data_3P1M
# 
_entry.id   3P1M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3P1M         
RCSB  RCSB061843   
WWPDB D_1000061843 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3P1M 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chaikuad, A.'                         1  
'Johansson, C.'                        2  
'Krojer, T.'                           3  
'Yue, W.W.'                            4  
'Phillips, C.'                         5  
'Bray, J.E.'                           6  
'Pike, A.C.W.'                         7  
'Muniz, J.R.C.'                        8  
'Vollmar, M.'                          9  
'Weigelt, J.'                          10 
'Arrowsmith, C.H.'                     11 
'Edwards, A.M.'                        12 
'Bountra, C.'                          13 
'Kavanagh, K.'                         14 
'Oppermann, U.'                        15 
'Structural Genomics Consortium (SGC)' 16 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of human ferredoxin-1 (FDX1) in complex with iron-sulfur cluster' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chaikuad, A.'     1  
primary 'Johansson, C.'    2  
primary 'Krojer, T.'       3  
primary 'Yue, W.W.'        4  
primary 'Phillips, C.'     5  
primary 'Bray, J.E.'       6  
primary 'Pike, A.C.W.'     7  
primary 'Muniz, J.R.C.'    8  
primary 'Vollmar, M.'      9  
primary 'Weigelt, J.'      10 
primary 'Arrowsmith, C.H.' 11 
primary 'Edwards, A.M.'    12 
primary 'Bountra, C.'      13 
primary 'Kavanagh, K.'     14 
primary 'Oppermann, U.'    15 
# 
_cell.entry_id           3P1M 
_cell.length_a           76.576 
_cell.length_b           76.576 
_cell.length_c           234.410 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3P1M 
_symmetry.space_group_name_H-M             'P 32' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                145 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Adrenodoxin, mitochondrial' 14572.235 8   ? ? '2Fe-2S ferredoxin-type domain, UNP residues 61-184' ? 
2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820   8   ? ? ?                                                    ? 
3 non-polymer syn 'CITRATE ANION'              189.100   9   ? ? ?                                                    ? 
4 non-polymer syn 'POTASSIUM ION'              39.098    8   ? ? ?                                                    ? 
5 non-polymer syn GLYCEROL                     92.094    2   ? ? ?                                                    ? 
6 water       nat water                        18.015    259 ? ? ?                                                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Adrenal ferredoxin, Ferredoxin-1, Hepatoredoxin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLD
LAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTSAENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLD
LAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTSAENLYFQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   SER n 
1 4   SER n 
1 5   GLU n 
1 6   ASP n 
1 7   LYS n 
1 8   ILE n 
1 9   THR n 
1 10  VAL n 
1 11  HIS n 
1 12  PHE n 
1 13  ILE n 
1 14  ASN n 
1 15  ARG n 
1 16  ASP n 
1 17  GLY n 
1 18  GLU n 
1 19  THR n 
1 20  LEU n 
1 21  THR n 
1 22  THR n 
1 23  LYS n 
1 24  GLY n 
1 25  LYS n 
1 26  VAL n 
1 27  GLY n 
1 28  ASP n 
1 29  SER n 
1 30  LEU n 
1 31  LEU n 
1 32  ASP n 
1 33  VAL n 
1 34  VAL n 
1 35  VAL n 
1 36  GLU n 
1 37  ASN n 
1 38  ASN n 
1 39  LEU n 
1 40  ASP n 
1 41  ILE n 
1 42  ASP n 
1 43  GLY n 
1 44  PHE n 
1 45  GLY n 
1 46  ALA n 
1 47  CYS n 
1 48  GLU n 
1 49  GLY n 
1 50  THR n 
1 51  LEU n 
1 52  ALA n 
1 53  CYS n 
1 54  SER n 
1 55  THR n 
1 56  CYS n 
1 57  HIS n 
1 58  LEU n 
1 59  ILE n 
1 60  PHE n 
1 61  GLU n 
1 62  ASP n 
1 63  HIS n 
1 64  ILE n 
1 65  TYR n 
1 66  GLU n 
1 67  LYS n 
1 68  LEU n 
1 69  ASP n 
1 70  ALA n 
1 71  ILE n 
1 72  THR n 
1 73  ASP n 
1 74  GLU n 
1 75  GLU n 
1 76  ASN n 
1 77  ASP n 
1 78  MET n 
1 79  LEU n 
1 80  ASP n 
1 81  LEU n 
1 82  ALA n 
1 83  TYR n 
1 84  GLY n 
1 85  LEU n 
1 86  THR n 
1 87  ASP n 
1 88  ARG n 
1 89  SER n 
1 90  ARG n 
1 91  LEU n 
1 92  GLY n 
1 93  CYS n 
1 94  GLN n 
1 95  ILE n 
1 96  CYS n 
1 97  LEU n 
1 98  THR n 
1 99  LYS n 
1 100 SER n 
1 101 MET n 
1 102 ASP n 
1 103 ASN n 
1 104 MET n 
1 105 THR n 
1 106 VAL n 
1 107 ARG n 
1 108 VAL n 
1 109 PRO n 
1 110 GLU n 
1 111 THR n 
1 112 VAL n 
1 113 ALA n 
1 114 ASP n 
1 115 ALA n 
1 116 ARG n 
1 117 GLN n 
1 118 SER n 
1 119 ILE n 
1 120 ASP n 
1 121 VAL n 
1 122 GLY n 
1 123 LYS n 
1 124 THR n 
1 125 SER n 
1 126 ALA n 
1 127 GLU n 
1 128 ASN n 
1 129 LEU n 
1 130 TYR n 
1 131 PHE n 
1 132 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ADX, FDX1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC-CTHF 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ADX_HUMAN 
_struct_ref.pdbx_db_accession          P10109 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDL
AYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
;
_struct_ref.pdbx_align_begin           61 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3P1M A 2 ? 125 ? P10109 61 ? 184 ? 61 184 
2 1 3P1M B 2 ? 125 ? P10109 61 ? 184 ? 61 184 
3 1 3P1M C 2 ? 125 ? P10109 61 ? 184 ? 61 184 
4 1 3P1M D 2 ? 125 ? P10109 61 ? 184 ? 61 184 
5 1 3P1M E 2 ? 125 ? P10109 61 ? 184 ? 61 184 
6 1 3P1M F 2 ? 125 ? P10109 61 ? 184 ? 61 184 
7 1 3P1M G 2 ? 125 ? P10109 61 ? 184 ? 61 184 
8 1 3P1M H 2 ? 125 ? P10109 61 ? 184 ? 61 184 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3P1M MET A 1   ? UNP P10109 ? ? 'EXPRESSION TAG' 60  1  
1 3P1M ALA A 126 ? UNP P10109 ? ? 'EXPRESSION TAG' 185 2  
1 3P1M GLU A 127 ? UNP P10109 ? ? 'EXPRESSION TAG' 186 3  
1 3P1M ASN A 128 ? UNP P10109 ? ? 'EXPRESSION TAG' 187 4  
1 3P1M LEU A 129 ? UNP P10109 ? ? 'EXPRESSION TAG' 188 5  
1 3P1M TYR A 130 ? UNP P10109 ? ? 'EXPRESSION TAG' 189 6  
1 3P1M PHE A 131 ? UNP P10109 ? ? 'EXPRESSION TAG' 190 7  
1 3P1M GLN A 132 ? UNP P10109 ? ? 'EXPRESSION TAG' 191 8  
2 3P1M MET B 1   ? UNP P10109 ? ? 'EXPRESSION TAG' 60  9  
2 3P1M ALA B 126 ? UNP P10109 ? ? 'EXPRESSION TAG' 185 10 
2 3P1M GLU B 127 ? UNP P10109 ? ? 'EXPRESSION TAG' 186 11 
2 3P1M ASN B 128 ? UNP P10109 ? ? 'EXPRESSION TAG' 187 12 
2 3P1M LEU B 129 ? UNP P10109 ? ? 'EXPRESSION TAG' 188 13 
2 3P1M TYR B 130 ? UNP P10109 ? ? 'EXPRESSION TAG' 189 14 
2 3P1M PHE B 131 ? UNP P10109 ? ? 'EXPRESSION TAG' 190 15 
2 3P1M GLN B 132 ? UNP P10109 ? ? 'EXPRESSION TAG' 191 16 
3 3P1M MET C 1   ? UNP P10109 ? ? 'EXPRESSION TAG' 60  17 
3 3P1M ALA C 126 ? UNP P10109 ? ? 'EXPRESSION TAG' 185 18 
3 3P1M GLU C 127 ? UNP P10109 ? ? 'EXPRESSION TAG' 186 19 
3 3P1M ASN C 128 ? UNP P10109 ? ? 'EXPRESSION TAG' 187 20 
3 3P1M LEU C 129 ? UNP P10109 ? ? 'EXPRESSION TAG' 188 21 
3 3P1M TYR C 130 ? UNP P10109 ? ? 'EXPRESSION TAG' 189 22 
3 3P1M PHE C 131 ? UNP P10109 ? ? 'EXPRESSION TAG' 190 23 
3 3P1M GLN C 132 ? UNP P10109 ? ? 'EXPRESSION TAG' 191 24 
4 3P1M MET D 1   ? UNP P10109 ? ? 'EXPRESSION TAG' 60  25 
4 3P1M ALA D 126 ? UNP P10109 ? ? 'EXPRESSION TAG' 185 26 
4 3P1M GLU D 127 ? UNP P10109 ? ? 'EXPRESSION TAG' 186 27 
4 3P1M ASN D 128 ? UNP P10109 ? ? 'EXPRESSION TAG' 187 28 
4 3P1M LEU D 129 ? UNP P10109 ? ? 'EXPRESSION TAG' 188 29 
4 3P1M TYR D 130 ? UNP P10109 ? ? 'EXPRESSION TAG' 189 30 
4 3P1M PHE D 131 ? UNP P10109 ? ? 'EXPRESSION TAG' 190 31 
4 3P1M GLN D 132 ? UNP P10109 ? ? 'EXPRESSION TAG' 191 32 
5 3P1M MET E 1   ? UNP P10109 ? ? 'EXPRESSION TAG' 60  33 
5 3P1M ALA E 126 ? UNP P10109 ? ? 'EXPRESSION TAG' 185 34 
5 3P1M GLU E 127 ? UNP P10109 ? ? 'EXPRESSION TAG' 186 35 
5 3P1M ASN E 128 ? UNP P10109 ? ? 'EXPRESSION TAG' 187 36 
5 3P1M LEU E 129 ? UNP P10109 ? ? 'EXPRESSION TAG' 188 37 
5 3P1M TYR E 130 ? UNP P10109 ? ? 'EXPRESSION TAG' 189 38 
5 3P1M PHE E 131 ? UNP P10109 ? ? 'EXPRESSION TAG' 190 39 
5 3P1M GLN E 132 ? UNP P10109 ? ? 'EXPRESSION TAG' 191 40 
6 3P1M MET F 1   ? UNP P10109 ? ? 'EXPRESSION TAG' 60  41 
6 3P1M ALA F 126 ? UNP P10109 ? ? 'EXPRESSION TAG' 185 42 
6 3P1M GLU F 127 ? UNP P10109 ? ? 'EXPRESSION TAG' 186 43 
6 3P1M ASN F 128 ? UNP P10109 ? ? 'EXPRESSION TAG' 187 44 
6 3P1M LEU F 129 ? UNP P10109 ? ? 'EXPRESSION TAG' 188 45 
6 3P1M TYR F 130 ? UNP P10109 ? ? 'EXPRESSION TAG' 189 46 
6 3P1M PHE F 131 ? UNP P10109 ? ? 'EXPRESSION TAG' 190 47 
6 3P1M GLN F 132 ? UNP P10109 ? ? 'EXPRESSION TAG' 191 48 
7 3P1M MET G 1   ? UNP P10109 ? ? 'EXPRESSION TAG' 60  49 
7 3P1M ALA G 126 ? UNP P10109 ? ? 'EXPRESSION TAG' 185 50 
7 3P1M GLU G 127 ? UNP P10109 ? ? 'EXPRESSION TAG' 186 51 
7 3P1M ASN G 128 ? UNP P10109 ? ? 'EXPRESSION TAG' 187 52 
7 3P1M LEU G 129 ? UNP P10109 ? ? 'EXPRESSION TAG' 188 53 
7 3P1M TYR G 130 ? UNP P10109 ? ? 'EXPRESSION TAG' 189 54 
7 3P1M PHE G 131 ? UNP P10109 ? ? 'EXPRESSION TAG' 190 55 
7 3P1M GLN G 132 ? UNP P10109 ? ? 'EXPRESSION TAG' 191 56 
8 3P1M MET H 1   ? UNP P10109 ? ? 'EXPRESSION TAG' 60  57 
8 3P1M ALA H 126 ? UNP P10109 ? ? 'EXPRESSION TAG' 185 58 
8 3P1M GLU H 127 ? UNP P10109 ? ? 'EXPRESSION TAG' 186 59 
8 3P1M ASN H 128 ? UNP P10109 ? ? 'EXPRESSION TAG' 187 60 
8 3P1M LEU H 129 ? UNP P10109 ? ? 'EXPRESSION TAG' 188 61 
8 3P1M TYR H 130 ? UNP P10109 ? ? 'EXPRESSION TAG' 189 62 
8 3P1M PHE H 131 ? UNP P10109 ? ? 'EXPRESSION TAG' 190 63 
8 3P1M GLN H 132 ? UNP P10109 ? ? 'EXPRESSION TAG' 191 64 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                     ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                     ?                               'C3 H7 N O2 S'   121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ?                               'Fe2 S2'         175.820 
FLC non-polymer         . 'CITRATE ANION'              ?                               'C6 H5 O7 -3'    189.100 
GLN 'L-peptide linking' y GLUTAMINE                    ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                      ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                     'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                    ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                        ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ?                               'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION'              ?                               'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE                      ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                       ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                   ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                      ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                       ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                    ?                               'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                     ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                       ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3P1M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.40 
_exptl_crystal.density_percent_sol   63.86 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    '1.75M Potassium Citrate (K3Cit), pH 7.4, VAPOR DIFFUSION, SITTING DROP, temperature 293.15K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2009-12-02 
_diffrn_detector.details                'Kirkpatrick Baez bimorph mirror pair' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (111) double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9763 
# 
_reflns.entry_id                     3P1M 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50.50 
_reflns.d_resolution_high            2.54 
_reflns.number_obs                   50786 
_reflns.number_all                   50847 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.111 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.6 
_reflns.B_iso_Wilson_estimate        53.4 
_reflns.pdbx_redundancy              5.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high                  2.54 
_reflns_shell.d_res_low                   2.67 
_reflns_shell.percent_possible_all        99.0 
_reflns_shell.Rmerge_I_obs                0.721 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.pdbx_redundancy             3.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           7351 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_diffrn_id              ? 
_reflns_shell.pdbx_ordinal                1 
# 
_refine.entry_id                                 3P1M 
_refine.ls_number_reflns_obs                     48817 
_refine.ls_number_reflns_all                     50786 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             43.91 
_refine.ls_d_res_high                            2.54 
_refine.ls_percent_reflns_obs                    99.74 
_refine.ls_R_factor_obs                          0.20541 
_refine.ls_R_factor_all                          0.20541 
_refine.ls_R_factor_R_work                       0.20395 
_refine.ls_R_factor_R_free                       0.24132 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.9 
_refine.ls_number_reflns_R_free                  1971 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.941 
_refine.correlation_coeff_Fo_to_Fc_free          0.917 
_refine.B_iso_mean                               39.327 
_refine.aniso_B[1][1]                            -1.08 
_refine.aniso_B[2][2]                            -1.08 
_refine.aniso_B[3][3]                            1.62 
_refine.aniso_B[1][2]                            -0.54 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS DURING REFINEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 1CJE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.254 
_refine.overall_SU_ML                            0.220 
_refine.overall_SU_B                             18.286 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3P1M 
_refine_analyze.Luzzati_coordinate_error_obs    0.370 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7733 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         169 
_refine_hist.number_atoms_solvent             259 
_refine_hist.number_atoms_total               8161 
_refine_hist.d_res_high                       2.54 
_refine_hist.d_res_low                        43.91 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.014  0.021  ? 7997  'X-RAY DIFFRACTION' ? 
r_bond_other_d         0.002  0.020  ? 5042  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.486  1.981  ? 10778 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      0.930  3.005  ? 12363 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 5.923  5.000  ? 1009  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 35.658 25.652 ? 368   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 14.765 15.000 ? 1352  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 20.656 15.000 ? 40    'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.077  0.200  ? 1290  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.004  0.020  ? 8931  'X-RAY DIFFRACTION' ? 
r_gen_planes_other     0.002  0.020  ? 1465  'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.421  1.500  ? 5032  'X-RAY DIFFRACTION' ? 
r_mcbond_other         0.110  1.500  ? 2108  'X-RAY DIFFRACTION' ? 
r_mcangle_it           0.786  2.000  ? 8122  'X-RAY DIFFRACTION' ? 
r_scbond_it            2.002  3.000  ? 2965  'X-RAY DIFFRACTION' ? 
r_scangle_it           2.194  4.500  ? 2640  'X-RAY DIFFRACTION' ? 
r_sphericity_free      9.033  3.000  ? 8     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
'X-RAY DIFFRACTION' 1 1 'TIGHT POSITIONAL'  F 1276 0.040 0.050  1  ? ? ? 
'X-RAY DIFFRACTION' 1 2 'TIGHT POSITIONAL'  B 1276 0.030 0.050  2  ? ? ? 
'X-RAY DIFFRACTION' 1 3 'TIGHT POSITIONAL'  D 1276 0.040 0.050  3  ? ? ? 
'X-RAY DIFFRACTION' 1 4 'TIGHT POSITIONAL'  E 1276 0.030 0.050  4  ? ? ? 
'X-RAY DIFFRACTION' 1 5 'TIGHT POSITIONAL'  G 1276 0.040 0.050  5  ? ? ? 
'X-RAY DIFFRACTION' 1 6 'TIGHT POSITIONAL'  H 1276 0.040 0.050  6  ? ? ? 
'X-RAY DIFFRACTION' 1 1 'TIGHT THERMAL'     F 1276 0.080 0.500  7  ? ? ? 
'X-RAY DIFFRACTION' 1 2 'TIGHT THERMAL'     B 1276 0.070 0.500  8  ? ? ? 
'X-RAY DIFFRACTION' 1 3 'TIGHT THERMAL'     D 1276 0.080 0.500  9  ? ? ? 
'X-RAY DIFFRACTION' 1 4 'TIGHT THERMAL'     E 1276 0.070 0.500  10 ? ? ? 
'X-RAY DIFFRACTION' 1 5 'TIGHT THERMAL'     G 1276 0.080 0.500  11 ? ? ? 
'X-RAY DIFFRACTION' 1 6 'TIGHT THERMAL'     H 1276 0.080 0.500  12 ? ? ? 
'X-RAY DIFFRACTION' 2 1 'MEDIUM POSITIONAL' E 119  0.240 0.500  13 ? ? ? 
'X-RAY DIFFRACTION' 2 1 'LOOSE POSITIONAL'  E 131  0.870 5.000  14 ? ? ? 
'X-RAY DIFFRACTION' 2 1 'MEDIUM THERMAL'    E 119  0.280 2.000  15 ? ? ? 
'X-RAY DIFFRACTION' 2 1 'LOOSE THERMAL'     E 131  0.410 10.000 16 ? ? ? 
'X-RAY DIFFRACTION' 3 1 'MEDIUM POSITIONAL' H 119  0.110 0.500  17 ? ? ? 
'X-RAY DIFFRACTION' 3 1 'LOOSE POSITIONAL'  H 139  0.390 5.000  18 ? ? ? 
'X-RAY DIFFRACTION' 3 1 'MEDIUM THERMAL'    H 119  0.210 2.000  19 ? ? ? 
'X-RAY DIFFRACTION' 3 1 'LOOSE THERMAL'     H 139  0.340 10.000 20 ? ? ? 
'X-RAY DIFFRACTION' 4 1 'MEDIUM POSITIONAL' G 83   0.100 0.500  21 ? ? ? 
'X-RAY DIFFRACTION' 4 1 'LOOSE POSITIONAL'  G 75   0.450 5.000  22 ? ? ? 
'X-RAY DIFFRACTION' 4 1 'MEDIUM THERMAL'    G 83   0.600 2.000  23 ? ? ? 
'X-RAY DIFFRACTION' 4 1 'LOOSE THERMAL'     G 75   0.430 10.000 24 ? ? ? 
'X-RAY DIFFRACTION' 5 1 'TIGHT POSITIONAL'  A 1330 0.110 0.050  25 ? ? ? 
'X-RAY DIFFRACTION' 5 1 'MEDIUM POSITIONAL' A 83   0.060 0.500  26 ? ? ? 
'X-RAY DIFFRACTION' 5 1 'LOOSE POSITIONAL'  A 80   0.110 5.000  27 ? ? ? 
'X-RAY DIFFRACTION' 5 1 'TIGHT THERMAL'     A 1330 0.290 0.500  28 ? ? ? 
'X-RAY DIFFRACTION' 5 1 'MEDIUM THERMAL'    A 83   0.270 2.000  29 ? ? ? 
'X-RAY DIFFRACTION' 5 1 'LOOSE THERMAL'     A 80   0.450 10.000 30 ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.537 
_refine_ls_shell.d_res_low                        2.603 
_refine_ls_shell.number_reflns_R_work             3528 
_refine_ls_shell.R_factor_R_work                  0.346 
_refine_ls_shell.percent_reflns_obs               97.27 
_refine_ls_shell.R_factor_R_free                  0.375 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             145 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 F 1 
2 B 1 
3 D 1 
4 E 1 
5 G 1 
6 H 1 
1 E 2 
2 B 2 
1 H 3 
2 D 3 
1 G 4 
2 F 4 
1 A 5 
2 C 5 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 1 F 67  F 171 ? . . . . . . . . 
1 2 1 1 B 67  B 171 ? . . . . . . . . 
1 3 1 1 D 67  D 171 ? . . . . . . . . 
1 4 1 1 E 67  E 171 ? . . . . . . . . 
1 5 1 1 G 67  G 171 ? . . . . . . . . 
1 6 1 1 H 67  H 171 ? . . . . . . . . 
2 1 1 5 E 172 E 191 ? . . . . . . . . 
2 2 1 5 B 172 B 191 ? . . . . . . . . 
3 1 1 5 H 172 H 191 ? . . . . . . . . 
3 2 1 5 D 172 D 191 ? . . . . . . . . 
4 1 1 5 G 172 G 185 ? . . . . . . . . 
4 2 1 5 F 172 F 185 ? . . . . . . . . 
5 1 1 1 A 67  A 171 ? . . . . . . . . 
5 2 1 1 C 67  C 171 ? . . . . . . . . 
5 1 2 5 A 172 A 185 ? . . . . . . . . 
5 2 2 5 C 172 C 185 ? . . . . . . . . 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
5 ? 
# 
_struct.entry_id                  3P1M 
_struct.title                     'Crystal structure of human ferredoxin-1 (FDX1) in complex with iron-sulfur cluster' 
_struct.pdbx_descriptor           'Adrenodoxin, mitochondrial' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3P1M 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            
'Structural Genomics Consortium, SGC, ELECTRON TRANSPORT, Adrenodoxin, Ferredoxin, iron-sulfur cluster, Mitochondria' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 4 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 4 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 4 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 4 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 4 ? 
Z  N N 2 ? 
AA N N 4 ? 
BA N N 5 ? 
CA N N 2 ? 
DA N N 3 ? 
EA N N 4 ? 
FA N N 5 ? 
GA N N 2 ? 
HA N N 3 ? 
IA N N 4 ? 
JA N N 6 ? 
KA N N 6 ? 
LA N N 6 ? 
MA N N 6 ? 
NA N N 6 ? 
OA N N 6 ? 
PA N N 6 ? 
QA N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'AUTHOR DETERMINED BIOLOGICAL UNIT: UNKNOWN.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 29  ? ASN A 37  ? SER A 88  ASN A 96  1 ? 9  
HELX_P HELX_P2  2  GLU A 61  ? LYS A 67  ? GLU A 120 LYS A 126 1 ? 7  
HELX_P HELX_P3  3  THR A 72  ? ASP A 80  ? THR A 131 ASP A 139 1 ? 9  
HELX_P HELX_P4  4  THR A 98  ? ASP A 102 ? THR A 157 ASP A 161 5 ? 5  
HELX_P HELX_P5  5  THR A 111 ? ARG A 116 ? THR A 170 ARG A 175 1 ? 6  
HELX_P HELX_P6  6  ASN A 128 ? GLN A 132 ? ASN A 187 GLN A 191 5 ? 5  
HELX_P HELX_P7  7  SER B 29  ? ASN B 37  ? SER B 88  ASN B 96  1 ? 9  
HELX_P HELX_P8  8  GLU B 61  ? GLU B 66  ? GLU B 120 GLU B 125 1 ? 6  
HELX_P HELX_P9  9  THR B 72  ? ASP B 80  ? THR B 131 ASP B 139 1 ? 9  
HELX_P HELX_P10 10 THR B 98  ? ASP B 102 ? THR B 157 ASP B 161 5 ? 5  
HELX_P HELX_P11 11 THR B 111 ? ARG B 116 ? THR B 170 ARG B 175 1 ? 6  
HELX_P HELX_P12 12 SER C 29  ? ASN C 37  ? SER C 88  ASN C 96  1 ? 9  
HELX_P HELX_P13 13 GLU C 61  ? LYS C 67  ? GLU C 120 LYS C 126 1 ? 7  
HELX_P HELX_P14 14 THR C 72  ? ASP C 80  ? THR C 131 ASP C 139 1 ? 9  
HELX_P HELX_P15 15 THR C 98  ? ASP C 102 ? THR C 157 ASP C 161 5 ? 5  
HELX_P HELX_P16 16 THR C 111 ? ARG C 116 ? THR C 170 ARG C 175 1 ? 6  
HELX_P HELX_P17 17 ASN C 128 ? GLN C 132 ? ASN C 187 GLN C 191 5 ? 5  
HELX_P HELX_P18 18 SER D 29  ? ASN D 37  ? SER D 88  ASN D 96  1 ? 9  
HELX_P HELX_P19 19 GLU D 61  ? GLU D 66  ? GLU D 120 GLU D 125 1 ? 6  
HELX_P HELX_P20 20 THR D 72  ? LEU D 81  ? THR D 131 LEU D 140 1 ? 10 
HELX_P HELX_P21 21 THR D 98  ? ASP D 102 ? THR D 157 ASP D 161 5 ? 5  
HELX_P HELX_P22 22 THR D 111 ? ARG D 116 ? THR D 170 ARG D 175 1 ? 6  
HELX_P HELX_P23 23 SER E 29  ? ASN E 37  ? SER E 88  ASN E 96  1 ? 9  
HELX_P HELX_P24 24 GLU E 61  ? GLU E 66  ? GLU E 120 GLU E 125 1 ? 6  
HELX_P HELX_P25 25 THR E 72  ? ASP E 80  ? THR E 131 ASP E 139 1 ? 9  
HELX_P HELX_P26 26 THR E 98  ? ASP E 102 ? THR E 157 ASP E 161 5 ? 5  
HELX_P HELX_P27 27 THR E 111 ? ARG E 116 ? THR E 170 ARG E 175 1 ? 6  
HELX_P HELX_P28 28 SER F 29  ? ASN F 37  ? SER F 88  ASN F 96  1 ? 9  
HELX_P HELX_P29 29 GLU F 61  ? GLU F 66  ? GLU F 120 GLU F 125 1 ? 6  
HELX_P HELX_P30 30 THR F 72  ? ASP F 80  ? THR F 131 ASP F 139 1 ? 9  
HELX_P HELX_P31 31 THR F 98  ? ASP F 102 ? THR F 157 ASP F 161 5 ? 5  
HELX_P HELX_P32 32 THR F 111 ? ARG F 116 ? THR F 170 ARG F 175 1 ? 6  
HELX_P HELX_P33 33 SER G 29  ? ASN G 37  ? SER G 88  ASN G 96  1 ? 9  
HELX_P HELX_P34 34 GLU G 61  ? GLU G 66  ? GLU G 120 GLU G 125 1 ? 6  
HELX_P HELX_P35 35 THR G 72  ? ASP G 80  ? THR G 131 ASP G 139 1 ? 9  
HELX_P HELX_P36 36 THR G 98  ? ASP G 102 ? THR G 157 ASP G 161 5 ? 5  
HELX_P HELX_P37 37 THR G 111 ? ARG G 116 ? THR G 170 ARG G 175 1 ? 6  
HELX_P HELX_P38 38 SER H 29  ? ASN H 37  ? SER H 88  ASN H 96  1 ? 9  
HELX_P HELX_P39 39 GLU H 61  ? GLU H 66  ? GLU H 120 GLU H 125 1 ? 6  
HELX_P HELX_P40 40 THR H 72  ? LEU H 81  ? THR H 131 LEU H 140 1 ? 10 
HELX_P HELX_P41 41 THR H 98  ? ASP H 102 ? THR H 157 ASP H 161 5 ? 5  
HELX_P HELX_P42 42 THR H 111 ? ARG H 116 ? THR H 170 ARG H 175 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D  CYS 47  SG  ? ? ? 1_555 S  FES . FE1 ? ? D CYS 106 D FES 5   1_555 ? ? ? ? ? ? ? 2.010 ? 
metalc2  metalc ? ? H  CYS 47  SG  ? ? ? 1_555 GA FES . FE1 ? ? H CYS 106 H FES 8   1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc3  metalc ? ? E  CYS 47  SG  ? ? ? 1_555 W  FES . FE1 ? ? E CYS 106 E FES 6   1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc4  metalc ? ? C  CYS 56  SG  ? ? ? 1_555 O  FES . FE2 ? ? C CYS 115 C FES 4   1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc5  metalc ? ? C  CYS 47  SG  ? ? ? 1_555 O  FES . FE1 ? ? C CYS 106 C FES 4   1_555 ? ? ? ? ? ? ? 2.049 ? 
metalc6  metalc ? ? E  CYS 53  SG  ? ? ? 1_555 W  FES . FE1 ? ? E CYS 112 E FES 6   1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc7  metalc ? ? A  CYS 56  SG  ? ? ? 1_555 I  FES . FE2 ? ? A CYS 115 A FES 2   1_555 ? ? ? ? ? ? ? 2.054 ? 
metalc8  metalc ? ? B  CYS 47  SG  ? ? ? 1_555 L  FES . FE1 ? ? B CYS 106 B FES 3   1_555 ? ? ? ? ? ? ? 2.055 ? 
metalc9  metalc ? ? E  CYS 56  SG  ? ? ? 1_555 W  FES . FE2 ? ? E CYS 115 E FES 6   1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc10 metalc ? ? F  CYS 47  SG  ? ? ? 1_555 Z  FES . FE1 ? ? F CYS 106 F FES 7   1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc11 metalc ? ? A  CYS 47  SG  ? ? ? 1_555 I  FES . FE1 ? ? A CYS 106 A FES 2   1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc12 metalc ? ? B  CYS 93  SG  ? ? ? 1_555 L  FES . FE2 ? ? B CYS 152 B FES 3   1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc13 metalc ? ? B  CYS 53  SG  ? ? ? 1_555 L  FES . FE1 ? ? B CYS 112 B FES 3   1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc14 metalc ? ? G  CYS 47  SG  ? ? ? 1_555 CA FES . FE1 ? ? G CYS 106 G FES 1   1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc15 metalc ? ? E  CYS 93  SG  ? ? ? 1_555 W  FES . FE2 ? ? E CYS 152 E FES 6   1_555 ? ? ? ? ? ? ? 2.065 ? 
metalc16 metalc ? ? G  CYS 53  SG  ? ? ? 1_555 CA FES . FE1 ? ? G CYS 112 G FES 1   1_555 ? ? ? ? ? ? ? 2.066 ? 
metalc17 metalc ? ? A  CYS 93  SG  ? ? ? 1_555 I  FES . FE2 ? ? A CYS 152 A FES 2   1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc18 metalc ? ? H  CYS 56  SG  ? ? ? 1_555 GA FES . FE2 ? ? H CYS 115 H FES 8   1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc19 metalc ? ? F  CYS 53  SG  ? ? ? 1_555 Z  FES . FE1 ? ? F CYS 112 F FES 7   1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc20 metalc ? ? B  CYS 56  SG  ? ? ? 1_555 L  FES . FE2 ? ? B CYS 115 B FES 3   1_555 ? ? ? ? ? ? ? 2.075 ? 
metalc21 metalc ? ? C  CYS 53  SG  ? ? ? 1_555 O  FES . FE1 ? ? C CYS 112 C FES 4   1_555 ? ? ? ? ? ? ? 2.081 ? 
metalc22 metalc ? ? H  CYS 93  SG  ? ? ? 1_555 GA FES . FE2 ? ? H CYS 152 H FES 8   1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc23 metalc ? ? F  CYS 56  SG  ? ? ? 1_555 Z  FES . FE2 ? ? F CYS 115 F FES 7   1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc24 metalc ? ? G  CYS 56  SG  ? ? ? 1_555 CA FES . FE2 ? ? G CYS 115 G FES 1   1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc25 metalc ? ? H  CYS 53  SG  ? ? ? 1_555 GA FES . FE1 ? ? H CYS 112 H FES 8   1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc26 metalc ? ? D  CYS 93  SG  ? ? ? 1_555 S  FES . FE2 ? ? D CYS 152 D FES 5   1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc27 metalc ? ? A  CYS 53  SG  ? ? ? 1_555 I  FES . FE1 ? ? A CYS 112 A FES 2   1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc28 metalc ? ? D  CYS 53  SG  ? ? ? 1_555 S  FES . FE1 ? ? D CYS 112 D FES 5   1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc29 metalc ? ? D  CYS 56  SG  ? ? ? 1_555 S  FES . FE2 ? ? D CYS 115 D FES 5   1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc30 metalc ? ? C  CYS 93  SG  ? ? ? 1_555 O  FES . FE2 ? ? C CYS 152 C FES 4   1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc31 metalc ? ? F  CYS 93  SG  ? ? ? 1_555 Z  FES . FE2 ? ? F CYS 152 F FES 7   1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc32 metalc ? ? G  CYS 93  SG  ? ? ? 1_555 CA FES . FE2 ? ? G CYS 152 G FES 1   1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc33 metalc ? ? J  FLC .   OHB ? ? ? 1_555 K  K   . K   ? ? A FLC 6   A K   192 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc34 metalc ? ? G  SER 118 O   ? ? ? 1_555 EA K   . K   ? ? G SER 177 G K   193 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc35 metalc ? ? A  SER 118 O   ? ? ? 1_555 K  K   . K   ? ? A SER 177 A K   192 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc36 metalc ? ? C  SER 118 O   ? ? ? 1_555 R  K   . K   ? ? C SER 177 C K   192 1_555 ? ? ? ? ? ? ? 2.445 ? 
metalc37 metalc ? ? D  SER 118 O   ? ? ? 1_555 V  K   . K   ? ? D SER 177 D K   192 1_555 ? ? ? ? ? ? ? 2.561 ? 
metalc38 metalc ? ? F  SER 118 O   ? ? ? 1_555 AA K   . K   ? ? F SER 177 F K   8   1_555 ? ? ? ? ? ? ? 2.581 ? 
metalc39 metalc ? ? E  ASP 120 OD1 ? ? ? 1_555 Y  K   . K   ? ? E ASP 179 E K   192 1_555 ? ? ? ? ? ? ? 2.610 ? 
metalc40 metalc ? ? M  FLC .   OHB ? ? ? 1_555 N  K   . K   ? ? B FLC 192 B K   193 1_555 ? ? ? ? ? ? ? 2.627 ? 
metalc41 metalc ? ? E  SER 118 O   ? ? ? 1_555 Y  K   . K   ? ? E SER 177 E K   192 1_555 ? ? ? ? ? ? ? 2.674 ? 
metalc42 metalc ? ? T  FLC .   OHB ? ? ? 1_555 V  K   . K   ? ? D FLC 2   D K   192 1_555 ? ? ? ? ? ? ? 2.745 ? 
metalc43 metalc ? ? X  FLC .   OHB ? ? ? 1_555 Y  K   . K   ? ? E FLC 4   E K   192 1_555 ? ? ? ? ? ? ? 2.762 ? 
metalc44 metalc ? ? P  FLC .   OB2 ? ? ? 1_555 R  K   . K   ? ? C FLC 5   C K   192 1_555 ? ? ? ? ? ? ? 2.807 ? 
metalc45 metalc ? ? P  FLC .   OHB ? ? ? 1_555 R  K   . K   ? ? C FLC 5   C K   192 1_555 ? ? ? ? ? ? ? 2.815 ? 
metalc46 metalc ? ? F  ASP 120 OD1 ? ? ? 1_555 AA K   . K   ? ? F ASP 179 F K   8   1_555 ? ? ? ? ? ? ? 2.856 ? 
metalc47 metalc ? ? D  ASP 120 OD1 ? ? ? 1_555 V  K   . K   ? ? D ASP 179 D K   192 1_555 ? ? ? ? ? ? ? 2.867 ? 
metalc48 metalc ? ? C  ASP 120 OD1 ? ? ? 1_555 R  K   . K   ? ? C ASP 179 C K   192 1_555 ? ? ? ? ? ? ? 2.930 ? 
metalc49 metalc ? ? A  ASP 120 OD1 ? ? ? 1_555 K  K   . K   ? ? A ASP 179 A K   192 1_555 ? ? ? ? ? ? ? 2.937 ? 
metalc50 metalc ? ? G  ASP 120 OD1 ? ? ? 1_555 EA K   . K   ? ? G ASP 179 G K   193 1_555 ? ? ? ? ? ? ? 2.980 ? 
metalc51 metalc ? ? DA FLC .   OHB ? ? ? 1_555 EA K   . K   ? ? G FLC 192 G K   193 1_555 ? ? ? ? ? ? ? 3.035 ? 
metalc52 metalc ? ? HA FLC .   OHB ? ? ? 1_555 IA K   . K   ? ? H FLC 7   H K   192 1_555 ? ? ? ? ? ? ? 3.057 ? 
metalc53 metalc ? ? D  SER 118 OG  ? ? ? 1_555 V  K   . K   ? ? D SER 177 D K   192 1_555 ? ? ? ? ? ? ? 3.240 ? 
metalc54 metalc ? ? T  FLC .   OG1 ? ? ? 1_555 V  K   . K   ? ? D FLC 2   D K   192 1_555 ? ? ? ? ? ? ? 3.252 ? 
metalc55 metalc ? ? HA FLC .   OA1 ? ? ? 1_555 IA K   . K   ? ? H FLC 7   H K   192 1_555 ? ? ? ? ? ? ? 3.375 ? 
metalc56 metalc ? ? HA FLC .   OB2 ? ? ? 1_555 IA K   . K   ? ? H FLC 7   H K   192 1_555 ? ? ? ? ? ? ? 3.414 ? 
metalc57 metalc ? ? N  K   .   K   ? ? ? 1_555 KA HOH . O   ? ? B K   193 B HOH 201 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc58 metalc ? ? V  K   .   K   ? ? ? 1_555 MA HOH . O   ? ? D K   192 D HOH 205 1_555 ? ? ? ? ? ? ? 2.705 ? 
metalc59 metalc ? ? EA K   .   K   ? ? ? 1_555 JA HOH . O   ? ? G K   193 A HOH 197 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc60 metalc ? ? EA K   .   K   ? ? ? 1_555 PA HOH . O   ? ? G K   193 G HOH 47  1_555 ? ? ? ? ? ? ? 3.139 ? 
metalc61 metalc ? ? R  K   .   K   ? ? ? 1_555 LA HOH . O   ? ? C K   192 C HOH 203 1_555 ? ? ? ? ? ? ? 3.357 ? 
metalc62 metalc ? ? B  SER 118 O   ? ? ? 1_555 IA K   . K   ? ? B SER 177 H K   192 1_555 ? ? ? ? ? ? ? 2.566 ? 
metalc63 metalc ? ? B  ASP 120 OD1 ? ? ? 1_555 IA K   . K   ? ? B ASP 179 H K   192 1_555 ? ? ? ? ? ? ? 2.634 ? 
metalc64 metalc ? ? AA K   .   K   ? ? ? 1_555 LA HOH . O   ? ? F K   8   C HOH 222 1_555 ? ? ? ? ? ? ? 2.642 ? 
metalc65 metalc ? ? H  SER 118 O   ? ? ? 1_555 N  K   . K   ? ? H SER 177 B K   193 1_555 ? ? ? ? ? ? ? 2.698 ? 
metalc66 metalc ? ? Q  FLC .   OHB ? ? ? 1_555 AA K   . K   ? ? C FLC 8   F K   8   1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc67 metalc ? ? H  ASP 120 OD1 ? ? ? 1_555 N  K   . K   ? ? H ASP 179 B K   193 1_555 ? ? ? ? ? ? ? 2.799 ? 
metalc68 metalc ? ? Q  FLC .   OG2 ? ? ? 1_555 AA K   . K   ? ? C FLC 8   F K   8   1_555 ? ? ? ? ? ? ? 3.346 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 2 ? 
D ? 5 ? 
E ? 5 ? 
F ? 3 ? 
G ? 2 ? 
H ? 3 ? 
I ? 2 ? 
J ? 3 ? 
K ? 2 ? 
L ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? parallel      
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? parallel      
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 19  ? GLY A 24  ? THR A 78  GLY A 83  
A 2 ILE A 8   ? ILE A 13  ? ILE A 67  ILE A 72  
A 3 MET A 104 ? ARG A 107 ? MET A 163 ARG A 166 
A 4 HIS A 57  ? PHE A 60  ? HIS A 116 PHE A 119 
A 5 SER A 89  ? LEU A 91  ? SER A 148 LEU A 150 
B 1 THR B 19  ? GLY B 24  ? THR B 78  GLY B 83  
B 2 ILE B 8   ? ILE B 13  ? ILE B 67  ILE B 72  
B 3 MET B 104 ? ARG B 107 ? MET B 163 ARG B 166 
C 1 HIS B 57  ? ILE B 59  ? HIS B 116 ILE B 118 
C 2 SER B 89  ? LEU B 91  ? SER B 148 LEU B 150 
D 1 THR C 19  ? LYS C 25  ? THR C 78  LYS C 84  
D 2 LYS C 7   ? ILE C 13  ? LYS C 66  ILE C 72  
D 3 MET C 104 ? ARG C 107 ? MET C 163 ARG C 166 
D 4 HIS C 57  ? PHE C 60  ? HIS C 116 PHE C 119 
D 5 SER C 89  ? LEU C 91  ? SER C 148 LEU C 150 
E 1 THR D 19  ? LYS D 25  ? THR D 78  LYS D 84  
E 2 LYS D 7   ? ILE D 13  ? LYS D 66  ILE D 72  
E 3 MET D 104 ? ARG D 107 ? MET D 163 ARG D 166 
E 4 HIS D 57  ? PHE D 60  ? HIS D 116 PHE D 119 
E 5 SER D 89  ? LEU D 91  ? SER D 148 LEU D 150 
F 1 THR E 19  ? LYS E 25  ? THR E 78  LYS E 84  
F 2 LYS E 7   ? ILE E 13  ? LYS E 66  ILE E 72  
F 3 MET E 104 ? ARG E 107 ? MET E 163 ARG E 166 
G 1 HIS E 57  ? ILE E 59  ? HIS E 116 ILE E 118 
G 2 SER E 89  ? LEU E 91  ? SER E 148 LEU E 150 
H 1 THR F 19  ? LYS F 25  ? THR F 78  LYS F 84  
H 2 LYS F 7   ? ILE F 13  ? LYS F 66  ILE F 72  
H 3 MET F 104 ? ARG F 107 ? MET F 163 ARG F 166 
I 1 HIS F 57  ? ILE F 59  ? HIS F 116 ILE F 118 
I 2 SER F 89  ? LEU F 91  ? SER F 148 LEU F 150 
J 1 THR G 19  ? LYS G 25  ? THR G 78  LYS G 84  
J 2 LYS G 7   ? ILE G 13  ? LYS G 66  ILE G 72  
J 3 MET G 104 ? ARG G 107 ? MET G 163 ARG G 166 
K 1 HIS G 57  ? ILE G 59  ? HIS G 116 ILE G 118 
K 2 SER G 89  ? LEU G 91  ? SER G 148 LEU G 150 
L 1 THR H 19  ? LYS H 25  ? THR H 78  LYS H 84  
L 2 LYS H 7   ? ILE H 13  ? LYS H 66  ILE H 72  
L 3 MET H 104 ? ARG H 107 ? MET H 163 ARG H 166 
L 4 HIS H 57  ? PHE H 60  ? HIS H 116 PHE H 119 
L 5 SER H 89  ? LEU H 91  ? SER H 148 LEU H 150 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 24  ? O GLY A 83  N ILE A 8   ? N ILE A 67  
A 2 3 N ILE A 13  ? N ILE A 72  O VAL A 106 ? O VAL A 165 
A 3 4 O ARG A 107 ? O ARG A 166 N ILE A 59  ? N ILE A 118 
A 4 5 N LEU A 58  ? N LEU A 117 O ARG A 90  ? O ARG A 149 
B 1 2 O GLY B 24  ? O GLY B 83  N ILE B 8   ? N ILE B 67  
B 2 3 N HIS B 11  ? N HIS B 70  O MET B 104 ? O MET B 163 
C 1 2 N LEU B 58  ? N LEU B 117 O ARG B 90  ? O ARG B 149 
D 1 2 O LEU C 20  ? O LEU C 79  N PHE C 12  ? N PHE C 71  
D 2 3 N HIS C 11  ? N HIS C 70  O MET C 104 ? O MET C 163 
D 3 4 O ARG C 107 ? O ARG C 166 N ILE C 59  ? N ILE C 118 
D 4 5 N LEU C 58  ? N LEU C 117 O ARG C 90  ? O ARG C 149 
E 1 2 O LEU D 20  ? O LEU D 79  N PHE D 12  ? N PHE D 71  
E 2 3 N HIS D 11  ? N HIS D 70  O MET D 104 ? O MET D 163 
E 3 4 O ARG D 107 ? O ARG D 166 N ILE D 59  ? N ILE D 118 
E 4 5 N LEU D 58  ? N LEU D 117 O ARG D 90  ? O ARG D 149 
F 1 2 O GLY E 24  ? O GLY E 83  N ILE E 8   ? N ILE E 67  
F 2 3 N HIS E 11  ? N HIS E 70  O MET E 104 ? O MET E 163 
G 1 2 N LEU E 58  ? N LEU E 117 O ARG E 90  ? O ARG E 149 
H 1 2 O GLY F 24  ? O GLY F 83  N ILE F 8   ? N ILE F 67  
H 2 3 N HIS F 11  ? N HIS F 70  O MET F 104 ? O MET F 163 
I 1 2 N LEU F 58  ? N LEU F 117 O ARG F 90  ? O ARG F 149 
J 1 2 O GLY G 24  ? O GLY G 83  N ILE G 8   ? N ILE G 67  
J 2 3 N HIS G 11  ? N HIS G 70  O MET G 104 ? O MET G 163 
K 1 2 N LEU G 58  ? N LEU G 117 O ARG G 90  ? O ARG G 149 
L 1 2 O LEU H 20  ? O LEU H 79  N PHE H 12  ? N PHE H 71  
L 2 3 N HIS H 11  ? N HIS H 70  O MET H 104 ? O MET H 163 
L 3 4 O ARG H 107 ? O ARG H 166 N ILE H 59  ? N ILE H 118 
L 4 5 N LEU H 58  ? N LEU H 117 O ARG H 90  ? O ARG H 149 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE FES A 2'   
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE FLC A 6'   
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE K A 192'   
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FES B 3'   
AC5 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE FLC B 192' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE K B 193'   
AC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE FES C 4'   
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FLC C 5'   
AC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FLC C 8'   
BC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE K C 192'   
BC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE FES D 5'   
BC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE FLC D 2'   
BC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE FLC D 9'   
BC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE K D 192'   
BC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FES E 6'   
BC7 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE FLC E 4'   
BC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE K E 192'   
BC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FES F 7'   
CC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE K F 8'     
CC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL F 1'   
CC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FES G 1'   
CC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FLC G 192' 
CC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE K G 193'   
CC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL G 194' 
CC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FES H 8'   
CC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE FLC H 7'   
CC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE K H 192'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 8 GLY A  45  ? GLY A 104 . ? 1_555 ? 
2   AC1 8 CYS A  47  ? CYS A 106 . ? 1_555 ? 
3   AC1 8 GLY A  49  ? GLY A 108 . ? 1_555 ? 
4   AC1 8 LEU A  51  ? LEU A 110 . ? 1_555 ? 
5   AC1 8 ALA A  52  ? ALA A 111 . ? 1_555 ? 
6   AC1 8 CYS A  53  ? CYS A 112 . ? 1_555 ? 
7   AC1 8 CYS A  56  ? CYS A 115 . ? 1_555 ? 
8   AC1 8 CYS A  93  ? CYS A 152 . ? 1_555 ? 
9   AC2 7 VAL A  112 ? VAL A 171 . ? 1_555 ? 
10  AC2 7 ARG A  116 ? ARG A 175 . ? 1_555 ? 
11  AC2 7 ASP A  120 ? ASP A 179 . ? 1_555 ? 
12  AC2 7 K   K  .   ? K   A 192 . ? 1_555 ? 
13  AC2 7 TYR G  83  ? TYR G 142 . ? 1_555 ? 
14  AC2 7 GLY G  84  ? GLY G 143 . ? 1_555 ? 
15  AC2 7 LEU G  85  ? LEU G 144 . ? 1_555 ? 
16  AC3 3 FLC J  .   ? FLC A 6   . ? 1_555 ? 
17  AC3 3 SER A  118 ? SER A 177 . ? 1_555 ? 
18  AC3 3 ASP A  120 ? ASP A 179 . ? 1_555 ? 
19  AC4 5 CYS B  47  ? CYS B 106 . ? 1_555 ? 
20  AC4 5 GLY B  49  ? GLY B 108 . ? 1_555 ? 
21  AC4 5 CYS B  53  ? CYS B 112 . ? 1_555 ? 
22  AC4 5 CYS B  56  ? CYS B 115 . ? 1_555 ? 
23  AC4 5 CYS B  93  ? CYS B 152 . ? 1_555 ? 
24  AC5 9 TYR B  83  ? TYR B 142 . ? 1_555 ? 
25  AC5 9 GLY B  84  ? GLY B 143 . ? 1_555 ? 
26  AC5 9 LEU B  85  ? LEU B 144 . ? 1_555 ? 
27  AC5 9 K   N  .   ? K   B 193 . ? 1_555 ? 
28  AC5 9 HOH KA .   ? HOH B 201 . ? 1_555 ? 
29  AC5 9 TYR H  83  ? TYR H 142 . ? 1_555 ? 
30  AC5 9 VAL H  112 ? VAL H 171 . ? 1_555 ? 
31  AC5 9 ARG H  116 ? ARG H 175 . ? 1_555 ? 
32  AC5 9 ASP H  120 ? ASP H 179 . ? 1_555 ? 
33  AC6 4 FLC M  .   ? FLC B 192 . ? 1_555 ? 
34  AC6 4 HOH KA .   ? HOH B 201 . ? 1_555 ? 
35  AC6 4 SER H  118 ? SER H 177 . ? 1_555 ? 
36  AC6 4 ASP H  120 ? ASP H 179 . ? 1_555 ? 
37  AC7 7 GLY C  45  ? GLY C 104 . ? 1_555 ? 
38  AC7 7 CYS C  47  ? CYS C 106 . ? 1_555 ? 
39  AC7 7 GLY C  49  ? GLY C 108 . ? 1_555 ? 
40  AC7 7 LEU C  51  ? LEU C 110 . ? 1_555 ? 
41  AC7 7 CYS C  53  ? CYS C 112 . ? 1_555 ? 
42  AC7 7 CYS C  56  ? CYS C 115 . ? 1_555 ? 
43  AC7 7 CYS C  93  ? CYS C 152 . ? 1_555 ? 
44  AC8 6 ARG C  116 ? ARG C 175 . ? 1_555 ? 
45  AC8 6 ASP C  120 ? ASP C 179 . ? 1_555 ? 
46  AC8 6 K   R  .   ? K   C 192 . ? 1_555 ? 
47  AC8 6 HOH LA .   ? HOH C 203 . ? 1_555 ? 
48  AC8 6 GLY F  84  ? GLY F 143 . ? 1_555 ? 
49  AC8 6 LEU F  85  ? LEU F 144 . ? 1_555 ? 
50  AC9 6 GLY C  84  ? GLY C 143 . ? 1_555 ? 
51  AC9 6 K   AA .   ? K   F 8   . ? 1_555 ? 
52  AC9 6 TYR F  83  ? TYR F 142 . ? 1_555 ? 
53  AC9 6 VAL F  112 ? VAL F 171 . ? 1_555 ? 
54  AC9 6 ARG F  116 ? ARG F 175 . ? 1_555 ? 
55  AC9 6 ASP F  120 ? ASP F 179 . ? 1_555 ? 
56  BC1 3 FLC P  .   ? FLC C 5   . ? 1_555 ? 
57  BC1 3 SER C  118 ? SER C 177 . ? 1_555 ? 
58  BC1 3 ASP C  120 ? ASP C 179 . ? 1_555 ? 
59  BC2 7 CYS D  47  ? CYS D 106 . ? 1_555 ? 
60  BC2 7 GLY D  49  ? GLY D 108 . ? 1_555 ? 
61  BC2 7 LEU D  51  ? LEU D 110 . ? 1_555 ? 
62  BC2 7 ALA D  52  ? ALA D 111 . ? 1_555 ? 
63  BC2 7 CYS D  53  ? CYS D 112 . ? 1_555 ? 
64  BC2 7 CYS D  56  ? CYS D 115 . ? 1_555 ? 
65  BC2 7 CYS D  93  ? CYS D 152 . ? 1_555 ? 
66  BC3 8 VAL D  112 ? VAL D 171 . ? 1_555 ? 
67  BC3 8 ARG D  116 ? ARG D 175 . ? 1_555 ? 
68  BC3 8 ASP D  120 ? ASP D 179 . ? 1_555 ? 
69  BC3 8 K   V  .   ? K   D 192 . ? 1_555 ? 
70  BC3 8 HOH MA .   ? HOH D 205 . ? 1_555 ? 
71  BC3 8 TYR E  83  ? TYR E 142 . ? 1_555 ? 
72  BC3 8 GLY E  84  ? GLY E 143 . ? 1_555 ? 
73  BC3 8 LEU E  85  ? LEU E 144 . ? 1_555 ? 
74  BC4 3 LEU D  20  ? LEU D 79  . ? 1_555 ? 
75  BC4 3 THR D  21  ? THR D 80  . ? 1_555 ? 
76  BC4 3 HOH MA .   ? HOH D 200 . ? 1_555 ? 
77  BC5 4 FLC T  .   ? FLC D 2   . ? 1_555 ? 
78  BC5 4 SER D  118 ? SER D 177 . ? 1_555 ? 
79  BC5 4 ASP D  120 ? ASP D 179 . ? 1_555 ? 
80  BC5 4 HOH MA .   ? HOH D 205 . ? 1_555 ? 
81  BC6 5 CYS E  47  ? CYS E 106 . ? 1_555 ? 
82  BC6 5 GLY E  49  ? GLY E 108 . ? 1_555 ? 
83  BC6 5 CYS E  53  ? CYS E 112 . ? 1_555 ? 
84  BC6 5 CYS E  56  ? CYS E 115 . ? 1_555 ? 
85  BC6 5 CYS E  93  ? CYS E 152 . ? 1_555 ? 
86  BC7 9 ALA D  82  ? ALA D 141 . ? 1_555 ? 
87  BC7 9 TYR D  83  ? TYR D 142 . ? 1_555 ? 
88  BC7 9 GLY D  84  ? GLY D 143 . ? 1_555 ? 
89  BC7 9 LEU D  85  ? LEU D 144 . ? 1_555 ? 
90  BC7 9 VAL E  112 ? VAL E 171 . ? 1_555 ? 
91  BC7 9 ALA E  115 ? ALA E 174 . ? 1_555 ? 
92  BC7 9 ARG E  116 ? ARG E 175 . ? 1_555 ? 
93  BC7 9 K   Y  .   ? K   E 192 . ? 1_555 ? 
94  BC7 9 HOH NA .   ? HOH E 202 . ? 1_555 ? 
95  BC8 3 FLC X  .   ? FLC E 4   . ? 1_555 ? 
96  BC8 3 SER E  118 ? SER E 177 . ? 1_555 ? 
97  BC8 3 ASP E  120 ? ASP E 179 . ? 1_555 ? 
98  BC9 6 GLY F  45  ? GLY F 104 . ? 1_555 ? 
99  BC9 6 CYS F  47  ? CYS F 106 . ? 1_555 ? 
100 BC9 6 GLY F  49  ? GLY F 108 . ? 1_555 ? 
101 BC9 6 CYS F  53  ? CYS F 112 . ? 1_555 ? 
102 BC9 6 CYS F  56  ? CYS F 115 . ? 1_555 ? 
103 BC9 6 CYS F  93  ? CYS F 152 . ? 1_555 ? 
104 CC1 4 FLC Q  .   ? FLC C 8   . ? 1_555 ? 
105 CC1 4 HOH LA .   ? HOH C 222 . ? 1_555 ? 
106 CC1 4 SER F  118 ? SER F 177 . ? 1_555 ? 
107 CC1 4 ASP F  120 ? ASP F 179 . ? 1_555 ? 
108 CC2 6 LEU C  81  ? LEU C 140 . ? 1_555 ? 
109 CC2 6 HOH LA .   ? HOH C 265 . ? 1_555 ? 
110 CC2 6 HOH LA .   ? HOH C 266 . ? 1_555 ? 
111 CC2 6 LEU F  81  ? LEU F 140 . ? 1_555 ? 
112 CC2 6 VAL F  112 ? VAL F 171 . ? 1_555 ? 
113 CC2 6 HOH OA .   ? HOH F 216 . ? 1_555 ? 
114 CC3 6 GLY G  45  ? GLY G 104 . ? 1_555 ? 
115 CC3 6 CYS G  47  ? CYS G 106 . ? 1_555 ? 
116 CC3 6 GLY G  49  ? GLY G 108 . ? 1_555 ? 
117 CC3 6 CYS G  53  ? CYS G 112 . ? 1_555 ? 
118 CC3 6 CYS G  56  ? CYS G 115 . ? 1_555 ? 
119 CC3 6 CYS G  93  ? CYS G 152 . ? 1_555 ? 
120 CC4 6 GLY A  84  ? GLY A 143 . ? 1_555 ? 
121 CC4 6 TYR G  83  ? TYR G 142 . ? 1_555 ? 
122 CC4 6 VAL G  112 ? VAL G 171 . ? 1_555 ? 
123 CC4 6 ARG G  116 ? ARG G 175 . ? 1_555 ? 
124 CC4 6 ASP G  120 ? ASP G 179 . ? 1_555 ? 
125 CC4 6 K   EA .   ? K   G 193 . ? 1_555 ? 
126 CC5 4 HOH JA .   ? HOH A 197 . ? 1_555 ? 
127 CC5 4 SER G  118 ? SER G 177 . ? 1_555 ? 
128 CC5 4 ASP G  120 ? ASP G 179 . ? 1_555 ? 
129 CC5 4 FLC DA .   ? FLC G 192 . ? 1_555 ? 
130 CC6 4 LEU A  81  ? LEU A 140 . ? 1_555 ? 
131 CC6 4 LEU G  81  ? LEU G 140 . ? 1_555 ? 
132 CC6 4 VAL G  112 ? VAL G 171 . ? 1_555 ? 
133 CC6 4 HOH PA .   ? HOH G 207 . ? 1_555 ? 
134 CC7 6 CYS H  47  ? CYS H 106 . ? 1_555 ? 
135 CC7 6 GLY H  49  ? GLY H 108 . ? 1_555 ? 
136 CC7 6 LEU H  51  ? LEU H 110 . ? 1_555 ? 
137 CC7 6 CYS H  53  ? CYS H 112 . ? 1_555 ? 
138 CC7 6 CYS H  56  ? CYS H 115 . ? 1_555 ? 
139 CC7 6 CYS H  93  ? CYS H 152 . ? 1_555 ? 
140 CC8 6 VAL B  112 ? VAL B 171 . ? 1_555 ? 
141 CC8 6 ARG B  116 ? ARG B 175 . ? 1_555 ? 
142 CC8 6 TYR H  83  ? TYR H 142 . ? 1_555 ? 
143 CC8 6 GLY H  84  ? GLY H 143 . ? 1_555 ? 
144 CC8 6 LEU H  85  ? LEU H 144 . ? 1_555 ? 
145 CC8 6 K   IA .   ? K   H 192 . ? 1_555 ? 
146 CC9 3 SER B  118 ? SER B 177 . ? 1_555 ? 
147 CC9 3 ASP B  120 ? ASP B 179 . ? 1_555 ? 
148 CC9 3 FLC HA .   ? FLC H 7   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3P1M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3P1M 
_atom_sites.fract_transf_matrix[1][1]   0.013059 
_atom_sites.fract_transf_matrix[1][2]   0.007540 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015079 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004266 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
K  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A  1 7   ? 8.771   7.733   -8.769  1.00 59.78  ? 66  LYS A N   1 
ATOM   2    C  CA  . LYS A  1 7   ? 9.200   8.833   -7.858  1.00 57.29  ? 66  LYS A CA  1 
ATOM   3    C  C   . LYS A  1 7   ? 8.255   8.852   -6.649  1.00 53.97  ? 66  LYS A C   1 
ATOM   4    O  O   . LYS A  1 7   ? 7.046   8.836   -6.786  1.00 54.40  ? 66  LYS A O   1 
ATOM   5    C  CB  . LYS A  1 7   ? 9.221   10.188  -8.608  1.00 59.05  ? 66  LYS A CB  1 
ATOM   6    N  N   . ILE A  1 8   ? 8.803   8.853   -5.455  1.00 51.35  ? 67  ILE A N   1 
ATOM   7    C  CA  . ILE A  1 8   ? 7.958   8.821   -4.273  1.00 49.12  ? 67  ILE A CA  1 
ATOM   8    C  C   . ILE A  1 8   ? 7.986   10.151  -3.521  1.00 47.34  ? 67  ILE A C   1 
ATOM   9    O  O   . ILE A  1 8   ? 8.951   10.901  -3.593  1.00 47.30  ? 67  ILE A O   1 
ATOM   10   C  CB  . ILE A  1 8   ? 8.326   7.651   -3.347  1.00 47.54  ? 67  ILE A CB  1 
ATOM   11   C  CG1 . ILE A  1 8   ? 9.642   7.908   -2.625  1.00 46.86  ? 67  ILE A CG1 1 
ATOM   12   C  CG2 . ILE A  1 8   ? 8.409   6.356   -4.153  1.00 49.54  ? 67  ILE A CG2 1 
ATOM   13   C  CD1 . ILE A  1 8   ? 9.556   7.635   -1.095  1.00 45.63  ? 67  ILE A CD1 1 
ATOM   14   N  N   . THR A  1 9   ? 6.906   10.431  -2.805  1.00 45.73  ? 68  THR A N   1 
ATOM   15   C  CA  . THR A  1 9   ? 6.750   11.684  -2.112  1.00 44.75  ? 68  THR A CA  1 
ATOM   16   C  C   . THR A  1 9   ? 7.190   11.545  -0.653  1.00 42.04  ? 68  THR A C   1 
ATOM   17   O  O   . THR A  1 9   ? 6.809   10.600  0.024   1.00 40.55  ? 68  THR A O   1 
ATOM   18   C  CB  . THR A  1 9   ? 5.291   12.172  -2.236  1.00 45.45  ? 68  THR A CB  1 
ATOM   19   O  OG1 . THR A  1 9   ? 5.082   12.653  -3.574  1.00 50.56  ? 68  THR A OG1 1 
ATOM   20   C  CG2 . THR A  1 9   ? 4.995   13.276  -1.281  1.00 43.13  ? 68  THR A CG2 1 
ATOM   21   N  N   . VAL A  1 10  ? 8.016   12.482  -0.192  1.00 41.37  ? 69  VAL A N   1 
ATOM   22   C  CA  . VAL A  1 10  ? 8.383   12.586  1.222   1.00 39.22  ? 69  VAL A CA  1 
ATOM   23   C  C   . VAL A  1 10  ? 8.162   13.997  1.699   1.00 38.88  ? 69  VAL A C   1 
ATOM   24   O  O   . VAL A  1 10  ? 8.455   14.956  0.974   1.00 40.59  ? 69  VAL A O   1 
ATOM   25   C  CB  . VAL A  1 10  ? 9.888   12.283  1.487   1.00 38.83  ? 69  VAL A CB  1 
ATOM   26   C  CG1 . VAL A  1 10  ? 10.179  12.241  3.000   1.00 36.81  ? 69  VAL A CG1 1 
ATOM   27   C  CG2 . VAL A  1 10  ? 10.319  10.992  0.810   1.00 38.33  ? 69  VAL A CG2 1 
ATOM   28   N  N   . HIS A  1 11  ? 7.666   14.092  2.925   1.00 37.21  ? 70  HIS A N   1 
ATOM   29   C  CA  . HIS A  1 11  ? 7.430   15.340  3.602   1.00 38.03  ? 70  HIS A CA  1 
ATOM   30   C  C   . HIS A  1 11  ? 8.476   15.502  4.691   1.00 37.48  ? 70  HIS A C   1 
ATOM   31   O  O   . HIS A  1 11  ? 8.634   14.618  5.540   1.00 36.02  ? 70  HIS A O   1 
ATOM   32   C  CB  . HIS A  1 11  ? 6.058   15.322  4.249   1.00 37.62  ? 70  HIS A CB  1 
ATOM   33   C  CG  . HIS A  1 11  ? 4.935   15.051  3.291   1.00 40.80  ? 70  HIS A CG  1 
ATOM   34   N  ND1 . HIS A  1 11  ? 4.542   15.956  2.316   1.00 43.33  ? 70  HIS A ND1 1 
ATOM   35   C  CD2 . HIS A  1 11  ? 4.100   13.987  3.176   1.00 40.44  ? 70  HIS A CD2 1 
ATOM   36   C  CE1 . HIS A  1 11  ? 3.520   15.456  1.646   1.00 43.55  ? 70  HIS A CE1 1 
ATOM   37   N  NE2 . HIS A  1 11  ? 3.234   14.264  2.145   1.00 43.54  ? 70  HIS A NE2 1 
ATOM   38   N  N   . PHE A  1 12  ? 9.190   16.624  4.659   1.00 38.78  ? 71  PHE A N   1 
ATOM   39   C  CA  . PHE A  1 12  ? 10.139  17.000  5.701   1.00 38.48  ? 71  PHE A CA  1 
ATOM   40   C  C   . PHE A  1 12  ? 9.597   18.132  6.527   1.00 39.56  ? 71  PHE A C   1 
ATOM   41   O  O   . PHE A  1 12  ? 9.290   19.180  5.983   1.00 41.49  ? 71  PHE A O   1 
ATOM   42   C  CB  . PHE A  1 12  ? 11.401  17.564  5.076   1.00 39.76  ? 71  PHE A CB  1 
ATOM   43   C  CG  . PHE A  1 12  ? 12.223  16.564  4.352   1.00 40.08  ? 71  PHE A CG  1 
ATOM   44   C  CD1 . PHE A  1 12  ? 13.309  15.982  4.957   1.00 40.53  ? 71  PHE A CD1 1 
ATOM   45   C  CD2 . PHE A  1 12  ? 11.927  16.217  3.062   1.00 42.12  ? 71  PHE A CD2 1 
ATOM   46   C  CE1 . PHE A  1 12  ? 14.084  15.071  4.271   1.00 42.62  ? 71  PHE A CE1 1 
ATOM   47   C  CE2 . PHE A  1 12  ? 12.708  15.307  2.371   1.00 43.12  ? 71  PHE A CE2 1 
ATOM   48   C  CZ  . PHE A  1 12  ? 13.782  14.735  2.971   1.00 41.94  ? 71  PHE A CZ  1 
ATOM   49   N  N   . ILE A  1 13  ? 9.519   17.953  7.835   1.00 38.87  ? 72  ILE A N   1 
ATOM   50   C  CA  . ILE A  1 13  ? 9.203   19.052  8.718   1.00 40.50  ? 72  ILE A CA  1 
ATOM   51   C  C   . ILE A  1 13  ? 10.514  19.720  9.110   1.00 42.55  ? 72  ILE A C   1 
ATOM   52   O  O   . ILE A  1 13  ? 11.350  19.131  9.786   1.00 42.73  ? 72  ILE A O   1 
ATOM   53   C  CB  . ILE A  1 13  ? 8.416   18.572  9.931   1.00 39.64  ? 72  ILE A CB  1 
ATOM   54   C  CG1 . ILE A  1 13  ? 7.153   17.840  9.455   1.00 39.18  ? 72  ILE A CG1 1 
ATOM   55   C  CG2 . ILE A  1 13  ? 8.044   19.711  10.847  1.00 38.50  ? 72  ILE A CG2 1 
ATOM   56   C  CD1 . ILE A  1 13  ? 6.298   17.317  10.596  1.00 39.30  ? 72  ILE A CD1 1 
ATOM   57   N  N   . ASN A  1 14  ? 10.697  20.945  8.652   1.00 44.96  ? 73  ASN A N   1 
ATOM   58   C  CA  . ASN A  1 14  ? 11.897  21.691  8.861   1.00 46.94  ? 73  ASN A CA  1 
ATOM   59   C  C   . ASN A  1 14  ? 12.012  22.183  10.328  1.00 47.88  ? 73  ASN A C   1 
ATOM   60   O  O   . ASN A  1 14  ? 11.048  22.138  11.111  1.00 47.13  ? 73  ASN A O   1 
ATOM   61   C  CB  . ASN A  1 14  ? 11.810  22.886  7.908   1.00 50.99  ? 73  ASN A CB  1 
ATOM   62   C  CG  . ASN A  1 14  ? 13.159  23.397  7.432   1.00 55.31  ? 73  ASN A CG  1 
ATOM   63   O  OD1 . ASN A  1 14  ? 14.200  22.764  7.648   1.00 58.09  ? 73  ASN A OD1 1 
ATOM   64   N  ND2 . ASN A  1 14  ? 13.140  24.570  6.762   1.00 59.43  ? 73  ASN A ND2 1 
ATOM   65   N  N   . ARG A  1 15  ? 13.192  22.688  10.683  1.00 49.10  ? 74  ARG A N   1 
ATOM   66   C  CA  . ARG A  1 15  ? 13.457  23.212  12.037  1.00 50.80  ? 74  ARG A CA  1 
ATOM   67   C  C   . ARG A  1 15  ? 12.556  24.393  12.417  1.00 54.03  ? 74  ARG A C   1 
ATOM   68   O  O   . ARG A  1 15  ? 12.245  24.589  13.589  1.00 54.31  ? 74  ARG A O   1 
ATOM   69   C  CB  . ARG A  1 15  ? 14.926  23.624  12.183  1.00 51.53  ? 74  ARG A CB  1 
ATOM   70   C  CG  . ARG A  1 15  ? 15.922  22.535  11.793  1.00 48.58  ? 74  ARG A CG  1 
ATOM   71   C  CD  . ARG A  1 15  ? 17.355  22.774  12.293  1.00 48.36  ? 74  ARG A CD  1 
ATOM   72   N  NE  . ARG A  1 15  ? 18.179  21.603  11.980  1.00 46.20  ? 74  ARG A NE  1 
ATOM   73   C  CZ  . ARG A  1 15  ? 19.141  21.534  11.058  1.00 45.49  ? 74  ARG A CZ  1 
ATOM   74   N  NH1 . ARG A  1 15  ? 19.505  22.604  10.353  1.00 49.29  ? 74  ARG A NH1 1 
ATOM   75   N  NH2 . ARG A  1 15  ? 19.773  20.380  10.864  1.00 40.85  ? 74  ARG A NH2 1 
ATOM   76   N  N   . ASP A  1 16  ? 12.143  25.155  11.406  1.00 56.66  ? 75  ASP A N   1 
ATOM   77   C  CA  . ASP A  1 16  ? 11.159  26.224  11.549  1.00 60.47  ? 75  ASP A CA  1 
ATOM   78   C  C   . ASP A  1 16  ? 9.735   25.757  11.848  1.00 59.26  ? 75  ASP A C   1 
ATOM   79   O  O   . ASP A  1 16  ? 8.919   26.551  12.286  1.00 62.04  ? 75  ASP A O   1 
ATOM   80   C  CB  . ASP A  1 16  ? 11.098  27.040  10.260  1.00 63.25  ? 75  ASP A CB  1 
ATOM   81   C  CG  . ASP A  1 16  ? 12.377  27.805  9.986   1.00 68.02  ? 75  ASP A CG  1 
ATOM   82   O  OD1 . ASP A  1 16  ? 12.983  28.364  10.943  1.00 72.91  ? 75  ASP A OD1 1 
ATOM   83   O  OD2 . ASP A  1 16  ? 12.757  27.863  8.791   1.00 73.04  ? 75  ASP A OD2 1 
ATOM   84   N  N   . GLY A  1 17  ? 9.423   24.498  11.571  1.00 56.01  ? 76  GLY A N   1 
ATOM   85   C  CA  . GLY A  1 17  ? 8.097   23.963  11.843  1.00 54.80  ? 76  GLY A CA  1 
ATOM   86   C  C   . GLY A  1 17  ? 7.263   23.820  10.595  1.00 54.19  ? 76  GLY A C   1 
ATOM   87   O  O   . GLY A  1 17  ? 6.113   23.431  10.666  1.00 52.66  ? 76  GLY A O   1 
ATOM   88   N  N   . GLU A  1 18  ? 7.890   24.103  9.459   1.00 55.00  ? 77  GLU A N   1 
ATOM   89   C  CA  . GLU A  1 18  ? 7.252   24.209  8.163   1.00 55.82  ? 77  GLU A CA  1 
ATOM   90   C  C   . GLU A  1 18  ? 7.381   22.894  7.398   1.00 52.65  ? 77  GLU A C   1 
ATOM   91   O  O   . GLU A  1 18  ? 8.402   22.230  7.503   1.00 51.59  ? 77  GLU A O   1 
ATOM   92   C  CB  . GLU A  1 18  ? 7.986   25.319  7.433   1.00 59.37  ? 77  GLU A CB  1 
ATOM   93   C  CG  . GLU A  1 18  ? 7.676   25.492  5.963   1.00 63.23  ? 77  GLU A CG  1 
ATOM   94   C  CD  . GLU A  1 18  ? 8.302   26.775  5.386   1.00 69.67  ? 77  GLU A CD  1 
ATOM   95   O  OE1 . GLU A  1 18  ? 9.025   27.486  6.136   1.00 74.02  ? 77  GLU A OE1 1 
ATOM   96   O  OE2 . GLU A  1 18  ? 8.067   27.072  4.187   1.00 72.12  ? 77  GLU A OE2 1 
ATOM   97   N  N   . THR A  1 19  ? 6.363   22.491  6.642   1.00 51.50  ? 78  THR A N   1 
ATOM   98   C  CA  . THR A  1 19  ? 6.446   21.248  5.878   1.00 48.59  ? 78  THR A CA  1 
ATOM   99   C  C   . THR A  1 19  ? 6.967   21.478  4.476   1.00 49.43  ? 78  THR A C   1 
ATOM   100  O  O   . THR A  1 19  ? 6.494   22.344  3.775   1.00 52.21  ? 78  THR A O   1 
ATOM   101  C  CB  . THR A  1 19  ? 5.099   20.542  5.753   1.00 47.97  ? 78  THR A CB  1 
ATOM   102  O  OG1 . THR A  1 19  ? 4.741   19.917  7.001   1.00 45.69  ? 78  THR A OG1 1 
ATOM   103  C  CG2 . THR A  1 19  ? 5.181   19.476  4.671   1.00 46.48  ? 78  THR A CG2 1 
ATOM   104  N  N   . LEU A  1 20  ? 7.960   20.705  4.073   1.00 48.05  ? 79  LEU A N   1 
ATOM   105  C  CA  . LEU A  1 20  ? 8.453   20.740  2.703   1.00 49.34  ? 79  LEU A CA  1 
ATOM   106  C  C   . LEU A  1 20  ? 8.043   19.419  2.093   1.00 47.87  ? 79  LEU A C   1 
ATOM   107  O  O   . LEU A  1 20  ? 8.248   18.378  2.699   1.00 45.04  ? 79  LEU A O   1 
ATOM   108  C  CB  . LEU A  1 20  ? 9.974   20.846  2.654   1.00 49.56  ? 79  LEU A CB  1 
ATOM   109  C  CG  . LEU A  1 20  ? 10.657  22.101  3.201   1.00 52.61  ? 79  LEU A CG  1 
ATOM   110  C  CD1 . LEU A  1 20  ? 10.170  22.368  4.590   1.00 53.43  ? 79  LEU A CD1 1 
ATOM   111  C  CD2 . LEU A  1 20  ? 12.165  21.936  3.207   1.00 52.67  ? 79  LEU A CD2 1 
ATOM   112  N  N   . THR A  1 21  ? 7.458   19.462  0.898   1.00 49.77  ? 80  THR A N   1 
ATOM   113  C  CA  . THR A  1 21  ? 7.070   18.255  0.198   1.00 48.83  ? 80  THR A CA  1 
ATOM   114  C  C   . THR A  1 21  ? 7.921   18.144  -1.031  1.00 50.49  ? 80  THR A C   1 
ATOM   115  O  O   . THR A  1 21  ? 8.098   19.116  -1.729  1.00 52.74  ? 80  THR A O   1 
ATOM   116  C  CB  . THR A  1 21  ? 5.623   18.296  -0.203  1.00 49.47  ? 80  THR A CB  1 
ATOM   117  O  OG1 . THR A  1 21  ? 4.826   18.449  0.972   1.00 48.68  ? 80  THR A OG1 1 
ATOM   118  C  CG2 . THR A  1 21  ? 5.261   17.007  -0.888  1.00 49.18  ? 80  THR A CG2 1 
ATOM   119  N  N   . THR A  1 22  ? 8.462   16.958  -1.283  1.00 49.85  ? 81  THR A N   1 
ATOM   120  C  CA  . THR A  1 22  ? 9.358   16.766  -2.412  1.00 52.06  ? 81  THR A CA  1 
ATOM   121  C  C   . THR A  1 22  ? 9.301   15.318  -2.866  1.00 51.81  ? 81  THR A C   1 
ATOM   122  O  O   . THR A  1 22  ? 8.718   14.489  -2.181  1.00 50.07  ? 81  THR A O   1 
ATOM   123  C  CB  . THR A  1 22  ? 10.791  17.158  -2.036  1.00 51.52  ? 81  THR A CB  1 
ATOM   124  O  OG1 . THR A  1 22  ? 11.622  17.184  -3.202  1.00 54.15  ? 81  THR A OG1 1 
ATOM   125  C  CG2 . THR A  1 22  ? 11.352  16.201  -1.001  1.00 48.58  ? 81  THR A CG2 1 
ATOM   126  N  N   . LYS A  1 23  ? 9.898   15.030  -4.017  1.00 54.32  ? 82  LYS A N   1 
ATOM   127  C  CA  . LYS A  1 23  ? 9.881   13.692  -4.584  1.00 55.35  ? 82  LYS A CA  1 
ATOM   128  C  C   . LYS A  1 23  ? 11.288  13.146  -4.801  1.00 55.54  ? 82  LYS A C   1 
ATOM   129  O  O   . LYS A  1 23  ? 12.176  13.878  -5.245  1.00 56.82  ? 82  LYS A O   1 
ATOM   130  C  CB  . LYS A  1 23  ? 9.130   13.697  -5.897  1.00 58.73  ? 82  LYS A CB  1 
ATOM   131  C  CG  . LYS A  1 23  ? 7.634   13.775  -5.717  1.00 60.62  ? 82  LYS A CG  1 
ATOM   132  C  CD  . LYS A  1 23  ? 6.982   14.287  -6.989  1.00 66.61  ? 82  LYS A CD  1 
ATOM   133  C  CE  . LYS A  1 23  ? 5.449   14.304  -6.895  1.00 68.53  ? 82  LYS A CE  1 
ATOM   134  N  NZ  . LYS A  1 23  ? 4.782   13.071  -7.455  1.00 69.31  ? 82  LYS A NZ  1 
ATOM   135  N  N   . GLY A  1 24  ? 11.475  11.860  -4.470  1.00 54.50  ? 83  GLY A N   1 
ATOM   136  C  CA  . GLY A  1 24  ? 12.756  11.152  -4.631  1.00 54.61  ? 83  GLY A CA  1 
ATOM   137  C  C   . GLY A  1 24  ? 12.644  9.842   -5.406  1.00 56.29  ? 83  GLY A C   1 
ATOM   138  O  O   . GLY A  1 24  ? 11.622  9.164   -5.351  1.00 55.91  ? 83  GLY A O   1 
ATOM   139  N  N   . LYS A  1 25  ? 13.701  9.486   -6.132  1.00 58.22  ? 84  LYS A N   1 
ATOM   140  C  CA  . LYS A  1 25  ? 13.756  8.204   -6.819  1.00 60.66  ? 84  LYS A CA  1 
ATOM   141  C  C   . LYS A  1 25  ? 13.976  7.098   -5.798  1.00 58.21  ? 84  LYS A C   1 
ATOM   142  O  O   . LYS A  1 25  ? 14.633  7.327   -4.789  1.00 56.63  ? 84  LYS A O   1 
ATOM   143  C  CB  . LYS A  1 25  ? 14.903  8.175   -7.836  1.00 63.82  ? 84  LYS A CB  1 
ATOM   144  C  CG  . LYS A  1 25  ? 14.844  9.257   -8.921  1.00 68.21  ? 84  LYS A CG  1 
ATOM   145  C  CD  . LYS A  1 25  ? 16.238  9.776   -9.330  1.00 70.76  ? 84  LYS A CD  1 
ATOM   146  C  CE  . LYS A  1 25  ? 16.233  10.252  -10.807 1.00 76.11  ? 84  LYS A CE  1 
ATOM   147  N  NZ  . LYS A  1 25  ? 17.561  10.762  -11.278 1.00 77.47  ? 84  LYS A NZ  1 
ATOM   148  N  N   . VAL A  1 26  ? 13.437  5.904   -6.045  1.00 58.80  ? 85  VAL A N   1 
ATOM   149  C  CA  . VAL A  1 26  ? 13.746  4.756   -5.199  1.00 57.05  ? 85  VAL A CA  1 
ATOM   150  C  C   . VAL A  1 26  ? 15.263  4.566   -5.159  1.00 56.54  ? 85  VAL A C   1 
ATOM   151  O  O   . VAL A  1 26  ? 15.987  4.904   -6.113  1.00 58.14  ? 85  VAL A O   1 
ATOM   152  C  CB  . VAL A  1 26  ? 13.040  3.468   -5.683  1.00 59.73  ? 85  VAL A CB  1 
ATOM   153  C  CG1 . VAL A  1 26  ? 13.524  2.234   -4.896  1.00 59.14  ? 85  VAL A CG1 1 
ATOM   154  C  CG2 . VAL A  1 26  ? 11.510  3.612   -5.555  1.00 59.25  ? 85  VAL A CG2 1 
ATOM   155  N  N   . GLY A  1 27  ? 15.748  4.108   -4.010  1.00 53.76  ? 86  GLY A N   1 
ATOM   156  C  CA  . GLY A  1 27  ? 17.182  3.872   -3.817  1.00 53.38  ? 86  GLY A CA  1 
ATOM   157  C  C   . GLY A  1 27  ? 17.999  5.071   -3.369  1.00 51.16  ? 86  GLY A C   1 
ATOM   158  O  O   . GLY A  1 27  ? 19.068  4.910   -2.792  1.00 50.61  ? 86  GLY A O   1 
ATOM   159  N  N   . ASP A  1 28  ? 17.520  6.274   -3.642  1.00 50.22  ? 87  ASP A N   1 
ATOM   160  C  CA  . ASP A  1 28  ? 18.202  7.453   -3.166  1.00 48.61  ? 87  ASP A CA  1 
ATOM   161  C  C   . ASP A  1 28  ? 18.142  7.463   -1.645  1.00 45.19  ? 87  ASP A C   1 
ATOM   162  O  O   . ASP A  1 28  ? 17.164  7.011   -1.035  1.00 43.98  ? 87  ASP A O   1 
ATOM   163  C  CB  . ASP A  1 28  ? 17.554  8.730   -3.719  1.00 49.49  ? 87  ASP A CB  1 
ATOM   164  C  CG  . ASP A  1 28  ? 17.936  9.009   -5.171  1.00 54.93  ? 87  ASP A CG  1 
ATOM   165  O  OD1 . ASP A  1 28  ? 19.110  8.753   -5.556  1.00 57.97  ? 87  ASP A OD1 1 
ATOM   166  O  OD2 . ASP A  1 28  ? 17.064  9.507   -5.924  1.00 57.95  ? 87  ASP A OD2 1 
ATOM   167  N  N   . SER A  1 29  ? 19.193  7.985   -1.041  1.00 43.56  ? 88  SER A N   1 
ATOM   168  C  CA  . SER A  1 29  ? 19.190  8.257   0.371   1.00 41.40  ? 88  SER A CA  1 
ATOM   169  C  C   . SER A  1 29  ? 18.388  9.539   0.632   1.00 40.57  ? 88  SER A C   1 
ATOM   170  O  O   . SER A  1 29  ? 18.081  10.315  -0.276  1.00 41.83  ? 88  SER A O   1 
ATOM   171  C  CB  . SER A  1 29  ? 20.615  8.463   0.864   1.00 41.21  ? 88  SER A CB  1 
ATOM   172  O  OG  . SER A  1 29  ? 20.992  9.833   0.698   1.00 43.91  ? 88  SER A OG  1 
ATOM   173  N  N   . LEU A  1 30  ? 18.082  9.784   1.889   1.00 38.44  ? 89  LEU A N   1 
ATOM   174  C  CA  . LEU A  1 30  ? 17.339  10.962  2.212   1.00 38.01  ? 89  LEU A CA  1 
ATOM   175  C  C   . LEU A  1 30  ? 18.249  12.154  2.135   1.00 38.66  ? 89  LEU A C   1 
ATOM   176  O  O   . LEU A  1 30  ? 17.800  13.224  1.791   1.00 40.13  ? 89  LEU A O   1 
ATOM   177  C  CB  . LEU A  1 30  ? 16.658  10.832  3.564   1.00 36.68  ? 89  LEU A CB  1 
ATOM   178  C  CG  . LEU A  1 30  ? 15.370  10.010  3.500   1.00 35.03  ? 89  LEU A CG  1 
ATOM   179  C  CD1 . LEU A  1 30  ? 15.104  9.497   4.818   1.00 35.04  ? 89  LEU A CD1 1 
ATOM   180  C  CD2 . LEU A  1 30  ? 14.195  10.842  3.069   1.00 35.96  ? 89  LEU A CD2 1 
ATOM   181  N  N   . LEU A  1 31  ? 19.537  11.980  2.404   1.00 38.55  ? 90  LEU A N   1 
ATOM   182  C  CA  . LEU A  1 31  ? 20.514  13.043  2.082   1.00 39.27  ? 90  LEU A CA  1 
ATOM   183  C  C   . LEU A  1 31  ? 20.416  13.342  0.598   1.00 41.94  ? 90  LEU A C   1 
ATOM   184  O  O   . LEU A  1 31  ? 20.351  14.492  0.188   1.00 42.66  ? 90  LEU A O   1 
ATOM   185  C  CB  . LEU A  1 31  ? 21.941  12.598  2.372   1.00 38.30  ? 90  LEU A CB  1 
ATOM   186  C  CG  . LEU A  1 31  ? 23.056  13.551  1.968   1.00 38.61  ? 90  LEU A CG  1 
ATOM   187  C  CD1 . LEU A  1 31  ? 22.945  14.848  2.728   1.00 38.80  ? 90  LEU A CD1 1 
ATOM   188  C  CD2 . LEU A  1 31  ? 24.410  12.923  2.184   1.00 36.01  ? 90  LEU A CD2 1 
ATOM   189  N  N   . ASP A  1 32  ? 20.420  12.285  -0.204  1.00 43.52  ? 91  ASP A N   1 
ATOM   190  C  CA  . ASP A  1 32  ? 20.364  12.455  -1.656  1.00 47.24  ? 91  ASP A CA  1 
ATOM   191  C  C   . ASP A  1 32  ? 19.188  13.375  -1.980  1.00 48.11  ? 91  ASP A C   1 
ATOM   192  O  O   . ASP A  1 32  ? 19.374  14.431  -2.608  1.00 50.05  ? 91  ASP A O   1 
ATOM   193  C  CB  . ASP A  1 32  ? 20.262  11.101  -2.408  1.00 47.97  ? 91  ASP A CB  1 
ATOM   194  C  CG  . ASP A  1 32  ? 21.630  10.414  -2.593  1.00 50.27  ? 91  ASP A CG  1 
ATOM   195  O  OD1 . ASP A  1 32  ? 22.650  10.985  -2.164  1.00 51.88  ? 91  ASP A OD1 1 
ATOM   196  O  OD2 . ASP A  1 32  ? 21.701  9.301   -3.180  1.00 54.72  ? 91  ASP A OD2 1 
ATOM   197  N  N   . VAL A  1 33  ? 18.007  13.005  -1.474  1.00 46.77  ? 92  VAL A N   1 
ATOM   198  C  CA  . VAL A  1 33  ? 16.791  13.794  -1.691  1.00 47.27  ? 92  VAL A CA  1 
ATOM   199  C  C   . VAL A  1 33  ? 16.949  15.255  -1.279  1.00 48.12  ? 92  VAL A C   1 
ATOM   200  O  O   . VAL A  1 33  ? 16.732  16.153  -2.089  1.00 51.15  ? 92  VAL A O   1 
ATOM   201  C  CB  . VAL A  1 33  ? 15.592  13.229  -0.947  1.00 45.08  ? 92  VAL A CB  1 
ATOM   202  C  CG1 . VAL A  1 33  ? 14.425  14.161  -1.145  1.00 45.44  ? 92  VAL A CG1 1 
ATOM   203  C  CG2 . VAL A  1 33  ? 15.270  11.825  -1.451  1.00 43.64  ? 92  VAL A CG2 1 
ATOM   204  N  N   . VAL A  1 34  ? 17.346  15.484  -0.035  1.00 46.43  ? 93  VAL A N   1 
ATOM   205  C  CA  . VAL A  1 34  ? 17.563  16.837  0.458   1.00 47.24  ? 93  VAL A CA  1 
ATOM   206  C  C   . VAL A  1 34  ? 18.430  17.639  -0.507  1.00 50.64  ? 93  VAL A C   1 
ATOM   207  O  O   . VAL A  1 34  ? 18.052  18.727  -0.922  1.00 52.54  ? 93  VAL A O   1 
ATOM   208  C  CB  . VAL A  1 34  ? 18.246  16.827  1.842   1.00 45.57  ? 93  VAL A CB  1 
ATOM   209  C  CG1 . VAL A  1 34  ? 18.764  18.251  2.212   1.00 45.68  ? 93  VAL A CG1 1 
ATOM   210  C  CG2 . VAL A  1 34  ? 17.306  16.246  2.901   1.00 41.66  ? 93  VAL A CG2 1 
ATOM   211  N  N   . VAL A  1 35  ? 19.582  17.081  -0.863  1.00 51.82  ? 94  VAL A N   1 
ATOM   212  C  CA  . VAL A  1 35  ? 20.550  17.781  -1.685  1.00 55.52  ? 94  VAL A CA  1 
ATOM   213  C  C   . VAL A  1 35  ? 20.036  18.015  -3.101  1.00 59.83  ? 94  VAL A C   1 
ATOM   214  O  O   . VAL A  1 35  ? 19.933  19.161  -3.526  1.00 62.46  ? 94  VAL A O   1 
ATOM   215  C  CB  . VAL A  1 35  ? 21.879  17.033  -1.758  1.00 55.19  ? 94  VAL A CB  1 
ATOM   216  C  CG1 . VAL A  1 35  ? 22.738  17.572  -2.889  1.00 56.73  ? 94  VAL A CG1 1 
ATOM   217  C  CG2 . VAL A  1 35  ? 22.588  17.122  -0.417  1.00 52.96  ? 94  VAL A CG2 1 
ATOM   218  N  N   . GLU A  1 36  ? 19.692  16.938  -3.811  1.00 61.26  ? 95  GLU A N   1 
ATOM   219  C  CA  . GLU A  1 36  ? 19.215  17.035  -5.204  1.00 65.46  ? 95  GLU A CA  1 
ATOM   220  C  C   . GLU A  1 36  ? 18.032  18.010  -5.401  1.00 67.22  ? 95  GLU A C   1 
ATOM   221  O  O   . GLU A  1 36  ? 17.928  18.636  -6.438  1.00 70.31  ? 95  GLU A O   1 
ATOM   222  C  CB  . GLU A  1 36  ? 18.866  15.644  -5.762  1.00 65.62  ? 95  GLU A CB  1 
ATOM   223  C  CG  . GLU A  1 36  ? 20.079  14.752  -6.115  1.00 68.08  ? 95  GLU A CG  1 
ATOM   224  C  CD  . GLU A  1 36  ? 19.715  13.585  -7.054  1.00 73.76  ? 95  GLU A CD  1 
ATOM   225  O  OE1 . GLU A  1 36  ? 19.644  13.794  -8.296  1.00 78.70  ? 95  GLU A OE1 1 
ATOM   226  O  OE2 . GLU A  1 36  ? 19.506  12.447  -6.553  1.00 75.26  ? 95  GLU A OE2 1 
ATOM   227  N  N   . ASN A  1 37  ? 17.158  18.150  -4.407  1.00 65.92  ? 96  ASN A N   1 
ATOM   228  C  CA  . ASN A  1 37  ? 16.033  19.105  -4.490  1.00 67.74  ? 96  ASN A CA  1 
ATOM   229  C  C   . ASN A  1 37  ? 16.237  20.439  -3.714  1.00 68.71  ? 96  ASN A C   1 
ATOM   230  O  O   . ASN A  1 37  ? 15.279  21.184  -3.497  1.00 69.32  ? 96  ASN A O   1 
ATOM   231  C  CB  . ASN A  1 37  ? 14.734  18.427  -4.014  1.00 65.64  ? 96  ASN A CB  1 
ATOM   232  C  CG  . ASN A  1 37  ? 14.401  17.176  -4.797  1.00 65.42  ? 96  ASN A CG  1 
ATOM   233  O  OD1 . ASN A  1 37  ? 14.145  16.136  -4.208  1.00 63.62  ? 96  ASN A OD1 1 
ATOM   234  N  ND2 . ASN A  1 37  ? 14.396  17.270  -6.123  1.00 68.55  ? 96  ASN A ND2 1 
ATOM   235  N  N   . ASN A  1 38  ? 17.464  20.745  -3.294  1.00 69.02  ? 97  ASN A N   1 
ATOM   236  C  CA  . ASN A  1 38  ? 17.766  22.048  -2.682  1.00 70.73  ? 97  ASN A CA  1 
ATOM   237  C  C   . ASN A  1 38  ? 16.767  22.456  -1.610  1.00 69.49  ? 97  ASN A C   1 
ATOM   238  O  O   . ASN A  1 38  ? 16.211  23.550  -1.644  1.00 71.39  ? 97  ASN A O   1 
ATOM   239  C  CB  . ASN A  1 38  ? 17.810  23.147  -3.749  1.00 75.25  ? 97  ASN A CB  1 
ATOM   240  C  CG  . ASN A  1 38  ? 18.878  22.906  -4.785  1.00 78.15  ? 97  ASN A CG  1 
ATOM   241  O  OD1 . ASN A  1 38  ? 18.764  22.001  -5.622  1.00 78.86  ? 97  ASN A OD1 1 
ATOM   242  N  ND2 . ASN A  1 38  ? 19.930  23.719  -4.741  1.00 81.15  ? 97  ASN A ND2 1 
ATOM   243  N  N   . LEU A  1 39  ? 16.526  21.572  -0.658  1.00 66.43  ? 98  LEU A N   1 
ATOM   244  C  CA  . LEU A  1 39  ? 15.601  21.908  0.409   1.00 65.68  ? 98  LEU A CA  1 
ATOM   245  C  C   . LEU A  1 39  ? 16.341  22.823  1.354   1.00 66.59  ? 98  LEU A C   1 
ATOM   246  O  O   . LEU A  1 39  ? 17.461  22.512  1.753   1.00 66.44  ? 98  LEU A O   1 
ATOM   247  C  CB  . LEU A  1 39  ? 15.138  20.669  1.156   1.00 62.05  ? 98  LEU A CB  1 
ATOM   248  C  CG  . LEU A  1 39  ? 14.620  19.506  0.308   1.00 61.26  ? 98  LEU A CG  1 
ATOM   249  C  CD1 . LEU A  1 39  ? 14.026  18.476  1.268   1.00 57.46  ? 98  LEU A CD1 1 
ATOM   250  C  CD2 . LEU A  1 39  ? 13.610  19.946  -0.762  1.00 61.71  ? 98  LEU A CD2 1 
ATOM   251  N  N   . ASP A  1 40  ? 15.737  23.953  1.703   1.00 68.23  ? 99  ASP A N   1 
ATOM   252  C  CA  . ASP A  1 40  ? 16.396  24.882  2.599   1.00 69.24  ? 99  ASP A CA  1 
ATOM   253  C  C   . ASP A  1 40  ? 16.431  24.267  4.009   1.00 66.09  ? 99  ASP A C   1 
ATOM   254  O  O   . ASP A  1 40  ? 15.504  24.461  4.818   1.00 65.72  ? 99  ASP A O   1 
ATOM   255  C  CB  . ASP A  1 40  ? 15.706  26.257  2.579   1.00 72.76  ? 99  ASP A CB  1 
ATOM   256  C  CG  . ASP A  1 40  ? 16.668  27.415  2.913   1.00 76.87  ? 99  ASP A CG  1 
ATOM   257  O  OD1 . ASP A  1 40  ? 17.909  27.210  2.932   1.00 77.31  ? 99  ASP A OD1 1 
ATOM   258  O  OD2 . ASP A  1 40  ? 16.179  28.545  3.147   1.00 81.19  ? 99  ASP A OD2 1 
ATOM   259  N  N   . ILE A  1 41  ? 17.489  23.490  4.272   1.00 63.53  ? 100 ILE A N   1 
ATOM   260  C  CA  . ILE A  1 41  ? 17.760  22.937  5.604   1.00 60.83  ? 100 ILE A CA  1 
ATOM   261  C  C   . ILE A  1 41  ? 19.208  23.289  5.923   1.00 61.32  ? 100 ILE A C   1 
ATOM   262  O  O   . ILE A  1 41  ? 20.104  22.768  5.300   1.00 61.55  ? 100 ILE A O   1 
ATOM   263  C  CB  . ILE A  1 41  ? 17.558  21.387  5.644   1.00 57.36  ? 100 ILE A CB  1 
ATOM   264  C  CG1 . ILE A  1 41  ? 16.150  21.006  5.206   1.00 56.09  ? 100 ILE A CG1 1 
ATOM   265  C  CG2 . ILE A  1 41  ? 17.740  20.835  7.065   1.00 55.75  ? 100 ILE A CG2 1 
ATOM   266  C  CD1 . ILE A  1 41  ? 16.076  19.671  4.566   1.00 52.87  ? 100 ILE A CD1 1 
ATOM   267  N  N   . ASP A  1 42  ? 19.449  24.192  6.860   1.00 62.31  ? 101 ASP A N   1 
ATOM   268  C  CA  . ASP A  1 42  ? 20.819  24.666  7.092   1.00 63.37  ? 101 ASP A CA  1 
ATOM   269  C  C   . ASP A  1 42  ? 21.766  23.532  7.506   1.00 59.67  ? 101 ASP A C   1 
ATOM   270  O  O   . ASP A  1 42  ? 21.498  22.820  8.459   1.00 58.20  ? 101 ASP A O   1 
ATOM   271  C  CB  . ASP A  1 42  ? 20.855  25.770  8.167   1.00 65.89  ? 101 ASP A CB  1 
ATOM   272  C  CG  . ASP A  1 42  ? 20.168  27.064  7.722   1.00 71.18  ? 101 ASP A CG  1 
ATOM   273  O  OD1 . ASP A  1 42  ? 19.436  27.057  6.697   1.00 73.31  ? 101 ASP A OD1 1 
ATOM   274  O  OD2 . ASP A  1 42  ? 20.353  28.095  8.412   1.00 74.51  ? 101 ASP A OD2 1 
ATOM   275  N  N   . GLY A  1 43  ? 22.869  23.367  6.785   1.00 58.47  ? 102 GLY A N   1 
ATOM   276  C  CA  . GLY A  1 43  ? 23.988  22.550  7.265   1.00 55.88  ? 102 GLY A CA  1 
ATOM   277  C  C   . GLY A  1 43  ? 23.835  21.035  7.206   1.00 51.80  ? 102 GLY A C   1 
ATOM   278  O  O   . GLY A  1 43  ? 24.673  20.318  7.727   1.00 50.51  ? 102 GLY A O   1 
ATOM   279  N  N   . PHE A  1 44  ? 22.793  20.556  6.542   1.00 49.40  ? 103 PHE A N   1 
ATOM   280  C  CA  . PHE A  1 44  ? 22.420  19.153  6.556   1.00 46.06  ? 103 PHE A CA  1 
ATOM   281  C  C   . PHE A  1 44  ? 23.334  18.341  5.646   1.00 45.12  ? 103 PHE A C   1 
ATOM   282  O  O   . PHE A  1 44  ? 23.414  18.613  4.461   1.00 46.55  ? 103 PHE A O   1 
ATOM   283  C  CB  . PHE A  1 44  ? 20.983  19.068  6.070   1.00 45.79  ? 103 PHE A CB  1 
ATOM   284  C  CG  . PHE A  1 44  ? 20.361  17.732  6.206   1.00 41.53  ? 103 PHE A CG  1 
ATOM   285  C  CD1 . PHE A  1 44  ? 19.695  17.383  7.365   1.00 39.45  ? 103 PHE A CD1 1 
ATOM   286  C  CD2 . PHE A  1 44  ? 20.380  16.841  5.163   1.00 41.37  ? 103 PHE A CD2 1 
ATOM   287  C  CE1 . PHE A  1 44  ? 19.076  16.156  7.487   1.00 36.86  ? 103 PHE A CE1 1 
ATOM   288  C  CE2 . PHE A  1 44  ? 19.766  15.578  5.304   1.00 39.39  ? 103 PHE A CE2 1 
ATOM   289  C  CZ  . PHE A  1 44  ? 19.120  15.256  6.456   1.00 35.37  ? 103 PHE A CZ  1 
ATOM   290  N  N   . GLY A  1 45  ? 24.048  17.371  6.204   1.00 42.88  ? 104 GLY A N   1 
ATOM   291  C  CA  . GLY A  1 45  ? 24.947  16.517  5.412   1.00 42.09  ? 104 GLY A CA  1 
ATOM   292  C  C   . GLY A  1 45  ? 26.330  17.076  5.079   1.00 43.07  ? 104 GLY A C   1 
ATOM   293  O  O   . GLY A  1 45  ? 26.792  16.935  3.953   1.00 43.78  ? 104 GLY A O   1 
ATOM   294  N  N   . ALA A  1 46  ? 26.981  17.701  6.061   1.00 42.90  ? 105 ALA A N   1 
ATOM   295  C  CA  . ALA A  1 46  ? 28.362  18.157  5.952   1.00 44.00  ? 105 ALA A CA  1 
ATOM   296  C  C   . ALA A  1 46  ? 29.359  17.160  5.339   1.00 44.00  ? 105 ALA A C   1 
ATOM   297  O  O   . ALA A  1 46  ? 30.114  17.529  4.432   1.00 45.46  ? 105 ALA A O   1 
ATOM   298  C  CB  . ALA A  1 46  ? 28.850  18.567  7.290   1.00 43.72  ? 105 ALA A CB  1 
ATOM   299  N  N   . CYS A  1 47  ? 29.354  15.908  5.798   1.00 42.79  ? 106 CYS A N   1 
ATOM   300  C  CA  . CYS A  1 47  ? 30.350  14.921  5.363   1.00 43.80  ? 106 CYS A CA  1 
ATOM   301  C  C   . CYS A  1 47  ? 30.018  14.259  4.030   1.00 44.76  ? 106 CYS A C   1 
ATOM   302  O  O   . CYS A  1 47  ? 30.737  13.370  3.584   1.00 44.67  ? 106 CYS A O   1 
ATOM   303  C  CB  . CYS A  1 47  ? 30.543  13.837  6.418   1.00 42.40  ? 106 CYS A CB  1 
ATOM   304  S  SG  . CYS A  1 47  ? 29.300  12.555  6.423   1.00 44.00  ? 106 CYS A SG  1 
ATOM   305  N  N   . GLU A  1 48  ? 28.915  14.692  3.419   1.00 45.91  ? 107 GLU A N   1 
ATOM   306  C  CA  . GLU A  1 48  ? 28.484  14.239  2.108   1.00 47.45  ? 107 GLU A CA  1 
ATOM   307  C  C   . GLU A  1 48  ? 28.199  12.733  2.115   1.00 46.14  ? 107 GLU A C   1 
ATOM   308  O  O   . GLU A  1 48  ? 28.358  12.035  1.115   1.00 46.55  ? 107 GLU A O   1 
ATOM   309  C  CB  . GLU A  1 48  ? 29.479  14.673  1.003   1.00 50.32  ? 107 GLU A CB  1 
ATOM   310  C  CG  . GLU A  1 48  ? 29.540  16.200  0.768   1.00 53.34  ? 107 GLU A CG  1 
ATOM   311  C  CD  . GLU A  1 48  ? 30.557  16.620  -0.307  1.00 57.72  ? 107 GLU A CD  1 
ATOM   312  O  OE1 . GLU A  1 48  ? 31.774  16.499  -0.061  1.00 59.34  ? 107 GLU A OE1 1 
ATOM   313  O  OE2 . GLU A  1 48  ? 30.146  17.103  -1.390  1.00 61.22  ? 107 GLU A OE2 1 
ATOM   314  N  N   . GLY A  1 49  ? 27.750  12.253  3.266   1.00 44.72  ? 108 GLY A N   1 
ATOM   315  C  CA  . GLY A  1 49  ? 27.247  10.887  3.384   1.00 43.84  ? 108 GLY A CA  1 
ATOM   316  C  C   . GLY A  1 49  ? 28.371  9.882   3.432   1.00 44.08  ? 108 GLY A C   1 
ATOM   317  O  O   . GLY A  1 49  ? 28.356  8.908   2.697   1.00 44.01  ? 108 GLY A O   1 
ATOM   318  N  N   . THR A  1 50  ? 29.343  10.127  4.307   1.00 43.91  ? 109 THR A N   1 
ATOM   319  C  CA  . THR A  1 50  ? 30.468  9.216   4.484   1.00 44.36  ? 109 THR A CA  1 
ATOM   320  C  C   . THR A  1 50  ? 30.581  8.794   5.956   1.00 43.64  ? 109 THR A C   1 
ATOM   321  O  O   . THR A  1 50  ? 31.673  8.464   6.440   1.00 44.65  ? 109 THR A O   1 
ATOM   322  C  CB  . THR A  1 50  ? 31.761  9.881   4.007   1.00 45.82  ? 109 THR A CB  1 
ATOM   323  O  OG1 . THR A  1 50  ? 31.931  11.138  4.687   1.00 46.10  ? 109 THR A OG1 1 
ATOM   324  C  CG2 . THR A  1 50  ? 31.680  10.153  2.510   1.00 46.48  ? 109 THR A CG2 1 
ATOM   325  N  N   . LEU A  1 51  ? 29.438  8.787   6.648   1.00 42.07  ? 110 LEU A N   1 
ATOM   326  C  CA  . LEU A  1 51  ? 29.357  8.391   8.043   1.00 41.11  ? 110 LEU A CA  1 
ATOM   327  C  C   . LEU A  1 51  ? 30.503  8.973   8.815   1.00 42.04  ? 110 LEU A C   1 
ATOM   328  O  O   . LEU A  1 51  ? 31.404  8.276   9.296   1.00 43.11  ? 110 LEU A O   1 
ATOM   329  C  CB  . LEU A  1 51  ? 29.311  6.879   8.189   1.00 40.76  ? 110 LEU A CB  1 
ATOM   330  C  CG  . LEU A  1 51  ? 27.890  6.327   8.147   1.00 40.03  ? 110 LEU A CG  1 
ATOM   331  C  CD1 . LEU A  1 51  ? 27.911  4.809   8.290   1.00 40.48  ? 110 LEU A CD1 1 
ATOM   332  C  CD2 . LEU A  1 51  ? 27.005  6.951   9.221   1.00 37.20  ? 110 LEU A CD2 1 
ATOM   333  N  N   . ALA A  1 52  ? 30.460  10.288  8.891   1.00 42.35  ? 111 ALA A N   1 
ATOM   334  C  CA  . ALA A  1 52  ? 31.476  11.041  9.548   1.00 42.79  ? 111 ALA A CA  1 
ATOM   335  C  C   . ALA A  1 52  ? 30.958  12.336  10.117  1.00 42.92  ? 111 ALA A C   1 
ATOM   336  O  O   . ALA A  1 52  ? 31.758  13.184  10.441  1.00 45.46  ? 111 ALA A O   1 
ATOM   337  C  CB  . ALA A  1 52  ? 32.593  11.301  8.607   1.00 43.39  ? 111 ALA A CB  1 
ATOM   338  N  N   . CYS A  1 53  ? 29.649  12.498  10.253  1.00 41.61  ? 112 CYS A N   1 
ATOM   339  C  CA  . CYS A  1 53  ? 29.088  13.639  10.972  1.00 42.12  ? 112 CYS A CA  1 
ATOM   340  C  C   . CYS A  1 53  ? 27.756  13.219  11.502  1.00 40.95  ? 112 CYS A C   1 
ATOM   341  O  O   . CYS A  1 53  ? 27.344  12.070  11.296  1.00 40.10  ? 112 CYS A O   1 
ATOM   342  C  CB  . CYS A  1 53  ? 28.928  14.851  10.043  1.00 43.30  ? 112 CYS A CB  1 
ATOM   343  S  SG  . CYS A  1 53  ? 27.752  14.676  8.691   1.00 43.68  ? 112 CYS A SG  1 
ATOM   344  N  N   . SER A  1 54  ? 27.052  14.112  12.168  1.00 41.24  ? 113 SER A N   1 
ATOM   345  C  CA  . SER A  1 54  ? 25.715  13.741  12.582  1.00 41.31  ? 113 SER A CA  1 
ATOM   346  C  C   . SER A  1 54  ? 24.647  14.630  11.970  1.00 41.79  ? 113 SER A C   1 
ATOM   347  O  O   . SER A  1 54  ? 23.461  14.464  12.230  1.00 41.83  ? 113 SER A O   1 
ATOM   348  C  CB  . SER A  1 54  ? 25.650  13.692  14.086  1.00 42.27  ? 113 SER A CB  1 
ATOM   349  O  OG  . SER A  1 54  ? 26.719  12.878  14.571  1.00 44.11  ? 113 SER A OG  1 
ATOM   350  N  N   . THR A  1 55  ? 25.069  15.487  11.052  1.00 32.36  ? 114 THR A N   1 
ATOM   351  C  CA  . THR A  1 55  ? 24.240  16.543  10.505  1.00 32.64  ? 114 THR A CA  1 
ATOM   352  C  C   . THR A  1 55  ? 23.025  16.034  9.706   1.00 33.76  ? 114 THR A C   1 
ATOM   353  O  O   . THR A  1 55  ? 22.027  16.766  9.583   1.00 34.26  ? 114 THR A O   1 
ATOM   354  C  CB  . THR A  1 55  ? 25.085  17.473  9.646   1.00 34.39  ? 114 THR A CB  1 
ATOM   355  O  OG1 . THR A  1 55  ? 25.569  16.758  8.510   1.00 37.45  ? 114 THR A OG1 1 
ATOM   356  C  CG2 . THR A  1 55  ? 26.291  18.003  10.448  1.00 32.22  ? 114 THR A CG2 1 
ATOM   357  N  N   . CYS A  1 56  ? 23.062  14.783  9.223   1.00 33.77  ? 115 CYS A N   1 
ATOM   358  C  CA  . CYS A  1 56  ? 21.936  14.223  8.468   1.00 34.10  ? 115 CYS A CA  1 
ATOM   359  C  C   . CYS A  1 56  ? 20.888  13.559  9.337   1.00 32.14  ? 115 CYS A C   1 
ATOM   360  O  O   . CYS A  1 56  ? 20.089  12.780  8.849   1.00 32.57  ? 115 CYS A O   1 
ATOM   361  C  CB  . CYS A  1 56  ? 22.416  13.216  7.403   1.00 36.55  ? 115 CYS A CB  1 
ATOM   362  S  SG  . CYS A  1 56  ? 23.317  11.767  7.992   1.00 37.00  ? 115 CYS A SG  1 
ATOM   363  N  N   . HIS A  1 57  ? 20.896  13.885  10.620  1.00 30.40  ? 116 HIS A N   1 
ATOM   364  C  CA  . HIS A  1 57  ? 20.006  13.322  11.604  1.00 28.30  ? 116 HIS A CA  1 
ATOM   365  C  C   . HIS A  1 57  ? 18.557  13.593  11.257  1.00 28.53  ? 116 HIS A C   1 
ATOM   366  O  O   . HIS A  1 57  ? 18.190  14.734  11.018  1.00 30.13  ? 116 HIS A O   1 
ATOM   367  C  CB  . HIS A  1 57  ? 20.372  13.968  12.945  1.00 27.26  ? 116 HIS A CB  1 
ATOM   368  C  CG  . HIS A  1 57  ? 19.548  13.512  14.110  1.00 25.56  ? 116 HIS A CG  1 
ATOM   369  N  ND1 . HIS A  1 57  ? 19.555  14.179  15.316  1.00 25.96  ? 116 HIS A ND1 1 
ATOM   370  C  CD2 . HIS A  1 57  ? 18.687  12.479  14.258  1.00 26.84  ? 116 HIS A CD2 1 
ATOM   371  C  CE1 . HIS A  1 57  ? 18.731  13.580  16.160  1.00 27.43  ? 116 HIS A CE1 1 
ATOM   372  N  NE2 . HIS A  1 57  ? 18.184  12.545  15.538  1.00 29.55  ? 116 HIS A NE2 1 
ATOM   373  N  N   . LEU A  1 58  ? 17.715  12.565  11.233  1.00 27.88  ? 117 LEU A N   1 
ATOM   374  C  CA  . LEU A  1 58  ? 16.289  12.782  10.974  1.00 27.54  ? 117 LEU A CA  1 
ATOM   375  C  C   . LEU A  1 58  ? 15.441  11.961  11.924  1.00 26.79  ? 117 LEU A C   1 
ATOM   376  O  O   . LEU A  1 58  ? 15.874  10.939  12.429  1.00 27.60  ? 117 LEU A O   1 
ATOM   377  C  CB  . LEU A  1 58  ? 15.961  12.392  9.528   1.00 28.88  ? 117 LEU A CB  1 
ATOM   378  C  CG  . LEU A  1 58  ? 16.399  13.349  8.420   1.00 30.15  ? 117 LEU A CG  1 
ATOM   379  C  CD1 . LEU A  1 58  ? 16.302  12.714  7.080   1.00 28.85  ? 117 LEU A CD1 1 
ATOM   380  C  CD2 . LEU A  1 58  ? 15.521  14.604  8.476   1.00 30.79  ? 117 LEU A CD2 1 
ATOM   381  N  N   . ILE A  1 59  ? 14.221  12.401  12.162  1.00 26.59  ? 118 ILE A N   1 
ATOM   382  C  CA  . ILE A  1 59  ? 13.274  11.664  12.981  1.00 25.96  ? 118 ILE A CA  1 
ATOM   383  C  C   . ILE A  1 59  ? 12.154  11.037  12.143  1.00 26.00  ? 118 ILE A C   1 
ATOM   384  O  O   . ILE A  1 59  ? 11.520  11.707  11.360  1.00 27.54  ? 118 ILE A O   1 
ATOM   385  C  CB  . ILE A  1 59  ? 12.680  12.575  14.006  1.00 25.75  ? 118 ILE A CB  1 
ATOM   386  C  CG1 . ILE A  1 59  ? 13.822  13.241  14.784  1.00 26.50  ? 118 ILE A CG1 1 
ATOM   387  C  CG2 . ILE A  1 59  ? 11.789  11.784  14.945  1.00 25.50  ? 118 ILE A CG2 1 
ATOM   388  C  CD1 . ILE A  1 59  ? 13.386  13.951  16.067  1.00 25.98  ? 118 ILE A CD1 1 
ATOM   389  N  N   . PHE A  1 60  ? 11.896  9.755   12.330  1.00 25.79  ? 119 PHE A N   1 
ATOM   390  C  CA  . PHE A  1 60  ? 10.983  9.036   11.483  1.00 26.42  ? 119 PHE A CA  1 
ATOM   391  C  C   . PHE A  1 60  ? 9.702   8.735   12.185  1.00 27.39  ? 119 PHE A C   1 
ATOM   392  O  O   . PHE A  1 60  ? 9.655   8.821   13.392  1.00 27.12  ? 119 PHE A O   1 
ATOM   393  C  CB  . PHE A  1 60  ? 11.640  7.771   10.990  1.00 26.43  ? 119 PHE A CB  1 
ATOM   394  C  CG  . PHE A  1 60  ? 12.849  8.026   10.138  1.00 25.75  ? 119 PHE A CG  1 
ATOM   395  C  CD1 . PHE A  1 60  ? 12.768  7.960   8.764   1.00 29.91  ? 119 PHE A CD1 1 
ATOM   396  C  CD2 . PHE A  1 60  ? 14.046  8.354   10.715  1.00 26.12  ? 119 PHE A CD2 1 
ATOM   397  C  CE1 . PHE A  1 60  ? 13.887  8.179   7.958   1.00 31.72  ? 119 PHE A CE1 1 
ATOM   398  C  CE2 . PHE A  1 60  ? 15.166  8.585   9.946   1.00 27.39  ? 119 PHE A CE2 1 
ATOM   399  C  CZ  . PHE A  1 60  ? 15.090  8.510   8.555   1.00 30.34  ? 119 PHE A CZ  1 
ATOM   400  N  N   . GLU A  1 61  ? 8.651   8.440   11.416  1.00 29.45  ? 120 GLU A N   1 
ATOM   401  C  CA  . GLU A  1 61  ? 7.398   7.931   11.972  1.00 31.68  ? 120 GLU A CA  1 
ATOM   402  C  C   . GLU A  1 61  ? 7.583   6.512   12.575  1.00 31.98  ? 120 GLU A C   1 
ATOM   403  O  O   . GLU A  1 61  ? 8.340   5.709   12.063  1.00 31.14  ? 120 GLU A O   1 
ATOM   404  C  CB  . GLU A  1 61  ? 6.290   7.909   10.906  1.00 33.48  ? 120 GLU A CB  1 
ATOM   405  C  CG  . GLU A  1 61  ? 5.784   9.295   10.453  1.00 36.55  ? 120 GLU A CG  1 
ATOM   406  C  CD  . GLU A  1 61  ? 4.901   9.268   9.172   1.00 40.75  ? 120 GLU A CD  1 
ATOM   407  O  OE1 . GLU A  1 61  ? 3.671   9.394   9.330   1.00 45.16  ? 120 GLU A OE1 1 
ATOM   408  O  OE2 . GLU A  1 61  ? 5.415   9.137   8.019   1.00 41.07  ? 120 GLU A OE2 1 
ATOM   409  N  N   . ASP A  1 62  ? 6.864   6.226   13.656  1.00 33.16  ? 121 ASP A N   1 
ATOM   410  C  CA  . ASP A  1 62  ? 6.929   4.933   14.324  1.00 34.25  ? 121 ASP A CA  1 
ATOM   411  C  C   . ASP A  1 62  ? 7.043   3.743   13.366  1.00 33.76  ? 121 ASP A C   1 
ATOM   412  O  O   . ASP A  1 62  ? 7.989   2.983   13.384  1.00 33.72  ? 121 ASP A O   1 
ATOM   413  C  CB  . ASP A  1 62  ? 5.676   4.738   15.177  1.00 36.08  ? 121 ASP A CB  1 
ATOM   414  C  CG  . ASP A  1 62  ? 5.544   5.756   16.285  1.00 39.47  ? 121 ASP A CG  1 
ATOM   415  O  OD1 . ASP A  1 62  ? 4.392   6.004   16.706  1.00 45.53  ? 121 ASP A OD1 1 
ATOM   416  O  OD2 . ASP A  1 62  ? 6.570   6.325   16.745  1.00 45.56  ? 121 ASP A OD2 1 
ATOM   417  N  N   . HIS A  1 63  ? 6.050   3.581   12.523  1.00 34.46  ? 122 HIS A N   1 
ATOM   418  C  CA  . HIS A  1 63  ? 5.977   2.414   11.671  1.00 34.32  ? 122 HIS A CA  1 
ATOM   419  C  C   . HIS A  1 63  ? 7.090   2.321   10.639  1.00 32.70  ? 122 HIS A C   1 
ATOM   420  O  O   . HIS A  1 63  ? 7.604   1.226   10.382  1.00 33.72  ? 122 HIS A O   1 
ATOM   421  C  CB  . HIS A  1 63  ? 4.602   2.300   11.032  1.00 35.83  ? 122 HIS A CB  1 
ATOM   422  C  CG  . HIS A  1 63  ? 4.209   3.459   10.169  1.00 38.28  ? 122 HIS A CG  1 
ATOM   423  N  ND1 . HIS A  1 63  ? 3.675   4.619   10.685  1.00 39.51  ? 122 HIS A ND1 1 
ATOM   424  C  CD2 . HIS A  1 63  ? 4.202   3.608   8.817   1.00 40.48  ? 122 HIS A CD2 1 
ATOM   425  C  CE1 . HIS A  1 63  ? 3.399   5.450   9.693   1.00 40.84  ? 122 HIS A CE1 1 
ATOM   426  N  NE2 . HIS A  1 63  ? 3.704   4.861   8.550   1.00 40.02  ? 122 HIS A NE2 1 
ATOM   427  N  N   . ILE A  1 64  ? 7.500   3.445   10.075  1.00 30.39  ? 123 ILE A N   1 
ATOM   428  C  CA  . ILE A  1 64  ? 8.584   3.421   9.126   1.00 29.72  ? 123 ILE A CA  1 
ATOM   429  C  C   . ILE A  1 64  ? 9.861   3.063   9.839   1.00 29.05  ? 123 ILE A C   1 
ATOM   430  O  O   . ILE A  1 64  ? 10.618  2.235   9.388   1.00 30.98  ? 123 ILE A O   1 
ATOM   431  C  CB  . ILE A  1 64  ? 8.773   4.769   8.462   1.00 29.32  ? 123 ILE A CB  1 
ATOM   432  C  CG1 . ILE A  1 64  ? 7.520   5.155   7.653   1.00 30.98  ? 123 ILE A CG1 1 
ATOM   433  C  CG2 . ILE A  1 64  ? 10.007  4.763   7.580   1.00 28.90  ? 123 ILE A CG2 1 
ATOM   434  C  CD1 . ILE A  1 64  ? 7.043   4.148   6.602   1.00 28.93  ? 123 ILE A CD1 1 
ATOM   435  N  N   . TYR A  1 65  ? 10.101  3.690   10.965  1.00 27.84  ? 124 TYR A N   1 
ATOM   436  C  CA  . TYR A  1 65  ? 11.318  3.469   11.732  1.00 27.66  ? 124 TYR A CA  1 
ATOM   437  C  C   . TYR A  1 65  ? 11.601  2.014   12.017  1.00 28.78  ? 124 TYR A C   1 
ATOM   438  O  O   . TYR A  1 65  ? 12.706  1.543   11.814  1.00 28.25  ? 124 TYR A O   1 
ATOM   439  C  CB  . TYR A  1 65  ? 11.210  4.188   13.073  1.00 26.73  ? 124 TYR A CB  1 
ATOM   440  C  CG  . TYR A  1 65  ? 12.393  3.980   13.985  1.00 26.16  ? 124 TYR A CG  1 
ATOM   441  C  CD1 . TYR A  1 65  ? 13.587  4.657   13.797  1.00 23.40  ? 124 TYR A CD1 1 
ATOM   442  C  CD2 . TYR A  1 65  ? 12.298  3.110   15.059  1.00 25.68  ? 124 TYR A CD2 1 
ATOM   443  C  CE1 . TYR A  1 65  ? 14.643  4.436   14.668  1.00 23.96  ? 124 TYR A CE1 1 
ATOM   444  C  CE2 . TYR A  1 65  ? 13.306  2.894   15.900  1.00 23.68  ? 124 TYR A CE2 1 
ATOM   445  C  CZ  . TYR A  1 65  ? 14.477  3.540   15.739  1.00 25.52  ? 124 TYR A CZ  1 
ATOM   446  O  OH  . TYR A  1 65  ? 15.467  3.281   16.689  1.00 24.43  ? 124 TYR A OH  1 
ATOM   447  N  N   . GLU A  1 66  ? 10.576  1.325   12.496  1.00 30.34  ? 125 GLU A N   1 
ATOM   448  C  CA  . GLU A  1 66  ? 10.679  -0.067  12.892  1.00 32.53  ? 125 GLU A CA  1 
ATOM   449  C  C   . GLU A  1 66  ? 11.234  -0.981  11.828  1.00 33.65  ? 125 GLU A C   1 
ATOM   450  O  O   . GLU A  1 66  ? 11.941  -1.922  12.171  1.00 34.52  ? 125 GLU A O   1 
ATOM   451  C  CB  . GLU A  1 66  ? 9.297   -0.591  13.327  1.00 34.01  ? 125 GLU A CB  1 
ATOM   452  C  CG  . GLU A  1 66  ? 9.307   -1.990  13.886  1.00 35.87  ? 125 GLU A CG  1 
ATOM   453  C  CD  . GLU A  1 66  ? 7.940   -2.465  14.351  1.00 39.91  ? 125 GLU A CD  1 
ATOM   454  O  OE1 . GLU A  1 66  ? 7.898   -3.319  15.283  1.00 45.02  ? 125 GLU A OE1 1 
ATOM   455  O  OE2 . GLU A  1 66  ? 6.913   -1.998  13.799  1.00 38.69  ? 125 GLU A OE2 1 
ATOM   456  N  N   . LYS A  1 67  ? 10.898  -0.727  10.557  1.00 34.03  ? 126 LYS A N   1 
ATOM   457  C  CA  . LYS A  1 67  ? 11.301  -1.625  9.464   1.00 35.65  ? 126 LYS A CA  1 
ATOM   458  C  C   . LYS A  1 67  ? 12.444  -1.029  8.621   1.00 35.39  ? 126 LYS A C   1 
ATOM   459  O  O   . LYS A  1 67  ? 12.674  -1.434  7.489   1.00 37.10  ? 126 LYS A O   1 
ATOM   460  C  CB  . LYS A  1 67  ? 10.099  -1.998  8.557   1.00 37.02  ? 126 LYS A CB  1 
ATOM   461  C  CG  . LYS A  1 67  ? 8.756   -2.539  9.248   1.00 39.56  ? 126 LYS A CG  1 
ATOM   462  C  CD  . LYS A  1 67  ? 8.588   -4.076  9.233   1.00 44.25  ? 126 LYS A CD  1 
ATOM   463  C  CE  . LYS A  1 67  ? 7.102   -4.549  9.163   1.00 47.72  ? 126 LYS A CE  1 
ATOM   464  N  NZ  . LYS A  1 67  ? 6.094   -3.927  10.180  1.00 47.54  ? 126 LYS A NZ  1 
ATOM   465  N  N   . LEU A  1 68  ? 13.170  -0.061  9.151   1.00 34.29  ? 127 LEU A N   1 
ATOM   466  C  CA  . LEU A  1 68  ? 14.354  0.455   8.450   1.00 34.14  ? 127 LEU A CA  1 
ATOM   467  C  C   . LEU A  1 68  ? 15.461  -0.568  8.492   1.00 35.33  ? 127 LEU A C   1 
ATOM   468  O  O   . LEU A  1 68  ? 15.409  -1.477  9.284   1.00 36.08  ? 127 LEU A O   1 
ATOM   469  C  CB  . LEU A  1 68  ? 14.835  1.767   9.085   1.00 32.71  ? 127 LEU A CB  1 
ATOM   470  C  CG  . LEU A  1 68  ? 13.959  2.990   8.775   1.00 31.00  ? 127 LEU A CG  1 
ATOM   471  C  CD1 . LEU A  1 68  ? 14.398  4.207   9.554   1.00 26.31  ? 127 LEU A CD1 1 
ATOM   472  C  CD2 . LEU A  1 68  ? 13.944  3.288   7.233   1.00 31.14  ? 127 LEU A CD2 1 
ATOM   473  N  N   . ASP A  1 69  ? 16.469  -0.426  7.646   1.00 36.62  ? 128 ASP A N   1 
ATOM   474  C  CA  . ASP A  1 69  ? 17.504  -1.451  7.551   1.00 38.91  ? 128 ASP A CA  1 
ATOM   475  C  C   . ASP A  1 69  ? 18.242  -1.475  8.860   1.00 38.26  ? 128 ASP A C   1 
ATOM   476  O  O   . ASP A  1 69  ? 18.414  -0.458  9.477   1.00 37.60  ? 128 ASP A O   1 
ATOM   477  C  CB  . ASP A  1 69  ? 18.500  -1.161  6.416   1.00 40.60  ? 128 ASP A CB  1 
ATOM   478  C  CG  . ASP A  1 69  ? 17.884  -1.279  5.022   1.00 43.93  ? 128 ASP A CG  1 
ATOM   479  O  OD1 . ASP A  1 69  ? 16.689  -1.679  4.924   1.00 45.46  ? 128 ASP A OD1 1 
ATOM   480  O  OD2 . ASP A  1 69  ? 18.609  -0.975  4.021   1.00 47.48  ? 128 ASP A OD2 1 
ATOM   481  N  N   . ALA A  1 70  ? 18.685  -2.635  9.290   1.00 40.19  ? 129 ALA A N   1 
ATOM   482  C  CA  . ALA A  1 70  ? 19.335  -2.739  10.588  1.00 40.34  ? 129 ALA A CA  1 
ATOM   483  C  C   . ALA A  1 70  ? 20.496  -1.745  10.652  1.00 40.08  ? 129 ALA A C   1 
ATOM   484  O  O   . ALA A  1 70  ? 21.299  -1.676  9.707   1.00 41.76  ? 129 ALA A O   1 
ATOM   485  C  CB  . ALA A  1 70  ? 19.841  -4.159  10.822  1.00 42.15  ? 129 ALA A CB  1 
ATOM   486  N  N   . ILE A  1 71  ? 20.590  -0.989  11.754  1.00 37.90  ? 130 ILE A N   1 
ATOM   487  C  CA  . ILE A  1 71  ? 21.677  -0.058  11.920  1.00 37.05  ? 130 ILE A CA  1 
ATOM   488  C  C   . ILE A  1 71  ? 23.002  -0.762  12.093  1.00 39.56  ? 130 ILE A C   1 
ATOM   489  O  O   . ILE A  1 71  ? 23.109  -1.748  12.834  1.00 40.57  ? 130 ILE A O   1 
ATOM   490  C  CB  . ILE A  1 71  ? 21.458  0.858   13.109  1.00 35.35  ? 130 ILE A CB  1 
ATOM   491  C  CG1 . ILE A  1 71  ? 22.408  2.068   13.021  1.00 34.78  ? 130 ILE A CG1 1 
ATOM   492  C  CG2 . ILE A  1 71  ? 21.616  0.105   14.392  1.00 34.48  ? 130 ILE A CG2 1 
ATOM   493  C  CD1 . ILE A  1 71  ? 21.982  3.236   13.900  1.00 32.31  ? 130 ILE A CD1 1 
ATOM   494  N  N   . THR A  1 72  ? 24.013  -0.244  11.400  1.00 40.73  ? 131 THR A N   1 
ATOM   495  C  CA  . THR A  1 72  ? 25.372  -0.764  11.498  1.00 42.80  ? 131 THR A CA  1 
ATOM   496  C  C   . THR A  1 72  ? 26.133  -0.098  12.616  1.00 42.07  ? 131 THR A C   1 
ATOM   497  O  O   . THR A  1 72  ? 25.718  0.913   13.140  1.00 39.52  ? 131 THR A O   1 
ATOM   498  C  CB  . THR A  1 72  ? 26.145  -0.526  10.207  1.00 44.62  ? 131 THR A CB  1 
ATOM   499  O  OG1 . THR A  1 72  ? 26.321  0.886   10.015  1.00 42.18  ? 131 THR A OG1 1 
ATOM   500  C  CG2 . THR A  1 72  ? 25.397  -1.167  9.016   1.00 44.32  ? 131 THR A CG2 1 
ATOM   501  N  N   . ASP A  1 73  ? 27.280  -0.655  12.953  1.00 44.84  ? 132 ASP A N   1 
ATOM   502  C  CA  . ASP A  1 73  ? 28.095  -0.081  14.006  1.00 45.16  ? 132 ASP A CA  1 
ATOM   503  C  C   . ASP A  1 73  ? 28.599  1.294   13.638  1.00 43.64  ? 132 ASP A C   1 
ATOM   504  O  O   . ASP A  1 73  ? 28.641  2.179   14.498  1.00 40.96  ? 132 ASP A O   1 
ATOM   505  C  CB  . ASP A  1 73  ? 29.285  -0.977  14.311  1.00 48.30  ? 132 ASP A CB  1 
ATOM   506  C  CG  . ASP A  1 73  ? 28.902  -2.167  15.146  1.00 52.19  ? 132 ASP A CG  1 
ATOM   507  O  OD1 . ASP A  1 73  ? 27.695  -2.288  15.477  1.00 52.52  ? 132 ASP A OD1 1 
ATOM   508  O  OD2 . ASP A  1 73  ? 29.810  -2.984  15.463  1.00 59.31  ? 132 ASP A OD2 1 
ATOM   509  N  N   . GLU A  1 74  ? 28.992  1.421   12.365  1.00 44.80  ? 133 GLU A N   1 
ATOM   510  C  CA  . GLU A  1 74  ? 29.508  2.645   11.766  1.00 44.86  ? 133 GLU A CA  1 
ATOM   511  C  C   . GLU A  1 74  ? 28.464  3.761   11.862  1.00 41.74  ? 133 GLU A C   1 
ATOM   512  O  O   . GLU A  1 74  ? 28.763  4.887   12.269  1.00 40.41  ? 133 GLU A O   1 
ATOM   513  C  CB  . GLU A  1 74  ? 29.847  2.396   10.302  1.00 47.84  ? 133 GLU A CB  1 
ATOM   514  C  CG  . GLU A  1 74  ? 31.188  2.933   9.844   1.00 53.79  ? 133 GLU A CG  1 
ATOM   515  C  CD  . GLU A  1 74  ? 31.303  3.041   8.293   1.00 61.52  ? 133 GLU A CD  1 
ATOM   516  O  OE1 . GLU A  1 74  ? 30.857  2.099   7.565   1.00 64.22  ? 133 GLU A OE1 1 
ATOM   517  O  OE2 . GLU A  1 74  ? 31.856  4.081   7.815   1.00 65.24  ? 133 GLU A OE2 1 
ATOM   518  N  N   . GLU A  1 75  ? 27.221  3.432   11.537  1.00 40.33  ? 134 GLU A N   1 
ATOM   519  C  CA  . GLU A  1 75  ? 26.161  4.399   11.638  1.00 37.48  ? 134 GLU A CA  1 
ATOM   520  C  C   . GLU A  1 75  ? 25.906  4.722   13.085  1.00 35.27  ? 134 GLU A C   1 
ATOM   521  O  O   . GLU A  1 75  ? 25.707  5.872   13.465  1.00 32.50  ? 134 GLU A O   1 
