PRO B 1  242 ? -21.423 13.378 18.143  1.00 46.86 ? 239 PRO B CG    1 
ATOM   3962 C  CD    . PRO B 1  242 ? -22.827 12.992 17.759  1.00 47.43 ? 239 PRO B CD    1 
ATOM   3963 N  N     . THR B 1  243 ? -21.743 15.293 15.203  1.00 45.77 ? 240 THR B N     1 
ATOM   3964 C  CA    . THR B 1  243 ? -21.102 15.832 14.002  1.00 45.19 ? 240 THR B CA    1 
ATOM   3965 C  C     . THR B 1  243 ? -22.111 16.426 13.018  1.00 44.57 ? 240 THR B C     1 
ATOM   3966 O  O     . THR B 1  243 ? -21.754 16.754 11.885  1.00 44.88 ? 240 THR B O     1 
ATOM   3967 C  CB    . THR B 1  243 ? -20.230 14.763 13.272  1.00 45.45 ? 240 THR B CB    1 
ATOM   3968 O  OG1   . THR B 1  243 ? -21.073 13.735 12.733  1.00 45.88 ? 240 THR B OG1   1 
ATOM   3969 C  CG2   . THR B 1  243 ? -19.184 14.152 14.222  1.00 44.72 ? 240 THR B CG2   1 
ATOM   3970 N  N     . LYS B 1  244 ? -23.361 16.577 13.449  1.00 43.55 ? 241 LYS B N     1 
ATOM   3971 C  CA    . LYS B 1  244 ? -24.439 16.976 12.536  1.00 42.98 ? 241 LYS B CA    1 
ATOM   3972 C  C     . LYS B 1  244 ? -24.920 18.423 12.697  1.00 41.82 ? 241 LYS B C     1 
ATOM   3973 O  O     . LYS B 1  244 ? -25.975 18.802 12.172  1.00 41.65 ? 241 LYS B O     1 
ATOM   3974 C  CB    . LYS B 1  244 ? -25.622 16.004 12.652  1.00 43.42 ? 241 LYS B CB    1 
ATOM   3975 C  CG    . LYS B 1  244 ? -25.250 14.536 12.347  1.00 45.86 ? 241 LYS B CG    1 
ATOM   3976 C  CD    . LYS B 1  244 ? -24.959 14.334 10.854  1.00 48.73 ? 241 LYS B CD    1 
ATOM   3977 C  CE    . LYS B 1  244 ? -24.518 12.902 10.556  1.00 50.26 ? 241 LYS B CE    1 
ATOM   3978 N  NZ    . LYS B 1  244 ? -24.146 12.762 9.116   1.00 52.53 ? 241 LYS B NZ    1 
ATOM   3979 N  N     . TRP B 1  245 ? -24.143 19.239 13.398  1.00 40.23 ? 242 TRP B N     1 
ATOM   3980 C  CA    . TRP B 1  245 ? -24.612 20.581 13.714  1.00 39.21 ? 242 TRP B CA    1 
ATOM   3981 C  C     . TRP B 1  245 ? -24.642 21.539 12.535  1.00 39.06 ? 242 TRP B C     1 
ATOM   3982 O  O     . TRP B 1  245 ? -25.476 22.455 12.509  1.00 38.64 ? 242 TRP B O     1 
ATOM   3983 C  CB    . TRP B 1  245 ? -23.877 21.177 14.905  1.00 38.39 ? 242 TRP B CB    1 
ATOM   3984 C  CG    . TRP B 1  245 ? -22.398 21.277 14.782  1.00 37.32 ? 242 TRP B CG    1 
ATOM   3985 C  CD1   . TRP B 1  245 ? -21.476 20.383 15.251  1.00 36.26 ? 242 TRP B CD1   1 
ATOM   3986 C  CD2   . TRP B 1  245 ? -21.653 22.361 14.207  1.00 35.55 ? 242 TRP B CD2   1 
ATOM   3987 N  NE1   . TRP B 1  245 ? -20.211 20.839 14.996  1.00 37.18 ? 242 TRP B NE1   1 
ATOM   3988 C  CE2   . TRP B 1  245 ? -20.287 22.046 14.348  1.00 35.28 ? 242 TRP B CE2   1 
ATOM   3989 C  CE3   . TRP B 1  245 ? -22.011 23.567 13.579  1.00 34.99 ? 242 TRP B CE3   1 
ATOM   3990 C  CZ2   . TRP B 1  245 ? -19.272 22.887 13.885  1.00 35.02 ? 242 TRP B CZ2   1 
ATOM   3991 C  CZ3   . TRP B 1  245 ? -21.005 24.397 13.113  1.00 33.00 ? 242 TRP B CZ3   1 
ATOM   3992 C  CH2   . TRP B 1  245 ? -19.647 24.053 13.273  1.00 33.75 ? 242 TRP B CH2   1 
ATOM   3993 N  N     . TYR B 1  246 ? -23.764 21.310 11.555  1.00 39.17 ? 243 TYR B N     1 
ATOM   3994 C  CA    . TYR B 1  246 ? -23.742 22.131 10.341  1.00 39.33 ? 243 TYR B CA    1 
ATOM   3995 C  C     . TYR B 1  246 ? -25.143 22.199 9.732   1.00 39.20 ? 243 TYR B C     1 
ATOM   3996 O  O     . TYR B 1  246 ? -25.679 23.291 9.513   1.00 38.78 ? 243 TYR B O     1 
ATOM   3997 C  CB    . TYR B 1  246 ? -22.722 21.611 9.317   1.00 39.63 ? 243 TYR B CB    1 
ATOM   3998 C  CG    . TYR B 1  246 ? -22.735 22.397 8.019   1.00 40.71 ? 243 TYR B CG    1 
ATOM   3999 C  CD1   . TYR B 1  246 ? -21.915 23.517 7.847   1.00 41.68 ? 243 TYR B CD1   1 
ATOM   4000 C  CD2   . TYR B 1  246 ? -23.586 22.034 6.971   1.00 41.66 ? 243 TYR B CD2   1 
ATOM   4001 C  CE1   . TYR B 1  246 ? -21.933 24.259 6.650   1.00 43.24 ? 243 TYR B CE1   1 
ATOM   4002 C  CE2   . TYR B 1  246 ? -23.614 22.764 5.776   1.00 43.49 ? 243 TYR B CE2   1 
ATOM   4003 C  CZ    . TYR B 1  246 ? -22.787 23.872 5.624   1.00 44.23 ? 243 TYR B CZ    1 
ATOM   4004 O  OH    . TYR B 1  246 ? -22.824 24.584 4.449   1.00 45.25 ? 243 TYR B OH    1 
ATOM   4005 N  N     . ASP B 1  247 ? -25.742 21.029 9.500   1.00 39.16 ? 244 ASP B N     1 
ATOM   4006 C  CA    . ASP B 1  247 ? -27.090 20.943 8.932   1.00 39.39 ? 244 ASP B CA    1 
ATOM   4007 C  C     . ASP B 1  247 ? -28.177 21.490 9.844   1.00 39.00 ? 244 ASP B C     1 
ATOM   4008 O  O     . ASP B 1  247 ? -29.267 21.809 9.368   1.00 38.94 ? 244 ASP B O     1 
ATOM   4009 C  CB    . ASP B 1  247 ? -27.436 19.498 8.573   1.00 40.00 ? 244 ASP B CB    1 
ATOM   4010 C  CG    . ASP B 1  247 ? -26.667 18.992 7.363   1.00 42.32 ? 244 ASP B CG    1 
ATOM   4011 O  OD1   . ASP B 1  247 ? -26.320 19.799 6.469   1.00 44.84 ? 244 ASP B OD1   1 
ATOM   4012 O  OD2   . ASP B 1  247 ? -26.428 17.774 7.303   1.00 46.03 ? 244 ASP B OD2   1 
ATOM   4013 N  N     . LEU B 1  248 ? -27.894 21.576 11.146  1.00 38.39 ? 245 LEU B N     1 
ATOM   4014 C  CA    . LEU B 1  248 ? -28.898 22.020 12.118  1.00 37.88 ? 245 LEU B CA    1 
ATOM   4015 C  C     . LEU B 1  248 ? -28.883 23.517 12.392  1.00 37.39 ? 245 LEU B C     1 
ATOM   4016 O  O     . LEU B 1  248 ? -29.811 24.038 13.009  1.00 37.39 ? 245 LEU B O     1 
ATOM   4017 C  CB    . LEU B 1  248 ? -28.803 21.218 13.426  1.00 38.05 ? 245 LEU B CB    1 
ATOM   4018 C  CG    . LEU B 1  248 ? -29.317 19.771 13.313  1.00 39.53 ? 245 LEU B CG    1 
ATOM   4019 C  CD1   . LEU B 1  248 ? -28.768 18.886 14.439  1.00 40.69 ? 245 LEU B CD1   1 
ATOM   4020 C  CD2   . LEU B 1  248 ? -30.855 19.705 13.248  1.00 39.75 ? 245 LEU B CD2   1 
ATOM   4021 N  N     . LEU B 1  249 ? -27.858 24.222 11.911  1.00 36.88 ? 246 LEU B N     1 
ATOM   4022 C  CA    . LEU B 1  249 ? -27.778 25.684 12.131  1.00 36.07 ? 246 LEU B CA    1 
ATOM   4023 C  C     . LEU B 1  249 ? -29.035 26.465 11.752  1.00 35.20 ? 246 LEU B C     1 
ATOM   4024 O  O     . LEU B 1  249 ? -29.439 27.341 12.503  1.00 34.87 ? 246 LEU B O     1 
ATOM   4025 C  CB    . LEU B 1  249 ? -26.528 26.307 11.483  1.00 35.78 ? 246 LEU B CB    1 
ATOM   4026 C  CG    . LEU B 1  249 ? -25.229 25.987 12.218  1.00 36.18 ? 246 LEU B CG    1 
ATOM   4027 C  CD1   . LEU B 1  249 ? -24.052 26.609 11.505  1.00 38.25 ? 246 LEU B CD1   1 
ATOM   4028 C  CD2   . LEU B 1  249 ? -25.250 26.431 13.683  1.00 36.67 ? 246 LEU B CD2   1 
ATOM   4029 N  N     . PRO B 1  250 ? -29.655 26.159 10.588  1.00 35.29 ? 247 PRO B N     1 
ATOM   4030 C  CA    . PRO B 1  250 ? -30.880 26.888 10.229  1.00 35.19 ? 247 PRO B CA    1 
ATOM   4031 C  C     . PRO B 1  250 ? -31.994 26.750 11.256  1.00 35.50 ? 247 PRO B C     1 
ATOM   4032 O  O     . PRO B 1  250 ? -32.665 27.741 11.569  1.00 35.96 ? 247 PRO B O     1 
ATOM   4033 C  CB    . PRO B 1  250 ? -31.309 26.239 8.907   1.00 35.15 ? 247 PRO B CB    1 
ATOM   4034 C  CG    . PRO B 1  250 ? -30.036 25.707 8.323   1.00 35.25 ? 247 PRO B CG    1 
ATOM   4035 C  CD    . PRO B 1  250 ? -29.207 25.265 9.496   1.00 34.83 ? 247 PRO B CD    1 
ATOM   4036 N  N     . VAL B 1  251 ? -32.180 25.535 11.763  1.00 35.80 ? 248 VAL B N     1 
ATOM   4037 C  CA    . VAL B 1  251 ? -33.185 25.223 12.792  1.00 36.02 ? 248 VAL B CA    1 
ATOM   4038 C  C     . VAL B 1  251 ? -32.947 26.044 14.070  1.00 34.73 ? 248 VAL B C     1 
ATOM   4039 O  O     . VAL B 1  251 ? -33.866 26.654 14.601  1.00 34.87 ? 248 VAL B O     1 
ATOM   4040 C  CB    . VAL B 1  251 ? -33.204 23.676 13.078  1.00 36.35 ? 248 VAL B CB    1 
ATOM   4041 C  CG1   . VAL B 1  251 ? -34.068 23.320 14.270  1.00 37.80 ? 248 VAL B CG1   1 
ATOM   4042 C  CG2   . VAL B 1  251 ? -33.698 22.924 11.858  1.00 37.95 ? 248 VAL B CG2   1 
ATOM   4043 N  N     . VAL B 1  252 ? -31.701 26.072 14.531  1.00 34.36 ? 249 VAL B N     1 
ATOM   4044 C  CA    . VAL B 1  252 ? -31.284 26.852 15.710  1.00 33.22 ? 249 VAL B CA    1 
ATOM   4045 C  C     . VAL B 1  252 ? -31.593 28.338 15.512  1.00 32.68 ? 249 VAL B C     1 
ATOM   4046 O  O     . VAL B 1  252 ? -32.219 28.997 16.372  1.00 32.21 ? 249 VAL B O     1 
ATOM   4047 C  CB    . VAL B 1  252 ? -29.771 26.645 15.989  1.00 33.65 ? 249 VAL B CB    1 
ATOM   4048 C  CG1   . VAL B 1  252 ? -29.258 27.565 17.127  1.00 33.42 ? 249 VAL B CG1   1 
ATOM   4049 C  CG2   . VAL B 1  252 ? -29.491 25.172 16.303  1.00 33.94 ? 249 VAL B CG2   1 
ATOM   4050 N  N     . GLN B 1  253 ? -31.207 28.848 14.347  1.00 31.12 ? 250 GLN B N     1 
ATOM   4051 C  CA    . GLN B 1  253 ? -31.371 30.265 14.052  1.00 30.17 ? 250 GLN B CA    1 
ATOM   4052 C  C     . GLN B 1  253 ? -32.847 30.665 14.049  1.00 29.28 ? 250 GLN B C     1 
ATOM   4053 O  O     . GLN B 1  253 ? -33.236 31.694 14.633  1.00 28.23 ? 250 GLN B O     1 
ATOM   4054 C  CB    . GLN B 1  253 ? -30.680 30.608 12.728  1.00 30.00 ? 250 GLN B CB    1 
ATOM   4055 C  CG    . GLN B 1  253 ? -30.373 32.070 12.615  1.00 32.34 ? 250 GLN B CG    1 
ATOM   4056 C  CD    . GLN B 1  253 ? -29.547 32.440 11.386  1.00 34.82 ? 250 GLN B CD    1 
ATOM   4057 O  OE1   . GLN B 1  253 ? -28.413 31.976 11.210  1.00 31.57 ? 250 GLN B OE1   1 
ATOM   4058 N  NE2   . GLN B 1  253 ? -30.111 33.323 10.550  1.00 34.27 ? 250 GLN B NE2   1 
ATOM   4059 N  N     . LEU B 1  254 ? -33.673 29.828 13.422  1.00 28.88 ? 251 LEU B N     1 
ATOM   4060 C  CA    . LEU B 1  254 ? -35.124 30.048 13.359  1.00 28.58 ? 251 LEU B CA    1 
ATOM   4061 C  C     . LEU B 1  254 ? -35.789 30.049 14.739  1.00 28.33 ? 251 LEU B C     1 
ATOM   4062 O  O     . LEU B 1  254 ? -36.691 30.864 15.006  1.00 28.97 ? 251 LEU B O     1 
ATOM   4063 C  CB    . LEU B 1  254 ? -35.798 29.003 12.439  1.00 28.21 ? 251 LEU B CB    1 
ATOM   4064 C  CG    . LEU B 1  254 ? -35.598 29.229 10.921  1.00 29.43 ? 251 LEU B CG    1 
ATOM   4065 C  CD1   . LEU B 1  254 ? -35.980 27.985 10.096  1.00 27.97 ? 251 LEU B CD1   1 
ATOM   4066 C  CD2   . LEU B 1  254 ? -36.381 30.466 10.447  1.00 26.75 ? 251 LEU B CD2   1 
ATOM   4067 N  N     . ALA B 1  255 ? -35.363 29.119 15.595  1.00 28.11 ? 252 ALA B N     1 
ATOM   4068 C  CA    . ALA B 1  255 ? -35.850 29.017 16.977  1.00 27.95 ? 252 ALA B CA    1 
ATOM   4069 C  C     . ALA B 1  255 ? -35.520 30.285 17.757  1.00 28.05 ? 252 ALA B C     1 
ATOM   4070 O  O     . ALA B 1  255 ? -36.396 30.881 18.372  1.00 28.65 ? 252 ALA B O     1 
ATOM   4071 C  CB    . ALA B 1  255 ? -35.240 27.800 17.660  1.00 27.77 ? 252 ALA B CB    1 
ATOM   4072 N  N     . LEU B 1  256 ? -34.259 30.702 17.711  1.00 27.97 ? 253 LEU B N     1 
ATOM   4073 C  CA    . LEU B 1  256 ? -33.816 31.910 18.408  1.00 28.17 ? 253 LEU B CA    1 
ATOM   4074 C  C     . LEU B 1  256 ? -34.651 33.105 17.985  1.00 27.88 ? 253 LEU B C     1 
ATOM   4075 O  O     . LEU B 1  256 ? -35.169 33.840 18.826  1.00 27.91 ? 253 LEU B O     1 
ATOM   4076 C  CB    . LEU B 1  256 ? -32.333 32.189 18.136  1.00 28.03 ? 253 LEU B CB    1 
ATOM   4077 C  CG    . LEU B 1  256 ? -31.343 31.093 18.581  1.00 29.96 ? 253 LEU B CG    1 
ATOM   4078 C  CD1   . LEU B 1  256 ? -29.963 31.345 17.969  1.00 30.79 ? 253 LEU B CD1   1 
ATOM   4079 C  CD2   . LEU B 1  256 ? -31.242 30.984 20.100  1.00 29.06 ? 253 LEU B CD2   1 
ATOM   4080 N  N     . ASN B 1  257 ? -34.804 33.270 16.672  1.00 27.27 ? 254 ASN B N     1 
ATOM   4081 C  CA    . ASN B 1  257 ? -35.398 34.477 16.099  1.00 26.78 ? 254 ASN B CA    1 
ATOM   4082 C  C     . ASN B 1  257 ? -36.928 34.508 16.174  1.00 26.58 ? 254 ASN B C     1 
ATOM   4083 O  O     . ASN B 1  257 ? -37.550 35.532 15.957  1.00 26.55 ? 254 ASN B O     1 
ATOM   4084 C  CB    . ASN B 1  257 ? -34.840 34.686 14.682  1.00 26.29 ? 254 ASN B CB    1 
ATOM   4085 C  CG    . ASN B 1  257 ? -33.357 35.077 14.709  1.00 27.62 ? 254 ASN B CG    1 
ATOM   4086 O  OD1   . ASN B 1  257 ? -32.885 35.677 15.688  1.00 26.43 ? 254 ASN B OD1   1 
ATOM   4087 N  ND2   . ASN B 1  257 ? -32.622 34.727 13.665  1.00 24.07 ? 254 ASN B ND2   1 
ATOM   4088 N  N     . ASN B 1  258 ? -37.521 33.377 16.528  1.00 27.00 ? 255 ASN B N     1 
ATOM   4089 C  CA    . ASN B 1  258 ? -38.950 33.313 16.791  1.00 28.13 ? 255 ASN B CA    1 
ATOM   4090 C  C     . ASN B 1  258 ? -39.286 33.101 18.288  1.00 29.33 ? 255 ASN B C     1 
ATOM   4091 O  O     . ASN B 1  258 ? -40.397 32.717 18.643  1.00 29.71 ? 255 ASN B O     1 
ATOM   4092 C  CB    . ASN B 1  258 ? -39.582 32.275 15.855  1.00 27.70 ? 255 ASN B CB    1 
ATOM   4093 C  CG    . ASN B 1  258 ? -39.530 32.734 14.405  1.00 27.15 ? 255 ASN B CG    1 
ATOM   4094 O  OD1   . ASN B 1  258 ? -40.368 33.525 13.987  1.00 29.60 ? 255 ASN B OD1   1 
ATOM   4095 N  ND2   . ASN B 1  258 ? -38.496 32.316 13.664  1.00 24.06 ? 255 ASN B ND2   1 
ATOM   4096 N  N     . THR B 1  259 ? -38.308 33.386 19.146  1.00 30.52 ? 256 THR B N     1 
ATOM   4097 C  CA    . THR B 1  259 ? -38.457 33.310 20.603  1.00 31.20 ? 256 THR B CA    1 
ATOM   4098 C  C     . THR B 1  259 ? -38.924 34.659 21.122  1.00 32.40 ? 256 THR B C     1 
ATOM   4099 O  O     . THR B 1  259 ? -38.251 35.682 20.956  1.00 32.39 ? 256 THR B O     1 
ATOM   4100 C  CB    . THR B 1  259 ? -37.116 32.925 21.291  1.00 30.99 ? 256 THR B CB    1 
ATOM   4101 O  OG1   . THR B 1  259 ? -36.764 31.584 20.915  1.00 31.21 ? 256 THR B OG1   1 
ATOM   4102 C  CG2   . THR B 1  259 ? -37.200 33.019 22.843  1.00 29.46 ? 256 THR B CG2   1 
ATOM   4103 N  N     . TYR B 1  260 ? -40.081 34.641 21.766  1.00 33.71 ? 257 TYR B N     1 
ATOM   4104 C  CA    . TYR B 1  260 ? -40.639 35.813 22.401  1.00 35.70 ? 257 TYR B CA    1 
ATOM   4105 C  C     . TYR B 1  260 ? -39.666 36.380 23.448  1.00 36.00 ? 257 TYR B C     1 
ATOM   4106 O  O     . TYR B 1  260 ? -39.074 35.625 24.213  1.00 36.14 ? 257 TYR B O     1 
ATOM   4107 C  CB    . TYR B 1  260 ? -41.978 35.418 23.037  1.00 36.34 ? 257 TYR B CB    1 
ATOM   4108 C  CG    . TYR B 1  260 ? -42.617 36.490 23.859  1.00 39.34 ? 257 TYR B CG    1 
ATOM   4109 C  CD1   . TYR B 1  260 ? -43.280 37.558 23.249  1.00 42.94 ? 257 TYR B CD1   1 
ATOM   4110 C  CD2   . TYR B 1  260 ? -42.575 36.438 25.261  1.00 42.18 ? 257 TYR B CD2   1 
ATOM   4111 C  CE1   . TYR B 1  260 ? -43.884 38.560 24.021  1.00 44.69 ? 257 TYR B CE1   1 
ATOM   4112 C  CE2   . TYR B 1  260 ? -43.170 37.427 26.039  1.00 43.51 ? 257 TYR B CE2   1 
ATOM   4113 C  CZ    . TYR B 1  260 ? -43.816 38.483 25.413  1.00 45.33 ? 257 TYR B CZ    1 
ATOM   4114 O  OH    . TYR B 1  260 ? -44.398 39.467 26.177  1.00 48.40 ? 257 TYR B OH    1 
ATOM   4115 N  N     . SER B 1  261 ? -39.480 37.699 23.443  1.00 36.58 ? 258 SER B N     1 
ATOM   4116 C  CA    . SER B 1  261 ? -38.703 38.386 24.472  1.00 37.65 ? 258 SER B CA    1 
ATOM   4117 C  C     . SER B 1  261 ? -39.626 39.065 25.493  1.00 38.37 ? 258 SER B C     1 
ATOM   4118 O  O     . SER B 1  261 ? -40.386 39.987 25.142  1.00 37.80 ? 258 SER B O     1 
ATOM   4119 C  CB    . SER B 1  261 ? -37.758 39.420 23.862  1.00 37.41 ? 258 SER B CB    1 
ATOM   4120 O  OG    . SER B 1  261 ? -37.459 40.445 24.804  1.00 38.59 ? 258 SER B OG    1 
ATOM   4121 N  N     . PRO B 1  262 ? -39.561 38.617 26.762  1.00 39.32 ? 259 PRO B N     1 
ATOM   4122 C  CA    . PRO B 1  262 ? -40.438 39.205 27.790  1.00 40.13 ? 259 PRO B CA    1 
ATOM   4123 C  C     . PRO B 1  262 ? -40.145 40.688 28.015  1.00 40.88 ? 259 PRO B C     1 
ATOM   4124 O  O     . PRO B 1  262 ? -41.068 41.469 28.291  1.00 41.35 ? 259 PRO B O     1 
ATOM   4125 C  CB    . PRO B 1  262 ? -40.148 38.369 29.040  1.00 40.14 ? 259 PRO B CB    1 
ATOM   4126 C  CG    . PRO B 1  262 ? -38.814 37.698 28.787  1.00 40.41 ? 259 PRO B CG    1 
ATOM   4127 C  CD    . PRO B 1  262 ? -38.705 37.533 27.291  1.00 39.81 ? 259 PRO B CD    1 
ATOM   4128 N  N     . VAL B 1  263 ? -38.883 41.083 27.856  1.00 41.46 ? 260 VAL B N     1 
ATOM   4129 C  CA    . VAL B 1  263 ? -38.509 42.502 27.941  1.00 42.14 ? 260 VAL B CA    1 
ATOM   4130 C  C     . VAL B 1  263 ? -39.138 43.312 26.811  1.00 42.75 ? 260 VAL B C     1 
ATOM   4131 O  O     . VAL B 1  263 ? -39.893 44.255 27.068  1.00 43.71 ? 260 VAL B O     1 
ATOM   4132 C  CB    . VAL B 1  263 ? -36.969 42.703 27.926  1.00 42.34 ? 260 VAL B CB    1 
ATOM   4133 C  CG1   . VAL B 1  263 ? -36.606 44.207 27.956  1.00 42.14 ? 260 VAL B CG1   1 
ATOM   4134 C  CG2   . VAL B 1  263 ? -36.304 41.934 29.081  1.00 42.45 ? 260 VAL B CG2   1 
ATOM   4135 N  N     . LEU B 1  264 ? -38.845 42.935 25.564  1.00 42.69 ? 261 LEU B N     1 
ATOM   4136 C  CA    . LEU B 1  264 ? -39.287 43.719 24.399  1.00 42.44 ? 261 LEU B CA    1 
ATOM   4137 C  C     . LEU B 1  264 ? -40.729 43.483 23.990  1.00 41.84 ? 261 LEU B C     1 
ATOM   4138 O  O     . LEU B 1  264 ? -41.323 44.321 23.304  1.00 42.30 ? 261 LEU B O     1 
ATOM   4139 C  CB    . LEU B 1  264 ? -38.367 43.474 23.202  1.00 42.65 ? 261 LEU B CB    1 
ATOM   4140 C  CG    . LEU B 1  264 ? -36.959 44.045 23.354  1.00 43.53 ? 261 LEU B CG    1 
ATOM   4141 C  CD1   . LEU B 1  264 ? -36.018 43.424 22.326  1.00 44.69 ? 261 LEU B CD1   1 
ATOM   4142 C  CD2   . LEU B 1  264 ? -36.971 45.565 23.248  1.00 45.29 ? 261 LEU B CD2   1 
ATOM   4143 N  N     . LYS B 1  265 ? -41.278 42.339 24.398  1.00 41.01 ? 262 LYS B N     1 
ATOM   4144 C  CA    . LYS B 1  265 ? -42.670 41.958 24.107  1.00 40.52 ? 262 LYS B CA    1 
ATOM   4145 C  C     . LYS B 1  265 ? -42.903 41.501 22.642  1.00 39.22 ? 262 LYS B C     1 
ATOM   4146 O  O     . LYS B 1  265 ? -44.047 41.443 22.167  1.00 38.99 ? 262 LYS B O     1 
ATOM   4147 C  CB    . LYS B 1  265 ? -43.658 43.059 24.550  1.00 41.12 ? 262 LYS B CB    1 
ATOM   4148 C  CG    . LYS B 1  265 ? -43.327 43.655 25.946  1.00 44.89 ? 262 LYS B CG    1 
ATOM   4149 C  CD    . LYS B 1  265 ? -44.530 43.701 26.886  1.00 49.83 ? 262 LYS B CD    1 
ATOM   4150 C  CE    . LYS B 1  265 ? -44.082 44.092 28.306  1.00 53.24 ? 262 LYS B CE    1 
ATOM   4151 N  NZ    . LYS B 1  265 ? -45.135 43.781 29.335  1.00 55.86 ? 262 LYS B NZ    1 
ATOM   4152 N  N     . TYR B 1  266 ? -41.813 41.166 21.947  1.00 36.94 ? 263 TYR B N     1 
ATOM   4153 C  CA    . TYR B 1  266 ? -41.883 40.642 20.578  1.00 35.43 ? 263 TYR B CA    1 
ATOM   4154 C  C     . TYR B 1  266 ? -40.750 39.674 20.336  1.00 33.60 ? 263 TYR B C     1 
ATOM   4155 O  O     . TYR B 1  266 ? -39.801 39.625 21.116  1.00 33.61 ? 263 TYR B O     1 
ATOM   4156 C  CB    . TYR B 1  266 ? -41.769 41.768 19.553  1.00 35.48 ? 263 TYR B CB    1 
ATOM   4157 C  CG    . TYR B 1  266 ? -42.941 42.694 19.544  1.00 37.57 ? 263 TYR B CG    1 
ATOM   4158 C  CD1   . TYR B 1  266 ? -44.157 42.304 18.970  1.00 39.10 ? 263 TYR B CD1   1 
ATOM   4159 C  CD2   . TYR B 1  266 ? -42.848 43.964 20.121  1.00 39.86 ? 263 TYR B CD2   1 
ATOM   4160 C  CE1   . TYR B 1  266 ? -45.251 43.154 18.969  1.00 40.53 ? 263 TYR B CE1   1 
ATOM   4161 C  CE2   . TYR B 1  266 ? -43.943 44.828 20.129  1.00 41.46 ? 263 TYR B CE2   1 
ATOM   4162 C  CZ    . TYR B 1  266 ? -45.137 44.414 19.546  1.00 42.43 ? 263 TYR B CZ    1 
ATOM   4163 O  OH    . TYR B 1  266 ? -46.220 45.259 19.543  1.00 43.80 ? 263 TYR B OH    1 
ATOM   4164 N  N     . THR B 1  267 ? -40.849 38.908 19.254  1.00 30.92 ? 264 THR B N     1 
ATOM   4165 C  CA    . THR B 1  267 ? -39.729 38.072 18.817  1.00 28.34 ? 264 THR B CA    1 
ATOM   4166 C  C     . THR B 1  267 ? -38.782 38.937 17.987  1.00 26.73 ? 264 THR B C     1 
ATOM   4167 O  O     . THR B 1  267 ? -39.166 39.997 17.508  1.00 26.16 ? 264 THR B O     1 
ATOM   4168 C  CB    . THR B 1  267 ? -40.200 36.914 17.957  1.00 27.77 ? 264 THR B CB    1 
ATOM   4169 O  OG1   . THR B 1  267 ? -40.649 37.443 16.705  1.00 26.43 ? 264 THR B OG1   1 
ATOM   4170 C  CG2   . THR B 1  267 ? -41.334 36.142 18.658  1.00 26.80 ? 264 THR B CG2   1 
ATOM   4171 N  N     . PRO B 1  268 ? -37.532 38.503 17.833  1.00 26.17 ? 265 PRO B N     1 
ATOM   4172 C  CA    . PRO B 1  268 ? -36.629 39.264 16.961  1.00 25.85 ? 265 PRO B CA    1 
ATOM   4173 C  C     . PRO B 1  268 ? -37.144 39.370 15.504  1.00 25.58 ? 265 PRO B C     1 
ATOM   4174 O  O     . PRO B 1  268 ? -36.990 40.419 14.874  1.00 24.83 ? 265 PRO B O     1 
ATOM   4175 C  CB    . PRO B 1  268 ? -35.332 38.450 17.031  1.00 25.40 ? 265 PRO B CB    1 
ATOM   4176 C  CG    . PRO B 1  268 ? -35.353 37.910 18.452  1.00 25.30 ? 265 PRO B CG    1 
ATOM   4177 C  CD    . PRO B 1  268 ? -36.802 37.511 18.650  1.00 25.96 ? 265 PRO B CD    1 
ATOM   4178 N  N     . HIS B 1  269 ? -37.762 38.301 14.997  1.00 25.52 ? 266 HIS B N     1 
ATOM   4179 C  CA    . HIS B 1  269 ? -38.400 38.333 13.661  1.00 25.66 ? 266 HIS B CA    1 
ATOM   4180 C  C     . HIS B 1  269 ? -39.394 39.481 13.536  1.00 26.11 ? 266 HIS B C     1 
ATOM   4181 O  O     . HIS B 1  269 ? -39.362 40.221 12.553  1.00 26.93 ? 266 HIS B O     1 
ATOM   4182 C  CB    . HIS B 1  269 ? -39.079 37.004 13.346  1.00 25.61 ? 266 HIS B CB    1 
ATOM   4183 C  CG    . HIS B 1  269 ? -39.776 36.967 12.017  1.00 25.66 ? 266 HIS B CG    1 
ATOM   4184 N  ND1   . HIS B 1  269 ? -39.308 36.218 10.950  1.00 25.80 ? 266 HIS B ND1   1 
ATOM   4185 C  CD2   . HIS B 1  269 ? -40.907 37.578 11.584  1.00 24.96 ? 266 HIS B CD2   1 
ATOM   4186 C  CE1   . HIS B 1  269 ? -40.128 36.364 9.920   1.00 26.49 ? 266 HIS B CE1   1 
ATOM   4187 N  NE2   . HIS B 1  269 ? -41.108 37.181 10.279  1.00 28.03 ? 266 HIS B NE2   1 
ATOM   4188 N  N     . GLN B 1  270 ? -40.256 39.658 14.534  1.00 25.84 ? 267 GLN B N     1 
ATOM   4189 C  CA    . GLN B 1  270 ? -41.272 40.720 14.490  1.00 26.40 ? 267 GLN B CA    1 
ATOM   4190 C  C     . GLN B 1  270 ? -40.661 42.097 14.528  1.00 25.56 ? 267 GLN B C     1 
ATOM   4191 O  O     . GLN B 1  270 ? -41.177 43.003 13.899  1.00 26.37 ? 267 GLN B O     1 
ATOM   4192 C  CB    . GLN B 1  270 ? -42.307 40.602 15.640  1.00 26.18 ? 267 GLN B CB    1 
ATOM   4193 C  CG    . GLN B 1  270 ? -43.186 39.356 15.573  1.00 28.48 ? 267 GLN B CG    1 
ATOM   4194 C  CD    . GLN B 1  270 ? -44.005 39.145 16.853  1.00 32.24 ? 267 GLN B CD    1 
ATOM   4195 O  OE1   . GLN B 1  270 ? -43.514 39.346 17.965  1.00 30.29 ? 267 GLN B OE1   1 
ATOM   4196 N  NE2   . GLN B 1  270 ? -45.259 38.750 16.689  1.00 32.44 ? 267 GLN B NE2   1 
ATOM   4197 N  N     . LEU B 1  271 ? -39.589 42.269 15.293  1.00 25.47 ? 268 LEU B N     1 
ATOM   4198 C  CA    . LEU B 1  271 ? -38.927 43.576 15.412  1.00 24.91 ? 268 LEU B CA    1 
ATOM   4199 C  C     . LEU B 1  271 ? -38.039 43.941 14.202  1.00 24.64 ? 268 LEU B C     1 
ATOM   4200 O  O     . LEU B 1  271 ? -37.836 45.122 13.891  1.00 24.98 ? 268 LEU B O     1 
ATOM   4201 C  CB    . LEU B 1  271 ? -38.095 43.637 16.706  1.00 25.23 ? 268 LEU B CB    1 
ATOM   4202 C  CG    . LEU B 1  271 ? -38.918 43.708 18.024  1.00 26.00 ? 268 LEU B CG    1 
ATOM   4203 C  CD1   . LEU B 1  271 ? -38.050 43.448 19.243  1.00 27.32 ? 268 LEU B CD1   1 
ATOM   4204 C  CD2   . LEU B 1  271 ? -39.680 45.060 18.167  1.00 27.03 ? 268 LEU B CD2   1 
ATOM   4205 N  N     . LEU B 1  272 ? -37.473 42.924 13.561  1.00 23.82 ? 269 LEU B N     1 
ATOM   4206 C  CA    . LEU B 1  272 ? -36.669 43.131 12.371  1.00 23.39 ? 269 LEU B CA    1 
ATOM   4207 C  C     . LEU B 1  272 ? -37.534 43.377 11.133  1.00 23.92 ? 269 LEU B C     1 
ATOM   4208 O  O     . LEU B 1  272 ? -37.205 44.250 10.326  1.00 23.50 ? 269 LEU B O     1 
ATOM   4209 C  CB    . LEU B 1  272 ? -35.698 41.959 12.147  1.00 23.25 ? 269 LEU B CB    1 
ATOM   4210 C  CG    . LEU B 1  272 ? -34.663 42.151 11.032  1.00 21.42 ? 269 LEU B CG    1 
ATOM   4211 C  CD1   . LEU B 1  272 ? -33.843 43.452 11.206  1.00 19.91 ? 269 LEU B CD1   1 
ATOM   4212 C  CD2   . LEU B 1  272 ? -33.741 40.945 10.923  1.00 18.68 ? 269 LEU B CD2   1 
ATOM   4213 N  N     . PHE B 1  273 ? -38.642 42.634 10.991  1.00 23.86 ? 270 PHE B N     1 
ATOM   4214 C  CA    . PHE B 1  273 ? -39.429 42.700 9.748   1.00 24.80 ? 270 PHE B CA    1 
ATOM   4215 C  C     . PHE B 1  273 ? -40.787 43.389 9.883   1.00 25.73 ? 270 PHE B C     1 
ATOM   4216 O  O     . PHE B 1  273 ? -41.416 43.733 8.866   1.00 24.97 ? 270 PHE B O     1 
ATOM   4217 C  CB    . PHE B 1  273 ? -39.659 41.306 9.172   1.00 23.95 ? 270 PHE B CB    1 
ATOM   4218 C  CG    . PHE B 1  273 ? -38.402 40.558 8.891   1.00 23.71 ? 270 PHE B CG    1 
ATOM   4219 C  CD1   . PHE B 1  273 ? -38.143 39.350 9.535   1.00 21.83 ? 270 PHE B CD1   1 
ATOM   4220 C  CD2   . PHE B 1  273 ? -37.480 41.044 7.955   1.00 21.98 ? 270 PHE B CD2   1 
ATOM   4221 C  CE1   . PHE B 1  273 ? -36.972 38.637 9.250   1.00 21.94 ? 270 PHE B CE1   1 
ATOM   4222 C  CE2   . PHE B 1  273 ? -36.326 40.353 7.663   1.00 21.69 ? 270 PHE B CE2   1 
ATOM   4223 C  CZ    . PHE B 1  273 ? -36.063 39.136 8.316   1.00 22.52 ? 270 PHE B CZ    1 
ATOM   4224 N  N     . GLY B 1  274 ? -41.248 43.560 11.123  1.00 26.13 ? 271 GLY B N     1 
ATOM   4225 C  CA    . GLY B 1  274 ? -42.527 44.220 11.374  1.00 27.54 ? 271 GLY B CA    1 
ATOM   4226 C  C     . GLY B 1  274 ? -43.726 43.368 11.000  1.00 28.56 ? 271 GLY B C     1 
ATOM   4227 O  O     . GLY B 1  274 ? -44.792 43.892 10.718  1.00 29.75 ? 271 GLY B O     1 
ATOM   4228 N  N     . ILE B 1  275 ? -43.552 42.053 10.979  1.00 29.34 ? 272 ILE B N     1 
ATOM   4229 C  CA    . ILE B 1  275 ? -44.647 41.139 10.679  1.00 30.56 ? 272 ILE B CA    1 
ATOM   4230 C  C     . ILE B 1  275 ? -44.554 39.934 11.581  1.00 31.31 ? 272 ILE B C     1 
ATOM   4231 O  O     . ILE B 1  275 ? -43.502 39.658 12.158  1.00 31.23 ? 272 ILE B O     1 
ATOM   4232 C  CB    . ILE B 1  275 ? -44.595 40.586 9.216   1.00 30.63 ? 272 ILE B CB    1 
ATOM   4233 C  CG1   . ILE B 1  275 ? -43.207 39.996 8.903   1.00 30.58 ? 272 ILE B CG1   1 
ATOM   4234 C  CG2   . ILE B 1  275 ? -45.066 41.640 8.206   1.00 30.26 ? 272 ILE B CG2   1 
ATOM   4235 C  CD1   . ILE B 1  275 ? -43.158 39.108 7.670   1.00 32.71 ? 272 ILE B CD1   1 
ATOM   4236 N  N     . ASP B 1  276 ? -45.649 39.189 11.663  1.00 32.69 ? 273 ASP B N     1 
ATOM   4237 C  CA    . ASP B 1  276 ? -45.611 37.875 12.284  1.00 34.04 ? 273 ASP B CA    1 
ATOM   4238 C  C     . ASP B 1  276 ? -44.856 36.947 11.370  1.00 34.59 ? 273 ASP B C     1 
ATOM   4239 O  O     . ASP B 1  276 ? -44.628 37.264 10.201  1.00 35.08 ? 273 ASP B O     1 
ATOM   4240 C  CB    . ASP B 1  276 ? -47.021 37.333 12.511  1.00 34.62 ? 273 ASP B CB    1 
ATOM   4241 C  CG    . ASP B 1  276 ? -47.761 38.078 13.587  1.00 36.79 ? 273 ASP B CG    1 
ATOM   4242 O  OD1   . ASP B 1  276 ? -47.117 38.791 14.396  1.00 38.54 ? 273 ASP B OD1   1 
ATOM   4243 O  OD2   . ASP B 1  276 ? -48.998 37.953 13.614  1.00 38.77 ? 273 ASP B OD2   1 
ATOM   4244 N  N     . SER B 1  277 ? -44.488 35.791 11.894  1.00 34.47 ? 274 SER B N     1 
ATOM   4245 C  CA    . SER B 1  277 ? -43.654 34.870 11.164  1.00 35.26 ? 274 SER B CA    1 
ATOM   4246 C  C     . SER B 1  277 ? -44.456 33.651 10.742  1.00 35.66 ? 274 SER B C     1 
ATOM   4247 O  O     . SER B 1  277 ? -45.533 33.397 11.286  1.00 35.61 ? 274 SER B O     1 
ATOM   4248 C  CB    . SER B 1  277 ? -42.463 34.490 12.038  1.00 35.03 ? 274 SER B CB    1 
ATOM   4249 O  OG    . SER B 1  277 ? -42.049 33.164 11.840  1.00 35.65 ? 274 SER B OG    1 
ATOM   4250 N  N     . ASN B 1  278 ? -43.929 32.896 9.779   1.00 35.78 ? 275 ASN B N     1 
ATOM   4251 C  CA    . ASN B 1  278 ? -44.578 31.667 9.349   1.00 36.43 ? 275 ASN B CA    1 
ATOM   4252 C  C     . ASN B 1  278 ? -44.121 30.463 10.149  1.00 37.74 ? 275 ASN B C     1 
ATOM   4253 O  O     . ASN B 1  278 ? -44.649 29.367 9.961   1.00 37.66 ? 275 ASN B O     1 
ATOM   4254 C  CB    . ASN B 1  278 ? -44.375 31.430 7.843   1.00 35.65 ? 275 ASN B CB    1 
ATOM   4255 C  CG    . ASN B 1  278 ? -44.833 32.607 7.013   1.00 34.68 ? 275 ASN B CG    1 
ATOM   4256 O  OD1   . ASN B 1  278 ? -45.950 33.099 7.193   1.00 30.98 ? 275 ASN B OD1   1 
ATOM   4257 N  ND2   . ASN B 1  278 ? -43.965 33.089 6.114   1.00 30.74 ? 275 ASN B ND2   1 
ATOM   4258 N  N     . THR B 1  279 ? -43.124 30.659 11.014  1.00 38.92 ? 276 THR B N     1 
ATOM   4259 C  CA    . THR B 1  279 ? -42.683 29.606 11.919  1.00 40.79 ? 276 THR B CA    1 
ATOM   4260 C  C     . THR B 1  279 ? -42.757 30.108 13.367  1.00 42.72 ? 276 THR B C     1 
ATOM   4261 O  O     . THR B 1  279 ? -41.724 30.239 14.024  1.00 42.39 ? 276 THR B O     1 
ATOM   4262 C  CB    . THR B 1  279 ? -41.243 29.120 11.618  1.00 40.63 ? 276 THR B CB    1 
ATOM   4263 O  OG1   . THR B 1  279 ? -40.342 30.232 11.667  1.00 39.01 ? 276 THR B OG1   1 
ATOM   4264 C  CG2   . THR B 1  279 ? -41.162 28.426 10.265  1.00 39.70 ? 276 THR B CG2   1 
ATOM   4265 N  N     . PRO B 1  280 ? -43.979 30.384 13.865  1.00 44.87 ? 277 PRO B N     1 
ATOM   4266 C  CA    . PRO B 1  280 ? -44.142 30.997 15.194  1.00 46.98 ? 277 PRO B CA    1 
ATOM   4267 C  C     . PRO B 1  280 ? -43.738 30.050 16.322  1.00 48.82 ? 277 PRO B C     1 
ATOM   4268 O  O     . PRO B 1  280 ? -43.342 30.505 17.395  1.00 49.58 ? 277 PRO B O     1 
ATOM   4269 C  CB    . PRO B 1  280 ? -45.648 31.269 15.274  1.00 46.89 ? 277 PRO B CB    1 
ATOM   4270 C  CG    . PRO B 1  280 ? -46.258 30.191 14.415  1.00 46.41 ? 277 PRO B CG    1 
ATOM   4271 C  CD    . PRO B 1  280 ? -45.280 29.991 13.279  1.00 45.03 ? 277 PRO B CD    1 
ATOM   4272 N  N     . PHE B 1  281 ? -43.846 28.749 16.066  1.00 50.75 ? 278 PHE B N     1 
ATOM   4273 C  CA    . PHE B 1  281 ? -43.543 27.729 17.058  1.00 52.80 ? 278 PHE B CA    1 
ATOM   4274 C  C     . PHE B 1  281 ? -42.214 27.047 16.726  1.00 53.91 ? 278 PHE B C     1 
ATOM   4275 O  O     . PHE B 1  281 ? -42.060 25.828 16.910  1.00 54.66 ? 278 PHE B O     1 
ATOM   4276 C  CB    . PHE B 1  281 ? -44.694 26.706 17.160  1.00 52.90 ? 278 PHE B CB    1 
ATOM   4277 N  N     . ALA B 1  282 ? -41.247 27.832 16.247  1.00 54.72 ? 279 ALA B N     1 
ATOM   4278 C  CA    . ALA B 1  282 ? -39.918 27.285 15.964  1.00 55.17 ? 279 ALA B CA    1 
ATOM   4279 C  C     . ALA B 1  282 ? -39.139 27.023 17.261  1.00 55.67 ? 279 ALA B C     1 
ATOM   4280 O  O     . ALA B 1  282 ? -38.255 26.162 17.283  1.00 55.94 ? 279 ALA B O     1 
ATOM   4281 C  CB    . ALA B 1  282 ? -39.133 28.178 15.008  1.00 54.70 ? 279 ALA B CB    1 
ATOM   4282 N  N     . ASN B 1  283 ? -39.476 27.739 18.337  1.00 55.90 ? 280 ASN B N     1 
ATOM   4283 C  CA    . ASN B 1  283 ? -38.814 27.513 19.626  1.00 56.55 ? 280 ASN B CA    1 
ATOM   4284 C  C     . ASN B 1  283 ? -39.543 26.522 20.546  1.00 56.60 ? 280 ASN B C     1 
ATOM   4285 O  O     . ASN B 1  283 ? -40.600 26.845 21.114  1.00 57.07 ? 280 ASN B O     1 
ATOM   4286 C  CB    . ASN B 1  283 ? -38.555 28.832 20.362  1.00 56.65 ? 280 ASN B CB    1 
ATOM   4287 C  CG    . ASN B 1  283 ? -37.690 28.642 21.609  1.00 58.02 ? 280 ASN B CG    1 
ATOM   4288 O  OD1   . ASN B 1  283 ? -36.561 28.132 21.534  1.00 58.13 ? 280 ASN B OD1   1 
ATOM   4289 N  ND2   . ASN B 1  283 ? -38.216 29.058 22.763  1.00 58.39 ? 280 ASN B ND2   1 
ATOM   4290 N  N     . GLN B 1  284 ? -38.969 25.322 20.683  1.00 56.40 ? 281 GLN B N     1 
ATOM   4291 C  CA    . GLN B 1  284 ? -39.482 24.284 21.605  1.00 55.87 ? 281 GLN B CA    1 
ATOM   4292 C  C     . GLN B 1  284 ? -38.483 23.986 22.742  1.00 55.24 ? 281 GLN B C     1 
ATOM   4293 O  O     . GLN B 1  284 ? -38.326 22.835 23.162  1.00 55.79 ? 281 GLN B O     1 
ATOM   4294 C  CB    . GLN B 1  284 ? -39.831 22.997 20.835  1.00 55.80 ? 281 GLN B CB    1 
ATOM   4295 N  N     . ASP B 1  285 ? -37.815 25.034 23.226  1.00 54.12 ? 282 ASP B N     1 
ATOM   4296 C  CA    . ASP B 1  285 ? -36.751 24.915 24.230  1.00 52.91 ? 282 ASP B CA    1 
ATOM   4297 C  C     . ASP B 1  285 ? -37.378 24.740 25.615  1.00 51.76 ? 282 ASP B C     1 
ATOM   4298 O  O     . ASP B 1  285 ? -38.193 25.563 26.037  1.00 51.53 ? 282 ASP B O     1 
ATOM   4299 C  CB    . ASP B 1  285 ? -35.857 26.169 24.183  1.00 52.97 ? 282 ASP B CB    1 
ATOM   4300 C  CG    . ASP B 1  285 ? -34.678 26.117 25.162  1.00 53.87 ? 282 ASP B CG    1 
ATOM   4301 O  OD1   . ASP B 1  285 ? -34.004 27.161 25.305  1.00 54.39 ? 282 ASP B OD1   1 
ATOM   4302 O  OD2   . ASP B 1  285 ? -34.415 25.063 25.787  1.00 54.50 ? 282 ASP B OD2   1 
ATOM   4303 N  N     . THR B 1  286 ? -37.005 23.662 26.305  1.00 50.20 ? 283 THR B N     1 