ATOM   522  C  CB  . GLU A  1 75  ? 24.864  3.906   10.981  1.00 37.40  ? 134 GLU A CB  1 
ATOM   523  C  CG  . GLU A  1 75  ? 23.784  5.002   11.038  1.00 35.47  ? 134 GLU A CG  1 
ATOM   524  C  CD  . GLU A  1 75  ? 22.452  4.604   10.489  1.00 34.32  ? 134 GLU A CD  1 
ATOM   525  O  OE1 . GLU A  1 75  ? 22.390  3.689   9.631   1.00 34.08  ? 134 GLU A OE1 1 
ATOM   526  O  OE2 . GLU A  1 75  ? 21.468  5.253   10.928  1.00 31.46  ? 134 GLU A OE2 1 
ATOM   527  N  N   . ASN A  1 76  ? 25.891  3.689   13.900  1.00 36.02  ? 135 ASN A N   1 
ATOM   528  C  CA  . ASN A  1 76  ? 25.590  3.891   15.301  1.00 35.02  ? 135 ASN A CA  1 
ATOM   529  C  C   . ASN A  1 76  ? 26.638  4.720   16.033  1.00 34.11  ? 135 ASN A C   1 
ATOM   530  O  O   . ASN A  1 76  ? 26.299  5.483   16.889  1.00 32.72  ? 135 ASN A O   1 
ATOM   531  C  CB  . ASN A  1 76  ? 25.381  2.550   15.991  1.00 36.65  ? 135 ASN A CB  1 
ATOM   532  C  CG  . ASN A  1 76  ? 24.706  2.705   17.301  1.00 36.97  ? 135 ASN A CG  1 
ATOM   533  O  OD1 . ASN A  1 76  ? 23.518  3.009   17.363  1.00 39.48  ? 135 ASN A OD1 1 
ATOM   534  N  ND2 . ASN A  1 76  ? 25.461  2.562   18.368  1.00 39.40  ? 135 ASN A ND2 1 
ATOM   535  N  N   . ASP A  1 77  ? 27.904  4.591   15.684  1.00 35.86  ? 136 ASP A N   1 
ATOM   536  C  CA  . ASP A  1 77  ? 28.943  5.400   16.309  1.00 36.41  ? 136 ASP A CA  1 
ATOM   537  C  C   . ASP A  1 77  ? 28.712  6.904   16.097  1.00 34.79  ? 136 ASP A C   1 
ATOM   538  O  O   . ASP A  1 77  ? 28.924  7.731   17.004  1.00 32.82  ? 136 ASP A O   1 
ATOM   539  C  CB  . ASP A  1 77  ? 30.304  5.028   15.727  1.00 39.59  ? 136 ASP A CB  1 
ATOM   540  C  CG  . ASP A  1 77  ? 30.853  3.703   16.263  1.00 43.24  ? 136 ASP A CG  1 
ATOM   541  O  OD1 . ASP A  1 77  ? 30.179  3.036   17.088  1.00 47.14  ? 136 ASP A OD1 1 
ATOM   542  O  OD2 . ASP A  1 77  ? 31.972  3.339   15.846  1.00 44.96  ? 136 ASP A OD2 1 
ATOM   543  N  N   . MET A  1 78  ? 28.269  7.256   14.892  1.00 34.68  ? 137 MET A N   1 
ATOM   544  C  CA  . MET A  1 78  ? 27.956  8.638   14.587  1.00 33.46  ? 137 MET A CA  1 
ATOM   545  C  C   . MET A  1 78  ? 26.585  9.071   15.054  1.00 30.86  ? 137 MET A C   1 
ATOM   546  O  O   . MET A  1 78  ? 26.412  10.206  15.484  1.00 30.74  ? 137 MET A O   1 
ATOM   547  C  CB  . MET A  1 78  ? 28.112  8.894   13.105  1.00 34.78  ? 137 MET A CB  1 
ATOM   548  C  CG  . MET A  1 78  ? 29.499  8.618   12.596  1.00 38.98  ? 137 MET A CG  1 
ATOM   549  S  SD  . MET A  1 78  ? 30.666  9.912   13.034  1.00 43.56  ? 137 MET A SD  1 
ATOM   550  C  CE  . MET A  1 78  ? 31.121  9.450   14.713  1.00 42.20  ? 137 MET A CE  1 
ATOM   551  N  N   . LEU A  1 79  ? 25.603  8.208   14.956  1.00 30.07  ? 138 LEU A N   1 
ATOM   552  C  CA  . LEU A  1 79  ? 24.289  8.561   15.445  1.00 29.17  ? 138 LEU A CA  1 
ATOM   553  C  C   . LEU A  1 79  ? 24.318  8.819   16.972  1.00 29.06  ? 138 LEU A C   1 
ATOM   554  O  O   . LEU A  1 79  ? 23.535  9.618   17.478  1.00 27.75  ? 138 LEU A O   1 
ATOM   555  C  CB  . LEU A  1 79  ? 23.282  7.470   15.083  1.00 29.17  ? 138 LEU A CB  1 
ATOM   556  C  CG  . LEU A  1 79  ? 21.830  7.580   15.536  1.00 28.33  ? 138 LEU A CG  1 
ATOM   557  C  CD1 . LEU A  1 79  ? 21.135  8.809   14.965  1.00 22.98  ? 138 LEU A CD1 1 
ATOM   558  C  CD2 . LEU A  1 79  ? 21.067  6.245   15.177  1.00 26.19  ? 138 LEU A CD2 1 
ATOM   559  N  N   . ASP A  1 80  ? 25.216  8.155   17.699  1.00 30.17  ? 139 ASP A N   1 
ATOM   560  C  CA  . ASP A  1 80  ? 25.414  8.476   19.107  1.00 30.55  ? 139 ASP A CA  1 
ATOM   561  C  C   . ASP A  1 80  ? 25.809  9.915   19.298  1.00 28.80  ? 139 ASP A C   1 
ATOM   562  O  O   . ASP A  1 80  ? 25.568  10.473  20.359  1.00 28.98  ? 139 ASP A O   1 
ATOM   563  C  CB  . ASP A  1 80  ? 26.550  7.653   19.727  1.00 33.37  ? 139 ASP A CB  1 
ATOM   564  C  CG  . ASP A  1 80  ? 26.092  6.347   20.362  1.00 38.69  ? 139 ASP A CG  1 
ATOM   565  O  OD1 . ASP A  1 80  ? 24.891  6.169   20.692  1.00 44.57  ? 139 ASP A OD1 1 
ATOM   566  O  OD2 . ASP A  1 80  ? 26.975  5.473   20.544  1.00 46.85  ? 139 ASP A OD2 1 
ATOM   567  N  N   . LEU A  1 81  ? 26.491  10.505  18.327  1.00 28.02  ? 140 LEU A N   1 
ATOM   568  C  CA  . LEU A  1 81  ? 26.933  11.873  18.472  1.00 26.68  ? 140 LEU A CA  1 
ATOM   569  C  C   . LEU A  1 81  ? 25.906  12.918  17.975  1.00 26.51  ? 140 LEU A C   1 
ATOM   570  O  O   . LEU A  1 81  ? 26.194  14.096  17.978  1.00 26.14  ? 140 LEU A O   1 
ATOM   571  C  CB  . LEU A  1 81  ? 28.297  12.078  17.835  1.00 27.31  ? 140 LEU A CB  1 
ATOM   572  C  CG  . LEU A  1 81  ? 29.489  11.326  18.470  1.00 26.82  ? 140 LEU A CG  1 
ATOM   573  C  CD1 . LEU A  1 81  ? 30.696  11.518  17.674  1.00 23.82  ? 140 LEU A CD1 1 
ATOM   574  C  CD2 . LEU A  1 81  ? 29.793  11.685  19.912  1.00 26.10  ? 140 LEU A CD2 1 
ATOM   575  N  N   . ALA A  1 82  ? 24.704  12.485  17.587  1.00 26.26  ? 141 ALA A N   1 
ATOM   576  C  CA  . ALA A  1 82  ? 23.658  13.388  17.154  1.00 25.30  ? 141 ALA A CA  1 
ATOM   577  C  C   . ALA A  1 82  ? 23.124  14.166  18.352  1.00 25.00  ? 141 ALA A C   1 
ATOM   578  O  O   . ALA A  1 82  ? 22.968  13.602  19.422  1.00 25.73  ? 141 ALA A O   1 
ATOM   579  C  CB  . ALA A  1 82  ? 22.543  12.619  16.479  1.00 24.09  ? 141 ALA A CB  1 
ATOM   580  N  N   . TYR A  1 83  ? 22.796  15.450  18.156  1.00 25.45  ? 142 TYR A N   1 
ATOM   581  C  CA  . TYR A  1 83  ? 22.282  16.280  19.229  1.00 24.85  ? 142 TYR A CA  1 
ATOM   582  C  C   . TYR A  1 83  ? 20.793  16.098  19.311  1.00 24.73  ? 142 TYR A C   1 
ATOM   583  O  O   . TYR A  1 83  ? 20.081  16.243  18.331  1.00 25.43  ? 142 TYR A O   1 
ATOM   584  C  CB  . TYR A  1 83  ? 22.641  17.771  19.049  1.00 25.46  ? 142 TYR A CB  1 
ATOM   585  C  CG  . TYR A  1 83  ? 22.043  18.626  20.159  1.00 25.13  ? 142 TYR A CG  1 
ATOM   586  C  CD1 . TYR A  1 83  ? 22.660  18.707  21.407  1.00 24.36  ? 142 TYR A CD1 1 
ATOM   587  C  CD2 . TYR A  1 83  ? 20.820  19.301  19.977  1.00 24.01  ? 142 TYR A CD2 1 
ATOM   588  C  CE1 . TYR A  1 83  ? 22.097  19.461  22.444  1.00 25.20  ? 142 TYR A CE1 1 
ATOM   589  C  CE2 . TYR A  1 83  ? 20.261  20.043  20.997  1.00 25.74  ? 142 TYR A CE2 1 
ATOM   590  C  CZ  . TYR A  1 83  ? 20.907  20.113  22.230  1.00 25.22  ? 142 TYR A CZ  1 
ATOM   591  O  OH  . TYR A  1 83  ? 20.357  20.835  23.231  1.00 27.88  ? 142 TYR A OH  1 
ATOM   592  N  N   . GLY A  1 84  ? 20.311  15.832  20.510  1.00 25.18  ? 143 GLY A N   1 
ATOM   593  C  CA  . GLY A  1 84  ? 18.934  15.404  20.698  1.00 25.00  ? 143 GLY A CA  1 
ATOM   594  C  C   . GLY A  1 84  ? 18.615  14.027  20.105  1.00 24.68  ? 143 GLY A C   1 
ATOM   595  O  O   . GLY A  1 84  ? 17.617  13.880  19.431  1.00 26.51  ? 143 GLY A O   1 
ATOM   596  N  N   . LEU A  1 85  ? 19.435  13.023  20.333  1.00 23.57  ? 144 LEU A N   1 
ATOM   597  C  CA  . LEU A  1 85  ? 19.116  11.708  19.810  1.00 23.87  ? 144 LEU A CA  1 
ATOM   598  C  C   . LEU A  1 85  ? 17.786  11.240  20.328  1.00 24.16  ? 144 LEU A C   1 
ATOM   599  O  O   . LEU A  1 85  ? 17.490  11.414  21.508  1.00 25.42  ? 144 LEU A O   1 
ATOM   600  C  CB  . LEU A  1 85  ? 20.189  10.713  20.203  1.00 23.99  ? 144 LEU A CB  1 
ATOM   601  C  CG  . LEU A  1 85  ? 20.089  9.293   19.688  1.00 23.31  ? 144 LEU A CG  1 
ATOM   602  C  CD1 . LEU A  1 85  ? 20.229  9.241   18.196  1.00 20.26  ? 144 LEU A CD1 1 
ATOM   603  C  CD2 . LEU A  1 85  ? 21.200  8.479   20.388  1.00 21.71  ? 144 LEU A CD2 1 
ATOM   604  N  N   . THR A  1 86  ? 16.967  10.671  19.440  1.00 23.87  ? 145 THR A N   1 
ATOM   605  C  CA  . THR A  1 86  ? 15.669  10.161  19.832  1.00 23.56  ? 145 THR A CA  1 
ATOM   606  C  C   . THR A  1 86  ? 15.581  8.675   19.582  1.00 23.85  ? 145 THR A C   1 
ATOM   607  O  O   . THR A  1 86  ? 16.417  8.085   18.892  1.00 23.67  ? 145 THR A O   1 
ATOM   608  C  CB  . THR A  1 86  ? 14.523  10.764  19.010  1.00 24.47  ? 145 THR A CB  1 
ATOM   609  O  OG1 . THR A  1 86  ? 14.516  10.152  17.703  1.00 22.83  ? 145 THR A OG1 1 
ATOM   610  C  CG2 . THR A  1 86  ? 14.620  12.345  18.971  1.00 21.58  ? 145 THR A CG2 1 
ATOM   611  N  N   . ASP A  1 87  ? 14.508  8.097   20.101  1.00 23.44  ? 146 ASP A N   1 
ATOM   612  C  CA  . ASP A  1 87  ? 14.262  6.705   19.930  1.00 23.88  ? 146 ASP A CA  1 
ATOM   613  C  C   . ASP A  1 87  ? 13.595  6.474   18.602  1.00 23.88  ? 146 ASP A C   1 
ATOM   614  O  O   . ASP A  1 87  ? 13.087  5.378   18.348  1.00 23.97  ? 146 ASP A O   1 
ATOM   615  C  CB  . ASP A  1 87  ? 13.468  6.127   21.115  1.00 24.78  ? 146 ASP A CB  1 
ATOM   616  C  CG  . ASP A  1 87  ? 12.091  6.761   21.310  1.00 25.77  ? 146 ASP A CG  1 
ATOM   617  O  OD1 . ASP A  1 87  ? 11.488  6.484   22.355  1.00 26.99  ? 146 ASP A OD1 1 
ATOM   618  O  OD2 . ASP A  1 87  ? 11.559  7.486   20.441  1.00 26.71  ? 146 ASP A OD2 1 
ATOM   619  N  N   . ARG A  1 88  ? 13.601  7.513   17.756  1.00 23.28  ? 147 ARG A N   1 
ATOM   620  C  CA  . ARG A  1 88  ? 13.109  7.398   16.380  1.00 23.67  ? 147 ARG A CA  1 
ATOM   621  C  C   . ARG A  1 88  ? 14.071  8.023   15.398  1.00 23.15  ? 147 ARG A C   1 
ATOM   622  O  O   . ARG A  1 88  ? 13.678  8.345   14.260  1.00 22.14  ? 147 ARG A O   1 
ATOM   623  C  CB  . ARG A  1 88  ? 11.730  8.056   16.237  1.00 24.72  ? 147 ARG A CB  1 
ATOM   624  C  CG  . ARG A  1 88  ? 10.638  7.436   17.104  1.00 25.06  ? 147 ARG A CG  1 
ATOM   625  C  CD  . ARG A  1 88  ? 10.212  6.047   16.543  1.00 25.86  ? 147 ARG A CD  1 
ATOM   626  N  NE  . ARG A  1 88  ? 9.094   5.468   17.291  1.00 24.89  ? 147 ARG A NE  1 
ATOM   627  C  CZ  . ARG A  1 88  ? 9.209   4.743   18.400  1.00 25.88  ? 147 ARG A CZ  1 
ATOM   628  N  NH1 . ARG A  1 88  ? 10.390  4.425   18.900  1.00 26.15  ? 147 ARG A NH1 1 
ATOM   629  N  NH2 . ARG A  1 88  ? 8.120   4.278   18.987  1.00 28.63  ? 147 ARG A NH2 1 
ATOM   630  N  N   . SER A  1 89  ? 15.337  8.138   15.831  1.00 22.86  ? 148 SER A N   1 
ATOM   631  C  CA  . SER A  1 89  ? 16.389  8.795   15.074  1.00 22.92  ? 148 SER A CA  1 
ATOM   632  C  C   . SER A  1 89  ? 17.244  7.856   14.231  1.00 23.90  ? 148 SER A C   1 
ATOM   633  O  O   . SER A  1 89  ? 17.630  6.795   14.665  1.00 24.61  ? 148 SER A O   1 
ATOM   634  C  CB  . SER A  1 89  ? 17.323  9.565   16.016  1.00 22.88  ? 148 SER A CB  1 
ATOM   635  O  OG  . SER A  1 89  ? 16.668  10.600  16.738  1.00 22.46  ? 148 SER A OG  1 
ATOM   636  N  N   . ARG A  1 90  ? 17.553  8.284   13.012  1.00 24.66  ? 149 ARG A N   1 
ATOM   637  C  CA  . ARG A  1 90  ? 18.578  7.656   12.196  1.00 25.80  ? 149 ARG A CA  1 
ATOM   638  C  C   . ARG A  1 90  ? 19.309  8.720   11.376  1.00 26.09  ? 149 ARG A C   1 
ATOM   639  O  O   . ARG A  1 90  ? 18.884  9.891   11.309  1.00 26.02  ? 149 ARG A O   1 
ATOM   640  C  CB  . ARG A  1 90  ? 17.995  6.591   11.240  1.00 27.06  ? 149 ARG A CB  1 
ATOM   641  C  CG  . ARG A  1 90  ? 17.333  5.376   11.894  1.00 27.69  ? 149 ARG A CG  1 
ATOM   642  C  CD  . ARG A  1 90  ? 18.363  4.495   12.580  1.00 29.82  ? 149 ARG A CD  1 
ATOM   643  N  NE  . ARG A  1 90  ? 19.257  3.828   11.640  1.00 29.60  ? 149 ARG A NE  1 
ATOM   644  C  CZ  . ARG A  1 90  ? 18.932  2.754   10.935  1.00 32.16  ? 149 ARG A CZ  1 
ATOM   645  N  NH1 . ARG A  1 90  ? 17.721  2.221   11.045  1.00 33.61  ? 149 ARG A NH1 1 
ATOM   646  N  NH2 . ARG A  1 90  ? 19.821  2.212   10.105  1.00 34.32  ? 149 ARG A NH2 1 
ATOM   647  N  N   . LEU A  1 91  ? 20.397  8.288   10.747  1.00 26.75  ? 150 LEU A N   1 
ATOM   648  C  CA  . LEU A  1 91  ? 21.159  9.135   9.867   1.00 27.71  ? 150 LEU A CA  1 
ATOM   649  C  C   . LEU A  1 91  ? 20.590  9.017   8.448   1.00 28.52  ? 150 LEU A C   1 
ATOM   650  O  O   . LEU A  1 91  ? 20.611  7.968   7.836   1.00 29.85  ? 150 LEU A O   1 
ATOM   651  C  CB  . LEU A  1 91  ? 22.658  8.798   9.955   1.00 28.08  ? 150 LEU A CB  1 
ATOM   652  C  CG  . LEU A  1 91  ? 23.261  9.068   11.357  1.00 26.21  ? 150 LEU A CG  1 
ATOM   653  C  CD1 . LEU A  1 91  ? 24.772  8.778   11.382  1.00 24.50  ? 150 LEU A CD1 1 
ATOM   654  C  CD2 . LEU A  1 91  ? 22.979  10.449  11.916  1.00 23.54  ? 150 LEU A CD2 1 
ATOM   655  N  N   . GLY A  1 92  ? 20.056  10.112  7.958   1.00 28.53  ? 151 GLY A N   1 
ATOM   656  C  CA  . GLY A  1 92  ? 19.441  10.154  6.648   1.00 30.67  ? 151 GLY A CA  1 
ATOM   657  C  C   . GLY A  1 92  ? 20.278  9.731   5.469   1.00 32.97  ? 151 GLY A C   1 
ATOM   658  O  O   . GLY A  1 92  ? 19.747  9.218   4.501   1.00 34.26  ? 151 GLY A O   1 
ATOM   659  N  N   . CYS A  1 93  ? 21.586  9.921   5.538   1.00 35.03  ? 152 CYS A N   1 
ATOM   660  C  CA  . CYS A  1 93  ? 22.440  9.516   4.416   1.00 38.60  ? 152 CYS A CA  1 
ATOM   661  C  C   . CYS A  1 93  ? 22.510  7.988   4.245   1.00 39.54  ? 152 CYS A C   1 
ATOM   662  O  O   . CYS A  1 93  ? 22.829  7.493   3.162   1.00 41.34  ? 152 CYS A O   1 
ATOM   663  C  CB  . CYS A  1 93  ? 23.838  10.126  4.518   1.00 39.44  ? 152 CYS A CB  1 
ATOM   664  S  SG  . CYS A  1 93  ? 24.787  9.682   5.992   1.00 41.21  ? 152 CYS A SG  1 
ATOM   665  N  N   . GLN A  1 94  ? 22.200  7.260   5.321   1.00 38.78  ? 153 GLN A N   1 
ATOM   666  C  CA  . GLN A  1 94  ? 22.126  5.779   5.322   1.00 39.34  ? 153 GLN A CA  1 
ATOM   667  C  C   . GLN A  1 94  ? 20.722  5.244   5.115   1.00 38.28  ? 153 GLN A C   1 
ATOM   668  O  O   . GLN A  1 94  ? 20.580  4.053   4.993   1.00 38.85  ? 153 GLN A O   1 
ATOM   669  C  CB  . GLN A  1 94  ? 22.632  5.200   6.654   1.00 38.49  ? 153 GLN A CB  1 
ATOM   670  C  CG  . GLN A  1 94  ? 24.007  5.684   7.047   1.00 39.47  ? 153 GLN A CG  1 
ATOM   671  C  CD  . GLN A  1 94  ? 25.033  5.245   6.052   1.00 42.16  ? 153 GLN A CD  1 
ATOM   672  O  OE1 . GLN A  1 94  ? 25.190  4.064   5.834   1.00 44.65  ? 153 GLN A OE1 1 
ATOM   673  N  NE2 . GLN A  1 94  ? 25.726  6.183   5.433   1.00 44.77  ? 153 GLN A NE2 1 
ATOM   674  N  N   . ILE A  1 95  ? 19.689  6.086   5.089   1.00 37.07  ? 154 ILE A N   1 
ATOM   675  C  CA  . ILE A  1 95  ? 18.325  5.558   4.891   1.00 37.07  ? 154 ILE A CA  1 
ATOM   676  C  C   . ILE A  1 95  ? 17.842  5.728   3.451   1.00 39.33  ? 154 ILE A C   1 
ATOM   677  O  O   . ILE A  1 95  ? 17.577  6.854   3.005   1.00 40.26  ? 154 ILE A O   1 
ATOM   678  C  CB  . ILE A  1 95  ? 17.298  6.198   5.830   1.00 34.53  ? 154 ILE A CB  1 
ATOM   679  C  CG1 . ILE A  1 95  ? 17.668  5.957   7.308   1.00 32.83  ? 154 ILE A CG1 1 
ATOM   680  C  CG2 . ILE A  1 95  ? 15.927  5.679   5.492   1.00 33.65  ? 154 ILE A CG2 1 
ATOM   681  C  CD1 . ILE A  1 95  ? 18.096  4.507   7.653   1.00 31.82  ? 154 ILE A CD1 1 
ATOM   682  N  N   . CYS A  1 96  ? 17.721  4.623   2.733   1.00 40.81  ? 155 CYS A N   1 
ATOM   683  C  CA  . CYS A  1 96  ? 17.315  4.681   1.326   1.00 43.65  ? 155 CYS A CA  1 
ATOM   684  C  C   . CYS A  1 96  ? 15.813  4.531   1.107   1.00 42.29  ? 155 CYS A C   1 
ATOM   685  O  O   . CYS A  1 96  ? 15.149  3.747   1.797   1.00 40.79  ? 155 CYS A O   1 
ATOM   686  C  CB  . CYS A  1 96  ? 18.073  3.644   0.492   1.00 46.21  ? 155 CYS A CB  1 
ATOM   687  S  SG  . CYS A  1 96  ? 19.803  4.155   0.246   1.00 52.79  ? 155 CYS A SG  1 
ATOM   688  N  N   . LEU A  1 97  ? 15.308  5.301   0.143   1.00 42.69  ? 156 LEU A N   1 
ATOM   689  C  CA  . LEU A  1 97  ? 13.912  5.257   -0.255  1.00 42.37  ? 156 LEU A CA  1 
ATOM   690  C  C   . LEU A  1 97  ? 13.495  3.902   -0.808  1.00 43.06  ? 156 LEU A C   1 
ATOM   691  O  O   . LEU A  1 97  ? 14.218  3.256   -1.593  1.00 45.40  ? 156 LEU A O   1 
ATOM   692  C  CB  . LEU A  1 97  ? 13.636  6.321   -1.316  1.00 44.09  ? 156 LEU A CB  1 
ATOM   693  C  CG  . LEU A  1 97  ? 13.620  7.777   -0.839  1.00 42.76  ? 156 LEU A CG  1 
ATOM   694  C  CD1 . LEU A  1 97  ? 13.272  8.630   -2.022  1.00 43.83  ? 156 LEU A CD1 1 
ATOM   695  C  CD2 . LEU A  1 97  ? 12.610  7.985   0.254   1.00 38.18  ? 156 LEU A CD2 1 
ATOM   696  N  N   . THR A  1 98  ? 12.316  3.473   -0.383  1.00 41.63  ? 157 THR A N   1 
ATOM   697  C  CA  . THR A  1 98  ? 11.659  2.297   -0.941  1.00 42.21  ? 157 THR A CA  1 
ATOM   698  C  C   . THR A  1 98  ? 10.265  2.723   -1.447  1.00 42.73  ? 157 THR A C   1 
ATOM   699  O  O   . THR A  1 98  ? 9.729   3.718   -1.012  1.00 41.79  ? 157 THR A O   1 
ATOM   700  C  CB  . THR A  1 98  ? 11.553  1.150   0.116   1.00 40.85  ? 157 THR A CB  1 
ATOM   701  O  OG1 . THR A  1 98  ? 10.704  1.554   1.185   1.00 39.58  ? 157 THR A OG1 1 
ATOM   702  C  CG2 . THR A  1 98  ? 12.894  0.761   0.669   1.00 37.83  ? 157 THR A CG2 1 
ATOM   703  N  N   . LYS A  1 99  ? 9.676   1.991   -2.381  1.00 45.19  ? 158 LYS A N   1 
ATOM   704  C  CA  . LYS A  1 99  ? 8.292   2.275   -2.780  1.00 45.91  ? 158 LYS A CA  1 
ATOM   705  C  C   . LYS A  1 99  ? 7.385   2.459   -1.541  1.00 43.66  ? 158 LYS A C   1 
ATOM   706  O  O   . LYS A  1 99  ? 6.532   3.325   -1.533  1.00 42.84  ? 158 LYS A O   1 
ATOM   707  C  CB  . LYS A  1 99  ? 7.729   1.159   -3.665  1.00 47.85  ? 158 LYS A CB  1 
ATOM   708  C  CG  . LYS A  1 99  ? 8.532   0.806   -4.948  1.00 52.76  ? 158 LYS A CG  1 
ATOM   709  C  CD  . LYS A  1 99  ? 7.880   -0.420  -5.713  1.00 56.35  ? 158 LYS A CD  1 
ATOM   710  C  CE  . LYS A  1 99  ? 8.647   -0.854  -6.971  1.00 59.96  ? 158 LYS A CE  1 
ATOM   711  N  NZ  . LYS A  1 99  ? 8.164   -2.146  -7.644  1.00 60.49  ? 158 LYS A NZ  1 
ATOM   712  N  N   . SER A  1 100 ? 7.601   1.665   -0.491  1.00 42.46  ? 159 SER A N   1 
ATOM   713  C  CA  . SER A  1 100 ? 6.710   1.640   0.675   1.00 41.87  ? 159 SER A CA  1 
ATOM   714  C  C   . SER A  1 100 ? 6.691   2.915   1.517   1.00 40.72  ? 159 SER A C   1 
ATOM   715  O  O   . SER A  1 100 ? 5.782   3.124   2.323   1.00 39.18  ? 159 SER A O   1 
ATOM   716  C  CB  . SER A  1 100 ? 7.100   0.481   1.603   1.00 41.89  ? 159 SER A CB  1 
ATOM   717  O  OG  . SER A  1 100 ? 8.264   0.807   2.357   1.00 41.88  ? 159 SER A OG  1 
ATOM   718  N  N   . MET A  1 101 ? 7.714   3.744   1.339   1.00 40.92  ? 160 MET A N   1 
ATOM   719  C  CA  . MET A  1 101 ? 7.848   4.983   2.067   1.00 40.40  ? 160 MET A CA  1 
ATOM   720  C  C   . MET A  1 101 ? 7.061   6.155   1.458   1.00 41.28  ? 160 MET A C   1 
ATOM   721  O  O   . MET A  1 101 ? 7.056   7.256   2.027   1.00 41.09  ? 160 MET A O   1 
ATOM   722  C  CB  . MET A  1 101 ? 9.331   5.357   2.151   1.00 40.44  ? 160 MET A CB  1 
ATOM   723  C  CG  . MET A  1 101 ? 10.130  4.438   3.032   1.00 41.39  ? 160 MET A CG  1 
ATOM   724  S  SD  . MET A  1 101 ? 11.860  4.938   3.098   1.00 45.66  ? 160 MET A SD  1 
ATOM   725  C  CE  . MET A  1 101 ? 12.666  3.416   3.623   1.00 45.71  ? 160 MET A CE  1 
ATOM   726  N  N   . ASP A  1 102 ? 6.413   5.938   0.314   1.00 42.33  ? 161 ASP A N   1 
ATOM   727  C  CA  . ASP A  1 102 ? 5.691   7.008   -0.378  1.00 43.18  ? 161 ASP A CA  1 
ATOM   728  C  C   . ASP A  1 102 ? 4.766   7.743   0.586   1.00 41.86  ? 161 ASP A C   1 
ATOM   729  O  O   . ASP A  1 102 ? 3.995   7.099   1.295   1.00 41.62  ? 161 ASP A O   1 
ATOM   730  C  CB  . ASP A  1 102 ? 4.863   6.408   -1.517  1.00 44.98  ? 161 ASP A CB  1 
ATOM   731  C  CG  . ASP A  1 102 ? 4.357   7.439   -2.509  1.00 47.55  ? 161 ASP A CG  1 
ATOM   732  O  OD1 . ASP A  1 102 ? 4.892   8.563   -2.604  1.00 50.34  ? 161 ASP A OD1 1 
ATOM   733  O  OD2 . ASP A  1 102 ? 3.409   7.102   -3.238  1.00 52.58  ? 161 ASP A OD2 1 
ATOM   734  N  N   . ASN A  1 103 ? 4.856   9.078   0.595   1.00 41.34  ? 162 ASN A N   1 
ATOM   735  C  CA  . ASN A  1 103 ? 4.024   9.972   1.424   1.00 40.31  ? 162 ASN A CA  1 
ATOM   736  C  C   . ASN A  1 103 ? 4.313   9.996   2.928   1.00 38.28  ? 162 ASN A C   1 
ATOM   737  O  O   . ASN A  1 103 ? 3.494   10.512  3.704   1.00 38.78  ? 162 ASN A O   1 
ATOM   738  C  CB  . ASN A  1 103 ? 2.535   9.698   1.213   1.00 41.37  ? 162 ASN A CB  1 
ATOM   739  C  CG  . ASN A  1 103 ? 2.113   9.795   -0.247  1.00 42.70  ? 162 ASN A CG  1 
ATOM   740  O  OD1 . ASN A  1 103 ? 2.212   10.860  -0.867  1.00 42.17  ? 162 ASN A OD1 1 
ATOM   741  N  ND2 . ASN A  1 103 ? 1.608   8.689   -0.787  1.00 40.62  ? 162 ASN A ND2 1 
ATOM   742  N  N   . MET A  1 104 ? 5.466   9.481   3.346   1.00 36.21  ? 163 MET A N   1 
ATOM   743  C  CA  . MET A  1 104 ? 5.831   9.498   4.772   1.00 34.67  ? 163 MET A CA  1 
ATOM   744  C  C   . MET A  1 104 ? 6.329   10.871  5.157   1.00 34.63  ? 163 MET A C   1 
ATOM   745  O  O   . MET A  1 104 ? 6.696   11.667  4.301   1.00 35.76  ? 163 MET A O   1 
ATOM   746  C  CB  . MET A  1 104 ? 6.948   8.505   5.086   1.00 33.18  ? 163 MET A CB  1 
ATOM   747  C  CG  . MET A  1 104 ? 8.319   8.989   4.674   1.00 32.92  ? 163 MET A CG  1 
ATOM   748  S  SD  . MET A  1 104 ? 9.678   7.891   4.981   1.00 30.61  ? 163 MET A SD  1 
ATOM   749  C  CE  . MET A  1 104 ? 10.971  8.680   4.051   1.00 33.81  ? 163 MET A CE  1 
ATOM   750  N  N   . THR A  1 105 ? 6.405   11.104  6.458   1.00 33.37  ? 164 THR A N   1 
ATOM   751  C  CA  . THR A  1 105 ? 6.875   12.349  6.993   1.00 33.20  ? 164 THR A CA  1 
ATOM   752  C  C   . THR A  1 105 ? 8.092   12.084  7.850   1.00 31.29  ? 164 THR A C   1 
ATOM   753  O  O   . THR A  1 105 ? 8.127   11.089  8.507   1.00 30.83  ? 164 THR A O   1 
ATOM   754  C  CB  . THR A  1 105 ? 5.794   12.936  7.837   1.00 34.21  ? 164 THR A CB  1 
ATOM   755  O  OG1 . THR A  1 105 ? 4.617   13.057  7.032   1.00 36.37  ? 164 THR A OG1 1 
ATOM   756  C  CG2 . THR A  1 105 ? 6.190   14.288  8.361   1.00 34.48  ? 164 THR A CG2 1 
ATOM   757  N  N   . VAL A  1 106 ? 9.095   12.958  7.805   1.00 30.78  ? 165 VAL A N   1 
ATOM   758  C  CA  . VAL A  1 106 ? 10.243  12.902  8.697   1.00 29.17  ? 165 VAL A CA  1 
ATOM   759  C  C   . VAL A  1 106 ? 10.411  14.292  9.291   1.00 29.93  ? 165 VAL A C   1 
ATOM   760  O  O   . VAL A  1 106 ? 9.973   15.257  8.684   1.00 30.81  ? 165 VAL A O   1 
ATOM   761  C  CB  . VAL A  1 106 ? 11.512  12.576  7.966   1.00 28.51  ? 165 VAL A CB  1 
ATOM   762  C  CG1 . VAL A  1 106 ? 11.428  11.233  7.383   1.00 28.90  ? 165 VAL A CG1 1 
ATOM   763  C  CG2 . VAL A  1 106 ? 11.774  13.609  6.906   1.00 29.17  ? 165 VAL A CG2 1 
ATOM   764  N  N   . ARG A  1 107 ? 11.023  14.414  10.466  1.00 29.23  ? 166 ARG A N   1 
ATOM   765  C  CA  . ARG A  1 107 ? 11.348  15.766  10.974  1.00 30.49  ? 166 ARG A CA  1 
ATOM   766  C  C   . ARG A  1 107 ? 12.847  16.045  11.102  1.00 29.67  ? 166 ARG A C   1 
ATOM   767  O  O   . ARG A  1 107 ? 13.608  15.161  11.489  1.00 27.49  ? 166 ARG A O   1 
ATOM   768  C  CB  . ARG A  1 107 ? 10.706  16.054  12.318  1.00 30.64  ? 166 ARG A CB  1 
ATOM   769  C  CG  . ARG A  1 107 ? 11.115  17.403  12.857  1.00 32.41  ? 166 ARG A CG  1 
ATOM   770  C  CD  . ARG A  1 107 ? 10.158  17.882  13.909  1.00 37.47  ? 166 ARG A CD  1 
ATOM   771  N  NE  . ARG A  1 107 ? 10.169  16.951  15.030  1.00 39.53  ? 166 ARG A NE  1 
ATOM   772  C  CZ  . ARG A  1 107 ? 11.027  16.976  16.049  1.00 41.43  ? 166 ARG A CZ  1 
ATOM   773  N  NH1 . ARG A  1 107 ? 10.928  16.045  16.989  1.00 44.24  ? 166 ARG A NH1 1 
ATOM   774  N  NH2 . ARG A  1 107 ? 11.979  17.896  16.145  1.00 40.16  ? 166 ARG A NH2 1 
ATOM   775  N  N   . VAL A  1 108 ? 13.242  17.282  10.771  1.00 30.39  ? 167 VAL A N   1 
ATOM   776  C  CA  . VAL A  1 108 ? 14.610  17.719  10.982  1.00 30.39  ? 167 VAL A CA  1 
ATOM   777  C  C   . VAL A  1 108 ? 14.747  18.317  12.398  1.00 29.60  ? 167 VAL A C   1 
ATOM   778  O  O   . VAL A  1 108 ? 14.145  19.345  12.738  1.00 30.45  ? 167 VAL A O   1 
ATOM   779  C  CB  . VAL A  1 108 ? 15.086  18.742  9.918   1.00 32.38  ? 167 VAL A CB  1 
ATOM   780  C  CG1 . VAL A  1 108 ? 16.617  18.862  9.986   1.00 31.23  ? 167 VAL A CG1 1 
ATOM   781  C  CG2 . VAL A  1 108 ? 14.584  18.371  8.503   1.00 32.21  ? 167 VAL A CG2 1 
ATOM   782  N  N   . PRO A  1 109 ? 15.514  17.658  13.244  1.00 28.55  ? 168 PRO A N   1 
ATOM   783  C  CA  . PRO A  1 109 ? 15.656  18.187  14.586  1.00 28.76  ? 168 PRO A CA  1 
ATOM   784  C  C   . PRO A  1 109 ? 16.632  19.348  14.627  1.00 29.54  ? 168 PRO A C   1 
ATOM   785  O  O   . PRO A  1 109 ? 17.482  19.484  13.758  1.00 29.53  ? 168 PRO A O   1 
ATOM   786  C  CB  . PRO A  1 109 ? 16.249  17.019  15.354  1.00 26.85  ? 168 PRO A CB  1 
ATOM   787  C  CG  . PRO A  1 109 ? 17.023  16.281  14.363  1.00 26.76  ? 168 PRO A CG  1 
ATOM   788  C  CD  . PRO A  1 109 ? 16.420  16.526  13.011  1.00 28.15  ? 168 PRO A CD  1 
ATOM   789  N  N   . GLU A  1 110 ? 16.514  20.139  15.681  1.00 30.58  ? 169 GLU A N   1 
ATOM   790  C  CA  . GLU A  1 110 ? 17.360  21.296  15.885  1.00 31.49  ? 169 GLU A CA  1 
ATOM   791  C  C   . GLU A  1 110 ? 18.772  20.856  16.172  1.00 29.65  ? 169 GLU A C   1 
ATOM   792  O  O   . GLU A  1 110 ? 19.013  19.770  16.666  1.00 28.80  ? 169 GLU A O   1 
ATOM   793  C  CB  . GLU A  1 110 ? 16.830  22.153  17.016  1.00 32.13  ? 169 GLU A CB  1 
ATOM   794  C  CG  . GLU A  1 110 ? 16.907  21.462  18.367  1.00 35.27  ? 169 GLU A CG  1 
ATOM   795  C  CD  . GLU A  1 110 ? 16.634  22.395  19.556  1.00 41.64  ? 169 GLU A CD  1 
ATOM   796  O  OE1 . GLU A  1 110 ? 16.572  21.865  20.708  1.00 42.06  ? 169 GLU A OE1 1 
ATOM   797  O  OE2 . GLU A  1 110 ? 16.495  23.642  19.330  1.00 46.33  ? 169 GLU A OE2 1 
ATOM   798  N  N   . THR A  1 111 ? 19.705  21.712  15.805  1.00 30.22  ? 170 THR A N   1 
ATOM   799  C  CA  . THR A  1 111 ? 21.109  21.491  16.054  1.00 28.86  ? 170 THR A CA  1 
ATOM   800  C  C   . THR A  1 111 ? 21.455  22.030  17.437  1.00 28.36  ? 170 THR A C   1 
ATOM   801  O  O   . THR A  1 111 ? 20.703  22.827  18.011  1.00 29.25  ? 170 THR A O   1 
ATOM   802  C  CB  . THR A  1 111 ? 21.950  22.285  15.056  1.00 30.11  ? 170 THR A CB  1 
ATOM   803  O  OG1 . THR A  1 111 ? 21.858  23.693  15.368  1.00 31.61  ? 170 THR A OG1 1 
ATOM   804  C  CG2 . THR A  1 111 ? 21.503  22.010  13.594  1.00 27.72  ? 170 THR A CG2 1 
ATOM   805  N  N   . VAL A  1 112 ? 22.640  21.666  17.914  1.00 27.13  ? 171 VAL A N   1 
ATOM   806  C  CA  . VAL A  1 112 ? 23.152  22.159  19.157  1.00 26.35  ? 171 VAL A CA  1 
ATOM   807  C  C   . VAL A  1 112 ? 23.310  23.704  19.149  1.00 28.02  ? 171 VAL A C   1 
ATOM   808  O  O   . VAL A  1 112 ? 23.086  24.350  20.152  1.00 28.29  ? 171 VAL A O   1 
ATOM   809  C  CB  . VAL A  1 112 ? 24.474  21.458  19.488  1.00 26.44  ? 171 VAL A CB  1 
ATOM   810  C  CG1 . VAL A  1 112 ? 25.592  21.887  18.493  1.00 25.31  ? 171 VAL A CG1 1 
ATOM   811  C  CG2 . VAL A  1 112 ? 24.870  21.708  20.979  1.00 23.68  ? 171 VAL A CG2 1 
ATOM   812  N  N   . ALA A  1 113 ? 23.664  24.283  18.008  1.00 29.27  ? 172 ALA A N   1 
ATOM   813  C  CA  . ALA A  1 113 ? 23.776  25.732  17.852  1.00 30.98  ? 172 ALA A CA  1 
ATOM   814  C  C   . ALA A  1 113 ? 22.416  26.402  18.003  1.00 32.28  ? 172 ALA A C   1 
ATOM   815  O  O   . ALA A  1 113 ? 22.290  27.453  18.651  1.00 32.88  ? 172 ALA A O   1 
ATOM   816  C  CB  . ALA A  1 113 ? 24.363  26.063  16.491  1.00 31.94  ? 172 ALA A CB  1 
ATOM   817  N  N   . ASP A  1 114 ? 21.387  25.796  17.418  1.00 32.76  ? 173 ASP A N   1 
ATOM   818  C  CA  . ASP A  1 114 ? 20.031  26.315  17.629  1.00 33.88  ? 173 ASP A CA  1 
ATOM   819  C  C   . ASP A  1 114 ? 19.696  26.283  19.139  1.00 32.76  ? 173 ASP A C   1 
ATOM   820  O  O   . ASP A  1 114 ? 19.174  27.216  19.678  1.00 32.80  ? 173 ASP A O   1 
ATOM   821  C  CB  . ASP A  1 114 ? 18.992  25.502  16.856  1.00 33.56  ? 173 ASP A CB  1 
ATOM   822  C  CG  . ASP A  1 114 ? 19.207  25.514  15.351  1.00 35.76  ? 173 ASP A CG  1 
ATOM   823  O  OD1 . ASP A  1 114 ? 19.658  26.536  14.789  1.00 38.88  ? 173 ASP A OD1 1 
ATOM   824  O  OD2 . ASP A  1 114 ? 18.902  24.475  14.718  1.00 35.85  ? 173 ASP A OD2 1 
ATOM   825  N  N   . ALA A  1 115 ? 20.023  25.190  19.807  1.00 31.90  ? 174 ALA A N   1 
ATOM   826  C  CA  . ALA A  1 115 ? 19.719  25.048  21.255  1.00 32.41  ? 174 ALA A CA  1 
ATOM   827  C  C   . ALA A  1 115 ? 20.496  26.025  22.146  1.00 33.60  ? 174 ALA A C   1 
ATOM   828  O  O   . ALA A  1 115 ? 20.055  26.337  23.250  1.00 34.41  ? 174 ALA A O   1 
ATOM   829  C  CB  . ALA A  1 115 ? 19.975  23.604  21.732  1.00 29.81  ? 174 ALA A CB  1 
ATOM   830  N  N   . ARG A  1 116 ? 21.641  26.495  21.658  1.00 34.37  ? 175 ARG A N   1 
ATOM   831  C  CA  . ARG A  1 116 ? 22.611  27.188  22.484  1.00 35.05  ? 175 ARG A CA  1 
ATOM   832  C  C   . ARG A  1 116 ? 22.145  28.595  22.843  1.00 38.04  ? 175 ARG A C   1 
ATOM   833  O  O   . ARG A  1 116 ? 21.703  29.385  21.976  1.00 39.14  ? 175 ARG A O   1 
ATOM   834  C  CB  . ARG A  1 116 ? 23.963  27.266  21.760  1.00 34.82  ? 175 ARG A CB  1 
ATOM   835  C  CG  . ARG A  1 116 ? 25.096  27.818  22.635  1.00 34.55  ? 175 ARG A CG  1 
ATOM   836  C  CD  . ARG A  1 116 ? 26.496  27.715  21.991  1.00 32.44  ? 175 ARG A CD  1 
ATOM   837  N  NE  . ARG A  1 116 ? 26.857  26.337  21.688  1.00 31.08  ? 175 ARG A NE  1 
ATOM   838  C  CZ  . ARG A  1 116 ? 27.146  25.828  20.478  1.00 30.41  ? 175 ARG A CZ  1 
ATOM   839  N  NH1 . ARG A  1 116 ? 27.455  24.542  20.404  1.00 28.28  ? 175 ARG A NH1 1 
ATOM   840  N  NH2 . ARG A  1 116 ? 27.154  26.558  19.356  1.00 30.30  ? 175 ARG A NH2 1 
ATOM   841  N  N   . GLN A  1 117 ? 22.256  28.911  24.127  1.00 38.99  ? 176 GLN A N   1 
ATOM   842  C  CA  . GLN A  1 117 ? 21.979  30.265  24.565  1.00 42.21  ? 176 GLN A CA  1 
ATOM   843  C  C   . GLN A  1 117 ? 23.271  31.020  24.868  1.00 41.87  ? 176 GLN A C   1 
ATOM   844  O  O   . GLN A  1 117 ? 23.361  32.207  24.621  1.00 43.43  ? 176 GLN A O   1 
ATOM   845  C  CB  . GLN A  1 117 ? 20.953  30.271  25.716  1.00 43.75  ? 176 GLN A CB  1 
ATOM   846  C  CG  . GLN A  1 117 ? 19.461  30.163  25.204  1.00 47.82  ? 176 GLN A CG  1 
ATOM   847  C  CD  . GLN A  1 117 ? 18.450  29.834  26.324  1.00 53.13  ? 176 GLN A CD  1 
ATOM   848  O  OE1 . GLN A  1 117 ? 18.391  30.512  27.364  1.00 55.35  ? 176 GLN A OE1 1 
ATOM   849  N  NE2 . GLN A  1 117 ? 17.633  28.796  26.098  1.00 55.73  ? 176 GLN A NE2 1 
ATOM   850  N  N   . SER A  1 118 ? 24.291  30.332  25.349  1.00 40.13  ? 177 SER A N   1 
ATOM   851  C  CA  . SER A  1 118 ? 25.607  30.957  25.409  1.00 41.22  ? 177 SER A CA  1 
ATOM   852  C  C   . SER A  1 118 ? 26.814  30.002  25.306  1.00 38.97  ? 177 SER A C   1 
ATOM   853  O  O   . SER A  1 118 ? 26.743  28.831  25.596  1.00 37.92  ? 177 SER A O   1 
ATOM   854  C  CB  . SER A  1 118 ? 25.734  31.860  26.663  1.00 42.56  ? 177 SER A CB  1 
ATOM   855  O  OG  . SER A  1 118 ? 25.614  31.093  27.843  1.00 43.12  ? 177 SER A OG  1 
ATOM   856  N  N   . ILE A  1 119 ? 27.933  30.556  24.892  1.00 39.33  ? 178 ILE A N   1 
ATOM   857  C  CA  . ILE A  1 119 ? 29.203  29.862  24.866  1.00 37.56  ? 178 ILE A CA  1 
ATOM   858  C  C   . ILE A  1 119 ? 29.735  29.800  26.292  1.00 37.03  ? 178 ILE A C   1 
ATOM   859  O  O   . ILE A  1 119 ? 29.604  30.787  27.031  1.00 37.87  ? 178 ILE A O   1 
ATOM   860  C  CB  . ILE A  1 119 ? 30.173  30.673  23.993  1.00 38.61  ? 178 ILE A CB  1 
ATOM   861  C  CG1 . ILE A  1 119 ? 29.697  30.622  22.531  1.00 38.84  ? 178 ILE A CG1 1 
ATOM   862  C  CG2 . ILE A  1 119 ? 31.554  30.168  24.159  1.00 37.02  ? 178 ILE A CG2 1 
ATOM   863  C  CD1 . ILE A  1 119 ? 30.171  31.779  21.671  1.00 41.41  ? 178 ILE A CD1 1 
ATOM   864  N  N   . ASP A  1 120 ? 30.335  28.664  26.664  1.00 35.00  ? 179 ASP A N   1 
ATOM   865  C  CA  . ASP A  1 120 ? 30.869  28.477  27.999  1.00 34.59  ? 179 ASP A CA  1 
ATOM   866  C  C   . ASP A  1 120 ? 32.281  29.018  28.153  1.00 34.56  ? 179 ASP A C   1 
ATOM   867  O  O   . ASP A  1 120 ? 33.005  29.203  27.166  1.00 34.99  ? 179 ASP A O   1 
ATOM   868  C  CB  . ASP A  1 120 ? 30.916  26.993  28.346  1.00 34.04  ? 179 ASP A CB  1 
ATOM   869  C  CG  . ASP A  1 120 ? 29.549  26.400  28.585  1.00 35.78  ? 179 ASP A CG  1 
ATOM   870  O  OD1 . ASP A  1 120 ? 28.679  27.146  29.114  1.00 43.00  ? 179 ASP A OD1 1 
ATOM   871  O  OD2 . ASP A  1 120 ? 29.338  25.200  28.259  1.00 34.12  ? 179 ASP A OD2 1 
ATOM   872  N  N   . VAL A  1 121 ? 32.660  29.240  29.409  1.00 33.44  ? 180 VAL A N   1 
ATOM   873  C  CA  . VAL A  1 121 ? 34.018  29.544  29.777  1.00 33.27  ? 180 VAL A CA  1 
ATOM   874  C  C   . VAL A  1 121 ? 34.903  28.328  29.502  1.00 33.32  ? 180 VAL A C   1 
ATOM   875  O  O   . VAL A  1 121 ? 34.631  27.236  29.954  1.00 33.55  ? 180 VAL A O   1 
ATOM   876  C  CB  . VAL A  1 121 ? 34.132  29.907  31.274  1.00 33.22  ? 180 VAL A CB  1 
ATOM   877  C  CG1 . VAL A  1 121 ? 35.560  30.257  31.627  1.00 31.99  ? 180 VAL A CG1 1 
ATOM   878  C  CG2 . VAL A  1 121 ? 33.220  31.056  31.618  1.00 32.15  ? 180 VAL A CG2 1 
ATOM   879  N  N   . GLY A  1 122 ? 35.972  28.515  28.757  1.00 34.19  ? 181 GLY A N   1 
ATOM   880  C  CA  . GLY A  1 122 ? 36.892  27.441  28.497  1.00 34.40  ? 181 GLY A CA  1 
ATOM   881  C  C   . GLY A  1 122 ? 37.872  27.330  29.648  1.00 35.46  ? 181 GLY A C   1 
ATOM   882  O  O   . GLY A  1 122 ? 38.366  28.340  30.154  1.00 36.35  ? 181 GLY A O   1 
ATOM   883  N  N   . LYS A  1 123 ? 38.154  26.091  30.037  1.00 35.44  ? 182 LYS A N   1 
ATOM   884  C  CA  . LYS A  1 123 ? 39.052  25.761  31.120  1.00 36.44  ? 182 LYS A CA  1 
ATOM   885  C  C   . LYS A  1 123 ? 39.878  24.555  30.701  1.00 36.96  ? 182 LYS A C   1 
ATOM   886  O  O   . LYS A  1 123 ? 39.306  23.499  30.480  1.00 36.69  ? 182 LYS A O   1 
ATOM   887  C  CB  . LYS A  1 123 ? 38.222  25.321  32.331  1.00 36.06  ? 182 LYS A CB  1 
ATOM   888  C  CG  . LYS A  1 123 ? 37.624  26.423  33.175  1.00 37.25  ? 182 LYS A CG  1 
ATOM   889  C  CD  . LYS A  1 123 ? 36.552  25.862  34.074  1.00 38.87  ? 182 LYS A CD  1 
ATOM   890  C  CE  . LYS A  1 123 ? 35.241  25.731  33.342  1.00 39.28  ? 182 LYS A CE  1 
ATOM   891  N  NZ  . LYS A  1 123 ? 34.395  24.607  33.847  1.00 41.30  ? 182 LYS A NZ  1 
ATOM   892  N  N   . THR A  1 124 ? 41.196  24.667  30.611  1.00 38.51  ? 183 THR A N   1 
ATOM   893  C  CA  . THR A  1 124 ? 42.003  23.468  30.403  1.00 39.61  ? 183 THR A CA  1 
ATOM   894  C  C   . THR A  1 124 ? 41.866  22.538  31.616  1.00 39.60  ? 183 THR A C   1 
ATOM   895  O  O   . THR A  1 124 ? 41.778  21.308  31.455  1.00 39.09  ? 183 THR A O   1 
ATOM   896  C  CB  . THR A  1 124 ? 43.477  23.765  30.201  1.00 41.39  ? 183 THR A CB  1 
ATOM   897  O  OG1 . THR A  1 124 ? 43.618  24.862  29.308  1.00 43.85  ? 183 THR A OG1 1 
ATOM   898  C  CG2 . THR A  1 124 ? 44.137  22.571  29.591  1.00 43.41  ? 183 THR A CG2 1 
ATOM   899  N  N   . SER A  1 125 ? 41.845  23.113  32.824  1.00 39.44  ? 184 SER A N   1 
ATOM   900  C  CA  . SER A  1 125 ? 41.448  22.336  34.004  1.00 39.23  ? 184 SER A CA  1 
ATOM   901  C  C   . SER A  1 125 ? 41.098  23.181  35.216  1.00 39.39  ? 184 SER A C   1 
ATOM   902  O  O   . SER A  1 125 ? 41.387  24.385  35.271  1.00 38.83  ? 184 SER A O   1 
ATOM   903  C  CB  . SER A  1 125 ? 42.540  21.367  34.414  1.00 40.50  ? 184 SER A CB  1 
ATOM   904  O  OG  . SER A  1 125 ? 43.556  22.097  35.037  1.00 41.73  ? 184 SER A OG  1 
ATOM   905  N  N   . ALA A  1 126 ? 40.483  22.502  36.191  1.00 39.95  ? 185 ALA A N   1 
ATOM   906  C  CA  . ALA A  1 126 ? 39.960  23.137  37.401  1.00 40.38  ? 185 ALA A CA  1 
ATOM   907  C  C   . ALA A  1 126 ? 40.750  22.756  38.627  1.00 42.39  ? 185 ALA A C   1 
ATOM   908  O  O   . ALA A  1 126 ? 41.473  21.764  38.654  1.00 44.22  ? 185 ALA A O   1 
ATOM   909  C  CB  . ALA A  1 126 ? 38.524  22.777  37.593  1.00 39.38  ? 185 ALA A CB  1 
ATOM   910  N  N   . GLU A  1 127 ? 40.608  23.567  39.653  1.00 43.45  ? 186 GLU A N   1 
ATOM   911  C  CA  . GLU A  1 127 ? 41.240  23.312  40.935  1.00 45.34  ? 186 GLU A CA  1 
ATOM   912  C  C   . GLU A  1 127 ? 40.347  23.832  42.073  1.00 44.78  ? 186 GLU A C   1 
ATOM   913  O  O   . GLU A  1 127 ? 39.703  24.852  41.953  1.00 44.44  ? 186 GLU A O   1 
ATOM   914  C  CB  . GLU A  1 127 ? 42.601  24.023  41.022  1.00 47.06  ? 186 GLU A CB  1 
ATOM   915  C  CG  . GLU A  1 127 ? 43.366  24.287  39.713  1.00 49.49  ? 186 GLU A CG  1 
ATOM   916  C  CD  . GLU A  1 127 ? 44.642  25.099  39.994  1.00 55.67  ? 186 GLU A CD  1 
ATOM   917  O  OE1 . GLU A  1 127 ? 45.721  24.462  40.097  1.00 61.14  ? 186 GLU A OE1 1 
ATOM   918  O  OE2 . GLU A  1 127 ? 44.570  26.359  40.154  1.00 56.41  ? 186 GLU A OE2 1 
ATOM   919  N  N   . ASN A  1 128 ? 40.327  23.139  43.191  1.00 45.48  ? 187 ASN A N   1 
ATOM   920  C  CA  . ASN A  1 128 ? 39.683  23.655  44.388  1.00 45.67  ? 187 ASN A CA  1 
ATOM   921  C  C   . ASN A  1 128 ? 40.694  23.831  45.461  1.00 46.94  ? 187 ASN A C   1 
ATOM   922  O  O   . ASN A  1 128 ? 40.786  23.043  46.386  1.00 48.58  ? 187 ASN A O   1 
ATOM   923  C  CB  . ASN A  1 128 ? 38.584  22.720  44.822  1.00 45.80  ? 187 ASN A CB  1 
ATOM   924  C  CG  . ASN A  1 128 ? 37.569  22.553  43.764  1.00 43.26  ? 187 ASN A CG  1 
ATOM   925  O  OD1 . ASN A  1 128 ? 36.539  23.186  43.805  1.00 44.61  ? 187 ASN A OD1 1 
ATOM   926  N  ND2 . ASN A  1 128 ? 37.873  21.745  42.770  1.00 42.14  ? 187 ASN A ND2 1 
ATOM   927  N  N   . LEU A  1 129 ? 41.467  24.891  45.326  1.00 47.05  ? 188 LEU A N   1 
ATOM   928  C  CA  . LEU A  1 129 ? 42.590  25.123  46.235  1.00 48.90  ? 188 LEU A CA  1 
ATOM   929  C  C   . LEU A  1 129 ? 42.137  25.429  47.666  1.00 50.85  ? 188 LEU A C   1 
ATOM   930  O  O   . LEU A  1 129 ? 42.965  25.600  48.563  1.00 51.86  ? 188 LEU A O   1 
ATOM   931  C  CB  . LEU A  1 129 ? 43.574  26.166  45.673  1.00 47.81  ? 188 LEU A CB  1 
ATOM   932  C  CG  . LEU A  1 129 ? 44.158  25.858  44.282  1.00 46.29  ? 188 LEU A CG  1 
ATOM   933  C  CD1 . LEU A  1 129 ? 45.234  26.861  43.865  1.00 43.48  ? 188 LEU A CD1 1 
ATOM   934  C  CD2 . LEU A  1 129 ? 44.706  24.429  44.144  1.00 46.42  ? 188 LEU A CD2 1 
ATOM   935  N  N   . TYR A  1 130 ? 40.829  25.429  47.901  1.00 51.75  ? 189 TYR A N   1 
ATOM   936  C  CA  . TYR A  1 130 ? 40.349  25.339  49.277  1.00 55.20  ? 189 TYR A CA  1 
ATOM   937  C  C   . TYR A  1 130 ? 41.041  24.181  50.020  1.00 57.89  ? 189 TYR A C   1 
ATOM   938  O  O   . TYR A  1 130 ? 41.239  24.276  51.236  1.00 59.86  ? 189 TYR A O   1 
ATOM   939  C  CB  . TYR A  1 130 ? 38.828  25.188  49.343  1.00 54.99  ? 189 TYR A CB  1 
ATOM   940  C  CG  . TYR A  1 130 ? 38.304  25.181  50.769  1.00 59.00  ? 189 TYR A CG  1 
ATOM   941  C  CD1 . TYR A  1 130 ? 37.660  24.073  51.283  1.00 61.97  ? 189 TYR A CD1 1 
ATOM   942  C  CD2 . TYR A  1 130 ? 38.497  26.262  51.611  1.00 62.44  ? 189 TYR A CD2 1 
ATOM   943  C  CE1 . TYR A  1 130 ? 37.203  24.041  52.567  1.00 64.89  ? 189 TYR A CE1 1 
ATOM   944  C  CE2 . TYR A  1 130 ? 38.039  26.242  52.902  1.00 65.60  ? 189 TYR A CE2 1 
ATOM   945  C  CZ  . TYR A  1 130 ? 37.386  25.119  53.375  1.00 67.05  ? 189 TYR A CZ  1 
ATOM   946  O  OH  . TYR A  1 130 ? 36.919  25.063  54.673  1.00 71.35  ? 189 TYR A OH  1 
ATOM   947  N  N   . PHE A  1 131 ? 41.417  23.129  49.266  1.00 58.24  ? 190 PHE A N   1 
ATOM   948  C  CA  . PHE A  1 131 ? 42.146  21.928  49.765  1.00 61.34  ? 190 PHE A CA  1 
ATOM   949  C  C   . PHE A  1 131 ? 43.670  21.767  49.426  1.00 62.72  ? 190 PHE A C   1 
ATOM   950  O  O   . PHE A  1 131 ? 44.154  20.644  49.232  1.00 63.86  ? 190 PHE A O   1 
ATOM   951  C  CB  . PHE A  1 131 ? 41.402  20.687  49.252  1.00 61.20  ? 190 PHE A CB  1 
ATOM   952  C  CG  . PHE A  1 131 ? 39.958  20.671  49.644  1.00 61.39  ? 190 PHE A CG  1 
ATOM   953  C  CD1 . PHE A  1 131 ? 39.598  20.482  50.984  1.00 62.78  ? 190 PHE A CD1 1 
ATOM   954  C  CD2 . PHE A  1 131 ? 38.971  20.908  48.704  1.00 58.14  ? 190 PHE A CD2 1 
ATOM   955  C  CE1 . PHE A  1 131 ? 38.291  20.503  51.358  1.00 62.95  ? 190 PHE A CE1 1 
ATOM   956  C  CE2 . PHE A  1 131 ? 37.650  20.920  49.076  1.00 58.86  ? 190 PHE A CE2 1 
ATOM   957  C  CZ  . PHE A  1 131 ? 37.308  20.714  50.401  1.00 61.28  ? 190 PHE A CZ  1 
ATOM   958  N  N   . GLN A  1 132 ? 44.414  22.871  49.355  1.00 63.01  ? 191 GLN A N   1 
ATOM   959  C  CA  . GLN A  1 132 ? 45.852  22.827  49.122  1.00 64.30  ? 191 GLN A CA  1 
ATOM   960  C  C   . GLN A  1 132 ? 46.523  22.427  50.413  1.00 67.26  ? 191 GLN A C   1 
ATOM   961  O  O   . GLN A  1 132 ? 46.312  23.088  51.423  1.00 68.60  ? 191 GLN A O   1 
ATOM   962  C  CB  . GLN A  1 132 ? 46.331  24.216  48.701  1.00 63.66  ? 191 GLN A CB  1 
ATOM   963  C  CG  . GLN A  1 132 ? 47.842  24.382  48.476  1.00 66.44  ? 191 GLN A CG  1 
ATOM   964  C  CD  . GLN A  1 132 ? 48.176  25.616  47.629  1.00 65.71  ? 191 GLN A CD  1 
ATOM   965  O  OE1 . GLN A  1 132 ? 48.629  26.648  48.150  1.00 67.86  ? 191 GLN A OE1 1 
ATOM   966  N  NE2 . GLN A  1 132 ? 47.937  25.515  46.322  1.00 62.42  ? 191 GLN A NE2 1 
ATOM   967  N  N   . LYS B  1 7   ? 68.850  17.744  95.704  1.00 68.21  ? 66  LYS B N   1 
ATOM   968  C  CA  . LYS B  1 7   ? 67.408  17.387  95.684  1.00 69.49  ? 66  LYS B CA  1 
ATOM   969  C  C   . LYS B  1 7   ? 67.107  16.095  94.892  1.00 67.26  ? 66  LYS B C   1 
ATOM   970  O  O   . LYS B  1 7   ? 66.357  15.268  95.416  1.00 68.18  ? 66  LYS B O   1 
ATOM   971  C  CB  . LYS B  1 7   ? 66.559  18.573  95.196  1.00 71.00  ? 66  LYS B CB  1 
ATOM   972  N  N   . ILE B  1 8   ? 67.671  15.893  93.674  1.00 65.06  ? 67  ILE B N   1 
ATOM   973  C  CA  . ILE B  1 8   ? 67.403  14.639  92.882  1.00 62.95  ? 67  ILE B CA  1 
ATOM   974  C  C   . ILE B  1 8   ? 68.633  13.798  92.458  1.00 60.35  ? 67  ILE B C   1 
ATOM   975  O  O   . ILE B  1 8   ? 69.747  14.297  92.343  1.00 59.72  ? 67  ILE B O   1 
ATOM   976  C  CB  . ILE B  1 8   ? 66.523  14.887  91.608  1.00 62.25  ? 67  ILE B CB  1 
ATOM   977  C  CG1 . ILE B  1 8   ? 67.293  15.630  90.524  1.00 60.44  ? 67  ILE B CG1 1 
ATOM   978  C  CG2 . ILE B  1 8   ? 65.268  15.657  91.943  1.00 64.78  ? 67  ILE B CG2 1 
ATOM   979  C  CD1 . ILE B  1 8   ? 66.860  15.198  89.142  1.00 59.11  ? 67  ILE B CD1 1 
ATOM   980  N  N   . THR B  1 9   ? 68.395  12.516  92.203  1.00 59.37  ? 68  THR B N   1 
ATOM   981  C  CA  . THR B  1 9   ? 69.452  11.565  91.895  1.00 57.96  ? 68  THR B CA  1 
ATOM   982  C  C   . THR B  1 9   ? 69.576  11.374  90.400  1.00 56.12  ? 68  THR B C   1 
ATOM   983  O  O   . THR B  1 9   ? 68.589  11.147  89.720  1.00 55.89  ? 68  THR B O   1 
ATOM   984  C  CB  . THR B  1 9   ? 69.173  10.191  92.554  1.00 58.78  ? 68  THR B CB  1 
ATOM   985  O  OG1 . THR B  1 9   ? 69.142  10.350  93.973  1.00 61.14  ? 68  THR B OG1 1 
ATOM   986  C  CG2 . THR B  1 9   ? 70.229  9.170   92.187  1.00 57.68  ? 68  THR B CG2 1 
ATOM   987  N  N   . VAL B  1 10  ? 70.805  11.469  89.906  1.00 55.04  ? 69  VAL B N   1 
ATOM   988  C  CA  . VAL B  1 10  ? 71.120  11.214  88.517  1.00 53.56  ? 69  VAL B CA  1 
ATOM   989  C  C   . VAL B  1 10  ? 72.240  10.180  88.446  1.00 53.39  ? 69  VAL B C   1 
ATOM   990  O  O   . VAL B  1 10  ? 73.248  10.290  89.129  1.00 53.45  ? 69  VAL B O   1 
ATOM   991  C  CB  . VAL B  1 10  ? 71.575  12.502  87.810  1.00 52.70  ? 69  VAL B CB  1 
ATOM   992  C  CG1 . VAL B  1 10  ? 71.868  12.215  86.353  1.00 51.46  ? 69  VAL B CG1 1 
ATOM   993  C  CG2 . VAL B  1 10  ? 70.514  13.577  87.948  1.00 53.26  ? 69  VAL B CG2 1 
ATOM   994  N  N   . HIS B  1 11  ? 72.035  9.175   87.610  1.00 53.30  ? 70  HIS B N   1 
ATOM   995  C  CA  . HIS B  1 11  ? 73.055  8.192   87.298  1.00 53.70  ? 70  HIS B CA  1 
ATOM   996  C  C   . HIS B  1 11  ? 73.754  8.531   85.975  1.00 52.74  ? 70  HIS B C   1 
ATOM   997  O  O   . HIS B  1 11  ? 73.096  8.809   84.976  1.00 52.21  ? 70  HIS B O   1 
ATOM   998  C  CB  . HIS B  1 11  ? 72.421  6.804   87.183  1.00 54.84  ? 70  HIS B CB  1 
ATOM   999  C  CG  . HIS B  1 11  ? 71.604  6.409   88.373  1.00 56.28  ? 70  HIS B CG  1 
ATOM   1000 N  ND1 . HIS B  1 11  ? 72.165  6.143   89.606  1.00 57.13  ? 70  HIS B ND1 1 
ATOM   1001 C  CD2 . HIS B  1 11  ? 70.266  6.232   88.518  1.00 56.71  ? 70  HIS B CD2 1 
ATOM   1002 C  CE1 . HIS B  1 11  ? 71.204  5.837   90.460  1.00 58.36  ? 70  HIS B CE1 1 
ATOM   1003 N  NE2 . HIS B  1 11  ? 70.046  5.881   89.827  1.00 58.12  ? 70  HIS B NE2 1 
ATOM   1004 N  N   . PHE B  1 12  ? 75.083  8.498   85.975  1.00 52.80  ? 71  PHE B N   1 
ATOM   1005 C  CA  . PHE B  1 12  ? 75.863  8.661   84.773  1.00 52.37  ? 71  PHE B CA  1 
ATOM   1006 C  C   . PHE B  1 12  ? 76.505  7.345   84.401  1.00 53.58  ? 71  PHE B C   1 
ATOM   1007 O  O   . PHE B  1 12  ? 77.077  6.679   85.232  1.00 54.79  ? 71  PHE B O   1 
ATOM   1008 C  CB  . PHE B  1 12  ? 76.974  9.671   84.997  1.00 52.25  ? 71  PHE B CB  1 
ATOM   1009 C  CG  . PHE B  1 12  ? 76.510  11.082  85.133  1.00 51.21  ? 71  PHE B CG  1 
ATOM   1010 C  CD1 . PHE B  1 12  ? 76.710  11.988  84.112  1.00 50.64  ? 71  PHE B CD1 1 
ATOM   1011 C  CD2 . PHE B  1 12  ? 75.917  11.518  86.293  1.00 51.63  ? 71  PHE B CD2 1 
ATOM   1012 C  CE1 . PHE B  1 12  ? 76.305  13.293  84.238  1.00 50.91  ? 71  PHE B CE1 1 
ATOM   1013 C  CE2 . PHE B  1 12  ? 75.509  12.815  86.424  1.00 51.84  ? 71  PHE B CE2 1 
ATOM   1014 C  CZ  . PHE B  1 12  ? 75.703  13.712  85.391  1.00 51.08  ? 71  PHE B CZ  1 
ATOM   1015 N  N   . ILE B  1 13  ? 76.428  6.973   83.140  1.00 53.77  ? 72  ILE B N   1 
ATOM   1016 C  CA  . ILE B  1 13  ? 77.269  5.909   82.631  1.00 55.64  ? 72  ILE B CA  1 
ATOM   1017 C  C   . ILE B  1 13  ? 78.456  6.543   81.911  1.00 55.97  ? 72  ILE B C   1 
ATOM   1018 O  O   . ILE B  1 13  ? 78.299  7.218   80.911  1.00 55.12  ? 72  ILE B O   1 
ATOM   1019 C  CB  . ILE B  1 13  ? 76.511  4.996   81.688  1.00 56.29  ? 72  ILE B CB  1 
ATOM   1020 C  CG1 . ILE B  1 13  ? 75.365  4.320   82.436  1.00 56.54  ? 72  ILE B CG1 1 
ATOM   1021 C  CG2 . ILE B  1 13  ? 77.432  3.969   81.097  1.00 57.85  ? 72  ILE B CG2 1 
ATOM   1022 C  CD1 . ILE B  1 13  ? 74.508  3.416   81.576  1.00 57.37  ? 72  ILE B CD1 1 
ATOM   1023 N  N   . ASN B  1 14  ? 79.652  6.295   82.422  1.00 57.59  ? 73  ASN B N   1 
ATOM   1024 C  CA  . ASN B  1 14  ? 80.861  6.891   81.892  1.00 58.28  ? 73  ASN B CA  1 
ATOM   1025 C  C   . ASN B  1 14  ? 81.272  6.223   80.572  1.00 59.76  ? 73  ASN B C   1 
ATOM   1026 O  O   . ASN B  1 14  ? 80.764  5.166   80.184  1.00 60.29  ? 73  ASN B O   1 
ATOM   1027 C  CB  . ASN B  1 14  ? 81.988  6.730   82.934  1.00 60.39  ? 73  ASN B CB  1 
ATOM   1028 C  CG  . ASN B  1 14  ? 82.905  7.969   83.050  1.00 61.34  ? 73  ASN B CG  1 
ATOM   1029 O  OD1 . ASN B  1 14  ? 83.037  8.788   82.121  1.00 60.83  ? 73  ASN B OD1 1 
ATOM   1030 N  ND2 . ASN B  1 14  ? 83.544  8.099   84.217  1.00 61.85  ? 73  ASN B ND2 1 
ATOM   1031 N  N   . ARG B  1 15  ? 82.239  6.829   79.903  1.00 60.48  ? 74  ARG B N   1 
ATOM   1032 C  CA  . ARG B  1 15  ? 82.832  6.235   78.708  1.00 62.66  ? 74  ARG B CA  1 
ATOM   1033 C  C   . ARG B  1 15  ? 83.419  4.883   79.012  1.00 65.97  ? 74  ARG B C   1 
ATOM   1034 O  O   . ARG B  1 15  ? 83.380  4.000   78.158  1.00 67.94  ? 74  ARG B O   1 
ATOM   1035 C  CB  . ARG B  1 15  ? 83.918  7.152   78.153  1.00 63.28  ? 74  ARG B CB  1 
ATOM   1036 C  CG  . ARG B  1 15  ? 83.360  8.402   77.490  1.00 60.97  ? 74  ARG B CG  1 
ATOM   1037 C  CD  . ARG B  1 15  ? 84.366  9.542   77.370  1.00 60.88  ? 74  ARG B CD  1 
ATOM   1038 N  NE  . ARG B  1 15  ? 83.690  10.794  77.023  1.00 58.90  ? 74  ARG B NE  1 
ATOM   1039 C  CZ  . ARG B  1 15  ? 84.082  12.016  77.389  1.00 58.52  ? 74  ARG B CZ  1 
ATOM   1040 N  NH1 . ARG B  1 15  ? 85.170  12.197  78.124  1.00 60.63  ? 74  ARG B NH1 1 
ATOM   1041 N  NH2 . ARG B  1 15  ? 83.374  13.071  77.027  1.00 56.14  ? 74  ARG B NH2 1 
ATOM   1042 N  N   . ASP B  1 16  ? 83.974  4.758   80.231  1.00 67.06  ? 75  ASP B N   1 
ATOM   1043 C  CA  . ASP B  1 16  ? 84.538  3.511   80.799  1.00 70.28  ? 75  ASP B CA  1 
ATOM   1044 C  C   . ASP B  1 16  ? 83.505  2.388   80.938  1.00 70.47  ? 75  ASP B C   1 
ATOM   1045 O  O   . ASP B  1 16  ? 83.848  1.219   80.985  1.00 73.30  ? 75  ASP B O   1 
ATOM   1046 C  CB  . ASP B  1 16  ? 85.121  3.798   82.208  1.00 70.68  ? 75  ASP B CB  1 
ATOM   1047 C  CG  . ASP B  1 16  ? 86.448  4.599   82.173  1.00 72.81  ? 75  ASP B CG  1 
ATOM   1048 O  OD1 . ASP B  1 16  ? 86.867  5.070   81.083  1.00 74.13  ? 75  ASP B OD1 1 
ATOM   1049 O  OD2 . ASP B  1 16  ? 87.072  4.763   83.252  1.00 73.60  ? 75  ASP B OD2 1 
ATOM   1050 N  N   . GLY B  1 17  ? 82.240  2.758   81.043  1.00 67.68  ? 76  GLY B N   1 
ATOM   1051 C  CA  . GLY B  1 17  ? 81.185  1.800   81.300  1.00 68.05  ? 76  GLY B CA  1 
ATOM   1052 C  C   . GLY B  1 17  ? 80.858  1.745   82.785  1.00 67.39  ? 76  GLY B C   1 
ATOM   1053 O  O   . GLY B  1 17  ? 80.037  0.934   83.213  1.00 68.12  ? 76  GLY B O   1 
ATOM   1054 N  N   . GLU B  1 18  ? 81.462  2.637   83.566  1.00 66.29  ? 77  GLU B N   1 
ATOM   1055 C  CA  . GLU B  1 18  ? 81.261  2.652   85.003  1.00 66.13  ? 77  GLU B CA  1 
ATOM   1056 C  C   . GLU B  1 18  ? 80.137  3.594   85.371  1.00 62.89  ? 77  GLU B C   1 
ATOM   1057 O  O   . GLU B  1 18  ? 80.039  4.669   84.801  1.00 60.93  ? 77  GLU B O   1 
ATOM   1058 C  CB  . GLU B  1 18  ? 82.541  3.093   85.682  1.00 67.58  ? 77  GLU B CB  1 
ATOM   1059 C  CG  . GLU B  1 18  ? 82.428  3.289   87.200  1.00 68.43  ? 77  GLU B CG  1 
ATOM   1060 N  N   . THR B  1 19  ? 79.285  3.185   86.313  1.00 62.72  ? 78  THR B N   1 
ATOM   1061 C  CA  . THR B  1 19  ? 78.120  3.972   86.686  1.00 60.45  ? 78  THR B CA  1 
ATOM   1062 C  C   . THR B  1 19  ? 78.424  4.801   87.925  1.00 59.92  ? 78  THR B C   1 
ATOM   1063 O  O   . THR B  1 19  ? 78.854  4.279   88.927  1.00 61.42  ? 78  THR B O   1 
ATOM   1064 C  CB  . THR B  1 19  ? 76.900  3.084   86.922  1.00 60.90  ? 78  THR B CB  1 
ATOM   1065 O  OG1 . THR B  1 19  ? 76.796  2.142   85.844  1.00 61.55  ? 78  THR B OG1 1 
ATOM   1066 C  CG2 . THR B  1 19  ? 75.625  3.949   86.996  1.00 59.24  ? 78  THR B CG2 1 
ATOM   1067 N  N   . LEU B  1 20  ? 78.225  6.109   87.814  1.00 58.21  ? 79  LEU B N   1 
ATOM   1068 C  CA  . LEU B  1 20  ? 78.417  7.033   88.916  1.00 58.11  ? 79  LEU B CA  1 
ATOM   1069 C  C   . LEU B  1 20  ? 77.034  7.548   89.308  1.00 57.13  ? 79  LEU B C   1 
ATOM   1070 O  O   . LEU B  1 20  ? 76.310  8.092   88.474  1.00 55.78  ? 79  LEU B O   1 
ATOM   1071 C  CB  . LEU B  1 20  ? 79.301  8.215   88.488  1.00 57.43  ? 79  LEU B CB  1 
ATOM   1072 C  CG  . LEU B  1 20  ? 80.583  7.934   87.695  1.00 59.03  ? 79  LEU B CG  1 
ATOM   1073 C  CD1 . LEU B  1 20  ? 81.192  9.239   87.221  1.00 58.14  ? 79  LEU B CD1 1 
ATOM   1074 C  CD2 . LEU B  1 20  ? 81.619  7.135   88.507  1.00 61.98  ? 79  LEU B CD2 1 
ATOM   1075 N  N   . THR B  1 21  ? 76.672  7.402   90.572  1.00 57.94  ? 80  THR B N   1 
ATOM   1076 C  CA  . THR B  1 21  ? 75.399  7.916   91.058  1.00 57.29  ? 80  THR B CA  1 
ATOM   1077 C  C   . THR B  1 21  ? 75.670  9.146   91.891  1.00 57.19  ? 80  THR B C   1 
ATOM   1078 O  O   . THR B  1 21  ? 76.485  9.095   92.772  1.00 58.48  ? 80  THR B O   1 
ATOM   1079 C  CB  . THR B  1 21  ? 74.686  6.879   91.931  1.00 58.83  ? 80  THR B CB  1 
ATOM   1080 O  OG1 . THR B  1 21  ? 74.298  5.754   91.149  1.00 58.31  ? 80  THR B OG1 1 
ATOM   1081 C  CG2 . THR B  1 21  ? 73.435  7.453   92.556  1.00 59.16  ? 80  THR B CG2 1 
ATOM   1082 N  N   . THR B  1 22  ? 74.983  10.243  91.604  1.00 56.41  ? 81  THR B N   1 
ATOM   1083 C  CA  . THR B  1 22  ? 75.208  11.521  92.282  1.00 57.02  ? 81  THR B CA  1 
ATOM   1084 C  C   . THR B  1 22  ? 73.879  12.247  92.462  1.00 57.29  ? 81  THR B C   1 
ATOM   1085 O  O   . THR B  1 22  ? 72.840  11.802  91.991  1.00 57.01  ? 81  THR B O   1 
ATOM   1086 C  CB  . THR B  1 22  ? 76.210  12.428  91.493  1.00 56.27  ? 81  THR B CB  1 
ATOM   1087 O  OG1 . THR B  1 22  ? 76.701  13.474  92.340  1.00 56.98  ? 81  THR B OG1 1 
ATOM   1088 C  CG2 . THR B  1 22  ? 75.558  13.017  90.234  1.00 54.34  ? 81  THR B CG2 1 
ATOM   1089 N  N   . LYS B  1 23  ? 73.928  13.371  93.153  1.00 58.51  ? 82  LYS B N   1 
ATOM   1090 C  CA  . LYS B  1 23  ? 72.727  14.098  93.518  1.00 59.69  ? 82  LYS B CA  1 
ATOM   1091 C  C   . LYS B  1 23  ? 72.881  15.511  93.007  1.00 59.47  ? 82  LYS B C   1 
ATOM   1092 O  O   . LYS B  1 23  ? 73.937  16.115  93.184  1.00 59.80  ? 82  LYS B O   1 
ATOM   1093 C  CB  . LYS B  1 23  ? 72.547  14.092  95.049  1.00 62.03  ? 82  LYS B CB  1 
ATOM   1094 C  CG  . LYS B  1 23  ? 71.917  12.808  95.596  1.00 62.93  ? 82  LYS B CG  1 
ATOM   1095 C  CD  . LYS B  1 23  ? 71.295  12.991  96.996  1.00 65.69  ? 82  LYS B CD  1 
ATOM   1096 C  CE  . LYS B  1 23  ? 72.323  13.025  98.117  1.00 67.34  ? 82  LYS B CE  1 
ATOM   1097 N  NZ  . LYS B  1 23  ? 73.249  14.171  98.030  1.00 68.01  ? 82  LYS B NZ  1 
ATOM   1098 N  N   . GLY B  1 24  ? 71.840  16.036  92.373  1.00 59.11  ? 83  GLY B N   1 
ATOM   1099 C  CA  . GLY B  1 24  ? 71.873  17.418  91.891  1.00 59.66  ? 83  GLY B CA  1 
ATOM   1100 C  C   . GLY B  1 24  ? 70.685  18.235  92.338  1.00 61.64  ? 83  GLY B C   1 
ATOM   1101 O  O   . GLY B  1 24  ? 69.631  17.685  92.637  1.00 62.13  ? 83  GLY B O   1 
ATOM   1102 N  N   . LYS B  1 25  ? 70.860  19.553  92.372  1.00 63.14  ? 84  LYS B N   1 
ATOM   1103 C  CA  . LYS B  1 25  ? 69.767  20.455  92.733  1.00 66.15  ? 84  LYS B CA  1 
ATOM   1104 C  C   . LYS B  1 25  ? 68.872  20.631  91.531  1.00 65.15  ? 84  LYS B C   1 
ATOM   1105 O  O   . LYS B  1 25  ? 69.359  20.734  90.405  1.00 63.30  ? 84  LYS B O   1 
ATOM   1106 C  CB  . LYS B  1 25  ? 70.288  21.835  93.172  1.00 68.65  ? 84  LYS B CB  1 
ATOM   1107 C  CG  . LYS B  1 25  ? 71.130  21.861  94.466  1.00 71.71  ? 84  LYS B CG  1 
ATOM   1108 C  CD  . LYS B  1 25  ? 72.445  22.690  94.230  1.00 74.71  ? 84  LYS B CD  1 
ATOM   1109 C  CE  . LYS B  1 25  ? 73.133  23.124  95.537  1.00 78.70  ? 84  LYS B CE  1 
ATOM   1110 N  NZ  . LYS B  1 25  ? 74.179  24.167  95.291  1.00 80.05  ? 84  LYS B NZ  1 
ATOM   1111 N  N   . VAL B  1 26  ? 67.566  20.670  91.769  1.00 67.00  ? 85  VAL B N   1 
ATOM   1112 C  CA  . VAL B  1 26  ? 66.603  21.027  90.724  1.00 67.26  ? 85  VAL B CA  1 
ATOM   1113 C  C   . VAL B  1 26  ? 66.956  22.440  90.204  1.00 68.15  ? 85  VAL B C   1 
ATOM   1114 O  O   . VAL B  1 26  ? 67.235  23.349  90.989  1.00 70.14  ? 85  VAL B O   1 
ATOM   1115 C  CB  . VAL B  1 26  ? 65.144  20.991  91.272  1.00 70.19  ? 85  VAL B CB  1 
ATOM   1116 C  CG1 . VAL B  1 26  ? 64.148  21.373  90.217  1.00 70.64  ? 85  VAL B CG1 1 
ATOM   1117 C  CG2 . VAL B  1 26  ? 64.812  19.610  91.806  1.00 70.10  ? 85  VAL B CG2 1 
ATOM   1118 N  N   . GLY B  1 27  ? 66.977  22.610  88.886  1.00 66.46  ? 86  GLY B N   1 
ATOM   1119 C  CA  . GLY B  1 27  ? 67.356  23.888  88.304  1.00 67.42  ? 86  GLY B CA  1 
ATOM   1120 C  C   . GLY B  1 27  ? 68.805  23.972  87.856  1.00 65.26  ? 86  GLY B C   1 
ATOM   1121 O  O   . GLY B  1 27  ? 69.155  24.839  87.062  1.00 65.48  ? 86  GLY B O   1 
ATOM   1122 N  N   . ASP B  1 28  ? 69.657  23.081  88.352  1.00 63.53  ? 87  ASP B N   1 
ATOM   1123 C  CA  . ASP B  1 28  ? 71.062  23.019  87.910  1.00 61.59  ? 87  ASP B CA  1 
ATOM   1124 C  C   . ASP B  1 28  ? 71.179  22.338  86.529  1.00 59.00  ? 87  ASP B C   1 
ATOM   1125 O  O   . ASP B  1 28  ? 70.390  21.438  86.195  1.00 57.89  ? 87  ASP B O   1 
ATOM   1126 C  CB  . ASP B  1 28  ? 71.916  22.229  88.921  1.00 61.12  ? 87  ASP B CB  1 
ATOM   1127 C  CG  . ASP B  1 28  ? 72.404  23.068  90.100  1.00 63.95  ? 87  ASP B CG  1 
ATOM   1128 O  OD1 . ASP B  1 28  ? 72.200  24.297  90.105  1.00 66.13  ? 87  ASP B OD1 1 
ATOM   1129 O  OD2 . ASP B  1 28  ? 73.018  22.479  91.027  1.00 64.30  ? 87  ASP B OD2 1 
ATOM   1130 N  N   . SER B  1 29  ? 72.166  22.755  85.733  1.00 57.94  ? 88  SER B N   1 
ATOM   1131 C  CA  . SER B  1 29  ? 72.422  22.101  84.448  1.00 55.95  ? 88  SER B CA  1 
ATOM   1132 C  C   . SER B  1 29  ? 73.217  20.837  84.707  1.00 54.43  ? 88  SER B C   1 
ATOM   1133 O  O   . SER B  1 29  ? 73.934  20.745  85.707  1.00 54.85  ? 88  SER B O   1 
ATOM   1134 C  CB  . SER B  1 29  ? 73.222  22.998  83.517  1.00 56.03  ? 88  SER B CB  1 
ATOM   1135 O  OG  . SER B  1 29  ? 74.607  22.955  83.834  1.00 55.86  ? 88  SER B OG  1 
ATOM   1136 N  N   . LEU B  1 30  ? 73.112  19.856  83.819  1.00 52.78  ? 89  LEU B N   1 
ATOM   1137 C  CA  . LEU B  1 30  ? 73.875  18.612  84.005  1.00 51.58  ? 89  LEU B CA  1 
ATOM   1138 C  C   . LEU B  1 30  ? 75.381  18.883  84.018  1.00 51.63  ? 89  LEU B C   1 
ATOM   1139 O  O   . LEU B  1 30  ? 76.140  18.178  84.686  1.00 51.55  ? 89  LEU B O   1 
ATOM   1140 C  CB  . LEU B  1 30  ? 73.496  17.565  82.960  1.00 50.28  ? 89  LEU B CB  1 
ATOM   1141 C  CG  . LEU B  1 30  ? 72.203  16.852  83.356  1.00 50.79  ? 89  LEU B CG  1 
ATOM   1142 C  CD1 . LEU B  1 30  ? 71.318  16.568  82.178  1.00 50.52  ? 89  LEU B CD1 1 
ATOM   1143 C  CD2 . LEU B  1 30  ? 72.504  15.564  84.125  1.00 50.06  ? 89  LEU B CD2 1 
ATOM   1144 N  N   . LEU B  1 31  ? 75.821  19.926  83.319  1.00 52.11  ? 90  LEU B N   1 
ATOM   1145 C  CA  . LEU B  1 31  ? 77.220  20.335  83.428  1.00 52.52  ? 90  LEU B CA  1 
ATOM   1146 C  C   . LEU B  1 31  ? 77.527  20.731  84.870  1.00 53.74  ? 90  LEU B C   1 
ATOM   1147 O  O   . LEU B  1 31  ? 78.507  20.272  85.439  1.00 54.17  ? 90  LEU B O   1 
ATOM   1148 C  CB  . LEU B  1 31  ? 77.555  21.488  82.479  1.00 52.69  ? 90  LEU B CB  1 
ATOM   1149 C  CG  . LEU B  1 31  ? 78.984  22.036  82.608  1.00 53.48  ? 90  LEU B CG  1 
ATOM   1150 C  CD1 . LEU B  1 31  ? 80.014  20.914  82.411  1.00 52.61  ? 90  LEU B CD1 1 
ATOM   1151 C  CD2 . LEU B  1 31  ? 79.239  23.192  81.661  1.00 53.32  ? 90  LEU B CD2 1 
ATOM   1152 N  N   . ASP B  1 32  ? 76.687  21.586  85.446  1.00 54.87  ? 91  ASP B N   1 
ATOM   1153 C  CA  . ASP B  1 32  ? 76.845  21.996  86.837  1.00 56.64  ? 91  ASP B CA  1 
ATOM   1154 C  C   . ASP B  1 32  ? 76.996  20.767  87.741  1.00 56.13  ? 91  ASP B C   1 
ATOM   1155 O  O   . ASP B  1 32  ? 77.831  20.754  88.630  1.00 57.29  ? 91  ASP B O   1 
ATOM   1156 C  CB  . ASP B  1 32  ? 75.649  22.834  87.320  1.00 58.24  ? 91  ASP B CB  1 
ATOM   1157 C  CG  . ASP B  1 32  ? 75.539  24.183  86.622  1.00 59.97  ? 91  ASP B CG  1 
ATOM   1158 O  OD1 . ASP B  1 32  ? 76.570  24.770  86.225  1.00 61.11  ? 91  ASP B OD1 1 
ATOM   1159 O  OD2 . ASP B  1 32  ? 74.396  24.672  86.479  1.00 61.22  ? 91  ASP B OD2 1 
ATOM   1160 N  N   . VAL B  1 33  ? 76.199  19.737  87.496  1.00 54.85  ? 92  VAL B N   1 
ATOM   1161 C  CA  . VAL B  1 33  ? 76.219  18.545  88.323  1.00 54.77  ? 92  VAL B CA  1 
ATOM   1162 C  C   . VAL B  1 33  ? 77.561  17.859  88.220  1.00 54.55  ? 92  VAL B C   1 
ATOM   1163 O  O   . VAL B  1 33  ? 78.158  17.516  89.227  1.00 55.96  ? 92  VAL B O   1 
ATOM   1164 C  CB  . VAL B  1 33  ? 75.103  17.561  87.941  1.00 53.85  ? 92  VAL B CB  1 
ATOM   1165 C  CG1 . VAL B  1 33  ? 75.285  16.228  88.651  1.00 53.29  ? 92  VAL B CG1 1 
ATOM   1166 C  CG2 . VAL B  1 33  ? 73.753  18.169  88.257  1.00 54.67  ? 92  VAL B CG2 1 
ATOM   1167 N  N   . VAL B  1 34  ? 78.050  17.680  87.002  1.00 53.51  ? 93  VAL B N   1 
ATOM   1168 C  CA  . VAL B  1 34  ? 79.356  17.083  86.785  1.00 53.54  ? 93  VAL B CA  1 
ATOM   1169 C  C   . VAL B  1 34  ? 80.467  17.864  87.519  1.00 55.14  ? 93  VAL B C   1 
ATOM   1170 O  O   . VAL B  1 34  ? 81.315  17.281  88.199  1.00 55.96  ? 93  VAL B O   1 
ATOM   1171 C  CB  . VAL B  1 34  ? 79.664  17.006  85.274  1.00 52.69  ? 93  VAL B CB  1 
ATOM   1172 C  CG1 . VAL B  1 34  ? 81.075  16.501  85.022  1.00 53.35  ? 93  VAL B CG1 1 
ATOM   1173 C  CG2 . VAL B  1 34  ? 78.652  16.115  84.572  1.00 51.30  ? 93  VAL B CG2 1 
ATOM   1174 N  N   . VAL B  1 35  ? 80.441  19.182  87.396  1.00 55.68  ? 94  VAL B N   1 
ATOM   1175 C  CA  . VAL B  1 35  ? 81.497  20.007  87.944  1.00 57.68  ? 94  VAL B CA  1 
ATOM   1176 C  C   . VAL B  1 35  ? 81.387  20.169  89.464  1.00 59.67  ? 94  VAL B C   1 
ATOM   1177 O  O   . VAL B  1 35  ? 82.383  20.007  90.191  1.00 61.18  ? 94  VAL B O   1 
ATOM   1178 C  CB  . VAL B  1 35  ? 81.505  21.406  87.299  1.00 58.29  ? 94  VAL B CB  1 
ATOM   1179 C  CG1 . VAL B  1 35  ? 82.427  22.338  88.061  1.00 60.34  ? 94  VAL B CG1 1 
ATOM   1180 C  CG2 . VAL B  1 35  ? 81.938  21.322  85.826  1.00 57.03  ? 94  VAL B CG2 1 
ATOM   1181 N  N   . GLU B  1 36  ? 80.189  20.513  89.944  1.00 59.90  ? 95  GLU B N   1 
ATOM   1182 C  CA  . GLU B  1 36  ? 79.987  20.764  91.381  1.00 62.16  ? 95  GLU B CA  1 
ATOM   1183 C  C   . GLU B  1 36  ? 80.270  19.523  92.237  1.00 62.27  ? 95  GLU B C   1 
ATOM   1184 O  O   . GLU B  1 36  ? 80.632  19.656  93.411  1.00 64.03  ? 95  GLU B O   1 
ATOM   1185 C  CB  . GLU B  1 36  ? 78.575  21.313  91.685  1.00 62.87  ? 95  GLU B CB  1 
ATOM   1186 C  CG  . GLU B  1 36  ? 78.480  22.847  91.841  1.00 67.09  ? 95  GLU B CG  1 
ATOM   1187 C  CD  . GLU B  1 36  ? 77.180  23.454  91.254  1.00 69.87  ? 95  GLU B CD  1 
ATOM   1188 O  OE1 . GLU B  1 36  ? 77.290  24.367  90.401  1.00 70.39  ? 95  GLU B OE1 1 
ATOM   1189 O  OE2 . GLU B  1 36  ? 76.057  23.027  91.633  1.00 71.78  ? 95  GLU B OE2 1 
ATOM   1190 N  N   . ASN B  1 37  ? 80.114  18.332  91.644  1.00 60.40  ? 96  ASN B N   1 
ATOM   1191 C  CA  . ASN B  1 37  ? 80.353  17.072  92.349  1.00 60.72  ? 96  ASN B CA  1 
ATOM   1192 C  C   . ASN B  1 37  ? 81.650  16.363  91.948  1.00 60.98  ? 96  ASN B C   1 
ATOM   1193 O  O   . ASN B  1 37  ? 81.906  15.240  92.381  1.00 61.45  ? 96  ASN B O   1 
ATOM   1194 C  CB  . ASN B  1 37  ? 79.156  16.125  92.159  1.00 59.56  ? 96  ASN B CB  1 
ATOM   1195 C  CG  . ASN B  1 37  ? 77.881  16.616  92.849  1.00 59.79  ? 96  ASN B CG  1 
ATOM   1196 O  OD1 . ASN B  1 37  ? 76.798  16.430  92.332  1.00 59.19  ? 96  ASN B OD1 1 
ATOM   1197 N  ND2 . ASN B  1 37  ? 78.009  17.228  94.009  1.00 61.78  ? 96  ASN B ND2 1 
ATOM   1198 N  N   . ASN B  1 38  ? 82.466  17.018  91.127  1.00 61.03  ? 97  ASN B N   1 
ATOM   1199 C  CA  . ASN B  1 38  ? 83.817  16.537  90.817  1.00 62.12  ? 97  ASN B CA  1 
ATOM   1200 C  C   . ASN B  1 38  ? 83.816  15.086  90.368  1.00 61.24  ? 97  ASN B C   1 
ATOM   1201 O  O   . ASN B  1 38  ? 84.517  14.262  90.935  1.00 62.59  ? 97  ASN B O   1 
ATOM   1202 C  CB  . ASN B  1 38  ? 84.753  16.696  92.037  1.00 64.78  ? 97  ASN B CB  1 
ATOM   1203 C  CG  . ASN B  1 38  ? 85.388  18.078  92.146  1.00 67.75  ? 97  ASN B CG  1 
ATOM   1204 O  OD1 . ASN B  1 38  ? 85.982  18.609  91.180  1.00 67.89  ? 97  ASN B OD1 1 
ATOM   1205 N  ND2 . ASN B  1 38  ? 85.299  18.659  93.344  1.00 71.01  ? 97  ASN B ND2 1 
ATOM   1206 N  N   . LEU B  1 39  ? 83.020  14.798  89.341  1.00 59.32  ? 98  LEU B N   1 
ATOM   1207 C  CA  . LEU B  1 39  ? 82.894  13.454  88.780  1.00 58.85  ? 98  LEU B CA  1 
ATOM   1208 C  C   . LEU B  1 39  ? 84.022  13.146  87.817  1.00 59.87  ? 98  LEU B C   1 
ATOM   1209 O  O   . LEU B  1 39  ? 84.545  14.055  87.148  1.00 59.80  ? 98  LEU B O   1 
ATOM   1210 C  CB  . LEU B  1 39  ? 81.570  13.303  88.024  1.00 56.69  ? 98  LEU B CB  1 
ATOM   1211 C  CG  . LEU B  1 39  ? 80.276  13.489  88.825  1.00 56.33  ? 98  LEU B CG  1 
ATOM   1212 C  CD1 . LEU B  1 39  ? 79.043  13.367  87.961  1.00 54.89  ? 98  LEU B CD1 1 
ATOM   1213 C  CD2 . LEU B  1 39  ? 80.187  12.485  89.946  1.00 57.94  ? 98  LEU B CD2 1 
ATOM   1214 N  N   . ASP B  1 40  ? 84.347  11.851  87.708  1.00 61.23  ? 99  ASP B N   1 
ATOM   1215 C  CA  . ASP B  1 40  ? 85.539  11.369  86.970  1.00 63.14  ? 99  ASP B CA  1 
ATOM   1216 C  C   . ASP B  1 40  ? 85.329  11.319  85.435  1.00 62.32  ? 99  ASP B C   1 
ATOM   1217 O  O   . ASP B  1 40  ? 85.575  10.274  84.807  1.00 64.15  ? 99  ASP B O   1 
ATOM   1218 C  CB  . ASP B  1 40  ? 85.955  9.976   87.508  1.00 65.28  ? 99  ASP B CB  1 
ATOM   1219 C  CG  . ASP B  1 40  ? 87.334  9.511   86.999  1.00 68.68  ? 99  ASP B CG  1 
ATOM   1220 O  OD1 . ASP B  1 40  ? 88.097  10.302  86.379  1.00 69.46  ? 99  ASP B OD1 1 
ATOM   1221 O  OD2 . ASP B  1 40  ? 87.654  8.327   87.230  1.00 71.17  ? 99  ASP B OD2 1 
ATOM   1222 N  N   . ILE B  1 41  ? 84.919  12.446  84.833  1.00 60.40  ? 100 ILE B N   1 
ATOM   1223 C  CA  . ILE B  1 41  ? 84.697  12.514  83.387  1.00 59.23  ? 100 ILE B CA  1 
ATOM   1224 C  C   . ILE B  1 41  ? 85.650  13.500  82.739  1.00 60.09  ? 100 ILE B C   1 
ATOM   1225 O  O   . ILE B  1 41  ? 85.496  14.717  82.900  1.00 59.76  ? 100 ILE B O   1 
ATOM   1226 C  CB  . ILE B  1 41  ? 83.298  12.962  83.039  1.00 56.99  ? 100 ILE B CB  1 
ATOM   1227 C  CG1 . ILE B  1 41  ? 82.255  12.151  83.798  1.00 56.27  ? 100 ILE B CG1 1 
ATOM   1228 C  CG2 . ILE B  1 41  ? 83.059  12.804  81.526  1.00 57.03  ? 100 ILE B CG2 1 
ATOM   1229 C  CD1 . ILE B  1 41  ? 80.894  12.819  83.803  1.00 53.56  ? 100 ILE B CD1 1 
ATOM   1230 N  N   . ASP B  1 42  ? 86.613  12.969  81.987  1.00 61.82  ? 101 ASP B N   1 
ATOM   1231 C  CA  . ASP B  1 42  ? 87.682  13.772  81.413  1.00 63.03  ? 101 ASP B CA  1 
ATOM   1232 C  C   . ASP B  1 42  ? 87.132  14.557  80.225  1.00 61.38  ? 101 ASP B C   1 
ATOM   1233 O  O   . ASP B  1 42  ? 86.341  14.034  79.463  1.00 60.72  ? 101 ASP B O   1 
ATOM   1234 C  CB  . ASP B  1 42  ? 88.859  12.865  80.988  1.00 66.24  ? 101 ASP B CB  1 
ATOM   1235 C  CG  . ASP B  1 42  ? 89.322  11.902  82.131  1.00 69.28  ? 101 ASP B CG  1 
ATOM   1236 O  OD1 . ASP B  1 42  ? 88.823  12.050  83.273  1.00 68.83  ? 101 ASP B OD1 1 
ATOM   1237 O  OD2 . ASP B  1 42  ? 90.157  10.991  81.892  1.00 71.81  ? 101 ASP B OD2 1 
ATOM   1238 N  N   . GLY B  1 43  ? 87.517  15.822  80.106  1.00 61.31  ? 102 GLY B N   1 
ATOM   1239 C  CA  . GLY B  1 43  ? 87.241  16.612  78.906  1.00 60.67  ? 102 GLY B CA  1 
ATOM   1240 C  C   . GLY B  1 43  ? 85.855  17.226  78.815  1.00 58.42  ? 102 GLY B C   1 
ATOM   1241 O  O   . GLY B  1 43  ? 85.611  18.072  77.942  1.00 58.93  ? 102 GLY B O   1 
ATOM   1242 N  N   . PHE B  1 44  ? 84.969  16.843  79.727  1.00 56.74  ? 103 PHE B N   1 
ATOM   1243 C  CA  . PHE B  1 44  ? 83.561  17.234  79.674  1.00 54.79  ? 103 PHE B CA  1 
ATOM   1244 C  C   . PHE B  1 44  ? 83.351  18.697  80.038  1.00 54.25  ? 103 PHE B C   1 
ATOM   1245 O  O   . PHE B  1 44  ? 83.682  19.099  81.136  1.00 55.20  ? 103 PHE B O   1 
ATOM   1246 C  CB  . PHE B  1 44  ? 82.775  16.354  80.653  1.00 54.07  ? 103 PHE B CB  1 
ATOM   1247 C  CG  . PHE B  1 44  ? 81.273  16.422  80.488  1.00 52.22  ? 103 PHE B CG  1 
ATOM   1248 C  CD1 . PHE B  1 44  ? 80.618  15.554  79.631  1.00 50.81  ? 103 PHE B CD1 1 
ATOM   1249 C  CD2 . PHE B  1 44  ? 80.516  17.320  81.226  1.00 51.62  ? 103 PHE B CD2 1 
ATOM   1250 C  CE1 . PHE B  1 44  ? 79.257  15.590  79.493  1.00 49.91  ? 103 PHE B CE1 1 
ATOM   1251 C  CE2 . PHE B  1 44  ? 79.145  17.367  81.084  1.00 50.64  ? 103 PHE B CE2 1 
ATOM   1252 C  CZ  . PHE B  1 44  ? 78.512  16.501  80.214  1.00 49.74  ? 103 PHE B CZ  1 
ATOM   1253 N  N   . GLY B  1 45  ? 82.779  19.482  79.133  1.00 53.58  ? 104 GLY B N   1 
ATOM   1254 C  CA  . GLY B  1 45  ? 82.445  20.881  79.423  1.00 53.70  ? 104 GLY B CA  1 
ATOM   1255 C  C   . GLY B  1 45  ? 83.583  21.870  79.224  1.00 55.05  ? 104 GLY B C   1 
ATOM   1256 O  O   . GLY B  1 45  ? 83.794  22.755  80.048  1.00 55.62  ? 104 GLY B O   1 
ATOM   1257 N  N   . ALA B  1 46  ? 84.310  21.730  78.119  1.00 55.76  ? 105 ALA B N   1 
ATOM   1258 C  CA  . ALA B  1 46  ? 85.445  22.626  77.811  1.00 57.52  ? 105 ALA B CA  1 
ATOM   1259 C  C   . ALA B  1 46  ? 85.080  24.110  77.745  1.00 58.01  ? 105 ALA B C   1 
ATOM   1260 O  O   . ALA B  1 46  ? 85.782  24.936  78.298  1.00 59.38  ? 105 ALA B O   1 
ATOM   1261 C  CB  . ALA B  1 46  ? 86.114  22.206  76.530  1.00 58.06  ? 105 ALA B CB  1 
ATOM   1262 N  N   . CYS B  1 47  ? 83.968  24.445  77.098  1.00 57.49  ? 106 CYS B N   1 
ATOM   1263 C  CA  . CYS B  1 47  ? 83.573  25.857  76.941  1.00 58.50  ? 106 CYS B CA  1 
ATOM   1264 C  C   . CYS B  1 47  ? 82.867  26.430  78.172  1.00 58.69  ? 106 CYS B C   1 
ATOM   1265 O  O   . CYS B  1 47  ? 82.422  27.584  78.152  1.00 59.64  ? 106 CYS B O   1 
ATOM   1266 C  CB  . CYS B  1 47  ? 82.703  26.031  75.698  1.00 57.87  ? 106 CYS B CB  1 
ATOM   1267 S  SG  . CYS B  1 47  ? 80.979  25.662  75.911  1.00 57.79  ? 106 CYS B SG  1 
ATOM   1268 N  N   . GLU B  1 48  ? 82.766  25.614  79.230  1.00 57.98  ? 107 GLU B N   1 
ATOM   1269 C  CA  . GLU B  1 48  ? 82.152  25.999  80.504  1.00 58.41  ? 107 GLU B CA  1 
ATOM   1270 C  C   . GLU B  1 48  ? 80.696  26.438  80.347  1.00 58.07  ? 107 GLU B C   1 
ATOM   1271 O  O   . GLU B  1 48  ? 80.218  27.335  81.044  1.00 59.35  ? 107 GLU B O   1 
ATOM   1272 C  CB  . GLU B  1 48  ? 83.005  27.075  81.210  1.00 60.80  ? 107 GLU B CB  1 
ATOM   1273 C  CG  . GLU B  1 48  ? 84.375  26.550  81.628  1.00 61.83  ? 107 GLU B CG  1 
ATOM   1274 C  CD  . GLU B  1 48  ? 85.185  27.542  82.436  1.00 65.19  ? 107 GLU B CD  1 
ATOM   1275 O  OE1 . GLU B  1 48  ? 85.506  28.611  81.893  1.00 66.83  ? 107 GLU B OE1 1 
ATOM   1276 O  OE2 . GLU B  1 48  ? 85.521  27.234  83.610  1.00 66.59  ? 107 GLU B OE2 1 
ATOM   1277 N  N   . GLY B  1 49  ? 79.998  25.794  79.420  1.00 56.65  ? 108 GLY B N   1 
ATOM   1278 C  CA  . GLY B  1 49  ? 78.576  26.011  79.244  1.00 56.61  ? 108 GLY B CA  1 
ATOM   1279 C  C   . GLY B  1 49  ? 78.198  27.286  78.516  1.00 58.12  ? 108 GLY B C   1 
ATOM   1280 O  O   . GLY B  1 49  ? 77.152  27.861  78.791  1.00 58.82  ? 108 GLY B O   1 
ATOM   1281 N  N   . THR B  1 50  ? 79.036  27.727  77.585  1.00 58.63  ? 109 THR B N   1 
ATOM   1282 C  CA  . THR B  1 50  ? 78.724  28.893  76.748  1.00 60.31  ? 109 THR B CA  1 
ATOM   1283 C  C   . THR B  1 50  ? 78.361  28.519  75.302  1.00 59.45  ? 109 THR B C   1 
ATOM   1284 O  O   . THR B  1 50  ? 78.479  29.334  74.392  1.00 60.77  ? 109 THR B O   1 
ATOM   1285 C  CB  . THR B  1 50  ? 79.893  29.871  76.747  1.00 61.97  ? 109 THR B CB  1 
ATOM   1286 O  OG1 . THR B  1 50  ? 81.049  29.211  76.232  1.00 61.34  ? 109 THR B OG1 1 
ATOM   1287 C  CG2 . THR B  1 50  ? 80.184  30.330  78.160  1.00 63.05  ? 109 THR B CG2 1 
ATOM   1288 N  N   . LEU B  1 51  ? 77.896  27.287  75.106  1.00 57.80  ? 110 LEU B N   1 
ATOM   1289 C  CA  . LEU B  1 51  ? 77.467  26.795  73.790  1.00 57.31  ? 110 LEU B CA  1 
ATOM   1290 C  C   . LEU B  1 51  ? 78.500  27.017  72.705  1.00 57.84  ? 110 LEU B C   1 
ATOM   1291 O  O   . LEU B  1 51  ? 78.178  27.503  71.630  1.00 59.05  ? 110 LEU B O   1 
ATOM   1292 C  CB  . LEU B  1 51  ? 76.128  27.411  73.375  1.00 58.19  ? 110 LEU B CB  1 
ATOM   1293 C  CG  . LEU B  1 51  ? 74.900  26.669  73.856  1.00 57.33  ? 110 LEU B CG  1 
ATOM   1294 C  CD1 . LEU B  1 51  ? 73.685  27.401  73.400  1.00 59.33  ? 110 LEU B CD1 1 
ATOM   1295 C  CD2 . LEU B  1 51  ? 74.868  25.254  73.343  1.00 55.70  ? 110 LEU B CD2 1 
ATOM   1296 N  N   . ALA B  1 52  ? 79.738  26.650  72.993  1.00 57.56  ? 111 ALA B N   1 
ATOM   1297 C  CA  . ALA B  1 52  ? 80.811  26.829  72.048  1.00 58.69  ? 111 ALA B CA  1 
ATOM   1298 C  C   . ALA B  1 52  ? 81.644  25.578  71.861  1.00 58.14  ? 111 ALA B C   1 
ATOM   1299 O  O   . ALA B  1 52  ? 82.578  25.599  71.099  1.00 59.58  ? 111 ALA B O   1 
ATOM   1300 C  CB  . ALA B  1 52  ? 81.688  27.999  72.473  1.00 60.25  ? 111 ALA B CB  1 
ATOM   1301 N  N   . CYS B  1 53  ? 81.322  24.491  72.549  1.00 56.82  ? 112 CYS B N   1 
ATOM   1302 C  CA  . CYS B  1 53  ? 81.973  23.212  72.291  1.00 56.70  ? 112 CYS B CA  1 
ATOM   1303 C  C   . CYS B  1 53  ? 80.911  22.147  72.097  1.00 55.39  ? 112 CYS B C   1 
ATOM   1304 O  O   . CYS B  1 53  ? 79.720  22.448  72.120  1.00 54.96  ? 112 CYS B O   1 
ATOM   1305 C  CB  . CYS B  1 53  ? 82.887  22.834  73.450  1.00 56.80  ? 112 CYS B CB  1 
ATOM   1306 S  SG  . CYS B  1 53  ? 82.052  22.551  75.023  1.00 57.22  ? 112 CYS B SG  1 
ATOM   1307 N  N   . SER B  1 54  ? 81.328  20.901  71.907  1.00 55.17  ? 113 SER B N   1 
ATOM   1308 C  CA  . SER B  1 54  ? 80.365  19.813  71.885  1.00 54.33  ? 113 SER B CA  1 
ATOM   1309 C  C   . SER B  1 54  ? 80.684  18.773  72.926  1.00 53.60  ? 113 SER B C   1 
ATOM   1310 O  O   . SER B  1 54  ? 80.265  17.644  72.801  1.00 53.33  ? 113 SER B O   1 
ATOM   1311 C  CB  . SER B  1 54  ? 80.345  19.162  70.521  1.00 55.29  ? 113 SER B CB  1 
ATOM   1312 O  OG  . SER B  1 54  ? 80.202  20.167  69.546  1.00 57.27  ? 113 SER B OG  1 
ATOM   1313 N  N   . THR B  1 55  ? 81.417  19.164  73.959  1.00 42.09  ? 114 THR B N   1 
ATOM   1314 C  CA  . THR B  1 55  ? 82.019  18.205  74.891  1.00 42.24  ? 114 THR B CA  1 
ATOM   1315 C  C   . THR B  1 55  ? 81.067  17.806  76.018  1.00 41.83  ? 114 THR B C   1 
ATOM   1316 O  O   . THR B  1 55  ? 81.282  16.778  76.660  1.00 41.79  ? 114 THR B O   1 
ATOM   1317 C  CB  . THR B  1 55  ? 83.346  18.745  75.470  1.00 44.67  ? 114 THR B CB  1 
ATOM   1318 O  OG1 . THR B  1 55  ? 83.092  19.874  76.301  1.00 46.06  ? 114 THR B OG1 1 
ATOM   1319 C  CG2 . THR B  1 55  ? 84.293  19.161  74.343  1.00 44.56  ? 114 THR B CG2 1 
ATOM   1320 N  N   . CYS B  1 56  ? 80.019  18.604  76.236  1.00 41.62  ? 115 CYS B N   1 
ATOM   1321 C  CA  . CYS B  1 56  ? 78.974  18.288  77.203  1.00 41.62  ? 115 CYS B CA  1 
ATOM   1322 C  C   . CYS B  1 56  ? 77.905  17.330  76.637  1.00 39.60  ? 115 CYS B C   1 
ATOM   1323 O  O   . CYS B  1 56  ? 76.866  17.103  77.248  1.00 39.24  ? 115 CYS B O   1 
ATOM   1324 C  CB  . CYS B  1 56  ? 78.312  19.573  77.728  1.00 43.10  ? 115 CYS B CB  1 
ATOM   1325 S  SG  . CYS B  1 56  ? 77.599  20.609  76.440  1.00 43.95  ? 115 CYS B SG  1 
ATOM   1326 N  N   . HIS B  1 57  ? 78.175  16.760  75.475  1.00 38.55  ? 116 HIS B N   1 
ATOM   1327 C  CA  . HIS B  1 57  ? 77.260  15.829  74.827  1.00 37.04  ? 116 HIS B CA  1 
ATOM   1328 C  C   . HIS B  1 57  ? 76.866  14.729  75.800  1.00 36.87  ? 116 HIS B C   1 
ATOM   1329 O  O   . HIS B  1 57  ? 77.740  14.129  76.411  1.00 37.54  ? 116 HIS B O   1 
ATOM   1330 C  CB  . HIS B  1 57  ? 77.956  15.254  73.588  1.00 36.07  ? 116 HIS B CB  1 
ATOM   1331 C  CG  . HIS B  1 57  ? 77.142  14.281  72.793  1.00 34.89  ? 116 HIS B CG  1 
ATOM   1332 N  ND1 . HIS B  1 57  ? 77.710  13.457  71.843  1.00 33.85  ? 116 HIS B ND1 1 
ATOM   1333 C  CD2 . HIS B  1 57  ? 75.821  13.984  72.802  1.00 35.02  ? 116 HIS B CD2 1 
ATOM   1334 C  CE1 . HIS B  1 57  ? 76.777  12.688  71.307  1.00 33.96  ? 116 HIS B CE1 1 
ATOM   1335 N  NE2 . HIS B  1 57  ? 75.619  12.995  71.864  1.00 34.65  ? 116 HIS B NE2 1 
ATOM   1336 N  N   . LEU B  1 58  ? 75.555  14.489  75.928  1.00 36.59  ? 117 LEU B N   1 
ATOM   1337 C  CA  . LEU B  1 58  ? 74.991  13.376  76.714  1.00 36.69  ? 117 LEU B CA  1 
ATOM   1338 C  C   . LEU B  1 58  ? 73.871  12.684  75.953  1.00 36.01  ? 117 LEU B C   1 
ATOM   1339 O  O   . LEU B  1 58  ? 73.186  13.275  75.138  1.00 36.16  ? 117 LEU B O   1 
ATOM   1340 C  CB  . LEU B  1 58  ? 74.438  13.868  78.063  1.00 37.64  ? 117 LEU B CB  1 
ATOM   1341 C  CG  . LEU B  1 58  ? 75.446  14.265  79.133  1.00 38.75  ? 117 LEU B CG  1 
ATOM   1342 C  CD1 . LEU B  1 58  ? 74.767  14.975  80.260  1.00 38.88  ? 117 LEU B CD1 1 
ATOM   1343 C  CD2 . LEU B  1 58  ? 76.214  13.067  79.640  1.00 39.65  ? 117 LEU B CD2 1 
ATOM   1344 N  N   . ILE B  1 59  ? 73.662  11.421  76.259  1.00 36.51  ? 118 ILE B N   1 
ATOM   1345 C  CA  . ILE B  1 59  ? 72.574  10.660  75.681  1.00 36.24  ? 118 ILE B CA  1 
ATOM   1346 C  C   . ILE B  1 59  ? 71.549  10.399  76.772  1.00 37.21  ? 118 ILE B C   1 
ATOM   1347 O  O   . ILE B  1 59  ? 71.916  10.034  77.885  1.00 37.96  ? 118 ILE B O   1 
ATOM   1348 C  CB  . ILE B  1 59  ? 73.078  9.335   75.121  1.00 36.34  ? 118 ILE B CB  1 
ATOM   1349 C  CG1 . ILE B  1 59  ? 73.987  9.598   73.925  1.00 35.62  ? 118 ILE B CG1 1 
ATOM   1350 C  CG2 . ILE B  1 59  ? 71.926  8.449   74.718  1.00 36.40  ? 118 ILE B CG2 1 
ATOM   1351 C  CD1 . ILE B  1 59  ? 74.718  8.358   73.447  1.00 36.72  ? 118 ILE B CD1 1 
ATOM   1352 N  N   . PHE B  1 60  ? 70.268  10.584  76.439  1.00 37.51  ? 119 PHE B N   1 
ATOM   1353 C  CA  . PHE B  1 60  ? 69.185  10.526  77.423  1.00 38.52  ? 119 PHE B CA  1 
ATOM   1354 C  C   . PHE B  1 60  ? 68.272  9.325   77.211  1.00 39.25  ? 119 PHE B C   1 
ATOM   1355 O  O   . PHE B  1 60  ? 68.251  8.708   76.137  1.00 38.35  ? 119 PHE B O   1 
ATOM   1356 C  CB  . PHE B  1 60  ? 68.380  11.813  77.371  1.00 39.12  ? 119 PHE B CB  1 
ATOM   1357 C  CG  . PHE B  1 60  ? 69.113  13.005  77.885  1.00 38.95  ? 119 PHE B CG  1 
ATOM   1358 C  CD1 . PHE B  1 60  ? 68.830  13.520  79.131  1.00 40.41  ? 119 PHE B CD1 1 
ATOM   1359 C  CD2 . PHE B  1 60  ? 70.095  13.616  77.123  1.00 38.14  ? 119 PHE B CD2 1 
ATOM   1360 C  CE1 . PHE B  1 60  ? 69.517  14.626  79.631  1.00 40.81  ? 119 PHE B CE1 1 
ATOM   1361 C  CE2 . PHE B  1 60  ? 70.790  14.713  77.613  1.00 38.70  ? 119 PHE B CE2 1 
ATOM   1362 C  CZ  . PHE B  1 60  ? 70.497  15.219  78.874  1.00 40.26  ? 119 PHE B CZ  1 
ATOM   1363 N  N   . GLU B  1 61  ? 67.562  8.968   78.281  1.00 40.82  ? 120 GLU B N   1 
ATOM   1364 C  CA  . GLU B  1 61  ? 66.510  7.956   78.212  1.00 42.40  ? 120 GLU B CA  1 
ATOM   1365 C  C   . GLU B  1 61  ? 65.328  8.472   77.371  1.00 42.71  ? 120 GLU B C   1 
ATOM   1366 O  O   . GLU B  1 61  ? 64.982  9.651   77.413  1.00 42.16  ? 120 GLU B O   1 
ATOM   1367 C  CB  . GLU B  1 61  ? 65.992  7.625   79.601  1.00 44.44  ? 120 GLU B CB  1 
ATOM   1368 C  CG  . GLU B  1 61  ? 66.981  6.990   80.541  1.00 45.75  ? 120 GLU B CG  1 
ATOM   1369 C  CD  . GLU B  1 61  ? 66.303  6.480   81.816  1.00 47.97  ? 120 GLU B CD  1 
ATOM   1370 O  OE1 . GLU B  1 61  ? 65.374  5.638   81.689  1.00 49.24  ? 120 GLU B OE1 1 
ATOM   1371 O  OE2 . GLU B  1 61  ? 66.710  6.942   82.914  1.00 48.20  ? 120 GLU B OE2 1 
ATOM   1372 N  N   . ASP B  1 62  ? 64.696  7.562   76.644  1.00 43.87  ? 121 ASP B N   1 
ATOM   1373 C  CA  . ASP B  1 62  ? 63.533  7.881   75.801  1.00 45.17  ? 121 ASP B CA  1 
ATOM   1374 C  C   . ASP B  1 62  ? 62.603  8.888   76.456  1.00 46.36  ? 121 ASP B C   1 
ATOM   1375 O  O   . ASP B  1 62  ? 62.453  10.010  75.954  1.00 45.62  ? 121 ASP B O   1 
ATOM   1376 C  CB  . ASP B  1 62  ? 62.743  6.601   75.479  1.00 47.04  ? 121 ASP B CB  1 
ATOM   1377 C  CG  . ASP B  1 62  ? 63.490  5.651   74.506  1.00 48.56  ? 121 ASP B CG  1 
ATOM   1378 O  OD1 . ASP B  1 62  ? 64.526  6.023   73.880  1.00 47.73  ? 121 ASP B OD1 1 
ATOM   1379 O  OD2 . ASP B  1 62  ? 63.061  4.486   74.398  1.00 52.22  ? 121 ASP B OD2 1 
ATOM   1380 N  N   . HIS B  1 63  ? 62.012  8.493   77.594  1.00 47.89  ? 122 HIS B N   1 
ATOM   1381 C  CA  . HIS B  1 63  ? 60.926  9.268   78.185  1.00 49.81  ? 122 HIS B CA  1 
ATOM   1382 C  C   . HIS B  1 63  ? 61.381  10.601  78.770  1.00 49.00  ? 122 HIS B C   1 
ATOM   1383 O  O   . HIS B  1 63  ? 60.584  11.506  78.920  1.00 51.06  ? 122 HIS B O   1 
ATOM   1384 C  CB  . HIS B  1 63  ? 60.174  8.449   79.236  1.00 52.43  ? 122 HIS B CB  1 
ATOM   1385 C  CG  . HIS B  1 63  ? 60.903  8.329   80.526  1.00 52.86  ? 122 HIS B CG  1 
ATOM   1386 N  ND1 . HIS B  1 63  ? 61.940  7.437   80.697  1.00 52.10  ? 122 HIS B ND1 1 
ATOM   1387 C  CD2 . HIS B  1 63  ? 60.787  9.015   81.691  1.00 54.25  ? 122 HIS B CD2 1 
ATOM   1388 C  CE1 . HIS B  1 63  ? 62.417  7.567   81.925  1.00 52.65  ? 122 HIS B CE1 1 
ATOM   1389 N  NE2 . HIS B  1 63  ? 61.742  8.525   82.543  1.00 53.63  ? 122 HIS B NE2 1 
ATOM   1390 N  N   . ILE B  1 64  ? 62.658  10.732  79.085  1.00 47.01  ? 123 ILE B N   1 
ATOM   1391 C  CA  . ILE B  1 64  ? 63.209  12.020  79.527  1.00 46.70  ? 123 ILE B CA  1 
ATOM   1392 C  C   . ILE B  1 64  ? 63.422  12.960  78.331  1.00 45.95  ? 123 ILE B C   1 
ATOM   1393 O  O   . ILE B  1 64  ? 63.078  14.141  78.373  1.00 46.85  ? 123 ILE B O   1 
ATOM   1394 C  CB  . ILE B  1 64  ? 64.549  11.806  80.255  1.00 45.19  ? 123 ILE B CB  1 
ATOM   1395 C  CG1 . ILE B  1 64  ? 64.329  10.970  81.523  1.00 47.59  ? 123 ILE B CG1 1 
ATOM   1396 C  CG2 . ILE B  1 64  ? 65.201  13.122  80.604  1.00 44.66  ? 123 ILE B CG2 1 
ATOM   1397 C  CD1 . ILE B  1 64  ? 63.399  11.630  82.577  1.00 49.08  ? 123 ILE B CD1 1 
ATOM   1398 N  N   . TYR B  1 65  ? 64.017  12.407  77.278  1.00 44.69  ? 124 TYR B N   1 
ATOM   1399 C  CA  . TYR B  1 65  ? 64.359  13.143  76.030  1.00 43.93  ? 124 TYR B CA  1 
ATOM   1400 C  C   . TYR B  1 65  ? 63.143  13.808  75.432  1.00 46.02  ? 124 TYR B C   1 
ATOM   1401 O  O   . TYR B  1 65  ? 63.168  14.973  75.093  1.00 47.06  ? 124 TYR B O   1 
ATOM   1402 C  CB  . TYR B  1 65  ? 64.930  12.174  74.993  1.00 42.20  ? 124 TYR B CB  1 
ATOM   1403 C  CG  . TYR B  1 65  ? 65.315  12.813  73.674  1.00 41.87  ? 124 TYR B CG  1 
ATOM   1404 C  CD1 . TYR B  1 65  ? 66.533  13.476  73.516  1.00 40.17  ? 124 TYR B CD1 1 
ATOM   1405 C  CD2 . TYR B  1 65  ? 64.475  12.740  72.578  1.00 43.72  ? 124 TYR B CD2 1 
ATOM   1406 C  CE1 . TYR B  1 65  ? 66.875  14.073  72.327  1.00 39.45  ? 124 TYR B CE1 1 
ATOM   1407 C  CE2 . TYR B  1 65  ? 64.822  13.324  71.365  1.00 42.66  ? 124 TYR B CE2 1 
ATOM   1408 C  CZ  . TYR B  1 65  ? 66.021  13.984  71.250  1.00 41.01  ? 124 TYR B CZ  1 
ATOM   1409 O  OH  . TYR B  1 65  ? 66.365  14.527  70.038  1.00 41.06  ? 124 TYR B OH  1 
ATOM   1410 N  N   . GLU B  1 66  ? 62.075  13.032  75.341  1.00 47.56  ? 125 GLU B N   1 
ATOM   1411 C  CA  . GLU B  1 66  ? 60.774  13.492  74.893  1.00 50.17  ? 125 GLU B CA  1 
ATOM   1412 C  C   . GLU B  1 66  ? 60.268  14.770  75.583  1.00 52.14  ? 125 GLU B C   1 
ATOM   1413 O  O   . GLU B  1 66  ? 59.518  15.542  74.991  1.00 54.11  ? 125 GLU B O   1 
ATOM   1414 C  CB  . GLU B  1 66  ? 59.775  12.356  75.137  1.00 51.64  ? 125 GLU B CB  1 
ATOM   1415 C  CG  . GLU B  1 66  ? 58.344  12.667  74.755  1.00 55.73  ? 125 GLU B CG  1 
ATOM   1416 C  CD  . GLU B  1 66  ? 57.426  11.471  74.932  1.00 58.62  ? 125 GLU B CD  1 
ATOM   1417 O  OE1 . GLU B  1 66  ? 56.642  11.218  73.999  1.00 60.53  ? 125 GLU B OE1 1 
ATOM   1418 O  OE2 . GLU B  1 66  ? 57.491  10.792  75.996  1.00 58.56  ? 125 GLU B OE2 1 
ATOM   1419 N  N   . LYS B  1 67  ? 60.656  14.973  76.838  1.00 51.83  ? 126 LYS B N   1 
ATOM   1420 C  CA  . LYS B  1 67  ? 60.096  16.049  77.656  1.00 54.23  ? 126 LYS B CA  1 
ATOM   1421 C  C   . LYS B  1 67  ? 60.988  17.273  77.752  1.00 53.39  ? 126 LYS B C   1 
ATOM   1422 O  O   . LYS B  1 67  ? 60.634  18.252  78.387  1.00 55.41  ? 126 LYS B O   1 
ATOM   1423 C  CB  . LYS B  1 67  ? 59.823  15.509  79.065  1.00 55.07  ? 126 LYS B CB  1 
ATOM   1424 N  N   . LEU B  1 68  ? 62.147  17.218  77.123  1.00 50.84  ? 127 LEU B N   1 
ATOM   1425 C  CA  . LEU B  1 68  ? 63.125  18.282  77.278  1.00 50.33  ? 127 LEU B CA  1 
ATOM   1426 C  C   . LEU B  1 68  ? 62.696  19.531  76.534  1.00 52.49  ? 127 LEU B C   1 
ATOM   1427 O  O   . LEU B  1 68  ? 61.945  19.447  75.554  1.00 53.29  ? 127 LEU B O   1 
ATOM   1428 C  CB  . LEU B  1 68  ? 64.487  17.814  76.789  1.00 47.34  ? 127 LEU B CB  1 
ATOM   1429 C  CG  . LEU B  1 68  ? 65.105  16.658  77.595  1.00 45.60  ? 127 LEU B CG  1 
ATOM   1430 C  CD1 . LEU B  1 68  ? 66.466  16.274  77.015  1.00 42.95  ? 127 LEU B CD1 1 
ATOM   1431 C  CD2 . LEU B  1 68  ? 65.253  17.010  79.065  1.00 45.71  ? 127 LEU B CD2 1 
ATOM   1432 N  N   . ASP B  1 69  ? 63.174  20.686  77.003  1.00 53.61  ? 128 ASP B N   1 
ATOM   1433 C  CA  . ASP B  1 69  ? 62.841  21.959  76.348  1.00 56.80  ? 128 ASP B CA  1 
ATOM   1434 C  C   . ASP B  1 69  ? 63.251  21.879  74.884  1.00 55.62  ? 128 ASP B C   1 
ATOM   1435 O  O   . ASP B  1 69  ? 64.302  21.334  74.568  1.00 53.33  ? 128 ASP B O   1 
ATOM   1436 C  CB  . ASP B  1 69  ? 63.569  23.159  76.980  1.00 57.96  ? 128 ASP B CB  1 
ATOM   1437 C  CG  . ASP B  1 69  ? 63.182  23.400  78.416  1.00 60.82  ? 128 ASP B CG  1 
ATOM   1438 O  OD1 . ASP B  1 69  ? 62.093  22.934  78.863  1.00 62.69  ? 128 ASP B OD1 1 
ATOM   1439 O  OD2 . ASP B  1 69  ? 63.980  24.075  79.100  1.00 61.82  ? 128 ASP B OD2 1 
ATOM   1440 N  N   . ALA B  1 70  ? 62.427  22.425  74.000  1.00 58.40  ? 129 ALA B N   1 
ATOM   1441 C  CA  . ALA B  1 70  ? 62.734  22.459  72.571  1.00 57.95  ? 129 ALA B CA  1 
ATOM   1442 C  C   . ALA B  1 70  ? 64.151  22.985  72.362  1.00 56.34  ? 129 ALA B C   1 
ATOM   1443 O  O   . ALA B  1 70  ? 64.575  23.943  73.017  1.00 57.75  ? 129 ALA B O   1 
ATOM   1444 C  CB  . ALA B  1 70  ? 61.742  23.339  71.844  1.00 61.89  ? 129 ALA B CB  1 
ATOM   1445 N  N   . ILE B  1 71  ? 64.881  22.354  71.453  1.00 53.74  ? 130 ILE B N   1 
ATOM   1446 C  CA  . ILE B  1 71  ? 66.267  22.714  71.206  1.00 52.26  ? 130 ILE B CA  1 
ATOM   1447 C  C   . ILE B  1 71  ? 66.424  24.027  70.429  1.00 55.04  ? 130 ILE B C   1 
ATOM   1448 O  O   . ILE B  1 71  ? 65.845  24.184  69.359  1.00 57.09  ? 130 ILE B O   1 
ATOM   1449 C  CB  . ILE B  1 71  ? 66.953  21.587  70.420  1.00 49.51  ? 130 ILE B CB  1 
ATOM   1450 C  CG1 . ILE B  1 71  ? 68.445  21.875  70.274  1.00 48.58  ? 130 ILE B CG1 1 
ATOM   1451 C  CG2 . ILE B  1 71  ? 66.299  21.416  69.035  1.00 50.61  ? 130 ILE B CG2 1 
ATOM   1452 C  CD1 . ILE B  1 71  ? 69.249  20.644  69.902  1.00 46.04  ? 130 ILE B CD1 1 
ATOM   1453 N  N   . THR B  1 72  ? 67.219  24.961  70.952  1.00 55.68  ? 131 THR B N   1 
ATOM   1454 C  CA  . THR B  1 72  ? 67.404  26.242  70.275  1.00 58.40  ? 131 THR B CA  1 
ATOM   1455 C  C   . THR B  1 72  ? 68.329  26.085  69.074  1.00 57.44  ? 131 THR B C   1 
ATOM   1456 O  O   . THR B  1 72  ? 69.052  25.103  68.955  1.00 54.51  ? 131 THR B O   1 
ATOM   1457 C  CB  . THR B  1 72  ? 67.980  27.327  71.195  1.00 60.07  ? 131 THR B CB  1 
ATOM   1458 O  OG1 . THR B  1 72  ? 69.344  27.022  71.515  1.00 57.12  ? 131 THR B OG1 1 
ATOM   1459 C  CG2 . THR B  1 72  ? 67.166  27.470  72.457  1.00 60.65  ? 131 THR B CG2 1 
ATOM   1460 N  N   . ASP B  1 73  ? 68.308  27.069  68.187  1.00 60.84  ? 132 ASP B N   1 
ATOM   1461 C  CA  . ASP B  1 73  ? 69.197  27.076  67.027  1.00 60.54  ? 132 ASP B CA  1 
ATOM   1462 C  C   . ASP B  1 73  ? 70.654  27.057  67.464  1.00 58.14  ? 132 ASP B C   1 
ATOM   1463 O  O   . ASP B  1 73  ? 71.457  26.292  66.938  1.00 55.80  ? 132 ASP B O   1 
ATOM   1464 C  CB  . ASP B  1 73  ? 68.928  28.313  66.172  1.00 65.21  ? 132 ASP B CB  1 
ATOM   1465 C  CG  . ASP B  1 73  ? 67.695  28.162  65.299  1.00 68.68  ? 132 ASP B CG  1 
ATOM   1466 O  OD1 . ASP B  1 73  ? 67.395  27.006  64.916  1.00 66.43  ? 132 ASP B OD1 1 
ATOM   1467 O  OD2 . ASP B  1 73  ? 67.044  29.198  64.971  1.00 73.95  ? 132 ASP B OD2 1 
ATOM   1468 N  N   . GLU B  1 74  ? 70.976  27.908  68.431  1.00 59.41  ? 133 GLU B N   1 
ATOM   1469 C  CA  . GLU B  1 74  ? 72.301  27.942  69.023  1.00 58.04  ? 133 GLU B CA  1 
ATOM   1470 C  C   . GLU B  1 74  ? 72.747  26.543  69.435  1.00 54.17  ? 133 GLU B C   1 
ATOM   1471 O  O   . GLU B  1 74  ? 73.784  26.073  68.970  1.00 52.81  ? 133 GLU B O   1 
ATOM   1472 C  CB  . GLU B  1 74  ? 72.323  28.849  70.255  1.00 60.22  ? 133 GLU B CB  1 
ATOM   1473 C  CG  . GLU B  1 74  ? 73.033  30.162  70.058  1.00 64.52  ? 133 GLU B CG  1 
ATOM   1474 C  CD  . GLU B  1 74  ? 73.442  30.800  71.398  1.00 67.89  ? 133 GLU B CD  1 
ATOM   1475 O  OE1 . GLU B  1 74  ? 72.554  31.340  72.124  1.00 70.25  ? 133 GLU B OE1 1 
ATOM   1476 O  OE2 . GLU B  1 74  ? 74.660  30.762  71.719  1.00 67.09  ? 133 GLU B OE2 1 
ATOM   1477 N  N   . GLU B  1 75  ? 71.981  25.869  70.305  1.00 52.73  ? 134 GLU B N   1 
ATOM   1478 C  CA  . GLU B  1 75  ? 72.375  24.519  70.734  1.00 49.12  ? 134 GLU B CA  1 
ATOM   1479 C  C   . GLU B  1 75  ? 72.552  23.600  69.533  1.00 47.29  ? 134 GLU B C   1 
ATOM   1480 O  O   . GLU B  1 75  ? 73.508  22.838  69.478  1.00 45.08  ? 134 GLU B O   1 
ATOM   1481 C  CB  . GLU B  1 75  ? 71.375  23.887  71.709  1.00 48.28  ? 134 GLU B CB  1 
ATOM   1482 C  CG  . GLU B  1 75  ? 71.773  22.457  72.112  1.00 45.29  ? 134 GLU B CG  1 
ATOM   1483 C  CD  . GLU B  1 75  ? 70.901  21.830  73.204  1.00 45.30  ? 134 GLU B CD  1 
ATOM   1484 O  OE1 . GLU B  1 75  ? 70.146  22.557  73.883  1.00 47.67  ? 134 GLU B OE1 1 
ATOM   1485 O  OE2 . GLU B  1 75  ? 70.978  20.591  73.403  1.00 42.36  ? 134 GLU B OE2 1 
ATOM   1486 N  N   . ASN B  1 76  ? 71.636  23.683  68.573  1.00 48.55  ? 135 ASN B N   1 
ATOM   1487 C  CA  . ASN B  1 76  ? 71.643  22.762  67.451  1.00 47.51  ? 135 ASN B CA  1 
ATOM   1488 C  C   . ASN B  1 76  ? 72.905  22.882  66.600  1.00 47.22  ? 135 ASN B C   1 
ATOM   1489 O  O   . ASN B  1 76  ? 73.419  21.890  66.072  1.00 45.40  ? 135 ASN B O   1 
ATOM   1490 C  CB  . ASN B  1 76  ? 70.417  22.996  66.582  1.00 50.19  ? 135 ASN B CB  1 
ATOM   1491 C  CG  . ASN B  1 76  ? 70.064  21.792  65.756  1.00 50.47  ? 135 ASN B CG  1 
ATOM   1492 O  OD1 . ASN B  1 76  ? 69.645  20.758  66.290  1.00 50.84  ? 135 ASN B OD1 1 
ATOM   1493 N  ND2 . ASN B  1 76  ? 70.250  21.899  64.454  1.00 51.48  ? 135 ASN B ND2 1 
ATOM   1494 N  N   . ASP B  1 77  ? 73.398  24.106  66.469  1.00 49.47  ? 136 ASP B N   1 
ATOM   1495 C  CA  . ASP B  1 77  ? 74.656  24.361  65.763  1.00 49.90  ? 136 ASP B CA  1 
ATOM   1496 C  C   . ASP B  1 77  ? 75.819  23.600  66.359  1.00 47.43  ? 136 ASP B C   1 
ATOM   1497 O  O   . ASP B  1 77  ? 76.592  22.976  65.628  1.00 46.71  ? 136 ASP B O   1 
ATOM   1498 C  CB  . ASP B  1 77  ? 74.984  25.855  65.775  1.00 53.26  ? 136 ASP B CB  1 
ATOM   1499 C  CG  . ASP B  1 77  ? 74.170  26.633  64.777  1.00 56.92  ? 136 ASP B CG  1 
ATOM   1500 O  OD1 . ASP B  1 77  ? 73.650  26.021  63.826  1.00 57.30  ? 136 ASP B OD1 1 
ATOM   1501 O  OD2 . ASP B  1 77  ? 74.061  27.858  64.948  1.00 61.11  ? 136 ASP B OD2 1 
ATOM   1502 N  N   . MET B  1 78  ? 75.942  23.646  67.684  1.00 46.56  ? 137 MET B N   1 
ATOM   1503 C  CA  . MET B  1 78  ? 77.015  22.928  68.384  1.00 44.61  ? 137 MET B CA  1 
ATOM   1504 C  C   . MET B  1 78  ? 76.746  21.436  68.445  1.00 42.08  ? 137 MET B C   1 
ATOM   1505 O  O   . MET B  1 78  ? 77.674  20.629  68.357  1.00 40.96  ? 137 MET B O   1 
ATOM   1506 C  CB  . MET B  1 78  ? 77.209  23.496  69.788  1.00 45.26  ? 137 MET B CB  1 
ATOM   1507 C  CG  . MET B  1 78  ? 77.620  24.959  69.784  1.00 48.61  ? 137 MET B CG  1 
ATOM   1508 S  SD  . MET B  1 78  ? 79.169  25.202  68.900  1.00 52.51  ? 137 MET B SD  1 
ATOM   1509 C  CE  . MET B  1 78  ? 78.671  25.603  67.231  1.00 50.54  ? 137 MET B CE  1 
ATOM   1510 N  N   . LEU B  1 79  ? 75.472  21.063  68.585  1.00 41.86  ? 138 LEU B N   1 
ATOM   1511 C  CA  . LEU B  1 79  ? 75.093  19.654  68.670  1.00 39.75  ? 138 LEU B CA  1 
ATOM   1512 C  C   . LEU B  1 79  ? 75.380  18.934  67.362  1.00 39.29  ? 138 LEU B C   1 
ATOM   1513 O  O   . LEU B  1 79  ? 75.725  17.766  67.366  1.00 38.40  ? 138 LEU B O   1 
ATOM   1514 C  CB  . LEU B  1 79  ? 73.622  19.504  69.063  1.00 39.77  ? 138 LEU B CB  1 
ATOM   1515 C  CG  . LEU B  1 79  ? 73.098  18.093  69.360  1.00 38.36  ? 138 LEU B CG  1 
ATOM   1516 C  CD1 . LEU B  1 79  ? 73.869  17.413  70.542  1.00 35.94  ? 138 LEU B CD1 1 
ATOM   1517 C  CD2 . LEU B  1 79  ? 71.602  18.166  69.657  1.00 37.48  ? 138 LEU B CD2 1 
ATOM   1518 N  N   . ASP B  1 80  ? 75.250  19.612  66.238  1.00 40.83  ? 139 ASP B N   1 
ATOM   1519 C  CA  . ASP B  1 80  ? 75.621  18.988  64.978  1.00 41.12  ? 139 ASP B CA  1 
ATOM   1520 C  C   . ASP B  1 80  ? 77.066  18.510  64.993  1.00 40.26  ? 139 ASP B C   1 
ATOM   1521 O  O   . ASP B  1 80  ? 77.402  17.553  64.318  1.00 39.90  ? 139 ASP B O   1 
ATOM   1522 C  CB  . ASP B  1 80  ? 75.487  19.985  63.823  1.00 43.87  ? 139 ASP B CB  1 
ATOM   1523 C  CG  . ASP B  1 80  ? 74.147  19.925  63.120  1.00 46.46  ? 139 ASP B CG  1 
ATOM   1524 O  OD1 . ASP B  1 80  ? 73.353  18.984  63.370  1.00 46.61  ? 139 ASP B OD1 1 
ATOM   1525 O  OD2 . ASP B  1 80  ? 73.895  20.849  62.302  1.00 50.81  ? 139 ASP B OD2 1 
ATOM   1526 N  N   . LEU B  1 81  ? 77.924  19.219  65.719  1.00 40.44  ? 140 LEU B N   1 
ATOM   1527 C  CA  . LEU B  1 81  ? 79.337  18.914  65.742  1.00 40.49  ? 140 LEU B CA  1 
ATOM   1528 C  C   . LEU B  1 81  ? 79.701  17.878  66.808  1.00 39.35  ? 140 LEU B C   1 
ATOM   1529 O  O   . LEU B  1 81  ? 80.855  17.531  66.956  1.00 40.09  ? 140 LEU B O   1 
ATOM   1530 C  CB  . LEU B  1 81  ? 80.145  20.192  65.934  1.00 42.05  ? 140 LEU B CB  1 
ATOM   1531 C  CG  . LEU B  1 81  ? 79.975  21.267  64.847  1.00 44.29  ? 140 LEU B CG  1 
ATOM   1532 C  CD1 . LEU B  1 81  ? 80.707  22.494  65.230  1.00 45.10  ? 140 LEU B CD1 1 
ATOM   1533 C  CD2 . LEU B  1 81  ? 80.415  20.787  63.466  1.00 43.45  ? 140 LEU B CD2 1 
ATOM   1534 N  N   . ALA B  1 82  ? 78.724  17.364  67.534  1.00 38.21  ? 141 ALA B N   1 
ATOM   1535 C  CA  . ALA B  1 82  ? 78.988  16.319  68.509  1.00 37.14  ? 141 ALA B CA  1 
ATOM   1536 C  C   . ALA B  1 82  ? 79.433  15.064  67.777  1.00 36.84  ? 141 ALA B C   1 
ATOM   1537 O  O   . ALA B  1 82  ? 78.794  14.676  66.801  1.00 36.36  ? 141 ALA B O   1 
ATOM   1538 C  CB  . ALA B  1 82  ? 77.744  16.018  69.322  1.00 36.19  ? 141 ALA B CB  1 
ATOM   1539 N  N   . TYR B  1 83  ? 80.519  14.434  68.252  1.00 36.98  ? 142 TYR B N   1 
ATOM   1540 C  CA  . TYR B  1 83  ? 80.935  13.186  67.693  1.00 37.16  ? 142 TYR B CA  1 
ATOM   1541 C  C   . TYR B  1 83  ? 80.028  12.082  68.175  1.00 36.55  ? 142 TYR B C   1 
ATOM   1542 O  O   . TYR B  1 83  ? 79.809  11.925  69.363  1.00 35.93  ? 142 TYR B O   1 
ATOM   1543 C  CB  . TYR B  1 83  ? 82.356  12.841  68.093  1.00 38.91  ? 142 TYR B CB  1 
ATOM   1544 C  CG  . TYR B  1 83  ? 82.826  11.551  67.443  1.00 39.60  ? 142 TYR B CG  1 
ATOM   1545 C  CD1 . TYR B  1 83  ? 83.258  11.535  66.128  1.00 39.69  ? 142 TYR B CD1 1 
ATOM   1546 C  CD2 . TYR B  1 83  ? 82.791  10.356  68.133  1.00 39.17  ? 142 TYR B CD2 1 
ATOM   1547 C  CE1 . TYR B  1 83  ? 83.650  10.377  65.520  1.00 40.31  ? 142 TYR B CE1 1 
ATOM   1548 C  CE2 . TYR B  1 83  ? 83.183  9.204   67.533  1.00 40.65  ? 142 TYR B CE2 1 
ATOM   1549 C  CZ  . TYR B  1 83  ? 83.613  9.217   66.218  1.00 41.31  ? 142 TYR B CZ  1 
ATOM   1550 O  OH  . TYR B  1 83  ? 84.025  8.055   65.605  1.00 44.48  ? 142 TYR B OH  1 
ATOM   1551 N  N   . GLY B  1 84  ? 79.552  11.282  67.233  1.00 36.80  ? 143 GLY B N   1 
ATOM   1552 C  CA  . GLY B  1 84  ? 78.633  10.194  67.519  1.00 36.22  ? 143 GLY B CA  1 
ATOM   1553 C  C   . GLY B  1 84  ? 77.251  10.659  67.907  1.00 35.48  ? 143 GLY B C   1 
ATOM   1554 O  O   . GLY B  1 84  ? 76.609  10.073  68.782  1.00 35.79  ? 143 GLY B O   1 
ATOM   1555 N  N   . LEU B  1 85  ? 76.775  11.696  67.238  1.00 35.78  ? 144 LEU B N   1 
ATOM   1556 C  CA  . LEU B  1 85  ? 75.433  12.251  67.482  1.00 35.60  ? 144 LEU B CA  1 
ATOM   1557 C  C   . LEU B  1 85  ? 74.369  11.172  67.316  1.00 35.85  ? 144 LEU B C   1 
ATOM   1558 O  O   . LEU B  1 85  ? 74.373  10.436  66.316  1.00 36.95  ? 144 LEU B O   1 
ATOM   1559 C  CB  . LEU B  1 85  ? 75.153  13.387  66.500  1.00 36.20  ? 144 LEU B CB  1 
ATOM   1560 C  CG  . LEU B  1 85  ? 73.823  14.144  66.558  1.00 36.62  ? 144 LEU B CG  1 
ATOM   1561 C  CD1 . LEU B  1 85  ? 73.694  14.886  67.889  1.00 35.12  ? 144 LEU B CD1 1 
ATOM   1562 C  CD2 . LEU B  1 85  ? 73.723  15.121  65.361  1.00 36.26  ? 144 LEU B CD2 1 
ATOM   1563 N  N   . THR B  1 86  ? 73.445  11.127  68.272  1.00 35.28  ? 145 THR B N   1 
ATOM   1564 C  CA  . THR B  1 86  ? 72.351  10.175  68.269  1.00 35.51  ? 145 THR B CA  1 
ATOM   1565 C  C   . THR B  1 86  ? 71.020  10.893  68.328  1.00 36.16  ? 145 THR B C   1 
ATOM   1566 O  O   . THR B  1 86  ? 70.967  12.062  68.681  1.00 35.74  ? 145 THR B O   1 
ATOM   1567 C  CB  . THR B  1 86  ? 72.388  9.283   69.547  1.00 35.64  ? 145 THR B CB  1 
ATOM   1568 O  OG1 . THR B  1 86  ? 72.062  10.060  70.702  1.00 34.27  ? 145 THR B OG1 1 
ATOM   1569 C  CG2 . THR B  1 86  ? 73.744  8.664   69.777  1.00 34.41  ? 145 THR B CG2 1 
ATOM   1570 N  N   . ASP B  1 87  ? 69.942  10.159  68.052  1.00 37.25  ? 146 ASP B N   1 
ATOM   1571 C  CA  . ASP B  1 87  ? 68.583  10.691  68.166  1.00 38.10  ? 146 ASP B CA  1 
ATOM   1572 C  C   . ASP B  1 87  ? 68.089  10.768  69.626  1.00 38.05  ? 146 ASP B C   1 
ATOM   1573 O  O   . ASP B  1 87  ? 66.892  10.870  69.876  1.00 39.26  ? 146 ASP B O   1 
ATOM   1574 C  CB  . ASP B  1 87  ? 67.623  9.864   67.334  1.00 39.36  ? 146 ASP B CB  1 
ATOM   1575 C  CG  . ASP B  1 87  ? 67.573  8.408   67.758  1.00 39.92  ? 146 ASP B CG  1 
ATOM   1576 O  OD1 . ASP B  1 87  ? 67.092  7.628   66.929  1.00 40.79  ? 146 ASP B OD1 1 
ATOM   1577 O  OD2 . ASP B  1 87  ? 67.979  8.038   68.888  1.00 36.53  ? 146 ASP B OD2 1 
ATOM   1578 N  N   . ARG B  1 88  ? 68.992  10.674  70.591  1.00 36.68  ? 147 ARG B N   1 
ATOM   1579 C  CA  . ARG B  1 88  ? 68.653  10.986  71.978  1.00 36.95  ? 147 ARG B CA  1 
ATOM   1580 C  C   . ARG B  1 88  ? 69.696  11.922  72.603  1.00 36.32  ? 147 ARG B C   1 
ATOM   1581 O  O   . ARG B  1 88  ? 69.748  12.077  73.831  1.00 36.53  ? 147 ARG B O   1 
ATOM   1582 C  CB  . ARG B  1 88  ? 68.565  9.697   72.799  1.00 37.29  ? 147 ARG B CB  1 
ATOM   1583 C  CG  . ARG B  1 88  ? 67.524  8.709   72.323  1.00 37.98  ? 147 ARG B CG  1 
ATOM   1584 C  CD  . ARG B  1 88  ? 66.146  9.075   72.815  1.00 39.54  ? 147 ARG B CD  1 
ATOM   1585 N  NE  . ARG B  1 88  ? 65.148  8.107   72.380  1.00 41.11  ? 147 ARG B NE  1 
ATOM   1586 C  CZ  . ARG B  1 88  ? 64.536  8.100   71.200  1.00 41.93  ? 147 ARG B CZ  1 
ATOM   1587 N  NH1 . ARG B  1 88  ? 64.764  9.042   70.277  1.00 42.72  ? 147 ARG B NH1 1 
ATOM   1588 N  NH2 . ARG B  1 88  ? 63.680  7.136   70.938  1.00 44.37  ? 147 ARG B NH2 1 
ATOM   1589 N  N   . SER B  1 89  ? 70.509  12.548  71.756  1.00 35.82  ? 148 SER B N   1 
ATOM   1590 C  CA  . SER B  1 89  ? 71.584  13.405  72.189  1.00 35.21  ? 148 SER B CA  1 
ATOM   1591 C  C   . SER B  1 89  ? 71.127  14.819  72.500  1.00 35.80  ? 148 SER B C   1 
ATOM   1592 O  O   . SER B  1 89  ? 70.304  15.370  71.798  1.00 36.47  ? 148 SER B O   1 
ATOM   1593 C  CB  . SER B  1 89  ? 72.624  13.454  71.094  1.00 34.92  ? 148 SER B CB  1 
ATOM   1594 O  OG  . SER B  1 89  ? 73.209  12.183  70.930  1.00 34.93  ? 148 SER B OG  1 
ATOM   1595 N  N   . ARG B  1 90  ? 71.671  15.397  73.564  1.00 36.02  ? 149 ARG B N   1 
ATOM   1596 C  CA  . ARG B  1 90  ? 71.566  16.829  73.829  1.00 37.30  ? 149 ARG B CA  1 
ATOM   1597 C  C   . ARG B  1 90  ? 72.853  17.288  74.481  1.00 37.44  ? 149 ARG B C   1 
ATOM   1598 O  O   . ARG B  1 90  ? 73.668  16.472  74.899  1.00 36.40  ? 149 ARG B O   1 
ATOM   1599 C  CB  . ARG B  1 90  ? 70.413  17.155  74.751  1.00 38.70  ? 149 ARG B CB  1 
ATOM   1600 C  CG  . ARG B  1 90  ? 69.013  16.881  74.183  1.00 40.00  ? 149 ARG B CG  1 
ATOM   1601 C  CD  . ARG B  1 90  ? 68.637  17.799  73.031  1.00 41.26  ? 149 ARG B CD  1 
ATOM   1602 N  NE  . ARG B  1 90  ? 68.644  19.202  73.448  1.00 42.92  ? 149 ARG B NE  1 
ATOM   1603 C  CZ  . ARG B  1 90  ? 67.590  19.876  73.906  1.00 45.46  ? 149 ARG B CZ  1 
ATOM   1604 N  NH1 . ARG B  1 90  ? 66.378  19.308  74.023  1.00 45.80  ? 149 ARG B NH1 1 
ATOM   1605 N  NH2 . ARG B  1 90  ? 67.756  21.141  74.264  1.00 46.77  ? 149 ARG B NH2 1 
ATOM   1606 N  N   . LEU B  1 91  ? 73.050  18.598  74.541  1.00 38.93  ? 150 LEU B N   1 
ATOM   1607 C  CA  . LEU B  1 91  ? 74.222  19.165  75.151  1.00 39.32  ? 150 LEU B CA  1 
ATOM   1608 C  C   . LEU B  1 91  ? 73.883  19.380  76.582  1.00 40.62  ? 150 LEU B C   1 
ATOM   1609 O  O   . LEU B  1 91  ? 73.090  20.256  76.873  1.00 42.43  ? 150 LEU B O   1 
ATOM   1610 C  CB  . LEU B  1 91  ? 74.584  20.478  74.488  1.00 40.79  ? 150 LEU B CB  1 
ATOM   1611 C  CG  . LEU B  1 91  ? 75.111  20.317  73.051  1.00 40.41  ? 150 LEU B CG  1 
ATOM   1612 C  CD1 . LEU B  1 91  ? 75.669  21.594  72.540  1.00 41.30  ? 150 LEU B CD1 1 
ATOM   1613 C  CD2 . LEU B  1 91  ? 76.181  19.283  72.951  1.00 38.62  ? 150 LEU B CD2 1 
ATOM   1614 N  N   . GLY B  1 92  ? 74.503  18.590  77.470  1.00 40.40  ? 151 GLY B N   1 
ATOM   1615 C  CA  . GLY B  1 92  ? 74.107  18.470  78.874  1.00 41.72  ? 151 GLY B CA  1 
ATOM   1616 C  C   . GLY B  1 92  ? 74.055  19.769  79.623  1.00 44.11  ? 151 GLY B C   1 
ATOM   1617 O  O   . GLY B  1 92  ? 73.419  19.904  80.654  1.00 45.77  ? 151 GLY B O   1 
ATOM   1618 N  N   . CYS B  1 93  ? 74.706  20.755  79.064  1.00 45.07  ? 152 CYS B N   1 
ATOM   1619 C  CA  . CYS B  1 93  ? 74.855  22.018  79.748  1.00 48.10  ? 152 CYS B CA  1 
ATOM   1620 C  C   . CYS B  1 93  ? 73.720  22.985  79.458  1.00 49.11  ? 152 CYS B C   1 
ATOM   1621 O  O   . CYS B  1 93  ? 73.650  24.050  80.064  1.00 50.91  ? 152 CYS B O   1 
ATOM   1622 C  CB  . CYS B  1 93  ? 76.183  22.624  79.371  1.00 49.08  ? 152 CYS B CB  1 
ATOM   1623 S  SG  . CYS B  1 93  ? 76.289  23.414  77.671  1.00 51.79  ? 152 CYS B SG  1 
ATOM   1624 N  N   . GLN B  1 94  ? 72.855  22.608  78.516  1.00 47.64  ? 153 GLN B N   1 
ATOM   1625 C  CA  . GLN B  1 94  ? 71.608  23.324  78.271  1.00 49.50  ? 153 GLN B CA  1 
ATOM   1626 C  C   . GLN B  1 94  ? 70.425  22.664  78.973  1.00 49.49  ? 153 GLN B C   1 
ATOM   1627 O  O   . GLN B  1 94  ? 69.355  23.254  79.056  1.00 51.39  ? 153 GLN B O   1 
ATOM   1628 C  CB  . GLN B  1 94  ? 71.343  23.431  76.761  1.00 48.61  ? 153 GLN B CB  1 
ATOM   1629 C  CG  . GLN B  1 94  ? 72.428  24.204  76.028  1.00 49.25  ? 153 GLN B CG  1 
ATOM   1630 C  CD  . GLN B  1 94  ? 72.538  25.622  76.518  1.00 52.18  ? 153 GLN B CD  1 
ATOM   1631 O  OE1 . GLN B  1 94  ? 71.585  26.404  76.442  1.00 54.45  ? 153 GLN B OE1 1 
ATOM   1632 N  NE2 . GLN B  1 94  ? 73.707  25.969  77.028  1.00 53.22  ? 153 GLN B NE2 1 
ATOM   1633 N  N   . ILE B  1 95  ? 70.638  21.450  79.481  1.00 47.74  ? 154 ILE B N   1 
ATOM   1634 C  CA  . ILE B  1 95  ? 69.576  20.654  80.079  1.00 47.72  ? 154 ILE B CA  1 
ATOM   1635 C  C   . ILE B  1 95  ? 69.581  20.792  81.601  1.00 49.97  ? 154 ILE B C   1 
ATOM   1636 O  O   . ILE B  1 95  ? 70.542  20.399  82.279  1.00 50.00  ? 154 ILE B O   1 
ATOM   1637 C  CB  . ILE B  1 95  ? 69.711  19.178  79.700  1.00 45.07  ? 154 ILE B CB  1 
ATOM   1638 C  CG1 . ILE B  1 95  ? 69.718  19.035  78.173  1.00 43.74  ? 154 ILE B CG1 1 
ATOM   1639 C  CG2 . ILE B  1 95  ? 68.601  18.363  80.324  1.00 44.19  ? 154 ILE B CG2 1 
ATOM   1640 C  CD1 . ILE B  1 95  ? 68.617  19.805  77.463  1.00 44.93  ? 154 ILE B CD1 1 
ATOM   1641 N  N   . CYS B  1 96  ? 68.492  21.358  82.113  1.00 52.19  ? 155 CYS B N   1 
ATOM   1642 C  CA  . CYS B  1 96  ? 68.342  21.627  83.520  1.00 54.82  ? 155 CYS B CA  1 
ATOM   1643 C  C   . CYS B  1 96  ? 67.491  20.571  84.195  1.00 54.71  ? 155 CYS B C   1 
ATOM   1644 O  O   . CYS B  1 96  ? 66.473  20.141  83.639  1.00 54.30  ? 155 CYS B O   1 
ATOM   1645 C  CB  . CYS B  1 96  ? 67.700  23.000  83.730  1.00 58.31  ? 155 CYS B CB  1 
ATOM   1646 S  SG  . CYS B  1 96  ? 68.895  24.308  83.532  1.00 62.51  ? 155 CYS B SG  1 
ATOM   1647 N  N   . LEU B  1 97  ? 67.895  20.200  85.415  1.00 55.48  ? 156 LEU B N   1 
ATOM   1648 C  CA  . LEU B  1 97  ? 67.214  19.176  86.179  1.00 55.66  ? 156 LEU B CA  1 
ATOM   1649 C  C   . LEU B  1 97  ? 65.828  19.631  86.569  1.00 58.25  ? 156 LEU B C   1 
ATOM   1650 O  O   . LEU B  1 97  ? 65.652  20.735  87.088  1.00 60.81  ? 156 LEU B O   1 
ATOM   1651 C  CB  . LEU B  1 97  ? 68.010  18.819  87.445  1.00 57.01  ? 156 LEU B CB  1 
ATOM   1652 C  CG  . LEU B  1 97  ? 69.385  18.147  87.250  1.00 54.86  ? 156 LEU B CG  1 
ATOM   1653 C  CD1 . LEU B  1 97  ? 70.022  17.876  88.564  1.00 55.87  ? 156 LEU B CD1 1 
ATOM   1654 C  CD2 . LEU B  1 97  ? 69.293  16.860  86.440  1.00 52.25  ? 156 LEU B CD2 1 
ATOM   1655 N  N   . THR B  1 98  ? 64.853  18.759  86.310  1.00 57.90  ? 157 THR B N   1 
ATOM   1656 C  CA  . THR B  1 98  ? 63.486  18.910  86.800  1.00 60.69  ? 157 THR B CA  1 
ATOM   1657 C  C   . THR B  1 98  ? 63.164  17.759  87.753  1.00 61.49  ? 157 THR B C   1 
ATOM   1658 O  O   . THR B  1 98  ? 63.797  16.704  87.708  1.00 59.32  ? 157 THR B O   1 
ATOM   1659 C  CB  . THR B  1 98  ? 62.464  18.895  85.638  1.00 60.50  ? 157 THR B CB  1 
ATOM   1660 O  OG1 . THR B  1 98  ? 62.553  17.660  84.917  1.00 57.98  ? 157 THR B OG1 1 
ATOM   1661 C  CG2 . THR B  1 98  ? 62.724  20.051  84.664  1.00 60.05  ? 157 THR B CG2 1 
ATOM   1662 N  N   . LYS B  1 99  ? 62.159  17.965  88.601  1.00 65.06  ? 158 LYS B N   1 
ATOM   1663 C  CA  . LYS B  1 99  ? 61.758  16.973  89.600  1.00 66.49  ? 158 LYS B CA  1 
ATOM   1664 C  C   . LYS B  1 99  ? 61.481  15.601  88.961  1.00 64.38  ? 158 LYS B C   1 
ATOM   1665 O  O   . LYS B  1 99  ? 61.756  14.562  89.546  1.00 64.58  ? 158 LYS B O   1 
ATOM   1666 C  CB  . LYS B  1 99  ? 60.530  17.458  90.385  1.00 70.60  ? 158 LYS B CB  1 
ATOM   1667 C  CG  . LYS B  1 99  ? 60.575  17.093  91.865  1.00 74.32  ? 158 LYS B CG  1 
ATOM   1668 C  CD  . LYS B  1 99  ? 59.337  17.538  92.625  1.00 80.44  ? 158 LYS B CD  1 
ATOM   1669 C  CE  . LYS B  1 99  ? 59.174  16.755  93.939  1.00 83.82  ? 158 LYS B CE  1 
ATOM   1670 N  NZ  . LYS B  1 99  ? 57.827  16.970  94.584  1.00 89.04  ? 158 LYS B NZ  1 
ATOM   1671 N  N   . SER B  1 100 ? 60.964  15.593  87.745  1.00 62.88  ? 159 SER B N   1 
ATOM   1672 C  CA  . SER B  1 100 ? 60.630  14.336  87.092  1.00 61.61  ? 159 SER B CA  1 
ATOM   1673 C  C   . SER B  1 100 ? 61.855  13.541  86.617  1.00 58.34  ? 159 SER B C   1 
ATOM   1674 O  O   . SER B  1 100 ? 61.705  12.398  86.173  1.00 57.33  ? 159 SER B O   1 
ATOM   1675 C  CB  . SER B  1 100 ? 59.718  14.617  85.895  1.00 61.76  ? 159 SER B CB  1 
ATOM   1676 O  OG  . SER B  1 100 ? 60.405  15.412  84.934  1.00 60.39  ? 159 SER B OG  1 
ATOM   1677 N  N   . MET B  1 101 ? 63.048  14.146  86.688  1.00 56.89  ? 160 MET B N   1 
ATOM   1678 C  CA  . MET B  1 101 ? 64.289  13.485  86.259  1.00 54.29  ? 160 MET B CA  1 
ATOM   1679 C  C   . MET B  1 101 ? 64.927  12.591  87.333  1.00 55.10  ? 160 MET B C   1 
ATOM   1680 O  O   . MET B  1 101 ? 65.920  11.930  87.070  1.00 53.46  ? 160 MET B O   1 
ATOM   1681 C  CB  . MET B  1 101 ? 65.321  14.526  85.793  1.00 52.96  ? 160 MET B CB  1 
ATOM   1682 C  CG  . MET B  1 101 ? 65.062  15.116  84.413  1.00 51.58  ? 160 MET B CG  1 
ATOM   1683 S  SD  . MET B  1 101 ? 66.219  16.424  83.979  1.00 52.56  ? 160 MET B SD  1 
ATOM   1684 C  CE  . MET B  1 101 ? 65.330  17.242  82.658  1.00 51.85  ? 160 MET B CE  1 
ATOM   1685 N  N   . ASP B  1 102 ? 64.356  12.558  88.534  1.00 58.21  ? 161 ASP B N   1 
ATOM   1686 C  CA  . ASP B  1 102 ? 64.914  11.757  89.622  1.00 59.62  ? 161 ASP B CA  1 
ATOM   1687 C  C   . ASP B  1 102 ? 65.149  10.294  89.171  1.00 58.41  ? 161 ASP B C   1 
ATOM   1688 O  O   . ASP B  1 102 ? 64.269  9.662   88.579  1.00 57.74  ? 161 ASP B O   1 
ATOM   1689 C  CB  . ASP B  1 102 ? 63.996  11.815  90.844  1.00 63.32  ? 161 ASP B CB  1 
ATOM   1690 C  CG  . ASP B  1 102 ? 64.675  11.371  92.125  1.00 65.90  ? 161 ASP B CG  1 
ATOM   1691 O  OD1 . ASP B  1 102 ? 65.768  11.869  92.439  1.00 65.52  ? 161 ASP B OD1 1 
ATOM   1692 O  OD2 . ASP B  1 102 ? 64.088  10.545  92.844  1.00 69.99  ? 161 ASP B OD2 1 
ATOM   1693 N  N   . ASN B  1 103 ? 66.364  9.799   89.432  1.00 58.05  ? 162 ASN B N   1 
ATOM   1694 C  CA  . ASN B  1 103 ? 66.810  8.457   89.053  1.00 57.54  ? 162 ASN B CA  1 
ATOM   1695 C  C   . ASN B  1 103 ? 66.920  8.172   87.549  1.00 54.40  ? 162 ASN B C   1 
ATOM   1696 O  O   . ASN B  1 103 ? 66.979  7.013   87.133  1.00 54.33  ? 162 ASN B O   1 
ATOM   1697 C  CB  . ASN B  1 103 ? 65.962  7.383   89.741  1.00 60.37  ? 162 ASN B CB  1 
ATOM   1698 C  CG  . ASN B  1 103 ? 66.305  7.216   91.202  1.00 63.98  ? 162 ASN B CG  1 
ATOM   1699 O  OD1 . ASN B  1 103 ? 67.430  6.867   91.557  1.00 64.38  ? 162 ASN B OD1 1 
ATOM   1700 N  ND2 . ASN B  1 103 ? 65.321  7.441   92.061  1.00 66.34  ? 162 ASN B ND2 1 
ATOM   1701 N  N   . MET B  1 104 ? 66.993  9.210   86.731  1.00 52.21  ? 163 MET B N   1 
ATOM   1702 C  CA  . MET B  1 104 ? 67.288  8.995   85.322  1.00 49.66  ? 163 MET B CA  1 
ATOM   1703 C  C   . MET B  1 104 ? 68.745  8.581   85.148  1.00 48.84  ? 163 MET B C   1 
ATOM   1704 O  O   . MET B  1 104 ? 69.583  8.805   86.015  1.00 49.84  ? 163 MET B O   1 
ATOM   1705 C  CB  . MET B  1 104 ? 66.999  10.239  84.490  1.00 48.00  ? 163 MET B CB  1 
ATOM   1706 C  CG  . MET B  1 104 ? 67.933  11.409  84.712  1.00 47.72  ? 163 MET B CG  1 
ATOM   1707 S  SD  . MET B  1 104 ? 67.751  12.711  83.443  1.00 46.05  ? 163 MET B SD  1 
ATOM   1708 C  CE  . MET B  1 104 ? 69.048  13.809  83.989  1.00 45.75  ? 163 MET B CE  1 
ATOM   1709 N  N   . THR B  1 105 ? 69.029  7.971   84.010  1.00 47.48  ? 164 THR B N   1 
ATOM   1710 C  CA  . THR B  1 105 ? 70.384  7.604   83.627  1.00 46.55  ? 164 THR B CA  1 
ATOM   1711 C  C   . THR B  1 105 ? 70.753  8.322   82.316  1.00 44.08  ? 164 THR B C   1 
ATOM   1712 O  O   . THR B  1 105 ? 70.022  8.271   81.335  1.00 43.24  ? 164 THR B O   1 
ATOM   1713 C  CB  . THR B  1 105 ? 70.476  6.097   83.424  1.00 47.32  ? 164 THR B CB  1 
ATOM   1714 O  OG1 . THR B  1 105 ? 70.025  5.453   84.615  1.00 50.32  ? 164 THR B OG1 1 
ATOM   1715 C  CG2 . THR B  1 105 ? 71.885  5.673   83.142  1.00 47.11  ? 164 THR B CG2 1 
ATOM   1716 N  N   . VAL B  1 106 ? 71.876  9.018   82.314  1.00 43.35  ? 165 VAL B N   1 
ATOM   1717 C  CA  . VAL B  1 106 ? 72.402  9.610   81.106  1.00 41.24  ? 165 VAL B CA  1 
ATOM   1718 C  C   . VAL B  1 106 ? 73.730  8.933   80.813  1.00 41.28  ? 165 VAL B C   1 
ATOM   1719 O  O   . VAL B  1 106 ? 74.437  8.521   81.745  1.00 42.92  ? 165 VAL B O   1 
ATOM   1720 C  CB  . VAL B  1 106 ? 72.637  11.118  81.266  1.00 41.12  ? 165 VAL B CB  1 
ATOM   1721 C  CG1 . VAL B  1 106 ? 71.329  11.823  81.479  1.00 41.29  ? 165 VAL B CG1 1 
ATOM   1722 C  CG2 . VAL B  1 106 ? 73.603  11.417  82.412  1.00 42.07  ? 165 VAL B CG2 1 
ATOM   1723 N  N   . ARG B  1 107 ? 74.058  8.776   79.537  1.00 58.35  ? 166 ARG B N   1 
ATOM   1724 C  CA  . ARG B  1 107 ? 75.318  8.165   79.168  1.00 57.46  ? 166 ARG B CA  1 
ATOM   1725 C  C   . ARG B  1 107 ? 76.272  9.198   78.562  1.00 54.38  ? 166 ARG B C   1 
ATOM   1726 O  O   . ARG B  1 107 ? 75.869  10.021  77.758  1.00 54.67  ? 166 ARG B O   1 
ATOM   1727 C  CB  . ARG B  1 107 ? 75.101  6.974   78.234  1.00 61.19  ? 166 ARG B CB  1 
ATOM   1728 C  CG  . ARG B  1 107 ? 76.411  6.360   77.786  1.00 61.24  ? 166 ARG B CG  1 
ATOM   1729 C  CD  . ARG B  1 107 ? 76.251  4.936   77.312  1.00 66.45  ? 166 ARG B CD  1 
ATOM   1730 N  NE  . ARG B  1 107 ? 75.561  4.850   76.034  1.00 69.93  ? 166 ARG B NE  1 
ATOM   1731 C  CZ  . ARG B  1 107 ? 76.118  5.106   74.853  1.00 69.68  ? 166 ARG B CZ  1 
ATOM   1732 N  NH1 . ARG B  1 107 ? 75.395  4.986   73.754  1.00 73.89  ? 166 ARG B NH1 1 
ATOM   1733 N  NH2 . ARG B  1 107 ? 77.389  5.483   74.758  1.00 65.64  ? 166 ARG B NH2 1 
ATOM   1734 N  N   . VAL B  1 108 ? 77.532  9.154   78.983  1.00 52.28  ? 167 VAL B N   1 
ATOM   1735 C  CA  . VAL B  1 108 ? 78.592  9.945   78.358  1.00 50.49  ? 167 VAL B CA  1 
ATOM   1736 C  C   . VAL B  1 108 ? 79.131  9.138   77.173  1.00 51.90  ? 167 VAL B C   1 
ATOM   1737 O  O   . VAL B  1 108 ? 79.661  8.040   77.372  1.00 53.37  ? 167 VAL B O   1 
ATOM   1738 C  CB  . VAL B  1 108 ? 79.760  10.240  79.311  1.00 48.56  ? 167 VAL B CB  1 
ATOM   1739 C  CG1 . VAL B  1 108 ? 80.602  11.350  78.764  1.00 46.53  ? 167 VAL B CG1 1 
ATOM   1740 C  CG2 . VAL B  1 108 ? 79.269  10.595  80.667  1.00 47.59  ? 167 VAL B CG2 1 
ATOM   1741 N  N   . PRO B  1 109 ? 78.964  9.656   75.942  1.00 52.15  ? 168 PRO B N   1 
ATOM   1742 C  CA  . PRO B  1 109 ? 79.396  8.942   74.751  1.00 53.57  ? 168 PRO B CA  1 
ATOM   1743 C  C   . PRO B  1 109 ? 80.891  9.142   74.488  1.00 51.29  ? 168 PRO B C   1 
ATOM   1744 O  O   . PRO B  1 109 ? 81.493  10.100  74.961  1.00 48.09  ? 168 PRO B O   1 
ATOM   1745 C  CB  . PRO B  1 109 ? 78.573  9.592   73.648  1.00 55.07  ? 168 PRO B CB  1 
ATOM   1746 C  CG  . PRO B  1 109 ? 78.353  10.978  74.124  1.00 53.30  ? 168 PRO B CG  1 
ATOM   1747 C  CD  . PRO B  1 109 ? 78.379  10.967  75.609  1.00 51.64  ? 168 PRO B CD  1 
ATOM   1748 N  N   . GLU B  1 110 ? 81.470  8.232   73.724  1.00 52.95  ? 169 GLU B N   1 
ATOM   1749 C  CA  . GLU B  1 110 ? 82.888  8.280   73.434  1.00 51.93  ? 169 GLU B CA  1 
ATOM   1750 C  C   . GLU B  1 110 ? 83.226  9.504   72.565  1.00 49.70  ? 169 GLU B C   1 
ATOM   1751 O  O   . GLU B  1 110 ? 82.406  9.967   71.804  1.00 49.91  ? 169 GLU B O   1 
ATOM   1752 C  CB  . GLU B  1 110 ? 83.366  6.971   72.775  1.00 54.87  ? 169 GLU B CB  1 
ATOM   1753 C  CG  . GLU B  1 110 ? 82.897  6.770   71.330  1.00 57.48  ? 169 GLU B CG  1 
ATOM   1754 C  CD  . GLU B  1 110 ? 83.544  5.563   70.607  1.00 62.60  ? 169 GLU B CD  1 
ATOM   1755 O  OE1 . GLU B  1 110 ? 83.122  5.297   69.455  1.00 64.97  ? 169 GLU B OE1 1 
ATOM   1756 O  OE2 . GLU B  1 110 ? 84.463  4.903   71.169  1.00 63.63  ? 169 GLU B OE2 1 
ATOM   1757 N  N   . THR B  1 111 ? 84.439  10.026  72.711  1.00 48.15  ? 170 THR B N   1 
ATOM   1758 C  CA  . THR B  1 111 ? 84.889  11.163  71.936  1.00 46.90  ? 170 THR B CA  1 
ATOM   1759 C  C   . THR B  1 111 ? 85.560  10.697  70.673  1.00 47.27  ? 170 THR B C   1 
ATOM   1760 O  O   . THR B  1 111 ? 85.841  9.524   70.519  1.00 48.85  ? 170 THR B O   1 
ATOM   1761 C  CB  . THR B  1 111 ? 85.904  12.009  72.681  1.00 45.78  ? 170 THR B CB  1 
ATOM   1762 O  OG1 . THR B  1 111 ? 87.151  11.289  72.823  1.00 47.00  ? 170 THR B OG1 1 
ATOM   1763 C  CG2 . THR B  1 111 ? 85.348  12.406  74.018  1.00 44.67  ? 170 THR B CG2 1 
ATOM   1764 N  N   . VAL B  1 112 ? 85.814  11.632  69.773  1.00 46.23  ? 171 VAL B N   1 
ATOM   1765 C  CA  . VAL B  1 112 ? 86.487  11.317  68.533  1.00 46.47  ? 171 VAL B CA  1 
ATOM   1766 C  C   . VAL B  1 112 ? 87.884  10.780  68.805  1.00 46.07  ? 171 VAL B C   1 
ATOM   1767 O  O   . VAL B  1 112 ? 88.352  9.878   68.102  1.00 47.05  ? 171 VAL B O   1 
ATOM   1768 C  CB  . VAL B  1 112 ? 86.559  12.541  67.571  1.00 46.09  ? 171 VAL B CB  1 
ATOM   1769 C  CG1 . VAL B  1 112 ? 87.450  13.629  68.123  1.00 44.50  ? 171 VAL B CG1 1 
ATOM   1770 C  CG2 . VAL B  1 112 ? 87.016  12.099  66.196  1.00 45.38  ? 171 VAL B CG2 1 
ATOM   1771 N  N   . ALA B  1 113 ? 88.532  11.337  69.827  1.00 44.47  ? 172 ALA B N   1 
ATOM   1772 C  CA  . ALA B  1 113 ? 89.852  10.869  70.270  1.00 45.27  ? 172 ALA B CA  1 
ATOM   1773 C  C   . ALA B  1 113 ? 89.824  9.419   70.694  1.00 47.29  ? 172 ALA B C   1 
ATOM   1774 O  O   . ALA B  1 113 ? 90.699  8.627   70.329  1.00 49.09  ? 172 ALA B O   1 
ATOM   1775 C  CB  . ALA B  1 113 ? 90.349  11.706  71.415  1.00 45.07  ? 172 ALA B CB  1 
ATOM   1776 N  N   . ASP B  1 114 ? 88.813  9.079   71.478  1.00 47.54  ? 173 ASP B N   1 
ATOM   1777 C  CA  . ASP B  1 114 ? 88.693  7.740   72.007  1.00 50.45  ? 173 ASP B CA  1 
ATOM   1778 C  C   . ASP B  1 114 ? 88.611  6.741   70.849  1.00 52.22  ? 173 ASP B C   1 
ATOM   1779 O  O   . ASP B  1 114 ? 89.163  5.640   70.937  1.00 56.02  ? 173 ASP B O   1 
ATOM   1780 C  CB  . ASP B  1 114 ? 87.472  7.610   72.972  1.00 50.64  ? 173 ASP B CB  1 
ATOM   1781 C  CG  . ASP B  1 114 ? 87.628  8.428   74.286  1.00 50.44  ? 173 ASP B CG  1 
ATOM   1782 O  OD1 . ASP B  1 114 ? 88.727  8.474   74.869  1.00 53.58  ? 173 ASP B OD1 1 
ATOM   1783 O  OD2 . ASP B  1 114 ? 86.645  9.045   74.749  1.00 50.53  ? 173 ASP B OD2 1 
ATOM   1784 N  N   . ALA B  1 115 ? 87.947  7.132   69.764  1.00 50.87  ? 174 ALA B N   1 
ATOM   1785 C  CA  . ALA B  1 115 ? 87.625  6.211   68.656  1.00 53.36  ? 174 ALA B CA  1 
ATOM   1786 C  C   . ALA B  1 115 ? 88.738  6.137   67.639  1.00 53.53  ? 174 ALA B C   1 
ATOM   1787 O  O   . ALA B  1 115 ? 88.763  5.253   66.797  1.00 56.28  ? 174 ALA B O   1 
ATOM   1788 C  CB  . ALA B  1 115 ? 86.326  6.645   67.960  1.00 52.84  ? 174 ALA B CB  1 
ATOM   1789 N  N   . ARG B  1 116 ? 89.644  7.096   67.708  1.00 51.47  ? 175 ARG B N   1 
ATOM   1790 C  CA  . ARG B  1 116 ? 90.697  7.225   66.727  1.00 51.60  ? 175 ARG B CA  1 
ATOM   1791 C  C   . ARG B  1 116 ? 91.748  6.128   66.882  1.00 55.69  ? 175 ARG B C   1 
ATOM   1792 O  O   . ARG B  1 116 ? 92.157  5.783   67.999  1.00 57.26  ? 175 ARG B O   1 
ATOM   1793 C  CB  . ARG B  1 116 ? 91.342  8.580   66.874  1.00 48.49  ? 175 ARG B CB  1 
ATOM   1794 C  CG  . ARG B  1 116 ? 92.160  8.970   65.669  1.00 48.42  ? 175 ARG B CG  1 
ATOM   1795 C  CD  . ARG B  1 116 ? 92.786  10.330  65.828  1.00 45.89  ? 175 ARG B CD  1 
ATOM   1796 N  NE  . ARG B  1 116 ? 91.779  11.384  65.756  1.00 45.09  ? 175 ARG B NE  1 
ATOM   1797 C  CZ  . ARG B  1 116 ? 91.535  12.292  66.700  1.00 45.02  ? 175 ARG B CZ  1 
ATOM   1798 N  NH1 . ARG B  1 116 ? 90.607  13.217  66.497  1.00 45.49  ? 175 ARG B NH1 1 
ATOM   1799 N  NH2 . ARG B  1 116 ? 92.225  12.319  67.824  1.00 46.35  ? 175 ARG B NH2 1 
ATOM   1800 N  N   . GLN B  1 117 ? 92.164  5.577   65.748  1.00 58.05  ? 176 GLN B N   1 
ATOM   1801 C  CA  . GLN B  1 117 ? 93.149  4.497   65.722  1.00 63.16  ? 176 GLN B CA  1 
ATOM   1802 C  C   . GLN B  1 117 ? 94.475  4.997   65.187  1.00 61.98  ? 176 GLN B C   1 
ATOM   1803 O  O   . GLN B  1 117 ? 95.545  4.612   65.667  1.00 64.97  ? 176 GLN B O   1 
ATOM   1804 C  CB  . GLN B  1 117 ? 92.647  3.332   64.868  1.00 67.40  ? 176 GLN B CB  1 
ATOM   1805 C  CG  . GLN B  1 117 ? 91.570  2.504   65.571  1.00 72.47  ? 176 GLN B CG  1 
ATOM   1806 C  CD  . GLN B  1 117 ? 91.077  1.354   64.703  1.00 80.53  ? 176 GLN B CD  1 
ATOM   1807 O  OE1 . GLN B  1 117 ? 90.776  1.541   63.523  1.00 82.94  ? 176 GLN B OE1 1 
ATOM   1808 N  NE2 . GLN B  1 117 ? 90.998  0.163   65.279  1.00 87.22  ? 176 GLN B NE2 1 
ATOM   1809 N  N   . SER B  1 118 ? 94.391  5.832   64.169  1.00 58.40  ? 177 SER B N   1 
ATOM   1810 C  CA  . SER B  1 118 ? 95.543  6.558   63.719  1.00 57.32  ? 177 SER B CA  1 
ATOM   1811 C  C   . SER B  1 118 ? 95.165  7.959   63.252  1.00 52.37  ? 177 SER B C   1 
ATOM   1812 O  O   . SER B  1 118 ? 94.034  8.240   62.886  1.00 50.17  ? 177 SER B O   1 
ATOM   1813 C  CB  . SER B  1 118 ? 96.220  5.793   62.600  1.00 60.03  ? 177 SER B CB  1 
ATOM   1814 O  OG  . SER B  1 118 ? 95.370  5.791   61.473  1.00 60.84  ? 177 SER B OG  1 
ATOM   1815 N  N   . ILE B  1 119 ? 96.152  8.835   63.306  1.00 51.23  ? 178 ILE B N   1 
ATOM   1816 C  CA  . ILE B  1 119 ? 96.081  10.195  62.780  1.00 47.94  ? 178 ILE B CA  1 
ATOM   1817 C  C   . ILE B  1 119 ? 96.158  10.163  61.247  1.00 47.12  ? 178 ILE B C   1 
ATOM   1818 O  O   . ILE B  1 119 ? 96.663  9.205   60.684  1.00 49.41  ? 178 ILE B O   1 
ATOM   1819 C  CB  . ILE B  1 119 ? 97.255  10.977  63.357  1.00 48.60  ? 178 ILE B CB  1 
ATOM   1820 C  CG1 . ILE B  1 119 ? 96.854  11.581  64.714  1.00 47.99  ? 178 ILE B CG1 1 
ATOM   1821 C  CG2 . ILE B  1 119 ? 97.778  11.970  62.362  1.00 47.43  ? 178 ILE B CG2 1 
ATOM   1822 C  CD1 . ILE B  1 119 ? 98.039  12.101  65.542  1.00 49.38  ? 178 ILE B CD1 1 
ATOM   1823 N  N   . ASP B  1 120 ? 95.638  11.183  60.573  1.00 44.92  ? 179 ASP B N   1 
ATOM   1824 C  CA  . ASP B  1 120 ? 95.617  11.213  59.099  1.00 44.53  ? 179 ASP B CA  1 
ATOM   1825 C  C   . ASP B  1 120 ? 96.805  11.952  58.498  1.00 42.98  ? 179 ASP B C   1 
ATOM   1826 O  O   . ASP B  1 120 ? 97.331  12.899  59.087  1.00 41.59  ? 179 ASP B O   1 
ATOM   1827 C  CB  . ASP B  1 120 ? 94.293  11.828  58.592  1.00 44.28  ? 179 ASP B CB  1 
ATOM   1828 C  CG  . ASP B  1 120 ? 93.146  10.786  58.488  1.00 48.34  ? 179 ASP B CG  1 
ATOM   1829 O  OD1 . ASP B  1 120 ? 93.254  9.692   59.104  1.00 51.59  ? 179 ASP B OD1 1 
ATOM   1830 O  OD2 . ASP B  1 120 ? 92.121  11.059  57.792  1.00 51.51  ? 179 ASP B OD2 1 
ATOM   1831 N  N   . VAL B  1 121 ? 97.228  11.509  57.316  1.00 43.37  ? 180 VAL B N   1 
ATOM   1832 C  CA  . VAL B  1 121 ? 98.245  12.239  56.532  1.00 42.70  ? 180 VAL B CA  1 
ATOM   1833 C  C   . VAL B  1 121 ? 97.610  13.535  56.126  1.00 41.82  ? 180 VAL B C   1 
ATOM   1834 O  O   . VAL B  1 121 ? 96.593  13.525  55.469  1.00 42.05  ? 180 VAL B O   1 
ATOM   1835 C  CB  . VAL B  1 121 ? 98.614  11.529  55.228  1.00 42.97  ? 180 VAL B CB  1 
ATOM   1836 C  CG1 . VAL B  1 121 ? 99.639  12.352  54.446  1.00 43.17  ? 180 VAL B CG1 1 
ATOM   1837 C  CG2 . VAL B  1 121 ? 99.151  10.176  55.495  1.00 45.18  ? 180 VAL B CG2 1 
ATOM   1838 N  N   . GLY B  1 122 ? 98.174  14.651  56.537  1.00 42.63  ? 181 GLY B N   1 
ATOM   1839 C  CA  . GLY B  1 122 ? 97.613  15.945  56.179  1.00 43.49  ? 181 GLY B CA  1 
ATOM   1840 C  C   . GLY B  1 122 ? 98.085  16.390  54.810  1.00 44.34  ? 181 GLY B C   1 
ATOM   1841 O  O   . GLY B  1 122 ? 99.273  16.378  54.547  1.00 45.48  ? 181 GLY B O   1 
ATOM   1842 N  N   . LYS B  1 123 ? 97.163  16.761  53.925  1.00 45.15  ? 182 LYS B N   1 
ATOM   1843 C  CA  . LYS B  1 123 ? 97.528  17.408  52.661  1.00 46.54  ? 182 LYS B CA  1 
ATOM   1844 C  C   . LYS B  1 123 ? 96.681  18.655  52.410  1.00 48.72  ? 182 LYS B C   1 
ATOM   1845 O  O   . LYS B  1 123 ? 95.596  18.770  52.924  1.00 48.88  ? 182 LYS B O   1 
ATOM   1846 C  CB  . LYS B  1 123 ? 97.463  16.433  51.480  1.00 46.08  ? 182 LYS B CB  1 
ATOM   1847 C  CG  . LYS B  1 123 ? 96.108  15.909  51.160  1.00 47.21  ? 182 LYS B CG  1 
ATOM   1848 C  CD  . LYS B  1 123 ? 96.163  14.791  50.125  1.00 48.42  ? 182 LYS B CD  1 
ATOM   1849 C  CE  . LYS B  1 123 ? 94.826  14.089  50.025  1.00 51.04  ? 182 LYS B CE  1 
ATOM   1850 N  NZ  . LYS B  1 123 ? 94.399  13.576  51.382  1.00 50.40  ? 182 LYS B NZ  1 
ATOM   1851 N  N   . THR B  1 124 ? 97.219  19.606  51.657  1.00 51.12  ? 183 THR B N   1 
ATOM   1852 C  CA  . THR B  1 124 ? 96.460  20.759  51.241  1.00 54.60  ? 183 THR B CA  1 
ATOM   1853 C  C   . THR B  1 124 ? 95.862  20.501  49.848  1.00 56.62  ? 183 THR B C   1 
ATOM   1854 O  O   . THR B  1 124 ? 94.684  20.762  49.651  1.00 59.97  ? 183 THR B O   1 
ATOM   1855 C  CB  . THR B  1 124 ? 97.315  22.026  51.248  1.00 57.02  ? 183 THR B CB  1 
ATOM   1856 O  OG1 . THR B  1 124 ? 98.459  21.821  50.431  1.00 56.59  ? 183 THR B OG1 1 
ATOM   1857 C  CG2 . THR B  1 124 ? 97.779  22.357  52.646  1.00 56.37  ? 183 THR B CG2 1 
ATOM   1858 N  N   . SER B  1 125 ? 96.639  19.966  48.904  1.00 56.08  ? 184 SER B N   1 
ATOM   1859 C  CA  . SER B  1 125 ? 96.130  19.666  47.559  1.00 58.20  ? 184 SER B CA  1 
ATOM   1860 C  C   . SER B  1 125 ? 96.000  18.184  47.228  1.00 57.28  ? 184 SER B C   1 
ATOM   1861 O  O   . SER B  1 125 ? 96.857  17.366  47.570  1.00 55.68  ? 184 SER B O   1 
ATOM   1862 C  CB  . SER B  1 125 ? 97.041  20.244  46.476  1.00 59.07  ? 184 SER B CB  1 
ATOM   1863 O  OG  . SER B  1 125 ? 97.400  21.572  46.753  1.00 61.63  ? 184 SER B OG  1 
ATOM   1864 N  N   . ALA B  1 126 ? 94.934  17.874  46.501  1.00 60.47  ? 185 ALA B N   1 
ATOM   1865 C  CA  . ALA B  1 126 ? 94.868  16.710  45.586  1.00 61.07  ? 185 ALA B CA  1 
ATOM   1866 C  C   . ALA B  1 126 ? 96.108  16.501  44.684  1.00 59.23  ? 185 ALA B C   1 
ATOM   1867 O  O   . ALA B  1 126 ? 96.629  15.393  44.579  1.00 57.99  ? 185 ALA B O   1 
ATOM   1868 C  CB  . ALA B  1 126 ? 93.601  16.851  44.669  1.00 65.76  ? 185 ALA B CB  1 
ATOM   1869 N  N   . GLU B  1 127 ? 96.555  17.549  44.012  1.00 59.88  ? 186 GLU B N   1 
ATOM   1870 C  CA  . GLU B  1 127 ? 97.514  17.368  42.916  1.00 59.78  ? 186 GLU B CA  1 
ATOM   1871 C  C   . GLU B  1 127 ? 98.985  17.215  43.348  1.00 56.59  ? 186 GLU B C   1 
ATOM   1872 O  O   . GLU B  1 127 ? 99.389  17.598  44.447  1.00 54.68  ? 186 GLU B O   1 
ATOM   1873 C  CB  . GLU B  1 127 ? 97.427  18.543  41.950  1.00 62.72  ? 186 GLU B CB  1 
ATOM   1874 C  CG  . GLU B  1 127 ? 96.063  18.757  41.340  1.00 68.35  ? 186 GLU B CG  1 
ATOM   1875 C  CD  . GLU B  1 127 ? 95.750  20.232  41.135  1.00 73.22  ? 186 GLU B CD  1 
ATOM   1876 O  OE1 . GLU B  1 127 ? 95.680  20.974  42.147  1.00 73.70  ? 186 GLU B OE1 1 
ATOM   1877 O  OE2 . GLU B  1 127 ? 95.570  20.644  39.971  1.00 77.13  ? 186 GLU B OE2 1 
ATOM   1878 N  N   . ASN B  1 128 ? 99.778  16.660  42.436  1.00 56.37  ? 187 ASN B N   1 
ATOM   1879 C  CA  . ASN B  1 128 ? 101.234 16.773  42.488  1.00 55.01  ? 187 ASN B CA  1 
ATOM   1880 C  C   . ASN B  1 128 ? 101.702 18.199  42.569  1.00 55.97  ? 187 ASN B C   1 
ATOM   1881 O  O   . ASN B  1 128 ? 101.028 19.120  42.128  1.00 57.89  ? 187 ASN B O   1 
ATOM   1882 C  CB  . ASN B  1 128 ? 101.857 16.132  41.254  1.00 55.23  ? 187 ASN B CB  1 
ATOM   1883 C  CG  . ASN B  1 128 ? 101.826 14.638  41.326  1.00 54.98  ? 187 ASN B CG  1 
ATOM   1884 O  OD1 . ASN B  1 128 ? 101.987 14.081  42.385  1.00 54.46  ? 187 ASN B OD1 1 
ATOM   1885 N  ND2 . ASN B  1 128 ? 101.623 13.979  40.204  1.00 58.17  ? 187 ASN B ND2 1 
ATOM   1886 N  N   . LEU B  1 129 ? 102.881 18.375  43.129  1.00 55.37  ? 188 LEU B N   1 
ATOM   1887 C  CA  . LEU B  1 129 ? 103.469 19.683  43.136  1.00 57.68  ? 188 LEU B CA  1 
ATOM   1888 C  C   . LEU B  1 129 ? 103.679 20.137  41.697  1.00 59.24  ? 188 LEU B C   1 
ATOM   1889 O  O   . LEU B  1 129 ? 103.392 21.281  41.369  1.00 61.66  ? 188 LEU B O   1 
ATOM   1890 C  CB  . LEU B  1 129 ? 104.751 19.701  43.969  1.00 57.71  ? 188 LEU B CB  1 
ATOM   1891 C  CG  . LEU B  1 129 ? 104.479 19.962  45.470  1.00 58.66  ? 188 LEU B CG  1 
ATOM   1892 C  CD1 . LEU B  1 129 ? 105.636 19.515  46.385  1.00 57.44  ? 188 LEU B CD1 1 
ATOM   1893 C  CD2 . LEU B  1 129 ? 104.156 21.471  45.686  1.00 62.94  ? 188 LEU B CD2 1 
ATOM   1894 N  N   . TYR B  1 130 ? 104.114 19.228  40.832  1.00 58.21  ? 189 TYR B N   1 
ATOM   1895 C  CA  . TYR B  1 130 ? 104.374 19.581  39.448  1.00 60.51  ? 189 TYR B CA  1 
ATOM   1896 C  C   . TYR B  1 130 ? 103.187 20.321  38.804  1.00 64.13  ? 189 TYR B C   1 
ATOM   1897 O  O   . TYR B  1 130 ? 103.347 21.367  38.155  1.00 67.43  ? 189 TYR B O   1 
ATOM   1898 C  CB  . TYR B  1 130 ? 104.723 18.336  38.641  1.00 58.89  ? 189 TYR B CB  1 
ATOM   1899 C  CG  . TYR B  1 130 ? 104.931 18.610  37.160  1.00 61.75  ? 189 TYR B CG  1 
ATOM   1900 C  CD1 . TYR B  1 130 ? 103.935 18.324  36.237  1.00 63.80  ? 189 TYR B CD1 1 
ATOM   1901 C  CD2 . TYR B  1 130 ? 106.115 19.172  36.681  1.00 62.33  ? 189 TYR B CD2 1 
ATOM   1902 C  CE1 . TYR B  1 130 ? 104.116 18.576  34.866  1.00 66.37  ? 189 TYR B CE1 1 
ATOM   1903 C  CE2 . TYR B  1 130 ? 106.301 19.423  35.310  1.00 63.92  ? 189 TYR B CE2 1 
ATOM   1904 C  CZ  . TYR B  1 130 ? 105.296 19.121  34.413  1.00 65.97  ? 189 TYR B CZ  1 
ATOM   1905 O  OH  . TYR B  1 130 ? 105.447 19.353  33.059  1.00 68.74  ? 189 TYR B OH  1 
ATOM   1906 N  N   . PHE B  1 131 ? 101.996 19.785  39.024  1.00 64.91  ? 190 PHE B N   1 
ATOM   1907 C  CA  . PHE B  1 131 ? 100.799 20.276  38.386  1.00 68.70  ? 190 PHE B CA  1 
ATOM   1908 C  C   . PHE B  1 131 ? 100.243 21.562  38.991  1.00 72.04  ? 190 PHE B C   1 
ATOM   1909 O  O   . PHE B  1 131 ? 99.717  22.410  38.270  1.00 76.87  ? 190 PHE B O   1 
ATOM   1910 C  CB  . PHE B  1 131 ? 99.749  19.172  38.385  1.00 68.60  ? 190 PHE B CB  1 
ATOM   1911 C  CG  . PHE B  1 131 ? 100.091 18.006  37.478  1.00 68.14  ? 190 PHE B CG  1 
ATOM   1912 C  CD1 . PHE B  1 131 ? 100.521 18.217  36.164  1.00 69.44  ? 190 PHE B CD1 1 
ATOM   1913 C  CD2 . PHE B  1 131 ? 99.945  16.697  37.918  1.00 66.75  ? 190 PHE B CD2 1 
ATOM   1914 C  CE1 . PHE B  1 131 ? 100.819 17.146  35.319  1.00 68.76  ? 190 PHE B CE1 1 
ATOM   1915 C  CE2 . PHE B  1 131 ? 100.236 15.615  37.063  1.00 66.57  ? 190 PHE B CE2 1 
ATOM   1916 C  CZ  . PHE B  1 131 ? 100.671 15.847  35.768  1.00 67.25  ? 190 PHE B CZ  1 
ATOM   1917 N  N   . GLN B  1 132 ? 100.375 21.722  40.296  1.00 70.79  ? 191 GLN B N   1 
ATOM   1918 C  CA  . GLN B  1 132 ? 99.889  22.917  40.962  1.00 74.44  ? 191 GLN B CA  1 
ATOM   1919 C  C   . GLN B  1 132 ? 100.291 24.182  40.229  1.00 79.34  ? 191 GLN B C   1 
ATOM   1920 O  O   . GLN B  1 132 ? 100.045 25.278  40.720  1.00 83.69  ? 191 GLN B O   1 
ATOM   1921 C  CB  . GLN B  1 132 ? 100.426 22.975  42.384  1.00 72.47  ? 191 GLN B CB  1 
ATOM   1922 C  CG  . GLN B  1 132 ? 99.715  22.026  43.329  1.00 69.75  ? 191 GLN B CG  1 
ATOM   1923 C  CD  . GLN B  1 132 ? 100.435 21.872  44.662  1.00 68.18  ? 191 GLN B CD  1 
ATOM   1924 O  OE1 . GLN B  1 132 ? 101.006 22.831  45.176  1.00 71.45  ? 191 GLN B OE1 1 
ATOM   1925 N  NE2 . GLN B  1 132 ? 100.413 20.663  45.229  1.00 63.08  ? 191 GLN B NE2 1 
ATOM   1926 N  N   . ASP C  1 6   ? 38.548  33.123  59.955  1.00 72.16  ? 65  ASP C N   1 
ATOM   1927 C  CA  . ASP C  1 6   ? 38.257  32.887  58.494  1.00 67.48  ? 65  ASP C CA  1 
ATOM   1928 C  C   . ASP C  1 6   ? 39.012  33.852  57.526  1.00 63.42  ? 65  ASP C C   1 
ATOM   1929 O  O   . ASP C  1 6   ? 38.385  34.761  56.935  1.00 61.30  ? 65  ASP C O   1 
ATOM   1930 C  CB  . ASP C  1 6   ? 36.736  32.957  58.250  1.00 67.54  ? 65  ASP C CB  1 
ATOM   1931 N  N   . LYS C  1 7   ? 40.337  33.640  57.380  1.00 62.13  ? 66  LYS C N   1 
ATOM   1932 C  CA  . LYS C  1 7   ? 41.228  34.465  56.503  1.00 58.98  ? 66  LYS C CA  1 
ATOM   1933 C  C   . LYS C  1 7   ? 41.791  33.654  55.304  1.00 55.02  ? 66  LYS C C   1 
ATOM   1934 O  O   . LYS C  1 7   ? 42.484  32.664  55.467  1.00 56.21  ? 66  LYS C O   1 
ATOM   1935 C  CB  . LYS C  1 7   ? 42.387  35.106  57.311  1.00 61.05  ? 66  LYS C CB  1 
ATOM   1936 N  N   . ILE C  1 8   ? 41.494  34.083  54.096  1.00 51.06  ? 67  ILE C N   1 
ATOM   1937 C  CA  . ILE C  1 8   ? 41.951  33.369  52.914  1.00 47.93  ? 67  ILE C CA  1 
ATOM   1938 C  C   . ILE C  1 8   ? 43.111  34.070  52.201  1.00 45.96  ? 67  ILE C C   1 
ATOM   1939 O  O   . ILE C  1 8   ? 43.307  35.281  52.325  1.00 46.02  ? 67  ILE C O   1 
ATOM   1940 C  CB  . ILE C  1 8   ? 40.783  33.136  51.942  1.00 45.86  ? 67  ILE C CB  1 
ATOM   1941 C  CG1 . ILE C  1 8   ? 40.329  34.436  51.295  1.00 44.97  ? 67  ILE C CG1 1 
ATOM   1942 C  CG2 . ILE C  1 8   ? 39.604  32.539  52.688  1.00 47.51  ? 67  ILE C CG2 1 
ATOM   1943 C  CD1 . ILE C  1 8   ? 39.702  34.211  49.935  1.00 44.58  ? 67  ILE C CD1 1 
ATOM   1944 N  N   . THR C  1 9   ? 43.881  33.288  51.454  1.00 44.02  ? 68  THR C N   1 
ATOM   1945 C  CA  . THR C  1 9   ? 45.051  33.798  50.751  1.00 42.85  ? 68  THR C CA  1 
ATOM   1946 C  C   . THR C  1 9   ? 44.721  34.097  49.273  1.00 39.73  ? 68  THR C C   1 
ATOM   1947 O  O   . THR C  1 9   ? 44.032  33.321  48.600  1.00 37.81  ? 68  THR C O   1 
ATOM   1948 C  CB  . THR C  1 9   ? 46.249  32.816  50.878  1.00 43.74  ? 68  THR C CB  1 
ATOM   1949 O  OG1 . THR C  1 9   ? 46.938  33.066  52.121  1.00 48.81  ? 68  THR C OG1 1 
ATOM   1950 C  CG2 . THR C  1 9   ? 47.233  32.973  49.726  1.00 41.09  ? 68  THR C CG2 1 
ATOM   1951 N  N   . VAL C  1 10  ? 45.200  35.238  48.789  1.00 38.68  ? 69  VAL C N   1 
ATOM   1952 C  CA  . VAL C  1 10  ? 45.026  35.609  47.398  1.00 36.16  ? 69  VAL C CA  1 
ATOM   1953 C  C   . VAL C  1 10  ? 46.333  36.144  46.920  1.00 36.07  ? 69  VAL C C   1 
ATOM   1954 O  O   . VAL C  1 10  ? 47.001  36.880  47.642  1.00 38.41  ? 69  VAL C O   1 
ATOM   1955 C  CB  . VAL C  1 10  ? 43.967  36.741  47.203  1.00 35.58  ? 69  VAL C CB  1 
ATOM   1956 C  CG1 . VAL C  1 10  ? 43.638  36.915  45.726  1.00 32.81  ? 69  VAL C CG1 1 
ATOM   1957 C  CG2 . VAL C  1 10  ? 42.702  36.449  47.998  1.00 36.01  ? 69  VAL C CG2 1 
ATOM   1958 N  N   . HIS C  1 11  ? 46.698  35.757  45.712  1.00 34.39  ? 70  HIS C N   1 
ATOM   1959 C  CA  . HIS C  1 11  ? 47.899  36.221  45.080  1.00 35.42  ? 70  HIS C CA  1 
ATOM   1960 C  C   . HIS C  1 11  ? 47.484  37.227  44.016  1.00 34.21  ? 70  HIS C C   1 
ATOM   1961 O  O   . HIS C  1 11  ? 46.580  36.961  43.221  1.00 32.38  ? 70  HIS C O   1 
ATOM   1962 C  CB  . HIS C  1 11  ? 48.617  35.049  44.428  1.00 35.60  ? 70  HIS C CB  1 
ATOM   1963 C  CG  . HIS C  1 11  ? 48.993  33.947  45.380  1.00 39.58  ? 70  HIS C CG  1 
ATOM   1964 N  ND1 . HIS C  1 11  ? 50.059  34.046  46.260  1.00 42.99  ? 70  HIS C ND1 1 
ATOM   1965 C  CD2 . HIS C  1 11  ? 48.461  32.713  45.574  1.00 40.07  ? 70  HIS C CD2 1 
ATOM   1966 C  CE1 . HIS C  1 11  ? 50.170  32.917  46.941  1.00 43.74  ? 70  HIS C CE1 1 
ATOM   1967 N  NE2 . HIS C  1 11  ? 49.218  32.091  46.541  1.00 42.41  ? 70  HIS C NE2 1 
ATOM   1968 N  N   . PHE C  1 12  ? 48.114  38.395  44.031  1.00 35.48  ? 71  PHE C N   1 
ATOM   1969 C  CA  . PHE C  1 12  ? 47.944  39.401  42.990  1.00 34.95  ? 71  PHE C CA  1 
ATOM   1970 C  C   . PHE C  1 12  ? 49.210  39.519  42.178  1.00 36.12  ? 71  PHE C C   1 
ATOM   1971 O  O   . PHE C  1 12  ? 50.256  39.761  42.745  1.00 37.77  ? 71  PHE C O   1 
ATOM   1972 C  CB  . PHE C  1 12  ? 47.756  40.771  43.600  1.00 36.20  ? 71  PHE C CB  1 
ATOM   1973 C  CG  . PHE C  1 12  ? 46.474  40.948  44.297  1.00 36.16  ? 71  PHE C CG  1 
ATOM   1974 C  CD1 . PHE C  1 12  ? 45.459  41.655  43.719  1.00 37.25  ? 71  PHE C CD1 1 
ATOM   1975 C  CD2 . PHE C  1 12  ? 46.291  40.450  45.545  1.00 39.24  ? 71  PHE C CD2 1 
ATOM   1976 C  CE1 . PHE C  1 12  ? 44.271  41.848  44.384  1.00 38.72  ? 71  PHE C CE1 1 
ATOM   1977 C  CE2 . PHE C  1 12  ? 45.102  40.642  46.211  1.00 40.93  ? 71  PHE C CE2 1 
ATOM   1978 C  CZ  . PHE C  1 12  ? 44.093  41.339  45.629  1.00 38.90  ? 71  PHE C CZ  1 
ATOM   1979 N  N   . ILE C  1 13  ? 49.107  39.375  40.862  1.00 35.65  ? 72  ILE C N   1 
ATOM   1980 C  CA  . ILE C  1 13  ? 50.218  39.633  39.962  1.00 37.66  ? 72  ILE C CA  1 
ATOM   1981 C  C   . ILE C  1 13  ? 50.146  41.087  39.513  1.00 39.31  ? 72  ILE C C   1 
ATOM   1982 O  O   . ILE C  1 13  ? 49.226  41.497  38.799  1.00 39.30  ? 72  ILE C O   1 
ATOM   1983 C  CB  . ILE C  1 13  ? 50.165  38.724  38.759  1.00 37.15  ? 72  ILE C CB  1 
ATOM   1984 C  CG1 . ILE C  1 13  ? 50.230  37.258  39.229  1.00 36.97  ? 72  ILE C CG1 1 
ATOM   1985 C  CG2 . ILE C  1 13  ? 51.293  39.048  37.783  1.00 36.99  ? 72  ILE C CG2 1 
ATOM   1986 C  CD1 . ILE C  1 13  ? 50.020  36.266  38.132  1.00 35.40  ? 72  ILE C CD1 1 
ATOM   1987 N  N   . ASN C  1 14  ? 51.107  41.866  39.970  1.00 41.64  ? 73  ASN C N   1 
ATOM   1988 C  CA  . ASN C  1 14  ? 51.118  43.268  39.768  1.00 43.18  ? 73  ASN C CA  1 
ATOM   1989 C  C   . ASN C  1 14  ? 51.453  43.625  38.328  1.00 43.65  ? 73  ASN C C   1 
ATOM   1990 O  O   . ASN C  1 14  ? 51.932  42.802  37.542  1.00 43.67  ? 73  ASN C O   1 
ATOM   1991 C  CB  . ASN C  1 14  ? 52.197  43.836  40.669  1.00 47.57  ? 73  ASN C CB  1 
ATOM   1992 C  CG  . ASN C  1 14  ? 51.919  45.248  41.107  1.00 51.21  ? 73  ASN C CG  1 
ATOM   1993 O  OD1 . ASN C  1 14  ? 50.925  45.864  40.689  1.00 52.74  ? 73  ASN C OD1 1 
ATOM   1994 N  ND2 . ASN C  1 14  ? 52.814  45.788  41.958  1.00 55.94  ? 73  ASN C ND2 1 
ATOM   1995 N  N   . ARG C  1 15  ? 51.233  44.887  38.005  1.00 44.12  ? 74  ARG C N   1 
ATOM   1996 C  CA  . ARG C  1 15  ? 51.588  45.435  36.703  1.00 45.59  ? 74  ARG C CA  1 
ATOM   1997 C  C   . ARG C  1 15  ? 53.049  45.204  36.333  1.00 49.16  ? 74  ARG C C   1 
ATOM   1998 O  O   . ARG C  1 15  ? 53.357  45.032  35.152  1.00 49.54  ? 74  ARG C O   1 
ATOM   1999 C  CB  . ARG C  1 15  ? 51.263  46.927  36.661  1.00 45.99  ? 74  ARG C CB  1 
ATOM   2000 C  CG  . ARG C  1 15  ? 49.795  47.198  36.853  1.00 42.88  ? 74  ARG C CG  1 
ATOM   2001 C  CD  . ARG C  1 15  ? 49.328  48.577  36.437  1.00 42.72  ? 74  ARG C CD  1 
ATOM   2002 N  NE  . ARG C  1 15  ? 47.886  48.688  36.700  1.00 40.36  ? 74  ARG C NE  1 
ATOM   2003 C  CZ  . ARG C  1 15  ? 47.314  49.404  37.663  1.00 39.29  ? 74  ARG C CZ  1 
ATOM   2004 N  NH1 . ARG C  1 15  ? 48.043  50.150  38.488  1.00 43.33  ? 74  ARG C NH1 1 
ATOM   2005 N  NH2 . ARG C  1 15  ? 45.988  49.386  37.787  1.00 36.12  ? 74  ARG C NH2 1 
ATOM   2006 N  N   . ASP C  1 16  ? 53.929  45.207  37.343  1.00 52.08  ? 75  ASP C N   1 
ATOM   2007 C  CA  . ASP C  1 16  ? 55.367  44.905  37.175  1.00 56.32  ? 75  ASP C CA  1 
ATOM   2008 C  C   . ASP C  1 16  ? 55.680  43.459  36.778  1.00 55.48  ? 75  ASP C C   1 
ATOM   2009 O  O   . ASP C  1 16  ? 56.730  43.203  36.223  1.00 57.58  ? 75  ASP C O   1 
ATOM   2010 C  CB  . ASP C  1 16  ? 56.111  45.152  38.487  1.00 59.38  ? 75  ASP C CB  1 
ATOM   2011 C  CG  . ASP C  1 16  ? 56.267  46.627  38.822  1.00 65.00  ? 75  ASP C CG  1 
ATOM   2012 O  OD1 . ASP C  1 16  ? 56.439  47.473  37.896  1.00 70.25  ? 75  ASP C OD1 1 
ATOM   2013 O  OD2 . ASP C  1 16  ? 56.266  46.932  40.042  1.00 70.47  ? 75  ASP C OD2 1 
ATOM   2014 N  N   . GLY C  1 17  ? 54.786  42.525  37.101  1.00 52.39  ? 76  GLY C N   1 
ATOM   2015 C  CA  . GLY C  1 17  ? 55.009  41.101  36.847  1.00 51.95  ? 76  GLY C CA  1 
ATOM   2016 C  C   . GLY C  1 17  ? 55.305  40.324  38.120  1.00 52.07  ? 76  GLY C C   1 
ATOM   2017 O  O   . GLY C  1 17  ? 55.648  39.150  38.076  1.00 51.64  ? 76  GLY C O   1 
ATOM   2018 N  N   . GLU C  1 18  ? 55.128  40.994  39.252  1.00 52.47  ? 77  GLU C N   1 
ATOM   2019 C  CA  . GLU C  1 18  ? 55.582  40.524  40.542  1.00 53.78  ? 77  GLU C CA  1 
ATOM   2020 C  C   . GLU C  1 18  ? 54.384  39.994  41.312  1.00 50.33  ? 77  GLU C C   1 
ATOM   2021 O  O   . GLU C  1 18  ? 53.329  40.622  41.294  1.00 48.54  ? 77  GLU C O   1 
ATOM   2022 C  CB  . GLU C  1 18  ? 56.216  41.721  41.266  1.00 57.48  ? 77  GLU C CB  1 
ATOM   2023 C  CG  . GLU C  1 18  ? 56.263  41.646  42.793  1.00 60.85  ? 77  GLU C CG  1 
ATOM   2024 C  CD  . GLU C  1 18  ? 57.095  42.778  43.431  1.00 67.25  ? 77  GLU C CD  1 
ATOM   2025 O  OE1 . GLU C  1 18  ? 57.447  43.750  42.712  1.00 71.16  ? 77  GLU C OE1 1 
ATOM   2026 O  OE2 . GLU C  1 18  ? 57.390  42.687  44.652  1.00 69.04  ? 77  GLU C OE2 1 
ATOM   2027 N  N   . THR C  1 19  ? 54.524  38.856  41.997  1.00 49.38  ? 78  THR C N   1 
ATOM   2028 C  CA  . THR C  1 19  ? 53.418  38.328  42.784  1.00 46.09  ? 78  THR C CA  1 
ATOM   2029 C  C   . THR C  1 19  ? 53.383  38.915  44.169  1.00 47.09  ? 78  THR C C   1 
ATOM   2030 O  O   . THR C  1 19  ? 54.345  38.844  44.891  1.00 50.56  ? 78  THR C O   1 
ATOM   2031 C  CB  . THR C  1 19  ? 53.474  36.822  42.939  1.00 45.57  ? 78  THR C CB  1 
ATOM   2032 O  OG1 . THR C  1 19  ? 53.168  36.184  41.694  1.00 43.44  ? 78  THR C OG1 1 
ATOM   2033 C  CG2 . THR C  1 19  ? 52.453  36.387  43.967  1.00 44.36  ? 78  THR C CG2 1 
ATOM   2034 N  N   . LEU C  1 20  ? 52.268  39.512  44.539  1.00 45.51  ? 79  LEU C N   1 
ATOM   2035 C  CA  . LEU C  1 20  ? 52.043  39.921  45.918  1.00 47.00  ? 79  LEU C CA  1 
ATOM   2036 C  C   . LEU C  1 20  ? 51.097  38.889  46.554  1.00 45.49  ? 79  LEU C C   1 
ATOM   2037 O  O   . LEU C  1 20  ? 50.067  38.558  45.981  1.00 42.39  ? 79  LEU C O   1 
ATOM   2038 C  CB  . LEU C  1 20  ? 51.433  41.313  45.972  1.00 46.73  ? 79  LEU C CB  1 
ATOM   2039 C  CG  . LEU C  1 20  ? 52.281  42.417  45.348  1.00 49.21  ? 79  LEU C CG  1 
ATOM   2040 C  CD1 . LEU C  1 20  ? 51.495  43.705  45.180  1.00 48.17  ? 79  LEU C CD1 1 
ATOM   2041 C  CD2 . LEU C  1 20  ? 53.492  42.653  46.223  1.00 54.15  ? 79  LEU C CD2 1 
ATOM   2042 N  N   . THR C  1 21  ? 51.461  38.371  47.726  1.00 47.73  ? 80  THR C N   1 
ATOM   2043 C  CA  . THR C  1 21  ? 50.609  37.429  48.435  1.00 46.95  ? 80  THR C CA  1 
ATOM   2044 C  C   . THR C  1 21  ? 50.092  38.095  49.691  1.00 48.78  ? 80  THR C C   1 
ATOM   2045 O  O   . THR C  1 21  ? 50.855  38.684  50.435  1.00 50.67  ? 80  THR C O   1 
ATOM   2046 C  CB  . THR C  1 21  ? 51.348  36.151  48.800  1.00 48.05  ? 80  THR C CB  1 
ATOM   2047 O  OG1 . THR C  1 21  ? 51.900  35.566  47.620  1.00 46.61  ? 80  THR C OG1 1 
ATOM   2048 C  CG2 . THR C  1 21  ? 50.381  35.176  49.396  1.00 47.91  ? 80  THR C CG2 1 
ATOM   2049 N  N   . THR C  1 22  ? 48.780  38.019  49.905  1.00 48.01  ? 81  THR C N   1 
ATOM   2050 C  CA  . THR C  1 22  ? 48.170  38.649  51.068  1.00 50.50  ? 81  THR C CA  1 
ATOM   2051 C  C   . THR C  1 22  ? 46.975  37.851  51.583  1.00 50.32  ? 81  THR C C   1 
ATOM   2052 O  O   . THR C  1 22  ? 46.678  36.789  51.075  1.00 48.82  ? 81  THR C O   1 
ATOM   2053 C  CB  . THR C  1 22  ? 47.763  40.084  50.738  1.00 49.87  ? 81  THR C CB  1 
ATOM   2054 O  OG1 . THR C  1 22  ? 47.561  40.828  51.952  1.00 52.80  ? 81  THR C OG1 1 
ATOM   2055 C  CG2 . THR C  1 22  ? 46.521  40.103  49.841  1.00 46.56  ? 81  THR C CG2 1 
ATOM   2056 N  N   . LYS C  1 23  ? 46.311  38.362  52.605  1.00 53.03  ? 82  LYS C N   1 
ATOM   2057 C  CA  . LYS C  1 23  ? 45.182  37.674  53.204  1.00 54.24  ? 82  LYS C CA  1 
ATOM   2058 C  C   . LYS C  1 23  ? 44.003  38.618  53.406  1.00 54.57  ? 82  LYS C C   1 
ATOM   2059 O  O   . LYS C  1 23  ? 44.172  39.740  53.914  1.00 56.48  ? 82  LYS C O   1 
ATOM   2060 C  CB  . LYS C  1 23  ? 45.585  37.073  54.545  1.00 57.89  ? 82  LYS C CB  1 
ATOM   2061 C  CG  . LYS C  1 23  ? 46.330  35.766  54.412  1.00 59.60  ? 82  LYS C CG  1 
ATOM   2062 C  CD  . LYS C  1 23  ? 47.166  35.495  55.655  1.00 66.35  ? 82  LYS C CD  1 
ATOM   2063 C  CE  . LYS C  1 23  ? 47.851  34.131  55.614  1.00 68.40  ? 82  LYS C CE  1 
ATOM   2064 N  NZ  . LYS C  1 23  ? 47.087  33.059  56.354  1.00 70.04  ? 82  LYS C NZ  1 
ATOM   2065 N  N   . GLY C  1 24  ? 42.815  38.155  53.010  1.00 52.86  ? 83  GLY C N   1 
ATOM   2066 C  CA  . GLY C  1 24  ? 41.575  38.897  53.229  1.00 53.30  ? 83  GLY C CA  1 
ATOM   2067 C  C   . GLY C  1 24  ? 40.571  38.099  54.034  1.00 55.19  ? 83  GLY C C   1 
ATOM   2068 O  O   . GLY C  1 24  ? 40.611  36.879  54.052  1.00 54.92  ? 83  GLY C O   1 
ATOM   2069 N  N   . LYS C  1 25  ? 39.654  38.801  54.686  1.00 57.49  ? 84  LYS C N   1 
ATOM   2070 C  CA  . LYS C  1 25  ? 38.583  38.162  55.451  1.00 60.24  ? 84  LYS C CA  1 
ATOM   2071 C  C   . LYS C  1 25  ? 37.506  37.746  54.453  1.00 57.53  ? 84  LYS C C   1 
ATOM   2072 O  O   . LYS C  1 25  ? 37.431  38.313  53.376  1.00 55.93  ? 84  LYS C O   1 
ATOM   2073 C  CB  . LYS C  1 25  ? 38.035  39.146  56.489  1.00 64.02  ? 84  LYS C CB  1 
ATOM   2074 C  CG  . LYS C  1 25  ? 39.151  39.872  57.283  1.00 67.91  ? 84  LYS C CG  1 
ATOM   2075 C  CD  . LYS C  1 25  ? 38.788  41.288  57.764  1.00 70.84  ? 84  LYS C CD  1 
ATOM   2076 C  CE  . LYS C  1 25  ? 38.869  41.397  59.311  1.00 76.09  ? 84  LYS C CE  1 
ATOM   2077 N  NZ  . LYS C  1 25  ? 39.045  42.809  59.777  1.00 77.53  ? 84  LYS C NZ  1 
ATOM   2078 N  N   . VAL C  1 26  ? 36.691  36.743  54.751  1.00 58.36  ? 85  VAL C N   1 
ATOM   2079 C  CA  . VAL C  1 26  ? 35.598  36.418  53.835  1.00 55.88  ? 85  VAL C CA  1 
ATOM   2080 C  C   . VAL C  1 26  ? 34.640  37.610  53.856  1.00 55.81  ? 85  VAL C C   1 
ATOM   2081 O  O   . VAL C  1 26  ? 34.502  38.269  54.887  1.00 58.40  ? 85  VAL C O   1 
ATOM   2082 C  CB  . VAL C  1 26  ? 34.909  35.086  54.222  1.00 58.19  ? 85  VAL C CB  1 
ATOM   2083 C  CG1 . VAL C  1 26  ? 33.533  34.932  53.546  1.00 57.42  ? 85  VAL C CG1 1 
ATOM   2084 C  CG2 . VAL C  1 26  ? 35.828  33.896  53.855  1.00 56.85  ? 85  VAL C CG2 1 
ATOM   2085 N  N   . GLY C  1 27  ? 34.044  37.936  52.707  1.00 52.47  ? 86  GLY C N   1 
ATOM   2086 C  CA  . GLY C  1 27  ? 33.055  39.028  52.633  1.00 52.68  ? 86  GLY C CA  1 
ATOM   2087 C  C   . GLY C  1 27  ? 33.653  40.358  52.205  1.00 50.84  ? 86  GLY C C   1 
ATOM   2088 O  O   . GLY C  1 27  ? 32.945  41.250  51.731  1.00 50.74  ? 86  GLY C O   1 
ATOM   2089 N  N   . ASP C  1 28  ? 34.958  40.494  52.391  1.00 49.51  ? 87  ASP C N   1 
ATOM   2090 C  CA  . ASP C  1 28  ? 35.689  41.606  51.848  1.00 47.77  ? 87  ASP C CA  1 
ATOM   2091 C  C   . ASP C  1 28  ? 35.681  41.524  50.313  1.00 44.03  ? 87  ASP C C   1 
ATOM   2092 O  O   . ASP C  1 28  ? 35.753  40.430  49.723  1.00 43.13  ? 87  ASP C O   1 
ATOM   2093 C  CB  . ASP C  1 28  ? 37.143  41.575  52.344  1.00 48.36  ? 87  ASP C CB  1 
ATOM   2094 C  CG  . ASP C  1 28  ? 37.299  42.022  53.788  1.00 53.25  ? 87  ASP C CG  1 
ATOM   2095 O  OD1 . ASP C  1 28  ? 36.485  42.848  54.270  1.00 56.15  ? 87  ASP C OD1 1 
ATOM   2096 O  OD2 . ASP C  1 28  ? 38.273  41.559  54.433  1.00 55.82  ? 87  ASP C OD2 1 
ATOM   2097 N  N   . SER C  1 29  ? 35.611  42.683  49.675  1.00 41.95  ? 88  SER C N   1 
ATOM   2098 C  CA  . SER C  1 29  ? 35.789  42.784  48.242  1.00 38.69  ? 88  SER C CA  1 
ATOM   2099 C  C   . SER C  1 29  ? 37.274  42.732  47.967  1.00 37.82  ? 88  SER C C   1 
ATOM   2100 O  O   . SER C  1 29  ? 38.090  42.885  48.861  1.00 39.98  ? 88  SER C O   1 
ATOM   2101 C  CB  . SER C  1 29  ? 35.275  44.135  47.754  1.00 38.43  ? 88  SER C CB  1 
ATOM   2102 O  OG  . SER C  1 29  ? 36.151  45.167  48.208  1.00 39.91  ? 88  SER C OG  1 
ATOM   2103 N  N   . LEU C  1 30  ? 37.658  42.562  46.723  1.00 35.50  ? 89  LEU C N   1 
ATOM   2104 C  CA  . LEU C  1 30  ? 39.067  42.581  46.441  1.00 34.91  ? 89  LEU C CA  1 
ATOM   2105 C  C   . LEU C  1 30  ? 39.642  43.991  46.562  1.00 35.14  ? 89  LEU C C   1 
ATOM   2106 O  O   . LEU C  1 30  ? 40.820  44.131  46.854  1.00 35.68  ? 89  LEU C O   1 
ATOM   2107 C  CB  . LEU C  1 30  ? 39.350  41.955  45.084  1.00 33.26  ? 89  LEU C CB  1 
ATOM   2108 C  CG  . LEU C  1 30  ? 39.376  40.427  45.109  1.00 32.37  ? 89  LEU C CG  1 
ATOM   2109 C  CD1 . LEU C  1 30  ? 39.040  39.894  43.764  1.00 30.19  ? 89  LEU C CD1 1 
ATOM   2110 C  CD2 . LEU C  1 30  ? 40.757  39.934  45.527  1.00 32.44  ? 89  LEU C CD2 1 
ATOM   2111 N  N   . LEU C  1 31  ? 38.821  45.030  46.385  1.00 34.89  ? 90  LEU C N   1 
ATOM   2112 C  CA  . LEU C  1 31  ? 39.277  46.410  46.689  1.00 35.79  ? 90  LEU C CA  1 
ATOM   2113 C  C   . LEU C  1 31  ? 39.638  46.464  48.154  1.00 38.99  ? 90  LEU C C   1 
ATOM   2114 O  O   . LEU C  1 31  ? 40.697  46.956  48.532  1.00 39.83  ? 90  LEU C O   1 
ATOM   2115 C  CB  . LEU C  1 31  ? 38.193  47.448  46.414  1.00 34.96  ? 90  LEU C CB  1 
ATOM   2116 C  CG  . LEU C  1 31  ? 38.476  48.907  46.824  1.00 36.43  ? 90  LEU C CG  1 
ATOM   2117 C  CD1 . LEU C  1 31  ? 39.759  49.465  46.203  1.00 34.61  ? 90  LEU C CD1 1 
ATOM   2118 C  CD2 . LEU C  1 31  ? 37.310  49.832  46.484  1.00 34.19  ? 90  LEU C CD2 1 
ATOM   2119 N  N   . ASP C  1 32  ? 38.745  45.938  48.986  1.00 41.27  ? 91  ASP C N   1 
ATOM   2120 C  CA  . ASP C  1 32  ? 38.971  45.953  50.430  1.00 45.32  ? 91  ASP C CA  1 
ATOM   2121 C  C   . ASP C  1 32  ? 40.358  45.405  50.785  1.00 46.13  ? 91  ASP C C   1 
ATOM   2122 O  O   . ASP C  1 32  ? 41.128  46.035  51.547  1.00 47.98  ? 91  ASP C O   1 
ATOM   2123 C  CB  . ASP C  1 32  ? 37.886  45.144  51.138  1.00 46.72  ? 91  ASP C CB  1 
ATOM   2124 C  CG  . ASP C  1 32  ? 36.580  45.902  51.257  1.00 49.66  ? 91  ASP C CG  1 
ATOM   2125 O  OD1 . ASP C  1 32  ? 36.607  47.134  51.065  1.00 52.08  ? 91  ASP C OD1 1 
ATOM   2126 O  OD2 . ASP C  1 32  ? 35.529  45.274  51.558  1.00 53.10  ? 91  ASP C OD2 1 
ATOM   2127 N  N   . VAL C  1 33  ? 40.652  44.233  50.215  1.00 44.22  ? 92  VAL C N   1 
ATOM   2128 C  CA  . VAL C  1 33  ? 41.925  43.542  50.422  1.00 44.68  ? 92  VAL C CA  1 
ATOM   2129 C  C   . VAL C  1 33  ? 43.093  44.414  50.013  1.00 45.56  ? 92  VAL C C   1 
ATOM   2130 O  O   . VAL C  1 33  ? 43.977  44.684  50.827  1.00 48.86  ? 92  VAL C O   1 
ATOM   2131 C  CB  . VAL C  1 33  ? 42.018  42.253  49.600  1.00 42.03  ? 92  VAL C CB  1 
ATOM   2132 C  CG1 . VAL C  1 33  ? 43.437  41.732  49.630  1.00 42.39  ? 92  VAL C CG1 1 
ATOM   2133 C  CG2 . VAL C  1 33  ? 41.009  41.222  50.095  1.00 40.06  ? 92  VAL C CG2 1 
ATOM   2134 N  N   . VAL C  1 34  ? 43.082  44.853  48.759  1.00 43.40  ? 93  VAL C N   1 
ATOM   2135 C  CA  . VAL C  1 34  ? 44.135  45.705  48.227  1.00 44.22  ? 93  VAL C CA  1 
ATOM   2136 C  C   . VAL C  1 34  ? 44.408  46.881  49.154  1.00 48.14  ? 93  VAL C C   1 
ATOM   2137 O  O   . VAL C  1 34  ? 45.544  47.141  49.519  1.00 50.43  ? 93  VAL C O   1 
ATOM   2138 C  CB  . VAL C  1 34  ? 43.730  46.302  46.852  1.00 42.31  ? 93  VAL C CB  1 
ATOM   2139 C  CG1 . VAL C  1 34  ? 44.642  47.504  46.509  1.00 42.06  ? 93  VAL C CG1 1 
ATOM   2140 C  CG2 . VAL C  1 34  ? 43.711  45.214  45.744  1.00 38.00  ? 93  VAL C CG2 1 
ATOM   2141 N  N   . VAL C  1 35  ? 43.343  47.574  49.532  1.00 49.69  ? 94  VAL C N   1 
ATOM   2142 C  CA  . VAL C  1 35  ? 43.435  48.775  50.347  1.00 53.71  ? 94  VAL C CA  1 
ATOM   2143 C  C   . VAL C  1 35  ? 43.887  48.494  51.767  1.00 58.62  ? 94  VAL C C   1 
ATOM   2144 O  O   . VAL C  1 35  ? 44.831  49.129  52.242  1.00 61.68  ? 94  VAL C O   1 
ATOM   2145 C  CB  . VAL C  1 35  ? 42.091  49.503  50.396  1.00 53.45  ? 94  VAL C CB  1 
ATOM   2146 C  CG1 . VAL C  1 35  ? 42.084  50.561  51.474  1.00 55.31  ? 94  VAL C CG1 1 
ATOM   2147 C  CG2 . VAL C  1 35  ? 41.778  50.089  49.008  1.00 51.04  ? 94  VAL C CG2 1 
ATOM   2148 N  N   . GLU C  1 36  ? 43.226  47.544  52.435  1.00 60.28  ? 95  GLU C N   1 
ATOM   2149 C  CA  . GLU C  1 36  ? 43.531  47.238  53.847  1.00 65.19  ? 95  GLU C CA  1 
ATOM   2150 C  C   . GLU C  1 36  ? 44.962  46.737  54.055  1.00 67.06  ? 95  GLU C C   1 
ATOM   2151 O  O   . GLU C  1 36  ? 45.578  47.053  55.072  1.00 71.02  ? 95  GLU C O   1 
ATOM   2152 C  CB  . GLU C  1 36  ? 42.512  46.252  54.445  1.00 65.72  ? 95  GLU C CB  1 
ATOM   2153 C  CG  . GLU C  1 36  ? 41.119  46.866  54.708  1.00 68.27  ? 95  GLU C CG  1 
ATOM   2154 C  CD  . GLU C  1 36  ? 40.246  46.004  55.618  1.00 74.06  ? 95  GLU C CD  1 
ATOM   2155 O  OE1 . GLU C  1 36  ? 40.464  46.013  56.860  1.00 79.51  ? 95  GLU C OE1 1 
ATOM   2156 O  OE2 . GLU C  1 36  ? 39.329  45.327  55.086  1.00 75.45  ? 95  GLU C OE2 1 
ATOM   2157 N  N   . ASN C  1 37  ? 45.499  45.999  53.083  1.00 65.02  ? 96  ASN C N   1 
ATOM   2158 C  CA  . ASN C  1 37  ? 46.885  45.507  53.164  1.00 66.88  ? 96  ASN C CA  1 
ATOM   2159 C  C   . ASN C  1 37  ? 47.936  46.330  52.372  1.00 67.72  ? 96  ASN C C   1 
ATOM   2160 O  O   . ASN C  1 37  ? 49.055  45.850  52.132  1.00 68.62  ? 96  ASN C O   1 
ATOM   2161 C  CB  . ASN C  1 37  ? 46.942  44.021  52.766  1.00 64.55  ? 96  ASN C CB  1 
ATOM   2162 C  CG  . ASN C  1 37  ? 46.046  43.147  53.638  1.00 64.79  ? 96  ASN C CG  1 
ATOM   2163 O  OD1 . ASN C  1 37  ? 45.171  42.463  53.130  1.00 62.15  ? 96  ASN C OD1 1 
ATOM   2164 N  ND2 . ASN C  1 37  ? 46.263  43.173  54.951  1.00 68.55  ? 96  ASN C ND2 1 
ATOM   2165 N  N   . ASN C  1 38  ? 47.600  47.568  51.989  1.00 67.94  ? 97  ASN C N   1 
ATOM   2166 C  CA  . ASN C  1 38  ? 48.585  48.502  51.412  1.00 69.26  ? 97  ASN C CA  1 
ATOM   2167 C  C   . ASN C  1 38  ? 49.442  47.883  50.325  1.00 67.51  ? 97  ASN C C   1 
ATOM   2168 O  O   . ASN C  1 38  ? 50.655  48.006  50.336  1.00 69.58  ? 97  ASN C O   1 
ATOM   2169 C  CB  . ASN C  1 38  ? 49.517  49.030  52.500  1.00 74.23  ? 97  ASN C CB  1 
ATOM   2170 C  CG  . ASN C  1 38  ? 48.793  49.834  53.535  1.00 77.68  ? 97  ASN C CG  1 
ATOM   2171 O  OD1 . ASN C  1 38  ? 48.119  49.284  54.410  1.00 79.17  ? 97  ASN C OD1 1 
ATOM   2172 N  ND2 . ASN C  1 38  ? 48.931  51.154  53.454  1.00 81.12  ? 97  ASN C ND2 1 
ATOM   2173 N  N   . LEU C  1 39  ? 48.807  47.195  49.392  1.00 64.08  ? 98  LEU C N   1 
ATOM   2174 C  CA  . LEU C  1 39  ? 49.543  46.592  48.291  1.00 62.86  ? 98  LEU C CA  1 
ATOM   2175 C  C   . LEU C  1 39  ? 49.896  47.713  47.326  1.00 63.13  ? 98  LEU C C   1 
ATOM   2176 O  O   . LEU C  1 39  ? 49.024  48.493  46.945  1.00 62.37  ? 98  LEU C O   1 
ATOM   2177 C  CB  . LEU C  1 39  ? 48.696  45.540  47.585  1.00 58.88  ? 98  LEU C CB  1 
ATOM   2178 C  CG  . LEU C  1 39  ? 47.977  44.560  48.513  1.00 58.89  ? 98  LEU C CG  1 
ATOM   2179 C  CD1 . LEU C  1 39  ? 47.383  43.437  47.681  1.00 55.00  ? 98  LEU C CD1 1 
ATOM   2180 C  CD2 . LEU C  1 39  ? 48.906  44.011  49.617  1.00 60.79  ? 98  LEU C CD2 1 
ATOM   2181 N  N   . ASP C  1 40  ? 51.158  47.809  46.933  1.00 64.61  ? 99  ASP C N   1 
ATOM   2182 C  CA  . ASP C  1 40  ? 51.548  48.896  46.060  1.00 65.44  ? 99  ASP C CA  1 
ATOM   2183 C  C   . ASP C  1 40  ? 51.029  48.576  44.654  1.00 61.82  ? 99  ASP C C   1 
ATOM   2184 O  O   . ASP C  1 40  ? 51.628  47.782  43.908  1.00 61.15  ? 99  ASP C O   1 
ATOM   2185 C  CB  . ASP C  1 40  ? 53.070  49.163  46.096  1.00 69.52  ? 99  ASP C CB  1 
ATOM   2186 C  CG  . ASP C  1 40  ? 53.424  50.636  45.813  1.00 72.59  ? 99  ASP C CG  1 
ATOM   2187 O  OD1 . ASP C  1 40  ? 52.514  51.457  45.533  1.00 71.30  ? 99  ASP C OD1 1 
ATOM   2188 O  OD2 . ASP C  1 40  ? 54.625  50.979  45.875  1.00 77.78  ? 99  ASP C OD2 1 
ATOM   2189 N  N   . ILE C  1 41  ? 49.869  49.161  44.341  1.00 59.29  ? 100 ILE C N   1 
ATOM   2190 C  CA  . ILE C  1 41  ? 49.233  49.040  43.034  1.00 56.04  ? 100 ILE C CA  1 
ATOM   2191 C  C   . ILE C  1 41  ? 48.763  50.449  42.703  1.00 56.42  ? 100 ILE C C   1 
ATOM   2192 O  O   . ILE C  1 41  ? 47.803  50.920  43.286  1.00 56.51  ? 100 ILE C O   1 
ATOM   2193 C  CB  . ILE C  1 41  ? 48.014  48.071  43.081  1.00 52.70  ? 100 ILE C CB  1 
ATOM   2194 C  CG1 . ILE C  1 41  ? 48.428  46.687  43.590  1.00 51.79  ? 100 ILE C CG1 1 
ATOM   2195 C  CG2 . ILE C  1 41  ? 47.361  47.946  41.692  1.00 50.17  ? 100 ILE C CG2 1 
ATOM   2196 C  CD1 . ILE C  1 41  ? 47.310  45.935  44.280  1.00 49.50  ? 100 ILE C CD1 1 
ATOM   2197 N  N   . ASP C  1 42  ? 49.447  51.140  41.804  1.00 57.43  ? 101 ASP C N   1 
ATOM   2198 C  CA  . ASP C  1 42  ? 49.163  52.563  41.585  1.00 58.35  ? 101 ASP C CA  1 
ATOM   2199 C  C   . ASP C  1 42  ? 47.733  52.788  41.075  1.00 54.70  ? 101 ASP C C   1 
ATOM   2200 O  O   . ASP C  1 42  ? 47.256  52.062  40.206  1.00 53.26  ? 101 ASP C O   1 
ATOM   2201 C  CB  . ASP C  1 42  ? 50.184  53.190  40.619  1.00 60.93  ? 101 ASP C CB  1 
ATOM   2202 C  CG  . ASP C  1 42  ? 51.611  53.209  41.192  1.00 66.30  ? 101 ASP C CG  1 
ATOM   2203 O  OD1 . ASP C  1 42  ? 51.878  52.467  42.182  1.00 68.02  ? 101 ASP C OD1 1 
ATOM   2204 O  OD2 . ASP C  1 42  ? 52.463  53.965  40.652  1.00 69.66  ? 101 ASP C OD2 1 
ATOM   2205 N  N   . GLY C  1 43  ? 47.043  53.774  41.644  1.00 53.87  ? 102 GLY C N   1 
ATOM   2206 C  CA  . GLY C  1 43  ? 45.728  54.203  41.152  1.00 50.74  ? 102 GLY C CA  1 
ATOM   2207 C  C   . GLY C  1 43  ? 44.516  53.323  41.479  1.00 47.06  ? 102 GLY C C   1 
ATOM   2208 O  O   . GLY C  1 43  ? 43.380  53.763  41.293  1.00 46.25  ? 102 GLY C O   1 
ATOM   2209 N  N   . PHE C  1 44  ? 44.736  52.113  41.993  1.00 44.45  ? 103 PHE C N   1 
ATOM   2210 C  CA  . PHE C  1 44  ? 43.679  51.104  42.096  1.00 41.00  ? 103 PHE C CA  1 
ATOM   2211 C  C   . PHE C  1 44  ? 42.516  51.506  43.008  1.00 40.61  ? 103 PHE C C   1 
ATOM   2212 O  O   . PHE C  1 44  ? 42.657  51.591  44.208  1.00 42.68  ? 103 PHE C O   1 
ATOM   2213 C  CB  . PHE C  1 44  ? 44.324  49.809  42.592  1.00 40.70  ? 103 PHE C CB  1 
ATOM   2214 C  CG  . PHE C  1 44  ? 43.458  48.586  42.485  1.00 35.91  ? 103 PHE C CG  1 
ATOM   2215 C  CD1 . PHE C  1 44  ? 43.438  47.838  41.316  1.00 33.32  ? 103 PHE C CD1 1 
ATOM   2216 C  CD2 . PHE C  1 44  ? 42.731  48.146  43.565  1.00 34.81  ? 103 PHE C CD2 1 
ATOM   2217 C  CE1 . PHE C  1 44  ? 42.684  46.684  41.214  1.00 32.17  ? 103 PHE C CE1 1 
ATOM   2218 C  CE2 . PHE C  1 44  ? 41.941  47.002  43.468  1.00 34.37  ? 103 PHE C CE2 1 
ATOM   2219 C  CZ  . PHE C  1 44  ? 41.918  46.265  42.299  1.00 31.37  ? 103 PHE C CZ  1 
ATOM   2220 N  N   . GLY C  1 45  ? 41.353  51.759  42.442  1.00 39.04  ? 104 GLY C N   1 
ATOM   2221 C  CA  . GLY C  1 45  ? 40.155  52.004  43.256  1.00 38.52  ? 104 GLY C CA  1 
ATOM   2222 C  C   . GLY C  1 45  ? 39.901  53.465  43.561  1.00 39.59  ? 104 GLY C C   1 
ATOM   2223 O  O   . GLY C  1 45  ? 39.558  53.808  44.669  1.00 40.87  ? 104 GLY C O   1 
ATOM   2224 N  N   . ALA C  1 46  ? 40.069  54.319  42.557  1.00 39.49  ? 105 ALA C N   1 
ATOM   2225 C  CA  . ALA C  1 46  ? 39.798  55.738  42.670  1.00 40.83  ? 105 ALA C CA  1 
ATOM   2226 C  C   . ALA C  1 46  ? 38.431  56.084  43.279  1.00 41.58  ? 105 ALA C C   1 
ATOM   2227 O  O   . ALA C  1 46  ? 38.359  56.877  44.214  1.00 44.31  ? 105 ALA C O   1 
ATOM   2228 C  CB  . ALA C  1 46  ? 39.913  56.359  41.331  1.00 40.56  ? 105 ALA C CB  1 
ATOM   2229 N  N   . CYS C  1 47  ? 37.343  55.491  42.802  1.00 40.35  ? 106 CYS C N   1 
ATOM   2230 C  CA  . CYS C  1 47  ? 36.010  55.886  43.303  1.00 41.75  ? 106 CYS C CA  1 
ATOM   2231 C  C   . CYS C  1 47  ? 35.632  55.263  44.650  1.00 42.93  ? 106 CYS C C   1 
ATOM   2232 O  O   . CYS C  1 47  ? 34.503  55.431  45.117  1.00 43.06  ? 106 CYS C O   1 
ATOM   2233 C  CB  . CYS C  1 47  ? 34.913  55.617  42.269  1.00 40.13  ? 106 CYS C CB  1 
ATOM   2234 S  SG  . CYS C  1 47  ? 34.499  53.928  42.061  1.00 40.89  ? 106 CYS C SG  1 
ATOM   2235 N  N   . GLU C  1 48  ? 36.587  54.548  45.249  1.00 43.79  ? 107 GLU C N   1 
ATOM   2236 C  CA  . GLU C  1 48  ? 36.445  53.935  46.566  1.00 45.75  ? 107 GLU C CA  1 
ATOM   2237 C  C   . GLU C  1 48  ? 35.300  52.927  46.595  1.00 44.76  ? 107 GLU C C   1 
ATOM   2238 O  O   . GLU C  1 48  ? 34.659  52.712  47.622  1.00 45.71  ? 107 GLU C O   1 
ATOM   2239 C  CB  . GLU C  1 48  ? 36.275  55.002  47.650  1.00 49.04  ? 107 GLU C CB  1 
ATOM   2240 C  CG  . GLU C  1 48  ? 37.389  56.036  47.656  1.00 52.20  ? 107 GLU C CG  1 
ATOM   2241 C  CD  . GLU C  1 48  ? 37.268  57.037  48.790  1.00 57.49  ? 107 GLU C CD  1 
ATOM   2242 O  OE1 . GLU C  1 48  ? 37.289  58.256  48.506  1.00 60.57  ? 107 GLU C OE1 1 
ATOM   2243 O  OE2 . GLU C  1 48  ? 37.148  56.609  49.958  1.00 60.62  ? 107 GLU C OE2 1 
ATOM   2244 N  N   . GLY C  1 49  ? 35.056  52.319  45.447  1.00 42.77  ? 108 GLY C N   1 
ATOM   2245 C  CA  . GLY C  1 49  ? 34.165  51.173  45.370  1.00 42.14  ? 108 GLY C CA  1 
ATOM   2246 C  C   . GLY C  1 49  ? 32.714  51.576  45.296  1.00 42.73  ? 108 GLY C C   1 
ATOM   2247 O  O   . GLY C  1 49  ? 31.889  50.950  45.916  1.00 42.92  ? 108 GLY C O   1 
ATOM   2248 N  N   . THR C  1 50  ? 32.419  52.614  44.516  1.00 42.91  ? 109 THR C N   1 
ATOM   2249 C  CA  . THR C  1 50  ? 31.045  53.085  44.303  1.00 43.82  ? 109 THR C CA  1 
ATOM   2250 C  C   . THR C  1 50  ? 30.615  52.915  42.846  1.00 42.33  ? 109 THR C C   1 
ATOM   2251 O  O   . THR C  1 50  ? 29.730  53.637  42.380  1.00 43.56  ? 109 THR C O   1 
ATOM   2252 C  CB  . THR C  1 50  ? 30.911  54.593  44.670  1.00 45.66  ? 109 THR C CB  1 
ATOM   2253 O  OG1 . THR C  1 50  ? 31.909  55.341  43.961  1.00 45.58  ? 109 THR C OG1 1 
ATOM   2254 C  CG2 . THR C  1 50  ? 31.106  54.822  46.160  1.00 47.02  ? 109 THR C CG2 1 
ATOM   2255 N  N   . LEU C  1 51  ? 31.233  51.962  42.139  1.00 40.31  ? 110 LEU C N   1 
ATOM   2256 C  CA  . LEU C  1 51  ? 30.948  51.683  40.722  1.00 38.90  ? 110 LEU C CA  1 
ATOM   2257 C  C   . LEU C  1 51  ? 30.847  52.967  39.939  1.00 39.73  ? 110 LEU C C   1 
ATOM   2258 O  O   . LEU C  1 51  ? 29.775  53.412  39.511  1.00 40.77  ? 110 LEU C O   1 
ATOM   2259 C  CB  . LEU C  1 51  ? 29.682  50.857  40.548  1.00 39.10  ? 110 LEU C CB  1 
ATOM   2260 C  CG  . LEU C  1 51  ? 29.849  49.346  40.478  1.00 38.46  ? 110 LEU C CG  1 
ATOM   2261 C  CD1 . LEU C  1 51  ? 28.511  48.723  40.129  1.00 38.07  ? 110 LEU C CD1 1 
ATOM   2262 C  CD2 . LEU C  1 51  ? 30.909  48.916  39.470  1.00 36.34  ? 110 LEU C CD2 1 
ATOM   2263 N  N   . ALA C  1 52  ? 31.992  53.595  39.806  1.00 39.75  ? 111 ALA C N   1 
ATOM   2264 C  CA  . ALA C  1 52  ? 32.068  54.838  39.110  1.00 40.17  ? 111 ALA C CA  1 
ATOM   2265 C  C   . ALA C  1 52  ? 33.454  55.110  38.618  1.00 39.72  ? 111 ALA C C   1 
ATOM   2266 O  O   . ALA C  1 52  ? 33.764  56.249  38.337  1.00 42.88  ? 111 ALA C O   1 
ATOM   2267 C  CB  . ALA C  1 52  ? 31.606  55.952  40.001  1.00 41.38  ? 111 ALA C CB  1 
ATOM   2268 N  N   . CYS C  1 53  ? 34.291  54.102  38.519  1.00 37.68  ? 112 CYS C N   1 
ATOM   2269 C  CA  . CYS C  1 53  ? 35.569  54.258  37.886  1.00 37.95  ? 112 CYS C CA  1 
ATOM   2270 C  C   . CYS C  1 53  ? 35.818  52.923  37.227  1.00 36.82  ? 112 CYS C C   1 
ATOM   2271 O  O   . CYS C  1 53  ? 34.968  52.014  37.316  1.00 36.54  ? 112 CYS C O   1 
ATOM   2272 C  CB  . CYS C  1 53  ? 36.646  54.591  38.937  1.00 38.95  ? 112 CYS C CB  1 
ATOM   2273 S  SG  . CYS C  1 53  ? 37.094  53.262  40.071  1.00 39.50  ? 112 CYS C SG  1 
ATOM   2274 N  N   . SER C  1 54  ? 36.941  52.743  36.573  1.00 36.32  ? 113 SER C N   1 
ATOM   2275 C  CA  . SER C  1 54  ? 37.211  51.387  36.136  1.00 36.53  ? 113 SER C CA  1 
ATOM   2276 C  C   . SER C  1 54  ? 38.552  50.884  36.655  1.00 36.69  ? 113 SER C C   1 
ATOM   2277 O  O   . SER C  1 54  ? 39.028  49.835  36.266  1.00 36.67  ? 113 SER C O   1 
ATOM   2278 C  CB  . SER C  1 54  ? 37.103  51.295  34.626  1.00 37.31  ? 113 SER C CB  1 
ATOM   2279 O  OG  . SER C  1 54  ? 35.844  51.818  34.189  1.00 40.54  ? 113 SER C OG  1 
ATOM   2280 N  N   . THR C  1 55  ? 39.099  51.604  37.619  1.00 32.60  ? 114 THR C N   1 
ATOM   2281 C  CA  . THR C  1 55  ? 40.453  51.431  38.048  1.00 32.55  ? 114 THR C CA  1 
ATOM   2282 C  C   . THR C  1 55  ? 40.659  50.149  38.831  1.00 33.58  ? 114 THR C C   1 
ATOM   2283 O  O   . THR C  1 55  ? 41.808  49.740  38.970  1.00 34.54  ? 114 THR C O   1 
ATOM   2284 C  CB  . THR C  1 55  ? 40.904  52.634  38.904  1.00 34.46  ? 114 THR C CB  1 
ATOM   2285 O  OG1 . THR C  1 55  ? 40.226  52.629  40.171  1.00 36.49  ? 114 THR C OG1 1 
ATOM   2286 C  CG2 . THR C  1 55  ? 40.618  53.946  38.188  1.00 32.40  ? 114 THR C CG2 1 
ATOM   2287 N  N   . CYS C  1 56  ? 39.580  49.507  39.317  1.00 33.61  ? 115 CYS C N   1 
ATOM   2288 C  CA  . CYS C  1 56  ? 39.687  48.255  40.108  1.00 33.99  ? 115 CYS C CA  1 
ATOM   2289 C  C   . CYS C  1 56  ? 39.617  47.005  39.263  1.00 31.80  ? 115 CYS C C   1 
ATOM   2290 O  O   . CYS C  1 56  ? 39.364  45.917  39.759  1.00 31.58  ? 115 CYS C O   1 
ATOM   2291 C  CB  . CYS C  1 56  ? 38.599  48.173  41.215  1.00 36.50  ? 115 CYS C CB  1 
ATOM   2292 S  SG  . CYS C  1 56  ? 36.852  48.121  40.692  1.00 37.52  ? 115 CYS C SG  1 
ATOM   2293 N  N   . HIS C  1 57  ? 39.851  47.179  37.976  1.00 29.95  ? 116 HIS C N   1 
ATOM   2294 C  CA  . HIS C  1 57  ? 39.796  46.123  37.016  1.00 28.23  ? 116 HIS C CA  1 
ATOM   2295 C  C   . HIS C  1 57  ? 40.718  44.999  37.470  1.00 29.03  ? 116 HIS C C   1 
ATOM   2296 O  O   . HIS C  1 57  ? 41.836  45.247  37.900  1.00 30.38  ? 116 HIS C O   1 
ATOM   2297 C  CB  . HIS C  1 57  ? 40.252  46.733  35.691  1.00 27.03  ? 116 HIS C CB  1 
ATOM   2298 C  CG  . HIS C  1 57  ? 40.263  45.793  34.528  1.00 24.39  ? 116 HIS C CG  1 
ATOM   2299 N  ND1 . HIS C  1 57  ? 40.837  46.131  33.325  1.00 23.48  ? 116 HIS C ND1 1 
ATOM   2300 C  CD2 . HIS C  1 57  ? 39.783  44.540  34.375  1.00 27.07  ? 116 HIS C CD2 1 
ATOM   2301 C  CE1 . HIS C  1 57  ? 40.714  45.129  32.475  1.00 26.34  ? 116 HIS C CE1 1 
ATOM   2302 N  NE2 . HIS C  1 57  ? 40.079  44.145  33.089  1.00 29.21  ? 116 HIS C NE2 1 
ATOM   2303 N  N   . LEU C  1 58  ? 40.264  43.758  37.399  1.00 28.47  ? 117 LEU C N   1 
ATOM   2304 C  CA  . LEU C  1 58  ? 41.188  42.655  37.638  1.00 28.33  ? 117 LEU C CA  1 
ATOM   2305 C  C   . LEU C  1 58  ? 40.904  41.512  36.717  1.00 27.17  ? 117 LEU C C   1 
ATOM   2306 O  O   . LEU C  1 58  ? 39.793  41.367  36.247  1.00 27.36  ? 117 LEU C O   1 
ATOM   2307 C  CB  . LEU C  1 58  ? 41.049  42.181  39.076  1.00 29.80  ? 117 LEU C CB  1 
ATOM   2308 C  CG  . LEU C  1 58  ? 41.754  42.976  40.159  1.00 30.12  ? 117 LEU C CG  1 
ATOM   2309 C  CD1 . LEU C  1 58  ? 41.350  42.456  41.532  1.00 28.12  ? 117 LEU C CD1 1 
ATOM   2310 C  CD2 . LEU C  1 58  ? 43.251  42.841  39.912  1.00 29.96  ? 117 LEU C CD2 1 
ATOM   2311 N  N   . ILE C  1 59  ? 41.900  40.684  36.473  1.00 27.02  ? 118 ILE C N   1 
ATOM   2312 C  CA  . ILE C  1 59  ? 41.706  39.468  35.680  1.00 26.79  ? 118 ILE C CA  1 
ATOM   2313 C  C   . ILE C  1 59  ? 41.744  38.184  36.521  1.00 27.20  ? 118 ILE C C   1 
ATOM   2314 O  O   . ILE C  1 59  ? 42.644  37.995  37.306  1.00 28.74  ? 118 ILE C O   1 
ATOM   2315 C  CB  . ILE C  1 59  ? 42.771  39.383  34.642  1.00 26.95  ? 118 ILE C CB  1 
ATOM   2316 C  CG1 . ILE C  1 59  ? 42.823  40.721  33.894  1.00 26.70  ? 118 ILE C CG1 1 
ATOM   2317 C  CG2 . ILE C  1 59  ? 42.474  38.234  33.702  1.00 26.81  ? 118 ILE C CG2 1 
ATOM   2318 C  CD1 . ILE C  1 59  ? 43.586  40.690  32.583  1.00 25.54  ? 118 ILE C CD1 1 
ATOM   2319 N  N   . PHE C  1 60  ? 40.776  37.297  36.336  1.00 27.25  ? 119 PHE C N   1 
ATOM   2320 C  CA  . PHE C  1 60  ? 40.617  36.121  37.169  1.00 27.60  ? 119 PHE C CA  1 
ATOM   2321 C  C   . PHE C  1 60  ? 40.944  34.853  36.446  1.00 28.69  ? 119 PHE C C   1 
ATOM   2322 O  O   . PHE C  1 60  ? 40.967  34.819  35.223  1.00 28.76  ? 119 PHE C O   1 
ATOM   2323 C  CB  . PHE C  1 60  ? 39.188  36.048  37.685  1.00 27.72  ? 119 PHE C CB  1 
ATOM   2324 C  CG  . PHE C  1 60  ? 38.804  37.212  38.555  1.00 27.18  ? 119 PHE C CG  1 
ATOM   2325 C  CD1 . PHE C  1 60  ? 38.835  37.108  39.935  1.00 29.69  ? 119 PHE C CD1 1 
ATOM   2326 C  CD2 . PHE C  1 60  ? 38.450  38.423  37.992  1.00 27.10  ? 119 PHE C CD2 1 
ATOM   2327 C  CE1 . PHE C  1 60  ? 38.485  38.206  40.753  1.00 30.80  ? 119 PHE C CE1 1 
ATOM   2328 C  CE2 . PHE C  1 60  ? 38.090  39.511  38.792  1.00 27.37  ? 119 PHE C CE2 1 
ATOM   2329 C  CZ  . PHE C  1 60  ? 38.124  39.403  40.174  1.00 29.26  ? 119 PHE C CZ  1 
ATOM   2330 N  N   . GLU C  1 61  ? 41.211  33.801  37.215  1.00 30.88  ? 120 GLU C N   1 
ATOM   2331 C  CA  . GLU C  1 61  ? 41.406  32.451  36.655  1.00 32.75  ? 120 GLU C CA  1 
ATOM   2332 C  C   . GLU C  1 61  ? 40.094  31.825  36.133  1.00 32.68  ? 120 GLU C C   1 
ATOM   2333 O  O   . GLU C  1 61  ? 39.041  31.984  36.717  1.00 32.02  ? 120 GLU C O   1 
ATOM   2334 C  CB  . GLU C  1 61  ? 42.025  31.520  37.701  1.00 34.74  ? 120 GLU C CB  1 
ATOM   2335 C  CG  . GLU C  1 61  ? 43.408  31.916  38.201  1.00 37.24  ? 120 GLU C CG  1 
ATOM   2336 C  CD  . GLU C  1 61  ? 43.888  31.049  39.377  1.00 41.43  ? 120 GLU C CD  1 
ATOM   2337 O  OE1 . GLU C  1 61  ? 44.550  30.013  39.118  1.00 45.96  ? 120 GLU C OE1 1 
ATOM   2338 O  OE2 . GLU C  1 61  ? 43.625  31.412  40.554  1.00 42.71  ? 120 GLU C OE2 1 
ATOM   2339 N  N   . ASP C  1 62  ? 40.193  31.091  35.042  1.00 33.69  ? 121 ASP C N   1 
ATOM   2340 C  CA  . ASP C  1 62  ? 39.038  30.544  34.359  1.00 34.49  ? 121 ASP C CA  1 
ATOM   2341 C  C   . ASP C  1 62  ? 37.943  30.028  35.294  1.00 34.11  ? 121 ASP C C   1 
ATOM   2342 O  O   . ASP C  1 62  ? 36.791  30.421  35.224  1.00 33.96  ? 121 ASP C O   1 
ATOM   2343 C  CB  . ASP C  1 62  ? 39.487  29.363  33.519  1.00 36.57  ? 121 ASP C CB  1 
ATOM   2344 C  CG  . ASP C  1 62  ? 40.491  29.725  32.463  1.00 39.82  ? 121 ASP C CG  1 
ATOM   2345 O  OD1 . ASP C  1 62  ? 41.352  28.857  32.192  1.00 46.35  ? 121 ASP C OD1 1 
ATOM   2346 O  OD2 . ASP C  1 62  ? 40.427  30.842  31.883  1.00 44.73  ? 121 ASP C OD2 1 
ATOM   2347 N  N   . HIS C  1 63  ? 38.319  29.119  36.173  1.00 34.74  ? 122 HIS C N   1 
ATOM   2348 C  CA  . HIS C  1 63  ? 37.358  28.427  37.010  1.00 34.56  ? 122 HIS C CA  1 
ATOM   2349 C  C   . HIS C  1 63  ? 36.719  29.330  38.030  1.00 32.68  ? 122 HIS C C   1 
ATOM   2350 O  O   . HIS C  1 63  ? 35.525  29.227  38.283  1.00 34.24  ? 122 HIS C O   1 
ATOM   2351 C  CB  . HIS C  1 63  ? 37.953  27.161  37.642  1.00 36.05  ? 122 HIS C CB  1 
ATOM   2352 C  CG  . HIS C  1 63  ? 39.157  27.398  38.505  1.00 38.98  ? 122 HIS C CG  1 
ATOM   2353 N  ND1 . HIS C  1 63  ? 40.413  27.635  37.984  1.00 41.44  ? 122 HIS C ND1 1 
ATOM   2354 C  CD2 . HIS C  1 63  ? 39.305  27.403  39.853  1.00 39.08  ? 122 HIS C CD2 1 
ATOM   2355 C  CE1 . HIS C  1 63  ? 41.275  27.795  38.976  1.00 41.12  ? 122 HIS C CE1 1 
ATOM   2356 N  NE2 . HIS C  1 63  ? 40.627  27.660  40.117  1.00 38.64  ? 122 HIS C NE2 1 
ATOM   2357 N  N   . ILE C  1 64  ? 37.479  30.247  38.578  1.00 30.43  ? 123 ILE C N   1 
ATOM   2358 C  CA  . ILE C  1 64  ? 36.929  31.196  39.520  1.00 30.00  ? 123 ILE C CA  1 
ATOM   2359 C  C   . ILE C  1 64  ? 35.993  32.170  38.860  1.00 29.35  ? 123 ILE C C   1 
ATOM   2360 O  O   . ILE C  1 64  ? 34.994  32.561  39.423  1.00 30.37  ? 123 ILE C O   1 
ATOM   2361 C  CB  . ILE C  1 64  ? 38.041  32.036  40.149  1.00 29.54  ? 123 ILE C CB  1 
ATOM   2362 C  CG1 . ILE C  1 64  ? 38.998  31.130  40.943  1.00 31.08  ? 123 ILE C CG1 1 
ATOM   2363 C  CG2 . ILE C  1 64  ? 37.437  33.090  41.060  1.00 29.56  ? 123 ILE C CG2 1 
ATOM   2364 C  CD1 . ILE C  1 64  ? 38.369  30.380  42.102  1.00 27.28  ? 123 ILE C CD1 1 
ATOM   2365 N  N   . TYR C  1 65  ? 36.360  32.595  37.662  1.00 28.65  ? 124 TYR C N   1 
ATOM   2366 C  CA  . TYR C  1 65  ? 35.613  33.587  36.911  1.00 28.02  ? 124 TYR C CA  1 
ATOM   2367 C  C   . TYR C  1 65  ? 34.209  33.154  36.669  1.00 28.81  ? 124 TYR C C   1 
ATOM   2368 O  O   . TYR C  1 65  ? 33.261  33.900  36.895  1.00 27.19  ? 124 TYR C O   1 
ATOM   2369 C  CB  . TYR C  1 65  ? 36.266  33.794  35.561  1.00 27.08  ? 124 TYR C CB  1 
ATOM   2370 C  CG  . TYR C  1 65  ? 35.508  34.715  34.659  1.00 26.36  ? 124 TYR C CG  1 
ATOM   2371 C  CD1 . TYR C  1 65  ? 35.537  36.085  34.834  1.00 24.58  ? 124 TYR C CD1 1 
ATOM   2372 C  CD2 . TYR C  1 65  ? 34.785  34.216  33.601  1.00 27.57  ? 124 TYR C CD2 1 
ATOM   2373 C  CE1 . TYR C  1 65  ? 34.831  36.908  33.982  1.00 25.22  ? 124 TYR C CE1 1 
ATOM   2374 C  CE2 . TYR C  1 65  ? 34.099  35.022  32.763  1.00 25.70  ? 124 TYR C CE2 1 
ATOM   2375 C  CZ  . TYR C  1 65  ? 34.119  36.351  32.938  1.00 25.62  ? 124 TYR C CZ  1 
ATOM   2376 O  OH  . TYR C  1 65  ? 33.423  37.120  32.037  1.00 27.09  ? 124 TYR C OH  1 
ATOM   2377 N  N   . GLU C  1 66  ? 34.116  31.915  36.212  1.00 30.73  ? 125 GLU C N   1 
ATOM   2378 C  CA  . GLU C  1 66  ? 32.860  31.331  35.802  1.00 33.11  ? 125 GLU C CA  1 
ATOM   2379 C  C   . GLU C  1 66  ? 31.818  31.330  36.909  1.00 34.28  ? 125 GLU C C   1 
ATOM   2380 O  O   . GLU C  1 66  ? 30.665  31.539  36.603  1.00 35.37  ? 125 GLU C O   1 
ATOM   2381 C  CB  . GLU C  1 66  ? 33.097  29.915  35.281  1.00 34.50  ? 125 GLU C CB  1 
ATOM   2382 C  CG  . GLU C  1 66  ? 31.861  29.206  34.803  1.00 37.03  ? 125 GLU C CG  1 
ATOM   2383 C  CD  . GLU C  1 66  ? 32.129  27.771  34.385  1.00 40.74  ? 125 GLU C CD  1 
ATOM   2384 O  OE1 . GLU C  1 66  ? 31.401  27.301  33.475  1.00 43.94  ? 125 GLU C OE1 1 
ATOM   2385 O  OE2 . GLU C  1 66  ? 33.056  27.123  34.953  1.00 39.34  ? 125 GLU C OE2 1 
ATOM   2386 N  N   . LYS C  1 67  ? 32.214  31.126  38.172  1.00 34.49  ? 126 LYS C N   1 
ATOM   2387 C  CA  . LYS C  1 67  ? 31.238  31.066  39.268  1.00 35.92  ? 126 LYS C CA  1 
ATOM   2388 C  C   . LYS C  1 67  ? 31.154  32.381  40.093  1.00 35.51  ? 126 LYS C C   1 
ATOM   2389 O  O   . LYS C  1 67  ? 30.687  32.399  41.231  1.00 36.39  ? 126 LYS C O   1 
ATOM   2390 C  CB  . LYS C  1 67  ? 31.488  29.854  40.199  1.00 37.11  ? 126 LYS C CB  1 
ATOM   2391 C  CG  . LYS C  1 67  ? 31.705  28.420  39.548  1.00 39.74  ? 126 LYS C CG  1 
ATOM   2392 C  CD  . LYS C  1 67  ? 30.432  27.565  39.393  1.00 45.32  ? 126 LYS C CD  1 
ATOM   2393 C  CE  . LYS C  1 67  ? 30.708  26.011  39.407  1.00 49.34  ? 126 LYS C CE  1 
ATOM   2394 N  NZ  . LYS C  1 67  ? 31.822  25.459  38.446  1.00 48.82  ? 126 LYS C NZ  1 
ATOM   2395 N  N   . LEU C  1 68  ? 31.563  33.502  39.531  1.00 34.33  ? 127 LEU C N   1 
ATOM   2396 C  CA  . LEU C  1 68  ? 31.417  34.761  40.277  1.00 34.48  ? 127 LEU C CA  1 
ATOM   2397 C  C   . LEU C  1 68  ? 29.988  35.241  40.250  1.00 35.50  ? 127 LEU C C   1 
ATOM   2398 O  O   . LEU C  1 68  ? 29.230  34.850  39.407  1.00 35.72  ? 127 LEU C O   1 
ATOM   2399 C  CB  . LEU C  1 68  ? 32.335  35.858  39.713  1.00 33.07  ? 127 LEU C CB  1 
ATOM   2400 C  CG  . LEU C  1 68  ? 33.839  35.647  39.943  1.00 31.88  ? 127 LEU C CG  1 
ATOM   2401 C  CD1 . LEU C  1 68  ? 34.696  36.662  39.165  1.00 25.76  ? 127 LEU C CD1 1 
ATOM   2402 C  CD2 . LEU C  1 68  ? 34.117  35.689  41.470  1.00 30.86  ? 127 LEU C CD2 1 
ATOM   2403 N  N   . ASP C  1 69  ? 29.634  36.130  41.163  1.00 36.97  ? 128 ASP C N   1 
ATOM   2404 C  CA  . ASP C  1 69  ? 28.275  36.663  41.215  1.00 39.05  ? 128 ASP C CA  1 
ATOM   2405 C  C   . ASP C  1 69  ? 27.907  37.226  39.846  1.00 38.29  ? 128 ASP C C   1 
ATOM   2406 O  O   . ASP C  1 69  ? 28.698  37.893  39.202  1.00 37.03  ? 128 ASP C O   1 
ATOM   2407 C  CB  . ASP C  1 69  ? 28.151  37.720  42.332  1.00 40.37  ? 128 ASP C CB  1 
ATOM   2408 C  CG  . ASP C  1 69  ? 28.173  37.104  43.755  1.00 44.24  ? 128 ASP C CG  1 
ATOM   2409 O  OD1 . ASP C  1 69  ? 28.376  35.862  43.878  1.00 46.41  ? 128 ASP C OD1 1 
ATOM   2410 O  OD2 . ASP C  1 69  ? 27.967  37.852  44.757  1.00 47.80  ? 128 ASP C OD2 1 
ATOM   2411 N  N   . ALA C  1 70  ? 26.723  36.920  39.368  1.00 40.20  ? 129 ALA C N   1 
ATOM   2412 C  CA  . ALA C  1 70  ? 26.338  37.329  38.017  1.00 40.54  ? 129 ALA C CA  1 
ATOM   2413 C  C   . ALA C  1 70  ? 26.523  38.835  37.899  1.00 40.20  ? 129 ALA C C   1 
ATOM   2414 O  O   . ALA C  1 70  ? 26.109  39.553  38.805  1.00 42.02  ? 129 ALA C O   1 
ATOM   2415 C  CB  . ALA C  1 70  ? 24.880  36.952  37.744  1.00 42.48  ? 129 ALA C CB  1 
ATOM   2416 N  N   . ILE C  1 71  ? 27.139  39.320  36.810  1.00 38.43  ? 130 ILE C N   1 
ATOM   2417 C  CA  . ILE C  1 71  ? 27.391  40.756  36.679  1.00 37.45  ? 130 ILE C CA  1 
ATOM   2418 C  C   . ILE C  1 71  ? 26.113  41.577  36.559  1.00 40.08  ? 130 ILE C C   1 
ATOM   2419 O  O   . ILE C  1 71  ? 25.197  41.214  35.803  1.00 41.17  ? 130 ILE C O   1 
ATOM   2420 C  CB  . ILE C  1 71  ? 28.270  41.081  35.489  1.00 35.68  ? 130 ILE C CB  1 
ATOM   2421 C  CG1 . ILE C  1 71  ? 28.876  42.492  35.660  1.00 35.72  ? 130 ILE C CG1 1 
ATOM   2422 C  CG2 . ILE C  1 71  ? 27.488  40.985  34.209  1.00 34.64  ? 130 ILE C CG2 1 
ATOM   2423 C  CD1 . ILE C  1 71  ? 30.073  42.788  34.715  1.00 32.97  ? 130 ILE C CD1 1 
ATOM   2424 N  N   . THR C  1 72  ? 26.066  42.685  37.298  1.00 40.69  ? 131 THR C N   1 
ATOM   2425 C  CA  . THR C  1 72  ? 24.952  43.623  37.223  1.00 42.98  ? 131 THR C CA  1 
ATOM   2426 C  C   . THR C  1 72  ? 25.176  44.620  36.116  1.00 42.28  ? 131 THR C C   1 
ATOM   2427 O  O   . THR C  1 72  ? 26.275  44.768  35.652  1.00 40.42  ? 131 THR C O   1 
ATOM   2428 C  CB  . THR C  1 72  ? 24.796  44.409  38.532  1.00 44.48  ? 131 THR C CB  1 
ATOM   2429 O  OG1 . THR C  1 72  ? 25.952  45.248  38.739  1.00 42.93  ? 131 THR C OG1 1 
ATOM   2430 C  CG2 . THR C  1 72  ? 24.620  43.445  39.696  1.00 44.05  ? 131 THR C CG2 1 
ATOM   2431 N  N   . ASP C  1 73  ? 24.141  45.359  35.743  1.00 45.27  ? 132 ASP C N   1 
ATOM   2432 C  CA  . ASP C  1 73  ? 24.258  46.382  34.687  1.00 45.25  ? 132 ASP C CA  1 
ATOM   2433 C  C   . ASP C  1 73  ? 25.133  47.558  35.080  1.00 43.68  ? 132 ASP C C   1 
ATOM   2434 O  O   . ASP C  1 73  ? 25.845  48.109  34.238  1.00 41.07  ? 132 ASP C O   1 
ATOM   2435 C  CB  . ASP C  1 73  ? 22.884  46.939  34.338  1.00 48.62  ? 132 ASP C CB  1 
ATOM   2436 C  CG  . ASP C  1 73  ? 22.129  46.074  33.361  1.00 52.38  ? 132 ASP C CG  1 
ATOM   2437 O  OD1 . ASP C  1 73  ? 22.635  44.982  33.001  1.00 53.03  ? 132 ASP C OD1 1 
ATOM   2438 O  OD2 . ASP C  1 73  ? 21.016  46.506  32.954  1.00 59.07  ? 132 ASP C OD2 1 
ATOM   2439 N  N   . GLU C  1 74  ? 25.015  47.944  36.353  1.00 44.93  ? 133 GLU C N   1 
ATOM   2440 C  CA  . GLU C  1 74  ? 25.780  49.025  36.957  1.00 44.80  ? 133 GLU C CA  1 
ATOM   2441 C  C   . GLU C  1 74  ? 27.241  48.647  36.895  1.00 41.55  ? 133 GLU C C   1 
ATOM   2442 O  O   . GLU C  1 74  ? 28.076  49.426  36.425  1.00 40.22  ? 133 GLU C O   1 
ATOM   2443 C  CB  . GLU C  1 74  ? 25.353  49.238  38.405  1.00 47.99  ? 133 GLU C CB  1 
ATOM   2444 C  CG  . GLU C  1 74  ? 25.266  50.691  38.843  1.00 53.42  ? 133 GLU C CG  1 
ATOM   2445 C  CD  . GLU C  1 74  ? 25.335  50.866  40.390  1.00 59.94  ? 133 GLU C CD  1 
ATOM   2446 O  OE1 . GLU C  1 74  ? 24.960  49.920  41.133  1.00 61.64  ? 133 GLU C OE1 1 
ATOM   2447 O  OE2 . GLU C  1 74  ? 25.776  51.961  40.847  1.00 63.78  ? 133 GLU C OE2 1 
ATOM   2448 N  N   . GLU C  1 75  ? 27.557  47.422  37.296  1.00 40.32  ? 134 GLU C N   1 
ATOM   2449 C  CA  . GLU C  1 75  ? 28.913  46.949  37.125  1.00 37.53  ? 134 GLU C CA  1 
ATOM   2450 C  C   . GLU C  1 75  ? 29.293  46.901  35.655  1.00 35.61  ? 134 GLU C C   1 
ATOM   2451 O  O   . GLU C  1 75  ? 30.391  47.311  35.271  1.00 33.32  ? 134 GLU C O   1 
ATOM   2452 C  CB  . GLU C  1 75  ? 29.154  45.568  37.750  1.00 37.35  ? 134 GLU C CB  1 
ATOM   2453 C  CG  . GLU C  1 75  ? 30.646  45.166  37.597  1.00 34.86  ? 134 GLU C CG  1 
ATOM   2454 C  CD  . GLU C  1 75  ? 31.032  43.854  38.203  1.00 34.13  ? 134 GLU C CD  1 
ATOM   2455 O  OE1 . GLU C  1 75  ? 30.269  43.316  39.041  1.00 33.20  ? 134 GLU C OE1 1 
ATOM   2456 O  OE2 . GLU C  1 75  ? 32.141  43.386  37.830  1.00 31.59  ? 134 GLU C OE2 1 
ATOM   2457 N  N   . ASN C  1 76  ? 28.405  46.360  34.832  1.00 36.48  ? 135 ASN C N   1 
ATOM   2458 C  CA  . ASN C  1 76  ? 28.734  46.195  33.413  1.00 35.52  ? 135 ASN C CA  1 
ATOM   2459 C  C   . ASN C  1 76  ? 29.030  47.517  32.697  1.00 34.43  ? 135 ASN C C   1 
ATOM   2460 O  O   . ASN C  1 76  ? 29.983  47.603  31.983  1.00 33.41  ? 135 ASN C O   1 
ATOM   2461 C  CB  . ASN C  1 76  ? 27.657  45.400  32.699  1.00 36.89  ? 135 ASN C CB  1 
ATOM   2462 C  CG  . ASN C  1 76  ? 28.141  44.844  31.401  1.00 37.71  ? 135 ASN C CG  1 
ATOM   2463 O  OD1 . ASN C  1 76  ? 29.081  44.057  31.357  1.00 39.31  ? 135 ASN C OD1 1 
ATOM   2464 N  ND2 . ASN C  1 76  ? 27.529  45.273  30.321  1.00 41.02  ? 135 ASN C ND2 1 
ATOM   2465 N  N   . ASP C  1 77  ? 28.239  48.550  32.941  1.00 36.14  ? 136 ASP C N   1 
ATOM   2466 C  CA  . ASP C  1 77  ? 28.464  49.867  32.365  1.00 36.31  ? 136 ASP C CA  1 
ATOM   2467 C  C   . ASP C  1 77  ? 29.896  50.371  32.606  1.00 34.54  ? 136 ASP C C   1 
ATOM   2468 O  O   . ASP C  1 77  ? 30.533  50.953  31.712  1.00 33.46  ? 136 ASP C O   1 
ATOM   2469 C  CB  . ASP C  1 77  ? 27.462  50.873  32.950  1.00 39.12  ? 136 ASP C CB  1 
ATOM   2470 C  CG  . ASP C  1 77  ? 26.014  50.709  32.386  1.00 43.93  ? 136 ASP C CG  1 
ATOM   2471 O  OD1 . ASP C  1 77  ? 25.714  49.712  31.674  1.00 47.17  ? 136 ASP C OD1 1 
ATOM   2472 O  OD2 . ASP C  1 77  ? 25.161  51.592  32.674  1.00 46.80  ? 136 ASP C OD2 1 
ATOM   2473 N  N   . MET C  1 78  ? 30.423  50.134  33.803  1.00 34.09  ? 137 MET C N   1 
ATOM   2474 C  CA  . MET C  1 78  ? 31.767  50.584  34.135  1.00 32.60  ? 137 MET C CA  1 
ATOM   2475 C  C   . MET C  1 78  ? 32.839  49.608  33.745  1.00 30.36  ? 137 MET C C   1 
ATOM   2476 O  O   . MET C  1 78  ? 33.926  50.021  33.407  1.00 30.19  ? 137 MET C O   1 
ATOM   2477 C  CB  . MET C  1 78  ? 31.879  50.904  35.601  1.00 34.19  ? 137 MET C CB  1 
ATOM   2478 C  CG  . MET C  1 78  ? 30.879  51.931  36.055  1.00 37.53  ? 137 MET C CG  1 
ATOM   2479 S  SD  . MET C  1 78  ? 31.399  53.584  35.614  1.00 41.65  ? 137 MET C SD  1 
ATOM   2480 C  CE  . MET C  1 78  ? 30.964  53.779  33.877  1.00 40.21  ? 137 MET C CE  1 
ATOM   2481 N  N   . LEU C  1 79  ? 32.563  48.324  33.770  1.00 29.83  ? 138 LEU C N   1 
ATOM   2482 C  CA  . LEU C  1 79  ? 33.519  47.372  33.246  1.00 28.93  ? 138 LEU C CA  1 
ATOM   2483 C  C   . LEU C  1 79  ? 33.793  47.588  31.735  1.00 29.30  ? 138 LEU C C   1 
ATOM   2484 O  O   . LEU C  1 79  ? 34.928  47.393  31.267  1.00 28.33  ? 138 LEU C O   1 
ATOM   2485 C  CB  . LEU C  1 79  ? 33.002  45.961  33.483  1.00 28.77  ? 138 LEU C CB  1 
ATOM   2486 C  CG  . LEU C  1 79  ? 33.847  44.779  33.036  1.00 26.82  ? 138 LEU C CG  1 
ATOM   2487 C  CD1 . LEU C  1 79  ? 35.257  44.814  33.656  1.00 21.09  ? 138 LEU C CD1 1 
ATOM   2488 C  CD2 . LEU C  1 79  ? 33.042  43.473  33.364  1.00 23.52  ? 138 LEU C CD2 1 
ATOM   2489 N  N   . ASP C  1 80  ? 32.757  47.962  30.977  1.00 30.58  ? 139 ASP C N   1 
ATOM   2490 C  CA  . ASP C  1 80  ? 32.916  48.269  29.551  1.00 31.17  ? 139 ASP C CA  1 
ATOM   2491 C  C   . ASP C  1 80  ? 33.931  49.354  29.315  1.00 29.00  ? 139 ASP C C   1 
ATOM   2492 O  O   . ASP C  1 80  ? 34.429  49.468  28.224  1.00 29.06  ? 139 ASP C O   1 
ATOM   2493 C  CB  . ASP C  1 80  ? 31.604  48.801  28.940  1.00 33.71  ? 139 ASP C CB  1 
ATOM   2494 C  CG  . ASP C  1 80  ? 30.802  47.746  28.170  1.00 39.40  ? 139 ASP C CG  1 
ATOM   2495 O  OD1 . ASP C  1 80  ? 31.225  46.549  28.082  1.00 45.25  ? 139 ASP C OD1 1 
ATOM   2496 O  OD2 . ASP C  1 80  ? 29.712  48.136  27.661  1.00 44.49  ? 139 ASP C OD2 1 
ATOM   2497 N  N   . LEU C  1 81  ? 34.154  50.214  30.300  1.00 27.96  ? 140 LEU C N   1 
ATOM   2498 C  CA  . LEU C  1 81  ? 35.079  51.314  30.148  1.00 26.53  ? 140 LEU C CA  1 
ATOM   2499 C  C   . LEU C  1 81  ? 36.502  50.978  30.646  1.00 25.90  ? 140 LEU C C   1 
ATOM   2500 O  O   . LEU C  1 81  ? 37.356  51.816  30.667  1.00 25.73  ? 140 LEU C O   1 
ATOM   2501 C  CB  . LEU C  1 81  ? 34.534  52.571  30.823  1.00 27.39  ? 140 LEU C CB  1 
ATOM   2502 C  CG  . LEU C  1 81  ? 33.290  53.229  30.191  1.00 26.63  ? 140 LEU C CG  1 
ATOM   2503 C  CD1 . LEU C  1 81  ? 32.845  54.357  31.002  1.00 21.28  ? 140 LEU C CD1 1 
ATOM   2504 C  CD2 . LEU C  1 81  ? 33.534  53.688  28.766  1.00 26.75  ? 140 LEU C CD2 1 
ATOM   2505 N  N   . ALA C  1 82  ? 36.757  49.729  30.997  1.00 25.82  ? 141 ALA C N   1 
ATOM   2506 C  CA  . ALA C  1 82  ? 38.061  49.294  31.439  1.00 24.91  ? 141 ALA C CA  1 
ATOM   2507 C  C   . ALA C  1 82  ? 38.987  49.146  30.248  1.00 24.49  ? 141 ALA C C   1 
ATOM   2508 O  O   . ALA C  1 82  ? 38.601  48.582  29.220  1.00 25.09  ? 141 ALA C O   1 
ATOM   2509 C  CB  . ALA C  1 82  ? 37.931  47.972  32.177  1.00 24.24  ? 141 ALA C CB  1 
ATOM   2510 N  N   . TYR C  1 83  ? 40.234  49.579  30.423  1.00 24.88  ? 142 TYR C N   1 
ATOM   2511 C  CA  . TYR C  1 83  ? 41.235  49.543  29.361  1.00 24.17  ? 142 TYR C CA  1 
ATOM   2512 C  C   . TYR C  1 83  ? 41.817  48.165  29.322  1.00 23.85  ? 142 TYR C C   1 
ATOM   2513 O  O   . TYR C  1 83  ? 42.300  47.649  30.321  1.00 24.20  ? 142 TYR C O   1 
ATOM   2514 C  CB  . TYR C  1 83  ? 42.357  50.598  29.567  1.00 25.07  ? 142 TYR C CB  1 
ATOM   2515 C  CG  . TYR C  1 83  ? 43.428  50.529  28.479  1.00 25.19  ? 142 TYR C CG  1 
ATOM   2516 C  CD1 . TYR C  1 83  ? 43.226  51.151  27.252  1.00 24.97  ? 142 TYR C CD1 1 
ATOM   2517 C  CD2 . TYR C  1 83  ? 44.590  49.777  28.651  1.00 23.74  ? 142 TYR C CD2 1 
ATOM   2518 C  CE1 . TYR C  1 83  ? 44.158  51.071  26.250  1.00 25.44  ? 142 TYR C CE1 1 
ATOM   2519 C  CE2 . TYR C  1 83  ? 45.523  49.683  27.654  1.00 25.34  ? 142 TYR C CE2 1 
ATOM   2520 C  CZ  . TYR C  1 83  ? 45.301  50.334  26.448  1.00 26.59  ? 142 TYR C CZ  1 
ATOM   2521 O  OH  . TYR C  1 83  ? 46.197  50.259  25.416  1.00 29.57  ? 142 TYR C OH  1 
ATOM   2522 N  N   . GLY C  1 84  ? 41.812  47.586  28.137  1.00 24.29  ? 143 GLY C N   1 
ATOM   2523 C  CA  . GLY C  1 84  ? 42.184  46.201  27.950  1.00 24.49  ? 143 GLY C CA  1 
ATOM   2524 C  C   . GLY C  1 84  ? 41.178  45.258  28.559  1.00 24.49  ? 143 GLY C C   1 
ATOM   2525 O  O   . GLY C  1 84  ? 41.556  44.323  29.232  1.00 26.73  ? 143 GLY C O   1 
ATOM   2526 N  N   . LEU C  1 85  ? 39.898  45.505  28.370  1.00 23.74  ? 144 LEU C N   1 
ATOM   2527 C  CA  . LEU C  1 85  ? 38.899  44.572  28.873  1.00 24.26  ? 144 LEU C CA  1 
ATOM   2528 C  C   . LEU C  1 85  ? 39.176  43.179  28.370  1.00 24.70  ? 144 LEU C C   1 
ATOM   2529 O  O   . LEU C  1 85  ? 39.535  43.019  27.186  1.00 26.61  ? 144 LEU C O   1 
ATOM   2530 C  CB  . LEU C  1 85  ? 37.526  44.980  28.394  1.00 24.30  ? 144 LEU C CB  1 
ATOM   2531 C  CG  . LEU C  1 85  ? 36.366  44.175  28.922  1.00 24.38  ? 144 LEU C CG  1 
ATOM   2532 C  CD1 . LEU C  1 85  ? 36.347  44.255  30.415  1.00 20.28  ? 144 LEU C CD1 1 
ATOM   2533 C  CD2 . LEU C  1 85  ? 35.083  44.758  28.281  1.00 21.85  ? 144 LEU C CD2 1 
ATOM   2534 N  N   . THR C  1 86  ? 39.018  42.173  29.235  1.00 23.71  ? 145 THR C N   1 
ATOM   2535 C  CA  . THR C  1 86  ? 39.177  40.782  28.797  1.00 23.17  ? 145 THR C CA  1 
ATOM   2536 C  C   . THR C  1 86  ? 37.936  39.955  29.041  1.00 23.06  ? 145 THR C C   1 
ATOM   2537 O  O   . THR C  1 86  ? 36.981  40.384  29.670  1.00 22.43  ? 145 THR C O   1 
ATOM   2538 C  CB  . THR C  1 86  ? 40.326  40.058  29.545  1.00 23.91  ? 145 THR C CB  1 
ATOM   2539 O  OG1 . THR C  1 86  ? 39.891  39.736  30.882  1.00 22.41  ? 145 THR C OG1 1 
ATOM   2540 C  CG2 . THR C  1 86  ? 41.645  40.908  29.509  1.00 19.99  ? 145 THR C CG2 1 
ATOM   2541 N  N   . ASP C  1 87  ? 37.984  38.728  28.567  1.00 23.39  ? 146 ASP C N   1 