ATOM   4304 C  CA    . THR B 1  286 ? -37.516 23.404 27.660  1.00 48.83 ? 283 THR B CA    1 
ATOM   4305 C  C     . THR B 1  286 ? -36.755 24.175 28.751  1.00 47.84 ? 283 THR B C     1 
ATOM   4306 O  O     . THR B 1  286 ? -37.180 24.166 29.913  1.00 47.76 ? 283 THR B O     1 
ATOM   4307 C  CB    . THR B 1  286 ? -37.528 21.901 28.004  1.00 48.80 ? 283 THR B CB    1 
ATOM   4308 O  OG1   . THR B 1  286 ? -36.195 21.381 27.905  1.00 48.64 ? 283 THR B OG1   1 
ATOM   4309 C  CG2   . THR B 1  286 ? -38.465 21.134 27.064  1.00 48.36 ? 283 THR B CG2   1 
ATOM   4310 N  N     . LEU B 1  287 ? -35.638 24.811 28.367  1.00 45.93 ? 284 LEU B N     1 
ATOM   4311 C  CA    . LEU B 1  287 ? -34.928 25.841 29.166  1.00 44.51 ? 284 LEU B CA    1 
ATOM   4312 C  C     . LEU B 1  287 ? -33.879 25.343 30.172  1.00 43.45 ? 284 LEU B C     1 
ATOM   4313 O  O     . LEU B 1  287 ? -33.149 26.139 30.771  1.00 42.86 ? 284 LEU B O     1 
ATOM   4314 C  CB    . LEU B 1  287 ? -35.906 26.835 29.825  1.00 44.17 ? 284 LEU B CB    1 
ATOM   4315 C  CG    . LEU B 1  287 ? -36.738 27.733 28.890  1.00 45.44 ? 284 LEU B CG    1 
ATOM   4316 C  CD1   . LEU B 1  287 ? -37.887 28.418 29.643  1.00 46.46 ? 284 LEU B CD1   1 
ATOM   4317 C  CD2   . LEU B 1  287 ? -35.873 28.770 28.157  1.00 45.77 ? 284 LEU B CD2   1 
ATOM   4318 N  N     . ASP B 1  288 ? -33.813 24.025 30.338  1.00 42.18 ? 285 ASP B N     1 
ATOM   4319 C  CA    . ASP B 1  288 ? -32.807 23.365 31.162  1.00 41.69 ? 285 ASP B CA    1 
ATOM   4320 C  C     . ASP B 1  288 ? -32.521 22.034 30.460  1.00 41.65 ? 285 ASP B C     1 
ATOM   4321 O  O     . ASP B 1  288 ? -33.387 21.503 29.755  1.00 40.87 ? 285 ASP B O     1 
ATOM   4322 C  CB    . ASP B 1  288 ? -33.337 23.160 32.605  1.00 41.14 ? 285 ASP B CB    1 
ATOM   4323 C  CG    . ASP B 1  288 ? -32.296 22.560 33.570  1.00 41.84 ? 285 ASP B CG    1 
ATOM   4324 O  OD1   . ASP B 1  288 ? -31.077 22.739 33.386  1.00 40.51 ? 285 ASP B OD1   1 
ATOM   4325 O  OD2   . ASP B 1  288 ? -32.704 21.899 34.551  1.00 42.90 ? 285 ASP B OD2   1 
ATOM   4326 N  N     . LEU B 1  289 ? -31.311 21.514 30.625  1.00 41.91 ? 286 LEU B N     1 
ATOM   4327 C  CA    . LEU B 1  289 ? -30.982 20.191 30.102  1.00 43.48 ? 286 LEU B CA    1 
ATOM   4328 C  C     . LEU B 1  289 ? -31.607 19.076 30.946  1.00 44.87 ? 286 LEU B C     1 
ATOM   4329 O  O     . LEU B 1  289 ? -31.654 19.166 32.175  1.00 44.89 ? 286 LEU B O     1 
ATOM   4330 C  CB    . LEU B 1  289 ? -29.460 20.006 29.976  1.00 43.19 ? 286 LEU B CB    1 
ATOM   4331 C  CG    . LEU B 1  289 ? -28.720 21.112 29.204  1.00 42.64 ? 286 LEU B CG    1 
ATOM   4332 C  CD1   . LEU B 1  289 ? -27.220 20.881 29.189  1.00 42.39 ? 286 LEU B CD1   1 
ATOM   4333 C  CD2   . LEU B 1  289 ? -29.255 21.258 27.784  1.00 41.08 ? 286 LEU B CD2   1 
ATOM   4334 N  N     . THR B 1  290 ? -32.122 18.052 30.264  1.00 46.24 ? 287 THR B N     1 
ATOM   4335 C  CA    . THR B 1  290 ? -32.575 16.819 30.901  1.00 47.57 ? 287 THR B CA    1 
ATOM   4336 C  C     . THR B 1  290 ? -31.359 15.949 31.201  1.00 48.64 ? 287 THR B C     1 
ATOM   4337 O  O     . THR B 1  290 ? -30.230 16.297 30.839  1.00 48.59 ? 287 THR B O     1 
ATOM   4338 C  CB    . THR B 1  290 ? -33.538 16.004 29.989  1.00 47.33 ? 287 THR B CB    1 
ATOM   4339 O  OG1   . THR B 1  290 ? -32.845 15.583 28.807  1.00 47.47 ? 287 THR B OG1   1 
ATOM   4340 C  CG2   . THR B 1  290 ? -34.773 16.818 29.598  1.00 47.60 ? 287 THR B CG2   1 
ATOM   4341 N  N     . ARG B 1  291 ? -31.603 14.810 31.850  1.00 50.30 ? 288 ARG B N     1 
ATOM   4342 C  CA    . ARG B 1  291 ? -30.541 13.879 32.217  1.00 51.64 ? 288 ARG B CA    1 
ATOM   4343 C  C     . ARG B 1  291 ? -29.750 13.361 30.999  1.00 52.01 ? 288 ARG B C     1 
ATOM   4344 O  O     . ARG B 1  291 ? -28.518 13.467 30.965  1.00 51.94 ? 288 ARG B O     1 
ATOM   4345 C  CB    . ARG B 1  291 ? -31.094 12.704 33.033  1.00 51.89 ? 288 ARG B CB    1 
ATOM   4346 C  CG    . ARG B 1  291 ? -29.994 11.747 33.447  1.00 53.62 ? 288 ARG B CG    1 
ATOM   4347 C  CD    . ARG B 1  291 ? -30.458 10.625 34.350  1.00 56.55 ? 288 ARG B CD    1 
ATOM   4348 N  NE    . ARG B 1  291 ? -29.301 9.839  34.788  1.00 58.33 ? 288 ARG B NE    1 
ATOM   4349 C  CZ    . ARG B 1  291 ? -28.826 8.774  34.146  1.00 58.84 ? 288 ARG B CZ    1 
ATOM   4350 N  NH1   . ARG B 1  291 ? -29.416 8.342  33.035  1.00 58.45 ? 288 ARG B NH1   1 
ATOM   4351 N  NH2   . ARG B 1  291 ? -27.763 8.135  34.624  1.00 59.84 ? 288 ARG B NH2   1 
ATOM   4352 N  N     . GLU B 1  292 ? -30.465 12.808 30.020  1.00 52.33 ? 289 GLU B N     1 
ATOM   4353 C  CA    . GLU B 1  292 ? -29.849 12.258 28.810  1.00 53.11 ? 289 GLU B CA    1 
ATOM   4354 C  C     . GLU B 1  292 ? -29.073 13.325 28.029  1.00 53.61 ? 289 GLU B C     1 
ATOM   4355 O  O     . GLU B 1  292 ? -28.035 13.027 27.441  1.00 53.97 ? 289 GLU B O     1 
ATOM   4356 C  CB    . GLU B 1  292 ? -30.903 11.600 27.909  1.00 52.87 ? 289 GLU B CB    1 
ATOM   4357 N  N     . GLU B 1  293 ? -29.575 14.561 28.030  1.00 54.03 ? 290 GLU B N     1 
ATOM   4358 C  CA    . GLU B 1  293 ? -28.882 15.675 27.367  1.00 54.32 ? 290 GLU B CA    1 
ATOM   4359 C  C     . GLU B 1  293 ? -27.564 16.024 28.067  1.00 55.17 ? 290 GLU B C     1 
ATOM   4360 O  O     . GLU B 1  293 ? -26.564 16.331 27.410  1.00 54.76 ? 290 GLU B O     1 
ATOM   4361 C  CB    . GLU B 1  293 ? -29.802 16.896 27.237  1.00 53.86 ? 290 GLU B CB    1 
ATOM   4362 C  CG    . GLU B 1  293 ? -30.936 16.679 26.237  1.00 52.11 ? 290 GLU B CG    1 
ATOM   4363 C  CD    . GLU B 1  293 ? -32.097 17.655 26.379  1.00 50.17 ? 290 GLU B CD    1 
ATOM   4364 O  OE1   . GLU B 1  293 ? -32.139 18.440 27.353  1.00 48.77 ? 290 GLU B OE1   1 
ATOM   4365 O  OE2   . GLU B 1  293 ? -32.975 17.645 25.490  1.00 48.96 ? 290 GLU B OE2   1 
ATOM   4366 N  N     . GLU B 1  294 ? -27.561 15.953 29.396  1.00 56.40 ? 291 GLU B N     1 
ATOM   4367 C  CA    . GLU B 1  294 ? -26.350 16.228 30.175  1.00 57.93 ? 291 GLU B CA    1 
ATOM   4368 C  C     . GLU B 1  294 ? -25.339 15.085 30.040  1.00 58.80 ? 291 GLU B C     1 
ATOM   4369 O  O     . GLU B 1  294 ? -24.128 15.315 30.083  1.00 58.54 ? 291 GLU B O     1 
ATOM   4370 C  CB    . GLU B 1  294 ? -26.689 16.496 31.650  1.00 57.85 ? 291 GLU B CB    1 
ATOM   4371 C  CG    . GLU B 1  294 ? -27.598 17.699 31.850  1.00 58.28 ? 291 GLU B CG    1 
ATOM   4372 C  CD    . GLU B 1  294 ? -27.714 18.142 33.295  1.00 59.18 ? 291 GLU B CD    1 
ATOM   4373 O  OE1   . GLU B 1  294 ? -27.941 17.276 34.169  1.00 60.23 ? 291 GLU B OE1   1 
ATOM   4374 O  OE2   . GLU B 1  294 ? -27.590 19.361 33.554  1.00 57.55 ? 291 GLU B OE2   1 
ATOM   4375 N  N     . LEU B 1  295 ? -25.856 13.867 29.862  1.00 60.25 ? 292 LEU B N     1 
ATOM   4376 C  CA    . LEU B 1  295 ? -25.030 12.680 29.628  1.00 61.78 ? 292 LEU B CA    1 
ATOM   4377 C  C     . LEU B 1  295 ? -24.322 12.713 28.279  1.00 62.92 ? 292 LEU B C     1 
ATOM   4378 O  O     . LEU B 1  295 ? -23.133 12.387 28.200  1.00 62.99 ? 292 LEU B O     1 
ATOM   4379 C  CB    . LEU B 1  295 ? -25.858 11.395 29.730  1.00 61.69 ? 292 LEU B CB    1 
ATOM   4380 C  CG    . LEU B 1  295 ? -26.265 10.852 31.105  1.00 61.69 ? 292 LEU B CG    1 
ATOM   4381 C  CD1   . LEU B 1  295 ? -26.923 9.485  30.931  1.00 61.54 ? 292 LEU B CD1   1 
ATOM   4382 C  CD2   . LEU B 1  295 ? -25.080 10.776 32.076  1.00 61.22 ? 292 LEU B CD2   1 
ATOM   4383 N  N     . SER B 1  296 ? -25.049 13.104 27.228  1.00 64.27 ? 293 SER B N     1 
ATOM   4384 C  CA    . SER B 1  296 ? -24.476 13.191 25.875  1.00 65.84 ? 293 SER B CA    1 
ATOM   4385 C  C     . SER B 1  296 ? -23.378 14.251 25.801  1.00 66.87 ? 293 SER B C     1 
ATOM   4386 O  O     . SER B 1  296 ? -22.388 14.073 25.097  1.00 66.90 ? 293 SER B O     1 
ATOM   4387 C  CB    . SER B 1  296 ? -25.557 13.450 24.813  1.00 65.73 ? 293 SER B CB    1 
ATOM   4388 O  OG    . SER B 1  296 ? -25.866 14.829 24.693  1.00 66.07 ? 293 SER B OG    1 
ATOM   4389 N  N     . LEU B 1  297 ? -23.567 15.349 26.529  1.00 68.47 ? 294 LEU B N     1 
ATOM   4390 C  CA    . LEU B 1  297 ? -22.548 16.382 26.656  1.00 70.23 ? 294 LEU B CA    1 
ATOM   4391 C  C     . LEU B 1  297 ? -21.330 15.838 27.415  1.00 71.66 ? 294 LEU B C     1 
ATOM   4392 O  O     . LEU B 1  297 ? -20.186 16.109 27.042  1.00 71.85 ? 294 LEU B O     1 
ATOM   4393 C  CB    . LEU B 1  297 ? -23.129 17.622 27.348  1.00 69.95 ? 294 LEU B CB    1 
ATOM   4394 C  CG    . LEU B 1  297 ? -22.232 18.834 27.630  1.00 69.98 ? 294 LEU B CG    1 
ATOM   4395 C  CD1   . LEU B 1  297 ? -21.698 19.460 26.347  1.00 70.52 ? 294 LEU B CD1   1 
ATOM   4396 C  CD2   . LEU B 1  297 ? -22.989 19.869 28.442  1.00 69.57 ? 294 LEU B CD2   1 
ATOM   4397 N  N     . LEU B 1  298 ? -21.599 15.062 28.468  1.00 73.46 ? 295 LEU B N     1 
ATOM   4398 C  CA    . LEU B 1  298 ? -20.576 14.409 29.292  1.00 75.08 ? 295 LEU B CA    1 
ATOM   4399 C  C     . LEU B 1  298 ? -19.792 13.341 28.511  1.00 76.06 ? 295 LEU B C     1 
ATOM   4400 O  O     . LEU B 1  298 ? -18.562 13.258 28.620  1.00 76.27 ? 295 LEU B O     1 
ATOM   4401 C  CB    . LEU B 1  298 ? -21.236 13.802 30.544  1.00 75.27 ? 295 LEU B CB    1 
ATOM   4402 C  CG    . LEU B 1  298 ? -20.532 12.768 31.437  1.00 76.06 ? 295 LEU B CG    1 
ATOM   4403 C  CD1   . LEU B 1  298 ? -19.308 13.361 32.149  1.00 76.51 ? 295 LEU B CD1   1 
ATOM   4404 C  CD2   . LEU B 1  298 ? -21.518 12.189 32.452  1.00 76.09 ? 295 LEU B CD2   1 
ATOM   4405 N  N     . GLN B 1  299 ? -20.516 12.537 27.732  1.00 77.20 ? 296 GLN B N     1 
ATOM   4406 C  CA    . GLN B 1  299 ? -19.934 11.503 26.871  1.00 78.42 ? 296 GLN B CA    1 
ATOM   4407 C  C     . GLN B 1  299 ? -19.038 12.088 25.770  1.00 79.07 ? 296 GLN B C     1 
ATOM   4408 O  O     . GLN B 1  299 ? -18.032 11.480 25.395  1.00 79.16 ? 296 GLN B O     1 
ATOM   4409 C  CB    . GLN B 1  299 ? -21.055 10.660 26.253  1.00 78.50 ? 296 GLN B CB    1 
ATOM   4410 C  CG    . GLN B 1  299 ? -20.599 9.416  25.491  1.00 79.51 ? 296 GLN B CG    1 
ATOM   4411 C  CD    . GLN B 1  299 ? -21.766 8.554  25.014  1.00 80.51 ? 296 GLN B CD    1 
ATOM   4412 O  OE1   . GLN B 1  299 ? -22.875 9.050  24.782  1.00 80.81 ? 296 GLN B OE1   1 
ATOM   4413 N  NE2   . GLN B 1  299 ? -21.518 7.258  24.865  1.00 80.36 ? 296 GLN B NE2   1 
ATOM   4414 N  N     . GLU B 1  300 ? -19.413 13.264 25.265  1.00 79.99 ? 297 GLU B N     1 
ATOM   4415 C  CA    . GLU B 1  300 ? -18.652 13.962 24.222  1.00 80.89 ? 297 GLU B CA    1 
ATOM   4416 C  C     . GLU B 1  300 ? -17.264 14.409 24.677  1.00 81.35 ? 297 GLU B C     1 
ATOM   4417 O  O     . GLU B 1  300 ? -16.293 14.299 23.924  1.00 81.56 ? 297 GLU B O     1 
ATOM   4418 C  CB    . GLU B 1  300 ? -19.442 15.155 23.663  1.00 80.96 ? 297 GLU B CB    1 
ATOM   4419 C  CG    . GLU B 1  300 ? -20.478 14.770 22.605  1.00 81.61 ? 297 GLU B CG    1 
ATOM   4420 C  CD    . GLU B 1  300 ? -19.912 13.839 21.539  1.00 82.36 ? 297 GLU B CD    1 
ATOM   4421 O  OE1   . GLU B 1  300 ? -18.968 14.250 20.822  1.00 82.45 ? 297 GLU B OE1   1 
ATOM   4422 O  OE2   . GLU B 1  300 ? -20.411 12.697 21.425  1.00 82.17 ? 297 GLU B OE2   1 
ATOM   4423 N  N     . ILE B 1  301 ? -17.173 14.913 25.904  1.00 81.88 ? 298 ILE B N     1 
ATOM   4424 C  CA    . ILE B 1  301 ? -15.887 15.332 26.460  1.00 82.36 ? 298 ILE B CA    1 
ATOM   4425 C  C     . ILE B 1  301 ? -15.018 14.121 26.818  1.00 82.61 ? 298 ILE B C     1 
ATOM   4426 O  O     . ILE B 1  301 ? -13.795 14.161 26.658  1.00 82.71 ? 298 ILE B O     1 
ATOM   4427 C  CB    . ILE B 1  301 ? -16.098 16.217 27.703  1.00 82.35 ? 298 ILE B CB    1 
ATOM   4428 C  CG1   . ILE B 1  301 ? -16.766 17.537 27.311  1.00 82.43 ? 298 ILE B CG1   1 
ATOM   4429 C  CG2   . ILE B 1  301 ? -14.774 16.473 28.406  1.00 82.44 ? 298 ILE B CG2   1 
ATOM   4430 C  CD1   . ILE B 1  301 ? -17.248 18.351 28.490  1.00 82.50 ? 298 ILE B CD1   1 
ATOM   4431 N  N     . ARG B 1  302 ? -15.663 13.044 27.270  1.00 82.88 ? 299 ARG B N     1 
ATOM   4432 C  CA    . ARG B 1  302 ? -14.985 11.778 27.587  1.00 83.05 ? 299 ARG B CA    1 
ATOM   4433 C  C     . ARG B 1  302 ? -14.686 10.931 26.340  1.00 83.12 ? 299 ARG B C     1 
ATOM   4434 O  O     . ARG B 1  302 ? -14.372 11.453 25.264  1.00 83.14 ? 299 ARG B O     1 
ATOM   4435 C  CB    . ARG B 1  302 ? -15.817 10.960 28.586  1.00 82.95 ? 299 ARG B CB    1 
ATOM   4436 O  "O5'" . DA  C 2  1   ? -50.119 23.916 -11.830 1.00 72.05 ? 1   DA  C "O5'" 1 
ATOM   4437 C  "C5'" . DA  C 2  1   ? -51.467 23.415 -11.824 1.00 72.88 ? 1   DA  C "C5'" 1 
ATOM   4438 C  "C4'" . DA  C 2  1   ? -52.412 24.390 -11.129 1.00 71.67 ? 1   DA  C "C4'" 1 
ATOM   4439 O  "O4'" . DA  C 2  1   ? -53.782 24.212 -11.579 1.00 72.82 ? 1   DA  C "O4'" 1 
ATOM   4440 C  "C3'" . DA  C 2  1   ? -52.467 24.327 -9.596  1.00 70.69 ? 1   DA  C "C3'" 1 
ATOM   4441 O  "O3'" . DA  C 2  1   ? -52.406 25.658 -9.057  1.00 66.00 ? 1   DA  C "O3'" 1 
ATOM   4442 C  "C2'" . DA  C 2  1   ? -53.836 23.698 -9.321  1.00 72.26 ? 1   DA  C "C2'" 1 
ATOM   4443 C  "C1'" . DA  C 2  1   ? -54.595 24.418 -10.434 1.00 74.10 ? 1   DA  C "C1'" 1 
ATOM   4444 N  N9    . DA  C 2  1   ? -55.997 24.041 -10.677 1.00 75.51 ? 1   DA  C N9    1 
ATOM   4445 C  C8    . DA  C 2  1   ? -57.095 24.625 -10.104 1.00 75.62 ? 1   DA  C C8    1 
ATOM   4446 N  N7    . DA  C 2  1   ? -58.246 24.132 -10.493 1.00 76.06 ? 1   DA  C N7    1 
ATOM   4447 C  C5    . DA  C 2  1   ? -57.886 23.144 -11.392 1.00 76.11 ? 1   DA  C C5    1 
ATOM   4448 C  C6    . DA  C 2  1   ? -58.652 22.239 -12.160 1.00 76.32 ? 1   DA  C C6    1 
ATOM   4449 N  N6    . DA  C 2  1   ? -59.987 22.197 -12.131 1.00 76.80 ? 1   DA  C N6    1 
ATOM   4450 N  N1    . DA  C 2  1   ? -57.986 21.374 -12.961 1.00 76.69 ? 1   DA  C N1    1 
ATOM   4451 C  C2    . DA  C 2  1   ? -56.641 21.425 -12.983 1.00 76.32 ? 1   DA  C C2    1 
ATOM   4452 N  N3    . DA  C 2  1   ? -55.812 22.226 -12.312 1.00 76.17 ? 1   DA  C N3    1 
ATOM   4453 C  C4    . DA  C 2  1   ? -56.502 23.072 -11.522 1.00 76.02 ? 1   DA  C C4    1 
ATOM   4454 P  P     . DT  C 2  2   ? -51.045 26.513 -8.899  1.00 63.85 ? 2   DT  C P     1 
ATOM   4455 O  OP1   . DT  C 2  2   ? -49.834 25.652 -9.092  1.00 61.78 ? 2   DT  C OP1   1 
ATOM   4456 O  OP2   . DT  C 2  2   ? -51.211 27.278 -7.640  1.00 63.86 ? 2   DT  C OP2   1 
ATOM   4457 O  "O5'" . DT  C 2  2   ? -51.168 27.584 -10.111 1.00 59.17 ? 2   DT  C "O5'" 1 
ATOM   4458 C  "C5'" . DT  C 2  2   ? -51.034 27.179 -11.500 1.00 52.20 ? 2   DT  C "C5'" 1 
ATOM   4459 C  "C4'" . DT  C 2  2   ? -51.617 28.179 -12.486 1.00 47.25 ? 2   DT  C "C4'" 1 
ATOM   4460 O  "O4'" . DT  C 2  2   ? -53.040 28.344 -12.289 1.00 46.51 ? 2   DT  C "O4'" 1 
ATOM   4461 C  "C3'" . DT  C 2  2   ? -50.986 29.566 -12.398 1.00 43.65 ? 2   DT  C "C3'" 1 
ATOM   4462 O  "O3'" . DT  C 2  2   ? -50.496 29.931 -13.683 1.00 36.11 ? 2   DT  C "O3'" 1 
ATOM   4463 C  "C2'" . DT  C 2  2   ? -52.111 30.476 -11.920 1.00 46.07 ? 2   DT  C "C2'" 1 
ATOM   4464 C  "C1'" . DT  C 2  2   ? -53.387 29.716 -12.266 1.00 49.84 ? 2   DT  C "C1'" 1 
ATOM   4465 N  N1    . DT  C 2  2   ? -54.536 29.873 -11.295 1.00 54.66 ? 2   DT  C N1    1 
ATOM   4466 C  C2    . DT  C 2  2   ? -55.000 31.102 -10.804 1.00 57.87 ? 2   DT  C C2    1 
ATOM   4467 O  O2    . DT  C 2  2   ? -54.561 32.213 -11.073 1.00 56.87 ? 2   DT  C O2    1 
ATOM   4468 N  N3    . DT  C 2  2   ? -56.060 31.000 -9.925  1.00 60.77 ? 2   DT  C N3    1 
ATOM   4469 C  C4    . DT  C 2  2   ? -56.698 29.848 -9.478  1.00 60.93 ? 2   DT  C C4    1 
ATOM   4470 O  O4    . DT  C 2  2   ? -57.635 29.861 -8.682  1.00 62.84 ? 2   DT  C O4    1 
ATOM   4471 C  C5    . DT  C 2  2   ? -56.168 28.624 -10.005 1.00 60.05 ? 2   DT  C C5    1 
ATOM   4472 C  C7    . DT  C 2  2   ? -56.777 27.323 -9.590  1.00 60.15 ? 2   DT  C C7    1 
ATOM   4473 C  C6    . DT  C 2  2   ? -55.138 28.697 -10.868 1.00 58.53 ? 2   DT  C C6    1 
ATOM   4474 P  P     . DT  C 2  3   ? -49.428 31.099 -13.927 1.00 31.59 ? 3   DT  C P     1 
ATOM   4475 O  OP1   . DT  C 2  3   ? -48.755 30.705 -15.199 1.00 31.17 ? 3   DT  C OP1   1 
ATOM   4476 O  OP2   . DT  C 2  3   ? -48.590 31.340 -12.728 1.00 31.40 ? 3   DT  C OP2   1 
ATOM   4477 O  "O5'" . DT  C 2  3   ? -50.339 32.390 -14.093 1.00 28.66 ? 3   DT  C "O5'" 1 
ATOM   4478 C  "C5'" . DT  C 2  3   ? -51.205 32.555 -15.208 1.00 29.14 ? 3   DT  C "C5'" 1 
ATOM   4479 C  "C4'" . DT  C 2  3   ? -51.792 33.953 -15.187 1.00 30.47 ? 3   DT  C "C4'" 1 
ATOM   4480 O  "O4'" . DT  C 2  3   ? -52.546 34.123 -13.953 1.00 31.82 ? 3   DT  C "O4'" 1 
ATOM   4481 C  "C3'" . DT  C 2  3   ? -50.791 35.115 -15.239 1.00 30.55 ? 3   DT  C "C3'" 1 
ATOM   4482 O  "O3'" . DT  C 2  3   ? -51.372 36.207 -15.927 1.00 28.42 ? 3   DT  C "O3'" 1 
ATOM   4483 C  "C2'" . DT  C 2  3   ? -50.626 35.535 -13.783 1.00 30.51 ? 3   DT  C "C2'" 1 
ATOM   4484 C  "C1'" . DT  C 2  3   ? -52.035 35.246 -13.250 1.00 30.62 ? 3   DT  C "C1'" 1 
ATOM   4485 N  N1    . DT  C 2  3   ? -52.032 34.970 -11.786 1.00 32.05 ? 3   DT  C N1    1 
ATOM   4486 C  C2    . DT  C 2  3   ? -52.832 35.747 -10.966 1.00 32.67 ? 3   DT  C C2    1 
ATOM   4487 O  O2    . DT  C 2  3   ? -53.582 36.642 -11.332 1.00 34.33 ? 3   DT  C O2    1 
ATOM   4488 N  N3    . DT  C 2  3   ? -52.742 35.424 -9.644  1.00 34.41 ? 3   DT  C N3    1 
ATOM   4489 C  C4    . DT  C 2  3   ? -51.968 34.452 -9.055  1.00 33.66 ? 3   DT  C C4    1 
ATOM   4490 O  O4    . DT  C 2  3   ? -51.998 34.290 -7.848  1.00 36.61 ? 3   DT  C O4    1 
ATOM   4491 C  C5    . DT  C 2  3   ? -51.133 33.681 -9.942  1.00 33.42 ? 3   DT  C C5    1 
ATOM   4492 C  C7    . DT  C 2  3   ? -50.253 32.595 -9.380  1.00 31.51 ? 3   DT  C C7    1 
ATOM   4493 C  C6    . DT  C 2  3   ? -51.210 33.967 -11.264 1.00 32.04 ? 3   DT  C C6    1 
ATOM   4494 P  P     . DG  C 2  4   ? -50.687 36.809 -17.229 1.00 27.45 ? 4   DG  C P     1 
ATOM   4495 O  OP1   . DG  C 2  4   ? -51.539 37.935 -17.654 1.00 24.77 ? 4   DG  C OP1   1 
ATOM   4496 O  OP2   . DG  C 2  4   ? -50.319 35.683 -18.124 1.00 26.94 ? 4   DG  C OP2   1 
ATOM   4497 O  "O5'" . DG  C 2  4   ? -49.305 37.369 -16.663 1.00 27.42 ? 4   DG  C "O5'" 1 
ATOM   4498 C  "C5'" . DG  C 2  4   ? -49.269 38.632 -16.035 1.00 28.56 ? 4   DG  C "C5'" 1 
ATOM   4499 C  "C4'" . DG  C 2  4   ? -47.888 38.895 -15.495 1.00 27.99 ? 4   DG  C "C4'" 1 
ATOM   4500 O  "O4'" . DG  C 2  4   ? -46.925 38.946 -16.582 1.00 28.84 ? 4   DG  C "O4'" 1 
ATOM   4501 C  "C3'" . DG  C 2  4   ? -47.780 40.230 -14.753 1.00 27.14 ? 4   DG  C "C3'" 1 
ATOM   4502 O  "O3'" . DG  C 2  4   ? -47.197 39.964 -13.452 1.00 25.12 ? 4   DG  C "O3'" 1 
ATOM   4503 C  "C2'" . DG  C 2  4   ? -46.914 41.103 -15.675 1.00 26.74 ? 4   DG  C "C2'" 1 
ATOM   4504 C  "C1'" . DG  C 2  4   ? -46.051 40.043 -16.346 1.00 28.47 ? 4   DG  C "C1'" 1 
ATOM   4505 N  N9    . DG  C 2  4   ? -45.459 40.418 -17.622 1.00 27.93 ? 4   DG  C N9    1 
ATOM   4506 C  C8    . DG  C 2  4   ? -46.123 40.699 -18.801 1.00 26.98 ? 4   DG  C C8    1 
ATOM   4507 N  N7    . DG  C 2  4   ? -45.318 40.977 -19.791 1.00 25.97 ? 4   DG  C N7    1 
ATOM   4508 C  C5    . DG  C 2  4   ? -44.046 40.862 -19.250 1.00 26.56 ? 4   DG  C C5    1 
ATOM   4509 C  C6    . DG  C 2  4   ? -42.772 41.054 -19.843 1.00 28.21 ? 4   DG  C C6    1 
ATOM   4510 O  O6    . DG  C 2  4   ? -42.513 41.370 -21.020 1.00 29.99 ? 4   DG  C O6    1 
ATOM   4511 N  N1    . DG  C 2  4   ? -41.726 40.845 -18.933 1.00 27.88 ? 4   DG  C N1    1 
ATOM   4512 C  C2    . DG  C 2  4   ? -41.897 40.496 -17.601 1.00 27.26 ? 4   DG  C C2    1 
ATOM   4513 N  N2    . DG  C 2  4   ? -40.786 40.322 -16.857 1.00 24.78 ? 4   DG  C N2    1 
ATOM   4514 N  N3    . DG  C 2  4   ? -43.085 40.302 -17.047 1.00 25.48 ? 4   DG  C N3    1 
ATOM   4515 C  C4    . DG  C 2  4   ? -44.112 40.507 -17.912 1.00 27.11 ? 4   DG  C C4    1 
ATOM   4516 P  P     . DT  C 2  5   ? -47.068 41.100 -12.336 1.00 25.35 ? 5   DT  C P     1 
ATOM   4517 O  OP1   . DT  C 2  5   ? -46.886 40.352 -11.067 1.00 25.27 ? 5   DT  C OP1   1 
ATOM   4518 O  OP2   . DT  C 2  5   ? -48.117 42.126 -12.542 1.00 23.97 ? 5   DT  C OP2   1 
ATOM   4519 O  "O5'" . DT  C 2  5   ? -45.709 41.866 -12.698 1.00 24.87 ? 5   DT  C "O5'" 1 
ATOM   4520 C  "C5'" . DT  C 2  5   ? -44.461 41.184 -12.515 1.00 23.68 ? 5   DT  C "C5'" 1 
ATOM   4521 C  "C4'" . DT  C 2  5   ? -43.315 42.076 -12.950 1.00 25.19 ? 5   DT  C "C4'" 1 
ATOM   4522 O  "O4'" . DT  C 2  5   ? -43.335 42.248 -14.382 1.00 25.87 ? 5   DT  C "O4'" 1 
ATOM   4523 C  "C3'" . DT  C 2  5   ? -43.315 43.497 -12.380 1.00 26.06 ? 5   DT  C "C3'" 1 
ATOM   4524 O  "O3'" . DT  C 2  5   ? -42.334 43.515 -11.335 1.00 28.40 ? 5   DT  C "O3'" 1 
ATOM   4525 C  "C2'" . DT  C 2  5   ? -42.948 44.428 -13.545 1.00 24.81 ? 5   DT  C "C2'" 1 
ATOM   4526 C  "C1'" . DT  C 2  5   ? -42.614 43.437 -14.660 1.00 26.78 ? 5   DT  C "C1'" 1 
ATOM   4527 N  N1    . DT  C 2  5   ? -42.997 43.778 -16.074 1.00 26.64 ? 5   DT  C N1    1 
ATOM   4528 C  C2    . DT  C 2  5   ? -41.979 43.913 -16.991 1.00 26.05 ? 5   DT  C C2    1 
ATOM   4529 O  O2    . DT  C 2  5   ? -40.805 43.797 -16.709 1.00 25.70 ? 5   DT  C O2    1 
ATOM   4530 N  N3    . DT  C 2  5   ? -42.385 44.185 -18.271 1.00 27.55 ? 5   DT  C N3    1 
ATOM   4531 C  C4    . DT  C 2  5   ? -43.686 44.336 -18.705 1.00 26.73 ? 5   DT  C C4    1 
ATOM   4532 O  O4    . DT  C 2  5   ? -43.918 44.560 -19.884 1.00 26.58 ? 5   DT  C O4    1 
ATOM   4533 C  C5    . DT  C 2  5   ? -44.712 44.194 -17.694 1.00 27.29 ? 5   DT  C C5    1 
ATOM   4534 C  C7    . DT  C 2  5   ? -46.167 44.368 -18.049 1.00 25.47 ? 5   DT  C C7    1 
ATOM   4535 C  C6    . DT  C 2  5   ? -44.323 43.916 -16.437 1.00 26.48 ? 5   DT  C C6    1 
ATOM   4536 P  P     . DC  C 2  6   ? -42.171 44.761 -10.329 1.00 28.41 ? 6   DC  C P     1 
ATOM   4537 O  OP1   . DC  C 2  6   ? -41.450 44.239 -9.152  1.00 29.02 ? 6   DC  C OP1   1 
ATOM   4538 O  OP2   . DC  C 2  6   ? -43.451 45.461 -10.183 1.00 27.19 ? 6   DC  C OP2   1 
ATOM   4539 O  "O5'" . DC  C 2  6   ? -41.255 45.778 -11.151 1.00 27.71 ? 6   DC  C "O5'" 1 
ATOM   4540 C  "C5'" . DC  C 2  6   ? -39.922 45.385 -11.528 1.00 25.71 ? 6   DC  C "C5'" 1 
ATOM   4541 C  "C4'" . DC  C 2  6   ? -39.336 46.446 -12.445 1.00 26.39 ? 6   DC  C "C4'" 1 
ATOM   4542 O  "O4'" . DC  C 2  6   ? -39.959 46.364 -13.757 1.00 26.89 ? 6   DC  C "O4'" 1 
ATOM   4543 C  "C3'" . DC  C 2  6   ? -39.516 47.901 -12.008 1.00 27.14 ? 6   DC  C "C3'" 1 
ATOM   4544 O  "O3'" . DC  C 2  6   ? -38.293 48.588 -12.278 1.00 26.87 ? 6   DC  C "O3'" 1 
ATOM   4545 C  "C2'" . DC  C 2  6   ? -40.650 48.406 -12.903 1.00 24.74 ? 6   DC  C "C2'" 1 
ATOM   4546 C  "C1'" . DC  C 2  6   ? -40.230 47.682 -14.186 1.00 26.07 ? 6   DC  C "C1'" 1 
ATOM   4547 N  N1    . DC  C 2  6   ? -41.199 47.631 -15.327 1.00 25.85 ? 6   DC  C N1    1 
ATOM   4548 C  C2    . DC  C 2  6   ? -40.676 47.521 -16.619 1.00 27.68 ? 6   DC  C C2    1 
ATOM   4549 O  O2    . DC  C 2  6   ? -39.443 47.476 -16.775 1.00 30.87 ? 6   DC  C O2    1 
ATOM   4550 N  N3    . DC  C 2  6   ? -41.539 47.467 -17.672 1.00 26.86 ? 6   DC  C N3    1 
ATOM   4551 C  C4    . DC  C 2  6   ? -42.875 47.536 -17.464 1.00 26.33 ? 6   DC  C C4    1 
ATOM   4552 N  N4    . DC  C 2  6   ? -43.659 47.471 -18.542 1.00 23.88 ? 6   DC  C N4    1 
ATOM   4553 C  C5    . DC  C 2  6   ? -43.441 47.638 -16.148 1.00 24.84 ? 6   DC  C C5    1 
ATOM   4554 C  C6    . DC  C 2  6   ? -42.566 47.685 -15.125 1.00 24.14 ? 6   DC  C C6    1 
ATOM   4555 P  P     . DA  C 2  7   ? -37.612 49.515 -11.179 1.00 26.21 ? 7   DA  C P     1 
ATOM   4556 O  OP1   . DA  C 2  7   ? -37.109 48.689 -10.068 1.00 28.77 ? 7   DA  C OP1   1 
ATOM   4557 O  OP2   . DA  C 2  7   ? -38.518 50.656 -10.894 1.00 25.63 ? 7   DA  C OP2   1 
ATOM   4558 O  "O5'" . DA  C 2  7   ? -36.306 50.057 -11.943 1.00 26.59 ? 7   DA  C "O5'" 1 
ATOM   4559 C  "C5'" . DA  C 2  7   ? -35.287 49.154 -12.339 1.00 26.52 ? 7   DA  C "C5'" 1 
ATOM   4560 C  "C4'" . DA  C 2  7   ? -34.508 49.682 -13.539 1.00 27.25 ? 7   DA  C "C4'" 1 
ATOM   4561 O  "O4'" . DA  C 2  7   ? -35.297 49.618 -14.757 1.00 26.20 ? 7   DA  C "O4'" 1 
ATOM   4562 C  "C3'" . DA  C 2  7   ? -34.044 51.139 -13.433 1.00 27.73 ? 7   DA  C "C3'" 1 
ATOM   4563 O  "O3'" . DA  C 2  7   ? -32.765 51.228 -14.067 1.00 28.26 ? 7   DA  C "O3'" 1 
ATOM   4564 C  "C2'" . DA  C 2  7   ? -35.138 51.923 -14.169 1.00 27.30 ? 7   DA  C "C2'" 1 
ATOM   4565 C  "C1'" . DA  C 2  7   ? -35.558 50.930 -15.253 1.00 26.35 ? 7   DA  C "C1'" 1 
ATOM   4566 N  N9    . DA  C 2  7   ? -36.978 50.929 -15.566 1.00 25.50 ? 7   DA  C N9    1 
ATOM   4567 C  C8    . DA  C 2  7   ? -38.006 50.917 -14.663 1.00 25.07 ? 7   DA  C C8    1 
ATOM   4568 N  N7    . DA  C 2  7   ? -39.196 50.904 -15.217 1.00 24.65 ? 7   DA  C N7    1 
ATOM   4569 C  C5    . DA  C 2  7   ? -38.948 50.866 -16.579 1.00 23.60 ? 7   DA  C C5    1 
ATOM   4570 C  C6    . DA  C 2  7   ? -39.801 50.817 -17.709 1.00 23.26 ? 7   DA  C C6    1 
ATOM   4571 N  N6    . DA  C 2  7   ? -41.139 50.804 -17.629 1.00 19.61 ? 7   DA  C N6    1 
ATOM   4572 N  N1    . DA  C 2  7   ? -39.226 50.809 -18.931 1.00 23.58 ? 7   DA  C N1    1 
ATOM   4573 C  C2    . DA  C 2  7   ? -37.894 50.832 -19.022 1.00 23.44 ? 7   DA  C C2    1 
ATOM   4574 N  N3    . DA  C 2  7   ? -37.005 50.879 -18.022 1.00 24.90 ? 7   DA  C N3    1 
ATOM   4575 C  C4    . DA  C 2  7   ? -37.584 50.890 -16.816 1.00 24.41 ? 7   DA  C C4    1 
ATOM   4576 P  P     . DT  C 2  8   ? -31.945 52.609 -14.144 1.00 29.10 ? 8   DT  C P     1 
ATOM   4577 O  OP1   . DT  C 2  8   ? -30.565 52.187 -14.470 1.00 27.37 ? 8   DT  C OP1   1 
ATOM   4578 O  OP2   . DT  C 2  8   ? -32.236 53.415 -12.951 1.00 24.88 ? 8   DT  C OP2   1 
ATOM   4579 O  "O5'" . DT  C 2  8   ? -32.601 53.361 -15.393 1.00 28.36 ? 8   DT  C "O5'" 1 
ATOM   4580 C  "C5'" . DT  C 2  8   ? -32.402 52.856 -16.720 1.00 27.12 ? 8   DT  C "C5'" 1 
ATOM   4581 C  "C4'" . DT  C 2  8   ? -33.191 53.657 -17.733 1.00 27.85 ? 8   DT  C "C4'" 1 
ATOM   4582 O  "O4'" . DT  C 2  8   ? -34.591 53.433 -17.492 1.00 24.91 ? 8   DT  C "O4'" 1 
ATOM   4583 C  "C3'" . DT  C 2  8   ? -33.079 55.177 -17.596 1.00 30.85 ? 8   DT  C "C3'" 1 
ATOM   4584 O  "O3'" . DT  C 2  8   ? -32.083 55.729 -18.449 1.00 36.55 ? 8   DT  C "O3'" 1 
ATOM   4585 C  "C2'" . DT  C 2  8   ? -34.464 55.748 -17.927 1.00 27.59 ? 8   DT  C "C2'" 1 
ATOM   4586 C  "C1'" . DT  C 2  8   ? -35.270 54.480 -18.155 1.00 26.03 ? 8   DT  C "C1'" 1 
ATOM   4587 N  N1    . DT  C 2  8   ? -36.641 54.428 -17.591 1.00 24.06 ? 8   DT  C N1    1 
ATOM   4588 C  C2    . DT  C 2  8   ? -37.691 54.324 -18.471 1.00 23.51 ? 8   DT  C C2    1 
ATOM   4589 O  O2    . DT  C 2  8   ? -37.557 54.291 -19.687 1.00 22.75 ? 8   DT  C O2    1 
ATOM   4590 N  N3    . DT  C 2  8   ? -38.926 54.250 -17.881 1.00 23.51 ? 8   DT  C N3    1 
ATOM   4591 C  C4    . DT  C 2  8   ? -39.178 54.253 -16.518 1.00 23.27 ? 8   DT  C C4    1 
ATOM   4592 O  O4    . DT  C 2  8   ? -40.318 54.164 -16.084 1.00 24.10 ? 8   DT  C O4    1 
ATOM   4593 C  C5    . DT  C 2  8   ? -38.032 54.370 -15.648 1.00 23.02 ? 8   DT  C C5    1 
ATOM   4594 C  C7    . DT  C 2  8   ? -38.224 54.398 -14.148 1.00 24.54 ? 8   DT  C C7    1 
ATOM   4595 C  C6    . DT  C 2  8   ? -36.822 54.446 -16.215 1.00 23.69 ? 8   DT  C C6    1 
ATOM   4596 P  P     . DG  C 2  9   ? -31.497 57.194 -18.014 1.00 41.34 ? 9   DG  C P     1 
ATOM   4597 O  OP1   . DG  C 2  9   ? -30.047 57.087 -17.996 1.00 36.51 ? 9   DG  C OP1   1 
ATOM   4598 O  OP2   . DG  C 2  9   ? -32.075 57.780 -16.744 1.00 36.76 ? 9   DG  C OP2   1 
ATOM   4599 O  "O5'" . DG  C 2  9   ? -32.036 58.049 -19.296 1.00 36.59 ? 9   DG  C "O5'" 1 
ATOM   4600 C  "C5'" . DG  C 2  9   ? -32.609 57.618 -20.536 1.00 32.96 ? 9   DG  C "C5'" 1 
ATOM   4601 C  "C4'" . DG  C 2  9   ? -33.609 58.651 -21.076 1.00 30.06 ? 9   DG  C "C4'" 1 
ATOM   4602 O  "O4'" . DG  C 2  9   ? -34.898 58.396 -20.450 1.00 29.49 ? 9   DG  C "O4'" 1 
ATOM   4603 C  "C3'" . DG  C 2  9   ? -33.310 60.125 -20.759 1.00 29.29 ? 9   DG  C "C3'" 1 
ATOM   4604 O  "O3'" . DG  C 2  9   ? -33.824 61.067 -21.729 1.00 30.20 ? 9   DG  C "O3'" 1 
ATOM   4605 C  "C2'" . DG  C 2  9   ? -34.027 60.340 -19.434 1.00 27.74 ? 9   DG  C "C2'" 1 
ATOM   4606 C  "C1'" . DG  C 2  9   ? -35.285 59.516 -19.675 1.00 28.12 ? 9   DG  C "C1'" 1 
ATOM   4607 N  N9    . DG  C 2  9   ? -35.965 59.039 -18.475 1.00 27.22 ? 9   DG  C N9    1 
ATOM   4608 C  C8    . DG  C 2  9   ? -35.499 58.936 -17.184 1.00 25.60 ? 9   DG  C C8    1 
ATOM   4609 N  N7    . DG  C 2  9   ? -36.393 58.469 -16.352 1.00 24.63 ? 9   DG  C N7    1 
ATOM   4610 C  C5    . DG  C 2  9   ? -37.524 58.264 -17.125 1.00 25.45 ? 9   DG  C C5    1 
ATOM   4611 C  C6    . DG  C 2  9   ? -38.813 57.765 -16.803 1.00 25.07 ? 9   DG  C C6    1 
ATOM   4612 O  O6    . DG  C 2  9   ? -39.239 57.403 -15.701 1.00 26.03 ? 9   DG  C O6    1 
ATOM   4613 N  N1    . DG  C 2  9   ? -39.668 57.716 -17.911 1.00 23.92 ? 9   DG  C N1    1 
ATOM   4614 C  C2    . DG  C 2  9   ? -39.303 58.094 -19.187 1.00 26.50 ? 9   DG  C C2    1 
ATOM   4615 N  N2    . DG  C 2  9   ? -40.213 58.010 -20.168 1.00 25.93 ? 9   DG  C N2    1 
ATOM   4616 N  N3    . DG  C 2  9   ? -38.105 58.546 -19.498 1.00 26.84 ? 9   DG  C N3    1 
ATOM   4617 C  C4    . DG  C 2  9   ? -37.272 58.617 -18.431 1.00 26.68 ? 9   DG  C C4    1 
ATOM   4618 P  P     . DG  C 2  10  ? -32.956 61.503 -22.993 1.00 31.76 ? 10  DG  C P     1 
ATOM   4619 O  OP1   . DG  C 2  10  ? -32.399 60.297 -23.642 1.00 33.14 ? 10  DG  C OP1   1 
ATOM   4620 O  OP2   . DG  C 2  10  ? -31.987 62.547 -22.610 1.00 32.28 ? 10  DG  C OP2   1 
ATOM   4621 O  "O5'" . DG  C 2  10  ? -34.094 62.138 -23.916 1.00 30.98 ? 10  DG  C "O5'" 1 
ATOM   4622 C  "C5'" . DG  C 2  10  ? -34.720 63.333 -23.550 1.00 31.00 ? 10  DG  C "C5'" 1 
ATOM   4623 C  "C4'" . DG  C 2  10  ? -36.184 63.216 -23.883 1.00 30.30 ? 10  DG  C "C4'" 1 
ATOM   4624 O  "O4'" . DG  C 2  10  ? -36.847 62.346 -22.940 1.00 29.34 ? 10  DG  C "O4'" 1 
ATOM   4625 C  "C3'" . DG  C 2  10  ? -36.936 64.529 -23.833 1.00 33.40 ? 10  DG  C "C3'" 1 
ATOM   4626 O  "O3'" . DG  C 2  10  ? -37.872 64.534 -24.904 1.00 37.50 ? 10  DG  C "O3'" 1 
ATOM   4627 C  "C2'" . DG  C 2  10  ? -37.651 64.485 -22.487 1.00 31.19 ? 10  DG  C "C2'" 1 
ATOM   4628 C  "C1'" . DG  C 2  10  ? -37.933 62.994 -22.321 1.00 29.61 ? 10  DG  C "C1'" 1 
ATOM   4629 N  N9    . DG  C 2  10  ? -37.933 62.615 -20.910 1.00 29.35 ? 10  DG  C N9    1 
ATOM   4630 C  C8    . DG  C 2  10  ? -36.900 62.767 -20.010 1.00 30.51 ? 10  DG  C C8    1 
ATOM   4631 N  N7    . DG  C 2  10  ? -37.199 62.338 -18.802 1.00 30.26 ? 10  DG  C N7    1 
ATOM   4632 C  C5    . DG  C 2  10  ? -38.513 61.878 -18.913 1.00 28.99 ? 10  DG  C C5    1 
ATOM   4633 C  C6    . DG  C 2  10  ? -39.376 61.297 -17.948 1.00 28.17 ? 10  DG  C C6    1 
ATOM   4634 O  O6    . DG  C 2  10  ? -39.177 61.056 -16.750 1.00 27.79 ? 10  DG  C O6    1 
ATOM   4635 N  N1    . DG  C 2  10  ? -40.610 60.984 -18.480 1.00 27.69 ? 10  DG  C N1    1 
ATOM   4636 C  C2    . DG  C 2  10  ? -40.990 61.192 -19.787 1.00 28.94 ? 10  DG  C C2    1 
ATOM   4637 N  N2    . DG  C 2  10  ? -42.248 60.815 -20.086 1.00 26.58 ? 10  DG  C N2    1 
ATOM   4638 N  N3    . DG  C 2  10  ? -40.195 61.718 -20.715 1.00 27.54 ? 10  DG  C N3    1 
ATOM   4639 C  C4    . DG  C 2  10  ? -38.975 62.041 -20.208 1.00 29.21 ? 10  DG  C C4    1 
ATOM   4640 P  P     . DA  C 2  11  ? -38.773 65.824 -25.241 1.00 40.98 ? 11  DA  C P     1 
ATOM   4641 O  OP1   . DA  C 2  11  ? -38.942 65.818 -26.710 1.00 43.03 ? 11  DA  C OP1   1 
ATOM   4642 O  OP2   . DA  C 2  11  ? -38.232 67.018 -24.567 1.00 41.73 ? 11  DA  C OP2   1 
ATOM   4643 O  "O5'" . DA  C 2  11  ? -40.147 65.504 -24.539 1.00 40.58 ? 11  DA  C "O5'" 1 
ATOM   4644 C  "C5'" . DA  C 2  11  ? -40.941 64.418 -24.948 1.00 40.12 ? 11  DA  C "C5'" 1 
ATOM   4645 C  "C4'" . DA  C 2  11  ? -42.269 64.502 -24.212 1.00 39.92 ? 11  DA  C "C4'" 1 
ATOM   4646 O  "O4'" . DA  C 2  11  ? -42.112 64.146 -22.807 1.00 40.55 ? 11  DA  C "O4'" 1 