ATOM   2542 C  CA  . ASP C  1 87  ? 36.889  37.813  28.769  1.00 23.94  ? 146 ASP C CA  1 
ATOM   2543 C  C   . ASP C  1 87  ? 37.068  37.105  30.098  1.00 23.72  ? 146 ASP C C   1 
ATOM   2544 O  O   . ASP C  1 87  ? 36.447  36.101  30.336  1.00 24.37  ? 146 ASP C O   1 
ATOM   2545 C  CB  . ASP C  1 87  ? 36.732  36.859  27.580  1.00 24.60  ? 146 ASP C CB  1 
ATOM   2546 C  CG  . ASP C  1 87  ? 37.965  36.018  27.321  1.00 26.61  ? 146 ASP C CG  1 
ATOM   2547 O  OD1 . ASP C  1 87  ? 38.068  35.383  26.225  1.00 27.78  ? 146 ASP C OD1 1 
ATOM   2548 O  OD2 . ASP C  1 87  ? 38.839  35.980  28.211  1.00 27.09  ? 146 ASP C OD2 1 
ATOM   2549 N  N   . ARG C  1 88  ? 37.921  37.658  30.965  1.00 23.32  ? 147 ARG C N   1 
ATOM   2550 C  CA  . ARG C  1 88  ? 38.100  37.162  32.323  1.00 23.73  ? 147 ARG C CA  1 
ATOM   2551 C  C   . ARG C  1 88  ? 38.181  38.329  33.313  1.00 23.76  ? 147 ARG C C   1 
ATOM   2552 O  O   . ARG C  1 88  ? 38.658  38.163  34.455  1.00 23.68  ? 147 ARG C O   1 
ATOM   2553 C  CB  . ARG C  1 88  ? 39.360  36.292  32.415  1.00 24.45  ? 147 ARG C CB  1 
ATOM   2554 C  CG  . ARG C  1 88  ? 39.355  35.041  31.516  1.00 24.49  ? 147 ARG C CG  1 
ATOM   2555 C  CD  . ARG C  1 88  ? 38.460  33.940  32.126  1.00 25.45  ? 147 ARG C CD  1 
ATOM   2556 N  NE  . ARG C  1 88  ? 38.536  32.698  31.364  1.00 25.48  ? 147 ARG C NE  1 
ATOM   2557 C  CZ  . ARG C  1 88  ? 37.854  32.454  30.249  1.00 25.67  ? 147 ARG C CZ  1 
ATOM   2558 N  NH1 . ARG C  1 88  ? 36.983  33.321  29.762  1.00 26.84  ? 147 ARG C NH1 1 
ATOM   2559 N  NH2 . ARG C  1 88  ? 38.022  31.321  29.628  1.00 28.56  ? 147 ARG C NH2 1 
ATOM   2560 N  N   . SER C  1 89  ? 37.665  39.490  32.888  1.00 23.24  ? 148 SER C N   1 
ATOM   2561 C  CA  . SER C  1 89  ? 37.745  40.722  33.659  1.00 23.17  ? 148 SER C CA  1 
ATOM   2562 C  C   . SER C  1 89  ? 36.498  40.990  34.506  1.00 23.92  ? 148 SER C C   1 
ATOM   2563 O  O   . SER C  1 89  ? 35.377  40.745  34.088  1.00 24.64  ? 148 SER C O   1 
ATOM   2564 C  CB  . SER C  1 89  ? 37.976  41.937  32.720  1.00 22.97  ? 148 SER C CB  1 
ATOM   2565 O  OG  . SER C  1 89  ? 39.165  41.847  31.942  1.00 22.53  ? 148 SER C OG  1 
ATOM   2566 N  N   . ARG C  1 90  ? 36.716  41.520  35.701  1.00 24.19  ? 149 ARG C N   1 
ATOM   2567 C  CA  . ARG C  1 90  ? 35.655  42.081  36.507  1.00 25.67  ? 149 ARG C CA  1 
ATOM   2568 C  C   . ARG C  1 90  ? 36.227  43.238  37.296  1.00 25.77  ? 149 ARG C C   1 
ATOM   2569 O  O   . ARG C  1 90  ? 37.445  43.443  37.358  1.00 25.53  ? 149 ARG C O   1 
ATOM   2570 C  CB  . ARG C  1 90  ? 35.024  41.075  37.518  1.00 27.01  ? 149 ARG C CB  1 
ATOM   2571 C  CG  . ARG C  1 90  ? 34.339  39.820  36.924  1.00 27.98  ? 149 ARG C CG  1 
ATOM   2572 C  CD  . ARG C  1 90  ? 33.040  40.146  36.211  1.00 29.75  ? 149 ARG C CD  1 
ATOM   2573 N  NE  . ARG C  1 90  ? 32.022  40.576  37.156  1.00 31.23  ? 149 ARG C NE  1 
ATOM   2574 C  CZ  . ARG C  1 90  ? 31.175  39.782  37.794  1.00 32.49  ? 149 ARG C CZ  1 
ATOM   2575 N  NH1 . ARG C  1 90  ? 31.163  38.461  37.587  1.00 33.89  ? 149 ARG C NH1 1 
ATOM   2576 N  NH2 . ARG C  1 90  ? 30.318  40.327  38.644  1.00 33.74  ? 149 ARG C NH2 1 
ATOM   2577 N  N   . LEU C  1 91  ? 35.318  43.972  37.916  1.00 26.48  ? 150 LEU C N   1 
ATOM   2578 C  CA  . LEU C  1 91  ? 35.677  45.061  38.755  1.00 27.46  ? 150 LEU C CA  1 
ATOM   2579 C  C   . LEU C  1 91  ? 35.877  44.470  40.155  1.00 28.37  ? 150 LEU C C   1 
ATOM   2580 O  O   . LEU C  1 91  ? 34.943  44.027  40.784  1.00 29.47  ? 150 LEU C O   1 
ATOM   2581 C  CB  . LEU C  1 91  ? 34.615  46.181  38.657  1.00 27.85  ? 150 LEU C CB  1 
ATOM   2582 C  CG  . LEU C  1 91  ? 34.508  46.766  37.223  1.00 25.95  ? 150 LEU C CG  1 
ATOM   2583 C  CD1 . LEU C  1 91  ? 33.565  47.975  37.122  1.00 25.61  ? 150 LEU C CD1 1 
ATOM   2584 C  CD2 . LEU C  1 91  ? 35.832  47.152  36.672  1.00 22.73  ? 150 LEU C CD2 1 
ATOM   2585 N  N   . GLY C  1 92  ? 37.120  44.447  40.613  1.00 28.93  ? 151 GLY C N   1 
ATOM   2586 C  CA  . GLY C  1 92  ? 37.492  43.820  41.895  1.00 31.05  ? 151 GLY C CA  1 
ATOM   2587 C  C   . GLY C  1 92  ? 36.698  44.261  43.104  1.00 33.19  ? 151 GLY C C   1 
ATOM   2588 O  O   . GLY C  1 92  ? 36.575  43.572  44.123  1.00 34.93  ? 151 GLY C O   1 
ATOM   2589 N  N   . CYS C  1 93  ? 36.084  45.394  42.964  1.00 34.57  ? 152 CYS C N   1 
ATOM   2590 C  CA  . CYS C  1 93  ? 35.418  45.983  44.096  1.00 38.19  ? 152 CYS C CA  1 
ATOM   2591 C  C   . CYS C  1 93  ? 33.994  45.502  44.291  1.00 38.90  ? 152 CYS C C   1 
ATOM   2592 O  O   . CYS C  1 93  ? 33.377  45.779  45.304  1.00 40.49  ? 152 CYS C O   1 
ATOM   2593 C  CB  . CYS C  1 93  ? 35.503  47.500  44.003  1.00 39.09  ? 152 CYS C CB  1 
ATOM   2594 S  SG  . CYS C  1 93  ? 34.404  48.373  42.767  1.00 42.11  ? 152 CYS C SG  1 
ATOM   2595 N  N   . GLN C  1 94  ? 33.496  44.763  43.311  1.00 38.07  ? 153 GLN C N   1 
ATOM   2596 C  CA  . GLN C  1 94  ? 32.201  44.096  43.371  1.00 38.89  ? 153 GLN C CA  1 
ATOM   2597 C  C   . GLN C  1 94  ? 32.400  42.591  43.550  1.00 38.11  ? 153 GLN C C   1 
ATOM   2598 O  O   . GLN C  1 94  ? 31.436  41.869  43.688  1.00 38.81  ? 153 GLN C O   1 
ATOM   2599 C  CB  . GLN C  1 94  ? 31.399  44.361  42.071  1.00 38.32  ? 153 GLN C CB  1 
ATOM   2600 C  CG  . GLN C  1 94  ? 31.136  45.822  41.767  1.00 38.62  ? 153 GLN C CG  1 
ATOM   2601 C  CD  . GLN C  1 94  ? 30.346  46.475  42.875  1.00 42.22  ? 153 GLN C CD  1 
ATOM   2602 O  OE1 . GLN C  1 94  ? 29.414  45.887  43.367  1.00 44.57  ? 153 GLN C OE1 1 
ATOM   2603 N  NE2 . GLN C  1 94  ? 30.723  47.682  43.282  1.00 43.38  ? 153 GLN C NE2 1 
ATOM   2604 N  N   . ILE C  1 95  ? 33.640  42.109  43.549  1.00 37.36  ? 154 ILE C N   1 
ATOM   2605 C  CA  . ILE C  1 95  ? 33.885  40.662  43.716  1.00 37.11  ? 154 ILE C CA  1 
ATOM   2606 C  C   . ILE C  1 95  ? 34.346  40.370  45.130  1.00 39.14  ? 154 ILE C C   1 
ATOM   2607 O  O   . ILE C  1 95  ? 35.437  40.759  45.513  1.00 39.67  ? 154 ILE C O   1 
ATOM   2608 C  CB  . ILE C  1 95  ? 34.930  40.123  42.744  1.00 34.68  ? 154 ILE C CB  1 
ATOM   2609 C  CG1 . ILE C  1 95  ? 34.505  40.407  41.304  1.00 32.49  ? 154 ILE C CG1 1 
ATOM   2610 C  CG2 . ILE C  1 95  ? 35.145  38.655  43.000  1.00 33.57  ? 154 ILE C CG2 1 
ATOM   2611 C  CD1 . ILE C  1 95  ? 33.228  39.691  40.854  1.00 31.64  ? 154 ILE C CD1 1 
ATOM   2612 N  N   . CYS C  1 96  ? 33.500  39.686  45.888  1.00 41.11  ? 155 CYS C N   1 
ATOM   2613 C  CA  . CYS C  1 96  ? 33.776  39.373  47.273  1.00 43.70  ? 155 CYS C CA  1 
ATOM   2614 C  C   . CYS C  1 96  ? 34.340  37.982  47.506  1.00 42.34  ? 155 CYS C C   1 
ATOM   2615 O  O   . CYS C  1 96  ? 33.970  37.011  46.840  1.00 40.66  ? 155 CYS C O   1 
ATOM   2616 C  CB  . CYS C  1 96  ? 32.513  39.559  48.112  1.00 46.58  ? 155 CYS C CB  1 
ATOM   2617 S  SG  . CYS C  1 96  ? 32.032  41.320  48.258  1.00 53.54  ? 155 CYS C SG  1 
ATOM   2618 N  N   . LEU C  1 97  ? 35.232  37.927  48.490  1.00 42.97  ? 156 LEU C N   1 
ATOM   2619 C  CA  . LEU C  1 97  ? 35.909  36.710  48.905  1.00 42.88  ? 156 LEU C CA  1 
ATOM   2620 C  C   . LEU C  1 97  ? 34.982  35.690  49.563  1.00 43.57  ? 156 LEU C C   1 
ATOM   2621 O  O   . LEU C  1 97  ? 34.230  35.979  50.510  1.00 45.63  ? 156 LEU C O   1 
ATOM   2622 C  CB  . LEU C  1 97  ? 37.037  37.043  49.888  1.00 44.53  ? 156 LEU C CB  1 
ATOM   2623 C  CG  . LEU C  1 97  ? 38.218  37.858  49.359  1.00 43.40  ? 156 LEU C CG  1 
ATOM   2624 C  CD1 . LEU C  1 97  ? 39.231  38.015  50.464  1.00 44.46  ? 156 LEU C CD1 1 
ATOM   2625 C  CD2 . LEU C  1 97  ? 38.840  37.148  48.204  1.00 40.23  ? 156 LEU C CD2 1 
ATOM   2626 N  N   . THR C  1 98  ? 35.058  34.483  49.032  1.00 42.27  ? 157 THR C N   1 
ATOM   2627 C  CA  . THR C  1 98  ? 34.394  33.331  49.588  1.00 42.82  ? 157 THR C CA  1 
ATOM   2628 C  C   . THR C  1 98  ? 35.477  32.355  50.082  1.00 43.48  ? 157 THR C C   1 
ATOM   2629 O  O   . THR C  1 98  ? 36.628  32.436  49.701  1.00 43.24  ? 157 THR C O   1 
ATOM   2630 C  CB  . THR C  1 98  ? 33.512  32.658  48.509  1.00 41.57  ? 157 THR C CB  1 
ATOM   2631 O  OG1 . THR C  1 98  ? 34.345  32.140  47.479  1.00 39.15  ? 157 THR C OG1 1 
ATOM   2632 C  CG2 . THR C  1 98  ? 32.490  33.618  47.937  1.00 37.66  ? 157 THR C CG2 1 
ATOM   2633 N  N   . LYS C  1 99  ? 35.126  31.433  50.944  1.00 45.59  ? 158 LYS C N   1 
ATOM   2634 C  CA  . LYS C  1 99  ? 36.112  30.476  51.416  1.00 46.68  ? 158 LYS C CA  1 
ATOM   2635 C  C   . LYS C  1 99  ? 36.749  29.757  50.236  1.00 44.86  ? 158 LYS C C   1 
ATOM   2636 O  O   . LYS C  1 99  ? 37.929  29.452  50.262  1.00 44.43  ? 158 LYS C O   1 
ATOM   2637 C  CB  . LYS C  1 99  ? 35.477  29.466  52.373  1.00 48.63  ? 158 LYS C CB  1 
ATOM   2638 C  CG  . LYS C  1 99  ? 34.904  30.068  53.648  1.00 52.72  ? 158 LYS C CG  1 
ATOM   2639 C  CD  . LYS C  1 99  ? 34.117  28.994  54.452  1.00 57.30  ? 158 LYS C CD  1 
ATOM   2640 C  CE  . LYS C  1 99  ? 33.527  29.507  55.759  1.00 60.21  ? 158 LYS C CE  1 
ATOM   2641 N  NZ  . LYS C  1 99  ? 32.621  28.474  56.362  1.00 62.64  ? 158 LYS C NZ  1 
ATOM   2642 N  N   . SER C  1 100 ? 35.967  29.527  49.187  1.00 44.07  ? 159 SER C N   1 
ATOM   2643 C  CA  . SER C  1 100 ? 36.394  28.712  48.068  1.00 43.21  ? 159 SER C CA  1 
ATOM   2644 C  C   . SER C  1 100 ? 37.462  29.376  47.217  1.00 42.31  ? 159 SER C C   1 
ATOM   2645 O  O   . SER C  1 100 ? 38.035  28.735  46.322  1.00 41.61  ? 159 SER C O   1 
ATOM   2646 C  CB  . SER C  1 100 ? 35.188  28.434  47.179  1.00 43.16  ? 159 SER C CB  1 
ATOM   2647 O  OG  . SER C  1 100 ? 34.802  29.616  46.477  1.00 43.76  ? 159 SER C OG  1 
ATOM   2648 N  N   . MET C  1 101 ? 37.699  30.668  47.456  1.00 42.19  ? 160 MET C N   1 
ATOM   2649 C  CA  . MET C  1 101 ? 38.679  31.424  46.688  1.00 41.35  ? 160 MET C CA  1 
ATOM   2650 C  C   . MET C  1 101 ? 40.115  31.311  47.237  1.00 41.81  ? 160 MET C C   1 
ATOM   2651 O  O   . MET C  1 101 ? 41.070  31.799  46.613  1.00 41.54  ? 160 MET C O   1 
ATOM   2652 C  CB  . MET C  1 101 ? 38.257  32.892  46.619  1.00 41.11  ? 160 MET C CB  1 
ATOM   2653 C  CG  . MET C  1 101 ? 37.091  33.130  45.703  1.00 42.03  ? 160 MET C CG  1 
ATOM   2654 S  SD  . MET C  1 101 ? 36.577  34.868  45.678  1.00 45.21  ? 160 MET C SD  1 
ATOM   2655 C  CE  . MET C  1 101 ? 34.947  34.699  44.933  1.00 45.27  ? 160 MET C CE  1 
ATOM   2656 N  N   . ASP C  1 102 ? 40.258  30.684  48.398  1.00 42.74  ? 161 ASP C N   1 
ATOM   2657 C  CA  . ASP C  1 102 ? 41.544  30.529  49.064  1.00 43.57  ? 161 ASP C CA  1 
ATOM   2658 C  C   . ASP C  1 102 ? 42.618  30.096  48.078  1.00 42.13  ? 161 ASP C C   1 
ATOM   2659 O  O   . ASP C  1 102 ? 42.414  29.124  47.353  1.00 41.47  ? 161 ASP C O   1 
ATOM   2660 C  CB  . ASP C  1 102 ? 41.423  29.468  50.167  1.00 45.31  ? 161 ASP C CB  1 
ATOM   2661 C  CG  . ASP C  1 102 ? 42.518  29.565  51.223  1.00 48.18  ? 161 ASP C CG  1 
ATOM   2662 O  OD1 . ASP C  1 102 ? 43.192  30.613  51.349  1.00 50.58  ? 161 ASP C OD1 1 
ATOM   2663 O  OD2 . ASP C  1 102 ? 42.691  28.581  51.964  1.00 53.28  ? 161 ASP C OD2 1 
ATOM   2664 N  N   . ASN C  1 103 ? 43.739  30.828  48.059  1.00 41.71  ? 162 ASN C N   1 
ATOM   2665 C  CA  . ASN C  1 103 ? 44.906  30.531  47.205  1.00 40.96  ? 162 ASN C CA  1 
ATOM   2666 C  C   . ASN C  1 103 ? 44.763  30.793  45.700  1.00 38.85  ? 162 ASN C C   1 
ATOM   2667 O  O   . ASN C  1 103 ? 45.588  30.311  44.912  1.00 39.22  ? 162 ASN C O   1 
ATOM   2668 C  CB  . ASN C  1 103 ? 45.358  29.090  47.427  1.00 41.94  ? 162 ASN C CB  1 
ATOM   2669 C  CG  . ASN C  1 103 ? 45.850  28.849  48.826  1.00 43.38  ? 162 ASN C CG  1 
ATOM   2670 O  OD1 . ASN C  1 103 ? 46.829  29.454  49.253  1.00 43.63  ? 162 ASN C OD1 1 
ATOM   2671 N  ND2 . ASN C  1 103 ? 45.195  27.951  49.540  1.00 42.20  ? 162 ASN C ND2 1 
ATOM   2672 N  N   . MET C  1 104 ? 43.735  31.545  45.300  1.00 37.00  ? 163 MET C N   1 
ATOM   2673 C  CA  . MET C  1 104 ? 43.565  31.930  43.895  1.00 35.42  ? 163 MET C CA  1 
ATOM   2674 C  C   . MET C  1 104 ? 44.517  33.047  43.543  1.00 35.45  ? 163 MET C C   1 
ATOM   2675 O  O   . MET C  1 104 ? 45.077  33.715  44.412  1.00 36.57  ? 163 MET C O   1 
ATOM   2676 C  CB  . MET C  1 104 ? 42.149  32.434  43.611  1.00 34.16  ? 163 MET C CB  1 
ATOM   2677 C  CG  . MET C  1 104 ? 41.834  33.854  44.128  1.00 33.82  ? 163 MET C CG  1 
ATOM   2678 S  SD  . MET C  1 104 ? 40.203  34.464  43.683  1.00 31.49  ? 163 MET C SD  1 
ATOM   2679 C  CE  . MET C  1 104 ? 40.248  36.114  44.302  1.00 33.26  ? 163 MET C CE  1 
ATOM   2680 N  N   . THR C  1 105 ? 44.630  33.287  42.246  1.00 34.30  ? 164 THR C N   1 
ATOM   2681 C  CA  . THR C  1 105 ? 45.518  34.275  41.704  1.00 33.55  ? 164 THR C CA  1 
ATOM   2682 C  C   . THR C  1 105 ? 44.699  35.188  40.857  1.00 31.50  ? 164 THR C C   1 
ATOM   2683 O  O   . THR C  1 105 ? 43.893  34.715  40.120  1.00 30.68  ? 164 THR C O   1 
ATOM   2684 C  CB  . THR C  1 105 ? 46.517  33.587  40.814  1.00 34.44  ? 164 THR C CB  1 
ATOM   2685 O  OG1 . THR C  1 105 ? 47.397  32.804  41.627  1.00 36.33  ? 164 THR C OG1 1 
ATOM   2686 C  CG2 . THR C  1 105 ? 47.331  34.592  40.014  1.00 35.25  ? 164 THR C CG2 1 
ATOM   2687 N  N   . VAL C  1 106 ? 44.899  36.497  40.963  1.00 31.30  ? 165 VAL C N   1 
ATOM   2688 C  CA  . VAL C  1 106 ? 44.303  37.459  40.037  1.00 29.35  ? 165 VAL C CA  1 
ATOM   2689 C  C   . VAL C  1 106 ? 45.415  38.279  39.453  1.00 29.97  ? 165 VAL C C   1 
ATOM   2690 O  O   . VAL C  1 106 ? 46.455  38.395  40.084  1.00 31.27  ? 165 VAL C O   1 
ATOM   2691 C  CB  . VAL C  1 106 ? 43.405  38.417  40.748  1.00 28.54  ? 165 VAL C CB  1 
ATOM   2692 C  CG1 . VAL C  1 106 ? 42.164  37.731  41.130  1.00 28.44  ? 165 VAL C CG1 1 
ATOM   2693 C  CG2 . VAL C  1 106 ? 44.121  38.972  41.926  1.00 28.27  ? 165 VAL C CG2 1 
ATOM   2694 N  N   . ARG C  1 107 ? 45.214  38.854  38.268  1.00 29.22  ? 166 ARG C N   1 
ATOM   2695 C  CA  . ARG C  1 107 ? 46.220  39.788  37.707  1.00 30.62  ? 166 ARG C CA  1 
ATOM   2696 C  C   . ARG C  1 107 ? 45.745  41.247  37.577  1.00 29.65  ? 166 ARG C C   1 
ATOM   2697 O  O   . ARG C  1 107 ? 44.605  41.520  37.256  1.00 28.08  ? 166 ARG C O   1 
ATOM   2698 C  CB  . ARG C  1 107 ? 46.796  39.313  36.373  1.00 30.79  ? 166 ARG C CB  1 
ATOM   2699 C  CG  . ARG C  1 107 ? 47.785  40.325  35.779  1.00 33.08  ? 166 ARG C CG  1 
ATOM   2700 C  CD  . ARG C  1 107 ? 48.660  39.706  34.716  1.00 37.83  ? 166 ARG C CD  1 
ATOM   2701 N  NE  . ARG C  1 107 ? 47.829  39.294  33.598  1.00 39.86  ? 166 ARG C NE  1 
ATOM   2702 C  CZ  . ARG C  1 107 ? 47.442  40.094  32.612  1.00 42.60  ? 166 ARG C CZ  1 
ATOM   2703 N  NH1 . ARG C  1 107 ? 46.661  39.614  31.652  1.00 45.10  ? 166 ARG C NH1 1 
ATOM   2704 N  NH2 . ARG C  1 107 ? 47.825  41.371  32.566  1.00 42.34  ? 166 ARG C NH2 1 
ATOM   2705 N  N   . VAL C  1 108 ? 46.642  42.179  37.869  1.00 31.05  ? 167 VAL C N   1 
ATOM   2706 C  CA  . VAL C  1 108 ? 46.323  43.582  37.693  1.00 30.69  ? 167 VAL C CA  1 
ATOM   2707 C  C   . VAL C  1 108 ? 46.792  43.993  36.300  1.00 30.10  ? 167 VAL C C   1 
ATOM   2708 O  O   . VAL C  1 108 ? 48.008  43.959  35.989  1.00 30.96  ? 167 VAL C O   1 
ATOM   2709 C  CB  . VAL C  1 108 ? 46.982  44.506  38.721  1.00 32.30  ? 167 VAL C CB  1 
ATOM   2710 C  CG1 . VAL C  1 108 ? 46.329  45.889  38.573  1.00 31.10  ? 167 VAL C CG1 1 
ATOM   2711 C  CG2 . VAL C  1 108 ? 46.906  43.916  40.167  1.00 30.75  ? 167 VAL C CG2 1 
ATOM   2712 N  N   . PRO C  1 109 ? 45.842  44.383  35.459  1.00 28.69  ? 168 PRO C N   1 
ATOM   2713 C  CA  . PRO C  1 109 ? 46.242  44.748  34.129  1.00 28.92  ? 168 PRO C CA  1 
ATOM   2714 C  C   . PRO C  1 109 ? 46.771  46.152  34.060  1.00 29.42  ? 168 PRO C C   1 
ATOM   2715 O  O   . PRO C  1 109 ? 46.474  46.993  34.906  1.00 28.55  ? 168 PRO C O   1 
ATOM   2716 C  CB  . PRO C  1 109 ? 44.935  44.623  33.329  1.00 27.52  ? 168 PRO C CB  1 
ATOM   2717 C  CG  . PRO C  1 109 ? 43.876  44.904  34.302  1.00 27.27  ? 168 PRO C CG  1 
ATOM   2718 C  CD  . PRO C  1 109 ? 44.416  44.662  35.691  1.00 28.25  ? 168 PRO C CD  1 
ATOM   2719 N  N   . GLU C  1 110 ? 47.517  46.407  32.997  1.00 31.05  ? 169 GLU C N   1 
ATOM   2720 C  CA  . GLU C  1 110 ? 48.080  47.736  32.759  1.00 31.98  ? 169 GLU C CA  1 
ATOM   2721 C  C   . GLU C  1 110 ? 46.967  48.724  32.506  1.00 30.04  ? 169 GLU C C   1 
ATOM   2722 O  O   . GLU C  1 110 ? 45.907  48.363  32.002  1.00 29.17  ? 169 GLU C O   1 
ATOM   2723 C  CB  . GLU C  1 110 ? 49.057  47.722  31.608  1.00 32.53  ? 169 GLU C CB  1 
ATOM   2724 C  CG  . GLU C  1 110 ? 48.402  47.459  30.264  1.00 36.01  ? 169 GLU C CG  1 
ATOM   2725 C  CD  . GLU C  1 110 ? 49.293  47.809  29.047  1.00 42.39  ? 169 GLU C CD  1 
ATOM   2726 O  OE1 . GLU C  1 110 ? 48.778  47.660  27.892  1.00 43.17  ? 169 GLU C OE1 1 
ATOM   2727 O  OE2 . GLU C  1 110 ? 50.480  48.235  29.255  1.00 47.12  ? 169 GLU C OE2 1 
ATOM   2728 N  N   . THR C  1 111 ? 47.226  49.966  32.893  1.00 30.62  ? 170 THR C N   1 
ATOM   2729 C  CA  . THR C  1 111 ? 46.333  51.116  32.649  1.00 28.95  ? 170 THR C CA  1 
ATOM   2730 C  C   . THR C  1 111 ? 46.614  51.723  31.270  1.00 28.28  ? 170 THR C C   1 
ATOM   2731 O  O   . THR C  1 111 ? 47.656  51.488  30.683  1.00 29.12  ? 170 THR C O   1 
ATOM   2732 C  CB  . THR C  1 111 ? 46.615  52.240  33.660  1.00 29.86  ? 170 THR C CB  1 
ATOM   2733 O  OG1 . THR C  1 111 ? 47.894  52.849  33.359  1.00 31.66  ? 170 THR C OG1 1 
ATOM   2734 C  CG2 . THR C  1 111 ? 46.588  51.701  35.092  1.00 27.01  ? 170 THR C CG2 1 
ATOM   2735 N  N   . VAL C  1 112 ? 45.723  52.582  30.814  1.00 27.25  ? 171 VAL C N   1 
ATOM   2736 C  CA  . VAL C  1 112 ? 45.890  53.230  29.550  1.00 26.57  ? 171 VAL C CA  1 
ATOM   2737 C  C   . VAL C  1 112 ? 47.142  54.109  29.564  1.00 28.06  ? 171 VAL C C   1 
ATOM   2738 O  O   . VAL C  1 112 ? 47.856  54.175  28.582  1.00 28.62  ? 171 VAL C O   1 
ATOM   2739 C  CB  . VAL C  1 112 ? 44.618  54.041  29.179  1.00 26.78  ? 171 VAL C CB  1 
ATOM   2740 C  CG1 . VAL C  1 112 ? 44.464  55.297  30.085  1.00 25.47  ? 171 VAL C CG1 1 
ATOM   2741 C  CG2 . VAL C  1 112 ? 44.608  54.381  27.652  1.00 24.03  ? 171 VAL C CG2 1 
ATOM   2742 N  N   . ALA C  1 113 ? 47.437  54.741  30.694  1.00 29.28  ? 172 ALA C N   1 
ATOM   2743 C  CA  . ALA C  1 113 ? 48.655  55.554  30.839  1.00 30.74  ? 172 ALA C CA  1 
ATOM   2744 C  C   . ALA C  1 113 ? 49.920  54.720  30.646  1.00 32.09  ? 172 ALA C C   1 
ATOM   2745 O  O   . ALA C  1 113 ? 50.885  55.156  29.995  1.00 32.99  ? 172 ALA C O   1 
ATOM   2746 C  CB  . ALA C  1 113 ? 48.669  56.217  32.167  1.00 31.63  ? 172 ALA C CB  1 
ATOM   2747 N  N   . ASP C  1 114 ? 49.911  53.510  31.193  1.00 32.75  ? 173 ASP C N   1 
ATOM   2748 C  CA  . ASP C  1 114 ? 51.035  52.582  30.994  1.00 34.00  ? 173 ASP C CA  1 
ATOM   2749 C  C   . ASP C  1 114 ? 51.212  52.278  29.498  1.00 33.59  ? 173 ASP C C   1 
ATOM   2750 O  O   . ASP C  1 114 ? 52.307  52.327  28.959  1.00 33.91  ? 173 ASP C O   1 
ATOM   2751 C  CB  . ASP C  1 114 ? 50.815  51.287  31.788  1.00 33.90  ? 173 ASP C CB  1 
ATOM   2752 C  CG  . ASP C  1 114 ? 50.815  51.499  33.327  1.00 34.81  ? 173 ASP C CG  1 
ATOM   2753 O  OD1 . ASP C  1 114 ? 51.493  52.418  33.805  1.00 36.19  ? 173 ASP C OD1 1 
ATOM   2754 O  OD2 . ASP C  1 114 ? 50.139  50.735  34.056  1.00 33.15  ? 173 ASP C OD2 1 
ATOM   2755 N  N   . ALA C  1 115 ? 50.111  51.995  28.821  1.00 32.80  ? 174 ALA C N   1 
ATOM   2756 C  CA  . ALA C  1 115 ? 50.153  51.682  27.373  1.00 33.17  ? 174 ALA C CA  1 
ATOM   2757 C  C   . ALA C  1 115 ? 50.593  52.873  26.511  1.00 34.29  ? 174 ALA C C   1 
ATOM   2758 O  O   . ALA C  1 115 ? 51.086  52.695  25.392  1.00 35.32  ? 174 ALA C O   1 
ATOM   2759 C  CB  . ALA C  1 115 ? 48.792  51.177  26.889  1.00 30.76  ? 174 ALA C CB  1 
ATOM   2760 N  N   . ARG C  1 116 ? 50.422  54.084  27.027  1.00 35.01  ? 175 ARG C N   1 
ATOM   2761 C  CA  . ARG C  1 116 ? 50.514  55.256  26.183  1.00 35.38  ? 175 ARG C CA  1 
ATOM   2762 C  C   . ARG C  1 116 ? 51.966  55.597  25.859  1.00 38.22  ? 175 ARG C C   1 
ATOM   2763 O  O   . ARG C  1 116 ? 52.861  55.522  26.714  1.00 39.55  ? 175 ARG C O   1 
ATOM   2764 C  CB  . ARG C  1 116 ? 49.822  56.444  26.835  1.00 34.94  ? 175 ARG C CB  1 
ATOM   2765 C  CG  . ARG C  1 116 ? 49.741  57.668  25.917  1.00 34.75  ? 175 ARG C CG  1 
ATOM   2766 C  CD  . ARG C  1 116 ? 49.006  58.858  26.541  1.00 32.01  ? 175 ARG C CD  1 
ATOM   2767 N  NE  . ARG C  1 116 ? 47.621  58.520  26.872  1.00 30.94  ? 175 ARG C NE  1 
ATOM   2768 C  CZ  . ARG C  1 116 ? 47.063  58.596  28.091  1.00 31.00  ? 175 ARG C CZ  1 
ATOM   2769 N  NH1 . ARG C  1 116 ? 45.779  58.279  28.232  1.00 28.72  ? 175 ARG C NH1 1 
ATOM   2770 N  NH2 . ARG C  1 116 ? 47.749  59.004  29.162  1.00 31.07  ? 175 ARG C NH2 1 
ATOM   2771 N  N   . GLN C  1 117 ? 52.181  55.977  24.606  1.00 39.25  ? 176 GLN C N   1 
ATOM   2772 C  CA  . GLN C  1 117 ? 53.494  56.389  24.147  1.00 42.22  ? 176 GLN C CA  1 
ATOM   2773 C  C   . GLN C  1 117 ? 53.527  57.891  23.859  1.00 41.64  ? 176 GLN C C   1 
ATOM   2774 O  O   . GLN C  1 117 ? 54.484  58.571  24.215  1.00 42.68  ? 176 GLN C O   1 
ATOM   2775 C  CB  . GLN C  1 117 ? 53.926  55.515  22.952  1.00 43.76  ? 176 GLN C CB  1 
ATOM   2776 C  CG  . GLN C  1 117 ? 54.521  54.105  23.413  1.00 48.22  ? 176 GLN C CG  1 
ATOM   2777 C  CD  . GLN C  1 117 ? 54.625  53.067  22.268  1.00 54.35  ? 176 GLN C CD  1 
ATOM   2778 O  OE1 . GLN C  1 117 ? 54.682  53.425  21.071  1.00 57.54  ? 176 GLN C OE1 1 
ATOM   2779 N  NE2 . GLN C  1 117 ? 54.652  51.776  22.634  1.00 57.06  ? 176 GLN C NE2 1 
ATOM   2780 N  N   . SER C  1 118 ? 52.469  58.416  23.263  1.00 39.53  ? 177 SER C N   1 
ATOM   2781 C  CA  . SER C  1 118 ? 52.333  59.862  23.185  1.00 40.56  ? 177 SER C CA  1 
ATOM   2782 C  C   . SER C  1 118 ? 50.903  60.380  23.346  1.00 38.26  ? 177 SER C C   1 
ATOM   2783 O  O   . SER C  1 118 ? 49.944  59.676  23.154  1.00 36.87  ? 177 SER C O   1 
ATOM   2784 C  CB  . SER C  1 118 ? 52.938  60.393  21.868  1.00 41.72  ? 177 SER C CB  1 
ATOM   2785 O  OG  . SER C  1 118 ? 52.095  60.057  20.778  1.00 41.09  ? 177 SER C OG  1 
ATOM   2786 N  N   . ILE C  1 119 ? 50.789  61.656  23.654  1.00 38.87  ? 178 ILE C N   1 
ATOM   2787 C  CA  . ILE C  1 119 ? 49.507  62.336  23.737  1.00 37.12  ? 178 ILE C CA  1 
ATOM   2788 C  C   . ILE C  1 119 ? 49.156  62.753  22.333  1.00 36.48  ? 178 ILE C C   1 
ATOM   2789 O  O   . ILE C  1 119 ? 50.037  63.174  21.597  1.00 37.69  ? 178 ILE C O   1 
ATOM   2790 C  CB  . ILE C  1 119 ? 49.681  63.563  24.649  1.00 38.30  ? 178 ILE C CB  1 
ATOM   2791 C  CG1 . ILE C  1 119 ? 49.680  63.093  26.114  1.00 38.48  ? 178 ILE C CG1 1 
ATOM   2792 C  CG2 . ILE C  1 119 ? 48.642  64.599  24.376  1.00 37.22  ? 178 ILE C CG2 1 
ATOM   2793 C  CD1 . ILE C  1 119 ? 50.735  63.760  27.001  1.00 40.68  ? 178 ILE C CD1 1 
ATOM   2794 N  N   . ASP C  1 120 ? 47.890  62.636  21.943  1.00 34.64  ? 179 ASP C N   1 
ATOM   2795 C  CA  . ASP C  1 120 ? 47.494  63.037  20.594  1.00 34.17  ? 179 ASP C CA  1 
ATOM   2796 C  C   . ASP C  1 120 ? 47.309  64.543  20.430  1.00 33.77  ? 179 ASP C C   1 
ATOM   2797 O  O   . ASP C  1 120 ? 47.081  65.275  21.408  1.00 33.54  ? 179 ASP C O   1 
ATOM   2798 C  CB  . ASP C  1 120 ? 46.195  62.342  20.179  1.00 33.13  ? 179 ASP C CB  1 
ATOM   2799 C  CG  . ASP C  1 120 ? 46.345  60.850  20.058  1.00 35.15  ? 179 ASP C CG  1 
ATOM   2800 O  OD1 . ASP C  1 120 ? 47.491  60.389  19.799  1.00 41.06  ? 179 ASP C OD1 1 
ATOM   2801 O  OD2 . ASP C  1 120 ? 45.326  60.117  20.228  1.00 36.24  ? 179 ASP C OD2 1 
ATOM   2802 N  N   . VAL C  1 121 ? 47.382  64.979  19.170  1.00 32.95  ? 180 VAL C N   1 
ATOM   2803 C  CA  . VAL C  1 121 ? 46.940  66.298  18.785  1.00 32.64  ? 180 VAL C CA  1 
ATOM   2804 C  C   . VAL C  1 121 ? 45.448  66.404  19.080  1.00 32.26  ? 180 VAL C C   1 
ATOM   2805 O  O   . VAL C  1 121 ? 44.661  65.592  18.635  1.00 31.72  ? 180 VAL C O   1 
ATOM   2806 C  CB  . VAL C  1 121 ? 47.130  66.569  17.284  1.00 32.93  ? 180 VAL C CB  1 
ATOM   2807 C  CG1 . VAL C  1 121 ? 46.524  67.920  16.915  1.00 31.48  ? 180 VAL C CG1 1 
ATOM   2808 C  CG2 . VAL C  1 121 ? 48.596  66.509  16.888  1.00 32.90  ? 180 VAL C CG2 1 
ATOM   2809 N  N   . GLY C  1 122 ? 45.064  67.413  19.834  1.00 33.16  ? 181 GLY C N   1 
ATOM   2810 C  CA  . GLY C  1 122 ? 43.670  67.685  20.101  1.00 33.10  ? 181 GLY C CA  1 
ATOM   2811 C  C   . GLY C  1 122 ? 43.044  68.567  19.031  1.00 33.82  ? 181 GLY C C   1 
ATOM   2812 O  O   . GLY C  1 122 ? 43.600  69.605  18.659  1.00 34.32  ? 181 GLY C O   1 
ATOM   2813 N  N   . LYS C  1 123 ? 41.873  68.136  18.563  1.00 33.73  ? 182 LYS C N   1 
ATOM   2814 C  CA  . LYS C  1 123 ? 41.093  68.801  17.529  1.00 34.87  ? 182 LYS C CA  1 
ATOM   2815 C  C   . LYS C  1 123 ? 39.639  68.893  17.988  1.00 34.90  ? 182 LYS C C   1 
ATOM   2816 O  O   . LYS C  1 123 ? 39.058  67.868  18.295  1.00 34.37  ? 182 LYS C O   1 
ATOM   2817 C  CB  . LYS C  1 123 ? 41.094  67.932  16.249  1.00 34.67  ? 182 LYS C CB  1 
ATOM   2818 C  CG  . LYS C  1 123 ? 42.392  67.833  15.462  1.00 35.86  ? 182 LYS C CG  1 
ATOM   2819 C  CD  . LYS C  1 123 ? 42.354  66.626  14.539  1.00 37.39  ? 182 LYS C CD  1 
ATOM   2820 C  CE  . LYS C  1 123 ? 42.993  65.447  15.214  1.00 37.45  ? 182 LYS C CE  1 
ATOM   2821 N  NZ  . LYS C  1 123 ? 42.883  64.131  14.518  1.00 39.29  ? 182 LYS C NZ  1 
ATOM   2822 N  N   . THR C  1 124 ? 39.036  70.079  17.998  1.00 36.36  ? 183 THR C N   1 
ATOM   2823 C  CA  . THR C  1 124 ? 37.597  70.175  18.213  1.00 37.39  ? 183 THR C CA  1 
ATOM   2824 C  C   . THR C  1 124 ? 36.843  69.613  17.001  1.00 37.45  ? 183 THR C C   1 
ATOM   2825 O  O   . THR C  1 124 ? 35.825  68.920  17.162  1.00 37.01  ? 183 THR C O   1 
ATOM   2826 C  CB  . THR C  1 124 ? 37.129  71.595  18.435  1.00 39.18  ? 183 THR C CB  1 
ATOM   2827 O  OG1 . THR C  1 124 ? 37.888  72.192  19.493  1.00 42.05  ? 183 THR C OG1 1 
ATOM   2828 C  CG2 . THR C  1 124 ? 35.685  71.572  18.836  1.00 40.95  ? 183 THR C CG2 1 
ATOM   2829 N  N   . SER C  1 125 ? 37.337  69.900  15.796  1.00 37.26  ? 184 SER C N   1 
ATOM   2830 C  CA  . SER C  1 125 ? 36.861  69.194  14.608  1.00 37.49  ? 184 SER C CA  1 
ATOM   2831 C  C   . SER C  1 125 ? 37.811  69.295  13.424  1.00 37.44  ? 184 SER C C   1 
ATOM   2832 O  O   . SER C  1 125 ? 38.759  70.087  13.432  1.00 36.69  ? 184 SER C O   1 
ATOM   2833 C  CB  . SER C  1 125 ? 35.505  69.706  14.186  1.00 38.70  ? 184 SER C CB  1 
ATOM   2834 O  OG  . SER C  1 125 ? 35.635  71.059  13.822  1.00 41.75  ? 184 SER C OG  1 
ATOM   2835 N  N   . ALA C  1 126 ? 37.531  68.466  12.409  1.00 38.25  ? 185 ALA C N   1 
ATOM   2836 C  CA  . ALA C  1 126 ? 38.386  68.346  11.213  1.00 38.59  ? 185 ALA C CA  1 
ATOM   2837 C  C   . ALA C  1 126 ? 37.686  68.810  9.973   1.00 39.83  ? 185 ALA C C   1 
ATOM   2838 O  O   . ALA C  1 126 ? 36.479  68.896  9.934   1.00 41.78  ? 185 ALA C O   1 
ATOM   2839 C  CB  . ALA C  1 126 ? 38.865  66.922  11.027  1.00 37.54  ? 185 ALA C CB  1 
ATOM   2840 N  N   . GLU C  1 127 ? 38.475  69.103  8.960   1.00 40.57  ? 186 GLU C N   1 
ATOM   2841 C  CA  . GLU C  1 127 ? 37.993  69.522  7.654   1.00 42.16  ? 186 GLU C CA  1 
ATOM   2842 C  C   . GLU C  1 127 ? 38.832  68.878  6.583   1.00 42.19  ? 186 GLU C C   1 
ATOM   2843 O  O   . GLU C  1 127 ? 39.904  68.390  6.845   1.00 42.12  ? 186 GLU C O   1 
ATOM   2844 C  CB  . GLU C  1 127 ? 38.164  71.021  7.464   1.00 43.35  ? 186 GLU C CB  1 
ATOM   2845 C  CG  . GLU C  1 127 ? 37.586  71.909  8.521   1.00 45.13  ? 186 GLU C CG  1 
ATOM   2846 C  CD  . GLU C  1 127 ? 37.859  73.362  8.196   1.00 50.19  ? 186 GLU C CD  1 
ATOM   2847 O  OE1 . GLU C  1 127 ? 39.058  73.778  8.144   1.00 51.81  ? 186 GLU C OE1 1 
ATOM   2848 O  OE2 . GLU C  1 127 ? 36.864  74.089  7.968   1.00 54.71  ? 186 GLU C OE2 1 
ATOM   2849 N  N   . ASN C  1 128 ? 38.324  68.907  5.366   1.00 43.75  ? 187 ASN C N   1 
ATOM   2850 C  CA  . ASN C  1 128 ? 38.995  68.402  4.197   1.00 44.24  ? 187 ASN C CA  1 
ATOM   2851 C  C   . ASN C  1 128 ? 38.591  69.330  3.099   1.00 46.39  ? 187 ASN C C   1 
ATOM   2852 O  O   . ASN C  1 128 ? 37.778  69.000  2.247   1.00 48.33  ? 187 ASN C O   1 
ATOM   2853 C  CB  . ASN C  1 128 ? 38.529  66.990  3.901   1.00 44.44  ? 187 ASN C CB  1 
ATOM   2854 C  CG  . ASN C  1 128 ? 38.986  66.017  4.929   1.00 41.23  ? 187 ASN C CG  1 
ATOM   2855 O  OD1 . ASN C  1 128 ? 40.010  65.391  4.767   1.00 41.32  ? 187 ASN C OD1 1 
ATOM   2856 N  ND2 . ASN C  1 128 ? 38.245  65.899  6.006   1.00 40.91  ? 187 ASN C ND2 1 
ATOM   2857 N  N   . LEU C  1 129 ? 39.141  70.529  3.152   1.00 47.05  ? 188 LEU C N   1 
ATOM   2858 C  CA  . LEU C  1 129 ? 38.721  71.603  2.259   1.00 49.44  ? 188 LEU C CA  1 
ATOM   2859 C  C   . LEU C  1 129 ? 39.244  71.388  0.848   1.00 51.93  ? 188 LEU C C   1 
ATOM   2860 O  O   . LEU C  1 129 ? 39.120  72.246  -0.021  1.00 53.28  ? 188 LEU C O   1 
ATOM   2861 C  CB  . LEU C  1 129 ? 39.095  72.974  2.833   1.00 48.49  ? 188 LEU C CB  1 
ATOM   2862 C  CG  . LEU C  1 129 ? 38.613  73.180  4.278   1.00 46.50  ? 188 LEU C CG  1 
ATOM   2863 C  CD1 . LEU C  1 129 ? 38.869  74.606  4.720   1.00 45.34  ? 188 LEU C CD1 1 
ATOM   2864 C  CD2 . LEU C  1 129 ? 37.148  72.831  4.476   1.00 45.54  ? 188 LEU C CD2 1 
ATOM   2865 N  N   . TYR C  1 130 ? 39.793  70.206  0.608   1.00 53.40  ? 189 TYR C N   1 
ATOM   2866 C  CA  . TYR C  1 130 ? 39.966  69.739  -0.764  1.00 56.78  ? 189 TYR C CA  1 
ATOM   2867 C  C   . TYR C  1 130 ? 38.613  69.767  -1.513  1.00 59.27  ? 189 TYR C C   1 
ATOM   2868 O  O   . TYR C  1 130 ? 38.578  69.971  -2.737  1.00 61.28  ? 189 TYR C O   1 
ATOM   2869 C  CB  . TYR C  1 130 ? 40.566  68.331  -0.756  1.00 56.51  ? 189 TYR C CB  1 
ATOM   2870 C  CG  . TYR C  1 130 ? 40.894  67.828  -2.138  1.00 61.22  ? 189 TYR C CG  1 
ATOM   2871 C  CD1 . TYR C  1 130 ? 40.277  66.701  -2.649  1.00 64.12  ? 189 TYR C CD1 1 
ATOM   2872 C  CD2 . TYR C  1 130 ? 41.791  68.497  -2.948  1.00 63.54  ? 189 TYR C CD2 1 
ATOM   2873 C  CE1 . TYR C  1 130 ? 40.560  66.239  -3.901  1.00 66.77  ? 189 TYR C CE1 1 
ATOM   2874 C  CE2 . TYR C  1 130 ? 42.082  68.035  -4.192  1.00 67.34  ? 189 TYR C CE2 1 
ATOM   2875 C  CZ  . TYR C  1 130 ? 41.458  66.900  -4.668  1.00 69.03  ? 189 TYR C CZ  1 
ATOM   2876 O  OH  . TYR C  1 130 ? 41.723  66.432  -5.940  1.00 75.48  ? 189 TYR C OH  1 
ATOM   2877 N  N   . PHE C  1 131 ? 37.529  69.579  -0.738  1.00 59.27  ? 190 PHE C N   1 
ATOM   2878 C  CA  . PHE C  1 131 ? 36.115  69.572  -1.198  1.00 62.02  ? 190 PHE C CA  1 
ATOM   2879 C  C   . PHE C  1 131 ? 35.232  70.821  -0.863  1.00 63.12  ? 190 PHE C C   1 
ATOM   2880 O  O   . PHE C  1 131 ? 34.040  70.673  -0.540  1.00 64.13  ? 190 PHE C O   1 
ATOM   2881 C  CB  . PHE C  1 131 ? 35.427  68.350  -0.564  1.00 61.49  ? 190 PHE C CB  1 
ATOM   2882 C  CG  . PHE C  1 131 ? 36.154  67.057  -0.806  1.00 61.55  ? 190 PHE C CG  1 
ATOM   2883 C  CD1 . PHE C  1 131 ? 36.297  66.568  -2.107  1.00 62.43  ? 190 PHE C CD1 1 
ATOM   2884 C  CD2 . PHE C  1 131 ? 36.705  66.340  0.253   1.00 59.27  ? 190 PHE C CD2 1 
ATOM   2885 C  CE1 . PHE C  1 131 ? 36.964  65.402  -2.351  1.00 62.97  ? 190 PHE C CE1 1 
ATOM   2886 C  CE2 . PHE C  1 131 ? 37.384  65.154  0.016   1.00 59.67  ? 190 PHE C CE2 1 
ATOM   2887 C  CZ  . PHE C  1 131 ? 37.509  64.681  -1.299  1.00 61.70  ? 190 PHE C CZ  1 
ATOM   2888 N  N   . GLN C  1 132 ? 35.793  72.031  -0.937  1.00 63.51  ? 191 GLN C N   1 
ATOM   2889 C  CA  . GLN C  1 132 ? 35.058  73.241  -0.561  1.00 64.20  ? 191 GLN C CA  1 
ATOM   2890 C  C   . GLN C  1 132 ? 34.254  73.707  -1.755  1.00 67.26  ? 191 GLN C C   1 
ATOM   2891 O  O   . GLN C  1 132 ? 34.825  73.921  -2.814  1.00 68.58  ? 191 GLN C O   1 
ATOM   2892 C  CB  . GLN C  1 132 ? 36.025  74.355  -0.120  1.00 63.33  ? 191 GLN C CB  1 
ATOM   2893 C  CG  . GLN C  1 132 ? 35.467  75.283  0.993   1.00 63.18  ? 191 GLN C CG  1 
ATOM   2894 C  CD  . GLN C  1 132 ? 36.412  76.440  1.374   1.00 62.29  ? 191 GLN C CD  1 
ATOM   2895 O  OE1 . GLN C  1 132 ? 37.088  77.037  0.523   1.00 62.60  ? 191 GLN C OE1 1 
ATOM   2896 N  NE2 . GLN C  1 132 ? 36.442  76.762  2.663   1.00 59.57  ? 191 GLN C NE2 1 
ATOM   2897 N  N   . ASP D  1 6   ? 65.623  -23.787 70.791  1.00 93.67  ? 65  ASP D N   1 
ATOM   2898 C  CA  . ASP D  1 6   ? 64.532  -23.512 71.762  1.00 91.10  ? 65  ASP D CA  1 
ATOM   2899 C  C   . ASP D  1 6   ? 63.743  -22.291 71.309  1.00 85.80  ? 65  ASP D C   1 
ATOM   2900 O  O   . ASP D  1 6   ? 64.008  -21.725 70.227  1.00 84.94  ? 65  ASP D O   1 
ATOM   2901 C  CB  . ASP D  1 6   ? 65.100  -23.297 73.170  1.00 91.58  ? 65  ASP D CB  1 
ATOM   2902 N  N   . LYS D  1 7   ? 62.771  -21.895 72.138  1.00 82.93  ? 66  LYS D N   1 
ATOM   2903 C  CA  . LYS D  1 7   ? 61.845  -20.791 71.837  1.00 77.54  ? 66  LYS D CA  1 
ATOM   2904 C  C   . LYS D  1 7   ? 62.159  -19.573 72.710  1.00 73.71  ? 66  LYS D C   1 
ATOM   2905 O  O   . LYS D  1 7   ? 62.590  -19.729 73.847  1.00 74.79  ? 66  LYS D O   1 
ATOM   2906 C  CB  . LYS D  1 7   ? 60.400  -21.252 72.085  1.00 78.05  ? 66  LYS D CB  1 
ATOM   2907 N  N   . ILE D  1 8   ? 61.911  -18.363 72.199  1.00 69.11  ? 67  ILE D N   1 
ATOM   2908 C  CA  . ILE D  1 8   ? 62.246  -17.139 72.958  1.00 66.11  ? 67  ILE D CA  1 
ATOM   2909 C  C   . ILE D  1 8   ? 61.033  -16.354 73.488  1.00 63.16  ? 67  ILE D C   1 
ATOM   2910 O  O   . ILE D  1 8   ? 59.937  -16.395 72.936  1.00 62.23  ? 67  ILE D O   1 
ATOM   2911 C  CB  . ILE D  1 8   ? 63.133  -16.143 72.176  1.00 64.27  ? 67  ILE D CB  1 
ATOM   2912 C  CG1 . ILE D  1 8   ? 62.375  -15.521 71.029  1.00 61.74  ? 67  ILE D CG1 1 
ATOM   2913 C  CG2 . ILE D  1 8   ? 64.370  -16.812 71.634  1.00 67.28  ? 67  ILE D CG2 1 
ATOM   2914 C  CD1 . ILE D  1 8   ? 62.762  -14.077 70.819  1.00 59.81  ? 67  ILE D CD1 1 
ATOM   2915 N  N   . THR D  1 9   ? 61.265  -15.623 74.563  1.00 62.02  ? 68  THR D N   1 
ATOM   2916 C  CA  . THR D  1 9   ? 60.207  -14.938 75.266  1.00 60.31  ? 68  THR D CA  1 
ATOM   2917 C  C   . THR D  1 9   ? 60.097  -13.489 74.768  1.00 57.19  ? 68  THR D C   1 
ATOM   2918 O  O   . THR D  1 9   ? 61.080  -12.772 74.668  1.00 56.49  ? 68  THR D O   1 
ATOM   2919 C  CB  . THR D  1 9   ? 60.463  -14.961 76.783  1.00 61.71  ? 68  THR D CB  1 
ATOM   2920 O  OG1 . THR D  1 9   ? 60.486  -16.318 77.240  1.00 65.52  ? 68  THR D OG1 1 
ATOM   2921 C  CG2 . THR D  1 9   ? 59.389  -14.196 77.529  1.00 60.15  ? 68  THR D CG2 1 
ATOM   2922 N  N   . VAL D  1 10  ? 58.882  -13.067 74.462  1.00 55.60  ? 69  VAL D N   1 
ATOM   2923 C  CA  . VAL D  1 10  ? 58.605  -11.693 74.090  1.00 53.09  ? 69  VAL D CA  1 
ATOM   2924 C  C   . VAL D  1 10  ? 57.479  -11.127 74.954  1.00 52.75  ? 69  VAL D C   1 
ATOM   2925 O  O   . VAL D  1 10  ? 56.432  -11.741 75.110  1.00 53.51  ? 69  VAL D O   1 
ATOM   2926 C  CB  . VAL D  1 10  ? 58.153  -11.573 72.625  1.00 51.90  ? 69  VAL D CB  1 
ATOM   2927 C  CG1 . VAL D  1 10  ? 57.831  -10.144 72.297  1.00 49.57  ? 69  VAL D CG1 1 
ATOM   2928 C  CG2 . VAL D  1 10  ? 59.208  -12.114 71.665  1.00 52.59  ? 69  VAL D CG2 1 
ATOM   2929 N  N   . HIS D  1 11  ? 57.715  -9.951  75.517  1.00 52.00  ? 70  HIS D N   1 
ATOM   2930 C  CA  . HIS D  1 11  ? 56.718  -9.249  76.290  1.00 51.92  ? 70  HIS D CA  1 
ATOM   2931 C  C   . HIS D  1 11  ? 56.045  -8.191  75.406  1.00 50.13  ? 70  HIS D C   1 
ATOM   2932 O  O   . HIS D  1 11  ? 56.719  -7.390  74.741  1.00 49.03  ? 70  HIS D O   1 
ATOM   2933 C  CB  . HIS D  1 11  ? 57.369  -8.562  77.493  1.00 52.84  ? 70  HIS D CB  1 
ATOM   2934 C  CG  . HIS D  1 11  ? 58.164  -9.487  78.365  1.00 55.03  ? 70  HIS D CG  1 
ATOM   2935 N  ND1 . HIS D  1 11  ? 57.579  -10.477 79.123  1.00 56.95  ? 70  HIS D ND1 1 
ATOM   2936 C  CD2 . HIS D  1 11  ? 59.494  -9.559  78.608  1.00 55.79  ? 70  HIS D CD2 1 
ATOM   2937 C  CE1 . HIS D  1 11  ? 58.517  -11.132 79.789  1.00 58.95  ? 70  HIS D CE1 1 
ATOM   2938 N  NE2 . HIS D  1 11  ? 59.687  -10.593 79.495  1.00 58.69  ? 70  HIS D NE2 1 
ATOM   2939 N  N   . PHE D  1 12  ? 54.713  -8.178  75.416  1.00 50.13  ? 71  PHE D N   1 
ATOM   2940 C  CA  . PHE D  1 12  ? 53.942  -7.140  74.737  1.00 48.81  ? 71  PHE D CA  1 
ATOM   2941 C  C   . PHE D  1 12  ? 53.282  -6.241  75.751  1.00 49.40  ? 71  PHE D C   1 
ATOM   2942 O  O   . PHE D  1 12  ? 52.649  -6.731  76.695  1.00 51.30  ? 71  PHE D O   1 
ATOM   2943 C  CB  . PHE D  1 12  ? 52.826  -7.762  73.923  1.00 49.05  ? 71  PHE D CB  1 
ATOM   2944 C  CG  . PHE D  1 12  ? 53.286  -8.505  72.731  1.00 48.35  ? 71  PHE D CG  1 
ATOM   2945 C  CD1 . PHE D  1 12  ? 53.135  -7.961  71.479  1.00 47.23  ? 71  PHE D CD1 1 
ATOM   2946 C  CD2 . PHE D  1 12  ? 53.834  -9.768  72.851  1.00 49.79  ? 71  PHE D CD2 1 
ATOM   2947 C  CE1 . PHE D  1 12  ? 53.547  -8.653  70.352  1.00 47.92  ? 71  PHE D CE1 1 
ATOM   2948 C  CE2 . PHE D  1 12  ? 54.242  -10.468 71.733  1.00 50.23  ? 71  PHE D CE2 1 
ATOM   2949 C  CZ  . PHE D  1 12  ? 54.101  -9.908  70.483  1.00 48.95  ? 71  PHE D CZ  1 
ATOM   2950 N  N   . ILE D  1 13  ? 53.416  -4.935  75.563  1.00 48.58  ? 72  ILE D N   1 
ATOM   2951 C  CA  . ILE D  1 13  ? 52.598  -3.984  76.299  1.00 49.75  ? 72  ILE D CA  1 
ATOM   2952 C  C   . ILE D  1 13  ? 51.418  -3.584  75.419  1.00 49.68  ? 72  ILE D C   1 
ATOM   2953 O  O   . ILE D  1 13  ? 51.584  -3.015  74.332  1.00 48.46  ? 72  ILE D O   1 
ATOM   2954 C  CB  . ILE D  1 13  ? 53.378  -2.755  76.709  1.00 49.83  ? 72  ILE D CB  1 
ATOM   2955 C  CG1 . ILE D  1 13  ? 54.505  -3.155  77.651  1.00 50.49  ? 72  ILE D CG1 1 
ATOM   2956 C  CG2 . ILE D  1 13  ? 52.444  -1.727  77.376  1.00 50.64  ? 72  ILE D CG2 1 
ATOM   2957 C  CD1 . ILE D  1 13  ? 55.369  -1.977  78.068  1.00 51.07  ? 72  ILE D CD1 1 
ATOM   2958 N  N   . ASN D  1 14  ? 50.227  -3.909  75.897  1.00 51.50  ? 73  ASN D N   1 
ATOM   2959 C  CA  . ASN D  1 14  ? 49.002  -3.701  75.147  1.00 52.12  ? 73  ASN D CA  1 
ATOM   2960 C  C   . ASN D  1 14  ? 48.577  -2.243  75.184  1.00 52.34  ? 73  ASN D C   1 
ATOM   2961 O  O   . ASN D  1 14  ? 49.083  -1.457  75.983  1.00 52.40  ? 73  ASN D O   1 
ATOM   2962 C  CB  . ASN D  1 14  ? 47.889  -4.569  75.731  1.00 54.70  ? 73  ASN D CB  1 
ATOM   2963 C  CG  . ASN D  1 14  ? 46.993  -5.161  74.662  1.00 56.59  ? 73  ASN D CG  1 
ATOM   2964 O  OD1 . ASN D  1 14  ? 46.932  -4.642  73.520  1.00 55.49  ? 73  ASN D OD1 1 
ATOM   2965 N  ND2 . ASN D  1 14  ? 46.255  -6.251  75.024  1.00 58.39  ? 73  ASN D ND2 1 
ATOM   2966 N  N   . ARG D  1 15  ? 47.635  -1.893  74.317  1.00 52.77  ? 74  ARG D N   1 
ATOM   2967 C  CA  . ARG D  1 15  ? 47.073  -0.544  74.301  1.00 54.11  ? 74  ARG D CA  1 
ATOM   2968 C  C   . ARG D  1 15  ? 46.503  -0.234  75.679  1.00 57.03  ? 74  ARG D C   1 
ATOM   2969 O  O   . ARG D  1 15  ? 46.581  0.908   76.155  1.00 58.14  ? 74  ARG D O   1 
ATOM   2970 C  CB  . ARG D  1 15  ? 46.009  -0.415  73.212  1.00 54.52  ? 74  ARG D CB  1 
ATOM   2971 C  CG  . ARG D  1 15  ? 46.593  -0.370  71.812  1.00 52.41  ? 74  ARG D CG  1 
ATOM   2972 C  CD  . ARG D  1 15  ? 45.609  -0.738  70.741  1.00 52.74  ? 74  ARG D CD  1 
ATOM   2973 N  NE  . ARG D  1 15  ? 46.307  -0.991  69.481  1.00 51.30  ? 74  ARG D NE  1 
ATOM   2974 C  CZ  . ARG D  1 15  ? 45.893  -1.828  68.524  1.00 51.78  ? 74  ARG D CZ  1 
ATOM   2975 N  NH1 . ARG D  1 15  ? 44.758  -2.519  68.665  1.00 54.53  ? 74  ARG D NH1 1 
ATOM   2976 N  NH2 . ARG D  1 15  ? 46.608  -1.983  67.411  1.00 49.51  ? 74  ARG D NH2 1 
ATOM   2977 N  N   . ASP D  1 16  ? 45.953  -1.281  76.307  1.00 58.68  ? 75  ASP D N   1 
ATOM   2978 C  CA  . ASP D  1 16  ? 45.390  -1.240  77.662  1.00 61.85  ? 75  ASP D CA  1 
ATOM   2979 C  C   . ASP D  1 16  ? 46.398  -0.905  78.744  1.00 61.73  ? 75  ASP D C   1 
ATOM   2980 O  O   . ASP D  1 16  ? 46.024  -0.496  79.843  1.00 64.21  ? 75  ASP D O   1 
ATOM   2981 C  CB  . ASP D  1 16  ? 44.777  -2.603  78.005  1.00 63.55  ? 75  ASP D CB  1 
ATOM   2982 C  CG  . ASP D  1 16  ? 43.453  -2.855  77.295  1.00 66.44  ? 75  ASP D CG  1 
ATOM   2983 O  OD1 . ASP D  1 16  ? 43.076  -2.053  76.395  1.00 66.92  ? 75  ASP D OD1 1 
ATOM   2984 O  OD2 . ASP D  1 16  ? 42.769  -3.860  77.655  1.00 68.97  ? 75  ASP D OD2 1 
ATOM   2985 N  N   . GLY D  1 17  ? 47.671  -1.123  78.445  1.00 59.17  ? 76  GLY D N   1 
ATOM   2986 C  CA  . GLY D  1 17  ? 48.734  -0.943  79.432  1.00 59.41  ? 76  GLY D CA  1 
ATOM   2987 C  C   . GLY D  1 17  ? 49.071  -2.247  80.142  1.00 59.83  ? 76  GLY D C   1 
ATOM   2988 O  O   . GLY D  1 17  ? 49.857  -2.272  81.087  1.00 60.55  ? 76  GLY D O   1 
ATOM   2989 N  N   . GLU D  1 18  ? 48.483  -3.337  79.664  1.00 59.71  ? 77  GLU D N   1 
ATOM   2990 C  CA  . GLU D  1 18  ? 48.642  -4.634  80.286  1.00 60.89  ? 77  GLU D CA  1 
ATOM   2991 C  C   . GLU D  1 18  ? 49.773  -5.364  79.587  1.00 58.17  ? 77  GLU D C   1 
ATOM   2992 O  O   . GLU D  1 18  ? 49.922  -5.275  78.374  1.00 55.94  ? 77  GLU D O   1 
ATOM   2993 C  CB  . GLU D  1 18  ? 47.321  -5.397  80.171  1.00 63.41  ? 77  GLU D CB  1 
ATOM   2994 C  CG  . GLU D  1 18  ? 47.298  -6.836  80.625  1.00 66.30  ? 77  GLU D CG  1 
ATOM   2995 C  CD  . GLU D  1 18  ? 45.873  -7.417  80.514  1.00 72.97  ? 77  GLU D CD  1 
ATOM   2996 O  OE1 . GLU D  1 18  ? 45.029  -6.801  79.799  1.00 74.72  ? 77  GLU D OE1 1 
ATOM   2997 O  OE2 . GLU D  1 18  ? 45.596  -8.473  81.143  1.00 77.74  ? 77  GLU D OE2 1 
ATOM   2998 N  N   . THR D  1 19  ? 50.581  -6.082  80.352  1.00 58.78  ? 78  THR D N   1 
ATOM   2999 C  CA  . THR D  1 19  ? 51.736  -6.765  79.782  1.00 57.00  ? 78  THR D CA  1 
ATOM   3000 C  C   . THR D  1 19  ? 51.402  -8.215  79.555  1.00 57.98  ? 78  THR D C   1 
ATOM   3001 O  O   . THR D  1 19  ? 50.998  -8.898  80.488  1.00 60.67  ? 78  THR D O   1 
ATOM   3002 C  CB  . THR D  1 19  ? 52.955  -6.660  80.704  1.00 57.52  ? 78  THR D CB  1 
ATOM   3003 O  OG1 . THR D  1 19  ? 53.141  -5.286  81.087  1.00 56.91  ? 78  THR D OG1 1 
ATOM   3004 C  CG2 . THR D  1 19  ? 54.197  -7.168  79.998  1.00 56.04  ? 78  THR D CG2 1 
ATOM   3005 N  N   . LEU D  1 20  ? 51.557  -8.667  78.311  1.00 56.39  ? 79  LEU D N   1 
ATOM   3006 C  CA  . LEU D  1 20  ? 51.338  -10.066 77.946  1.00 57.85  ? 79  LEU D CA  1 
ATOM   3007 C  C   . LEU D  1 20  ? 52.688  -10.694 77.627  1.00 57.07  ? 79  LEU D C   1 
ATOM   3008 O  O   . LEU D  1 20  ? 53.433  -10.171 76.812  1.00 54.72  ? 79  LEU D O   1 
ATOM   3009 C  CB  . LEU D  1 20  ? 50.430  -10.201 76.723  1.00 57.30  ? 79  LEU D CB  1 
ATOM   3010 C  CG  . LEU D  1 20  ? 49.161  -9.344  76.654  1.00 58.00  ? 79  LEU D CG  1 
ATOM   3011 C  CD1 . LEU D  1 20  ? 48.532  -9.446  75.275  1.00 57.26  ? 79  LEU D CD1 1 
ATOM   3012 C  CD2 . LEU D  1 20  ? 48.161  -9.763  77.704  1.00 62.14  ? 79  LEU D CD2 1 
ATOM   3013 N  N   . THR D  1 21  ? 52.997  -11.799 78.301  1.00 59.42  ? 80  THR D N   1 
ATOM   3014 C  CA  . THR D  1 21  ? 54.234  -12.500 78.086  1.00 59.19  ? 80  THR D CA  1 
ATOM   3015 C  C   . THR D  1 21  ? 53.902  -13.759 77.301  1.00 60.39  ? 80  THR D C   1 
ATOM   3016 O  O   . THR D  1 21  ? 52.978  -14.488 77.644  1.00 62.89  ? 80  THR D O   1 
ATOM   3017 C  CB  . THR D  1 21  ? 54.904  -12.831 79.427  1.00 61.31  ? 80  THR D CB  1 
ATOM   3018 O  OG1 . THR D  1 21  ? 55.223  -11.606 80.109  1.00 59.73  ? 80  THR D OG1 1 
ATOM   3019 C  CG2 . THR D  1 21  ? 56.171  -13.668 79.196  1.00 62.30  ? 80  THR D CG2 1 
ATOM   3020 N  N   . THR D  1 22  ? 54.649  -14.000 76.237  1.00 59.14  ? 81  THR D N   1 
ATOM   3021 C  CA  . THR D  1 22  ? 54.437  -15.174 75.415  1.00 60.74  ? 81  THR D CA  1 
ATOM   3022 C  C   . THR D  1 22  ? 55.765  -15.659 74.870  1.00 61.06  ? 81  THR D C   1 
ATOM   3023 O  O   . THR D  1 22  ? 56.800  -15.055 75.109  1.00 60.23  ? 81  THR D O   1 
ATOM   3024 C  CB  . THR D  1 22  ? 53.471  -14.889 74.256  1.00 59.71  ? 81  THR D CB  1 
ATOM   3025 O  OG1 . THR D  1 22  ? 53.015  -16.123 73.688  1.00 62.09  ? 81  THR D OG1 1 
ATOM   3026 C  CG2 . THR D  1 22  ? 54.129  -14.065 73.162  1.00 56.59  ? 81  THR D CG2 1 
ATOM   3027 N  N   . LYS D  1 23  ? 55.726  -16.770 74.151  1.00 63.29  ? 82  LYS D N   1 
ATOM   3028 C  CA  . LYS D  1 23  ? 56.925  -17.440 73.670  1.00 64.48  ? 82  LYS D CA  1 
ATOM   3029 C  C   . LYS D  1 23  ? 56.770  -17.590 72.169  1.00 63.89  ? 82  LYS D C   1 
ATOM   3030 O  O   . LYS D  1 23  ? 55.702  -17.961 71.691  1.00 64.74  ? 82  LYS D O   1 
ATOM   3031 C  CB  . LYS D  1 23  ? 57.086  -18.814 74.349  1.00 68.58  ? 82  LYS D CB  1 
ATOM   3032 C  CG  . LYS D  1 23  ? 57.716  -18.749 75.750  1.00 69.90  ? 82  LYS D CG  1 
ATOM   3033 C  CD  . LYS D  1 23  ? 58.287  -20.107 76.225  1.00 74.11  ? 82  LYS D CD  1 
ATOM   3034 N  N   . GLY D  1 24  ? 57.825  -17.289 71.425  1.00 62.79  ? 83  GLY D N   1 
ATOM   3035 C  CA  . GLY D  1 24  ? 57.794  -17.458 69.977  1.00 62.74  ? 83  GLY D CA  1 
ATOM   3036 C  C   . GLY D  1 24  ? 58.961  -18.289 69.486  1.00 65.13  ? 83  GLY D C   1 
ATOM   3037 O  O   . GLY D  1 24  ? 59.970  -18.437 70.174  1.00 65.72  ? 83  GLY D O   1 
ATOM   3038 N  N   . LYS D  1 25  ? 58.814  -18.835 68.285  1.00 66.60  ? 84  LYS D N   1 
ATOM   3039 C  CA  . LYS D  1 25  ? 59.903  -19.555 67.644  1.00 69.58  ? 84  LYS D CA  1 
ATOM   3040 C  C   . LYS D  1 25  ? 60.821  -18.553 66.971  1.00 67.45  ? 84  LYS D C   1 
ATOM   3041 O  O   . LYS D  1 25  ? 60.360  -17.578 66.381  1.00 64.80  ? 84  LYS D O   1 
ATOM   3042 C  CB  . LYS D  1 25  ? 59.378  -20.556 66.603  1.00 72.73  ? 84  LYS D CB  1 
ATOM   3043 C  CG  . LYS D  1 25  ? 58.608  -21.753 67.194  1.00 77.20  ? 84  LYS D CG  1 
ATOM   3044 N  N   . VAL D  1 26  ? 62.120  -18.804 67.052  1.00 69.24  ? 85  VAL D N   1 
ATOM   3045 C  CA  . VAL D  1 26  ? 63.095  -18.034 66.294  1.00 68.67  ? 85  VAL D CA  1 
ATOM   3046 C  C   . VAL D  1 26  ? 62.754  -18.190 64.811  1.00 69.26  ? 85  VAL D C   1 
ATOM   3047 O  O   . VAL D  1 26  ? 62.455  -19.293 64.363  1.00 71.72  ? 85  VAL D O   1 
ATOM   3048 C  CB  . VAL D  1 26  ? 64.538  -18.562 66.554  1.00 72.07  ? 85  VAL D CB  1 
ATOM   3049 C  CG1 . VAL D  1 26  ? 65.557  -17.809 65.711  1.00 71.99  ? 85  VAL D CG1 1 
ATOM   3050 C  CG2 . VAL D  1 26  ? 64.895  -18.471 68.045  1.00 72.32  ? 85  VAL D CG2 1 
ATOM   3051 N  N   . GLY D  1 27  ? 62.770  -17.088 64.065  1.00 66.94  ? 86  GLY D N   1 
ATOM   3052 C  CA  . GLY D  1 27  ? 62.405  -17.115 62.647  1.00 67.67  ? 86  GLY D CA  1 
ATOM   3053 C  C   . GLY D  1 27  ? 60.968  -16.705 62.354  1.00 65.34  ? 86  GLY D C   1 
ATOM   3054 O  O   . GLY D  1 27  ? 60.664  -16.356 61.209  1.00 65.14  ? 86  GLY D O   1 
ATOM   3055 N  N   . ASP D  1 28  ? 60.096  -16.740 63.373  1.00 63.80  ? 87  ASP D N   1 
ATOM   3056 C  CA  . ASP D  1 28  ? 58.695  -16.289 63.236  1.00 61.86  ? 87  ASP D CA  1 
ATOM   3057 C  C   . ASP D  1 28  ? 58.616  -14.752 63.229  1.00 58.55  ? 87  ASP D C   1 
ATOM   3058 O  O   . ASP D  1 28  ? 59.433  -14.077 63.877  1.00 57.47  ? 87  ASP D O   1 
ATOM   3059 C  CB  . ASP D  1 28  ? 57.824  -16.829 64.391  1.00 62.00  ? 87  ASP D CB  1 
ATOM   3060 C  CG  . ASP D  1 28  ? 57.326  -18.265 64.168  1.00 66.02  ? 87  ASP D CG  1 
ATOM   3061 O  OD1 . ASP D  1 28  ? 57.530  -18.864 63.083  1.00 68.61  ? 87  ASP D OD1 1 
ATOM   3062 O  OD2 . ASP D  1 28  ? 56.694  -18.795 65.104  1.00 67.12  ? 87  ASP D OD2 1 
ATOM   3063 N  N   . SER D  1 29  ? 57.640  -14.202 62.507  1.00 57.21  ? 88  SER D N   1 
ATOM   3064 C  CA  . SER D  1 29  ? 57.391  -12.760 62.535  1.00 54.59  ? 88  SER D CA  1 
ATOM   3065 C  C   . SER D  1 29  ? 56.616  -12.445 63.814  1.00 52.95  ? 88  SER D C   1 
ATOM   3066 O  O   . SER D  1 29  ? 55.941  -13.323 64.374  1.00 53.85  ? 88  SER D O   1 
ATOM   3067 C  CB  . SER D  1 29  ? 56.596  -12.313 61.299  1.00 54.37  ? 88  SER D CB  1 
ATOM   3068 O  OG  . SER D  1 29  ? 55.219  -12.660 61.400  1.00 54.53  ? 88  SER D OG  1 
ATOM   3069 N  N   . LEU D  1 30  ? 56.711  -11.201 64.280  1.00 50.75  ? 89  LEU D N   1 
ATOM   3070 C  CA  . LEU D  1 30  ? 55.962  -10.812 65.469  1.00 49.50  ? 89  LEU D CA  1 
ATOM   3071 C  C   . LEU D  1 30  ? 54.462  -10.936 65.239  1.00 49.61  ? 89  LEU D C   1 
ATOM   3072 O  O   . LEU D  1 30  ? 53.706  -11.220 66.163  1.00 49.93  ? 89  LEU D O   1 
ATOM   3073 C  CB  . LEU D  1 30  ? 56.378  -9.420  65.945  1.00 47.59  ? 89  LEU D CB  1 
ATOM   3074 C  CG  . LEU D  1 30  ? 57.671  -9.515  66.755  1.00 48.09  ? 89  LEU D CG  1 
ATOM   3075 C  CD1 . LEU D  1 30  ? 58.578  -8.352  66.514  1.00 47.79  ? 89  LEU D CD1 1 
ATOM   3076 C  CD2 . LEU D  1 30  ? 57.362  -9.640  68.216  1.00 47.53  ? 89  LEU D CD2 1 
ATOM   3077 N  N   . LEU D  1 31  ? 54.024  -10.758 63.999  1.00 49.99  ? 90  LEU D N   1 
ATOM   3078 C  CA  . LEU D  1 31  ? 52.614  -10.990 63.681  1.00 50.72  ? 90  LEU D CA  1 
ATOM   3079 C  C   . LEU D  1 31  ? 52.288  -12.445 63.977  1.00 53.03  ? 90  LEU D C   1 
ATOM   3080 O  O   . LEU D  1 31  ? 51.327  -12.740 64.688  1.00 53.94  ? 90  LEU D O   1 
ATOM   3081 C  CB  . LEU D  1 31  ? 52.291  -10.637 62.213  1.00 50.76  ? 90  LEU D CB  1 
ATOM   3082 C  CG  . LEU D  1 31  ? 50.863  -10.948 61.769  1.00 51.92  ? 90  LEU D CG  1 
ATOM   3083 C  CD1 . LEU D  1 31  ? 49.845  -10.251 62.669  1.00 50.98  ? 90  LEU D CD1 1 
ATOM   3084 C  CD2 . LEU D  1 31  ? 50.640  -10.570 60.312  1.00 51.97  ? 90  LEU D CD2 1 
ATOM   3085 N  N   . ASP D  1 32  ? 53.107  -13.349 63.436  1.00 54.59  ? 91  ASP D N   1 
ATOM   3086 C  CA  . ASP D  1 32  ? 52.909  -14.789 63.645  1.00 57.36  ? 91  ASP D CA  1 
ATOM   3087 C  C   . ASP D  1 32  ? 52.753  -15.056 65.130  1.00 57.27  ? 91  ASP D C   1 
ATOM   3088 O  O   . ASP D  1 32  ? 51.940  -15.853 65.522  1.00 59.48  ? 91  ASP D O   1 
ATOM   3089 C  CB  . ASP D  1 32  ? 54.092  -15.612 63.093  1.00 59.17  ? 91  ASP D CB  1 
ATOM   3090 C  CG  . ASP D  1 32  ? 54.198  -15.564 61.565  1.00 60.49  ? 91  ASP D CG  1 
ATOM   3091 O  OD1 . ASP D  1 32  ? 53.146  -15.487 60.886  1.00 61.76  ? 91  ASP D OD1 1 
ATOM   3092 O  OD2 . ASP D  1 32  ? 55.337  -15.603 61.040  1.00 61.03  ? 91  ASP D OD2 1 
ATOM   3093 N  N   . VAL D  1 33  ? 53.537  -14.372 65.949  1.00 55.40  ? 92  VAL D N   1 
ATOM   3094 C  CA  . VAL D  1 33  ? 53.506  -14.579 67.385  1.00 55.89  ? 92  VAL D CA  1 
ATOM   3095 C  C   . VAL D  1 33  ? 52.161  -14.169 67.964  1.00 55.79  ? 92  VAL D C   1 
ATOM   3096 O  O   . VAL D  1 33  ? 51.554  -14.894 68.742  1.00 58.42  ? 92  VAL D O   1 
ATOM   3097 C  CB  . VAL D  1 33  ? 54.652  -13.806 68.104  1.00 54.05  ? 92  VAL D CB  1 
ATOM   3098 C  CG1 . VAL D  1 33  ? 54.481  -13.852 69.620  1.00 54.01  ? 92  VAL D CG1 1 
ATOM   3099 C  CG2 . VAL D  1 33  ? 56.008  -14.359 67.692  1.00 54.85  ? 92  VAL D CG2 1 
ATOM   3100 N  N   . VAL D  1 34  ? 51.692  -13.004 67.585  1.00 53.78  ? 93  VAL D N   1 
ATOM   3101 C  CA  . VAL D  1 34  ? 50.403  -12.524 68.062  1.00 53.97  ? 93  VAL D CA  1 
ATOM   3102 C  C   . VAL D  1 34  ? 49.278  -13.476 67.665  1.00 56.79  ? 93  VAL D C   1 
ATOM   3103 O  O   . VAL D  1 34  ? 48.399  -13.787 68.470  1.00 58.53  ? 93  VAL D O   1 
ATOM   3104 C  CB  . VAL D  1 34  ? 50.108  -11.114 67.485  1.00 51.99  ? 93  VAL D CB  1 
ATOM   3105 C  CG1 . VAL D  1 34  ? 48.699  -10.650 67.825  1.00 52.52  ? 93  VAL D CG1 1 
ATOM   3106 C  CG2 . VAL D  1 34  ? 51.116  -10.127 68.000  1.00 49.45  ? 93  VAL D CG2 1 
ATOM   3107 N  N   . VAL D  1 35  ? 49.318  -13.944 66.419  1.00 57.71  ? 94  VAL D N   1 
ATOM   3108 C  CA  . VAL D  1 35  ? 48.257  -14.798 65.877  1.00 60.99  ? 94  VAL D CA  1 
ATOM   3109 C  C   . VAL D  1 35  ? 48.352  -16.226 66.391  1.00 64.37  ? 94  VAL D C   1 
ATOM   3110 O  O   . VAL D  1 35  ? 47.365  -16.765 66.887  1.00 67.67  ? 94  VAL D O   1 
ATOM   3111 C  CB  . VAL D  1 35  ? 48.269  -14.833 64.313  1.00 61.24  ? 94  VAL D CB  1 
ATOM   3112 C  CG1 . VAL D  1 35  ? 47.310  -15.906 63.797  1.00 64.92  ? 94  VAL D CG1 1 
ATOM   3113 C  CG2 . VAL D  1 35  ? 47.903  -13.466 63.730  1.00 58.54  ? 94  VAL D CG2 1 
ATOM   3114 N  N   . GLU D  1 36  ? 49.529  -16.839 66.273  1.00 64.62  ? 95  GLU D N   1 
ATOM   3115 C  CA  . GLU D  1 36  ? 49.705  -18.244 66.676  1.00 68.46  ? 95  GLU D CA  1 
ATOM   3116 C  C   . GLU D  1 36  ? 49.434  -18.437 68.168  1.00 69.43  ? 95  GLU D C   1 
ATOM   3117 O  O   . GLU D  1 36  ? 49.052  -19.523 68.573  1.00 73.36  ? 95  GLU D O   1 
ATOM   3118 C  CB  . GLU D  1 36  ? 51.102  -18.789 66.295  1.00 68.71  ? 95  GLU D CB  1 
ATOM   3119 C  CG  . GLU D  1 36  ? 51.441  -18.764 64.784  1.00 67.96  ? 95  GLU D CG  1 
ATOM   3120 N  N   . ASN D  1 37  ? 49.598  -17.384 68.973  1.00 66.50  ? 96  ASN D N   1 
ATOM   3121 C  CA  . ASN D  1 37  ? 49.325  -17.463 70.413  1.00 67.82  ? 96  ASN D CA  1 
ATOM   3122 C  C   . ASN D  1 37  ? 48.031  -16.777 70.870  1.00 68.19  ? 96  ASN D C   1 
ATOM   3123 O  O   . ASN D  1 37  ? 47.757  -16.696 72.078  1.00 69.28  ? 96  ASN D O   1 
ATOM   3124 C  CB  . ASN D  1 37  ? 50.514  -16.915 71.202  1.00 65.48  ? 96  ASN D CB  1 
ATOM   3125 C  CG  . ASN D  1 37  ? 51.756  -17.781 71.064  1.00 66.29  ? 96  ASN D CG  1 
ATOM   3126 O  OD1 . ASN D  1 37  ? 52.870  -17.264 70.996  1.00 64.25  ? 96  ASN D OD1 1 
ATOM   3127 N  ND2 . ASN D  1 37  ? 51.570  -19.106 71.033  1.00 69.98  ? 96  ASN D ND2 1 
ATOM   3128 N  N   . ASN D  1 38  ? 47.225  -16.321 69.907  1.00 67.82  ? 97  ASN D N   1 
ATOM   3129 C  CA  . ASN D  1 38  ? 45.868  -15.805 70.179  1.00 69.24  ? 97  ASN D CA  1 
ATOM   3130 C  C   . ASN D  1 38  ? 45.860  -14.785 71.308  1.00 67.47  ? 97  ASN D C   1 
ATOM   3131 O  O   . ASN D  1 38  ? 45.140  -14.937 72.303  1.00 70.16  ? 97  ASN D O   1 
ATOM   3132 C  CB  . ASN D  1 38  ? 44.895  -16.954 70.507  1.00 74.39  ? 97  ASN D CB  1 
ATOM   3133 C  CG  . ASN D  1 38  ? 44.191  -17.497 69.282  1.00 78.25  ? 97  ASN D CG  1 
ATOM   3134 O  OD1 . ASN D  1 38  ? 43.843  -16.746 68.359  1.00 78.46  ? 97  ASN D OD1 1 
ATOM   3135 N  ND2 . ASN D  1 38  ? 43.939  -18.811 69.280  1.00 84.05  ? 97  ASN D ND2 1 
ATOM   3136 N  N   . LEU D  1 39  ? 46.698  -13.768 71.153  1.00 63.52  ? 98  LEU D N   1 
ATOM   3137 C  CA  . LEU D  1 39  ? 46.830  -12.694 72.142  1.00 62.07  ? 98  LEU D CA  1 
ATOM   3138 C  C   . LEU D  1 39  ? 45.691  -11.693 72.022  1.00 62.35  ? 98  LEU D C   1 
ATOM   3139 O  O   . LEU D  1 39  ? 45.120  -11.507 70.949  1.00 62.26  ? 98  LEU D O   1 
ATOM   3140 C  CB  . LEU D  1 39  ? 48.160  -11.942 71.956  1.00 58.21  ? 98  LEU D CB  1 
ATOM   3141 C  CG  . LEU D  1 39  ? 49.436  -12.765 72.152  1.00 58.46  ? 98  LEU D CG  1 
ATOM   3142 C  CD1 . LEU D  1 39  ? 50.672  -11.928 71.836  1.00 55.28  ? 98  LEU D CD1 1 
ATOM   3143 C  CD2 . LEU D  1 39  ? 49.498  -13.361 73.566  1.00 60.80  ? 98  LEU D CD2 1 
ATOM   3144 N  N   . ASP D  1 40  ? 45.405  -11.015 73.127  1.00 63.06  ? 99  ASP D N   1 
ATOM   3145 C  CA  . ASP D  1 40  ? 44.248  -10.128 73.220  1.00 64.46  ? 99  ASP D CA  1 
ATOM   3146 C  C   . ASP D  1 40  ? 44.479  -8.731  72.615  1.00 61.88  ? 99  ASP D C   1 
ATOM   3147 O  O   . ASP D  1 40  ? 44.298  -7.713  73.316  1.00 62.61  ? 99  ASP D O   1 
ATOM   3148 C  CB  . ASP D  1 40  ? 43.831  -9.998  74.703  1.00 67.10  ? 99  ASP D CB  1 
ATOM   3149 C  CG  . ASP D  1 40  ? 42.452  -9.334  74.884  1.00 70.47  ? 99  ASP D CG  1 
ATOM   3150 O  OD1 . ASP D  1 40  ? 41.787  -9.016  73.851  1.00 70.64  ? 99  ASP D OD1 1 
ATOM   3151 O  OD2 . ASP D  1 40  ? 42.052  -9.136  76.070  1.00 73.19  ? 99  ASP D OD2 1 
ATOM   3152 N  N   . ILE D  1 41  ? 44.859  -8.674  71.326  1.00 59.64  ? 100 ILE D N   1 
ATOM   3153 C  CA  . ILE D  1 41  ? 45.119  -7.402  70.638  1.00 56.83  ? 100 ILE D CA  1 
ATOM   3154 C  C   . ILE D  1 41  ? 44.177  -7.189  69.462  1.00 57.75  ? 100 ILE D C   1 
ATOM   3155 O  O   . ILE D  1 41  ? 44.315  -7.811  68.414  1.00 57.96  ? 100 ILE D O   1 
ATOM   3156 C  CB  . ILE D  1 41  ? 46.535  -7.330  70.082  1.00 54.02  ? 100 ILE D CB  1 
ATOM   3157 C  CG1 . ILE D  1 41  ? 47.565  -7.682  71.159  1.00 53.38  ? 100 ILE D CG1 1 
ATOM   3158 C  CG2 . ILE D  1 41  ? 46.791  -5.921  69.531  1.00 52.70  ? 100 ILE D CG2 1 
ATOM   3159 C  CD1 . ILE D  1 41  ? 48.943  -8.043  70.586  1.00 50.75  ? 100 ILE D CD1 1 
ATOM   3160 N  N   . ASP D  1 42  ? 43.238  -6.273  69.623  1.00 58.90  ? 101 ASP D N   1 
ATOM   3161 C  CA  . ASP D  1 42  ? 42.189  -6.091  68.632  1.00 60.38  ? 101 ASP D CA  1 
ATOM   3162 C  C   . ASP D  1 42  ? 42.734  -5.373  67.400  1.00 58.05  ? 101 ASP D C   1 
ATOM   3163 O  O   . ASP D  1 42  ? 43.506  -4.429  67.521  1.00 56.50  ? 101 ASP D O   1 
ATOM   3164 C  CB  . ASP D  1 42  ? 41.032  -5.290  69.251  1.00 63.20  ? 101 ASP D CB  1 
ATOM   3165 C  CG  . ASP D  1 42  ? 40.527  -5.899  70.598  1.00 67.37  ? 101 ASP D CG  1 
ATOM   3166 O  OD1 . ASP D  1 42  ? 40.947  -7.040  70.970  1.00 68.02  ? 101 ASP D OD1 1 
ATOM   3167 O  OD2 . ASP D  1 42  ? 39.701  -5.234  71.286  1.00 69.58  ? 101 ASP D OD2 1 
ATOM   3168 N  N   . GLY D  1 43  ? 42.356  -5.828  66.207  1.00 58.59  ? 102 GLY D N   1 
ATOM   3169 C  CA  . GLY D  1 43  ? 42.678  -5.111  64.966  1.00 57.06  ? 102 GLY D CA  1 
ATOM   3170 C  C   . GLY D  1 43  ? 44.052  -5.363  64.378  1.00 54.69  ? 102 GLY D C   1 
ATOM   3171 O  O   . GLY D  1 43  ? 44.312  -4.991  63.237  1.00 54.97  ? 102 GLY D O   1 
ATOM   3172 N  N   . PHE D  1 44  ? 44.919  -6.033  65.129  1.00 53.38  ? 103 PHE D N   1 
ATOM   3173 C  CA  . PHE D  1 44  ? 46.330  -6.182  64.768  1.00 51.17  ? 103 PHE D CA  1 
ATOM   3174 C  C   . PHE D  1 44  ? 46.528  -7.138  63.605  1.00 51.40  ? 103 PHE D C   1 
ATOM   3175 O  O   . PHE D  1 44  ? 46.141  -8.282  63.686  1.00 53.29  ? 103 PHE D O   1 
ATOM   3176 C  CB  . PHE D  1 44  ? 47.099  -6.706  65.991  1.00 50.57  ? 103 PHE D CB  1 
ATOM   3177 C  CG  . PHE D  1 44  ? 48.589  -6.603  65.873  1.00 48.26  ? 103 PHE D CG  1 
ATOM   3178 C  CD1 . PHE D  1 44  ? 49.252  -5.457  66.282  1.00 46.08  ? 103 PHE D CD1 1 
ATOM   3179 C  CD2 . PHE D  1 44  ? 49.329  -7.660  65.382  1.00 48.18  ? 103 PHE D CD2 1 
ATOM   3180 C  CE1 . PHE D  1 44  ? 50.627  -5.365  66.182  1.00 45.36  ? 103 PHE D CE1 1 
ATOM   3181 C  CE2 . PHE D  1 44  ? 50.701  -7.566  65.289  1.00 47.15  ? 103 PHE D CE2 1 
ATOM   3182 C  CZ  . PHE D  1 44  ? 51.349  -6.409  65.692  1.00 45.55  ? 103 PHE D CZ  1 
ATOM   3183 N  N   . GLY D  1 45  ? 47.129  -6.670  62.524  1.00 50.39  ? 104 GLY D N   1 
ATOM   3184 C  CA  . GLY D  1 45  ? 47.470  -7.528  61.392  1.00 50.90  ? 104 GLY D CA  1 
ATOM   3185 C  C   . GLY D  1 45  ? 46.344  -7.735  60.394  1.00 52.81  ? 104 GLY D C   1 
ATOM   3186 O  O   . GLY D  1 45  ? 46.146  -8.837  59.903  1.00 54.34  ? 104 GLY D O   1 
ATOM   3187 N  N   . ALA D  1 46  ? 45.614  -6.676  60.075  1.00 53.06  ? 105 ALA D N   1 
ATOM   3188 C  CA  . ALA D  1 46  ? 44.494  -6.757  59.129  1.00 55.32  ? 105 ALA D CA  1 
ATOM   3189 C  C   . ALA D  1 46  ? 44.862  -7.328  57.754  1.00 56.39  ? 105 ALA D C   1 
ATOM   3190 O  O   . ALA D  1 46  ? 44.133  -8.155  57.212  1.00 58.72  ? 105 ALA D O   1 
ATOM   3191 C  CB  . ALA D  1 46  ? 43.862  -5.394  58.964  1.00 55.31  ? 105 ALA D CB  1 
ATOM   3192 N  N   . CYS D  1 47  ? 45.993  -6.911  57.186  1.00 55.36  ? 106 CYS D N   1 
ATOM   3193 C  CA  . CYS D  1 47  ? 46.392  -7.395  55.843  1.00 56.82  ? 106 CYS D CA  1 
ATOM   3194 C  C   . CYS D  1 47  ? 47.035  -8.784  55.844  1.00 57.56  ? 106 CYS D C   1 
ATOM   3195 O  O   . CYS D  1 47  ? 47.451  -9.281  54.784  1.00 58.84  ? 106 CYS D O   1 
ATOM   3196 C  CB  . CYS D  1 47  ? 47.301  -6.376  55.128  1.00 55.82  ? 106 CYS D CB  1 
ATOM   3197 S  SG  . CYS D  1 47  ? 49.113  -6.436  55.436  1.00 55.74  ? 106 CYS D SG  1 
ATOM   3198 N  N   . GLU D  1 48  ? 47.114  -9.393  57.030  1.00 56.92  ? 107 GLU D N   1 
ATOM   3199 C  CA  . GLU D  1 48  ? 47.713  -10.710 57.217  1.00 57.87  ? 107 GLU D CA  1 
ATOM   3200 C  C   . GLU D  1 48  ? 49.161  -10.763 56.723  1.00 57.08  ? 107 GLU D C   1 
ATOM   3201 O  O   . GLU D  1 48  ? 49.611  -11.766 56.169  1.00 58.79  ? 107 GLU D O   1 
ATOM   3202 C  CB  . GLU D  1 48  ? 46.853  -11.803 56.573  1.00 61.14  ? 107 GLU D CB  1 
ATOM   3203 C  CG  . GLU D  1 48  ? 45.495  -11.934 57.251  1.00 62.98  ? 107 GLU D CG  1 
ATOM   3204 C  CD  . GLU D  1 48  ? 44.643  -13.073 56.694  1.00 67.80  ? 107 GLU D CD  1 
ATOM   3205 O  OE1 . GLU D  1 48  ? 44.299  -13.008 55.492  1.00 69.68  ? 107 GLU D OE1 1 
ATOM   3206 O  OE2 . GLU D  1 48  ? 44.290  -14.009 57.461  1.00 70.09  ? 107 GLU D OE2 1 
ATOM   3207 N  N   . GLY D  1 49  ? 49.883  -9.672  56.948  1.00 55.09  ? 108 GLY D N   1 
ATOM   3208 C  CA  . GLY D  1 49  ? 51.326  -9.637  56.713  1.00 54.82  ? 108 GLY D CA  1 
ATOM   3209 C  C   . GLY D  1 49  ? 51.726  -9.533  55.253  1.00 56.28  ? 108 GLY D C   1 
ATOM   3210 O  O   . GLY D  1 49  ? 52.771  -10.028 54.858  1.00 56.92  ? 108 GLY D O   1 
ATOM   3211 N  N   . THR D  1 50  ? 50.893  -8.884  54.449  1.00 56.95  ? 109 THR D N   1 
ATOM   3212 C  CA  . THR D  1 50  ? 51.219  -8.645  53.034  1.00 58.83  ? 109 THR D CA  1 
ATOM   3213 C  C   . THR D  1 50  ? 51.646  -7.192  52.729  1.00 57.92  ? 109 THR D C   1 
ATOM   3214 O  O   . THR D  1 50  ? 51.609  -6.765  51.580  1.00 59.65  ? 109 THR D O   1 
ATOM   3215 C  CB  . THR D  1 50  ? 50.043  -9.060  52.144  1.00 60.93  ? 109 THR D CB  1 
ATOM   3216 O  OG1 . THR D  1 50  ? 48.863  -8.348  52.541  1.00 60.49  ? 109 THR D OG1 1 
ATOM   3217 C  CG2 . THR D  1 50  ? 49.787  -10.536 52.294  1.00 62.41  ? 109 THR D CG2 1 
ATOM   3218 N  N   . LEU D  1 51  ? 52.078  -6.458  53.758  1.00 55.93  ? 110 LEU D N   1 
ATOM   3219 C  CA  . LEU D  1 51  ? 52.527  -5.056  53.628  1.00 55.54  ? 110 LEU D CA  1 
ATOM   3220 C  C   . LEU D  1 51  ? 51.499  -4.161  52.929  1.00 56.42  ? 110 LEU D C   1 
ATOM   3221 O  O   . LEU D  1 51  ? 51.809  -3.388  52.016  1.00 57.95  ? 110 LEU D O   1 
ATOM   3222 C  CB  . LEU D  1 51  ? 53.888  -4.964  52.926  1.00 57.00  ? 110 LEU D CB  1 
ATOM   3223 C  CG  . LEU D  1 51  ? 55.120  -5.105  53.827  1.00 56.23  ? 110 LEU D CG  1 
ATOM   3224 C  CD1 . LEU D  1 51  ? 56.380  -5.037  53.005  1.00 58.54  ? 110 LEU D CD1 1 
ATOM   3225 C  CD2 . LEU D  1 51  ? 55.143  -4.038  54.915  1.00 54.21  ? 110 LEU D CD2 1 
ATOM   3226 N  N   . ALA D  1 52  ? 50.262  -4.262  53.383  1.00 56.01  ? 111 ALA D N   1 
ATOM   3227 C  CA  . ALA D  1 52  ? 49.190  -3.478  52.807  1.00 57.03  ? 111 ALA D CA  1 
ATOM   3228 C  C   . ALA D  1 52  ? 48.364  -2.751  53.859  1.00 55.94  ? 111 ALA D C   1 
ATOM   3229 O  O   . ALA D  1 52  ? 47.430  -2.077  53.501  1.00 57.87  ? 111 ALA D O   1 
ATOM   3230 C  CB  . ALA D  1 52  ? 48.310  -4.365  51.953  1.00 58.71  ? 111 ALA D CB  1 
ATOM   3231 N  N   . CYS D  1 53  ? 48.686  -2.883  55.140  1.00 54.12  ? 112 CYS D N   1 
ATOM   3232 C  CA  . CYS D  1 53  ? 48.048  -2.086  56.197  1.00 53.53  ? 112 CYS D CA  1 
ATOM   3233 C  C   . CYS D  1 53  ? 49.123  -1.445  57.072  1.00 51.89  ? 112 CYS D C   1 
ATOM   3234 O  O   . CYS D  1 53  ? 50.305  -1.535  56.774  1.00 51.89  ? 112 CYS D O   1 
ATOM   3235 C  CB  . CYS D  1 53  ? 47.124  -2.967  57.045  1.00 53.27  ? 112 CYS D CB  1 
ATOM   3236 S  SG  . CYS D  1 53  ? 47.914  -4.282  57.981  1.00 53.75  ? 112 CYS D SG  1 
ATOM   3237 N  N   . SER D  1 54  ? 48.725  -0.775  58.136  1.00 51.16  ? 113 SER D N   1 
ATOM   3238 C  CA  . SER D  1 54  ? 49.713  -0.303  59.102  1.00 50.21  ? 113 SER D CA  1 
ATOM   3239 C  C   . SER D  1 54  ? 49.363  -0.806  60.503  1.00 48.96  ? 113 SER D C   1 
ATOM   3240 O  O   . SER D  1 54  ? 49.778  -0.216  61.505  1.00 48.38  ? 113 SER D O   1 
ATOM   3241 C  CB  . SER D  1 54  ? 49.762  1.230   59.102  1.00 51.21  ? 113 SER D CB  1 
ATOM   3242 O  OG  . SER D  1 54  ? 49.849  1.737   57.790  1.00 54.02  ? 113 SER D OG  1 
ATOM   3243 N  N   . THR D  1 55  ? 48.593  -1.885  60.574  1.00 41.52  ? 114 THR D N   1 
ATOM   3244 C  CA  . THR D  1 55  ? 47.993  -2.293  61.836  1.00 41.79  ? 114 THR D CA  1 
ATOM   3245 C  C   . THR D  1 55  ? 48.910  -3.157  62.679  1.00 42.28  ? 114 THR D C   1 
ATOM   3246 O  O   . THR D  1 55  ? 48.716  -3.256  63.866  1.00 42.42  ? 114 THR D O   1 
ATOM   3247 C  CB  . THR D  1 55  ? 46.699  -3.008  61.584  1.00 43.28  ? 114 THR D CB  1 
ATOM   3248 O  OG1 . THR D  1 55  ? 46.987  -4.190  60.851  1.00 44.88  ? 114 THR D OG1 1 
ATOM   3249 C  CG2 . THR D  1 55  ? 45.770  -2.134  60.763  1.00 41.93  ? 114 THR D CG2 1 
ATOM   3250 N  N   . CYS D  1 56  ? 49.936  -3.734  62.068  1.00 42.95  ? 115 CYS D N   1 
ATOM   3251 C  CA  . CYS D  1 56  ? 50.976  -4.473  62.802  1.00 43.65  ? 115 CYS D CA  1 
ATOM   3252 C  C   . CYS D  1 56  ? 52.065  -3.573  63.404  1.00 42.01  ? 115 CYS D C   1 
ATOM   3253 O  O   . CYS D  1 56  ? 53.078  -4.049  63.875  1.00 42.17  ? 115 CYS D O   1 
ATOM   3254 C  CB  . CYS D  1 56  ? 51.619  -5.511  61.899  1.00 45.30  ? 115 CYS D CB  1 
ATOM   3255 S  SG  . CYS D  1 56  ? 52.320  -4.848  60.456  1.00 45.61  ? 115 CYS D SG  1 
ATOM   3256 N  N   . HIS D  1 57  ? 51.830  -2.268  63.408  1.00 40.71  ? 116 HIS D N   1 
ATOM   3257 C  CA  . HIS D  1 57  ? 52.733  -1.299  64.012  1.00 39.32  ? 116 HIS D CA  1 
ATOM   3258 C  C   . HIS D  1 57  ? 53.118  -1.708  65.430  1.00 39.41  ? 116 HIS D C   1 
ATOM   3259 O  O   . HIS D  1 57  ? 52.267  -2.024  66.239  1.00 39.75  ? 116 HIS D O   1 
ATOM   3260 C  CB  . HIS D  1 57  ? 52.034  0.075   64.004  1.00 38.05  ? 116 HIS D CB  1 
ATOM   3261 C  CG  . HIS D  1 57  ? 52.856  1.196   64.543  1.00 36.82  ? 116 HIS D CG  1 
ATOM   3262 N  ND1 . HIS D  1 57  ? 52.298  2.401   64.907  1.00 34.94  ? 116 HIS D ND1 1 
ATOM   3263 C  CD2 . HIS D  1 57  ? 54.187  1.305   64.773  1.00 37.14  ? 116 HIS D CD2 1 
ATOM   3264 C  CE1 . HIS D  1 57  ? 53.248  3.211   65.333  1.00 35.61  ? 116 HIS D CE1 1 
ATOM   3265 N  NE2 . HIS D  1 57  ? 54.406  2.568   65.265  1.00 37.16  ? 116 HIS D NE2 1 
ATOM   3266 N  N   . LEU D  1 58  ? 54.416  -1.711  65.703  1.00 39.54  ? 117 LEU D N   1 
ATOM   3267 C  CA  . LEU D  1 58  ? 54.939  -1.942  67.053  1.00 39.68  ? 117 LEU D CA  1 
ATOM   3268 C  C   . LEU D  1 58  ? 56.067  -0.980  67.371  1.00 38.91  ? 117 LEU D C   1 
ATOM   3269 O  O   . LEU D  1 58  ? 56.739  -0.494  66.480  1.00 39.07  ? 117 LEU D O   1 
ATOM   3270 C  CB  . LEU D  1 58  ? 55.466  -3.372  67.170  1.00 40.97  ? 117 LEU D CB  1 
ATOM   3271 C  CG  . LEU D  1 58  ? 54.432  -4.497  67.253  1.00 41.89  ? 117 LEU D CG  1 
ATOM   3272 C  CD1 . LEU D  1 58  ? 55.076  -5.832  67.051  1.00 41.98  ? 117 LEU D CD1 1 
ATOM   3273 C  CD2 . LEU D  1 58  ? 53.693  -4.432  68.582  1.00 42.34  ? 117 LEU D CD2 1 
ATOM   3274 N  N   . ILE D  1 59  ? 56.274  -0.716  68.650  1.00 39.00  ? 118 ILE D N   1 
ATOM   3275 C  CA  . ILE D  1 59  ? 57.380  0.113   69.101  1.00 38.63  ? 118 ILE D CA  1 
ATOM   3276 C  C   . ILE D  1 59  ? 58.419  -0.775  69.813  1.00 39.40  ? 118 ILE D C   1 
ATOM   3277 O  O   . ILE D  1 59  ? 58.065  -1.623  70.604  1.00 39.84  ? 118 ILE D O   1 
ATOM   3278 C  CB  . ILE D  1 59  ? 56.891  1.177   70.047  1.00 38.22  ? 118 ILE D CB  1 
ATOM   3279 C  CG1 . ILE D  1 59  ? 55.995  2.148   69.299  1.00 37.95  ? 118 ILE D CG1 1 
ATOM   3280 C  CG2 . ILE D  1 59  ? 58.041  1.927   70.629  1.00 38.02  ? 118 ILE D CG2 1 
ATOM   3281 C  CD1 . ILE D  1 59  ? 55.279  3.072   70.209  1.00 38.43  ? 118 ILE D CD1 1 
ATOM   3282 N  N   . PHE D  1 60  ? 59.696  -0.564  69.510  1.00 39.34  ? 119 PHE D N   1 
ATOM   3283 C  CA  . PHE D  1 60  ? 60.767  -1.417  69.975  1.00 40.08  ? 119 PHE D CA  1 
ATOM   3284 C  C   . PHE D  1 60  ? 61.748  -0.731  70.948  1.00 40.22  ? 119 PHE D C   1 
ATOM   3285 O  O   . PHE D  1 60  ? 61.920  0.502   70.970  1.00 39.41  ? 119 PHE D O   1 
ATOM   3286 C  CB  . PHE D  1 60  ? 61.549  -1.950  68.784  1.00 40.71  ? 119 PHE D CB  1 
ATOM   3287 C  CG  . PHE D  1 60  ? 60.788  -2.934  67.950  1.00 41.19  ? 119 PHE D CG  1 
ATOM   3288 C  CD1 . PHE D  1 60  ? 61.068  -4.290  68.018  1.00 42.19  ? 119 PHE D CD1 1 
ATOM   3289 C  CD2 . PHE D  1 60  ? 59.793  -2.493  67.076  1.00 40.75  ? 119 PHE D CD2 1 
ATOM   3290 C  CE1 . PHE D  1 60  ? 60.375  -5.202  67.239  1.00 43.16  ? 119 PHE D CE1 1 
ATOM   3291 C  CE2 . PHE D  1 60  ? 59.089  -3.400  66.299  1.00 41.66  ? 119 PHE D CE2 1 
ATOM   3292 C  CZ  . PHE D  1 60  ? 59.384  -4.764  66.388  1.00 43.28  ? 119 PHE D CZ  1 
ATOM   3293 N  N   . GLU D  1 61  ? 62.391  -1.561  71.764  1.00 40.86  ? 120 GLU D N   1 
ATOM   3294 C  CA  . GLU D  1 61  ? 63.455  -1.089  72.637  1.00 41.47  ? 120 GLU D CA  1 
ATOM   3295 C  C   . GLU D  1 61  ? 64.660  -0.594  71.815  1.00 41.39  ? 120 GLU D C   1 
ATOM   3296 O  O   . GLU D  1 61  ? 65.004  -1.160  70.770  1.00 40.82  ? 120 GLU D O   1 
ATOM   3297 C  CB  . GLU D  1 61  ? 63.934  -2.222  73.555  1.00 42.67  ? 120 GLU D CB  1 
ATOM   3298 C  CG  . GLU D  1 61  ? 62.893  -2.760  74.514  1.00 43.66  ? 120 GLU D CG  1 
ATOM   3299 C  CD  . GLU D  1 61  ? 63.461  -3.704  75.548  1.00 44.74  ? 120 GLU D CD  1 
ATOM   3300 O  OE1 . GLU D  1 61  ? 64.349  -3.267  76.323  1.00 45.58  ? 120 GLU D OE1 1 
ATOM   3301 O  OE2 . GLU D  1 61  ? 63.015  -4.875  75.589  1.00 44.92  ? 120 GLU D OE2 1 
ATOM   3302 N  N   . ASP D  1 62  ? 65.303  0.444   72.322  1.00 41.67  ? 121 ASP D N   1 
ATOM   3303 C  CA  . ASP D  1 62  ? 66.452  1.048   71.658  1.00 42.65  ? 121 ASP D CA  1 
ATOM   3304 C  C   . ASP D  1 62  ? 67.406  0.000   71.051  1.00 43.37  ? 121 ASP D C   1 
ATOM   3305 O  O   . ASP D  1 62  ? 67.633  -0.035  69.835  1.00 43.36  ? 121 ASP D O   1 
ATOM   3306 C  CB  . ASP D  1 62  ? 67.233  1.896   72.664  1.00 43.48  ? 121 ASP D CB  1 
ATOM   3307 C  CG  . ASP D  1 62  ? 66.477  3.164   73.090  1.00 45.23  ? 121 ASP D CG  1 
ATOM   3308 O  OD1 . ASP D  1 62  ? 65.435  3.525   72.477  1.00 44.89  ? 121 ASP D OD1 1 
ATOM   3309 O  OD2 . ASP D  1 62  ? 66.939  3.808   74.075  1.00 48.41  ? 121 ASP D OD2 1 
ATOM   3310 N  N   . HIS D  1 63  ? 67.949  -0.865  71.899  1.00 43.72  ? 122 HIS D N   1 
ATOM   3311 C  CA  . HIS D  1 63  ? 69.028  -1.766  71.465  1.00 44.91  ? 122 HIS D CA  1 
ATOM   3312 C  C   . HIS D  1 63  ? 68.590  -2.852  70.500  1.00 44.84  ? 122 HIS D C   1 
ATOM   3313 O  O   . HIS D  1 63  ? 69.418  -3.404  69.796  1.00 46.35  ? 122 HIS D O   1 
ATOM   3314 C  CB  . HIS D  1 63  ? 69.747  -2.386  72.675  1.00 45.61  ? 122 HIS D CB  1 
ATOM   3315 C  CG  . HIS D  1 63  ? 68.976  -3.478  73.334  1.00 46.21  ? 122 HIS D CG  1 
ATOM   3316 N  ND1 . HIS D  1 63  ? 67.986  -3.231  74.259  1.00 46.11  ? 122 HIS D ND1 1 
ATOM   3317 C  CD2 . HIS D  1 63  ? 69.022  -4.821  73.184  1.00 47.59  ? 122 HIS D CD2 1 
ATOM   3318 C  CE1 . HIS D  1 63  ? 67.461  -4.378  74.656  1.00 46.38  ? 122 HIS D CE1 1 
ATOM   3319 N  NE2 . HIS D  1 63  ? 68.077  -5.358  74.023  1.00 46.88  ? 122 HIS D NE2 1 
ATOM   3320 N  N   . ILE D  1 64  ? 67.305  -3.162  70.484  1.00 43.93  ? 123 ILE D N   1 
ATOM   3321 C  CA  . ILE D  1 64  ? 66.733  -4.088  69.522  1.00 44.41  ? 123 ILE D CA  1 
ATOM   3322 C  C   . ILE D  1 64  ? 66.537  -3.398  68.175  1.00 44.58  ? 123 ILE D C   1 
ATOM   3323 O  O   . ILE D  1 64  ? 66.899  -3.945  67.121  1.00 45.50  ? 123 ILE D O   1 
ATOM   3324 C  CB  . ILE D  1 64  ? 65.381  -4.622  70.023  1.00 43.92  ? 123 ILE D CB  1 
ATOM   3325 C  CG1 . ILE D  1 64  ? 65.579  -5.436  71.327  1.00 45.45  ? 123 ILE D CG1 1 
ATOM   3326 C  CG2 . ILE D  1 64  ? 64.707  -5.464  68.977  1.00 44.20  ? 123 ILE D CG2 1 
ATOM   3327 C  CD1 . ILE D  1 64  ? 66.454  -6.715  71.193  1.00 45.83  ? 123 ILE D CD1 1 
ATOM   3328 N  N   . TYR D  1 65  ? 65.941  -2.201  68.222  1.00 43.67  ? 124 TYR D N   1 
ATOM   3329 C  CA  . TYR D  1 65  ? 65.625  -1.420  67.036  1.00 43.35  ? 124 TYR D CA  1 
ATOM   3330 C  C   . TYR D  1 65  ? 66.867  -1.237  66.185  1.00 44.84  ? 124 TYR D C   1 
ATOM   3331 O  O   . TYR D  1 65  ? 66.857  -1.474  64.982  1.00 45.93  ? 124 TYR D O   1 
ATOM   3332 C  CB  . TYR D  1 65  ? 65.081  -0.054  67.450  1.00 42.20  ? 124 TYR D CB  1 
ATOM   3333 C  CG  . TYR D  1 65  ? 64.713  0.864   66.298  1.00 41.93  ? 124 TYR D CG  1 
ATOM   3334 C  CD1 . TYR D  1 65  ? 63.502  0.734   65.626  1.00 41.11  ? 124 TYR D CD1 1 
ATOM   3335 C  CD2 . TYR D  1 65  ? 65.573  1.855   65.889  1.00 43.01  ? 124 TYR D CD2 1 
ATOM   3336 C  CE1 . TYR D  1 65  ? 63.181  1.560   64.572  1.00 40.51  ? 124 TYR D CE1 1 
ATOM   3337 C  CE2 . TYR D  1 65  ? 65.253  2.680   64.843  1.00 42.50  ? 124 TYR D CE2 1 
ATOM   3338 C  CZ  . TYR D  1 65  ? 64.066  2.523   64.199  1.00 41.19  ? 124 TYR D CZ  1 
ATOM   3339 O  OH  . TYR D  1 65  ? 63.801  3.369   63.201  1.00 41.45  ? 124 TYR D OH  1 
ATOM   3340 N  N   . GLU D  1 66  ? 67.936  -0.817  66.846  1.00 45.17  ? 125 GLU D N   1 
ATOM   3341 C  CA  . GLU D  1 66  ? 69.233  -0.588  66.223  1.00 46.59  ? 125 GLU D CA  1 
ATOM   3342 C  C   . GLU D  1 66  ? 69.739  -1.751  65.363  1.00 48.24  ? 125 GLU D C   1 
ATOM   3343 O  O   . GLU D  1 66  ? 70.483  -1.541  64.394  1.00 49.19  ? 125 GLU D O   1 
ATOM   3344 C  CB  . GLU D  1 66  ? 70.222  -0.333  67.343  1.00 46.91  ? 125 GLU D CB  1 
ATOM   3345 C  CG  . GLU D  1 66  ? 71.628  -0.144  66.933  1.00 49.35  ? 125 GLU D CG  1 
ATOM   3346 C  CD  . GLU D  1 66  ? 72.486  0.218   68.111  1.00 50.86  ? 125 GLU D CD  1 
ATOM   3347 O  OE1 . GLU D  1 66  ? 73.264  1.202   67.957  1.00 51.70  ? 125 GLU D OE1 1 
ATOM   3348 O  OE2 . GLU D  1 66  ? 72.357  -0.471  69.175  1.00 50.16  ? 125 GLU D OE2 1 
ATOM   3349 N  N   . LYS D  1 67  ? 69.338  -2.970  65.720  1.00 48.13  ? 126 LYS D N   1 
ATOM   3350 C  CA  . LYS D  1 67  ? 69.870  -4.163  65.088  1.00 50.01  ? 126 LYS D CA  1 
ATOM   3351 C  C   . LYS D  1 67  ? 68.959  -4.786  64.038  1.00 50.24  ? 126 LYS D C   1 
ATOM   3352 O  O   . LYS D  1 67  ? 69.318  -5.797  63.431  1.00 51.74  ? 126 LYS D O   1 
ATOM   3353 C  CB  . LYS D  1 67  ? 70.206  -5.185  66.167  1.00 50.36  ? 126 LYS D CB  1 
ATOM   3354 C  CG  . LYS D  1 67  ? 71.333  -4.727  67.090  1.00 51.67  ? 126 LYS D CG  1 
ATOM   3355 C  CD  . LYS D  1 67  ? 72.565  -4.192  66.315  1.00 54.09  ? 126 LYS D CD  1 
ATOM   3356 C  CE  . LYS D  1 67  ? 73.835  -4.324  67.151  1.00 55.49  ? 126 LYS D CE  1 
ATOM   3357 N  NZ  . LYS D  1 67  ? 75.025  -3.757  66.463  1.00 56.68  ? 126 LYS D NZ  1 
ATOM   3358 N  N   . LEU D  1 68  ? 67.788  -4.192  63.824  1.00 48.74  ? 127 LEU D N   1 
ATOM   3359 C  CA  . LEU D  1 68  ? 66.796  -4.777  62.933  1.00 48.99  ? 127 LEU D CA  1 
ATOM   3360 C  C   . LEU D  1 68  ? 67.227  -4.668  61.491  1.00 50.53  ? 127 LEU D C   1 
ATOM   3361 O  O   . LEU D  1 68  ? 68.024  -3.792  61.155  1.00 50.93  ? 127 LEU D O   1 
ATOM   3362 C  CB  . LEU D  1 68  ? 65.457  -4.090  63.122  1.00 47.23  ? 127 LEU D CB  1 
ATOM   3363 C  CG  . LEU D  1 68  ? 64.838  -4.294  64.488  1.00 46.01  ? 127 LEU D CG  1 
ATOM   3364 C  CD1 . LEU D  1 68  ? 63.521  -3.565  64.517  1.00 44.24  ? 127 LEU D CD1 1 
ATOM   3365 C  CD2 . LEU D  1 68  ? 64.650  -5.794  64.754  1.00 46.19  ? 127 LEU D CD2 1 
ATOM   3366 N  N   . ASP D  1 69  ? 66.731  -5.566  60.646  1.00 51.79  ? 128 ASP D N   1 
ATOM   3367 C  CA  . ASP D  1 69  ? 67.099  -5.544  59.228  1.00 54.34  ? 128 ASP D CA  1 
ATOM   3368 C  C   . ASP D  1 69  ? 66.720  -4.189  58.651  1.00 53.39  ? 128 ASP D C   1 
ATOM   3369 O  O   . ASP D  1 69  ? 65.672  -3.630  58.999  1.00 51.88  ? 128 ASP D O   1 
ATOM   3370 C  CB  . ASP D  1 69  ? 66.391  -6.638  58.419  1.00 55.96  ? 128 ASP D CB  1 
ATOM   3371 C  CG  . ASP D  1 69  ? 66.798  -8.071  58.831  1.00 58.86  ? 128 ASP D CG  1 
ATOM   3372 O  OD1 . ASP D  1 69  ? 67.920  -8.298  59.373  1.00 59.95  ? 128 ASP D OD1 1 
ATOM   3373 O  OD2 . ASP D  1 69  ? 65.975  -8.992  58.597  1.00 60.31  ? 128 ASP D OD2 1 
ATOM   3374 N  N   . ALA D  1 70  ? 67.577  -3.660  57.783  1.00 54.97  ? 129 ALA D N   1 
ATOM   3375 C  CA  . ALA D  1 70  ? 67.309  -2.396  57.116  1.00 54.51  ? 129 ALA D CA  1 
ATOM   3376 C  C   . ALA D  1 70  ? 65.888  -2.404  56.532  1.00 53.55  ? 129 ALA D C   1 
ATOM   3377 O  O   . ALA D  1 70  ? 65.453  -3.404  55.961  1.00 54.92  ? 129 ALA D O   1 
ATOM   3378 C  CB  . ALA D  1 70  ? 68.350  -2.151  56.022  1.00 56.90  ? 129 ALA D CB  1 
ATOM   3379 N  N   . ILE D  1 71  ? 65.170  -1.299  56.713  1.00 51.38  ? 130 ILE D N   1 
ATOM   3380 C  CA  . ILE D  1 71  ? 63.775  -1.199  56.297  1.00 50.43  ? 130 ILE D CA  1 
ATOM   3381 C  C   . ILE D  1 71  ? 63.615  -1.077  54.769  1.00 52.19  ? 130 ILE D C   1 
ATOM   3382 O  O   . ILE D  1 71  ? 64.221  -0.200  54.159  1.00 53.47  ? 130 ILE D O   1 
ATOM   3383 C  CB  . ILE D  1 71  ? 63.094  0.012   56.990  1.00 47.99  ? 130 ILE D CB  1 
ATOM   3384 C  CG1 . ILE D  1 71  ? 61.623  0.059   56.616  1.00 47.24  ? 130 ILE D CG1 1 
ATOM   3385 C  CG2 . ILE D  1 71  ? 63.795  1.332   56.632  1.00 48.31  ? 130 ILE D CG2 1 
ATOM   3386 C  CD1 . ILE D  1 71  ? 60.848  0.937   57.476  1.00 45.72  ? 130 ILE D CD1 1 
ATOM   3387 N  N   . THR D  1 72  ? 62.804  -1.933  54.152  1.00 52.74  ? 131 THR D N   1 
ATOM   3388 C  CA  . THR D  1 72  ? 62.626  -1.858  52.697  1.00 54.48  ? 131 THR D CA  1 
ATOM   3389 C  C   . THR D  1 72  ? 61.733  -0.687  52.299  1.00 53.10  ? 131 THR D C   1 
ATOM   3390 O  O   . THR D  1 72  ? 61.016  -0.114  53.118  1.00 51.12  ? 131 THR D O   1 
ATOM   3391 C  CB  . THR D  1 72  ? 62.044  -3.156  52.079  1.00 56.29  ? 131 THR D CB  1 
ATOM   3392 O  OG1 . THR D  1 72  ? 60.661  -3.303  52.420  1.00 54.08  ? 131 THR D OG1 1 
ATOM   3393 C  CG2 . THR D  1 72  ? 62.846  -4.387  52.515  1.00 57.15  ? 131 THR D CG2 1 
ATOM   3394 N  N   . ASP D  1 73  ? 61.788  -0.313  51.035  1.00 54.99  ? 132 ASP D N   1 
ATOM   3395 C  CA  . ASP D  1 73  ? 60.914  0.749   50.531  1.00 54.09  ? 132 ASP D CA  1 
ATOM   3396 C  C   . ASP D  1 73  ? 59.440  0.385   50.731  1.00 52.35  ? 132 ASP D C   1 
ATOM   3397 O  O   . ASP D  1 73  ? 58.625  1.201   51.169  1.00 50.16  ? 132 ASP D O   1 
ATOM   3398 C  CB  . ASP D  1 73  ? 61.193  0.987   49.044  1.00 56.90  ? 132 ASP D CB  1 
ATOM   3399 C  CG  . ASP D  1 73  ? 62.476  1.809   48.807  1.00 59.53  ? 132 ASP D CG  1 
ATOM   3400 O  OD1 . ASP D  1 73  ? 62.783  2.687   49.656  1.00 58.04  ? 132 ASP D OD1 1 
ATOM   3401 O  OD2 . ASP D  1 73  ? 63.168  1.588   47.777  1.00 63.05  ? 132 ASP D OD2 1 
ATOM   3402 N  N   . GLU D  1 74  ? 59.112  -0.854  50.393  1.00 53.72  ? 133 GLU D N   1 
ATOM   3403 C  CA  . GLU D  1 74  ? 57.789  -1.382  50.613  1.00 52.70  ? 133 GLU D CA  1 
ATOM   3404 C  C   . GLU D  1 74  ? 57.326  -1.154  52.042  1.00 50.22  ? 133 GLU D C   1 
ATOM   3405 O  O   . GLU D  1 74  ? 56.261  -0.563  52.257  1.00 48.87  ? 133 GLU D O   1 
ATOM   3406 C  CB  . GLU D  1 74  ? 57.756  -2.878  50.314  1.00 55.06  ? 133 GLU D CB  1 
ATOM   3407 C  CG  . GLU D  1 74  ? 57.049  -3.238  49.026  1.00 58.13  ? 133 GLU D CG  1 
ATOM   3408 C  CD  . GLU D  1 74  ? 56.603  -4.708  48.998  1.00 62.02  ? 133 GLU D CD  1 
ATOM   3409 O  OE1 . GLU D  1 74  ? 57.488  -5.603  48.835  1.00 64.45  ? 133 GLU D OE1 1 
ATOM   3410 O  OE2 . GLU D  1 74  ? 55.360  -4.948  49.132  1.00 61.49  ? 133 GLU D OE2 1 
ATOM   3411 N  N   . GLU D  1 75  ? 58.097  -1.621  53.022  1.00 49.85  ? 134 GLU D N   1 
ATOM   3412 C  CA  . GLU D  1 75  ? 57.698  -1.415  54.407  1.00 47.53  ? 134 GLU D CA  1 
ATOM   3413 C  C   . GLU D  1 75  ? 57.540  0.062   54.700  1.00 45.52  ? 134 GLU D C   1 
ATOM   3414 O  O   . GLU D  1 75  ? 56.601  0.485   55.369  1.00 43.83  ? 134 GLU D O   1 
ATOM   3415 C  CB  . GLU D  1 75  ? 58.684  -2.028  55.409  1.00 47.56  ? 134 GLU D CB  1 
ATOM   3416 C  CG  . GLU D  1 75  ? 58.263  -1.767  56.879  1.00 45.45  ? 134 GLU D CG  1 
ATOM   3417 C  CD  . GLU D  1 75  ? 59.136  -2.454  57.920  1.00 46.09  ? 134 GLU D CD  1 
ATOM   3418 O  OE1 . GLU D  1 75  ? 59.949  -3.354  57.565  1.00 48.50  ? 134 GLU D OE1 1 
ATOM   3419 O  OE2 . GLU D  1 75  ? 59.015  -2.095  59.111  1.00 43.47  ? 134 GLU D OE2 1 
ATOM   3420 N  N   . ASN D  1 76  ? 58.469  0.859   54.216  1.00 46.04  ? 135 ASN D N   1 
ATOM   3421 C  CA  . ASN D  1 76  ? 58.465  2.259   54.594  1.00 44.87  ? 135 ASN D CA  1 
ATOM   3422 C  C   . ASN D  1 76  ? 57.208  2.987   54.124  1.00 43.90  ? 135 ASN D C   1 
ATOM   3423 O  O   . ASN D  1 76  ? 56.682  3.870   54.808  1.00 42.39  ? 135 ASN D O   1 
ATOM   3424 C  CB  . ASN D  1 76  ? 59.706  2.934   54.043  1.00 46.70  ? 135 ASN D CB  1 
ATOM   3425 C  CG  . ASN D  1 76  ? 60.063  4.189   54.811  1.00 47.16  ? 135 ASN D CG  1 
ATOM   3426 O  OD1 . ASN D  1 76  ? 60.488  4.122   55.977  1.00 48.23  ? 135 ASN D OD1 1 
ATOM   3427 N  ND2 . ASN D  1 76  ? 59.881  5.347   54.173  1.00 47.22  ? 135 ASN D ND2 1 
ATOM   3428 N  N   . ASP D  1 77  ? 56.728  2.611   52.942  1.00 45.25  ? 136 ASP D N   1 
ATOM   3429 C  CA  . ASP D  1 77  ? 55.492  3.154   52.405  1.00 44.58  ? 136 ASP D CA  1 
ATOM   3430 C  C   . ASP D  1 77  ? 54.337  2.968   53.392  1.00 42.72  ? 136 ASP D C   1 
ATOM   3431 O  O   . ASP D  1 77  ? 53.610  3.919   53.701  1.00 41.43  ? 136 ASP D O   1 
ATOM   3432 C  CB  . ASP D  1 77  ? 55.171  2.489   51.053  1.00 46.70  ? 136 ASP D CB  1 
ATOM   3433 C  CG  . ASP D  1 77  ? 56.046  3.028   49.905  1.00 49.37  ? 136 ASP D CG  1 
ATOM   3434 O  OD1 . ASP D  1 77  ? 56.579  4.164   50.052  1.00 49.57  ? 136 ASP D OD1 1 
ATOM   3435 O  OD2 . ASP D  1 77  ? 56.190  2.332   48.858  1.00 52.37  ? 136 ASP D OD2 1 
ATOM   3436 N  N   . MET D  1 78  ? 54.185  1.751   53.901  1.00 42.71  ? 137 MET D N   1 
ATOM   3437 C  CA  . MET D  1 78  ? 53.092  1.450   54.823  1.00 41.53  ? 137 MET D CA  1 
ATOM   3438 C  C   . MET D  1 78  ? 53.366  2.027   56.195  1.00 39.84  ? 137 MET D C   1 
ATOM   3439 O  O   . MET D  1 78  ? 52.450  2.484   56.874  1.00 38.62  ? 137 MET D O   1 
ATOM   3440 C  CB  . MET D  1 78  ? 52.851  -0.054  54.909  1.00 42.65  ? 137 MET D CB  1 
ATOM   3441 C  CG  . MET D  1 78  ? 52.421  -0.677  53.585  1.00 44.85  ? 137 MET D CG  1 
ATOM   3442 S  SD  . MET D  1 78  ? 50.875  0.020   52.936  1.00 47.53  ? 137 MET D SD  1 
ATOM   3443 C  CE  . MET D  1 78  ? 51.437  1.253   51.788  1.00 44.33  ? 137 MET D CE  1 
ATOM   3444 N  N   . LEU D  1 79  ? 54.628  2.050   56.586  1.00 40.23  ? 138 LEU D N   1 
ATOM   3445 C  CA  . LEU D  1 79  ? 54.987  2.555   57.901  1.00 39.20  ? 138 LEU D CA  1 
ATOM   3446 C  C   . LEU D  1 79  ? 54.731  4.052   58.002  1.00 38.27  ? 138 LEU D C   1 
ATOM   3447 O  O   . LEU D  1 79  ? 54.437  4.556   59.095  1.00 37.29  ? 138 LEU D O   1 
ATOM   3448 C  CB  . LEU D  1 79  ? 56.449  2.241   58.212  1.00 39.93  ? 138 LEU D CB  1 
ATOM   3449 C  CG  . LEU D  1 79  ? 56.962  2.599   59.618  1.00 39.28  ? 138 LEU D CG  1 
ATOM   3450 C  CD1 . LEU D  1 79  ? 56.186  1.933   60.761  1.00 37.05  ? 138 LEU D CD1 1 
ATOM   3451 C  CD2 . LEU D  1 79  ? 58.481  2.275   59.693  1.00 38.57  ? 138 LEU D CD2 1 
ATOM   3452 N  N   . ASP D  1 80  ? 54.847  4.768   56.878  1.00 38.78  ? 139 ASP D N   1 
ATOM   3453 C  CA  . ASP D  1 80  ? 54.520  6.197   56.866  1.00 38.27  ? 139 ASP D CA  1 
ATOM   3454 C  C   . ASP D  1 80  ? 53.094  6.439   57.277  1.00 37.09  ? 139 ASP D C   1 
ATOM   3455 O  O   . ASP D  1 80  ? 52.793  7.479   57.873  1.00 36.43  ? 139 ASP D O   1 
ATOM   3456 C  CB  . ASP D  1 80  ? 54.696  6.811   55.482  1.00 39.52  ? 139 ASP D CB  1 
ATOM   3457 C  CG  . ASP D  1 80  ? 56.060  7.433   55.263  1.00 42.23  ? 139 ASP D CG  1 
ATOM   3458 O  OD1 . ASP D  1 80  ? 56.859  7.638   56.217  1.00 43.00  ? 139 ASP D OD1 1 
ATOM   3459 O  OD2 . ASP D  1 80  ? 56.333  7.742   54.070  1.00 45.95  ? 139 ASP D OD2 1 
ATOM   3460 N  N   . LEU D  1 81  ? 52.220  5.490   56.952  1.00 36.97  ? 140 LEU D N   1 
ATOM   3461 C  CA  . LEU D  1 81  ? 50.806  5.614   57.259  1.00 36.53  ? 140 LEU D CA  1 
ATOM   3462 C  C   . LEU D  1 81  ? 50.436  5.109   58.655  1.00 36.45  ? 140 LEU D C   1 
ATOM   3463 O  O   . LEU D  1 81  ? 49.254  5.129   59.024  1.00 36.69  ? 140 LEU D O   1 
ATOM   3464 C  CB  . LEU D  1 81  ? 49.965  4.889   56.201  1.00 37.01  ? 140 LEU D CB  1 
ATOM   3465 C  CG  . LEU D  1 81  ? 50.162  5.394   54.760  1.00 38.06  ? 140 LEU D CG  1 
ATOM   3466 C  CD1 . LEU D  1 81  ? 49.382  4.553   53.815  1.00 37.73  ? 140 LEU D CD1 1 
ATOM   3467 C  CD2 . LEU D  1 81  ? 49.805  6.862   54.597  1.00 35.83  ? 140 LEU D CD2 1 
ATOM   3468 N  N   . ALA D  1 82  ? 51.410  4.649   59.433  1.00 36.37  ? 141 ALA D N   1 
ATOM   3469 C  CA  . ALA D  1 82  ? 51.110  4.240   60.802  1.00 36.22  ? 141 ALA D CA  1 
ATOM   3470 C  C   . ALA D  1 82  ? 50.675  5.444   61.612  1.00 35.23  ? 141 ALA D C   1 
ATOM   3471 O  O   . ALA D  1 82  ? 51.279  6.495   61.526  1.00 34.73  ? 141 ALA D O   1 
ATOM   3472 C  CB  . ALA D  1 82  ? 52.313  3.584   61.453  1.00 36.37  ? 141 ALA D CB  1 
ATOM   3473 N  N   . TYR D  1 83  ? 49.605  5.292   62.370  1.00 35.23  ? 142 TYR D N   1 
ATOM   3474 C  CA  . TYR D  1 83  ? 49.193  6.340   63.276  1.00 35.25  ? 142 TYR D CA  1 
ATOM   3475 C  C   . TYR D  1 83  ? 50.080  6.361   64.523  1.00 35.44  ? 142 TYR D C   1 
ATOM   3476 O  O   . TYR D  1 83  ? 50.303  5.344   65.153  1.00 35.44  ? 142 TYR D O   1 
ATOM   3477 C  CB  . TYR D  1 83  ? 47.754  6.173   63.730  1.00 35.88  ? 142 TYR D CB  1 
ATOM   3478 C  CG  . TYR D  1 83  ? 47.319  7.326   64.635  1.00 36.20  ? 142 TYR D CG  1 
ATOM   3479 C  CD1 . TYR D  1 83  ? 46.896  8.532   64.091  1.00 35.14  ? 142 TYR D CD1 1 
ATOM   3480 C  CD2 . TYR D  1 83  ? 47.348  7.210   66.035  1.00 36.21  ? 142 TYR D CD2 1 
ATOM   3481 C  CE1 . TYR D  1 83  ? 46.521  9.587   64.901  1.00 35.09  ? 142 TYR D CE1 1 
ATOM   3482 C  CE2 . TYR D  1 83  ? 46.961  8.262   66.853  1.00 36.70  ? 142 TYR D CE2 1 
ATOM   3483 C  CZ  . TYR D  1 83  ? 46.561  9.446   66.282  1.00 36.33  ? 142 TYR D CZ  1 
ATOM   3484 O  OH  . TYR D  1 83  ? 46.188  10.471  67.116  1.00 38.79  ? 142 TYR D OH  1 
ATOM   3485 N  N   . GLY D  1 84  ? 50.544  7.555   64.872  1.00 35.67  ? 143 GLY D N   1 
ATOM   3486 C  CA  . GLY D  1 84  ? 51.500  7.781   65.944  1.00 35.78  ? 143 GLY D CA  1 
ATOM   3487 C  C   . GLY D  1 84  ? 52.891  7.223   65.675  1.00 35.80  ? 143 GLY D C   1 
ATOM   3488 O  O   . GLY D  1 84  ? 53.528  6.706   66.583  1.00 36.51  ? 143 GLY D O   1 
ATOM   3489 N  N   . LEU D  1 85  ? 53.365  7.333   64.435  1.00 35.90  ? 144 LEU D N   1 
ATOM   3490 C  CA  . LEU D  1 85  ? 54.704  6.843   64.040  1.00 36.30  ? 144 LEU D CA  1 
ATOM   3491 C  C   . LEU D  1 85  ? 55.790  7.413   64.925  1.00 36.51  ? 144 LEU D C   1 
ATOM   3492 O  O   . LEU D  1 85  ? 55.811  8.607   65.180  1.00 37.47  ? 144 LEU D O   1 
ATOM   3493 C  CB  . LEU D  1 85  ? 54.999  7.251   62.596  1.00 36.48  ? 144 LEU D CB  1 
ATOM   3494 C  CG  . LEU D  1 85  ? 56.319  6.861   61.944  1.00 36.80  ? 144 LEU D CG  1 
ATOM   3495 C  CD1 . LEU D  1 85  ? 56.406  5.370   61.827  1.00 35.70  ? 144 LEU D CD1 1 
ATOM   3496 C  CD2 . LEU D  1 85  ? 56.414  7.528   60.562  1.00 35.59  ? 144 LEU D CD2 1 
ATOM   3497 N  N   . THR D  1 86  ? 56.692  6.557   65.379  1.00 36.54  ? 145 THR D N   1 
ATOM   3498 C  CA  . THR D  1 86  ? 57.798  6.966   66.262  1.00 36.98  ? 145 THR D CA  1 
ATOM   3499 C  C   . THR D  1 86  ? 59.133  6.620   65.630  1.00 37.50  ? 145 THR D C   1 
ATOM   3500 O  O   . THR D  1 86  ? 59.214  5.859   64.665  1.00 37.29  ? 145 THR D O   1 
ATOM   3501 C  CB  . THR D  1 86  ? 57.777  6.229   67.625  1.00 37.11  ? 145 THR D CB  1 
ATOM   3502 O  OG1 . THR D  1 86  ? 58.211  4.871   67.453  1.00 36.30  ? 145 THR D OG1 1 
ATOM   3503 C  CG2 . THR D  1 86  ? 56.392  6.256   68.242  1.00 35.78  ? 145 THR D CG2 1 
ATOM   3504 N  N   . ASP D  1 87  ? 60.187  7.148   66.212  1.00 38.27  ? 146 ASP D N   1 
ATOM   3505 C  CA  . ASP D  1 87  ? 61.538  6.795   65.772  1.00 39.07  ? 146 ASP D CA  1 
ATOM   3506 C  C   . ASP D  1 87  ? 62.000  5.417   66.277  1.00 38.99  ? 146 ASP D C   1 
ATOM   3507 O  O   . ASP D  1 87  ? 63.171  5.079   66.138  1.00 39.88  ? 146 ASP D O   1 
ATOM   3508 C  CB  . ASP D  1 87  ? 62.522  7.870   66.208  1.00 39.78  ? 146 ASP D CB  1 
ATOM   3509 C  CG  . ASP D  1 87  ? 62.495  8.108   67.695  1.00 39.91  ? 146 ASP D CG  1 
ATOM   3510 O  OD1 . ASP D  1 87  ? 63.030  9.155   68.108  1.00 40.50  ? 146 ASP D OD1 1 
ATOM   3511 O  OD2 . ASP D  1 87  ? 61.949  7.256   68.438  1.00 36.67  ? 146 ASP D OD2 1 
ATOM   3512 N  N   . ARG D  1 88  ? 61.090  4.632   66.851  1.00 38.19  ? 147 ARG D N   1 
ATOM   3513 C  CA  . ARG D  1 88  ? 61.364  3.231   67.190  1.00 38.51  ? 147 ARG D CA  1 
ATOM   3514 C  C   . ARG D  1 88  ? 60.290  2.305   66.592  1.00 38.21  ? 147 ARG D C   1 
ATOM   3515 O  O   . ARG D  1 88  ? 60.171  1.153   66.950  1.00 38.45  ? 147 ARG D O   1 
ATOM   3516 C  CB  . ARG D  1 88  ? 61.423  3.060   68.709  1.00 38.39  ? 147 ARG D CB  1 
ATOM   3517 C  CG  . ARG D  1 88  ? 62.479  3.915   69.382  1.00 38.64  ? 147 ARG D CG  1 
ATOM   3518 C  CD  . ARG D  1 88  ? 63.856  3.320   69.249  1.00 39.49  ? 147 ARG D CD  1 
ATOM   3519 N  NE  . ARG D  1 88  ? 64.853  4.128   69.939  1.00 40.40  ? 147 ARG D NE  1 
ATOM   3520 C  CZ  . ARG D  1 88  ? 65.523  5.161   69.427  1.00 40.65  ? 147 ARG D CZ  1 
ATOM   3521 N  NH1 . ARG D  1 88  ? 65.329  5.562   68.185  1.00 41.61  ? 147 ARG D NH1 1 
ATOM   3522 N  NH2 . ARG D  1 88  ? 66.406  5.808   70.187  1.00 42.43  ? 147 ARG D NH2 1 
ATOM   3523 N  N   . SER D  1 89  ? 59.526  2.816   65.652  1.00 37.83  ? 148 SER D N   1 
ATOM   3524 C  CA  . SER D  1 89  ? 58.459  2.062   65.060  1.00 37.61  ? 148 SER D CA  1 
ATOM   3525 C  C   . SER D  1 89  ? 58.913  1.152   63.925  1.00 38.11  ? 148 SER D C   1 
ATOM   3526 O  O   . SER D  1 89  ? 59.779  1.487   63.149  1.00 38.29  ? 148 SER D O   1 
ATOM   3527 C  CB  . SER D  1 89  ? 57.403  3.033   64.555  1.00 37.03  ? 148 SER D CB  1 
ATOM   3528 O  OG  . SER D  1 89  ? 56.848  3.749   65.649  1.00 36.67  ? 148 SER D OG  1 
ATOM   3529 N  N   . ARG D  1 90  ? 58.317  -0.017  63.849  1.00 38.56  ? 149 ARG D N   1 
ATOM   3530 C  CA  . ARG D  1 90  ? 58.428  -0.863  62.678  1.00 39.98  ? 149 ARG D CA  1 
ATOM   3531 C  C   . ARG D  1 90  ? 57.137  -1.639  62.559  1.00 40.20  ? 149 ARG D C   1 
ATOM   3532 O  O   . ARG D  1 90  ? 56.334  -1.682  63.499  1.00 39.21  ? 149 ARG D O   1 
ATOM   3533 C  CB  . ARG D  1 90  ? 59.587  -1.866  62.808  1.00 41.47  ? 149 ARG D CB  1 
ATOM   3534 C  CG  . ARG D  1 90  ? 61.007  -1.273  62.808  1.00 42.06  ? 149 ARG D CG  1 
ATOM   3535 C  CD  . ARG D  1 90  ? 61.391  -0.650  61.490  1.00 42.66  ? 149 ARG D CD  1 
ATOM   3536 N  NE  . ARG D  1 90  ? 61.368  -1.627  60.417  1.00 44.08  ? 149 ARG D NE  1 
ATOM   3537 C  CZ  . ARG D  1 90  ? 62.408  -2.354  60.009  1.00 46.28  ? 149 ARG D CZ  1 
ATOM   3538 N  NH1 . ARG D  1 90  ? 63.619  -2.222  60.552  1.00 46.42  ? 149 ARG D NH1 1 
ATOM   3539 N  NH2 . ARG D  1 90  ? 62.233  -3.226  59.027  1.00 47.46  ? 149 ARG D NH2 1 
ATOM   3540 N  N   . LEU D  1 91  ? 56.963  -2.284  61.412  1.00 41.46  ? 150 LEU D N   1 
ATOM   3541 C  CA  . LEU D  1 91  ? 55.781  -3.087  61.160  1.00 42.08  ? 150 LEU D CA  1 
ATOM   3542 C  C   . LEU D  1 91  ? 56.089  -4.488  61.614  1.00 43.60  ? 150 LEU D C   1 
ATOM   3543 O  O   . LEU D  1 91  ? 56.906  -5.176  60.997  1.00 45.24  ? 150 LEU D O   1 
ATOM   3544 C  CB  . LEU D  1 91  ? 55.409  -3.040  59.675  1.00 42.75  ? 150 LEU D CB  1 
ATOM   3545 C  CG  . LEU D  1 91  ? 54.926  -1.657  59.201  1.00 41.88  ? 150 LEU D CG  1 
ATOM   3546 C  CD1 . LEU D  1 91  ? 54.387  -1.696  57.780  1.00 41.69  ? 150 LEU D CD1 1 
ATOM   3547 C  CD2 . LEU D  1 91  ? 53.886  -1.093  60.164  1.00 39.72  ? 150 LEU D CD2 1 
ATOM   3548 N  N   . GLY D  1 92  ? 55.424  -4.917  62.685  1.00 43.64  ? 151 GLY D N   1 
ATOM   3549 C  CA  . GLY D  1 92  ? 55.784  -6.136  63.393  1.00 45.18  ? 151 GLY D CA  1 
ATOM   3550 C  C   . GLY D  1 92  ? 55.802  -7.376  62.531  1.00 47.68  ? 151 GLY D C   1 
ATOM   3551 O  O   . GLY D  1 92  ? 56.357  -8.440  62.863  1.00 49.42  ? 151 GLY D O   1 
ATOM   3552 N  N   . CYS D  1 93  ? 55.192  -7.238  61.386  1.00 48.29  ? 152 CYS D N   1 
ATOM   3553 C  CA  . CYS D  1 93  ? 55.030  -8.387  60.538  1.00 51.13  ? 152 CYS D CA  1 
ATOM   3554 C  C   . CYS D  1 93  ? 56.192  -8.557  59.557  1.00 51.94  ? 152 CYS D C   1 
ATOM   3555 O  O   . CYS D  1 93  ? 56.304  -9.581  58.878  1.00 53.81  ? 152 CYS D O   1 
ATOM   3556 C  CB  . CYS D  1 93  ? 53.690  -8.318  59.833  1.00 51.48  ? 152 CYS D CB  1 
ATOM   3557 S  SG  . CYS D  1 93  ? 53.581  -7.220  58.349  1.00 54.44  ? 152 CYS D SG  1 
ATOM   3558 N  N   . GLN D  1 94  ? 57.069  -7.563  59.498  1.00 50.43  ? 153 GLN D N   1 
ATOM   3559 C  CA  . GLN D  1 94  ? 58.312  -7.696  58.764  1.00 51.55  ? 153 GLN D CA  1 
ATOM   3560 C  C   . GLN D  1 94  ? 59.485  -8.043  59.690  1.00 51.63  ? 153 GLN D C   1 
ATOM   3561 O  O   . GLN D  1 94  ? 60.573  -8.346  59.216  1.00 53.11  ? 153 GLN D O   1 
ATOM   3562 C  CB  . GLN D  1 94  ? 58.591  -6.403  58.010  1.00 50.19  ? 153 GLN D CB  1 
ATOM   3563 C  CG  . GLN D  1 94  ? 57.524  -6.071  57.003  1.00 50.60  ? 153 GLN D CG  1 
ATOM   3564 C  CD  . GLN D  1 94  ? 57.383  -7.149  55.953  1.00 53.06  ? 153 GLN D CD  1 
ATOM   3565 O  OE1 . GLN D  1 94  ? 58.335  -7.456  55.226  1.00 54.62  ? 153 GLN D OE1 1 
ATOM   3566 N  NE2 . GLN D  1 94  ? 56.191  -7.731  55.866  1.00 53.86  ? 153 GLN D NE2 1 
ATOM   3567 N  N   . ILE D  1 95  ? 59.261  -8.000  60.998  1.00 50.21  ? 154 ILE D N   1 
ATOM   3568 C  CA  . ILE D  1 95  ? 60.322  -8.219  61.964  1.00 50.17  ? 154 ILE D CA  1 
ATOM   3569 C  C   . ILE D  1 95  ? 60.276  -9.644  62.470  1.00 52.50  ? 154 ILE D C   1 
ATOM   3570 O  O   . ILE D  1 95  ? 59.285  -10.064 63.084  1.00 53.00  ? 154 ILE D O   1 
ATOM   3571 C  CB  . ILE D  1 95  ? 60.196  -7.254  63.140  1.00 47.89  ? 154 ILE D CB  1 
ATOM   3572 C  CG1 . ILE D  1 95  ? 60.231  -5.808  62.620  1.00 46.40  ? 154 ILE D CG1 1 
ATOM   3573 C  CG2 . ILE D  1 95  ? 61.259  -7.520  64.172  1.00 46.61  ? 154 ILE D CG2 1 
ATOM   3574 C  CD1 . ILE D  1 95  ? 61.305  -5.526  61.575  1.00 46.95  ? 154 ILE D CD1 1 
ATOM   3575 N  N   . CYS D  1 96  ? 61.356  -10.377 62.198  1.00 54.22  ? 155 CYS D N   1 
ATOM   3576 C  CA  . CYS D  1 96  ? 61.485  -11.769 62.585  1.00 56.65  ? 155 CYS D CA  1 
ATOM   3577 C  C   . CYS D  1 96  ? 62.316  -11.949 63.845  1.00 56.00  ? 155 CYS D C   1 
ATOM   3578 O  O   . CYS D  1 96  ? 63.329  -11.259 64.042  1.00 55.02  ? 155 CYS D O   1 
ATOM   3579 C  CB  . CYS D  1 96  ? 62.112  -12.566 61.441  1.00 59.74  ? 155 CYS D CB  1 
ATOM   3580 S  SG  . CYS D  1 96  ? 60.910  -12.973 60.134  1.00 64.55  ? 155 CYS D SG  1 
ATOM   3581 N  N   . LEU D  1 97  ? 61.892  -12.891 64.686  1.00 56.89  ? 156 LEU D N   1 
ATOM   3582 C  CA  . LEU D  1 97  ? 62.572  -13.151 65.959  1.00 56.57  ? 156 LEU D CA  1 
ATOM   3583 C  C   . LEU D  1 97  ? 63.969  -13.727 65.765  1.00 58.07  ? 156 LEU D C   1 
ATOM   3584 O  O   . LEU D  1 97  ? 64.161  -14.705 65.032  1.00 60.58  ? 156 LEU D O   1 
ATOM   3585 C  CB  . LEU D  1 97  ? 61.761  -14.114 66.830  1.00 57.71  ? 156 LEU D CB  1 
ATOM   3586 C  CG  . LEU D  1 97  ? 60.420  -13.623 67.356  1.00 56.40  ? 156 LEU D CG  1 
ATOM   3587 C  CD1 . LEU D  1 97  ? 59.784  -14.713 68.191  1.00 57.22  ? 156 LEU D CD1 1 
ATOM   3588 C  CD2 . LEU D  1 97  ? 60.578  -12.323 68.159  1.00 53.69  ? 156 LEU D CD2 1 
ATOM   3589 N  N   . THR D  1 98  ? 64.937  -13.111 66.429  1.00 56.75  ? 157 THR D N   1 
ATOM   3590 C  CA  . THR D  1 98  ? 66.287  -13.655 66.498  1.00 58.40  ? 157 THR D CA  1 
ATOM   3591 C  C   . THR D  1 98  ? 66.582  -14.018 67.930  1.00 58.24  ? 157 THR D C   1 
ATOM   3592 O  O   . THR D  1 98  ? 65.947  -13.494 68.844  1.00 56.42  ? 157 THR D O   1 
ATOM   3593 C  CB  . THR D  1 98  ? 67.337  -12.644 66.045  1.00 57.53  ? 157 THR D CB  1 
ATOM   3594 O  OG1 . THR D  1 98  ? 67.261  -11.488 66.899  1.00 55.45  ? 157 THR D OG1 1 
ATOM   3595 C  CG2 . THR D  1 98  ? 67.115  -12.270 64.571  1.00 57.65  ? 157 THR D CG2 1 
ATOM   3596 N  N   . LYS D  1 99  ? 67.570  -14.892 68.113  1.00 60.38  ? 158 LYS D N   1 
ATOM   3597 C  CA  . LYS D  1 99  ? 67.957  -15.365 69.438  1.00 60.62  ? 158 LYS D CA  1 
ATOM   3598 C  C   . LYS D  1 99  ? 68.242  -14.205 70.399  1.00 58.06  ? 158 LYS D C   1 
ATOM   3599 O  O   . LYS D  1 99  ? 67.924  -14.289 71.580  1.00 57.99  ? 158 LYS D O   1 
ATOM   3600 C  CB  . LYS D  1 99  ? 69.173  -16.305 69.350  1.00 63.06  ? 158 LYS D CB  1 
ATOM   3601 C  CG  . LYS D  1 99  ? 69.109  -17.476 70.358  1.00 65.74  ? 158 LYS D CG  1 
ATOM   3602 C  CD  . LYS D  1 99  ? 70.133  -18.615 70.108  1.00 70.39  ? 158 LYS D CD  1 
ATOM   3603 C  CE  . LYS D  1 99  ? 69.473  -19.941 69.643  1.00 74.46  ? 158 LYS D CE  1 
ATOM   3604 N  NZ  . LYS D  1 99  ? 70.269  -21.182 70.083  1.00 78.67  ? 158 LYS D NZ  1 
ATOM   3605 N  N   . SER D  1 100 ? 68.798  -13.110 69.894  1.00 56.55  ? 159 SER D N   1 
ATOM   3606 C  CA  . SER D  1 100 ? 69.132  -11.970 70.744  1.00 54.71  ? 159 SER D CA  1 
ATOM   3607 C  C   . SER D  1 100 ? 67.924  -11.166 71.244  1.00 52.61  ? 159 SER D C   1 
ATOM   3608 O  O   . SER D  1 100 ? 68.086  -10.269 72.062  1.00 51.18  ? 159 SER D O   1 
ATOM   3609 C  CB  . SER D  1 100 ? 70.056  -11.032 69.983  1.00 54.40  ? 159 SER D CB  1 
ATOM   3610 O  OG  . SER D  1 100 ? 69.353  -10.500 68.870  1.00 54.68  ? 159 SER D OG  1 
ATOM   3611 N  N   . MET D  1 101 ? 66.732  -11.476 70.742  1.00 52.75  ? 160 MET D N   1 
ATOM   3612 C  CA  . MET D  1 101 ? 65.504  -10.777 71.147  1.00 51.29  ? 160 MET D CA  1 
ATOM   3613 C  C   . MET D  1 101 ? 64.847  -11.345 72.416  1.00 51.79  ? 160 MET D C   1 
ATOM   3614 O  O   . MET D  1 101 ? 63.828  -10.826 72.881  1.00 50.97  ? 160 MET D O   1 
ATOM   3615 C  CB  . MET D  1 101 ? 64.471  -10.787 70.000  1.00 51.32  ? 160 MET D CB  1 
ATOM   3616 C  CG  . MET D  1 101 ? 64.757  -9.823  68.870  1.00 50.44  ? 160 MET D CG  1 
ATOM   3617 S  SD  . MET D  1 101 ? 63.624  -10.050 67.489  1.00 52.68  ? 160 MET D SD  1 
ATOM   3618 C  CE  . MET D  1 101 ? 64.467  -9.125  66.192  1.00 51.82  ? 160 MET D CE  1 
ATOM   3619 N  N   . ASP D  1 102 ? 65.399  -12.416 72.974  1.00 53.63  ? 161 ASP D N   1 
ATOM   3620 C  CA  . ASP D  1 102 ? 64.798  -13.044 74.158  1.00 54.32  ? 161 ASP D CA  1 
ATOM   3621 C  C   . ASP D  1 102 ? 64.554  -12.022 75.273  1.00 52.58  ? 161 ASP D C   1 
ATOM   3622 O  O   . ASP D  1 102 ? 65.435  -11.256 75.609  1.00 51.45  ? 161 ASP D O   1 
ATOM   3623 C  CB  . ASP D  1 102 ? 65.684  -14.191 74.658  1.00 56.40  ? 161 ASP D CB  1 
ATOM   3624 C  CG  . ASP D  1 102 ? 64.939  -15.154 75.619  1.00 58.49  ? 161 ASP D CG  1 
ATOM   3625 O  OD1 . ASP D  1 102 ? 63.821  -15.602 75.295  1.00 58.93  ? 161 ASP D OD1 1 
ATOM   3626 O  OD2 . ASP D  1 102 ? 65.484  -15.484 76.696  1.00 60.81  ? 161 ASP D OD2 1 
ATOM   3627 N  N   . ASN D  1 103 ? 63.341  -12.016 75.820  1.00 52.77  ? 162 ASN D N   1 
ATOM   3628 C  CA  . ASN D  1 103 ? 62.909  -11.084 76.872  1.00 51.81  ? 162 ASN D CA  1 
ATOM   3629 C  C   . ASN D  1 103 ? 62.826  -9.599  76.474  1.00 49.61  ? 162 ASN D C   1 
ATOM   3630 O  O   . ASN D  1 103 ? 62.773  -8.709  77.321  1.00 49.04  ? 162 ASN D O   1 
ATOM   3631 C  CB  . ASN D  1 103 ? 63.762  -11.272 78.134  1.00 52.72  ? 162 ASN D CB  1 
ATOM   3632 C  CG  . ASN D  1 103 ? 63.406  -12.532 78.880  1.00 55.23  ? 162 ASN D CG  1 
ATOM   3633 O  OD1 . ASN D  1 103 ? 62.264  -12.714 79.339  1.00 55.74  ? 162 ASN D OD1 1 
ATOM   3634 N  ND2 . ASN D  1 103 ? 64.376  -13.411 79.013  1.00 56.06  ? 162 ASN D ND2 1 
ATOM   3635 N  N   . MET D  1 104 ? 62.773  -9.313  75.183  1.00 48.77  ? 163 MET D N   1 
ATOM   3636 C  CA  . MET D  1 104 ? 62.515  -7.943  74.763  1.00 46.90  ? 163 MET D CA  1 
ATOM   3637 C  C   . MET D  1 104 ? 61.072  -7.583  75.035  1.00 46.79  ? 163 MET D C   1 
ATOM   3638 O  O   . MET D  1 104 ? 60.221  -8.451  75.162  1.00 48.06  ? 163 MET D O   1 
ATOM   3639 C  CB  . MET D  1 104 ? 62.800  -7.764  73.287  1.00 46.21  ? 163 MET D CB  1 
ATOM   3640 C  CG  . MET D  1 104 ? 61.840  -8.485  72.373  1.00 47.07  ? 163 MET D CG  1 
ATOM   3641 S  SD  . MET D  1 104 ? 62.052  -8.009  70.655  1.00 47.95  ? 163 MET D SD  1 
ATOM   3642 C  CE  . MET D  1 104 ? 60.689  -8.850  69.868  1.00 46.94  ? 163 MET D CE  1 
ATOM   3643 N  N   . THR D  1 105 ? 60.801  -6.290  75.106  1.00 45.80  ? 164 THR D N   1 
ATOM   3644 C  CA  . THR D  1 105 ? 59.453  -5.758  75.262  1.00 45.19  ? 164 THR D CA  1 
ATOM   3645 C  C   . THR D  1 105 ? 59.154  -4.907  74.048  1.00 43.75  ? 164 THR D C   1 
ATOM   3646 O  O   . THR D  1 105 ? 59.950  -4.063  73.680  1.00 42.54  ? 164 THR D O   1 
ATOM   3647 C  CB  . THR D  1 105 ? 59.354  -4.899  76.530  1.00 45.14  ? 164 THR D CB  1 
ATOM   3648 O  OG1 . THR D  1 105 ? 59.766  -5.691  77.650  1.00 46.69  ? 164 THR D OG1 1 
ATOM   3649 C  CG2 . THR D  1 105 ? 57.947  -4.395  76.746  1.00 44.76  ? 164 THR D CG2 1 
ATOM   3650 N  N   . VAL D  1 106 ? 58.013  -5.153  73.414  1.00 43.91  ? 165 VAL D N   1 
ATOM   3651 C  CA  . VAL D  1 106 ? 57.518  -4.273  72.368  1.00 42.42  ? 165 VAL D CA  1 
ATOM   3652 C  C   . VAL D  1 106 ? 56.235  -3.690  72.859  1.00 42.30  ? 165 VAL D C   1 
ATOM   3653 O  O   . VAL D  1 106 ? 55.522  -4.340  73.594  1.00 43.77  ? 165 VAL D O   1 
ATOM   3654 C  CB  . VAL D  1 106 ? 57.249  -5.035  71.056  1.00 43.09  ? 165 VAL D CB  1 
ATOM   3655 C  CG1 . VAL D  1 106 ? 58.572  -5.592  70.488  1.00 43.25  ? 165 VAL D CG1 1 
ATOM   3656 C  CG2 . VAL D  1 106 ? 56.236  -6.124  71.268  1.00 43.94  ? 165 VAL D CG2 1 
ATOM   3657 N  N   . ARG D  1 107 ? 55.913  -2.472  72.445  1.00 41.38  ? 166 ARG D N   1 
ATOM   3658 C  CA  . ARG D  1 107 ? 54.620  -1.862  72.788  1.00 41.37  ? 166 ARG D CA  1 
ATOM   3659 C  C   . ARG D  1 107 ? 53.689  -1.713  71.582  1.00 40.66  ? 166 ARG D C   1 
ATOM   3660 O  O   . ARG D  1 107 ? 54.125  -1.344  70.499  1.00 39.64  ? 166 ARG D O   1 
ATOM   3661 C  CB  . ARG D  1 107 ? 54.822  -0.518  73.457  1.00 40.67  ? 166 ARG D CB  1 
ATOM   3662 C  CG  . ARG D  1 107 ? 53.498  0.152   73.810  1.00 41.33  ? 166 ARG D CG  1 
ATOM   3663 C  CD  . ARG D  1 107 ? 53.668  1.192   74.906  1.00 42.09  ? 166 ARG D CD  1 
ATOM   3664 N  NE  . ARG D  1 107 ? 54.385  2.359   74.430  1.00 41.51  ? 166 ARG D NE  1 
ATOM   3665 C  CZ  . ARG D  1 107 ? 53.864  3.314   73.637  1.00 41.20  ? 166 ARG D CZ  1 
ATOM   3666 N  NH1 . ARG D  1 107 ? 54.616  4.344   73.247  1.00 40.85  ? 166 ARG D NH1 1 
ATOM   3667 N  NH2 . ARG D  1 107 ? 52.607  3.252   73.214  1.00 40.68  ? 166 ARG D NH2 1 
ATOM   3668 N  N   . VAL D  1 108 ? 52.415  -2.050  71.791  1.00 41.80  ? 167 VAL D N   1 
ATOM   3669 C  CA  . VAL D  1 108 ? 51.364  -1.846  70.804  1.00 41.49  ? 167 VAL D CA  1 
ATOM   3670 C  C   . VAL D  1 108 ? 50.842  -0.440  71.020  1.00 40.94  ? 167 VAL D C   1 
ATOM   3671 O  O   . VAL D  1 108 ? 50.261  -0.141  72.088  1.00 41.82  ? 167 VAL D O   1 
ATOM   3672 C  CB  . VAL D  1 108 ? 50.188  -2.817  70.979  1.00 43.13  ? 167 VAL D CB  1 
ATOM   3673 C  CG1 . VAL D  1 108 ? 49.328  -2.796  69.734  1.00 42.59  ? 167 VAL D CG1 1 
ATOM   3674 C  CG2 . VAL D  1 108 ? 50.693  -4.220  71.263  1.00 43.96  ? 167 VAL D CG2 1 
ATOM   3675 N  N   . PRO D  1 109 ? 51.057  0.436   70.021  1.00 39.70  ? 168 PRO D N   1 
ATOM   3676 C  CA  . PRO D  1 109 ? 50.648  1.818   70.141  1.00 38.94  ? 168 PRO D CA  1 
ATOM   3677 C  C   . PRO D  1 109 ? 49.166  1.967   69.852  1.00 39.17  ? 168 PRO D C   1 
ATOM   3678 O  O   . PRO D  1 109 ? 48.570  1.113   69.183  1.00 38.87  ? 168 PRO D O   1 
ATOM   3679 C  CB  . PRO D  1 109 ? 51.469  2.507   69.064  1.00 37.89  ? 168 PRO D CB  1 
ATOM   3680 C  CG  . PRO D  1 109 ? 51.675  1.471   68.025  1.00 37.79  ? 168 PRO D CG  1 
ATOM   3681 C  CD  . PRO D  1 109 ? 51.626  0.145   68.686  1.00 38.96  ? 168 PRO D CD  1 
ATOM   3682 N  N   . GLU D  1 110 ? 48.586  3.057   70.348  1.00 39.49  ? 169 GLU D N   1 
ATOM   3683 C  CA  . GLU D  1 110 ? 47.157  3.330   70.163  1.00 40.14  ? 169 GLU D CA  1 
ATOM   3684 C  C   . GLU D  1 110 ? 46.865  3.577   68.687  1.00 38.64  ? 169 GLU D C   1 
ATOM   3685 O  O   . GLU D  1 110 ? 47.730  4.039   67.958  1.00 36.92  ? 169 GLU D O   1 
ATOM   3686 C  CB  . GLU D  1 110 ? 46.680  4.525   71.042  1.00 40.89  ? 169 GLU D CB  1 
ATOM   3687 C  CG  . GLU D  1 110 ? 47.147  5.911   70.585  1.00 40.47  ? 169 GLU D CG  1 
ATOM   3688 C  CD  . GLU D  1 110 ? 46.480  7.114   71.320  1.00 43.53  ? 169 GLU D CD  1 
ATOM   3689 O  OE1 . GLU D  1 110 ? 46.980  8.266   71.101  1.00 43.57  ? 169 GLU D OE1 1 
ATOM   3690 O  OE2 . GLU D  1 110 ? 45.485  6.940   72.076  1.00 44.99  ? 169 GLU D OE2 1 
ATOM   3691 N  N   . THR D  1 111 ? 45.638  3.254   68.280  1.00 39.48  ? 170 THR D N   1 
ATOM   3692 C  CA  . THR D  1 111 ? 45.177  3.477   66.920  1.00 38.78  ? 170 THR D CA  1 
ATOM   3693 C  C   . THR D  1 111 ? 44.553  4.844   66.810  1.00 38.22  ? 170 THR D C   1 
ATOM   3694 O  O   . THR D  1 111 ? 44.258  5.480   67.828  1.00 38.62  ? 170 THR D O   1 
ATOM   3695 C  CB  . THR D  1 111 ? 44.120  2.459   66.483  1.00 39.64  ? 170 THR D CB  1 
ATOM   3696 O  OG1 . THR D  1 111 ? 42.901  2.704   67.189  1.00 41.10  ? 170 THR D OG1 1 
ATOM   3697 C  CG2 . THR D  1 111 ? 44.610  1.055   66.717  1.00 39.48  ? 170 THR D CG2 1 
ATOM   3698 N  N   . VAL D  1 112 ? 44.336  5.267   65.564  1.00 37.17  ? 171 VAL D N   1 
ATOM   3699 C  CA  . VAL D  1 112 ? 43.643  6.505   65.300  1.00 36.77  ? 171 VAL D CA  1 
ATOM   3700 C  C   . VAL D  1 112 ? 42.270  6.443   65.966  1.00 37.91  ? 171 VAL D C   1 
ATOM   3701 O  O   . VAL D  1 112 ? 41.813  7.417   66.555  1.00 38.31  ? 171 VAL D O   1 
ATOM   3702 C  CB  . VAL D  1 112 ? 43.544  6.828   63.787  1.00 35.92  ? 171 VAL D CB  1 
ATOM   3703 C  CG1 . VAL D  1 112 ? 42.646  5.861   63.058  1.00 35.75  ? 171 VAL D CG1 1 
ATOM   3704 C  CG2 . VAL D  1 112 ? 43.079  8.259   63.618  1.00 34.33  ? 171 VAL D CG2 1 
ATOM   3705 N  N   . ALA D  1 113 ? 41.653  5.272   65.918  1.00 38.98  ? 172 ALA D N   1 
ATOM   3706 C  CA  . ALA D  1 113 ? 40.348  5.050   66.548  1.00 41.46  ? 172 ALA D CA  1 
ATOM   3707 C  C   . ALA D  1 113 ? 40.368  5.243   68.055  1.00 43.11  ? 172 ALA D C   1 
ATOM   3708 O  O   . ALA D  1 113 ? 39.478  5.877   68.599  1.00 45.27  ? 172 ALA D O   1 
ATOM   3709 C  CB  . ALA D  1 113 ? 39.810  3.682   66.209  1.00 41.97  ? 172 ALA D CB  1 
ATOM   3710 N  N   . ASP D  1 114 ? 41.366  4.705   68.734  1.00 43.37  ? 173 ASP D N   1 
ATOM   3711 C  CA  . ASP D  1 114 ? 41.529  4.975   70.168  1.00 44.69  ? 173 ASP D CA  1 
ATOM   3712 C  C   . ASP D  1 114 ? 41.675  6.481   70.446  1.00 44.69  ? 173 ASP D C   1 
ATOM   3713 O  O   . ASP D  1 114 ? 41.137  7.002   71.421  1.00 46.71  ? 173 ASP D O   1 
ATOM   3714 C  CB  . ASP D  1 114 ? 42.767  4.266   70.724  1.00 44.35  ? 173 ASP D CB  1 
ATOM   3715 C  CG  . ASP D  1 114 ? 42.752  2.750   70.492  1.00 45.29  ? 173 ASP D CG  1 
ATOM   3716 O  OD1 . ASP D  1 114 ? 41.677  2.114   70.577  1.00 46.77  ? 173 ASP D OD1 1 
ATOM   3717 O  OD2 . ASP D  1 114 ? 43.838  2.187   70.234  1.00 44.12  ? 173 ASP D OD2 1 
ATOM   3718 N  N   . ALA D  1 115 ? 42.408  7.176   69.578  1.00 43.39  ? 174 ALA D N   1 
ATOM   3719 C  CA  . ALA D  1 115 ? 42.747  8.581   69.801  1.00 43.04  ? 174 ALA D CA  1 
ATOM   3720 C  C   . ALA D  1 115 ? 41.503  9.430   69.632  1.00 44.28  ? 174 ALA D C   1 
ATOM   3721 O  O   . ALA D  1 115 ? 41.184  10.249  70.480  1.00 45.67  ? 174 ALA D O   1 
ATOM   3722 C  CB  . ALA D  1 115 ? 43.807  9.013   68.821  1.00 40.84  ? 174 ALA D CB  1 
ATOM   3723 N  N   . ARG D  1 116 ? 40.817  9.187   68.520  1.00 44.04  ? 175 ARG D N   1 
ATOM   3724 C  CA  . ARG D  1 116 ? 39.643  9.929   68.083  1.00 45.02  ? 175 ARG D CA  1 
ATOM   3725 C  C   . ARG D  1 116 ? 38.625  10.210  69.174  1.00 47.77  ? 175 ARG D C   1 
ATOM   3726 O  O   . ARG D  1 116 ? 38.252  9.315   69.938  1.00 48.99  ? 175 ARG D O   1 
ATOM   3727 C  CB  . ARG D  1 116 ? 38.942  9.144   66.969  1.00 44.46  ? 175 ARG D CB  1 
ATOM   3728 C  CG  . ARG D  1 116 ? 37.755  9.841   66.346  1.00 44.09  ? 175 ARG D CG  1 
ATOM   3729 C  CD  . ARG D  1 116 ? 37.205  9.045   65.157  1.00 44.06  ? 175 ARG D CD  1 
ATOM   3730 N  NE  . ARG D  1 116 ? 38.217  8.725   64.142  1.00 41.80  ? 175 ARG D NE  1 
ATOM   3731 C  CZ  . ARG D  1 116 ? 38.458  7.518   63.624  1.00 41.39  ? 175 ARG D CZ  1 
ATOM   3732 N  NH1 . ARG D  1 116 ? 39.415  7.362   62.724  1.00 42.64  ? 175 ARG D NH1 1 
ATOM   3733 N  NH2 . ARG D  1 116 ? 37.761  6.461   63.971  1.00 43.46  ? 175 ARG D NH2 1 
ATOM   3734 N  N   . GLN D  1 117 ? 38.180  11.459  69.219  1.00 49.02  ? 176 GLN D N   1 
ATOM   3735 C  CA  . GLN D  1 117 ? 37.127  11.876  70.130  1.00 52.41  ? 176 GLN D CA  1 
ATOM   3736 C  C   . GLN D  1 117 ? 35.817  12.291  69.445  1.00 52.61  ? 176 GLN D C   1 
ATOM   3737 O  O   . GLN D  1 117 ? 34.775  12.308  70.079  1.00 54.64  ? 176 GLN D O   1 
ATOM   3738 C  CB  . GLN D  1 117 ? 37.654  12.973  71.059  1.00 54.01  ? 176 GLN D CB  1 
ATOM   3739 C  CG  . GLN D  1 117 ? 38.209  12.344  72.359  1.00 58.26  ? 176 GLN D CG  1 
ATOM   3740 C  CD  . GLN D  1 117 ? 38.893  13.332  73.296  1.00 62.72  ? 176 GLN D CD  1 
ATOM   3741 O  OE1 . GLN D  1 117 ? 39.526  14.299  72.848  1.00 62.82  ? 176 GLN D OE1 1 
ATOM   3742 N  NE2 . GLN D  1 117 ? 38.786  13.076  74.613  1.00 66.94  ? 176 GLN D NE2 1 
ATOM   3743 N  N   . SER D  1 118 ? 35.884  12.586  68.149  1.00 50.81  ? 177 SER D N   1 
ATOM   3744 C  CA  . SER D  1 118 ? 34.724  13.016  67.355  1.00 50.95  ? 177 SER D CA  1 
ATOM   3745 C  C   . SER D  1 118 ? 34.953  12.602  65.893  1.00 48.13  ? 177 SER D C   1 
ATOM   3746 O  O   . SER D  1 118 ? 36.080  12.532  65.435  1.00 45.82  ? 177 SER D O   1 
ATOM   3747 C  CB  . SER D  1 118 ? 34.610  14.539  67.423  1.00 51.68  ? 177 SER D CB  1 
ATOM   3748 O  OG  . SER D  1 118 ? 35.818  15.123  66.904  1.00 50.96  ? 177 SER D OG  1 
ATOM   3749 N  N   . ILE D  1 119 ? 33.891  12.314  65.162  1.00 48.09  ? 178 ILE D N   1 
ATOM   3750 C  CA  . ILE D  1 119 ? 34.010  12.051  63.726  1.00 45.51  ? 178 ILE D CA  1 
ATOM   3751 C  C   . ILE D  1 119 ? 33.832  13.408  63.115  1.00 45.00  ? 178 ILE D C   1 
ATOM   3752 O  O   . ILE D  1 119 ? 33.025  14.192  63.584  1.00 46.10  ? 178 ILE D O   1 
ATOM   3753 C  CB  . ILE D  1 119 ? 32.934  11.041  63.244  1.00 46.27  ? 178 ILE D CB  1 
ATOM   3754 C  CG1 . ILE D  1 119 ? 33.268  9.654   63.834  1.00 46.00  ? 178 ILE D CG1 1 
ATOM   3755 C  CG2 . ILE D  1 119 ? 32.819  11.005  61.704  1.00 42.60  ? 178 ILE D CG2 1 
ATOM   3756 C  CD1 . ILE D  1 119 ? 32.087  8.712   63.976  1.00 46.66  ? 178 ILE D CD1 1 
ATOM   3757 N  N   . ASP D  1 120 ? 34.618  13.712  62.103  1.00 42.90  ? 179 ASP D N   1 
ATOM   3758 C  CA  . ASP D  1 120 ? 34.525  15.007  61.491  1.00 42.63  ? 179 ASP D CA  1 
ATOM   3759 C  C   . ASP D  1 120 ? 33.324  15.151  60.548  1.00 41.98  ? 179 ASP D C   1 
ATOM   3760 O  O   . ASP D  1 120 ? 32.881  14.184  59.920  1.00 40.75  ? 179 ASP D O   1 
ATOM   3761 C  CB  . ASP D  1 120 ? 35.802  15.286  60.724  1.00 42.03  ? 179 ASP D CB  1 
ATOM   3762 C  CG  . ASP D  1 120 ? 36.867  15.931  61.575  1.00 45.51  ? 179 ASP D CG  1 
ATOM   3763 O  OD1 . ASP D  1 120 ? 36.716  15.982  62.832  1.00 50.09  ? 179 ASP D OD1 1 
ATOM   3764 O  OD2 . ASP D  1 120 ? 37.866  16.388  60.966  1.00 48.98  ? 179 ASP D OD2 1 
ATOM   3765 N  N   . VAL D  1 121 ? 32.816  16.383  60.462  1.00 41.91  ? 180 VAL D N   1 
ATOM   3766 C  CA  . VAL D  1 121 ? 31.852  16.757  59.448  1.00 41.56  ? 180 VAL D CA  1 
ATOM   3767 C  C   . VAL D  1 121 ? 32.513  16.588  58.102  1.00 40.37  ? 180 VAL D C   1 
ATOM   3768 O  O   . VAL D  1 121 ? 33.565  17.158  57.869  1.00 40.10  ? 180 VAL D O   1 
ATOM   3769 C  CB  . VAL D  1 121 ? 31.454  18.239  59.533  1.00 42.21  ? 180 VAL D CB  1 
ATOM   3770 C  CG1 . VAL D  1 121 ? 30.665  18.617  58.302  1.00 41.86  ? 180 VAL D CG1 1 
ATOM   3771 C  CG2 . VAL D  1 121 ? 30.658  18.541  60.777  1.00 42.94  ? 180 VAL D CG2 1 
ATOM   3772 N  N   . GLY D  1 122 ? 31.908  15.816  57.212  1.00 40.39  ? 181 GLY D N   1 
ATOM   3773 C  CA  . GLY D  1 122 ? 32.487  15.590  55.910  1.00 39.82  ? 181 GLY D CA  1 
ATOM   3774 C  C   . GLY D  1 122 ? 31.974  16.616  54.942  1.00 40.37  ? 181 GLY D C   1 
ATOM   3775 O  O   . GLY D  1 122 ? 30.783  16.787  54.838  1.00 41.27  ? 181 GLY D O   1 
ATOM   3776 N  N   . LYS D  1 123 ? 32.853  17.326  54.244  1.00 40.96  ? 182 LYS D N   1 
ATOM   3777 C  CA  . LYS D  1 123 ? 32.389  18.231  53.167  1.00 41.82  ? 182 LYS D CA  1 
ATOM   3778 C  C   . LYS D  1 123 ? 33.098  17.970  51.843  1.00 41.39  ? 182 LYS D C   1 
ATOM   3779 O  O   . LYS D  1 123 ? 34.290  17.761  51.789  1.00 40.31  ? 182 LYS D O   1 
ATOM   3780 C  CB  . LYS D  1 123 ? 32.509  19.711  53.567  1.00 42.41  ? 182 LYS D CB  1 
ATOM   3781 C  CG  . LYS D  1 123 ? 33.908  20.247  53.573  1.00 43.11  ? 182 LYS D CG  1 
ATOM   3782 C  CD  . LYS D  1 123 ? 34.121  21.362  54.604  1.00 45.73  ? 182 LYS D CD  1 
ATOM   3783 C  CE  . LYS D  1 123 ? 35.592  21.379  55.079  1.00 47.08  ? 182 LYS D CE  1 
ATOM   3784 N  NZ  . LYS D  1 123 ? 35.897  22.296  56.233  1.00 48.38  ? 182 LYS D NZ  1 
ATOM   3785 N  N   . THR D  1 124 ? 32.337  17.962  50.769  1.00 42.61  ? 183 THR D N   1 
ATOM   3786 C  CA  . THR D  1 124 ? 32.918  17.883  49.455  1.00 43.39  ? 183 THR D CA  1 
ATOM   3787 C  C   . THR D  1 124 ? 33.583  19.245  49.096  1.00 44.72  ? 183 THR D C   1 
ATOM   3788 O  O   . THR D  1 124 ? 34.734  19.279  48.614  1.00 45.09  ? 183 THR D O   1 
ATOM   3789 C  CB  . THR D  1 124 ? 31.847  17.532  48.486  1.00 43.49  ? 183 THR D CB  1 
ATOM   3790 O  OG1 . THR D  1 124 ? 31.012  16.572  49.125  1.00 45.24  ? 183 THR D OG1 1 
ATOM   3791 C  CG2 . THR D  1 124 ? 32.424  16.960  47.206  1.00 43.46  ? 183 THR D CG2 1 
ATOM   3792 N  N   . SER D  1 125 ? 32.890  20.343  49.419  1.00 45.15  ? 184 SER D N   1 
ATOM   3793 C  CA  . SER D  1 125 ? 33.273  21.686  48.980  1.00 45.85  ? 184 SER D CA  1 
ATOM   3794 C  C   . SER D  1 125 ? 32.818  22.767  49.999  1.00 46.60  ? 184 SER D C   1 
ATOM   3795 O  O   . SER D  1 125 ? 32.258  22.444  51.050  1.00 47.67  ? 184 SER D O   1 
ATOM   3796 C  CB  . SER D  1 125 ? 32.606  21.943  47.617  1.00 46.44  ? 184 SER D CB  1 
ATOM   3797 O  OG  . SER D  1 125 ? 31.176  21.736  47.660  1.00 45.55  ? 184 SER D OG  1 
ATOM   3798 N  N   . ALA D  1 126 ? 33.035  24.037  49.678  1.00 46.59  ? 185 ALA D N   1 
ATOM   3799 C  CA  . ALA D  1 126 ? 32.435  25.135  50.423  1.00 47.27  ? 185 ALA D CA  1 
ATOM   3800 C  C   . ALA D  1 126 ? 31.368  25.803  49.546  1.00 47.20  ? 185 ALA D C   1 
ATOM   3801 O  O   . ALA D  1 126 ? 30.708  25.142  48.741  1.00 46.66  ? 185 ALA D O   1 
ATOM   3802 C  CB  . ALA D  1 126 ? 33.511  26.136  50.842  1.00 48.63  ? 185 ALA D CB  1 
ATOM   3803 N  N   . GLU D  1 127 ? 31.185  27.102  49.693  1.00 47.80  ? 186 GLU D N   1 
ATOM   3804 C  CA  . GLU D  1 127 ? 30.214  27.821  48.851  1.00 48.98  ? 186 GLU D CA  1 
ATOM   3805 C  C   . GLU D  1 127 ? 30.131  27.276  47.413  1.00 47.52  ? 186 GLU D C   1 
ATOM   3806 O  O   . GLU D  1 127 ? 29.038  27.065  46.875  1.00 47.81  ? 186 GLU D O   1 
ATOM   3807 C  CB  . GLU D  1 127 ? 30.519  29.329  48.778  1.00 50.90  ? 186 GLU D CB  1 
ATOM   3808 C  CG  . GLU D  1 127 ? 30.826  30.030  50.097  1.00 53.41  ? 186 GLU D CG  1 
ATOM   3809 C  CD  . GLU D  1 127 ? 32.317  30.007  50.474  1.00 56.19  ? 186 GLU D CD  1 
ATOM   3810 O  OE1 . GLU D  1 127 ? 33.094  29.154  49.953  1.00 55.69  ? 186 GLU D OE1 1 
ATOM   3811 O  OE2 . GLU D  1 127 ? 32.707  30.847  51.319  1.00 58.62  ? 186 GLU D OE2 1 
ATOM   3812 N  N   . ASN D  1 128 ? 31.289  27.083  46.796  1.00 46.53  ? 187 ASN D N   1 
ATOM   3813 C  CA  . ASN D  1 128 ? 31.355  26.668  45.410  1.00 46.35  ? 187 ASN D CA  1 
ATOM   3814 C  C   . ASN D  1 128 ? 32.329  25.556  45.232  1.00 45.24  ? 187 ASN D C   1 
ATOM   3815 O  O   . ASN D  1 128 ? 33.194  25.346  46.053  1.00 46.12  ? 187 ASN D O   1 
ATOM   3816 C  CB  . ASN D  1 128 ? 31.771  27.834  44.510  1.00 47.65  ? 187 ASN D CB  1 
ATOM   3817 C  CG  . ASN D  1 128 ? 30.618  28.755  44.209  1.00 49.95  ? 187 ASN D CG  1 
ATOM   3818 O  OD1 . ASN D  1 128 ? 29.718  28.427  43.402  1.00 52.87  ? 187 ASN D OD1 1 
ATOM   3819 N  ND2 . ASN D  1 128 ? 30.599  29.900  44.880  1.00 50.24  ? 187 ASN D ND2 1 
ATOM   3820 N  N   . LEU D  1 129 ? 32.187  24.853  44.130  1.00 44.74  ? 188 LEU D N   1 
ATOM   3821 C  CA  . LEU D  1 129 ? 33.053  23.749  43.785  1.00 43.64  ? 188 LEU D CA  1 
ATOM   3822 C  C   . LEU D  1 129 ? 33.347  23.892  42.291  1.00 43.64  ? 188 LEU D C   1 
ATOM   3823 O  O   . LEU D  1 129 ? 32.430  24.131  41.508  1.00 44.21  ? 188 LEU D O   1 
ATOM   3824 C  CB  . LEU D  1 129 ? 32.280  22.474  44.066  1.00 43.12  ? 188 LEU D CB  1 
ATOM   3825 C  CG  . LEU D  1 129 ? 32.838  21.136  43.590  1.00 44.86  ? 188 LEU D CG  1 
ATOM   3826 C  CD1 . LEU D  1 129 ? 34.189  20.852  44.233  1.00 46.15  ? 188 LEU D CD1 1 
ATOM   3827 C  CD2 . LEU D  1 129 ? 31.846  20.027  43.912  1.00 47.04  ? 188 LEU D CD2 1 
ATOM   3828 N  N   . TYR D  1 130 ? 34.604  23.776  41.889  1.00 43.08  ? 189 TYR D N   1 
ATOM   3829 C  CA  . TYR D  1 130 ? 34.989  24.091  40.507  1.00 43.78  ? 189 TYR D CA  1 
ATOM   3830 C  C   . TYR D  1 130 ? 35.331  22.840  39.672  1.00 44.21  ? 189 TYR D C   1 
ATOM   3831 O  O   . TYR D  1 130 ? 36.120  21.975  40.089  1.00 43.75  ? 189 TYR D O   1 
ATOM   3832 C  CB  . TYR D  1 130 ? 36.145  25.075  40.501  1.00 44.36  ? 189 TYR D CB  1 
ATOM   3833 C  CG  . TYR D  1 130 ? 35.892  26.326  41.302  1.00 42.45  ? 189 TYR D CG  1 
ATOM   3834 C  CD1 . TYR D  1 130 ? 35.112  27.366  40.798  1.00 41.76  ? 189 TYR D CD1 1 
ATOM   3835 C  CD2 . TYR D  1 130 ? 36.458  26.492  42.548  1.00 40.47  ? 189 TYR D CD2 1 
ATOM   3836 C  CE1 . TYR D  1 130 ? 34.890  28.527  41.530  1.00 40.57  ? 189 TYR D CE1 1 
ATOM   3837 C  CE2 . TYR D  1 130 ? 36.252  27.655  43.283  1.00 39.57  ? 189 TYR D CE2 1 
ATOM   3838 C  CZ  . TYR D  1 130 ? 35.470  28.655  42.772  1.00 40.20  ? 189 TYR D CZ  1 
ATOM   3839 O  OH  . TYR D  1 130 ? 35.270  29.770  43.530  1.00 40.41  ? 189 TYR D OH  1 
ATOM   3840 N  N   . PHE D  1 131 ? 34.728  22.756  38.493  1.00 45.39  ? 190 PHE D N   1 
ATOM   3841 C  CA  . PHE D  1 131 ? 34.820  21.568  37.645  1.00 46.19  ? 190 PHE D CA  1 
ATOM   3842 C  C   . PHE D  1 131 ? 35.376  22.034  36.340  1.00 48.22  ? 190 PHE D C   1 
ATOM   3843 O  O   . PHE D  1 131 ? 35.200  23.203  35.982  1.00 49.08  ? 190 PHE D O   1 
ATOM   3844 C  CB  . PHE D  1 131 ? 33.424  21.000  37.328  1.00 45.76  ? 190 PHE D CB  1 
ATOM   3845 C  CG  . PHE D  1 131 ? 32.622  20.562  38.539  1.00 45.35  ? 190 PHE D CG  1 
ATOM   3846 C  CD1 . PHE D  1 131 ? 32.672  19.250  38.984  1.00 45.89  ? 190 PHE D CD1 1 
ATOM   3847 C  CD2 . PHE D  1 131 ? 31.763  21.445  39.193  1.00 45.67  ? 190 PHE D CD2 1 
ATOM   3848 C  CE1 . PHE D  1 131 ? 31.915  18.832  40.084  1.00 44.46  ? 190 PHE D CE1 1 
ATOM   3849 C  CE2 . PHE D  1 131 ? 31.017  21.042  40.302  1.00 44.76  ? 190 PHE D CE2 1 
ATOM   3850 C  CZ  . PHE D  1 131 ? 31.094  19.723  40.744  1.00 43.96  ? 190 PHE D CZ  1 
ATOM   3851 N  N   . GLN D  1 132 ? 35.976  21.135  35.576  1.00 49.12  ? 191 GLN D N   1 
ATOM   3852 C  CA  . GLN D  1 132 ? 36.154  21.451  34.145  1.00 51.66  ? 191 GLN D CA  1 
ATOM   3853 C  C   . GLN D  1 132 ? 34.840  21.311  33.358  1.00 51.42  ? 191 GLN D C   1 
ATOM   3854 O  O   . GLN D  1 132 ? 34.464  22.216  32.625  1.00 51.90  ? 191 GLN D O   1 
ATOM   3855 C  CB  . GLN D  1 132 ? 37.248  20.615  33.519  1.00 52.97  ? 191 GLN D CB  1 
ATOM   3856 C  CG  . GLN D  1 132 ? 37.048  19.177  33.722  1.00 52.87  ? 191 GLN D CG  1 
ATOM   3857 C  CD  . GLN D  1 132 ? 38.064  18.400  33.016  1.00 53.20  ? 191 GLN D CD  1 
ATOM   3858 O  OE1 . GLN D  1 132 ? 39.261  18.584  33.244  1.00 54.86  ? 191 GLN D OE1 1 
ATOM   3859 N  NE2 . GLN D  1 132 ? 37.615  17.506  32.152  1.00 52.42  ? 191 GLN D NE2 1 
ATOM   3860 N  N   . ASP E  1 6   ? 26.439  0.984   29.728  1.00 91.50  ? 65  ASP E N   1 
ATOM   3861 C  CA  . ASP E  1 6   ? 26.408  2.445   30.019  1.00 87.82  ? 65  ASP E CA  1 
ATOM   3862 C  C   . ASP E  1 6   ? 27.647  2.898   30.842  1.00 82.31  ? 65  ASP E C   1 
ATOM   3863 O  O   . ASP E  1 6   ? 28.243  2.107   31.588  1.00 81.09  ? 65  ASP E O   1 
ATOM   3864 C  CB  . ASP E  1 6   ? 25.091  2.809   30.728  1.00 88.08  ? 65  ASP E CB  1 
ATOM   3865 N  N   . LYS E  1 7   ? 28.015  4.173   30.691  1.00 79.35  ? 66  LYS E N   1 
ATOM   3866 C  CA  . LYS E  1 7   ? 29.198  4.758   31.331  1.00 74.59  ? 66  LYS E CA  1 
ATOM   3867 C  C   . LYS E  1 7   ? 28.826  6.032   32.030  1.00 71.41  ? 66  LYS E C   1 
ATOM   3868 O  O   . LYS E  1 7   ? 28.054  6.832   31.478  1.00 72.20  ? 66  LYS E O   1 
ATOM   3869 C  CB  . LYS E  1 7   ? 30.241  5.135   30.280  1.00 75.29  ? 66  LYS E CB  1 
ATOM   3870 C  CG  . LYS E  1 7   ? 30.875  3.965   29.555  1.00 78.05  ? 66  LYS E CG  1 
ATOM   3871 C  CD  . LYS E  1 7   ? 31.759  3.153   30.473  1.00 75.65  ? 66  LYS E CD  1 
ATOM   3872 C  CE  . LYS E  1 7   ? 33.068  3.863   30.837  1.00 72.64  ? 66  LYS E CE  1 
ATOM   3873 N  NZ  . LYS E  1 7   ? 34.127  3.644   29.819  1.00 73.93  ? 66  LYS E NZ  1 
ATOM   3874 N  N   . ILE E  1 8   ? 29.396  6.247   33.221  1.00 67.76  ? 67  ILE E N   1 
ATOM   3875 C  CA  . ILE E  1 8   ? 29.107  7.473   33.975  1.00 65.08  ? 67  ILE E CA  1 
ATOM   3876 C  C   . ILE E  1 8   ? 30.324  8.306   34.372  1.00 61.85  ? 67  ILE E C   1 
ATOM   3877 O  O   . ILE E  1 8   ? 31.430  7.804   34.470  1.00 61.22  ? 67  ILE E O   1 
ATOM   3878 C  CB  . ILE E  1 8   ? 28.248  7.204   35.242  1.00 64.46  ? 67  ILE E CB  1 
ATOM   3879 C  CG1 . ILE E  1 8   ? 29.028  6.459   36.317  1.00 62.30  ? 67  ILE E CG1 1 
ATOM   3880 C  CG2 . ILE E  1 8   ? 27.007  6.408   34.911  1.00 67.70  ? 67  ILE E CG2 1 
ATOM   3881 C  CD1 . ILE E  1 8   ? 28.616  6.888   37.691  1.00 60.64  ? 67  ILE E CD1 1 
ATOM   3882 N  N   . THR E  1 9   ? 30.089  9.589   34.616  1.00 60.48  ? 68  THR E N   1 
ATOM   3883 C  CA  . THR E  1 9   ? 31.145  10.532  34.930  1.00 58.55  ? 68  THR E CA  1 
ATOM   3884 C  C   . THR E  1 9   ? 31.270  10.725  36.438  1.00 56.44  ? 68  THR E C   1 
ATOM   3885 O  O   . THR E  1 9   ? 30.277  10.952  37.130  1.00 56.13  ? 68  THR E O   1 
ATOM   3886 C  CB  . THR E  1 9   ? 30.886  11.897  34.263  1.00 59.20  ? 68  THR E CB  1 
ATOM   3887 O  OG1 . THR E  1 9   ? 30.885  11.730  32.842  1.00 61.99  ? 68  THR E OG1 1 
ATOM   3888 C  CG2 . THR E  1 9   ? 31.950  12.921  34.642  1.00 57.60  ? 68  THR E CG2 1 
ATOM   3889 N  N   . VAL E  1 10  ? 32.505  10.630  36.928  1.00 55.04  ? 69  VAL E N   1 
ATOM   3890 C  CA  . VAL E  1 10  ? 32.823  10.894  38.309  1.00 53.29  ? 69  VAL E CA  1 
ATOM   3891 C  C   . VAL E  1 10  ? 33.938  11.931  38.378  1.00 52.86  ? 69  VAL E C   1 
ATOM   3892 O  O   . VAL E  1 10  ? 34.943  11.830  37.695  1.00 53.10  ? 69  VAL E O   1 
ATOM   3893 C  CB  . VAL E  1 10  ? 33.278  9.616   39.024  1.00 52.63  ? 69  VAL E CB  1 
ATOM   3894 C  CG1 . VAL E  1 10  ? 33.581  9.917   40.477  1.00 51.22  ? 69  VAL E CG1 1 
ATOM   3895 C  CG2 . VAL E  1 10  ? 32.213  8.537   38.923  1.00 53.41  ? 69  VAL E CG2 1 
ATOM   3896 N  N   . HIS E  1 11  ? 33.742  12.928  39.217  1.00 52.61  ? 70  HIS E N   1 
ATOM   3897 C  CA  . HIS E  1 11  ? 34.760  13.910  39.518  1.00 52.84  ? 70  HIS E CA  1 
ATOM   3898 C  C   . HIS E  1 11  ? 35.464  13.595  40.837  1.00 51.92  ? 70  HIS E C   1 
ATOM   3899 O  O   . HIS E  1 11  ? 34.815  13.340  41.841  1.00 51.46  ? 70  HIS E O   1 
ATOM   3900 C  CB  . HIS E  1 11  ? 34.118  15.290  39.629  1.00 53.83  ? 70  HIS E CB  1 
ATOM   3901 C  CG  . HIS E  1 11  ? 33.308  15.678  38.435  1.00 55.19  ? 70  HIS E CG  1 
ATOM   3902 N  ND1 . HIS E  1 11  ? 33.870  15.929  37.200  1.00 56.00  ? 70  HIS E ND1 1 
ATOM   3903 C  CD2 . HIS E  1 11  ? 31.972  15.867  38.289  1.00 55.82  ? 70  HIS E CD2 1 
ATOM   3904 C  CE1 . HIS E  1 11  ? 32.913  16.239  36.344  1.00 57.28  ? 70  HIS E CE1 1 
ATOM   3905 N  NE2 . HIS E  1 11  ? 31.754  16.210  36.977  1.00 57.22  ? 70  HIS E NE2 1 
ATOM   3906 N  N   . PHE E  1 12  ? 36.791  13.626  40.831  1.00 52.11  ? 71  PHE E N   1 
ATOM   3907 C  CA  . PHE E  1 12  ? 37.567  13.451  42.041  1.00 51.90  ? 71  PHE E CA  1 
ATOM   3908 C  C   . PHE E  1 12  ? 38.212  14.760  42.422  1.00 53.19  ? 71  PHE E C   1 
ATOM   3909 O  O   . PHE E  1 12  ? 38.797  15.422  41.591  1.00 54.40  ? 71  PHE E O   1 
ATOM   3910 C  CB  . PHE E  1 12  ? 38.678  12.436  41.821  1.00 51.97  ? 71  PHE E CB  1 
ATOM   3911 C  CG  . PHE E  1 12  ? 38.215  11.021  41.689  1.00 50.84  ? 71  PHE E CG  1 
ATOM   3912 C  CD1 . PHE E  1 12  ? 38.418  10.120  42.706  1.00 50.41  ? 71  PHE E CD1 1 
ATOM   3913 C  CD2 . PHE E  1 12  ? 37.638  10.578  40.527  1.00 51.30  ? 71  PHE E CD2 1 
ATOM   3914 C  CE1 . PHE E  1 12  ? 38.008  8.807   42.583  1.00 50.73  ? 71  PHE E CE1 1 
ATOM   3915 C  CE2 . PHE E  1 12  ? 37.240  9.274   40.394  1.00 51.63  ? 71  PHE E CE2 1 
ATOM   3916 C  CZ  . PHE E  1 12  ? 37.423  8.382   41.426  1.00 50.92  ? 71  PHE E CZ  1 
ATOM   3917 N  N   . ILE E  1 13  ? 38.126  15.136  43.685  1.00 53.47  ? 72  ILE E N   1 
ATOM   3918 C  CA  . ILE E  1 13  ? 38.968  16.202  44.188  1.00 55.54  ? 72  ILE E CA  1 
ATOM   3919 C  C   . ILE E  1 13  ? 40.163  15.566  44.894  1.00 56.33  ? 72  ILE E C   1 
ATOM   3920 O  O   . ILE E  1 13  ? 40.008  14.854  45.863  1.00 55.54  ? 72  ILE E O   1 
ATOM   3921 C  CB  . ILE E  1 13  ? 38.218  17.093  45.128  1.00 56.28  ? 72  ILE E CB  1 
ATOM   3922 C  CG1 . ILE E  1 13  ? 37.073  17.769  44.379  1.00 56.26  ? 72  ILE E CG1 1 
ATOM   3923 C  CG2 . ILE E  1 13  ? 39.138  18.123  45.725  1.00 58.31  ? 72  ILE E CG2 1 
ATOM   3924 C  CD1 . ILE E  1 13  ? 36.225  18.671  45.247  1.00 57.25  ? 72  ILE E CD1 1 
ATOM   3925 N  N   . ASN E  1 14  ? 41.362  15.832  44.393  1.00 58.25  ? 73  ASN E N   1 
ATOM   3926 C  CA  . ASN E  1 14  ? 42.571  15.228  44.915  1.00 59.36  ? 73  ASN E CA  1 
ATOM   3927 C  C   . ASN E  1 14  ? 42.976  15.873  46.245  1.00 61.24  ? 73  ASN E C   1 
ATOM   3928 O  O   . ASN E  1 14  ? 42.448  16.907  46.654  1.00 61.72  ? 73  ASN E O   1 
ATOM   3929 C  CB  . ASN E  1 14  ? 43.698  15.390  43.875  1.00 61.74  ? 73  ASN E CB  1 
ATOM   3930 C  CG  . ASN E  1 14  ? 44.629  14.174  43.790  1.00 63.01  ? 73  ASN E CG  1 
ATOM   3931 O  OD1 . ASN E  1 14  ? 44.789  13.401  44.747  1.00 62.77  ? 73  ASN E OD1 1 
ATOM   3932 N  ND2 . ASN E  1 14  ? 45.256  14.012  42.626  1.00 63.62  ? 73  ASN E ND2 1 
ATOM   3933 N  N   . ARG E  1 15  ? 43.953  15.266  46.903  1.00 62.43  ? 74  ARG E N   1 
ATOM   3934 C  CA  . ARG E  1 15  ? 44.545  15.861  48.095  1.00 65.36  ? 74  ARG E CA  1 
ATOM   3935 C  C   . ARG E  1 15  ? 45.144  17.212  47.792  1.00 68.96  ? 74  ARG E C   1 
ATOM   3936 O  O   . ARG E  1 15  ? 45.133  18.082  48.647  1.00 71.28  ? 74  ARG E O   1 
ATOM   3937 C  CB  . ARG E  1 15  ? 45.624  14.942  48.660  1.00 66.43  ? 74  ARG E CB  1 
ATOM   3938 C  CG  . ARG E  1 15  ? 45.063  13.703  49.327  1.00 63.74  ? 74  ARG E CG  1 
ATOM   3939 C  CD  . ARG E  1 15  ? 46.072  12.565  49.459  1.00 64.08  ? 74  ARG E CD  1 
ATOM   3940 N  NE  . ARG E  1 15  ? 45.397  11.311  49.808  1.00 61.65  ? 74  ARG E NE  1 
ATOM   3941 C  CZ  . ARG E  1 15  ? 45.784  10.087  49.434  1.00 61.19  ? 74  ARG E CZ  1 
ATOM   3942 N  NH1 . ARG E  1 15  ? 46.872  9.904   48.702  1.00 63.73  ? 74  ARG E NH1 1 
ATOM   3943 N  NH2 . ARG E  1 15  ? 45.074  9.028   49.789  1.00 58.51  ? 74  ARG E NH2 1 
ATOM   3944 N  N   . ASP E  1 16  ? 45.683  17.341  46.571  1.00 70.02  ? 75  ASP E N   1 
ATOM   3945 C  CA  . ASP E  1 16  ? 46.248  18.589  46.005  1.00 73.71  ? 75  ASP E CA  1 
ATOM   3946 C  C   . ASP E  1 16  ? 45.218  19.713  45.865  1.00 73.50  ? 75  ASP E C   1 
ATOM   3947 O  O   . ASP E  1 16  ? 45.581  20.886  45.818  1.00 76.63  ? 75  ASP E O   1 
ATOM   3948 C  CB  . ASP E  1 16  ? 46.835  18.312  44.597  1.00 74.07  ? 75  ASP E CB  1 
ATOM   3949 C  CG  . ASP E  1 16  ? 48.160  17.551  44.637  1.00 76.87  ? 75  ASP E CG  1 
ATOM   3950 O  OD1 . ASP E  1 16  ? 48.580  17.117  45.732  1.00 78.74  ? 75  ASP E OD1 1 
ATOM   3951 O  OD2 . ASP E  1 16  ? 48.789  17.390  43.565  1.00 77.95  ? 75  ASP E OD2 1 
ATOM   3952 N  N   . GLY E  1 17  ? 43.945  19.341  45.763  1.00 69.87  ? 76  GLY E N   1 
ATOM   3953 C  CA  . GLY E  1 17  ? 42.886  20.294  45.509  1.00 69.77  ? 76  GLY E CA  1 
ATOM   3954 C  C   . GLY E  1 17  ? 42.558  20.340  44.027  1.00 68.58  ? 76  GLY E C   1 
ATOM   3955 O  O   . GLY E  1 17  ? 41.751  21.148  43.597  1.00 69.03  ? 76  GLY E O   1 
ATOM   3956 N  N   . GLU E  1 18  ? 43.156  19.450  43.244  1.00 67.52  ? 77  GLU E N   1 
ATOM   3957 C  CA  . GLU E  1 18  ? 42.954  19.446  41.811  1.00 67.06  ? 77  GLU E CA  1 
ATOM   3958 C  C   . GLU E  1 18  ? 41.833  18.514  41.442  1.00 63.25  ? 77  GLU E C   1 
ATOM   3959 O  O   . GLU E  1 18  ? 41.743  17.444  41.999  1.00 61.33  ? 77  GLU E O   1 
ATOM   3960 C  CB  . GLU E  1 18  ? 44.227  19.004  41.125  1.00 69.01  ? 77  GLU E CB  1 
ATOM   3961 C  CG  . GLU E  1 18  ? 44.095  18.808  39.615  1.00 69.64  ? 77  GLU E CG  1 
ATOM   3962 N  N   . THR E  1 19  ? 40.981  18.924  40.505  1.00 62.70  ? 78  THR E N   1 
ATOM   3963 C  CA  . THR E  1 19  ? 39.826  18.135  40.126  1.00 60.13  ? 78  THR E CA  1 
ATOM   3964 C  C   . THR E  1 19  ? 40.142  17.297  38.889  1.00 59.71  ? 78  THR E C   1 
ATOM   3965 O  O   . THR E  1 19  ? 40.617  17.808  37.892  1.00 61.44  ? 78  THR E O   1 
ATOM   3966 C  CB  . THR E  1 19  ? 38.598  19.019  39.890  1.00 60.28  ? 78  THR E CB  1 
ATOM   3967 O  OG1 . THR E  1 19  ? 38.489  19.968  40.963  1.00 61.03  ? 78  THR E OG1 1 
ATOM   3968 C  CG2 . THR E  1 19  ? 37.314  18.157  39.831  1.00 58.29  ? 78  THR E CG2 1 
ATOM   3969 N  N   . LEU E  1 20  ? 39.922  15.992  38.999  1.00 57.90  ? 79  LEU E N   1 
ATOM   3970 C  CA  . LEU E  1 20  ? 40.122  15.066  37.901  1.00 57.95  ? 79  LEU E CA  1 
ATOM   3971 C  C   . LEU E  1 20  ? 38.749  14.555  37.511  1.00 56.73  ? 79  LEU E C   1 
ATOM   3972 O  O   . LEU E  1 20  ? 38.021  14.038  38.357  1.00 55.37  ? 79  LEU E O   1 
ATOM   3973 C  CB  . LEU E  1 20  ? 41.009  13.882  38.329  1.00 57.59  ? 79  LEU E CB  1 
ATOM   3974 C  CG  . LEU E  1 20  ? 42.308  14.153  39.107  1.00 59.60  ? 79  LEU E CG  1 
ATOM   3975 C  CD1 . LEU E  1 20  ? 42.911  12.844  39.568  1.00 59.00  ? 79  LEU E CD1 1 
ATOM   3976 C  CD2 . LEU E  1 20  ? 43.361  14.942  38.295  1.00 62.92  ? 79  LEU E CD2 1 
ATOM   3977 N  N   . THR E  1 21  ? 38.394  14.687  36.241  1.00 57.60  ? 80  THR E N   1 
ATOM   3978 C  CA  . THR E  1 21  ? 37.127  14.177  35.743  1.00 56.89  ? 80  THR E CA  1 
ATOM   3979 C  C   . THR E  1 21  ? 37.401  12.939  34.919  1.00 57.17  ? 80  THR E C   1 
ATOM   3980 O  O   . THR E  1 21  ? 38.227  12.973  34.049  1.00 58.67  ? 80  THR E O   1 
ATOM   3981 C  CB  . THR E  1 21  ? 36.410  15.222  34.867  1.00 58.38  ? 80  THR E CB  1 
ATOM   3982 O  OG1 . THR E  1 21  ? 36.015  16.352  35.652  1.00 57.55  ? 80  THR E OG1 1 
ATOM   3983 C  CG2 . THR E  1 21  ? 35.172  14.645  34.213  1.00 58.74  ? 80  THR E CG2 1 
ATOM   3984 N  N   . THR E  1 22  ? 36.702  11.848  35.215  1.00 56.48  ? 81  THR E N   1 
ATOM   3985 C  CA  . THR E  1 22  ? 36.919  10.568  34.551  1.00 57.48  ? 81  THR E CA  1 
ATOM   3986 C  C   . THR E  1 22  ? 35.592  9.857   34.359  1.00 57.79  ? 81  THR E C   1 
ATOM   3987 O  O   . THR E  1 22  ? 34.558  10.328  34.794  1.00 57.46  ? 81  THR E O   1 
ATOM   3988 C  CB  . THR E  1 22  ? 37.920  9.669   35.353  1.00 56.77  ? 81  THR E CB  1 
ATOM   3989 O  OG1 . THR E  1 22  ? 38.416  8.612   34.526  1.00 57.97  ? 81  THR E OG1 1 
ATOM   3990 C  CG2 . THR E  1 22  ? 37.264  9.091   36.591  1.00 54.73  ? 81  THR E CG2 1 
ATOM   3991 N  N   . LYS E  1 23  ? 35.630  8.729   33.676  1.00 59.49  ? 82  LYS E N   1 
ATOM   3992 C  CA  . LYS E  1 23  ? 34.426  8.004   33.319  1.00 60.98  ? 82  LYS E CA  1 
ATOM   3993 C  C   . LYS E  1 23  ? 34.588  6.593   33.822  1.00 60.96  ? 82  LYS E C   1 
ATOM   3994 O  O   . LYS E  1 23  ? 35.644  5.994   33.630  1.00 61.58  ? 82  LYS E O   1 
ATOM   3995 C  CB  . LYS E  1 23  ? 34.239  8.007   31.792  1.00 63.89  ? 82  LYS E CB  1 
ATOM   3996 C  CG  . LYS E  1 23  ? 33.613  9.280   31.256  1.00 64.55  ? 82  LYS E CG  1 
ATOM   3997 C  CD  . LYS E  1 23  ? 33.065  9.092   29.849  1.00 68.08  ? 82  LYS E CD  1 
ATOM   3998 C  CE  . LYS E  1 23  ? 34.094  8.404   28.964  1.00 70.69  ? 82  LYS E CE  1 
ATOM   3999 N  NZ  . LYS E  1 23  ? 33.855  8.618   27.532  1.00 74.76  ? 82  LYS E NZ  1 
ATOM   4000 N  N   . GLY E  1 24  ? 33.556  6.060   34.461  1.00 60.66  ? 83  GLY E N   1 
ATOM   4001 C  CA  . GLY E  1 24  ? 33.596  4.676   34.942  1.00 61.40  ? 83  GLY E CA  1 
ATOM   4002 C  C   . GLY E  1 24  ? 32.408  3.858   34.501  1.00 63.87  ? 83  GLY E C   1 
ATOM   4003 O  O   . GLY E  1 24  ? 31.349  4.409   34.213  1.00 64.49  ? 83  GLY E O   1 
ATOM   4004 N  N   . LYS E  1 25  ? 32.588  2.542   34.460  1.00 65.81  ? 84  LYS E N   1 
ATOM   4005 C  CA  . LYS E  1 25  ? 31.492  1.630   34.110  1.00 69.54  ? 84  LYS E CA  1 
ATOM   4006 C  C   . LYS E  1 25  ? 30.581  1.466   35.308  1.00 68.39  ? 84  LYS E C   1 
ATOM   4007 O  O   . LYS E  1 25  ? 31.049  1.379   36.440  1.00 65.94  ? 84  LYS E O   1 
ATOM   4008 C  CB  . LYS E  1 25  ? 32.003  0.244   33.663  1.00 72.51  ? 84  LYS E CB  1 
ATOM   4009 C  CG  . LYS E  1 25  ? 32.794  0.239   32.337  1.00 75.92  ? 84  LYS E CG  1 
ATOM   4010 C  CD  . LYS E  1 25  ? 32.331  -0.886  31.365  1.00 82.06  ? 84  LYS E CD  1 
ATOM   4011 C  CE  . LYS E  1 25  ? 32.869  -0.699  29.913  1.00 84.86  ? 84  LYS E CE  1 
ATOM   4012 N  NZ  . LYS E  1 25  ? 32.149  -1.524  28.870  1.00 90.05  ? 84  LYS E NZ  1 
ATOM   4013 N  N   . VAL E  1 26  ? 29.279  1.428   35.059  1.00 70.80  ? 85  VAL E N   1 
ATOM   4014 C  CA  . VAL E  1 26  ? 28.319  1.065   36.106  1.00 71.20  ? 85  VAL E CA  1 
ATOM   4015 C  C   . VAL E  1 26  ? 28.674  -0.347  36.619  1.00 72.23  ? 85  VAL E C   1 
ATOM   4016 O  O   . VAL E  1 26  ? 28.958  -1.253  35.826  1.00 74.67  ? 85  VAL E O   1 
ATOM   4017 C  CB  . VAL E  1 26  ? 26.863  1.099   35.562  1.00 74.96  ? 85  VAL E CB  1 
ATOM   4018 C  CG1 . VAL E  1 26  ? 25.865  0.696   36.621  1.00 75.70  ? 85  VAL E CG1 1 
ATOM   4019 C  CG2 . VAL E  1 26  ? 26.533  2.486   35.049  1.00 74.61  ? 85  VAL E CG2 1 
ATOM   4020 N  N   . GLY E  1 27  ? 28.699  -0.515  37.939  1.00 70.17  ? 86  GLY E N   1 
ATOM   4021 C  CA  . GLY E  1 27  ? 29.081  -1.790  38.532  1.00 71.17  ? 86  GLY E CA  1 
ATOM   4022 C  C   . GLY E  1 27  ? 30.529  -1.875  38.987  1.00 68.34  ? 86  GLY E C   1 
ATOM   4023 O  O   . GLY E  1 27  ? 30.886  -2.736  39.791  1.00 68.53  ? 86  GLY E O   1 
ATOM   4024 N  N   . ASP E  1 28  ? 31.377  -0.993  38.484  1.00 66.24  ? 87  ASP E N   1 
ATOM   4025 C  CA  . ASP E  1 28  ? 32.780  -0.939  38.928  1.00 63.85  ? 87  ASP E CA  1 
ATOM   4026 C  C   . ASP E  1 28  ? 32.887  -0.256  40.304  1.00 60.75  ? 87  ASP E C   1 
ATOM   4027 O  O   . ASP E  1 28  ? 32.072  0.616   40.641  1.00 59.70  ? 87  ASP E O   1 
ATOM   4028 C  CB  . ASP E  1 28  ? 33.638  -0.155  37.917  1.00 63.28  ? 87  ASP E CB  1 
ATOM   4029 C  CG  . ASP E  1 28  ? 34.108  -0.998  36.725  1.00 66.65  ? 87  ASP E CG  1 
ATOM   4030 O  OD1 . ASP E  1 28  ? 33.895  -2.228  36.692  1.00 69.40  ? 87  ASP E OD1 1 
ATOM   4031 O  OD2 . ASP E  1 28  ? 34.711  -0.410  35.801  1.00 67.15  ? 87  ASP E OD2 1 
ATOM   4032 N  N   . SER E  1 29  ? 33.887  -0.647  41.096  1.00 59.36  ? 88  SER E N   1 
ATOM   4033 C  CA  . SER E  1 29  ? 34.137  0.005   42.383  1.00 56.89  ? 88  SER E CA  1 
ATOM   4034 C  C   . SER E  1 29  ? 34.914  1.278   42.131  1.00 55.10  ? 88  SER E C   1 
ATOM   4035 O  O   . SER E  1 29  ? 35.626  1.381   41.130  1.00 55.60  ? 88  SER E O   1 
ATOM   4036 C  CB  . SER E  1 29  ? 34.936  -0.899  43.315  1.00 56.87  ? 88  SER E CB  1 
ATOM   4037 O  OG  . SER E  1 29  ? 36.321  -0.884  42.995  1.00 56.80  ? 88  SER E OG  1 
ATOM   4038 N  N   . LEU E  1 30  ? 34.811  2.250   43.029  1.00 53.21  ? 89  LEU E N   1 
ATOM   4039 C  CA  . LEU E  1 30  ? 35.581  3.485   42.851  1.00 51.85  ? 89  LEU E CA  1 
ATOM   4040 C  C   . LEU E  1 30  ? 37.088  3.233   42.835  1.00 51.82  ? 89  LEU E C   1 
ATOM   4041 O  O   . LEU E  1 30  ? 37.842  3.982   42.207  1.00 51.61  ? 89  LEU E O   1 
ATOM   4042 C  CB  . LEU E  1 30  ? 35.196  4.531   43.890  1.00 50.44  ? 89  LEU E CB  1 
ATOM   4043 C  CG  . LEU E  1 30  ? 33.897  5.246   43.473  1.00 51.08  ? 89  LEU E CG  1 
ATOM   4044 C  CD1 . LEU E  1 30  ? 32.982  5.544   44.627  1.00 50.83  ? 89  LEU E CD1 1 
ATOM   4045 C  CD2 . LEU E  1 30  ? 34.206  6.527   42.709  1.00 50.02  ? 89  LEU E CD2 1 
ATOM   4046 N  N   . LEU E  1 31  ? 37.533  2.167   43.495  1.00 52.40  ? 90  LEU E N   1 
ATOM   4047 C  CA  . LEU E  1 31  ? 38.935  1.775   43.391  1.00 52.83  ? 90  LEU E CA  1 
ATOM   4048 C  C   . LEU E  1 31  ? 39.238  1.381   41.953  1.00 54.30  ? 90  LEU E C   1 
ATOM   4049 O  O   . LEU E  1 31  ? 40.210  1.843   41.374  1.00 54.79  ? 90  LEU E O   1 
ATOM   4050 C  CB  . LEU E  1 31  ? 39.276  0.622   44.338  1.00 53.14  ? 90  LEU E CB  1 
ATOM   4051 C  CG  . LEU E  1 31  ? 40.712  0.076   44.193  1.00 54.13  ? 90  LEU E CG  1 
ATOM   4052 C  CD1 . LEU E  1 31  ? 41.751  1.199   44.402  1.00 53.27  ? 90  LEU E CD1 1 
ATOM   4053 C  CD2 . LEU E  1 31  ? 40.977  -1.083  45.119  1.00 54.12  ? 90  LEU E CD2 1 
ATOM   4054 N  N   . ASP E  1 32  ? 38.396  0.522   41.385  1.00 55.76  ? 91  ASP E N   1 
ATOM   4055 C  CA  . ASP E  1 32  ? 38.551  0.103   39.983  1.00 57.83  ? 91  ASP E CA  1 
ATOM   4056 C  C   . ASP E  1 32  ? 38.695  1.319   39.071  1.00 57.31  ? 91  ASP E C   1 
ATOM   4057 O  O   . ASP E  1 32  ? 39.510  1.323   38.164  1.00 58.73  ? 91  ASP E O   1 
ATOM   4058 C  CB  . ASP E  1 32  ? 37.361  -0.739  39.506  1.00 59.69  ? 91  ASP E CB  1 
ATOM   4059 C  CG  . ASP E  1 32  ? 37.261  -2.085  40.212  1.00 61.46  ? 91  ASP E CG  1 
ATOM   4060 O  OD1 . ASP E  1 32  ? 38.298  -2.633  40.635  1.00 62.51  ? 91  ASP E OD1 1 
ATOM   4061 O  OD2 . ASP E  1 32  ? 36.131  -2.607  40.344  1.00 62.86  ? 91  ASP E OD2 1 
ATOM   4062 N  N   . VAL E  1 33  ? 37.909  2.355   39.333  1.00 55.79  ? 92  VAL E N   1 
ATOM   4063 C  CA  . VAL E  1 33  ? 37.929  3.553   38.510  1.00 55.70  ? 92  VAL E CA  1 
ATOM   4064 C  C   . VAL E  1 33  ? 39.280  4.232   38.609  1.00 55.46  ? 92  VAL E C   1 
ATOM   4065 O  O   . VAL E  1 33  ? 39.872  4.576   37.596  1.00 57.08  ? 92  VAL E O   1 
ATOM   4066 C  CB  . VAL E  1 33  ? 36.809  4.539   38.889  1.00 54.42  ? 92  VAL E CB  1 
ATOM   4067 C  CG1 . VAL E  1 33  ? 36.980  5.875   38.175  1.00 53.93  ? 92  VAL E CG1 1 
ATOM   4068 C  CG2 . VAL E  1 33  ? 35.465  3.932   38.558  1.00 55.54  ? 92  VAL E CG2 1 
ATOM   4069 N  N   . VAL E  1 34  ? 39.774  4.405   39.827  1.00 54.20  ? 93  VAL E N   1 
ATOM   4070 C  CA  . VAL E  1 34  ? 41.075  5.015   40.044  1.00 54.29  ? 93  VAL E CA  1 
ATOM   4071 C  C   . VAL E  1 34  ? 42.160  4.235   39.308  1.00 56.29  ? 93  VAL E C   1 
ATOM   4072 O  O   . VAL E  1 34  ? 42.975  4.811   38.604  1.00 57.45  ? 93  VAL E O   1 
ATOM   4073 C  CB  . VAL E  1 34  ? 41.391  5.097   41.549  1.00 53.35  ? 93  VAL E CB  1 
ATOM   4074 C  CG1 . VAL E  1 34  ? 42.784  5.617   41.786  1.00 54.14  ? 93  VAL E CG1 1 
ATOM   4075 C  CG2 . VAL E  1 34  ? 40.362  5.973   42.261  1.00 51.58  ? 93  VAL E CG2 1 
ATOM   4076 N  N   . VAL E  1 35  ? 42.143  2.918   39.441  1.00 57.05  ? 94  VAL E N   1 
ATOM   4077 C  CA  . VAL E  1 35  ? 43.209  2.097   38.892  1.00 59.57  ? 94  VAL E CA  1 
ATOM   4078 C  C   . VAL E  1 35  ? 43.103  1.934   37.374  1.00 61.95  ? 94  VAL E C   1 
ATOM   4079 O  O   . VAL E  1 35  ? 44.101  2.085   36.652  1.00 64.04  ? 94  VAL E O   1 
ATOM   4080 C  CB  . VAL E  1 35  ? 43.232  0.695   39.532  1.00 60.17  ? 94  VAL E CB  1 
ATOM   4081 C  CG1 . VAL E  1 35  ? 44.176  -0.226  38.768  1.00 62.73  ? 94  VAL E CG1 1 
ATOM   4082 C  CG2 . VAL E  1 35  ? 43.650  0.777   40.994  1.00 58.64  ? 94  VAL E CG2 1 
ATOM   4083 N  N   . GLU E  1 36  ? 41.908  1.592   36.892  1.00 62.15  ? 95  GLU E N   1 
ATOM   4084 C  CA  . GLU E  1 36  ? 41.717  1.326   35.456  1.00 64.84  ? 95  GLU E CA  1 
ATOM   4085 C  C   . GLU E  1 36  ? 41.957  2.571   34.594  1.00 65.12  ? 95  GLU E C   1 
ATOM   4086 O  O   . GLU E  1 36  ? 42.290  2.444   33.410  1.00 67.49  ? 95  GLU E O   1 
ATOM   4087 C  CB  . GLU E  1 36  ? 40.336  0.704   35.160  1.00 65.58  ? 95  GLU E CB  1 
ATOM   4088 C  CG  . GLU E  1 36  ? 40.220  -0.790  35.543  1.00 66.97  ? 95  GLU E CG  1 
ATOM   4089 N  N   . ASN E  1 37  ? 41.810  3.759   35.194  1.00 62.67  ? 96  ASN E N   1 
ATOM   4090 C  CA  . ASN E  1 37  ? 42.059  5.016   34.496  1.00 63.15  ? 96  ASN E CA  1 
ATOM   4091 C  C   . ASN E  1 37  ? 43.368  5.721   34.888  1.00 63.61  ? 96  ASN E C   1 
ATOM   4092 O  O   . ASN E  1 37  ? 43.639  6.835   34.427  1.00 64.29  ? 96  ASN E O   1 
ATOM   4093 C  CB  . ASN E  1 37  ? 40.865  5.966   34.674  1.00 61.47  ? 96  ASN E CB  1 
ATOM   4094 C  CG  . ASN E  1 37  ? 39.591  5.469   33.979  1.00 61.80  ? 96  ASN E CG  1 
ATOM   4095 O  OD1 . ASN E  1 37  ? 38.505  5.691   34.473  1.00 60.80  ? 96  ASN E OD1 1 
ATOM   4096 N  ND2 . ASN E  1 37  ? 39.726  4.820   32.839  1.00 64.35  ? 96  ASN E ND2 1 
ATOM   4097 N  N   . ASN E  1 38  ? 44.181  5.068   35.718  1.00 63.74  ? 97  ASN E N   1 
ATOM   4098 C  CA  . ASN E  1 38  ? 45.535  5.539   36.044  1.00 65.13  ? 97  ASN E CA  1 
ATOM   4099 C  C   . ASN E  1 38  ? 45.543  7.005   36.458  1.00 64.07  ? 97  ASN E C   1 
ATOM   4100 O  O   . ASN E  1 38  ? 46.219  7.837   35.859  1.00 65.80  ? 97  ASN E O   1 
ATOM   4101 C  CB  . ASN E  1 38  ? 46.515  5.256   34.884  1.00 68.72  ? 97  ASN E CB  1 
ATOM   4102 C  CG  . ASN E  1 38  ? 47.189  3.853   34.987  1.00 72.02  ? 97  ASN E CG  1 
ATOM   4103 O  OD1 . ASN E  1 38  ? 47.430  3.201   33.966  1.00 76.72  ? 97  ASN E OD1 1 
ATOM   4104 N  ND2 . ASN E  1 38  ? 47.493  3.401   36.216  1.00 70.61  ? 97  ASN E ND2 1 
ATOM   4105 N  N   . LEU E  1 39  ? 44.750  7.295   37.488  1.00 61.50  ? 98  LEU E N   1 
ATOM   4106 C  CA  . LEU E  1 39  ? 44.616  8.642   38.044  1.00 60.81  ? 98  LEU E CA  1 
ATOM   4107 C  C   . LEU E  1 39  ? 45.758  8.957   38.993  1.00 62.20  ? 98  LEU E C   1 
ATOM   4108 O  O   . LEU E  1 39  ? 46.317  8.053   39.628  1.00 62.44  ? 98  LEU E O   1 
ATOM   4109 C  CB  . LEU E  1 39  ? 43.295  8.797   38.804  1.00 57.97  ? 98  LEU E CB  1 
ATOM   4110 C  CG  . LEU E  1 39  ? 42.003  8.616   38.001  1.00 57.34  ? 98  LEU E CG  1 
ATOM   4111 C  CD1 . LEU E  1 39  ? 40.805  8.763   38.904  1.00 55.43  ? 98  LEU E CD1 1 
ATOM   4112 C  CD2 . LEU E  1 39  ? 41.914  9.612   36.853  1.00 59.02  ? 98  LEU E CD2 1 
ATOM   4113 N  N   . ASP E  1 40  ? 46.068  10.255  39.109  1.00 63.62  ? 99  ASP E N   1 
ATOM   4114 C  CA  . ASP E  1 40  ? 47.248  10.740  39.847  1.00 65.94  ? 99  ASP E CA  1 
ATOM   4115 C  C   . ASP E  1 40  ? 47.028  10.793  41.376  1.00 64.88  ? 99  ASP E C   1 
ATOM   4116 O  O   . ASP E  1 40  ? 47.223  11.851  41.991  1.00 66.77  ? 99  ASP E O   1 
ATOM   4117 C  CB  . ASP E  1 40  ? 47.657  12.132  39.319  1.00 68.30  ? 99  ASP E CB  1 
ATOM   4118 C  CG  . ASP E  1 40  ? 49.038  12.586  39.830  1.00 72.63  ? 99  ASP E CG  1 
ATOM   4119 O  OD1 . ASP E  1 40  ? 49.780  11.790  40.477  1.00 73.71  ? 99  ASP E OD1 1 
ATOM   4120 O  OD2 . ASP E  1 40  ? 49.387  13.758  39.571  1.00 75.52  ? 99  ASP E OD2 1 
ATOM   4121 N  N   . ILE E  1 41  ? 46.654  9.660   41.985  1.00 62.76  ? 100 ILE E N   1 
ATOM   4122 C  CA  . ILE E  1 41  ? 46.430  9.595   43.432  1.00 61.50  ? 100 ILE E CA  1 
ATOM   4123 C  C   . ILE E  1 41  ? 47.395  8.614   44.071  1.00 62.78  ? 100 ILE E C   1 
ATOM   4124 O  O   . ILE E  1 41  ? 47.252  7.398   43.909  1.00 62.31  ? 100 ILE E O   1 
ATOM   4125 C  CB  . ILE E  1 41  ? 45.011  9.145   43.787  1.00 58.56  ? 100 ILE E CB  1 
ATOM   4126 C  CG1 . ILE E  1 41  ? 43.972  9.947   43.015  1.00 57.33  ? 100 ILE E CG1 1 
ATOM   4127 C  CG2 . ILE E  1 41  ? 44.779  9.314   45.295  1.00 58.59  ? 100 ILE E CG2 1 
ATOM   4128 C  CD1 . ILE E  1 41  ? 42.649  9.286   42.969  1.00 54.42  ? 100 ILE E CD1 1 
ATOM   4129 N  N   . ASP E  1 42  ? 48.354  9.147   44.823  1.00 65.04  ? 101 ASP E N   1 
ATOM   4130 C  CA  . ASP E  1 42  ? 49.412  8.342   45.408  1.00 66.81  ? 101 ASP E CA  1 
ATOM   4131 C  C   . ASP E  1 42  ? 48.856  7.556   46.598  1.00 64.85  ? 101 ASP E C   1 
ATOM   4132 O  O   . ASP E  1 42  ? 48.048  8.074   47.355  1.00 63.91  ? 101 ASP E O   1 
ATOM   4133 C  CB  . ASP E  1 42  ? 50.588  9.242   45.831  1.00 70.88  ? 101 ASP E CB  1 
ATOM   4134 C  CG  . ASP E  1 42  ? 51.059  10.200  44.685  1.00 74.36  ? 101 ASP E CG  1 
ATOM   4135 O  OD1 . ASP E  1 42  ? 50.598  10.040  43.529  1.00 73.65  ? 101 ASP E OD1 1 
ATOM   4136 O  OD2 . ASP E  1 42  ? 51.871  11.125  44.938  1.00 77.52  ? 101 ASP E OD2 1 
ATOM   4137 N  N   . GLY E  1 43  ? 49.243  6.291   46.722  1.00 64.84  ? 102 GLY E N   1 
ATOM   4138 C  CA  . GLY E  1 43  ? 48.952  5.499   47.921  1.00 64.03  ? 102 GLY E CA  1 
ATOM   4139 C  C   . GLY E  1 43  ? 47.561  4.889   48.023  1.00 60.97  ? 102 GLY E C   1 
ATOM   4140 O  O   . GLY E  1 43  ? 47.315  4.049   48.902  1.00 61.33  ? 102 GLY E O   1 
ATOM   4141 N  N   . PHE E  1 44  ? 46.675  5.264   47.110  1.00 58.91  ? 103 PHE E N   1 
ATOM   4142 C  CA  . PHE E  1 44  ? 45.265  4.870   47.161  1.00 56.30  ? 103 PHE E CA  1 
ATOM   4143 C  C   . PHE E  1 44  ? 45.061  3.405   46.781  1.00 55.70  ? 103 PHE E C   1 
ATOM   4144 O  O   . PHE E  1 44  ? 45.402  3.004   45.678  1.00 56.71  ? 103 PHE E O   1 
ATOM   4145 C  CB  . PHE E  1 44  ? 44.486  5.745   46.183  1.00 55.28  ? 103 PHE E CB  1 
ATOM   4146 C  CG  . PHE E  1 44  ? 42.995  5.683   46.347  1.00 53.08  ? 103 PHE E CG  1 
ATOM   4147 C  CD1 . PHE E  1 44  ? 42.346  6.544   47.209  1.00 51.64  ? 103 PHE E CD1 1 
ATOM   4148 C  CD2 . PHE E  1 44  ? 42.234  4.788   45.606  1.00 52.24  ? 103 PHE E CD2 1 
ATOM   4149 C  CE1 . PHE E  1 44  ? 40.976  6.507   47.342  1.00 50.49  ? 103 PHE E CE1 1 
ATOM   4150 C  CE2 . PHE E  1 44  ? 40.876  4.751   45.739  1.00 50.96  ? 103 PHE E CE2 1 
ATOM   4151 C  CZ  . PHE E  1 44  ? 40.239  5.613   46.608  1.00 49.96  ? 103 PHE E CZ  1 
ATOM   4152 N  N   . GLY E  1 45  ? 44.499  2.615   47.686  1.00 54.81  ? 104 GLY E N   1 
ATOM   4153 C  CA  . GLY E  1 45  ? 44.174  1.221   47.399  1.00 54.72  ? 104 GLY E CA  1 
ATOM   4154 C  C   . GLY E  1 45  ? 45.311  0.233   47.607  1.00 56.41  ? 104 GLY E C   1 
ATOM   4155 O  O   . GLY E  1 45  ? 45.516  -0.666  46.802  1.00 57.08  ? 104 GLY E O   1 
ATOM   4156 N  N   . ALA E  1 46  ? 46.035  0.379   48.709  1.00 57.33  ? 105 ALA E N   1 
ATOM   4157 C  CA  . ALA E  1 46  ? 47.163  -0.507  49.015  1.00 59.47  ? 105 ALA E CA  1 
ATOM   4158 C  C   . ALA E  1 46  ? 46.797  -1.990  49.080  1.00 59.75  ? 105 ALA E C   1 
ATOM   4159 O  O   . ALA E  1 46  ? 47.498  -2.816  48.525  1.00 61.35  ? 105 ALA E O   1 
ATOM   4160 C  CB  . ALA E  1 46  ? 47.828  -0.081  50.298  1.00 60.37  ? 105 ALA E CB  1 
ATOM   4161 N  N   . CYS E  1 47  ? 45.686  -2.325  49.728  1.00 58.85  ? 106 CYS E N   1 
ATOM   4162 C  CA  . CYS E  1 47  ? 45.290  -3.737  49.890  1.00 59.68  ? 106 CYS E CA  1 
ATOM   4163 C  C   . CYS E  1 47  ? 44.579  -4.313  48.663  1.00 59.73  ? 106 CYS E C   1 
ATOM   4164 O  O   . CYS E  1 47  ? 44.141  -5.476  48.685  1.00 60.52  ? 106 CYS E O   1 
ATOM   4165 C  CB  . CYS E  1 47  ? 44.418  -3.918  51.137  1.00 58.87  ? 106 CYS E CB  1 
ATOM   4166 S  SG  . CYS E  1 47  ? 42.695  -3.617  50.930  1.00 58.70  ? 106 CYS E SG  1 
ATOM   4167 N  N   . GLU E  1 48  ? 44.474  -3.496  47.604  1.00 58.99  ? 107 GLU E N   1 
ATOM   4168 C  CA  . GLU E  1 48  ? 43.865  -3.893  46.334  1.00 59.42  ? 107 GLU E CA  1 
ATOM   4169 C  C   . GLU E  1 48  ? 42.414  -4.338  46.504  1.00 58.82  ? 107 GLU E C   1 
ATOM   4170 O  O   . GLU E  1 48  ? 41.941  -5.256  45.826  1.00 60.21  ? 107 GLU E O   1 
ATOM   4171 C  CB  . GLU E  1 48  ? 44.721  -4.968  45.632  1.00 62.12  ? 107 GLU E CB  1 
ATOM   4172 C  CG  . GLU E  1 48  ? 46.092  -4.440  45.202  1.00 63.53  ? 107 GLU E CG  1 
ATOM   4173 C  CD  . GLU E  1 48  ? 46.896  -5.439  44.403  1.00 67.41  ? 107 GLU E CD  1 
ATOM   4174 O  OE1 . GLU E  1 48  ? 47.253  -6.501  44.958  1.00 69.16  ? 107 GLU E OE1 1 
ATOM   4175 O  OE2 . GLU E  1 48  ? 47.186  -5.150  43.219  1.00 69.12  ? 107 GLU E OE2 1 
ATOM   4176 N  N   . GLY E  1 49  ? 41.717  -3.686  47.424  1.00 57.18  ? 108 GLY E N   1 
ATOM   4177 C  CA  . GLY E  1 49  ? 40.295  -3.904  47.596  1.00 57.07  ? 108 GLY E CA  1 
ATOM   4178 C  C   . GLY E  1 49  ? 39.930  -5.178  48.317  1.00 58.42  ? 108 GLY E C   1 
ATOM   4179 O  O   . GLY E  1 49  ? 38.902  -5.761  48.034  1.00 59.25  ? 108 GLY E O   1 
ATOM   4180 N  N   . THR E  1 50  ? 40.764  -5.612  49.249  1.00 58.98  ? 109 THR E N   1 
ATOM   4181 C  CA  . THR E  1 50  ? 40.450  -6.780  50.087  1.00 60.71  ? 109 THR E CA  1 
ATOM   4182 C  C   . THR E  1 50  ? 40.092  -6.412  51.532  1.00 59.85  ? 109 THR E C   1 
ATOM   4183 O  O   . THR E  1 50  ? 40.196  -7.229  52.433  1.00 61.24  ? 109 THR E O   1 
ATOM   4184 C  CB  . THR E  1 50  ? 41.602  -7.761  50.086  1.00 62.41  ? 109 THR E CB  1 
ATOM   4185 O  OG1 . THR E  1 50  ? 42.752  -7.113  50.618  1.00 62.04  ? 109 THR E OG1 1 
ATOM   4186 C  CG2 . THR E  1 50  ? 41.900  -8.207  48.669  1.00 63.58  ? 109 THR E CG2 1 
ATOM   4187 N  N   . LEU E  1 51  ? 39.632  -5.183  51.732  1.00 58.30  ? 110 LEU E N   1 
ATOM   4188 C  CA  . LEU E  1 51  ? 39.195  -4.700  53.046  1.00 58.05  ? 110 LEU E CA  1 
ATOM   4189 C  C   . LEU E  1 51  ? 40.227  -4.945  54.121  1.00 58.64  ? 110 LEU E C   1 
ATOM   4190 O  O   . LEU E  1 51  ? 39.910  -5.458  55.180  1.00 59.96  ? 110 LEU E O   1 
ATOM   4191 C  CB  . LEU E  1 51  ? 37.845  -5.310  53.460  1.00 59.05  ? 110 LEU E CB  1 
ATOM   4192 C  CG  . LEU E  1 51  ? 36.608  -4.569  52.987  1.00 58.29  ? 110 LEU E CG  1 
ATOM   4193 C  CD1 . LEU E  1 51  ? 35.390  -5.312  53.443  1.00 60.56  ? 110 LEU E CD1 1 
ATOM   4194 C  CD2 . LEU E  1 51  ? 36.574  -3.146  53.509  1.00 56.74  ? 110 LEU E CD2 1 
ATOM   4195 N  N   . ALA E  1 52  ? 41.456  -4.553  53.840  1.00 58.38  ? 111 ALA E N   1 
ATOM   4196 C  CA  . ALA E  1 52  ? 42.529  -4.719  54.783  1.00 59.67  ? 111 ALA E CA  1 
ATOM   4197 C  C   . ALA E  1 52  ? 43.359  -3.466  54.961  1.00 59.41  ? 111 ALA E C   1 
ATOM   4198 O  O   . ALA E  1 52  ? 44.313  -3.490  55.705  1.00 61.25  ? 111 ALA E O   1 
ATOM   4199 C  CB  . ALA E  1 52  ? 43.409  -5.883  54.354  1.00 61.15  ? 111 ALA E CB  1 
ATOM   4200 N  N   . CYS E  1 53  ? 43.023  -2.375  54.283  1.00 57.97  ? 112 CYS E N   1 
ATOM   4201 C  CA  . CYS E  1 53  ? 43.679  -1.097  54.539  1.00 58.24  ? 112 CYS E CA  1 
ATOM   4202 C  C   . CYS E  1 53  ? 42.623  -0.029  54.747  1.00 56.93  ? 112 CYS E C   1 
ATOM   4203 O  O   . CYS E  1 53  ? 41.441  -0.332  54.760  1.00 56.48  ? 112 CYS E O   1 
ATOM   4204 C  CB  . CYS E  1 53  ? 44.600  -0.723  53.377  1.00 58.33  ? 112 CYS E CB  1 
ATOM   4205 S  SG  . CYS E  1 53  ? 43.765  -0.456  51.803  1.00 58.38  ? 112 CYS E SG  1 
ATOM   4206 N  N   . SER E  1 54  ? 43.033  1.221   54.919  1.00 57.06  ? 113 SER E N   1 
ATOM   4207 C  CA  . SER E  1 54  ? 42.061  2.311   54.941  1.00 56.18  ? 113 SER E CA  1 
ATOM   4208 C  C   . SER E  1 54  ? 42.366  3.343   53.884  1.00 55.35  ? 113 SER E C   1 
ATOM   4209 O  O   . SER E  1 54  ? 41.923  4.471   53.982  1.00 55.17  ? 113 SER E O   1 
ATOM   4210 C  CB  . SER E  1 54  ? 42.058  2.977   56.302  1.00 57.60  ? 113 SER E CB  1 
ATOM   4211 O  OG  . SER E  1 54  ? 41.969  1.988   57.296  1.00 59.87  ? 113 SER E OG  1 
ATOM   4212 N  N   . THR E  1 55  ? 43.119  2.946   52.869  1.00 41.16  ? 114 THR E N   1 
ATOM   4213 C  CA  . THR E  1 55  ? 43.732  3.901   51.935  1.00 40.97  ? 114 THR E CA  1 
ATOM   4214 C  C   . THR E  1 55  ? 42.798  4.284   50.785  1.00 40.86  ? 114 THR E C   1 
ATOM   4215 O  O   . THR E  1 55  ? 43.051  5.280   50.100  1.00 40.62  ? 114 THR E O   1 
ATOM   4216 C  CB  . THR E  1 55  ? 45.057  3.364   51.364  1.00 42.56  ? 114 THR E CB  1 
ATOM   4217 O  OG1 . THR E  1 55  ? 44.808  2.236   50.542  1.00 44.08  ? 114 THR E OG1 1 
ATOM   4218 C  CG2 . THR E  1 55  ? 45.994  2.952   52.472  1.00 42.23  ? 114 THR E CG2 1 
ATOM   4219 N  N   . CYS E  1 56  ? 41.733  3.498   50.587  1.00 41.07  ? 115 CYS E N   1 
ATOM   4220 C  CA  . CYS E  1 56  ? 40.681  3.823   49.621  1.00 41.28  ? 115 CYS E CA  1 
ATOM   4221 C  C   . CYS E  1 56  ? 39.623  4.784   50.174  1.00 39.53  ? 115 CYS E C   1 
ATOM   4222 O  O   . CYS E  1 56  ? 38.610  5.023   49.544  1.00 39.47  ? 115 CYS E O   1 
ATOM   4223 C  CB  . CYS E  1 56  ? 40.010  2.542   49.093  1.00 42.99  ? 115 CYS E CB  1 
ATOM   4224 S  SG  . CYS E  1 56  ? 39.314  1.469   50.373  1.00 44.30  ? 115 CYS E SG  1 
ATOM   4225 N  N   . HIS E  1 57  ? 39.876  5.349   51.343  1.00 38.55  ? 116 HIS E N   1 
ATOM   4226 C  CA  . HIS E  1 57  ? 38.961  6.279   51.987  1.00 37.33  ? 116 HIS E CA  1 
ATOM   4227 C  C   . HIS E  1 57  ? 38.571  7.379   51.003  1.00 37.14  ? 116 HIS E C   1 
ATOM   4228 O  O   . HIS E  1 57  ? 39.441  7.975   50.388  1.00 37.42  ? 116 HIS E O   1 
ATOM   4229 C  CB  . HIS E  1 57  ? 39.657  6.855   53.224  1.00 36.32  ? 116 HIS E CB  1 
ATOM   4230 C  CG  . HIS E  1 57  ? 38.853  7.839   54.016  1.00 35.29  ? 116 HIS E CG  1 
ATOM   4231 N  ND1 . HIS E  1 57  ? 39.428  8.662   54.963  1.00 33.74  ? 116 HIS E ND1 1 
ATOM   4232 C  CD2 . HIS E  1 57  ? 37.531  8.129   54.021  1.00 35.73  ? 116 HIS E CD2 1 
ATOM   4233 C  CE1 . HIS E  1 57  ? 38.496  9.422   55.508  1.00 34.19  ? 116 HIS E CE1 1 
ATOM   4234 N  NE2 . HIS E  1 57  ? 37.334  9.110   54.963  1.00 35.30  ? 116 HIS E NE2 1 
ATOM   4235 N  N   . LEU E  1 58  ? 37.263  7.615   50.863  1.00 37.24  ? 117 LEU E N   1 
ATOM   4236 C  CA  . LEU E  1 58  ? 36.699  8.738   50.084  1.00 37.28  ? 117 LEU E CA  1 
ATOM   4237 C  C   . LEU E  1 58  ? 35.570  9.424   50.837  1.00 36.85  ? 117 LEU E C   1 
ATOM   4238 O  O   . LEU E  1 58  ? 34.887  8.828   51.634  1.00 37.33  ? 117 LEU E O   1 
ATOM   4239 C  CB  . LEU E  1 58  ? 36.148  8.255   48.744  1.00 38.12  ? 117 LEU E CB  1 
ATOM   4240 C  CG  . LEU E  1 58  ? 37.161  7.846   47.685  1.00 38.85  ? 117 LEU E CG  1 
ATOM   4241 C  CD1 . LEU E  1 58  ? 36.510  7.104   46.563  1.00 38.90  ? 117 LEU E CD1 1 
ATOM   4242 C  CD2 . LEU E  1 58  ? 37.902  9.041   47.170  1.00 39.22  ? 117 LEU E CD2 1 
ATOM   4243 N  N   . ILE E  1 59  ? 35.363  10.691  50.552  1.00 37.22  ? 118 ILE E N   1 
ATOM   4244 C  CA  . ILE E  1 59  ? 34.273  11.445  51.139  1.00 37.14  ? 118 ILE E CA  1 
ATOM   4245 C  C   . ILE E  1 59  ? 33.248  11.719  50.055  1.00 38.07  ? 118 ILE E C   1 
ATOM   4246 O  O   . ILE E  1 59  ? 33.601  12.127  48.952  1.00 38.65  ? 118 ILE E O   1 
ATOM   4247 C  CB  . ILE E  1 59  ? 34.769  12.769  51.711  1.00 37.11  ? 118 ILE E CB  1 
ATOM   4248 C  CG1 . ILE E  1 59  ? 35.699  12.516  52.906  1.00 36.19  ? 118 ILE E CG1 1 
ATOM   4249 C  CG2 . ILE E  1 59  ? 33.601  13.614  52.150  1.00 37.12  ? 118 ILE E CG2 1 
ATOM   4250 C  CD1 . ILE E  1 59  ? 36.428  13.763  53.376  1.00 36.70  ? 118 ILE E CD1 1 
ATOM   4251 N  N   . PHE E  1 60  ? 31.977  11.512  50.390  1.00 38.70  ? 119 PHE E N   1 
ATOM   4252 C  CA  . PHE E  1 60  ? 30.884  11.575  49.420  1.00 39.74  ? 119 PHE E CA  1 
ATOM   4253 C  C   . PHE E  1 60  ? 29.964  12.783  49.615  1.00 40.40  ? 119 PHE E C   1 
ATOM   4254 O  O   . PHE E  1 60  ? 29.901  13.379  50.703  1.00 39.53  ? 119 PHE E O   1 
ATOM   4255 C  CB  . PHE E  1 60  ? 30.084  10.283  49.479  1.00 40.51  ? 119 PHE E CB  1 
ATOM   4256 C  CG  . PHE E  1 60  ? 30.821  9.088   48.957  1.00 40.40  ? 119 PHE E CG  1 
ATOM   4257 C  CD1 . PHE E  1 60  ? 30.550  8.589   47.691  1.00 41.60  ? 119 PHE E CD1 1 
ATOM   4258 C  CD2 . PHE E  1 60  ? 31.808  8.476   49.712  1.00 39.44  ? 119 PHE E CD2 1 
ATOM   4259 C  CE1 . PHE E  1 60  ? 31.249  7.487   47.192  1.00 41.72  ? 119 PHE E CE1 1 
ATOM   4260 C  CE2 . PHE E  1 60  ? 32.497  7.383   49.218  1.00 39.87  ? 119 PHE E CE2 1 
ATOM   4261 C  CZ  . PHE E  1 60  ? 32.216  6.893   47.959  1.00 41.14  ? 119 PHE E CZ  1 
ATOM   4262 N  N   . GLU E  1 61  ? 29.285  13.154  48.527  1.00 41.65  ? 120 GLU E N   1 
ATOM   4263 C  CA  . GLU E  1 61  ? 28.224  14.153  48.595  1.00 43.23  ? 120 GLU E CA  1 
ATOM   4264 C  C   . GLU E  1 61  ? 27.051  13.622  49.438  1.00 43.83  ? 120 GLU E C   1 
ATOM   4265 O  O   . GLU E  1 61  ? 26.730  12.425  49.413  1.00 43.12  ? 120 GLU E O   1 
ATOM   4266 C  CB  . GLU E  1 61  ? 27.701  14.477  47.212  1.00 44.95  ? 120 GLU E CB  1 
ATOM   4267 C  CG  . GLU E  1 61  ? 28.697  15.118  46.264  1.00 45.99  ? 120 GLU E CG  1 
ATOM   4268 C  CD  . GLU E  1 61  ? 28.029  15.604  44.969  1.00 47.77  ? 120 GLU E CD  1 
ATOM   4269 O  OE1 . GLU E  1 61  ? 27.121  16.484  45.035  1.00 49.20  ? 120 GLU E OE1 1 
ATOM   4270 O  OE2 . GLU E  1 61  ? 28.418  15.083  43.896  1.00 47.60  ? 120 GLU E OE2 1 
ATOM   4271 N  N   . ASP E  1 62  ? 26.409  14.536  50.159  1.00 44.96  ? 121 ASP E N   1 
ATOM   4272 C  CA  . ASP E  1 62  ? 25.254  14.225  50.996  1.00 46.32  ? 121 ASP E CA  1 
ATOM   4273 C  C   . ASP E  1 62  ? 24.333  13.214  50.325  1.00 47.41  ? 121 ASP E C   1 
ATOM   4274 O  O   . ASP E  1 62  ? 24.171  12.086  50.816  1.00 46.84  ? 121 ASP E O   1 
ATOM   4275 C  CB  . ASP E  1 62  ? 24.469  15.512  51.318  1.00 48.09  ? 121 ASP E CB  1 
ATOM   4276 C  CG  . ASP E  1 62  ? 25.225  16.461  52.289  1.00 49.52  ? 121 ASP E CG  1 
ATOM   4277 O  OD1 . ASP E  1 62  ? 26.262  16.090  52.899  1.00 48.79  ? 121 ASP E OD1 1 
ATOM   4278 O  OD2 . ASP E  1 62  ? 24.787  17.617  52.432  1.00 53.11  ? 121 ASP E OD2 1 
ATOM   4279 N  N   . HIS E  1 63  ? 23.745  13.616  49.193  1.00 48.59  ? 122 HIS E N   1 
ATOM   4280 C  CA  . HIS E  1 63  ? 22.644  12.840  48.616  1.00 50.38  ? 122 HIS E CA  1 
ATOM   4281 C  C   . HIS E  1 63  ? 23.099  11.505  48.024  1.00 49.60  ? 122 HIS E C   1 
ATOM   4282 O  O   . HIS E  1 63  ? 22.295  10.607  47.836  1.00 51.48  ? 122 HIS E O   1 
ATOM   4283 C  CB  . HIS E  1 63  ? 21.879  13.651  47.571  1.00 52.45  ? 122 HIS E CB  1 
ATOM   4284 C  CG  . HIS E  1 63  ? 22.609  13.776  46.288  1.00 52.63  ? 122 HIS E CG  1 
ATOM   4285 N  ND1 . HIS E  1 63  ? 23.649  14.661  46.126  1.00 51.94  ? 122 HIS E ND1 1 
ATOM   4286 C  CD2 . HIS E  1 63  ? 22.511  13.080  45.131  1.00 53.82  ? 122 HIS E CD2 1 
ATOM   4287 C  CE1 . HIS E  1 63  ? 24.139  14.527  44.906  1.00 52.18  ? 122 HIS E CE1 1 
ATOM   4288 N  NE2 . HIS E  1 63  ? 23.473  13.569  44.285  1.00 52.89  ? 122 HIS E NE2 1 
ATOM   4289 N  N   . ILE E  1 64  ? 24.382  11.371  47.732  1.00 47.71  ? 123 ILE E N   1 
ATOM   4290 C  CA  . ILE E  1 64  ? 24.928  10.081  47.299  1.00 47.34  ? 123 ILE E CA  1 
ATOM   4291 C  C   . ILE E  1 64  ? 25.123  9.140   48.505  1.00 47.03  ? 123 ILE E C   1 
ATOM   4292 O  O   . ILE E  1 64  ? 24.753  7.963   48.469  1.00 48.02  ? 123 ILE E O   1 
ATOM   4293 C  CB  . ILE E  1 64  ? 26.257  10.285  46.574  1.00 45.69  ? 123 ILE E CB  1 
ATOM   4294 C  CG1 . ILE E  1 64  ? 26.033  11.119  45.309  1.00 47.74  ? 123 ILE E CG1 1 
ATOM   4295 C  CG2 . ILE E  1 64  ? 26.874  8.971   46.198  1.00 45.13  ? 123 ILE E CG2 1 
ATOM   4296 C  CD1 . ILE E  1 64  ? 25.106  10.450  44.263  1.00 48.66  ? 123 ILE E CD1 1 
ATOM   4297 N  N   . TYR E  1 65  ? 25.716  9.689   49.562  1.00 45.98  ? 124 TYR E N   1 
ATOM   4298 C  CA  . TYR E  1 65  ? 26.057  8.954   50.803  1.00 45.38  ? 124 TYR E CA  1 
ATOM   4299 C  C   . TYR E  1 65  ? 24.835  8.291   51.407  1.00 47.43  ? 124 TYR E C   1 
ATOM   4300 O  O   . TYR E  1 65  ? 24.836  7.123   51.758  1.00 48.36  ? 124 TYR E O   1 
ATOM   4301 C  CB  . TYR E  1 65  ? 26.652  9.932   51.828  1.00 43.85  ? 124 TYR E CB  1 
ATOM   4302 C  CG  . TYR E  1 65  ? 27.044  9.304   53.145  1.00 43.68  ? 124 TYR E CG  1 
ATOM   4303 C  CD1 . TYR E  1 65  ? 28.257  8.639   53.297  1.00 42.02  ? 124 TYR E CD1 1 
ATOM   4304 C  CD2 . TYR E  1 65  ? 26.185  9.360   54.245  1.00 45.50  ? 124 TYR E CD2 1 
ATOM   4305 C  CE1 . TYR E  1 65  ? 28.607  8.059   54.493  1.00 41.52  ? 124 TYR E CE1 1 
ATOM   4306 C  CE2 . TYR E  1 65  ? 26.527  8.783   55.451  1.00 44.56  ? 124 TYR E CE2 1 
ATOM   4307 C  CZ  . TYR E  1 65  ? 27.737  8.135   55.572  1.00 43.09  ? 124 TYR E CZ  1 
ATOM   4308 O  OH  . TYR E  1 65  ? 28.072  7.578   56.782  1.00 43.10  ? 124 TYR E OH  1 
ATOM   4309 N  N   . GLU E  1 66  ? 23.781  9.076   51.494  1.00 48.81  ? 125 GLU E N   1 
ATOM   4310 C  CA  . GLU E  1 66  ? 22.485  8.616   51.932  1.00 51.18  ? 125 GLU E CA  1 
ATOM   4311 C  C   . GLU E  1 66  ? 21.981  7.339   51.245  1.00 52.86  ? 125 GLU E C   1 
ATOM   4312 O  O   . GLU E  1 66  ? 21.249  6.558   51.852  1.00 54.61  ? 125 GLU E O   1 
ATOM   4313 C  CB  . GLU E  1 66  ? 21.484  9.742   51.676  1.00 52.50  ? 125 GLU E CB  1 
ATOM   4314 C  CG  . GLU E  1 66  ? 20.054  9.443   52.062  1.00 56.10  ? 125 GLU E CG  1 
ATOM   4315 C  CD  . GLU E  1 66  ? 19.151  10.641  51.869  1.00 58.72  ? 125 GLU E CD  1 
ATOM   4316 O  OE1 . GLU E  1 66  ? 18.348  10.907  52.786  1.00 60.87  ? 125 GLU E OE1 1 
ATOM   4317 O  OE2 . GLU E  1 66  ? 19.237  11.310  50.807  1.00 58.42  ? 125 GLU E OE2 1 
ATOM   4318 N  N   . LYS E  1 67  ? 22.354  7.141   49.986  1.00 52.41  ? 126 LYS E N   1 
ATOM   4319 C  CA  . LYS E  1 67  ? 21.789  6.065   49.174  1.00 54.50  ? 126 LYS E CA  1 
ATOM   4320 C  C   . LYS E  1 67  ? 22.674  4.831   49.089  1.00 53.88  ? 126 LYS E C   1 
ATOM   4321 O  O   . LYS E  1 67  ? 22.283  3.842   48.485  1.00 55.72  ? 126 LYS E O   1 
ATOM   4322 C  CB  . LYS E  1 67  ? 21.505  6.596   47.758  1.00 54.95  ? 126 LYS E CB  1 
ATOM   4323 N  N   . LEU E  1 68  ? 23.849  4.881   49.701  1.00 51.59  ? 127 LEU E N   1 
ATOM   4324 C  CA  . LEU E  1 68  ? 24.830  3.819   49.553  1.00 51.28  ? 127 LEU E CA  1 
ATOM   4325 C  C   . LEU E  1 68  ? 24.408  2.571   50.305  1.00 53.43  ? 127 LEU E C   1 
ATOM   4326 O  O   . LEU E  1 68  ? 23.666  2.651   51.284  1.00 54.28  ? 127 LEU E O   1 
ATOM   4327 C  CB  . LEU E  1 68  ? 26.202  4.284   50.044  1.00 48.66  ? 127 LEU E CB  1 
ATOM   4328 C  CG  . LEU E  1 68  ? 26.818  5.443   49.253  1.00 46.84  ? 127 LEU E CG  1 
ATOM   4329 C  CD1 . LEU E  1 68  ? 28.148  5.817   49.891  1.00 44.57  ? 127 LEU E CD1 1 
ATOM   4330 C  CD2 . LEU E  1 68  ? 26.994  5.111   47.774  1.00 46.49  ? 127 LEU E CD2 1 
ATOM   4331 N  N   . ASP E  1 69  ? 24.883  1.417   49.839  1.00 54.48  ? 128 ASP E N   1 
ATOM   4332 C  CA  . ASP E  1 69  ? 24.533  0.150   50.482  1.00 57.44  ? 128 ASP E CA  1 
ATOM   4333 C  C   . ASP E  1 69  ? 24.956  0.243   51.944  1.00 56.76  ? 128 ASP E C   1 
ATOM   4334 O  O   . ASP E  1 69  ? 26.010  0.812   52.263  1.00 54.80  ? 128 ASP E O   1 
ATOM   4335 C  CB  . ASP E  1 69  ? 25.257  -1.049  49.838  1.00 58.57  ? 128 ASP E CB  1 
ATOM   4336 C  CG  . ASP E  1 69  ? 24.861  -1.286  48.380  1.00 60.98  ? 128 ASP E CG  1 
ATOM   4337 O  OD1 . ASP E  1 69  ? 23.769  -0.825  47.927  1.00 62.33  ? 128 ASP E OD1 1 
ATOM   4338 O  OD2 . ASP E  1 69  ? 25.660  -1.956  47.682  1.00 61.85  ? 128 ASP E OD2 1 
ATOM   4339 N  N   . ALA E  1 70  ? 24.142  -0.316  52.831  1.00 59.42  ? 129 ALA E N   1 
ATOM   4340 C  CA  . ALA E  1 70  ? 24.451  -0.345  54.261  1.00 59.19  ? 129 ALA E CA  1 
ATOM   4341 C  C   . ALA E  1 70  ? 25.867  -0.853  54.459  1.00 57.72  ? 129 ALA E C   1 
ATOM   4342 O  O   . ALA E  1 70  ? 26.299  -1.779  53.779  1.00 59.03  ? 129 ALA E O   1 
ATOM   4343 C  CB  . ALA E  1 70  ? 23.463  -1.236  54.999  1.00 62.77  ? 129 ALA E CB  1 
ATOM   4344 N  N   . ILE E  1 71  ? 26.592  -0.236  55.377  1.00 55.48  ? 130 ILE E N   1 
ATOM   4345 C  CA  . ILE E  1 71  ? 27.982  -0.595  55.622  1.00 54.10  ? 130 ILE E CA  1 
ATOM   4346 C  C   . ILE E  1 71  ? 28.132  -1.920  56.399  1.00 56.86  ? 130 ILE E C   1 
ATOM   4347 O  O   . ILE E  1 71  ? 27.542  -2.083  57.461  1.00 58.92  ? 130 ILE E O   1 
ATOM   4348 C  CB  . ILE E  1 71  ? 28.675  0.542   56.398  1.00 51.43  ? 130 ILE E CB  1 
ATOM   4349 C  CG1 . ILE E  1 71  ? 30.173  0.255   56.535  1.00 50.63  ? 130 ILE E CG1 1 
ATOM   4350 C  CG2 . ILE E  1 71  ? 28.031  0.731   57.787  1.00 52.49  ? 130 ILE E CG2 1 
ATOM   4351 C  CD1 . ILE E  1 71  ? 31.002  1.472   56.876  1.00 47.95  ? 130 ILE E CD1 1 
ATOM   4352 N  N   . THR E  1 72  ? 28.931  -2.857  55.882  1.00 57.50  ? 131 THR E N   1 
ATOM   4353 C  CA  . THR E  1 72  ? 29.123  -4.138  56.554  1.00 60.02  ? 131 THR E CA  1 
ATOM   4354 C  C   . THR E  1 72  ? 30.061  -3.975  57.744  1.00 59.17  ? 131 THR E C   1 
ATOM   4355 O  O   . THR E  1 72  ? 30.795  -2.993  57.840  1.00 56.14  ? 131 THR E O   1 
ATOM   4356 C  CB  . THR E  1 72  ? 29.698  -5.228  55.630  1.00 61.57  ? 131 THR E CB  1 
ATOM   4357 O  OG1 . THR E  1 72  ? 31.063  -4.941  55.305  1.00 58.78  ? 131 THR E OG1 1 
ATOM   4358 C  CG2 . THR E  1 72  ? 28.885  -5.365  54.369  1.00 61.97  ? 131 THR E CG2 1 
ATOM   4359 N  N   . ASP E  1 73  ? 30.030  -4.948  58.649  1.00 62.37  ? 132 ASP E N   1 
ATOM   4360 C  CA  . ASP E  1 73  ? 30.913  -4.950  59.814  1.00 62.04  ? 132 ASP E CA  1 
ATOM   4361 C  C   . ASP E  1 73  ? 32.379  -4.936  59.395  1.00 59.73  ? 132 ASP E C   1 
ATOM   4362 O  O   . ASP E  1 73  ? 33.189  -4.202  59.959  1.00 57.35  ? 132 ASP E O   1 
ATOM   4363 C  CB  . ASP E  1 73  ? 30.643  -6.186  60.670  1.00 66.54  ? 132 ASP E CB  1 
ATOM   4364 C  CG  . ASP E  1 73  ? 29.414  -6.029  61.557  1.00 69.83  ? 132 ASP E CG  1 
ATOM   4365 O  OD1 . ASP E  1 73  ? 29.135  -4.875  61.964  1.00 67.68  ? 132 ASP E OD1 1 
ATOM   4366 O  OD2 . ASP E  1 73  ? 28.747  -7.056  61.866  1.00 74.74  ? 132 ASP E OD2 1 
ATOM   4367 N  N   . GLU E  1 74  ? 32.701  -5.774  58.414  1.00 60.93  ? 133 GLU E N   1 
ATOM   4368 C  CA  . GLU E  1 74  ? 34.023  -5.818  57.824  1.00 59.51  ? 133 GLU E CA  1 
ATOM   4369 C  C   . GLU E  1 74  ? 34.467  -4.425  57.403  1.00 55.70  ? 133 GLU E C   1 
ATOM   4370 O  O   . GLU E  1 74  ? 35.483  -3.959  57.870  1.00 54.24  ? 133 GLU E O   1 
ATOM   4371 C  CB  . GLU E  1 74  ? 34.045  -6.737  56.600  1.00 61.66  ? 133 GLU E CB  1 
ATOM   4372 C  CG  . GLU E  1 74  ? 34.767  -8.043  56.792  1.00 65.66  ? 133 GLU E CG  1 
ATOM   4373 C  CD  . GLU E  1 74  ? 35.175  -8.692  55.447  1.00 68.93  ? 133 GLU E CD  1 
ATOM   4374 O  OE1 . GLU E  1 74  ? 34.285  -9.255  54.740  1.00 71.28  ? 133 GLU E OE1 1 
ATOM   4375 O  OE2 . GLU E  1 74  ? 36.388  -8.647  55.108  1.00 67.92  ? 133 GLU E OE2 1 
ATOM   4376 N  N   . GLU E  1 75  ? 33.710  -3.754  56.529  1.00 54.45  ? 134 GLU E N   1 
ATOM   4377 C  CA  . GLU E  1 75  ? 34.100  -2.403  56.090  1.00 50.89  ? 134 GLU E CA  1 
ATOM   4378 C  C   . GLU E  1 75  ? 34.273  -1.484  57.287  1.00 49.15  ? 134 GLU E C   1 
ATOM   4379 O  O   . GLU E  1 75  ? 35.228  -0.717  57.345  1.00 47.03  ? 134 GLU E O   1 
ATOM   4380 C  CB  . GLU E  1 75  ? 33.094  -1.773  55.111  1.00 50.08  ? 134 GLU E CB  1 
ATOM   4381 C  CG  . GLU E  1 75  ? 33.490  -0.355  54.705  1.00 47.25  ? 134 GLU E CG  1 
ATOM   4382 C  CD  . GLU E  1 75  ? 32.618  0.298   53.628  1.00 47.09  ? 134 GLU E CD  1 
ATOM   4383 O  OE1 . GLU E  1 75  ? 31.883  -0.391  52.900  1.00 49.31  ? 134 GLU E OE1 1 
ATOM   4384 O  OE2 . GLU E  1 75  ? 32.680  1.536   53.501  1.00 44.11  ? 134 GLU E OE2 1 
ATOM   4385 N  N   . ASN E  1 76  ? 33.355  -1.565  58.243  1.00 50.44  ? 135 ASN E N   1 
ATOM   4386 C  CA  . ASN E  1 76  ? 33.362  -0.640  59.372  1.00 49.42  ? 135 ASN E CA  1 
ATOM   4387 C  C   . ASN E  1 76  ? 34.622  -0.754  60.208  1.00 48.70  ? 135 ASN E C   1 
ATOM   4388 O  O   . ASN E  1 76  ? 35.119  0.239   60.717  1.00 46.86  ? 135 ASN E O   1 
ATOM   4389 C  CB  . ASN E  1 76  ? 32.130  -0.865  60.256  1.00 52.04  ? 135 ASN E CB  1 
ATOM   4390 C  CG  . ASN E  1 76  ? 31.791  0.348   61.097  1.00 52.15  ? 135 ASN E CG  1 
ATOM   4391 O  OD1 . ASN E  1 76  ? 31.380  1.397   60.579  1.00 52.47  ? 135 ASN E OD1 1 
ATOM   4392 N  ND2 . ASN E  1 76  ? 31.958  0.216   62.397  1.00 53.06  ? 135 ASN E ND2 1 
ATOM   4393 N  N   . ASP E  1 77  ? 35.119  -1.973  60.349  1.00 50.86  ? 136 ASP E N   1 
ATOM   4394 C  CA  . ASP E  1 77  ? 36.372  -2.228  61.067  1.00 51.05  ? 136 ASP E CA  1 
ATOM   4395 C  C   . ASP E  1 77  ? 37.540  -1.473  60.471  1.00 48.40  ? 136 ASP E C   1 
ATOM   4396 O  O   . ASP E  1 77  ? 38.335  -0.878  61.207  1.00 47.33  ? 136 ASP E O   1 
ATOM   4397 C  CB  . ASP E  1 77  ? 36.693  -3.730  61.070  1.00 54.30  ? 136 ASP E CB  1 
ATOM   4398 C  CG  . ASP E  1 77  ? 35.867  -4.494  62.076  1.00 57.98  ? 136 ASP E CG  1 
ATOM   4399 O  OD1 . ASP E  1 77  ? 35.348  -3.861  63.012  1.00 58.23  ? 136 ASP E OD1 1 
ATOM   4400 O  OD2 . ASP E  1 77  ? 35.733  -5.729  61.940  1.00 62.32  ? 136 ASP E OD2 1 
ATOM   4401 N  N   . MET E  1 78  ? 37.646  -1.506  59.140  1.00 47.60  ? 137 MET E N   1 
ATOM   4402 C  CA  . MET E  1 78  ? 38.726  -0.798  58.439  1.00 45.54  ? 137 MET E CA  1 
ATOM   4403 C  C   . MET E  1 78  ? 38.468  0.701   58.366  1.00 42.94  ? 137 MET E C   1 
ATOM   4404 O  O   . MET E  1 78  ? 39.398  1.501   58.434  1.00 41.40  ? 137 MET E O   1 
ATOM   4405 C  CB  . MET E  1 78  ? 38.928  -1.374  57.042  1.00 46.13  ? 137 MET E CB  1 
ATOM   4406 C  CG  . MET E  1 78  ? 39.346  -2.828  57.044  1.00 49.36  ? 137 MET E CG  1 
ATOM   4407 S  SD  . MET E  1 78  ? 40.905  -3.065  57.892  1.00 52.77  ? 137 MET E SD  1 
ATOM   4408 C  CE  . MET E  1 78  ? 40.406  -3.490  59.565  1.00 50.93  ? 137 MET E CE  1 
ATOM   4409 N  N   . LEU E  1 79  ? 37.199  1.075   58.245  1.00 43.01  ? 138 LEU E N   1 
ATOM   4410 C  CA  . LEU E  1 79  ? 36.823  2.475   58.146  1.00 40.98  ? 138 LEU E CA  1 
ATOM   4411 C  C   . LEU E  1 79  ? 37.110  3.184   59.447  1.00 40.34  ? 138 LEU E C   1 
ATOM   4412 O  O   . LEU E  1 79  ? 37.485  4.341   59.434  1.00 39.10  ? 138 LEU E O   1 
ATOM   4413 C  CB  . LEU E  1 79  ? 35.353  2.624   57.750  1.00 41.42  ? 138 LEU E CB  1 
ATOM   4414 C  CG  . LEU E  1 79  ? 34.815  4.027   57.449  1.00 40.12  ? 138 LEU E CG  1 
ATOM   4415 C  CD1 . LEU E  1 79  ? 35.564  4.727   56.271  1.00 37.46  ? 138 LEU E CD1 1 
ATOM   4416 C  CD2 . LEU E  1 79  ? 33.299  3.943   57.156  1.00 39.49  ? 138 LEU E CD2 1 
ATOM   4417 N  N   . ASP E  1 80  ? 36.964  2.505   60.578  1.00 41.81  ? 139 ASP E N   1 
ATOM   4418 C  CA  . ASP E  1 80  ? 37.340  3.125   61.857  1.00 41.80  ? 139 ASP E CA  1 
ATOM   4419 C  C   . ASP E  1 80  ? 38.794  3.598   61.848  1.00 40.51  ? 139 ASP E C   1 
ATOM   4420 O  O   . ASP E  1 80  ? 39.136  4.568   62.520  1.00 39.82  ? 139 ASP E O   1 
ATOM   4421 C  CB  . ASP E  1 80  ? 37.198  2.137   63.022  1.00 44.33  ? 139 ASP E CB  1 
ATOM   4422 C  CG  . ASP E  1 80  ? 35.835  2.193   63.717  1.00 47.24  ? 139 ASP E CG  1 
ATOM   4423 O  OD1 . ASP E  1 80  ? 35.058  3.163   63.497  1.00 47.48  ? 139 ASP E OD1 1 
ATOM   4424 O  OD2 . ASP E  1 80  ? 35.538  1.242   64.494  1.00 51.48  ? 139 ASP E OD2 1 
ATOM   4425 N  N   . LEU E  1 81  ? 39.650  2.884   61.125  1.00 40.51  ? 140 LEU E N   1 
ATOM   4426 C  CA  . LEU E  1 81  ? 41.059  3.199   61.093  1.00 40.01  ? 140 LEU E CA  1 
ATOM   4427 C  C   . LEU E  1 81  ? 41.430  4.253   60.050  1.00 38.72  ? 140 LEU E C   1 
ATOM   4428 O  O   . LEU E  1 81  ? 42.585  4.627   59.948  1.00 38.74  ? 140 LEU E O   1 
ATOM   4429 C  CB  . LEU E  1 81  ? 41.871  1.928   60.889  1.00 41.42  ? 140 LEU E CB  1 
ATOM   4430 C  CG  . LEU E  1 81  ? 41.701  0.862   61.976  1.00 43.51  ? 140 LEU E CG  1 
ATOM   4431 C  CD1 . LEU E  1 81  ? 42.456  -0.350  61.577  1.00 44.22  ? 140 LEU E CD1 1 
ATOM   4432 C  CD2 . LEU E  1 81  ? 42.136  1.346   63.353  1.00 42.15  ? 140 LEU E CD2 1 
ATOM   4433 N  N   . ALA E  1 82  ? 40.454  4.754   59.298  1.00 38.14  ? 141 ALA E N   1 
ATOM   4434 C  CA  . ALA E  1 82  ? 40.712  5.792   58.312  1.00 36.83  ? 141 ALA E CA  1 
ATOM   4435 C  C   . ALA E  1 82  ? 41.151  7.054   59.035  1.00 36.13  ? 141 ALA E C   1 
ATOM   4436 O  O   . ALA E  1 82  ? 40.532  7.436   60.029  1.00 35.73  ? 141 ALA E O   1 
ATOM   4437 C  CB  . ALA E  1 82  ? 39.476  6.060   57.501  1.00 36.65  ? 141 ALA E CB  1 
ATOM   4438 N  N   . TYR E  1 83  ? 42.232  7.683   58.562  1.00 35.82  ? 142 TYR E N   1 
ATOM   4439 C  CA  . TYR E  1 83  ? 42.649  8.929   59.141  1.00 35.45  ? 142 TYR E CA  1 
ATOM   4440 C  C   . TYR E  1 83  ? 41.741  10.022  58.671  1.00 35.00  ? 142 TYR E C   1 
ATOM   4441 O  O   . TYR E  1 83  ? 41.525  10.162  57.492  1.00 34.73  ? 142 TYR E O   1 
ATOM   4442 C  CB  . TYR E  1 83  ? 44.063  9.284   58.724  1.00 36.42  ? 142 TYR E CB  1 
ATOM   4443 C  CG  . TYR E  1 83  ? 44.536  10.574  59.361  1.00 36.42  ? 142 TYR E CG  1 
ATOM   4444 C  CD1 . TYR E  1 83  ? 44.963  10.594  60.682  1.00 36.18  ? 142 TYR E CD1 1 
ATOM   4445 C  CD2 . TYR E  1 83  ? 44.524  11.759  58.665  1.00 35.74  ? 142 TYR E CD2 1 
ATOM   4446 C  CE1 . TYR E  1 83  ? 45.365  11.762  61.284  1.00 36.05  ? 142 TYR E CE1 1 
ATOM   4447 C  CE2 . TYR E  1 83  ? 44.919  12.921  59.265  1.00 36.61  ? 142 TYR E CE2 1 
ATOM   4448 C  CZ  . TYR E  1 83  ? 45.336  12.914  60.577  1.00 36.62  ? 142 TYR E CZ  1 
ATOM   4449 O  OH  . TYR E  1 83  ? 45.754  14.060  61.181  1.00 38.81  ? 142 TYR E OH  1 
ATOM   4450 N  N   . GLY E  1 84  ? 41.270  10.834  59.604  1.00 35.16  ? 143 GLY E N   1 
ATOM   4451 C  CA  . GLY E  1 84  ? 40.351  11.925  59.309  1.00 34.97  ? 143 GLY E CA  1 
ATOM   4452 C  C   . GLY E  1 84  ? 38.958  11.458  58.916  1.00 34.91  ? 143 GLY E C   1 
ATOM   4453 O  O   . GLY E  1 84  ? 38.331  12.011  58.037  1.00 35.34  ? 143 GLY E O   1 
ATOM   4454 N  N   . LEU E  1 85  ? 38.476  10.438  59.586  1.00 35.49  ? 144 LEU E N   1 
ATOM   4455 C  CA  . LEU E  1 85  ? 37.144  9.883   59.335  1.00 35.96  ? 144 LEU E CA  1 
ATOM   4456 C  C   . LEU E  1 85  ? 36.091  10.967  59.495  1.00 36.15  ? 144 LEU E C   1 
ATOM   4457 O  O   . LEU E  1 85  ? 36.132  11.738  60.450  1.00 36.73  ? 144 LEU E O   1 
ATOM   4458 C  CB  . LEU E  1 85  ? 36.865  8.732   60.323  1.00 36.69  ? 144 LEU E CB  1 
ATOM   4459 C  CG  . LEU E  1 85  ? 35.535  7.976   60.281  1.00 37.56  ? 144 LEU E CG  1 
ATOM   4460 C  CD1 . LEU E  1 85  ? 35.386  7.242   58.947  1.00 36.37  ? 144 LEU E CD1 1 
ATOM   4461 C  CD2 . LEU E  1 85  ? 35.434  7.001   61.471  1.00 37.00  ? 144 LEU E CD2 1 
ATOM   4462 N  N   . THR E  1 86  ? 35.138  10.981  58.565  1.00 36.11  ? 145 THR E N   1 
ATOM   4463 C  CA  . THR E  1 86  ? 34.062  11.931  58.566  1.00 36.30  ? 145 THR E CA  1 
ATOM   4464 C  C   . THR E  1 86  ? 32.735  11.215  58.494  1.00 37.49  ? 145 THR E C   1 
ATOM   4465 O  O   . THR E  1 86  ? 32.673  10.049  58.104  1.00 37.24  ? 145 THR E O   1 
ATOM   4466 C  CB  . THR E  1 86  ? 34.107  12.811  57.290  1.00 36.62  ? 145 THR E CB  1 
ATOM   4467 O  OG1 . THR E  1 86  ? 33.710  12.042  56.143  1.00 35.70  ? 145 THR E OG1 1 
ATOM   4468 C  CG2 . THR E  1 86  ? 35.500  13.416  57.045  1.00 34.64  ? 145 THR E CG2 1 
ATOM   4469 N  N   . ASP E  1 87  ? 31.655  11.956  58.765  1.00 38.68  ? 146 ASP E N   1 
ATOM   4470 C  CA  . ASP E  1 87  ? 30.292  11.428  58.641  1.00 39.63  ? 146 ASP E CA  1 
ATOM   4471 C  C   . ASP E  1 87  ? 29.799  11.325  57.198  1.00 39.72  ? 146 ASP E C   1 
ATOM   4472 O  O   . ASP E  1 87  ? 28.595  11.176  56.962  1.00 41.03  ? 146 ASP E O   1 
ATOM   4473 C  CB  . ASP E  1 87  ? 29.328  12.258  59.463  1.00 40.82  ? 146 ASP E CB  1 
ATOM   4474 C  CG  . ASP E  1 87  ? 29.301  13.707  59.047  1.00 41.20  ? 146 ASP E CG  1 
ATOM   4475 O  OD1 . ASP E  1 87  ? 28.822  14.520  59.848  1.00 41.93  ? 146 ASP E OD1 1 
ATOM   4476 O  OD2 . ASP E  1 87  ? 29.747  14.051  57.936  1.00 38.20  ? 146 ASP E OD2 1 
ATOM   4477 N  N   . ARG E  1 88  ? 30.704  11.442  56.229  1.00 38.31  ? 147 ARG E N   1 
ATOM   4478 C  CA  . ARG E  1 88  ? 30.380  11.135  54.836  1.00 38.65  ? 147 ARG E CA  1 
ATOM   4479 C  C   . ARG E  1 88  ? 31.431  10.218  54.199  1.00 38.03  ? 147 ARG E C   1 
ATOM   4480 O  O   . ARG E  1 88  ? 31.487  10.066  52.970  1.00 38.00  ? 147 ARG E O   1 
ATOM   4481 C  CB  . ARG E  1 88  ? 30.288  12.428  54.027  1.00 38.80  ? 147 ARG E CB  1 
ATOM   4482 C  CG  . ARG E  1 88  ? 29.246  13.420  54.507  1.00 39.45  ? 147 ARG E CG  1 
ATOM   4483 C  CD  . ARG E  1 88  ? 27.848  13.044  54.011  1.00 41.35  ? 147 ARG E CD  1 
ATOM   4484 N  NE  . ARG E  1 88  ? 26.840  14.014  54.426  1.00 42.60  ? 147 ARG E NE  1 
ATOM   4485 C  CZ  . ARG E  1 88  ? 26.226  14.024  55.600  1.00 43.47  ? 147 ARG E CZ  1 
ATOM   4486 N  NH1 . ARG E  1 88  ? 26.477  13.084  56.523  1.00 44.50  ? 147 ARG E NH1 1 
ATOM   4487 N  NH2 . ARG E  1 88  ? 25.350  14.977  55.864  1.00 45.66  ? 147 ARG E NH2 1 
ATOM   4488 N  N   . SER E  1 89  ? 32.240  9.585   55.049  1.00 37.70  ? 148 SER E N   1 
ATOM   4489 C  CA  . SER E  1 89  ? 33.312  8.712   54.620  1.00 36.92  ? 148 SER E CA  1 
ATOM   4490 C  C   . SER E  1 89  ? 32.848  7.289   54.330  1.00 37.60  ? 148 SER E C   1 
ATOM   4491 O  O   . SER E  1 89  ? 32.048  6.725   55.067  1.00 38.20  ? 148 SER E O   1 
ATOM   4492 C  CB  . SER E  1 89  ? 34.360  8.665   55.708  1.00 36.44  ? 148 SER E CB  1 
ATOM   4493 O  OG  . SER E  1 89  ? 34.926  9.945   55.884  1.00 36.28  ? 148 SER E OG  1 
ATOM   4494 N  N   . ARG E  1 90  ? 33.377  6.722   53.256  1.00 37.60  ? 149 ARG E N   1 
ATOM   4495 C  CA  . ARG E  1 90  ? 33.286  5.297   52.995  1.00 39.17  ? 149 ARG E CA  1 
ATOM   4496 C  C   . ARG E  1 90  ? 34.586  4.836   52.355  1.00 38.96  ? 149 ARG E C   1 
ATOM   4497 O  O   . ARG E  1 90  ? 35.405  5.653   51.937  1.00 37.64  ? 149 ARG E O   1 
ATOM   4498 C  CB  . ARG E  1 90  ? 32.122  4.965   52.063  1.00 40.62  ? 149 ARG E CB  1 
ATOM   4499 C  CG  . ARG E  1 90  ? 30.715  5.231   52.637  1.00 41.99  ? 149 ARG E CG  1 
ATOM   4500 C  CD  . ARG E  1 90  ? 30.341  4.306   53.813  1.00 43.25  ? 149 ARG E CD  1 
ATOM   4501 N  NE  . ARG E  1 90  ? 30.344  2.903   53.403  1.00 44.85  ? 149 ARG E NE  1 
ATOM   4502 C  CZ  . ARG E  1 90  ? 29.294  2.231   52.928  1.00 47.38  ? 149 ARG E CZ  1 
ATOM   4503 N  NH1 . ARG E  1 90  ? 28.087  2.798   52.797  1.00 47.70  ? 149 ARG E NH1 1 
ATOM   4504 N  NH2 . ARG E  1 90  ? 29.456  0.966   52.573  1.00 48.67  ? 149 ARG E NH2 1 
ATOM   4505 N  N   . LEU E  1 91  ? 34.774  3.527   52.289  1.00 40.38  ? 150 LEU E N   1 
ATOM   4506 C  CA  . LEU E  1 91  ? 35.937  2.956   51.671  1.00 40.61  ? 150 LEU E CA  1 
ATOM   4507 C  C   . LEU E  1 91  ? 35.572  2.744   50.241  1.00 41.77  ? 150 LEU E C   1 
ATOM   4508 O  O   . LEU E  1 91  ? 34.736  1.886   49.948  1.00 43.52  ? 150 LEU E O   1 
ATOM   4509 C  CB  . LEU E  1 91  ? 36.297  1.641   52.335  1.00 42.03  ? 150 LEU E CB  1 
ATOM   4510 C  CG  . LEU E  1 91  ? 36.827  1.811   53.771  1.00 41.89  ? 150 LEU E CG  1 
ATOM   4511 C  CD1 . LEU E  1 91  ? 37.406  0.520   54.304  1.00 42.55  ? 150 LEU E CD1 1 
ATOM   4512 C  CD2 . LEU E  1 91  ? 37.881  2.881   53.861  1.00 39.60  ? 150 LEU E CD2 1 
ATOM   4513 N  N   . GLY E  1 92  ? 36.211  3.515   49.355  1.00 41.22  ? 151 GLY E N   1 
ATOM   4514 C  CA  . GLY E  1 92  ? 35.817  3.632   47.950  1.00 42.36  ? 151 GLY E CA  1 
ATOM   4515 C  C   . GLY E  1 92  ? 35.803  2.337   47.196  1.00 44.55  ? 151 GLY E C   1 
ATOM   4516 O  O   . GLY E  1 92  ? 35.213  2.202   46.141  1.00 46.17  ? 151 GLY E O   1 
ATOM   4517 N  N   . CYS E  1 93  ? 36.429  1.350   47.775  1.00 45.58  ? 152 CYS E N   1 
ATOM   4518 C  CA  . CYS E  1 93  ? 36.580  0.086   47.102  1.00 48.32  ? 152 CYS E CA  1 
ATOM   4519 C  C   . CYS E  1 93  ? 35.443  -0.874  47.385  1.00 49.52  ? 152 CYS E C   1 
ATOM   4520 O  O   . CYS E  1 93  ? 35.349  -1.931  46.758  1.00 51.10  ? 152 CYS E O   1 
ATOM   4521 C  CB  . CYS E  1 93  ? 37.912  -0.518  47.478  1.00 49.10  ? 152 CYS E CB  1 
ATOM   4522 S  SG  . CYS E  1 93  ? 38.037  -1.301  49.170  1.00 52.39  ? 152 CYS E SG  1 
ATOM   4523 N  N   . GLN E  1 94  ? 34.581  -0.492  48.322  1.00 48.58  ? 153 GLN E N   1 
ATOM   4524 C  CA  . GLN E  1 94  ? 33.322  -1.210  48.560  1.00 50.50  ? 153 GLN E CA  1 
ATOM   4525 C  C   . GLN E  1 94  ? 32.147  -0.528  47.861  1.00 50.24  ? 153 GLN E C   1 
ATOM   4526 O  O   . GLN E  1 94  ? 31.057  -1.098  47.768  1.00 52.20  ? 153 GLN E O   1 
ATOM   4527 C  CB  . GLN E  1 94  ? 33.061  -1.333  50.070  1.00 49.89  ? 153 GLN E CB  1 
ATOM   4528 C  CG  . GLN E  1 94  ? 34.145  -2.100  50.783  1.00 50.59  ? 153 GLN E CG  1 
ATOM   4529 C  CD  . GLN E  1 94  ? 34.272  -3.510  50.266  1.00 53.26  ? 153 GLN E CD  1 
ATOM   4530 O  OE1 . GLN E  1 94  ? 33.329  -4.318  50.345  1.00 55.64  ? 153 GLN E OE1 1 
ATOM   4531 N  NE2 . GLN E  1 94  ? 35.445  -3.827  49.741  1.00 53.89  ? 153 GLN E NE2 1 
ATOM   4532 N  N   . ILE E  1 95  ? 32.379  0.677   47.355  1.00 48.34  ? 154 ILE E N   1 
ATOM   4533 C  CA  . ILE E  1 95  ? 31.309  1.466   46.751  1.00 48.45  ? 154 ILE E CA  1 
ATOM   4534 C  C   . ILE E  1 95  ? 31.307  1.312   45.233  1.00 50.08  ? 154 ILE E C   1 
ATOM   4535 O  O   . ILE E  1 95  ? 32.279  1.679   44.564  1.00 50.02  ? 154 ILE E O   1 
ATOM   4536 C  CB  . ILE E  1 95  ? 31.442  2.940   47.122  1.00 45.89  ? 154 ILE E CB  1 
ATOM   4537 C  CG1 . ILE E  1 95  ? 31.435  3.079   48.651  1.00 44.96  ? 154 ILE E CG1 1 
ATOM   4538 C  CG2 . ILE E  1 95  ? 30.341  3.756   46.469  1.00 45.00  ? 154 ILE E CG2 1 
ATOM   4539 C  CD1 . ILE E  1 95  ? 30.359  2.277   49.365  1.00 46.32  ? 154 ILE E CD1 1 
ATOM   4540 N  N   . CYS E  1 96  ? 30.219  0.748   44.721  1.00 52.02  ? 155 CYS E N   1 
ATOM   4541 C  CA  . CYS E  1 96  ? 30.054  0.473   43.302  1.00 54.15  ? 155 CYS E CA  1 
ATOM   4542 C  C   . CYS E  1 96  ? 29.189  1.520   42.597  1.00 53.82  ? 155 CYS E C   1 
ATOM   4543 O  O   . CYS E  1 96  ? 28.155  1.949   43.120  1.00 53.60  ? 155 CYS E O   1 
ATOM   4544 C  CB  . CYS E  1 96  ? 29.412  -0.906  43.106  1.00 57.27  ? 155 CYS E CB  1 
ATOM   4545 S  SG  . CYS E  1 96  ? 30.589  -2.237  43.289  1.00 61.58  ? 155 CYS E SG  1 
ATOM   4546 N  N   . LEU E  1 97  ? 29.604  1.892   41.390  1.00 54.01  ? 156 LEU E N   1 
ATOM   4547 C  CA  . LEU E  1 97  ? 28.928  2.926   40.640  1.00 53.93  ? 156 LEU E CA  1 
ATOM   4548 C  C   . LEU E  1 97  ? 27.536  2.488   40.240  1.00 56.19  ? 156 LEU E C   1 
ATOM   4549 O  O   . LEU E  1 97  ? 27.355  1.397   39.694  1.00 58.37  ? 156 LEU E O   1 
ATOM   4550 C  CB  . LEU E  1 97  ? 29.721  3.280   39.379  1.00 54.64  ? 156 LEU E CB  1 
ATOM   4551 C  CG  . LEU E  1 97  ? 31.090  3.941   39.582  1.00 52.77  ? 156 LEU E CG  1 
ATOM   4552 C  CD1 . LEU E  1 97  ? 31.772  4.224   38.263  1.00 53.05  ? 156 LEU E CD1 1 
ATOM   4553 C  CD2 . LEU E  1 97  ? 30.967  5.213   40.412  1.00 50.68  ? 156 LEU E CD2 1 
ATOM   4554 N  N   . THR E  1 98  ? 26.561  3.356   40.515  1.00 55.83  ? 157 THR E N   1 
ATOM   4555 C  CA  . THR E  1 98  ? 25.198  3.198   40.023  1.00 58.07  ? 157 THR E CA  1 
ATOM   4556 C  C   . THR E  1 98  ? 24.880  4.341   39.065  1.00 58.44  ? 157 THR E C   1 
ATOM   4557 O  O   . THR E  1 98  ? 25.515  5.389   39.105  1.00 56.65  ? 157 THR E O   1 
ATOM   4558 C  CB  . THR E  1 98  ? 24.157  3.197   41.177  1.00 58.31  ? 157 THR E CB  1 
ATOM   4559 O  OG1 . THR E  1 98  ? 24.183  4.445   41.882  1.00 56.61  ? 157 THR E OG1 1 
ATOM   4560 C  CG2 . THR E  1 98  ? 24.440  2.051   42.166  1.00 58.18  ? 157 THR E CG2 1 
ATOM   4561 N  N   . LYS E  1 99  ? 23.879  4.134   38.213  1.00 61.33  ? 158 LYS E N   1 