ATOM   4647 C  "C3'" . DA  C 2  11  ? -42.931 65.873 -24.189 1.00 40.99 ? 11  DA  C "C3'" 1 
ATOM   4648 O  "O3'" . DA  C 2  11  ? -44.311 65.571 -24.229 1.00 43.99 ? 11  DA  C "O3'" 1 
ATOM   4649 C  "C2'" . DA  C 2  11  ? -42.509 66.467 -22.837 1.00 39.03 ? 11  DA  C "C2'" 1 
ATOM   4650 C  "C1'" . DA  C 2  11  ? -42.548 65.209 -21.960 1.00 38.51 ? 11  DA  C "C1'" 1 
ATOM   4651 N  N9    . DA  C 2  11  ? -41.640 65.185 -20.815 1.00 35.26 ? 11  DA  C N9    1 
ATOM   4652 C  C8    . DA  C 2  11  ? -40.345 65.629 -20.802 1.00 34.81 ? 11  DA  C C8    1 
ATOM   4653 N  N7    . DA  C 2  11  ? -39.741 65.466 -19.641 1.00 34.24 ? 11  DA  C N7    1 
ATOM   4654 C  C5    . DA  C 2  11  ? -40.696 64.856 -18.843 1.00 33.92 ? 11  DA  C C5    1 
ATOM   4655 C  C6    . DA  C 2  11  ? -40.675 64.420 -17.493 1.00 33.01 ? 11  DA  C C6    1 
ATOM   4656 N  N6    . DA  C 2  11  ? -39.604 64.528 -16.690 1.00 32.04 ? 11  DA  C N6    1 
ATOM   4657 N  N1    . DA  C 2  11  ? -41.801 63.863 -17.002 1.00 33.22 ? 11  DA  C N1    1 
ATOM   4658 C  C2    . DA  C 2  11  ? -42.882 63.742 -17.797 1.00 32.98 ? 11  DA  C C2    1 
ATOM   4659 N  N3    . DA  C 2  11  ? -43.008 64.125 -19.069 1.00 33.89 ? 11  DA  C N3    1 
ATOM   4660 C  C4    . DA  C 2  11  ? -41.877 64.678 -19.548 1.00 33.80 ? 11  DA  C C4    1 
ATOM   4661 P  P     . DA  C 2  12  ? -45.474 66.654 -24.391 1.00 44.53 ? 12  DA  C P     1 
ATOM   4662 O  OP1   . DA  C 2  12  ? -46.295 66.106 -25.489 1.00 45.49 ? 12  DA  C OP1   1 
ATOM   4663 O  OP2   . DA  C 2  12  ? -44.914 68.024 -24.389 1.00 41.56 ? 12  DA  C OP2   1 
ATOM   4664 O  "O5'" . DA  C 2  12  ? -46.321 66.504 -23.052 1.00 42.68 ? 12  DA  C "O5'" 1 
ATOM   4665 C  "C5'" . DA  C 2  12  ? -46.796 65.230 -22.638 1.00 41.01 ? 12  DA  C "C5'" 1 
ATOM   4666 C  "C4'" . DA  C 2  12  ? -47.426 65.355 -21.267 1.00 39.43 ? 12  DA  C "C4'" 1 
ATOM   4667 O  "O4'" . DA  C 2  12  ? -46.406 65.409 -20.229 1.00 38.27 ? 12  DA  C "O4'" 1 
ATOM   4668 C  "C3'" . DA  C 2  12  ? -48.291 66.598 -21.075 1.00 39.59 ? 12  DA  C "C3'" 1 
ATOM   4669 O  "O3'" . DA  C 2  12  ? -49.468 66.106 -20.463 1.00 39.22 ? 12  DA  C "O3'" 1 
ATOM   4670 C  "C2'" . DA  C 2  12  ? -47.443 67.535 -20.188 1.00 37.10 ? 12  DA  C "C2'" 1 
ATOM   4671 C  "C1'" . DA  C 2  12  ? -46.594 66.546 -19.386 1.00 36.51 ? 12  DA  C "C1'" 1 
ATOM   4672 N  N9    . DA  C 2  12  ? -45.234 66.952 -19.018 1.00 33.56 ? 12  DA  C N9    1 
ATOM   4673 C  C8    . DA  C 2  12  ? -44.311 67.537 -19.829 1.00 32.62 ? 12  DA  C C8    1 
ATOM   4674 N  N7    . DA  C 2  12  ? -43.163 67.768 -19.246 1.00 31.54 ? 12  DA  C N7    1 
ATOM   4675 C  C5    . DA  C 2  12  ? -43.333 67.287 -17.960 1.00 30.69 ? 12  DA  C C5    1 
ATOM   4676 C  C6    . DA  C 2  12  ? -42.464 67.223 -16.841 1.00 30.30 ? 12  DA  C C6    1 
ATOM   4677 N  N6    . DA  C 2  12  ? -41.191 67.669 -16.858 1.00 28.44 ? 12  DA  C N6    1 
ATOM   4678 N  N1    . DA  C 2  12  ? -42.951 66.679 -15.706 1.00 28.94 ? 12  DA  C N1    1 
ATOM   4679 C  C2    . DA  C 2  12  ? -44.212 66.230 -15.690 1.00 30.18 ? 12  DA  C C2    1 
ATOM   4680 N  N3    . DA  C 2  12  ? -45.117 66.232 -16.676 1.00 30.32 ? 12  DA  C N3    1 
ATOM   4681 C  C4    . DA  C 2  12  ? -44.606 66.773 -17.802 1.00 31.54 ? 12  DA  C C4    1 
ATOM   4682 P  P     . DT  C 2  13  ? -50.599 67.071 -19.884 1.00 41.99 ? 13  DT  C P     1 
ATOM   4683 O  OP1   . DT  C 2  13  ? -51.863 66.290 -19.894 1.00 41.48 ? 13  DT  C OP1   1 
ATOM   4684 O  OP2   . DT  C 2  13  ? -50.503 68.390 -20.533 1.00 40.80 ? 13  DT  C OP2   1 
ATOM   4685 O  "O5'" . DT  C 2  13  ? -50.119 67.247 -18.357 1.00 41.94 ? 13  DT  C "O5'" 1 
ATOM   4686 C  "C5'" . DT  C 2  13  ? -50.053 66.140 -17.449 1.00 37.97 ? 13  DT  C "C5'" 1 
ATOM   4687 C  "C4'" . DT  C 2  13  ? -49.650 66.630 -16.070 1.00 37.39 ? 13  DT  C "C4'" 1 
ATOM   4688 O  "O4'" . DT  C 2  13  ? -48.269 67.083 -16.068 1.00 35.35 ? 13  DT  C "O4'" 1 
ATOM   4689 C  "C3'" . DT  C 2  13  ? -50.486 67.794 -15.535 1.00 37.70 ? 13  DT  C "C3'" 1 
ATOM   4690 O  "O3'" . DT  C 2  13  ? -51.069 67.333 -14.328 1.00 40.79 ? 13  DT  C "O3'" 1 
ATOM   4691 C  "C2'" . DT  C 2  13  ? -49.493 68.946 -15.345 1.00 36.07 ? 13  DT  C "C2'" 1 
ATOM   4692 C  "C1'" . DT  C 2  13  ? -48.175 68.200 -15.197 1.00 35.37 ? 13  DT  C "C1'" 1 
ATOM   4693 N  N1    . DT  C 2  13  ? -46.948 68.900 -15.608 1.00 33.45 ? 13  DT  C N1    1 
ATOM   4694 C  C2    . DT  C 2  13  ? -45.881 68.928 -14.730 1.00 33.66 ? 13  DT  C C2    1 
ATOM   4695 O  O2    . DT  C 2  13  ? -45.895 68.433 -13.612 1.00 34.09 ? 13  DT  C O2    1 
ATOM   4696 N  N3    . DT  C 2  13  ? -44.772 69.572 -15.218 1.00 32.16 ? 13  DT  C N3    1 
ATOM   4697 C  C4    . DT  C 2  13  ? -44.624 70.162 -16.458 1.00 30.19 ? 13  DT  C C4    1 
ATOM   4698 O  O4    . DT  C 2  13  ? -43.564 70.694 -16.773 1.00 29.65 ? 13  DT  C O4    1 
ATOM   4699 C  C5    . DT  C 2  13  ? -45.775 70.094 -17.332 1.00 30.92 ? 13  DT  C C5    1 
ATOM   4700 C  C7    . DT  C 2  13  ? -45.753 70.701 -18.715 1.00 30.93 ? 13  DT  C C7    1 
ATOM   4701 C  C6    . DT  C 2  13  ? -46.861 69.463 -16.871 1.00 31.84 ? 13  DT  C C6    1 
ATOM   4702 P  P     . DT  C 2  14  ? -51.885 68.242 -13.279 1.00 42.75 ? 14  DT  C P     1 
ATOM   4703 O  OP1   . DT  C 2  14  ? -52.888 67.358 -12.673 1.00 41.85 ? 14  DT  C OP1   1 
ATOM   4704 O  OP2   . DT  C 2  14  ? -52.205 69.564 -13.873 1.00 43.00 ? 14  DT  C OP2   1 
ATOM   4705 O  "O5'" . DT  C 2  14  ? -50.775 68.569 -12.170 1.00 40.78 ? 14  DT  C "O5'" 1 
ATOM   4706 C  "C5'" . DT  C 2  14  ? -50.138 67.542 -11.462 1.00 38.15 ? 14  DT  C "C5'" 1 
ATOM   4707 C  "C4'" . DT  C 2  14  ? -49.151 68.186 -10.519 1.00 37.75 ? 14  DT  C "C4'" 1 
ATOM   4708 O  "O4'" . DT  C 2  14  ? -48.089 68.858 -11.250 1.00 35.05 ? 14  DT  C "O4'" 1 
ATOM   4709 C  "C3'" . DT  C 2  14  ? -49.786 69.216 -9.598  1.00 38.21 ? 14  DT  C "C3'" 1 
ATOM   4710 O  "O3'" . DT  C 2  14  ? -49.408 68.794 -8.305  1.00 39.63 ? 14  DT  C "O3'" 1 
ATOM   4711 C  "C2'" . DT  C 2  14  ? -49.184 70.552 -10.066 1.00 36.69 ? 14  DT  C "C2'" 1 
ATOM   4712 C  "C1'" . DT  C 2  14  ? -47.837 70.115 -10.652 1.00 35.48 ? 14  DT  C "C1'" 1 
ATOM   4713 N  N1    . DT  C 2  14  ? -47.197 70.943 -11.749 1.00 34.15 ? 14  DT  C N1    1 
ATOM   4714 C  C2    . DT  C 2  14  ? -45.857 71.277 -11.643 1.00 33.54 ? 14  DT  C C2    1 
ATOM   4715 O  O2    . DT  C 2  14  ? -45.167 70.975 -10.688 1.00 35.08 ? 14  DT  C O2    1 
ATOM   4716 N  N3    . DT  C 2  14  ? -45.340 71.975 -12.704 1.00 32.21 ? 14  DT  C N3    1 
ATOM   4717 C  C4    . DT  C 2  14  ? -46.025 72.381 -13.845 1.00 32.60 ? 14  DT  C C4    1 
ATOM   4718 O  O4    . DT  C 2  14  ? -45.465 73.022 -14.730 1.00 32.93 ? 14  DT  C O4    1 
ATOM   4719 C  C5    . DT  C 2  14  ? -47.420 72.013 -13.896 1.00 32.47 ? 14  DT  C C5    1 
ATOM   4720 C  C7    . DT  C 2  14  ? -48.293 72.380 -15.061 1.00 33.14 ? 14  DT  C C7    1 
ATOM   4721 C  C6    . DT  C 2  14  ? -47.924 71.312 -12.864 1.00 33.04 ? 14  DT  C C6    1 
ATOM   4722 P  P     . DT  C 2  15  ? -49.763 69.563 -6.941  1.00 40.77 ? 15  DT  C P     1 
ATOM   4723 O  OP1   . DT  C 2  15  ? -49.989 68.501 -5.932  1.00 42.63 ? 15  DT  C OP1   1 
ATOM   4724 O  OP2   . DT  C 2  15  ? -50.771 70.609 -7.199  1.00 40.13 ? 15  DT  C OP2   1 
ATOM   4725 O  "O5'" . DT  C 2  15  ? -48.409 70.327 -6.592  1.00 39.49 ? 15  DT  C "O5'" 1 
ATOM   4726 C  "C5'" . DT  C 2  15  ? -47.186 69.636 -6.449  1.00 38.32 ? 15  DT  C "C5'" 1 
ATOM   4727 C  "C4'" . DT  C 2  15  ? -46.064 70.639 -6.258  1.00 38.36 ? 15  DT  C "C4'" 1 
ATOM   4728 O  "O4'" . DT  C 2  15  ? -45.793 71.373 -7.485  1.00 36.04 ? 15  DT  C "O4'" 1 
ATOM   4729 C  "C3'" . DT  C 2  15  ? -46.288 71.690 -5.167  1.00 37.68 ? 15  DT  C "C3'" 1 
ATOM   4730 O  "O3'" . DT  C 2  15  ? -45.143 71.562 -4.314  1.00 38.20 ? 15  DT  C "O3'" 1 
ATOM   4731 C  "C2'" . DT  C 2  15  ? -46.394 73.032 -5.915  1.00 35.49 ? 15  DT  C "C2'" 1 
ATOM   4732 C  "C1'" . DT  C 2  15  ? -45.568 72.736 -7.172  1.00 36.09 ? 15  DT  C "C1'" 1 
ATOM   4733 N  N1    . DT  C 2  15  ? -45.841 73.474 -8.454  1.00 34.05 ? 15  DT  C N1    1 
ATOM   4734 C  C2    . DT  C 2  15  ? -44.774 74.032 -9.150  1.00 32.66 ? 15  DT  C C2    1 
ATOM   4735 O  O2    . DT  C 2  15  ? -43.610 74.000 -8.777  1.00 31.60 ? 15  DT  C O2    1 
ATOM   4736 N  N3    . DT  C 2  15  ? -45.119 74.647 -10.332 1.00 34.64 ? 15  DT  C N3    1 
ATOM   4737 C  C4    . DT  C 2  15  ? -46.398 74.738 -10.870 1.00 35.70 ? 15  DT  C C4    1 
ATOM   4738 O  O4    . DT  C 2  15  ? -46.594 75.307 -11.934 1.00 38.57 ? 15  DT  C O4    1 
ATOM   4739 C  C5    . DT  C 2  15  ? -47.463 74.142 -10.098 1.00 36.35 ? 15  DT  C C5    1 
ATOM   4740 C  C7    . DT  C 2  15  ? -48.885 74.193 -10.587 1.00 37.41 ? 15  DT  C C7    1 
ATOM   4741 C  C6    . DT  C 2  15  ? -47.140 73.530 -8.943  1.00 35.24 ? 15  DT  C C6    1 
ATOM   4742 P  P     . DC  C 2  16  ? -44.872 72.521 -3.070  1.00 40.09 ? 16  DC  C P     1 
ATOM   4743 O  OP1   . DC  C 2  16  ? -44.159 71.705 -2.075  1.00 41.12 ? 16  DC  C OP1   1 
ATOM   4744 O  OP2   . DC  C 2  16  ? -46.110 73.255 -2.738  1.00 39.28 ? 16  DC  C OP2   1 
ATOM   4745 O  "O5'" . DC  C 2  16  ? -43.816 73.571 -3.662  1.00 38.66 ? 16  DC  C "O5'" 1 
ATOM   4746 C  "C5'" . DC  C 2  16  ? -42.553 73.092 -4.099  1.00 38.77 ? 16  DC  C "C5'" 1 
ATOM   4747 C  "C4'" . DC  C 2  16  ? -41.729 74.254 -4.608  1.00 40.44 ? 16  DC  C "C4'" 1 
ATOM   4748 O  "O4'" . DC  C 2  16  ? -42.375 74.823 -5.777  1.00 39.74 ? 16  DC  C "O4'" 1 
ATOM   4749 C  "C3'" . DC  C 2  16  ? -41.572 75.392 -3.592  1.00 40.34 ? 16  DC  C "C3'" 1 
ATOM   4750 O  "O3'" . DC  C 2  16  ? -40.178 75.671 -3.549  1.00 43.70 ? 16  DC  C "O3'" 1 
ATOM   4751 C  "C2'" . DC  C 2  16  ? -42.435 76.529 -4.153  1.00 38.91 ? 16  DC  C "C2'" 1 
ATOM   4752 C  "C1'" . DC  C 2  16  ? -42.416 76.237 -5.652  1.00 36.79 ? 16  DC  C "C1'" 1 
ATOM   4753 N  N1    . DC  C 2  16  ? -43.556 76.645 -6.533  1.00 33.92 ? 16  DC  C N1    1 
ATOM   4754 C  C2    . DC  C 2  16  ? -43.264 77.327 -7.735  1.00 32.74 ? 16  DC  C C2    1 
ATOM   4755 O  O2    . DC  C 2  16  ? -42.083 77.610 -7.997  1.00 31.89 ? 16  DC  C O2    1 
ATOM   4756 N  N3    . DC  C 2  16  ? -44.279 77.670 -8.573  1.00 31.15 ? 16  DC  C N3    1 
ATOM   4757 C  C4    . DC  C 2  16  ? -45.530 77.337 -8.249  1.00 32.44 ? 16  DC  C C4    1 
ATOM   4758 N  N4    . DC  C 2  16  ? -46.502 77.673 -9.091  1.00 31.33 ? 16  DC  C N4    1 
ATOM   4759 C  C5    . DC  C 2  16  ? -45.852 76.635 -7.039  1.00 33.30 ? 16  DC  C C5    1 
ATOM   4760 C  C6    . DC  C 2  16  ? -44.839 76.302 -6.227  1.00 32.95 ? 16  DC  C C6    1 
ATOM   4761 P  P     . DG  C 2  17  ? -39.415 76.554 -2.425  1.00 46.78 ? 17  DG  C P     1 
ATOM   4762 O  OP1   . DG  C 2  17  ? -38.024 76.001 -2.386  1.00 43.28 ? 17  DG  C OP1   1 
ATOM   4763 O  OP2   . DG  C 2  17  ? -40.256 76.681 -1.220  1.00 44.27 ? 17  DG  C OP2   1 
ATOM   4764 O  "O5'" . DG  C 2  17  ? -39.419 78.006 -3.117  1.00 43.59 ? 17  DG  C "O5'" 1 
ATOM   4765 C  "C5'" . DG  C 2  17  ? -38.505 78.306 -4.173  1.00 41.22 ? 17  DG  C "C5'" 1 
ATOM   4766 C  "C4'" . DG  C 2  17  ? -38.691 79.748 -4.621  1.00 39.73 ? 17  DG  C "C4'" 1 
ATOM   4767 O  "O4'" . DG  C 2  17  ? -39.927 79.861 -5.366  1.00 37.44 ? 17  DG  C "O4'" 1 
ATOM   4768 C  "C3'" . DG  C 2  17  ? -38.788 80.760 -3.482  1.00 39.20 ? 17  DG  C "C3'" 1 
ATOM   4769 O  "O3'" . DG  C 2  17  ? -37.806 81.743 -3.759  1.00 40.67 ? 17  DG  C "O3'" 1 
ATOM   4770 C  "C2'" . DG  C 2  17  ? -40.250 81.239 -3.505  1.00 37.85 ? 17  DG  C "C2'" 1 
ATOM   4771 C  "C1'" . DG  C 2  17  ? -40.656 80.995 -4.960  1.00 37.02 ? 17  DG  C "C1'" 1 
ATOM   4772 N  N9    . DG  C 2  17  ? -42.050 80.683 -5.288  1.00 34.38 ? 17  DG  C N9    1 
ATOM   4773 C  C8    . DG  C 2  17  ? -42.944 79.931 -4.569  1.00 34.39 ? 17  DG  C C8    1 
ATOM   4774 N  N7    . DG  C 2  17  ? -44.113 79.814 -5.144  1.00 34.48 ? 17  DG  C N7    1 
ATOM   4775 C  C5    . DG  C 2  17  ? -43.980 80.520 -6.332  1.00 34.10 ? 17  DG  C C5    1 
ATOM   4776 C  C6    . DG  C 2  17  ? -44.909 80.746 -7.375  1.00 33.75 ? 17  DG  C C6    1 
ATOM   4777 O  O6    . DG  C 2  17  ? -46.082 80.354 -7.465  1.00 35.60 ? 17  DG  C O6    1 
ATOM   4778 N  N1    . DG  C 2  17  ? -44.382 81.520 -8.408  1.00 33.23 ? 17  DG  C N1    1 
ATOM   4779 C  C2    . DG  C 2  17  ? -43.108 82.018 -8.434  1.00 33.76 ? 17  DG  C C2    1 
ATOM   4780 N  N2    . DG  C 2  17  ? -42.788 82.749 -9.521  1.00 31.27 ? 17  DG  C N2    1 
ATOM   4781 N  N3    . DG  C 2  17  ? -42.223 81.811 -7.454  1.00 33.89 ? 17  DG  C N3    1 
ATOM   4782 C  C4    . DG  C 2  17  ? -42.718 81.057 -6.435  1.00 33.77 ? 17  DG  C C4    1 
ATOM   4783 P  P     . DC  C 2  18  ? -37.495 82.995 -2.795  1.00 41.30 ? 18  DC  C P     1 
ATOM   4784 O  OP1   . DC  C 2  18  ? -36.118 83.428 -3.136  1.00 40.21 ? 18  DC  C OP1   1 
ATOM   4785 O  OP2   . DC  C 2  18  ? -37.861 82.669 -1.405  1.00 38.31 ? 18  DC  C OP2   1 
ATOM   4786 O  "O5'" . DC  C 2  18  ? -38.546 84.073 -3.332  1.00 39.85 ? 18  DC  C "O5'" 1 
ATOM   4787 C  "C5'" . DC  C 2  18  ? -38.284 84.699 -4.592  1.00 38.86 ? 18  DC  C "C5'" 1 
ATOM   4788 C  "C4'" . DC  C 2  18  ? -39.511 85.412 -5.124  1.00 37.49 ? 18  DC  C "C4'" 1 
ATOM   4789 O  "O4'" . DC  C 2  18  ? -40.625 84.503 -5.187  1.00 36.41 ? 18  DC  C "O4'" 1 
ATOM   4790 C  "C3'" . DC  C 2  18  ? -40.014 86.564 -4.255  1.00 37.75 ? 18  DC  C "C3'" 1 
ATOM   4791 O  "O3'" . DC  C 2  18  ? -39.577 87.758 -4.877  1.00 38.52 ? 18  DC  C "O3'" 1 
ATOM   4792 C  "C2'" . DC  C 2  18  ? -41.536 86.417 -4.296  1.00 36.97 ? 18  DC  C "C2'" 1 
ATOM   4793 C  "C1'" . DC  C 2  18  ? -41.761 85.311 -5.330  1.00 36.75 ? 18  DC  C "C1'" 1 
ATOM   4794 N  N1    . DC  C 2  18  ? -42.994 84.495 -5.097  1.00 37.82 ? 18  DC  C N1    1 
ATOM   4795 C  C2    . DC  C 2  18  ? -44.022 84.509 -6.056  1.00 39.03 ? 18  DC  C C2    1 
ATOM   4796 O  O2    . DC  C 2  18  ? -43.891 85.184 -7.086  1.00 39.75 ? 18  DC  C O2    1 
ATOM   4797 N  N3    . DC  C 2  18  ? -45.147 83.774 -5.828  1.00 38.52 ? 18  DC  C N3    1 
ATOM   4798 C  C4    . DC  C 2  18  ? -45.253 83.050 -4.702  1.00 37.81 ? 18  DC  C C4    1 
ATOM   4799 N  N4    . DC  C 2  18  ? -46.372 82.337 -4.534  1.00 38.00 ? 18  DC  C N4    1 
ATOM   4800 C  C5    . DC  C 2  18  ? -44.227 83.023 -3.709  1.00 37.71 ? 18  DC  C C5    1 
ATOM   4801 C  C6    . DC  C 2  18  ? -43.127 83.749 -3.943  1.00 37.80 ? 18  DC  C C6    1 
ATOM   4802 P  P     . DA  C 2  19  ? -39.875 89.222 -4.298  1.00 40.23 ? 19  DA  C P     1 
ATOM   4803 O  OP1   . DA  C 2  19  ? -38.833 90.119 -4.878  1.00 37.75 ? 19  DA  C OP1   1 
ATOM   4804 O  OP2   . DA  C 2  19  ? -40.039 89.137 -2.833  1.00 38.18 ? 19  DA  C OP2   1 
ATOM   4805 O  "O5'" . DA  C 2  19  ? -41.314 89.600 -4.905  1.00 36.51 ? 19  DA  C "O5'" 1 
ATOM   4806 C  "C5'" . DA  C 2  19  ? -41.408 89.884 -6.285  1.00 35.08 ? 19  DA  C "C5'" 1 
ATOM   4807 C  "C4'" . DA  C 2  19  ? -42.835 90.168 -6.704  1.00 36.36 ? 19  DA  C "C4'" 1 
ATOM   4808 O  "O4'" . DA  C 2  19  ? -43.622 88.970 -6.524  1.00 36.64 ? 19  DA  C "O4'" 1 
ATOM   4809 C  "C3'" . DA  C 2  19  ? -43.532 91.257 -5.889  1.00 36.81 ? 19  DA  C "C3'" 1 
ATOM   4810 O  "O3'" . DA  C 2  19  ? -44.262 92.076 -6.755  1.00 35.50 ? 19  DA  C "O3'" 1 
ATOM   4811 C  "C2'" . DA  C 2  19  ? -44.489 90.475 -4.992  1.00 37.17 ? 19  DA  C "C2'" 1 
ATOM   4812 C  "C1'" . DA  C 2  19  ? -44.849 89.317 -5.925  1.00 38.54 ? 19  DA  C "C1'" 1 
ATOM   4813 N  N9    . DA  C 2  19  ? -45.387 88.171 -5.197  1.00 39.24 ? 19  DA  C N9    1 
ATOM   4814 C  C8    . DA  C 2  19  ? -44.842 87.614 -4.073  1.00 38.72 ? 19  DA  C C8    1 
ATOM   4815 N  N7    . DA  C 2  19  ? -45.531 86.601 -3.616  1.00 39.38 ? 19  DA  C N7    1 
ATOM   4816 C  C5    . DA  C 2  19  ? -46.592 86.492 -4.501  1.00 39.49 ? 19  DA  C C5    1 
ATOM   4817 C  C6    . DA  C 2  19  ? -47.685 85.609 -4.555  1.00 41.38 ? 19  DA  C C6    1 
ATOM   4818 N  N6    . DA  C 2  19  ? -47.854 84.644 -3.644  1.00 43.57 ? 19  DA  C N6    1 
ATOM   4819 N  N1    . DA  C 2  19  ? -48.590 85.744 -5.553  1.00 41.22 ? 19  DA  C N1    1 
ATOM   4820 C  C2    . DA  C 2  19  ? -48.405 86.721 -6.457  1.00 42.15 ? 19  DA  C C2    1 
ATOM   4821 N  N3    . DA  C 2  19  ? -47.410 87.616 -6.497  1.00 41.17 ? 19  DA  C N3    1 
ATOM   4822 C  C4    . DA  C 2  19  ? -46.527 87.446 -5.485  1.00 39.42 ? 19  DA  C C4    1 
ATOM   4823 O  "O5'" . DT  D 3  1   ? -57.476 82.353 -6.801  1.00 72.44 ? 1   DT  D "O5'" 1 
ATOM   4824 C  "C5'" . DT  D 3  1   ? -57.273 82.992 -8.052  1.00 71.27 ? 1   DT  D "C5'" 1 
ATOM   4825 C  "C4'" . DT  D 3  1   ? -56.252 84.117 -7.958  1.00 70.48 ? 1   DT  D "C4'" 1 
ATOM   4826 O  "O4'" . DT  D 3  1   ? -55.346 83.945 -6.841  1.00 70.04 ? 1   DT  D "O4'" 1 
ATOM   4827 C  "C3'" . DT  D 3  1   ? -55.315 84.173 -9.155  1.00 69.57 ? 1   DT  D "C3'" 1 
ATOM   4828 O  "O3'" . DT  D 3  1   ? -55.880 84.988 -10.169 1.00 68.85 ? 1   DT  D "O3'" 1 
ATOM   4829 C  "C2'" . DT  D 3  1   ? -54.017 84.770 -8.616  1.00 68.91 ? 1   DT  D "C2'" 1 
ATOM   4830 C  "C1'" . DT  D 3  1   ? -54.221 84.769 -7.106  1.00 68.05 ? 1   DT  D "C1'" 1 
ATOM   4831 N  N1    . DT  D 3  1   ? -53.031 84.335 -6.294  1.00 66.39 ? 1   DT  D N1    1 
ATOM   4832 C  C2    . DT  D 3  1   ? -51.795 84.932 -6.490  1.00 65.36 ? 1   DT  D C2    1 
ATOM   4833 O  O2    . DT  D 3  1   ? -51.561 85.797 -7.316  1.00 64.37 ? 1   DT  D O2    1 
ATOM   4834 N  N3    . DT  D 3  1   ? -50.806 84.460 -5.668  1.00 65.31 ? 1   DT  D N3    1 
ATOM   4835 C  C4    . DT  D 3  1   ? -50.913 83.486 -4.688  1.00 65.92 ? 1   DT  D C4    1 
ATOM   4836 O  O4    . DT  D 3  1   ? -49.952 83.142 -4.006  1.00 65.88 ? 1   DT  D O4    1 
ATOM   4837 C  C5    . DT  D 3  1   ? -52.227 82.908 -4.527  1.00 66.22 ? 1   DT  D C5    1 
ATOM   4838 C  C7    . DT  D 3  1   ? -52.482 81.840 -3.498  1.00 66.51 ? 1   DT  D C7    1 
ATOM   4839 C  C6    . DT  D 3  1   ? -53.206 83.360 -5.325  1.00 66.18 ? 1   DT  D C6    1 
ATOM   4840 P  P     . DG  D 3  2   ? -55.616 84.593 -11.700 1.00 68.47 ? 2   DG  D P     1 
ATOM   4841 O  OP1   . DG  D 3  2   ? -56.323 85.578 -12.563 1.00 68.64 ? 2   DG  D OP1   1 
ATOM   4842 O  OP2   . DG  D 3  2   ? -55.863 83.136 -11.855 1.00 67.42 ? 2   DG  D OP2   1 
ATOM   4843 O  "O5'" . DG  D 3  2   ? -54.041 84.849 -11.839 1.00 64.74 ? 2   DG  D "O5'" 1 
ATOM   4844 C  "C5'" . DG  D 3  2   ? -53.559 86.173 -12.006 1.00 58.49 ? 2   DG  D "C5'" 1 
ATOM   4845 C  "C4'" . DG  D 3  2   ? -52.121 86.112 -12.458 1.00 53.06 ? 2   DG  D "C4'" 1 
ATOM   4846 O  "O4'" . DG  D 3  2   ? -51.292 85.783 -11.325 1.00 51.51 ? 2   DG  D "O4'" 1 
ATOM   4847 C  "C3'" . DG  D 3  2   ? -51.844 85.056 -13.516 1.00 51.62 ? 2   DG  D "C3'" 1 
ATOM   4848 O  "O3'" . DG  D 3  2   ? -51.064 85.702 -14.507 1.00 49.70 ? 2   DG  D "O3'" 1 
ATOM   4849 C  "C2'" . DG  D 3  2   ? -51.099 83.937 -12.775 1.00 50.00 ? 2   DG  D "C2'" 1 
ATOM   4850 C  "C1'" . DG  D 3  2   ? -50.435 84.694 -11.629 1.00 49.57 ? 2   DG  D "C1'" 1 
ATOM   4851 N  N9    . DG  D 3  2   ? -50.240 83.949 -10.383 1.00 45.76 ? 2   DG  D N9    1 
ATOM   4852 C  C8    . DG  D 3  2   ? -51.118 83.089 -9.773  1.00 44.50 ? 2   DG  D C8    1 
ATOM   4853 N  N7    . DG  D 3  2   ? -50.663 82.588 -8.658  1.00 44.04 ? 2   DG  D N7    1 
ATOM   4854 C  C5    . DG  D 3  2   ? -49.405 83.149 -8.513  1.00 43.07 ? 2   DG  D C5    1 
ATOM   4855 C  C6    . DG  D 3  2   ? -48.434 82.987 -7.497  1.00 43.12 ? 2   DG  D C6    1 
ATOM   4856 O  O6    . DG  D 3  2   ? -48.485 82.285 -6.476  1.00 43.20 ? 2   DG  D O6    1 
ATOM   4857 N  N1    . DG  D 3  2   ? -47.283 83.733 -7.747  1.00 42.69 ? 2   DG  D N1    1 
ATOM   4858 C  C2    . DG  D 3  2   ? -47.102 84.551 -8.843  1.00 42.32 ? 2   DG  D C2    1 
ATOM   4859 N  N2    . DG  D 3  2   ? -45.939 85.211 -8.931  1.00 41.90 ? 2   DG  D N2    1 
ATOM   4860 N  N3    . DG  D 3  2   ? -48.009 84.717 -9.786  1.00 43.36 ? 2   DG  D N3    1 
ATOM   4861 C  C4    . DG  D 3  2   ? -49.133 83.991 -9.566  1.00 44.29 ? 2   DG  D C4    1 
ATOM   4862 P  P     . DC  D 3  3   ? -50.553 84.966 -15.819 1.00 47.85 ? 3   DC  D P     1 
ATOM   4863 O  OP1   . DC  D 3  3   ? -50.727 85.916 -16.934 1.00 48.54 ? 3   DC  D OP1   1 
ATOM   4864 O  OP2   . DC  D 3  3   ? -51.176 83.618 -15.900 1.00 49.79 ? 3   DC  D OP2   1 
ATOM   4865 O  "O5'" . DC  D 3  3   ? -48.999 84.799 -15.531 1.00 45.55 ? 3   DC  D "O5'" 1 
ATOM   4866 C  "C5'" . DC  D 3  3   ? -48.189 85.964 -15.533 1.00 43.23 ? 3   DC  D "C5'" 1 
ATOM   4867 C  "C4'" . DC  D 3  3   ? -46.770 85.608 -15.175 1.00 39.91 ? 3   DC  D "C4'" 1 
ATOM   4868 O  "O4'" . DC  D 3  3   ? -46.811 85.023 -13.852 1.00 40.04 ? 3   DC  D "O4'" 1 
ATOM   4869 C  "C3'" . DC  D 3  3   ? -46.122 84.595 -16.125 1.00 38.78 ? 3   DC  D "C3'" 1 
ATOM   4870 O  "O3'" . DC  D 3  3   ? -44.922 85.134 -16.703 1.00 35.18 ? 3   DC  D "O3'" 1 
ATOM   4871 C  "C2'" . DC  D 3  3   ? -45.835 83.379 -15.246 1.00 39.95 ? 3   DC  D "C2'" 1 
ATOM   4872 C  "C1'" . DC  D 3  3   ? -45.930 83.914 -13.810 1.00 39.92 ? 3   DC  D "C1'" 1 
ATOM   4873 N  N1    . DC  D 3  3   ? -46.481 82.956 -12.783 1.00 38.17 ? 3   DC  D N1    1 
ATOM   4874 C  C2    . DC  D 3  3   ? -45.731 82.708 -11.620 1.00 37.83 ? 3   DC  D C2    1 
ATOM   4875 O  O2    . DC  D 3  3   ? -44.638 83.259 -11.474 1.00 40.40 ? 3   DC  D O2    1 
ATOM   4876 N  N3    . DC  D 3  3   ? -46.207 81.857 -10.678 1.00 37.09 ? 3   DC  D N3    1 
ATOM   4877 C  C4    . DC  D 3  3   ? -47.401 81.279 -10.857 1.00 36.57 ? 3   DC  D C4    1 
ATOM   4878 N  N4    . DC  D 3  3   ? -47.826 80.465 -9.886  1.00 37.17 ? 3   DC  D N4    1 
ATOM   4879 C  C5    . DC  D 3  3   ? -48.197 81.524 -12.022 1.00 35.77 ? 3   DC  D C5    1 
ATOM   4880 C  C6    . DC  D 3  3   ? -47.707 82.362 -12.957 1.00 36.19 ? 3   DC  D C6    1 
ATOM   4881 P  P     . DG  D 3  4   ? -44.165 84.376 -17.895 1.00 34.46 ? 4   DG  D P     1 
ATOM   4882 O  OP1   . DG  D 3  4   ? -43.518 85.391 -18.771 1.00 33.16 ? 4   DG  D OP1   1 
ATOM   4883 O  OP2   . DG  D 3  4   ? -45.152 83.420 -18.483 1.00 32.16 ? 4   DG  D OP2   1 
ATOM   4884 O  "O5'" . DG  D 3  4   ? -43.011 83.586 -17.152 1.00 32.57 ? 4   DG  D "O5'" 1 
ATOM   4885 C  "C5'" . DG  D 3  4   ? -41.922 84.313 -16.573 1.00 32.44 ? 4   DG  D "C5'" 1 
ATOM   4886 C  "C4'" . DG  D 3  4   ? -40.932 83.340 -15.972 1.00 33.48 ? 4   DG  D "C4'" 1 
ATOM   4887 O  "O4'" . DG  D 3  4   ? -41.602 82.643 -14.875 1.00 33.38 ? 4   DG  D "O4'" 1 
ATOM   4888 C  "C3'" . DG  D 3  4   ? -40.411 82.260 -16.926 1.00 34.48 ? 4   DG  D "C3'" 1 
ATOM   4889 O  "O3'" . DG  D 3  4   ? -39.037 82.102 -16.611 1.00 36.63 ? 4   DG  D "O3'" 1 
ATOM   4890 C  "C2'" . DG  D 3  4   ? -41.271 81.043 -16.570 1.00 33.80 ? 4   DG  D "C2'" 1 
ATOM   4891 C  "C1'" . DG  D 3  4   ? -41.487 81.251 -15.064 1.00 32.01 ? 4   DG  D "C1'" 1 
ATOM   4892 N  N9    . DG  D 3  4   ? -42.693 80.660 -14.511 1.00 31.10 ? 4   DG  D N9    1 
ATOM   4893 C  C8    . DG  D 3  4   ? -43.902 80.465 -15.136 1.00 30.97 ? 4   DG  D C8    1 
ATOM   4894 N  N7    . DG  D 3  4   ? -44.800 79.920 -14.356 1.00 30.69 ? 4   DG  D N7    1 
ATOM   4895 C  C5    . DG  D 3  4   ? -44.137 79.741 -13.136 1.00 30.27 ? 4   DG  D C5    1 
ATOM   4896 C  C6    . DG  D 3  4   ? -44.597 79.182 -11.918 1.00 30.54 ? 4   DG  D C6    1 
ATOM   4897 O  O6    . DG  D 3  4   ? -45.734 78.720 -11.665 1.00 29.03 ? 4   DG  D O6    1 
ATOM   4898 N  N1    . DG  D 3  4   ? -43.595 79.190 -10.940 1.00 29.27 ? 4   DG  D N1    1 
ATOM   4899 C  C2    . DG  D 3  4   ? -42.318 79.677 -11.110 1.00 29.66 ? 4   DG  D C2    1 
ATOM   4900 N  N2    . DG  D 3  4   ? -41.492 79.614 -10.056 1.00 26.95 ? 4   DG  D N2    1 
ATOM   4901 N  N3    . DG  D 3  4   ? -41.876 80.197 -12.250 1.00 30.19 ? 4   DG  D N3    1 
ATOM   4902 C  C4    . DG  D 3  4   ? -42.842 80.199 -13.214 1.00 30.75 ? 4   DG  D C4    1 
ATOM   4903 P  P     . DA  D 3  5   ? -38.052 80.990 -17.197 1.00 38.28 ? 5   DA  D P     1 
ATOM   4904 O  OP1   . DA  D 3  5   ? -36.744 81.597 -17.499 1.00 37.59 ? 5   DA  D OP1   1 
ATOM   4905 O  OP2   . DA  D 3  5   ? -38.790 80.210 -18.206 1.00 39.88 ? 5   DA  D OP2   1 
ATOM   4906 O  "O5'" . DA  D 3  5   ? -37.804 80.106 -15.894 1.00 39.80 ? 5   DA  D "O5'" 1 
ATOM   4907 C  "C5'" . DA  D 3  5   ? -37.372 80.772 -14.711 1.00 41.43 ? 5   DA  D "C5'" 1 
ATOM   4908 C  "C4'" . DA  D 3  5   ? -37.219 79.771 -13.590 1.00 43.66 ? 5   DA  D "C4'" 1 
ATOM   4909 O  "O4'" . DA  D 3  5   ? -38.510 79.233 -13.187 1.00 42.86 ? 5   DA  D "O4'" 1 
ATOM   4910 C  "C3'" . DA  D 3  5   ? -36.365 78.575 -13.983 1.00 45.16 ? 5   DA  D "C3'" 1 
ATOM   4911 O  "O3'" . DA  D 3  5   ? -35.489 78.385 -12.875 1.00 47.67 ? 5   DA  D "O3'" 1 
ATOM   4912 C  "C2'" . DA  D 3  5   ? -37.373 77.437 -14.262 1.00 42.77 ? 5   DA  D "C2'" 1 
ATOM   4913 C  "C1'" . DA  D 3  5   ? -38.540 77.818 -13.346 1.00 40.92 ? 5   DA  D "C1'" 1 
ATOM   4914 N  N9    . DA  D 3  5   ? -39.910 77.491 -13.747 1.00 36.75 ? 5   DA  D N9    1 
ATOM   4915 C  C8    . DA  D 3  5   ? -40.507 77.662 -14.960 1.00 36.71 ? 5   DA  D C8    1 
ATOM   4916 N  N7    . DA  D 3  5   ? -41.776 77.308 -14.997 1.00 34.52 ? 5   DA  D N7    1 
ATOM   4917 C  C5    . DA  D 3  5   ? -42.029 76.875 -13.709 1.00 34.50 ? 5   DA  D C5    1 
ATOM   4918 C  C6    . DA  D 3  5   ? -43.185 76.352 -13.094 1.00 33.90 ? 5   DA  D C6    1 
ATOM   4919 N  N6    . DA  D 3  5   ? -44.350 76.203 -13.741 1.00 34.03 ? 5   DA  D N6    1 
ATOM   4920 N  N1    . DA  D 3  5   ? -43.111 76.001 -11.791 1.00 31.85 ? 5   DA  D N1    1 
ATOM   4921 C  C2    . DA  D 3  5   ? -41.952 76.170 -11.153 1.00 32.68 ? 5   DA  D C2    1 
ATOM   4922 N  N3    . DA  D 3  5   ? -40.790 76.645 -11.627 1.00 35.01 ? 5   DA  D N3    1 
ATOM   4923 C  C4    . DA  D 3  5   ? -40.896 76.986 -12.926 1.00 35.15 ? 5   DA  D C4    1 
ATOM   4924 P  P     . DA  D 3  6   ? -34.404 77.206 -12.866 1.00 49.61 ? 6   DA  D P     1 
ATOM   4925 O  OP1   . DA  D 3  6   ? -33.258 77.726 -12.086 1.00 47.72 ? 6   DA  D OP1   1 
ATOM   4926 O  OP2   . DA  D 3  6   ? -34.244 76.691 -14.259 1.00 47.52 ? 6   DA  D OP2   1 
ATOM   4927 O  "O5'" . DA  D 3  6   ? -35.177 76.050 -12.032 1.00 45.56 ? 6   DA  D "O5'" 1 
ATOM   4928 C  "C5'" . DA  D 3  6   ? -35.437 76.250 -10.656 1.00 40.31 ? 6   DA  D "C5'" 1 
ATOM   4929 C  "C4'" . DA  D 3  6   ? -36.206 75.080 -10.087 1.00 37.16 ? 6   DA  D "C4'" 1 
ATOM   4930 O  "O4'" . DA  D 3  6   ? -37.485 74.979 -10.741 1.00 35.78 ? 6   DA  D "O4'" 1 
ATOM   4931 C  "C3'" . DA  D 3  6   ? -35.544 73.711 -10.214 1.00 35.61 ? 6   DA  D "C3'" 1 
ATOM   4932 O  "O3'" . DA  D 3  6   ? -35.484 73.249 -8.877  1.00 34.84 ? 6   DA  D "O3'" 1 
ATOM   4933 C  "C2'" . DA  D 3  6   ? -36.494 72.912 -11.114 1.00 33.49 ? 6   DA  D "C2'" 1 
ATOM   4934 C  "C1'" . DA  D 3  6   ? -37.822 73.618 -10.896 1.00 32.43 ? 6   DA  D "C1'" 1 
ATOM   4935 N  N9    . DA  D 3  6   ? -38.762 73.636 -12.004 1.00 31.02 ? 6   DA  D N9    1 
ATOM   4936 C  C8    . DA  D 3  6   ? -38.494 74.011 -13.294 1.00 30.43 ? 6   DA  D C8    1 
ATOM   4937 N  N7    . DA  D 3  6   ? -39.547 73.950 -14.079 1.00 30.73 ? 6   DA  D N7    1 
ATOM   4938 C  C5    . DA  D 3  6   ? -40.571 73.522 -13.255 1.00 29.09 ? 6   DA  D C5    1 
ATOM   4939 C  C6    . DA  D 3  6   ? -41.935 73.260 -13.487 1.00 28.42 ? 6   DA  D C6    1 
ATOM   4940 N  N6    . DA  D 3  6   ? -42.525 73.400 -14.679 1.00 29.12 ? 6   DA  D N6    1 
ATOM   4941 N  N1    . DA  D 3  6   ? -42.682 72.835 -12.447 1.00 27.56 ? 6   DA  D N1    1 
ATOM   4942 C  C2    . DA  D 3  6   ? -42.098 72.686 -11.258 1.00 27.30 ? 6   DA  D C2    1 
ATOM   4943 N  N3    . DA  D 3  6   ? -40.831 72.902 -10.926 1.00 28.73 ? 6   DA  D N3    1 
ATOM   4944 C  C4    . DA  D 3  6   ? -40.109 73.326 -11.971 1.00 28.84 ? 6   DA  D C4    1 
ATOM   4945 P  P     . DA  D 3  7   ? -34.992 71.783 -8.448  1.00 35.20 ? 7   DA  D P     1 
ATOM   4946 O  OP1   . DA  D 3  7   ? -34.430 71.925 -7.087  1.00 35.59 ? 7   DA  D OP1   1 
ATOM   4947 O  OP2   . DA  D 3  7   ? -34.158 71.186 -9.509  1.00 35.17 ? 7   DA  D OP2   1 
ATOM   4948 O  "O5'" . DA  D 3  7   ? -36.382 71.006 -8.360  1.00 33.04 ? 7   DA  D "O5'" 1 
ATOM   4949 C  "C5'" . DA  D 3  7   ? -37.398 71.519 -7.540  1.00 31.16 ? 7   DA  D "C5'" 1 
ATOM   4950 C  "C4'" . DA  D 3  7   ? -38.566 70.557 -7.498  1.00 31.68 ? 7   DA  D "C4'" 1 
ATOM   4951 O  "O4'" . DA  D 3  7   ? -39.364 70.685 -8.707  1.00 31.29 ? 7   DA  D "O4'" 1 
ATOM   4952 C  "C3'" . DA  D 3  7   ? -38.169 69.079 -7.370  1.00 30.55 ? 7   DA  D "C3'" 1 
ATOM   4953 O  "O3'" . DA  D 3  7   ? -38.900 68.565 -6.258  1.00 31.43 ? 7   DA  D "O3'" 1 
ATOM   4954 C  "C2'" . DA  D 3  7   ? -38.543 68.469 -8.734  1.00 29.29 ? 7   DA  D "C2'" 1 
ATOM   4955 C  "C1'" . DA  D 3  7   ? -39.670 69.391 -9.217  1.00 29.90 ? 7   DA  D "C1'" 1 
ATOM   4956 N  N9    . DA  D 3  7   ? -39.775 69.613 -10.661 1.00 28.68 ? 7   DA  D N9    1 
ATOM   4957 C  C8    . DA  D 3  7   ? -38.755 69.975 -11.491 1.00 29.44 ? 7   DA  D C8    1 
ATOM   4958 N  N7    . DA  D 3  7   ? -39.119 70.141 -12.735 1.00 30.50 ? 7   DA  D N7    1 
ATOM   4959 C  C5    . DA  D 3  7   ? -40.480 69.882 -12.716 1.00 29.18 ? 7   DA  D C5    1 
ATOM   4960 C  C6    . DA  D 3  7   ? -41.448 69.895 -13.744 1.00 29.34 ? 7   DA  D C6    1 
ATOM   4961 N  N6    . DA  D 3  7   ? -41.127 70.200 -15.005 1.00 29.84 ? 7   DA  D N6    1 
ATOM   4962 N  N1    . DA  D 3  7   ? -42.726 69.586 -13.428 1.00 28.59 ? 7   DA  D N1    1 
ATOM   4963 C  C2    . DA  D 3  7   ? -43.000 69.296 -12.141 1.00 29.26 ? 7   DA  D C2    1 
ATOM   4964 N  N3    . DA  D 3  7   ? -42.162 69.243 -11.088 1.00 29.01 ? 7   DA  D N3    1 
ATOM   4965 C  C4    . DA  D 3  7   ? -40.903 69.556 -11.448 1.00 28.18 ? 7   DA  D C4    1 
ATOM   4966 P  P     . DT  D 3  8   ? -38.853 67.013 -5.808  1.00 31.63 ? 8   DT  D P     1 
ATOM   4967 O  OP1   . DT  D 3  8   ? -39.302 66.969 -4.410  1.00 32.47 ? 8   DT  D OP1   1 
ATOM   4968 O  OP2   . DT  D 3  8   ? -37.583 66.404 -6.235  1.00 29.01 ? 8   DT  D OP2   1 
ATOM   4969 O  "O5'" . DT  D 3  8   ? -40.060 66.405 -6.653  1.00 31.29 ? 8   DT  D "O5'" 1 
ATOM   4970 C  "C5'" . DT  D 3  8   ? -41.386 66.869 -6.445  1.00 29.10 ? 8   DT  D "C5'" 1 
ATOM   4971 C  "C4'" . DT  D 3  8   ? -42.314 66.264 -7.483  1.00 31.25 ? 8   DT  D "C4'" 1 
ATOM   4972 O  "O4'" . DT  D 3  8   ? -41.991 66.664 -8.845  1.00 32.26 ? 8   DT  D "O4'" 1 
ATOM   4973 C  "C3'" . DT  D 3  8   ? -42.328 64.733 -7.489  1.00 31.31 ? 8   DT  D "C3'" 1 
ATOM   4974 O  "O3'" . DT  D 3  8   ? -43.640 64.406 -7.051  1.00 31.28 ? 8   DT  D "O3'" 1 
ATOM   4975 C  "C2'" . DT  D 3  8   ? -41.991 64.347 -8.936  1.00 30.70 ? 8   DT  D "C2'" 1 
ATOM   4976 C  "C1'" . DT  D 3  8   ? -42.335 65.610 -9.724  1.00 30.07 ? 8   DT  D "C1'" 1 
ATOM   4977 N  N1    . DT  D 3  8   ? -41.593 65.920 -11.013 1.00 30.52 ? 8   DT  D N1    1 
ATOM   4978 C  C2    . DT  D 3  8   ? -42.305 66.093 -12.187 1.00 29.31 ? 8   DT  D C2    1 
ATOM   4979 O  O2    . DT  D 3  8   ? -43.513 65.991 -12.260 1.00 31.57 ? 8   DT  D O2    1 
ATOM   4980 N  N3    . DT  D 3  8   ? -41.555 66.407 -13.293 1.00 29.05 ? 8   DT  D N3    1 
ATOM   4981 C  C4    . DT  D 3  8   ? -40.183 66.556 -13.340 1.00 27.23 ? 8   DT  D C4    1 
ATOM   4982 O  O4    . DT  D 3  8   ? -39.602 66.841 -14.378 1.00 28.43 ? 8   DT  D O4    1 
ATOM   4983 C  C5    . DT  D 3  8   ? -39.484 66.373 -12.088 1.00 27.18 ? 8   DT  D C5    1 
ATOM   4984 C  C7    . DT  D 3  8   ? -37.985 66.503 -12.034 1.00 25.65 ? 8   DT  D C7    1 
ATOM   4985 C  C6    . DT  D 3  8   ? -40.210 66.068 -11.003 1.00 28.36 ? 8   DT  D C6    1 
ATOM   4986 P  P     . DT  D 3  9   ? -44.167 62.909 -6.905  1.00 33.15 ? 9   DT  D P     1 
ATOM   4987 O  OP1   . DT  D 3  9   ? -45.269 62.940 -5.918  1.00 34.22 ? 9   DT  D OP1   1 
ATOM   4988 O  OP2   . DT  D 3  9   ? -43.018 61.995 -6.755  1.00 34.18 ? 9   DT  D OP2   1 
ATOM   4989 O  "O5'" . DT  D 3  9   ? -44.803 62.668 -8.349  1.00 33.67 ? 9   DT  D "O5'" 1 