ATOM   4562 C  CA  . LYS E  1 99  ? 23.473  5.122   37.210  1.00 62.12  ? 158 LYS E CA  1 
ATOM   4563 C  C   . LYS E  1 99  ? 23.200  6.493   37.854  1.00 60.49  ? 158 LYS E C   1 
ATOM   4564 O  O   . LYS E  1 99  ? 23.481  7.534   37.273  1.00 60.50  ? 158 LYS E O   1 
ATOM   4565 C  CB  . LYS E  1 99  ? 22.240  4.630   36.443  1.00 65.28  ? 158 LYS E CB  1 
ATOM   4566 C  CG  . LYS E  1 99  ? 22.225  4.967   34.945  1.00 68.32  ? 158 LYS E CG  1 
ATOM   4567 C  CD  . LYS E  1 99  ? 22.361  3.723   34.020  1.00 72.03  ? 158 LYS E CD  1 
ATOM   4568 N  N   . SER E  1 100 ? 22.692  6.497   39.076  1.00 59.59  ? 159 SER E N   1 
ATOM   4569 C  CA  . SER E  1 100 ? 22.355  7.748   39.748  1.00 58.66  ? 159 SER E CA  1 
ATOM   4570 C  C   . SER E  1 100 ? 23.575  8.536   40.243  1.00 55.85  ? 159 SER E C   1 
ATOM   4571 O  O   . SER E  1 100 ? 23.436  9.662   40.719  1.00 55.08  ? 159 SER E O   1 
ATOM   4572 C  CB  . SER E  1 100 ? 21.434  7.449   40.938  1.00 59.11  ? 159 SER E CB  1 
ATOM   4573 O  OG  . SER E  1 100 ? 22.116  6.620   41.876  1.00 58.32  ? 159 SER E OG  1 
ATOM   4574 N  N   . MET E  1 101 ? 24.760  7.946   40.148  1.00 54.64  ? 160 MET E N   1 
ATOM   4575 C  CA  . MET E  1 101 ? 25.987  8.613   40.581  1.00 52.52  ? 160 MET E CA  1 
ATOM   4576 C  C   . MET E  1 101 ? 26.620  9.509   39.517  1.00 52.94  ? 160 MET E C   1 
ATOM   4577 O  O   . MET E  1 101 ? 27.626  10.160  39.795  1.00 51.51  ? 160 MET E O   1 
ATOM   4578 C  CB  . MET E  1 101 ? 27.023  7.571   41.032  1.00 51.59  ? 160 MET E CB  1 
ATOM   4579 C  CG  . MET E  1 101 ? 26.759  6.966   42.410  1.00 50.76  ? 160 MET E CG  1 
ATOM   4580 S  SD  . MET E  1 101 ? 27.980  5.722   42.908  1.00 51.91  ? 160 MET E SD  1 
ATOM   4581 C  CE  . MET E  1 101 ? 27.063  4.885   44.215  1.00 51.57  ? 160 MET E CE  1 
ATOM   4582 N  N   . ASP E  1 102 ? 26.051  9.543   38.308  1.00 55.31  ? 161 ASP E N   1 
ATOM   4583 C  CA  . ASP E  1 102 ? 26.621  10.335  37.209  1.00 56.21  ? 161 ASP E CA  1 
ATOM   4584 C  C   . ASP E  1 102 ? 26.856  11.804  37.641  1.00 55.36  ? 161 ASP E C   1 
ATOM   4585 O  O   . ASP E  1 102 ? 25.966  12.449  38.205  1.00 54.97  ? 161 ASP E O   1 
ATOM   4586 C  CB  . ASP E  1 102 ? 25.712  10.273  35.981  1.00 59.03  ? 161 ASP E CB  1 
ATOM   4587 C  CG  . ASP E  1 102 ? 26.393  10.733  34.708  1.00 60.89  ? 161 ASP E CG  1 
ATOM   4588 O  OD1 . ASP E  1 102 ? 27.496  10.249  34.384  1.00 60.29  ? 161 ASP E OD1 1 
ATOM   4589 O  OD2 . ASP E  1 102 ? 25.789  11.561  34.002  1.00 64.47  ? 161 ASP E OD2 1 
ATOM   4590 N  N   . ASN E  1 103 ? 28.075  12.294  37.394  1.00 54.84  ? 162 ASN E N   1 
ATOM   4591 C  CA  . ASN E  1 103 ? 28.506  13.641  37.766  1.00 54.50  ? 162 ASN E CA  1 
ATOM   4592 C  C   . ASN E  1 103 ? 28.619  13.938  39.269  1.00 52.15  ? 162 ASN E C   1 
ATOM   4593 O  O   . ASN E  1 103 ? 28.706  15.107  39.679  1.00 52.22  ? 162 ASN E O   1 
ATOM   4594 C  CB  . ASN E  1 103 ? 27.655  14.711  37.065  1.00 56.86  ? 162 ASN E CB  1 
ATOM   4595 C  CG  . ASN E  1 103 ? 28.024  14.887  35.588  1.00 59.74  ? 162 ASN E CG  1 
ATOM   4596 O  OD1 . ASN E  1 103 ? 29.167  15.211  35.249  1.00 59.56  ? 162 ASN E OD1 1 
ATOM   4597 N  ND2 . ASN E  1 103 ? 27.041  14.694  34.707  1.00 61.44  ? 162 ASN E ND2 1 
ATOM   4598 N  N   . MET E  1 104 ? 28.685  12.899  40.093  1.00 50.50  ? 163 MET E N   1 
ATOM   4599 C  CA  . MET E  1 104 ? 28.995  13.112  41.499  1.00 48.38  ? 163 MET E CA  1 
ATOM   4600 C  C   . MET E  1 104 ? 30.465  13.505  41.659  1.00 47.66  ? 163 MET E C   1 
ATOM   4601 O  O   . MET E  1 104 ? 31.306  13.249  40.792  1.00 48.06  ? 163 MET E O   1 
ATOM   4602 C  CB  . MET E  1 104 ? 28.706  11.871  42.317  1.00 47.24  ? 163 MET E CB  1 
ATOM   4603 C  CG  . MET E  1 104 ? 29.662  10.711  42.089  1.00 46.95  ? 163 MET E CG  1 
ATOM   4604 S  SD  . MET E  1 104 ? 29.494  9.445   43.367  1.00 45.75  ? 163 MET E SD  1 
ATOM   4605 C  CE  . MET E  1 104 ? 30.740  8.304   42.821  1.00 45.22  ? 163 MET E CE  1 
ATOM   4606 N  N   . THR E  1 105 ? 30.757  14.120  42.795  1.00 46.76  ? 164 THR E N   1 
ATOM   4607 C  CA  . THR E  1 105 ? 32.110  14.488  43.186  1.00 45.60  ? 164 THR E CA  1 
ATOM   4608 C  C   . THR E  1 105 ? 32.451  13.776  44.490  1.00 43.61  ? 164 THR E C   1 
ATOM   4609 O  O   . THR E  1 105 ? 31.688  13.798  45.446  1.00 43.16  ? 164 THR E O   1 
ATOM   4610 C  CB  . THR E  1 105 ? 32.188  15.983  43.390  1.00 46.23  ? 164 THR E CB  1 
ATOM   4611 O  OG1 . THR E  1 105 ? 31.717  16.600  42.197  1.00 48.84  ? 164 THR E OG1 1 
ATOM   4612 C  CG2 . THR E  1 105 ? 33.596  16.434  43.671  1.00 45.78  ? 164 THR E CG2 1 
ATOM   4613 N  N   . VAL E  1 106 ? 33.582  13.102  44.507  1.00 42.90  ? 165 VAL E N   1 
ATOM   4614 C  CA  . VAL E  1 106 ? 34.104  12.496  45.718  1.00 41.07  ? 165 VAL E CA  1 
ATOM   4615 C  C   . VAL E  1 106 ? 35.434  13.167  45.995  1.00 40.82  ? 165 VAL E C   1 
ATOM   4616 O  O   . VAL E  1 106 ? 36.152  13.551  45.054  1.00 41.80  ? 165 VAL E O   1 
ATOM   4617 C  CB  . VAL E  1 106 ? 34.352  10.994  45.552  1.00 40.89  ? 165 VAL E CB  1 
ATOM   4618 C  CG1 . VAL E  1 106 ? 33.070  10.292  45.292  1.00 41.34  ? 165 VAL E CG1 1 
ATOM   4619 C  CG2 . VAL E  1 106 ? 35.328  10.726  44.423  1.00 41.28  ? 165 VAL E CG2 1 
ATOM   4620 N  N   . ARG E  1 107 ? 35.763  13.328  47.273  1.00 47.83  ? 166 ARG E N   1 
ATOM   4621 C  CA  . ARG E  1 107 ? 37.026  13.940  47.644  1.00 47.69  ? 166 ARG E CA  1 
ATOM   4622 C  C   . ARG E  1 107 ? 37.972  12.902  48.258  1.00 45.21  ? 166 ARG E C   1 
ATOM   4623 O  O   . ARG E  1 107 ? 37.566  12.093  49.069  1.00 44.84  ? 166 ARG E O   1 
ATOM   4624 C  CB  . ARG E  1 107 ? 36.807  15.141  48.574  1.00 50.25  ? 166 ARG E CB  1 
ATOM   4625 C  CG  . ARG E  1 107 ? 38.122  15.753  49.022  1.00 51.02  ? 166 ARG E CG  1 
ATOM   4626 C  CD  . ARG E  1 107 ? 37.963  17.169  49.498  1.00 55.19  ? 166 ARG E CD  1 
ATOM   4627 N  NE  . ARG E  1 107 ? 37.261  17.257  50.768  1.00 57.09  ? 166 ARG E NE  1 
ATOM   4628 C  CZ  . ARG E  1 107 ? 37.815  17.015  51.946  1.00 56.99  ? 166 ARG E CZ  1 
ATOM   4629 N  NH1 . ARG E  1 107 ? 37.081  17.139  53.041  1.00 59.84  ? 166 ARG E NH1 1 
ATOM   4630 N  NH2 . ARG E  1 107 ? 39.096  16.640  52.044  1.00 54.41  ? 166 ARG E NH2 1 
ATOM   4631 N  N   . VAL E  1 108 ? 39.227  12.933  47.836  1.00 44.36  ? 167 VAL E N   1 
ATOM   4632 C  CA  . VAL E  1 108 ? 40.292  12.153  48.466  1.00 43.09  ? 167 VAL E CA  1 
ATOM   4633 C  C   . VAL E  1 108 ? 40.838  12.963  49.648  1.00 44.24  ? 167 VAL E C   1 
ATOM   4634 O  O   . VAL E  1 108 ? 41.379  14.052  49.444  1.00 45.79  ? 167 VAL E O   1 
ATOM   4635 C  CB  . VAL E  1 108 ? 41.462  11.868  47.515  1.00 42.22  ? 167 VAL E CB  1 
ATOM   4636 C  CG1 . VAL E  1 108 ? 42.330  10.796  48.086  1.00 40.54  ? 167 VAL E CG1 1 
ATOM   4637 C  CG2 . VAL E  1 108 ? 40.957  11.460  46.182  1.00 41.64  ? 167 VAL E CG2 1 
ATOM   4638 N  N   . PRO E  1 109 ? 40.672  12.450  50.885  1.00 43.93  ? 168 PRO E N   1 
ATOM   4639 C  CA  . PRO E  1 109 ? 41.103  13.173  52.078  1.00 45.04  ? 168 PRO E CA  1 
ATOM   4640 C  C   . PRO E  1 109 ? 42.595  12.990  52.331  1.00 43.63  ? 168 PRO E C   1 
ATOM   4641 O  O   . PRO E  1 109 ? 43.206  12.064  51.831  1.00 41.17  ? 168 PRO E O   1 
ATOM   4642 C  CB  . PRO E  1 109 ? 40.286  12.521  53.182  1.00 45.51  ? 168 PRO E CB  1 
ATOM   4643 C  CG  . PRO E  1 109 ? 40.065  11.133  52.700  1.00 43.81  ? 168 PRO E CG  1 
ATOM   4644 C  CD  . PRO E  1 109 ? 40.081  11.144  51.219  1.00 42.84  ? 168 PRO E CD  1 
ATOM   4645 N  N   . GLU E  1 110 ? 43.170  13.889  53.103  1.00 45.24  ? 169 GLU E N   1 
ATOM   4646 C  CA  . GLU E  1 110 ? 44.594  13.836  53.391  1.00 44.86  ? 169 GLU E CA  1 
ATOM   4647 C  C   . GLU E  1 110 ? 44.929  12.615  54.256  1.00 42.72  ? 169 GLU E C   1 
ATOM   4648 O  O   . GLU E  1 110 ? 44.100  12.142  55.001  1.00 42.40  ? 169 GLU E O   1 
ATOM   4649 C  CB  . GLU E  1 110 ? 45.069  15.143  54.044  1.00 47.51  ? 169 GLU E CB  1 
ATOM   4650 C  CG  . GLU E  1 110 ? 44.609  15.344  55.468  1.00 49.38  ? 169 GLU E CG  1 
ATOM   4651 C  CD  . GLU E  1 110 ? 45.263  16.540  56.187  1.00 54.19  ? 169 GLU E CD  1 
ATOM   4652 O  OE1 . GLU E  1 110 ? 44.800  16.832  57.320  1.00 56.08  ? 169 GLU E OE1 1 
ATOM   4653 O  OE2 . GLU E  1 110 ? 46.224  17.165  55.647  1.00 55.35  ? 169 GLU E OE2 1 
ATOM   4654 N  N   . THR E  1 111 ? 46.139  12.086  54.106  1.00 41.93  ? 170 THR E N   1 
ATOM   4655 C  CA  . THR E  1 111 ? 46.597  10.938  54.890  1.00 40.54  ? 170 THR E CA  1 
ATOM   4656 C  C   . THR E  1 111 ? 47.276  11.402  56.149  1.00 40.95  ? 170 THR E C   1 
ATOM   4657 O  O   . THR E  1 111 ? 47.564  12.575  56.310  1.00 42.48  ? 170 THR E O   1 
ATOM   4658 C  CB  . THR E  1 111 ? 47.628  10.094  54.157  1.00 39.59  ? 170 THR E CB  1 
ATOM   4659 O  OG1 . THR E  1 111 ? 48.859  10.828  54.052  1.00 41.32  ? 170 THR E OG1 1 
ATOM   4660 C  CG2 . THR E  1 111 ? 47.118  9.701   52.792  1.00 38.47  ? 170 THR E CG2 1 
ATOM   4661 N  N   . VAL E  1 112 ? 47.539  10.469  57.048  1.00 39.88  ? 171 VAL E N   1 
ATOM   4662 C  CA  . VAL E  1 112 ? 48.193  10.806  58.297  1.00 39.99  ? 171 VAL E CA  1 
ATOM   4663 C  C   . VAL E  1 112 ? 49.581  11.390  58.039  1.00 40.14  ? 171 VAL E C   1 
ATOM   4664 O  O   . VAL E  1 112 ? 50.023  12.301  58.747  1.00 41.10  ? 171 VAL E O   1 
ATOM   4665 C  CB  . VAL E  1 112 ? 48.260  9.584   59.245  1.00 39.38  ? 171 VAL E CB  1 
ATOM   4666 C  CG1 . VAL E  1 112 ? 49.184  8.524   58.693  1.00 37.89  ? 171 VAL E CG1 1 
ATOM   4667 C  CG2 . VAL E  1 112 ? 48.677  10.014  60.658  1.00 38.91  ? 171 VAL E CG2 1 
ATOM   4668 N  N   . ALA E  1 113 ? 50.245  10.877  57.007  1.00 38.96  ? 172 ALA E N   1 
ATOM   4669 C  CA  . ALA E  1 113 ? 51.560  11.369  56.577  1.00 39.96  ? 172 ALA E CA  1 
ATOM   4670 C  C   . ALA E  1 113 ? 51.541  12.820  56.108  1.00 42.20  ? 172 ALA E C   1 
ATOM   4671 O  O   . ALA E  1 113 ? 52.433  13.612  56.437  1.00 44.44  ? 172 ALA E O   1 
ATOM   4672 C  CB  . ALA E  1 113 ? 52.096  10.500  55.490  1.00 39.48  ? 172 ALA E CB  1 
ATOM   4673 N  N   . ASP E  1 114 ? 50.527  13.167  55.336  1.00 42.39  ? 173 ASP E N   1 
ATOM   4674 C  CA  . ASP E  1 114 ? 50.404  14.514  54.834  1.00 45.24  ? 173 ASP E CA  1 
ATOM   4675 C  C   . ASP E  1 114 ? 50.311  15.444  56.039  1.00 46.38  ? 173 ASP E C   1 
ATOM   4676 O  O   . ASP E  1 114 ? 50.849  16.552  56.022  1.00 50.08  ? 173 ASP E O   1 
ATOM   4677 C  CB  . ASP E  1 114 ? 49.149  14.674  53.916  1.00 45.73  ? 173 ASP E CB  1 
ATOM   4678 C  CG  . ASP E  1 114 ? 49.168  13.737  52.670  1.00 46.81  ? 173 ASP E CG  1 
ATOM   4679 O  OD1 . ASP E  1 114 ? 50.263  13.435  52.119  1.00 50.81  ? 173 ASP E OD1 1 
ATOM   4680 O  OD2 . ASP E  1 114 ? 48.076  13.294  52.245  1.00 46.87  ? 173 ASP E OD2 1 
ATOM   4681 N  N   . ALA E  1 115 ? 49.641  14.986  57.088  1.00 44.59  ? 174 ALA E N   1 
ATOM   4682 C  CA  . ALA E  1 115 ? 49.286  15.834  58.230  1.00 46.63  ? 174 ALA E CA  1 
ATOM   4683 C  C   . ALA E  1 115 ? 50.400  15.915  59.257  1.00 47.09  ? 174 ALA E C   1 
ATOM   4684 O  O   . ALA E  1 115 ? 50.406  16.792  60.117  1.00 49.35  ? 174 ALA E O   1 
ATOM   4685 C  CB  . ALA E  1 115 ? 47.992  15.305  58.904  1.00 45.59  ? 174 ALA E CB  1 
ATOM   4686 N  N   . ARG E  1 116 ? 51.325  14.972  59.171  1.00 45.39  ? 175 ARG E N   1 
ATOM   4687 C  CA  . ARG E  1 116 ? 52.391  14.843  60.148  1.00 45.73  ? 175 ARG E CA  1 
ATOM   4688 C  C   . ARG E  1 116 ? 53.447  15.903  59.936  1.00 49.11  ? 175 ARG E C   1 
ATOM   4689 O  O   . ARG E  1 116 ? 53.863  16.188  58.814  1.00 50.21  ? 175 ARG E O   1 
ATOM   4690 C  CB  . ARG E  1 116 ? 53.031  13.466  60.024  1.00 43.13  ? 175 ARG E CB  1 
ATOM   4691 C  CG  . ARG E  1 116 ? 54.022  13.113  61.137  1.00 42.97  ? 175 ARG E CG  1 
ATOM   4692 C  CD  . ARG E  1 116 ? 54.601  11.713  60.928  1.00 39.89  ? 175 ARG E CD  1 
ATOM   4693 N  NE  . ARG E  1 116 ? 53.554  10.698  61.002  1.00 38.45  ? 175 ARG E NE  1 
ATOM   4694 C  CZ  . ARG E  1 116 ? 53.294  9.771   60.080  1.00 39.48  ? 175 ARG E CZ  1 
ATOM   4695 N  NH1 . ARG E  1 116 ? 52.305  8.904   60.260  1.00 40.37  ? 175 ARG E NH1 1 
ATOM   4696 N  NH2 . ARG E  1 116 ? 54.017  9.672   58.991  1.00 42.12  ? 175 ARG E NH2 1 
ATOM   4697 N  N   . GLN E  1 117 ? 53.889  16.475  61.034  1.00 51.28  ? 176 GLN E N   1 
ATOM   4698 C  CA  . GLN E  1 117 ? 54.884  17.519  60.981  1.00 55.54  ? 176 GLN E CA  1 
ATOM   4699 C  C   . GLN E  1 117 ? 56.170  17.090  61.652  1.00 54.54  ? 176 GLN E C   1 
ATOM   4700 O  O   . GLN E  1 117 ? 57.238  17.636  61.398  1.00 56.83  ? 176 GLN E O   1 
ATOM   4701 C  CB  . GLN E  1 117 ? 54.289  18.760  61.617  1.00 59.62  ? 176 GLN E CB  1 
ATOM   4702 C  CG  . GLN E  1 117 ? 52.990  19.145  60.906  1.00 62.51  ? 176 GLN E CG  1 
ATOM   4703 C  CD  . GLN E  1 117 ? 52.666  20.605  61.039  1.00 70.43  ? 176 GLN E CD  1 
ATOM   4704 O  OE1 . GLN E  1 117 ? 52.973  21.221  62.067  1.00 74.30  ? 176 GLN E OE1 1 
ATOM   4705 N  NE2 . GLN E  1 117 ? 52.034  21.180  60.003  1.00 73.70  ? 176 GLN E NE2 1 
ATOM   4706 N  N   . SER E  1 118 ? 56.042  16.104  62.517  1.00 51.47  ? 177 SER E N   1 
ATOM   4707 C  CA  . SER E  1 118 ? 57.180  15.396  63.026  1.00 50.78  ? 177 SER E CA  1 
ATOM   4708 C  C   . SER E  1 118 ? 56.785  14.010  63.520  1.00 46.75  ? 177 SER E C   1 
ATOM   4709 O  O   . SER E  1 118 ? 55.629  13.729  63.858  1.00 45.08  ? 177 SER E O   1 
ATOM   4710 C  CB  . SER E  1 118 ? 57.841  16.180  64.151  1.00 53.39  ? 177 SER E CB  1 
ATOM   4711 O  OG  . SER E  1 118 ? 56.920  16.373  65.207  1.00 54.71  ? 177 SER E OG  1 
ATOM   4712 N  N   . ILE E  1 119 ? 57.799  13.160  63.516  1.00 45.46  ? 178 ILE E N   1 
ATOM   4713 C  CA  . ILE E  1 119 ? 57.781  11.810  64.026  1.00 42.10  ? 178 ILE E CA  1 
ATOM   4714 C  C   . ILE E  1 119 ? 57.940  11.848  65.532  1.00 41.79  ? 178 ILE E C   1 
ATOM   4715 O  O   . ILE E  1 119 ? 58.679  12.677  66.054  1.00 43.61  ? 178 ILE E O   1 
ATOM   4716 C  CB  . ILE E  1 119 ? 58.987  11.101  63.468  1.00 42.34  ? 178 ILE E CB  1 
ATOM   4717 C  CG1 . ILE E  1 119 ? 58.706  10.625  62.038  1.00 41.81  ? 178 ILE E CG1 1 
ATOM   4718 C  CG2 . ILE E  1 119 ? 59.431  10.003  64.387  1.00 41.53  ? 178 ILE E CG2 1 
ATOM   4719 C  CD1 . ILE E  1 119 ? 60.012  10.439  61.227  1.00 43.05  ? 178 ILE E CD1 1 
ATOM   4720 N  N   . ASP E  1 120 ? 57.274  10.928  66.228  1.00 40.02  ? 179 ASP E N   1 
ATOM   4721 C  CA  . ASP E  1 120 ? 57.281  10.905  67.698  1.00 40.07  ? 179 ASP E CA  1 
ATOM   4722 C  C   . ASP E  1 120 ? 58.478  10.181  68.299  1.00 38.06  ? 179 ASP E C   1 
ATOM   4723 O  O   . ASP E  1 120 ? 59.047  9.280   67.696  1.00 35.79  ? 179 ASP E O   1 
ATOM   4724 C  CB  . ASP E  1 120 ? 55.952  10.319  68.230  1.00 39.81  ? 179 ASP E CB  1 
ATOM   4725 C  CG  . ASP E  1 120 ? 54.857  11.408  68.419  1.00 44.46  ? 179 ASP E CG  1 
ATOM   4726 O  OD1 . ASP E  1 120 ? 55.155  12.591  68.062  1.00 47.86  ? 179 ASP E OD1 1 
ATOM   4727 O  OD2 . ASP E  1 120 ? 53.713  11.104  68.914  1.00 44.95  ? 179 ASP E OD2 1 
ATOM   4728 N  N   . VAL E  1 121 ? 58.853  10.599  69.504  1.00 38.89  ? 180 VAL E N   1 
ATOM   4729 C  CA  . VAL E  1 121 ? 59.891  9.912   70.266  1.00 38.37  ? 180 VAL E CA  1 
ATOM   4730 C  C   . VAL E  1 121 ? 59.272  8.619   70.702  1.00 37.37  ? 180 VAL E C   1 
ATOM   4731 O  O   . VAL E  1 121 ? 58.228  8.634   71.313  1.00 37.47  ? 180 VAL E O   1 
ATOM   4732 C  CB  . VAL E  1 121 ? 60.306  10.656  71.538  1.00 39.45  ? 180 VAL E CB  1 
ATOM   4733 C  CG1 . VAL E  1 121 ? 61.280  9.774   72.379  1.00 39.20  ? 180 VAL E CG1 1 
ATOM   4734 C  CG2 . VAL E  1 121 ? 60.969  11.932  71.198  1.00 40.92  ? 180 VAL E CG2 1 
ATOM   4735 N  N   . GLY E  1 122 ? 59.914  7.510   70.370  1.00 37.66  ? 181 GLY E N   1 
ATOM   4736 C  CA  . GLY E  1 122 ? 59.408  6.189   70.690  1.00 37.73  ? 181 GLY E CA  1 
ATOM   4737 C  C   . GLY E  1 122 ? 59.900  5.706   72.046  1.00 38.54  ? 181 GLY E C   1 
ATOM   4738 O  O   . GLY E  1 122 ? 61.087  5.619   72.269  1.00 39.18  ? 181 GLY E O   1 
ATOM   4739 N  N   . LYS E  1 123 ? 58.975  5.393   72.946  1.00 39.36  ? 182 LYS E N   1 
ATOM   4740 C  CA  . LYS E  1 123 ? 59.297  4.773   74.219  1.00 40.83  ? 182 LYS E CA  1 
ATOM   4741 C  C   . LYS E  1 123 ? 58.416  3.529   74.445  1.00 42.20  ? 182 LYS E C   1 
ATOM   4742 O  O   . LYS E  1 123 ? 57.280  3.499   74.015  1.00 42.31  ? 182 LYS E O   1 
ATOM   4743 C  CB  . LYS E  1 123 ? 59.176  5.774   75.367  1.00 41.34  ? 182 LYS E CB  1 
ATOM   4744 C  CG  . LYS E  1 123 ? 57.872  6.454   75.474  1.00 43.14  ? 182 LYS E CG  1 
ATOM   4745 C  CD  . LYS E  1 123 ? 57.838  7.392   76.673  1.00 46.06  ? 182 LYS E CD  1 
ATOM   4746 C  CE  . LYS E  1 123 ? 56.436  7.928   76.914  1.00 48.56  ? 182 LYS E CE  1 
ATOM   4747 N  NZ  . LYS E  1 123 ? 55.761  8.264   75.598  1.00 47.75  ? 182 LYS E NZ  1 
ATOM   4748 N  N   . THR E  1 124 ? 58.980  2.489   75.062  1.00 43.82  ? 183 THR E N   1 
ATOM   4749 C  CA  . THR E  1 124 ? 58.224  1.299   75.409  1.00 45.92  ? 183 THR E CA  1 
ATOM   4750 C  C   . THR E  1 124 ? 57.556  1.541   76.733  1.00 48.16  ? 183 THR E C   1 
ATOM   4751 O  O   . THR E  1 124 ? 56.376  1.263   76.848  1.00 50.83  ? 183 THR E O   1 
ATOM   4752 C  CB  . THR E  1 124 ? 59.088  0.046   75.514  1.00 47.11  ? 183 THR E CB  1 
ATOM   4753 O  OG1 . THR E  1 124 ? 60.282  0.368   76.215  1.00 47.62  ? 183 THR E OG1 1 
ATOM   4754 C  CG2 . THR E  1 124 ? 59.454  -0.474  74.135  1.00 45.99  ? 183 THR E CG2 1 
ATOM   4755 N  N   . SER E  1 125 ? 58.276  2.062   77.729  1.00 48.82  ? 184 SER E N   1 
ATOM   4756 C  CA  . SER E  1 125 ? 57.618  2.502   78.969  1.00 51.00  ? 184 SER E CA  1 
ATOM   4757 C  C   . SER E  1 125 ? 57.871  3.954   79.428  1.00 51.14  ? 184 SER E C   1 
ATOM   4758 O  O   . SER E  1 125 ? 58.920  4.567   79.173  1.00 49.94  ? 184 SER E O   1 
ATOM   4759 C  CB  . SER E  1 125 ? 57.965  1.545   80.109  1.00 53.22  ? 184 SER E CB  1 
ATOM   4760 O  OG  . SER E  1 125 ? 59.334  1.605   80.403  1.00 51.84  ? 184 SER E OG  1 
ATOM   4761 N  N   . ALA E  1 126 ? 56.869  4.484   80.125  1.00 54.12  ? 185 ALA E N   1 
ATOM   4762 C  CA  . ALA E  1 126 ? 56.963  5.746   80.898  1.00 55.40  ? 185 ALA E CA  1 
ATOM   4763 C  C   . ALA E  1 126 ? 57.978  5.765   82.048  1.00 55.63  ? 185 ALA E C   1 
ATOM   4764 O  O   . ALA E  1 126 ? 58.464  6.839   82.402  1.00 56.26  ? 185 ALA E O   1 
ATOM   4765 C  CB  . ALA E  1 126 ? 55.586  6.112   81.467  1.00 58.70  ? 185 ALA E CB  1 
ATOM   4766 N  N   . GLU E  1 127 ? 58.270  4.624   82.662  1.00 55.73  ? 186 GLU E N   1 
ATOM   4767 C  CA  . GLU E  1 127 ? 59.140  4.641   83.846  1.00 56.80  ? 186 GLU E CA  1 
ATOM   4768 C  C   . GLU E  1 127 ? 60.646  4.731   83.443  1.00 54.42  ? 186 GLU E C   1 
ATOM   4769 O  O   . GLU E  1 127 ? 61.044  4.250   82.380  1.00 52.71  ? 186 GLU E O   1 
ATOM   4770 C  CB  . GLU E  1 127 ? 58.843  3.426   84.759  1.00 58.83  ? 186 GLU E CB  1 
ATOM   4771 N  N   . ASN E  1 128 ? 61.468  5.385   84.272  1.00 55.10  ? 187 ASN E N   1 
ATOM   4772 C  CA  . ASN E  1 128 ? 62.943  5.268   84.192  1.00 53.67  ? 187 ASN E CA  1 
ATOM   4773 C  C   . ASN E  1 128 ? 63.376  3.842   83.974  1.00 53.60  ? 187 ASN E C   1 
ATOM   4774 O  O   . ASN E  1 128 ? 62.591  2.906   84.069  1.00 55.16  ? 187 ASN E O   1 
ATOM   4775 C  CB  . ASN E  1 128 ? 63.607  5.723   85.487  1.00 54.83  ? 187 ASN E CB  1 
ATOM   4776 C  CG  . ASN E  1 128 ? 63.388  7.183   85.779  1.00 56.00  ? 187 ASN E CG  1 
ATOM   4777 O  OD1 . ASN E  1 128 ? 63.030  7.954   84.906  1.00 54.60  ? 187 ASN E OD1 1 
ATOM   4778 N  ND2 . ASN E  1 128 ? 63.607  7.573   87.032  1.00 58.39  ? 187 ASN E ND2 1 
ATOM   4779 N  N   . LEU E  1 129 ? 64.645  3.670   83.693  1.00 53.05  ? 188 LEU E N   1 
ATOM   4780 C  CA  . LEU E  1 129 ? 65.198  2.350   83.707  1.00 54.18  ? 188 LEU E CA  1 
ATOM   4781 C  C   . LEU E  1 129 ? 65.422  1.924   85.152  1.00 56.43  ? 188 LEU E C   1 
ATOM   4782 O  O   . LEU E  1 129 ? 65.187  0.765   85.481  1.00 58.57  ? 188 LEU E O   1 
ATOM   4783 C  CB  . LEU E  1 129 ? 66.476  2.295   82.870  1.00 53.66  ? 188 LEU E CB  1 
ATOM   4784 C  CG  . LEU E  1 129 ? 66.162  2.288   81.355  1.00 53.44  ? 188 LEU E CG  1 
ATOM   4785 C  CD1 . LEU E  1 129 ? 67.417  2.488   80.473  1.00 52.41  ? 188 LEU E CD1 1 
ATOM   4786 C  CD2 . LEU E  1 129 ? 65.410  0.986   80.976  1.00 55.11  ? 188 LEU E CD2 1 
ATOM   4787 N  N   . TYR E  1 130 ? 65.837  2.848   86.022  1.00 56.69  ? 189 TYR E N   1 
ATOM   4788 C  CA  . TYR E  1 130 ? 66.063  2.515   87.433  1.00 59.00  ? 189 TYR E CA  1 
ATOM   4789 C  C   . TYR E  1 130 ? 64.825  1.847   88.041  1.00 62.07  ? 189 TYR E C   1 
ATOM   4790 O  O   . TYR E  1 130 ? 64.916  0.768   88.637  1.00 64.07  ? 189 TYR E O   1 
ATOM   4791 C  CB  . TYR E  1 130 ? 66.448  3.763   88.227  1.00 58.94  ? 189 TYR E CB  1 
ATOM   4792 C  CG  . TYR E  1 130 ? 66.654  3.550   89.718  1.00 61.66  ? 189 TYR E CG  1 
ATOM   4793 C  CD1 . TYR E  1 130 ? 67.878  3.138   90.232  1.00 61.83  ? 189 TYR E CD1 1 
ATOM   4794 C  CD2 . TYR E  1 130 ? 65.625  3.788   90.623  1.00 64.76  ? 189 TYR E CD2 1 
ATOM   4795 C  CE1 . TYR E  1 130 ? 68.071  2.967   91.615  1.00 63.83  ? 189 TYR E CE1 1 
ATOM   4796 C  CE2 . TYR E  1 130 ? 65.814  3.619   92.006  1.00 67.36  ? 189 TYR E CE2 1 
ATOM   4797 C  CZ  . TYR E  1 130 ? 67.036  3.210   92.492  1.00 66.51  ? 189 TYR E CZ  1 
ATOM   4798 O  OH  . TYR E  1 130 ? 67.207  3.047   93.856  1.00 69.21  ? 189 TYR E OH  1 
ATOM   4799 N  N   . PHE E  1 131 ? 63.662  2.466   87.837  1.00 63.25  ? 190 PHE E N   1 
ATOM   4800 C  CA  . PHE E  1 131 ? 62.404  1.943   88.377  1.00 66.52  ? 190 PHE E CA  1 
ATOM   4801 C  C   . PHE E  1 131 ? 61.838  0.733   87.596  1.00 67.54  ? 190 PHE E C   1 
ATOM   4802 O  O   . PHE E  1 131 ? 60.691  0.326   87.797  1.00 70.03  ? 190 PHE E O   1 
ATOM   4803 C  CB  . PHE E  1 131 ? 61.374  3.068   88.451  1.00 67.54  ? 190 PHE E CB  1 
ATOM   4804 C  CG  . PHE E  1 131 ? 61.773  4.204   89.361  1.00 68.39  ? 190 PHE E CG  1 
ATOM   4805 C  CD1 . PHE E  1 131 ? 62.139  3.964   90.686  1.00 70.86  ? 190 PHE E CD1 1 
ATOM   4806 C  CD2 . PHE E  1 131 ? 61.750  5.517   88.907  1.00 67.48  ? 190 PHE E CD2 1 
ATOM   4807 C  CE1 . PHE E  1 131 ? 62.498  5.017   91.537  1.00 71.76  ? 190 PHE E CE1 1 
ATOM   4808 C  CE2 . PHE E  1 131 ? 62.100  6.577   89.758  1.00 68.59  ? 190 PHE E CE2 1 
ATOM   4809 C  CZ  . PHE E  1 131 ? 62.468  6.327   91.068  1.00 70.43  ? 190 PHE E CZ  1 
ATOM   4810 N  N   . GLN E  1 132 ? 62.649  0.180   86.701  1.00 66.29  ? 191 GLN E N   1 
ATOM   4811 C  CA  . GLN E  1 132 ? 62.441  -1.154  86.145  1.00 68.12  ? 191 GLN E CA  1 
ATOM   4812 C  C   . GLN E  1 132 ? 61.171  -1.284  85.355  1.00 68.70  ? 191 GLN E C   1 
ATOM   4813 O  O   . GLN E  1 132 ? 61.204  -0.986  84.163  1.00 67.20  ? 191 GLN E O   1 
ATOM   4814 C  CB  . GLN E  1 132 ? 62.503  -2.231  87.228  1.00 71.88  ? 191 GLN E CB  1 
ATOM   4815 C  CG  . GLN E  1 132 ? 62.995  -3.579  86.688  1.00 73.74  ? 191 GLN E CG  1 
ATOM   4816 C  CD  . GLN E  1 132 ? 64.531  -3.679  86.608  1.00 72.31  ? 191 GLN E CD  1 
ATOM   4817 O  OE1 . GLN E  1 132 ? 65.224  -2.723  86.233  1.00 68.05  ? 191 GLN E OE1 1 
ATOM   4818 N  NE2 . GLN E  1 132 ? 65.058  -4.852  86.957  1.00 74.15  ? 191 GLN E NE2 1 
ATOM   4819 N  N   . GLU F  1 5   ? 24.741  86.828  38.499  1.00 92.86  ? 64  GLU F N   1 
ATOM   4820 C  CA  . GLU F  1 5   ? 25.651  86.149  37.532  1.00 88.85  ? 64  GLU F CA  1 
ATOM   4821 C  C   . GLU F  1 5   ? 24.826  85.530  36.393  1.00 86.33  ? 64  GLU F C   1 
ATOM   4822 O  O   . GLU F  1 5   ? 24.215  84.461  36.558  1.00 84.93  ? 64  GLU F O   1 
ATOM   4823 C  CB  . GLU F  1 5   ? 26.495  85.080  38.244  1.00 86.34  ? 64  GLU F CB  1 
ATOM   4824 N  N   . ASP F  1 6   ? 24.795  86.213  35.246  1.00 86.02  ? 65  ASP F N   1 
ATOM   4825 C  CA  . ASP F  1 6   ? 23.957  85.780  34.113  1.00 83.91  ? 65  ASP F CA  1 
ATOM   4826 C  C   . ASP F  1 6   ? 24.602  84.621  33.328  1.00 78.54  ? 65  ASP F C   1 
ATOM   4827 O  O   . ASP F  1 6   ? 25.700  84.182  33.657  1.00 76.87  ? 65  ASP F O   1 
ATOM   4828 C  CB  . ASP F  1 6   ? 23.542  86.972  33.205  1.00 86.40  ? 65  ASP F CB  1 
ATOM   4829 C  CG  . ASP F  1 6   ? 24.726  87.714  32.598  1.00 86.82  ? 65  ASP F CG  1 
ATOM   4830 O  OD1 . ASP F  1 6   ? 25.746  87.065  32.248  1.00 85.06  ? 65  ASP F OD1 1 
ATOM   4831 O  OD2 . ASP F  1 6   ? 24.610  88.952  32.461  1.00 89.46  ? 65  ASP F OD2 1 
ATOM   4832 N  N   . LYS F  1 7   ? 23.900  84.142  32.301  1.00 75.94  ? 66  LYS F N   1 
ATOM   4833 C  CA  . LYS F  1 7   ? 24.228  82.892  31.625  1.00 71.27  ? 66  LYS F CA  1 
ATOM   4834 C  C   . LYS F  1 7   ? 24.985  83.092  30.312  1.00 68.60  ? 66  LYS F C   1 
ATOM   4835 O  O   . LYS F  1 7   ? 24.940  84.165  29.725  1.00 69.88  ? 66  LYS F O   1 
ATOM   4836 C  CB  . LYS F  1 7   ? 22.940  82.123  31.334  1.00 71.23  ? 66  LYS F CB  1 
ATOM   4837 C  CG  . LYS F  1 7   ? 22.051  81.895  32.540  1.00 73.90  ? 66  LYS F CG  1 
ATOM   4838 C  CD  . LYS F  1 7   ? 20.968  80.851  32.234  1.00 75.81  ? 66  LYS F CD  1 
ATOM   4839 C  CE  . LYS F  1 7   ? 19.981  80.699  33.395  1.00 79.95  ? 66  LYS F CE  1 
ATOM   4840 N  NZ  . LYS F  1 7   ? 19.041  79.557  33.192  1.00 80.87  ? 66  LYS F NZ  1 
ATOM   4841 N  N   . ILE F  1 8   ? 25.675  82.029  29.875  1.00 64.51  ? 67  ILE F N   1 
ATOM   4842 C  CA  . ILE F  1 8   ? 26.380  81.954  28.573  1.00 62.13  ? 67  ILE F CA  1 
ATOM   4843 C  C   . ILE F  1 8   ? 26.039  80.698  27.751  1.00 59.71  ? 67  ILE F C   1 
ATOM   4844 O  O   . ILE F  1 8   ? 25.544  79.706  28.277  1.00 59.08  ? 67  ILE F O   1 
ATOM   4845 C  CB  . ILE F  1 8   ? 27.918  82.044  28.761  1.00 60.93  ? 67  ILE F CB  1 
ATOM   4846 C  CG1 . ILE F  1 8   ? 28.479  80.823  29.481  1.00 58.89  ? 67  ILE F CG1 1 
ATOM   4847 C  CG2 . ILE F  1 8   ? 28.284  83.288  29.536  1.00 63.32  ? 67  ILE F CG2 1 
ATOM   4848 C  CD1 . ILE F  1 8   ? 29.879  80.443  28.974  1.00 56.90  ? 67  ILE F CD1 1 
ATOM   4849 N  N   . THR F  1 9   ? 26.333  80.760  26.458  1.00 58.70  ? 68  THR F N   1 
ATOM   4850 C  CA  . THR F  1 9   ? 26.048  79.682  25.531  1.00 57.29  ? 68  THR F CA  1 
ATOM   4851 C  C   . THR F  1 9   ? 27.278  78.802  25.309  1.00 55.06  ? 68  THR F C   1 
ATOM   4852 O  O   . THR F  1 9   ? 28.371  79.303  25.072  1.00 54.40  ? 68  THR F O   1 
ATOM   4853 C  CB  . THR F  1 9   ? 25.597  80.251  24.189  1.00 58.37  ? 68  THR F CB  1 
ATOM   4854 O  OG1 . THR F  1 9   ? 24.421  81.051  24.388  1.00 61.19  ? 68  THR F OG1 1 
ATOM   4855 C  CG2 . THR F  1 9   ? 25.316  79.136  23.187  1.00 57.25  ? 68  THR F CG2 1 
ATOM   4856 N  N   . VAL F  1 10  ? 27.076  77.488  25.404  1.00 53.94  ? 69  VAL F N   1 
ATOM   4857 C  CA  . VAL F  1 10  ? 28.100  76.504  25.125  1.00 51.90  ? 69  VAL F CA  1 
ATOM   4858 C  C   . VAL F  1 10  ? 27.566  75.498  24.122  1.00 51.76  ? 69  VAL F C   1 
ATOM   4859 O  O   . VAL F  1 10  ? 26.474  74.959  24.276  1.00 52.40  ? 69  VAL F O   1 
ATOM   4860 C  CB  . VAL F  1 10  ? 28.491  75.756  26.394  1.00 51.02  ? 69  VAL F CB  1 
ATOM   4861 C  CG1 . VAL F  1 10  ? 29.552  74.683  26.088  1.00 49.47  ? 69  VAL F CG1 1 
ATOM   4862 C  CG2 . VAL F  1 10  ? 28.967  76.728  27.448  1.00 51.40  ? 69  VAL F CG2 1 
ATOM   4863 N  N   . HIS F  1 11  ? 28.348  75.249  23.089  1.00 51.39  ? 70  HIS F N   1 
ATOM   4864 C  CA  . HIS F  1 11  ? 28.044  74.213  22.118  1.00 51.66  ? 70  HIS F CA  1 
ATOM   4865 C  C   . HIS F  1 11  ? 28.830  72.942  22.473  1.00 50.18  ? 70  HIS F C   1 
ATOM   4866 O  O   . HIS F  1 11  ? 30.029  73.017  22.755  1.00 49.26  ? 70  HIS F O   1 
ATOM   4867 C  CB  . HIS F  1 11  ? 28.437  74.699  20.718  1.00 52.43  ? 70  HIS F CB  1 
ATOM   4868 C  CG  . HIS F  1 11  ? 27.832  76.015  20.338  1.00 53.87  ? 70  HIS F CG  1 
ATOM   4869 N  ND1 . HIS F  1 11  ? 26.483  76.174  20.115  1.00 55.47  ? 70  HIS F ND1 1 
ATOM   4870 C  CD2 . HIS F  1 11  ? 28.393  77.226  20.122  1.00 54.34  ? 70  HIS F CD2 1 
ATOM   4871 C  CE1 . HIS F  1 11  ? 26.238  77.431  19.791  1.00 56.73  ? 70  HIS F CE1 1 
ATOM   4872 N  NE2 . HIS F  1 11  ? 27.379  78.093  19.794  1.00 56.26  ? 70  HIS F NE2 1 
ATOM   4873 N  N   . PHE F  1 12  ? 28.156  71.792  22.449  1.00 50.36  ? 71  PHE F N   1 
ATOM   4874 C  CA  . PHE F  1 12  ? 28.800  70.484  22.599  1.00 49.50  ? 71  PHE F CA  1 
ATOM   4875 C  C   . PHE F  1 12  ? 28.719  69.714  21.313  1.00 50.39  ? 71  PHE F C   1 
ATOM   4876 O  O   . PHE F  1 12  ? 27.642  69.611  20.737  1.00 52.04  ? 71  PHE F O   1 
ATOM   4877 C  CB  . PHE F  1 12  ? 28.060  69.655  23.625  1.00 49.75  ? 71  PHE F CB  1 
ATOM   4878 C  CG  . PHE F  1 12  ? 28.221  70.136  25.018  1.00 48.77  ? 71  PHE F CG  1 
ATOM   4879 C  CD1 . PHE F  1 12  ? 29.024  69.467  25.889  1.00 47.88  ? 71  PHE F CD1 1 
ATOM   4880 C  CD2 . PHE F  1 12  ? 27.536  71.235  25.467  1.00 49.73  ? 71  PHE F CD2 1 
ATOM   4881 C  CE1 . PHE F  1 12  ? 29.153  69.882  27.197  1.00 48.32  ? 71  PHE F CE1 1 
ATOM   4882 C  CE2 . PHE F  1 12  ? 27.668  71.662  26.764  1.00 50.01  ? 71  PHE F CE2 1 
ATOM   4883 C  CZ  . PHE F  1 12  ? 28.477  70.982  27.636  1.00 48.85  ? 71  PHE F CZ  1 
ATOM   4884 N  N   . ILE F  1 13  ? 29.831  69.142  20.877  1.00 49.78  ? 72  ILE F N   1 
ATOM   4885 C  CA  . ILE F  1 13  ? 29.798  68.169  19.806  1.00 51.25  ? 72  ILE F CA  1 
ATOM   4886 C  C   . ILE F  1 13  ? 29.794  66.807  20.467  1.00 51.42  ? 72  ILE F C   1 
ATOM   4887 O  O   . ILE F  1 13  ? 30.679  66.486  21.212  1.00 50.34  ? 72  ILE F O   1 
ATOM   4888 C  CB  . ILE F  1 13  ? 30.985  68.328  18.853  1.00 51.23  ? 72  ILE F CB  1 
ATOM   4889 C  CG1 . ILE F  1 13  ? 30.915  69.699  18.177  1.00 51.27  ? 72  ILE F CG1 1 
ATOM   4890 C  CG2 . ILE F  1 13  ? 31.006  67.201  17.814  1.00 52.00  ? 72  ILE F CG2 1 
ATOM   4891 C  CD1 . ILE F  1 13  ? 32.065  69.990  17.271  1.00 51.39  ? 72  ILE F CD1 1 
ATOM   4892 N  N   . ASN F  1 14  ? 28.766  66.026  20.204  1.00 53.37  ? 73  ASN F N   1 
ATOM   4893 C  CA  . ASN F  1 14  ? 28.588  64.713  20.811  1.00 54.07  ? 73  ASN F CA  1 
ATOM   4894 C  C   . ASN F  1 14  ? 29.439  63.662  20.136  1.00 54.52  ? 73  ASN F C   1 
ATOM   4895 O  O   . ASN F  1 14  ? 29.982  63.884  19.068  1.00 54.66  ? 73  ASN F O   1 
ATOM   4896 C  CB  . ASN F  1 14  ? 27.113  64.287  20.664  1.00 56.72  ? 73  ASN F CB  1 
ATOM   4897 C  CG  . ASN F  1 14  ? 26.600  63.551  21.868  1.00 58.15  ? 73  ASN F CG  1 
ATOM   4898 O  OD1 . ASN F  1 14  ? 27.385  62.962  22.666  1.00 57.37  ? 73  ASN F OD1 1 
ATOM   4899 N  ND2 . ASN F  1 14  ? 25.266  63.562  22.022  1.00 59.26  ? 73  ASN F ND2 1 
ATOM   4900 N  N   . ARG F  1 15  ? 29.518  62.492  20.748  1.00 55.11  ? 74  ARG F N   1 
ATOM   4901 C  CA  . ARG F  1 15  ? 30.225  61.367  20.148  1.00 56.67  ? 74  ARG F CA  1 
ATOM   4902 C  C   . ARG F  1 15  ? 29.608  61.020  18.806  1.00 59.68  ? 74  ARG F C   1 
ATOM   4903 O  O   . ARG F  1 15  ? 30.315  60.640  17.878  1.00 60.71  ? 74  ARG F O   1 
ATOM   4904 C  CB  . ARG F  1 15  ? 30.186  60.157  21.071  1.00 57.15  ? 74  ARG F CB  1 
ATOM   4905 C  CG  . ARG F  1 15  ? 31.085  60.304  22.276  1.00 54.74  ? 74  ARG F CG  1 
ATOM   4906 C  CD  . ARG F  1 15  ? 30.717  59.377  23.418  1.00 54.93  ? 74  ARG F CD  1 
ATOM   4907 N  NE  . ARG F  1 15  ? 31.410  59.795  24.640  1.00 53.21  ? 74  ARG F NE  1 
ATOM   4908 C  CZ  . ARG F  1 15  ? 30.933  59.652  25.881  1.00 53.36  ? 74  ARG F CZ  1 
ATOM   4909 N  NH1 . ARG F  1 15  ? 29.752  59.067  26.084  1.00 56.17  ? 74  ARG F NH1 1 
ATOM   4910 N  NH2 . ARG F  1 15  ? 31.627  60.087  26.935  1.00 50.83  ? 74  ARG F NH2 1 
ATOM   4911 N  N   . ASP F  1 16  ? 28.284  61.181  18.730  1.00 61.35  ? 75  ASP F N   1 
ATOM   4912 C  CA  . ASP F  1 16  ? 27.488  61.013  17.503  1.00 64.36  ? 75  ASP F CA  1 
ATOM   4913 C  C   . ASP F  1 16  ? 27.807  61.992  16.386  1.00 64.13  ? 75  ASP F C   1 
ATOM   4914 O  O   . ASP F  1 16  ? 27.454  61.761  15.248  1.00 66.59  ? 75  ASP F O   1 
ATOM   4915 C  CB  . ASP F  1 16  ? 26.009  61.212  17.819  1.00 65.78  ? 75  ASP F CB  1 
ATOM   4916 C  CG  . ASP F  1 16  ? 25.401  60.051  18.601  1.00 68.28  ? 75  ASP F CG  1 
ATOM   4917 O  OD1 . ASP F  1 16  ? 26.144  59.109  18.966  1.00 69.33  ? 75  ASP F OD1 1 
ATOM   4918 O  OD2 . ASP F  1 16  ? 24.167  60.077  18.844  1.00 69.73  ? 75  ASP F OD2 1 
ATOM   4919 N  N   . GLY F  1 17  ? 28.444  63.103  16.712  1.00 61.57  ? 76  GLY F N   1 
ATOM   4920 C  CA  . GLY F  1 17  ? 28.777  64.114  15.717  1.00 61.69  ? 76  GLY F CA  1 
ATOM   4921 C  C   . GLY F  1 17  ? 27.692  65.166  15.647  1.00 61.86  ? 76  GLY F C   1 
ATOM   4922 O  O   . GLY F  1 17  ? 27.716  66.042  14.791  1.00 62.55  ? 76  GLY F O   1 
ATOM   4923 N  N   . GLU F  1 18  ? 26.758  65.098  16.579  1.00 61.53  ? 77  GLU F N   1 
ATOM   4924 C  CA  . GLU F  1 18  ? 25.649  66.014  16.609  1.00 62.03  ? 77  GLU F CA  1 
ATOM   4925 C  C   . GLU F  1 18  ? 25.972  67.168  17.546  1.00 59.24  ? 77  GLU F C   1 
ATOM   4926 O  O   . GLU F  1 18  ? 26.583  66.966  18.595  1.00 57.41  ? 77  GLU F O   1 
ATOM   4927 C  CB  . GLU F  1 18  ? 24.407  65.275  17.082  1.00 64.14  ? 77  GLU F CB  1 
ATOM   4928 C  CG  . GLU F  1 18  ? 23.257  66.214  17.338  1.00 65.53  ? 77  GLU F CG  1 
ATOM   4929 C  CD  . GLU F  1 18  ? 21.914  65.579  17.343  1.00 68.39  ? 77  GLU F CD  1 
ATOM   4930 O  OE1 . GLU F  1 18  ? 21.780  64.447  16.829  1.00 73.18  ? 77  GLU F OE1 1 
ATOM   4931 O  OE2 . GLU F  1 18  ? 20.987  66.244  17.857  1.00 67.50  ? 77  GLU F OE2 1 
ATOM   4932 N  N   . THR F  1 19  ? 25.575  68.379  17.176  1.00 59.23  ? 78  THR F N   1 
ATOM   4933 C  CA  . THR F  1 19  ? 25.892  69.557  17.975  1.00 57.27  ? 78  THR F CA  1 
ATOM   4934 C  C   . THR F  1 19  ? 24.718  69.934  18.860  1.00 57.70  ? 78  THR F C   1 
ATOM   4935 O  O   . THR F  1 19  ? 23.612  70.119  18.366  1.00 59.84  ? 78  THR F O   1 
ATOM   4936 C  CB  . THR F  1 19  ? 26.266  70.736  17.095  1.00 57.47  ? 78  THR F CB  1 
ATOM   4937 O  OG1 . THR F  1 19  ? 27.261  70.316  16.160  1.00 57.13  ? 78  THR F OG1 1 
ATOM   4938 C  CG2 . THR F  1 19  ? 26.810  71.872  17.927  1.00 56.00  ? 78  THR F CG2 1 
ATOM   4939 N  N   . LEU F  1 20  ? 24.952  70.017  20.164  1.00 56.06  ? 79  LEU F N   1 
ATOM   4940 C  CA  . LEU F  1 20  ? 23.920  70.415  21.103  1.00 56.81  ? 79  LEU F CA  1 
ATOM   4941 C  C   . LEU F  1 20  ? 24.285  71.797  21.616  1.00 55.97  ? 79  LEU F C   1 
ATOM   4942 O  O   . LEU F  1 20  ? 25.390  72.009  22.094  1.00 54.40  ? 79  LEU F O   1 
ATOM   4943 C  CB  . LEU F  1 20  ? 23.830  69.450  22.279  1.00 56.32  ? 79  LEU F CB  1 
ATOM   4944 C  CG  . LEU F  1 20  ? 23.812  67.949  21.986  1.00 57.63  ? 79  LEU F CG  1 
ATOM   4945 C  CD1 . LEU F  1 20  ? 23.961  67.159  23.282  1.00 56.69  ? 79  LEU F CD1 1 
ATOM   4946 C  CD2 . LEU F  1 20  ? 22.542  67.536  21.249  1.00 60.77  ? 79  LEU F CD2 1 
ATOM   4947 N  N   . THR F  1 21  ? 23.361  72.744  21.510  1.00 57.45  ? 80  THR F N   1 
ATOM   4948 C  CA  . THR F  1 21  ? 23.587  74.089  22.003  1.00 56.94  ? 80  THR F CA  1 
ATOM   4949 C  C   . THR F  1 21  ? 22.784  74.252  23.273  1.00 57.27  ? 80  THR F C   1 
ATOM   4950 O  O   . THR F  1 21  ? 21.633  73.884  23.316  1.00 58.95  ? 80  THR F O   1 
ATOM   4951 C  CB  . THR F  1 21  ? 23.163  75.115  20.962  1.00 58.47  ? 80  THR F CB  1 
ATOM   4952 O  OG1 . THR F  1 21  ? 24.040  74.995  19.833  1.00 57.39  ? 80  THR F OG1 1 
ATOM   4953 C  CG2 . THR F  1 21  ? 23.200  76.545  21.544  1.00 59.08  ? 80  THR F CG2 1 
ATOM   4954 N  N   . THR F  1 22  ? 23.410  74.766  24.313  1.00 56.27  ? 81  THR F N   1 
ATOM   4955 C  CA  . THR F  1 22  ? 22.736  74.957  25.582  1.00 57.23  ? 81  THR F CA  1 
ATOM   4956 C  C   . THR F  1 22  ? 23.253  76.210  26.270  1.00 57.56  ? 81  THR F C   1 
ATOM   4957 O  O   . THR F  1 22  ? 24.150  76.885  25.765  1.00 57.31  ? 81  THR F O   1 
ATOM   4958 C  CB  . THR F  1 22  ? 22.903  73.737  26.514  1.00 56.39  ? 81  THR F CB  1 
ATOM   4959 O  OG1 . THR F  1 22  ? 21.984  73.859  27.607  1.00 57.55  ? 81  THR F OG1 1 
ATOM   4960 C  CG2 . THR F  1 22  ? 24.335  73.616  27.060  1.00 54.07  ? 81  THR F CG2 1 
ATOM   4961 N  N   . LYS F  1 23  ? 22.695  76.513  27.430  1.00 58.83  ? 82  LYS F N   1 
ATOM   4962 C  CA  . LYS F  1 23  ? 23.033  77.725  28.158  1.00 59.80  ? 82  LYS F CA  1 
ATOM   4963 C  C   . LYS F  1 23  ? 23.412  77.353  29.575  1.00 59.39  ? 82  LYS F C   1 
ATOM   4964 O  O   . LYS F  1 23  ? 22.682  76.611  30.229  1.00 59.92  ? 82  LYS F O   1 
ATOM   4965 C  CB  . LYS F  1 23  ? 21.827  78.667  28.177  1.00 62.62  ? 82  LYS F CB  1 
ATOM   4966 C  CG  . LYS F  1 23  ? 21.662  79.461  26.875  1.00 63.66  ? 82  LYS F CG  1 
ATOM   4967 C  CD  . LYS F  1 23  ? 20.825  80.722  27.033  1.00 66.55  ? 82  LYS F CD  1 
ATOM   4968 C  CE  . LYS F  1 23  ? 21.715  81.973  26.963  1.00 67.65  ? 82  LYS F CE  1 
ATOM   4969 N  NZ  . LYS F  1 23  ? 20.964  83.247  27.228  1.00 72.13  ? 82  LYS F NZ  1 
ATOM   4970 N  N   . GLY F  1 24  ? 24.540  77.868  30.053  1.00 58.63  ? 83  GLY F N   1 
ATOM   4971 C  CA  . GLY F  1 24  ? 24.998  77.583  31.415  1.00 58.46  ? 83  GLY F CA  1 
ATOM   4972 C  C   . GLY F  1 24  ? 25.255  78.844  32.216  1.00 60.34  ? 83  GLY F C   1 
ATOM   4973 O  O   . GLY F  1 24  ? 25.523  79.906  31.647  1.00 60.72  ? 83  GLY F O   1 
ATOM   4974 N  N   . LYS F  1 25  ? 25.165  78.725  33.541  1.00 61.48  ? 84  LYS F N   1 
ATOM   4975 C  CA  . LYS F  1 25  ? 25.441  79.851  34.427  1.00 64.18  ? 84  LYS F CA  1 
ATOM   4976 C  C   . LYS F  1 25  ? 26.940  80.013  34.559  1.00 62.81  ? 84  LYS F C   1 
ATOM   4977 O  O   . LYS F  1 25  ? 27.663  79.033  34.646  1.00 60.65  ? 84  LYS F O   1 
ATOM   4978 C  CB  . LYS F  1 25  ? 24.832  79.638  35.822  1.00 66.35  ? 84  LYS F CB  1 
ATOM   4979 C  CG  . LYS F  1 25  ? 23.297  79.597  35.864  1.00 69.79  ? 84  LYS F CG  1 
ATOM   4980 C  CD  . LYS F  1 25  ? 22.772  78.589  36.945  1.00 73.35  ? 84  LYS F CD  1 
ATOM   4981 C  CE  . LYS F  1 25  ? 21.557  77.743  36.457  1.00 74.97  ? 84  LYS F CE  1 
ATOM   4982 N  NZ  . LYS F  1 25  ? 21.673  76.275  36.811  1.00 73.87  ? 84  LYS F NZ  1 
ATOM   4983 N  N   . VAL F  1 26  ? 27.403  81.254  34.575  1.00 64.48  ? 85  VAL F N   1 
ATOM   4984 C  CA  . VAL F  1 26  ? 28.793  81.522  34.878  1.00 64.26  ? 85  VAL F CA  1 
ATOM   4985 C  C   . VAL F  1 26  ? 29.066  80.940  36.276  1.00 64.59  ? 85  VAL F C   1 
ATOM   4986 O  O   . VAL F  1 26  ? 28.222  81.033  37.172  1.00 66.39  ? 85  VAL F O   1 
ATOM   4987 C  CB  . VAL F  1 26  ? 29.081  83.035  34.813  1.00 67.17  ? 85  VAL F CB  1 
ATOM   4988 C  CG1 . VAL F  1 26  ? 30.516  83.343  35.205  1.00 67.30  ? 85  VAL F CG1 1 
ATOM   4989 C  CG2 . VAL F  1 26  ? 28.790  83.560  33.418  1.00 67.15  ? 85  VAL F CG2 1 
ATOM   4990 N  N   . GLY F  1 27  ? 30.210  80.290  36.446  1.00 62.76  ? 86  GLY F N   1 
ATOM   4991 C  CA  . GLY F  1 27  ? 30.553  79.672  37.730  1.00 63.18  ? 86  GLY F CA  1 
ATOM   4992 C  C   . GLY F  1 27  ? 30.219  78.189  37.828  1.00 61.07  ? 86  GLY F C   1 
ATOM   4993 O  O   . GLY F  1 27  ? 30.763  77.499  38.694  1.00 60.79  ? 86  GLY F O   1 
ATOM   4994 N  N   . ASP F  1 28  ? 29.339  77.693  36.951  1.00 59.72  ? 87  ASP F N   1 
ATOM   4995 C  CA  . ASP F  1 28  ? 28.988  76.261  36.913  1.00 57.89  ? 87  ASP F CA  1 
ATOM   4996 C  C   . ASP F  1 28  ? 30.089  75.446  36.210  1.00 55.25  ? 87  ASP F C   1 
ATOM   4997 O  O   . ASP F  1 28  ? 30.762  75.942  35.304  1.00 54.46  ? 87  ASP F O   1 
ATOM   4998 C  CB  . ASP F  1 28  ? 27.649  76.044  36.173  1.00 58.13  ? 87  ASP F CB  1 
ATOM   4999 C  CG  . ASP F  1 28  ? 26.399  76.229  37.076  1.00 60.95  ? 87  ASP F CG  1 
ATOM   5000 O  OD1 . ASP F  1 28  ? 26.512  76.464  38.304  1.00 62.64  ? 87  ASP F OD1 1 
ATOM   5001 O  OD2 . ASP F  1 28  ? 25.277  76.113  36.528  1.00 61.74  ? 87  ASP F OD2 1 
ATOM   5002 N  N   . SER F  1 29  ? 30.269  74.195  36.623  1.00 53.86  ? 88  SER F N   1 
ATOM   5003 C  CA  . SER F  1 29  ? 31.201  73.309  35.936  1.00 51.76  ? 88  SER F CA  1 
ATOM   5004 C  C   . SER F  1 29  ? 30.529  72.790  34.684  1.00 50.61  ? 88  SER F C   1 
ATOM   5005 O  O   . SER F  1 29  ? 29.308  72.712  34.619  1.00 51.42  ? 88  SER F O   1 
ATOM   5006 C  CB  . SER F  1 29  ? 31.631  72.130  36.822  1.00 51.19  ? 88  SER F CB  1 
ATOM   5007 O  OG  . SER F  1 29  ? 30.690  71.077  36.814  1.00 51.22  ? 88  SER F OG  1 
ATOM   5008 N  N   . LEU F  1 30  ? 31.321  72.405  33.698  1.00 48.93  ? 89  LEU F N   1 
ATOM   5009 C  CA  . LEU F  1 30  ? 30.750  71.833  32.487  1.00 48.24  ? 89  LEU F CA  1 
ATOM   5010 C  C   . LEU F  1 30  ? 29.955  70.564  32.771  1.00 48.17  ? 89  LEU F C   1 
ATOM   5011 O  O   . LEU F  1 30  ? 28.982  70.300  32.091  1.00 48.66  ? 89  LEU F O   1 
ATOM   5012 C  CB  . LEU F  1 30  ? 31.816  71.624  31.415  1.00 46.69  ? 89  LEU F CB  1 
ATOM   5013 C  CG  . LEU F  1 30  ? 32.084  72.957  30.710  1.00 47.22  ? 89  LEU F CG  1 
ATOM   5014 C  CD1 . LEU F  1 30  ? 33.517  73.132  30.361  1.00 46.67  ? 89  LEU F CD1 1 
ATOM   5015 C  CD2 . LEU F  1 30  ? 31.198  73.087  29.486  1.00 47.22  ? 89  LEU F CD2 1 
ATOM   5016 N  N   . LEU F  1 31  ? 30.328  69.815  33.800  1.00 48.16  ? 90  LEU F N   1 
ATOM   5017 C  CA  . LEU F  1 31  ? 29.531  68.678  34.219  1.00 48.64  ? 90  LEU F CA  1 
ATOM   5018 C  C   . LEU F  1 31  ? 28.161  69.152  34.674  1.00 50.52  ? 90  LEU F C   1 
ATOM   5019 O  O   . LEU F  1 31  ? 27.140  68.583  34.269  1.00 51.43  ? 90  LEU F O   1 
ATOM   5020 C  CB  . LEU F  1 31  ? 30.201  67.902  35.349  1.00 48.45  ? 90  LEU F CB  1 
ATOM   5021 C  CG  . LEU F  1 31  ? 29.388  66.739  35.931  1.00 49.04  ? 90  LEU F CG  1 
ATOM   5022 C  CD1 . LEU F  1 31  ? 29.016  65.717  34.857  1.00 48.51  ? 90  LEU F CD1 1 
ATOM   5023 C  CD2 . LEU F  1 31  ? 30.109  66.079  37.079  1.00 48.45  ? 90  LEU F CD2 1 
ATOM   5024 N  N   . ASP F  1 32  ? 28.134  70.185  35.516  1.00 51.52  ? 91  ASP F N   1 
ATOM   5025 C  CA  . ASP F  1 32  ? 26.872  70.760  35.974  1.00 53.49  ? 91  ASP F CA  1 
ATOM   5026 C  C   . ASP F  1 32  ? 25.998  71.103  34.784  1.00 53.65  ? 91  ASP F C   1 
ATOM   5027 O  O   . ASP F  1 32  ? 24.804  70.871  34.823  1.00 55.23  ? 91  ASP F O   1 
ATOM   5028 C  CB  . ASP F  1 32  ? 27.099  72.028  36.815  1.00 54.95  ? 91  ASP F CB  1 
ATOM   5029 C  CG  . ASP F  1 32  ? 27.775  71.739  38.161  1.00 55.84  ? 91  ASP F CG  1 
ATOM   5030 O  OD1 . ASP F  1 32  ? 27.595  70.626  38.685  1.00 56.54  ? 91  ASP F OD1 1 
ATOM   5031 O  OD2 . ASP F  1 32  ? 28.496  72.610  38.709  1.00 56.69  ? 91  ASP F OD2 1 
ATOM   5032 N  N   . VAL F  1 33  ? 26.597  71.650  33.729  1.00 52.55  ? 92  VAL F N   1 
ATOM   5033 C  CA  . VAL F  1 33  ? 25.854  72.043  32.538  1.00 53.09  ? 92  VAL F CA  1 
ATOM   5034 C  C   . VAL F  1 33  ? 25.218  70.841  31.851  1.00 53.04  ? 92  VAL F C   1 
ATOM   5035 O  O   . VAL F  1 33  ? 24.041  70.870  31.508  1.00 54.82  ? 92  VAL F O   1 
ATOM   5036 C  CB  . VAL F  1 33  ? 26.740  72.784  31.544  1.00 51.92  ? 92  VAL F CB  1 
ATOM   5037 C  CG1 . VAL F  1 33  ? 25.987  73.022  30.241  1.00 52.20  ? 92  VAL F CG1 1 
ATOM   5038 C  CG2 . VAL F  1 33  ? 27.175  74.082  32.142  1.00 52.70  ? 92  VAL F CG2 1 
ATOM   5039 N  N   . VAL F  1 34  ? 25.996  69.790  31.670  1.00 51.52  ? 93  VAL F N   1 
ATOM   5040 C  CA  . VAL F  1 34  ? 25.487  68.581  31.069  1.00 51.93  ? 93  VAL F CA  1 
ATOM   5041 C  C   . VAL F  1 34  ? 24.311  68.003  31.872  1.00 53.61  ? 93  VAL F C   1 
ATOM   5042 O  O   . VAL F  1 34  ? 23.314  67.595  31.299  1.00 54.75  ? 93  VAL F O   1 
ATOM   5043 C  CB  . VAL F  1 34  ? 26.621  67.528  30.939  1.00 50.62  ? 93  VAL F CB  1 
ATOM   5044 C  CG1 . VAL F  1 34  ? 26.070  66.204  30.378  1.00 51.22  ? 93  VAL F CG1 1 
ATOM   5045 C  CG2 . VAL F  1 34  ? 27.735  68.050  30.063  1.00 48.54  ? 93  VAL F CG2 1 
ATOM   5046 N  N   . VAL F  1 35  ? 24.444  67.974  33.196  1.00 53.98  ? 94  VAL F N   1 
ATOM   5047 C  CA  . VAL F  1 35  ? 23.457  67.345  34.068  1.00 55.93  ? 94  VAL F CA  1 
ATOM   5048 C  C   . VAL F  1 35  ? 22.223  68.212  34.269  1.00 58.35  ? 94  VAL F C   1 
ATOM   5049 O  O   . VAL F  1 35  ? 21.085  67.746  34.117  1.00 60.53  ? 94  VAL F O   1 
ATOM   5050 C  CB  . VAL F  1 35  ? 24.047  67.025  35.465  1.00 55.87  ? 94  VAL F CB  1 
ATOM   5051 C  CG1 . VAL F  1 35  ? 22.933  66.609  36.431  1.00 58.11  ? 94  VAL F CG1 1 
ATOM   5052 C  CG2 . VAL F  1 35  ? 25.102  65.934  35.380  1.00 54.16  ? 94  VAL F CG2 1 
ATOM   5053 N  N   . GLU F  1 36  ? 22.439  69.476  34.617  1.00 58.55  ? 95  GLU F N   1 
ATOM   5054 C  CA  . GLU F  1 36  ? 21.329  70.383  34.895  1.00 61.16  ? 95  GLU F CA  1 
ATOM   5055 C  C   . GLU F  1 36  ? 20.463  70.650  33.662  1.00 61.72  ? 95  GLU F C   1 
ATOM   5056 O  O   . GLU F  1 36  ? 19.300  71.010  33.801  1.00 64.00  ? 95  GLU F O   1 
ATOM   5057 C  CB  . GLU F  1 36  ? 21.813  71.692  35.557  1.00 61.75  ? 95  GLU F CB  1 
ATOM   5058 C  CG  . GLU F  1 36  ? 22.089  71.492  37.078  1.00 65.12  ? 95  GLU F CG  1 
ATOM   5059 C  CD  . GLU F  1 36  ? 22.672  72.726  37.797  1.00 69.98  ? 95  GLU F CD  1 
ATOM   5060 O  OE1 . GLU F  1 36  ? 22.144  73.858  37.624  1.00 73.05  ? 95  GLU F OE1 1 
ATOM   5061 O  OE2 . GLU F  1 36  ? 23.658  72.552  38.565  1.00 72.29  ? 95  GLU F OE2 1 
ATOM   5062 N  N   . ASN F  1 37  ? 21.017  70.445  32.469  1.00 60.01  ? 96  ASN F N   1 
ATOM   5063 C  CA  . ASN F  1 37  ? 20.254  70.575  31.228  1.00 61.03  ? 96  ASN F CA  1 
ATOM   5064 C  C   . ASN F  1 37  ? 19.888  69.243  30.556  1.00 61.43  ? 96  ASN F C   1 
ATOM   5065 O  O   . ASN F  1 37  ? 19.319  69.237  29.462  1.00 62.57  ? 96  ASN F O   1 
ATOM   5066 C  CB  . ASN F  1 37  ? 20.997  71.494  30.243  1.00 59.73  ? 96  ASN F CB  1 
ATOM   5067 C  CG  . ASN F  1 37  ? 21.079  72.942  30.730  1.00 60.02  ? 96  ASN F CG  1 
ATOM   5068 O  OD1 . ASN F  1 37  ? 22.040  73.634  30.437  1.00 59.05  ? 96  ASN F OD1 1 
ATOM   5069 N  ND2 . ASN F  1 37  ? 20.070  73.398  31.459  1.00 62.11  ? 96  ASN F ND2 1 
ATOM   5070 N  N   . ASN F  1 38  ? 20.182  68.129  31.218  1.00 61.07  ? 97  ASN F N   1 
ATOM   5071 C  CA  . ASN F  1 38  ? 19.732  66.817  30.754  1.00 62.39  ? 97  ASN F CA  1 
ATOM   5072 C  C   . ASN F  1 38  ? 20.027  66.614  29.266  1.00 61.74  ? 97  ASN F C   1 
ATOM   5073 O  O   . ASN F  1 38  ? 19.107  66.307  28.485  1.00 63.55  ? 97  ASN F O   1 
ATOM   5074 C  CB  . ASN F  1 38  ? 18.228  66.628  31.030  1.00 65.48  ? 97  ASN F CB  1 
ATOM   5075 N  N   . LEU F  1 39  ? 21.309  66.790  28.908  1.00 59.22  ? 98  LEU F N   1 
ATOM   5076 C  CA  . LEU F  1 39  ? 21.823  66.577  27.544  1.00 58.71  ? 98  LEU F CA  1 
ATOM   5077 C  C   . LEU F  1 39  ? 22.034  65.095  27.222  1.00 59.46  ? 98  LEU F C   1 
ATOM   5078 O  O   . LEU F  1 39  ? 22.308  64.284  28.110  1.00 59.31  ? 98  LEU F O   1 
ATOM   5079 C  CB  . LEU F  1 39  ? 23.162  67.286  27.349  1.00 56.02  ? 98  LEU F CB  1 
ATOM   5080 C  CG  . LEU F  1 39  ? 23.168  68.798  27.540  1.00 55.91  ? 98  LEU F CG  1 
ATOM   5081 C  CD1 . LEU F  1 39  ? 24.574  69.369  27.425  1.00 53.76  ? 98  LEU F CD1 1 
ATOM   5082 C  CD2 . LEU F  1 39  ? 22.237  69.463  26.538  1.00 57.86  ? 98  LEU F CD2 1 
ATOM   5083 N  N   . ASP F  1 40  ? 21.950  64.767  25.934  1.00 60.66  ? 99  ASP F N   1 
ATOM   5084 C  CA  . ASP F  1 40  ? 21.970  63.379  25.463  1.00 62.30  ? 99  ASP F CA  1 
ATOM   5085 C  C   . ASP F  1 40  ? 23.405  62.822  25.365  1.00 60.72  ? 99  ASP F C   1 
ATOM   5086 O  O   . ASP F  1 40  ? 23.814  62.389  24.279  1.00 62.11  ? 99  ASP F O   1 
ATOM   5087 C  CB  . ASP F  1 40  ? 21.256  63.296  24.086  1.00 64.73  ? 99  ASP F CB  1 
ATOM   5088 C  CG  . ASP F  1 40  ? 20.965  61.848  23.625  1.00 68.04  ? 99  ASP F CG  1 
ATOM   5089 O  OD1 . ASP F  1 40  ? 21.206  60.887  24.402  1.00 68.61  ? 99  ASP F OD1 1 
ATOM   5090 O  OD2 . ASP F  1 40  ? 20.489  61.677  22.473  1.00 70.54  ? 99  ASP F OD2 1 
ATOM   5091 N  N   . ILE F  1 41  ? 24.140  62.791  26.489  1.00 58.50  ? 100 ILE F N   1 
ATOM   5092 C  CA  . ILE F  1 41  ? 25.487  62.224  26.527  1.00 56.82  ? 100 ILE F CA  1 
ATOM   5093 C  C   . ILE F  1 41  ? 25.556  61.051  27.498  1.00 57.48  ? 100 ILE F C   1 
ATOM   5094 O  O   . ILE F  1 41  ? 25.501  61.242  28.711  1.00 57.41  ? 100 ILE F O   1 
ATOM   5095 C  CB  . ILE F  1 41  ? 26.532  63.267  26.968  1.00 54.18  ? 100 ILE F CB  1 
ATOM   5096 C  CG1 . ILE F  1 41  ? 26.387  64.540  26.139  1.00 53.71  ? 100 ILE F CG1 1 
ATOM   5097 C  CG2 . ILE F  1 41  ? 27.934  62.692  26.803  1.00 53.44  ? 100 ILE F CG2 1 
ATOM   5098 C  CD1 . ILE F  1 41  ? 27.039  65.746  26.739  1.00 51.11  ? 100 ILE F CD1 1 
ATOM   5099 N  N   . ASP F  1 42  ? 25.721  59.847  26.971  1.00 58.74  ? 101 ASP F N   1 
ATOM   5100 C  CA  . ASP F  1 42  ? 25.676  58.654  27.794  1.00 59.82  ? 101 ASP F CA  1 
ATOM   5101 C  C   . ASP F  1 42  ? 26.985  58.541  28.547  1.00 57.54  ? 101 ASP F C   1 
ATOM   5102 O  O   . ASP F  1 42  ? 28.007  58.888  28.007  1.00 56.37  ? 101 ASP F O   1 
ATOM   5103 C  CB  . ASP F  1 42  ? 25.430  57.421  26.908  1.00 62.78  ? 101 ASP F CB  1 
ATOM   5104 C  CG  . ASP F  1 42  ? 24.196  57.590  25.989  1.00 66.54  ? 101 ASP F CG  1 
ATOM   5105 O  OD1 . ASP F  1 42  ? 23.411  58.567  26.196  1.00 66.63  ? 101 ASP F OD1 1 
ATOM   5106 O  OD2 . ASP F  1 42  ? 24.015  56.751  25.059  1.00 68.94  ? 101 ASP F OD2 1 
ATOM   5107 N  N   . GLY F  1 43  ? 26.937  58.119  29.809  1.00 57.44  ? 102 GLY F N   1 
ATOM   5108 C  CA  . GLY F  1 43  ? 28.130  57.747  30.567  1.00 56.07  ? 102 GLY F CA  1 
ATOM   5109 C  C   . GLY F  1 43  ? 28.941  58.894  31.144  1.00 53.70  ? 102 GLY F C   1 
ATOM   5110 O  O   . GLY F  1 43  ? 29.885  58.655  31.904  1.00 53.60  ? 102 GLY F O   1 
ATOM   5111 N  N   . PHE F  1 44  ? 28.573  60.123  30.809  1.00 52.40  ? 103 PHE F N   1 
ATOM   5112 C  CA  . PHE F  1 44  ? 29.364  61.305  31.167  1.00 50.49  ? 103 PHE F CA  1 
ATOM   5113 C  C   . PHE F  1 44  ? 29.230  61.672  32.648  1.00 49.90  ? 103 PHE F C   1 
ATOM   5114 O  O   . PHE F  1 44  ? 28.139  61.907  33.108  1.00 51.25  ? 103 PHE F O   1 
ATOM   5115 C  CB  . PHE F  1 44  ? 28.908  62.488  30.288  1.00 50.17  ? 103 PHE F CB  1 
ATOM   5116 C  CG  . PHE F  1 44  ? 29.827  63.674  30.308  1.00 47.99  ? 103 PHE F CG  1 
ATOM   5117 C  CD1 . PHE F  1 44  ? 30.857  63.784  29.407  1.00 46.35  ? 103 PHE F CD1 1 
ATOM   5118 C  CD2 . PHE F  1 44  ? 29.626  64.693  31.208  1.00 47.79  ? 103 PHE F CD2 1 
ATOM   5119 C  CE1 . PHE F  1 44  ? 31.689  64.854  29.430  1.00 45.55  ? 103 PHE F CE1 1 
ATOM   5120 C  CE2 . PHE F  1 44  ? 30.451  65.768  31.237  1.00 46.63  ? 103 PHE F CE2 1 
ATOM   5121 C  CZ  . PHE F  1 44  ? 31.491  65.853  30.343  1.00 45.66  ? 103 PHE F CZ  1 
ATOM   5122 N  N   . GLY F  1 45  ? 30.333  61.708  33.386  1.00 48.56  ? 104 GLY F N   1 
ATOM   5123 C  CA  . GLY F  1 45  ? 30.307  62.112  34.783  1.00 48.50  ? 104 GLY F CA  1 
ATOM   5124 C  C   . GLY F  1 45  ? 29.887  61.027  35.760  1.00 49.64  ? 104 GLY F C   1 
ATOM   5125 O  O   . GLY F  1 45  ? 29.083  61.268  36.647  1.00 50.35  ? 104 GLY F O   1 
ATOM   5126 N  N   . ALA F  1 46  ? 30.440  59.833  35.610  1.00 49.91  ? 105 ALA F N   1 
ATOM   5127 C  CA  . ALA F  1 46  ? 30.133  58.731  36.501  1.00 51.24  ? 105 ALA F CA  1 
ATOM   5128 C  C   . ALA F  1 46  ? 30.430  59.024  37.977  1.00 51.49  ? 105 ALA F C   1 
ATOM   5129 O  O   . ALA F  1 46  ? 29.624  58.678  38.824  1.00 52.80  ? 105 ALA F O   1 
ATOM   5130 C  CB  . ALA F  1 46  ? 30.851  57.492  36.063  1.00 51.40  ? 105 ALA F CB  1 
ATOM   5131 N  N   . CYS F  1 47  ? 31.561  59.668  38.290  1.00 50.46  ? 106 CYS F N   1 
ATOM   5132 C  CA  . CYS F  1 47  ? 31.948  59.918  39.694  1.00 50.92  ? 106 CYS F CA  1 
ATOM   5133 C  C   . CYS F  1 47  ? 31.254  61.129  40.284  1.00 51.44  ? 106 CYS F C   1 
ATOM   5134 O  O   . CYS F  1 47  ? 31.479  61.489  41.445  1.00 52.17  ? 106 CYS F O   1 
ATOM   5135 C  CB  . CYS F  1 47  ? 33.468  60.014  39.851  1.00 49.72  ? 106 CYS F CB  1 
ATOM   5136 S  SG  . CYS F  1 47  ? 34.229  61.530  39.411  1.00 49.70  ? 106 CYS F SG  1 
ATOM   5137 N  N   . GLU F  1 48  ? 30.395  61.749  39.493  1.00 51.23  ? 107 GLU F N   1 
ATOM   5138 C  CA  . GLU F  1 48  ? 29.665  62.931  39.915  1.00 52.10  ? 107 GLU F CA  1 
ATOM   5139 C  C   . GLU F  1 48  ? 30.584  64.061  40.345  1.00 51.33  ? 107 GLU F C   1 
ATOM   5140 O  O   . GLU F  1 48  ? 30.293  64.796  41.269  1.00 52.54  ? 107 GLU F O   1 
ATOM   5141 C  CB  . GLU F  1 48  ? 28.637  62.587  41.003  1.00 54.37  ? 107 GLU F CB  1 
ATOM   5142 C  CG  . GLU F  1 48  ? 27.534  61.657  40.515  1.00 55.71  ? 107 GLU F CG  1 
ATOM   5143 C  CD  . GLU F  1 48  ? 26.452  61.398  41.568  1.00 59.25  ? 107 GLU F CD  1 
ATOM   5144 O  OE1 . GLU F  1 48  ? 26.750  60.763  42.611  1.00 60.34  ? 107 GLU F OE1 1 
ATOM   5145 O  OE2 . GLU F  1 48  ? 25.289  61.811  41.353  1.00 61.04  ? 107 GLU F OE2 1 
ATOM   5146 N  N   . GLY F  1 49  ? 31.693  64.202  39.643  1.00 49.94  ? 108 GLY F N   1 
ATOM   5147 C  CA  . GLY F  1 49  ? 32.568  65.346  39.811  1.00 49.84  ? 108 GLY F CA  1 
ATOM   5148 C  C   . GLY F  1 49  ? 33.456  65.294  41.033  1.00 50.49  ? 108 GLY F C   1 
ATOM   5149 O  O   . GLY F  1 49  ? 33.835  66.341  41.542  1.00 50.85  ? 108 GLY F O   1 
ATOM   5150 N  N   . THR F  1 50  ? 33.806  64.093  41.491  1.00 50.43  ? 109 THR F N   1 
ATOM   5151 C  CA  . THR F  1 50  ? 34.703  63.943  42.645  1.00 51.38  ? 109 THR F CA  1 
ATOM   5152 C  C   . THR F  1 50  ? 36.113  63.538  42.266  1.00 50.23  ? 109 THR F C   1 
ATOM   5153 O  O   . THR F  1 50  ? 36.842  63.001  43.096  1.00 50.93  ? 109 THR F O   1 
ATOM   5154 C  CB  . THR F  1 50  ? 34.129  62.932  43.672  1.00 52.68  ? 109 THR F CB  1 
ATOM   5155 O  OG1 . THR F  1 50  ? 34.005  61.641  43.072  1.00 52.37  ? 109 THR F OG1 1 
ATOM   5156 C  CG2 . THR F  1 50  ? 32.759  63.389  44.165  1.00 53.76  ? 109 THR F CG2 1 
ATOM   5157 N  N   . LEU F  1 51  ? 36.492  63.808  41.015  1.00 49.09  ? 110 LEU F N   1 
ATOM   5158 C  CA  . LEU F  1 51  ? 37.837  63.491  40.494  1.00 48.33  ? 110 LEU F CA  1 
ATOM   5159 C  C   . LEU F  1 51  ? 38.219  62.040  40.727  1.00 48.35  ? 110 LEU F C   1 
ATOM   5160 O  O   . LEU F  1 51  ? 39.311  61.739  41.195  1.00 48.98  ? 110 LEU F O   1 
ATOM   5161 C  CB  . LEU F  1 51  ? 38.908  64.430  41.075  1.00 48.68  ? 110 LEU F CB  1 
ATOM   5162 C  CG  . LEU F  1 51  ? 39.106  65.722  40.322  1.00 48.50  ? 110 LEU F CG  1 
ATOM   5163 C  CD1 . LEU F  1 51  ? 40.132  66.570  41.027  1.00 49.80  ? 110 LEU F CD1 1 
ATOM   5164 C  CD2 . LEU F  1 51  ? 39.526  65.435  38.871  1.00 47.15  ? 110 LEU F CD2 1 
ATOM   5165 N  N   . ALA F  1 52  ? 37.319  61.137  40.377  1.00 48.44  ? 111 ALA F N   1 
ATOM   5166 C  CA  . ALA F  1 52  ? 37.570  59.715  40.547  1.00 48.95  ? 111 ALA F CA  1 
ATOM   5167 C  C   . ALA F  1 52  ? 37.273  58.890  39.292  1.00 48.76  ? 111 ALA F C   1 
ATOM   5168 O  O   . ALA F  1 52  ? 37.436  57.687  39.300  1.00 50.20  ? 111 ALA F O   1 
ATOM   5169 C  CB  . ALA F  1 52  ? 36.776  59.211  41.727  1.00 50.00  ? 111 ALA F CB  1 
ATOM   5170 N  N   . CYS F  1 53  ? 36.828  59.515  38.213  1.00 48.12  ? 112 CYS F N   1 
ATOM   5171 C  CA  . CYS F  1 53  ? 36.686  58.817  36.928  1.00 48.13  ? 112 CYS F CA  1 
ATOM   5172 C  C   . CYS F  1 53  ? 37.359  59.646  35.837  1.00 46.99  ? 112 CYS F C   1 
ATOM   5173 O  O   . CYS F  1 53  ? 37.939  60.696  36.111  1.00 46.63  ? 112 CYS F O   1 
ATOM   5174 C  CB  . CYS F  1 53  ? 35.216  58.621  36.594  1.00 48.61  ? 112 CYS F CB  1 
ATOM   5175 S  SG  . CYS F  1 53  ? 34.317  60.112  36.295  1.00 49.29  ? 112 CYS F SG  1 
ATOM   5176 N  N   . SER F  1 54  ? 37.289  59.203  34.600  1.00 46.83  ? 113 SER F N   1 
ATOM   5177 C  CA  . SER F  1 54  ? 37.788  60.036  33.522  1.00 46.11  ? 113 SER F CA  1 
ATOM   5178 C  C   . SER F  1 54  ? 36.705  60.296  32.516  1.00 46.10  ? 113 SER F C   1 
ATOM   5179 O  O   . SER F  1 54  ? 36.999  60.611  31.381  1.00 45.65  ? 113 SER F O   1 
ATOM   5180 C  CB  . SER F  1 54  ? 38.933  59.329  32.837  1.00 46.58  ? 113 SER F CB  1 
ATOM   5181 O  OG  . SER F  1 54  ? 39.838  58.858  33.803  1.00 48.06  ? 113 SER F OG  1 
ATOM   5182 N  N   . THR F  1 55  ? 35.451  60.160  32.941  1.00 32.20  ? 114 THR F N   1 
ATOM   5183 C  CA  . THR F  1 55  ? 34.331  60.130  32.015  1.00 32.07  ? 114 THR F CA  1 
ATOM   5184 C  C   . THR F  1 55  ? 33.826  61.523  31.635  1.00 32.67  ? 114 THR F C   1 
ATOM   5185 O  O   . THR F  1 55  ? 33.104  61.641  30.664  1.00 32.54  ? 114 THR F O   1 
ATOM   5186 C  CB  . THR F  1 55  ? 33.188  59.271  32.563  1.00 33.05  ? 114 THR F CB  1 
ATOM   5187 O  OG1 . THR F  1 55  ? 32.643  59.861  33.739  1.00 34.70  ? 114 THR F OG1 1 
ATOM   5188 C  CG2 . THR F  1 55  ? 33.689  57.912  32.907  1.00 31.66  ? 114 THR F CG2 1 
ATOM   5189 N  N   . CYS F  1 56  ? 34.206  62.552  32.403  1.00 33.35  ? 115 CYS F N   1 
ATOM   5190 C  CA  . CYS F  1 56  ? 33.897  63.951  32.079  1.00 34.09  ? 115 CYS F CA  1 
ATOM   5191 C  C   . CYS F  1 56  ? 34.903  64.565  31.110  1.00 32.63  ? 115 CYS F C   1 
ATOM   5192 O  O   . CYS F  1 56  ? 34.901  65.752  30.886  1.00 32.81  ? 115 CYS F O   1 
ATOM   5193 C  CB  . CYS F  1 56  ? 33.798  64.811  33.354  1.00 35.81  ? 115 CYS F CB  1 
ATOM   5194 S  SG  . CYS F  1 56  ? 35.267  64.887  34.323  1.00 36.19  ? 115 CYS F SG  1 
ATOM   5195 N  N   . HIS F  1 57  ? 35.748  63.736  30.520  1.00 31.61  ? 116 HIS F N   1 
ATOM   5196 C  CA  . HIS F  1 57  ? 36.738  64.175  29.532  1.00 30.60  ? 116 HIS F CA  1 
ATOM   5197 C  C   . HIS F  1 57  ? 36.102  65.011  28.442  1.00 30.96  ? 116 HIS F C   1 
ATOM   5198 O  O   . HIS F  1 57  ? 35.112  64.596  27.860  1.00 31.16  ? 116 HIS F O   1 
ATOM   5199 C  CB  . HIS F  1 57  ? 37.403  62.945  28.935  1.00 29.41  ? 116 HIS F CB  1 
ATOM   5200 C  CG  . HIS F  1 57  ? 38.487  63.228  27.937  1.00 28.91  ? 116 HIS F CG  1 
ATOM   5201 N  ND1 . HIS F  1 57  ? 38.980  62.250  27.096  1.00 27.25  ? 116 HIS F ND1 1 
ATOM   5202 C  CD2 . HIS F  1 57  ? 39.187  64.353  27.652  1.00 29.44  ? 116 HIS F CD2 1 
ATOM   5203 C  CE1 . HIS F  1 57  ? 39.931  62.757  26.338  1.00 27.75  ? 116 HIS F CE1 1 
ATOM   5204 N  NE2 . HIS F  1 57  ? 40.080  64.032  26.656  1.00 29.21  ? 116 HIS F NE2 1 
ATOM   5205 N  N   . LEU F  1 58  ? 36.668  66.191  28.189  1.00 31.25  ? 117 LEU F N   1 
ATOM   5206 C  CA  . LEU F  1 58  ? 36.254  67.057  27.086  1.00 31.86  ? 117 LEU F CA  1 
ATOM   5207 C  C   . LEU F  1 58  ? 37.460  67.610  26.354  1.00 31.49  ? 117 LEU F C   1 
ATOM   5208 O  O   . LEU F  1 58  ? 38.539  67.752  26.917  1.00 31.92  ? 117 LEU F O   1 
ATOM   5209 C  CB  . LEU F  1 58  ? 35.418  68.237  27.616  1.00 33.23  ? 117 LEU F CB  1 
ATOM   5210 C  CG  . LEU F  1 58  ? 33.979  67.946  28.032  1.00 33.90  ? 117 LEU F CG  1 
ATOM   5211 C  CD1 . LEU F  1 58  ? 33.394  69.115  28.760  1.00 34.24  ? 117 LEU F CD1 1 
ATOM   5212 C  CD2 . LEU F  1 58  ? 33.168  67.601  26.800  1.00 34.29  ? 117 LEU F CD2 1 
ATOM   5213 N  N   . ILE F  1 59  ? 37.269  67.955  25.094  1.00 32.20  ? 118 ILE F N   1 
ATOM   5214 C  CA  . ILE F  1 59  ? 38.302  68.604  24.275  1.00 31.99  ? 118 ILE F CA  1 
ATOM   5215 C  C   . ILE F  1 59  ? 37.885  70.042  24.011  1.00 33.24  ? 118 ILE F C   1 
ATOM   5216 O  O   . ILE F  1 59  ? 36.730  70.301  23.677  1.00 34.14  ? 118 ILE F O   1 
ATOM   5217 C  CB  . ILE F  1 59  ? 38.467  67.866  22.939  1.00 31.95  ? 118 ILE F CB  1 
ATOM   5218 C  CG1 . ILE F  1 59  ? 39.025  66.470  23.203  1.00 30.75  ? 118 ILE F CG1 1 
ATOM   5219 C  CG2 . ILE F  1 59  ? 39.388  68.623  21.991  1.00 31.96  ? 118 ILE F CG2 1 
ATOM   5220 C  CD1 . ILE F  1 59  ? 38.986  65.637  21.974  1.00 31.76  ? 118 ILE F CD1 1 
ATOM   5221 N  N   . PHE F  1 60  ? 38.829  70.969  24.169  1.00 33.50  ? 119 PHE F N   1 
ATOM   5222 C  CA  . PHE F  1 60  ? 38.546  72.399  24.146  1.00 34.59  ? 119 PHE F CA  1 
ATOM   5223 C  C   . PHE F  1 60  ? 39.184  73.096  22.948  1.00 35.20  ? 119 PHE F C   1 
ATOM   5224 O  O   . PHE F  1 60  ? 40.156  72.603  22.375  1.00 34.60  ? 119 PHE F O   1 
ATOM   5225 C  CB  . PHE F  1 60  ? 39.075  73.036  25.431  1.00 34.99  ? 119 PHE F CB  1 
ATOM   5226 C  CG  . PHE F  1 60  ? 38.285  72.689  26.632  1.00 34.78  ? 119 PHE F CG  1 
ATOM   5227 C  CD1 . PHE F  1 60  ? 37.352  73.583  27.152  1.00 36.30  ? 119 PHE F CD1 1 
ATOM   5228 C  CD2 . PHE F  1 60  ? 38.463  71.468  27.260  1.00 33.85  ? 119 PHE F CD2 1 
ATOM   5229 C  CE1 . PHE F  1 60  ? 36.586  73.258  28.295  1.00 36.80  ? 119 PHE F CE1 1 
ATOM   5230 C  CE2 . PHE F  1 60  ? 37.713  71.131  28.400  1.00 34.63  ? 119 PHE F CE2 1 
ATOM   5231 C  CZ  . PHE F  1 60  ? 36.758  72.034  28.917  1.00 36.13  ? 119 PHE F CZ  1 
ATOM   5232 N  N   . GLU F  1 61  ? 38.623  74.242  22.580  1.00 36.44  ? 120 GLU F N   1 
ATOM   5233 C  CA  . GLU F  1 61  ? 39.198  75.097  21.550  1.00 37.57  ? 120 GLU F CA  1 
ATOM   5234 C  C   . GLU F  1 61  ? 40.517  75.684  22.025  1.00 37.21  ? 120 GLU F C   1 
ATOM   5235 O  O   . GLU F  1 61  ? 40.689  75.979  23.199  1.00 36.51  ? 120 GLU F O   1 
ATOM   5236 C  CB  . GLU F  1 61  ? 38.245  76.270  21.238  1.00 39.67  ? 120 GLU F CB  1 
ATOM   5237 C  CG  . GLU F  1 61  ? 36.897  75.865  20.653  1.00 41.08  ? 120 GLU F CG  1 
ATOM   5238 C  CD  . GLU F  1 61  ? 36.090  77.037  20.089  1.00 43.35  ? 120 GLU F CD  1 
ATOM   5239 O  OE1 . GLU F  1 61  ? 36.582  77.722  19.149  1.00 44.47  ? 120 GLU F OE1 1 
ATOM   5240 O  OE2 . GLU F  1 61  ? 34.950  77.246  20.576  1.00 43.50  ? 120 GLU F OE2 1 
ATOM   5241 N  N   . ASP F  1 62  ? 41.432  75.867  21.085  1.00 38.09  ? 121 ASP F N   1 
ATOM   5242 C  CA  . ASP F  1 62  ? 42.763  76.412  21.359  1.00 38.74  ? 121 ASP F CA  1 
ATOM   5243 C  C   . ASP F  1 62  ? 42.698  77.566  22.378  1.00 39.46  ? 121 ASP F C   1 
ATOM   5244 O  O   . ASP F  1 62  ? 43.200  77.475  23.499  1.00 38.47  ? 121 ASP F O   1 
ATOM   5245 C  CB  . ASP F  1 62  ? 43.401  76.906  20.049  1.00 39.92  ? 121 ASP F CB  1 
ATOM   5246 C  CG  . ASP F  1 62  ? 43.747  75.761  19.065  1.00 41.77  ? 121 ASP F CG  1 
ATOM   5247 O  OD1 . ASP F  1 62  ? 43.701  74.535  19.434  1.00 41.81  ? 121 ASP F OD1 1 
ATOM   5248 O  OD2 . ASP F  1 62  ? 44.048  76.063  17.887  1.00 44.70  ? 121 ASP F OD2 1 
ATOM   5249 N  N   . HIS F  1 63  ? 42.033  78.638  21.982  1.00 40.63  ? 122 HIS F N   1 
ATOM   5250 C  CA  . HIS F  1 63  ? 42.094  79.858  22.753  1.00 41.99  ? 122 HIS F CA  1 
ATOM   5251 C  C   . HIS F  1 63  ? 41.364  79.810  24.093  1.00 41.63  ? 122 HIS F C   1 
ATOM   5252 O  O   . HIS F  1 63  ? 41.592  80.659  24.928  1.00 43.26  ? 122 HIS F O   1 
ATOM   5253 C  CB  . HIS F  1 63  ? 41.568  81.021  21.937  1.00 43.81  ? 122 HIS F CB  1 
ATOM   5254 C  CG  . HIS F  1 63  ? 40.086  81.038  21.828  1.00 45.03  ? 122 HIS F CG  1 
ATOM   5255 N  ND1 . HIS F  1 63  ? 39.395  80.263  20.919  1.00 44.61  ? 122 HIS F ND1 1 
ATOM   5256 C  CD2 . HIS F  1 63  ? 39.157  81.737  22.529  1.00 46.86  ? 122 HIS F CD2 1 
ATOM   5257 C  CE1 . HIS F  1 63  ? 38.099  80.481  21.071  1.00 45.85  ? 122 HIS F CE1 1 
ATOM   5258 N  NE2 . HIS F  1 63  ? 37.928  81.370  22.039  1.00 46.89  ? 122 HIS F NE2 1 
ATOM   5259 N  N   . ILE F  1 64  ? 40.479  78.850  24.284  1.00 40.46  ? 123 ILE F N   1 
ATOM   5260 C  CA  . ILE F  1 64  ? 39.865  78.603  25.580  1.00 40.45  ? 123 ILE F CA  1 
ATOM   5261 C  C   . ILE F  1 64  ? 40.808  77.798  26.476  1.00 39.68  ? 123 ILE F C   1 
ATOM   5262 O  O   . ILE F  1 64  ? 41.038  78.154  27.638  1.00 40.45  ? 123 ILE F O   1 
ATOM   5263 C  CB  . ILE F  1 64  ? 38.556  77.829  25.402  1.00 39.93  ? 123 ILE F CB  1 
ATOM   5264 C  CG1 . ILE F  1 64  ? 37.563  78.671  24.596  1.00 42.10  ? 123 ILE F CG1 1 
ATOM   5265 C  CG2 . ILE F  1 64  ? 37.938  77.448  26.739  1.00 39.47  ? 123 ILE F CG2 1 
ATOM   5266 C  CD1 . ILE F  1 64  ? 37.121  79.964  25.270  1.00 43.21  ? 123 ILE F CD1 1 
ATOM   5267 N  N   . TYR F  1 65  ? 41.364  76.730  25.912  1.00 38.37  ? 124 TYR F N   1 
ATOM   5268 C  CA  . TYR F  1 65  ? 42.291  75.837  26.620  1.00 37.64  ? 124 TYR F CA  1 
ATOM   5269 C  C   . TYR F  1 65  ? 43.419  76.624  27.254  1.00 38.90  ? 124 TYR F C   1 
ATOM   5270 O  O   . TYR F  1 65  ? 43.661  76.503  28.441  1.00 39.93  ? 124 TYR F O   1 
ATOM   5271 C  CB  . TYR F  1 65  ? 42.873  74.801  25.646  1.00 36.24  ? 124 TYR F CB  1 
ATOM   5272 C  CG  . TYR F  1 65  ? 43.818  73.801  26.269  1.00 35.61  ? 124 TYR F CG  1 
ATOM   5273 C  CD1 . TYR F  1 65  ? 43.349  72.692  26.955  1.00 34.50  ? 124 TYR F CD1 1 
ATOM   5274 C  CD2 . TYR F  1 65  ? 45.187  73.954  26.169  1.00 36.69  ? 124 TYR F CD2 1 
ATOM   5275 C  CE1 . TYR F  1 65  ? 44.226  71.777  27.519  1.00 33.65  ? 124 TYR F CE1 1 
ATOM   5276 C  CE2 . TYR F  1 65  ? 46.062  73.037  26.748  1.00 35.50  ? 124 TYR F CE2 1 
ATOM   5277 C  CZ  . TYR F  1 65  ? 45.573  71.978  27.408  1.00 34.07  ? 124 TYR F CZ  1 
ATOM   5278 O  OH  . TYR F  1 65  ? 46.448  71.111  27.936  1.00 34.38  ? 124 TYR F OH  1 
ATOM   5279 N  N   . GLU F  1 66  ? 44.073  77.453  26.453  1.00 39.49  ? 125 GLU F N   1 
ATOM   5280 C  CA  . GLU F  1 66  ? 45.171  78.316  26.891  1.00 40.93  ? 125 GLU F CA  1 
ATOM   5281 C  C   . GLU F  1 66  ? 44.901  79.138  28.182  1.00 42.47  ? 125 GLU F C   1 
ATOM   5282 O  O   . GLU F  1 66  ? 45.832  79.467  28.926  1.00 42.85  ? 125 GLU F O   1 
ATOM   5283 C  CB  . GLU F  1 66  ? 45.452  79.275  25.756  1.00 41.77  ? 125 GLU F CB  1 
ATOM   5284 C  CG  . GLU F  1 66  ? 46.481  80.309  26.016  1.00 44.24  ? 125 GLU F CG  1 
ATOM   5285 C  CD  . GLU F  1 66  ? 46.729  81.161  24.780  1.00 46.21  ? 125 GLU F CD  1 
ATOM   5286 O  OE1 . GLU F  1 66  ? 47.928  81.407  24.482  1.00 47.06  ? 125 GLU F OE1 1 
ATOM   5287 O  OE2 . GLU F  1 66  ? 45.731  81.554  24.112  1.00 46.08  ? 125 GLU F OE2 1 
ATOM   5288 N  N   . LYS F  1 67  ? 43.625  79.456  28.425  1.00 42.78  ? 126 LYS F N   1 
ATOM   5289 C  CA  . LYS F  1 67  ? 43.235  80.350  29.519  1.00 44.67  ? 126 LYS F CA  1 
ATOM   5290 C  C   . LYS F  1 67  ? 42.712  79.625  30.760  1.00 44.41  ? 126 LYS F C   1 
ATOM   5291 O  O   . LYS F  1 67  ? 42.373  80.282  31.747  1.00 46.00  ? 126 LYS F O   1 
ATOM   5292 C  CB  . LYS F  1 67  ? 42.137  81.323  29.047  1.00 45.67  ? 126 LYS F CB  1 
ATOM   5293 C  CG  . LYS F  1 67  ? 42.497  82.208  27.898  1.00 46.82  ? 126 LYS F CG  1 
ATOM   5294 C  CD  . LYS F  1 67  ? 43.792  82.932  28.160  1.00 49.67  ? 126 LYS F CD  1 
ATOM   5295 C  CE  . LYS F  1 67  ? 43.965  84.167  27.289  1.00 51.39  ? 126 LYS F CE  1 
ATOM   5296 N  NZ  . LYS F  1 67  ? 45.416  84.424  27.143  1.00 52.15  ? 126 LYS F NZ  1 
ATOM   5297 N  N   . LEU F  1 68  ? 42.627  78.295  30.711  1.00 42.64  ? 127 LEU F N   1 
ATOM   5298 C  CA  . LEU F  1 68  ? 42.020  77.533  31.806  1.00 42.47  ? 127 LEU F CA  1 
ATOM   5299 C  C   . LEU F  1 68  ? 42.918  77.530  33.032  1.00 43.57  ? 127 LEU F C   1 
ATOM   5300 O  O   . LEU F  1 68  ? 44.126  77.680  32.924  1.00 43.63  ? 127 LEU F O   1 
ATOM   5301 C  CB  . LEU F  1 68  ? 41.727  76.106  31.359  1.00 40.28  ? 127 LEU F CB  1 
ATOM   5302 C  CG  . LEU F  1 68  ? 40.700  75.997  30.221  1.00 39.64  ? 127 LEU F CG  1 
ATOM   5303 C  CD1 . LEU F  1 68  ? 40.500  74.517  29.833  1.00 37.42  ? 127 LEU F CD1 1 
ATOM   5304 C  CD2 . LEU F  1 68  ? 39.367  76.659  30.552  1.00 39.66  ? 127 LEU F CD2 1 
ATOM   5305 N  N   . ASP F  1 69  ? 42.315  77.360  34.201  1.00 44.78  ? 128 ASP F N   1 
ATOM   5306 C  CA  . ASP F  1 69  ? 43.074  77.331  35.437  1.00 46.90  ? 128 ASP F CA  1 
ATOM   5307 C  C   . ASP F  1 69  ? 44.110  76.227  35.311  1.00 45.73  ? 128 ASP F C   1 
ATOM   5308 O  O   . ASP F  1 69  ? 43.821  75.166  34.752  1.00 44.44  ? 128 ASP F O   1 
ATOM   5309 C  CB  . ASP F  1 69  ? 42.180  77.047  36.662  1.00 48.42  ? 128 ASP F CB  1 
ATOM   5310 C  CG  . ASP F  1 69  ? 41.112  78.135  36.915  1.00 51.22  ? 128 ASP F CG  1 
ATOM   5311 O  OD1 . ASP F  1 69  ? 41.249  79.297  36.446  1.00 52.38  ? 128 ASP F OD1 1 
ATOM   5312 O  OD2 . ASP F  1 69  ? 40.117  77.799  37.611  1.00 52.60  ? 128 ASP F OD2 1 
ATOM   5313 N  N   . ALA F  1 70  ? 45.305  76.465  35.839  1.00 47.10  ? 129 ALA F N   1 
ATOM   5314 C  CA  . ALA F  1 70  ? 46.352  75.458  35.855  1.00 46.40  ? 129 ALA F CA  1 
ATOM   5315 C  C   . ALA F  1 70  ? 45.808  74.136  36.398  1.00 45.46  ? 129 ALA F C   1 
ATOM   5316 O  O   . ALA F  1 70  ? 45.036  74.100  37.347  1.00 46.86  ? 129 ALA F O   1 
ATOM   5317 C  CB  . ALA F  1 70  ? 47.526  75.936  36.693  1.00 48.70  ? 129 ALA F CB  1 
ATOM   5318 N  N   . ILE F  1 71  ? 46.223  73.048  35.784  1.00 43.45  ? 130 ILE F N   1 
ATOM   5319 C  CA  . ILE F  1 71  ? 45.732  71.735  36.163  1.00 42.56  ? 130 ILE F CA  1 
ATOM   5320 C  C   . ILE F  1 71  ? 46.326  71.228  37.491  1.00 44.41  ? 130 ILE F C   1 
ATOM   5321 O  O   . ILE F  1 71  ? 47.535  71.227  37.668  1.00 45.95  ? 130 ILE F O   1 
ATOM   5322 C  CB  . ILE F  1 71  ? 45.987  70.738  35.014  1.00 40.17  ? 130 ILE F CB  1 
ATOM   5323 C  CG1 . ILE F  1 71  ? 45.345  69.404  35.321  1.00 39.82  ? 130 ILE F CG1 1 
ATOM   5324 C  CG2 . ILE F  1 71  ? 47.480  70.566  34.749  1.00 40.58  ? 130 ILE F CG2 1 
ATOM   5325 C  CD1 . ILE F  1 71  ? 45.248  68.516  34.122  1.00 37.91  ? 130 ILE F CD1 1 
ATOM   5326 N  N   . THR F  1 72  ? 45.486  70.799  38.434  1.00 45.16  ? 131 THR F N   1 
ATOM   5327 C  CA  . THR F  1 72  ? 46.010  70.286  39.716  1.00 46.82  ? 131 THR F CA  1 
ATOM   5328 C  C   . THR F  1 72  ? 46.524  68.875  39.554  1.00 45.77  ? 131 THR F C   1 
ATOM   5329 O  O   . THR F  1 72  ? 46.218  68.202  38.561  1.00 43.80  ? 131 THR F O   1 
ATOM   5330 C  CB  . THR F  1 72  ? 44.985  70.283  40.853  1.00 48.53  ? 131 THR F CB  1 
ATOM   5331 O  OG1 . THR F  1 72  ? 44.000  69.270  40.627  1.00 46.49  ? 131 THR F OG1 1 
ATOM   5332 C  CG2 . THR F  1 72  ? 44.324  71.653  41.020  1.00 49.19  ? 131 THR F CG2 1 
ATOM   5333 N  N   . ASP F  1 73  ? 47.327  68.437  40.512  1.00 47.92  ? 132 ASP F N   1 
ATOM   5334 C  CA  . ASP F  1 73  ? 47.886  67.090  40.495  1.00 47.46  ? 132 ASP F CA  1 
ATOM   5335 C  C   . ASP F  1 73  ? 46.775  66.070  40.497  1.00 45.79  ? 132 ASP F C   1 
ATOM   5336 O  O   . ASP F  1 73  ? 46.797  65.117  39.741  1.00 43.94  ? 132 ASP F O   1 
ATOM   5337 C  CB  . ASP F  1 73  ? 48.792  66.880  41.706  1.00 50.79  ? 132 ASP F CB  1 
ATOM   5338 C  CG  . ASP F  1 73  ? 50.184  67.488  41.513  1.00 53.32  ? 132 ASP F CG  1 
ATOM   5339 O  OD1 . ASP F  1 73  ? 50.674  67.519  40.355  1.00 51.73  ? 132 ASP F OD1 1 
ATOM   5340 O  OD2 . ASP F  1 73  ? 50.791  67.921  42.520  1.00 57.18  ? 132 ASP F OD2 1 
ATOM   5341 N  N   . GLU F  1 74  ? 45.792  66.299  41.350  1.00 47.03  ? 133 GLU F N   1 
ATOM   5342 C  CA  . GLU F  1 74  ? 44.613  65.460  41.420  1.00 45.96  ? 133 GLU F CA  1 
ATOM   5343 C  C   . GLU F  1 74  ? 43.951  65.271  40.063  1.00 43.17  ? 133 GLU F C   1 
ATOM   5344 O  O   . GLU F  1 74  ? 43.712  64.139  39.641  1.00 41.63  ? 133 GLU F O   1 
ATOM   5345 C  CB  . GLU F  1 74  ? 43.589  66.077  42.363  1.00 48.09  ? 133 GLU F CB  1 
ATOM   5346 C  CG  . GLU F  1 74  ? 43.412  65.360  43.668  1.00 51.40  ? 133 GLU F CG  1 
ATOM   5347 C  CD  . GLU F  1 74  ? 42.055  65.708  44.341  1.00 54.87  ? 133 GLU F CD  1 
ATOM   5348 O  OE1 . GLU F  1 74  ? 41.935  66.847  44.865  1.00 57.03  ? 133 GLU F OE1 1 
ATOM   5349 O  OE2 . GLU F  1 74  ? 41.124  64.843  44.345  1.00 54.12  ? 133 GLU F OE2 1 
ATOM   5350 N  N   . GLU F  1 75  ? 43.630  66.376  39.385  1.00 42.57  ? 134 GLU F N   1 
ATOM   5351 C  CA  . GLU F  1 75  ? 43.024  66.266  38.056  1.00 40.00  ? 134 GLU F CA  1 
ATOM   5352 C  C   . GLU F  1 75  ? 43.922  65.488  37.140  1.00 38.15  ? 134 GLU F C   1 
ATOM   5353 O  O   . GLU F  1 75  ? 43.452  64.609  36.447  1.00 36.48  ? 134 GLU F O   1 
ATOM   5354 C  CB  . GLU F  1 75  ? 42.695  67.616  37.407  1.00 39.79  ? 134 GLU F CB  1 
ATOM   5355 C  CG  . GLU F  1 75  ? 42.086  67.461  35.992  1.00 37.49  ? 134 GLU F CG  1 
ATOM   5356 C  CD  . GLU F  1 75  ? 41.634  68.767  35.351  1.00 38.15  ? 134 GLU F CD  1 
ATOM   5357 O  OE1 . GLU F  1 75  ? 41.490  69.784  36.094  1.00 40.12  ? 134 GLU F OE1 1 
ATOM   5358 O  OE2 . GLU F  1 75  ? 41.435  68.775  34.097  1.00 35.11  ? 134 GLU F OE2 1 
ATOM   5359 N  N   . ASN F  1 76  ? 45.215  65.788  37.169  1.00 38.96  ? 135 ASN F N   1 
ATOM   5360 C  CA  . ASN F  1 76  ? 46.143  65.179  36.230  1.00 37.91  ? 135 ASN F CA  1 
ATOM   5361 C  C   . ASN F  1 76  ? 46.212  63.651  36.355  1.00 37.27  ? 135 ASN F C   1 
ATOM   5362 O  O   . ASN F  1 76  ? 46.276  62.914  35.362  1.00 35.79  ? 135 ASN F O   1 
ATOM   5363 C  CB  . ASN F  1 76  ? 47.527  65.781  36.394  1.00 39.81  ? 135 ASN F CB  1 
ATOM   5364 C  CG  . ASN F  1 76  ? 48.354  65.615  35.146  1.00 40.35  ? 135 ASN F CG  1 
ATOM   5365 O  OD1 . ASN F  1 76  ? 48.030  66.198  34.091  1.00 41.23  ? 135 ASN F OD1 1 
ATOM   5366 N  ND2 . ASN F  1 76  ? 49.399  64.783  35.228  1.00 40.62  ? 135 ASN F ND2 1 
ATOM   5367 N  N   . ASP F  1 77  ? 46.162  63.179  37.590  1.00 38.78  ? 136 ASP F N   1 
ATOM   5368 C  CA  . ASP F  1 77  ? 46.090  61.758  37.848  1.00 38.72  ? 136 ASP F CA  1 
ATOM   5369 C  C   . ASP F  1 77  ? 44.933  61.084  37.100  1.00 36.59  ? 136 ASP F C   1 
ATOM   5370 O  O   . ASP F  1 77  ? 45.119  60.048  36.469  1.00 35.74  ? 136 ASP F O   1 
ATOM   5371 C  CB  . ASP F  1 77  ? 45.950  61.497  39.359  1.00 41.18  ? 136 ASP F CB  1 
ATOM   5372 C  CG  . ASP F  1 77  ? 47.256  61.668  40.106  1.00 44.13  ? 136 ASP F CG  1 
ATOM   5373 O  OD1 . ASP F  1 77  ? 48.316  61.481  39.482  1.00 44.43  ? 136 ASP F OD1 1 
ATOM   5374 O  OD2 . ASP F  1 77  ? 47.242  61.977  41.325  1.00 47.73  ? 136 ASP F OD2 1 
ATOM   5375 N  N   . MET F  1 78  ? 43.748  61.671  37.175  1.00 35.95  ? 137 MET F N   1 
ATOM   5376 C  CA  . MET F  1 78  ? 42.600  61.097  36.507  1.00 34.61  ? 137 MET F CA  1 
ATOM   5377 C  C   . MET F  1 78  ? 42.628  61.372  35.019  1.00 32.87  ? 137 MET F C   1 
ATOM   5378 O  O   . MET F  1 78  ? 42.187  60.540  34.230  1.00 31.62  ? 137 MET F O   1 
ATOM   5379 C  CB  . MET F  1 78  ? 41.302  61.628  37.107  1.00 35.41  ? 137 MET F CB  1 
ATOM   5380 C  CG  . MET F  1 78  ? 41.111  61.274  38.561  1.00 37.64  ? 137 MET F CG  1 
ATOM   5381 S  SD  . MET F  1 78  ? 41.016  59.478  38.827  1.00 41.06  ? 137 MET F SD  1 
ATOM   5382 C  CE  . MET F  1 78  ? 42.692  59.060  39.318  1.00 38.47  ? 137 MET F CE  1 
ATOM   5383 N  N   . LEU F  1 79  ? 43.164  62.527  34.629  1.00 33.21  ? 138 LEU F N   1 
ATOM   5384 C  CA  . LEU F  1 79  ? 43.221  62.879  33.222  1.00 31.89  ? 138 LEU F CA  1 
ATOM   5385 C  C   . LEU F  1 79  ? 44.151  61.924  32.492  1.00 31.18  ? 138 LEU F C   1 
ATOM   5386 O  O   . LEU F  1 79  ? 43.902  61.589  31.350  1.00 30.05  ? 138 LEU F O   1 
ATOM   5387 C  CB  . LEU F  1 79  ? 43.632  64.335  33.049  1.00 32.24  ? 138 LEU F CB  1 
ATOM   5388 C  CG  . LEU F  1 79  ? 43.622  64.909  31.630  1.00 31.57  ? 138 LEU F CG  1 
ATOM   5389 C  CD1 . LEU F  1 79  ? 42.233  64.838  30.996  1.00 29.47  ? 138 LEU F CD1 1 
ATOM   5390 C  CD2 . LEU F  1 79  ? 44.171  66.344  31.658  1.00 30.81  ? 138 LEU F CD2 1 
ATOM   5391 N  N   . ASP F  1 80  ? 45.211  61.461  33.158  1.00 32.20  ? 139 ASP F N   1 
ATOM   5392 C  CA  . ASP F  1 80  ? 46.103  60.500  32.512  1.00 32.24  ? 139 ASP F CA  1 
ATOM   5393 C  C   . ASP F  1 80  ? 45.361  59.245  32.050  1.00 31.20  ? 139 ASP F C   1 
ATOM   5394 O  O   . ASP F  1 80  ? 45.809  58.578  31.097  1.00 30.72  ? 139 ASP F O   1 
ATOM   5395 C  CB  . ASP F  1 80  ? 47.214  60.039  33.453  1.00 33.90  ? 139 ASP F CB  1 
ATOM   5396 C  CG  . ASP F  1 80  ? 48.481  60.863  33.331  1.00 36.61  ? 139 ASP F CG  1 
ATOM   5397 O  OD1 . ASP F  1 80  ? 48.693  61.578  32.304  1.00 37.07  ? 139 ASP F OD1 1 
ATOM   5398 O  OD2 . ASP F  1 80  ? 49.294  60.786  34.288  1.00 40.27  ? 139 ASP F OD2 1 
ATOM   5399 N  N   . LEU F  1 81  ? 44.288  58.901  32.766  1.00 30.83  ? 140 LEU F N   1 
ATOM   5400 C  CA  . LEU F  1 81  ? 43.521  57.707  32.475  1.00 30.18  ? 140 LEU F CA  1 
ATOM   5401 C  C   . LEU F  1 81  ? 42.405  57.965  31.473  1.00 29.54  ? 140 LEU F C   1 
ATOM   5402 O  O   . LEU F  1 81  ? 41.630  57.072  31.183  1.00 29.67  ? 140 LEU F O   1 
ATOM   5403 C  CB  . LEU F  1 81  ? 42.950  57.105  33.762  1.00 30.63  ? 140 LEU F CB  1 
ATOM   5404 C  CG  . LEU F  1 81  ? 43.992  56.688  34.816  1.00 32.49  ? 140 LEU F CG  1 
ATOM   5405 C  CD1 . LEU F  1 81  ? 43.285  56.219  36.046  1.00 32.27  ? 140 LEU F CD1 1 
ATOM   5406 C  CD2 . LEU F  1 81  ? 44.992  55.643  34.341  1.00 31.01  ? 140 LEU F CD2 1 
ATOM   5407 N  N   . ALA F  1 82  ? 42.295  59.175  30.951  1.00 29.28  ? 141 ALA F N   1 
ATOM   5408 C  CA  . ALA F  1 82  ? 41.277  59.450  29.936  1.00 28.78  ? 141 ALA F CA  1 
ATOM   5409 C  C   . ALA F  1 82  ? 41.639  58.682  28.661  1.00 28.11  ? 141 ALA F C   1 
ATOM   5410 O  O   . ALA F  1 82  ? 42.788  58.693  28.232  1.00 27.72  ? 141 ALA F O   1 
ATOM   5411 C  CB  . ALA F  1 82  ? 41.167  60.966  29.652  1.00 28.41  ? 141 ALA F CB  1 
ATOM   5412 N  N   . TYR F  1 83  ? 40.664  58.013  28.069  1.00 27.77  ? 142 TYR F N   1 
ATOM   5413 C  CA  . TYR F  1 83  ? 40.913  57.341  26.809  1.00 27.91  ? 142 TYR F CA  1 
ATOM   5414 C  C   . TYR F  1 83  ? 40.959  58.358  25.708  1.00 27.94  ? 142 TYR F C   1 
ATOM   5415 O  O   . TYR F  1 83  ? 40.066  59.204  25.605  1.00 28.09  ? 142 TYR F O   1 
ATOM   5416 C  CB  . TYR F  1 83  ? 39.828  56.312  26.475  1.00 28.49  ? 142 TYR F CB  1 
ATOM   5417 C  CG  . TYR F  1 83  ? 40.132  55.589  25.184  1.00 28.53  ? 142 TYR F CG  1 
ATOM   5418 C  CD1 . TYR F  1 83  ? 41.050  54.556  25.142  1.00 28.00  ? 142 TYR F CD1 1 
ATOM   5419 C  CD2 . TYR F  1 83  ? 39.537  55.970  24.003  1.00 28.49  ? 142 TYR F CD2 1 
ATOM   5420 C  CE1 . TYR F  1 83  ? 41.353  53.915  23.959  1.00 27.83  ? 142 TYR F CE1 1 
ATOM   5421 C  CE2 . TYR F  1 83  ? 39.815  55.311  22.832  1.00 29.22  ? 142 TYR F CE2 1 
ATOM   5422 C  CZ  . TYR F  1 83  ? 40.722  54.293  22.822  1.00 28.70  ? 142 TYR F CZ  1 
ATOM   5423 O  OH  . TYR F  1 83  ? 40.996  53.659  21.650  1.00 31.63  ? 142 TYR F OH  1 
ATOM   5424 N  N   . GLY F  1 84  ? 41.978  58.249  24.871  1.00 28.07  ? 143 GLY F N   1 
ATOM   5425 C  CA  . GLY F  1 84  ? 42.200  59.184  23.782  1.00 28.61  ? 143 GLY F CA  1 
ATOM   5426 C  C   . GLY F  1 84  ? 42.619  60.574  24.189  1.00 28.48  ? 143 GLY F C   1 
ATOM   5427 O  O   . GLY F  1 84  ? 42.277  61.542  23.525  1.00 29.20  ? 143 GLY F O   1 
ATOM   5428 N  N   . LEU F  1 85  ? 43.407  60.659  25.253  1.00 28.85  ? 144 LEU F N   1 
ATOM   5429 C  CA  . LEU F  1 85  ? 43.932  61.936  25.780  1.00 29.10  ? 144 LEU F CA  1 
ATOM   5430 C  C   . LEU F  1 85  ? 44.654  62.781  24.747  1.00 29.46  ? 144 LEU F C   1 
ATOM   5431 O  O   . LEU F  1 85  ? 45.536  62.303  24.065  1.00 30.46  ? 144 LEU F O   1 
ATOM   5432 C  CB  . LEU F  1 85  ? 44.923  61.658  26.906  1.00 29.52  ? 144 LEU F CB  1 
ATOM   5433 C  CG  . LEU F  1 85  ? 45.551  62.839  27.657  1.00 29.76  ? 144 LEU F CG  1 
ATOM   5434 C  CD1 . LEU F  1 85  ? 44.496  63.588  28.431  1.00 28.43  ? 144 LEU F CD1 1 
ATOM   5435 C  CD2 . LEU F  1 85  ? 46.623  62.336  28.571  1.00 28.95  ? 144 LEU F CD2 1 
ATOM   5436 N  N   . THR F  1 86  ? 44.290  64.047  24.680  1.00 29.57  ? 145 THR F N   1 
ATOM   5437 C  CA  . THR F  1 86  ? 44.829  64.980  23.698  1.00 30.09  ? 145 THR F CA  1 
ATOM   5438 C  C   . THR F  1 86  ? 45.504  66.122  24.400  1.00 30.68  ? 145 THR F C   1 
ATOM   5439 O  O   . THR F  1 86  ? 45.312  66.346  25.608  1.00 30.40  ? 145 THR F O   1 
ATOM   5440 C  CB  . THR F  1 86  ? 43.708  65.627  22.838  1.00 30.30  ? 145 THR F CB  1 
ATOM   5441 O  OG1 . THR F  1 86  ? 43.009  66.605  23.617  1.00 29.26  ? 145 THR F OG1 1 
ATOM   5442 C  CG2 . THR F  1 86  ? 42.760  64.563  22.300  1.00 28.92  ? 145 THR F CG2 1 
ATOM   5443 N  N   . ASP F  1 87  ? 46.231  66.902  23.626  1.00 31.54  ? 146 ASP F N   1 
ATOM   5444 C  CA  . ASP F  1 87  ? 46.828  68.127  24.144  1.00 32.14  ? 146 ASP F CA  1 
ATOM   5445 C  C   . ASP F  1 87  ? 45.840  69.302  24.307  1.00 32.14  ? 146 ASP F C   1 
ATOM   5446 O  O   . ASP F  1 87  ? 46.256  70.410  24.565  1.00 32.84  ? 146 ASP F O   1 
ATOM   5447 C  CB  . ASP F  1 87  ? 48.009  68.515  23.273  1.00 32.77  ? 146 ASP F CB  1 
ATOM   5448 C  CG  . ASP F  1 87  ? 47.624  68.697  21.850  1.00 33.59  ? 146 ASP F CG  1 
ATOM   5449 O  OD1 . ASP F  1 87  ? 48.544  68.646  21.002  1.00 34.08  ? 146 ASP F OD1 1 
ATOM   5450 O  OD2 . ASP F  1 87  ? 46.406  68.906  21.596  1.00 30.73  ? 146 ASP F OD2 1 
ATOM   5451 N  N   . ARG F  1 88  ? 44.542  69.060  24.152  1.00 31.72  ? 147 ARG F N   1 
ATOM   5452 C  CA  . ARG F  1 88  ? 43.495  70.045  24.471  1.00 31.76  ? 147 ARG F CA  1 
ATOM   5453 C  C   . ARG F  1 88  ? 42.452  69.435  25.406  1.00 31.39  ? 147 ARG F C   1 
ATOM   5454 O  O   . ARG F  1 88  ? 41.361  69.964  25.550  1.00 31.64  ? 147 ARG F O   1 
ATOM   5455 C  CB  . ARG F  1 88  ? 42.813  70.502  23.197  1.00 32.13  ? 147 ARG F CB  1 
ATOM   5456 C  CG  . ARG F  1 88  ? 43.741  71.129  22.177  1.00 32.77  ? 147 ARG F CG  1 
ATOM   5457 C  CD  . ARG F  1 88  ? 44.049  72.567  22.501  1.00 33.97  ? 147 ARG F CD  1 
ATOM   5458 N  NE  . ARG F  1 88  ? 44.907  73.183  21.481  1.00 35.06  ? 147 ARG F NE  1 
ATOM   5459 C  CZ  . ARG F  1 88  ? 46.236  73.165  21.471  1.00 34.99  ? 147 ARG F CZ  1 
ATOM   5460 N  NH1 . ARG F  1 88  ? 46.909  72.554  22.414  1.00 35.90  ? 147 ARG F NH1 1 
ATOM   5461 N  NH2 . ARG F  1 88  ? 46.898  73.752  20.503  1.00 36.82  ? 147 ARG F NH2 1 
ATOM   5462 N  N   . SER F  1 89  ? 42.795  68.316  26.051  1.00 30.80  ? 148 SER F N   1 
ATOM   5463 C  CA  . SER F  1 89  ? 41.892  67.635  26.949  1.00 30.30  ? 148 SER F CA  1 
ATOM   5464 C  C   . SER F  1 89  ? 41.913  68.189  28.355  1.00 30.71  ? 148 SER F C   1 
ATOM   5465 O  O   . SER F  1 89  ? 42.958  68.555  28.862  1.00 30.91  ? 148 SER F O   1 
ATOM   5466 C  CB  . SER F  1 89  ? 42.281  66.178  27.006  1.00 29.85  ? 148 SER F CB  1 
ATOM   5467 O  OG  . SER F  1 89  ? 42.119  65.573  25.741  1.00 29.79  ? 148 SER F OG  1 
ATOM   5468 N  N   . ARG F  1 90  ? 40.737  68.266  28.971  1.00 31.22  ? 149 ARG F N   1 
ATOM   5469 C  CA  . ARG F  1 90  ? 40.609  68.502  30.413  1.00 32.18  ? 149 ARG F CA  1 
ATOM   5470 C  C   . ARG F  1 90  ? 39.415  67.727  30.900  1.00 32.06  ? 149 ARG F C   1 
ATOM   5471 O  O   . ARG F  1 90  ? 38.629  67.240  30.102  1.00 31.12  ? 149 ARG F O   1 
ATOM   5472 C  CB  . ARG F  1 90  ? 40.403  69.989  30.715  1.00 33.87  ? 149 ARG F CB  1 
ATOM   5473 C  CG  . ARG F  1 90  ? 41.624  70.915  30.409  1.00 34.68  ? 149 ARG F CG  1 
ATOM   5474 C  CD  . ARG F  1 90  ? 42.830  70.635  31.315  1.00 34.97  ? 149 ARG F CD  1 
ATOM   5475 N  NE  . ARG F  1 90  ? 42.500  70.846  32.717  1.00 36.17  ? 149 ARG F NE  1 
ATOM   5476 C  CZ  . ARG F  1 90  ? 42.675  71.983  33.401  1.00 38.61  ? 149 ARG F CZ  1 
ATOM   5477 N  NH1 . ARG F  1 90  ? 43.225  73.064  32.845  1.00 38.86  ? 149 ARG F NH1 1 
ATOM   5478 N  NH2 . ARG F  1 90  ? 42.319  72.038  34.693  1.00 39.81  ? 149 ARG F NH2 1 
ATOM   5479 N  N   . LEU F  1 91  ? 39.272  67.632  32.212  1.00 33.28  ? 150 LEU F N   1 
ATOM   5480 C  CA  . LEU F  1 91  ? 38.148  66.958  32.821  1.00 33.40  ? 150 LEU F CA  1 
ATOM   5481 C  C   . LEU F  1 91  ? 37.078  67.996  33.029  1.00 34.98  ? 150 LEU F C   1 
ATOM   5482 O  O   . LEU F  1 91  ? 37.246  68.907  33.824  1.00 36.53  ? 150 LEU F O   1 
ATOM   5483 C  CB  . LEU F  1 91  ? 38.574  66.307  34.130  1.00 33.99  ? 150 LEU F CB  1 
ATOM   5484 C  CG  . LEU F  1 91  ? 39.549  65.122  33.934  1.00 33.49  ? 150 LEU F CG  1 
ATOM   5485 C  CD1 . LEU F  1 91  ? 39.775  64.285  35.180  1.00 33.44  ? 150 LEU F CD1 1 
ATOM   5486 C  CD2 . LEU F  1 91  ? 39.111  64.206  32.844  1.00 31.57  ? 150 LEU F CD2 1 
ATOM   5487 N  N   . GLY F  1 92  ? 35.973  67.875  32.290  1.00 35.09  ? 151 GLY F N   1 
ATOM   5488 C  CA  . GLY F  1 92  ? 34.958  68.948  32.206  1.00 36.79  ? 151 GLY F CA  1 
ATOM   5489 C  C   . GLY F  1 92  ? 34.382  69.376  33.544  1.00 38.88  ? 151 GLY F C   1 
ATOM   5490 O  O   . GLY F  1 92  ? 33.770  70.433  33.703  1.00 40.77  ? 151 GLY F O   1 
ATOM   5491 N  N   . CYS F  1 93  ? 34.613  68.555  34.528  1.00 39.12  ? 152 CYS F N   1 
ATOM   5492 C  CA  . CYS F  1 93  ? 33.992  68.779  35.809  1.00 41.85  ? 152 CYS F CA  1 
ATOM   5493 C  C   . CYS F  1 93  ? 34.836  69.616  36.727  1.00 42.63  ? 152 CYS F C   1 
ATOM   5494 O  O   . CYS F  1 93  ? 34.387  70.011  37.790  1.00 44.10  ? 152 CYS F O   1 
ATOM   5495 C  CB  . CYS F  1 93  ? 33.627  67.439  36.457  1.00 42.14  ? 152 CYS F CB  1 
ATOM   5496 S  SG  . CYS F  1 93  ? 34.995  66.438  37.243  1.00 43.70  ? 152 CYS F SG  1 
ATOM   5497 N  N   . GLN F  1 94  ? 36.067  69.867  36.307  1.00 41.46  ? 153 GLN F N   1 
ATOM   5498 C  CA  . GLN F  1 94  ? 36.932  70.801  36.988  1.00 42.90  ? 153 GLN F CA  1 
ATOM   5499 C  C   . GLN F  1 94  ? 36.972  72.165  36.287  1.00 43.27  ? 153 GLN F C   1 
ATOM   5500 O  O   . GLN F  1 94  ? 37.515  73.128  36.831  1.00 44.94  ? 153 GLN F O   1 
ATOM   5501 C  CB  . GLN F  1 94  ? 38.329  70.226  37.080  1.00 41.71  ? 153 GLN F CB  1 
ATOM   5502 C  CG  . GLN F  1 94  ? 38.396  68.933  37.845  1.00 41.85  ? 153 GLN F CG  1 
ATOM   5503 C  CD  . GLN F  1 94  ? 37.956  69.078  39.274  1.00 44.04  ? 153 GLN F CD  1 
ATOM   5504 O  OE1 . GLN F  1 94  ? 38.525  69.858  40.033  1.00 45.80  ? 153 GLN F OE1 1 
ATOM   5505 N  NE2 . GLN F  1 94  ? 36.950  68.315  39.653  1.00 44.49  ? 153 GLN F NE2 1 
ATOM   5506 N  N   . ILE F  1 95  ? 36.366  72.255  35.107  1.00 42.03  ? 154 ILE F N   1 
ATOM   5507 C  CA  . ILE F  1 95  ? 36.374  73.485  34.338  1.00 42.37  ? 154 ILE F CA  1 
ATOM   5508 C  C   . ILE F  1 95  ? 35.085  74.269  34.527  1.00 44.82  ? 154 ILE F C   1 
ATOM   5509 O  O   . ILE F  1 95  ? 34.000  73.812  34.147  1.00 45.25  ? 154 ILE F O   1 
ATOM   5510 C  CB  . ILE F  1 95  ? 36.564  73.192  32.865  1.00 40.25  ? 154 ILE F CB  1 
ATOM   5511 C  CG1 . ILE F  1 95  ? 37.878  72.409  32.669  1.00 38.84  ? 154 ILE F CG1 1 
ATOM   5512 C  CG2 . ILE F  1 95  ? 36.512  74.472  32.071  1.00 39.54  ? 154 ILE F CG2 1 
ATOM   5513 C  CD1 . ILE F  1 95  ? 39.082  72.964  33.416  1.00 39.15  ? 154 ILE F CD1 1 
ATOM   5514 N  N   . CYS F  1 96  ? 35.220  75.459  35.101  1.00 46.72  ? 155 CYS F N   1 
ATOM   5515 C  CA  . CYS F  1 96  ? 34.095  76.329  35.372  1.00 49.27  ? 155 CYS F CA  1 
ATOM   5516 C  C   . CYS F  1 96  ? 33.913  77.393  34.301  1.00 49.10  ? 155 CYS F C   1 
ATOM   5517 O  O   . CYS F  1 96  ? 34.863  77.949  33.792  1.00 48.43  ? 155 CYS F O   1 
ATOM   5518 C  CB  . CYS F  1 96  ? 34.286  76.975  36.738  1.00 52.23  ? 155 CYS F CB  1 
ATOM   5519 S  SG  . CYS F  1 96  ? 33.970  75.768  38.091  1.00 56.27  ? 155 CYS F SG  1 
ATOM   5520 N  N   . LEU F  1 97  ? 32.664  77.663  33.964  1.00 50.31  ? 156 LEU F N   1 
ATOM   5521 C  CA  . LEU F  1 97  ? 32.335  78.647  32.945  1.00 50.78  ? 156 LEU F CA  1 
ATOM   5522 C  C   . LEU F  1 97  ? 32.727  80.056  33.367  1.00 52.76  ? 156 LEU F C   1 
ATOM   5523 O  O   . LEU F  1 97  ? 32.392  80.499  34.478  1.00 54.97  ? 156 LEU F O   1 
ATOM   5524 C  CB  . LEU F  1 97  ? 30.825  78.628  32.641  1.00 52.29  ? 156 LEU F CB  1 
ATOM   5525 C  CG  . LEU F  1 97  ? 30.277  77.366  31.970  1.00 50.42  ? 156 LEU F CG  1 
ATOM   5526 C  CD1 . LEU F  1 97  ? 28.804  77.518  31.702  1.00 51.47  ? 156 LEU F CD1 1 
ATOM   5527 C  CD2 . LEU F  1 97  ? 31.007  77.050  30.686  1.00 48.05  ? 156 LEU F CD2 1 
ATOM   5528 N  N   . THR F  1 98  ? 33.437  80.745  32.472  1.00 51.98  ? 157 THR F N   1 
ATOM   5529 C  CA  . THR F  1 98  ? 33.727  82.167  32.633  1.00 54.20  ? 157 THR F CA  1 
ATOM   5530 C  C   . THR F  1 98  ? 33.046  82.927  31.516  1.00 55.01  ? 157 THR F C   1 
ATOM   5531 O  O   . THR F  1 98  ? 32.711  82.355  30.486  1.00 53.47  ? 157 THR F O   1 
ATOM   5532 C  CB  . THR F  1 98  ? 35.233  82.462  32.585  1.00 53.23  ? 157 THR F CB  1 
ATOM   5533 O  OG1 . THR F  1 98  ? 35.763  82.027  31.327  1.00 51.46  ? 157 THR F OG1 1 
ATOM   5534 C  CG2 . THR F  1 98  ? 35.945  81.746  33.718  1.00 52.51  ? 157 THR F CG2 1 
ATOM   5535 N  N   . LYS F  1 99  ? 32.843  84.219  31.728  1.00 57.88  ? 158 LYS F N   1 
ATOM   5536 C  CA  . LYS F  1 99  ? 32.154  85.062  30.742  1.00 59.35  ? 158 LYS F CA  1 
ATOM   5537 C  C   . LYS F  1 99  ? 32.814  84.927  29.338  1.00 57.18  ? 158 LYS F C   1 
ATOM   5538 O  O   . LYS F  1 99  ? 32.146  84.929  28.312  1.00 57.58  ? 158 LYS F O   1 
ATOM   5539 C  CB  . LYS F  1 99  ? 32.121  86.525  31.218  1.00 62.41  ? 158 LYS F CB  1 
ATOM   5540 C  CG  . LYS F  1 99  ? 30.799  87.245  30.931  1.00 66.11  ? 158 LYS F CG  1 
ATOM   5541 N  N   . SER F  1 100 ? 34.123  84.759  29.293  1.00 55.28  ? 159 SER F N   1 
ATOM   5542 C  CA  . SER F  1 100 ? 34.823  84.726  28.008  1.00 53.89  ? 159 SER F CA  1 
ATOM   5543 C  C   . SER F  1 100 ? 34.614  83.412  27.232  1.00 51.48  ? 159 SER F C   1 
ATOM   5544 O  O   . SER F  1 100 ? 35.100  83.262  26.099  1.00 50.14  ? 159 SER F O   1 
ATOM   5545 C  CB  . SER F  1 100 ? 36.310  84.921  28.243  1.00 53.13  ? 159 SER F CB  1 
ATOM   5546 O  OG  . SER F  1 100 ? 36.778  83.843  29.028  1.00 52.29  ? 159 SER F OG  1 
ATOM   5547 N  N   . MET F  1 101 ? 33.915  82.463  27.849  1.00 50.94  ? 160 MET F N   1 
ATOM   5548 C  CA  . MET F  1 101 ? 33.628  81.180  27.202  1.00 49.08  ? 160 MET F CA  1 
ATOM   5549 C  C   . MET F  1 101 ? 32.360  81.206  26.340  1.00 50.20  ? 160 MET F C   1 
ATOM   5550 O  O   . MET F  1 101 ? 32.019  80.208  25.712  1.00 49.04  ? 160 MET F O   1 
ATOM   5551 C  CB  . MET F  1 101 ? 33.516  80.049  28.248  1.00 48.10  ? 160 MET F CB  1 
ATOM   5552 C  CG  . MET F  1 101 ? 34.839  79.556  28.810  1.00 46.46  ? 160 MET F CG  1 
ATOM   5553 S  SD  . MET F  1 101 ? 34.628  78.242  30.042  1.00 47.59  ? 160 MET F SD  1 
ATOM   5554 C  CE  . MET F  1 101 ? 36.215  78.368  30.907  1.00 46.50  ? 160 MET F CE  1 
ATOM   5555 N  N   . ASP F  1 102 ? 31.646  82.326  26.315  1.00 52.86  ? 161 ASP F N   1 
ATOM   5556 C  CA  . ASP F  1 102 ? 30.387  82.388  25.570  1.00 54.41  ? 161 ASP F CA  1 
ATOM   5557 C  C   . ASP F  1 102 ? 30.592  81.949  24.110  1.00 53.12  ? 161 ASP F C   1 
ATOM   5558 O  O   . ASP F  1 102 ? 31.539  82.382  23.454  1.00 52.22  ? 161 ASP F O   1 
ATOM   5559 C  CB  . ASP F  1 102 ? 29.796  83.800  25.655  1.00 57.51  ? 161 ASP F CB  1 
ATOM   5560 C  CG  . ASP F  1 102 ? 28.314  83.857  25.274  1.00 60.24  ? 161 ASP F CG  1 
ATOM   5561 O  OD1 . ASP F  1 102 ? 27.505  83.036  25.762  1.00 59.76  ? 161 ASP F OD1 1 
ATOM   5562 O  OD2 . ASP F  1 102 ? 27.949  84.774  24.512  1.00 64.00  ? 161 ASP F OD2 1 
ATOM   5563 N  N   . ASN F  1 103 ? 29.716  81.061  23.643  1.00 53.08  ? 162 ASN F N   1 
ATOM   5564 C  CA  . ASN F  1 103 ? 29.767  80.484  22.294  1.00 52.52  ? 162 ASN F CA  1 
ATOM   5565 C  C   . ASN F  1 103 ? 30.985  79.611  21.976  1.00 49.60  ? 162 ASN F C   1 
ATOM   5566 O  O   . ASN F  1 103 ? 31.293  79.387  20.812  1.00 49.38  ? 162 ASN F O   1 
ATOM   5567 C  CB  . ASN F  1 103 ? 29.597  81.565  21.227  1.00 54.70  ? 162 ASN F CB  1 
ATOM   5568 C  CG  . ASN F  1 103 ? 28.144  82.001  21.060  1.00 58.33  ? 162 ASN F CG  1 
ATOM   5569 O  OD1 . ASN F  1 103 ? 27.267  81.183  20.763  1.00 58.35  ? 162 ASN F OD1 1 
ATOM   5570 N  ND2 . ASN F  1 103 ? 27.890  83.301  21.224  1.00 60.17  ? 162 ASN F ND2 1 
ATOM   5571 N  N   . MET F  1 104 ? 31.663  79.099  22.997  1.00 47.69  ? 163 MET F N   1 
ATOM   5572 C  CA  . MET F  1 104 ? 32.701  78.097  22.759  1.00 45.32  ? 163 MET F CA  1 
ATOM   5573 C  C   . MET F  1 104 ? 32.074  76.760  22.376  1.00 44.53  ? 163 MET F C   1 
ATOM   5574 O  O   . MET F  1 104 ? 30.929  76.468  22.682  1.00 45.33  ? 163 MET F O   1 
ATOM   5575 C  CB  . MET F  1 104 ? 33.608  77.904  23.984  1.00 43.75  ? 163 MET F CB  1 
ATOM   5576 C  CG  . MET F  1 104 ? 32.947  77.222  25.146  1.00 43.65  ? 163 MET F CG  1 
ATOM   5577 S  SD  . MET F  1 104 ? 34.133  76.857  26.404  1.00 42.22  ? 163 MET F SD  1 
ATOM   5578 C  CE  . MET F  1 104 ? 33.129  75.920  27.560  1.00 41.78  ? 163 MET F CE  1 
ATOM   5579 N  N   . THR F  1 105 ? 32.870  75.938  21.726  1.00 43.39  ? 164 THR F N   1 
ATOM   5580 C  CA  . THR F  1 105 ? 32.488  74.570  21.389  1.00 42.29  ? 164 THR F CA  1 
ATOM   5581 C  C   . THR F  1 105 ? 33.455  73.613  22.095  1.00 39.92  ? 164 THR F C   1 
ATOM   5582 O  O   . THR F  1 105 ? 34.691  73.777  22.021  1.00 38.75  ? 164 THR F O   1 
ATOM   5583 C  CB  . THR F  1 105 ? 32.562  74.360  19.866  1.00 42.93  ? 164 THR F CB  1 
ATOM   5584 O  OG1 . THR F  1 105 ? 31.746  75.344  19.199  1.00 45.58  ? 164 THR F OG1 1 
ATOM   5585 C  CG2 . THR F  1 105 ? 32.092  72.986  19.499  1.00 42.03  ? 164 THR F CG2 1 
ATOM   5586 N  N   . VAL F  1 106 ? 32.897  72.631  22.796  1.00 39.27  ? 165 VAL F N   1 
ATOM   5587 C  CA  . VAL F  1 106 ? 33.707  71.547  23.373  1.00 37.16  ? 165 VAL F CA  1 
ATOM   5588 C  C   . VAL F  1 106 ? 33.279  70.283  22.689  1.00 36.62  ? 165 VAL F C   1 
ATOM   5589 O  O   . VAL F  1 106 ? 32.157  70.190  22.263  1.00 37.96  ? 165 VAL F O   1 
ATOM   5590 C  CB  . VAL F  1 106 ? 33.534  71.411  24.899  1.00 36.90  ? 165 VAL F CB  1 
ATOM   5591 C  CG1 . VAL F  1 106 ? 34.030  72.656  25.601  1.00 37.34  ? 165 VAL F CG1 1 
ATOM   5592 C  CG2 . VAL F  1 106 ? 32.094  71.129  25.271  1.00 37.73  ? 165 VAL F CG2 1 
ATOM   5593 N  N   . ARG F  1 107 ? 34.182  69.329  22.537  1.00 35.34  ? 166 ARG F N   1 
ATOM   5594 C  CA  . ARG F  1 107 ? 33.824  68.042  21.949  1.00 35.12  ? 166 ARG F CA  1 
ATOM   5595 C  C   . ARG F  1 107 ? 33.914  66.919  22.982  1.00 33.82  ? 166 ARG F C   1 
ATOM   5596 O  O   . ARG F  1 107 ? 34.872  66.854  23.754  1.00 32.74  ? 166 ARG F O   1 
ATOM   5597 C  CB  . ARG F  1 107 ? 34.690  67.716  20.729  1.00 34.59  ? 166 ARG F CB  1 
ATOM   5598 C  CG  . ARG F  1 107 ? 34.393  66.365  20.154  1.00 34.67  ? 166 ARG F CG  1 
ATOM   5599 C  CD  . ARG F  1 107 ? 34.839  66.238  18.741  1.00 36.24  ? 166 ARG F CD  1 
ATOM   5600 N  NE  . ARG F  1 107 ? 36.290  66.186  18.632  1.00 35.79  ? 166 ARG F NE  1 
ATOM   5601 C  CZ  . ARG F  1 107 ? 37.032  65.116  18.896  1.00 34.74  ? 166 ARG F CZ  1 
ATOM   5602 N  NH1 . ARG F  1 107 ? 38.344  65.194  18.744  1.00 34.69  ? 166 ARG F NH1 1 
ATOM   5603 N  NH2 . ARG F  1 107 ? 36.469  63.977  19.308  1.00 33.88  ? 166 ARG F NH2 1 
ATOM   5604 N  N   . VAL F  1 108 ? 32.901  66.048  22.987  1.00 34.29  ? 167 VAL F N   1 
ATOM   5605 C  CA  . VAL F  1 108 ? 32.907  64.835  23.798  1.00 33.47  ? 167 VAL F CA  1 
ATOM   5606 C  C   . VAL F  1 108 ? 33.599  63.755  22.974  1.00 33.00  ? 167 VAL F C   1 
ATOM   5607 O  O   . VAL F  1 108 ? 33.101  63.369  21.911  1.00 34.10  ? 167 VAL F O   1 
ATOM   5608 C  CB  . VAL F  1 108 ? 31.507  64.313  24.136  1.00 34.63  ? 167 VAL F CB  1 
ATOM   5609 C  CG1 . VAL F  1 108 ? 31.620  63.288  25.230  1.00 33.32  ? 167 VAL F CG1 1 
ATOM   5610 C  CG2 . VAL F  1 108 ? 30.565  65.431  24.547  1.00 35.72  ? 167 VAL F CG2 1 
ATOM   5611 N  N   . PRO F  1 109 ? 34.762  63.291  23.436  1.00 31.62  ? 168 PRO F N   1 
ATOM   5612 C  CA  . PRO F  1 109 ? 35.545  62.305  22.685  1.00 31.07  ? 168 PRO F CA  1 
ATOM   5613 C  C   . PRO F  1 109 ? 34.987  60.924  22.840  1.00 30.63  ? 168 PRO F C   1 
ATOM   5614 O  O   . PRO F  1 109 ? 34.227  60.694  23.753  1.00 30.52  ? 168 PRO F O   1 
ATOM   5615 C  CB  . PRO F  1 109 ? 36.941  62.402  23.327  1.00 29.97  ? 168 PRO F CB  1 
ATOM   5616 C  CG  . PRO F  1 109 ? 36.691  62.876  24.725  1.00 29.85  ? 168 PRO F CG  1 
ATOM   5617 C  CD  . PRO F  1 109 ? 35.378  63.625  24.738  1.00 30.78  ? 168 PRO F CD  1 
ATOM   5618 N  N   . GLU F  1 110 ? 35.365  60.010  21.961  1.00 30.90  ? 169 GLU F N   1 
ATOM   5619 C  CA  . GLU F  1 110 ? 34.876  58.632  22.045  1.00 31.44  ? 169 GLU F CA  1 
ATOM   5620 C  C   . GLU F  1 110 ? 35.463  57.887  23.236  1.00 29.99  ? 169 GLU F C   1 
ATOM   5621 O  O   . GLU F  1 110 ? 36.536  58.179  23.662  1.00 28.69  ? 169 GLU F O   1 
ATOM   5622 C  CB  . GLU F  1 110 ? 35.177  57.860  20.756  1.00 32.38  ? 169 GLU F CB  1 
ATOM   5623 C  CG  . GLU F  1 110 ? 36.631  57.536  20.532  1.00 32.25  ? 169 GLU F CG  1 
ATOM   5624 C  CD  . GLU F  1 110 ? 36.907  56.633  19.311  1.00 35.71  ? 169 GLU F CD  1 
ATOM   5625 O  OE1 . GLU F  1 110 ? 38.120  56.546  18.958  1.00 35.94  ? 169 GLU F OE1 1 
ATOM   5626 O  OE2 . GLU F  1 110 ? 35.956  56.013  18.720  1.00 37.35  ? 169 GLU F OE2 1 
ATOM   5627 N  N   . THR F  1 111 ? 34.728  56.931  23.767  1.00 30.40  ? 170 THR F N   1 
ATOM   5628 C  CA  . THR F  1 111 ? 35.197  56.161  24.888  1.00 29.66  ? 170 THR F CA  1 
ATOM   5629 C  C   . THR F  1 111 ? 35.974  54.962  24.383  1.00 29.34  ? 170 THR F C   1 
ATOM   5630 O  O   . THR F  1 111 ? 35.934  54.633  23.193  1.00 30.12  ? 170 THR F O   1 
ATOM   5631 C  CB  . THR F  1 111 ? 34.013  55.657  25.714  1.00 30.36  ? 170 THR F CB  1 
ATOM   5632 O  OG1 . THR F  1 111 ? 33.295  54.677  24.954  1.00 31.39  ? 170 THR F OG1 1 
ATOM   5633 C  CG2 . THR F  1 111 ? 33.094  56.810  26.088  1.00 29.89  ? 170 THR F CG2 1 
ATOM   5634 N  N   . VAL F  1 112 ? 36.653  54.291  25.295  1.00 28.44  ? 171 VAL F N   1 
ATOM   5635 C  CA  . VAL F  1 112 ? 37.368  53.073  24.962  1.00 28.44  ? 171 VAL F CA  1 
ATOM   5636 C  C   . VAL F  1 112 ? 36.411  52.031  24.391  1.00 29.16  ? 171 VAL F C   1 
ATOM   5637 O  O   . VAL F  1 112 ? 36.792  51.248  23.544  1.00 28.99  ? 171 VAL F O   1 
ATOM   5638 C  CB  . VAL F  1 112 ? 38.140  52.497  26.219  1.00 28.08  ? 171 VAL F CB  1 
ATOM   5639 C  CG1 . VAL F  1 112 ? 37.155  51.952  27.302  1.00 27.58  ? 171 VAL F CG1 1 
ATOM   5640 C  CG2 . VAL F  1 112 ? 39.125  51.440  25.797  1.00 26.84  ? 171 VAL F CG2 1 
ATOM   5641 N  N   . ALA F  1 113 ? 35.171  52.039  24.869  1.00 29.95  ? 172 ALA F N   1 
ATOM   5642 C  CA  . ALA F  1 113 ? 34.170  51.074  24.408  1.00 31.57  ? 172 ALA F CA  1 
ATOM   5643 C  C   . ALA F  1 113 ? 33.780  51.342  22.959  1.00 32.98  ? 172 ALA F C   1 
ATOM   5644 O  O   . ALA F  1 113 ? 33.583  50.403  22.195  1.00 34.82  ? 172 ALA F O   1 
ATOM   5645 C  CB  . ALA F  1 113 ? 32.955  51.080  25.296  1.00 31.36  ? 172 ALA F CB  1 
ATOM   5646 N  N   . ASP F  1 114 ? 33.707  52.614  22.575  1.00 33.34  ? 173 ASP F N   1 
ATOM   5647 C  CA  . ASP F  1 114 ? 33.370  52.974  21.193  1.00 34.66  ? 173 ASP F CA  1 
ATOM   5648 C  C   . ASP F  1 114 ? 34.426  52.440  20.265  1.00 34.45  ? 173 ASP F C   1 
ATOM   5649 O  O   . ASP F  1 114 ? 34.105  51.975  19.181  1.00 35.75  ? 173 ASP F O   1 
ATOM   5650 C  CB  . ASP F  1 114 ? 33.213  54.496  21.011  1.00 34.83  ? 173 ASP F CB  1 
ATOM   5651 C  CG  . ASP F  1 114 ? 32.092  55.097  21.901  1.00 37.03  ? 173 ASP F CG  1 
ATOM   5652 O  OD1 . ASP F  1 114 ? 31.008  54.460  22.026  1.00 39.28  ? 173 ASP F OD1 1 
ATOM   5653 O  OD2 . ASP F  1 114 ? 32.302  56.194  22.491  1.00 37.70  ? 173 ASP F OD2 1 
ATOM   5654 N  N   . ALA F  1 115 ? 35.678  52.460  20.722  1.00 33.00  ? 174 ALA F N   1 
ATOM   5655 C  CA  . ALA F  1 115 ? 36.827  52.131  19.868  1.00 33.34  ? 174 ALA F CA  1 
ATOM   5656 C  C   . ALA F  1 115 ? 37.051  50.650  19.781  1.00 34.69  ? 174 ALA F C   1 
ATOM   5657 O  O   . ALA F  1 115 ? 37.648  50.160  18.844  1.00 36.09  ? 174 ALA F O   1 
ATOM   5658 C  CB  . ALA F  1 115 ? 38.065  52.777  20.399  1.00 31.58  ? 174 ALA F CB  1 
ATOM   5659 N  N   . ARG F  1 116 ? 36.592  49.930  20.789  1.00 35.16  ? 175 ARG F N   1 
ATOM   5660 C  CA  . ARG F  1 116 ? 36.951  48.534  20.941  1.00 35.77  ? 175 ARG F CA  1 
ATOM   5661 C  C   . ARG F  1 116 ? 36.267  47.719  19.847  1.00 38.63  ? 175 ARG F C   1 
ATOM   5662 O  O   . ARG F  1 116 ? 35.033  47.721  19.753  1.00 38.80  ? 175 ARG F O   1 
ATOM   5663 C  CB  . ARG F  1 116 ? 36.519  48.039  22.340  1.00 34.68  ? 175 ARG F CB  1 
ATOM   5664 C  CG  . ARG F  1 116 ? 36.762  46.578  22.576  1.00 33.47  ? 175 ARG F CG  1 
ATOM   5665 C  CD  . ARG F  1 116 ? 36.348  46.130  23.923  1.00 31.03  ? 175 ARG F CD  1 
ATOM   5666 N  NE  . ARG F  1 116 ? 37.062  46.861  24.955  1.00 29.00  ? 175 ARG F NE  1 
ATOM   5667 C  CZ  . ARG F  1 116 ? 36.516  47.658  25.869  1.00 29.51  ? 175 ARG F CZ  1 
ATOM   5668 N  NH1 . ARG F  1 116 ? 37.321  48.265  26.752  1.00 29.55  ? 175 ARG F NH1 1 
ATOM   5669 N  NH2 . ARG F  1 116 ? 35.185  47.853  25.922  1.00 30.51  ? 175 ARG F NH2 1 
ATOM   5670 N  N   . GLN F  1 117 ? 37.057  47.027  19.027  1.00 41.00  ? 176 GLN F N   1 
ATOM   5671 C  CA  . GLN F  1 117 ? 36.474  46.139  18.027  1.00 44.60  ? 176 GLN F CA  1 
ATOM   5672 C  C   . GLN F  1 117 ? 36.226  44.745  18.623  1.00 45.50  ? 176 GLN F C   1 
ATOM   5673 O  O   . GLN F  1 117 ? 35.230  44.094  18.297  1.00 47.38  ? 176 GLN F O   1 
ATOM   5674 C  CB  . GLN F  1 117 ? 37.324  46.115  16.748  1.00 46.80  ? 176 GLN F CB  1 
ATOM   5675 C  CG  . GLN F  1 117 ? 37.497  47.525  16.062  1.00 47.51  ? 176 GLN F CG  1 
ATOM   5676 N  N   . SER F  1 118 ? 37.095  44.302  19.528  1.00 44.75  ? 177 SER F N   1 
ATOM   5677 C  CA  . SER F  1 118 ? 36.848  43.043  20.242  1.00 45.47  ? 177 SER F CA  1 
ATOM   5678 C  C   . SER F  1 118 ? 37.466  42.988  21.628  1.00 43.51  ? 177 SER F C   1 
ATOM   5679 O  O   . SER F  1 118 ? 38.315  43.793  21.969  1.00 45.06  ? 177 SER F O   1 
ATOM   5680 C  CB  . SER F  1 118 ? 37.426  41.890  19.447  1.00 47.53  ? 177 SER F CB  1 
ATOM   5681 O  OG  . SER F  1 118 ? 38.820  42.070  19.341  1.00 49.26  ? 177 SER F OG  1 
ATOM   5682 N  N   . ILE F  1 119 ? 37.046  41.983  22.402  1.00 42.72  ? 178 ILE F N   1 
ATOM   5683 C  CA  . ILE F  1 119 ? 37.445  41.828  23.799  1.00 39.47  ? 178 ILE F CA  1 
ATOM   5684 C  C   . ILE F  1 119 ? 38.672  40.958  23.814  1.00 39.20  ? 178 ILE F C   1 
ATOM   5685 O  O   . ILE F  1 119 ? 38.734  39.965  23.090  1.00 40.40  ? 178 ILE F O   1 
ATOM   5686 C  CB  . ILE F  1 119 ? 36.298  41.207  24.584  1.00 39.73  ? 178 ILE F CB  1 
ATOM   5687 C  CG1 . ILE F  1 119 ? 35.238  42.285  24.820  1.00 40.49  ? 178 ILE F CG1 1 
ATOM   5688 C  CG2 . ILE F  1 119 ? 36.721  40.692  25.919  1.00 37.96  ? 178 ILE F CG2 1 
ATOM   5689 C  CD1 . ILE F  1 119 ? 33.960  41.776  25.483  1.00 42.86  ? 178 ILE F CD1 1 
ATOM   5690 N  N   . ASP F  1 120 ? 39.677  41.331  24.603  1.00 36.94  ? 179 ASP F N   1 
ATOM   5691 C  CA  . ASP F  1 120 ? 40.860  40.480  24.693  1.00 36.81  ? 179 ASP F CA  1 
ATOM   5692 C  C   . ASP F  1 120 ? 40.634  39.158  25.449  1.00 35.81  ? 179 ASP F C   1 
ATOM   5693 O  O   . ASP F  1 120 ? 39.715  38.994  26.244  1.00 34.17  ? 179 ASP F O   1 
ATOM   5694 C  CB  . ASP F  1 120 ? 42.048  41.225  25.300  1.00 36.56  ? 179 ASP F CB  1 
ATOM   5695 C  CG  . ASP F  1 120 ? 42.703  42.254  24.327  1.00 40.29  ? 179 ASP F CG  1 
ATOM   5696 O  OD1 . ASP F  1 120 ? 42.200  42.471  23.186  1.00 42.55  ? 179 ASP F OD1 1 
ATOM   5697 O  OD2 . ASP F  1 120 ? 43.723  42.880  24.743  1.00 45.52  ? 179 ASP F OD2 1 
ATOM   5698 N  N   . VAL F  1 121 ? 41.519  38.219  25.148  1.00 36.12  ? 180 VAL F N   1 
ATOM   5699 C  CA  . VAL F  1 121 ? 41.633  36.961  25.846  1.00 36.45  ? 180 VAL F CA  1 
ATOM   5700 C  C   . VAL F  1 121 ? 42.301  37.224  27.175  1.00 36.04  ? 180 VAL F C   1 
ATOM   5701 O  O   . VAL F  1 121 ? 43.406  37.755  27.237  1.00 35.92  ? 180 VAL F O   1 
ATOM   5702 C  CB  . VAL F  1 121 ? 42.521  35.955  25.065  1.00 38.39  ? 180 VAL F CB  1 
ATOM   5703 C  CG1 . VAL F  1 121 ? 42.831  34.744  25.933  1.00 37.67  ? 180 VAL F CG1 1 
ATOM   5704 C  CG2 . VAL F  1 121 ? 41.892  35.560  23.759  1.00 36.76  ? 180 VAL F CG2 1 
ATOM   5705 N  N   . GLY F  1 122 ? 41.619  36.845  28.236  1.00 36.64  ? 181 GLY F N   1 
ATOM   5706 C  CA  . GLY F  1 122 ? 42.093  37.067  29.594  1.00 36.73  ? 181 GLY F CA  1 
ATOM   5707 C  C   . GLY F  1 122 ? 43.021  35.964  30.010  1.00 38.25  ? 181 GLY F C   1 
ATOM   5708 O  O   . GLY F  1 122 ? 42.851  34.817  29.638  1.00 40.18  ? 181 GLY F O   1 
ATOM   5709 N  N   . LYS F  1 123 ? 43.986  36.311  30.828  1.00 38.48  ? 182 LYS F N   1 
ATOM   5710 C  CA  . LYS F  1 123 ? 45.129  35.456  31.040  1.00 40.35  ? 182 LYS F CA  1 
ATOM   5711 C  C   . LYS F  1 123 ? 45.740  35.958  32.326  1.00 40.04  ? 182 LYS F C   1 
ATOM   5712 O  O   . LYS F  1 123 ? 45.913  37.164  32.468  1.00 38.31  ? 182 LYS F O   1 
ATOM   5713 C  CB  . LYS F  1 123 ? 46.049  35.705  29.859  1.00 40.77  ? 182 LYS F CB  1 
ATOM   5714 C  CG  . LYS F  1 123 ? 47.101  34.706  29.588  1.00 44.35  ? 182 LYS F CG  1 
ATOM   5715 C  CD  . LYS F  1 123 ? 47.840  35.076  28.291  1.00 46.96  ? 182 LYS F CD  1 
ATOM   5716 C  CE  . LYS F  1 123 ? 48.668  36.360  28.428  1.00 47.57  ? 182 LYS F CE  1 
ATOM   5717 N  NZ  . LYS F  1 123 ? 48.545  37.257  27.259  1.00 47.97  ? 182 LYS F NZ  1 
ATOM   5718 N  N   . THR F  1 124 ? 46.014  35.079  33.282  1.00 41.89  ? 183 THR F N   1 
ATOM   5719 C  CA  . THR F  1 124 ? 46.686  35.515  34.513  1.00 42.85  ? 183 THR F CA  1 
ATOM   5720 C  C   . THR F  1 124 ? 48.200  35.370  34.353  1.00 45.36  ? 183 THR F C   1 
ATOM   5721 O  O   . THR F  1 124 ? 48.931  36.299  34.684  1.00 46.14  ? 183 THR F O   1 
ATOM   5722 C  CB  . THR F  1 124 ? 46.171  34.823  35.791  1.00 44.06  ? 183 THR F CB  1 
ATOM   5723 O  OG1 . THR F  1 124 ? 46.163  33.422  35.606  1.00 44.47  ? 183 THR F OG1 1 
ATOM   5724 C  CG2 . THR F  1 124 ? 44.747  35.285  36.149  1.00 41.66  ? 183 THR F CG2 1 
ATOM   5725 N  N   . SER F  1 125 ? 48.690  34.262  33.797  1.00 47.53  ? 184 SER F N   1 
ATOM   5726 C  CA  . SER F  1 125 ? 50.118  34.214  33.345  1.00 49.75  ? 184 SER F CA  1 
ATOM   5727 C  C   . SER F  1 125 ? 50.374  33.716  31.893  1.00 49.98  ? 184 SER F C   1 
ATOM   5728 O  O   . SER F  1 125 ? 49.507  33.093  31.251  1.00 50.10  ? 184 SER F O   1 
ATOM   5729 C  CB  . SER F  1 125 ? 50.947  33.367  34.305  1.00 52.42  ? 184 SER F CB  1 
ATOM   5730 O  OG  . SER F  1 125 ? 50.336  32.104  34.491  1.00 55.46  ? 184 SER F OG  1 
ATOM   5731 N  N   . ALA F  1 126 ? 51.582  33.967  31.396  1.00 109.07 ? 185 ALA F N   1 
ATOM   5732 C  CA  . ALA F  1 126 ? 52.000  33.417  30.111  1.00 98.81  ? 185 ALA F CA  1 
ATOM   5733 C  C   . ALA F  1 126 ? 52.479  31.988  30.283  1.00 92.81  ? 185 ALA F C   1 
ATOM   5734 O  O   . ALA F  1 126 ? 53.133  31.458  29.399  1.00 88.95  ? 185 ALA F O   1 
ATOM   5735 C  CB  . ALA F  1 126 ? 53.107  34.267  29.509  1.00 101.91 ? 185 ALA F CB  1 
ATOM   5736 N  N   . GLU F  1 127 ? 52.123  31.354  31.397  1.00 93.28  ? 186 GLU F N   1 
ATOM   5737 C  CA  . GLU F  1 127 ? 52.787  30.141  31.830  1.00 91.02  ? 186 GLU F CA  1 
ATOM   5738 C  C   . GLU F  1 127 ? 51.999  28.876  31.533  1.00 84.68  ? 186 GLU F C   1 
ATOM   5739 O  O   . GLU F  1 127 ? 50.808  28.807  31.798  1.00 84.52  ? 186 GLU F O   1 
ATOM   5740 C  CB  . GLU F  1 127 ? 53.079  30.210  33.321  1.00 98.10  ? 186 GLU F CB  1 
ATOM   5741 C  CG  . GLU F  1 127 ? 54.217  29.306  33.744  1.00 100.78 ? 186 GLU F CG  1 
ATOM   5742 C  CD  . GLU F  1 127 ? 54.113  28.877  35.195  1.00 106.09 ? 186 GLU F CD  1 
ATOM   5743 O  OE1 . GLU F  1 127 ? 53.944  29.753  36.074  1.00 113.53 ? 186 GLU F OE1 1 
ATOM   5744 O  OE2 . GLU F  1 127 ? 54.196  27.657  35.454  1.00 103.70 ? 186 GLU F OE2 1 
ATOM   5745 N  N   . ASN F  1 128 ? 52.705  27.886  30.986  1.00 82.24  ? 187 ASN F N   1 
ATOM   5746 C  CA  . ASN F  1 128 ? 52.188  26.542  30.743  1.00 79.94  ? 187 ASN F CA  1 
ATOM   5747 C  C   . ASN F  1 128 ? 51.707  25.854  32.001  1.00 81.40  ? 187 ASN F C   1 
ATOM   5748 O  O   . ASN F  1 128 ? 52.353  25.937  33.050  1.00 84.26  ? 187 ASN F O   1 
ATOM   5749 C  CB  . ASN F  1 128 ? 53.273  25.651  30.143  1.00 81.86  ? 187 ASN F CB  1 
ATOM   5750 C  CG  . ASN F  1 128 ? 53.373  25.767  28.650  1.00 80.69  ? 187 ASN F CG  1 
ATOM   5751 O  OD1 . ASN F  1 128 ? 52.556  26.406  27.996  1.00 76.38  ? 187 ASN F OD1 1 
ATOM   5752 N  ND2 . ASN F  1 128 ? 54.377  25.118  28.090  1.00 86.36  ? 187 ASN F ND2 1 
ATOM   5753 N  N   . LEU F  1 129 ? 50.587  25.147  31.873  1.00 81.02  ? 188 LEU F N   1 
ATOM   5754 C  CA  . LEU F  1 129 ? 50.001  24.417  32.989  1.00 83.22  ? 188 LEU F CA  1 
ATOM   5755 C  C   . LEU F  1 129 ? 50.934  23.299  33.456  1.00 84.32  ? 188 LEU F C   1 
ATOM   5756 O  O   . LEU F  1 129 ? 51.036  23.025  34.653  1.00 85.77  ? 188 LEU F O   1 
ATOM   5757 C  CB  . LEU F  1 129 ? 48.634  23.852  32.593  1.00 85.77  ? 188 LEU F CB  1 
ATOM   5758 C  CG  . LEU F  1 129 ? 47.920  22.958  33.612  1.00 89.79  ? 188 LEU F CG  1 
ATOM   5759 C  CD1 . LEU F  1 129 ? 47.885  23.565  35.016  1.00 90.77  ? 188 LEU F CD1 1 
ATOM   5760 C  CD2 . LEU F  1 129 ? 46.520  22.699  33.113  1.00 96.17  ? 188 LEU F CD2 1 
ATOM   5761 N  N   . TYR F  1 130 ? 51.610  22.675  32.495  1.00 85.25  ? 189 TYR F N   1 
ATOM   5762 C  CA  . TYR F  1 130 ? 52.569  21.615  32.755  1.00 90.06  ? 189 TYR F CA  1 
ATOM   5763 C  C   . TYR F  1 130 ? 53.582  22.000  33.852  1.00 92.42  ? 189 TYR F C   1 
ATOM   5764 O  O   . TYR F  1 130 ? 53.946  21.161  34.689  1.00 96.28  ? 189 TYR F O   1 
ATOM   5765 C  CB  . TYR F  1 130 ? 53.277  21.232  31.446  1.00 93.97  ? 189 TYR F CB  1 
ATOM   5766 C  CG  . TYR F  1 130 ? 54.451  20.274  31.585  1.00 103.26 ? 189 TYR F CG  1 
ATOM   5767 C  CD1 . TYR F  1 130 ? 54.282  18.983  32.095  1.00 109.33 ? 189 TYR F CD1 1 
ATOM   5768 C  CD2 . TYR F  1 130 ? 55.733  20.653  31.176  1.00 108.96 ? 189 TYR F CD2 1 
ATOM   5769 C  CE1 . TYR F  1 130 ? 55.379  18.092  32.212  1.00 119.70 ? 189 TYR F CE1 1 
ATOM   5770 C  CE2 . TYR F  1 130 ? 56.821  19.787  31.288  1.00 120.83 ? 189 TYR F CE2 1 
ATOM   5771 C  CZ  . TYR F  1 130 ? 56.648  18.504  31.806  1.00 126.28 ? 189 TYR F CZ  1 
ATOM   5772 O  OH  . TYR F  1 130 ? 57.744  17.659  31.900  1.00 138.43 ? 189 TYR F OH  1 
ATOM   5773 N  N   . PHE F  1 131 ? 54.015  23.263  33.857  1.00 91.62  ? 190 PHE F N   1 
ATOM   5774 C  CA  . PHE F  1 131 ? 54.985  23.732  34.843  1.00 97.10  ? 190 PHE F CA  1 
ATOM   5775 C  C   . PHE F  1 131 ? 54.313  24.051  36.181  1.00 97.01  ? 190 PHE F C   1 
ATOM   5776 O  O   . PHE F  1 131 ? 54.868  23.751  37.244  1.00 102.44 ? 190 PHE F O   1 
ATOM   5777 C  CB  . PHE F  1 131 ? 55.767  24.955  34.326  1.00 100.09 ? 190 PHE F CB  1 
ATOM   5778 C  CG  . PHE F  1 131 ? 56.477  24.725  33.012  1.00 102.09 ? 190 PHE F CG  1 
ATOM   5779 C  CD1 . PHE F  1 131 ? 56.369  25.654  31.980  1.00 98.92  ? 190 PHE F CD1 1 
ATOM   5780 C  CD2 . PHE F  1 131 ? 57.246  23.580  32.799  1.00 108.73 ? 190 PHE F CD2 1 
ATOM   5781 C  CE1 . PHE F  1 131 ? 57.014  25.444  30.757  1.00 101.47 ? 190 PHE F CE1 1 
ATOM   5782 C  CE2 . PHE F  1 131 ? 57.888  23.368  31.581  1.00 113.34 ? 190 PHE F CE2 1 
ATOM   5783 C  CZ  . PHE F  1 131 ? 57.770  24.303  30.560  1.00 109.15 ? 190 PHE F CZ  1 
ATOM   5784 N  N   . GLN F  1 132 ? 53.127  24.658  36.138  1.00 93.03  ? 191 GLN F N   1 
ATOM   5785 C  CA  . GLN F  1 132 ? 52.443  25.048  37.368  1.00 95.76  ? 191 GLN F CA  1 
ATOM   5786 C  C   . GLN F  1 132 ? 51.720  23.859  37.974  1.00 94.67  ? 191 GLN F C   1 
ATOM   5787 O  O   . GLN F  1 132 ? 52.327  23.081  38.705  1.00 97.22  ? 191 GLN F O   1 
ATOM   5788 C  CB  . GLN F  1 132 ? 51.468  26.199  37.131  1.00 96.09  ? 191 GLN F CB  1 
ATOM   5789 C  CG  . GLN F  1 132 ? 51.205  27.026  38.413  1.00 104.45 ? 191 GLN F CG  1 
ATOM   5790 C  CD  . GLN F  1 132 ? 50.265  28.213  38.191  1.00 108.18 ? 191 GLN F CD  1 
ATOM   5791 O  OE1 . GLN F  1 132 ? 49.797  28.462  37.075  1.00 102.70 ? 191 GLN F OE1 1 
ATOM   5792 N  NE2 . GLN F  1 132 ? 49.986  28.948  39.263  1.00 118.27 ? 191 GLN F NE2 1 
ATOM   5793 N  N   . GLU G  1 5   ? 62.674  20.042  9.910   1.00 98.09  ? 64  GLU G N   1 
ATOM   5794 C  CA  . GLU G  1 5   ? 61.829  20.747  10.916  1.00 94.06  ? 64  GLU G CA  1 
ATOM   5795 C  C   . GLU G  1 5   ? 61.770  19.961  12.234  1.00 91.19  ? 64  GLU G C   1 
ATOM   5796 O  O   . GLU G  1 5   ? 61.668  18.720  12.246  1.00 90.70  ? 64  GLU G O   1 
ATOM   5797 C  CB  . GLU G  1 5   ? 60.408  20.989  10.375  1.00 90.76  ? 64  GLU G CB  1 
ATOM   5798 N  N   . ASP G  1 6   ? 61.815  20.708  13.336  1.00 89.43  ? 65  ASP G N   1 
ATOM   5799 C  CA  . ASP G  1 6   ? 61.968  20.139  14.681  1.00 87.38  ? 65  ASP G CA  1 
ATOM   5800 C  C   . ASP G  1 6   ? 60.672  19.519  15.228  1.00 81.86  ? 65  ASP G C   1 
ATOM   5801 O  O   . ASP G  1 6   ? 59.610  19.629  14.616  1.00 79.47  ? 65  ASP G O   1 
ATOM   5802 C  CB  . ASP G  1 6   ? 62.505  21.214  15.652  1.00 88.28  ? 65  ASP G CB  1 
ATOM   5803 C  CG  . ASP G  1 6   ? 63.924  21.677  15.292  1.00 94.42  ? 65  ASP G CG  1 
ATOM   5804 O  OD1 . ASP G  1 6   ? 64.920  20.981  15.633  1.00 97.66  ? 65  ASP G OD1 1 
ATOM   5805 O  OD2 . ASP G  1 6   ? 64.041  22.747  14.656  1.00 97.93  ? 65  ASP G OD2 1 
ATOM   5806 N  N   . LYS G  1 7   ? 60.789  18.850  16.376  1.00 79.76  ? 66  LYS G N   1 
ATOM   5807 C  CA  . LYS G  1 7   ? 59.650  18.259  17.072  1.00 75.28  ? 66  LYS G CA  1 
ATOM   5808 C  C   . LYS G  1 7   ? 59.436  18.929  18.420  1.00 72.77  ? 66  LYS G C   1 
ATOM   5809 O  O   . LYS G  1 7   ? 60.385  19.335  19.079  1.00 74.17  ? 66  LYS G O   1 
ATOM   5810 C  CB  . LYS G  1 7   ? 59.857  16.760  17.280  1.00 75.84  ? 66  LYS G CB  1 
ATOM   5811 C  CG  . LYS G  1 7   ? 59.734  15.938  16.013  1.00 77.66  ? 66  LYS G CG  1 
ATOM   5812 C  CD  . LYS G  1 7   ? 59.702  14.427  16.298  1.00 79.55  ? 66  LYS G CD  1 
ATOM   5813 C  CE  . LYS G  1 7   ? 59.254  13.629  15.067  1.00 80.33  ? 66  LYS G CE  1 
ATOM   5814 N  NZ  . LYS G  1 7   ? 59.982  12.343  14.924  1.00 84.01  ? 66  LYS G NZ  1 
ATOM   5815 N  N   . ILE G  1 8   ? 58.169  19.037  18.813  1.00 68.95  ? 67  ILE G N   1 
ATOM   5816 C  CA  . ILE G  1 8   ? 57.760  19.617  20.107  1.00 66.59  ? 67  ILE G CA  1 
ATOM   5817 C  C   . ILE G  1 8   ? 56.843  18.695  20.930  1.00 64.02  ? 67  ILE G C   1 
ATOM   5818 O  O   . ILE G  1 8   ? 56.212  17.773  20.398  1.00 63.30  ? 67  ILE G O   1 
ATOM   5819 C  CB  . ILE G  1 8   ? 57.081  20.997  19.909  1.00 65.34  ? 67  ILE G CB  1 
ATOM   5820 C  CG1 . ILE G  1 8   ? 55.739  20.869  19.183  1.00 63.09  ? 67  ILE G CG1 1 
ATOM   5821 C  CG2 . ILE G  1 8   ? 57.992  21.929  19.122  1.00 67.88  ? 67  ILE G CG2 1 
ATOM   5822 C  CD1 . ILE G  1 8   ? 54.703  21.881  19.669  1.00 60.86  ? 67  ILE G CD1 1 
ATOM   5823 N  N   . THR G  1 9   ? 56.770  18.973  22.225  1.00 62.87  ? 68  THR G N   1 
ATOM   5824 C  CA  . THR G  1 9   ? 55.972  18.189  23.149  1.00 61.48  ? 68  THR G CA  1 
ATOM   5825 C  C   . THR G  1 9   ? 54.574  18.812  23.371  1.00 59.05  ? 68  THR G C   1 
ATOM   5826 O  O   . THR G  1 9   ? 54.442  20.019  23.623  1.00 58.31  ? 68  THR G O   1 
ATOM   5827 C  CB  . THR G  1 9   ? 56.685  18.068  24.500  1.00 62.64  ? 68  THR G CB  1 
ATOM   5828 O  OG1 . THR G  1 9   ? 57.948  17.411  24.311  1.00 65.77  ? 68  THR G OG1 1 
ATOM   5829 C  CG2 . THR G  1 9   ? 55.832  17.293  25.505  1.00 61.35  ? 68  THR G CG2 1 
ATOM   5830 N  N   . VAL G  1 10  ? 53.544  17.971  23.272  1.00 57.82  ? 69  VAL G N   1 
ATOM   5831 C  CA  . VAL G  1 10  ? 52.182  18.363  23.547  1.00 55.67  ? 69  VAL G CA  1 
ATOM   5832 C  C   . VAL G  1 10  ? 51.586  17.408  24.553  1.00 55.52  ? 69  VAL G C   1 
ATOM   5833 O  O   . VAL G  1 10  ? 51.681  16.208  24.410  1.00 56.30  ? 69  VAL G O   1 
ATOM   5834 C  CB  . VAL G  1 10  ? 51.341  18.326  22.276  1.00 54.74  ? 69  VAL G CB  1 
ATOM   5835 C  CG1 . VAL G  1 10  ? 49.884  18.713  22.583  1.00 53.08  ? 69  VAL G CG1 1 
ATOM   5836 C  CG2 . VAL G  1 10  ? 51.940  19.234  21.215  1.00 55.09  ? 69  VAL G CG2 1 
ATOM   5837 N  N   . HIS G  1 11  ? 50.969  17.963  25.578  1.00 55.23  ? 70  HIS G N   1 
ATOM   5838 C  CA  . HIS G  1 11  ? 50.226  17.187  26.556  1.00 55.61  ? 70  HIS G CA  1 
ATOM   5839 C  C   . HIS G  1 11  ? 48.740  17.238  26.218  1.00 54.13  ? 70  HIS G C   1 
ATOM   5840 O  O   . HIS G  1 11  ? 48.212  18.322  25.965  1.00 53.15  ? 70  HIS G O   1 
ATOM   5841 C  CB  . HIS G  1 11  ? 50.443  17.780  27.950  1.00 56.32  ? 70  HIS G CB  1 
ATOM   5842 C  CG  . HIS G  1 11  ? 51.882  17.913  28.327  1.00 57.89  ? 70  HIS G CG  1 
ATOM   5843 N  ND1 . HIS G  1 11  ? 52.696  16.819  28.540  1.00 59.72  ? 70  HIS G ND1 1 
ATOM   5844 C  CD2 . HIS G  1 11  ? 52.651  19.005  28.540  1.00 58.20  ? 70  HIS G CD2 1 
ATOM   5845 C  CE1 . HIS G  1 11  ? 53.909  17.235  28.858  1.00 61.00  ? 70  HIS G CE1 1 
ATOM   5846 N  NE2 . HIS G  1 11  ? 53.909  18.557  28.861  1.00 60.46  ? 70  HIS G NE2 1 
ATOM   5847 N  N   . PHE G  1 12  ? 48.083  16.079  26.228  1.00 54.36  ? 71  PHE G N   1 
ATOM   5848 C  CA  . PHE G  1 12  ? 46.638  15.974  26.076  1.00 53.59  ? 71  PHE G CA  1 
ATOM   5849 C  C   . PHE G  1 12  ? 45.997  15.517  27.363  1.00 54.80  ? 71  PHE G C   1 
ATOM   5850 O  O   . PHE G  1 12  ? 46.427  14.517  27.931  1.00 56.59  ? 71  PHE G O   1 
ATOM   5851 C  CB  . PHE G  1 12  ? 46.299  14.914  25.049  1.00 53.88  ? 71  PHE G CB  1 
ATOM   5852 C  CG  . PHE G  1 12  ? 46.629  15.290  23.657  1.00 52.75  ? 71  PHE G CG  1 
ATOM   5853 C  CD1 . PHE G  1 12  ? 45.640  15.644  22.782  1.00 51.80  ? 71  PHE G CD1 1 
ATOM   5854 C  CD2 . PHE G  1 12  ? 47.924  15.244  23.201  1.00 53.57  ? 71  PHE G CD2 1 
ATOM   5855 C  CE1 . PHE G  1 12  ? 45.940  15.964  21.462  1.00 52.09  ? 71  PHE G CE1 1 
ATOM   5856 C  CE2 . PHE G  1 12  ? 48.226  15.569  21.892  1.00 53.61  ? 71  PHE G CE2 1 
ATOM   5857 C  CZ  . PHE G  1 12  ? 47.235  15.927  21.020  1.00 52.38  ? 71  PHE G CZ  1 
ATOM   5858 N  N   . ILE G  1 13  ? 44.947  16.203  27.798  1.00 54.30  ? 72  ILE G N   1 
ATOM   5859 C  CA  . ILE G  1 13  ? 44.115  15.687  28.861  1.00 56.12  ? 72  ILE G CA  1 
ATOM   5860 C  C   . ILE G  1 13  ? 42.929  14.996  28.210  1.00 56.51  ? 72  ILE G C   1 
ATOM   5861 O  O   . ILE G  1 13  ? 42.200  15.605  27.465  1.00 55.36  ? 72  ILE G O   1 
ATOM   5862 C  CB  . ILE G  1 13  ? 43.654  16.784  29.812  1.00 56.13  ? 72  ILE G CB  1 
ATOM   5863 C  CG1 . ILE G  1 13  ? 44.869  17.405  30.494  1.00 56.08  ? 72  ILE G CG1 1 
ATOM   5864 C  CG2 . ILE G  1 13  ? 42.664  16.223  30.833  1.00 57.39  ? 72  ILE G CG2 1 
ATOM   5865 C  CD1 . ILE G  1 13  ? 44.537  18.532  31.412  1.00 56.33  ? 72  ILE G CD1 1 
ATOM   5866 N  N   . ASN G  1 14  ? 42.772  13.709  28.481  1.00 58.61  ? 73  ASN G N   1 
ATOM   5867 C  CA  . ASN G  1 14  ? 41.731  12.890  27.878  1.00 59.54  ? 73  ASN G CA  1 
ATOM   5868 C  C   . ASN G  1 14  ? 40.398  13.090  28.555  1.00 60.47  ? 73  ASN G C   1 
ATOM   5869 O  O   . ASN G  1 14  ? 40.320  13.663  29.632  1.00 60.87  ? 73  ASN G O   1 
ATOM   5870 C  CB  . ASN G  1 14  ? 42.112  11.407  28.005  1.00 62.25  ? 73  ASN G CB  1 
ATOM   5871 C  CG  . ASN G  1 14  ? 41.732  10.599  26.789  1.00 63.65  ? 73  ASN G CG  1 
ATOM   5872 O  OD1 . ASN G  1 14  ? 40.848  10.997  25.993  1.00 62.83  ? 73  ASN G OD1 1 
ATOM   5873 N  ND2 . ASN G  1 14  ? 42.397  9.442   26.626  1.00 64.79  ? 73  ASN G ND2 1 
ATOM   5874 N  N   . ARG G  1 15  ? 39.343  12.589  27.931  1.00 61.24  ? 74  ARG G N   1 
ATOM   5875 C  CA  . ARG G  1 15  ? 38.010  12.657  28.518  1.00 63.22  ? 74  ARG G CA  1 
ATOM   5876 C  C   . ARG G  1 15  ? 38.016  11.966  29.861  1.00 66.60  ? 74  ARG G C   1 
ATOM   5877 O  O   . ARG G  1 15  ? 37.339  12.412  30.781  1.00 67.95  ? 74  ARG G O   1 
ATOM   5878 C  CB  . ARG G  1 15  ? 36.984  12.016  27.596  1.00 63.85  ? 74  ARG G CB  1 
ATOM   5879 C  CG  . ARG G  1 15  ? 36.664  12.861  26.398  1.00 61.27  ? 74  ARG G CG  1 
ATOM   5880 C  CD  . ARG G  1 15  ? 36.047  12.070  25.252  1.00 61.59  ? 74  ARG G CD  1 
ATOM   5881 N  NE  . ARG G  1 15  ? 36.060  12.872  24.025  1.00 59.43  ? 74  ARG G NE  1 
ATOM   5882 C  CZ  . ARG G  1 15  ? 36.162  12.389  22.784  1.00 59.23  ? 74  ARG G CZ  1 
ATOM   5883 N  NH1 . ARG G  1 15  ? 36.251  11.084  22.582  1.00 62.00  ? 74  ARG G NH1 1 
ATOM   5884 N  NH2 . ARG G  1 15  ? 36.173  13.215  21.731  1.00 56.63  ? 74  ARG G NH2 1 
ATOM   5885 N  N   . ASP G  1 16  ? 38.812  10.892  29.944  1.00 68.28  ? 75  ASP G N   1 
ATOM   5886 C  CA  . ASP G  1 16  ? 39.066  10.108  31.171  1.00 71.70  ? 75  ASP G CA  1 
ATOM   5887 C  C   . ASP G  1 16  ? 39.756  10.879  32.284  1.00 71.38  ? 75  ASP G C   1 
ATOM   5888 O  O   . ASP G  1 16  ? 39.728  10.464  33.421  1.00 74.18  ? 75  ASP G O   1 
ATOM   5889 C  CB  . ASP G  1 16  ? 39.981  8.921   30.855  1.00 72.99  ? 75  ASP G CB  1 
ATOM   5890 C  CG  . ASP G  1 16  ? 39.281  7.814   30.082  1.00 75.66  ? 75  ASP G CG  1 
ATOM   5891 O  OD1 . ASP G  1 16  ? 38.104  7.994   29.697  1.00 76.90  ? 75  ASP G OD1 1 
ATOM   5892 O  OD2 . ASP G  1 16  ? 39.912  6.752   29.864  1.00 77.24  ? 75  ASP G OD2 1 
ATOM   5893 N  N   . GLY G  1 17  ? 40.412  11.977  31.951  1.00 68.33  ? 76  GLY G N   1 
ATOM   5894 C  CA  . GLY G  1 17  ? 41.124  12.764  32.942  1.00 68.37  ? 76  GLY G CA  1 
ATOM   5895 C  C   . GLY G  1 17  ? 42.569  12.326  33.017  1.00 68.25  ? 76  GLY G C   1 
ATOM   5896 O  O   . GLY G  1 17  ? 43.320  12.755  33.885  1.00 68.93  ? 76  GLY G O   1 
ATOM   5897 N  N   . GLU G  1 18  ? 42.969  11.495  32.077  1.00 67.73  ? 77  GLU G N   1 
ATOM   5898 C  CA  . GLU G  1 18  ? 44.319  11.000  32.048  1.00 68.20  ? 77  GLU G CA  1 
ATOM   5899 C  C   . GLU G  1 18  ? 45.167  11.855  31.110  1.00 64.86  ? 77  GLU G C   1 
ATOM   5900 O  O   . GLU G  1 18  ? 44.701  12.260  30.060  1.00 62.74  ? 77  GLU G O   1 
ATOM   5901 C  CB  . GLU G  1 18  ? 44.312  9.550   31.582  1.00 70.45  ? 77  GLU G CB  1 
ATOM   5902 C  CG  . GLU G  1 18  ? 45.717  9.039   31.344  1.00 71.58  ? 77  GLU G CG  1 
ATOM   5903 C  CD  . GLU G  1 18  ? 45.850  7.564   31.192  1.00 73.94  ? 77  GLU G CD  1 
ATOM   5904 O  OE1 . GLU G  1 18  ? 44.851  6.833   31.382  1.00 78.20  ? 77  GLU G OE1 1 
ATOM   5905 O  OE2 . GLU G  1 18  ? 46.984  7.144   30.878  1.00 72.94  ? 77  GLU G OE2 1 
ATOM   5906 N  N   . THR G  1 19  ? 46.411  12.122  31.485  1.00 64.77  ? 78  THR G N   1 
ATOM   5907 C  CA  . THR G  1 19  ? 47.274  12.987  30.688  1.00 62.43  ? 78  THR G CA  1 
ATOM   5908 C  C   . THR G  1 19  ? 48.181  12.168  29.807  1.00 62.71  ? 78  THR G C   1 
ATOM   5909 O  O   . THR G  1 19  ? 48.882  11.300  30.295  1.00 64.99  ? 78  THR G O   1 
ATOM   5910 C  CB  . THR G  1 19  ? 48.119  13.894  31.565  1.00 62.51  ? 78  THR G CB  1 
ATOM   5911 O  OG1 . THR G  1 19  ? 47.274  14.542  32.516  1.00 62.41  ? 78  THR G OG1 1 
ATOM   5912 C  CG2 . THR G  1 19  ? 48.823  14.931  30.718  1.00 60.76  ? 78  THR G CG2 1 
ATOM   5913 N  N   . LEU G  1 20  ? 48.147  12.423  28.508  1.00 60.86  ? 79  LEU G N   1 
ATOM   5914 C  CA  . LEU G  1 20  ? 49.000  11.716  27.575  1.00 61.55  ? 79  LEU G CA  1 
ATOM   5915 C  C   . LEU G  1 20  ? 50.005  12.723  27.072  1.00 60.48  ? 79  LEU G C   1 
ATOM   5916 O  O   . LEU G  1 20  ? 49.621  13.780  26.623  1.00 58.66  ? 79  LEU G O   1 
ATOM   5917 C  CB  . LEU G  1 20  ? 48.206  11.162  26.395  1.00 60.95  ? 79  LEU G CB  1 
ATOM   5918 C  CG  . LEU G  1 20  ? 46.917  10.392  26.681  1.00 62.42  ? 79  LEU G CG  1 
ATOM   5919 C  CD1 . LEU G  1 20  ? 46.177  10.129  25.387  1.00 61.41  ? 79  LEU G CD1 1 
ATOM   5920 C  CD2 . LEU G  1 20  ? 47.198  9.072   27.395  1.00 66.05  ? 79  LEU G CD2 1 
ATOM   5921 N  N   . THR G  1 21  ? 51.293  12.399  27.161  1.00 62.01  ? 80  THR G N   1 
ATOM   5922 C  CA  . THR G  1 21  ? 52.344  13.268  26.661  1.00 61.34  ? 80  THR G CA  1 
ATOM   5923 C  C   . THR G  1 21  ? 52.899  12.662  25.391  1.00 61.73  ? 80  THR G C   1 
ATOM   5924 O  O   . THR G  1 21  ? 53.175  11.482  25.346  1.00 63.71  ? 80  THR G O   1 
ATOM   5925 C  CB  . THR G  1 21  ? 53.449  13.432  27.699  1.00 63.05  ? 80  THR G CB  1 
ATOM   5926 O  OG1 . THR G  1 21  ? 52.919  14.164  28.820  1.00 61.85  ? 80  THR G OG1 1 
ATOM   5927 C  CG2 . THR G  1 21  ? 54.655  14.163  27.096  1.00 63.52  ? 80  THR G CG2 1 
ATOM   5928 N  N   . THR G  1 22  ? 53.028  13.460  24.349  1.00 60.51  ? 81  THR G N   1 
ATOM   5929 C  CA  . THR G  1 22  ? 53.530  12.961  23.087  1.00 61.49  ? 81  THR G CA  1 
ATOM   5930 C  C   . THR G  1 22  ? 54.358  14.029  22.404  1.00 61.84  ? 81  THR G C   1 
ATOM   5931 O  O   . THR G  1 22  ? 54.496  15.146  22.914  1.00 61.46  ? 81  THR G O   1 
ATOM   5932 C  CB  . THR G  1 22  ? 52.386  12.504  22.162  1.00 60.51  ? 81  THR G CB  1 
ATOM   5933 O  OG1 . THR G  1 22  ? 52.935  11.763  21.072  1.00 61.77  ? 81  THR G OG1 1 
ATOM   5934 C  CG2 . THR G  1 22  ? 51.578  13.687  21.616  1.00 58.02  ? 81  THR G CG2 1 
ATOM   5935 N  N   . LYS G  1 23  ? 54.900  13.692  21.245  1.00 63.12  ? 82  LYS G N   1 
ATOM   5936 C  CA  . LYS G  1 23  ? 55.770  14.592  20.515  1.00 64.18  ? 82  LYS G CA  1 
ATOM   5937 C  C   . LYS G  1 23  ? 55.255  14.744  19.093  1.00 63.65  ? 82  LYS G C   1 
ATOM   5938 O  O   . LYS G  1 23  ? 54.980  13.752  18.434  1.00 64.24  ? 82  LYS G O   1 
ATOM   5939 C  CB  . LYS G  1 23  ? 57.191  14.026  20.499  1.00 67.35  ? 82  LYS G CB  1 
ATOM   5940 C  CG  . LYS G  1 23  ? 57.962  14.283  21.803  1.00 68.57  ? 82  LYS G CG  1 
ATOM   5941 C  CD  . LYS G  1 23  ? 59.477  14.224  21.643  1.00 71.73  ? 82  LYS G CD  1 
ATOM   5942 C  CE  . LYS G  1 23  ? 60.059  15.631  21.874  1.00 72.48  ? 82  LYS G CE  1 
ATOM   5943 N  NZ  . LYS G  1 23  ? 61.527  15.741  21.614  1.00 77.69  ? 82  LYS G NZ  1 
ATOM   5944 N  N   . GLY G  1 24  ? 55.140  15.979  18.616  1.00 62.80  ? 83  GLY G N   1 
ATOM   5945 C  CA  . GLY G  1 24  ? 54.670  16.234  17.257  1.00 62.53  ? 83  GLY G CA  1 
ATOM   5946 C  C   . GLY G  1 24  ? 55.627  17.099  16.462  1.00 64.57  ? 83  GLY G C   1 
ATOM   5947 O  O   . GLY G  1 24  ? 56.412  17.861  17.028  1.00 65.20  ? 83  GLY G O   1 
ATOM   5948 N  N   . LYS G  1 25  ? 55.572  16.965  15.141  1.00 65.82  ? 84  LYS G N   1 
ATOM   5949 C  CA  . LYS G  1 25  ? 56.414  17.761  14.253  1.00 68.76  ? 84  LYS G CA  1 
ATOM   5950 C  C   . LYS G  1 25  ? 55.809  19.141  14.110  1.00 67.29  ? 84  LYS G C   1 
ATOM   5951 O  O   . LYS G  1 25  ? 54.600  19.276  14.007  1.00 64.88  ? 84  LYS G O   1 
ATOM   5952 C  CB  . LYS G  1 25  ? 56.541  17.112  12.865  1.00 71.07  ? 84  LYS G CB  1 
ATOM   5953 C  CG  . LYS G  1 25  ? 57.292  15.778  12.853  1.00 74.63  ? 84  LYS G CG  1 
ATOM   5954 C  CD  . LYS G  1 25  ? 56.998  14.922  11.598  1.00 78.23  ? 84  LYS G CD  1 
ATOM   5955 C  CE  . LYS G  1 25  ? 57.838  13.620  11.611  1.00 82.00  ? 84  LYS G CE  1 
ATOM   5956 N  NZ  . LYS G  1 25  ? 57.602  12.709  10.436  1.00 84.32  ? 84  LYS G NZ  1 
ATOM   5957 N  N   . VAL G  1 26  ? 56.652  20.162  14.103  1.00 69.18  ? 85  VAL G N   1 
ATOM   5958 C  CA  . VAL G  1 26  ? 56.195  21.504  13.797  1.00 68.98  ? 85  VAL G CA  1 
ATOM   5959 C  C   . VAL G  1 26  ? 55.572  21.466  12.396  1.00 69.34  ? 85  VAL G C   1 
ATOM   5960 O  O   . VAL G  1 26  ? 56.106  20.816  11.500  1.00 71.41  ? 85  VAL G O   1 
ATOM   5961 C  CB  . VAL G  1 26  ? 57.357  22.509  13.854  1.00 72.19  ? 85  VAL G CB  1 
ATOM   5962 C  CG1 . VAL G  1 26  ? 56.900  23.896  13.452  1.00 72.29  ? 85  VAL G CG1 1 
ATOM   5963 C  CG2 . VAL G  1 26  ? 57.966  22.524  15.252  1.00 72.25  ? 85  VAL G CG2 1 
ATOM   5964 N  N   . GLY G  1 27  ? 54.427  22.119  12.223  1.00 67.32  ? 86  GLY G N   1 
ATOM   5965 C  CA  . GLY G  1 27  ? 53.714  22.100  10.946  1.00 67.74  ? 86  GLY G CA  1 
ATOM   5966 C  C   . GLY G  1 27  ? 52.608  21.057  10.845  1.00 65.39  ? 86  GLY G C   1 
ATOM   5967 O  O   . GLY G  1 27  ? 51.745  21.179  9.981   1.00 65.18  ? 86  GLY G O   1 
ATOM   5968 N  N   . ASP G  1 28  ? 52.616  20.042  11.719  1.00 63.90  ? 87  ASP G N   1 
ATOM   5969 C  CA  . ASP G  1 28  ? 51.551  19.023  11.758  1.00 61.78  ? 87  ASP G CA  1 
ATOM   5970 C  C   . ASP G  1 28  ? 50.302  19.578  12.459  1.00 59.05  ? 87  ASP G C   1 
ATOM   5971 O  O   . ASP G  1 28  ? 50.402  20.425  13.350  1.00 58.21  ? 87  ASP G O   1 
ATOM   5972 C  CB  . ASP G  1 28  ? 52.032  17.756  12.497  1.00 61.93  ? 87  ASP G CB  1 
ATOM   5973 C  CG  . ASP G  1 28  ? 52.837  16.780  11.596  1.00 65.02  ? 87  ASP G CG  1 
ATOM   5974 O  OD1 . ASP G  1 28  ? 52.986  17.001  10.373  1.00 66.84  ? 87  ASP G OD1 1 
ATOM   5975 O  OD2 . ASP G  1 28  ? 53.321  15.757  12.125  1.00 65.92  ? 87  ASP G OD2 1 
ATOM   5976 N  N   . SER G  1 29  ? 49.125  19.105  12.058  1.00 57.60  ? 88  SER G N   1 
ATOM   5977 C  CA  . SER G  1 29  ? 47.884  19.471  12.750  1.00 55.43  ? 88  SER G CA  1 
ATOM   5978 C  C   . SER G  1 29  ? 47.758  18.632  14.006  1.00 54.01  ? 88  SER G C   1 
ATOM   5979 O  O   . SER G  1 29  ? 48.301  17.549  14.083  1.00 54.84  ? 88  SER G O   1 
ATOM   5980 C  CB  . SER G  1 29  ? 46.647  19.248  11.863  1.00 54.91  ? 88  SER G CB  1 
ATOM   5981 O  OG  . SER G  1 29  ? 46.216  17.894  11.875  1.00 54.67  ? 88  SER G OG  1 
ATOM   5982 N  N   . LEU G  1 30  ? 47.024  19.120  14.983  1.00 52.29  ? 89  LEU G N   1 
ATOM   5983 C  CA  . LEU G  1 30  ? 46.820  18.344  16.190  1.00 51.67  ? 89  LEU G CA  1 
ATOM   5984 C  C   . LEU G  1 30  ? 46.111  17.029  15.908  1.00 51.68  ? 89  LEU G C   1 
ATOM   5985 O  O   . LEU G  1 30  ? 46.375  16.041  16.582  1.00 52.22  ? 89  LEU G O   1 
ATOM   5986 C  CB  . LEU G  1 30  ? 46.103  19.159  17.255  1.00 50.25  ? 89  LEU G CB  1 
ATOM   5987 C  CG  . LEU G  1 30  ? 47.113  20.065  17.974  1.00 50.72  ? 89  LEU G CG  1 
ATOM   5988 C  CD1 . LEU G  1 30  ? 46.521  21.370  18.333  1.00 50.12  ? 89  LEU G CD1 1 
ATOM   5989 C  CD2 . LEU G  1 30  ? 47.662  19.374  19.214  1.00 50.70  ? 89  LEU G CD2 1 
ATOM   5990 N  N   . LEU G  1 31  ? 45.271  16.984  14.881  1.00 51.65  ? 90  LEU G N   1 
ATOM   5991 C  CA  . LEU G  1 31  ? 44.692  15.719  14.454  1.00 52.10  ? 90  LEU G CA  1 
ATOM   5992 C  C   . LEU G  1 31  ? 45.778  14.770  14.019  1.00 53.89  ? 90  LEU G C   1 
ATOM   5993 O  O   . LEU G  1 31  ? 45.789  13.611  14.459  1.00 54.95  ? 90  LEU G O   1 
ATOM   5994 C  CB  . LEU G  1 31  ? 43.699  15.901  13.308  1.00 52.04  ? 90  LEU G CB  1 
ATOM   5995 C  CG  . LEU G  1 31  ? 43.090  14.606  12.744  1.00 52.59  ? 90  LEU G CG  1 
ATOM   5996 C  CD1 . LEU G  1 31  ? 42.387  13.805  13.833  1.00 51.99  ? 90  LEU G CD1 1 
ATOM   5997 C  CD2 . LEU G  1 31  ? 42.144  14.876  11.615  1.00 51.97  ? 90  LEU G CD2 1 
ATOM   5998 N  N   . ASP G  1 32  ? 46.687  15.247  13.167  1.00 54.84  ? 91  ASP G N   1 
ATOM   5999 C  CA  . ASP G  1 32  ? 47.823  14.438  12.714  1.00 56.92  ? 91  ASP G CA  1 
ATOM   6000 C  C   . ASP G  1 32  ? 48.563  13.846  13.904  1.00 57.16  ? 91  ASP G C   1 
ATOM   6001 O  O   . ASP G  1 32  ? 48.974  12.694  13.867  1.00 58.61  ? 91  ASP G O   1 
ATOM   6002 C  CB  . ASP G  1 32  ? 48.813  15.267  11.870  1.00 58.45  ? 91  ASP G CB  1 
ATOM   6003 C  CG  . ASP G  1 32  ? 48.232  15.702  10.515  1.00 59.37  ? 91  ASP G CG  1 
ATOM   6004 O  OD1 . ASP G  1 32  ? 47.365  14.992  9.973   1.00 60.01  ? 91  ASP G OD1 1 
ATOM   6005 O  OD2 . ASP G  1 32  ? 48.637  16.757  9.984   1.00 60.44  ? 91  ASP G OD2 1 
ATOM   6006 N  N   . VAL G  1 33  ? 48.735  14.644  14.956  1.00 56.05  ? 92  VAL G N   1 
ATOM   6007 C  CA  . VAL G  1 33  ? 49.464  14.198  16.132  1.00 56.64  ? 92  VAL G CA  1 
ATOM   6008 C  C   . VAL G  1 33  ? 48.740  13.049  16.802  1.00 56.61  ? 92  VAL G C   1 
ATOM   6009 O  O   . VAL G  1 33  ? 49.351  12.048  17.116  1.00 58.55  ? 92  VAL G O   1 
ATOM   6010 C  CB  . VAL G  1 33  ? 49.677  15.332  17.135  1.00 55.53  ? 92  VAL G CB  1 
ATOM   6011 C  CG1 . VAL G  1 33  ? 50.230  14.788  18.451  1.00 55.75  ? 92  VAL G CG1 1 
ATOM   6012 C  CG2 . VAL G  1 33  ? 50.607  16.360  16.546  1.00 56.29  ? 92  VAL G CG2 1 
ATOM   6013 N  N   . VAL G  1 34  ? 47.439  13.193  16.996  1.00 55.12  ? 93  VAL G N   1 
ATOM   6014 C  CA  . VAL G  1 34  ? 46.643  12.143  17.595  1.00 55.55  ? 93  VAL G CA  1 
ATOM   6015 C  C   . VAL G  1 34  ? 46.740  10.834  16.786  1.00 57.32  ? 93  VAL G C   1 
ATOM   6016 O  O   . VAL G  1 34  ? 46.924  9.759   17.341  1.00 58.63  ? 93  VAL G O   1 
ATOM   6017 C  CB  . VAL G  1 34  ? 45.169  12.595  17.722  1.00 54.25  ? 93  VAL G CB  1 
ATOM   6018 C  CG1 . VAL G  1 34  ? 44.307  11.466  18.293  1.00 55.01  ? 93  VAL G CG1 1 
ATOM   6019 C  CG2 . VAL G  1 34  ? 45.058  13.829  18.590  1.00 52.37  ? 93  VAL G CG2 1 
ATOM   6020 N  N   . VAL G  1 35  ? 46.625  10.943  15.471  1.00 57.63  ? 94  VAL G N   1 
ATOM   6021 C  CA  . VAL G  1 35  ? 46.576  9.773   14.597  1.00 59.61  ? 94  VAL G CA  1 
ATOM   6022 C  C   . VAL G  1 35  ? 47.947  9.144   14.403  1.00 62.03  ? 94  VAL G C   1 
ATOM   6023 O  O   . VAL G  1 35  ? 48.109  7.933   14.568  1.00 64.32  ? 94  VAL G O   1 
ATOM   6024 C  CB  . VAL G  1 35  ? 45.996  10.129  13.197  1.00 59.45  ? 94  VAL G CB  1 
ATOM   6025 C  CG1 . VAL G  1 35  ? 46.208  8.984   12.222  1.00 61.58  ? 94  VAL G CG1 1 
ATOM   6026 C  CG2 . VAL G  1 35  ? 44.515  10.473  13.297  1.00 57.76  ? 94  VAL G CG2 1 
ATOM   6027 N  N   . GLU G  1 36  ? 48.933  9.955   14.045  1.00 62.19  ? 95  GLU G N   1 
ATOM   6028 C  CA  . GLU G  1 36  ? 50.272  9.441   13.772  1.00 64.98  ? 95  GLU G CA  1 
ATOM   6029 C  C   . GLU G  1 36  ? 50.945  8.840   15.008  1.00 65.71  ? 95  GLU G C   1 
ATOM   6030 O  O   . GLU G  1 36  ? 51.857  8.036   14.873  1.00 68.29  ? 95  GLU G O   1 
ATOM   6031 C  CB  . GLU G  1 36  ? 51.158  10.499  13.081  1.00 65.68  ? 95  GLU G CB  1 
ATOM   6032 C  CG  . GLU G  1 36  ? 50.818  10.611  11.553  1.00 68.94  ? 95  GLU G CG  1 
ATOM   6033 C  CD  . GLU G  1 36  ? 51.592  11.712  10.794  1.00 73.92  ? 95  GLU G CD  1 
ATOM   6034 O  OE1 . GLU G  1 36  ? 52.854  11.762  10.882  1.00 77.08  ? 95  GLU G OE1 1 
ATOM   6035 O  OE2 . GLU G  1 36  ? 50.928  12.514  10.075  1.00 75.91  ? 95  GLU G OE2 1 
ATOM   6036 N  N   . ASN G  1 37  ? 50.482  9.203   16.200  1.00 63.99  ? 96  ASN G N   1 
ATOM   6037 C  CA  . ASN G  1 37  ? 50.991  8.612   17.439  1.00 65.22  ? 96  ASN G CA  1 
ATOM   6038 C  C   . ASN G  1 37  ? 50.033  7.638   18.118  1.00 65.71  ? 96  ASN G C   1 
ATOM   6039 O  O   . ASN G  1 37  ? 50.325  7.151   19.216  1.00 66.92  ? 96  ASN G O   1 
ATOM   6040 C  CB  . ASN G  1 37  ? 51.412  9.717   18.423  1.00 63.92  ? 96  ASN G CB  1 
ATOM   6041 C  CG  . ASN G  1 37  ? 52.639  10.507  17.942  1.00 64.36  ? 96  ASN G CG  1 
ATOM   6042 O  OD1 . ASN G  1 37  ? 52.762  11.691  18.228  1.00 63.14  ? 96  ASN G OD1 1 
ATOM   6043 N  ND2 . ASN G  1 37  ? 53.547  9.847   17.212  1.00 66.63  ? 96  ASN G ND2 1 
ATOM   6044 N  N   . ASN G  1 38  ? 48.913  7.346   17.456  1.00 65.31  ? 97  ASN G N   1 
ATOM   6045 C  CA  . ASN G  1 38  ? 47.980  6.313   17.910  1.00 66.73  ? 97  ASN G CA  1 
ATOM   6046 C  C   . ASN G  1 38  ? 47.664  6.457   19.401  1.00 66.21  ? 97  ASN G C   1 
ATOM   6047 O  O   . ASN G  1 38  ? 47.871  5.516   20.183  1.00 68.32  ? 97  ASN G O   1 
ATOM   6048 C  CB  . ASN G  1 38  ? 48.515  4.912   17.557  1.00 70.16  ? 97  ASN G CB  1 
ATOM   6049 C  CG  . ASN G  1 38  ? 48.366  4.586   16.040  1.00 72.85  ? 97  ASN G CG  1 
ATOM   6050 O  OD1 . ASN G  1 38  ? 48.427  5.478   15.182  1.00 73.74  ? 97  ASN G OD1 1 
ATOM   6051 N  ND2 . ASN G  1 38  ? 48.143  3.312   15.724  1.00 75.34  ? 97  ASN G ND2 1 
ATOM   6052 N  N   . LEU G  1 39  ? 47.165  7.648   19.762  1.00 63.54  ? 98  LEU G N   1 
ATOM   6053 C  CA  . LEU G  1 39  ? 46.732  7.974   21.128  1.00 63.11  ? 98  LEU G CA  1 
ATOM   6054 C  C   . LEU G  1 39  ? 45.349  7.405   21.450  1.00 64.13  ? 98  LEU G C   1 
ATOM   6055 O  O   . LEU G  1 39  ? 44.522  7.190   20.555  1.00 64.05  ? 98  LEU G O   1 
ATOM   6056 C  CB  . LEU G  1 39  ? 46.678  9.480   21.323  1.00 60.34  ? 98  LEU G CB  1 
ATOM   6057 C  CG  . LEU G  1 39  ? 47.988  10.229  21.137  1.00 60.07  ? 98  LEU G CG  1 
ATOM   6058 C  CD1 . LEU G  1 39  ? 47.768  11.727  21.278  1.00 57.79  ? 98  LEU G CD1 1 
ATOM   6059 C  CD2 . LEU G  1 39  ? 49.008  9.737   22.138  1.00 62.21  ? 98  LEU G CD2 1 
ATOM   6060 N  N   . ASP G  1 40  ? 45.101  7.186   22.741  1.00 65.51  ? 99  ASP G N   1 
ATOM   6061 C  CA  . ASP G  1 40  ? 43.887  6.506   23.217  1.00 67.50  ? 99  ASP G CA  1 
ATOM   6062 C  C   . ASP G  1 40  ? 42.674  7.461   23.324  1.00 65.98  ? 99  ASP G C   1 
ATOM   6063 O  O   . ASP G  1 40  ? 42.094  7.588   24.416  1.00 67.49  ? 99  ASP G O   1 
ATOM   6064 C  CB  . ASP G  1 40  ? 44.177  5.849   24.593  1.00 70.24  ? 99  ASP G CB  1 
ATOM   6065 C  CG  . ASP G  1 40  ? 43.079  4.862   25.054  1.00 73.97  ? 99  ASP G CG  1 
ATOM   6066 O  OD1 . ASP G  1 40  ? 42.148  4.546   24.278  1.00 74.68  ? 99  ASP G OD1 1 
ATOM   6067 O  OD2 . ASP G  1 40  ? 43.160  4.390   26.208  1.00 76.80  ? 99  ASP G OD2 1 
ATOM   6068 N  N   . ILE G  1 41  ? 42.280  8.092   22.199  1.00 63.58  ? 100 ILE G N   1 
ATOM   6069 C  CA  . ILE G  1 41  ? 41.117  8.981   22.154  1.00 61.79  ? 100 ILE G CA  1 
ATOM   6070 C  C   . ILE G  1 41  ? 40.070  8.449   21.181  1.00 62.52  ? 100 ILE G C   1 
ATOM   6071 O  O   . ILE G  1 41  ? 40.267  8.470   19.970  1.00 62.18  ? 100 ILE G O   1 
ATOM   6072 C  CB  . ILE G  1 41  ? 41.508  10.395  21.706  1.00 58.88  ? 100 ILE G CB  1 
ATOM   6073 C  CG1 . ILE G  1 41  ? 42.682  10.905  22.533  1.00 58.26  ? 100 ILE G CG1 1 
ATOM   6074 C  CG2 . ILE G  1 41  ? 40.319  11.331  21.844  1.00 58.30  ? 100 ILE G CG2 1 
ATOM   6075 C  CD1 . ILE G  1 41  ? 43.399  12.062  21.933  1.00 55.36  ? 100 ILE G CD1 1 
ATOM   6076 N  N   . ASP G  1 42  ? 38.946  7.997   21.709  1.00 64.22  ? 101 ASP G N   1 
ATOM   6077 C  CA  . ASP G  1 42  ? 37.940  7.358   20.882  1.00 65.48  ? 101 ASP G CA  1 
ATOM   6078 C  C   . ASP G  1 42  ? 37.178  8.428   20.128  1.00 63.05  ? 101 ASP G C   1 
ATOM   6079 O  O   . ASP G  1 42  ? 36.959  9.479   20.665  1.00 61.96  ? 101 ASP G O   1 
ATOM   6080 C  CB  . ASP G  1 42  ? 37.002  6.511   21.757  1.00 68.99  ? 101 ASP G CB  1 
ATOM   6081 C  CG  . ASP G  1 42  ? 37.769  5.504   22.654  1.00 72.86  ? 101 ASP G CG  1 
ATOM   6082 O  OD1 . ASP G  1 42  ? 38.995  5.288   22.432  1.00 72.65  ? 101 ASP G OD1 1 
ATOM   6083 O  OD2 . ASP G  1 42  ? 37.146  4.930   23.590  1.00 75.79  ? 101 ASP G OD2 1 
ATOM   6084 N  N   . GLY G  1 43  ? 36.843  8.176   18.865  1.00 62.85  ? 102 GLY G N   1 
ATOM   6085 C  CA  . GLY G  1 43  ? 35.930  9.028   18.102  1.00 61.51  ? 102 GLY G CA  1 
ATOM   6086 C  C   . GLY G  1 43  ? 36.516  10.302  17.532  1.00 58.71  ? 102 GLY G C   1 
ATOM   6087 O  O   . GLY G  1 43  ? 35.839  11.005  16.798  1.00 58.70  ? 102 GLY G O   1 
ATOM   6088 N  N   . PHE G  1 44  ? 37.769  10.591  17.849  1.00 57.33  ? 103 PHE G N   1 
ATOM   6089 C  CA  . PHE G  1 44  ? 38.405  11.861  17.486  1.00 55.04  ? 103 PHE G CA  1 
ATOM   6090 C  C   . PHE G  1 44  ? 38.788  11.917  16.011  1.00 54.22  ? 103 PHE G C   1 
ATOM   6091 O  O   . PHE G  1 44  ? 39.526  11.083  15.552  1.00 55.41  ? 103 PHE G O   1 
ATOM   6092 C  CB  . PHE G  1 44  ? 39.652  12.058  18.362  1.00 54.53  ? 103 PHE G CB  1 
ATOM   6093 C  CG  . PHE G  1 44  ? 40.217  13.459  18.343  1.00 52.37  ? 103 PHE G CG  1 
ATOM   6094 C  CD1 . PHE G  1 44  ? 39.790  14.413  19.252  1.00 50.78  ? 103 PHE G CD1 1 
ATOM   6095 C  CD2 . PHE G  1 44  ? 41.209  13.798  17.447  1.00 51.72  ? 103 PHE G CD2 1 
ATOM   6096 C  CE1 . PHE G  1 44  ? 40.314  15.679  19.235  1.00 49.82  ? 103 PHE G CE1 1 
ATOM   6097 C  CE2 . PHE G  1 44  ? 41.734  15.060  17.427  1.00 50.49  ? 103 PHE G CE2 1 
ATOM   6098 C  CZ  . PHE G  1 44  ? 41.287  16.007  18.324  1.00 49.61  ? 103 PHE G CZ  1 
ATOM   6099 N  N   . GLY G  1 45  ? 38.268  12.889  15.273  1.00 52.97  ? 104 GLY G N   1 
ATOM   6100 C  CA  . GLY G  1 45  ? 38.639  13.083  13.880  1.00 52.65  ? 104 GLY G CA  1 
ATOM   6101 C  C   . GLY G  1 45  ? 37.900  12.200  12.895  1.00 53.82  ? 104 GLY G C   1 
ATOM   6102 O  O   . GLY G  1 45  ? 38.496  11.665  11.981  1.00 54.30  ? 104 GLY G O   1 
ATOM   6103 N  N   . ALA G  1 46  ? 36.592  12.069  13.064  1.00 54.36  ? 105 ALA G N   1 
ATOM   6104 C  CA  . ALA G  1 46  ? 35.777  11.273  12.163  1.00 55.78  ? 105 ALA G CA  1 
ATOM   6105 C  C   . ALA G  1 46  ? 35.895  11.685  10.691  1.00 55.78  ? 105 ALA G C   1 
ATOM   6106 O  O   . ALA G  1 46  ? 36.044  10.824  9.845   1.00 57.07  ? 105 ALA G O   1 
ATOM   6107 C  CB  . ALA G  1 46  ? 34.351  11.294  12.595  1.00 56.25  ? 105 ALA G CB  1 
ATOM   6108 N  N   . CYS G  1 47  ? 35.863  12.981  10.379  1.00 54.78  ? 106 CYS G N   1 
ATOM   6109 C  CA  . CYS G  1 47  ? 35.898  13.431  8.977   1.00 55.18  ? 106 CYS G CA  1 
ATOM   6110 C  C   . CYS G  1 47  ? 37.303  13.443  8.384   1.00 55.35  ? 106 CYS G C   1 
ATOM   6111 O  O   . CYS G  1 47  ? 37.499  13.844  7.237   1.00 55.88  ? 106 CYS G O   1 
ATOM   6112 C  CB  . CYS G  1 47  ? 35.229  14.791  8.820   1.00 54.20  ? 106 CYS G CB  1 
ATOM   6113 S  SG  . CYS G  1 47  ? 36.214  16.180  9.207   1.00 54.10  ? 106 CYS G SG  1 
ATOM   6114 N  N   . GLU G  1 48  ? 38.277  12.994  9.164   1.00 55.16  ? 107 GLU G N   1 
ATOM   6115 C  CA  . GLU G  1 48  ? 39.674  12.948  8.749   1.00 55.67  ? 107 GLU G CA  1 
ATOM   6116 C  C   . GLU G  1 48  ? 40.192  14.308  8.316   1.00 54.95  ? 107 GLU G C   1 
ATOM   6117 O  O   . GLU G  1 48  ? 40.963  14.421  7.386   1.00 56.09  ? 107 GLU G O   1 
ATOM   6118 C  CB  . GLU G  1 48  ? 39.885  11.889  7.667   1.00 57.84  ? 107 GLU G CB  1 
ATOM   6119 C  CG  . GLU G  1 48  ? 39.626  10.473  8.154   1.00 59.20  ? 107 GLU G CG  1 
ATOM   6120 C  CD  . GLU G  1 48  ? 39.927  9.406   7.106   1.00 62.69  ? 107 GLU G CD  1 
ATOM   6121 O  OE1 . GLU G  1 48  ? 39.236  9.372   6.056   1.00 63.87  ? 107 GLU G OE1 1 
ATOM   6122 O  OE2 . GLU G  1 48  ? 40.840  8.571   7.330   1.00 64.57  ? 107 GLU G OE2 1 
ATOM   6123 N  N   . GLY G  1 49  ? 39.751  15.343  9.015   1.00 53.71  ? 108 GLY G N   1 
ATOM   6124 C  CA  . GLY G  1 49  ? 40.288  16.680  8.849   1.00 53.58  ? 108 GLY G CA  1 
ATOM   6125 C  C   . GLY G  1 49  ? 39.800  17.423  7.630   1.00 54.32  ? 108 GLY G C   1 
ATOM   6126 O  O   . GLY G  1 49  ? 40.531  18.247  7.099   1.00 54.81  ? 108 GLY G O   1 
ATOM   6127 N  N   . THR G  1 50  ? 38.579  17.142  7.184   1.00 54.38  ? 109 THR G N   1 
ATOM   6128 C  CA  . THR G  1 50  ? 38.004  17.838  6.028   1.00 55.53  ? 109 THR G CA  1 
ATOM   6129 C  C   . THR G  1 50  ? 36.952  18.859  6.408   1.00 54.73  ? 109 THR G C   1 
ATOM   6130 O  O   . THR G  1 50  ? 36.141  19.251  5.574   1.00 55.69  ? 109 THR G O   1 
ATOM   6131 C  CB  . THR G  1 50  ? 37.431  16.838  4.985   1.00 56.84  ? 109 THR G CB  1 
ATOM   6132 O  OG1 . THR G  1 50  ? 36.386  16.059  5.564   1.00 56.62  ? 109 THR G OG1 1 
ATOM   6133 C  CG2 . THR G  1 50  ? 38.528  15.907  4.503   1.00 57.71  ? 109 THR G CG2 1 
ATOM   6134 N  N   . LEU G  1 51  ? 36.992  19.310  7.663   1.00 53.64  ? 110 LEU G N   1 
ATOM   6135 C  CA  . LEU G  1 51  ? 36.054  20.308  8.187   1.00 53.15  ? 110 LEU G CA  1 
ATOM   6136 C  C   . LEU G  1 51  ? 34.601  19.919  7.957   1.00 53.56  ? 110 LEU G C   1 
ATOM   6137 O  O   . LEU G  1 51  ? 33.785  20.713  7.496   1.00 54.53  ? 110 LEU G O   1 
ATOM   6138 C  CB  . LEU G  1 51  ? 36.340  21.699  7.608   1.00 53.88  ? 110 LEU G CB  1 
ATOM   6139 C  CG  . LEU G  1 51  ? 37.373  22.513  8.365   1.00 53.51  ? 110 LEU G CG  1 
ATOM   6140 C  CD1 . LEU G  1 51  ? 37.602  23.832  7.664   1.00 55.03  ? 110 LEU G CD1 1 
ATOM   6141 C  CD2 . LEU G  1 51  ? 36.912  22.728  9.825   1.00 52.14  ? 110 LEU G CD2 1 
ATOM   6142 N  N   . ALA G  1 52  ? 34.270  18.690  8.309   1.00 53.50  ? 111 ALA G N   1 
ATOM   6143 C  CA  . ALA G  1 52  ? 32.919  18.204  8.134   1.00 54.35  ? 111 ALA G CA  1 
ATOM   6144 C  C   . ALA G  1 52  ? 32.360  17.529  9.377   1.00 54.25  ? 111 ALA G C   1 
ATOM   6145 O  O   . ALA G  1 52  ? 31.242  17.061  9.354   1.00 55.91  ? 111 ALA G O   1 
ATOM   6146 C  CB  . ALA G  1 52  ? 32.872  17.261  6.949   1.00 55.31  ? 111 ALA G CB  1 
ATOM   6147 N  N   . CYS G  1 53  ? 33.125  17.458  10.457  1.00 53.37  ? 112 CYS G N   1 
ATOM   6148 C  CA  . CYS G  1 53  ? 32.597  16.995  11.734  1.00 53.67  ? 112 CYS G CA  1 
ATOM   6149 C  C   . CYS G  1 53  ? 32.947  17.998  12.837  1.00 52.54  ? 112 CYS G C   1 
ATOM   6150 O  O   . CYS G  1 53  ? 33.513  19.046  12.585  1.00 52.02  ? 112 CYS G O   1 
ATOM   6151 C  CB  . CYS G  1 53  ? 33.155  15.615  12.054  1.00 53.97  ? 112 CYS G CB  1 
ATOM   6152 S  SG  . CYS G  1 53  ? 34.898  15.543  12.276  1.00 54.51  ? 112 CYS G SG  1 
ATOM   6153 N  N   . SER G  1 54  ? 32.615  17.697  14.068  1.00 52.66  ? 113 SER G N   1 
ATOM   6154 C  CA  . SER G  1 54  ? 33.086  18.540  15.148  1.00 51.98  ? 113 SER G CA  1 
ATOM   6155 C  C   . SER G  1 54  ? 33.860  17.722  16.152  1.00 51.84  ? 113 SER G C   1 
ATOM   6156 O  O   . SER G  1 54  ? 33.977  18.114  17.305  1.00 51.58  ? 113 SER G O   1 
ATOM   6157 C  CB  . SER G  1 54  ? 31.899  19.172  15.846  1.00 53.00  ? 113 SER G CB  1 
ATOM   6158 O  OG  . SER G  1 54  ? 31.043  19.770  14.907  1.00 54.76  ? 113 SER G OG  1 
ATOM   6159 N  N   . THR G  1 55  ? 34.376  16.572  15.722  1.00 32.47  ? 114 THR G N   1 
ATOM   6160 C  CA  . THR G  1 55  ? 34.893  15.587  16.652  1.00 32.40  ? 114 THR G CA  1 
ATOM   6161 C  C   . THR G  1 55  ? 36.361  15.854  17.024  1.00 33.20  ? 114 THR G C   1 
ATOM   6162 O  O   . THR G  1 55  ? 36.836  15.277  17.981  1.00 33.23  ? 114 THR G O   1 
ATOM   6163 C  CB  . THR G  1 55  ? 34.700  14.159  16.108  1.00 33.65  ? 114 THR G CB  1 
ATOM   6164 O  OG1 . THR G  1 55  ? 35.485  13.946  14.928  1.00 35.72  ? 114 THR G OG1 1 
ATOM   6165 C  CG2 . THR G  1 55  ? 33.266  13.934  15.762  1.00 31.99  ? 114 THR G CG2 1 
ATOM   6166 N  N   . CYS G  1 56  ? 37.058  16.709  16.257  1.00 33.64  ? 115 CYS G N   1 
ATOM   6167 C  CA  . CYS G  1 56  ? 38.418  17.141  16.589  1.00 34.49  ? 115 CYS G CA  1 
ATOM   6168 C  C   . CYS G  1 56  ? 38.449  18.311  17.568  1.00 32.88  ? 115 CYS G C   1 
ATOM   6169 O  O   . CYS G  1 56  ? 39.461  18.933  17.785  1.00 32.96  ? 115 CYS G O   1 
ATOM   6170 C  CB  . CYS G  1 56  ? 39.215  17.489  15.314  1.00 36.20  ? 115 CYS G CB  1 
ATOM   6171 S  SG  . CYS G  1 56  ? 38.578  18.822  14.347  1.00 36.70  ? 115 CYS G SG  1 
ATOM   6172 N  N   . HIS G  1 57  ? 37.310  18.610  18.163  1.00 31.97  ? 116 HIS G N   1 
ATOM   6173 C  CA  . HIS G  1 57  ? 37.190  19.697  19.156  1.00 30.73  ? 116 HIS G CA  1 
ATOM   6174 C  C   . HIS G  1 57  ? 38.207  19.566  20.273  1.00 31.07  ? 116 HIS G C   1 
ATOM   6175 O  O   . HIS G  1 57  ? 38.296  18.524  20.894  1.00 31.33  ? 116 HIS G O   1 
ATOM   6176 C  CB  . HIS G  1 57  ? 35.792  19.664  19.735  1.00 29.35  ? 116 HIS G CB  1 
ATOM   6177 C  CG  . HIS G  1 57  ? 35.495  20.737  20.730  1.00 28.81  ? 116 HIS G CG  1 
ATOM   6178 N  ND1 . HIS G  1 57  ? 34.404  20.673  21.567  1.00 27.34  ? 116 HIS G ND1 1 
ATOM   6179 C  CD2 . HIS G  1 57  ? 36.119  21.903  21.016  1.00 29.46  ? 116 HIS G CD2 1 
ATOM   6180 C  CE1 . HIS G  1 57  ? 34.369  21.747  22.329  1.00 27.74  ? 116 HIS G CE1 1 
ATOM   6181 N  NE2 . HIS G  1 57  ? 35.395  22.515  22.006  1.00 29.16  ? 116 HIS G NE2 1 
ATOM   6182 N  N   . LEU G  1 58  ? 38.975  20.629  20.503  1.00 31.54  ? 117 LEU G N   1 
ATOM   6183 C  CA  . LEU G  1 58  ? 39.937  20.711  21.609  1.00 32.17  ? 117 LEU G CA  1 
ATOM   6184 C  C   . LEU G  1 58  ? 39.792  22.034  22.319  1.00 31.66  ? 117 LEU G C   1 
ATOM   6185 O  O   . LEU G  1 58  ? 39.354  23.028  21.739  1.00 31.78  ? 117 LEU G O   1 
ATOM   6186 C  CB  . LEU G  1 58  ? 41.380  20.592  21.086  1.00 33.54  ? 117 LEU G CB  1 
ATOM   6187 C  CG  . LEU G  1 58  ? 41.838  19.200  20.659  1.00 34.58  ? 117 LEU G CG  1 
ATOM   6188 C  CD1 . LEU G  1 58  ? 43.155  19.275  19.903  1.00 34.83  ? 117 LEU G CD1 1 
ATOM   6189 C  CD2 . LEU G  1 58  ? 41.934  18.319  21.895  1.00 34.97  ? 117 LEU G CD2 1 
ATOM   6190 N  N   . ILE G  1 59  ? 40.188  22.050  23.577  1.00 32.44  ? 118 ILE G N   1 
ATOM   6191 C  CA  . ILE G  1 59  ? 40.240  23.272  24.383  1.00 32.28  ? 118 ILE G CA  1 
ATOM   6192 C  C   . ILE G  1 59  ? 41.702  23.624  24.638  1.00 33.62  ? 118 ILE G C   1 
ATOM   6193 O  O   . ILE G  1 59  ? 42.499  22.744  24.953  1.00 34.64  ? 118 ILE G O   1 
ATOM   6194 C  CB  . ILE G  1 59  ? 39.531  23.054  25.709  1.00 32.36  ? 118 ILE G CB  1 
ATOM   6195 C  CG1 . ILE G  1 59  ? 38.041  22.827  25.450  1.00 31.01  ? 118 ILE G CG1 1 
ATOM   6196 C  CG2 . ILE G  1 59  ? 39.766  24.209  26.658  1.00 32.46  ? 118 ILE G CG2 1 
ATOM   6197 C  CD1 . ILE G  1 59  ? 37.336  22.352  26.695  1.00 32.08  ? 118 ILE G CD1 1 
ATOM   6198 N  N   . PHE G  1 60  ? 42.042  24.906  24.485  1.00 33.76  ? 119 PHE G N   1 
ATOM   6199 C  CA  . PHE G  1 60  ? 43.419  25.371  24.521  1.00 34.99  ? 119 PHE G CA  1 
ATOM   6200 C  C   . PHE G  1 60  ? 43.698  26.258  25.731  1.00 35.92  ? 119 PHE G C   1 
ATOM   6201 O  O   . PHE G  1 60  ? 42.764  26.818  26.344  1.00 35.25  ? 119 PHE G O   1 
ATOM   6202 C  CB  . PHE G  1 60  ? 43.718  26.145  23.247  1.00 35.40  ? 119 PHE G CB  1 
ATOM   6203 C  CG  . PHE G  1 60  ? 43.811  25.281  22.026  1.00 35.12  ? 119 PHE G CG  1 
ATOM   6204 C  CD1 . PHE G  1 60  ? 45.040  24.921  21.510  1.00 36.60  ? 119 PHE G CD1 1 
ATOM   6205 C  CD2 . PHE G  1 60  ? 42.674  24.817  21.405  1.00 34.03  ? 119 PHE G CD2 1 
ATOM   6206 C  CE1 . PHE G  1 60  ? 45.139  24.102  20.378  1.00 37.06  ? 119 PHE G CE1 1 
ATOM   6207 C  CE2 . PHE G  1 60  ? 42.755  24.004  20.291  1.00 34.67  ? 119 PHE G CE2 1 
ATOM   6208 C  CZ  . PHE G  1 60  ? 43.997  23.642  19.772  1.00 36.34  ? 119 PHE G CZ  1 
ATOM   6209 N  N   . GLU G  1 61  ? 44.977  26.346  26.094  1.00 37.08  ? 120 GLU G N   1 
ATOM   6210 C  CA  . GLU G  1 61  ? 45.416  27.267  27.126  1.00 38.34  ? 120 GLU G CA  1 
ATOM   6211 C  C   . GLU G  1 61  ? 45.253  28.714  26.651  1.00 38.16  ? 120 GLU G C   1 
ATOM   6212 O  O   . GLU G  1 61  ? 45.407  29.016  25.472  1.00 37.26  ? 120 GLU G O   1 
ATOM   6213 C  CB  . GLU G  1 61  ? 46.900  27.034  27.434  1.00 40.69  ? 120 GLU G CB  1 
ATOM   6214 C  CG  . GLU G  1 61  ? 47.241  25.667  28.029  1.00 42.16  ? 120 GLU G CG  1 
ATOM   6215 C  CD  . GLU G  1 61  ? 48.670  25.578  28.591  1.00 44.63  ? 120 GLU G CD  1 
ATOM   6216 O  OE1 . GLU G  1 61  ? 49.013  26.358  29.532  1.00 45.90  ? 120 GLU G OE1 1 
ATOM   6217 O  OE2 . GLU G  1 61  ? 49.441  24.710  28.100  1.00 44.91  ? 120 GLU G OE2 1 
ATOM   6218 N  N   . ASP G  1 62  ? 44.965  29.603  27.591  1.00 39.20  ? 121 ASP G N   1 
ATOM   6219 C  CA  . ASP G  1 62  ? 44.767  31.032  27.316  1.00 39.76  ? 121 ASP G CA  1 
ATOM   6220 C  C   . ASP G  1 62  ? 45.801  31.569  26.306  1.00 40.40  ? 121 ASP G C   1 
ATOM   6221 O  O   . ASP G  1 62  ? 45.473  31.991  25.194  1.00 39.48  ? 121 ASP G O   1 
ATOM   6222 C  CB  . ASP G  1 62  ? 44.883  31.831  28.630  1.00 41.34  ? 121 ASP G CB  1 
ATOM   6223 C  CG  . ASP G  1 62  ? 43.710  31.575  29.623  1.00 43.19  ? 121 ASP G CG  1 
ATOM   6224 O  OD1 . ASP G  1 62  ? 42.635  31.009  29.259  1.00 43.00  ? 121 ASP G OD1 1 
ATOM   6225 O  OD2 . ASP G  1 62  ? 43.851  31.947  30.808  1.00 46.54  ? 121 ASP G OD2 1 
ATOM   6226 N  N   . HIS G  1 63  ? 47.063  31.514  26.694  1.00 41.67  ? 122 HIS G N   1 
ATOM   6227 C  CA  . HIS G  1 63  ? 48.095  32.178  25.922  1.00 42.86  ? 122 HIS G CA  1 
ATOM   6228 C  C   . HIS G  1 63  ? 48.415  31.531  24.582  1.00 42.31  ? 122 HIS G C   1 
ATOM   6229 O  O   . HIS G  1 63  ? 49.015  32.167  23.735  1.00 43.82  ? 122 HIS G O   1 
ATOM   6230 C  CB  . HIS G  1 63  ? 49.362  32.286  26.744  1.00 44.88  ? 122 HIS G CB  1 
ATOM   6231 C  CG  . HIS G  1 63  ? 50.111  31.002  26.840  1.00 46.04  ? 122 HIS G CG  1 
ATOM   6232 N  ND1 . HIS G  1 63  ? 49.789  30.013  27.747  1.00 45.81  ? 122 HIS G ND1 1 
ATOM   6233 C  CD2 . HIS G  1 63  ? 51.179  30.545  26.135  1.00 47.83  ? 122 HIS G CD2 1 
ATOM   6234 C  CE1 . HIS G  1 63  ? 50.616  28.994  27.586  1.00 46.84  ? 122 HIS G CE1 1 
ATOM   6235 N  NE2 . HIS G  1 63  ? 51.471  29.292  26.619  1.00 47.88  ? 122 HIS G NE2 1 
ATOM   6236 N  N   . ILE G  1 64  ? 48.046  30.277  24.399  1.00 41.10  ? 123 ILE G N   1 
ATOM   6237 C  CA  . ILE G  1 64  ? 48.136  29.625  23.102  1.00 40.94  ? 123 ILE G CA  1 
ATOM   6238 C  C   . ILE G  1 64  ? 46.970  30.027  22.193  1.00 40.10  ? 123 ILE G C   1 
ATOM   6239 O  O   . ILE G  1 64  ? 47.168  30.370  21.020  1.00 40.83  ? 123 ILE G O   1 
ATOM   6240 C  CB  . ILE G  1 64  ? 48.110  28.108  23.275  1.00 40.39  ? 123 ILE G CB  1 
ATOM   6241 C  CG1 . ILE G  1 64  ? 49.323  27.650  24.078  1.00 42.60  ? 123 ILE G CG1 1 
ATOM   6242 C  CG2 . ILE G  1 64  ? 48.089  27.413  21.924  1.00 39.98  ? 123 ILE G CG2 1 
ATOM   6243 C  CD1 . ILE G  1 64  ? 50.666  27.918  23.400  1.00 43.81  ? 123 ILE G CD1 1 
ATOM   6244 N  N   . TYR G  1 65  ? 45.763  29.976  22.750  1.00 38.82  ? 124 TYR G N   1 
ATOM   6245 C  CA  . TYR G  1 65  ? 44.529  30.335  22.043  1.00 37.99  ? 124 TYR G CA  1 
ATOM   6246 C  C   . TYR G  1 65  ? 44.665  31.704  21.415  1.00 39.33  ? 124 TYR G C   1 
ATOM   6247 O  O   . TYR G  1 65  ? 44.442  31.868  20.221  1.00 40.27  ? 124 TYR G O   1 
ATOM   6248 C  CB  . TYR G  1 65  ? 43.339  30.336  23.018  1.00 36.69  ? 124 TYR G CB  1 
ATOM   6249 C  CG  . TYR G  1 65  ? 41.993  30.644  22.399  1.00 35.95  ? 124 TYR G CG  1 
ATOM   6250 C  CD1 . TYR G  1 65  ? 41.276  29.684  21.713  1.00 34.61  ? 124 TYR G CD1 1 
ATOM   6251 C  CD2 . TYR G  1 65  ? 41.426  31.904  22.514  1.00 37.11  ? 124 TYR G CD2 1 
ATOM   6252 C  CE1 . TYR G  1 65  ? 40.038  29.978  21.170  1.00 33.86  ? 124 TYR G CE1 1 
ATOM   6253 C  CE2 . TYR G  1 65  ? 40.191  32.197  21.965  1.00 35.89  ? 124 TYR G CE2 1 
ATOM   6254 C  CZ  . TYR G  1 65  ? 39.517  31.235  21.298  1.00 34.44  ? 124 TYR G CZ  1 
ATOM   6255 O  OH  . TYR G  1 65  ? 38.309  31.542  20.770  1.00 34.62  ? 124 TYR G OH  1 
ATOM   6256 N  N   . GLU G  1 66  ? 45.058  32.675  22.230  1.00 40.04  ? 125 GLU G N   1 
ATOM   6257 C  CA  . GLU G  1 66  ? 45.251  34.065  21.800  1.00 41.51  ? 125 GLU G CA  1 
ATOM   6258 C  C   . GLU G  1 66  ? 46.077  34.250  20.513  1.00 42.84  ? 125 GLU G C   1 
ATOM   6259 O  O   . GLU G  1 66  ? 45.875  35.221  19.770  1.00 43.40  ? 125 GLU G O   1 
ATOM   6260 C  CB  . GLU G  1 66  ? 45.944  34.787  22.937  1.00 42.46  ? 125 GLU G CB  1 
ATOM   6261 C  CG  . GLU G  1 66  ? 46.296  36.203  22.690  1.00 45.05  ? 125 GLU G CG  1 
ATOM   6262 C  CD  . GLU G  1 66  ? 46.904  36.831  23.930  1.00 47.29  ? 125 GLU G CD  1 
ATOM   6263 O  OE1 . GLU G  1 66  ? 46.537  37.991  24.260  1.00 48.17  ? 125 GLU G OE1 1 
ATOM   6264 O  OE2 . GLU G  1 66  ? 47.741  36.139  24.575  1.00 47.21  ? 125 GLU G OE2 1 
ATOM   6265 N  N   . LYS G  1 67  ? 46.990  33.309  20.264  1.00 43.05  ? 126 LYS G N   1 
ATOM   6266 C  CA  . LYS G  1 67  ? 47.947  33.411  19.161  1.00 44.82  ? 126 LYS G CA  1 
ATOM   6267 C  C   . LYS G  1 67  ? 47.592  32.580  17.922  1.00 44.48  ? 126 LYS G C   1 
ATOM   6268 O  O   . LYS G  1 67  ? 48.350  32.577  16.946  1.00 45.99  ? 126 LYS G O   1 
ATOM   6269 C  CB  . LYS G  1 67  ? 49.333  32.963  19.634  1.00 45.85  ? 126 LYS G CB  1 
ATOM   6270 C  CG  . LYS G  1 67  ? 49.940  33.765  20.749  1.00 47.39  ? 126 LYS G CG  1 
ATOM   6271 C  CD  . LYS G  1 67  ? 50.020  35.245  20.447  1.00 50.80  ? 126 LYS G CD  1 
ATOM   6272 C  CE  . LYS G  1 67  ? 51.097  35.921  21.294  1.00 53.93  ? 126 LYS G CE  1 
ATOM   6273 N  NZ  . LYS G  1 67  ? 50.749  37.342  21.539  1.00 55.68  ? 126 LYS G NZ  1 
ATOM   6274 N  N   . LEU G  1 68  ? 46.473  31.858  17.961  1.00 42.71  ? 127 LEU G N   1 
ATOM   6275 C  CA  . LEU G  1 68  ? 46.125  30.950  16.873  1.00 42.45  ? 127 LEU G CA  1 
ATOM   6276 C  C   . LEU G  1 68  ? 45.671  31.727  15.651  1.00 43.65  ? 127 LEU G C   1 
ATOM   6277 O  O   . LEU G  1 68  ? 45.178  32.849  15.758  1.00 43.79  ? 127 LEU G O   1 
ATOM   6278 C  CB  . LEU G  1 68  ? 45.037  29.988  17.326  1.00 40.37  ? 127 LEU G CB  1 
ATOM   6279 C  CG  . LEU G  1 68  ? 45.443  29.039  18.466  1.00 39.63  ? 127 LEU G CG  1 
ATOM   6280 C  CD1 . LEU G  1 68  ? 44.264  28.154  18.864  1.00 37.27  ? 127 LEU G CD1 1 
ATOM   6281 C  CD2 . LEU G  1 68  ? 46.641  28.193  18.086  1.00 39.71  ? 127 LEU G CD2 1 
ATOM   6282 N  N   . ASP G  1 69  ? 45.835  31.124  14.482  1.00 44.81  ? 128 ASP G N   1 
ATOM   6283 C  CA  . ASP G  1 69  ? 45.423  31.774  13.243  1.00 46.91  ? 128 ASP G CA  1 
ATOM   6284 C  C   . ASP G  1 69  ? 43.949  32.119  13.363  1.00 45.80  ? 128 ASP G C   1 
ATOM   6285 O  O   . ASP G  1 69  ? 43.166  31.337  13.928  1.00 44.32  ? 128 ASP G O   1 
ATOM   6286 C  CB  . ASP G  1 69  ? 45.632  30.866  12.016  1.00 48.41  ? 128 ASP G CB  1 
ATOM   6287 C  CG  . ASP G  1 69  ? 47.113  30.506  11.760  1.00 51.20  ? 128 ASP G CG  1 
ATOM   6288 O  OD1 . ASP G  1 69  ? 48.042  31.208  12.231  1.00 52.42  ? 128 ASP G OD1 1 
ATOM   6289 O  OD2 . ASP G  1 69  ? 47.343  29.491  11.061  1.00 52.80  ? 128 ASP G OD2 1 
ATOM   6290 N  N   . ALA G  1 70  ? 43.563  33.274  12.830  1.00 47.35  ? 129 ALA G N   1 
ATOM   6291 C  CA  . ALA G  1 70  ? 42.156  33.684  12.806  1.00 46.76  ? 129 ALA G CA  1 
ATOM   6292 C  C   . ALA G  1 70  ? 41.272  32.564  12.239  1.00 45.77  ? 129 ALA G C   1 
ATOM   6293 O  O   . ALA G  1 70  ? 41.617  31.921  11.252  1.00 47.21  ? 129 ALA G O   1 
ATOM   6294 C  CB  . ALA G  1 70  ? 41.981  34.954  11.998  1.00 49.06  ? 129 ALA G CB  1 
ATOM   6295 N  N   . ILE G  1 71  ? 40.136  32.345  12.878  1.00 43.63  ? 130 ILE G N   1 
ATOM   6296 C  CA  . ILE G  1 71  ? 39.247  31.259  12.512  1.00 42.69  ? 130 ILE G CA  1 
ATOM   6297 C  C   . ILE G  1 71  ? 38.507  31.534  11.205  1.00 44.76  ? 130 ILE G C   1 
ATOM   6298 O  O   . ILE G  1 71  ? 37.925  32.610  11.047  1.00 46.40  ? 130 ILE G O   1 
ATOM   6299 C  CB  . ILE G  1 71  ? 38.239  30.984  13.652  1.00 40.35  ? 130 ILE G CB  1 
ATOM   6300 C  CG1 . ILE G  1 71  ? 37.404  29.773  13.319  1.00 39.79  ? 130 ILE G CG1 1 
ATOM   6301 C  CG2 . ILE G  1 71  ? 37.344  32.189  13.908  1.00 40.76  ? 130 ILE G CG2 1 
ATOM   6302 C  CD1 . ILE G  1 71  ? 36.670  29.241  14.472  1.00 38.21  ? 130 ILE G CD1 1 
ATOM   6303 N  N   . THR G  1 72  ? 38.539  30.590  10.256  1.00 45.36  ? 131 THR G N   1 
ATOM   6304 C  CA  . THR G  1 72  ? 37.852  30.803  8.972   1.00 47.27  ? 131 THR G CA  1 
ATOM   6305 C  C   . THR G  1 72  ? 36.369  30.560  9.144   1.00 46.21  ? 131 THR G C   1 
ATOM   6306 O  O   . THR G  1 72  ? 35.934  29.974  10.139  1.00 44.09  ? 131 THR G O   1 
ATOM   6307 C  CB  . THR G  1 72  ? 38.355  29.901  7.839   1.00 48.98  ? 131 THR G CB  1 
ATOM   6308 O  OG1 . THR G  1 72  ? 37.950  28.552  8.089   1.00 46.68  ? 131 THR G OG1 1 
ATOM   6309 C  CG2 . THR G  1 72  ? 39.868  29.995  7.679   1.00 49.53  ? 131 THR G CG2 1 
ATOM   6310 N  N   . ASP G  1 73  ? 35.590  31.032  8.183   1.00 48.51  ? 132 ASP G N   1 
ATOM   6311 C  CA  . ASP G  1 73  ? 34.143  30.829  8.200   1.00 48.15  ? 132 ASP G CA  1 
ATOM   6312 C  C   . ASP G  1 73  ? 33.843  29.343  8.208   1.00 46.34  ? 132 ASP G C   1 
ATOM   6313 O  O   . ASP G  1 73  ? 33.000  28.873  8.962   1.00 44.22  ? 132 ASP G O   1 
ATOM   6314 C  CB  . ASP G  1 73  ? 33.498  31.489  6.970   1.00 51.54  ? 132 ASP G CB  1 
ATOM   6315 C  CG  . ASP G  1 73  ? 33.302  32.997  7.139   1.00 54.34  ? 132 ASP G CG  1 
ATOM   6316 O  OD1 . ASP G  1 73  ? 33.091  33.435  8.300   1.00 52.81  ? 132 ASP G OD1 1 
ATOM   6317 O  OD2 . ASP G  1 73  ? 33.337  33.739  6.110   1.00 58.41  ? 132 ASP G OD2 1 
ATOM   6318 N  N   . GLU G  1 74  ? 34.541  28.617  7.342   1.00 47.64  ? 133 GLU G N   1 
ATOM   6319 C  CA  . GLU G  1 74  ? 34.398  27.172  7.256   1.00 46.56  ? 133 GLU G CA  1 
ATOM   6320 C  C   . GLU G  1 74  ? 34.566  26.491  8.604   1.00 43.51  ? 133 GLU G C   1 
ATOM   6321 O  O   . GLU G  1 74  ? 33.708  25.709  9.019   1.00 42.00  ? 133 GLU G O   1 
ATOM   6322 C  CB  . GLU G  1 74  ? 35.430  26.603  6.302   1.00 48.71  ? 133 GLU G CB  1 
ATOM   6323 C  CG  . GLU G  1 74  ? 34.881  26.098  5.008   1.00 52.11  ? 133 GLU G CG  1 
ATOM   6324 C  CD  . GLU G  1 74  ? 35.856  25.111  4.334   1.00 55.72  ? 133 GLU G CD  1 
ATOM   6325 O  OE1 . GLU G  1 74  ? 36.883  25.592  3.790   1.00 58.11  ? 133 GLU G OE1 1 
ATOM   6326 O  OE2 . GLU G  1 74  ? 35.597  23.872  4.360   1.00 55.01  ? 133 GLU G OE2 1 
ATOM   6327 N  N   . GLU G  1 75  ? 35.682  26.763  9.284   1.00 42.87  ? 134 GLU G N   1 
ATOM   6328 C  CA  . GLU G  1 75  ? 35.880  26.187  10.619  1.00 40.04  ? 134 GLU G CA  1 
ATOM   6329 C  C   . GLU G  1 75  ? 34.753  26.579  11.522  1.00 38.21  ? 134 GLU G C   1 
ATOM   6330 O  O   . GLU G  1 75  ? 34.202  25.734  12.190  1.00 36.55  ? 134 GLU G O   1 
ATOM   6331 C  CB  . GLU G  1 75  ? 37.199  26.590  11.264  1.00 39.81  ? 134 GLU G CB  1 
ATOM   6332 C  CG  . GLU G  1 75  ? 37.375  25.986  12.681  1.00 37.54  ? 134 GLU G CG  1 
ATOM   6333 C  CD  . GLU G  1 75  ? 38.740  26.238  13.313  1.00 37.85  ? 134 GLU G CD  1 
ATOM   6334 O  OE1 . GLU G  1 75  ? 39.668  26.655  12.575  1.00 39.86  ? 134 GLU G OE1 1 
ATOM   6335 O  OE2 . GLU G  1 75  ? 38.881  26.023  14.555  1.00 34.99  ? 134 GLU G OE2 1 
ATOM   6336 N  N   . ASN G  1 76  ? 34.377  27.851  11.501  1.00 39.09  ? 135 ASN G N   1 
ATOM   6337 C  CA  . ASN G  1 76  ? 33.377  28.348  12.435  1.00 38.09  ? 135 ASN G CA  1 
ATOM   6338 C  C   . ASN G  1 76  ? 32.034  27.634  12.300  1.00 37.28  ? 135 ASN G C   1 
ATOM   6339 O  O   . ASN G  1 76  ? 31.347  27.372  13.276  1.00 36.09  ? 135 ASN G O   1 
ATOM   6340 C  CB  . ASN G  1 76  ? 33.205  29.851  12.268  1.00 39.96  ? 135 ASN G CB  1 
ATOM   6341 C  CG  . ASN G  1 76  ? 32.673  30.495  13.511  1.00 40.62  ? 135 ASN G CG  1 
ATOM   6342 O  OD1 . ASN G  1 76  ? 33.358  30.518  14.556  1.00 41.29  ? 135 ASN G OD1 1 
ATOM   6343 N  ND2 . ASN G  1 76  ? 31.426  30.994  13.439  1.00 41.19  ? 135 ASN G ND2 1 
ATOM   6344 N  N   . ASP G  1 77  ? 31.660  27.323  11.078  1.00 38.82  ? 136 ASP G N   1 
ATOM   6345 C  CA  . ASP G  1 77  ? 30.449  26.563  10.830  1.00 38.89  ? 136 ASP G CA  1 
ATOM   6346 C  C   . ASP G  1 77  ? 30.426  25.228  11.584  1.00 36.63  ? 136 ASP G C   1 
ATOM   6347 O  O   . ASP G  1 77  ? 29.432  24.871  12.212  1.00 35.65  ? 136 ASP G O   1 
ATOM   6348 C  CB  . ASP G  1 77  ? 30.264  26.316  9.317   1.00 41.32  ? 136 ASP G CB  1 
ATOM   6349 C  CG  . ASP G  1 77  ? 29.748  27.533  8.587   1.00 44.42  ? 136 ASP G CG  1 
ATOM   6350 O  OD1 . ASP G  1 77  ? 29.123  28.373  9.255   1.00 44.62  ? 136 ASP G OD1 1 
ATOM   6351 O  OD2 . ASP G  1 77  ? 29.955  27.663  7.349   1.00 48.17  ? 136 ASP G OD2 1 
ATOM   6352 N  N   . MET G  1 78  ? 31.521  24.494  11.508  1.00 36.08  ? 137 MET G N   1 
ATOM   6353 C  CA  . MET G  1 78  ? 31.604  23.221  12.169  1.00 34.49  ? 137 MET G CA  1 
ATOM   6354 C  C   . MET G  1 78  ? 31.844  23.366  13.648  1.00 32.74  ? 137 MET G C   1 
ATOM   6355 O  O   . MET G  1 78  ? 31.377  22.532  14.439  1.00 31.59  ? 137 MET G O   1 
ATOM   6356 C  CB  . MET G  1 78  ? 32.715  22.389  11.565  1.00 35.52  ? 137 MET G CB  1 
ATOM   6357 C  CG  . MET G  1 78  ? 32.501  22.035  10.119  1.00 37.80  ? 137 MET G CG  1 
ATOM   6358 S  SD  . MET G  1 78  ? 31.004  21.043  9.914   1.00 41.07  ? 137 MET G SD  1 
ATOM   6359 C  CE  . MET G  1 78  ? 29.804  22.270  9.392   1.00 38.65  ? 137 MET G CE  1 
ATOM   6360 N  N   . LEU G  1 79  ? 32.550  24.422  14.043  1.00 33.10  ? 138 LEU G N   1 
ATOM   6361 C  CA  . LEU G  1 79  ? 32.824  24.657  15.451  1.00 31.66  ? 138 LEU G CA  1 
ATOM   6362 C  C   . LEU G  1 79  ? 31.547  24.990  16.179  1.00 30.90  ? 138 LEU G C   1 
ATOM   6363 O  O   . LEU G  1 79  ? 31.388  24.605  17.323  1.00 29.71  ? 138 LEU G O   1 
ATOM   6364 C  CB  . LEU G  1 79  ? 33.871  25.754  15.623  1.00 32.22  ? 138 LEU G CB  1 
ATOM   6365 C  CG  . LEU G  1 79  ? 34.371  26.037  17.050  1.00 31.39  ? 138 LEU G CG  1 
ATOM   6366 C  CD1 . LEU G  1 79  ? 35.004  24.814  17.708  1.00 29.24  ? 138 LEU G CD1 1 
ATOM   6367 C  CD2 . LEU G  1 79  ? 35.329  27.212  17.006  1.00 30.84  ? 138 LEU G CD2 1 
ATOM   6368 N  N   . ASP G  1 80  ? 30.620  25.684  15.517  1.00 31.82  ? 139 ASP G N   1 
ATOM   6369 C  CA  . ASP G  1 80  ? 29.340  25.961  16.153  1.00 31.91  ? 139 ASP G CA  1 
ATOM   6370 C  C   . ASP G  1 80  ? 28.634  24.693  16.600  1.00 30.75  ? 139 ASP G C   1 
ATOM   6371 O  O   . ASP G  1 80  ? 27.851  24.745  17.546  1.00 30.34  ? 139 ASP G O   1 
ATOM   6372 C  CB  . ASP G  1 80  ? 28.393  26.694  15.224  1.00 33.73  ? 139 ASP G CB  1 
ATOM   6373 C  CG  . ASP G  1 80  ? 28.483  28.189  15.355  1.00 36.71  ? 139 ASP G CG  1 
ATOM   6374 O  OD1 . ASP G  1 80  ? 29.055  28.696  16.367  1.00 37.13  ? 139 ASP G OD1 1 
ATOM   6375 O  OD2 . ASP G  1 80  ? 27.973  28.872  14.425  1.00 40.62  ? 139 ASP G OD2 1 
ATOM   6376 N  N   . LEU G  1 81  ? 28.869  23.588  15.888  1.00 30.47  ? 140 LEU G N   1 
ATOM   6377 C  CA  . LEU G  1 81  ? 28.213  22.326  16.194  1.00 29.80  ? 140 LEU G CA  1 
ATOM   6378 C  C   . LEU G  1 81  ? 28.998  21.471  17.178  1.00 29.19  ? 140 LEU G C   1 
ATOM   6379 O  O   . LEU G  1 81  ? 28.609  20.341  17.481  1.00 29.23  ? 140 LEU G O   1 
ATOM   6380 C  CB  . LEU G  1 81  ? 27.939  21.543  14.916  1.00 30.46  ? 140 LEU G CB  1 
ATOM   6381 C  CG  . LEU G  1 81  ? 27.077  22.260  13.854  1.00 32.29  ? 140 LEU G CG  1 
ATOM   6382 C  CD1 . LEU G  1 81  ? 27.046  21.431  12.602  1.00 32.25  ? 140 LEU G CD1 1 
ATOM   6383 C  CD2 . LEU G  1 81  ? 25.685  22.599  14.307  1.00 30.61  ? 140 LEU G CD2 1 
ATOM   6384 N  N   . ALA G  1 82  ? 30.103  21.985  17.698  1.00 29.08  ? 141 ALA G N   1 
ATOM   6385 C  CA  . ALA G  1 82  ? 30.838  21.242  18.719  1.00 28.48  ? 141 ALA G CA  1 
ATOM   6386 C  C   . ALA G  1 82  ? 29.981  21.193  19.983  1.00 27.69  ? 141 ALA G C   1 
ATOM   6387 O  O   . ALA G  1 82  ? 29.402  22.191  20.368  1.00 27.14  ? 141 ALA G O   1 
ATOM   6388 C  CB  . ALA G  1 82  ? 32.203  21.881  19.008  1.00 28.32  ? 141 ALA G CB  1 
ATOM   6389 N  N   . TYR G  1 83  ? 29.889  20.019  20.595  1.00 27.46  ? 142 TYR G N   1 
ATOM   6390 C  CA  . TYR G  1 83  ? 29.182  19.893  21.862  1.00 27.55  ? 142 TYR G CA  1 
ATOM   6391 C  C   . TYR G  1 83  ? 30.038  20.452  22.977  1.00 27.61  ? 142 TYR G C   1 
ATOM   6392 O  O   . TYR G  1 83  ? 31.201  20.095  23.116  1.00 27.88  ? 142 TYR G O   1 
ATOM   6393 C  CB  . TYR G  1 83  ? 28.826  18.438  22.186  1.00 27.98  ? 142 TYR G CB  1 
ATOM   6394 C  CG  . TYR G  1 83  ? 28.068  18.324  23.483  1.00 28.26  ? 142 TYR G CG  1 
ATOM   6395 C  CD1 . TYR G  1 83  ? 26.717  18.598  23.535  1.00 27.85  ? 142 TYR G CD1 1 
ATOM   6396 C  CD2 . TYR G  1 83  ? 28.705  18.007  24.665  1.00 28.22  ? 142 TYR G CD2 1 
ATOM   6397 C  CE1 . TYR G  1 83  ? 26.019  18.538  24.707  1.00 27.52  ? 142 TYR G CE1 1 
ATOM   6398 C  CE2 . TYR G  1 83  ? 28.000  17.924  25.835  1.00 28.90  ? 142 TYR G CE2 1 
ATOM   6399 C  CZ  . TYR G  1 83  ? 26.657  18.193  25.840  1.00 28.63  ? 142 TYR G CZ  1 
ATOM   6400 O  OH  . TYR G  1 83  ? 25.921  18.108  26.995  1.00 31.47  ? 142 TYR G OH  1 
ATOM   6401 N  N   . GLY G  1 84  ? 29.441  21.301  23.789  1.00 27.87  ? 143 GLY G N   1 
ATOM   6402 C  CA  . GLY G  1 84  ? 30.129  21.959  24.898  1.00 28.55  ? 143 GLY G CA  1 
ATOM   6403 C  C   . GLY G  1 84  ? 31.127  23.017  24.477  1.00 28.42  ? 143 GLY G C   1 
ATOM   6404 O  O   . GLY G  1 84  ? 32.171  23.175  25.084  1.00 29.36  ? 143 GLY G O   1 
ATOM   6405 N  N   . LEU G  1 85  ? 30.796  23.739  23.430  1.00 28.67  ? 144 LEU G N   1 
ATOM   6406 C  CA  . LEU G  1 85  ? 31.641  24.820  22.895  1.00 29.10  ? 144 LEU G CA  1 
ATOM   6407 C  C   . LEU G  1 85  ? 32.006  25.872  23.924  1.00 29.53  ? 144 LEU G C   1 
ATOM   6408 O  O   . LEU G  1 85  ? 31.140  26.373  24.624  1.00 30.38  ? 144 LEU G O   1 
ATOM   6409 C  CB  . LEU G  1 85  ? 30.915  25.523  21.762  1.00 29.23  ? 144 LEU G CB  1 
ATOM   6410 C  CG  . LEU G  1 85  ? 31.637  26.658  21.010  1.00 29.87  ? 144 LEU G CG  1 
ATOM   6411 C  CD1 . LEU G  1 85  ? 32.847  26.139  20.235  1.00 28.18  ? 144 LEU G CD1 1 
ATOM   6412 C  CD2 . LEU G  1 85  ? 30.664  27.363  20.078  1.00 28.77  ? 144 LEU G CD2 1 
ATOM   6413 N  N   . THR G  1 86  ? 33.291  26.196  23.983  1.00 29.65  ? 145 THR G N   1 
ATOM   6414 C  CA  . THR G  1 86  ? 33.839  27.099  24.990  1.00 30.26  ? 145 THR G CA  1 
ATOM   6415 C  C   . THR G  1 86  ? 34.484  28.251  24.294  1.00 30.92  ? 145 THR G C   1 
ATOM   6416 O  O   . THR G  1 86  ? 34.745  28.193  23.090  1.00 30.47  ? 145 THR G O   1 
ATOM   6417 C  CB  . THR G  1 86  ? 34.959  26.437  25.830  1.00 30.68  ? 145 THR G CB  1 
ATOM   6418 O  OG1 . THR G  1 86  ? 36.153  26.293  25.037  1.00 29.33  ? 145 THR G OG1 1 
ATOM   6419 C  CG2 . THR G  1 86  ? 34.496  25.085  26.369  1.00 29.19  ? 145 THR G CG2 1 
ATOM   6420 N  N   . ASP G  1 87  ? 34.808  29.275  25.063  1.00 31.91  ? 146 ASP G N   1 
ATOM   6421 C  CA  . ASP G  1 87  ? 35.566  30.406  24.538  1.00 32.63  ? 146 ASP G CA  1 
ATOM   6422 C  C   . ASP G  1 87  ? 37.073  30.146  24.412  1.00 32.63  ? 146 ASP G C   1 
ATOM   6423 O  O   . ASP G  1 87  ? 37.825  31.078  24.270  1.00 33.54  ? 146 ASP G O   1 
ATOM   6424 C  CB  . ASP G  1 87  ? 35.325  31.629  25.409  1.00 33.66  ? 146 ASP G CB  1 
ATOM   6425 C  CG  . ASP G  1 87  ? 35.713  31.391  26.840  1.00 34.66  ? 146 ASP G CG  1 
ATOM   6426 O  OD1 . ASP G  1 87  ? 35.240  32.157  27.725  1.00 35.25  ? 146 ASP G OD1 1 
ATOM   6427 O  OD2 . ASP G  1 87  ? 36.492  30.421  27.057  1.00 31.71  ? 146 ASP G OD2 1 
ATOM   6428 N  N   . ARG G  1 88  ? 37.508  28.894  24.511  1.00 32.13  ? 147 ARG G N   1 
ATOM   6429 C  CA  . ARG G  1 88  ? 38.884  28.478  24.191  1.00 32.17  ? 147 ARG G CA  1 
ATOM   6430 C  C   . ARG G  1 88  ? 38.870  27.275  23.262  1.00 31.54  ? 147 ARG G C   1 
ATOM   6431 O  O   . ARG G  1 88  ? 39.860  26.579  23.145  1.00 32.05  ? 147 ARG G O   1 
ATOM   6432 C  CB  . ARG G  1 88  ? 39.638  28.113  25.467  1.00 32.68  ? 147 ARG G CB  1 
ATOM   6433 C  CG  . ARG G  1 88  ? 39.719  29.234  26.508  1.00 33.39  ? 147 ARG G CG  1 
ATOM   6434 C  CD  . ARG G  1 88  ? 40.800  30.221  26.171  1.00 34.56  ? 147 ARG G CD  1 
ATOM   6435 N  NE  . ARG G  1 88  ? 40.902  31.264  27.193  1.00 35.98  ? 147 ARG G NE  1 
ATOM   6436 C  CZ  . ARG G  1 88  ? 40.209  32.392  27.218  1.00 36.06  ? 147 ARG G CZ  1 
ATOM   6437 N  NH1 . ARG G  1 88  ? 39.339  32.676  26.273  1.00 36.96  ? 147 ARG G NH1 1 
ATOM   6438 N  NH2 . ARG G  1 88  ? 40.396  33.252  28.187  1.00 38.24  ? 147 ARG G NH2 1 
ATOM   6439 N  N   . SER G  1 89  ? 37.744  27.030  22.596  1.00 30.84  ? 148 SER G N   1 
ATOM   6440 C  CA  . SER G  1 89  ? 37.606  25.901  21.705  1.00 30.24  ? 148 SER G CA  1 
ATOM   6441 C  C   . SER G  1 89  ? 38.092  26.195  20.306  1.00 30.77  ? 148 SER G C   1 
ATOM   6442 O  O   . SER G  1 89  ? 37.900  27.286  19.802  1.00 30.96  ? 148 SER G O   1 
ATOM   6443 C  CB  . SER G  1 89  ? 36.152  25.486  21.643  1.00 29.63  ? 148 SER G CB  1 
ATOM   6444 O  OG  . SER G  1 89  ? 35.682  25.028  22.909  1.00 29.60  ? 148 SER G OG  1 
ATOM   6445 N  N   . ARG G  1 90  ? 38.754  25.213  19.694  1.00 31.14  ? 149 ARG G N   1 
ATOM   6446 C  CA  . ARG G  1 90  ? 39.009  25.211  18.265  1.00 32.11  ? 149 ARG G CA  1 
ATOM   6447 C  C   . ARG G  1 90  ? 38.942  23.773  17.788  1.00 32.24  ? 149 ARG G C   1 
ATOM   6448 O  O   . ARG G  1 90  ? 38.917  22.844  18.598  1.00 31.20  ? 149 ARG G O   1 
ATOM   6449 C  CB  . ARG G  1 90  ? 40.397  25.786  17.941  1.00 33.90  ? 149 ARG G CB  1 
ATOM   6450 C  CG  . ARG G  1 90  ? 40.592  27.306  18.245  1.00 34.63  ? 149 ARG G CG  1 
ATOM   6451 C  CD  . ARG G  1 90  ? 39.746  28.204  17.358  1.00 35.00  ? 149 ARG G CD  1 
ATOM   6452 N  NE  . ARG G  1 90  ? 40.082  28.019  15.952  1.00 36.42  ? 149 ARG G NE  1 
ATOM   6453 C  CZ  . ARG G  1 90  ? 40.980  28.725  15.267  1.00 38.36  ? 149 ARG G CZ  1 
ATOM   6454 N  NH1 . ARG G  1 90  ? 41.637  29.734  15.832  1.00 38.91  ? 149 ARG G NH1 1 
ATOM   6455 N  NH2 . ARG G  1 90  ? 41.206  28.438  13.987  1.00 39.29  ? 149 ARG G NH2 1 
ATOM   6456 N  N   . LEU G  1 91  ? 38.933  23.601  16.465  1.00 33.39  ? 150 LEU G N   1 
ATOM   6457 C  CA  . LEU G  1 91  ? 38.914  22.295  15.846  1.00 33.42  ? 150 LEU G CA  1 
ATOM   6458 C  C   . LEU G  1 91  ? 40.355  21.902  15.639  1.00 35.11  ? 150 LEU G C   1 
ATOM   6459 O  O   . LEU G  1 91  ? 41.063  22.511  14.850  1.00 36.73  ? 150 LEU G O   1 
ATOM   6460 C  CB  . LEU G  1 91  ? 38.123  22.339  14.545  1.00 33.99  ? 150 LEU G CB  1 
ATOM   6461 C  CG  . LEU G  1 91  ? 36.608  22.590  14.728  1.00 33.36  ? 150 LEU G CG  1 
ATOM   6462 C  CD1 . LEU G  1 91  ? 35.767  22.353  13.486  1.00 33.29  ? 150 LEU G CD1 1 
ATOM   6463 C  CD2 . LEU G  1 91  ? 36.020  21.783  15.845  1.00 31.52  ? 150 LEU G CD2 1 
ATOM   6464 N  N   . GLY G  1 92  ? 40.803  20.885  16.372  1.00 35.34  ? 151 GLY G N   1 
ATOM   6465 C  CA  . GLY G  1 92  ? 42.228  20.555  16.460  1.00 37.05  ? 151 GLY G CA  1 
ATOM   6466 C  C   . GLY G  1 92  ? 42.876  20.286  15.112  1.00 39.29  ? 151 GLY G C   1 
ATOM   6467 O  O   . GLY G  1 92  ? 44.092  20.303  14.938  1.00 41.20  ? 151 GLY G O   1 
ATOM   6468 N  N   . CYS G  1 93  ? 42.044  20.052  14.137  1.00 39.54  ? 152 CYS G N   1 
ATOM   6469 C  CA  . CYS G  1 93  ? 42.546  19.613  12.863  1.00 42.42  ? 152 CYS G CA  1 
ATOM   6470 C  C   . CYS G  1 93  ? 42.873  20.760  11.933  1.00 43.20  ? 152 CYS G C   1 
ATOM   6471 O  O   . CYS G  1 93  ? 43.463  20.560  10.877  1.00 44.41  ? 152 CYS G O   1 
ATOM   6472 C  CB  . CYS G  1 93  ? 41.567  18.630  12.229  1.00 42.66  ? 152 CYS G CB  1 
ATOM   6473 S  SG  . CYS G  1 93  ? 40.031  19.305  11.399  1.00 44.30  ? 152 CYS G SG  1 
ATOM   6474 N  N   . GLN G  1 94  ? 42.472  21.957  12.353  1.00 41.87  ? 153 GLN G N   1 
ATOM   6475 C  CA  . GLN G  1 94  ? 42.846  23.176  11.677  1.00 43.20  ? 153 GLN G CA  1 
ATOM   6476 C  C   . GLN G  1 94  ? 44.028  23.868  12.364  1.00 43.50  ? 153 GLN G C   1 
ATOM   6477 O  O   . GLN G  1 94  ? 44.624  24.777  11.797  1.00 45.26  ? 153 GLN G O   1 
ATOM   6478 C  CB  . GLN G  1 94  ? 41.648  24.104  11.604  1.00 41.80  ? 153 GLN G CB  1 
ATOM   6479 C  CG  . GLN G  1 94  ? 40.509  23.522  10.829  1.00 42.01  ? 153 GLN G CG  1 
ATOM   6480 C  CD  . GLN G  1 94  ? 40.876  23.208  9.419   1.00 44.18  ? 153 GLN G CD  1 
ATOM   6481 O  OE1 . GLN G  1 94  ? 41.278  24.082  8.668   1.00 46.17  ? 153 GLN G OE1 1 
ATOM   6482 N  NE2 . GLN G  1 94  ? 40.725  21.967  9.042   1.00 45.01  ? 153 GLN G NE2 1 
ATOM   6483 N  N   . ILE G  1 95  ? 44.386  23.410  13.558  1.00 42.21  ? 154 ILE G N   1 
ATOM   6484 C  CA  . ILE G  1 95  ? 45.436  24.033  14.333  1.00 42.55  ? 154 ILE G CA  1 
ATOM   6485 C  C   . ILE G  1 95  ? 46.756  23.306  14.135  1.00 45.19  ? 154 ILE G C   1 
ATOM   6486 O  O   . ILE G  1 95  ? 46.884  22.123  14.480  1.00 45.59  ? 154 ILE G O   1 
ATOM   6487 C  CB  . ILE G  1 95  ? 45.076  24.055  15.806  1.00 40.34  ? 154 ILE G CB  1 
ATOM   6488 C  CG1 . ILE G  1 95  ? 43.743  24.802  15.991  1.00 38.91  ? 154 ILE G CG1 1 
ATOM   6489 C  CG2 . ILE G  1 95  ? 46.183  24.660  16.609  1.00 39.65  ? 154 ILE G CG2 1 
ATOM   6490 C  CD1 . ILE G  1 95  ? 43.630  26.122  15.209  1.00 39.23  ? 154 ILE G CD1 1 
ATOM   6491 N  N   . CYS G  1 96  ? 47.729  24.029  13.580  1.00 47.02  ? 155 CYS G N   1 
ATOM   6492 C  CA  . CYS G  1 96  ? 49.053  23.497  13.314  1.00 49.63  ? 155 CYS G CA  1 
ATOM   6493 C  C   . CYS G  1 96  ? 50.077  23.862  14.385  1.00 49.46  ? 155 CYS G C   1 
ATOM   6494 O  O   . CYS G  1 96  ? 50.109  24.972  14.895  1.00 48.82  ? 155 CYS G O   1 
ATOM   6495 C  CB  . CYS G  1 96  ? 49.515  23.987  11.945  1.00 52.52  ? 155 CYS G CB  1 
ATOM   6496 S  SG  . CYS G  1 96  ? 48.643  23.115  10.605  1.00 56.80  ? 155 CYS G SG  1 
ATOM   6497 N  N   . LEU G  1 97  ? 50.932  22.911  14.714  1.00 50.79  ? 156 LEU G N   1 
ATOM   6498 C  CA  . LEU G  1 97  ? 51.948  23.118  15.732  1.00 51.29  ? 156 LEU G CA  1 
ATOM   6499 C  C   . LEU G  1 97  ? 52.963  24.164  15.306  1.00 53.17  ? 156 LEU G C   1 
ATOM   6500 O  O   . LEU G  1 97  ? 53.488  24.114  14.188  1.00 55.38  ? 156 LEU G O   1 
ATOM   6501 C  CB  . LEU G  1 97  ? 52.684  21.806  16.034  1.00 53.02  ? 156 LEU G CB  1 
ATOM   6502 C  CG  . LEU G  1 97  ? 51.869  20.691  16.698  1.00 51.36  ? 156 LEU G CG  1 
ATOM   6503 C  CD1 . LEU G  1 97  ? 52.731  19.482  16.955  1.00 52.69  ? 156 LEU G CD1 1 
ATOM   6504 C  CD2 . LEU G  1 97  ? 51.232  21.152  17.993  1.00 49.04  ? 156 LEU G CD2 1 
ATOM   6505 N  N   . THR G  1 98  ? 53.211  25.117  16.200  1.00 52.37  ? 157 THR G N   1 
ATOM   6506 C  CA  . THR G  1 98  ? 54.293  26.083  16.041  1.00 54.49  ? 157 THR G CA  1 
ATOM   6507 C  C   . THR G  1 98  ? 55.286  25.887  17.167  1.00 55.46  ? 157 THR G C   1 
ATOM   6508 O  O   . THR G  1 98  ? 54.962  25.313  18.207  1.00 54.01  ? 157 THR G O   1 
ATOM   6509 C  CB  . THR G  1 98  ? 53.799  27.535  16.089  1.00 53.39  ? 157 THR G CB  1 
ATOM   6510 O  OG1 . THR G  1 98  ? 53.167  27.784  17.345  1.00 51.60  ? 157 THR G OG1 1 
ATOM   6511 C  CG2 . THR G  1 98  ? 52.805  27.810  14.970  1.00 52.65  ? 157 THR G CG2 1 
ATOM   6512 N  N   . LYS G  1 99  ? 56.507  26.358  16.949  1.00 58.33  ? 158 LYS G N   1 
ATOM   6513 C  CA  . LYS G  1 99  ? 57.585  26.179  17.929  1.00 59.83  ? 158 LYS G CA  1 
ATOM   6514 C  C   . LYS G  1 99  ? 57.144  26.677  19.337  1.00 57.71  ? 158 LYS G C   1 
ATOM   6515 O  O   . LYS G  1 99  ? 57.531  26.120  20.362  1.00 58.24  ? 158 LYS G O   1 
ATOM   6516 C  CB  . LYS G  1 99  ? 58.860  26.890  17.451  1.00 62.78  ? 158 LYS G CB  1 
ATOM   6517 C  CG  . LYS G  1 99  ? 60.165  26.142  17.756  1.00 66.84  ? 158 LYS G CG  1 
ATOM   6518 C  CD  . LYS G  1 99  ? 60.627  25.217  16.610  1.00 70.40  ? 158 LYS G CD  1 
ATOM   6519 N  N   . SER G  1 100 ? 56.316  27.712  19.386  1.00 55.59  ? 159 SER G N   1 
ATOM   6520 C  CA  . SER G  1 100 ? 55.942  28.306  20.670  1.00 54.26  ? 159 SER G CA  1 
ATOM   6521 C  C   . SER G  1 100 ? 54.916  27.466  21.451  1.00 51.96  ? 159 SER G C   1 
ATOM   6522 O  O   . SER G  1 100 ? 54.556  27.803  22.583  1.00 50.79  ? 159 SER G O   1 
ATOM   6523 C  CB  . SER G  1 100 ? 55.380  29.697  20.434  1.00 53.42  ? 159 SER G CB  1 
ATOM   6524 O  OG  . SER G  1 100 ? 54.225  29.594  19.632  1.00 52.72  ? 159 SER G OG  1 
ATOM   6525 N  N   . MET G  1 101 ? 54.444  26.389  20.835  1.00 51.37  ? 160 MET G N   1 
ATOM   6526 C  CA  . MET G  1 101 ? 53.481  25.505  21.465  1.00 49.70  ? 160 MET G CA  1 
ATOM   6527 C  C   . MET G  1 101 ? 54.122  24.410  22.313  1.00 51.06  ? 160 MET G C   1 
ATOM   6528 O  O   . MET G  1 101 ? 53.410  23.624  22.933  1.00 50.04  ? 160 MET G O   1 
ATOM   6529 C  CB  . MET G  1 101 ? 52.566  24.846  20.409  1.00 48.72  ? 160 MET G CB  1 
ATOM   6530 C  CG  . MET G  1 101 ? 51.468  25.756  19.842  1.00 46.83  ? 160 MET G CG  1 
ATOM   6531 S  SD  . MET G  1 101 ? 50.477  24.915  18.579  1.00 48.26  ? 160 MET G SD  1 
ATOM   6532 C  CE  . MET G  1 101 ? 49.732  26.336  17.732  1.00 46.68  ? 160 MET G CE  1 
ATOM   6533 N  N   . ASP G  1 102 ? 55.447  24.343  22.349  1.00 53.81  ? 161 ASP G N   1 
ATOM   6534 C  CA  . ASP G  1 102 ? 56.132  23.287  23.102  1.00 55.60  ? 161 ASP G CA  1 
ATOM   6535 C  C   . ASP G  1 102 ? 55.655  23.249  24.557  1.00 54.48  ? 161 ASP G C   1 
ATOM   6536 O  O   . ASP G  1 102 ? 55.583  24.288  25.212  1.00 53.58  ? 161 ASP G O   1 
ATOM   6537 C  CB  . ASP G  1 102 ? 57.651  23.487  23.033  1.00 58.73  ? 161 ASP G CB  1 
ATOM   6538 C  CG  . ASP G  1 102 ? 58.430  22.245  23.433  1.00 61.68  ? 161 ASP G CG  1 
ATOM   6539 O  OD1 . ASP G  1 102 ? 58.135  21.134  22.941  1.00 61.37  ? 161 ASP G OD1 1 
ATOM   6540 O  OD2 . ASP G  1 102 ? 59.380  22.396  24.224  1.00 65.60  ? 161 ASP G OD2 1 
ATOM   6541 N  N   . ASN G  1 103 ? 55.305  22.050  25.024  1.00 54.58  ? 162 ASN G N   1 
ATOM   6542 C  CA  . ASN G  1 103 ? 54.787  21.808  26.386  1.00 54.25  ? 162 ASN G CA  1 
ATOM   6543 C  C   . ASN G  1 103 ? 53.428  22.429  26.714  1.00 51.20  ? 162 ASN G C   1 
ATOM   6544 O  O   . ASN G  1 103 ? 53.082  22.586  27.889  1.00 51.06  ? 162 ASN G O   1 
ATOM   6545 C  CB  . ASN G  1 103 ? 55.815  22.199  27.455  1.00 56.59  ? 162 ASN G CB  1 
ATOM   6546 C  CG  . ASN G  1 103 ? 56.940  21.175  27.592  1.00 60.50  ? 162 ASN G CG  1 
ATOM   6547 O  OD1 . ASN G  1 103 ? 56.707  19.994  27.893  1.00 60.90  ? 162 ASN G OD1 1 
ATOM   6548 N  ND2 . ASN G  1 103 ? 58.170  21.633  27.405  1.00 62.34  ? 162 ASN G ND2 1 
ATOM   6549 N  N   . MET G  1 104 ? 52.651  22.760  25.690  1.00 48.99  ? 163 MET G N   1 
ATOM   6550 C  CA  . MET G  1 104 ? 51.275  23.162  25.921  1.00 46.56  ? 163 MET G CA  1 
ATOM   6551 C  C   . MET G  1 104 ? 50.446  21.944  26.302  1.00 45.91  ? 163 MET G C   1 
ATOM   6552 O  O   . MET G  1 104 ? 50.809  20.809  26.017  1.00 46.86  ? 163 MET G O   1 
ATOM   6553 C  CB  . MET G  1 104 ? 50.659  23.845  24.695  1.00 44.77  ? 163 MET G CB  1 
ATOM   6554 C  CG  . MET G  1 104 ? 50.391  22.915  23.518  1.00 44.57  ? 163 MET G CG  1 
ATOM   6555 S  SD  . MET G  1 104 ? 49.476  23.753  22.248  1.00 42.73  ? 163 MET G SD  1 
ATOM   6556 C  CE  . MET G  1 104 ? 49.182  22.423  21.086  1.00 42.43  ? 163 MET G CE  1 
ATOM   6557 N  N   . THR G  1 105 ? 49.317  22.225  26.935  1.00 44.55  ? 164 THR G N   1 
ATOM   6558 C  CA  . THR G  1 105 ? 48.317  21.229  27.276  1.00 43.60  ? 164 THR G CA  1 
ATOM   6559 C  C   . THR G  1 105 ? 46.995  21.587  26.567  1.00 41.04  ? 164 THR G C   1 
ATOM   6560 O  O   . THR G  1 105 ? 46.511  22.717  26.635  1.00 39.89  ? 164 THR G O   1 
ATOM   6561 C  CB  . THR G  1 105 ? 48.095  21.189  28.803  1.00 44.44  ? 164 THR G CB  1 
ATOM   6562 O  OG1 . THR G  1 105 ? 49.351  20.967  29.486  1.00 47.09  ? 164 THR G OG1 1 
ATOM   6563 C  CG2 . THR G  1 105 ? 47.108  20.114  29.157  1.00 43.51  ? 164 THR G CG2 1 
ATOM   6564 N  N   . VAL G  1 106 ? 46.428  20.621  25.867  1.00 40.40  ? 165 VAL G N   1 
ATOM   6565 C  CA  . VAL G  1 106 ? 45.101  20.776  25.295  1.00 38.11  ? 165 VAL G CA  1 
ATOM   6566 C  C   . VAL G  1 106 ? 44.223  19.753  25.971  1.00 37.69  ? 165 VAL G C   1 
ATOM   6567 O  O   . VAL G  1 106 ? 44.711  18.730  26.387  1.00 39.16  ? 165 VAL G O   1 
ATOM   6568 C  CB  . VAL G  1 106 ? 45.083  20.546  23.761  1.00 37.81  ? 165 VAL G CB  1 
ATOM   6569 C  CG1 . VAL G  1 106 ? 45.891  21.609  23.063  1.00 37.95  ? 165 VAL G CG1 1 
ATOM   6570 C  CG2 . VAL G  1 106 ? 45.580  19.167  23.402  1.00 38.53  ? 165 VAL G CG2 1 
ATOM   6571 N  N   . ARG G  1 107 ? 42.938  20.045  26.111  1.00 36.20  ? 166 ARG G N   1 
ATOM   6572 C  CA  . ARG G  1 107 ? 42.009  19.090  26.709  1.00 36.10  ? 166 ARG G CA  1 
ATOM   6573 C  C   . ARG G  1 107 ? 40.996  18.601  25.673  1.00 34.66  ? 166 ARG G C   1 
ATOM   6574 O  O   . ARG G  1 107 ? 40.473  19.386  24.881  1.00 33.63  ? 166 ARG G O   1 
ATOM   6575 C  CB  . ARG G  1 107 ? 41.301  19.681  27.939  1.00 35.55  ? 166 ARG G CB  1 
ATOM   6576 C  CG  . ARG G  1 107 ? 40.273  18.737  28.522  1.00 35.96  ? 166 ARG G CG  1 
ATOM   6577 C  CD  . ARG G  1 107 ? 39.933  19.074  29.957  1.00 37.45  ? 166 ARG G CD  1 
ATOM   6578 N  NE  . ARG G  1 107 ? 39.162  20.307  30.069  1.00 36.58  ? 166 ARG G NE  1 
ATOM   6579 C  CZ  . ARG G  1 107 ? 37.871  20.409  29.797  1.00 35.48  ? 166 ARG G CZ  1 
ATOM   6580 N  NH1 . ARG G  1 107 ? 37.276  21.579  29.945  1.00 35.52  ? 166 ARG G NH1 1 
ATOM   6581 N  NH2 . ARG G  1 107 ? 37.175  19.348  29.383  1.00 34.59  ? 166 ARG G NH2 1 