ATOM   4990 C  "C5'" . DT  D 3  9   ? -45.880 63.494 -8.776  1.00 33.47 ? 9   DT  D "C5'" 1 
ATOM   4991 C  "C4'" . DT  D 3  9   ? -46.272 63.134 -10.194 1.00 33.69 ? 9   DT  D "C4'" 1 
ATOM   4992 O  "O4'" . DT  D 3  9   ? -45.240 63.520 -11.136 1.00 32.84 ? 9   DT  D "O4'" 1 
ATOM   4993 C  "C3'" . DT  D 3  9   ? -46.535 61.635 -10.402 1.00 33.96 ? 9   DT  D "C3'" 1 
ATOM   4994 O  "O3'" . DT  D 3  9   ? -47.841 61.542 -10.949 1.00 36.06 ? 9   DT  D "O3'" 1 
ATOM   4995 C  "C2'" . DT  D 3  9   ? -45.402 61.162 -11.318 1.00 32.40 ? 9   DT  D "C2'" 1 
ATOM   4996 C  "C1'" . DT  D 3  9   ? -45.073 62.444 -12.071 1.00 32.36 ? 9   DT  D "C1'" 1 
ATOM   4997 N  N1    . DT  D 3  9   ? -43.697 62.600 -12.616 1.00 30.10 ? 9   DT  D N1    1 
ATOM   4998 C  C2    . DT  D 3  9   ? -43.540 63.001 -13.932 1.00 29.26 ? 9   DT  D C2    1 
ATOM   4999 O  O2    . DT  D 3  9   ? -44.458 63.203 -14.706 1.00 29.17 ? 9   DT  D O2    1 
ATOM   5000 N  N3    . DT  D 3  9   ? -42.240 63.164 -14.325 1.00 28.14 ? 9   DT  D N3    1 
ATOM   5001 C  C4    . DT  D 3  9   ? -41.104 62.972 -13.562 1.00 26.93 ? 9   DT  D C4    1 
ATOM   5002 O  O4    . DT  D 3  9   ? -40.002 63.158 -14.050 1.00 25.82 ? 9   DT  D O4    1 
ATOM   5003 C  C5    . DT  D 3  9   ? -41.334 62.549 -12.197 1.00 26.58 ? 9   DT  D C5    1 
ATOM   5004 C  C7    . DT  D 3  9   ? -40.204 62.300 -11.250 1.00 26.66 ? 9   DT  D C7    1 
ATOM   5005 C  C6    . DT  D 3  9   ? -42.602 62.391 -11.793 1.00 28.24 ? 9   DT  D C6    1 
ATOM   5006 P  P     . DC  D 3  10  ? -48.540 60.183 -11.468 1.00 38.88 ? 10  DC  D P     1 
ATOM   5007 O  OP1   . DC  D 3  10  ? -49.992 60.441 -11.317 1.00 38.04 ? 10  DC  D OP1   1 
ATOM   5008 O  OP2   . DC  D 3  10  ? -47.896 59.001 -10.853 1.00 36.58 ? 10  DC  D OP2   1 
ATOM   5009 O  "O5'" . DC  D 3  10  ? -48.150 60.203 -13.019 1.00 34.77 ? 10  DC  D "O5'" 1 
ATOM   5010 C  "C5'" . DC  D 3  10  ? -48.754 61.181 -13.866 1.00 33.50 ? 10  DC  D "C5'" 1 
ATOM   5011 C  "C4'" . DC  D 3  10  ? -48.322 60.982 -15.301 1.00 33.15 ? 10  DC  D "C4'" 1 
ATOM   5012 O  "O4'" . DC  D 3  10  ? -46.881 61.164 -15.434 1.00 32.63 ? 10  DC  D "O4'" 1 
ATOM   5013 C  "C3'" . DC  D 3  10  ? -48.623 59.607 -15.893 1.00 33.43 ? 10  DC  D "C3'" 1 
ATOM   5014 O  "O3'" . DC  D 3  10  ? -49.263 59.834 -17.134 1.00 34.88 ? 10  DC  D "O3'" 1 
ATOM   5015 C  "C2'" . DC  D 3  10  ? -47.248 58.951 -16.083 1.00 31.31 ? 10  DC  D "C2'" 1 
ATOM   5016 C  "C1'" . DC  D 3  10  ? -46.340 60.152 -16.271 1.00 30.56 ? 10  DC  D "C1'" 1 
ATOM   5017 N  N1    . DC  D 3  10  ? -44.903 60.042 -15.857 1.00 30.22 ? 10  DC  D N1    1 
ATOM   5018 C  C2    . DC  D 3  10  ? -43.907 60.325 -16.784 1.00 30.21 ? 10  DC  D C2    1 
ATOM   5019 O  O2    . DC  D 3  10  ? -44.222 60.627 -17.936 1.00 32.51 ? 10  DC  D O2    1 
ATOM   5020 N  N3    . DC  D 3  10  ? -42.603 60.260 -16.410 1.00 31.50 ? 10  DC  D N3    1 
ATOM   5021 C  C4    . DC  D 3  10  ? -42.293 59.947 -15.150 1.00 30.45 ? 10  DC  D C4    1 
ATOM   5022 N  N4    . DC  D 3  10  ? -40.995 59.897 -14.820 1.00 29.14 ? 10  DC  D N4    1 
ATOM   5023 C  C5    . DC  D 3  10  ? -43.303 59.636 -14.191 1.00 30.43 ? 10  DC  D C5    1 
ATOM   5024 C  C6    . DC  D 3  10  ? -44.579 59.704 -14.573 1.00 29.42 ? 10  DC  D C6    1 
ATOM   5025 P  P     . DC  D 3  11  ? -50.087 58.681 -17.870 1.00 36.25 ? 11  DC  D P     1 
ATOM   5026 O  OP1   . DC  D 3  11  ? -51.036 59.395 -18.745 1.00 37.99 ? 11  DC  D OP1   1 
ATOM   5027 O  OP2   . DC  D 3  11  ? -50.501 57.675 -16.884 1.00 36.53 ? 11  DC  D OP2   1 
ATOM   5028 O  "O5'" . DC  D 3  11  ? -48.988 57.945 -18.762 1.00 35.85 ? 11  DC  D "O5'" 1 
ATOM   5029 C  "C5'" . DC  D 3  11  ? -48.414 58.578 -19.903 1.00 32.99 ? 11  DC  D "C5'" 1 
ATOM   5030 C  "C4'" . DC  D 3  11  ? -47.319 57.666 -20.423 1.00 31.57 ? 11  DC  D "C4'" 1 
ATOM   5031 O  "O4'" . DC  D 3  11  ? -46.137 57.854 -19.602 1.00 29.59 ? 11  DC  D "O4'" 1 
ATOM   5032 C  "C3'" . DC  D 3  11  ? -47.632 56.170 -20.379 1.00 31.70 ? 11  DC  D "C3'" 1 
ATOM   5033 O  "O3'" . DC  D 3  11  ? -47.214 55.598 -21.614 1.00 33.53 ? 11  DC  D "O3'" 1 
ATOM   5034 C  "C2'" . DC  D 3  11  ? -46.754 55.645 -19.236 1.00 29.91 ? 11  DC  D "C2'" 1 
ATOM   5035 C  "C1'" . DC  D 3  11  ? -45.561 56.595 -19.373 1.00 28.75 ? 11  DC  D "C1'" 1 
ATOM   5036 N  N1    . DC  D 3  11  ? -44.608 56.651 -18.218 1.00 30.02 ? 11  DC  D N1    1 
ATOM   5037 C  C2    . DC  D 3  11  ? -43.255 56.963 -18.465 1.00 30.04 ? 11  DC  D C2    1 
ATOM   5038 O  O2    . DC  D 3  11  ? -42.889 57.222 -19.616 1.00 30.64 ? 11  DC  D O2    1 
ATOM   5039 N  N3    . DC  D 3  11  ? -42.368 56.993 -17.426 1.00 29.95 ? 11  DC  D N3    1 
ATOM   5040 C  C4    . DC  D 3  11  ? -42.800 56.730 -16.179 1.00 29.31 ? 11  DC  D C4    1 
ATOM   5041 N  N4    . DC  D 3  11  ? -41.890 56.766 -15.201 1.00 29.50 ? 11  DC  D N4    1 
ATOM   5042 C  C5    . DC  D 3  11  ? -44.170 56.403 -15.898 1.00 28.73 ? 11  DC  D C5    1 
ATOM   5043 C  C6    . DC  D 3  11  ? -45.037 56.372 -16.933 1.00 29.12 ? 11  DC  D C6    1 
ATOM   5044 P  P     . DA  D 3  12  ? -48.249 55.151 -22.757 1.00 33.70 ? 12  DA  D P     1 
ATOM   5045 O  OP1   . DA  D 3  12  ? -49.168 56.277 -22.988 1.00 33.92 ? 12  DA  D OP1   1 
ATOM   5046 O  OP2   . DA  D 3  12  ? -48.759 53.814 -22.448 1.00 33.68 ? 12  DA  D OP2   1 
ATOM   5047 O  "O5'" . DA  D 3  12  ? -47.234 55.053 -23.991 1.00 32.99 ? 12  DA  D "O5'" 1 
ATOM   5048 C  "C5'" . DA  D 3  12  ? -46.711 56.250 -24.571 1.00 30.77 ? 12  DA  D "C5'" 1 
ATOM   5049 C  "C4'" . DA  D 3  12  ? -45.304 55.969 -25.083 1.00 31.46 ? 12  DA  D "C4'" 1 
ATOM   5050 O  "O4'" . DA  D 3  12  ? -44.356 55.734 -23.999 1.00 28.63 ? 12  DA  D "O4'" 1 
ATOM   5051 C  "C3'" . DA  D 3  12  ? -45.132 54.752 -25.994 1.00 32.40 ? 12  DA  D "C3'" 1 
ATOM   5052 O  "O3'" . DA  D 3  12  ? -44.142 55.161 -26.952 1.00 34.11 ? 12  DA  D "O3'" 1 
ATOM   5053 C  "C2'" . DA  D 3  12  ? -44.664 53.641 -25.028 1.00 30.56 ? 12  DA  D "C2'" 1 
ATOM   5054 C  "C1'" . DA  D 3  12  ? -43.777 54.429 -24.063 1.00 28.41 ? 12  DA  D "C1'" 1 
ATOM   5055 N  N9    . DA  D 3  12  ? -43.759 54.078 -22.644 1.00 28.94 ? 12  DA  D N9    1 
ATOM   5056 C  C8    . DA  D 3  12  ? -44.821 53.673 -21.888 1.00 27.98 ? 12  DA  D C8    1 
ATOM   5057 N  N7    . DA  D 3  12  ? -44.533 53.486 -20.624 1.00 28.72 ? 12  DA  D N7    1 
ATOM   5058 C  C5    . DA  D 3  12  ? -43.184 53.809 -20.528 1.00 26.99 ? 12  DA  D C5    1 
ATOM   5059 C  C6    . DA  D 3  12  ? -42.286 53.841 -19.426 1.00 25.32 ? 12  DA  D C6    1 
ATOM   5060 N  N6    . DA  D 3  12  ? -42.631 53.506 -18.171 1.00 25.02 ? 12  DA  D N6    1 
ATOM   5061 N  N1    . DA  D 3  12  ? -41.010 54.198 -19.672 1.00 24.55 ? 12  DA  D N1    1 
ATOM   5062 C  C2    . DA  D 3  12  ? -40.661 54.536 -20.924 1.00 25.90 ? 12  DA  D C2    1 
ATOM   5063 N  N3    . DA  D 3  12  ? -41.427 54.562 -22.021 1.00 28.06 ? 12  DA  D N3    1 
ATOM   5064 C  C4    . DA  D 3  12  ? -42.696 54.189 -21.760 1.00 26.13 ? 12  DA  D C4    1 
ATOM   5065 P  P     . DT  D 3  13  ? -43.745 54.291 -28.243 1.00 35.41 ? 13  DT  D P     1 
ATOM   5066 O  OP1   . DT  D 3  13  ? -43.211 55.290 -29.209 1.00 34.62 ? 13  DT  D OP1   1 
ATOM   5067 O  OP2   . DT  D 3  13  ? -44.915 53.437 -28.545 1.00 36.71 ? 13  DT  D OP2   1 
ATOM   5068 O  "O5'" . DT  D 3  13  ? -42.573 53.312 -27.756 1.00 31.69 ? 13  DT  D "O5'" 1 
ATOM   5069 C  "C5'" . DT  D 3  13  ? -41.355 53.974 -27.411 1.00 28.72 ? 13  DT  D "C5'" 1 
ATOM   5070 C  "C4'" . DT  D 3  13  ? -40.330 53.048 -26.790 1.00 27.16 ? 13  DT  D "C4'" 1 
ATOM   5071 O  "O4'" . DT  D 3  13  ? -40.621 52.860 -25.383 1.00 26.52 ? 13  DT  D "O4'" 1 
ATOM   5072 C  "C3'" . DT  D 3  13  ? -40.264 51.661 -27.408 1.00 27.47 ? 13  DT  D "C3'" 1 
ATOM   5073 O  "O3'" . DT  D 3  13  ? -39.004 51.576 -28.088 1.00 29.35 ? 13  DT  D "O3'" 1 
ATOM   5074 C  "C2'" . DT  D 3  13  ? -40.353 50.686 -26.228 1.00 26.02 ? 13  DT  D "C2'" 1 
ATOM   5075 C  "C1'" . DT  D 3  13  ? -40.109 51.586 -25.009 1.00 27.69 ? 13  DT  D "C1'" 1 
ATOM   5076 N  N1    . DT  D 3  13  ? -40.798 51.233 -23.699 1.00 27.29 ? 13  DT  D N1    1 
ATOM   5077 C  C2    . DT  D 3  13  ? -40.066 51.288 -22.516 1.00 27.03 ? 13  DT  D C2    1 
ATOM   5078 O  O2    . DT  D 3  13  ? -38.881 51.578 -22.476 1.00 23.87 ? 13  DT  D O2    1 
ATOM   5079 N  N3    . DT  D 3  13  ? -40.778 50.985 -21.371 1.00 23.99 ? 13  DT  D N3    1 
ATOM   5080 C  C4    . DT  D 3  13  ? -42.117 50.646 -21.289 1.00 25.87 ? 13  DT  D C4    1 
ATOM   5081 O  O4    . DT  D 3  13  ? -42.639 50.404 -20.199 1.00 26.49 ? 13  DT  D O4    1 
ATOM   5082 C  C5    . DT  D 3  13  ? -42.840 50.606 -22.556 1.00 24.67 ? 13  DT  D C5    1 
ATOM   5083 C  C7    . DT  D 3  13  ? -44.309 50.240 -22.614 1.00 21.96 ? 13  DT  D C7    1 
ATOM   5084 C  C6    . DT  D 3  13  ? -42.153 50.907 -23.673 1.00 25.58 ? 13  DT  D C6    1 
ATOM   5085 P  P     . DG  D 3  14  ? -38.645 50.262 -28.943 1.00 30.53 ? 14  DG  D P     1 
ATOM   5086 O  OP1   . DG  D 3  14  ? -37.736 50.692 -30.011 1.00 34.47 ? 14  DG  D OP1   1 
ATOM   5087 O  OP2   . DG  D 3  14  ? -39.909 49.560 -29.263 1.00 30.58 ? 14  DG  D OP2   1 
ATOM   5088 O  "O5'" . DG  D 3  14  ? -37.813 49.397 -27.890 1.00 29.42 ? 14  DG  D "O5'" 1 
ATOM   5089 C  "C5'" . DG  D 3  14  ? -36.784 50.010 -27.112 1.00 30.95 ? 14  DG  D "C5'" 1 
ATOM   5090 C  "C4'" . DG  D 3  14  ? -36.348 49.059 -26.011 1.00 31.20 ? 14  DG  D "C4'" 1 
ATOM   5091 O  "O4'" . DG  D 3  14  ? -37.368 48.989 -24.982 1.00 30.43 ? 14  DG  D "O4'" 1 
ATOM   5092 C  "C3'" . DG  D 3  14  ? -36.105 47.623 -26.466 1.00 32.99 ? 14  DG  D "C3'" 1 
ATOM   5093 O  "O3'" . DG  D 3  14  ? -34.849 47.247 -25.933 1.00 36.81 ? 14  DG  D "O3'" 1 
ATOM   5094 C  "C2'" . DG  D 3  14  ? -37.258 46.820 -25.851 1.00 31.93 ? 14  DG  D "C2'" 1 
ATOM   5095 C  "C1'" . DG  D 3  14  ? -37.562 47.645 -24.601 1.00 29.72 ? 14  DG  D "C1'" 1 
ATOM   5096 N  N9    . DG  D 3  14  ? -38.921 47.574 -24.056 1.00 29.43 ? 14  DG  D N9    1 
ATOM   5097 C  C8    . DG  D 3  14  ? -40.117 47.524 -24.737 1.00 28.18 ? 14  DG  D C8    1 
ATOM   5098 N  N7    . DG  D 3  14  ? -41.154 47.487 -23.951 1.00 27.68 ? 14  DG  D N7    1 
ATOM   5099 C  C5    . DG  D 3  14  ? -40.639 47.508 -22.667 1.00 27.59 ? 14  DG  D C5    1 
ATOM   5100 C  C6    . DG  D 3  14  ? -41.272 47.471 -21.401 1.00 28.12 ? 14  DG  D C6    1 
ATOM   5101 O  O6    . DG  D 3  14  ? -42.485 47.421 -21.143 1.00 26.62 ? 14  DG  D O6    1 
ATOM   5102 N  N1    . DG  D 3  14  ? -40.347 47.519 -20.348 1.00 26.45 ? 14  DG  D N1    1 
ATOM   5103 C  C2    . DG  D 3  14  ? -38.984 47.576 -20.495 1.00 28.31 ? 14  DG  D C2    1 
ATOM   5104 N  N2    . DG  D 3  14  ? -38.236 47.605 -19.372 1.00 25.33 ? 14  DG  D N2    1 
ATOM   5105 N  N3    . DG  D 3  14  ? -38.389 47.600 -21.676 1.00 27.71 ? 14  DG  D N3    1 
ATOM   5106 C  C4    . DG  D 3  14  ? -39.261 47.559 -22.712 1.00 28.81 ? 14  DG  D C4    1 
ATOM   5107 P  P     . DA  D 3  15  ? -34.009 45.976 -26.430 1.00 38.94 ? 15  DA  D P     1 
ATOM   5108 O  OP1   . DA  D 3  15  ? -32.633 46.480 -26.615 1.00 39.94 ? 15  DA  D OP1   1 
ATOM   5109 O  OP2   . DA  D 3  15  ? -34.711 45.188 -27.458 1.00 37.50 ? 15  DA  D OP2   1 
ATOM   5110 O  "O5'" . DA  D 3  15  ? -33.977 45.044 -25.139 1.00 39.07 ? 15  DA  D "O5'" 1 
ATOM   5111 C  "C5'" . DA  D 3  15  ? -33.296 45.457 -23.956 1.00 38.03 ? 15  DA  D "C5'" 1 
ATOM   5112 C  "C4'" . DA  D 3  15  ? -33.700 44.524 -22.839 1.00 38.21 ? 15  DA  D "C4'" 1 
ATOM   5113 O  "O4'" . DA  D 3  15  ? -35.084 44.807 -22.501 1.00 36.45 ? 15  DA  D "O4'" 1 
ATOM   5114 C  "C3'" . DA  D 3  15  ? -33.654 43.062 -23.281 1.00 39.75 ? 15  DA  D "C3'" 1 
ATOM   5115 O  "O3'" . DA  D 3  15  ? -32.842 42.304 -22.405 1.00 41.88 ? 15  DA  D "O3'" 1 
ATOM   5116 C  "C2'" . DA  D 3  15  ? -35.116 42.605 -23.298 1.00 37.41 ? 15  DA  D "C2'" 1 
ATOM   5117 C  "C1'" . DA  D 3  15  ? -35.743 43.581 -22.316 1.00 35.93 ? 15  DA  D "C1'" 1 
ATOM   5118 N  N9    . DA  D 3  15  ? -37.170 43.764 -22.551 1.00 32.53 ? 15  DA  D N9    1 
ATOM   5119 C  C8    . DA  D 3  15  ? -37.818 43.788 -23.760 1.00 31.19 ? 15  DA  D C8    1 
ATOM   5120 N  N7    . DA  D 3  15  ? -39.113 43.940 -23.658 1.00 29.38 ? 15  DA  D N7    1 
ATOM   5121 C  C5    . DA  D 3  15  ? -39.317 44.012 -22.285 1.00 29.50 ? 15  DA  D C5    1 
ATOM   5122 C  C6    . DA  D 3  15  ? -40.477 44.176 -21.504 1.00 28.26 ? 15  DA  D C6    1 
ATOM   5123 N  N6    . DA  D 3  15  ? -41.695 44.313 -22.028 1.00 26.62 ? 15  DA  D N6    1 
ATOM   5124 N  N1    . DA  D 3  15  ? -40.330 44.210 -20.161 1.00 28.91 ? 15  DA  D N1    1 
ATOM   5125 C  C2    . DA  D 3  15  ? -39.112 44.076 -19.629 1.00 28.65 ? 15  DA  D C2    1 
ATOM   5126 N  N3    . DA  D 3  15  ? -37.954 43.907 -20.259 1.00 28.87 ? 15  DA  D N3    1 
ATOM   5127 C  C4    . DA  D 3  15  ? -38.129 43.901 -21.589 1.00 29.15 ? 15  DA  D C4    1 
ATOM   5128 P  P     . DC  D 3  16  ? -32.349 40.805 -22.795 1.00 46.06 ? 16  DC  D P     1 
ATOM   5129 O  OP1   . DC  D 3  16  ? -30.879 40.790 -22.729 1.00 44.79 ? 16  DC  D OP1   1 
ATOM   5130 O  OP2   . DC  D 3  16  ? -33.057 40.273 -23.981 1.00 43.64 ? 16  DC  D OP2   1 
ATOM   5131 O  "O5'" . DC  D 3  16  ? -32.940 39.994 -21.518 1.00 42.18 ? 16  DC  D "O5'" 1 
ATOM   5132 C  "C5'" . DC  D 3  16  ? -32.404 40.118 -20.201 1.00 34.78 ? 16  DC  D "C5'" 1 
ATOM   5133 C  "C4'" . DC  D 3  16  ? -33.416 39.616 -19.187 1.00 31.60 ? 16  DC  D "C4'" 1 
ATOM   5134 O  "O4'" . DC  D 3  16  ? -34.561 40.488 -19.259 1.00 28.51 ? 16  DC  D "O4'" 1 
ATOM   5135 C  "C3'" . DC  D 3  16  ? -33.986 38.227 -19.446 1.00 29.24 ? 16  DC  D "C3'" 1 
ATOM   5136 O  "O3'" . DC  D 3  16  ? -33.198 37.272 -18.814 1.00 30.57 ? 16  DC  D "O3'" 1 
ATOM   5137 C  "C2'" . DC  D 3  16  ? -35.354 38.281 -18.782 1.00 26.62 ? 16  DC  D "C2'" 1 
ATOM   5138 C  "C1'" . DC  D 3  16  ? -35.718 39.766 -18.848 1.00 26.96 ? 16  DC  D "C1'" 1 
ATOM   5139 N  N1    . DC  D 3  16  ? -36.838 40.052 -19.782 1.00 25.22 ? 16  DC  D N1    1 
ATOM   5140 C  C2    . DC  D 3  16  ? -38.029 40.576 -19.275 1.00 25.10 ? 16  DC  D C2    1 
ATOM   5141 O  O2    . DC  D 3  16  ? -38.134 40.791 -18.050 1.00 27.32 ? 16  DC  D O2    1 
ATOM   5142 N  N3    . DC  D 3  16  ? -39.047 40.817 -20.141 1.00 24.07 ? 16  DC  D N3    1 
ATOM   5143 C  C4    . DC  D 3  16  ? -38.915 40.581 -21.458 1.00 26.28 ? 16  DC  D C4    1 
ATOM   5144 N  N4    . DC  D 3  16  ? -39.974 40.846 -22.263 1.00 24.21 ? 16  DC  D N4    1 
ATOM   5145 C  C5    . DC  D 3  16  ? -37.702 40.055 -21.997 1.00 24.03 ? 16  DC  D C5    1 
ATOM   5146 C  C6    . DC  D 3  16  ? -36.706 39.805 -21.134 1.00 24.57 ? 16  DC  D C6    1 
ATOM   5147 P  P     . DA  D 3  17  ? -32.053 36.436 -19.545 1.00 31.55 ? 17  DA  D P     1 
ATOM   5148 O  OP1   . DA  D 3  17  ? -31.674 35.378 -18.588 1.00 31.69 ? 17  DA  D OP1   1 
ATOM   5149 O  OP2   . DA  D 3  17  ? -31.019 37.365 -20.040 1.00 33.60 ? 17  DA  D OP2   1 
ATOM   5150 O  "O5'" . DA  D 3  17  ? -32.791 35.847 -20.850 1.00 31.99 ? 17  DA  D "O5'" 1 
ATOM   5151 C  "C5'" . DA  D 3  17  ? -33.427 34.570 -20.860 1.00 30.72 ? 17  DA  D "C5'" 1 
ATOM   5152 C  "C4'" . DA  D 3  17  ? -34.745 34.654 -20.107 1.00 30.22 ? 17  DA  D "C4'" 1 
ATOM   5153 O  "O4'" . DA  D 3  17  ? -35.650 35.607 -20.721 1.00 30.15 ? 17  DA  D "O4'" 1 
ATOM   5154 C  "C3'" . DA  D 3  17  ? -35.519 33.346 -20.060 1.00 32.31 ? 17  DA  D "C3'" 1 
ATOM   5155 O  "O3'" . DA  D 3  17  ? -35.397 32.831 -18.760 1.00 34.71 ? 17  DA  D "O3'" 1 
ATOM   5156 C  "C2'" . DA  D 3  17  ? -36.965 33.728 -20.362 1.00 30.98 ? 17  DA  D "C2'" 1 
ATOM   5157 C  "C1'" . DA  D 3  17  ? -36.935 35.247 -20.267 1.00 30.40 ? 17  DA  D "C1'" 1 
ATOM   5158 N  N9    . DA  D 3  17  ? -37.985 35.819 -21.081 1.00 29.79 ? 17  DA  D N9    1 
ATOM   5159 C  C8    . DA  D 3  17  ? -38.130 35.693 -22.442 1.00 30.00 ? 17  DA  D C8    1 
ATOM   5160 N  N7    . DA  D 3  17  ? -39.190 36.308 -22.903 1.00 29.77 ? 17  DA  D N7    1 
ATOM   5161 C  C5    . DA  D 3  17  ? -39.784 36.875 -21.780 1.00 27.76 ? 17  DA  D C5    1 
ATOM   5162 C  C6    . DA  D 3  17  ? -40.949 37.650 -21.593 1.00 28.09 ? 17  DA  D C6    1 
ATOM   5163 N  N6    . DA  D 3  17  ? -41.758 38.011 -22.602 1.00 27.53 ? 17  DA  D N6    1 
ATOM   5164 N  N1    . DA  D 3  17  ? -41.267 38.028 -20.324 1.00 26.10 ? 17  DA  D N1    1 
ATOM   5165 C  C2    . DA  D 3  17  ? -40.458 37.675 -19.319 1.00 24.85 ? 17  DA  D C2    1 
ATOM   5166 N  N3    . DA  D 3  17  ? -39.338 36.961 -19.378 1.00 27.11 ? 17  DA  D N3    1 
ATOM   5167 C  C4    . DA  D 3  17  ? -39.055 36.581 -20.642 1.00 28.28 ? 17  DA  D C4    1 
HETATM 5168 ZN ZN    . ZN  E 4  .   ? -54.610 23.209 -46.290 1.00 29.08 ? 393 ZN  A ZN    1 
HETATM 5169 MN MN    . MN  F 5  .   ? -36.189 29.501 -15.545 1.00 36.47 ? 394 MN  A MN    1 
HETATM 5170 S  S     . SO4 G 6  .   ? -50.309 16.704 -31.907 1.00 57.54 ? 395 SO4 A S     1 
HETATM 5171 O  O1    . SO4 G 6  .   ? -48.948 16.928 -31.420 1.00 58.29 ? 395 SO4 A O1    1 
HETATM 5172 O  O2    . SO4 G 6  .   ? -50.681 15.331 -31.615 1.00 59.33 ? 395 SO4 A O2    1 
HETATM 5173 O  O3    . SO4 G 6  .   ? -51.252 17.624 -31.299 1.00 57.88 ? 395 SO4 A O3    1 
HETATM 5174 O  O4    . SO4 G 6  .   ? -50.360 16.903 -33.351 1.00 59.97 ? 395 SO4 A O4    1 
HETATM 5175 C  C1    . GOL H 7  .   ? -28.884 16.504 -9.523  1.00 60.01 ? 801 GOL A C1    1 
HETATM 5176 O  O1    . GOL H 7  .   ? -27.837 16.901 -8.658  1.00 60.03 ? 801 GOL A O1    1 
HETATM 5177 C  C2    . GOL H 7  .   ? -30.030 17.477 -9.309  1.00 59.36 ? 801 GOL A C2    1 
HETATM 5178 O  O2    . GOL H 7  .   ? -30.181 17.634 -7.923  1.00 58.05 ? 801 GOL A O2    1 
HETATM 5179 C  C3    . GOL H 7  .   ? -31.335 17.024 -9.971  1.00 59.89 ? 801 GOL A C3    1 
HETATM 5180 O  O3    . GOL H 7  .   ? -31.954 18.121 -10.627 1.00 58.87 ? 801 GOL A O3    1 
HETATM 5181 N  N     . NH4 I 8  .   ? -54.695 38.475 -7.510  1.00 31.38 ? 396 NH4 A N     1 
HETATM 5182 S  S     . SO4 J 6  .   ? -36.827 26.351 -38.657 1.00 65.97 ? 397 SO4 A S     1 
HETATM 5183 O  O1    . SO4 J 6  .   ? -36.062 25.631 -39.676 1.00 64.92 ? 397 SO4 A O1    1 
HETATM 5184 O  O2    . SO4 J 6  .   ? -37.807 27.219 -39.312 1.00 64.50 ? 397 SO4 A O2    1 
HETATM 5185 O  O3    . SO4 J 6  .   ? -37.529 25.425 -37.764 1.00 65.98 ? 397 SO4 A O3    1 
HETATM 5186 O  O4    . SO4 J 6  .   ? -35.908 27.135 -37.831 1.00 65.73 ? 397 SO4 A O4    1 
HETATM 5187 C  C1    . GOL K 7  .   ? -13.179 33.815 -13.023 1.00 55.48 ? 398 GOL A C1    1 
HETATM 5188 O  O1    . GOL K 7  .   ? -13.281 34.891 -12.136 1.00 56.00 ? 398 GOL A O1    1 
HETATM 5189 C  C2    . GOL K 7  .   ? -12.283 32.874 -12.270 1.00 55.75 ? 398 GOL A C2    1 
HETATM 5190 O  O2    . GOL K 7  .   ? -11.176 33.667 -11.924 1.00 56.73 ? 398 GOL A O2    1 
HETATM 5191 C  C3    . GOL K 7  .   ? -11.865 31.689 -13.132 1.00 56.47 ? 398 GOL A C3    1 
HETATM 5192 O  O3    . GOL K 7  .   ? -10.926 30.937 -12.389 1.00 57.11 ? 398 GOL A O3    1 
HETATM 5193 MN MN    . MN  L 5  .   ? -14.743 35.351 22.489  1.00 39.03 ? 393 MN  B MN    1 
HETATM 5194 C  C1    . GOL M 7  .   ? -45.235 42.598 14.631  1.00 64.38 ? 803 GOL B C1    1 
HETATM 5195 O  O1    . GOL M 7  .   ? -46.528 42.104 14.368  1.00 62.95 ? 803 GOL B O1    1 
HETATM 5196 C  C2    . GOL M 7  .   ? -45.281 44.108 14.816  1.00 65.53 ? 803 GOL B C2    1 
HETATM 5197 O  O2    . GOL M 7  .   ? -44.967 44.728 13.592  1.00 68.40 ? 803 GOL B O2    1 
HETATM 5198 C  C3    . GOL M 7  .   ? -44.271 44.575 15.857  1.00 65.69 ? 803 GOL B C3    1 
HETATM 5199 O  O3    . GOL M 7  .   ? -44.553 45.913 16.215  1.00 64.65 ? 803 GOL B O3    1 
HETATM 5200 MN MN    . MN  N 5  .   ? -20.919 34.599 25.727  1.00 36.02 ? 394 MN  B MN    1 
HETATM 5201 C  C1    . GOL O 7  .   ? -19.546 39.820 22.900  1.00 51.71 ? 395 GOL B C1    1 
HETATM 5202 O  O1    . GOL O 7  .   ? -19.712 40.339 21.595  1.00 51.05 ? 395 GOL B O1    1 
HETATM 5203 C  C2    . GOL O 7  .   ? -20.269 40.774 23.843  1.00 51.93 ? 395 GOL B C2    1 
HETATM 5204 O  O2    . GOL O 7  .   ? -19.368 41.341 24.770  1.00 51.36 ? 395 GOL B O2    1 
HETATM 5205 C  C3    . GOL O 7  .   ? -21.459 40.072 24.485  1.00 50.85 ? 395 GOL B C3    1 
HETATM 5206 O  O3    . GOL O 7  .   ? -21.988 40.819 25.554  1.00 49.78 ? 395 GOL B O3    1 
HETATM 5207 S  S     . SO4 P 6  .   ? -34.552 39.740 26.173  1.00 98.81 ? 396 SO4 B S     1 
HETATM 5208 O  O1    . SO4 P 6  .   ? -34.354 38.999 24.930  1.00 98.64 ? 396 SO4 B O1    1 
HETATM 5209 O  O2    . SO4 P 6  .   ? -35.861 39.409 26.739  1.00 98.71 ? 396 SO4 B O2    1 
HETATM 5210 O  O3    . SO4 P 6  .   ? -33.504 39.365 27.117  1.00 98.32 ? 396 SO4 B O3    1 
HETATM 5211 O  O4    . SO4 P 6  .   ? -34.471 41.175 25.896  1.00 98.52 ? 396 SO4 B O4    1 
HETATM 5212 O  O1    . HEZ Q 9  .   ? -19.493 25.679 24.191  1.00 58.79 ? 397 HEZ B O1    1 
HETATM 5213 C  C1    . HEZ Q 9  .   ? -20.619 25.280 23.389  1.00 58.28 ? 397 HEZ B C1    1 
HETATM 5214 C  C2    . HEZ Q 9  .   ? -21.114 23.903 23.820  1.00 58.55 ? 397 HEZ B C2    1 
HETATM 5215 C  C3    . HEZ Q 9  .   ? -22.363 23.449 23.062  1.00 58.46 ? 397 HEZ B C3    1 
HETATM 5216 C  C4    . HEZ Q 9  .   ? -22.056 22.253 22.165  1.00 58.73 ? 397 HEZ B C4    1 
HETATM 5217 C  C5    . HEZ Q 9  .   ? -22.822 20.980 22.510  1.00 60.16 ? 397 HEZ B C5    1 
HETATM 5218 C  C6    . HEZ Q 9  .   ? -22.120 19.759 21.899  1.00 61.52 ? 397 HEZ B C6    1 
HETATM 5219 O  O6    . HEZ Q 9  .   ? -22.802 18.530 22.211  1.00 62.36 ? 397 HEZ B O6    1 
HETATM 5220 C  C1    . GOL R 7  .   ? -42.569 53.370 -14.160 1.00 32.52 ? 20  GOL C C1    1 
HETATM 5221 O  O1    . GOL R 7  .   ? -41.405 53.769 -13.527 1.00 30.07 ? 20  GOL C O1    1 
HETATM 5222 C  C2    . GOL R 7  .   ? -42.764 51.877 -13.937 1.00 35.79 ? 20  GOL C C2    1 
HETATM 5223 O  O2    . GOL R 7  .   ? -42.104 51.109 -14.927 1.00 31.23 ? 20  GOL C O2    1 
HETATM 5224 C  C3    . GOL R 7  .   ? -44.262 51.727 -14.115 1.00 37.88 ? 20  GOL C C3    1 
HETATM 5225 O  O3    . GOL R 7  .   ? -44.669 50.693 -13.273 1.00 42.95 ? 20  GOL C O3    1 
HETATM 5226 O  O     . HOH S 10 .   ? -36.000 27.493 -14.458 1.00 35.94 ? 399 HOH A O     1 
HETATM 5227 O  O     . HOH S 10 .   ? -36.153 28.373 -17.602 1.00 35.81 ? 400 HOH A O     1 
HETATM 5228 O  O     . HOH S 10 .   ? -28.296 34.203 -19.114 1.00 42.96 ? 401 HOH A O     1 
HETATM 5229 O  O     . HOH S 10 .   ? -43.589 38.152 -0.227  1.00 24.86 ? 402 HOH A O     1 
HETATM 5230 O  O     . HOH S 10 .   ? -44.902 36.163 5.545   1.00 32.41 ? 403 HOH A O     1 
HETATM 5231 O  O     . HOH S 10 .   ? -48.275 40.176 10.417  1.00 33.71 ? 404 HOH A O     1 
HETATM 5232 O  O     . HOH S 10 .   ? -28.947 49.568 3.917   1.00 26.72 ? 405 HOH A O     1 
HETATM 5233 O  O     . HOH S 10 .   ? -38.564 42.522 -10.340 1.00 32.32 ? 406 HOH A O     1 
HETATM 5234 O  O     . HOH S 10 .   ? -32.928 43.711 -5.358  1.00 31.86 ? 407 HOH A O     1 
HETATM 5235 O  O     . HOH S 10 .   ? -44.018 37.107 -11.441 1.00 25.98 ? 408 HOH A O     1 
HETATM 5236 O  O     . HOH S 10 .   ? -48.294 44.700 -0.537  1.00 53.50 ? 409 HOH A O     1 
HETATM 5237 O  O     . HOH S 10 .   ? -47.785 41.014 -8.492  1.00 29.86 ? 410 HOH A O     1 
HETATM 5238 O  O     . HOH S 10 .   ? -46.201 43.230 -7.524  1.00 32.43 ? 411 HOH A O     1 
HETATM 5239 O  O     . HOH S 10 .   ? -20.251 34.992 -4.862  1.00 42.53 ? 412 HOH A O     1 
HETATM 5240 O  O     . HOH S 10 .   ? -27.183 35.674 -0.949  1.00 40.30 ? 413 HOH A O     1 
HETATM 5241 O  O     . HOH S 10 .   ? -23.305 24.170 -7.018  1.00 38.32 ? 414 HOH A O     1 
HETATM 5242 O  O     . HOH S 10 .   ? -41.223 19.730 -7.161  1.00 30.64 ? 415 HOH A O     1 
HETATM 5243 O  O     . HOH S 10 .   ? -44.321 19.797 -34.717 1.00 32.70 ? 416 HOH A O     1 
HETATM 5244 O  O     . HOH S 10 .   ? -41.597 19.335 -34.031 1.00 39.88 ? 417 HOH A O     1 
HETATM 5245 O  O     . HOH S 10 .   ? -32.770 46.353 -17.027 1.00 41.66 ? 418 HOH A O     1 
HETATM 5246 O  O     . HOH S 10 .   ? -35.058 45.719 -18.864 1.00 51.37 ? 419 HOH A O     1 
HETATM 5247 O  O     . HOH S 10 .   ? -50.278 46.848 -16.910 1.00 31.15 ? 420 HOH A O     1 
HETATM 5248 O  O     . HOH S 10 .   ? -34.353 25.312 6.499   1.00 40.35 ? 421 HOH A O     1 
HETATM 5249 O  O     . HOH S 10 .   ? -60.610 38.532 -53.095 1.00 31.82 ? 422 HOH A O     1 
HETATM 5250 O  O     . HOH S 10 .   ? -60.124 46.913 -22.897 1.00 46.83 ? 423 HOH A O     1 
HETATM 5251 O  O     . HOH S 10 .   ? -35.968 13.926 -7.615  1.00 50.23 ? 424 HOH A O     1 
HETATM 5252 O  O     . HOH S 10 .   ? -37.789 13.524 -9.691  1.00 49.54 ? 425 HOH A O     1 
HETATM 5253 O  O     . HOH S 10 .   ? -31.332 48.503 -11.938 1.00 38.40 ? 426 HOH A O     1 
HETATM 5254 O  O     . HOH S 10 .   ? -34.214 57.052 9.760   1.00 42.60 ? 427 HOH A O     1 
HETATM 5255 O  O     . HOH S 10 .   ? -39.346 25.289 -40.153 1.00 39.37 ? 428 HOH A O     1 
HETATM 5256 O  O     . HOH S 10 .   ? -48.895 19.298 -34.710 1.00 33.40 ? 429 HOH A O     1 
HETATM 5257 O  O     . HOH S 10 .   ? -53.838 21.480 -28.586 1.00 28.68 ? 430 HOH A O     1 
HETATM 5258 O  O     . HOH S 10 .   ? -34.242 33.170 11.658  1.00 26.84 ? 431 HOH A O     1 
HETATM 5259 O  O     . HOH S 10 .   ? -60.584 34.591 -60.312 1.00 35.46 ? 432 HOH A O     1 
HETATM 5260 O  O     . HOH S 10 .   ? -46.103 25.985 -38.471 1.00 26.57 ? 433 HOH A O     1 
HETATM 5261 O  O     . HOH S 10 .   ? -61.048 21.566 -62.232 1.00 52.26 ? 434 HOH A O     1 
HETATM 5262 O  O     . HOH S 10 .   ? -24.824 55.036 6.310   1.00 42.57 ? 435 HOH A O     1 
HETATM 5263 O  O     . HOH S 10 .   ? -21.323 54.760 4.305   1.00 56.28 ? 436 HOH A O     1 
HETATM 5264 O  O     . HOH S 10 .   ? -27.434 54.090 8.724   1.00 40.36 ? 437 HOH A O     1 
HETATM 5265 O  O     . HOH S 10 .   ? -28.621 52.134 10.064  1.00 43.09 ? 438 HOH A O     1 
HETATM 5266 O  O     . HOH S 10 .   ? -36.819 61.476 12.730  1.00 47.93 ? 439 HOH A O     1 
HETATM 5267 O  O     . HOH S 10 .   ? -25.322 26.717 6.991   1.00 57.30 ? 440 HOH A O     1 
HETATM 5268 O  O     . HOH S 10 .   ? -38.382 29.903 -12.360 1.00 33.44 ? 441 HOH A O     1 
HETATM 5269 O  O     . HOH S 10 .   ? -42.528 31.134 -15.855 1.00 35.25 ? 442 HOH A O     1 
HETATM 5270 O  O     . HOH S 10 .   ? -67.219 16.637 -54.317 1.00 45.46 ? 443 HOH A O     1 
HETATM 5271 O  O     . HOH S 10 .   ? -69.749 20.111 -64.868 1.00 50.19 ? 444 HOH A O     1 
HETATM 5272 O  O     . HOH S 10 .   ? -47.309 39.515 -22.390 1.00 46.29 ? 445 HOH A O     1 
HETATM 5273 O  O     . HOH S 10 .   ? -26.916 24.421 2.731   1.00 37.43 ? 446 HOH A O     1 
HETATM 5274 O  O     . HOH S 10 .   ? -51.750 42.850 -22.600 1.00 29.00 ? 447 HOH A O     1 
HETATM 5275 O  O     . HOH S 10 .   ? -24.341 27.334 0.237   1.00 50.98 ? 448 HOH A O     1 
HETATM 5276 O  O     . HOH S 10 .   ? -23.668 29.270 -3.520  1.00 52.89 ? 449 HOH A O     1 
HETATM 5277 O  O     . HOH S 10 .   ? -34.477 18.370 5.018   1.00 61.01 ? 450 HOH A O     1 
HETATM 5278 O  O     . HOH S 10 .   ? -57.614 39.175 -20.242 1.00 30.61 ? 451 HOH A O     1 
HETATM 5279 O  O     . HOH S 10 .   ? -58.003 37.192 -21.952 1.00 43.71 ? 452 HOH A O     1 
HETATM 5280 O  O     . HOH S 10 .   ? -64.513 26.714 -31.199 1.00 42.15 ? 453 HOH A O     1 
HETATM 5281 O  O     . HOH S 10 .   ? -29.036 20.585 -13.677 1.00 69.23 ? 454 HOH A O     1 
HETATM 5282 O  O     . HOH S 10 .   ? -31.628 15.858 -6.762  1.00 59.64 ? 455 HOH A O     1 
HETATM 5283 O  O     . HOH S 10 .   ? -36.577 54.500 8.341   1.00 44.06 ? 456 HOH A O     1 
HETATM 5284 O  O     . HOH S 10 .   ? -48.664 46.324 5.934   1.00 48.19 ? 457 HOH A O     1 
HETATM 5285 O  O     . HOH S 10 .   ? -31.067 54.418 -5.759  1.00 20.26 ? 458 HOH A O     1 
HETATM 5286 O  O     . HOH S 10 .   ? -28.747 52.967 -5.812  1.00 23.73 ? 459 HOH A O     1 
HETATM 5287 O  O     . HOH S 10 .   ? -27.568 50.972 -3.896  1.00 26.38 ? 460 HOH A O     1 
HETATM 5288 O  O     . HOH S 10 .   ? -52.437 39.038 8.841   1.00 65.55 ? 461 HOH A O     1 
HETATM 5289 O  O     . HOH S 10 .   ? -51.400 18.417 -49.656 1.00 43.16 ? 462 HOH A O     1 
HETATM 5290 O  O     . HOH S 10 .   ? -52.456 47.696 -4.361  1.00 62.70 ? 463 HOH A O     1 
HETATM 5291 O  O     . HOH S 10 .   ? -56.452 19.595 -47.560 1.00 43.20 ? 464 HOH A O     1 
HETATM 5292 O  O     . HOH S 10 .   ? -54.329 18.139 -44.004 1.00 34.73 ? 465 HOH A O     1 
HETATM 5293 O  O     . HOH S 10 .   ? -56.845 17.335 -43.669 1.00 42.96 ? 466 HOH A O     1 
HETATM 5294 O  O     . HOH S 10 .   ? -48.066 55.756 -8.024  1.00 53.79 ? 467 HOH A O     1 
HETATM 5295 O  O     . HOH S 10 .   ? -15.503 45.686 -22.212 1.00 54.89 ? 468 HOH A O     1 
HETATM 5296 O  O     . HOH S 10 .   ? -44.028 18.628 -41.569 1.00 29.60 ? 469 HOH A O     1 
HETATM 5297 O  O     . HOH S 10 .   ? -43.891 26.892 -40.156 1.00 42.06 ? 470 HOH A O     1 
HETATM 5298 O  O     . HOH S 10 .   ? -42.579 28.965 -41.218 1.00 58.81 ? 471 HOH A O     1 
HETATM 5299 O  O     . HOH S 10 .   ? -46.932 29.547 -38.573 1.00 35.50 ? 472 HOH A O     1 
HETATM 5300 O  O     . HOH S 10 .   ? -56.330 28.151 -44.396 1.00 26.44 ? 473 HOH A O     1 
HETATM 5301 O  O     . HOH S 10 .   ? -20.103 29.860 -3.143  1.00 54.79 ? 474 HOH A O     1 
HETATM 5302 O  O     . HOH S 10 .   ? -49.396 38.591 -23.626 1.00 41.23 ? 475 HOH A O     1 
HETATM 5303 O  O     . HOH S 10 .   ? -41.115 48.769 -8.773  1.00 27.41 ? 476 HOH A O     1 
HETATM 5304 O  O     . HOH S 10 .   ? -39.762 31.459 -16.210 1.00 38.89 ? 477 HOH A O     1 
HETATM 5305 O  O     . HOH S 10 .   ? -33.580 23.452 -13.944 1.00 32.89 ? 478 HOH A O     1 
HETATM 5306 O  O     . HOH S 10 .   ? -25.217 20.685 -8.689  1.00 57.34 ? 479 HOH A O     1 
HETATM 5307 O  O     . HOH S 10 .   ? -24.884 21.000 -5.534  1.00 57.80 ? 480 HOH A O     1 
HETATM 5308 O  O     . HOH S 10 .   ? -16.226 26.071 -4.957  1.00 62.80 ? 481 HOH A O     1 
HETATM 5309 O  O     . HOH S 10 .   ? -47.022 48.639 -15.645 1.00 39.92 ? 482 HOH A O     1 
HETATM 5310 O  O     . HOH S 10 .   ? -57.605 20.036 -60.215 1.00 45.28 ? 483 HOH A O     1 
HETATM 5311 O  O     . HOH S 10 .   ? -15.093 48.144 -24.000 1.00 61.74 ? 484 HOH A O     1 
HETATM 5312 O  O     . HOH S 10 .   ? -41.898 26.310 -7.002  1.00 33.24 ? 485 HOH A O     1 
HETATM 5313 O  O     . HOH S 10 .   ? -33.836 54.791 6.884   1.00 38.37 ? 486 HOH A O     1 
HETATM 5314 O  O     . HOH S 10 .   ? -31.908 51.146 1.071   1.00 24.74 ? 487 HOH A O     1 
HETATM 5315 O  O     . HOH S 10 .   ? -48.363 25.627 -23.331 1.00 29.10 ? 488 HOH A O     1 
HETATM 5316 O  O     . HOH S 10 .   ? -48.488 27.477 -21.400 1.00 24.05 ? 489 HOH A O     1 
HETATM 5317 O  O     . HOH S 10 .   ? -48.859 36.254 -7.357  1.00 34.50 ? 490 HOH A O     1 
HETATM 5318 O  O     . HOH S 10 .   ? -40.504 58.974 -9.121  1.00 28.55 ? 491 HOH A O     1 
HETATM 5319 O  O     . HOH S 10 .   ? -37.835 49.013 -4.685  1.00 33.00 ? 492 HOH A O     1 
HETATM 5320 O  O     . HOH S 10 .   ? -39.241 46.603 -4.759  1.00 32.64 ? 493 HOH A O     1 
HETATM 5321 O  O     . HOH S 10 .   ? -35.425 48.743 -6.526  1.00 31.18 ? 494 HOH A O     1 
HETATM 5322 O  O     . HOH S 10 .   ? -27.105 49.395 -13.618 1.00 22.72 ? 495 HOH A O     1 
HETATM 5323 O  O     . HOH S 10 .   ? -28.930 47.565 -13.218 1.00 34.42 ? 496 HOH A O     1 
HETATM 5324 O  O     . HOH S 10 .   ? -51.398 39.862 5.316   1.00 65.95 ? 497 HOH A O     1 
HETATM 5325 O  O     . HOH S 10 .   ? -50.530 37.551 4.395   1.00 35.88 ? 498 HOH A O     1 
HETATM 5326 O  O     . HOH S 10 .   ? -51.546 35.322 3.458   1.00 58.32 ? 499 HOH A O     1 
HETATM 5327 O  O     . HOH S 10 .   ? -46.876 38.741 -7.397  1.00 34.30 ? 500 HOH A O     1 
HETATM 5328 O  O     . HOH S 10 .   ? -37.438 45.133 -6.642  1.00 45.42 ? 501 HOH A O     1 
HETATM 5329 O  O     . HOH S 10 .   ? -42.761 46.844 -7.416  1.00 55.40 ? 502 HOH A O     1 
HETATM 5330 O  O     . HOH S 10 .   ? -43.777 26.706 7.569   1.00 53.45 ? 503 HOH A O     1 
HETATM 5331 O  O     . HOH S 10 .   ? -48.963 24.227 2.574   1.00 61.28 ? 504 HOH A O     1 
HETATM 5332 O  O     . HOH S 10 .   ? -48.498 22.443 0.028   1.00 63.25 ? 505 HOH A O     1 
HETATM 5333 O  O     . HOH S 10 .   ? -62.575 45.877 -34.801 1.00 59.22 ? 506 HOH A O     1 
HETATM 5334 O  O     . HOH S 10 .   ? -41.880 20.657 -28.505 1.00 47.01 ? 507 HOH A O     1 
HETATM 5335 O  O     . HOH S 10 .   ? -45.230 21.210 -27.022 1.00 50.05 ? 508 HOH A O     1 
HETATM 5336 O  O     . HOH S 10 .   ? -50.498 21.010 -16.889 1.00 49.12 ? 509 HOH A O     1 
HETATM 5337 O  O     . HOH S 10 .   ? -49.272 23.875 -15.936 1.00 35.70 ? 510 HOH A O     1 
HETATM 5338 O  O     . HOH S 10 .   ? -43.443 34.164 -23.690 1.00 50.45 ? 511 HOH A O     1 
HETATM 5339 O  O     . HOH S 10 .   ? -45.914 32.656 -24.376 1.00 45.14 ? 512 HOH A O     1 
HETATM 5340 O  O     . HOH S 10 .   ? -24.365 36.658 -3.273  1.00 39.38 ? 513 HOH A O     1 
HETATM 5341 O  O     . HOH S 10 .   ? -51.572 49.951 -2.802  1.00 62.20 ? 514 HOH A O     1 
HETATM 5342 O  O     . HOH S 10 .   ? -52.744 52.362 -2.866  1.00 67.47 ? 515 HOH A O     1 
HETATM 5343 O  O     . HOH S 10 .   ? -54.026 26.926 -53.546 1.00 27.75 ? 516 HOH A O     1 
HETATM 5344 O  O     . HOH S 10 .   ? -63.338 29.855 -35.621 1.00 44.83 ? 517 HOH A O     1 
HETATM 5345 O  O     . HOH S 10 .   ? -52.200 50.651 -14.249 1.00 53.78 ? 518 HOH A O     1 
HETATM 5346 O  O     . HOH S 10 .   ? -63.845 33.407 -43.248 1.00 41.64 ? 519 HOH A O     1 
HETATM 5347 O  O     . HOH S 10 .   ? -65.064 31.296 -37.473 1.00 51.29 ? 520 HOH A O     1 
HETATM 5348 O  O     . HOH S 10 .   ? -48.003 47.099 -5.027  1.00 46.17 ? 521 HOH A O     1 
HETATM 5349 O  O     . HOH S 10 .   ? -49.850 45.111 -6.456  1.00 77.44 ? 522 HOH A O     1 
HETATM 5350 O  O     . HOH S 10 .   ? -30.912 20.176 -15.411 1.00 57.81 ? 523 HOH A O     1 
HETATM 5351 O  O     . HOH S 10 .   ? -32.760 22.179 -16.354 1.00 48.99 ? 524 HOH A O     1 
HETATM 5352 O  O     . HOH S 10 .   ? -36.373 23.854 -18.665 1.00 54.18 ? 525 HOH A O     1 
HETATM 5353 O  O     . HOH S 10 .   ? -50.960 37.714 -6.313  1.00 40.89 ? 526 HOH A O     1 
HETATM 5354 O  O     . HOH S 10 .   ? -52.253 20.304 -26.740 1.00 33.37 ? 527 HOH A O     1 
HETATM 5355 O  O     . HOH S 10 .   ? -30.267 42.186 -4.981  1.00 37.40 ? 528 HOH A O     1 
HETATM 5356 O  O     . HOH S 10 .   ? -50.011 37.726 0.309   1.00 33.59 ? 529 HOH A O     1 
HETATM 5357 O  O     . HOH S 10 .   ? -36.365 44.873 -11.212 1.00 44.79 ? 530 HOH A O     1 
HETATM 5358 O  O     . HOH S 10 .   ? -47.526 44.964 -8.608  1.00 44.71 ? 531 HOH A O     1 
HETATM 5359 O  O     . HOH S 10 .   ? -56.131 40.211 -37.111 1.00 26.35 ? 532 HOH A O     1 
HETATM 5360 O  O     . HOH S 10 .   ? -12.357 41.076 -13.800 1.00 45.30 ? 533 HOH A O     1 
HETATM 5361 O  O     . HOH S 10 .   ? -42.031 51.732 21.891  1.00 51.61 ? 534 HOH A O     1 
HETATM 5362 O  O     . HOH S 10 .   ? -75.695 27.923 -49.836 1.00 55.93 ? 535 HOH A O     1 
HETATM 5363 O  O     . HOH S 10 .   ? -55.317 42.374 -25.595 1.00 29.35 ? 536 HOH A O     1 
HETATM 5364 O  O     . HOH S 10 .   ? -35.970 63.957 3.906   1.00 60.66 ? 537 HOH A O     1 
HETATM 5365 O  O     . HOH S 10 .   ? -44.262 58.207 -8.849  1.00 53.60 ? 538 HOH A O     1 
HETATM 5366 O  O     . HOH S 10 .   ? -45.471 56.434 -7.925  1.00 57.05 ? 539 HOH A O     1 
HETATM 5367 O  O     . HOH S 10 .   ? -49.469 32.477 -34.329 1.00 28.54 ? 540 HOH A O     1 
HETATM 5368 O  O     . HOH S 10 .   ? -46.082 53.679 -4.976  1.00 34.14 ? 541 HOH A O     1 
HETATM 5369 O  O     . HOH S 10 .   ? -42.734 29.047 -17.787 1.00 33.49 ? 542 HOH A O     1 
HETATM 5370 O  O     . HOH S 10 .   ? -27.228 52.659 0.110   1.00 29.51 ? 543 HOH A O     1 
HETATM 5371 O  O     . HOH S 10 .   ? -70.813 32.311 -54.943 1.00 32.34 ? 544 HOH A O     1 
HETATM 5372 O  O     . HOH S 10 .   ? -69.004 27.813 -22.700 1.00 68.17 ? 545 HOH A O     1 
HETATM 5373 O  O     . HOH S 10 .   ? -72.699 24.214 -52.798 1.00 43.63 ? 546 HOH A O     1 
HETATM 5374 O  O     . HOH S 10 .   ? -32.894 61.221 5.127   1.00 40.94 ? 547 HOH A O     1 
HETATM 5375 O  O     . HOH S 10 .   ? -65.177 22.878 -41.344 1.00 57.84 ? 548 HOH A O     1 
HETATM 5376 O  O     . HOH S 10 .   ? -62.388 34.911 -63.603 1.00 56.41 ? 549 HOH A O     1 
HETATM 5377 O  O     . HOH S 10 .   ? -32.846 47.697 -9.728  1.00 45.17 ? 550 HOH A O     1 
HETATM 5378 O  O     . HOH S 10 .   ? -39.849 19.970 -15.383 1.00 43.10 ? 551 HOH A O     1 
HETATM 5379 O  O     . HOH S 10 .   ? -37.135 56.792 1.985   1.00 50.53 ? 552 HOH A O     1 
HETATM 5380 O  O     . HOH S 10 .   ? -37.763 55.038 4.045   1.00 43.99 ? 553 HOH A O     1 
HETATM 5381 O  O     . HOH S 10 .   ? -34.804 20.664 -36.456 1.00 47.15 ? 554 HOH A O     1 
HETATM 5382 O  O     . HOH S 10 .   ? -22.408 32.252 -21.923 1.00 58.65 ? 555 HOH A O     1 
HETATM 5383 O  O     . HOH S 10 .   ? -50.128 46.534 -3.583  1.00 58.52 ? 556 HOH A O     1 
HETATM 5384 O  O     . HOH S 10 .   ? -44.950 54.745 -2.766  1.00 42.29 ? 557 HOH A O     1 
HETATM 5385 O  O     . HOH S 10 .   ? -62.069 28.001 -32.217 1.00 37.25 ? 558 HOH A O     1 
HETATM 5386 O  O     . HOH S 10 .   ? -15.063 48.007 -15.205 1.00 53.98 ? 559 HOH A O     1 
HETATM 5387 O  O     . HOH S 10 .   ? -61.109 19.563 -38.246 1.00 65.32 ? 560 HOH A O     1 
HETATM 5388 O  O     . HOH S 10 .   ? -61.260 19.797 -35.531 1.00 63.09 ? 561 HOH A O     1 
HETATM 5389 O  O     . HOH S 10 .   ? -36.654 24.389 -35.432 1.00 43.02 ? 562 HOH A O     1 
HETATM 5390 O  O     . HOH S 10 .   ? -51.105 37.808 -28.456 1.00 33.45 ? 563 HOH A O     1 
HETATM 5391 O  O     . HOH S 10 .   ? -41.415 29.293 -35.826 1.00 59.11 ? 564 HOH A O     1 
HETATM 5392 O  O     . HOH S 10 .   ? -52.017 52.163 -7.316  1.00 46.33 ? 565 HOH A O     1 
HETATM 5393 O  O     . HOH S 10 .   ? -15.480 26.217 -7.505  1.00 61.62 ? 566 HOH A O     1 
HETATM 5394 O  O     . HOH S 10 .   ? -50.057 16.157 -21.149 1.00 56.10 ? 567 HOH A O     1 
HETATM 5395 O  O     . HOH S 10 .   ? -55.077 47.000 -31.472 1.00 46.82 ? 568 HOH A O     1 
HETATM 5396 O  O     . HOH S 10 .   ? -34.065 46.702 -7.056  1.00 34.19 ? 569 HOH A O     1 
HETATM 5397 O  O     . HOH S 10 .   ? -45.523 47.316 -13.342 1.00 40.02 ? 570 HOH A O     1 
HETATM 5398 O  O     . HOH S 10 .   ? -35.066 22.174 -17.263 1.00 43.34 ? 571 HOH A O     1 
HETATM 5399 O  O     . HOH S 10 .   ? -31.865 27.314 -16.383 1.00 39.25 ? 572 HOH A O     1 
HETATM 5400 O  O     . HOH S 10 .   ? -31.465 25.223 -17.629 1.00 61.87 ? 573 HOH A O     1 
HETATM 5401 O  O     . HOH S 10 .   ? -51.034 32.759 -5.752  1.00 54.45 ? 574 HOH A O     1 
HETATM 5402 O  O     . HOH S 10 .   ? -35.586 17.144 1.852   1.00 65.04 ? 575 HOH A O     1 
HETATM 5403 O  O     . HOH S 10 .   ? -46.521 53.438 0.202   1.00 45.42 ? 576 HOH A O     1 
HETATM 5404 O  O     . HOH S 10 .   ? -47.888 21.530 -16.717 1.00 64.69 ? 577 HOH A O     1 
HETATM 5405 O  O     . HOH S 10 .   ? -56.826 27.108 -36.454 1.00 29.92 ? 578 HOH A O     1 
HETATM 5406 O  O     . HOH S 10 .   ? -62.256 39.574 -54.812 1.00 48.01 ? 579 HOH A O     1 
HETATM 5407 O  O     . HOH S 10 .   ? -25.951 50.779 -1.519  1.00 24.06 ? 580 HOH A O     1 
HETATM 5408 O  O     . HOH S 10 .   ? -24.075 49.598 -1.615  1.00 37.79 ? 581 HOH A O     1 
HETATM 5409 O  O     . HOH S 10 .   ? -22.146 49.296 -2.873  1.00 62.17 ? 582 HOH A O     1 
HETATM 5410 O  O     . HOH S 10 .   ? -46.482 45.199 7.360   1.00 45.23 ? 583 HOH A O     1 
HETATM 5411 O  O     . HOH S 10 .   ? -44.257 26.785 -31.888 1.00 43.47 ? 584 HOH A O     1 
HETATM 5412 O  O     . HOH S 10 .   ? -68.374 33.962 -55.232 1.00 39.44 ? 585 HOH A O     1 
HETATM 5413 O  O     . HOH S 10 .   ? -62.923 24.198 -36.765 1.00 45.02 ? 586 HOH A O     1 
HETATM 5414 O  O     . HOH S 10 .   ? -34.041 26.003 -14.728 1.00 37.53 ? 587 HOH A O     1 
HETATM 5415 O  O     . HOH S 10 .   ? -36.446 31.460 -16.631 1.00 35.30 ? 588 HOH A O     1 
HETATM 5416 O  O     . HOH S 10 .   ? -34.101 29.734 -15.749 1.00 35.49 ? 589 HOH A O     1 
HETATM 5417 O  O     . HOH S 10 .   ? -37.394 26.205 -17.442 1.00 57.23 ? 590 HOH A O     1 
HETATM 5418 O  O     . HOH S 10 .   ? -68.504 33.565 -52.353 1.00 33.24 ? 591 HOH A O     1 
HETATM 5419 O  O     . HOH S 10 .   ? -70.503 32.346 -49.453 1.00 40.35 ? 592 HOH A O     1 
HETATM 5420 O  O     . HOH S 10 .   ? -69.783 35.900 -57.188 1.00 47.83 ? 593 HOH A O     1 
HETATM 5421 O  O     . HOH S 10 .   ? -53.236 33.858 -28.139 1.00 30.62 ? 594 HOH A O     1 
HETATM 5422 O  O     . HOH S 10 .   ? -46.256 25.545 -25.428 1.00 27.04 ? 595 HOH A O     1 
HETATM 5423 O  O     . HOH S 10 .   ? -44.596 27.368 -26.291 1.00 36.57 ? 596 HOH A O     1 
HETATM 5424 O  O     . HOH S 10 .   ? -46.473 22.967 -24.663 1.00 40.53 ? 597 HOH A O     1 
HETATM 5425 O  O     . HOH S 10 .   ? -31.091 55.076 0.991   1.00 34.57 ? 598 HOH A O     1 
HETATM 5426 O  O     . HOH S 10 .   ? -57.333 26.612 -42.277 1.00 27.31 ? 599 HOH A O     1 
HETATM 5427 O  O     . HOH S 10 .   ? -41.405 27.003 -40.606 1.00 55.51 ? 600 HOH A O     1 
HETATM 5428 O  O     . HOH S 10 .   ? -46.552 18.364 -34.830 1.00 42.67 ? 601 HOH A O     1 
HETATM 5429 O  O     . HOH S 10 .   ? -38.549 16.227 -37.562 1.00 42.10 ? 602 HOH A O     1 
HETATM 5430 O  O     . HOH S 10 .   ? -37.125 18.203 -38.959 1.00 36.38 ? 603 HOH A O     1 
HETATM 5431 O  O     . HOH S 10 .   ? -34.735 18.687 -37.646 1.00 50.21 ? 604 HOH A O     1 
HETATM 5432 O  O     . HOH S 10 .   ? -32.313 17.111 -38.868 1.00 54.60 ? 605 HOH A O     1 
HETATM 5433 O  O     . HOH S 10 .   ? -44.119 18.907 -27.973 1.00 62.19 ? 606 HOH A O     1 
HETATM 5434 O  O     . HOH S 10 .   ? -46.961 22.366 -2.475  1.00 49.07 ? 607 HOH A O     1 
HETATM 5435 O  O     . HOH S 10 .   ? -44.132 19.992 -1.773  1.00 50.98 ? 608 HOH A O     1 
HETATM 5436 O  O     . HOH S 10 .   ? -45.476 21.678 -0.370  1.00 46.23 ? 609 HOH A O     1 
HETATM 5437 O  O     . HOH S 10 .   ? -47.533 27.312 3.190   1.00 39.26 ? 610 HOH A O     1 
HETATM 5438 O  O     . HOH S 10 .   ? -50.277 32.190 0.756   1.00 56.51 ? 611 HOH A O     1 
HETATM 5439 O  O     . HOH S 10 .   ? -48.460 33.613 -0.583  1.00 38.99 ? 612 HOH A O     1 
HETATM 5440 O  O     . HOH S 10 .   ? -48.997 35.933 -1.576  1.00 32.23 ? 613 HOH A O     1 
HETATM 5441 O  O     . HOH S 10 .   ? -51.697 39.936 -1.910  1.00 45.62 ? 614 HOH A O     1 
HETATM 5442 O  O     . HOH S 10 .   ? -51.392 43.741 -2.155  1.00 60.14 ? 615 HOH A O     1 
HETATM 5443 O  O     . HOH S 10 .   ? -49.211 47.862 -1.444  1.00 54.14 ? 616 HOH A O     1 
HETATM 5444 O  O     . HOH S 10 .   ? -53.046 47.792 0.094   1.00 56.01 ? 617 HOH A O     1 
HETATM 5445 O  O     . HOH S 10 .   ? -60.182 43.175 -28.431 1.00 40.38 ? 618 HOH A O     1 
HETATM 5446 O  O     . HOH S 10 .   ? -60.116 39.806 -25.099 1.00 44.67 ? 619 HOH A O     1 
HETATM 5447 O  O     . HOH S 10 .   ? -60.558 41.727 -22.823 1.00 54.18 ? 620 HOH A O     1 
HETATM 5448 O  O     . HOH S 10 .   ? -53.430 44.198 -24.356 1.00 32.53 ? 621 HOH A O     1 
HETATM 5449 O  O     . HOH S 10 .   ? -51.999 44.727 -26.480 1.00 44.87 ? 622 HOH A O     1 
HETATM 5450 O  O     . HOH S 10 .   ? -51.741 40.367 -26.663 1.00 32.41 ? 623 HOH A O     1 
HETATM 5451 O  O     . HOH S 10 .   ? -51.776 40.363 -23.911 1.00 36.20 ? 624 HOH A O     1 
HETATM 5452 O  O     . HOH S 10 .   ? -45.052 29.298 -32.115 1.00 50.49 ? 625 HOH A O     1 
HETATM 5453 O  O     . HOH S 10 .   ? -45.647 20.658 -20.981 1.00 53.17 ? 626 HOH A O     1 
HETATM 5454 O  O     . HOH S 10 .   ? -43.716 19.139 -7.513  1.00 40.71 ? 627 HOH A O     1 
HETATM 5455 O  O     . HOH S 10 .   ? -35.251 24.551 8.378   1.00 55.86 ? 628 HOH A O     1 
HETATM 5456 O  O     . HOH S 10 .   ? -36.504 20.553 8.871   1.00 57.85 ? 629 HOH A O     1 
HETATM 5457 O  O     . HOH S 10 .   ? -32.452 23.183 6.881   1.00 35.86 ? 630 HOH A O     1 
HETATM 5458 O  O     . HOH S 10 .   ? -27.498 24.530 5.907   1.00 55.92 ? 631 HOH A O     1 
HETATM 5459 O  O     . HOH S 10 .   ? -16.456 37.820 -3.005  1.00 61.98 ? 632 HOH A O     1 
HETATM 5460 O  O     . HOH S 10 .   ? -18.237 35.737 -2.796  1.00 52.18 ? 633 HOH A O     1 
HETATM 5461 O  O     . HOH S 10 .   ? -22.366 35.005 -3.442  1.00 39.86 ? 634 HOH A O     1 
HETATM 5462 O  O     . HOH S 10 .   ? -20.131 25.052 -4.460  1.00 58.45 ? 635 HOH A O     1 
HETATM 5463 O  O     . HOH S 10 .   ? -15.584 29.666 -3.901  1.00 63.46 ? 636 HOH A O     1 
HETATM 5464 O  O     . HOH S 10 .   ? -14.661 36.456 -9.563  1.00 36.61 ? 637 HOH A O     1 
HETATM 5465 O  O     . HOH S 10 .   ? -23.084 58.354 2.608   1.00 42.91 ? 638 HOH A O     1 
HETATM 5466 O  O     . HOH S 10 .   ? -39.870 50.775 20.095  1.00 29.96 ? 639 HOH A O     1 
HETATM 5467 O  O     . HOH S 10 .   ? -65.023 27.929 -67.222 1.00 31.75 ? 640 HOH A O     1 
HETATM 5468 O  O     . HOH S 10 .   ? -60.200 46.248 -36.106 1.00 46.86 ? 641 HOH A O     1 
HETATM 5469 O  O     . HOH S 10 .   ? -69.686 18.128 -53.183 1.00 44.43 ? 642 HOH A O     1 
HETATM 5470 O  O     . HOH S 10 .   ? -40.231 52.691 8.488   1.00 30.83 ? 643 HOH A O     1 
HETATM 5471 O  O     . HOH S 10 .   ? -55.288 42.289 -12.897 1.00 37.66 ? 644 HOH A O     1 
HETATM 5472 O  O     . HOH S 10 .   ? -55.685 17.762 -54.328 1.00 53.07 ? 645 HOH A O     1 
HETATM 5473 O  O     . HOH S 10 .   ? -63.232 33.495 -27.750 1.00 54.85 ? 646 HOH A O     1 
HETATM 5474 O  O     . HOH S 10 .   ? -43.140 53.547 20.934  1.00 40.71 ? 647 HOH A O     1 
HETATM 5475 O  O     . HOH S 10 .   ? -67.716 19.344 -62.532 1.00 56.04 ? 648 HOH A O     1 
HETATM 5476 O  O     . HOH S 10 .   ? -20.748 29.119 -19.930 1.00 44.47 ? 649 HOH A O     1 
HETATM 5477 O  O     . HOH S 10 .   ? -44.500 28.127 5.294   1.00 41.87 ? 650 HOH A O     1 
HETATM 5478 O  O     . HOH S 10 .   ? -63.309 31.491 -41.126 1.00 34.66 ? 651 HOH A O     1 
HETATM 5479 O  O     . HOH S 10 .   ? -72.058 21.264 -64.984 1.00 39.91 ? 652 HOH A O     1 
HETATM 5480 O  O     . HOH S 10 .   ? -33.970 52.005 -10.071 1.00 31.35 ? 653 HOH A O     1 
HETATM 5481 O  O     . HOH S 10 .   ? -28.078 21.953 2.755   1.00 38.48 ? 654 HOH A O     1 
HETATM 5482 O  O     . HOH S 10 .   ? -54.805 20.128 -55.901 1.00 41.70 ? 655 HOH A O     1 
HETATM 5483 O  O     . HOH S 10 .   ? -32.335 19.578 3.050   1.00 46.45 ? 656 HOH A O     1 
HETATM 5484 O  O     . HOH S 10 .   ? -47.772 50.737 -14.816 1.00 63.24 ? 657 HOH A O     1 
HETATM 5485 O  O     . HOH S 10 .   ? -39.037 53.713 5.582   1.00 50.96 ? 658 HOH A O     1 
HETATM 5486 O  O     . HOH S 10 .   ? -60.543 17.947 -27.466 1.00 66.19 ? 659 HOH A O     1 
HETATM 5487 O  O     . HOH S 10 .   ? -30.305 54.676 8.828   1.00 50.31 ? 660 HOH A O     1 
HETATM 5488 O  O     . HOH S 10 .   ? -64.580 27.809 -16.320 1.00 47.86 ? 661 HOH A O     1 
HETATM 5489 O  O     . HOH S 10 .   ? -39.210 58.016 -0.423  1.00 48.53 ? 662 HOH A O     1 
HETATM 5490 O  O     . HOH S 10 .   ? -77.376 35.385 -68.193 1.00 60.14 ? 663 HOH A O     1 
HETATM 5491 O  O     . HOH S 10 .   ? -40.553 59.275 18.854  1.00 50.70 ? 664 HOH A O     1 
HETATM 5492 O  O     . HOH S 10 .   ? -77.705 28.719 -51.066 1.00 58.53 ? 665 HOH A O     1 
HETATM 5493 O  O     . HOH S 10 .   ? -39.246 14.428 4.068   1.00 52.67 ? 666 HOH A O     1 
HETATM 5494 O  O     . HOH S 10 .   ? -67.155 32.590 -60.742 1.00 46.33 ? 667 HOH A O     1 
HETATM 5495 O  O     . HOH S 10 .   ? -63.547 22.043 -66.145 1.00 63.16 ? 668 HOH A O     1 
HETATM 5496 O  O     . HOH S 10 .   ? -46.814 49.777 23.186  1.00 59.88 ? 669 HOH A O     1 
HETATM 5497 O  O     . HOH S 10 .   ? -53.157 47.808 -24.773 1.00 52.25 ? 670 HOH A O     1 
HETATM 5498 O  O     . HOH S 10 .   ? -57.970 17.267 -32.578 1.00 46.40 ? 671 HOH A O     1 
HETATM 5499 O  O     . HOH S 10 .   ? -45.502 48.796 15.889  1.00 52.18 ? 672 HOH A O     1 
HETATM 5500 O  O     . HOH S 10 .   ? -54.795 14.557 -17.226 1.00 53.35 ? 673 HOH A O     1 
HETATM 5501 O  O     . HOH S 10 .   ? -12.505 39.690 -8.779  1.00 59.00 ? 674 HOH A O     1 
HETATM 5502 O  O     . HOH S 10 .   ? -52.913 33.708 -30.766 1.00 51.08 ? 675 HOH A O     1 
HETATM 5503 O  O     . HOH S 10 .   ? -66.510 29.964 -20.252 1.00 51.98 ? 676 HOH A O     1 
HETATM 5504 O  O     . HOH S 10 .   ? -49.382 56.313 3.613   1.00 64.37 ? 677 HOH A O     1 
HETATM 5505 O  O     . HOH S 10 .   ? -62.277 34.555 -20.766 1.00 42.75 ? 678 HOH A O     1 
HETATM 5506 O  O     . HOH S 10 .   ? -68.831 27.587 -44.057 1.00 45.18 ? 679 HOH A O     1 
HETATM 5507 O  O     . HOH S 10 .   ? -54.734 30.276 -38.045 1.00 55.49 ? 680 HOH A O     1 
HETATM 5508 O  O     . HOH S 10 .   ? -66.496 14.745 -58.360 1.00 58.54 ? 681 HOH A O     1 
HETATM 5509 O  O     . HOH S 10 .   ? -35.836 14.458 0.287   1.00 64.80 ? 682 HOH A O     1 
HETATM 5510 O  O     . HOH S 10 .   ? -51.545 51.317 8.174   1.00 59.86 ? 683 HOH A O     1 
HETATM 5511 O  O     . HOH S 10 .   ? -45.936 20.694 4.560   1.00 58.01 ? 684 HOH A O     1 
HETATM 5512 O  O     . HOH S 10 .   ? -48.550 23.056 -7.091  1.00 51.27 ? 685 HOH A O     1 
HETATM 5513 O  O     . HOH S 10 .   ? -82.359 29.574 -67.419 1.00 55.75 ? 686 HOH A O     1 
HETATM 5514 O  O     . HOH S 10 .   ? -46.696 22.075 1.897   1.00 65.46 ? 687 HOH A O     1 
HETATM 5515 O  O     . HOH S 10 .   ? -52.162 42.656 -28.144 1.00 42.20 ? 688 HOH A O     1 
HETATM 5516 O  O     . HOH S 10 .   ? -46.081 50.011 -8.485  1.00 62.12 ? 689 HOH A O     1 
HETATM 5517 O  O     . HOH S 10 .   ? -15.036 34.321 -17.006 1.00 61.51 ? 690 HOH A O     1 
HETATM 5518 O  O     . HOH S 10 .   ? -37.976 18.015 -28.242 1.00 70.72 ? 691 HOH A O     1 
HETATM 5519 O  O     . HOH S 10 .   ? -13.890 28.971 -13.765 1.00 56.82 ? 692 HOH A O     1 
HETATM 5520 O  O     . HOH S 10 .   ? -28.512 19.523 -1.794  1.00 42.44 ? 693 HOH A O     1 
HETATM 5521 O  O     . HOH S 10 .   ? -34.030 63.172 10.846  1.00 53.34 ? 694 HOH A O     1 
HETATM 5522 O  O     . HOH S 10 .   ? -61.234 46.437 -38.858 1.00 44.10 ? 695 HOH A O     1 
HETATM 5523 O  O     . HOH S 10 .   ? -72.266 35.217 -56.825 1.00 44.15 ? 696 HOH A O     1 
HETATM 5524 O  O     . HOH S 10 .   ? -37.682 17.536 -12.489 1.00 58.56 ? 697 HOH A O     1 
HETATM 5525 O  O     . HOH S 10 .   ? -57.539 43.496 -6.522  1.00 70.13 ? 698 HOH A O     1 
HETATM 5526 O  O     . HOH S 10 .   ? -50.084 33.467 -31.666 1.00 45.66 ? 699 HOH A O     1 
HETATM 5527 O  O     . HOH S 10 .   ? -83.478 30.894 -64.837 1.00 59.87 ? 700 HOH A O     1 
HETATM 5528 O  O     . HOH S 10 .   ? -50.920 42.791 -30.403 1.00 59.51 ? 701 HOH A O     1 
HETATM 5529 O  O     . HOH S 10 .   ? -63.386 38.030 -56.996 1.00 54.53 ? 702 HOH A O     1 
HETATM 5530 O  O     . HOH T 10 .   ? -18.956 43.477 2.366   1.00 43.34 ? 398 HOH B O     1 
HETATM 5531 O  O     . HOH T 10 .   ? -8.909  43.607 5.061   1.00 53.20 ? 399 HOH B O     1 
HETATM 5532 O  O     . HOH T 10 .   ? -12.831 44.070 1.685   1.00 69.11 ? 400 HOH B O     1 
HETATM 5533 O  O     . HOH T 10 .   ? -15.364 36.948 1.283   1.00 41.56 ? 401 HOH B O     1 
HETATM 5534 O  O     . HOH T 10 .   ? -17.751 35.403 1.823   1.00 35.77 ? 402 HOH B O     1 
HETATM 5535 O  O     . HOH T 10 .   ? -43.633 26.938 13.774  1.00 46.95 ? 403 HOH B O     1 
HETATM 5536 O  O     . HOH T 10 .   ? -4.801  46.418 15.269  1.00 52.09 ? 404 HOH B O     1 
HETATM 5537 O  O     . HOH T 10 .   ? -25.600 44.463 30.224  1.00 60.51 ? 405 HOH B O     1 
HETATM 5538 O  O     . HOH T 10 .   ? -20.991 48.676 25.417  1.00 61.05 ? 406 HOH B O     1 
HETATM 5539 O  O     . HOH T 10 .   ? -20.919 51.061 24.253  1.00 61.56 ? 407 HOH B O     1 
HETATM 5540 O  O     . HOH T 10 .   ? -10.598 30.963 6.312   1.00 59.38 ? 408 HOH B O     1 
HETATM 5541 O  O     . HOH T 10 .   ? -17.072 21.821 3.727   1.00 59.88 ? 409 HOH B O     1 
HETATM 5542 O  O     . HOH T 10 .   ? -22.469 37.343 19.557  1.00 23.87 ? 410 HOH B O     1 
HETATM 5543 O  O     . HOH T 10 .   ? -35.792 36.641 21.897  1.00 30.51 ? 411 HOH B O     1 
HETATM 5544 O  O     . HOH T 10 .   ? -27.413 34.475 2.546   1.00 53.50 ? 412 HOH B O     1 
HETATM 5545 O  O     . HOH T 10 .   ? -21.034 51.260 4.691   1.00 41.91 ? 413 HOH B O     1 
HETATM 5546 O  O     . HOH T 10 .   ? -20.653 45.204 2.243   1.00 57.88 ? 414 HOH B O     1 
HETATM 5547 O  O     . HOH T 10 .   ? -13.477 36.107 20.854  1.00 35.88 ? 415 HOH B O     1 
HETATM 5548 O  O     . HOH T 10 .   ? -19.649 36.484 25.245  1.00 36.13 ? 416 HOH B O     1 
HETATM 5549 O  O     . HOH T 10 .   ? -19.869 33.138 24.301  1.00 37.83 ? 417 HOH B O     1 
HETATM 5550 O  O     . HOH T 10 .   ? -19.230 34.141 27.459  1.00 47.39 ? 418 HOH B O     1 
HETATM 5551 O  O     . HOH T 10 .   ? -35.253 36.257 24.659  1.00 43.68 ? 419 HOH B O     1 
HETATM 5552 O  O     . HOH T 10 .   ? -32.711 35.104 24.973  1.00 40.63 ? 420 HOH B O     1 
HETATM 5553 O  O     . HOH T 10 .   ? -31.752 37.499 24.973  1.00 35.10 ? 421 HOH B O     1 
HETATM 5554 O  O     . HOH T 10 .   ? -16.968 35.542 27.096  1.00 38.71 ? 422 HOH B O     1 
HETATM 5555 O  O     . HOH T 10 .   ? -17.145 37.334 24.725  1.00 37.46 ? 423 HOH B O     1 
HETATM 5556 O  O     . HOH T 10 .   ? -14.595 34.326 27.675  1.00 33.95 ? 424 HOH B O     1 
HETATM 5557 O  O     . HOH T 10 .   ? -11.885 34.493 19.549  1.00 38.91 ? 425 HOH B O     1 
HETATM 5558 O  O     . HOH T 10 .   ? -44.545 35.471 14.907  1.00 48.51 ? 426 HOH B O     1 
HETATM 5559 O  O     . HOH T 10 .   ? -42.632 35.857 7.987   1.00 41.67 ? 427 HOH B O     1 
HETATM 5560 O  O     . HOH T 10 .   ? -33.625 32.890 22.220  1.00 33.11 ? 428 HOH B O     1 
HETATM 5561 O  O     . HOH T 10 .   ? -18.182 30.855 24.762  1.00 55.24 ? 429 HOH B O     1 
HETATM 5562 O  O     . HOH T 10 .   ? -12.894 41.665 26.694  1.00 39.26 ? 430 HOH B O     1 
HETATM 5563 O  O     . HOH T 10 .   ? -29.504 51.509 12.402  1.00 32.15 ? 431 HOH B O     1 
HETATM 5564 O  O     . HOH T 10 .   ? -26.542 31.358 8.535   1.00 52.68 ? 432 HOH B O     1 
HETATM 5565 O  O     . HOH T 10 .   ? -8.629  30.550 8.814   1.00 39.46 ? 433 HOH B O     1 
HETATM 5566 O  O     . HOH T 10 .   ? -5.380  35.219 4.941   1.00 60.16 ? 434 HOH B O     1 
HETATM 5567 O  O     . HOH T 10 .   ? -9.106  38.345 5.389   1.00 52.01 ? 435 HOH B O     1 
HETATM 5568 O  O     . HOH T 10 .   ? -10.683 36.539 4.092   1.00 45.09 ? 436 HOH B O     1 
HETATM 5569 O  O     . HOH T 10 .   ? -9.569  41.274 4.173   1.00 53.31 ? 437 HOH B O     1 
HETATM 5570 O  O     . HOH T 10 .   ? -12.941 40.969 1.802   1.00 39.62 ? 438 HOH B O     1 
HETATM 5571 O  O     . HOH T 10 .   ? -18.065 39.422 -0.762  1.00 49.60 ? 439 HOH B O     1 
HETATM 5572 O  O     . HOH T 10 .   ? -13.074 51.426 14.303  1.00 49.10 ? 440 HOH B O     1 
HETATM 5573 O  O     . HOH T 10 .   ? -24.326 22.365 33.284  1.00 65.60 ? 441 HOH B O     1 
HETATM 5574 O  O     . HOH T 10 .   ? -24.124 25.010 33.414  1.00 58.20 ? 442 HOH B O     1 
HETATM 5575 O  O     . HOH T 10 .   ? -14.828 54.134 9.817   1.00 55.59 ? 443 HOH B O     1 
HETATM 5576 O  O     . HOH T 10 .   ? -16.937 54.130 11.344  1.00 70.04 ? 444 HOH B O     1 
HETATM 5577 O  O     . HOH T 10 .   ? -11.355 49.942 11.791  1.00 40.13 ? 445 HOH B O     1 
HETATM 5578 O  O     . HOH T 10 .   ? -8.811  47.540 15.645  1.00 41.47 ? 446 HOH B O     1 
HETATM 5579 O  O     . HOH T 10 .   ? -24.200 23.911 2.443   1.00 47.89 ? 447 HOH B O     1 
HETATM 5580 O  O     . HOH T 10 .   ? -5.516  48.530 10.098  1.00 50.71 ? 448 HOH B O     1 
HETATM 5581 O  O     . HOH T 10 .   ? -7.689  47.000 19.818  1.00 61.67 ? 449 HOH B O     1 
HETATM 5582 O  O     . HOH T 10 .   ? -11.366 48.187 25.122  1.00 51.79 ? 450 HOH B O     1 
HETATM 5583 O  O     . HOH T 10 .   ? -30.043 22.363 6.690   1.00 42.61 ? 451 HOH B O     1 
HETATM 5584 O  O     . HOH T 10 .   ? -33.815 17.797 14.374  1.00 54.72 ? 452 HOH B O     1 
HETATM 5585 O  O     . HOH T 10 .   ? -33.385 16.175 19.123  1.00 55.51 ? 453 HOH B O     1 
HETATM 5586 O  O     . HOH T 10 .   ? -31.127 14.224 19.131  1.00 58.72 ? 454 HOH B O     1 
HETATM 5587 O  O     . HOH T 10 .   ? -32.436 16.195 23.205  1.00 43.54 ? 455 HOH B O     1 
HETATM 5588 O  O     . HOH T 10 .   ? -24.661 52.856 16.877  1.00 50.08 ? 456 HOH B O     1 
HETATM 5589 O  O     . HOH T 10 .   ? -26.723 21.763 32.502  1.00 42.04 ? 457 HOH B O     1 
HETATM 5590 O  O     . HOH T 10 .   ? -25.618 16.910 22.914  1.00 43.71 ? 458 HOH B O     1 
HETATM 5591 O  O     . HOH T 10 .   ? -41.434 32.278 22.280  1.00 43.43 ? 459 HOH B O     1 
HETATM 5592 O  O     . HOH T 10 .   ? -43.546 33.807 17.121  1.00 58.52 ? 460 HOH B O     1 
HETATM 5593 O  O     . HOH T 10 .   ? -22.228 12.345 14.707  1.00 51.31 ? 461 HOH B O     1 
HETATM 5594 O  O     . HOH T 10 .   ? -46.333 36.606 8.132   1.00 53.51 ? 462 HOH B O     1 
HETATM 5595 O  O     . HOH T 10 .   ? -41.506 29.465 18.707  1.00 58.85 ? 463 HOH B O     1 
HETATM 5596 O  O     . HOH T 10 .   ? -24.613 12.073 21.843  1.00 53.83 ? 464 HOH B O     1 
HETATM 5597 O  O     . HOH T 10 .   ? -38.257 29.420 25.300  1.00 54.42 ? 465 HOH B O     1 
HETATM 5598 O  O     . HOH T 10 .   ? -16.946 28.556 22.903  1.00 44.81 ? 466 HOH B O     1 
HETATM 5599 O  O     . HOH T 10 .   ? -33.619 46.476 22.593  1.00 53.45 ? 467 HOH B O     1 
HETATM 5600 O  O     . HOH T 10 .   ? -36.635 24.158 18.632  1.00 58.51 ? 468 HOH B O     1 
HETATM 5601 O  O     . HOH T 10 .   ? -47.977 34.851 9.207   1.00 63.13 ? 469 HOH B O     1 
HETATM 5602 O  O     . HOH T 10 .   ? -10.716 43.770 3.283   1.00 61.53 ? 470 HOH B O     1 
HETATM 5603 O  O     . HOH T 10 .   ? -34.179 45.121 25.361  1.00 65.04 ? 471 HOH B O     1 
HETATM 5604 O  O     . HOH T 10 .   ? -28.756 23.476 32.056  1.00 50.31 ? 472 HOH B O     1 
HETATM 5605 O  O     . HOH T 10 .   ? -48.692 44.493 17.821  1.00 55.03 ? 473 HOH B O     1 
HETATM 5606 O  O     . HOH T 10 .   ? -29.536 35.485 4.340   1.00 66.11 ? 474 HOH B O     1 
HETATM 5607 O  O     . HOH T 10 .   ? -26.757 34.543 5.334   1.00 52.63 ? 475 HOH B O     1 
HETATM 5608 O  O     . HOH T 10 .   ? -16.785 15.213 11.280  1.00 51.60 ? 476 HOH B O     1 
HETATM 5609 O  O     . HOH T 10 .   ? -18.513 15.475 9.597   1.00 56.62 ? 477 HOH B O     1 
HETATM 5610 O  O     . HOH T 10 .   ? -20.995 15.717 9.118   1.00 60.75 ? 478 HOH B O     1 
HETATM 5611 O  O     . HOH T 10 .   ? -26.000 28.920 7.956   1.00 58.74 ? 479 HOH B O     1 
HETATM 5612 O  O     . HOH T 10 .   ? -28.931 44.988 23.469  1.00 57.09 ? 480 HOH B O     1 
HETATM 5613 O  O     . HOH T 10 .   ? -28.091 48.304 19.342  1.00 48.16 ? 481 HOH B O     1 
HETATM 5614 O  O     . HOH T 10 .   ? -28.450 51.842 19.566  1.00 48.26 ? 482 HOH B O     1 
HETATM 5615 O  O     . HOH T 10 .   ? -22.515 52.376 21.668  1.00 69.48 ? 483 HOH B O     1 
HETATM 5616 O  O     . HOH T 10 .   ? -12.121 50.450 31.387  1.00 59.85 ? 484 HOH B O     1 
HETATM 5617 O  O     . HOH T 10 .   ? -12.262 51.160 19.599  1.00 59.48 ? 485 HOH B O     1 
HETATM 5618 O  O     . HOH T 10 .   ? -11.820 53.885 15.272  1.00 62.31 ? 486 HOH B O     1 
HETATM 5619 O  O     . HOH T 10 .   ? -10.247 49.737 14.819  1.00 45.66 ? 487 HOH B O     1 
HETATM 5620 O  O     . HOH T 10 .   ? -6.086  48.294 14.901  1.00 49.14 ? 488 HOH B O     1 
HETATM 5621 O  O     . HOH T 10 .   ? -4.946  49.138 12.772  1.00 64.81 ? 489 HOH B O     1 
HETATM 5622 O  O     . HOH T 10 .   ? -17.150 53.395 3.276   1.00 60.74 ? 490 HOH B O     1 
HETATM 5623 O  O     . HOH T 10 .   ? -14.376 54.081 7.321   1.00 46.22 ? 491 HOH B O     1 
HETATM 5624 O  O     . HOH T 10 .   ? -8.799  47.692 21.838  1.00 65.19 ? 492 HOH B O     1 
HETATM 5625 O  O     . HOH T 10 .   ? -17.436 40.844 31.576  1.00 45.89 ? 493 HOH B O     1 
HETATM 5626 O  O     . HOH T 10 .   ? -17.108 38.428 31.586  1.00 55.04 ? 494 HOH B O     1 
HETATM 5627 O  O     . HOH T 10 .   ? -13.588 36.695 31.999  1.00 54.51 ? 495 HOH B O     1 
HETATM 5628 O  O     . HOH T 10 .   ? -20.305 53.788 11.692  1.00 48.38 ? 496 HOH B O     1 
HETATM 5629 O  O     . HOH T 10 .   ? -26.461 50.527 19.805  1.00 47.33 ? 497 HOH B O     1 
HETATM 5630 O  O     . HOH T 10 .   ? -27.413 47.020 22.347  1.00 53.85 ? 498 HOH B O     1 
HETATM 5631 O  O     . HOH T 10 .   ? -25.416 48.733 23.330  1.00 55.69 ? 499 HOH B O     1 
HETATM 5632 O  O     . HOH T 10 .   ? -30.176 30.809 28.322  1.00 42.96 ? 500 HOH B O     1 
HETATM 5633 O  O     . HOH T 10 .   ? -33.860 32.005 26.741  1.00 47.31 ? 501 HOH B O     1 
HETATM 5634 O  O     . HOH T 10 .   ? -35.465 30.094 24.901  1.00 49.43 ? 502 HOH B O     1 
HETATM 5635 O  O     . HOH T 10 .   ? -26.955 14.675 34.884  1.00 64.16 ? 503 HOH B O     1 
HETATM 5636 O  O     . HOH T 10 .   ? -47.687 44.072 9.679   1.00 54.73 ? 504 HOH B O     1 
HETATM 5637 O  O     . HOH T 10 .   ? -39.630 33.466 25.992  1.00 52.88 ? 505 HOH B O     1 
HETATM 5638 O  O     . HOH T 10 .   ? -11.622 48.265 32.255  1.00 58.23 ? 506 HOH B O     1 
HETATM 5639 O  O     . HOH T 10 .   ? -41.594 25.112 24.682  1.00 61.55 ? 507 HOH B O     1 
HETATM 5640 O  O     . HOH T 10 .   ? -39.999 27.217 25.113  1.00 64.84 ? 508 HOH B O     1 
HETATM 5641 O  O     . HOH T 10 .   ? -2.743  45.127 15.997  1.00 64.36 ? 509 HOH B O     1 
HETATM 5642 O  O     . HOH T 10 .   ? -3.761  43.850 18.116  1.00 49.46 ? 510 HOH B O     1 
HETATM 5643 O  O     . HOH T 10 .   ? -14.835 33.476 21.750  1.00 33.90 ? 511 HOH B O     1 
HETATM 5644 O  O     . HOH T 10 .   ? -15.177 44.502 17.243  1.00 34.18 ? 512 HOH B O     1 
HETATM 5645 O  O     . HOH T 10 .   ? -19.595 37.094 0.286   1.00 39.03 ? 513 HOH B O     1 
HETATM 5646 O  O     . HOH T 10 .   ? -16.136 34.705 24.292  1.00 32.69 ? 514 HOH B O     1 
HETATM 5647 O  O     . HOH T 10 .   ? -44.515 37.649 20.161  1.00 44.18 ? 515 HOH B O     1 
HETATM 5648 O  O     . HOH T 10 .   ? -32.244 35.658 18.190  1.00 26.44 ? 516 HOH B O     1 
HETATM 5649 O  O     . HOH T 10 .   ? -28.863 47.228 16.751  1.00 24.58 ? 517 HOH B O     1 
HETATM 5650 O  O     . HOH T 10 .   ? -29.567 45.326 2.127   1.00 28.76 ? 518 HOH B O     1 
HETATM 5651 O  O     . HOH T 10 .   ? -28.813 43.180 0.244   1.00 24.15 ? 519 HOH B O     1 
HETATM 5652 O  O     . HOH T 10 .   ? -13.760 29.138 7.486   1.00 33.94 ? 520 HOH B O     1 
HETATM 5653 O  O     . HOH T 10 .   ? -34.012 53.024 22.884  1.00 41.66 ? 521 HOH B O     1 
HETATM 5654 O  O     . HOH T 10 .   ? -36.526 52.103 19.524  1.00 37.80 ? 522 HOH B O     1 
HETATM 5655 O  O     . HOH T 10 .   ? -41.499 33.213 8.314   1.00 30.25 ? 523 HOH B O     1 
HETATM 5656 O  O     . HOH T 10 .   ? -38.084 33.825 10.986  1.00 29.96 ? 524 HOH B O     1 
HETATM 5657 O  O     . HOH T 10 .   ? -34.828 30.220 22.039  1.00 41.97 ? 525 HOH B O     1 
HETATM 5658 O  O     . HOH T 10 .   ? -27.729 44.557 28.650  1.00 53.84 ? 526 HOH B O     1 
HETATM 5659 O  O     . HOH T 10 .   ? -29.382 43.922 27.560  1.00 64.71 ? 527 HOH B O     1 
HETATM 5660 O  O     . HOH T 10 .   ? -34.521 46.788 29.111  1.00 56.19 ? 528 HOH B O     1 
HETATM 5661 O  O     . HOH T 10 .   ? -16.542 38.533 21.041  1.00 30.16 ? 529 HOH B O     1 
HETATM 5662 O  O     . HOH T 10 .   ? -24.602 18.304 9.561   1.00 53.14 ? 530 HOH B O     1 
HETATM 5663 O  O     . HOH T 10 .   ? -39.552 32.047 9.720   1.00 26.77 ? 531 HOH B O     1 
HETATM 5664 O  O     . HOH T 10 .   ? -15.832 17.059 9.556   1.00 55.17 ? 532 HOH B O     1 
HETATM 5665 O  O     . HOH T 10 .   ? -33.342 55.995 15.915  1.00 35.00 ? 533 HOH B O     1 
HETATM 5666 O  O     . HOH T 10 .   ? -15.465 46.310 28.795  1.00 45.10 ? 534 HOH B O     1 
HETATM 5667 O  O     . HOH T 10 .   ? -13.859 54.038 13.741  1.00 60.50 ? 535 HOH B O     1 
HETATM 5668 O  O     . HOH T 10 .   ? -14.854 32.610 25.783  1.00 46.53 ? 536 HOH B O     1 
HETATM 5669 O  O     . HOH T 10 .   ? -23.968 37.206 -0.814  1.00 34.99 ? 537 HOH B O     1 
HETATM 5670 O  O     . HOH T 10 .   ? -15.605 52.719 20.755  1.00 52.74 ? 538 HOH B O     1 
HETATM 5671 O  O     . HOH T 10 .   ? -42.052 35.545 15.396  1.00 30.95 ? 539 HOH B O     1 
HETATM 5672 O  O     . HOH T 10 .   ? -9.223  45.127 14.563  1.00 28.38 ? 540 HOH B O     1 
HETATM 5673 O  O     . HOH T 10 .   ? -9.691  34.614 17.618  1.00 33.13 ? 541 HOH B O     1 
HETATM 5674 O  O     . HOH T 10 .   ? -13.407 50.079 21.797  1.00 37.44 ? 542 HOH B O     1 
HETATM 5675 O  O     . HOH T 10 .   ? -20.221 41.862 0.820   1.00 43.46 ? 543 HOH B O     1 
HETATM 5676 O  O     . HOH U 10 .   ? -28.621 53.724 -15.534 1.00 22.82 ? 21  HOH C O     1 
HETATM 5677 O  O     . HOH U 10 .   ? -39.987 52.693 -11.497 1.00 22.15 ? 22  HOH C O     1 
HETATM 5678 O  O     . HOH U 10 .   ? -56.338 33.957 -10.696 1.00 48.40 ? 23  HOH C O     1 
HETATM 5679 O  O     . HOH U 10 .   ? -31.580 49.842 -19.501 1.00 34.04 ? 39  HOH C O     1 
HETATM 5680 O  O     . HOH U 10 .   ? -34.410 50.458 -18.940 1.00 33.21 ? 40  HOH C O     1 
HETATM 5681 O  O     . HOH U 10 .   ? -39.374 58.663 -22.966 1.00 34.38 ? 48  HOH C O     1 
HETATM 5682 O  O     . HOH U 10 .   ? -60.681 20.556 -14.544 1.00 69.12 ? 54  HOH C O     1 
HETATM 5683 O  O     . HOH U 10 .   ? -41.097 73.005 -8.040  1.00 33.46 ? 58  HOH C O     1 
HETATM 5684 O  O     . HOH U 10 .   ? -35.565 58.094 -13.656 1.00 24.74 ? 64  HOH C O     1 
HETATM 5685 O  O     . HOH U 10 .   ? -46.253 78.430 -4.092  1.00 39.58 ? 88  HOH C O     1 
HETATM 5686 O  O     . HOH U 10 .   ? -51.186 71.828 -12.620 1.00 48.18 ? 90  HOH C O     1 
HETATM 5687 O  O     . HOH U 10 .   ? -45.562 69.318 -22.200 1.00 61.82 ? 91  HOH C O     1 
HETATM 5688 O  O     . HOH U 10 .   ? -30.664 56.195 -19.880 1.00 20.96 ? 92  HOH C O     1 
HETATM 5689 O  O     . HOH U 10 .   ? -33.846 56.335 -12.243 1.00 25.97 ? 93  HOH C O     1 
HETATM 5690 O  O     . HOH U 10 .   ? -40.806 60.843 -23.507 1.00 51.98 ? 99  HOH C O     1 
HETATM 5691 O  O     . HOH U 10 .   ? -54.113 66.685 -17.688 1.00 62.87 ? 116 HOH C O     1 
HETATM 5692 O  O     . HOH U 10 .   ? -46.443 48.060 -18.308 1.00 43.91 ? 120 HOH C O     1 
HETATM 5693 O  O     . HOH U 10 .   ? -48.294 35.965 -10.008 1.00 36.21 ? 124 HOH C O     1 
HETATM 5694 O  O     . HOH U 10 .   ? -46.499 37.976 -10.151 1.00 34.90 ? 125 HOH C O     1 
HETATM 5695 O  O     . HOH U 10 .   ? -51.322 33.204 -18.708 1.00 25.69 ? 133 HOH C O     1 
HETATM 5696 O  O     . HOH U 10 .   ? -45.654 67.200 -9.020  1.00 38.04 ? 145 HOH C O     1 
HETATM 5697 O  O     . HOH U 10 .   ? -48.029 64.965 -13.205 1.00 29.86 ? 147 HOH C O     1 
HETATM 5698 O  O     . HOH U 10 .   ? -39.303 43.401 -8.094  1.00 50.77 ? 157 HOH C O     1 
HETATM 5699 O  O     . HOH U 10 .   ? -49.027 43.589 -10.442 1.00 32.73 ? 191 HOH C O     1 
HETATM 5700 O  O     . HOH U 10 .   ? -46.771 89.007 -8.765  1.00 60.66 ? 221 HOH C O     1 
HETATM 5701 O  O     . HOH U 10 .   ? -44.452 40.068 -22.935 1.00 57.45 ? 253 HOH C O     1 
HETATM 5702 O  O     . HOH U 10 .   ? -29.643 50.791 -12.087 1.00 38.47 ? 254 HOH C O     1 
HETATM 5703 O  O     . HOH U 10 .   ? -45.880 74.407 -17.019 1.00 37.58 ? 263 HOH C O     1 
HETATM 5704 O  O     . HOH U 10 .   ? -46.744 41.827 -22.062 1.00 41.21 ? 277 HOH C O     1 
HETATM 5705 O  O     . HOH U 10 .   ? -42.410 72.278 -18.545 1.00 49.56 ? 293 HOH C O     1 
HETATM 5706 O  O     . HOH U 10 .   ? -42.074 56.175 -12.406 1.00 27.24 ? 302 HOH C O     1 
HETATM 5707 O  O     . HOH U 10 .   ? -34.859 82.736 -5.448  1.00 52.55 ? 304 HOH C O     1 
HETATM 5708 O  O     . HOH U 10 .   ? -38.091 57.921 -13.218 1.00 23.00 ? 317 HOH C O     1 
HETATM 5709 O  O     . HOH U 10 .   ? -47.997 33.925 -11.885 1.00 23.41 ? 318 HOH C O     1 
HETATM 5710 O  O     . HOH U 10 .   ? -56.566 19.600 -14.568 1.00 62.96 ? 319 HOH C O     1 
HETATM 5711 O  O     . HOH U 10 .   ? -43.902 69.270 -8.791  1.00 33.75 ? 350 HOH C O     1 
HETATM 5712 O  O     . HOH U 10 .   ? -46.950 64.314 -15.644 1.00 33.96 ? 352 HOH C O     1 
HETATM 5713 O  O     . HOH U 10 .   ? -47.736 63.236 -18.207 1.00 40.76 ? 353 HOH C O     1 
HETATM 5714 O  O     . HOH U 10 .   ? -34.260 52.254 -21.001 1.00 36.19 ? 359 HOH C O     1 
HETATM 5715 O  O     . HOH U 10 .   ? -47.888 91.415 -6.800  1.00 50.21 ? 388 HOH C O     1 
HETATM 5716 O  O     . HOH U 10 .   ? -49.132 77.287 -8.195  1.00 46.42 ? 393 HOH C O     1 
HETATM 5717 O  O     . HOH U 10 .   ? -48.014 79.100 -5.980  1.00 45.19 ? 394 HOH C O     1 
HETATM 5718 O  O     . HOH U 10 .   ? -46.911 75.502 -3.622  1.00 45.63 ? 395 HOH C O     1 
HETATM 5719 O  O     . HOH U 10 .   ? -46.714 80.611 -1.438  1.00 53.21 ? 396 HOH C O     1 
HETATM 5720 O  O     . HOH U 10 .   ? -42.414 78.215 -1.297  1.00 50.10 ? 397 HOH C O     1 
HETATM 5721 O  O     . HOH U 10 .   ? -36.811 74.939 -4.926  1.00 39.88 ? 398 HOH C O     1 
HETATM 5722 O  O     . HOH U 10 .   ? -38.819 74.641 -7.025  1.00 43.19 ? 399 HOH C O     1 
HETATM 5723 O  O     . HOH U 10 .   ? -39.540 76.975 -8.597  1.00 38.79 ? 400 HOH C O     1 
HETATM 5724 O  O     . HOH U 10 .   ? -41.285 69.167 -20.228 1.00 47.58 ? 404 HOH C O     1 
HETATM 5725 O  O     . HOH U 10 .   ? -49.552 70.850 -18.430 1.00 53.91 ? 405 HOH C O     1 
HETATM 5726 O  O     . HOH U 10 .   ? -51.795 71.166 -16.521 1.00 55.35 ? 406 HOH C O     1 
HETATM 5727 O  O     . HOH U 10 .   ? -38.118 85.234 -9.234  1.00 32.74 ? 422 HOH C O     1 
HETATM 5728 O  O     . HOH U 10 .   ? -36.028 84.855 -7.747  1.00 52.05 ? 423 HOH C O     1 
HETATM 5729 O  O     . HOH U 10 .   ? -43.184 86.584 -9.384  1.00 53.37 ? 424 HOH C O     1 
HETATM 5730 O  O     . HOH U 10 .   ? -42.258 89.210 -1.956  1.00 43.64 ? 425 HOH C O     1 
HETATM 5731 O  O     . HOH U 10 .   ? -44.014 85.684 -1.213  1.00 70.52 ? 426 HOH C O     1 
HETATM 5732 O  O     . HOH U 10 .   ? -46.595 85.172 -1.660  1.00 54.83 ? 427 HOH C O     1 
HETATM 5733 O  O     . HOH U 10 .   ? -46.652 66.198 -6.260  1.00 53.19 ? 428 HOH C O     1 
HETATM 5734 O  O     . HOH U 10 .   ? -45.176 67.147 -4.426  1.00 62.58 ? 429 HOH C O     1 
HETATM 5735 O  O     . HOH U 10 .   ? -41.963 72.947 -0.425  1.00 51.61 ? 433 HOH C O     1 
HETATM 5736 O  O     . HOH U 10 .   ? -34.444 53.927 -11.944 1.00 40.77 ? 445 HOH C O     1 
HETATM 5737 O  O     . HOH U 10 .   ? -43.386 48.365 -10.107 1.00 45.71 ? 459 HOH C O     1 
HETATM 5738 O  O     . HOH U 10 .   ? -49.678 64.772 -9.069  1.00 46.63 ? 462 HOH C O     1 
HETATM 5739 O  O     . HOH U 10 .   ? -52.448 72.148 -10.172 1.00 55.15 ? 466 HOH C O     1 
HETATM 5740 O  O     . HOH U 10 .   ? -49.955 72.687 -7.207  1.00 51.41 ? 469 HOH C O     1 
HETATM 5741 O  O     . HOH U 10 .   ? -42.763 83.248 -0.557  1.00 55.73 ? 470 HOH C O     1 
HETATM 5742 O  O     . HOH U 10 .   ? -46.078 49.942 -16.355 1.00 57.43 ? 473 HOH C O     1 
HETATM 5743 O  O     . HOH U 10 .   ? -50.570 63.807 -12.404 1.00 51.80 ? 514 HOH C O     1 
HETATM 5744 O  O     . HOH U 10 .   ? -38.185 67.698 -22.567 1.00 56.84 ? 517 HOH C O     1 
HETATM 5745 O  O     . HOH U 10 .   ? -37.540 66.307 -18.660 1.00 45.04 ? 518 HOH C O     1 
HETATM 5746 O  O     . HOH U 10 .   ? -55.197 38.615 -10.739 1.00 45.74 ? 527 HOH C O     1 
HETATM 5747 O  O     . HOH U 10 .   ? -49.097 25.467 -13.674 1.00 42.55 ? 529 HOH C O     1 
HETATM 5748 O  O     . HOH V 10 .   ? -30.549 33.074 -18.216 1.00 30.81 ? 25  HOH D O     1 
HETATM 5749 O  O     . HOH V 10 .   ? -33.012 31.538 -18.202 1.00 48.69 ? 26  HOH D O     1 
HETATM 5750 O  O     . HOH V 10 .   ? -31.652 42.640 -20.864 1.00 35.03 ? 31  HOH D O     1 
HETATM 5751 O  O     . HOH V 10 .   ? -35.614 48.365 -21.891 1.00 29.55 ? 37  HOH D O     1 
HETATM 5752 O  O     . HOH V 10 .   ? -36.267 50.867 -22.583 1.00 28.98 ? 38  HOH D O     1 
HETATM 5753 O  O     . HOH V 10 .   ? -35.324 47.793 -18.893 1.00 46.98 ? 41  HOH D O     1 
HETATM 5754 O  O     . HOH V 10 .   ? -32.977 74.172 -6.832  1.00 43.37 ? 51  HOH D O     1 
HETATM 5755 O  O     . HOH V 10 .   ? -45.256 52.763 -17.290 1.00 38.82 ? 55  HOH D O     1 
HETATM 5756 O  O     . HOH V 10 .   ? -36.444 43.660 -26.946 1.00 44.48 ? 57  HOH D O     1 
HETATM 5757 O  O     . HOH V 10 .   ? -43.931 50.193 -26.294 1.00 33.82 ? 60  HOH D O     1 
HETATM 5758 O  O     . HOH V 10 .   ? -38.191 79.836 -10.412 1.00 51.87 ? 66  HOH D O     1 
HETATM 5759 O  O     . HOH V 10 .   ? -35.094 38.302 -23.766 1.00 39.69 ? 72  HOH D O     1 
HETATM 5760 O  O     . HOH V 10 .   ? -30.396 37.475 -22.694 1.00 52.06 ? 97  HOH D O     1 
HETATM 5761 O  O     . HOH V 10 .   ? -33.049 78.898 -9.828  1.00 53.46 ? 105 HOH D O     1 
HETATM 5762 O  O     . HOH V 10 .   ? -51.927 58.093 -21.075 1.00 52.65 ? 106 HOH D O     1 
HETATM 5763 O  O     . HOH V 10 .   ? -51.843 80.672 -6.995  1.00 63.88 ? 120 HOH D O     1 
HETATM 5764 O  O     . HOH V 10 .   ? -40.324 58.557 -12.041 1.00 25.60 ? 136 HOH D O     1 
HETATM 5765 O  O     . HOH V 10 .   ? -42.091 70.741 -6.848  1.00 29.30 ? 143 HOH D O     1 
HETATM 5766 O  O     . HOH V 10 .   ? -30.199 47.498 -25.240 1.00 33.91 ? 184 HOH D O     1 
HETATM 5767 O  O     . HOH V 10 .   ? -43.841 85.833 -21.341 1.00 30.58 ? 196 HOH D O     1 
HETATM 5768 O  O     . HOH V 10 .   ? -39.727 82.142 -11.932 1.00 33.12 ? 198 HOH D O     1 
HETATM 5769 O  O     . HOH V 10 .   ? -37.291 70.326 -14.534 1.00 50.70 ? 235 HOH D O     1 
HETATM 5770 O  O     . HOH V 10 .   ? -43.041 77.487 -17.092 1.00 56.27 ? 245 HOH D O     1 
HETATM 5771 O  O     . HOH V 10 .   ? -45.468 50.600 -18.928 1.00 43.95 ? 259 HOH D O     1 
HETATM 5772 O  O     . HOH V 10 .   ? -42.769 60.265 -9.014  1.00 28.47 ? 265 HOH D O     1 
HETATM 5773 O  O     . HOH V 10 .   ? -40.890 47.462 -28.033 1.00 36.83 ? 266 HOH D O     1 
HETATM 5774 O  O     . HOH V 10 .   ? -39.577 40.180 -25.050 1.00 38.04 ? 270 HOH D O     1 
HETATM 5775 O  O     . HOH V 10 .   ? -46.085 86.991 -11.649 1.00 47.79 ? 273 HOH D O     1 
HETATM 5776 O  O     . HOH V 10 .   ? -45.439 62.418 -19.692 1.00 45.15 ? 291 HOH D O     1 
HETATM 5777 O  O     . HOH V 10 .   ? -40.968 74.169 -17.206 1.00 48.49 ? 294 HOH D O     1 
HETATM 5778 O  O     . HOH V 10 .   ? -40.706 37.494 -25.437 1.00 57.18 ? 308 HOH D O     1 
HETATM 5779 O  O     . HOH V 10 .   ? -37.097 30.480 -19.204 1.00 49.68 ? 345 HOH D O     1 
HETATM 5780 O  O     . HOH V 10 .   ? -39.755 29.950 -18.751 1.00 42.26 ? 346 HOH D O     1 
HETATM 5781 O  O     . HOH V 10 .   ? -46.128 66.352 -11.636 1.00 33.37 ? 351 HOH D O     1 
HETATM 5782 O  O     . HOH V 10 .   ? -33.760 47.226 -20.551 1.00 42.66 ? 360 HOH D O     1 
HETATM 5783 O  O     . HOH V 10 .   ? -38.578 84.004 -13.576 1.00 37.47 ? 365 HOH D O     1 
HETATM 5784 O  O     . HOH V 10 .   ? -40.400 83.999 -20.220 1.00 49.58 ? 391 HOH D O     1 
HETATM 5785 O  O     . HOH V 10 .   ? -50.216 78.856 -10.805 1.00 54.28 ? 392 HOH D O     1 
HETATM 5786 O  O     . HOH V 10 .   ? -37.674 78.881 -7.921  1.00 54.06 ? 401 HOH D O     1 
HETATM 5787 O  O     . HOH V 10 .   ? -35.756 69.375 -11.021 1.00 36.92 ? 402 HOH D O     1 
HETATM 5788 O  O     . HOH V 10 .   ? -38.703 70.818 -16.494 1.00 49.44 ? 403 HOH D O     1 
HETATM 5789 O  O     . HOH V 10 .   ? -48.047 77.844 -12.973 1.00 50.70 ? 407 HOH D O     1 
HETATM 5790 O  O     . HOH V 10 .   ? -47.158 79.156 -15.263 1.00 47.40 ? 408 HOH D O     1 
HETATM 5791 O  O     . HOH V 10 .   ? -45.580 77.055 -16.553 1.00 50.95 ? 409 HOH D O     1 
HETATM 5792 O  O     . HOH V 10 .   ? -53.687 82.112 -11.221 1.00 66.63 ? 410 HOH D O     1 
HETATM 5793 O  O     . HOH V 10 .   ? -53.802 82.107 -15.930 1.00 65.62 ? 411 HOH D O     1 
HETATM 5794 O  O     . HOH V 10 .   ? -47.477 83.397 -19.775 1.00 49.04 ? 412 HOH D O     1 
HETATM 5795 O  O     . HOH V 10 .   ? -46.349 84.806 -22.900 1.00 54.88 ? 413 HOH D O     1 
HETATM 5796 O  O     . HOH V 10 .   ? -41.639 84.930 -22.530 1.00 46.26 ? 414 HOH D O     1 
HETATM 5797 O  O     . HOH V 10 .   ? -37.817 82.827 -20.141 1.00 44.65 ? 415 HOH D O     1 
HETATM 5798 O  O     . HOH V 10 .   ? -41.542 80.274 -20.118 1.00 60.15 ? 416 HOH D O     1 
HETATM 5799 O  O     . HOH V 10 .   ? -44.652 80.814 -18.399 1.00 46.33 ? 417 HOH D O     1 
HETATM 5800 O  O     . HOH V 10 .   ? -40.563 78.231 -18.598 1.00 62.52 ? 418 HOH D O     1 
HETATM 5801 O  O     . HOH V 10 .   ? -35.451 74.891 -14.865 1.00 51.76 ? 419 HOH D O     1 
HETATM 5802 O  O     . HOH V 10 .   ? -40.856 65.375 -3.176  1.00 42.77 ? 430 HOH D O     1 
HETATM 5803 O  O     . HOH V 10 .   ? -41.134 69.465 -4.066  1.00 53.40 ? 431 HOH D O     1 
HETATM 5804 O  O     . HOH V 10 .   ? -38.970 71.404 -3.766  1.00 44.00 ? 432 HOH D O     1 
HETATM 5805 O  O     . HOH V 10 .   ? -46.799 54.883 -13.546 1.00 51.69 ? 458 HOH D O     1 
HETATM 5806 O  O     . HOH V 10 .   ? -46.416 57.429 -12.796 1.00 44.02 ? 464 HOH D O     1 
HETATM 5807 O  O     . HOH V 10 .   ? -44.285 57.153 -11.559 1.00 50.54 ? 465 HOH D O     1 
HETATM 5808 O  O     . HOH V 10 .   ? -47.615 60.735 -6.598  1.00 64.44 ? 468 HOH D O     1 
HETATM 5809 O  O     . HOH V 10 .   ? -31.262 46.418 -20.737 1.00 43.38 ? 472 HOH D O     1 
HETATM 5810 O  O     . HOH V 10 .   ? -29.553 34.527 -22.278 1.00 52.56 ? 506 HOH D O     1 
HETATM 5811 O  O     . HOH V 10 .   ? -33.998 36.092 -24.420 1.00 46.31 ? 507 HOH D O     1 
HETATM 5812 O  O     . HOH V 10 .   ? -35.499 33.203 -23.962 1.00 56.96 ? 508 HOH D O     1 
HETATM 5813 O  O     . HOH V 10 .   ? -40.886 43.694 -25.786 1.00 50.62 ? 509 HOH D O     1 
HETATM 5814 O  O     . HOH V 10 .   ? -42.987 43.881 -24.948 1.00 47.86 ? 510 HOH D O     1 
HETATM 5815 O  O     . HOH V 10 .   ? -47.458 51.381 -23.443 1.00 47.97 ? 511 HOH D O     1 
HETATM 5816 O  O     . HOH V 10 .   ? -49.150 58.663 -23.634 1.00 51.84 ? 512 HOH D O     1 
HETATM 5817 O  O     . HOH V 10 .   ? -49.550 58.978 -26.892 1.00 62.47 ? 513 HOH D O     1 
HETATM 5818 O  O     . HOH V 10 .   ? -51.582 63.025 -15.774 1.00 58.85 ? 515 HOH D O     1 
HETATM 5819 O  O     . HOH V 10 .   ? -34.822 69.064 -13.509 1.00 46.59 ? 530 HOH D O     1 
HETATM 5820 O  O     . HOH V 10 .   ? -34.666 66.797 -14.586 1.00 40.20 ? 531 HOH D O     1 
HETATM 5821 O  O     . HOH V 10 .   ? -33.363 66.757 -16.643 1.00 58.39 ? 532 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   PRO 2   -1  ?   ?   ?   A . n 
A 1 3   GLY 3   0   ?   ?   ?   A . n 
A 1 4   CYS 4   1   ?   ?   ?   A . n 
A 1 5   ASN 5   2   ?   ?   ?   A . n 
A 1 6   THR 6   3   ?   ?   ?   A . n 
A 1 7   LYS 7   4   ?   ?   ?   A . n 
A 1 8   LYS 8   5   ?   ?   ?   A . n 
A 1 9   PRO 9   6   ?   ?   ?   A . n 
A 1 10  ASN 10  7   ?   ?   ?   A . n 
A 1 11  LEU 11  8   8   LEU LEU A . n 
A 1 12  ASP 12  9   9   ASP ASP A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  GLU 14  11  11  GLU GLU A . n 
A 1 15  LEU 15  12  12  LEU LEU A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  GLN 17  14  14  GLN GLN A . n 
A 1 18  LEU 18  15  15  LEU LEU A . n 
A 1 19  LEU 19  16  16  LEU LEU A . n 
A 1 20  GLN 20  17  17  GLN GLN A . n 
A 1 21  GLY 21  18  18  GLY GLY A . n 
A 1 22  HIS 22  19  19  HIS HIS A . n 
A 1 23  TYR 23  20  20  TYR TYR A . n 
A 1 24  ILE 24  21  21  ILE ILE A . n 
A 1 25  LYS 25  22  22  LYS LYS A . n 
A 1 26  GLY 26  23  23  GLY GLY A . n 
A 1 27  TYR 27  24  24  TYR TYR A . n 
A 1 28  PRO 28  25  25  PRO PRO A . n 
A 1 29  LYS 29  26  26  LYS LYS A . n 
A 1 30  GLN 30  27  27  GLN GLN A . n 
A 1 31  TYR 31  28  28  TYR TYR A . n 
A 1 32  THR 32  29  29  THR THR A . n 
A 1 33  TYR 33  30  30  TYR TYR A . n 
A 1 34  PHE 34  31  31  PHE PHE A . n 
A 1 35  LEU 35  32  32  LEU LEU A . n 
A 1 36  GLU 36  33  33  GLU GLU A . n 
A 1 37  ASP 37  34  34  ASP ASP A . n 
A 1 38  GLY 38  35  35  GLY GLY A . n 
A 1 39  LYS 39  36  36  LYS LYS A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  LYS 41  38  38  LYS LYS A . n 
A 1 42  VAL 42  39  39  VAL VAL A . n 
A 1 43  SER 43  40  40  SER SER A . n 
A 1 44  ARG 44  41  41  ARG ARG A . n 
A 1 45  PRO 45  42  42  PRO PRO A . n 
A 1 46  GLU 46  43  43  GLU GLU A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  VAL 48  45  45  VAL VAL A . n 
A 1 49  LYS 49  46  46  LYS LYS A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  PRO 52  49  49  PRO PRO A . n 
A 1 53  PRO 53  50  50  PRO PRO A . n 
A 1 54  GLN 54  51  51  GLN GLN A . n 
A 1 55  SER 55  52  52  SER SER A . n 
A 1 56  ASP 56  53  53  ASP ASP A . n 
A 1 57  ARG 57  54  54  ARG ARG A . n 
A 1 58  GLN 58  55  55  GLN GLN A . n 
A 1 59  LYS 59  56  56  LYS LYS A . n 
A 1 60  ILE 60  57  57  ILE ILE A . n 
A 1 61  VAL 61  58  58  VAL VAL A . n 
A 1 62  LEU 62  59  59  LEU LEU A . n 
A 1 63  GLN 63  60  60  GLN GLN A . n 
A 1 64  ALA 64  61  61  ALA ALA A . n 
A 1 65  HIS 65  62  62  HIS HIS A . n 
A 1 66  ASN 66  63  63  ASN ASN A . n 
A 1 67  LEU 67  64  64  LEU LEU A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  HIS 69  66  66  HIS HIS A . n 
A 1 70  THR 70  67  67  THR THR A . n 
A 1 71  GLY 71  68  68  GLY GLY A . n 
A 1 72  ARG 72  69  69  ARG ARG A . n 
A 1 73  GLU 73  70  70  GLU GLU A . n 
A 1 74  ALA 74  71  71  ALA ALA A . n 
A 1 75  THR 75  72  72  THR THR A . n 
A 1 76  LEU 76  73  73  LEU LEU A . n 
A 1 77  LEU 77  74  74  LEU LEU A . n 
A 1 78  LYS 78  75  75  LYS LYS A . n 
A 1 79  ILE 79  76  76  ILE ILE A . n 
A 1 80  ALA 80  77  77  ALA ALA A . n 
A 1 81  ASN 81  78  78  ASN ASN A . n 
A 1 82  LEU 82  79  79  LEU LEU A . n 
A 1 83  TYR 83  80  80  TYR TYR A . n 
A 1 84  TRP 84  81  81  TRP TRP A . n 
A 1 85  TRP 85  82  82  TRP TRP A . n 
A 1 86  PRO 86  83  83  PRO PRO A . n 
A 1 87  ASN 87  84  84  ASN ASN A . n 
A 1 88  MET 88  85  85  MET MET A . n 
A 1 89  ARG 89  86  86  ARG ARG A . n 
A 1 90  LYS 90  87  87  LYS LYS A . n 
A 1 91  ASP 91  88  88  ASP ASP A . n 
A 1 92  VAL 92  89  89  VAL VAL A . n 
A 1 93  VAL 93  90  90  VAL VAL A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  GLN 95  92  92  GLN GLN A . n 
A 1 96  LEU 96  93  93  LEU LEU A . n 
A 1 97  GLY 97  94  94  GLY GLY A . n 
A 1 98  ARG 98  95  95  ARG ARG A . n 
A 1 99  CYS 99  96  96  CYS CYS A . n 
A 1 100 GLN 100 97  97  GLN GLN A . n 
A 1 101 GLN 101 98  98  GLN GLN A . n 
A 1 102 CYS 102 99  99  CYS CYS A . n 
A 1 103 LEU 103 100 100 LEU LEU A . n 
A 1 104 ILE 104 101 101 ILE ILE A . n 
A 1 105 THR 105 102 102 THR THR A . n 
A 1 106 ASN 106 103 103 ASN ASN A . n 
A 1 107 ALA 107 104 104 ALA ALA A . n 
A 1 108 SER 108 105 105 SER SER A . n 
A 1 109 ASN 109 106 106 ASN ASN A . n 
A 1 110 LYS 110 107 107 LYS LYS A . n 
A 1 111 ALA 111 108 108 ALA ALA A . n 
A 1 112 SER 112 109 109 SER SER A . n 
A 1 113 GLY 113 110 110 GLY GLY A . n 
A 1 114 PRO 114 111 111 PRO PRO A . n 
A 1 115 ILE 115 112 112 ILE ILE A . n 
A 1 116 LEU 116 113 113 LEU LEU A . n 
A 1 117 ARG 117 114 114 ARG ARG A . n 
A 1 118 PRO 118 115 115 PRO PRO A . n 
A 1 119 ASP 119 116 116 ASP ASP A . n 
A 1 120 ARG 120 117 117 ARG ARG A . n 
A 1 121 PRO 121 118 118 PRO PRO A . n 
A 1 122 GLN 122 119 119 GLN GLN A . n 
A 1 123 LYS 123 120 120 LYS LYS A . n 
A 1 124 PRO 124 121 121 PRO PRO A . n 
A 1 125 PHE 125 122 122 PHE PHE A . n 
A 1 126 ASP 126 123 123 ASP ASP A . n 
A 1 127 LYS 127 124 124 LYS LYS A . n 
A 1 128 PHE 128 125 125 PHE PHE A . n 
A 1 129 PHE 129 126 126 PHE PHE A . n 
A 1 130 ILE 130 127 127 ILE ILE A . n 
A 1 131 ASP 131 128 128 ASP ASP A . n 
A 1 132 TYR 132 129 129 TYR TYR A . n 
A 1 133 ILE 133 130 130 ILE ILE A . n 
A 1 134 GLY 134 131 131 GLY GLY A . n 
A 1 135 PRO 135 132 132 PRO PRO A . n 
A 1 136 LEU 136 133 133 LEU LEU A . n 
A 1 137 PRO 137 134 134 PRO PRO A . n 
A 1 138 PRO 138 135 135 PRO PRO A . n 
A 1 139 SER 139 136 136 SER SER A . n 
A 1 140 GLN 140 137 137 GLN GLN A . n 
A 1 141 GLY 141 138 138 GLY GLY A . n 
A 1 142 TYR 142 139 139 TYR TYR A . n 
A 1 143 LEU 143 140 140 LEU LEU A . n 
A 1 144 TYR 144 141 141 TYR TYR A . n 
A 1 145 VAL 145 142 142 VAL VAL A . n 
A 1 146 LEU 146 143 143 LEU LEU A . n 
A 1 147 VAL 147 144 144 VAL VAL A . n 
A 1 148 VAL 148 145 145 VAL VAL A . n 
A 1 149 VAL 149 146 146 VAL VAL A . n 
A 1 150 ASP 150 147 147 ASP ASP A . n 
A 1 151 GLY 151 148 148 GLY GLY A . n 
A 1 152 MET 152 149 149 MET MET A . n 
A 1 153 THR 153 150 150 THR THR A . n 
A 1 154 GLY 154 151 151 GLY GLY A . n 
A 1 155 PHE 155 152 152 PHE PHE A . n 
A 1 156 THR 156 153 153 THR THR A . n 
A 1 157 TRP 157 154 154 TRP TRP A . n 
A 1 158 LEU 158 155 155 LEU LEU A . n 
A 1 159 TYR 159 156 156 TYR TYR A . n 
A 1 160 PRO 160 157 157 PRO PRO A . n 
A 1 161 THR 161 158 158 THR THR A . n 
A 1 162 LYS 162 159 159 LYS LYS A . n 
A 1 163 ALA 163 160 160 ALA ALA A . n 
A 1 164 PRO 164 161 161 PRO PRO A . n 
A 1 165 SER 165 162 162 SER SER A . n 
A 1 166 THR 166 163 163 THR THR A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ALA 168 165 165 ALA ALA A . n 
A 1 169 THR 169 166 166 THR THR A . n 
A 1 170 VAL 170 167 167 VAL VAL A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 SER 172 169 169 SER SER A . n 
A 1 173 LEU 173 170 170 LEU LEU A . n 
A 1 174 ASN 174 171 171 ASN ASN A . n 
A 1 175 VAL 175 172 172 VAL VAL A . n 
A 1 176 LEU 176 173 173 LEU LEU A . n 
A 1 177 THR 177 174 174 THR THR A . n 
A 1 178 SER 178 175 175 SER SER A . n 
A 1 179 ILE 179 176 176 ILE ILE A . n 
A 1 180 ALA 180 177 177 ALA ALA A . n 
A 1 181 ILE 181 178 178 ILE ILE A . n 
A 1 182 PRO 182 179 179 PRO PRO A . n 
A 1 183 LYS 183 180 180 LYS LYS A . n 
A 1 184 VAL 184 181 181 VAL VAL A . n 
A 1 185 ILE 185 182 182 ILE ILE A . n 
A 1 186 HIS 186 183 183 HIS HIS A . n 
A 1 187 SER 187 184 184 SER SER A . n 
A 1 188 ASP 188 185 185 ASP ASP A . n 
A 1 189 GLN 189 186 186 GLN GLN A . n 
A 1 190 GLY 190 187 187 GLY GLY A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 SER 195 192 192 SER SER A . n 
A 1 196 SER 196 193 193 SER SER A . n 
A 1 197 THR 197 194 194 THR THR A . n 
A 1 198 PHE 198 195 195 PHE PHE A . n 
A 1 199 ALA 199 196 196 ALA ALA A . n 
A 1 200 GLU 200 197 197 GLU GLU A . n 
A 1 201 TRP 201 198 198 TRP TRP A . n 
A 1 202 ALA 202 199 199 ALA ALA A . n 
A 1 203 LYS 203 200 200 LYS LYS A . n 
A 1 204 GLU 204 201 201 GLU GLU A . n 
A 1 205 ARG 205 202 202 ARG ARG A . n 
A 1 206 GLY 206 203 203 GLY GLY A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 HIS 208 205 205 HIS HIS A . n 
A 1 209 LEU 209 206 206 LEU LEU A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 PHE 211 208 208 PHE PHE A . n 
A 1 212 SER 212 209 209 SER SER A . n 
A 1 213 THR 213 210 210 THR THR A . n 
A 1 214 PRO 214 211 211 PRO PRO A . n 
A 1 215 TYR 215 212 212 TYR TYR A . n 
A 1 216 HIS 216 213 213 HIS HIS A . n 
A 1 217 PRO 217 214 214 PRO PRO A . n 
A 1 218 GLN 218 215 215 GLN GLN A . n 
A 1 219 SER 219 216 216 SER SER A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 GLY 221 218 218 GLY GLY A . n 
A 1 222 LYS 222 219 219 LYS LYS A . n 
A 1 223 VAL 223 220 220 VAL VAL A . n 
A 1 224 GLU 224 221 221 GLU GLU A . n 
A 1 225 ARG 225 222 222 ARG ARG A . n 
A 1 226 LYS 226 223 223 LYS LYS A . n 
A 1 227 HIS 227 224 224 HIS HIS A . n 
A 1 228 SER 228 225 225 SER SER A . n 
A 1 229 ASP 229 226 226 ASP ASP A . n 
A 1 230 ILE 230 227 227 ILE ILE A . n 
A 1 231 LYS 231 228 228 LYS LYS A . n 
A 1 232 ARG 232 229 229 ARG ARG A . n 
A 1 233 LEU 233 230 230 LEU LEU A . n 
A 1 234 LEU 234 231 231 LEU LEU A . n 
A 1 235 THR 235 232 232 THR THR A . n 
A 1 236 LYS 236 233 233 LYS LYS A . n 
A 1 237 LEU 237 234 234 LEU LEU A . n 
A 1 238 LEU 238 235 235 LEU LEU A . n 
A 1 239 VAL 239 236 236 VAL VAL A . n 
A 1 240 GLY 240 237 237 GLY GLY A . n 
A 1 241 ARG 241 238 238 ARG ARG A . n 
A 1 242 PRO 242 239 239 PRO PRO A . n 
A 1 243 THR 243 240 240 THR THR A . n 
A 1 244 LYS 244 241 241 LYS LYS A . n 
A 1 245 TRP 245 242 242 TRP TRP A . n 
A 1 246 TYR 246 243 243 TYR TYR A . n 
A 1 247 ASP 247 244 244 ASP ASP A . n 
A 1 248 LEU 248 245 245 LEU LEU A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PRO 250 247 247 PRO PRO A . n 
A 1 251 VAL 251 248 248 VAL VAL A . n 
A 1 252 VAL 252 249 249 VAL VAL A . n 
A 1 253 GLN 253 250 250 GLN GLN A . n 
A 1 254 LEU 254 251 251 LEU LEU A . n 
A 1 255 ALA 255 252 252 ALA ALA A . n 
A 1 256 LEU 256 253 253 LEU LEU A . n 
A 1 257 ASN 257 254 254 ASN ASN A . n 
A 1 258 ASN 258 255 255 ASN ASN A . n 
A 1 259 THR 259 256 256 THR THR A . n 
A 1 260 TYR 260 257 257 TYR TYR A . n 
A 1 261 SER 261 258 258 SER SER A . n 
A 1 262 PRO 262 259 259 PRO PRO A . n 
A 1 263 VAL 263 260 260 VAL VAL A . n 
A 1 264 LEU 264 261 261 LEU LEU A . n 
A 1 265 LYS 265 262 262 LYS LYS A . n 
A 1 266 TYR 266 263 263 TYR TYR A . n 
A 1 267 THR 267 264 264 THR THR A . n 
A 1 268 PRO 268 265 265 PRO PRO A . n 
A 1 269 HIS 269 266 266 HIS HIS A . n 
A 1 270 GLN 270 267 267 GLN GLN A . n 
A 1 271 LEU 271 268 268 LEU LEU A . n 
A 1 272 LEU 272 269 269 LEU LEU A . n 
A 1 273 PHE 273 270 270 PHE PHE A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 ASP 276 273 273 ASP ASP A . n 
A 1 277 SER 277 274 274 SER SER A . n 
A 1 278 ASN 278 275 275 ASN ASN A . n 
A 1 279 THR 279 276 276 THR THR A . n 
A 1 280 PRO 280 277 277 PRO PRO A . n 
A 1 281 PHE 281 278 278 PHE PHE A . n 
A 1 282 ALA 282 279 279 ALA ALA A . n 
A 1 283 ASN 283 280 280 ASN ASN A . n 
A 1 284 GLN 284 281 281 GLN GLN A . n 
A 1 285 ASP 285 282 282 ASP ASP A . n 
A 1 286 THR 286 283 283 THR THR A . n 
A 1 287 LEU 287 284 284 LEU LEU A . n 
A 1 288 ASP 288 285 285 ASP ASP A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 THR 290 287 287 THR THR A . n 
A 1 291 ARG 291 288 288 ARG ARG A . n 
A 1 292 GLU 292 289 289 GLU GLU A . n 
A 1 293 GLU 293 290 290 GLU GLU A . n 
A 1 294 GLU 294 291 291 GLU GLU A . n 
A 1 295 LEU 295 292 292 LEU LEU A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 LEU 297 294 294 LEU LEU A . n 
A 1 298 LEU 298 295 295 LEU LEU A . n 
A 1 299 GLN 299 296 296 GLN GLN A . n 
A 1 300 GLU 300 297 297 GLU GLU A . n 
A 1 301 ILE 301 298 298 ILE ILE A . n 
A 1 302 ARG 302 299 299 ARG ARG A . n 
A 1 303 THR 303 300 300 THR THR A . n 
A 1 304 SER 304 301 301 SER SER A . n 
A 1 305 LEU 305 302 302 LEU LEU A . n 
A 1 306 TYR 306 303 303 TYR TYR A . n 
A 1 307 HIS 307 304 304 HIS HIS A . n 
A 1 308 PRO 308 305 305 PRO PRO A . n 
A 1 309 SER 309 306 306 SER SER A . n 
A 1 310 THR 310 307 307 THR THR A . n 
A 1 311 PRO 311 308 308 PRO PRO A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 ALA 313 310 310 ALA ALA A . n 
A 1 314 SER 314 311 311 SER SER A . n 
A 1 315 SER 315 312 312 SER SER A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 SER 317 314 314 SER SER A . n 
A 1 318 TRP 318 315 315 TRP TRP A . n 
A 1 319 SER 319 316 316 SER SER A . n 
A 1 320 PRO 320 317 317 PRO PRO A . n 
A 1 321 VAL 321 318 318 VAL VAL A . n 
A 1 322 VAL 322 319 319 VAL VAL A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 GLN 324 321 321 GLN GLN A . n 
A 1 325 LEU 325 322 322 LEU LEU A . n 
A 1 326 VAL 326 323 323 VAL VAL A . n 
A 1 327 GLN 327 324 324 GLN GLN A . n 
A 1 328 GLU 328 325 325 GLU GLU A . n 
A 1 329 ARG 329 326 326 ARG ARG A . n 
A 1 330 VAL 330 327 327 VAL VAL A . n 
A 1 331 ALA 331 328 328 ALA ALA A . n 
A 1 332 ARG 332 329 329 ARG ARG A . n 
A 1 333 PRO 333 330 330 PRO PRO A . n 
A 1 334 ALA 334 331 331 ALA ALA A . n 
A 1 335 SER 335 332 332 SER SER A . n 
A 1 336 LEU 336 333 333 LEU LEU A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 PRO 338 335 335 PRO PRO A . n 
A 1 339 ARG 339 336 336 ARG ARG A . n 
A 1 340 TRP 340 337 337 TRP TRP A . n 
A 1 341 HIS 341 338 338 HIS HIS A . n 
A 1 342 LYS 342 339 339 LYS LYS A . n 
A 1 343 PRO 343 340 340 PRO PRO A . n 
A 1 344 SER 344 341 341 SER SER A . n 
A 1 345 THR 345 342 342 THR THR A . n 
A 1 346 VAL 346 343 343 VAL VAL A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 LYS 348 345 345 LYS LYS A . n 
A 1 349 VAL 349 346 346 VAL VAL A . n 
A 1 350 LEU 350 347 347 LEU LEU A . n 
A 1 351 ASN 351 348 348 ASN ASN A . n 
A 1 352 PRO 352 349 349 PRO PRO A . n 
A 1 353 ARG 353 350 350 ARG ARG A . n 
A 1 354 THR 354 351 351 THR THR A . n 
A 1 355 VAL 355 352 352 VAL VAL A . n 
A 1 356 VAL 356 353 353 VAL VAL A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 LEU 358 355 355 LEU LEU A . n 
A 1 359 ASP 359 356 356 ASP ASP A . n 
A 1 360 HIS 360 357 357 HIS HIS A . n 
A 1 361 LEU 361 358 358 LEU LEU A . n 
A 1 362 GLY 362 359 359 GLY GLY A . n 
A 1 363 ASN 363 360 360 ASN ASN A . n 
A 1 364 ASN 364 361 361 ASN ASN A . n 
A 1 365 ARG 365 362 362 ARG ARG A . n 
A 1 366 THR 366 363 363 THR THR A . n 
A 1 367 VAL 367 364 364 VAL VAL A . n 
A 1 368 SER 368 365 365 SER SER A . n 
A 1 369 ILE 369 366 366 ILE ILE A . n 
A 1 370 ASP 370 367 367 ASP ASP A . n 
A 1 371 ASN 371 368 368 ASN ASN A . n 
A 1 372 LEU 372 369 369 LEU LEU A . n 
A 1 373 LYS 373 370 370 LYS LYS A . n 
A 1 374 PRO 374 371 371 PRO PRO A . n 
A 1 375 THR 375 372 372 THR THR A . n 
A 1 376 SER 376 373 373 SER SER A . n 
A 1 377 HIS 377 374 374 HIS HIS A . n 
A 1 378 GLN 378 375 375 GLN GLN A . n 
A 1 379 ASN 379 376 ?   ?   ?   A . n 
A 1 380 GLY 380 377 ?   ?   ?   A . n 
A 1 381 THR 381 378 ?   ?   ?   A . n 
A 1 382 THR 382 379 ?   ?   ?   A . n 
A 1 383 ASN 383 380 ?   ?   ?   A . n 
A 1 384 ASP 384 381 ?   ?   ?   A . n 
A 1 385 THR 385 382 ?   ?   ?   A . n 
A 1 386 ALA 386 383 ?   ?   ?   A . n 
A 1 387 THR 387 384 ?   ?   ?   A . n 
A 1 388 MET 388 385 ?   ?   ?   A . n 
A 1 389 ASP 389 386 ?   ?   ?   A . n 
A 1 390 HIS 390 387 ?   ?   ?   A . n 
A 1 391 LEU 391 388 ?   ?   ?   A . n 
A 1 392 GLU 392 389 ?   ?   ?   A . n 
A 1 393 LYS 393 390 ?   ?   ?   A . n 
A 1 394 ASN 394 391 ?   ?   ?   A . n 
A 1 395 GLU 395 392 ?   ?   ?   A . n 
B 1 1   GLY 1   -2  ?   ?   ?   B . n 
B 1 2   PRO 2   -1  ?   ?   ?   B . n 
B 1 3   GLY 3   0   ?   ?   ?   B . n 
B 1 4   CYS 4   1   ?   ?   ?   B . n 
B 1 5   ASN 5   2   ?   ?   ?   B . n 
B 1 6   THR 6   3   ?   ?   ?   B . n 
B 1 7   LYS 7   4   ?   ?   ?   B . n 
B 1 8   LYS 8   5   ?   ?   ?   B . n 
B 1 9   PRO 9   6   ?   ?   ?   B . n 
B 1 10  ASN 10  7   ?   ?   ?   B . n 
B 1 11  LEU 11  8   ?   ?   ?   B . n 
B 1 12  ASP 12  9   ?   ?   ?   B . n 
B 1 13  ALA 13  10  ?   ?   ?   B . n 
B 1 14  GLU 14  11  ?   ?   ?   B . n 
B 1 15  LEU 15  12  ?   ?   ?   B . n 
B 1 16  ASP 16  13  ?   ?   ?   B . n 
B 1 17  GLN 17  14  ?   ?   ?   B . n 
B 1 18  LEU 18  15  ?   ?   ?   B . n 
B 1 19  LEU 19  16  ?   ?   ?   B . n 
B 1 20  GLN 20  17  ?   ?   ?   B . n 
B 1 21  GLY 21  18  ?   ?   ?   B . n 
B 1 22  HIS 22  19  ?   ?   ?   B . n 
B 1 23  TYR 23  20  ?   ?   ?   B . n 
B 1 24  ILE 24  21  ?   ?   ?   B . n 
B 1 25  LYS 25  22  ?   ?   ?   B . n 
B 1 26  GLY 26  23  ?   ?   ?   B . n 
B 1 27  TYR 27  24  ?   ?   ?   B . n 
B 1 28  PRO 28  25  ?   ?   ?   B . n 
B 1 29  LYS 29  26  ?   ?   ?   B . n 
B 1 30  GLN 30  27  ?   ?   ?   B . n 
B 1 31  TYR 31  28  ?   ?   ?   B . n 
B 1 32  THR 32  29  ?   ?   ?   B . n 
B 1 33  TYR 33  30  ?   ?   ?   B . n 
B 1 34  PHE 34  31  ?   ?   ?   B . n 
B 1 35  LEU 35  32  ?   ?   ?   B . n 
B 1 36  GLU 36  33  ?   ?   ?   B . n 
B 1 37  ASP 37  34  ?   ?   ?   B . n 
B 1 38  GLY 38  35  ?   ?   ?   B . n 
B 1 39  LYS 39  36  ?   ?   ?   B . n 
B 1 40  VAL 40  37  ?   ?   ?   B . n 
B 1 41  LYS 41  38  ?   ?   ?   B . n 
B 1 42  VAL 42  39  ?   ?   ?   B . n 
B 1 43  SER 43  40  ?   ?   ?   B . n 
B 1 44  ARG 44  41  ?   ?   ?   B . n 
B 1 45  PRO 45  42  ?   ?   ?   B . n 
B 1 46  GLU 46  43  ?   ?   ?   B . n 
B 1 47  GLY 47  44  ?   ?   ?   B . n 
B 1 48  VAL 48  45  ?   ?   ?   B . n 
B 1 49  LYS 49  46  ?   ?   ?   B . n 
B 1 50  ILE 50  47  ?   ?   ?   B . n 
B 1 51  ILE 51  48  ?   ?   ?   B . n 
B 1 52  PRO 52  49  ?   ?   ?   B . n 
B 1 53  PRO 53  50  ?   ?   ?   B . n 
B 1 54  GLN 54  51  ?   ?   ?   B . n 
B 1 55  SER 55  52  ?   ?   ?   B . n 
B 1 56  ASP 56  53  ?   ?   ?   B . n 
B 1 57  ARG 57  54  ?   ?   ?   B . n 
B 1 58  GLN 58  55  ?   ?   ?   B . n 
B 1 59  LYS 59  56  ?   ?   ?   B . n 
B 1 60  ILE 60  57  ?   ?   ?   B . n 
B 1 61  VAL 61  58  ?   ?   ?   B . n 
B 1 62  LEU 62  59  ?   ?   ?   B . n 
B 1 63  GLN 63  60  ?   ?   ?   B . n 
B 1 64  ALA 64  61  ?   ?   ?   B . n 
B 1 65  HIS 65  62  ?   ?   ?   B . n 
B 1 66  ASN 66  63  ?   ?   ?   B . n 
B 1 67  LEU 67  64  ?   ?   ?   B . n 
B 1 68  ALA 68  65  ?   ?   ?   B . n 
B 1 69  HIS 69  66  ?   ?   ?   B . n 
B 1 70  THR 70  67  ?   ?   ?   B . n 
B 1 71  GLY 71  68  ?   ?   ?   B . n 
B 1 72  ARG 72  69  ?   ?   ?   B . n 
B 1 73  GLU 73  70  ?   ?   ?   B . n 
B 1 74  ALA 74  71  ?   ?   ?   B . n 
B 1 75  THR 75  72  ?   ?   ?   B . n 
B 1 76  LEU 76  73  ?   ?   ?   B . n 
B 1 77  LEU 77  74  ?   ?   ?   B . n 
B 1 78  LYS 78  75  ?   ?   ?   B . n 
B 1 79  ILE 79  76  ?   ?   ?   B . n 
B 1 80  ALA 80  77  ?   ?   ?   B . n 
B 1 81  ASN 81  78  ?   ?   ?   B . n 
B 1 82  LEU 82  79  ?   ?   ?   B . n 
B 1 83  TYR 83  80  ?   ?   ?   B . n 
B 1 84  TRP 84  81  ?   ?   ?   B . n 
B 1 85  TRP 85  82  ?   ?   ?   B . n 
B 1 86  PRO 86  83  ?   ?   ?   B . n 
B 1 87  ASN 87  84  ?   ?   ?   B . n 
B 1 88  MET 88  85  ?   ?   ?   B . n 
B 1 89  ARG 89  86  ?   ?   ?   B . n 
B 1 90  LYS 90  87  ?   ?   ?   B . n 
B 1 91  ASP 91  88  ?   ?   ?   B . n 
B 1 92  VAL 92  89  ?   ?   ?   B . n 
B 1 93  VAL 93  90  ?   ?   ?   B . n 
B 1 94  LYS 94  91  ?   ?   ?   B . n 
B 1 95  GLN 95  92  ?   ?   ?   B . n 
B 1 96  LEU 96  93  ?   ?   ?   B . n 
B 1 97  GLY 97  94  ?   ?   ?   B . n 
B 1 98  ARG 98  95  ?   ?   ?   B . n 
B 1 99  CYS 99  96  ?   ?   ?   B . n 
B 1 100 GLN 100 97  ?   ?   ?   B . n 
B 1 101 GLN 101 98  ?   ?   ?   B . n 
B 1 102 CYS 102 99  ?   ?   ?   B . n 
B 1 103 LEU 103 100 ?   ?   ?   B . n 
B 1 104 ILE 104 101 ?   ?   ?   B . n 
B 1 105 THR 105 102 ?   ?   ?   B . n 
B 1 106 ASN 106 103 ?   ?   ?   B . n 
B 1 107 ALA 107 104 ?   ?   ?   B . n 
B 1 108 SER 108 105 ?   ?   ?   B . n 
B 1 109 ASN 109 106 ?   ?   ?   B . n 
B 1 110 LYS 110 107 ?   ?   ?   B . n 
B 1 111 ALA 111 108 ?   ?   ?   B . n 
B 1 112 SER 112 109 ?   ?   ?   B . n 
B 1 113 GLY 113 110 ?   ?   ?   B . n 
B 1 114 PRO 114 111 ?   ?   ?   B . n 
B 1 115 ILE 115 112 ?   ?   ?   B . n 
B 1 116 LEU 116 113 ?   ?   ?   B . n 
B 1 117 ARG 117 114 ?   ?   ?   B . n 
B 1 118 PRO 118 115 ?   ?   ?   B . n 
B 1 119 ASP 119 116 116 ASP ASP B . n 
B 1 120 ARG 120 117 117 ARG ARG B . n 
B 1 121 PRO 121 118 118 PRO PRO B . n 
B 1 122 GLN 122 119 119 GLN GLN B . n 
B 1 123 LYS 123 120 120 LYS LYS B . n 
B 1 124 PRO 124 121 121 PRO PRO B . n 
B 1 125 PHE 125 122 122 PHE PHE B . n 
B 1 126 ASP 126 123 123 ASP ASP B . n 
B 1 127 LYS 127 124 124 LYS LYS B . n 
B 1 128 PHE 128 125 125 PHE PHE B . n 
B 1 129 PHE 129 126 126 PHE PHE B . n 
B 1 130 ILE 130 127 127 ILE ILE B . n 
B 1 131 ASP 131 128 128 ASP ASP B . n 
B 1 132 TYR 132 129 129 TYR TYR B . n 
B 1 133 ILE 133 130 130 ILE ILE B . n 
B 1 134 GLY 134 131 131 GLY GLY B . n 
B 1 135 PRO 135 132 132 PRO PRO B . n 
B 1 136 LEU 136 133 133 LEU LEU B . n 
B 1 137 PRO 137 134 134 PRO PRO B . n 
B 1 138 PRO 138 135 135 PRO PRO B . n 
B 1 139 SER 139 136 136 SER SER B . n 
B 1 140 GLN 140 137 137 GLN GLN B . n 
B 1 141 GLY 141 138 138 GLY GLY B . n 
B 1 142 TYR 142 139 139 TYR TYR B . n 
B 1 143 LEU 143 140 140 LEU LEU B . n 
B 1 144 TYR 144 141 141 TYR TYR B . n 
B 1 145 VAL 145 142 142 VAL VAL B . n 
B 1 146 LEU 146 143 143 LEU LEU B . n 
B 1 147 VAL 147 144 144 VAL VAL B . n 
B 1 148 VAL 148 145 145 VAL VAL B . n 
B 1 149 VAL 149 146 146 VAL VAL B . n 
B 1 150 ASP 150 147 147 ASP ASP B . n 
B 1 151 GLY 151 148 148 GLY GLY B . n 
B 1 152 MET 152 149 149 MET MET B . n 
B 1 153 THR 153 150 150 THR THR B . n 
B 1 154 GLY 154 151 151 GLY GLY B . n 
B 1 155 PHE 155 152 152 PHE PHE B . n 
B 1 156 THR 156 153 153 THR THR B . n 
B 1 157 TRP 157 154 154 TRP TRP B . n 
B 1 158 LEU 158 155 155 LEU LEU B . n 
B 1 159 TYR 159 156 156 TYR TYR B . n 
B 1 160 PRO 160 157 157 PRO PRO B . n 
B 1 161 THR 161 158 158 THR THR B . n 
B 1 162 LYS 162 159 159 LYS LYS B . n 
B 1 163 ALA 163 160 160 ALA ALA B . n 
B 1 164 PRO 164 161 161 PRO PRO B . n 
B 1 165 SER 165 162 162 SER SER B . n 
B 1 166 THR 166 163 163 THR THR B . n 
B 1 167 SER 167 164 164 SER SER B . n 
B 1 168 ALA 168 165 165 ALA ALA B . n 
B 1 169 THR 169 166 166 THR THR B . n 
B 1 170 VAL 170 167 167 VAL VAL B . n 
B 1 171 LYS 171 168 168 LYS LYS B . n 
B 1 172 SER 172 169 169 SER SER B . n 
B 1 173 LEU 173 170 170 LEU LEU B . n 
B 1 174 ASN 174 171 171 ASN ASN B . n 
B 1 175 VAL 175 172 172 VAL VAL B . n 
B 1 176 LEU 176 173 173 LEU LEU B . n 
B 1 177 THR 177 174 174 THR THR B . n 
B 1 178 SER 178 175 175 SER SER B . n 
B 1 179 ILE 179 176 176 ILE ILE B . n 
B 1 180 ALA 180 177 177 ALA ALA B . n 
B 1 181 ILE 181 178 178 ILE ILE B . n 
B 1 182 PRO 182 179 179 PRO PRO B . n 
B 1 183 LYS 183 180 180 LYS LYS B . n 
B 1 184 VAL 184 181 181 VAL VAL B . n 
B 1 185 ILE 185 182 182 ILE ILE B . n 
B 1 186 HIS 186 183 183 HIS HIS B . n 
B 1 187 SER 187 184 184 SER SER B . n 
B 1 188 ASP 188 185 185 ASP ASP B . n 
B 1 189 GLN 189 186 186 GLN GLN B . n 
B 1 190 GLY 190 187 187 GLY GLY B . n 
B 1 191 ALA 191 188 188 ALA ALA B . n 
B 1 192 ALA 192 189 189 ALA ALA B . n 
B 1 193 PHE 193 190 190 PHE PHE B . n 
B 1 194 THR 194 191 191 THR THR B . n 
B 1 195 SER 195 192 192 SER SER B . n 
B 1 196 SER 196 193 193 SER SER B . n 
B 1 197 THR 197 194 194 THR THR B . n 
B 1 198 PHE 198 195 195 PHE PHE B . n 
B 1 199 ALA 199 196 196 ALA ALA B . n 
B 1 200 GLU 200 197 197 GLU GLU B . n 
B 1 201 TRP 201 198 198 TRP TRP B . n 
B 1 202 ALA 202 199 199 ALA ALA B . n 
B 1 203 LYS 203 200 200 LYS LYS B . n 
B 1 204 GLU 204 201 201 GLU GLU B . n 
B 1 205 ARG 205 202 202 ARG ARG B . n 
B 1 206 GLY 206 203 203 GLY GLY B . n 
B 1 207 ILE 207 204 204 ILE ILE B . n 
B 1 208 HIS 208 205 205 HIS HIS B . n 
B 1 209 LEU 209 206 206 LEU LEU B . n 
B 1 210 GLU 210 207 207 GLU GLU B . n 
B 1 211 PHE 211 208 208 PHE PHE B . n 
B 1 212 SER 212 209 209 SER SER B . n 
B 1 213 THR 213 210 210 THR THR B . n 
B 1 214 PRO 214 211 211 PRO PRO B . n 
B 1 215 TYR 215 212 212 TYR TYR B . n 
B 1 216 HIS 216 213 213 HIS HIS B . n 
B 1 217 PRO 217 214 214 PRO PRO B . n 
B 1 218 GLN 218 215 215 GLN GLN B . n 
B 1 219 SER 219 216 216 SER SER B . n 
B 1 220 SER 220 217 217 SER SER B . n 
B 1 221 GLY 221 218 218 GLY GLY B . n 
B 1 222 LYS 222 219 219 LYS LYS B . n 
B 1 223 VAL 223 220 220 VAL VAL B . n 
B 1 224 GLU 224 221 221 GLU GLU B . n 
B 1 225 ARG 225 222 222 ARG ARG B . n 
B 1 226 LYS 226 223 223 LYS LYS B . n 
B 1 227 HIS 227 224 224 HIS HIS B . n 
B 1 228 SER 228 225 225 SER SER B . n 
B 1 229 ASP 229 226 226 ASP ASP B . n 
B 1 230 ILE 230 227 227 ILE ILE B . n 
B 1 231 LYS 231 228 228 LYS LYS B . n 
B 1 232 ARG 232 229 229 ARG ARG B . n 
B 1 233 LEU 233 230 230 LEU LEU B . n 
B 1 234 LEU 234 231 231 LEU LEU B . n 
B 1 235 THR 235 232 232 THR THR B . n 
B 1 236 LYS 236 233 233 LYS LYS B . n 
B 1 237 LEU 237 234 234 LEU LEU B . n 
B 1 238 LEU 238 235 235 LEU LEU B . n 
B 1 239 VAL 239 236 236 VAL VAL B . n 
B 1 240 GLY 240 237 237 GLY GLY B . n 
B 1 241 ARG 241 238 238 ARG ARG B . n 
B 1 242 PRO 242 239 239 PRO PRO B . n 
B 1 243 THR 243 240 240 THR THR B . n 
B 1 244 LYS 244 241 241 LYS LYS B . n 
B 1 245 TRP 245 242 242 TRP TRP B . n 
B 1 246 TYR 246 243 243 TYR TYR B . n 
B 1 247 ASP 247 244 244 ASP ASP B . n 
B 1 248 LEU 248 245 245 LEU LEU B . n 
B 1 249 LEU 249 246 246 LEU LEU B . n 
B 1 250 PRO 250 247 247 PRO PRO B . n 
B 1 251 VAL 251 248 248 VAL VAL B . n 
B 1 252 VAL 252 249 249 VAL VAL B . n 
B 1 253 GLN 253 250 250 GLN GLN B . n 
B 1 254 LEU 254 251 251 LEU LEU B . n 
B 1 255 ALA 255 252 252 ALA ALA B . n 
B 1 256 LEU 256 253 253 LEU LEU B . n 
B 1 257 ASN 257 254 254 ASN ASN B . n 
B 1 258 ASN 258 255 255 ASN ASN B . n 
B 1 259 THR 259 256 256 THR THR B . n 
B 1 260 TYR 260 257 257 TYR TYR B . n 
B 1 261 SER 261 258 258 SER SER B . n 
B 1 262 PRO 262 259 259 PRO PRO B . n 
B 1 263 VAL 263 260 260 VAL VAL B . n 
B 1 264 LEU 264 261 261 LEU LEU B . n 
B 1 265 LYS 265 262 262 LYS LYS B . n 
B 1 266 TYR 266 263 263 TYR TYR B . n 
B 1 267 THR 267 264 264 THR THR B . n 
B 1 268 PRO 268 265 265 PRO PRO B . n 
B 1 269 HIS 269 266 266 HIS HIS B . n 
B 1 270 GLN 270 267 267 GLN GLN B . n 
B 1 271 LEU 271 268 268 LEU LEU B . n 
B 1 272 LEU 272 269 269 LEU LEU B . n 
B 1 273 PHE 273 270 270 PHE PHE B . n 
B 1 274 GLY 274 271 271 GLY GLY B . n 
B 1 275 ILE 275 272 272 ILE ILE B . n 
B 1 276 ASP 276 273 273 ASP ASP B . n 
B 1 277 SER 277 274 274 SER SER B . n 
B 1 278 ASN 278 275 275 ASN ASN B . n 
B 1 279 THR 279 276 276 THR THR B . n 
B 1 280 PRO 280 277 277 PRO PRO B . n 
B 1 281 PHE 281 278 278 PHE PHE B . n 
B 1 282 ALA 282 279 279 ALA ALA B . n 
B 1 283 ASN 283 280 280 ASN ASN B . n 
B 1 284 GLN 284 281 281 GLN GLN B . n 
B 1 285 ASP 285 282 282 ASP ASP B . n 
B 1 286 THR 286 283 283 THR THR B . n 
B 1 287 LEU 287 284 284 LEU LEU B . n 
B 1 288 ASP 288 285 285 ASP ASP B . n 
B 1 289 LEU 289 286 286 LEU LEU B . n 
B 1 290 THR 290 287 287 THR THR B . n 
B 1 291 ARG 291 288 288 ARG ARG B . n 
B 1 292 GLU 292 289 289 GLU GLU B . n 
B 1 293 GLU 293 290 290 GLU GLU B . n 
B 1 294 GLU 294 291 291 GLU GLU B . n 
B 1 295 LEU 295 292 292 LEU LEU B . n 
B 1 296 SER 296 293 293 SER SER B . n 
B 1 297 LEU 297 294 294 LEU LEU B . n 
B 1 298 LEU 298 295 295 LEU LEU B . n 
B 1 299 GLN 299 296 296 GLN GLN B . n 
B 1 300 GLU 300 297 297 GLU GLU B . n 
B 1 301 ILE 301 298 298 ILE ILE B . n 
B 1 302 ARG 302 299 299 ARG ARG B . n 
B 1 303 THR 303 300 ?   ?   ?   B . n 
B 1 304 SER 304 301 ?   ?   ?   B . n 
B 1 305 LEU 305 302 ?   ?   ?   B . n 
B 1 306 TYR 306 303 ?   ?   ?   B . n 
B 1 307 HIS 307 304 ?   ?   ?   B . n 
B 1 308 PRO 308 305 ?   ?   ?   B . n 
B 1 309 SER 309 306 ?   ?   ?   B . n 
B 1 310 THR 310 307 ?   ?   ?   B . n 
B 1 311 PRO 311 308 ?   ?   ?   B . n 
B 1 312 PRO 312 309 ?   ?   ?   B . n 
B 1 313 ALA 313 310 ?   ?   ?   B . n 
B 1 314 SER 314 311 ?   ?   ?   B . n 
B 1 315 SER 315 312 ?   ?   ?   B . n 
B 1 316 ARG 316 313 ?   ?   ?   B . n 
B 1 317 SER 317 314 ?   ?   ?   B . n 
B 1 318 TRP 318 315 ?   ?   ?   B . n 
B 1 319 SER 319 316 ?   ?   ?   B . n 
B 1 320 PRO 320 317 ?   ?   ?   B . n 
B 1 321 VAL 321 318 ?   ?   ?   B . n 
B 1 322 VAL 322 319 ?   ?   ?   B . n 
B 1 323 GLY 323 320 ?   ?   ?   B . n 
B 1 324 GLN 324 321 ?   ?   ?   B . n 
B 1 325 LEU 325 322 ?   ?   ?   B . n 
B 1 326 VAL 326 323 ?   ?   ?   B . n 
B 1 327 GLN 327 324 ?   ?   ?   B . n 
B 1 328 GLU 328 325 ?   ?   ?   B . n 
B 1 329 ARG 329 326 ?   ?   ?   B . n 
B 1 330 VAL 330 327 ?   ?   ?   B . n 
B 1 331 ALA 331 328 ?   ?   ?   B . n 
B 1 332 ARG 332 329 ?   ?   ?   B . n 
B 1 333 PRO 333 330 ?   ?   ?   B . n 
B 1 334 ALA 334 331 ?   ?   ?   B . n 
B 1 335 SER 335 332 ?   ?   ?   B . n 
B 1 336 LEU 336 333 ?   ?   ?   B . n 
B 1 337 ARG 337 334 ?   ?   ?   B . n 
B 1 338 PRO 338 335 ?   ?   ?   B . n 
B 1 339 ARG 339 336 ?   ?   ?   B . n 
B 1 340 TRP 340 337 ?   ?   ?   B . n 
B 1 341 HIS 341 338 ?   ?   ?   B . n 
B 1 342 LYS 342 339 ?   ?   ?   B . n 
B 1 343 PRO 343 340 ?   ?   ?   B . n 
B 1 344 SER 344 341 ?   ?   ?   B . n 
B 1 345 THR 345 342 ?   ?   ?   B . n 
B 1 346 VAL 346 343 ?   ?   ?   B . n 
B 1 347 LEU 347 344 ?   ?   ?   B . n 
B 1 348 LYS 348 345 ?   ?   ?   B . n 
B 1 349 VAL 349 346 ?   ?   ?   B . n 
B 1 350 LEU 350 347 ?   ?   ?   B . n 
B 1 351 ASN 351 348 ?   ?   ?   B . n 
B 1 352 PRO 352 349 ?   ?   ?   B . n 
B 1 353 ARG 353 350 ?   ?   ?   B . n 
B 1 354 THR 354 351 ?   ?   ?   B . n 
B 1 355 VAL 355 352 ?   ?   ?   B . n 
B 1 356 VAL 356 353 ?   ?   ?   B . n 
B 1 357 ILE 357 354 ?   ?   ?   B . n 
B 1 358 LEU 358 355 ?   ?   ?   B . n 
B 1 359 ASP 359 356 ?   ?   ?   B . n 
B 1 360 HIS 360 357 ?   ?   ?   B . n 
B 1 361 LEU 361 358 ?   ?   ?   B . n 
B 1 362 GLY 362 359 ?   ?   ?   B . n 
B 1 363 ASN 363 360 ?   ?   ?   B . n 
B 1 364 ASN 364 361 ?   ?   ?   B . n 
B 1 365 ARG 365 362 ?   ?   ?   B . n 
B 1 366 THR 366 363 ?   ?   ?   B . n 
B 1 367 VAL 367 364 ?   ?   ?   B . n 
B 1 368 SER 368 365 ?   ?   ?   B . n 
B 1 369 ILE 369 366 ?   ?   ?   B . n 
B 1 370 ASP 370 367 ?   ?   ?   B . n 
B 1 371 ASN 371 368 ?   ?   ?   B . n 
B 1 372 LEU 372 369 ?   ?   ?   B . n 
B 1 373 LYS 373 370 ?   ?   ?   B . n 
B 1 374 PRO 374 371 ?   ?   ?   B . n 
B 1 375 THR 375 372 ?   ?   ?   B . n 
B 1 376 SER 376 373 ?   ?   ?   B . n 
B 1 377 HIS 377 374 ?   ?   ?   B . n 
B 1 378 GLN 378 375 ?   ?   ?   B . n 
B 1 379 ASN 379 376 ?   ?   ?   B . n 
B 1 380 GLY 380 377 ?   ?   ?   B . n 
B 1 381 THR 381 378 ?   ?   ?   B . n 
B 1 382 THR 382 379 ?   ?   ?   B . n 
B 1 383 ASN 383 380 ?   ?   ?   B . n 
B 1 384 ASP 384 381 ?   ?   ?   B . n 
B 1 385 THR 385 382 ?   ?   ?   B . n 
B 1 386 ALA 386 383 ?   ?   ?   B . n 
B 1 387 THR 387 384 ?   ?   ?   B . n 
B 1 388 MET 388 385 ?   ?   ?   B . n 
B 1 389 ASP 389 386 ?   ?   ?   B . n 
B 1 390 HIS 390 387 ?   ?   ?   B . n 
B 1 391 LEU 391 388 ?   ?   ?   B . n 
B 1 392 GLU 392 389 ?   ?   ?   B . n 
B 1 393 LYS 393 390 ?   ?   ?   B . n 
B 1 394 ASN 394 391 ?   ?   ?   B . n 
B 1 395 GLU 395 392 ?   ?   ?   B . n 
C 2 1   DA  1   1   1   DA  DA  C . n 
C 2 2   DT  2   2   2   DT  DT  C . n 
C 2 3   DT  3   3   3   DT  DT  C . n 
C 2 4   DG  4   4   4   DG  DG  C . n 
C 2 5   DT  5   5   5   DT  DT  C . n 
C 2 6   DC  6   6   6   DC  DC  C . n 
C 2 7   DA  7   7   7   DA  DA  C . n 
C 2 8   DT  8   8   8   DT  DT  C . n 
C 2 9   DG  9   9   9   DG  DG  C . n 
C 2 10  DG  10  10  10  DG  DG  C . n 
C 2 11  DA  11  11  11  DA  DA  C . n 
C 2 12  DA  12  12  12  DA  DA  C . n 
C 2 13  DT  13  13  13  DT  DT  C . n 
C 2 14  DT  14  14  14  DT  DT  C . n 
C 2 15  DT  15  15  15  DT  DT  C . n 
C 2 16  DC  16  16  16  DC  DC  C . n 
C 2 17  DG  17  17  17  DG  DG  C . n 
C 2 18  DC  18  18  18  DC  DC  C . n 
C 2 19  DA  19  19  19  DA  DA  C . n 
D 3 1   DT  1   1   1   DT  DT  D . n 
D 3 2   DG  2   2   2   DG  DG  D . n 
D 3 3   DC  3   3   3   DC  DC  D . n 
D 3 4   DG  4   4   4   DG  DG  D . n 
D 3 5   DA  5   5   5   DA  DA  D . n 
D 3 6   DA  6   6   6   DA  DA  D . n 
D 3 7   DA  7   7   7   DA  DA  D . n 
D 3 8   DT  8   8   8   DT  DT  D . n 
D 3 9   DT  9   9   9   DT  DT  D . n 
D 3 10  DC  10  10  10  DC  DC  D . n 
D 3 11  DC  11  11  11  DC  DC  D . n 
D 3 12  DA  12  12  12  DA  DA  D . n 
D 3 13  DT  13  13  13  DT  DT  D . n 
D 3 14  DG  14  14  14  DG  DG  D . n 
D 3 15  DA  15  15  15  DA  DA  D . n 
D 3 16  DC  16  16  16  DC  DC  D . n 
D 3 17  DA  17  17  17  DA  DA  D . n 
# 
_struct_site_keywords.site_id   1 
_struct_site_keywords.text      'OUTSIDE BINDER' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 29130 ? 
1 MORE         -261  ? 
1 'SSA (A^2)'  57010 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -61.0800000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 ND1 ? A HIS 69  ? A HIS 66  ? 1_555 105.5 ? 
2  NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96  ? 1_555 110.2 ? 
3  ND1 ? A HIS 69  ? A HIS 66  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 99  ? A CYS 96  ? 1_555 105.9 ? 
4  NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 101.8 ? 
5  ND1 ? A HIS 69  ? A HIS 66  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 113.1 ? 
6  SG  ? A CYS 99  ? A CYS 96  ? 1_555 ZN ? E ZN . ? A ZN 393 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 119.4 ? 
7  O   ? T HOH .   ? B HOH 511 ? 1_555 MN ? L MN . ? B MN 393 ? 1_555 OD1 ? B ASP 188 ? B ASP 185 ? 1_555 179.1 ? 
8  O   ? T HOH .   ? B HOH 511 ? 1_555 MN ? L MN . ? B MN 393 ? 1_555 O   ? T HOH .   ? B HOH 415 ? 1_555 94.2  ? 
9  OD1 ? B ASP 188 ? B ASP 185 ? 1_555 MN ? L MN . ? B MN 393 ? 1_555 O   ? T HOH .   ? B HOH 415 ? 1_555 84.9  ? 
10 O   ? T HOH .   ? B HOH 511 ? 1_555 MN ? L MN . ? B MN 393 ? 1_555 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 87.3  ? 
11 OD1 ? B ASP 188 ? B ASP 185 ? 1_555 MN ? L MN . ? B MN 393 ? 1_555 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 92.6  ? 
12 O   ? T HOH .   ? B HOH 415 ? 1_555 MN ? L MN . ? B MN 393 ? 1_555 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 91.5  ? 
13 O   ? T HOH .   ? B HOH 511 ? 1_555 MN ? L MN . ? B MN 393 ? 1_555 O   ? T HOH .   ? B HOH 514 ? 1_555 89.9  ? 
14 OD1 ? B ASP 188 ? B ASP 185 ? 1_555 MN ? L MN . ? B MN 393 ? 1_555 O   ? T HOH .   ? B HOH 514 ? 1_555 91.0  ? 
15 O   ? T HOH .   ? B HOH 415 ? 1_555 MN ? L MN . ? B MN 393 ? 1_555 O   ? T HOH .   ? B HOH 514 ? 1_555 175.7 ? 
16 OD1 ? B ASP 131 ? B ASP 128 ? 1_555 MN ? L MN . ? B MN 393 ? 1_555 O   ? T HOH .   ? B HOH 514 ? 1_555 87.6  ? 
17 O   ? S HOH .   ? A HOH 589 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 91.2  ? 
18 O   ? S HOH .   ? A HOH 589 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 177.4 ? 
19 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 86.7  ? 
20 O   ? S HOH .   ? A HOH 589 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 588 ? 1_555 88.3  ? 
21 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 588 ? 1_555 87.3  ? 
22 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 588 ? 1_555 93.1  ? 
23 O   ? S HOH .   ? A HOH 589 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 399 ? 1_555 93.5  ? 
24 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 399 ? 1_555 93.3  ? 
25 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 399 ? 1_555 85.1  ? 
26 O   ? S HOH .   ? A HOH 588 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 399 ? 1_555 178.1 ? 
27 O   ? S HOH .   ? A HOH 589 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 400 ? 1_555 87.3  ? 
28 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 400 ? 1_555 176.8 ? 
29 OD1 ? A ASP 188 ? A ASP 185 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 400 ? 1_555 94.9  ? 
30 O   ? S HOH .   ? A HOH 588 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 400 ? 1_555 89.8  ? 
31 O   ? S HOH .   ? A HOH 399 ? 1_555 MN ? F MN . ? A MN 394 ? 1_555 O   ? S HOH .   ? A HOH 400 ? 1_555 89.6  ? 
32 OE1 ? B GLU 224 ? B GLU 221 ? 1_555 MN ? N MN . ? B MN 394 ? 1_555 O   ? T HOH .   ? B HOH 417 ? 1_555 175.1 ? 
33 OE1 ? B GLU 224 ? B GLU 221 ? 1_555 MN ? N MN . ? B MN 394 ? 1_555 O   ? T HOH .   ? B HOH 416 ? 1_555 80.9  ? 
34 O   ? T HOH .   ? B HOH 417 ? 1_555 MN ? N MN . ? B MN 394 ? 1_555 O   ? T HOH .   ? B HOH 416 ? 1_555 97.9  ? 
35 OE1 ? B GLU 224 ? B GLU 221 ? 1_555 MN ? N MN . ? B MN 394 ? 1_555 ND1 ? B HIS 227 ? B HIS 224 ? 1_555 91.1  ? 
36 O   ? T HOH .   ? B HOH 417 ? 1_555 MN ? N MN . ? B MN 394 ? 1_555 ND1 ? B HIS 227 ? B HIS 224 ? 1_555 84.1  ? 
37 O   ? T HOH .   ? B HOH 416 ? 1_555 MN ? N MN . ? B MN 394 ? 1_555 ND1 ? B HIS 227 ? B HIS 224 ? 1_555 85.8  ? 
38 OE1 ? B GLU 224 ? B GLU 221 ? 1_555 MN ? N MN . ? B MN 394 ? 1_555 O   ? T HOH .   ? B HOH 418 ? 1_555 94.3  ? 
39 O   ? T HOH .   ? B HOH 417 ? 1_555 MN ? N MN . ? B MN 394 ? 1_555 O   ? T HOH .   ? B HOH 418 ? 1_555 90.3  ? 
40 O   ? T HOH .   ? B HOH 416 ? 1_555 MN ? N MN . ? B MN 394 ? 1_555 O   ? T HOH .   ? B HOH 418 ? 1_555 85.5  ? 
41 ND1 ? B HIS 227 ? B HIS 224 ? 1_555 MN ? N MN . ? B MN 394 ? 1_555 O   ? T HOH .   ? B HOH 418 ? 1_555 168.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-11-17 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .       ?               package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk    'data reduction'  
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/   ?          ? 
2 SCALA       3.3.16  2010/01/06      other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html   Fortran_77 ? 
3 PHASER      .       ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
4 REFMAC      .       ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
5 PDB_EXTRACT 3.10    'June 10, 2010' package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
6 ADSC        Quantum ?               ?       ?                    ?                           'data collection' ? ?          ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O     A HOH 482 ? ? O C HOH 473 ? ? 1.76 
2 1 "O3'" D DA  15  ? ? O D HOH 31  ? ? 1.98 
3 1 "O3'" C DT  8   ? ? O C HOH 92  ? ? 2.07 
4 1 O     B HOH 526 ? ? O B HOH 527 ? ? 2.08 
5 1 O     A HOH 419 ? ? O D HOH 41  ? ? 2.09 
6 1 OP2   C DA  11  ? ? O C HOH 517 ? ? 2.11 
7 1 OP1   C DG  9   ? ? O C HOH 92  ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE    A ARG 69 ? ? CZ    A ARG 69 ? ? NH1   A ARG 69 ? ? 124.30 120.30 4.00  0.50 N 
2  1 NE    A ARG 69 ? ? CZ    A ARG 69 ? ? NH2   A ARG 69 ? ? 115.54 120.30 -4.76 0.50 N 
3  1 "C3'" C DA  1  ? ? "C2'" C DA  1  ? ? "C1'" C DA  1  ? ? 96.88  102.40 -5.52 0.80 N 
4  1 "O4'" C DA  1  ? ? "C1'" C DA  1  ? ? N9    C DA  1  ? ? 112.04 108.30 3.74  0.30 N 
5  1 "C3'" C DC  6  ? ? "C2'" C DC  6  ? ? "C1'" C DC  6  ? ? 97.51  102.40 -4.89 0.80 N 
6  1 P     C DG  9  ? ? "O5'" C DG  9  ? ? "C5'" C DG  9  ? ? 130.87 120.90 9.97  1.60 N 
7  1 "O4'" D DT  1  ? ? "C1'" D DT  1  ? ? N1    D DT  1  ? ? 111.02 108.30 2.72  0.30 N 
8  1 "O4'" D DA  6  ? ? "C1'" D DA  6  ? ? N9    D DA  6  ? ? 103.08 108.00 -4.92 0.70 N 
9  1 "O4'" D DA  7  ? ? "C1'" D DA  7  ? ? N9    D DA  7  ? ? 103.34 108.00 -4.66 0.70 N 
10 1 "O4'" D DC  11 ? ? "C1'" D DC  11 ? ? N1    D DC  11 ? ? 110.69 108.30 2.39  0.30 N 
11 1 "O4'" D DA  12 ? ? "C1'" D DA  12 ? ? N9    D DA  12 ? ? 100.41 108.00 -7.59 0.70 N 
12 1 "O4'" D DA  17 ? ? "C1'" D DA  17 ? ? N9    D DA  17 ? ? 112.30 108.30 4.00  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 122 ? ? 72.16  -0.91 
2 1 PHE B 122 ? ? 76.13  -5.23 
3 1 GLN B 186 ? ? -94.70 30.19 
4 1 LEU B 284 ? ? 87.42  -7.25 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 8   ? CG  ? A LEU 11  CG  
2  1 Y 1 A LEU 8   ? CD1 ? A LEU 11  CD1 
3  1 Y 1 A LEU 8   ? CD2 ? A LEU 11  CD2 
4  1 Y 1 B PHE 278 ? CG  ? B PHE 281 CG  
5  1 Y 1 B PHE 278 ? CD1 ? B PHE 281 CD1 
6  1 Y 1 B PHE 278 ? CD2 ? B PHE 281 CD2 
7  1 Y 1 B PHE 278 ? CE1 ? B PHE 281 CE1 
8  1 Y 1 B PHE 278 ? CE2 ? B PHE 281 CE2 
9  1 Y 1 B PHE 278 ? CZ  ? B PHE 281 CZ  
10 1 Y 1 B GLN 281 ? CG  ? B GLN 284 CG  
11 1 Y 1 B GLN 281 ? CD  ? B GLN 284 CD  
12 1 Y 1 B GLN 281 ? OE1 ? B GLN 284 OE1 
13 1 Y 1 B GLN 281 ? NE2 ? B GLN 284 NE2 
14 1 Y 1 B GLU 289 ? CG  ? B GLU 292 CG  
15 1 Y 1 B GLU 289 ? CD  ? B GLU 292 CD  
16 1 Y 1 B GLU 289 ? OE1 ? B GLU 292 OE1 
17 1 Y 1 B GLU 289 ? OE2 ? B GLU 292 OE2 
18 1 Y 1 B ARG 299 ? CG  ? B ARG 302 CG  
19 1 Y 1 B ARG 299 ? CD  ? B ARG 302 CD  
20 1 Y 1 B ARG 299 ? NE  ? B ARG 302 NE  
21 1 Y 1 B ARG 299 ? CZ  ? B ARG 302 CZ  
22 1 Y 1 B ARG 299 ? NH1 ? B ARG 302 NH1 
23 1 Y 1 B ARG 299 ? NH2 ? B ARG 302 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY -2  ? A GLY 1   
2   1 Y 1 A PRO -1  ? A PRO 2   
3   1 Y 1 A GLY 0   ? A GLY 3   
4   1 Y 1 A CYS 1   ? A CYS 4   
5   1 Y 1 A ASN 2   ? A ASN 5   
6   1 Y 1 A THR 3   ? A THR 6   
7   1 Y 1 A LYS 4   ? A LYS 7   
8   1 Y 1 A LYS 5   ? A LYS 8   
9   1 Y 1 A PRO 6   ? A PRO 9   
10  1 Y 1 A ASN 7   ? A ASN 10  
11  1 Y 1 A ASN 376 ? A ASN 379 
12  1 Y 1 A GLY 377 ? A GLY 380 
13  1 Y 1 A THR 378 ? A THR 381 
14  1 Y 1 A THR 379 ? A THR 382 
15  1 Y 1 A ASN 380 ? A ASN 383 
16  1 Y 1 A ASP 381 ? A ASP 384 
17  1 Y 1 A THR 382 ? A THR 385 
18  1 Y 1 A ALA 383 ? A ALA 386 
19  1 Y 1 A THR 384 ? A THR 387 
20  1 Y 1 A MET 385 ? A MET 388 
21  1 Y 1 A ASP 386 ? A ASP 389 
22  1 Y 1 A HIS 387 ? A HIS 390 
23  1 Y 1 A LEU 388 ? A LEU 391 
24  1 Y 1 A GLU 389 ? A GLU 392 
25  1 Y 1 A LYS 390 ? A LYS 393 
26  1 Y 1 A ASN 391 ? A ASN 394 
27  1 Y 1 A GLU 392 ? A GLU 395 
28  1 Y 1 B GLY -2  ? B GLY 1   
29  1 Y 1 B PRO -1  ? B PRO 2   
30  1 Y 1 B GLY 0   ? B GLY 3   
31  1 Y 1 B CYS 1   ? B CYS 4   
32  1 Y 1 B ASN 2   ? B ASN 5   
33  1 Y 1 B THR 3   ? B THR 6   
34  1 Y 1 B LYS 4   ? B LYS 7   
35  1 Y 1 B LYS 5   ? B LYS 8   
36  1 Y 1 B PRO 6   ? B PRO 9   
37  1 Y 1 B ASN 7   ? B ASN 10  
38  1 Y 1 B LEU 8   ? B LEU 11  
39  1 Y 1 B ASP 9   ? B ASP 12  
40  1 Y 1 B ALA 10  ? B ALA 13  
41  1 Y 1 B GLU 11  ? B GLU 14  
42  1 Y 1 B LEU 12  ? B LEU 15  
43  1 Y 1 B ASP 13  ? B ASP 16  
44  1 Y 1 B GLN 14  ? B GLN 17  
45  1 Y 1 B LEU 15  ? B LEU 18  
46  1 Y 1 B LEU 16  ? B LEU 19  
47  1 Y 1 B GLN 17  ? B GLN 20  
48  1 Y 1 B GLY 18  ? B GLY 21  
49  1 Y 1 B HIS 19  ? B HIS 22  
50  1 Y 1 B TYR 20  ? B TYR 23  
51  1 Y 1 B ILE 21  ? B ILE 24  
52  1 Y 1 B LYS 22  ? B LYS 25  
53  1 Y 1 B GLY 23  ? B GLY 26  
54  1 Y 1 B TYR 24  ? B TYR 27  
55  1 Y 1 B PRO 25  ? B PRO 28  
56  1 Y 1 B LYS 26  ? B LYS 29  
57  1 Y 1 B GLN 27  ? B GLN 30  
58  1 Y 1 B TYR 28  ? B TYR 31  
59  1 Y 1 B THR 29  ? B THR 32  
60  1 Y 1 B TYR 30  ? B TYR 33  
61  1 Y 1 B PHE 31  ? B PHE 34  
62  1 Y 1 B LEU 32  ? B LEU 35  
63  1 Y 1 B GLU 33  ? B GLU 36  
64  1 Y 1 B ASP 34  ? B ASP 37  
65  1 Y 1 B GLY 35  ? B GLY 38  
66  1 Y 1 B LYS 36  ? B LYS 39  
67  1 Y 1 B VAL 37  ? B VAL 40  
68  1 Y 1 B LYS 38  ? B LYS 41  
69  1 Y 1 B VAL 39  ? B VAL 42  
70  1 Y 1 B SER 40  ? B SER 43  
71  1 Y 1 B ARG 41  ? B ARG 44  
72  1 Y 1 B PRO 42  ? B PRO 45  
73  1 Y 1 B GLU 43  ? B GLU 46  
74  1 Y 1 B GLY 44  ? B GLY 47  
75  1 Y 1 B VAL 45  ? B VAL 48  
76  1 Y 1 B LYS 46  ? B LYS 49  
77  1 Y 1 B ILE 47  ? B ILE 50  
78  1 Y 1 B ILE 48  ? B ILE 51  
79  1 Y 1 B PRO 49  ? B PRO 52  
80  1 Y 1 B PRO 50  ? B PRO 53  
81  1 Y 1 B GLN 51  ? B GLN 54  
82  1 Y 1 B SER 52  ? B SER 55  
83  1 Y 1 B ASP 53  ? B ASP 56  
84  1 Y 1 B ARG 54  ? B ARG 57  
85  1 Y 1 B GLN 55  ? B GLN 58  
86  1 Y 1 B LYS 56  ? B LYS 59  
87  1 Y 1 B ILE 57  ? B ILE 60  
88  1 Y 1 B VAL 58  ? B VAL 61  
89  1 Y 1 B LEU 59  ? B LEU 62  
90  1 Y 1 B GLN 60  ? B GLN 63  
91  1 Y 1 B ALA 61  ? B ALA 64  
92  1 Y 1 B HIS 62  ? B HIS 65  
93  1 Y 1 B ASN 63  ? B ASN 66  
94  1 Y 1 B LEU 64  ? B LEU 67  
95  1 Y 1 B ALA 65  ? B ALA 68  
96  1 Y 1 B HIS 66  ? B HIS 69  
97  1 Y 1 B THR 67  ? B THR 70  
98  1 Y 1 B GLY 68  ? B GLY 71  
99  1 Y 1 B ARG 69  ? B ARG 72  
100 1 Y 1 B GLU 70  ? B GLU 73  
101 1 Y 1 B ALA 71  ? B ALA 74  
102 1 Y 1 B THR 72  ? B THR 75  
103 1 Y 1 B LEU 73  ? B LEU 76  
104 1 Y 1 B LEU 74  ? B LEU 77  
105 1 Y 1 B LYS 75  ? B LYS 78  
106 1 Y 1 B ILE 76  ? B ILE 79  
107 1 Y 1 B ALA 77  ? B ALA 80  
108 1 Y 1 B ASN 78  ? B ASN 81  
109 1 Y 1 B LEU 79  ? B LEU 82  
110 1 Y 1 B TYR 80  ? B TYR 83  
111 1 Y 1 B TRP 81  ? B TRP 84  
112 1 Y 1 B TRP 82  ? B TRP 85  
113 1 Y 1 B PRO 83  ? B PRO 86  
114 1 Y 1 B ASN 84  ? B ASN 87  
115 1 Y 1 B MET 85  ? B MET 88  
116 1 Y 1 B ARG 86  ? B ARG 89  
117 1 Y 1 B LYS 87  ? B LYS 90  
118 1 Y 1 B ASP 88  ? B ASP 91  
119 1 Y 1 B VAL 89  ? B VAL 92  
120 1 Y 1 B VAL 90  ? B VAL 93  
121 1 Y 1 B LYS 91  ? B LYS 94  
122 1 Y 1 B GLN 92  ? B GLN 95  
123 1 Y 1 B LEU 93  ? B LEU 96  
124 1 Y 1 B GLY 94  ? B GLY 97  
125 1 Y 1 B ARG 95  ? B ARG 98  
126 1 Y 1 B CYS 96  ? B CYS 99  
127 1 Y 1 B GLN 97  ? B GLN 100 
128 1 Y 1 B GLN 98  ? B GLN 101 
129 1 Y 1 B CYS 99  ? B CYS 102 
130 1 Y 1 B LEU 100 ? B LEU 103 
131 1 Y 1 B ILE 101 ? B ILE 104 
132 1 Y 1 B THR 102 ? B THR 105 
133 1 Y 1 B ASN 103 ? B ASN 106 
134 1 Y 1 B ALA 104 ? B ALA 107 
135 1 Y 1 B SER 105 ? B SER 108 
136 1 Y 1 B ASN 106 ? B ASN 109 
137 1 Y 1 B LYS 107 ? B LYS 110 
138 1 Y 1 B ALA 108 ? B ALA 111 
139 1 Y 1 B SER 109 ? B SER 112 
140 1 Y 1 B GLY 110 ? B GLY 113 
141 1 Y 1 B PRO 111 ? B PRO 114 
142 1 Y 1 B ILE 112 ? B ILE 115 
143 1 Y 1 B LEU 113 ? B LEU 116 
144 1 Y 1 B ARG 114 ? B ARG 117 
145 1 Y 1 B PRO 115 ? B PRO 118 
146 1 Y 1 B THR 300 ? B THR 303 
147 1 Y 1 B SER 301 ? B SER 304 
148 1 Y 1 B LEU 302 ? B LEU 305 
149 1 Y 1 B TYR 303 ? B TYR 306 
150 1 Y 1 B HIS 304 ? B HIS 307 
151 1 Y 1 B PRO 305 ? B PRO 308 
152 1 Y 1 B SER 306 ? B SER 309 
153 1 Y 1 B THR 307 ? B THR 310 
154 1 Y 1 B PRO 308 ? B PRO 311 
155 1 Y 1 B PRO 309 ? B PRO 312 
156 1 Y 1 B ALA 310 ? B ALA 313 
157 1 Y 1 B SER 311 ? B SER 314 
158 1 Y 1 B SER 312 ? B SER 315 
159 1 Y 1 B ARG 313 ? B ARG 316 
160 1 Y 1 B SER 314 ? B SER 317 
161 1 Y 1 B TRP 315 ? B TRP 318 
162 1 Y 1 B SER 316 ? B SER 319 
163 1 Y 1 B PRO 317 ? B PRO 320 
164 1 Y 1 B VAL 318 ? B VAL 321 
165 1 Y 1 B VAL 319 ? B VAL 322 
166 1 Y 1 B GLY 320 ? B GLY 323 
167 1 Y 1 B GLN 321 ? B GLN 324 
168 1 Y 1 B LEU 322 ? B LEU 325 
169 1 Y 1 B VAL 323 ? B VAL 326 
170 1 Y 1 B GLN 324 ? B GLN 327 
171 1 Y 1 B GLU 325 ? B GLU 328 
172 1 Y 1 B ARG 326 ? B ARG 329 
173 1 Y 1 B VAL 327 ? B VAL 330 
174 1 Y 1 B ALA 328 ? B ALA 331 
175 1 Y 1 B ARG 329 ? B ARG 332 
176 1 Y 1 B PRO 330 ? B PRO 333 
177 1 Y 1 B ALA 331 ? B ALA 334 
178 1 Y 1 B SER 332 ? B SER 335 
179 1 Y 1 B LEU 333 ? B LEU 336 
180 1 Y 1 B ARG 334 ? B ARG 337 
181 1 Y 1 B PRO 335 ? B PRO 338 
182 1 Y 1 B ARG 336 ? B ARG 339 
183 1 Y 1 B TRP 337 ? B TRP 340 
184 1 Y 1 B HIS 338 ? B HIS 341 
185 1 Y 1 B LYS 339 ? B LYS 342 
186 1 Y 1 B PRO 340 ? B PRO 343 
187 1 Y 1 B SER 341 ? B SER 344 
188 1 Y 1 B THR 342 ? B THR 345 
189 1 Y 1 B VAL 343 ? B VAL 346 
190 1 Y 1 B LEU 344 ? B LEU 347 
191 1 Y 1 B LYS 345 ? B LYS 348 
192 1 Y 1 B VAL 346 ? B VAL 349 
193 1 Y 1 B LEU 347 ? B LEU 350 
194 1 Y 1 B ASN 348 ? B ASN 351 
195 1 Y 1 B PRO 349 ? B PRO 352 
196 1 Y 1 B ARG 350 ? B ARG 353 
197 1 Y 1 B THR 351 ? B THR 354 
198 1 Y 1 B VAL 352 ? B VAL 355 
199 1 Y 1 B VAL 353 ? B VAL 356 
200 1 Y 1 B ILE 354 ? B ILE 357 
201 1 Y 1 B LEU 355 ? B LEU 358 
202 1 Y 1 B ASP 356 ? B ASP 359 
203 1 Y 1 B HIS 357 ? B HIS 360 
204 1 Y 1 B LEU 358 ? B LEU 361 
205 1 Y 1 B GLY 359 ? B GLY 362 
206 1 Y 1 B ASN 360 ? B ASN 363 
207 1 Y 1 B ASN 361 ? B ASN 364 
208 1 Y 1 B ARG 362 ? B ARG 365 
209 1 Y 1 B THR 363 ? B THR 366 
210 1 Y 1 B VAL 364 ? B VAL 367 
211 1 Y 1 B SER 365 ? B SER 368 
212 1 Y 1 B ILE 366 ? B ILE 369 
213 1 Y 1 B ASP 367 ? B ASP 370 
214 1 Y 1 B ASN 368 ? B ASN 371 
215 1 Y 1 B LEU 369 ? B LEU 372 
216 1 Y 1 B LYS 370 ? B LYS 373 
217 1 Y 1 B PRO 371 ? B PRO 374 
218 1 Y 1 B THR 372 ? B THR 375 
219 1 Y 1 B SER 373 ? B SER 376 
220 1 Y 1 B HIS 374 ? B HIS 377 
221 1 Y 1 B GLN 375 ? B GLN 378 
222 1 Y 1 B ASN 376 ? B ASN 379 
223 1 Y 1 B GLY 377 ? B GLY 380 
224 1 Y 1 B THR 378 ? B THR 381 
225 1 Y 1 B THR 379 ? B THR 382 
226 1 Y 1 B ASN 380 ? B ASN 383 
227 1 Y 1 B ASP 381 ? B ASP 384 
228 1 Y 1 B THR 382 ? B THR 385 
229 1 Y 1 B ALA 383 ? B ALA 386 
230 1 Y 1 B THR 384 ? B THR 387 
231 1 Y 1 B MET 385 ? B MET 388 
232 1 Y 1 B ASP 386 ? B ASP 389 
233 1 Y 1 B HIS 387 ? B HIS 390 
234 1 Y 1 B LEU 388 ? B LEU 391 
235 1 Y 1 B GLU 389 ? B GLU 392 
236 1 Y 1 B LYS 390 ? B LYS 393 
237 1 Y 1 B ASN 391 ? B ASN 394 
238 1 Y 1 B GLU 392 ? B GLU 395 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3OYM 'double helix'        
3OYM 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 4  1_555 D DC 16 1_555 -0.311 -0.046 -0.586 -26.156 -16.964 -0.941 1  C_DG4:DC16_D  C 4  ? D 16 ? 19 1 
1 C DT 5  1_555 D DA 15 1_555 -0.054 -0.102 0.223  -12.268 -5.967  4.813  2  C_DT5:DA15_D  C 5  ? D 15 ? 20 1 
1 C DC 6  1_555 D DG 14 1_555 0.216  -0.108 -0.177 4.915   -3.171  -1.327 3  C_DC6:DG14_D  C 6  ? D 14 ? 19 1 
1 C DA 7  1_555 D DT 13 1_555 0.033  -0.053 -0.126 1.433   -14.554 0.056  4  C_DA7:DT13_D  C 7  ? D 13 ? 20 1 
1 C DT 8  1_555 D DA 12 1_555 0.021  -0.122 0.022  -0.962  -15.593 6.629  5  C_DT8:DA12_D  C 8  ? D 12 ? 20 1 
1 C DG 9  1_555 D DC 11 1_555 -0.077 -0.158 -0.009 6.481   2.741   -1.747 6  C_DG9:DC11_D  C 9  ? D 11 ? 19 1 
1 C DG 10 1_555 D DC 10 1_555 -0.263 -0.074 0.092  14.227  -10.912 -0.909 7  C_DG10:DC10_D C 10 ? D 10 ? 19 1 
1 C DA 11 1_555 D DT 9  1_555 0.129  -0.125 0.010  5.141   -15.913 2.277  8  C_DA11:DT9_D  C 11 ? D 9  ? 20 1 
1 C DA 12 1_555 D DT 8  1_555 0.087  -0.117 0.078  -0.136  -14.125 2.185  9  C_DA12:DT8_D  C 12 ? D 8  ? 20 1 
1 C DT 13 1_555 D DA 7  1_555 0.074  -0.210 0.177  -1.787  -14.840 2.502  10 C_DT13:DA7_D  C 13 ? D 7  ? 20 1 
1 C DT 14 1_555 D DA 6  1_555 -0.064 -0.142 -0.070 -3.380  -13.572 0.858  11 C_DT14:DA6_D  C 14 ? D 6  ? 20 1 
1 C DT 15 1_555 D DA 5  1_555 -0.176 -0.100 -0.072 -4.003  -14.919 0.603  12 C_DT15:DA5_D  C 15 ? D 5  ? 20 1 
1 C DC 16 1_555 D DG 4  1_555 0.203  -0.137 -0.050 -9.472  -12.156 -0.989 13 C_DC16:DG4_D  C 16 ? D 4  ? 19 1 
1 C DG 17 1_555 D DC 3  1_555 -0.403 -0.104 0.119  -2.370  -7.712  0.991  14 C_DG17:DC3_D  C 17 ? D 3  ? 19 1 
1 C DC 18 1_555 D DG 2  1_555 0.000  -0.117 0.058  2.586   -1.794  -0.087 15 C_DC18:DG2_D  C 18 ? D 2  ? 19 1 
1 C DA 19 1_555 D DT 1  1_555 0.260  -0.373 0.418  18.416  -5.828  -4.399 16 C_DA19:DT1_D  C 19 ? D 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 4  1_555 D DC 16 1_555 C DT 5  1_555 D DA 15 1_555 0.666  -0.110 2.999 -4.713 1.417  34.808 -0.374 -1.740 2.881 2.354  
7.829  35.143 1  CC_DG4DT5:DA15DC16_DD  C 4  ? D 16 ? C 5  ? D 15 ? 
1 C DT 5  1_555 D DA 15 1_555 C DC 6  1_555 D DG 14 1_555 0.128  0.325  2.980 3.598  7.681  28.791 -0.841 0.440  2.960 15.040 
-7.045 29.989 2  CC_DT5DC6:DG14DA15_DD  C 5  ? D 15 ? C 6  ? D 14 ? 
1 C DC 6  1_555 D DG 14 1_555 C DA 7  1_555 D DT 13 1_555 -1.370 0.991  3.373 -3.748 7.597  38.239 0.495  1.560  3.610 11.426 
5.637  39.132 3  CC_DC6DA7:DT13DG14_DD  C 6  ? D 14 ? C 7  ? D 13 ? 
1 C DA 7  1_555 D DT 13 1_555 C DT 8  1_555 D DA 12 1_555 0.429  -0.323 3.319 -0.570 2.856  29.683 -1.228 -0.953 3.266 5.558  
1.109  29.822 4  CC_DA7DT8:DA12DT13_DD  C 7  ? D 13 ? C 8  ? D 12 ? 
1 C DT 8  1_555 D DA 12 1_555 C DG 9  1_555 D DC 11 1_555 0.766  1.900  3.283 3.879  6.203  37.470 2.075  -0.651 3.599 9.544  
-5.969 38.152 5  CC_DT8DG9:DC11DA12_DD  C 8  ? D 12 ? C 9  ? D 11 ? 
1 C DG 9  1_555 D DC 11 1_555 C DG 10 1_555 D DC 10 1_555 -0.876 0.569  3.130 -1.929 5.976  31.148 -0.036 1.253  3.227 10.988 
3.547  31.759 6  CC_DG9DG10:DC10DC11_DD C 9  ? D 11 ? C 10 ? D 10 ? 
1 C DG 10 1_555 D DC 10 1_555 C DA 11 1_555 D DT 9  1_555 0.010  -0.195 3.427 1.768  2.003  40.879 -0.507 0.187  3.412 2.864  
-2.527 40.963 7  CC_DG10DA11:DT9DC10_DD C 10 ? D 10 ? C 11 ? D 9  ? 
1 C DA 11 1_555 D DT 9  1_555 C DA 12 1_555 D DT 8  1_555 -0.260 0.019  3.255 -2.846 -1.874 39.073 0.252  0.048  3.261 -2.796 
4.246  39.215 8  CC_DA11DA12:DT8DT9_DD  C 11 ? D 9  ? C 12 ? D 8  ? 
1 C DA 12 1_555 D DT 8  1_555 C DT 13 1_555 D DA 7  1_555 -0.098 -0.531 3.267 -0.460 -3.489 32.906 -0.339 0.095  3.305 -6.137 
0.809  33.089 9  CC_DA12DT13:DA7DT8_DD  C 12 ? D 8  ? C 13 ? D 7  ? 
1 C DT 13 1_555 D DA 7  1_555 C DT 14 1_555 D DA 6  1_555 -0.033 -0.361 3.212 2.260  -3.095 37.105 -0.161 0.346  3.223 -4.848 
-3.539 37.296 10 CC_DT13DT14:DA6DA7_DD  C 13 ? D 7  ? C 14 ? D 6  ? 
1 C DT 14 1_555 D DA 6  1_555 C DT 15 1_555 D DA 5  1_555 0.021  -0.094 3.231 0.572  -2.588 37.517 0.187  0.040  3.230 -4.018 
-0.887 37.607 11 CC_DT14DT15:DA5DA6_DD  C 14 ? D 6  ? C 15 ? D 5  ? 
1 C DT 15 1_555 D DA 5  1_555 C DC 16 1_555 D DG 4  1_555 -0.139 0.056  3.352 -0.778 -0.433 40.006 0.132  0.112  3.353 -0.633 
1.137  40.015 12 CC_DT15DC16:DG4DA5_DD  C 15 ? D 5  ? C 16 ? D 4  ? 
1 C DC 16 1_555 D DG 4  1_555 C DG 17 1_555 D DC 3  1_555 0.169  0.601  3.150 -3.654 11.525 32.090 -0.784 -0.859 3.138 19.984 
6.336  34.236 13 CC_DC16DG17:DC3DG4_DD  C 16 ? D 4  ? C 17 ? D 3  ? 
1 C DG 17 1_555 D DC 3  1_555 C DC 18 1_555 D DG 2  1_555 0.632  -0.132 3.182 -0.042 2.555  31.860 -0.689 -1.156 3.161 4.646  
0.077  31.959 14 CC_DG17DC18:DG2DC3_DD  C 17 ? D 3  ? C 18 ? D 2  ? 
1 C DC 18 1_555 D DG 2  1_555 C DA 19 1_555 D DT 1  1_555 0.248  -0.465 2.805 -2.560 10.002 37.188 -1.743 -0.642 2.578 15.325 
3.922  38.546 15 CC_DC18DA19:DT1DG2_DD  C 18 ? D 2  ? C 19 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4  'ZINC ION'           ZN  
5  'MANGANESE (II) ION' MN  
6  'SULFATE ION'        SO4 
7  GLYCEROL             GOL 
8  'AMMONIUM ION'       NH4 
9  HEXANE-1,6-DIOL      HEZ 
10 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4  ZN  1   393 393 ZN  ZN  A . 
F 5  MN  1   394 394 MN  MN  A . 
G 6  SO4 1   395 395 SO4 SO4 A . 
H 7  GOL 1   801 801 GOL GOL A . 
I 8  NH4 1   396 396 NH4 NH4 A . 
J 6  SO4 1   397 397 SO4 SO4 A . 
K 7  GOL 1   398 398 GOL GOL A . 
L 5  MN  1   393 393 MN  MN  B . 
M 7  GOL 1   803 803 GOL GOL B . 
N 5  MN  1   394 358 MN  MN  B . 
O 7  GOL 1   395 359 GOL GOL B . 
P 6  SO4 1   396 360 SO4 SO4 B . 
Q 9  HEZ 1   397 361 HEZ HEZ B . 
R 7  GOL 1   20  20  GOL GOL C . 
S 10 HOH 1   399 399 HOH HOH A . 
S 10 HOH 2   400 400 HOH HOH A . 
S 10 HOH 3   401 401 HOH HOH A . 
S 10 HOH 4   402 402 HOH HOH A . 
S 10 HOH 5   403 403 HOH HOH A . 
S 10 HOH 6   404 404 HOH HOH A . 
S 10 HOH 7   405 405 HOH HOH A . 
S 10 HOH 8   406 406 HOH HOH A . 
S 10 HOH 9   407 407 HOH HOH A . 
S 10 HOH 10  408 408 HOH HOH A . 
S 10 HOH 11  409 409 HOH HOH A . 
S 10 HOH 12  410 410 HOH HOH A . 
S 10 HOH 13  411 411 HOH HOH A . 
S 10 HOH 14  412 412 HOH HOH A . 
S 10 HOH 15  413 413 HOH HOH A . 
S 10 HOH 16  414 414 HOH HOH A . 
S 10 HOH 17  415 415 HOH HOH A . 
S 10 HOH 18  416 416 HOH HOH A . 
S 10 HOH 19  417 417 HOH HOH A . 
S 10 HOH 20  418 418 HOH HOH A . 
S 10 HOH 21  419 419 HOH HOH A . 
S 10 HOH 22  420 420 HOH HOH A . 
S 10 HOH 23  421 421 HOH HOH A . 
S 10 HOH 24  422 422 HOH HOH A . 
S 10 HOH 25  423 423 HOH HOH A . 
S 10 HOH 26  424 424 HOH HOH A . 
S 10 HOH 27  425 425 HOH HOH A . 
S 10 HOH 28  426 426 HOH HOH A . 
S 10 HOH 29  427 427 HOH HOH A . 
S 10 HOH 30  428 428 HOH HOH A . 
S 10 HOH 31  429 429 HOH HOH A . 
S 10 HOH 32  430 430 HOH HOH A . 
S 10 HOH 33  431 431 HOH HOH A . 
S 10 HOH 34  432 432 HOH HOH A . 
S 10 HOH 35  433 433 HOH HOH A . 
S 10 HOH 36  434 434 HOH HOH A . 
S 10 HOH 37  435 435 HOH HOH A . 
S 10 HOH 38  436 436 HOH HOH A . 
S 10 HOH 39  437 437 HOH HOH A . 
S 10 HOH 40  438 438 HOH HOH A . 
S 10 HOH 41  439 439 HOH HOH A . 
S 10 HOH 42  440 440 HOH HOH A . 
S 10 HOH 43  441 441 HOH HOH A . 
S 10 HOH 44  442 442 HOH HOH A . 
S 10 HOH 45  443 443 HOH HOH A . 
S 10 HOH 46  444 444 HOH HOH A . 
S 10 HOH 47  445 445 HOH HOH A . 
S 10 HOH 48  446 446 HOH HOH A . 
S 10 HOH 49  447 447 HOH HOH A . 
S 10 HOH 50  448 448 HOH HOH A . 
S 10 HOH 51  449 449 HOH HOH A . 
S 10 HOH 52  450 450 HOH HOH A . 
S 10 HOH 53  451 451 HOH HOH A . 
S 10 HOH 54  452 452 HOH HOH A . 
S 10 HOH 55  453 453 HOH HOH A . 
S 10 HOH 56  454 454 HOH HOH A . 
S 10 HOH 57  455 455 HOH HOH A . 
S 10 HOH 58  456 456 HOH HOH A . 
S 10 HOH 59  457 457 HOH HOH A . 
S 10 HOH 60  458 458 HOH HOH A . 
S 10 HOH 61  459 459 HOH HOH A . 
S 10 HOH 62  460 460 HOH HOH A . 
S 10 HOH 63  461 461 HOH HOH A . 
S 10 HOH 64  462 462 HOH HOH A . 
S 10 HOH 65  463 463 HOH HOH A . 
S 10 HOH 66  464 464 HOH HOH A . 
S 10 HOH 67  465 465 HOH HOH A . 
S 10 HOH 68  466 466 HOH HOH A . 
S 10 HOH 69  467 467 HOH HOH A . 
S 10 HOH 70  468 468 HOH HOH A . 
S 10 HOH 71  469 469 HOH HOH A . 
S 10 HOH 72  470 470 HOH HOH A . 
S 10 HOH 73  471 471 HOH HOH A . 
S 10 HOH 74  472 472 HOH HOH A . 
S 10 HOH 75  473 473 HOH HOH A . 
S 10 HOH 76  474 474 HOH HOH A . 
S 10 HOH 77  475 475 HOH HOH A . 
S 10 HOH 78  476 476 HOH HOH A . 
S 10 HOH 79  477 477 HOH HOH A . 
S 10 HOH 80  478 478 HOH HOH A . 
S 10 HOH 81  479 479 HOH HOH A . 
S 10 HOH 82  480 480 HOH HOH A . 
S 10 HOH 83  481 481 HOH HOH A . 
S 10 HOH 84  482 482 HOH HOH A . 
S 10 HOH 85  483 483 HOH HOH A . 
S 10 HOH 86  484 484 HOH HOH A . 
S 10 HOH 87  485 485 HOH HOH A . 
S 10 HOH 88  486 486 HOH HOH A . 
S 10 HOH 89  487 487 HOH HOH A . 
S 10 HOH 90  488 488 HOH HOH A . 
S 10 HOH 91  489 489 HOH HOH A . 
S 10 HOH 92  490 490 HOH HOH A . 
S 10 HOH 93  491 491 HOH HOH A . 
S 10 HOH 94  492 492 HOH HOH A . 
S 10 HOH 95  493 493 HOH HOH A . 
S 10 HOH 96  494 494 HOH HOH A . 
S 10 HOH 97  495 495 HOH HOH A . 
S 10 HOH 98  496 496 HOH HOH A . 
S 10 HOH 99  497 497 HOH HOH A . 
S 10 HOH 100 498 498 HOH HOH A . 
S 10 HOH 101 499 499 HOH HOH A . 
S 10 HOH 102 500 500 HOH HOH A . 
S 10 HOH 103 501 501 HOH HOH A . 
S 10 HOH 104 502 502 HOH HOH A . 
S 10 HOH 105 503 503 HOH HOH A . 
S 10 HOH 106 504 504 HOH HOH A . 
S 10 HOH 107 505 505 HOH HOH A . 
S 10 HOH 108 506 506 HOH HOH A . 
S 10 HOH 109 507 507 HOH HOH A . 
S 10 HOH 110 508 508 HOH HOH A . 
S 10 HOH 111 509 509 HOH HOH A . 
S 10 HOH 112 510 510 HOH HOH A . 
S 10 HOH 113 511 511 HOH HOH A . 
S 10 HOH 114 512 512 HOH HOH A . 
S 10 HOH 115 513 513 HOH HOH A . 
S 10 HOH 116 514 514 HOH HOH A . 
S 10 HOH 117 515 515 HOH HOH A . 
S 10 HOH 118 516 516 HOH HOH A . 
S 10 HOH 119 517 517 HOH HOH A . 
S 10 HOH 120 518 518 HOH HOH A . 
S 10 HOH 121 519 519 HOH HOH A . 
S 10 HOH 122 520 520 HOH HOH A . 
S 10 HOH 123 521 521 HOH HOH A . 
S 10 HOH 124 522 522 HOH HOH A . 
S 10 HOH 125 523 523 HOH HOH A . 
S 10 HOH 126 524 524 HOH HOH A . 
S 10 HOH 127 525 525 HOH HOH A . 
S 10 HOH 128 526 526 HOH HOH A . 
S 10 HOH 129 527 527 HOH HOH A . 
S 10 HOH 130 528 528 HOH HOH A . 
S 10 HOH 131 529 529 HOH HOH A . 
S 10 HOH 132 530 530 HOH HOH A . 
S 10 HOH 133 531 531 HOH HOH A . 
S 10 HOH 134 532 532 HOH HOH A . 
S 10 HOH 135 533 533 HOH HOH A . 
S 10 HOH 136 534 534 HOH HOH A . 
S 10 HOH 137 535 535 HOH HOH A . 
S 10 HOH 138 536 536 HOH HOH A . 
S 10 HOH 139 537 537 HOH HOH A . 
S 10 HOH 140 538 538 HOH HOH A . 
S 10 HOH 141 539 539 HOH HOH A . 
S 10 HOH 142 540 540 HOH HOH A . 
S 10 HOH 143 541 541 HOH HOH A . 
S 10 HOH 144 542 542 HOH HOH A . 
S 10 HOH 145 543 543 HOH HOH A . 
S 10 HOH 146 544 544 HOH HOH A . 
S 10 HOH 147 545 545 HOH HOH A . 
S 10 HOH 148 546 546 HOH HOH A . 
S 10 HOH 149 547 547 HOH HOH A . 
S 10 HOH 150 548 548 HOH HOH A . 
S 10 HOH 151 549 549 HOH HOH A . 
S 10 HOH 152 550 550 HOH HOH A . 
S 10 HOH 153 551 551 HOH HOH A . 
S 10 HOH 154 552 552 HOH HOH A . 
S 10 HOH 155 553 553 HOH HOH A . 
S 10 HOH 156 554 554 HOH HOH A . 
S 10 HOH 157 555 555 HOH HOH A . 
S 10 HOH 158 556 556 HOH HOH A . 
S 10 HOH 159 557 557 HOH HOH A . 
S 10 HOH 160 558 558 HOH HOH A . 
S 10 HOH 161 559 559 HOH HOH A . 
S 10 HOH 162 560 560 HOH HOH A . 
S 10 HOH 163 561 561 HOH HOH A . 
S 10 HOH 164 562 562 HOH HOH A . 
S 10 HOH 165 563 563 HOH HOH A . 
S 10 HOH 166 564 564 HOH HOH A . 
S 10 HOH 167 565 565 HOH HOH A . 
S 10 HOH 168 566 566 HOH HOH A . 
S 10 HOH 169 567 567 HOH HOH A . 
S 10 HOH 170 568 568 HOH HOH A . 
S 10 HOH 171 569 569 HOH HOH A . 
S 10 HOH 172 570 570 HOH HOH A . 
S 10 HOH 173 571 571 HOH HOH A . 
S 10 HOH 174 572 572 HOH HOH A . 
S 10 HOH 175 573 573 HOH HOH A . 
S 10 HOH 176 574 574 HOH HOH A . 
S 10 HOH 177 575 575 HOH HOH A . 
S 10 HOH 178 576 576 HOH HOH A . 
S 10 HOH 179 577 577 HOH HOH A . 
S 10 HOH 180 578 578 HOH HOH A . 
S 10 HOH 181 579 579 HOH HOH A . 
S 10 HOH 182 580 580 HOH HOH A . 
S 10 HOH 183 581 581 HOH HOH A . 
S 10 HOH 184 582 582 HOH HOH A . 
S 10 HOH 185 583 583 HOH HOH A . 
S 10 HOH 186 584 584 HOH HOH A . 
S 10 HOH 187 585 585 HOH HOH A . 
S 10 HOH 188 586 586 HOH HOH A . 
S 10 HOH 189 587 587 HOH HOH A . 
S 10 HOH 190 588 588 HOH HOH A . 
S 10 HOH 191 589 589 HOH HOH A . 
S 10 HOH 192 590 590 HOH HOH A . 
S 10 HOH 193 591 591 HOH HOH A . 
S 10 HOH 194 592 592 HOH HOH A . 
S 10 HOH 195 593 593 HOH HOH A . 
S 10 HOH 196 594 594 HOH HOH A . 
S 10 HOH 197 595 595 HOH HOH A . 
S 10 HOH 198 596 596 HOH HOH A . 
S 10 HOH 199 597 597 HOH HOH A . 
S 10 HOH 200 598 598 HOH HOH A . 
S 10 HOH 201 599 599 HOH HOH A . 
S 10 HOH 202 600 600 HOH HOH A . 
S 10 HOH 203 601 601 HOH HOH A . 
S 10 HOH 204 602 602 HOH HOH A . 
S 10 HOH 205 603 603 HOH HOH A . 
S 10 HOH 206 604 604 HOH HOH A . 
S 10 HOH 207 605 605 HOH HOH A . 
S 10 HOH 208 606 606 HOH HOH A . 
S 10 HOH 209 607 607 HOH HOH A . 
S 10 HOH 210 608 608 HOH HOH A . 
S 10 HOH 211 609 609 HOH HOH A . 
S 10 HOH 212 610 610 HOH HOH A . 
S 10 HOH 213 611 611 HOH HOH A . 
S 10 HOH 214 612 612 HOH HOH A . 
S 10 HOH 215 613 613 HOH HOH A . 
S 10 HOH 216 614 614 HOH HOH A . 
S 10 HOH 217 615 615 HOH HOH A . 
S 10 HOH 218 616 616 HOH HOH A . 
S 10 HOH 219 617 617 HOH HOH A . 
S 10 HOH 220 618 618 HOH HOH A . 
S 10 HOH 221 619 619 HOH HOH A . 
S 10 HOH 222 620 620 HOH HOH A . 
S 10 HOH 223 621 621 HOH HOH A . 
S 10 HOH 224 622 622 HOH HOH A . 
S 10 HOH 225 623 623 HOH HOH A . 
S 10 HOH 226 624 624 HOH HOH A . 
S 10 HOH 227 625 625 HOH HOH A . 
S 10 HOH 228 626 626 HOH HOH A . 
S 10 HOH 229 627 627 HOH HOH A . 
S 10 HOH 230 628 628 HOH HOH A . 
S 10 HOH 231 629 629 HOH HOH A . 
S 10 HOH 232 630 630 HOH HOH A . 
S 10 HOH 233 631 631 HOH HOH A . 
S 10 HOH 234 632 632 HOH HOH A . 
S 10 HOH 235 633 633 HOH HOH A . 
S 10 HOH 236 634 634 HOH HOH A . 
S 10 HOH 237 635 635 HOH HOH A . 
S 10 HOH 238 636 636 HOH HOH A . 
S 10 HOH 239 637 637 HOH HOH A . 
S 10 HOH 240 638 638 HOH HOH A . 
S 10 HOH 241 639 639 HOH HOH A . 
S 10 HOH 242 640 640 HOH HOH A . 
S 10 HOH 243 641 641 HOH HOH A . 
S 10 HOH 244 642 642 HOH HOH A . 
S 10 HOH 245 643 643 HOH HOH A . 
S 10 HOH 246 644 644 HOH HOH A . 
S 10 HOH 247 645 645 HOH HOH A . 
S 10 HOH 248 646 646 HOH HOH A . 
S 10 HOH 249 647 647 HOH HOH A . 
S 10 HOH 250 648 648 HOH HOH A . 
S 10 HOH 251 649 649 HOH HOH A . 
S 10 HOH 252 650 650 HOH HOH A . 
S 10 HOH 253 651 651 HOH HOH A . 
S 10 HOH 254 652 652 HOH HOH A . 
S 10 HOH 255 653 653 HOH HOH A . 
S 10 HOH 256 654 654 HOH HOH A . 
S 10 HOH 257 655 655 HOH HOH A . 
S 10 HOH 258 656 656 HOH HOH A . 
S 10 HOH 259 657 657 HOH HOH A . 
S 10 HOH 260 658 658 HOH HOH A . 
S 10 HOH 261 659 659 HOH HOH A . 
S 10 HOH 262 660 660 HOH HOH A . 
S 10 HOH 263 661 661 HOH HOH A . 
S 10 HOH 264 662 662 HOH HOH A . 
S 10 HOH 265 663 663 HOH HOH A . 
S 10 HOH 266 664 664 HOH HOH A . 
S 10 HOH 267 665 665 HOH HOH A . 
S 10 HOH 268 666 666 HOH HOH A . 
S 10 HOH 269 667 667 HOH HOH A . 
S 10 HOH 270 668 668 HOH HOH A . 
S 10 HOH 271 669 669 HOH HOH A . 
S 10 HOH 272 670 670 HOH HOH A . 
S 10 HOH 273 671 671 HOH HOH A . 
S 10 HOH 274 672 672 HOH HOH A . 
S 10 HOH 275 673 673 HOH HOH A . 
S 10 HOH 276 674 674 HOH HOH A . 
S 10 HOH 277 675 675 HOH HOH A . 
S 10 HOH 278 676 676 HOH HOH A . 
S 10 HOH 279 677 677 HOH HOH A . 
S 10 HOH 280 678 678 HOH HOH A . 
S 10 HOH 281 679 679 HOH HOH A . 
S 10 HOH 282 680 680 HOH HOH A . 
S 10 HOH 283 681 681 HOH HOH A . 
S 10 HOH 284 682 682 HOH HOH A . 
S 10 HOH 285 683 683 HOH HOH A . 
S 10 HOH 286 684 684 HOH HOH A . 
S 10 HOH 287 685 685 HOH HOH A . 
S 10 HOH 288 686 686 HOH HOH A . 
S 10 HOH 289 687 687 HOH HOH A . 
S 10 HOH 290 688 688 HOH HOH A . 
S 10 HOH 291 689 689 HOH HOH A . 
S 10 HOH 292 690 690 HOH HOH A . 
S 10 HOH 293 691 691 HOH HOH A . 
S 10 HOH 294 692 692 HOH HOH A . 
S 10 HOH 295 693 693 HOH HOH A . 
S 10 HOH 296 694 694 HOH HOH A . 
S 10 HOH 297 695 695 HOH HOH A . 
S 10 HOH 298 696 696 HOH HOH A . 
S 10 HOH 299 697 697 HOH HOH A . 
S 10 HOH 300 698 698 HOH HOH A . 
S 10 HOH 301 699 699 HOH HOH A . 
S 10 HOH 302 700 700 HOH HOH A . 
S 10 HOH 303 701 701 HOH HOH A . 
S 10 HOH 304 702 702 HOH HOH A . 
T 10 HOH 1   398 398 HOH HOH B . 
T 10 HOH 2   399 399 HOH HOH B . 
T 10 HOH 3   400 400 HOH HOH B . 
T 10 HOH 4   401 401 HOH HOH B . 
T 10 HOH 5   402 402 HOH HOH B . 
T 10 HOH 6   403 403 HOH HOH B . 
T 10 HOH 7   404 404 HOH HOH B . 
T 10 HOH 8   405 405 HOH HOH B . 
T 10 HOH 9   406 406 HOH HOH B . 
T 10 HOH 10  407 407 HOH HOH B . 
T 10 HOH 11  408 408 HOH HOH B . 
T 10 HOH 12  409 409 HOH HOH B . 
T 10 HOH 13  410 410 HOH HOH B . 
T 10 HOH 14  411 411 HOH HOH B . 
T 10 HOH 15  412 412 HOH HOH B . 
T 10 HOH 16  413 413 HOH HOH B . 
T 10 HOH 17  414 414 HOH HOH B . 
T 10 HOH 18  415 415 HOH HOH B . 
T 10 HOH 19  416 416 HOH HOH B . 
T 10 HOH 20  417 417 HOH HOH B . 
T 10 HOH 21  418 418 HOH HOH B . 
T 10 HOH 22  419 419 HOH HOH B . 
T 10 HOH 23  420 420 HOH HOH B . 
T 10 HOH 24  421 421 HOH HOH B . 
T 10 HOH 25  422 422 HOH HOH B . 
T 10 HOH 26  423 423 HOH HOH B . 
T 10 HOH 27  424 424 HOH HOH B . 
T 10 HOH 28  425 425 HOH HOH B . 
T 10 HOH 29  426 426 HOH HOH B . 
T 10 HOH 30  427 427 HOH HOH B . 
T 10 HOH 31  428 428 HOH HOH B . 
T 10 HOH 32  429 429 HOH HOH B . 
T 10 HOH 33  430 430 HOH HOH B . 
T 10 HOH 34  431 431 HOH HOH B . 
T 10 HOH 35  432 432 HOH HOH B . 
T 10 HOH 36  433 433 HOH HOH B . 
T 10 HOH 37  434 434 HOH HOH B . 
T 10 HOH 38  435 435 HOH HOH B . 
T 10 HOH 39  436 436 HOH HOH B . 
T 10 HOH 40  437 437 HOH HOH B . 
T 10 HOH 41  438 438 HOH HOH B . 
T 10 HOH 42  439 439 HOH HOH B . 
T 10 HOH 43  440 440 HOH HOH B . 
T 10 HOH 44  441 441 HOH HOH B . 
T 10 HOH 45  442 442 HOH HOH B . 
T 10 HOH 46  443 443 HOH HOH B . 
T 10 HOH 47  444 444 HOH HOH B . 
T 10 HOH 48  445 445 HOH HOH B . 
T 10 HOH 49  446 446 HOH HOH B . 
T 10 HOH 50  447 447 HOH HOH B . 
T 10 HOH 51  448 448 HOH HOH B . 
T 10 HOH 52  449 449 HOH HOH B . 
T 10 HOH 53  450 450 HOH HOH B . 
T 10 HOH 54  451 451 HOH HOH B . 
T 10 HOH 55  452 452 HOH HOH B . 
T 10 HOH 56  453 453 HOH HOH B . 
T 10 HOH 57  454 454 HOH HOH B . 
T 10 HOH 58  455 455 HOH HOH B . 
T 10 HOH 59  456 456 HOH HOH B . 
T 10 HOH 60  457 457 HOH HOH B . 
T 10 HOH 61  458 458 HOH HOH B . 
T 10 HOH 62  459 459 HOH HOH B . 
T 10 HOH 63  460 460 HOH HOH B . 
T 10 HOH 64  461 461 HOH HOH B . 
T 10 HOH 65  462 462 HOH HOH B . 
T 10 HOH 66  463 463 HOH HOH B . 
T 10 HOH 67  464 464 HOH HOH B . 
T 10 HOH 68  465 465 HOH HOH B . 
T 10 HOH 69  466 466 HOH HOH B . 
T 10 HOH 70  467 467 HOH HOH B . 
T 10 HOH 71  468 468 HOH HOH B . 
T 10 HOH 72  469 469 HOH HOH B . 
T 10 HOH 73  470 470 HOH HOH B . 
T 10 HOH 74  471 471 HOH HOH B . 
T 10 HOH 75  472 472 HOH HOH B . 
T 10 HOH 76  473 473 HOH HOH B . 
T 10 HOH 77  474 474 HOH HOH B . 
T 10 HOH 78  475 475 HOH HOH B . 
T 10 HOH 79  476 476 HOH HOH B . 
T 10 HOH 80  477 477 HOH HOH B . 
T 10 HOH 81  478 478 HOH HOH B . 
T 10 HOH 82  479 479 HOH HOH B . 
T 10 HOH 83  480 480 HOH HOH B . 
T 10 HOH 84  481 481 HOH HOH B . 
T 10 HOH 85  482 482 HOH HOH B . 
T 10 HOH 86  483 483 HOH HOH B . 
T 10 HOH 87  484 484 HOH HOH B . 
T 10 HOH 88  485 485 HOH HOH B . 
T 10 HOH 89  486 486 HOH HOH B . 
T 10 HOH 90  487 487 HOH HOH B . 
T 10 HOH 91  488 488 HOH HOH B . 
T 10 HOH 92  489 489 HOH HOH B . 
T 10 HOH 93  490 490 HOH HOH B . 
T 10 HOH 94  491 491 HOH HOH B . 
T 10 HOH 95  492 492 HOH HOH B . 
T 10 HOH 96  493 493 HOH HOH B . 
T 10 HOH 97  494 494 HOH HOH B . 
T 10 HOH 98  495 495 HOH HOH B . 
T 10 HOH 99  496 496 HOH HOH B . 
T 10 HOH 100 497 497 HOH HOH B . 
T 10 HOH 101 498 498 HOH HOH B . 
T 10 HOH 102 499 499 HOH HOH B . 
T 10 HOH 103 500 500 HOH HOH B . 
T 10 HOH 104 501 501 HOH HOH B . 
T 10 HOH 105 502 502 HOH HOH B . 
T 10 HOH 106 503 503 HOH HOH B . 
T 10 HOH 107 504 504 HOH HOH B . 
T 10 HOH 108 505 505 HOH HOH B . 
T 10 HOH 109 506 506 HOH HOH B . 
T 10 HOH 110 507 507 HOH HOH B . 
T 10 HOH 111 508 508 HOH HOH B . 
T 10 HOH 112 509 509 HOH HOH B . 
T 10 HOH 113 510 510 HOH HOH B . 
T 10 HOH 114 511 362 HOH HOH B . 
T 10 HOH 115 512 363 HOH HOH B . 
T 10 HOH 116 513 364 HOH HOH B . 
T 10 HOH 117 514 365 HOH HOH B . 
T 10 HOH 118 515 366 HOH HOH B . 
T 10 HOH 119 516 367 HOH HOH B . 
T 10 HOH 120 517 368 HOH HOH B . 
T 10 HOH 121 518 369 HOH HOH B . 
T 10 HOH 122 519 370 HOH HOH B . 
T 10 HOH 123 520 371 HOH HOH B . 
T 10 HOH 124 521 372 HOH HOH B . 
T 10 HOH 125 522 373 HOH HOH B . 
T 10 HOH 126 523 374 HOH HOH B . 
T 10 HOH 127 524 375 HOH HOH B . 
T 10 HOH 128 525 376 HOH HOH B . 
T 10 HOH 129 526 377 HOH HOH B . 
T 10 HOH 130 527 378 HOH HOH B . 
T 10 HOH 131 528 379 HOH HOH B . 
T 10 HOH 132 529 380 HOH HOH B . 
T 10 HOH 133 530 381 HOH HOH B . 
T 10 HOH 134 531 382 HOH HOH B . 
T 10 HOH 135 532 383 HOH HOH B . 
T 10 HOH 136 533 384 HOH HOH B . 
T 10 HOH 137 534 385 HOH HOH B . 
T 10 HOH 138 535 386 HOH HOH B . 
T 10 HOH 139 536 387 HOH HOH B . 
T 10 HOH 140 537 389 HOH HOH B . 
T 10 HOH 141 538 390 HOH HOH B . 
T 10 HOH 142 539 392 HOH HOH B . 
T 10 HOH 143 540 394 HOH HOH B . 
T 10 HOH 144 541 395 HOH HOH B . 
T 10 HOH 145 542 396 HOH HOH B . 
T 10 HOH 146 543 397 HOH HOH B . 
U 10 HOH 1   21  21  HOH HOH C . 
U 10 HOH 2   22  22  HOH HOH C . 
U 10 HOH 3   23  23  HOH HOH C . 
U 10 HOH 4   39  39  HOH HOH C . 
U 10 HOH 5   40  40  HOH HOH C . 
U 10 HOH 6   48  48  HOH HOH C . 
U 10 HOH 7   54  54  HOH HOH C . 
U 10 HOH 8   58  58  HOH HOH C . 
U 10 HOH 9   64  64  HOH HOH C . 
U 10 HOH 10  88  88  HOH HOH C . 
U 10 HOH 11  90  90  HOH HOH C . 
U 10 HOH 12  91  91  HOH HOH C . 
U 10 HOH 13  92  92  HOH HOH C . 
U 10 HOH 14  93  93  HOH HOH C . 
U 10 HOH 15  99  99  HOH HOH C . 
U 10 HOH 16  116 116 HOH HOH C . 
U 10 HOH 17  120 120 HOH HOH C . 
U 10 HOH 18  124 124 HOH HOH C . 
U 10 HOH 19  125 125 HOH HOH C . 
U 10 HOH 20  133 133 HOH HOH C . 
U 10 HOH 21  145 145 HOH HOH C . 
U 10 HOH 22  147 147 HOH HOH C . 
U 10 HOH 23  157 157 HOH HOH C . 
U 10 HOH 24  191 191 HOH HOH C . 
U 10 HOH 25  221 221 HOH HOH C . 
U 10 HOH 26  253 253 HOH HOH C . 
U 10 HOH 27  254 254 HOH HOH C . 
U 10 HOH 28  263 263 HOH HOH C . 
U 10 HOH 29  277 277 HOH HOH C . 
U 10 HOH 30  293 293 HOH HOH C . 
U 10 HOH 31  302 302 HOH HOH C . 
U 10 HOH 32  304 304 HOH HOH C . 
U 10 HOH 33  317 317 HOH HOH C . 
U 10 HOH 34  318 318 HOH HOH C . 
U 10 HOH 35  319 319 HOH HOH C . 
U 10 HOH 36  350 350 HOH HOH C . 
U 10 HOH 37  352 352 HOH HOH C . 
U 10 HOH 38  353 353 HOH HOH C . 
U 10 HOH 39  359 359 HOH HOH C . 
U 10 HOH 40  388 388 HOH HOH C . 
U 10 HOH 41  393 393 HOH HOH C . 
U 10 HOH 42  394 394 HOH HOH C . 
U 10 HOH 43  395 395 HOH HOH C . 
U 10 HOH 44  396 396 HOH HOH C . 
U 10 HOH 45  397 397 HOH HOH C . 
U 10 HOH 46  398 398 HOH HOH C . 
U 10 HOH 47  399 399 HOH HOH C . 
U 10 HOH 48  400 400 HOH HOH C . 
U 10 HOH 49  404 404 HOH HOH C . 
U 10 HOH 50  405 405 HOH HOH C . 
U 10 HOH 51  406 406 HOH HOH C . 
U 10 HOH 52  422 422 HOH HOH C . 
U 10 HOH 53  423 423 HOH HOH C . 
U 10 HOH 54  424 424 HOH HOH C . 
U 10 HOH 55  425 425 HOH HOH C . 
U 10 HOH 56  426 426 HOH HOH C . 
U 10 HOH 57  427 427 HOH HOH C . 
U 10 HOH 58  428 428 HOH HOH C . 
U 10 HOH 59  429 429 HOH HOH C . 
U 10 HOH 60  433 433 HOH HOH C . 
U 10 HOH 61  445 445 HOH HOH C . 
U 10 HOH 62  459 459 HOH HOH C . 
U 10 HOH 63  462 462 HOH HOH C . 
U 10 HOH 64  466 466 HOH HOH C . 
U 10 HOH 65  469 469 HOH HOH C . 
U 10 HOH 66  470 470 HOH HOH C . 
U 10 HOH 67  473 473 HOH HOH C . 
U 10 HOH 68  514 514 HOH HOH C . 
U 10 HOH 69  517 517 HOH HOH C . 
U 10 HOH 70  518 518 HOH HOH C . 
U 10 HOH 71  527 527 HOH HOH C . 
U 10 HOH 72  529 529 HOH HOH C . 
V 10 HOH 1   25  25  HOH HOH D . 
V 10 HOH 2   26  26  HOH HOH D . 
V 10 HOH 3   31  31  HOH HOH D . 
V 10 HOH 4   37  37  HOH HOH D . 
V 10 HOH 5   38  38  HOH HOH D . 
V 10 HOH 6   41  41  HOH HOH D . 
V 10 HOH 7   51  51  HOH HOH D . 
V 10 HOH 8   55  55  HOH HOH D . 
V 10 HOH 9   57  57  HOH HOH D . 
V 10 HOH 10  60  60  HOH HOH D . 
V 10 HOH 11  66  66  HOH HOH D . 
V 10 HOH 12  72  72  HOH HOH D . 
V 10 HOH 13  97  97  HOH HOH D . 
V 10 HOH 14  105 105 HOH HOH D . 
V 10 HOH 15  106 106 HOH HOH D . 
V 10 HOH 16  120 120 HOH HOH D . 
V 10 HOH 17  136 136 HOH HOH D . 
V 10 HOH 18  143 143 HOH HOH D . 
V 10 HOH 19  184 184 HOH HOH D . 
V 10 HOH 20  196 196 HOH HOH D . 
V 10 HOH 21  198 198 HOH HOH D . 
V 10 HOH 22  235 235 HOH HOH D . 
V 10 HOH 23  245 245 HOH HOH D . 
V 10 HOH 24  259 259 HOH HOH D . 
V 10 HOH 25  265 265 HOH HOH D . 
V 10 HOH 26  266 266 HOH HOH D . 
V 10 HOH 27  270 270 HOH HOH D . 
V 10 HOH 28  273 273 HOH HOH D . 
V 10 HOH 29  291 291 HOH HOH D . 
V 10 HOH 30  294 294 HOH HOH D . 
V 10 HOH 31  308 308 HOH HOH D . 
V 10 HOH 32  345 345 HOH HOH D . 
V 10 HOH 33  346 346 HOH HOH D . 
V 10 HOH 34  351 351 HOH HOH D . 
V 10 HOH 35  360 360 HOH HOH D . 
V 10 HOH 36  365 365 HOH HOH D . 
V 10 HOH 37  391 391 HOH HOH D . 
V 10 HOH 38  392 392 HOH HOH D . 
V 10 HOH 39  401 401 HOH HOH D . 
V 10 HOH 40  402 402 HOH HOH D . 
V 10 HOH 41  403 403 HOH HOH D . 
V 10 HOH 42  407 407 HOH HOH D . 
V 10 HOH 43  408 408 HOH HOH D . 
V 10 HOH 44  409 409 HOH HOH D . 
V 10 HOH 45  410 410 HOH HOH D . 
V 10 HOH 46  411 411 HOH HOH D . 
V 10 HOH 47  412 412 HOH HOH D . 
V 10 HOH 48  413 413 HOH HOH D . 
V 10 HOH 49  414 414 HOH HOH D . 
V 10 HOH 50  415 415 HOH HOH D . 
V 10 HOH 51  416 416 HOH HOH D . 
V 10 HOH 52  417 417 HOH HOH D . 
V 10 HOH 53  418 418 HOH HOH D . 
V 10 HOH 54  419 419 HOH HOH D . 
V 10 HOH 55  430 430 HOH HOH D . 
V 10 HOH 56  431 431 HOH HOH D . 
V 10 HOH 57  432 432 HOH HOH D . 
V 10 HOH 58  458 458 HOH HOH D . 
V 10 HOH 59  464 464 HOH HOH D . 
V 10 HOH 60  465 465 HOH HOH D . 
V 10 HOH 61  468 468 HOH HOH D . 
V 10 HOH 62  472 472 HOH HOH D . 
V 10 HOH 63  506 506 HOH HOH D . 
V 10 HOH 64  507 507 HOH HOH D . 
V 10 HOH 65  508 508 HOH HOH D . 
V 10 HOH 66  509 509 HOH HOH D . 
V 10 HOH 67  510 510 HOH HOH D . 
V 10 HOH 68  511 511 HOH HOH D . 
V 10 HOH 69  512 512 HOH HOH D . 
V 10 HOH 70  513 513 HOH HOH D . 
V 10 HOH 71  515 515 HOH HOH D . 
V 10 HOH 72  530 530 HOH HOH D . 
V 10 HOH 73  531 531 HOH HOH D . 
V 10 HOH 74  532 532 HOH HOH D . 
#