ATOM   6582 N  N   . VAL G  1 108 ? 40.738  17.300  25.681  1.00 35.19  ? 167 VAL G N   1 
ATOM   6583 C  CA  . VAL G  1 108 ? 39.673  16.709  24.886  1.00 34.24  ? 167 VAL G CA  1 
ATOM   6584 C  C   . VAL G  1 108 ? 38.384  16.755  25.700  1.00 33.54  ? 167 VAL G C   1 
ATOM   6585 O  O   . VAL G  1 108 ? 38.270  16.097  26.723  1.00 34.81  ? 167 VAL G O   1 
ATOM   6586 C  CB  . VAL G  1 108 ? 39.927  15.248  24.534  1.00 35.57  ? 167 VAL G CB  1 
ATOM   6587 C  CG1 . VAL G  1 108 ? 38.974  14.830  23.435  1.00 34.12  ? 167 VAL G CG1 1 
ATOM   6588 C  CG2 . VAL G  1 108 ? 41.373  15.021  24.111  1.00 36.78  ? 167 VAL G CG2 1 
ATOM   6589 N  N   . PRO G  1 109 ? 37.411  17.534  25.243  1.00 32.08  ? 168 PRO G N   1 
ATOM   6590 C  CA  . PRO G  1 109 ? 36.178  17.717  25.994  1.00 31.47  ? 168 PRO G CA  1 
ATOM   6591 C  C   . PRO G  1 109 ? 35.247  16.543  25.833  1.00 31.19  ? 168 PRO G C   1 
ATOM   6592 O  O   . PRO G  1 109 ? 35.406  15.762  24.918  1.00 30.90  ? 168 PRO G O   1 
ATOM   6593 C  CB  . PRO G  1 109 ? 35.571  18.982  25.355  1.00 30.38  ? 168 PRO G CB  1 
ATOM   6594 C  CG  . PRO G  1 109 ? 36.103  19.003  23.946  1.00 29.98  ? 168 PRO G CG  1 
ATOM   6595 C  CD  . PRO G  1 109 ? 37.385  18.227  23.932  1.00 31.01  ? 168 PRO G CD  1 
ATOM   6596 N  N   . GLU G  1 110 ? 34.275  16.419  26.721  1.00 31.51  ? 169 GLU G N   1 
ATOM   6597 C  CA  . GLU G  1 110 ? 33.316  15.323  26.628  1.00 31.98  ? 169 GLU G CA  1 
ATOM   6598 C  C   . GLU G  1 110 ? 32.391  15.465  25.426  1.00 30.30  ? 169 GLU G C   1 
ATOM   6599 O  O   . GLU G  1 110 ? 32.156  16.541  24.963  1.00 28.96  ? 169 GLU G O   1 
ATOM   6600 C  CB  . GLU G  1 110 ? 32.498  15.205  27.912  1.00 32.88  ? 169 GLU G CB  1 
ATOM   6601 C  CG  . GLU G  1 110 ? 31.486  16.288  28.140  1.00 32.46  ? 169 GLU G CG  1 
ATOM   6602 C  CD  . GLU G  1 110 ? 30.561  16.041  29.374  1.00 36.11  ? 169 GLU G CD  1 
ATOM   6603 O  OE1 . GLU G  1 110 ? 29.844  17.012  29.752  1.00 36.14  ? 169 GLU G OE1 1 
ATOM   6604 O  OE2 . GLU G  1 110 ? 30.529  14.899  29.966  1.00 37.78  ? 169 GLU G OE2 1 
ATOM   6605 N  N   . THR G  1 111 ? 31.916  14.351  24.909  1.00 30.77  ? 170 THR G N   1 
ATOM   6606 C  CA  . THR G  1 111 ? 31.026  14.358  23.771  1.00 29.95  ? 170 THR G CA  1 
ATOM   6607 C  C   . THR G  1 111 ? 29.602  14.425  24.266  1.00 29.47  ? 170 THR G C   1 
ATOM   6608 O  O   . THR G  1 111 ? 29.346  14.236  25.462  1.00 30.53  ? 170 THR G O   1 
ATOM   6609 C  CB  . THR G  1 111 ? 31.178  13.073  22.954  1.00 30.76  ? 170 THR G CB  1 
ATOM   6610 O  OG1 . THR G  1 111 ? 30.712  11.969  23.750  1.00 31.97  ? 170 THR G OG1 1 
ATOM   6611 C  CG2 . THR G  1 111 ? 32.620  12.861  22.551  1.00 30.35  ? 170 THR G CG2 1 
ATOM   6612 N  N   . VAL G  1 112 ? 28.678  14.672  23.350  1.00 28.41  ? 171 VAL G N   1 
ATOM   6613 C  CA  . VAL G  1 112 ? 27.271  14.661  23.690  1.00 28.29  ? 171 VAL G CA  1 
ATOM   6614 C  C   . VAL G  1 112 ? 26.837  13.290  24.260  1.00 29.06  ? 171 VAL G C   1 
ATOM   6615 O  O   . VAL G  1 112 ? 25.977  13.219  25.120  1.00 29.11  ? 171 VAL G O   1 
ATOM   6616 C  CB  . VAL G  1 112 ? 26.391  15.057  22.461  1.00 27.91  ? 171 VAL G CB  1 
ATOM   6617 C  CG1 . VAL G  1 112 ? 26.435  13.985  21.353  1.00 27.37  ? 171 VAL G CG1 1 
ATOM   6618 C  CG2 . VAL G  1 112 ? 24.969  15.350  22.917  1.00 26.59  ? 171 VAL G CG2 1 
ATOM   6619 N  N   . ALA G  1 113 ? 27.451  12.216  23.784  1.00 29.80  ? 172 ALA G N   1 
ATOM   6620 C  CA  . ALA G  1 113 ? 27.146  10.874  24.279  1.00 31.57  ? 172 ALA G CA  1 
ATOM   6621 C  C   . ALA G  1 113 ? 27.559  10.675  25.731  1.00 33.18  ? 172 ALA G C   1 
ATOM   6622 O  O   . ALA G  1 113 ? 26.870  9.979   26.446  1.00 35.45  ? 172 ALA G O   1 
ATOM   6623 C  CB  . ALA G  1 113 ? 27.792  9.830   23.412  1.00 31.81  ? 172 ALA G CB  1 
ATOM   6624 N  N   . ASP G  1 114 ? 28.651  11.299  26.168  1.00 33.55  ? 173 ASP G N   1 
ATOM   6625 C  CA  . ASP G  1 114 ? 29.120  11.169  27.554  1.00 35.54  ? 173 ASP G CA  1 
ATOM   6626 C  C   . ASP G  1 114 ? 28.155  11.806  28.530  1.00 35.35  ? 173 ASP G C   1 
ATOM   6627 O  O   . ASP G  1 114 ? 27.979  11.318  29.646  1.00 36.62  ? 173 ASP G O   1 
ATOM   6628 C  CB  . ASP G  1 114 ? 30.508  11.814  27.754  1.00 36.06  ? 173 ASP G CB  1 
ATOM   6629 C  CG  . ASP G  1 114 ? 31.617  11.198  26.834  1.00 38.29  ? 173 ASP G CG  1 
ATOM   6630 O  OD1 . ASP G  1 114 ? 31.646  9.944   26.614  1.00 39.12  ? 173 ASP G OD1 1 
ATOM   6631 O  OD2 . ASP G  1 114 ? 32.462  11.990  26.331  1.00 38.66  ? 173 ASP G OD2 1 
ATOM   6632 N  N   . ALA G  1 115 ? 27.522  12.890  28.094  1.00 33.95  ? 174 ALA G N   1 
ATOM   6633 C  CA  . ALA G  1 115 ? 26.662  13.710  28.967  1.00 34.13  ? 174 ALA G CA  1 
ATOM   6634 C  C   . ALA G  1 115 ? 25.250  13.228  28.939  1.00 34.70  ? 174 ALA G C   1 
ATOM   6635 O  O   . ALA G  1 115 ? 24.474  13.544  29.805  1.00 36.45  ? 174 ALA G O   1 
ATOM   6636 C  CB  . ALA G  1 115 ? 26.689  15.157  28.536  1.00 32.31  ? 174 ALA G CB  1 
ATOM   6637 N  N   . ARG G  1 116 ? 24.890  12.487  27.917  1.00 34.72  ? 175 ARG G N   1 
ATOM   6638 C  CA  . ARG G  1 116 ? 23.490  12.123  27.738  1.00 35.07  ? 175 ARG G CA  1 
ATOM   6639 C  C   . ARG G  1 116 ? 23.105  11.117  28.814  1.00 37.92  ? 175 ARG G C   1 
ATOM   6640 O  O   . ARG G  1 116 ? 23.712  10.049  28.906  1.00 38.60  ? 175 ARG G O   1 
ATOM   6641 C  CB  . ARG G  1 116 ? 23.291  11.534  26.339  1.00 33.45  ? 175 ARG G CB  1 
ATOM   6642 C  CG  . ARG G  1 116 ? 21.975  10.904  26.098  1.00 31.42  ? 175 ARG G CG  1 
ATOM   6643 C  CD  . ARG G  1 116 ? 21.962  10.222  24.775  1.00 30.26  ? 175 ARG G CD  1 
ATOM   6644 N  NE  . ARG G  1 116 ? 22.208  11.222  23.753  1.00 29.04  ? 175 ARG G NE  1 
ATOM   6645 C  CZ  . ARG G  1 116 ? 23.161  11.195  22.835  1.00 27.37  ? 175 ARG G CZ  1 
ATOM   6646 N  NH1 . ARG G  1 116 ? 23.992  10.163  22.709  1.00 28.50  ? 175 ARG G NH1 1 
ATOM   6647 N  NH2 . ARG G  1 116 ? 23.252  12.223  22.008  1.00 27.75  ? 175 ARG G NH2 1 
ATOM   6648 N  N   . GLN G  1 117 ? 22.107  11.450  29.620  1.00 40.20  ? 176 GLN G N   1 
ATOM   6649 C  CA  . GLN G  1 117 ? 21.598  10.478  30.588  1.00 44.25  ? 176 GLN G CA  1 
ATOM   6650 C  C   . GLN G  1 117 ? 20.462  9.643   30.003  1.00 44.44  ? 176 GLN G C   1 
ATOM   6651 O  O   . GLN G  1 117 ? 20.290  8.476   30.375  1.00 46.53  ? 176 GLN G O   1 
ATOM   6652 C  CB  . GLN G  1 117 ? 21.170  11.155  31.899  1.00 46.80  ? 176 GLN G CB  1 
ATOM   6653 C  CG  . GLN G  1 117 ? 22.334  11.845  32.661  1.00 49.70  ? 176 GLN G CG  1 
ATOM   6654 C  CD  . GLN G  1 117 ? 21.909  12.403  34.038  1.00 56.38  ? 176 GLN G CD  1 
ATOM   6655 O  OE1 . GLN G  1 117 ? 21.720  11.650  35.015  1.00 60.53  ? 176 GLN G OE1 1 
ATOM   6656 N  NE2 . GLN G  1 117 ? 21.760  13.729  34.114  1.00 57.68  ? 176 GLN G NE2 1 
ATOM   6657 N  N   . SER G  1 118 ? 19.690  10.221  29.089  1.00 42.58  ? 177 SER G N   1 
ATOM   6658 C  CA  . SER G  1 118 ? 18.641  9.449   28.445  1.00 42.68  ? 177 SER G CA  1 
ATOM   6659 C  C   . SER G  1 118 ? 18.441  9.856   27.000  1.00 39.94  ? 177 SER G C   1 
ATOM   6660 O  O   . SER G  1 118 ? 18.749  10.976  26.622  1.00 37.38  ? 177 SER G O   1 
ATOM   6661 C  CB  . SER G  1 118 ? 17.323  9.629   29.186  1.00 44.40  ? 177 SER G CB  1 
ATOM   6662 O  OG  . SER G  1 118 ? 16.589  10.713  28.628  1.00 45.73  ? 177 SER G OG  1 
ATOM   6663 N  N   . ILE G  1 119 ? 17.860  8.942   26.225  1.00 39.78  ? 178 ILE G N   1 
ATOM   6664 C  CA  . ILE G  1 119 ? 17.553  9.154   24.807  1.00 37.88  ? 178 ILE G CA  1 
ATOM   6665 C  C   . ILE G  1 119 ? 16.158  9.736   24.741  1.00 37.67  ? 178 ILE G C   1 
ATOM   6666 O  O   . ILE G  1 119 ? 15.232  9.132   25.271  1.00 39.72  ? 178 ILE G O   1 
ATOM   6667 C  CB  . ILE G  1 119 ? 17.627  7.812   24.034  1.00 37.98  ? 178 ILE G CB  1 
ATOM   6668 C  CG1 . ILE G  1 119 ? 19.103  7.495   23.739  1.00 39.61  ? 178 ILE G CG1 1 
ATOM   6669 C  CG2 . ILE G  1 119 ? 16.915  7.893   22.758  1.00 36.40  ? 178 ILE G CG2 1 
ATOM   6670 C  CD1 . ILE G  1 119 ? 19.419  6.081   23.180  1.00 41.52  ? 178 ILE G CD1 1 
ATOM   6671 N  N   . ASP G  1 120 ? 15.994  10.894  24.107  1.00 35.27  ? 179 ASP G N   1 
ATOM   6672 C  CA  . ASP G  1 120 ? 14.664  11.485  23.984  1.00 35.56  ? 179 ASP G CA  1 
ATOM   6673 C  C   . ASP G  1 120 ? 13.639  10.599  23.249  1.00 34.48  ? 179 ASP G C   1 
ATOM   6674 O  O   . ASP G  1 120 ? 13.972  9.752   22.430  1.00 32.95  ? 179 ASP G O   1 
ATOM   6675 C  CB  . ASP G  1 120 ? 14.703  12.845  23.277  1.00 35.32  ? 179 ASP G CB  1 
ATOM   6676 C  CG  . ASP G  1 120 ? 15.321  13.980  24.138  1.00 38.92  ? 179 ASP G CG  1 
ATOM   6677 O  OD1 . ASP G  1 120 ? 15.606  13.811  25.357  1.00 39.61  ? 179 ASP G OD1 1 
ATOM   6678 O  OD2 . ASP G  1 120 ? 15.532  15.082  23.543  1.00 45.93  ? 179 ASP G OD2 1 
ATOM   6679 N  N   . VAL G  1 121 ? 12.383  10.834  23.589  1.00 34.46  ? 180 VAL G N   1 
ATOM   6680 C  CA  . VAL G  1 121 ? 11.245  10.296  22.883  1.00 34.86  ? 180 VAL G CA  1 
ATOM   6681 C  C   . VAL G  1 121 ? 11.123  11.036  21.575  1.00 34.50  ? 180 VAL G C   1 
ATOM   6682 O  O   . VAL G  1 121 ? 10.980  12.257  21.539  1.00 34.74  ? 180 VAL G O   1 
ATOM   6683 C  CB  . VAL G  1 121 ? 9.940   10.566  23.653  1.00 36.53  ? 180 VAL G CB  1 
ATOM   6684 C  CG1 . VAL G  1 121 ? 8.747   10.385  22.743  1.00 36.12  ? 180 VAL G CG1 1 
ATOM   6685 C  CG2 . VAL G  1 121 ? 9.846   9.735   24.909  1.00 35.36  ? 180 VAL G CG2 1 
ATOM   6686 N  N   . GLY G  1 122 ? 11.179  10.288  20.500  1.00 34.98  ? 181 GLY G N   1 
ATOM   6687 C  CA  . GLY G  1 122 ? 11.102  10.843  19.162  1.00 35.36  ? 181 GLY G CA  1 
ATOM   6688 C  C   . GLY G  1 122 ? 9.675   11.062  18.730  1.00 36.83  ? 181 GLY G C   1 
ATOM   6689 O  O   . GLY G  1 122 ? 8.779   10.388  19.186  1.00 38.57  ? 181 GLY G O   1 
ATOM   6690 N  N   . LYS G  1 123 ? 9.493   11.963  17.783  1.00 37.36  ? 182 LYS G N   1 
ATOM   6691 C  CA  . LYS G  1 123 ? 8.221   12.629  17.565  1.00 39.24  ? 182 LYS G CA  1 
ATOM   6692 C  C   . LYS G  1 123 ? 8.346   13.369  16.241  1.00 39.26  ? 182 LYS G C   1 
ATOM   6693 O  O   . LYS G  1 123 ? 9.330   14.063  16.036  1.00 38.66  ? 182 LYS G O   1 
ATOM   6694 C  CB  . LYS G  1 123 ? 8.070   13.635  18.721  1.00 39.65  ? 182 LYS G CB  1 
ATOM   6695 C  CG  . LYS G  1 123 ? 6.704   14.199  18.960  1.00 42.79  ? 182 LYS G CG  1 
ATOM   6696 C  CD  . LYS G  1 123 ? 6.503   14.605  20.452  1.00 45.37  ? 182 LYS G CD  1 
ATOM   6697 C  CE  . LYS G  1 123 ? 6.927   16.041  20.819  1.00 45.73  ? 182 LYS G CE  1 
ATOM   6698 N  NZ  . LYS G  1 123 ? 8.403   16.183  20.957  1.00 45.13  ? 182 LYS G NZ  1 
ATOM   6699 N  N   . THR G  1 124 ? 7.408   13.220  15.319  1.00 41.23  ? 183 THR G N   1 
ATOM   6700 C  CA  . THR G  1 124 ? 7.443   14.055  14.112  1.00 41.97  ? 183 THR G CA  1 
ATOM   6701 C  C   . THR G  1 124 ? 6.518   15.248  14.305  1.00 44.50  ? 183 THR G C   1 
ATOM   6702 O  O   . THR G  1 124 ? 6.811   16.340  13.810  1.00 45.36  ? 183 THR G O   1 
ATOM   6703 C  CB  . THR G  1 124 ? 7.163   13.291  12.803  1.00 43.31  ? 183 THR G CB  1 
ATOM   6704 O  OG1 . THR G  1 124 ? 5.953   12.558  12.907  1.00 43.96  ? 183 THR G OG1 1 
ATOM   6705 C  CG2 . THR G  1 124 ? 8.306   12.315  12.475  1.00 40.72  ? 183 THR G CG2 1 
ATOM   6706 N  N   . SER G  1 125 ? 5.445   15.088  15.079  1.00 46.08  ? 184 SER G N   1 
ATOM   6707 C  CA  . SER G  1 125 ? 4.682   16.268  15.538  1.00 48.31  ? 184 SER G CA  1 
ATOM   6708 C  C   . SER G  1 125 ? 3.935   16.121  16.877  1.00 49.05  ? 184 SER G C   1 
ATOM   6709 O  O   . SER G  1 125 ? 3.733   15.022  17.395  1.00 49.27  ? 184 SER G O   1 
ATOM   6710 C  CB  . SER G  1 125 ? 3.679   16.639  14.466  1.00 50.84  ? 184 SER G CB  1 
ATOM   6711 O  OG  . SER G  1 125 ? 3.074   15.447  14.024  1.00 53.30  ? 184 SER G OG  1 
ATOM   6712 N  N   . ALA G  1 126 ? 3.493   17.249  17.418  1.00 69.69  ? 185 ALA G N   1 
ATOM   6713 C  CA  . ALA G  1 126 ? 2.625   17.239  18.595  1.00 66.88  ? 185 ALA G CA  1 
ATOM   6714 C  C   . ALA G  1 126 ? 1.182   16.946  18.213  1.00 63.79  ? 185 ALA G C   1 
ATOM   6715 O  O   . ALA G  1 126 ? 0.338   16.873  19.101  1.00 62.94  ? 185 ALA G O   1 
ATOM   6716 C  CB  . ALA G  1 126 ? 2.702   18.583  19.345  1.00 71.95  ? 185 ALA G CB  1 
ATOM   6717 N  N   . GLU G  1 127 ? 0.888   16.774  16.921  1.00 64.20  ? 186 GLU G N   1 
ATOM   6718 C  CA  . GLU G  1 127 ? -0.500  16.641  16.458  1.00 64.30  ? 186 GLU G CA  1 
ATOM   6719 C  C   . GLU G  1 127 ? -1.130  15.301  16.872  1.00 60.47  ? 186 GLU G C   1 
ATOM   6720 O  O   . GLU G  1 127 ? -0.526  14.236  16.719  1.00 57.45  ? 186 GLU G O   1 
ATOM   6721 C  CB  . GLU G  1 127 ? -0.610  16.846  14.938  1.00 68.12  ? 186 GLU G CB  1 
ATOM   6722 N  N   . ASN G  1 128 ? -2.349  15.399  17.415  1.00 61.78  ? 187 ASN G N   1 
ATOM   6723 C  CA  . ASN G  1 128 ? -3.160  14.253  17.830  1.00 60.81  ? 187 ASN G CA  1 
ATOM   6724 C  C   . ASN G  1 128 ? -3.560  13.409  16.646  1.00 63.09  ? 187 ASN G C   1 
ATOM   6725 O  O   . ASN G  1 128 ? -3.918  13.942  15.587  1.00 66.60  ? 187 ASN G O   1 
ATOM   6726 C  CB  . ASN G  1 128 ? -4.441  14.723  18.529  1.00 63.03  ? 187 ASN G CB  1 
ATOM   6727 C  CG  . ASN G  1 128 ? -4.261  14.905  20.016  1.00 61.76  ? 187 ASN G CG  1 
ATOM   6728 O  OD1 . ASN G  1 128 ? -3.493  14.183  20.656  1.00 59.98  ? 187 ASN G OD1 1 
ATOM   6729 N  ND2 . ASN G  1 128 ? -4.982  15.855  20.582  1.00 63.78  ? 187 ASN G ND2 1 
ATOM   6730 N  N   . LEU G  1 129 ? -3.519  12.093  16.826  1.00 63.08  ? 188 LEU G N   1 
ATOM   6731 C  CA  . LEU G  1 129 ? -3.899  11.184  15.755  1.00 66.88  ? 188 LEU G CA  1 
ATOM   6732 C  C   . LEU G  1 129 ? -5.326  11.463  15.234  1.00 72.46  ? 188 LEU G C   1 
ATOM   6733 O  O   . LEU G  1 129 ? -5.559  11.404  14.021  1.00 76.56  ? 188 LEU G O   1 
ATOM   6734 C  CB  . LEU G  1 129 ? -3.754  9.719   16.200  1.00 67.98  ? 188 LEU G CB  1 
ATOM   6735 C  CG  . LEU G  1 129 ? -4.248  8.678   15.192  1.00 73.11  ? 188 LEU G CG  1 
ATOM   6736 C  CD1 . LEU G  1 129 ? -3.491  8.778   13.859  1.00 72.85  ? 188 LEU G CD1 1 
ATOM   6737 C  CD2 . LEU G  1 129 ? -4.132  7.300   15.788  1.00 76.13  ? 188 LEU G CD2 1 
ATOM   6738 N  N   . TYR G  1 130 ? -6.264  11.765  16.131  1.00 74.35  ? 189 TYR G N   1 
ATOM   6739 C  CA  . TYR G  1 130 ? -7.652  11.997  15.724  1.00 81.99  ? 189 TYR G CA  1 
ATOM   6740 C  C   . TYR G  1 130 ? -7.704  13.043  14.607  1.00 86.05  ? 189 TYR G C   1 
ATOM   6741 O  O   . TYR G  1 130 ? -8.289  12.798  13.541  1.00 92.47  ? 189 TYR G O   1 
ATOM   6742 C  CB  . TYR G  1 130 ? -8.524  12.418  16.918  1.00 83.37  ? 189 TYR G CB  1 
ATOM   6743 C  CG  . TYR G  1 130 ? -9.928  12.876  16.542  1.00 93.41  ? 189 TYR G CG  1 
ATOM   6744 C  CD1 . TYR G  1 130 ? -10.807 12.030  15.855  1.00 101.56 ? 189 TYR G CD1 1 
ATOM   6745 C  CD2 . TYR G  1 130 ? -10.383 14.157  16.883  1.00 96.79  ? 189 TYR G CD2 1 
ATOM   6746 C  CE1 . TYR G  1 130 ? -12.098 12.454  15.507  1.00 111.76 ? 189 TYR G CE1 1 
ATOM   6747 C  CE2 . TYR G  1 130 ? -11.665 14.584  16.542  1.00 107.15 ? 189 TYR G CE2 1 
ATOM   6748 C  CZ  . TYR G  1 130 ? -12.517 13.732  15.856  1.00 114.76 ? 189 TYR G CZ  1 
ATOM   6749 O  OH  . TYR G  1 130 ? -13.784 14.167  15.520  1.00 126.61 ? 189 TYR G OH  1 
ATOM   6750 N  N   . PHE G  1 131 ? -7.058  14.184  14.857  1.00 84.04  ? 190 PHE G N   1 
ATOM   6751 C  CA  . PHE G  1 131 ? -6.998  15.300  13.900  1.00 89.64  ? 190 PHE G CA  1 
ATOM   6752 C  C   . PHE G  1 131 ? -6.304  14.855  12.601  1.00 90.55  ? 190 PHE G C   1 
ATOM   6753 O  O   . PHE G  1 131 ? -6.780  15.128  11.495  1.00 98.11  ? 190 PHE G O   1 
ATOM   6754 C  CB  . PHE G  1 131 ? -6.255  16.507  14.514  1.00 87.84  ? 190 PHE G CB  1 
ATOM   6755 C  CG  . PHE G  1 131 ? -7.060  17.279  15.541  1.00 91.05  ? 190 PHE G CG  1 
ATOM   6756 C  CD1 . PHE G  1 131 ? -7.651  18.494  15.209  1.00 101.13 ? 190 PHE G CD1 1 
ATOM   6757 C  CD2 . PHE G  1 131 ? -7.202  16.803  16.839  1.00 85.87  ? 190 PHE G CD2 1 
ATOM   6758 C  CE1 . PHE G  1 131 ? -8.382  19.206  16.152  1.00 105.91 ? 190 PHE G CE1 1 
ATOM   6759 C  CE2 . PHE G  1 131 ? -7.928  17.500  17.784  1.00 88.79  ? 190 PHE G CE2 1 
ATOM   6760 C  CZ  . PHE G  1 131 ? -8.516  18.695  17.450  1.00 99.65  ? 190 PHE G CZ  1 
ATOM   6761 N  N   . GLN G  1 132 ? -5.187  14.151  12.756  1.00 84.24  ? 191 GLN G N   1 
ATOM   6762 C  CA  . GLN G  1 132 ? -4.388  13.683  11.631  1.00 84.99  ? 191 GLN G CA  1 
ATOM   6763 C  C   . GLN G  1 132 ? -5.039  12.474  10.961  1.00 88.42  ? 191 GLN G C   1 
ATOM   6764 O  O   . GLN G  1 132 ? -6.121  12.582  10.396  1.00 95.34  ? 191 GLN G O   1 
ATOM   6765 C  CB  . GLN G  1 132 ? -2.998  13.301  12.128  1.00 78.75  ? 191 GLN G CB  1 
ATOM   6766 C  CG  . GLN G  1 132 ? -1.933  13.268  11.036  1.00 81.36  ? 191 GLN G CG  1 
ATOM   6767 C  CD  . GLN G  1 132 ? -0.739  12.386  11.396  1.00 77.63  ? 191 GLN G CD  1 
ATOM   6768 O  OE1 . GLN G  1 132 ? -0.464  12.135  12.573  1.00 72.90  ? 191 GLN G OE1 1 
ATOM   6769 N  NE2 . GLN G  1 132 ? -0.033  11.906  10.374  1.00 80.73  ? 191 GLN G NE2 1 
ATOM   6770 N  N   . GLU H  1 5   ? 102.146 48.963  55.634  1.00 99.74  ? 64  GLU H N   1 
ATOM   6771 C  CA  . GLU H  1 5   ? 102.553 48.309  54.359  1.00 97.86  ? 64  GLU H CA  1 
ATOM   6772 C  C   . GLU H  1 5   ? 103.061 46.863  54.583  1.00 92.80  ? 64  GLU H C   1 
ATOM   6773 O  O   . GLU H  1 5   ? 103.607 46.255  53.661  1.00 91.67  ? 64  GLU H O   1 
ATOM   6774 C  CB  . GLU H  1 5   ? 103.605 49.176  53.624  1.00 101.93 ? 64  GLU H CB  1 
ATOM   6775 N  N   . ASP H  1 6   ? 102.849 46.314  55.789  1.00 90.43  ? 65  ASP H N   1 
ATOM   6776 C  CA  . ASP H  1 6   ? 103.335 44.968  56.172  1.00 85.73  ? 65  ASP H CA  1 
ATOM   6777 C  C   . ASP H  1 6   ? 102.202 43.948  56.298  1.00 81.24  ? 65  ASP H C   1 
ATOM   6778 O  O   . ASP H  1 6   ? 102.049 43.311  57.365  1.00 79.17  ? 65  ASP H O   1 
ATOM   6779 C  CB  . ASP H  1 6   ? 104.080 45.027  57.513  1.00 86.74  ? 65  ASP H CB  1 
ATOM   6780 N  N   . LYS H  1 7   ? 101.432 43.784  55.208  1.00 79.53  ? 66  LYS H N   1 
ATOM   6781 C  CA  . LYS H  1 7   ? 100.252 42.872  55.156  1.00 75.02  ? 66  LYS H CA  1 
ATOM   6782 C  C   . LYS H  1 7   ? 100.429 41.712  54.156  1.00 70.95  ? 66  LYS H C   1 
ATOM   6783 O  O   . LYS H  1 7   ? 100.691 41.949  52.979  1.00 71.95  ? 66  LYS H O   1 
ATOM   6784 C  CB  . LYS H  1 7   ? 98.985  43.670  54.786  1.00 77.08  ? 66  LYS H CB  1 
ATOM   6785 N  N   . ILE H  1 8   ? 100.197 40.472  54.613  1.00 66.19  ? 67  ILE H N   1 
ATOM   6786 C  CA  . ILE H  1 8   ? 100.526 39.251  53.834  1.00 62.97  ? 67  ILE H CA  1 
ATOM   6787 C  C   . ILE H  1 8   ? 99.318  38.451  53.314  1.00 60.51  ? 67  ILE H C   1 
ATOM   6788 O  O   . ILE H  1 8   ? 98.224  38.488  53.874  1.00 60.04  ? 67  ILE H O   1 
ATOM   6789 C  CB  . ILE H  1 8   ? 101.415 38.244  54.615  1.00 60.77  ? 67  ILE H CB  1 
ATOM   6790 C  CG1 . ILE H  1 8   ? 100.662 37.612  55.765  1.00 58.60  ? 67  ILE H CG1 1 
ATOM   6791 C  CG2 . ILE H  1 8   ? 102.665 38.906  55.156  1.00 63.19  ? 67  ILE H CG2 1 
ATOM   6792 C  CD1 . ILE H  1 8   ? 101.048 36.151  55.966  1.00 56.36  ? 67  ILE H CD1 1 
ATOM   6793 N  N   . THR H  1 9   ? 99.554  37.705  52.245  1.00 59.18  ? 68  THR H N   1 
ATOM   6794 C  CA  . THR H  1 9   ? 98.497  37.018  51.534  1.00 57.93  ? 68  THR H CA  1 
ATOM   6795 C  C   . THR H  1 9   ? 98.392  35.571  51.998  1.00 54.81  ? 68  THR H C   1 
ATOM   6796 O  O   . THR H  1 9   ? 99.376  34.855  52.068  1.00 53.69  ? 68  THR H O   1 
ATOM   6797 C  CB  . THR H  1 9   ? 98.749  37.039  50.012  1.00 59.25  ? 68  THR H CB  1 
ATOM   6798 O  OG1 . THR H  1 9   ? 98.776  38.396  49.537  1.00 62.90  ? 68  THR H OG1 1 
ATOM   6799 C  CG2 . THR H  1 9   ? 97.672  36.248  49.285  1.00 58.06  ? 68  THR H CG2 1 
ATOM   6800 N  N   . VAL H  1 10  ? 97.177  35.151  52.306  1.00 53.70  ? 69  VAL H N   1 
ATOM   6801 C  CA  . VAL H  1 10  ? 96.897  33.781  52.692  1.00 51.32  ? 69  VAL H CA  1 
ATOM   6802 C  C   . VAL H  1 10  ? 95.759  33.218  51.834  1.00 51.34  ? 69  VAL H C   1 
ATOM   6803 O  O   . VAL H  1 10  ? 94.715  33.844  51.680  1.00 52.51  ? 69  VAL H O   1 
ATOM   6804 C  CB  . VAL H  1 10  ? 96.458  33.662  54.171  1.00 50.29  ? 69  VAL H CB  1 
ATOM   6805 C  CG1 . VAL H  1 10  ? 96.142  32.213  54.511  1.00 47.84  ? 69  VAL H CG1 1 
ATOM   6806 C  CG2 . VAL H  1 10  ? 97.529  34.208  55.131  1.00 50.58  ? 69  VAL H CG2 1 
ATOM   6807 N  N   . HIS H  1 11  ? 95.983  32.033  51.276  1.00 50.37  ? 70  HIS H N   1 
ATOM   6808 C  CA  . HIS H  1 11  ? 94.990  31.329  50.506  1.00 50.54  ? 70  HIS H CA  1 
ATOM   6809 C  C   . HIS H  1 11  ? 94.319  30.276  51.389  1.00 48.82  ? 70  HIS H C   1 
ATOM   6810 O  O   . HIS H  1 11  ? 94.994  29.497  52.057  1.00 47.53  ? 70  HIS H O   1 
ATOM   6811 C  CB  . HIS H  1 11  ? 95.641  30.643  49.299  1.00 51.24  ? 70  HIS H CB  1 
ATOM   6812 C  CG  . HIS H  1 11  ? 96.434  31.566  48.424  1.00 53.31  ? 70  HIS H CG  1 
ATOM   6813 N  ND1 . HIS H  1 11  ? 95.852  32.559  47.664  1.00 55.54  ? 70  HIS H ND1 1 
ATOM   6814 C  CD2 . HIS H  1 11  ? 97.765  31.641  48.181  1.00 53.66  ? 70  HIS H CD2 1 
ATOM   6815 C  CE1 . HIS H  1 11  ? 96.790  33.212  46.998  1.00 57.07  ? 70  HIS H CE1 1 
ATOM   6816 N  NE2 . HIS H  1 11  ? 97.958  32.671  47.288  1.00 56.31  ? 70  HIS H NE2 1 
ATOM   6817 N  N   . PHE H  1 12  ? 92.988  30.254  51.385  1.00 49.20  ? 71  PHE H N   1 
ATOM   6818 C  CA  . PHE H  1 12  ? 92.213  29.224  52.078  1.00 47.94  ? 71  PHE H CA  1 
ATOM   6819 C  C   . PHE H  1 12  ? 91.541  28.322  51.077  1.00 48.65  ? 71  PHE H C   1 
ATOM   6820 O  O   . PHE H  1 12  ? 90.900  28.804  50.152  1.00 50.71  ? 71  PHE H O   1 
ATOM   6821 C  CB  . PHE H  1 12  ? 91.101  29.846  52.893  1.00 48.39  ? 71  PHE H CB  1 
ATOM   6822 C  CG  . PHE H  1 12  ? 91.566  30.589  54.087  1.00 47.67  ? 71  PHE H CG  1 
ATOM   6823 C  CD1 . PHE H  1 12  ? 91.425  30.045  55.336  1.00 46.52  ? 71  PHE H CD1 1 
ATOM   6824 C  CD2 . PHE H  1 12  ? 92.118  31.848  53.969  1.00 49.03  ? 71  PHE H CD2 1 
ATOM   6825 C  CE1 . PHE H  1 12  ? 91.842  30.740  56.460  1.00 47.12  ? 71  PHE H CE1 1 
ATOM   6826 C  CE2 . PHE H  1 12  ? 92.529  32.546  55.080  1.00 49.42  ? 71  PHE H CE2 1 
ATOM   6827 C  CZ  . PHE H  1 12  ? 92.391  31.996  56.323  1.00 48.19  ? 71  PHE H CZ  1 
ATOM   6828 N  N   . ILE H  1 13  ? 91.684  27.017  51.252  1.00 47.65  ? 72  ILE H N   1 
ATOM   6829 C  CA  . ILE H  1 13  ? 90.875  26.077  50.502  1.00 48.83  ? 72  ILE H CA  1 
ATOM   6830 C  C   . ILE H  1 13  ? 89.705  25.671  51.381  1.00 48.90  ? 72  ILE H C   1 
ATOM   6831 O  O   . ILE H  1 13  ? 89.892  25.086  52.452  1.00 47.40  ? 72  ILE H O   1 
ATOM   6832 C  CB  . ILE H  1 13  ? 91.659  24.849  50.101  1.00 48.65  ? 72  ILE H CB  1 
ATOM   6833 C  CG1 . ILE H  1 13  ? 92.787  25.246  49.164  1.00 48.99  ? 72  ILE H CG1 1 
ATOM   6834 C  CG2 . ILE H  1 13  ? 90.731  23.793  49.440  1.00 49.44  ? 72  ILE H CG2 1 
ATOM   6835 C  CD1 . ILE H  1 13  ? 93.613  24.084  48.740  1.00 49.23  ? 72  ILE H CD1 1 
ATOM   6836 N  N   . ASN H  1 14  ? 88.504  25.995  50.919  1.00 50.94  ? 73  ASN H N   1 
ATOM   6837 C  CA  . ASN H  1 14  ? 87.285  25.778  51.676  1.00 51.56  ? 73  ASN H CA  1 
ATOM   6838 C  C   . ASN H  1 14  ? 86.862  24.322  51.644  1.00 51.60  ? 73  ASN H C   1 
ATOM   6839 O  O   . ASN H  1 14  ? 87.337  23.543  50.819  1.00 51.58  ? 73  ASN H O   1 
ATOM   6840 C  CB  . ASN H  1 14  ? 86.161  26.632  51.088  1.00 54.50  ? 73  ASN H CB  1 
ATOM   6841 C  CG  . ASN H  1 14  ? 85.241  27.211  52.156  1.00 56.42  ? 73  ASN H CG  1 
ATOM   6842 O  OD1 . ASN H  1 14  ? 85.170  26.695  53.299  1.00 55.14  ? 73  ASN H OD1 1 
ATOM   6843 N  ND2 . ASN H  1 14  ? 84.499  28.293  51.784  1.00 58.44  ? 73  ASN H ND2 1 
ATOM   6844 N  N   . ARG H  1 15  ? 85.930  23.970  52.525  1.00 51.93  ? 74  ARG H N   1 
ATOM   6845 C  CA  . ARG H  1 15  ? 85.349  22.629  52.534  1.00 52.97  ? 74  ARG H CA  1 
ATOM   6846 C  C   . ARG H  1 15  ? 84.752  22.319  51.172  1.00 56.02  ? 74  ARG H C   1 
ATOM   6847 O  O   . ARG H  1 15  ? 84.790  21.177  50.717  1.00 56.95  ? 74  ARG H O   1 
ATOM   6848 C  CB  . ARG H  1 15  ? 84.285  22.510  53.620  1.00 53.27  ? 74  ARG H CB  1 
ATOM   6849 C  CG  . ARG H  1 15  ? 84.864  22.458  55.014  1.00 51.05  ? 74  ARG H CG  1 
ATOM   6850 C  CD  . ARG H  1 15  ? 83.890  22.839  56.084  1.00 51.29  ? 74  ARG H CD  1 
ATOM   6851 N  NE  . ARG H  1 15  ? 84.605  23.108  57.330  1.00 49.66  ? 74  ARG H NE  1 
ATOM   6852 C  CZ  . ARG H  1 15  ? 84.198  23.948  58.281  1.00 50.26  ? 74  ARG H CZ  1 
ATOM   6853 N  NH1 . ARG H  1 15  ? 83.049  24.619  58.149  1.00 53.37  ? 74  ARG H NH1 1 
ATOM   6854 N  NH2 . ARG H  1 15  ? 84.924  24.121  59.383  1.00 47.91  ? 74  ARG H NH2 1 
ATOM   6855 N  N   . ASP H  1 16  ? 84.212  23.365  50.536  1.00 58.06  ? 75  ASP H N   1 
ATOM   6856 C  CA  . ASP H  1 16  ? 83.665  23.322  49.171  1.00 61.33  ? 75  ASP H CA  1 
ATOM   6857 C  C   . ASP H  1 16  ? 84.679  22.983  48.093  1.00 61.23  ? 75  ASP H C   1 
ATOM   6858 O  O   . ASP H  1 16  ? 84.307  22.543  47.003  1.00 63.69  ? 75  ASP H O   1 
ATOM   6859 C  CB  . ASP H  1 16  ? 83.047  24.679  48.818  1.00 63.32  ? 75  ASP H CB  1 
ATOM   6860 C  CG  . ASP H  1 16  ? 81.718  24.926  49.520  1.00 66.06  ? 75  ASP H CG  1 
ATOM   6861 O  OD1 . ASP H  1 16  ? 81.355  24.156  50.459  1.00 66.34  ? 75  ASP H OD1 1 
ATOM   6862 O  OD2 . ASP H  1 16  ? 81.025  25.899  49.120  1.00 68.68  ? 75  ASP H OD2 1 
ATOM   6863 N  N   . GLY H  1 17  ? 85.954  23.213  48.390  1.00 58.61  ? 76  GLY H N   1 
ATOM   6864 C  CA  . GLY H  1 17  ? 87.019  23.020  47.407  1.00 58.77  ? 76  GLY H CA  1 
ATOM   6865 C  C   . GLY H  1 17  ? 87.365  24.318  46.700  1.00 59.42  ? 76  GLY H C   1 
ATOM   6866 O  O   . GLY H  1 17  ? 88.174  24.341  45.775  1.00 60.12  ? 76  GLY H O   1 
ATOM   6867 N  N   . GLU H  1 18  ? 86.762  25.407  47.159  1.00 59.58  ? 77  GLU H N   1 
ATOM   6868 C  CA  . GLU H  1 18  ? 86.928  26.705  46.532  1.00 60.95  ? 77  GLU H CA  1 
ATOM   6869 C  C   . GLU H  1 18  ? 88.053  27.447  47.230  1.00 58.18  ? 77  GLU H C   1 
ATOM   6870 O  O   . GLU H  1 18  ? 88.189  27.374  48.447  1.00 55.89  ? 77  GLU H O   1 
ATOM   6871 C  CB  . GLU H  1 18  ? 85.611  27.474  46.635  1.00 63.66  ? 77  GLU H CB  1 
ATOM   6872 C  CG  . GLU H  1 18  ? 85.618  28.903  46.153  1.00 66.59  ? 77  GLU H CG  1 
ATOM   6873 C  CD  . GLU H  1 18  ? 84.192  29.415  46.002  1.00 73.46  ? 77  GLU H CD  1 
ATOM   6874 O  OE1 . GLU H  1 18  ? 84.000  30.547  45.484  1.00 78.31  ? 77  GLU H OE1 1 
ATOM   6875 O  OE2 . GLU H  1 18  ? 83.258  28.667  46.405  1.00 75.59  ? 77  GLU H OE2 1 
ATOM   6876 N  N   . THR H  1 19  ? 88.863  28.160  46.461  1.00 58.73  ? 78  THR H N   1 
ATOM   6877 C  CA  . THR H  1 19  ? 90.007  28.846  47.028  1.00 56.81  ? 78  THR H CA  1 
ATOM   6878 C  C   . THR H  1 19  ? 89.689  30.305  47.248  1.00 57.94  ? 78  THR H C   1 
ATOM   6879 O  O   . THR H  1 19  ? 89.299  30.990  46.316  1.00 60.75  ? 78  THR H O   1 
ATOM   6880 C  CB  . THR H  1 19  ? 91.218  28.712  46.116  1.00 57.16  ? 78  THR H CB  1 
ATOM   6881 O  OG1 . THR H  1 19  ? 91.368  27.329  45.747  1.00 56.37  ? 78  THR H OG1 1 
ATOM   6882 C  CG2 . THR H  1 19  ? 92.486  29.200  46.837  1.00 55.36  ? 78  THR H CG2 1 
ATOM   6883 N  N   . LEU H  1 20  ? 89.837  30.759  48.491  1.00 56.30  ? 79  LEU H N   1 
ATOM   6884 C  CA  . LEU H  1 20  ? 89.616  32.154  48.856  1.00 57.83  ? 79  LEU H CA  1 
ATOM   6885 C  C   . LEU H  1 20  ? 90.966  32.776  49.166  1.00 56.89  ? 79  LEU H C   1 
ATOM   6886 O  O   . LEU H  1 20  ? 91.711  32.252  49.988  1.00 54.28  ? 79  LEU H O   1 
ATOM   6887 C  CB  . LEU H  1 20  ? 88.723  32.282  50.093  1.00 57.34  ? 79  LEU H CB  1 
ATOM   6888 C  CG  . LEU H  1 20  ? 87.450  31.431  50.166  1.00 58.24  ? 79  LEU H CG  1 
ATOM   6889 C  CD1 . LEU H  1 20  ? 86.835  31.531  51.563  1.00 57.44  ? 79  LEU H CD1 1 
ATOM   6890 C  CD2 . LEU H  1 20  ? 86.430  31.841  49.110  1.00 62.32  ? 79  LEU H CD2 1 
ATOM   6891 N  N   . THR H  1 21  ? 91.278  33.884  48.491  1.00 59.21  ? 80  THR H N   1 
ATOM   6892 C  CA  . THR H  1 21  ? 92.532  34.581  48.704  1.00 58.72  ? 80  THR H CA  1 
ATOM   6893 C  C   . THR H  1 21  ? 92.198  35.820  49.508  1.00 59.82  ? 80  THR H C   1 
ATOM   6894 O  O   . THR H  1 21  ? 91.250  36.507  49.201  1.00 62.47  ? 80  THR H O   1 
ATOM   6895 C  CB  . THR H  1 21  ? 93.198  34.927  47.362  1.00 60.72  ? 80  THR H CB  1 
ATOM   6896 O  OG1 . THR H  1 21  ? 93.573  33.708  46.698  1.00 59.04  ? 80  THR H OG1 1 
ATOM   6897 C  CG2 . THR H  1 21  ? 94.426  35.811  47.579  1.00 61.50  ? 80  THR H CG2 1 
ATOM   6898 N  N   . THR H  1 22  ? 92.952  36.073  50.564  1.00 58.39  ? 81  THR H N   1 
ATOM   6899 C  CA  . THR H  1 22  ? 92.724  37.245  51.385  1.00 60.13  ? 81  THR H CA  1 
ATOM   6900 C  C   . THR H  1 22  ? 94.045  37.750  51.927  1.00 60.15  ? 81  THR H C   1 
ATOM   6901 O  O   . THR H  1 22  ? 95.084  37.167  51.665  1.00 59.06  ? 81  THR H O   1 
ATOM   6902 C  CB  . THR H  1 22  ? 91.740  36.968  52.531  1.00 59.34  ? 81  THR H CB  1 
ATOM   6903 O  OG1 . THR H  1 22  ? 91.275  38.211  53.065  1.00 61.82  ? 81  THR H OG1 1 
ATOM   6904 C  CG2 . THR H  1 22  ? 92.380  36.147  53.652  1.00 56.05  ? 81  THR H CG2 1 
ATOM   6905 N  N   . LYS H  1 23  ? 93.998  38.860  52.647  1.00 62.29  ? 82  LYS H N   1 
ATOM   6906 C  CA  . LYS H  1 23  ? 95.192  39.529  53.123  1.00 63.18  ? 82  LYS H CA  1 
ATOM   6907 C  C   . LYS H  1 23  ? 95.037  39.683  54.618  1.00 62.67  ? 82  LYS H C   1 
ATOM   6908 O  O   . LYS H  1 23  ? 93.969  40.042  55.087  1.00 63.80  ? 82  LYS H O   1 
ATOM   6909 C  CB  . LYS H  1 23  ? 95.350  40.902  52.438  1.00 67.20  ? 82  LYS H CB  1 
ATOM   6910 C  CG  . LYS H  1 23  ? 95.989  40.829  51.036  1.00 68.17  ? 82  LYS H CG  1 
ATOM   6911 C  CD  . LYS H  1 23  ? 96.584  42.171  50.563  1.00 72.08  ? 82  LYS H CD  1 
ATOM   6912 N  N   . GLY H  1 24  ? 96.092  39.392  55.368  1.00 61.33  ? 83  GLY H N   1 
ATOM   6913 C  CA  . GLY H  1 24  ? 96.058  39.557  56.819  1.00 61.30  ? 83  GLY H CA  1 
ATOM   6914 C  C   . GLY H  1 24  ? 97.223  40.386  57.314  1.00 63.35  ? 83  GLY H C   1 
ATOM   6915 O  O   . GLY H  1 24  ? 98.223  40.553  56.614  1.00 63.73  ? 83  GLY H O   1 
ATOM   6916 N  N   . LYS H  1 25  ? 97.083  40.922  58.520  1.00 64.79  ? 84  LYS H N   1 
ATOM   6917 C  CA  . LYS H  1 25  ? 98.174  41.644  59.157  1.00 67.37  ? 84  LYS H CA  1 
ATOM   6918 C  C   . LYS H  1 25  ? 99.099  40.649  59.832  1.00 64.96  ? 84  LYS H C   1 
ATOM   6919 O  O   . LYS H  1 25  ? 98.644  39.675  60.433  1.00 62.61  ? 84  LYS H O   1 
ATOM   6920 C  CB  . LYS H  1 25  ? 97.641  42.653  60.188  1.00 70.76  ? 84  LYS H CB  1 
ATOM   6921 C  CG  . LYS H  1 25  ? 96.849  43.810  59.547  1.00 75.42  ? 84  LYS H CG  1 
ATOM   6922 C  CD  . LYS H  1 25  ? 96.236  44.817  60.537  1.00 81.02  ? 84  LYS H CD  1 
ATOM   6923 C  CE  . LYS H  1 25  ? 96.169  46.236  59.879  1.00 86.86  ? 84  LYS H CE  1 
ATOM   6924 N  NZ  . LYS H  1 25  ? 95.251  47.213  60.553  1.00 90.88  ? 84  LYS H NZ  1 
ATOM   6925 N  N   . VAL H  1 26  ? 100.396 40.903  59.745  1.00 66.22  ? 85  VAL H N   1 
ATOM   6926 C  CA  . VAL H  1 26  ? 101.372 40.138  60.507  1.00 65.30  ? 85  VAL H CA  1 
ATOM   6927 C  C   . VAL H  1 26  ? 101.045 40.293  61.999  1.00 66.09  ? 85  VAL H C   1 
ATOM   6928 O  O   . VAL H  1 26  ? 100.756 41.396  62.457  1.00 68.69  ? 85  VAL H O   1 
ATOM   6929 C  CB  . VAL H  1 26  ? 102.814 40.659  60.235  1.00 67.98  ? 85  VAL H CB  1 
ATOM   6930 C  CG1 . VAL H  1 26  ? 103.833 39.913  61.078  1.00 67.39  ? 85  VAL H CG1 1 
ATOM   6931 C  CG2 . VAL H  1 26  ? 103.160 40.541  58.743  1.00 67.90  ? 85  VAL H CG2 1 
ATOM   6932 N  N   . GLY H  1 27  ? 101.063 39.190  62.742  1.00 63.76  ? 86  GLY H N   1 
ATOM   6933 C  CA  . GLY H  1 27  ? 100.688 39.214  64.158  1.00 64.63  ? 86  GLY H CA  1 
ATOM   6934 C  C   . GLY H  1 27  ? 99.242  38.812  64.443  1.00 62.90  ? 86  GLY H C   1 
ATOM   6935 O  O   . GLY H  1 27  ? 98.920  38.465  65.588  1.00 62.81  ? 86  GLY H O   1 
ATOM   6936 N  N   . ASP H  1 28  ? 98.374  38.852  63.421  1.00 61.68  ? 87  ASP H N   1 
ATOM   6937 C  CA  . ASP H  1 28  ? 96.973  38.412  63.563  1.00 60.23  ? 87  ASP H CA  1 
ATOM   6938 C  C   . ASP H  1 28  ? 96.900  36.878  63.576  1.00 56.81  ? 87  ASP H C   1 
ATOM   6939 O  O   . ASP H  1 28  ? 97.734  36.221  62.954  1.00 55.51  ? 87  ASP H O   1 
ATOM   6940 C  CB  . ASP H  1 28  ? 96.103  38.955  62.403  1.00 60.74  ? 87  ASP H CB  1 
ATOM   6941 C  CG  . ASP H  1 28  ? 95.601  40.408  62.623  1.00 64.94  ? 87  ASP H CG  1 
ATOM   6942 O  OD1 . ASP H  1 28  ? 95.790  41.015  63.715  1.00 67.37  ? 87  ASP H OD1 1 
ATOM   6943 O  OD2 . ASP H  1 28  ? 94.976  40.942  61.677  1.00 66.16  ? 87  ASP H OD2 1 
ATOM   6944 N  N   . SER H  1 29  ? 95.918  36.315  64.287  1.00 55.78  ? 88  SER H N   1 
ATOM   6945 C  CA  . SER H  1 29  ? 95.668  34.867  64.258  1.00 52.92  ? 88  SER H CA  1 
ATOM   6946 C  C   . SER H  1 29  ? 94.902  34.543  62.982  1.00 51.52  ? 88  SER H C   1 
ATOM   6947 O  O   . SER H  1 29  ? 94.229  35.416  62.400  1.00 52.69  ? 88  SER H O   1 
ATOM   6948 C  CB  . SER H  1 29  ? 94.867  34.425  65.494  1.00 52.92  ? 88  SER H CB  1 
ATOM   6949 O  OG  . SER H  1 29  ? 93.491  34.792  65.401  1.00 53.41  ? 88  SER H OG  1 
ATOM   6950 N  N   . LEU H  1 30  ? 94.993  33.300  62.529  1.00 49.14  ? 89  LEU H N   1 
ATOM   6951 C  CA  . LEU H  1 30  ? 94.238  32.912  61.339  1.00 48.13  ? 89  LEU H CA  1 
ATOM   6952 C  C   . LEU H  1 30  ? 92.729  33.036  61.565  1.00 48.68  ? 89  LEU H C   1 
ATOM   6953 O  O   . LEU H  1 30  ? 91.967  33.304  60.635  1.00 49.15  ? 89  LEU H O   1 
ATOM   6954 C  CB  . LEU H  1 30  ? 94.659  31.530  60.862  1.00 45.96  ? 89  LEU H CB  1 
ATOM   6955 C  CG  . LEU H  1 30  ? 95.964  31.633  60.066  1.00 46.12  ? 89  LEU H CG  1 
ATOM   6956 C  CD1 . LEU H  1 30  ? 96.872  30.503  60.321  1.00 45.27  ? 89  LEU H CD1 1 
ATOM   6957 C  CD2 . LEU H  1 30  ? 95.673  31.749  58.591  1.00 45.89  ? 89  LEU H CD2 1 
ATOM   6958 N  N   . LEU H  1 31  ? 92.291  32.867  62.810  1.00 49.07  ? 90  LEU H N   1 
ATOM   6959 C  CA  . LEU H  1 31  ? 90.883  33.099  63.136  1.00 50.03  ? 90  LEU H CA  1 
ATOM   6960 C  C   . LEU H  1 31  ? 90.550  34.556  62.845  1.00 52.65  ? 90  LEU H C   1 
ATOM   6961 O  O   . LEU H  1 31  ? 89.581  34.856  62.136  1.00 53.78  ? 90  LEU H O   1 
ATOM   6962 C  CB  . LEU H  1 31  ? 90.571  32.753  64.602  1.00 50.02  ? 90  LEU H CB  1 
ATOM   6963 C  CG  . LEU H  1 31  ? 89.141  33.064  65.052  1.00 51.44  ? 90  LEU H CG  1 
ATOM   6964 C  CD1 . LEU H  1 31  ? 88.115  32.361  64.168  1.00 50.53  ? 90  LEU H CD1 1 
ATOM   6965 C  CD2 . LEU H  1 31  ? 88.919  32.695  66.499  1.00 51.23  ? 90  LEU H CD2 1 
ATOM   6966 N  N   . ASP H  1 32  ? 91.373  35.457  63.384  1.00 54.15  ? 91  ASP H N   1 
ATOM   6967 C  CA  . ASP H  1 32  ? 91.189  36.894  63.162  1.00 57.00  ? 91  ASP H CA  1 
ATOM   6968 C  C   . ASP H  1 32  ? 91.043  37.162  61.677  1.00 57.05  ? 91  ASP H C   1 
ATOM   6969 O  O   . ASP H  1 32  ? 90.235  37.978  61.277  1.00 59.53  ? 91  ASP H O   1 
ATOM   6970 C  CB  . ASP H  1 32  ? 92.375  37.709  63.707  1.00 58.61  ? 91  ASP H CB  1 
ATOM   6971 C  CG  . ASP H  1 32  ? 92.487  37.666  65.230  1.00 59.90  ? 91  ASP H CG  1 
ATOM   6972 O  OD1 . ASP H  1 32  ? 91.436  37.563  65.916  1.00 61.29  ? 91  ASP H OD1 1 
ATOM   6973 O  OD2 . ASP H  1 32  ? 93.635  37.742  65.737  1.00 60.26  ? 91  ASP H OD2 1 
ATOM   6974 N  N   . VAL H  1 33  ? 91.825  36.466  60.860  1.00 55.02  ? 92  VAL H N   1 
ATOM   6975 C  CA  . VAL H  1 33  ? 91.790  36.680  59.415  1.00 55.54  ? 92  VAL H CA  1 
ATOM   6976 C  C   . VAL H  1 33  ? 90.444  36.289  58.839  1.00 55.62  ? 92  VAL H C   1 
ATOM   6977 O  O   . VAL H  1 33  ? 89.836  37.030  58.080  1.00 58.37  ? 92  VAL H O   1 
ATOM   6978 C  CB  . VAL H  1 33  ? 92.922  35.908  58.696  1.00 53.40  ? 92  VAL H CB  1 
ATOM   6979 C  CG1 . VAL H  1 33  ? 92.726  35.931  57.189  1.00 53.48  ? 92  VAL H CG1 1 
ATOM   6980 C  CG2 . VAL H  1 33  ? 94.276  36.501  59.075  1.00 54.09  ? 92  VAL H CG2 1 
ATOM   6981 N  N   . VAL H  1 34  ? 89.978  35.118  59.214  1.00 53.74  ? 93  VAL H N   1 
ATOM   6982 C  CA  . VAL H  1 34  ? 88.686  34.625  58.751  1.00 54.02  ? 93  VAL H CA  1 
ATOM   6983 C  C   . VAL H  1 34  ? 87.567  35.574  59.147  1.00 56.86  ? 93  VAL H C   1 
ATOM   6984 O  O   . VAL H  1 34  ? 86.707  35.889  58.334  1.00 58.76  ? 93  VAL H O   1 
ATOM   6985 C  CB  . VAL H  1 34  ? 88.406  33.212  59.338  1.00 51.87  ? 93  VAL H CB  1 
ATOM   6986 C  CG1 . VAL H  1 34  ? 86.996  32.732  58.996  1.00 52.43  ? 93  VAL H CG1 1 
ATOM   6987 C  CG2 . VAL H  1 34  ? 89.437  32.237  58.838  1.00 49.05  ? 93  VAL H CG2 1 
ATOM   6988 N  N   . VAL H  1 35  ? 87.602  36.043  60.393  1.00 57.75  ? 94  VAL H N   1 
ATOM   6989 C  CA  . VAL H  1 35  ? 86.535  36.894  60.928  1.00 61.09  ? 94  VAL H CA  1 
ATOM   6990 C  C   . VAL H  1 35  ? 86.619  38.323  60.406  1.00 64.53  ? 94  VAL H C   1 
ATOM   6991 O  O   . VAL H  1 35  ? 85.619  38.856  59.919  1.00 67.75  ? 94  VAL H O   1 
ATOM   6992 C  CB  . VAL H  1 35  ? 86.550  36.935  62.483  1.00 61.23  ? 94  VAL H CB  1 
ATOM   6993 C  CG1 . VAL H  1 35  ? 85.574  37.989  62.994  1.00 64.93  ? 94  VAL H CG1 1 
ATOM   6994 C  CG2 . VAL H  1 35  ? 86.216  35.566  63.067  1.00 58.53  ? 94  VAL H CG2 1 
ATOM   6995 N  N   . GLU H  1 36  ? 87.801  38.936  60.513  1.00 64.73  ? 95  GLU H N   1 
ATOM   6996 C  CA  . GLU H  1 36  ? 87.984  40.337  60.116  1.00 68.52  ? 95  GLU H CA  1 
ATOM   6997 C  C   . GLU H  1 36  ? 87.712  40.537  58.629  1.00 69.50  ? 95  GLU H C   1 
ATOM   6998 O  O   . GLU H  1 36  ? 87.312  41.627  58.230  1.00 73.28  ? 95  GLU H O   1 
ATOM   6999 C  CB  . GLU H  1 36  ? 89.375  40.869  60.511  1.00 68.55  ? 95  GLU H CB  1 
ATOM   7000 N  N   . ASN H  1 37  ? 87.882  39.482  57.827  1.00 66.53  ? 96  ASN H N   1 
ATOM   7001 C  CA  . ASN H  1 37  ? 87.601  39.557  56.383  1.00 67.92  ? 96  ASN H CA  1 
ATOM   7002 C  C   . ASN H  1 37  ? 86.298  38.876  55.933  1.00 68.44  ? 96  ASN H C   1 
ATOM   7003 O  O   . ASN H  1 37  ? 86.024  38.783  54.727  1.00 69.51  ? 96  ASN H O   1 
ATOM   7004 C  CB  . ASN H  1 37  ? 88.787  39.014  55.585  1.00 65.52  ? 96  ASN H CB  1 
ATOM   7005 C  CG  . ASN H  1 37  ? 90.025  39.897  55.703  1.00 66.20  ? 96  ASN H CG  1 
ATOM   7006 O  OD1 . ASN H  1 37  ? 91.145  39.391  55.778  1.00 64.07  ? 96  ASN H OD1 1 
ATOM   7007 N  ND2 . ASN H  1 37  ? 89.827  41.225  55.719  1.00 69.86  ? 96  ASN H ND2 1 
ATOM   7008 N  N   . ASN H  1 38  ? 85.490  38.428  56.903  1.00 68.14  ? 97  ASN H N   1 
ATOM   7009 C  CA  . ASN H  1 38  ? 84.125  37.916  56.648  1.00 69.44  ? 97  ASN H CA  1 
ATOM   7010 C  C   . ASN H  1 38  ? 84.123  36.886  55.523  1.00 67.72  ? 97  ASN H C   1 
ATOM   7011 O  O   . ASN H  1 38  ? 83.418  37.052  54.524  1.00 70.35  ? 97  ASN H O   1 
ATOM   7012 C  CB  . ASN H  1 38  ? 83.142  39.070  56.340  1.00 74.37  ? 97  ASN H CB  1 
ATOM   7013 N  N   . LEU H  1 39  ? 84.959  35.859  55.684  1.00 63.73  ? 98  LEU H N   1 
ATOM   7014 C  CA  . LEU H  1 39  ? 85.104  34.786  54.696  1.00 62.27  ? 98  LEU H CA  1 
ATOM   7015 C  C   . LEU H  1 39  ? 83.971  33.787  54.811  1.00 62.51  ? 98  LEU H C   1 
ATOM   7016 O  O   . LEU H  1 39  ? 83.410  33.593  55.886  1.00 62.42  ? 98  LEU H O   1 
ATOM   7017 C  CB  . LEU H  1 39  ? 86.436  34.044  54.882  1.00 58.37  ? 98  LEU H CB  1 
ATOM   7018 C  CG  . LEU H  1 39  ? 87.712  34.870  54.674  1.00 58.62  ? 98  LEU H CG  1 
ATOM   7019 C  CD1 . LEU H  1 39  ? 88.953  34.035  54.993  1.00 55.29  ? 98  LEU H CD1 1 
ATOM   7020 C  CD2 . LEU H  1 39  ? 87.784  35.463  53.254  1.00 60.88  ? 98  LEU H CD2 1 
ATOM   7021 N  N   . ASP H  1 40  ? 83.679  33.119  53.701  1.00 63.26  ? 99  ASP H N   1 
ATOM   7022 C  CA  . ASP H  1 40  ? 82.524  32.229  53.600  1.00 64.61  ? 99  ASP H CA  1 
ATOM   7023 C  C   . ASP H  1 40  ? 82.771  30.839  54.215  1.00 61.84  ? 99  ASP H C   1 
ATOM   7024 O  O   . ASP H  1 40  ? 82.600  29.819  53.519  1.00 62.56  ? 99  ASP H O   1 
ATOM   7025 C  CB  . ASP H  1 40  ? 82.111  32.082  52.111  1.00 67.18  ? 99  ASP H CB  1 
ATOM   7026 C  CG  . ASP H  1 40  ? 80.743  31.397  51.930  1.00 70.37  ? 99  ASP H CG  1 
ATOM   7027 O  OD1 . ASP H  1 40  ? 80.057  31.116  52.954  1.00 70.53  ? 99  ASP H OD1 1 
ATOM   7028 O  OD2 . ASP H  1 40  ? 80.361  31.154  50.752  1.00 73.16  ? 99  ASP H OD2 1 
ATOM   7029 N  N   . ILE H  1 41  ? 83.144  30.788  55.502  1.00 59.51  ? 100 ILE H N   1 
ATOM   7030 C  CA  . ILE H  1 41  ? 83.401  29.507  56.192  1.00 56.64  ? 100 ILE H CA  1 
ATOM   7031 C  C   . ILE H  1 41  ? 82.458  29.292  57.370  1.00 57.34  ? 100 ILE H C   1 
ATOM   7032 O  O   . ILE H  1 41  ? 82.600  29.916  58.419  1.00 57.53  ? 100 ILE H O   1 
ATOM   7033 C  CB  . ILE H  1 41  ? 84.816  29.416  56.744  1.00 53.61  ? 100 ILE H CB  1 
ATOM   7034 C  CG1 . ILE H  1 41  ? 85.844  29.771  55.672  1.00 53.15  ? 100 ILE H CG1 1 
ATOM   7035 C  CG2 . ILE H  1 41  ? 85.053  28.008  57.241  1.00 52.20  ? 100 ILE H CG2 1 
ATOM   7036 C  CD1 . ILE H  1 41  ? 87.209  30.129  56.243  1.00 50.59  ? 100 ILE H CD1 1 
ATOM   7037 N  N   . ASP H  1 42  ? 81.518  28.373  57.209  1.00 58.32  ? 101 ASP H N   1 
ATOM   7038 C  CA  . ASP H  1 42  ? 80.465  28.179  58.198  1.00 59.53  ? 101 ASP H CA  1 
ATOM   7039 C  C   . ASP H  1 42  ? 80.982  27.444  59.432  1.00 57.05  ? 101 ASP H C   1 
ATOM   7040 O  O   . ASP H  1 42  ? 81.704  26.454  59.315  1.00 55.42  ? 101 ASP H O   1 
ATOM   7041 C  CB  . ASP H  1 42  ? 79.320  27.381  57.572  1.00 62.06  ? 101 ASP H CB  1 
ATOM   7042 C  CG  . ASP H  1 42  ? 78.852  27.975  56.221  1.00 66.29  ? 101 ASP H CG  1 
ATOM   7043 O  OD1 . ASP H  1 42  ? 79.282  29.116  55.859  1.00 67.21  ? 101 ASP H OD1 1 
ATOM   7044 O  OD2 . ASP H  1 42  ? 78.053  27.296  55.518  1.00 68.32  ? 101 ASP H OD2 1 
ATOM   7045 N  N   . GLY H  1 43  ? 80.627  27.918  60.623  1.00 57.45  ? 102 GLY H N   1 
ATOM   7046 C  CA  . GLY H  1 43  ? 80.954  27.204  61.865  1.00 55.70  ? 102 GLY H CA  1 
ATOM   7047 C  C   . GLY H  1 43  ? 82.341  27.443  62.449  1.00 53.44  ? 102 GLY H C   1 
ATOM   7048 O  O   . GLY H  1 43  ? 82.603  27.069  63.590  1.00 53.50  ? 102 GLY H O   1 
ATOM   7049 N  N   . PHE H  1 44  ? 83.212  28.108  61.696  1.00 52.38  ? 103 PHE H N   1 
ATOM   7050 C  CA  . PHE H  1 44  ? 84.615  28.272  62.056  1.00 50.18  ? 103 PHE H CA  1 
ATOM   7051 C  C   . PHE H  1 44  ? 84.812  29.238  63.219  1.00 50.45  ? 103 PHE H C   1 
ATOM   7052 O  O   . PHE H  1 44  ? 84.451  30.387  63.138  1.00 52.37  ? 103 PHE H O   1 
ATOM   7053 C  CB  . PHE H  1 44  ? 85.387  28.788  60.827  1.00 49.75  ? 103 PHE H CB  1 
ATOM   7054 C  CG  . PHE H  1 44  ? 86.890  28.689  60.947  1.00 47.41  ? 103 PHE H CG  1 
ATOM   7055 C  CD1 . PHE H  1 44  ? 87.554  27.556  60.539  1.00 45.08  ? 103 PHE H CD1 1 
ATOM   7056 C  CD2 . PHE H  1 44  ? 87.629  29.740  61.448  1.00 47.42  ? 103 PHE H CD2 1 
ATOM   7057 C  CE1 . PHE H  1 44  ? 88.919  27.464  60.644  1.00 44.02  ? 103 PHE H CE1 1 
ATOM   7058 C  CE2 . PHE H  1 44  ? 88.983  29.649  61.539  1.00 46.18  ? 103 PHE H CE2 1 
ATOM   7059 C  CZ  . PHE H  1 44  ? 89.629  28.505  61.131  1.00 44.39  ? 103 PHE H CZ  1 
ATOM   7060 N  N   . GLY H  1 45  ? 85.407  28.770  64.296  1.00 49.32  ? 104 GLY H N   1 
ATOM   7061 C  CA  . GLY H  1 45  ? 85.744  29.635  65.420  1.00 49.94  ? 104 GLY H CA  1 
ATOM   7062 C  C   . GLY H  1 45  ? 84.615  29.842  66.409  1.00 51.73  ? 104 GLY H C   1 
ATOM   7063 O  O   . GLY H  1 45  ? 84.420  30.939  66.898  1.00 53.41  ? 104 GLY H O   1 
ATOM   7064 N  N   . ALA H  1 46  ? 83.884  28.785  66.727  1.00 51.72  ? 105 ALA H N   1 
ATOM   7065 C  CA  . ALA H  1 46  ? 82.778  28.876  67.676  1.00 53.77  ? 105 ALA H CA  1 
ATOM   7066 C  C   . ALA H  1 46  ? 83.167  29.459  69.038  1.00 54.79  ? 105 ALA H C   1 
ATOM   7067 O  O   . ALA H  1 46  ? 82.459  30.308  69.556  1.00 57.27  ? 105 ALA H O   1 
ATOM   7068 C  CB  . ALA H  1 46  ? 82.132  27.520  67.857  1.00 53.40  ? 105 ALA H CB  1 
ATOM   7069 N  N   . CYS H  1 47  ? 84.291  29.036  69.612  1.00 53.59  ? 106 CYS H N   1 
ATOM   7070 C  CA  . CYS H  1 47  ? 84.687  29.518  70.946  1.00 55.15  ? 106 CYS H CA  1 
ATOM   7071 C  C   . CYS H  1 47  ? 85.333  30.898  70.948  1.00 56.22  ? 106 CYS H C   1 
ATOM   7072 O  O   . CYS H  1 47  ? 85.759  31.392  72.003  1.00 57.58  ? 106 CYS H O   1 
ATOM   7073 C  CB  . CYS H  1 47  ? 85.593  28.494  71.666  1.00 53.90  ? 106 CYS H CB  1 
ATOM   7074 S  SG  . CYS H  1 47  ? 87.376  28.547  71.352  1.00 53.83  ? 106 CYS H SG  1 
ATOM   7075 N  N   . GLU H  1 48  ? 85.398  31.515  69.770  1.00 55.87  ? 107 GLU H N   1 
ATOM   7076 C  CA  . GLU H  1 48  ? 85.995  32.831  69.592  1.00 57.08  ? 107 GLU H CA  1 
ATOM   7077 C  C   . GLU H  1 48  ? 87.448  32.885  70.094  1.00 56.26  ? 107 GLU H C   1 
ATOM   7078 O  O   . GLU H  1 48  ? 87.892  33.889  70.664  1.00 58.06  ? 107 GLU H O   1 
ATOM   7079 C  CB  . GLU H  1 48  ? 85.127  33.916  70.237  1.00 60.45  ? 107 GLU H CB  1 
ATOM   7080 C  CG  . GLU H  1 48  ? 83.770  34.049  69.561  1.00 62.24  ? 107 GLU H CG  1 
ATOM   7081 C  CD  . GLU H  1 48  ? 82.931  35.200  70.109  1.00 67.11  ? 107 GLU H CD  1 
ATOM   7082 O  OE1 . GLU H  1 48  ? 82.579  35.163  71.312  1.00 69.00  ? 107 GLU H OE1 1 
ATOM   7083 O  OE2 . GLU H  1 48  ? 82.600  36.126  69.335  1.00 69.47  ? 107 GLU H OE2 1 
ATOM   7084 N  N   . GLY H  1 49  ? 88.177  31.796  69.864  1.00 53.94  ? 108 GLY H N   1 
ATOM   7085 C  CA  . GLY H  1 49  ? 89.621  31.759  70.104  1.00 53.53  ? 108 GLY H CA  1 
ATOM   7086 C  C   . GLY H  1 49  ? 90.032  31.658  71.561  1.00 54.89  ? 108 GLY H C   1 
ATOM   7087 O  O   . GLY H  1 49  ? 91.085  32.149  71.947  1.00 55.37  ? 108 GLY H O   1 
ATOM   7088 N  N   . THR H  1 50  ? 89.197  31.010  72.371  1.00 55.49  ? 109 THR H N   1 
ATOM   7089 C  CA  . THR H  1 50  ? 89.518  30.771  73.785  1.00 57.09  ? 109 THR H CA  1 
ATOM   7090 C  C   . THR H  1 50  ? 89.940  29.316  74.085  1.00 55.71  ? 109 THR H C   1 
ATOM   7091 O  O   . THR H  1 50  ? 89.881  28.863  75.231  1.00 57.06  ? 109 THR H O   1 
ATOM   7092 C  CB  . THR H  1 50  ? 88.338  31.185  74.674  1.00 59.28  ? 109 THR H CB  1 
ATOM   7093 O  OG1 . THR H  1 50  ? 87.169  30.455  74.282  1.00 58.75  ? 109 THR H OG1 1 
ATOM   7094 C  CG2 . THR H  1 50  ? 88.070  32.659  74.521  1.00 61.10  ? 109 THR H CG2 1 
ATOM   7095 N  N   . LEU H  1 51  ? 90.383  28.600  73.050  1.00 53.58  ? 110 LEU H N   1 
ATOM   7096 C  CA  . LEU H  1 51  ? 90.824  27.197  73.177  1.00 52.73  ? 110 LEU H CA  1 
ATOM   7097 C  C   . LEU H  1 51  ? 89.798  26.311  73.870  1.00 53.27  ? 110 LEU H C   1 
ATOM   7098 O  O   . LEU H  1 51  ? 90.117  25.566  74.785  1.00 54.48  ? 110 LEU H O   1 
ATOM   7099 C  CB  . LEU H  1 51  ? 92.173  27.099  73.895  1.00 53.75  ? 110 LEU H CB  1 
ATOM   7100 C  CG  . LEU H  1 51  ? 93.402  27.223  72.996  1.00 52.85  ? 110 LEU H CG  1 
ATOM   7101 C  CD1 . LEU H  1 51  ? 94.647  27.123  73.835  1.00 54.79  ? 110 LEU H CD1 1 
ATOM   7102 C  CD2 . LEU H  1 51  ? 93.422  26.168  71.906  1.00 50.65  ? 110 LEU H CD2 1 
ATOM   7103 N  N   . ALA H  1 52  ? 88.556  26.397  73.416  1.00 53.05  ? 111 ALA H N   1 
ATOM   7104 C  CA  . ALA H  1 52  ? 87.481  25.606  74.001  1.00 53.90  ? 111 ALA H CA  1 
ATOM   7105 C  C   . ALA H  1 52  ? 86.632  24.888  72.956  1.00 52.77  ? 111 ALA H C   1 
ATOM   7106 O  O   . ALA H  1 52  ? 85.675  24.238  73.318  1.00 54.39  ? 111 ALA H O   1 
ATOM   7107 C  CB  . ALA H  1 52  ? 86.615  26.483  74.885  1.00 55.76  ? 111 ALA H CB  1 
ATOM   7108 N  N   . CYS H  1 53  ? 86.962  25.000  71.673  1.00 51.18  ? 112 CYS H N   1 
ATOM   7109 C  CA  . CYS H  1 53  ? 86.319  24.201  70.622  1.00 50.36  ? 112 CYS H CA  1 
ATOM   7110 C  C   . CYS H  1 53  ? 87.393  23.552  69.763  1.00 48.69  ? 112 CYS H C   1 
ATOM   7111 O  O   . CYS H  1 53  ? 88.577  23.653  70.067  1.00 48.61  ? 112 CYS H O   1 
ATOM   7112 C  CB  . CYS H  1 53  ? 85.408  25.083  69.769  1.00 50.49  ? 112 CYS H CB  1 
ATOM   7113 S  SG  . CYS H  1 53  ? 86.197  26.406  68.823  1.00 51.60  ? 112 CYS H SG  1 
ATOM   7114 N  N   . SER H  1 54  ? 86.999  22.878  68.695  1.00 47.96  ? 113 SER H N   1 
ATOM   7115 C  CA  . SER H  1 54  ? 87.990  22.413  67.721  1.00 46.77  ? 113 SER H CA  1 
ATOM   7116 C  C   . SER H  1 54  ? 87.644  22.919  66.319  1.00 45.94  ? 113 SER H C   1 
ATOM   7117 O  O   . SER H  1 54  ? 88.079  22.344  65.319  1.00 45.28  ? 113 SER H O   1 
ATOM   7118 C  CB  . SER H  1 54  ? 88.048  20.887  67.721  1.00 47.23  ? 113 SER H CB  1 
ATOM   7119 O  OG  . SER H  1 54  ? 88.117  20.400  69.038  1.00 49.74  ? 113 SER H OG  1 
ATOM   7120 N  N   . THR H  1 55  ? 86.871  23.998  66.245  1.00 40.80  ? 114 THR H N   1 
ATOM   7121 C  CA  . THR H  1 55  ? 86.266  24.409  64.982  1.00 41.16  ? 114 THR H CA  1 
ATOM   7122 C  C   . THR H  1 55  ? 87.186  25.289  64.144  1.00 41.90  ? 114 THR H C   1 
ATOM   7123 O  O   . THR H  1 55  ? 86.983  25.414  62.948  1.00 42.06  ? 114 THR H O   1 
ATOM   7124 C  CB  . THR H  1 55  ? 84.977  25.114  65.226  1.00 42.70  ? 114 THR H CB  1 
ATOM   7125 O  OG1 . THR H  1 55  ? 85.252  26.298  65.963  1.00 44.37  ? 114 THR H OG1 1 
ATOM   7126 C  CG2 . THR H  1 55  ? 84.026  24.225  66.024  1.00 41.37  ? 114 THR H CG2 1 
ATOM   7127 N  N   . CYS H  1 56  ? 88.224  25.850  64.764  1.00 42.36  ? 115 CYS H N   1 
ATOM   7128 C  CA  . CYS H  1 56  ? 89.272  26.580  64.035  1.00 43.02  ? 115 CYS H CA  1 
ATOM   7129 C  C   . CYS H  1 56  ? 90.358  25.684  63.425  1.00 41.26  ? 115 CYS H C   1 
ATOM   7130 O  O   . CYS H  1 56  ? 91.364  26.164  62.944  1.00 41.49  ? 115 CYS H O   1 
ATOM   7131 C  CB  . CYS H  1 56  ? 89.921  27.613  64.938  1.00 44.72  ? 115 CYS H CB  1 
ATOM   7132 S  SG  . CYS H  1 56  ? 90.668  26.925  66.373  1.00 45.04  ? 115 CYS H SG  1 
ATOM   7133 N  N   . HIS H  1 57  ? 90.124  24.379  63.419  1.00 39.96  ? 116 HIS H N   1 
ATOM   7134 C  CA  . HIS H  1 57  ? 91.025  23.403  62.827  1.00 38.51  ? 116 HIS H CA  1 
ATOM   7135 C  C   . HIS H  1 57  ? 91.411  23.820  61.419  1.00 38.69  ? 116 HIS H C   1 
ATOM   7136 O  O   . HIS H  1 57  ? 90.561  24.126  60.613  1.00 39.19  ? 116 HIS H O   1 
ATOM   7137 C  CB  . HIS H  1 57  ? 90.321  22.030  62.833  1.00 37.23  ? 116 HIS H CB  1 
ATOM   7138 C  CG  . HIS H  1 57  ? 91.138  20.898  62.303  1.00 36.03  ? 116 HIS H CG  1 
ATOM   7139 N  ND1 . HIS H  1 57  ? 90.574  19.694  61.942  1.00 34.37  ? 116 HIS H ND1 1 
ATOM   7140 C  CD2 . HIS H  1 57  ? 92.466  20.779  62.071  1.00 36.46  ? 116 HIS H CD2 1 
ATOM   7141 C  CE1 . HIS H  1 57  ? 91.520  18.881  61.509  1.00 34.84  ? 116 HIS H CE1 1 
ATOM   7142 N  NE2 . HIS H  1 57  ? 92.679  19.513  61.582  1.00 36.11  ? 116 HIS H NE2 1 
ATOM   7143 N  N   . LEU H  1 58  ? 92.715  23.835  61.151  1.00 38.81  ? 117 LEU H N   1 
ATOM   7144 C  CA  . LEU H  1 58  ? 93.249  24.058  59.795  1.00 39.02  ? 117 LEU H CA  1 
ATOM   7145 C  C   . LEU H  1 58  ? 94.394  23.102  59.480  1.00 38.10  ? 117 LEU H C   1 
ATOM   7146 O  O   . LEU H  1 58  ? 95.054  22.610  60.372  1.00 38.05  ? 117 LEU H O   1 
ATOM   7147 C  CB  . LEU H  1 58  ? 93.762  25.488  59.666  1.00 40.24  ? 117 LEU H CB  1 
ATOM   7148 C  CG  . LEU H  1 58  ? 92.733  26.617  59.581  1.00 41.30  ? 117 LEU H CG  1 
ATOM   7149 C  CD1 . LEU H  1 58  ? 93.399  27.940  59.779  1.00 41.24  ? 117 LEU H CD1 1 
ATOM   7150 C  CD2 . LEU H  1 58  ? 91.967  26.570  58.248  1.00 42.02  ? 117 LEU H CD2 1 
ATOM   7151 N  N   . ILE H  1 59  ? 94.598  22.830  58.201  1.00 38.30  ? 118 ILE H N   1 
ATOM   7152 C  CA  . ILE H  1 59  ? 95.689  21.985  57.747  1.00 37.78  ? 118 ILE H CA  1 
ATOM   7153 C  C   . ILE H  1 59  ? 96.710  22.845  57.004  1.00 38.57  ? 118 ILE H C   1 
ATOM   7154 O  O   . ILE H  1 59  ? 96.350  23.628  56.154  1.00 39.31  ? 118 ILE H O   1 
ATOM   7155 C  CB  . ILE H  1 59  ? 95.173  20.907  56.805  1.00 37.75  ? 118 ILE H CB  1 
ATOM   7156 C  CG1 . ILE H  1 59  ? 94.255  19.953  57.565  1.00 37.34  ? 118 ILE H CG1 1 
ATOM   7157 C  CG2 . ILE H  1 59  ? 96.309  20.129  56.206  1.00 37.46  ? 118 ILE H CG2 1 
ATOM   7158 C  CD1 . ILE H  1 59  ? 93.547  19.018  56.671  1.00 38.04  ? 118 ILE H CD1 1 
ATOM   7159 N  N   . PHE H  1 60  ? 97.988  22.666  57.317  1.00 38.50  ? 119 PHE H N   1 
ATOM   7160 C  CA  . PHE H  1 60  ? 99.042  23.534  56.851  1.00 39.01  ? 119 PHE H CA  1 
ATOM   7161 C  C   . PHE H  1 60  ? 100.019 22.854  55.913  1.00 39.14  ? 119 PHE H C   1 
ATOM   7162 O  O   . PHE H  1 60  ? 100.184 21.634  55.939  1.00 38.46  ? 119 PHE H O   1 
ATOM   7163 C  CB  . PHE H  1 60  ? 99.820  24.059  58.045  1.00 39.61  ? 119 PHE H CB  1 
ATOM   7164 C  CG  . PHE H  1 60  ? 99.056  25.036  58.873  1.00 39.94  ? 119 PHE H CG  1 
ATOM   7165 C  CD1 . PHE H  1 60  ? 99.338  26.392  58.799  1.00 41.09  ? 119 PHE H CD1 1 
ATOM   7166 C  CD2 . PHE H  1 60  ? 98.056  24.598  59.738  1.00 39.41  ? 119 PHE H CD2 1 
ATOM   7167 C  CE1 . PHE H  1 60  ? 98.633  27.313  59.571  1.00 42.14  ? 119 PHE H CE1 1 
ATOM   7168 C  CE2 . PHE H  1 60  ? 97.346  25.499  60.516  1.00 40.48  ? 119 PHE H CE2 1 
ATOM   7169 C  CZ  . PHE H  1 60  ? 97.632  26.871  60.426  1.00 42.17  ? 119 PHE H CZ  1 
ATOM   7170 N  N   . GLU H  1 61  ? 100.681 23.670  55.095  1.00 39.81  ? 120 GLU H N   1 
ATOM   7171 C  CA  . GLU H  1 61  ? 101.735 23.190  54.222  1.00 40.46  ? 120 GLU H CA  1 
ATOM   7172 C  C   . GLU H  1 61  ? 102.934 22.683  55.038  1.00 40.21  ? 120 GLU H C   1 
ATOM   7173 O  O   . GLU H  1 61  ? 103.276 23.222  56.088  1.00 39.50  ? 120 GLU H O   1 
ATOM   7174 C  CB  . GLU H  1 61  ? 102.218 24.316  53.288  1.00 41.65  ? 120 GLU H CB  1 
ATOM   7175 C  CG  . GLU H  1 61  ? 101.170 24.842  52.307  1.00 42.93  ? 120 GLU H CG  1 
ATOM   7176 C  CD  . GLU H  1 61  ? 101.750 25.785  51.268  1.00 44.01  ? 120 GLU H CD  1 
ATOM   7177 O  OE1 . GLU H  1 61  ? 102.644 25.348  50.491  1.00 44.83  ? 120 GLU H OE1 1 
ATOM   7178 O  OE2 . GLU H  1 61  ? 101.306 26.956  51.228  1.00 44.10  ? 120 GLU H OE2 1 
ATOM   7179 N  N   . ASP H  1 62  ? 103.583 21.658  54.515  1.00 40.73  ? 121 ASP H N   1 
ATOM   7180 C  CA  . ASP H  1 62  ? 104.733 21.059  55.168  1.00 41.62  ? 121 ASP H CA  1 
ATOM   7181 C  C   . ASP H  1 62  ? 105.678 22.098  55.778  1.00 42.16  ? 121 ASP H C   1 
ATOM   7182 O  O   . ASP H  1 62  ? 105.897 22.133  57.006  1.00 42.02  ? 121 ASP H O   1 
ATOM   7183 C  CB  . ASP H  1 62  ? 105.513 20.211  54.165  1.00 42.52  ? 121 ASP H CB  1 
ATOM   7184 C  CG  . ASP H  1 62  ? 104.750 18.964  53.735  1.00 44.47  ? 121 ASP H CG  1 
ATOM   7185 O  OD1 . ASP H  1 62  ? 103.736 18.584  54.388  1.00 44.07  ? 121 ASP H OD1 1 
ATOM   7186 O  OD2 . ASP H  1 62  ? 105.163 18.388  52.691  1.00 47.82  ? 121 ASP H OD2 1 
ATOM   7187 N  N   . HIS H  1 63  ? 106.235 22.948  54.926  1.00 42.36  ? 122 HIS H N   1 
ATOM   7188 C  CA  . HIS H  1 63  ? 107.310 23.853  55.361  1.00 43.37  ? 122 HIS H CA  1 
ATOM   7189 C  C   . HIS H  1 63  ? 106.859 24.950  56.308  1.00 43.27  ? 122 HIS H C   1 
ATOM   7190 O  O   . HIS H  1 63  ? 107.678 25.507  57.008  1.00 44.90  ? 122 HIS H O   1 
ATOM   7191 C  CB  . HIS H  1 63  ? 108.024 24.473  54.153  1.00 44.11  ? 122 HIS H CB  1 
ATOM   7192 C  CG  . HIS H  1 63  ? 107.241 25.560  53.498  1.00 44.71  ? 122 HIS H CG  1 
ATOM   7193 N  ND1 . HIS H  1 63  ? 106.228 25.307  52.597  1.00 44.50  ? 122 HIS H ND1 1 
ATOM   7194 C  CD2 . HIS H  1 63  ? 107.295 26.903  53.638  1.00 46.01  ? 122 HIS H CD2 1 
ATOM   7195 C  CE1 . HIS H  1 63  ? 105.704 26.451  52.196  1.00 45.08  ? 122 HIS H CE1 1 
ATOM   7196 N  NE2 . HIS H  1 63  ? 106.333 27.435  52.814  1.00 45.66  ? 122 HIS H NE2 1 
ATOM   7197 N  N   . ILE H  1 64  ? 105.576 25.271  56.315  1.00 42.48  ? 123 ILE H N   1 
ATOM   7198 C  CA  . ILE H  1 64  ? 105.000 26.191  57.281  1.00 42.91  ? 123 ILE H CA  1 
ATOM   7199 C  C   . ILE H  1 64  ? 104.798 25.501  58.639  1.00 43.10  ? 123 ILE H C   1 
ATOM   7200 O  O   . ILE H  1 64  ? 105.166 26.039  59.691  1.00 44.01  ? 123 ILE H O   1 
ATOM   7201 C  CB  . ILE H  1 64  ? 103.653 26.705  56.779  1.00 42.43  ? 123 ILE H CB  1 
ATOM   7202 C  CG1 . ILE H  1 64  ? 103.855 27.517  55.486  1.00 43.99  ? 123 ILE H CG1 1 
ATOM   7203 C  CG2 . ILE H  1 64  ? 102.961 27.541  57.839  1.00 42.84  ? 123 ILE H CG2 1 
ATOM   7204 C  CD1 . ILE H  1 64  ? 104.729 28.789  55.624  1.00 44.22  ? 123 ILE H CD1 1 
ATOM   7205 N  N   . TYR H  1 65  ? 104.199 24.309  58.601  1.00 42.26  ? 124 TYR H N   1 
ATOM   7206 C  CA  . TYR H  1 65  ? 103.898 23.534  59.799  1.00 41.97  ? 124 TYR H CA  1 
ATOM   7207 C  C   . TYR H  1 65  ? 105.160 23.357  60.638  1.00 43.47  ? 124 TYR H C   1 
ATOM   7208 O  O   . TYR H  1 65  ? 105.172 23.578  61.852  1.00 44.64  ? 124 TYR H O   1 
ATOM   7209 C  CB  . TYR H  1 65  ? 103.359 22.160  59.394  1.00 40.87  ? 124 TYR H CB  1 
ATOM   7210 C  CG  . TYR H  1 65  ? 102.994 21.254  60.551  1.00 40.59  ? 124 TYR H CG  1 
ATOM   7211 C  CD1 . TYR H  1 65  ? 101.787 21.385  61.218  1.00 39.74  ? 124 TYR H CD1 1 
ATOM   7212 C  CD2 . TYR H  1 65  ? 103.845 20.263  60.957  1.00 41.84  ? 124 TYR H CD2 1 
ATOM   7213 C  CE1 . TYR H  1 65  ? 101.464 20.561  62.262  1.00 39.45  ? 124 TYR H CE1 1 
ATOM   7214 C  CE2 . TYR H  1 65  ? 103.534 19.432  62.009  1.00 41.29  ? 124 TYR H CE2 1 
ATOM   7215 C  CZ  . TYR H  1 65  ? 102.355 19.584  62.656  1.00 40.25  ? 124 TYR H CZ  1 
ATOM   7216 O  OH  . TYR H  1 65  ? 102.079 18.737  63.674  1.00 40.31  ? 124 TYR H OH  1 
ATOM   7217 N  N   . GLU H  1 66  ? 106.220 22.941  59.967  1.00 43.73  ? 125 GLU H N   1 
ATOM   7218 C  CA  . GLU H  1 66  ? 107.517 22.701  60.596  1.00 45.22  ? 125 GLU H CA  1 
ATOM   7219 C  C   . GLU H  1 66  ? 108.018 23.867  61.464  1.00 46.85  ? 125 GLU H C   1 
ATOM   7220 O  O   . GLU H  1 66  ? 108.743 23.650  62.453  1.00 47.86  ? 125 GLU H O   1 
ATOM   7221 C  CB  . GLU H  1 66  ? 108.507 22.436  59.475  1.00 45.53  ? 125 GLU H CB  1 
ATOM   7222 C  CG  . GLU H  1 66  ? 109.906 22.249  59.882  1.00 48.00  ? 125 GLU H CG  1 
ATOM   7223 C  CD  . GLU H  1 66  ? 110.772 21.910  58.693  1.00 49.56  ? 125 GLU H CD  1 
ATOM   7224 O  OE1 . GLU H  1 66  ? 111.596 20.954  58.844  1.00 50.29  ? 125 GLU H OE1 1 
ATOM   7225 O  OE2 . GLU H  1 66  ? 110.606 22.609  57.627  1.00 48.84  ? 125 GLU H OE2 1 
ATOM   7226 N  N   . LYS H  1 67  ? 107.619 25.089  61.099  1.00 46.60  ? 126 LYS H N   1 
ATOM   7227 C  CA  . LYS H  1 67  ? 108.139 26.289  61.726  1.00 48.53  ? 126 LYS H CA  1 
ATOM   7228 C  C   . LYS H  1 67  ? 107.213 26.919  62.773  1.00 48.87  ? 126 LYS H C   1 
ATOM   7229 O  O   . LYS H  1 67  ? 107.545 27.931  63.387  1.00 50.49  ? 126 LYS H O   1 
ATOM   7230 C  CB  . LYS H  1 67  ? 108.481 27.301  60.637  1.00 48.89  ? 126 LYS H CB  1 
ATOM   7231 C  CG  . LYS H  1 67  ? 109.584 26.799  59.678  1.00 50.96  ? 126 LYS H CG  1 
ATOM   7232 C  CD  . LYS H  1 67  ? 110.818 26.219  60.455  1.00 54.31  ? 126 LYS H CD  1 
ATOM   7233 C  CE  . LYS H  1 67  ? 112.096 26.142  59.598  1.00 55.47  ? 126 LYS H CE  1 
ATOM   7234 N  NZ  . LYS H  1 67  ? 113.268 25.641  60.379  1.00 56.68  ? 126 LYS H NZ  1 
ATOM   7235 N  N   . LEU H  1 68  ? 106.055 26.317  62.990  1.00 47.51  ? 127 LEU H N   1 
ATOM   7236 C  CA  . LEU H  1 68  ? 105.061 26.898  63.881  1.00 47.82  ? 127 LEU H CA  1 
ATOM   7237 C  C   . LEU H  1 68  ? 105.494 26.786  65.320  1.00 49.38  ? 127 LEU H C   1 
ATOM   7238 O  O   . LEU H  1 68  ? 106.286 25.910  65.644  1.00 49.79  ? 127 LEU H O   1 
ATOM   7239 C  CB  . LEU H  1 68  ? 103.719 26.201  63.688  1.00 45.91  ? 127 LEU H CB  1 
ATOM   7240 C  CG  . LEU H  1 68  ? 103.110 26.398  62.310  1.00 44.48  ? 127 LEU H CG  1 
ATOM   7241 C  CD1 . LEU H  1 68  ? 101.788 25.665  62.233  1.00 42.68  ? 127 LEU H CD1 1 
ATOM   7242 C  CD2 . LEU H  1 68  ? 102.935 27.889  62.026  1.00 44.75  ? 127 LEU H CD2 1 
ATOM   7243 N  N   . ASP H  1 69  ? 105.002 27.684  66.170  1.00 50.77  ? 128 ASP H N   1 
ATOM   7244 C  CA  . ASP H  1 69  ? 105.378 27.660  67.589  1.00 53.53  ? 128 ASP H CA  1 
ATOM   7245 C  C   . ASP H  1 69  ? 105.007 26.301  68.172  1.00 52.66  ? 128 ASP H C   1 
ATOM   7246 O  O   . ASP H  1 69  ? 103.959 25.734  67.835  1.00 51.15  ? 128 ASP H O   1 
ATOM   7247 C  CB  . ASP H  1 69  ? 104.663 28.748  68.402  1.00 55.35  ? 128 ASP H CB  1 
ATOM   7248 C  CG  . ASP H  1 69  ? 105.037 30.167  67.983  1.00 58.14  ? 128 ASP H CG  1 
ATOM   7249 O  OD1 . ASP H  1 69  ? 106.157 30.403  67.441  1.00 59.28  ? 128 ASP H OD1 1 
ATOM   7250 O  OD2 . ASP H  1 69  ? 104.189 31.061  68.208  1.00 59.61  ? 128 ASP H OD2 1 
ATOM   7251 N  N   . ALA H  1 70  ? 105.862 25.777  69.041  1.00 54.36  ? 129 ALA H N   1 
ATOM   7252 C  CA  . ALA H  1 70  ? 105.588 24.510  69.709  1.00 53.98  ? 129 ALA H CA  1 
ATOM   7253 C  C   . ALA H  1 70  ? 104.167 24.512  70.303  1.00 53.01  ? 129 ALA H C   1 
ATOM   7254 O  O   . ALA H  1 70  ? 103.727 25.498  70.898  1.00 54.43  ? 129 ALA H O   1 
ATOM   7255 C  CB  . ALA H  1 70  ? 106.628 24.259  70.795  1.00 56.56  ? 129 ALA H CB  1 
ATOM   7256 N  N   . ILE H  1 71  ? 103.457 23.409  70.117  1.00 50.78  ? 130 ILE H N   1 
ATOM   7257 C  CA  . ILE H  1 71  ? 102.063 23.317  70.537  1.00 49.87  ? 130 ILE H CA  1 
ATOM   7258 C  C   . ILE H  1 71  ? 101.935 23.214  72.065  1.00 51.93  ? 130 ILE H C   1 
ATOM   7259 O  O   . ILE H  1 71  ? 102.590 22.373  72.678  1.00 53.40  ? 130 ILE H O   1 
ATOM   7260 C  CB  . ILE H  1 71  ? 101.377 22.109  69.845  1.00 47.27  ? 130 ILE H CB  1 
ATOM   7261 C  CG1 . ILE H  1 71  ? 99.900  22.073  70.189  1.00 46.60  ? 130 ILE H CG1 1 
ATOM   7262 C  CG2 . ILE H  1 71  ? 102.057 20.797  70.225  1.00 47.66  ? 130 ILE H CG2 1 
ATOM   7263 C  CD1 . ILE H  1 71  ? 99.135  21.192  69.297  1.00 44.71  ? 130 ILE H CD1 1 
ATOM   7264 N  N   . THR H  1 72  ? 101.104 24.057  72.684  1.00 52.62  ? 131 THR H N   1 
ATOM   7265 C  CA  . THR H  1 72  ? 100.921 23.984  74.145  1.00 54.50  ? 131 THR H CA  1 
ATOM   7266 C  C   . THR H  1 72  ? 100.036 22.817  74.522  1.00 53.08  ? 131 THR H C   1 
ATOM   7267 O  O   . THR H  1 72  ? 99.325  22.246  73.694  1.00 50.90  ? 131 THR H O   1 
ATOM   7268 C  CB  . THR H  1 72  ? 100.340 25.286  74.786  1.00 56.54  ? 131 THR H CB  1 
ATOM   7269 O  OG1 . THR H  1 72  ? 98.940  25.434  74.505  1.00 54.19  ? 131 THR H OG1 1 
ATOM   7270 C  CG2 . THR H  1 72  ? 101.139 26.527  74.338  1.00 57.48  ? 131 THR H CG2 1 
ATOM   7271 N  N   . ASP H  1 73  ? 100.082 22.449  75.784  1.00 55.29  ? 132 ASP H N   1 
ATOM   7272 C  CA  . ASP H  1 73  ? 99.216  21.386  76.289  1.00 54.35  ? 132 ASP H CA  1 
ATOM   7273 C  C   . ASP H  1 73  ? 97.759  21.747  76.080  1.00 52.45  ? 132 ASP H C   1 
ATOM   7274 O  O   . ASP H  1 73  ? 96.968  20.916  75.647  1.00 50.28  ? 132 ASP H O   1 
ATOM   7275 C  CB  . ASP H  1 73  ? 99.490  21.152  77.778  1.00 57.54  ? 132 ASP H CB  1 
ATOM   7276 C  CG  . ASP H  1 73  ? 100.759 20.323  78.012  1.00 60.25  ? 132 ASP H CG  1 
ATOM   7277 O  OD1 . ASP H  1 73  ? 101.071 19.463  77.147  1.00 58.59  ? 132 ASP H OD1 1 
ATOM   7278 O  OD2 . ASP H  1 73  ? 101.443 20.530  79.045  1.00 64.30  ? 132 ASP H OD2 1 
ATOM   7279 N  N   . GLU H  1 74  ? 97.415  22.988  76.409  1.00 53.94  ? 133 GLU H N   1 
ATOM   7280 C  CA  . GLU H  1 74  ? 96.079  23.511  76.206  1.00 52.85  ? 133 GLU H CA  1 
ATOM   7281 C  C   . GLU H  1 74  ? 95.601  23.277  74.776  1.00 50.08  ? 133 GLU H C   1 
ATOM   7282 O  O   . GLU H  1 74  ? 94.531  22.667  74.559  1.00 48.48  ? 133 GLU H O   1 
ATOM   7283 C  CB  . GLU H  1 74  ? 96.041  25.003  76.508  1.00 55.36  ? 133 GLU H CB  1 
ATOM   7284 C  CG  . GLU H  1 74  ? 95.339  25.373  77.771  1.00 58.68  ? 133 GLU H CG  1 
ATOM   7285 C  CD  . GLU H  1 74  ? 94.902  26.845  77.757  1.00 62.74  ? 133 GLU H CD  1 
ATOM   7286 O  OE1 . GLU H  1 74  ? 95.792  27.739  77.894  1.00 65.07  ? 133 GLU H OE1 1 
ATOM   7287 O  OE2 . GLU H  1 74  ? 93.662  27.086  77.604  1.00 62.19  ? 133 GLU H OE2 1 
ATOM   7288 N  N   . GLU H  1 75  ? 96.370  23.750  73.797  1.00 49.56  ? 134 GLU H N   1 
ATOM   7289 C  CA  . GLU H  1 75  ? 95.966  23.552  72.407  1.00 46.98  ? 134 GLU H CA  1 
ATOM   7290 C  C   . GLU H  1 75  ? 95.805  22.067  72.121  1.00 44.89  ? 134 GLU H C   1 
ATOM   7291 O  O   . GLU H  1 75  ? 94.859  21.632  71.467  1.00 43.03  ? 134 GLU H O   1 
ATOM   7292 C  CB  . GLU H  1 75  ? 96.959  24.169  71.412  1.00 46.91  ? 134 GLU H CB  1 
ATOM   7293 C  CG  . GLU H  1 75  ? 96.542  23.918  69.944  1.00 44.79  ? 134 GLU H CG  1 
ATOM   7294 C  CD  . GLU H  1 75  ? 97.417  24.607  68.897  1.00 45.27  ? 134 GLU H CD  1 
ATOM   7295 O  OE1 . GLU H  1 75  ? 98.223  25.515  69.228  1.00 47.57  ? 134 GLU H OE1 1 
ATOM   7296 O  OE2 . GLU H  1 75  ? 97.296  24.232  67.716  1.00 42.57  ? 134 GLU H OE2 1 
ATOM   7297 N  N   . ASN H  1 76  ? 96.745  21.278  72.603  1.00 45.55  ? 135 ASN H N   1 
ATOM   7298 C  CA  . ASN H  1 76  ? 96.752  19.883  72.236  1.00 44.40  ? 135 ASN H CA  1 
ATOM   7299 C  C   . ASN H  1 76  ? 95.499  19.151  72.709  1.00 43.35  ? 135 ASN H C   1 
ATOM   7300 O  O   . ASN H  1 76  ? 94.984  18.264  72.031  1.00 41.88  ? 135 ASN H O   1 
ATOM   7301 C  CB  . ASN H  1 76  ? 98.000  19.220  72.798  1.00 46.29  ? 135 ASN H CB  1 
ATOM   7302 C  CG  . ASN H  1 76  ? 98.367  17.981  72.034  1.00 46.78  ? 135 ASN H CG  1 
ATOM   7303 O  OD1 . ASN H  1 76  ? 98.793  18.056  70.859  1.00 47.78  ? 135 ASN H OD1 1 
ATOM   7304 N  ND2 . ASN H  1 76  ? 98.204  16.825  72.677  1.00 47.02  ? 135 ASN H ND2 1 
ATOM   7305 N  N   . ASP H  1 77  ? 95.021  19.521  73.892  1.00 44.74  ? 136 ASP H N   1 
ATOM   7306 C  CA  . ASP H  1 77  ? 93.788  18.970  74.424  1.00 44.14  ? 136 ASP H CA  1 
ATOM   7307 C  C   . ASP H  1 77  ? 92.631  19.151  73.448  1.00 42.15  ? 136 ASP H C   1 
ATOM   7308 O  O   . ASP H  1 77  ? 91.899  18.196  73.171  1.00 40.78  ? 136 ASP H O   1 
ATOM   7309 C  CB  . ASP H  1 77  ? 93.454  19.627  75.779  1.00 46.53  ? 136 ASP H CB  1 
ATOM   7310 C  CG  . ASP H  1 77  ? 94.301  19.062  76.934  1.00 49.18  ? 136 ASP H CG  1 
ATOM   7311 O  OD1 . ASP H  1 77  ? 94.798  17.919  76.795  1.00 49.23  ? 136 ASP H OD1 1 
ATOM   7312 O  OD2 . ASP H  1 77  ? 94.463  19.751  77.977  1.00 52.62  ? 136 ASP H OD2 1 
ATOM   7313 N  N   . MET H  1 78  ? 92.477  20.370  72.925  1.00 42.07  ? 137 MET H N   1 
ATOM   7314 C  CA  . MET H  1 78  ? 91.380  20.672  72.008  1.00 40.72  ? 137 MET H CA  1 
ATOM   7315 C  C   . MET H  1 78  ? 91.662  20.103  70.638  1.00 38.97  ? 137 MET H C   1 
ATOM   7316 O  O   . MET H  1 78  ? 90.750  19.681  69.941  1.00 37.66  ? 137 MET H O   1 
ATOM   7317 C  CB  . MET H  1 78  ? 91.130  22.176  71.924  1.00 41.91  ? 137 MET H CB  1 
ATOM   7318 C  CG  . MET H  1 78  ? 90.697  22.809  73.237  1.00 44.25  ? 137 MET H CG  1 
ATOM   7319 S  SD  . MET H  1 78  ? 89.143  22.141  73.871  1.00 47.08  ? 137 MET H SD  1 
ATOM   7320 C  CE  . MET H  1 78  ? 89.733  20.872  74.987  1.00 43.85  ? 137 MET H CE  1 
ATOM   7321 N  N   . LEU H  1 79  ? 92.929  20.070  70.257  1.00 39.35  ? 138 LEU H N   1 
ATOM   7322 C  CA  . LEU H  1 79  ? 93.283  19.556  68.937  1.00 38.29  ? 138 LEU H CA  1 
ATOM   7323 C  C   . LEU H  1 79  ? 93.029  18.057  68.830  1.00 37.26  ? 138 LEU H C   1 
ATOM   7324 O  O   . LEU H  1 79  ? 92.774  17.526  67.731  1.00 36.19  ? 138 LEU H O   1 
ATOM   7325 C  CB  . LEU H  1 79  ? 94.740  19.871  68.607  1.00 38.90  ? 138 LEU H CB  1 
ATOM   7326 C  CG  . LEU H  1 79  ? 95.247  19.496  67.197  1.00 38.07  ? 138 LEU H CG  1 
ATOM   7327 C  CD1 . LEU H  1 79  ? 94.463  20.188  66.064  1.00 35.87  ? 138 LEU H CD1 1 
ATOM   7328 C  CD2 . LEU H  1 79  ? 96.772  19.760  67.100  1.00 37.37  ? 138 LEU H CD2 1 
ATOM   7329 N  N   . ASP H  1 80  ? 93.123  17.360  69.965  1.00 37.94  ? 139 ASP H N   1 
ATOM   7330 C  CA  . ASP H  1 80  ? 92.804  15.930  69.983  1.00 37.45  ? 139 ASP H CA  1 
ATOM   7331 C  C   . ASP H  1 80  ? 91.374  15.690  69.564  1.00 36.30  ? 139 ASP H C   1 
ATOM   7332 O  O   . ASP H  1 80  ? 91.078  14.651  68.949  1.00 35.84  ? 139 ASP H O   1 
ATOM   7333 C  CB  . ASP H  1 80  ? 92.985  15.330  71.361  1.00 38.78  ? 139 ASP H CB  1 
ATOM   7334 C  CG  . ASP H  1 80  ? 94.324  14.700  71.571  1.00 41.50  ? 139 ASP H CG  1 
ATOM   7335 O  OD1 . ASP H  1 80  ? 95.093  14.489  70.603  1.00 42.27  ? 139 ASP H OD1 1 
ATOM   7336 O  OD2 . ASP H  1 80  ? 94.589  14.375  72.766  1.00 45.43  ? 139 ASP H OD2 1 
ATOM   7337 N  N   . LEU H  1 81  ? 90.495  16.643  69.889  1.00 36.14  ? 140 LEU H N   1 
ATOM   7338 C  CA  . LEU H  1 81  ? 89.080  16.519  69.583  1.00 35.49  ? 140 LEU H CA  1 
ATOM   7339 C  C   . LEU H  1 81  ? 88.703  17.024  68.192  1.00 35.55  ? 140 LEU H C   1 
ATOM   7340 O  O   . LEU H  1 81  ? 87.517  17.006  67.838  1.00 35.70  ? 140 LEU H O   1 
ATOM   7341 C  CB  . LEU H  1 81  ? 88.252  17.241  70.632  1.00 35.97  ? 140 LEU H CB  1 
ATOM   7342 C  CG  . LEU H  1 81  ? 88.420  16.726  72.084  1.00 37.21  ? 140 LEU H CG  1 
ATOM   7343 C  CD1 . LEU H  1 81  ? 87.606  17.562  73.022  1.00 36.73  ? 140 LEU H CD1 1 
ATOM   7344 C  CD2 . LEU H  1 81  ? 88.048  15.254  72.242  1.00 35.00  ? 140 LEU H CD2 1 
ATOM   7345 N  N   . ALA H  1 82  ? 89.680  17.474  67.402  1.00 35.40  ? 141 ALA H N   1 
ATOM   7346 C  CA  . ALA H  1 82  ? 89.390  17.895  66.037  1.00 35.26  ? 141 ALA H CA  1 
ATOM   7347 C  C   . ALA H  1 82  ? 88.949  16.708  65.206  1.00 34.37  ? 141 ALA H C   1 
ATOM   7348 O  O   . ALA H  1 82  ? 89.548  15.663  65.271  1.00 34.28  ? 141 ALA H O   1 
ATOM   7349 C  CB  . ALA H  1 82  ? 90.617  18.544  65.395  1.00 35.41  ? 141 ALA H CB  1 
ATOM   7350 N  N   . TYR H  1 83  ? 87.883  16.859  64.447  1.00 34.46  ? 142 TYR H N   1 
ATOM   7351 C  CA  . TYR H  1 83  ? 87.471  15.792  63.551  1.00 34.71  ? 142 TYR H CA  1 
ATOM   7352 C  C   . TYR H  1 83  ? 88.369  15.748  62.319  1.00 35.02  ? 142 TYR H C   1 
ATOM   7353 O  O   . TYR H  1 83  ? 88.588  16.762  61.663  1.00 35.09  ? 142 TYR H O   1 
ATOM   7354 C  CB  . TYR H  1 83  ? 86.035  15.956  63.086  1.00 35.27  ? 142 TYR H CB  1 
ATOM   7355 C  CG  . TYR H  1 83  ? 85.595  14.795  62.207  1.00 35.93  ? 142 TYR H CG  1 
ATOM   7356 C  CD1 . TYR H  1 83  ? 85.171  13.574  62.779  1.00 35.03  ? 142 TYR H CD1 1 
ATOM   7357 C  CD2 . TYR H  1 83  ? 85.626  14.888  60.818  1.00 35.87  ? 142 TYR H CD2 1 
ATOM   7358 C  CE1 . TYR H  1 83  ? 84.778  12.512  61.981  1.00 35.03  ? 142 TYR H CE1 1 
ATOM   7359 C  CE2 . TYR H  1 83  ? 85.239  13.828  60.021  1.00 36.54  ? 142 TYR H CE2 1 
ATOM   7360 C  CZ  . TYR H  1 83  ? 84.822  12.650  60.602  1.00 36.28  ? 142 TYR H CZ  1 
ATOM   7361 O  OH  . TYR H  1 83  ? 84.444  11.606  59.803  1.00 39.02  ? 142 TYR H OH  1 
ATOM   7362 N  N   . GLY H  1 84  ? 88.856  14.553  62.007  1.00 35.28  ? 143 GLY H N   1 
ATOM   7363 C  CA  . GLY H  1 84  ? 89.787  14.325  60.903  1.00 35.44  ? 143 GLY H CA  1 
ATOM   7364 C  C   . GLY H  1 84  ? 91.160  14.891  61.161  1.00 35.26  ? 143 GLY H C   1 
ATOM   7365 O  O   . GLY H  1 84  ? 91.770  15.416  60.254  1.00 36.12  ? 143 GLY H O   1 
ATOM   7366 N  N   . LEU H  1 85  ? 91.643  14.776  62.398  1.00 35.39  ? 144 LEU H N   1 
ATOM   7367 C  CA  . LEU H  1 85  ? 92.985  15.268  62.802  1.00 35.58  ? 144 LEU H CA  1 
ATOM   7368 C  C   . LEU H  1 85  ? 94.080  14.681  61.937  1.00 35.98  ? 144 LEU H C   1 
ATOM   7369 O  O   . LEU H  1 85  ? 94.095  13.474  61.695  1.00 36.77  ? 144 LEU H O   1 
ATOM   7370 C  CB  . LEU H  1 85  ? 93.274  14.877  64.253  1.00 35.73  ? 144 LEU H CB  1 
ATOM   7371 C  CG  . LEU H  1 85  ? 94.598  15.278  64.916  1.00 35.98  ? 144 LEU H CG  1 
ATOM   7372 C  CD1 . LEU H  1 85  ? 94.674  16.776  65.051  1.00 34.66  ? 144 LEU H CD1 1 
ATOM   7373 C  CD2 . LEU H  1 85  ? 94.712  14.606  66.302  1.00 34.68  ? 144 LEU H CD2 1 
ATOM   7374 N  N   . THR H  1 86  ? 94.987  15.543  61.480  1.00 35.96  ? 145 THR H N   1 
ATOM   7375 C  CA  . THR H  1 86  ? 96.087  15.141  60.596  1.00 36.33  ? 145 THR H CA  1 
ATOM   7376 C  C   . THR H  1 86  ? 97.414  15.477  61.233  1.00 36.77  ? 145 THR H C   1 
ATOM   7377 O  O   . THR H  1 86  ? 97.506  16.204  62.222  1.00 36.36  ? 145 THR H O   1 
ATOM   7378 C  CB  . THR H  1 86  ? 96.043  15.876  59.216  1.00 36.61  ? 145 THR H CB  1 
ATOM   7379 O  OG1 . THR H  1 86  ? 96.483  17.242  59.347  1.00 35.56  ? 145 THR H OG1 1 
ATOM   7380 C  CG2 . THR H  1 86  ? 94.655  15.844  58.629  1.00 35.26  ? 145 THR H CG2 1 
ATOM   7381 N  N   . ASP H  1 87  ? 98.463  14.966  60.628  1.00 37.77  ? 146 ASP H N   1 
ATOM   7382 C  CA  . ASP H  1 87  ? 99.822  15.316  61.060  1.00 38.49  ? 146 ASP H CA  1 
ATOM   7383 C  C   . ASP H  1 87  ? 100.293 16.686  60.543  1.00 38.16  ? 146 ASP H C   1 
ATOM   7384 O  O   . ASP H  1 87  ? 101.473 17.003  60.651  1.00 38.92  ? 146 ASP H O   1 
ATOM   7385 C  CB  . ASP H  1 87  ? 100.799 14.230  60.633  1.00 39.33  ? 146 ASP H CB  1 
ATOM   7386 C  CG  . ASP H  1 87  ? 100.780 13.987  59.136  1.00 39.61  ? 146 ASP H CG  1 
ATOM   7387 O  OD1 . ASP H  1 87  ? 101.271 12.913  58.733  1.00 40.38  ? 146 ASP H OD1 1 
ATOM   7388 O  OD2 . ASP H  1 87  ? 100.283 14.853  58.376  1.00 36.36  ? 146 ASP H OD2 1 
ATOM   7389 N  N   . ARG H  1 88  ? 99.382  17.480  59.988  1.00 37.28  ? 147 ARG H N   1 
ATOM   7390 C  CA  . ARG H  1 88  ? 99.665  18.873  59.641  1.00 37.49  ? 147 ARG H CA  1 
ATOM   7391 C  C   . ARG H  1 88  ? 98.589  19.802  60.239  1.00 37.29  ? 147 ARG H C   1 
ATOM   7392 O  O   . ARG H  1 88  ? 98.447  20.953  59.849  1.00 37.51  ? 147 ARG H O   1 
ATOM   7393 C  CB  . ARG H  1 88  ? 99.718  19.040  58.117  1.00 37.43  ? 147 ARG H CB  1 
ATOM   7394 C  CG  . ARG H  1 88  ? 100.758 18.191  57.435  1.00 37.71  ? 147 ARG H CG  1 
ATOM   7395 C  CD  . ARG H  1 88  ? 102.141 18.782  57.569  1.00 38.69  ? 147 ARG H CD  1 
ATOM   7396 N  NE  . ARG H  1 88  ? 103.147 17.984  56.874  1.00 39.57  ? 147 ARG H NE  1 
ATOM   7397 C  CZ  . ARG H  1 88  ? 103.816 16.959  57.380  1.00 39.78  ? 147 ARG H CZ  1 
ATOM   7398 N  NH1 . ARG H  1 88  ? 103.618 16.570  58.622  1.00 41.24  ? 147 ARG H NH1 1 
ATOM   7399 N  NH2 . ARG H  1 88  ? 104.694 16.309  56.634  1.00 41.62  ? 147 ARG H NH2 1 
ATOM   7400 N  N   . SER H  1 89  ? 97.840  19.299  61.199  1.00 36.81  ? 148 SER H N   1 
ATOM   7401 C  CA  . SER H  1 89  ? 96.765  20.049  61.777  1.00 36.60  ? 148 SER H CA  1 
ATOM   7402 C  C   . SER H  1 89  ? 97.228  20.959  62.903  1.00 37.00  ? 148 SER H C   1 
ATOM   7403 O  O   . SER H  1 89  ? 98.073  20.602  63.702  1.00 37.04  ? 148 SER H O   1 
ATOM   7404 C  CB  . SER H  1 89  ? 95.710  19.070  62.294  1.00 35.97  ? 148 SER H CB  1 
ATOM   7405 O  OG  . SER H  1 89  ? 95.177  18.334  61.209  1.00 36.06  ? 148 SER H OG  1 
ATOM   7406 N  N   . ARG H  1 90  ? 96.639  22.139  62.969  1.00 37.49  ? 149 ARG H N   1 
ATOM   7407 C  CA  . ARG H  1 90  ? 96.728  22.987  64.144  1.00 38.81  ? 149 ARG H CA  1 
ATOM   7408 C  C   . ARG H  1 90  ? 95.437  23.761  64.275  1.00 39.13  ? 149 ARG H C   1 
ATOM   7409 O  O   . ARG H  1 90  ? 94.622  23.802  63.343  1.00 38.36  ? 149 ARG H O   1 
ATOM   7410 C  CB  . ARG H  1 90  ? 97.875  23.989  64.019  1.00 40.32  ? 149 ARG H CB  1 
ATOM   7411 C  CG  . ARG H  1 90  ? 99.295  23.403  64.011  1.00 40.86  ? 149 ARG H CG  1 
ATOM   7412 C  CD  . ARG H  1 90  ? 99.671  22.776  65.327  1.00 41.50  ? 149 ARG H CD  1 
ATOM   7413 N  NE  . ARG H  1 90  ? 99.648  23.751  66.403  1.00 42.98  ? 149 ARG H NE  1 
ATOM   7414 C  CZ  . ARG H  1 90  ? 100.691 24.470  66.813  1.00 45.23  ? 149 ARG H CZ  1 
ATOM   7415 N  NH1 . ARG H  1 90  ? 101.894 24.336  66.258  1.00 45.33  ? 149 ARG H NH1 1 
ATOM   7416 N  NH2 . ARG H  1 90  ? 100.529 25.336  67.808  1.00 46.64  ? 149 ARG H NH2 1 
ATOM   7417 N  N   . LEU H  1 91  ? 95.263  24.402  65.423  1.00 40.42  ? 150 LEU H N   1 
ATOM   7418 C  CA  . LEU H  1 91  ? 94.075  25.192  65.672  1.00 41.16  ? 150 LEU H CA  1 
ATOM   7419 C  C   . LEU H  1 91  ? 94.391  26.581  65.205  1.00 42.70  ? 150 LEU H C   1 
ATOM   7420 O  O   . LEU H  1 91  ? 95.222  27.261  65.816  1.00 44.42  ? 150 LEU H O   1 
ATOM   7421 C  CB  . LEU H  1 91  ? 93.697  25.151  67.158  1.00 41.94  ? 150 LEU H CB  1 
ATOM   7422 C  CG  . LEU H  1 91  ? 93.203  23.772  67.645  1.00 40.87  ? 150 LEU H CG  1 
ATOM   7423 C  CD1 . LEU H  1 91  ? 92.670  23.813  69.078  1.00 40.77  ? 150 LEU H CD1 1 
ATOM   7424 C  CD2 . LEU H  1 91  ? 92.170  23.190  66.699  1.00 38.81  ? 150 LEU H CD2 1 
ATOM   7425 N  N   . GLY H  1 92  ? 93.728  27.005  64.129  1.00 42.65  ? 151 GLY H N   1 
ATOM   7426 C  CA  . GLY H  1 92  ? 94.091  28.230  63.427  1.00 44.40  ? 151 GLY H CA  1 
ATOM   7427 C  C   . GLY H  1 92  ? 94.110  29.476  64.295  1.00 46.99  ? 151 GLY H C   1 
ATOM   7428 O  O   . GLY H  1 92  ? 94.691  30.520  63.969  1.00 48.73  ? 151 GLY H O   1 
ATOM   7429 N  N   . CYS H  1 93  ? 93.475  29.358  65.433  1.00 47.55  ? 152 CYS H N   1 
ATOM   7430 C  CA  . CYS H  1 93  ? 93.310  30.505  66.276  1.00 50.68  ? 152 CYS H CA  1 
ATOM   7431 C  C   . CYS H  1 93  ? 94.467  30.665  67.264  1.00 51.49  ? 152 CYS H C   1 
ATOM   7432 O  O   . CYS H  1 93  ? 94.572  31.677  67.951  1.00 53.50  ? 152 CYS H O   1 
ATOM   7433 C  CB  . CYS H  1 93  ? 91.969  30.436  66.985  1.00 51.26  ? 152 CYS H CB  1 
ATOM   7434 S  SG  . CYS H  1 93  ? 91.866  29.341  68.512  1.00 53.99  ? 152 CYS H SG  1 
ATOM   7435 N  N   . GLN H  1 94  ? 95.345  29.673  67.318  1.00 49.79  ? 153 GLN H N   1 
ATOM   7436 C  CA  . GLN H  1 94  ? 96.591  29.810  68.052  1.00 51.05  ? 153 GLN H CA  1 
ATOM   7437 C  C   . GLN H  1 94  ? 97.770  30.156  67.137  1.00 51.02  ? 153 GLN H C   1 
ATOM   7438 O  O   . GLN H  1 94  ? 98.847  30.477  67.628  1.00 52.51  ? 153 GLN H O   1 
ATOM   7439 C  CB  . GLN H  1 94  ? 96.875  28.516  68.805  1.00 49.68  ? 153 GLN H CB  1 
ATOM   7440 C  CG  . GLN H  1 94  ? 95.807  28.182  69.810  1.00 50.11  ? 153 GLN H CG  1 
ATOM   7441 C  CD  . GLN H  1 94  ? 95.670  29.270  70.851  1.00 52.90  ? 153 GLN H CD  1 
ATOM   7442 O  OE1 . GLN H  1 94  ? 96.640  29.608  71.534  1.00 54.51  ? 153 GLN H OE1 1 
ATOM   7443 N  NE2 . GLN H  1 94  ? 94.459  29.824  70.981  1.00 53.73  ? 153 GLN H NE2 1 
ATOM   7444 N  N   . ILE H  1 95  ? 97.555  30.106  65.821  1.00 49.53  ? 154 ILE H N   1 
ATOM   7445 C  CA  . ILE H  1 95  ? 98.614  30.321  64.848  1.00 49.28  ? 154 ILE H CA  1 
ATOM   7446 C  C   . ILE H  1 95  ? 98.579  31.736  64.332  1.00 51.72  ? 154 ILE H C   1 
ATOM   7447 O  O   . ILE H  1 95  ? 97.601  32.143  63.700  1.00 52.32  ? 154 ILE H O   1 
ATOM   7448 C  CB  . ILE H  1 95  ? 98.468  29.365  63.682  1.00 46.90  ? 154 ILE H CB  1 
ATOM   7449 C  CG1 . ILE H  1 95  ? 98.495  27.921  64.209  1.00 45.33  ? 154 ILE H CG1 1 
ATOM   7450 C  CG2 . ILE H  1 95  ? 99.518  29.620  62.645  1.00 45.48  ? 154 ILE H CG2 1 
ATOM   7451 C  CD1 . ILE H  1 95  ? 99.557  27.649  65.266  1.00 45.88  ? 154 ILE H CD1 1 
ATOM   7452 N  N   . CYS H  1 96  ? 99.650  32.478  64.618  1.00 53.48  ? 155 CYS H N   1 
ATOM   7453 C  CA  . CYS H  1 96  ? 99.779  33.874  64.226  1.00 56.06  ? 155 CYS H CA  1 
ATOM   7454 C  C   . CYS H  1 96  ? 100.616 34.077  62.964  1.00 55.28  ? 155 CYS H C   1 
ATOM   7455 O  O   . CYS H  1 96  ? 101.650 33.424  62.766  1.00 54.19  ? 155 CYS H O   1 
ATOM   7456 C  CB  . CYS H  1 96  ? 100.392 34.667  65.374  1.00 59.28  ? 155 CYS H CB  1 
ATOM   7457 S  SG  . CYS H  1 96  ? 99.180  35.052  66.683  1.00 64.59  ? 155 CYS H SG  1 
ATOM   7458 N  N   . LEU H  1 97  ? 100.176 35.005  62.121  1.00 56.22  ? 156 LEU H N   1 
ATOM   7459 C  CA  . LEU H  1 97  ? 100.852 35.262  60.849  1.00 55.86  ? 156 LEU H CA  1 
ATOM   7460 C  C   . LEU H  1 97  ? 102.253 35.824  61.043  1.00 57.30  ? 156 LEU H C   1 
ATOM   7461 O  O   . LEU H  1 97  ? 102.456 36.782  61.797  1.00 59.93  ? 156 LEU H O   1 
ATOM   7462 C  CB  . LEU H  1 97  ? 100.043 36.227  59.976  1.00 57.20  ? 156 LEU H CB  1 
ATOM   7463 C  CG  . LEU H  1 97  ? 98.704  35.733  59.447  1.00 55.95  ? 156 LEU H CG  1 
ATOM   7464 C  CD1 . LEU H  1 97  ? 98.037  36.811  58.631  1.00 56.89  ? 156 LEU H CD1 1 
ATOM   7465 C  CD2 . LEU H  1 97  ? 98.902  34.442  58.624  1.00 53.17  ? 156 LEU H CD2 1 
ATOM   7466 N  N   . THR H  1 98  ? 103.215 35.212  60.361  1.00 55.79  ? 157 THR H N   1 
ATOM   7467 C  CA  . THR H  1 98  ? 104.562 35.747  60.295  1.00 57.33  ? 157 THR H CA  1 
ATOM   7468 C  C   . THR H  1 98  ? 104.858 36.108  58.859  1.00 57.09  ? 157 THR H C   1 
ATOM   7469 O  O   . THR H  1 98  ? 104.218 35.585  57.945  1.00 55.26  ? 157 THR H O   1 
ATOM   7470 C  CB  . THR H  1 98  ? 105.600 34.730  60.753  1.00 56.33  ? 157 THR H CB  1 
ATOM   7471 O  OG1 . THR H  1 98  ? 105.513 33.581  59.901  1.00 54.12  ? 157 THR H OG1 1 
ATOM   7472 C  CG2 . THR H  1 98  ? 105.362 34.334  62.224  1.00 56.48  ? 157 THR H CG2 1 
ATOM   7473 N  N   . LYS H  1 99  ? 105.843 36.988  58.672  1.00 59.18  ? 158 LYS H N   1 
ATOM   7474 C  CA  . LYS H  1 99  ? 106.232 37.460  57.345  1.00 59.37  ? 158 LYS H CA  1 
ATOM   7475 C  C   . LYS H  1 99  ? 106.542 36.300  56.383  1.00 56.71  ? 158 LYS H C   1 
ATOM   7476 O  O   . LYS H  1 99  ? 106.293 36.409  55.185  1.00 56.75  ? 158 LYS H O   1 
ATOM   7477 C  CB  . LYS H  1 99  ? 107.442 38.403  57.431  1.00 61.86  ? 158 LYS H CB  1 
ATOM   7478 C  CG  . LYS H  1 99  ? 107.392 39.613  56.455  1.00 64.55  ? 158 LYS H CG  1 
ATOM   7479 N  N   . SER H  1 100 ? 107.065 35.194  56.898  1.00 54.99  ? 159 SER H N   1 
ATOM   7480 C  CA  . SER H  1 100 ? 107.417 34.060  56.053  1.00 53.00  ? 159 SER H CA  1 
ATOM   7481 C  C   . SER H  1 100 ? 106.210 33.248  55.570  1.00 51.09  ? 159 SER H C   1 
ATOM   7482 O  O   . SER H  1 100 ? 106.376 32.324  54.777  1.00 49.41  ? 159 SER H O   1 
ATOM   7483 C  CB  . SER H  1 100 ? 108.343 33.134  56.819  1.00 52.60  ? 159 SER H CB  1 
ATOM   7484 O  OG  . SER H  1 100 ? 107.642 32.616  57.941  1.00 52.96  ? 159 SER H OG  1 
ATOM   7485 N  N   . MET H  1 101 ? 105.013 33.580  56.058  1.00 51.30  ? 160 MET H N   1 
ATOM   7486 C  CA  . MET H  1 101 ? 103.781 32.876  55.655  1.00 50.01  ? 160 MET H CA  1 
ATOM   7487 C  C   . MET H  1 101 ? 103.127 33.440  54.381  1.00 50.59  ? 160 MET H C   1 
ATOM   7488 O  O   . MET H  1 101 ? 102.124 32.920  53.898  1.00 49.80  ? 160 MET H O   1 
ATOM   7489 C  CB  . MET H  1 101 ? 102.741 32.886  56.800  1.00 50.10  ? 160 MET H CB  1 
ATOM   7490 C  CG  . MET H  1 101 ? 103.035 31.932  57.943  1.00 49.18  ? 160 MET H CG  1 
ATOM   7491 S  SD  . MET H  1 101 ? 101.877 32.144  59.313  1.00 51.85  ? 160 MET H SD  1 
ATOM   7492 C  CE  . MET H  1 101 ? 102.714 31.238  60.636  1.00 50.66  ? 160 MET H CE  1 
ATOM   7493 N  N   . ASP H  1 102 ? 103.680 34.505  53.831  1.00 52.41  ? 161 ASP H N   1 
ATOM   7494 C  CA  . ASP H  1 102 ? 103.077 35.125  52.647  1.00 53.40  ? 161 ASP H CA  1 
ATOM   7495 C  C   . ASP H  1 102 ? 102.823 34.103  51.530  1.00 51.71  ? 161 ASP H C   1 
ATOM   7496 O  O   . ASP H  1 102 ? 103.698 33.332  51.191  1.00 50.45  ? 161 ASP H O   1 
ATOM   7497 C  CB  . ASP H  1 102 ? 103.960 36.276  52.141  1.00 55.35  ? 161 ASP H CB  1 
ATOM   7498 C  CG  . ASP H  1 102 ? 103.213 37.224  51.194  1.00 57.70  ? 161 ASP H CG  1 
ATOM   7499 O  OD1 . ASP H  1 102 ? 102.085 37.649  51.511  1.00 58.25  ? 161 ASP H OD1 1 
ATOM   7500 O  OD2 . ASP H  1 102 ? 103.772 37.586  50.134  1.00 60.43  ? 161 ASP H OD2 1 
ATOM   7501 N  N   . ASN H  1 103 ? 101.611 34.107  50.981  1.00 52.15  ? 162 ASN H N   1 
ATOM   7502 C  CA  . ASN H  1 103 ? 101.184 33.173  49.926  1.00 51.31  ? 162 ASN H CA  1 
ATOM   7503 C  C   . ASN H  1 103 ? 101.101 31.694  50.322  1.00 48.94  ? 162 ASN H C   1 
ATOM   7504 O  O   . ASN H  1 103 ? 101.049 30.808  49.465  1.00 48.38  ? 162 ASN H O   1 
ATOM   7505 C  CB  . ASN H  1 103 ? 102.049 33.340  48.664  1.00 52.11  ? 162 ASN H CB  1 
ATOM   7506 C  CG  . ASN H  1 103 ? 101.697 34.565  47.901  1.00 54.82  ? 162 ASN H CG  1 
ATOM   7507 O  OD1 . ASN H  1 103 ? 100.552 34.738  47.456  1.00 55.54  ? 162 ASN H OD1 1 
ATOM   7508 N  ND2 . ASN H  1 103 ? 102.681 35.439  47.726  1.00 55.65  ? 162 ASN H ND2 1 
ATOM   7509 N  N   . MET H  1 104 ? 101.047 31.413  51.616  1.00 48.03  ? 163 MET H N   1 
ATOM   7510 C  CA  . MET H  1 104 ? 100.773 30.049  52.049  1.00 46.09  ? 163 MET H CA  1 
ATOM   7511 C  C   . MET H  1 104 ? 99.329  29.691  51.771  1.00 46.17  ? 163 MET H C   1 
ATOM   7512 O  O   . MET H  1 104 ? 98.475  30.551  51.667  1.00 47.43  ? 163 MET H O   1 
ATOM   7513 C  CB  . MET H  1 104 ? 101.064 29.872  53.529  1.00 45.19  ? 163 MET H CB  1 
ATOM   7514 C  CG  . MET H  1 104 ? 100.111 30.592  54.444  1.00 46.16  ? 163 MET H CG  1 
ATOM   7515 S  SD  . MET H  1 104 ? 100.311 30.105  56.159  1.00 46.85  ? 163 MET H SD  1 
ATOM   7516 C  CE  . MET H  1 104 ? 98.956  30.933  56.923  1.00 46.01  ? 163 MET H CE  1 
ATOM   7517 N  N   . THR H  1 105 ? 99.066  28.397  51.683  1.00 45.36  ? 164 THR H N   1 
ATOM   7518 C  CA  . THR H  1 105 ? 97.721  27.852  51.537  1.00 44.87  ? 164 THR H CA  1 
ATOM   7519 C  C   . THR H  1 105 ? 97.433  27.002  52.742  1.00 43.19  ? 164 THR H C   1 
ATOM   7520 O  O   . THR H  1 105 ? 98.239  26.165  53.110  1.00 42.00  ? 164 THR H O   1 
ATOM   7521 C  CB  . THR H  1 105 ? 97.636  26.991  50.273  1.00 45.06  ? 164 THR H CB  1 
ATOM   7522 O  OG1 . THR H  1 105 ? 98.089  27.774  49.160  1.00 46.54  ? 164 THR H OG1 1 
ATOM   7523 C  CG2 . THR H  1 105 ? 96.222  26.492  50.047  1.00 44.98  ? 164 THR H CG2 1 
ATOM   7524 N  N   . VAL H  1 106 ? 96.294  27.244  53.376  1.00 43.59  ? 165 VAL H N   1 
ATOM   7525 C  CA  . VAL H  1 106 ? 95.789  26.371  54.441  1.00 42.03  ? 165 VAL H CA  1 
ATOM   7526 C  C   . VAL H  1 106 ? 94.495  25.790  53.952  1.00 42.03  ? 165 VAL H C   1 
ATOM   7527 O  O   . VAL H  1 106 ? 93.775  26.443  53.218  1.00 43.53  ? 165 VAL H O   1 
ATOM   7528 C  CB  . VAL H  1 106 ? 95.519  27.147  55.751  1.00 42.44  ? 165 VAL H CB  1 
ATOM   7529 C  CG1 . VAL H  1 106 ? 96.833  27.686  56.320  1.00 42.52  ? 165 VAL H CG1 1 
ATOM   7530 C  CG2 . VAL H  1 106 ? 94.534  28.253  55.512  1.00 43.42  ? 165 VAL H CG2 1 
ATOM   7531 N  N   . ARG H  1 107 ? 94.178  24.575  54.373  1.00 41.00  ? 166 ARG H N   1 
ATOM   7532 C  CA  . ARG H  1 107 ? 92.900  23.957  54.015  1.00 41.34  ? 166 ARG H CA  1 
ATOM   7533 C  C   . ARG H  1 107 ? 91.981  23.806  55.215  1.00 40.54  ? 166 ARG H C   1 
ATOM   7534 O  O   . ARG H  1 107 ? 92.444  23.433  56.284  1.00 39.52  ? 166 ARG H O   1 
ATOM   7535 C  CB  . ARG H  1 107 ? 93.112  22.611  53.349  1.00 40.72  ? 166 ARG H CB  1 
ATOM   7536 C  CG  . ARG H  1 107 ? 91.794  21.949  52.988  1.00 41.76  ? 166 ARG H CG  1 
ATOM   7537 C  CD  . ARG H  1 107 ? 91.966  20.910  51.898  1.00 42.64  ? 166 ARG H CD  1 
ATOM   7538 N  NE  . ARG H  1 107 ? 92.678  19.747  52.382  1.00 41.95  ? 166 ARG H NE  1 
ATOM   7539 C  CZ  . ARG H  1 107 ? 92.156  18.804  53.181  1.00 41.48  ? 166 ARG H CZ  1 
ATOM   7540 N  NH1 . ARG H  1 107 ? 92.911  17.778  53.594  1.00 41.08  ? 166 ARG H NH1 1 
ATOM   7541 N  NH2 . ARG H  1 107 ? 90.895  18.869  53.580  1.00 41.15  ? 166 ARG H NH2 1 
ATOM   7542 N  N   . VAL H  1 108 ? 90.703  24.145  55.024  1.00 41.66  ? 167 VAL H N   1 
ATOM   7543 C  CA  . VAL H  1 108 ? 89.662  23.933  56.016  1.00 41.44  ? 167 VAL H CA  1 
ATOM   7544 C  C   . VAL H  1 108 ? 89.145  22.525  55.803  1.00 40.99  ? 167 VAL H C   1 
ATOM   7545 O  O   . VAL H  1 108 ? 88.541  22.219  54.755  1.00 42.21  ? 167 VAL H O   1 
ATOM   7546 C  CB  . VAL H  1 108 ? 88.479  24.909  55.853  1.00 43.38  ? 167 VAL H CB  1 
ATOM   7547 C  CG1 . VAL H  1 108 ? 87.613  24.887  57.088  1.00 42.54  ? 167 VAL H CG1 1 
ATOM   7548 C  CG2 . VAL H  1 108 ? 88.990  26.331  55.555  1.00 44.22  ? 167 VAL H CG2 1 
ATOM   7549 N  N   . PRO H  1 109 ? 89.371  21.654  56.791  1.00 39.48  ? 168 PRO H N   1 
ATOM   7550 C  CA  . PRO H  1 109 ? 88.933  20.275  56.685  1.00 38.96  ? 168 PRO H CA  1 
ATOM   7551 C  C   . PRO H  1 109 ? 87.445  20.125  56.984  1.00 39.37  ? 168 PRO H C   1 
ATOM   7552 O  O   . PRO H  1 109 ? 86.853  20.979  57.668  1.00 38.92  ? 168 PRO H O   1 
ATOM   7553 C  CB  . PRO H  1 109 ? 89.738  19.586  57.769  1.00 37.64  ? 168 PRO H CB  1 
ATOM   7554 C  CG  . PRO H  1 109 ? 89.939  20.620  58.813  1.00 37.43  ? 168 PRO H CG  1 
ATOM   7555 C  CD  . PRO H  1 109 ? 89.897  21.961  58.133  1.00 38.65  ? 168 PRO H CD  1 
ATOM   7556 N  N   . GLU H  1 110 ? 86.858  19.034  56.491  1.00 39.74  ? 169 GLU H N   1 
ATOM   7557 C  CA  . GLU H  1 110 ? 85.432  18.773  56.678  1.00 40.48  ? 169 GLU H CA  1 
ATOM   7558 C  C   . GLU H  1 110 ? 85.127  18.532  58.157  1.00 38.97  ? 169 GLU H C   1 
ATOM   7559 O  O   . GLU H  1 110 ? 85.975  18.046  58.903  1.00 37.18  ? 169 GLU H O   1 
ATOM   7560 C  CB  . GLU H  1 110 ? 84.951  17.583  55.808  1.00 41.55  ? 169 GLU H CB  1 
ATOM   7561 C  CG  . GLU H  1 110 ? 85.427  16.206  56.261  1.00 41.21  ? 169 GLU H CG  1 
ATOM   7562 C  CD  . GLU H  1 110 ? 84.774  15.014  55.527  1.00 44.58  ? 169 GLU H CD  1 
ATOM   7563 O  OE1 . GLU H  1 110 ? 85.313  13.880  55.716  1.00 44.77  ? 169 GLU H OE1 1 
ATOM   7564 O  OE2 . GLU H  1 110 ? 83.762  15.186  54.796  1.00 46.24  ? 169 GLU H OE2 1 
ATOM   7565 N  N   . THR H  1 111 ? 83.903  18.865  58.558  1.00 39.77  ? 170 THR H N   1 
ATOM   7566 C  CA  . THR H  1 111 ? 83.454  18.638  59.912  1.00 38.84  ? 170 THR H CA  1 
ATOM   7567 C  C   . THR H  1 111 ? 82.826  17.265  60.026  1.00 38.33  ? 170 THR H C   1 
ATOM   7568 O  O   . THR H  1 111 ? 82.562  16.616  59.012  1.00 38.94  ? 170 THR H O   1 
ATOM   7569 C  CB  . THR H  1 111 ? 82.405  19.653  60.350  1.00 39.81  ? 170 THR H CB  1 
ATOM   7570 O  OG1 . THR H  1 111 ? 81.185  19.402  59.651  1.00 41.74  ? 170 THR H OG1 1 
ATOM   7571 C  CG2 . THR H  1 111 ? 82.887  21.057  60.115  1.00 39.52  ? 170 THR H CG2 1 
ATOM   7572 N  N   . VAL H  1 112 ? 82.591  16.848  61.272  1.00 37.10  ? 171 VAL H N   1 
ATOM   7573 C  CA  . VAL H  1 112 ? 81.915  15.608  61.535  1.00 36.71  ? 171 VAL H CA  1 
ATOM   7574 C  C   . VAL H  1 112 ? 80.549  15.637  60.868  1.00 38.16  ? 171 VAL H C   1 
ATOM   7575 O  O   . VAL H  1 112 ? 80.104  14.633  60.297  1.00 38.69  ? 171 VAL H O   1 
ATOM   7576 C  CB  . VAL H  1 112 ? 81.807  15.282  63.048  1.00 35.74  ? 171 VAL H CB  1 
ATOM   7577 C  CG1 . VAL H  1 112 ? 80.895  16.236  63.788  1.00 35.37  ? 171 VAL H CG1 1 
ATOM   7578 C  CG2 . VAL H  1 112 ? 81.340  13.836  63.209  1.00 34.40  ? 171 VAL H CG2 1 
ATOM   7579 N  N   . ALA H  1 113 ? 79.907  16.797  60.883  1.00 39.17  ? 172 ALA H N   1 
ATOM   7580 C  CA  . ALA H  1 113 ? 78.589  16.914  60.294  1.00 41.84  ? 172 ALA H CA  1 
ATOM   7581 C  C   . ALA H  1 113 ? 78.628  16.798  58.777  1.00 44.21  ? 172 ALA H C   1 
ATOM   7582 O  O   . ALA H  1 113 ? 77.750  16.180  58.191  1.00 46.72  ? 172 ALA H O   1 
ATOM   7583 C  CB  . ALA H  1 113 ? 77.907  18.206  60.713  1.00 42.71  ? 172 ALA H CB  1 
ATOM   7584 N  N   . ASP H  1 114 ? 79.619  17.376  58.114  1.00 44.60  ? 173 ASP H N   1 
ATOM   7585 C  CA  . ASP H  1 114 ? 79.712  17.165  56.666  1.00 46.68  ? 173 ASP H CA  1 
ATOM   7586 C  C   . ASP H  1 114 ? 79.888  15.678  56.356  1.00 46.66  ? 173 ASP H C   1 
ATOM   7587 O  O   . ASP H  1 114 ? 79.322  15.164  55.397  1.00 49.72  ? 173 ASP H O   1 
ATOM   7588 C  CB  . ASP H  1 114 ? 80.855  17.965  56.031  1.00 46.66  ? 173 ASP H CB  1 
ATOM   7589 C  CG  . ASP H  1 114 ? 80.718  19.463  56.251  1.00 48.04  ? 173 ASP H CG  1 
ATOM   7590 O  OD1 . ASP H  1 114 ? 79.601  20.003  56.109  1.00 49.36  ? 173 ASP H OD1 1 
ATOM   7591 O  OD2 . ASP H  1 114 ? 81.738  20.101  56.588  1.00 48.58  ? 173 ASP H OD2 1 
ATOM   7592 N  N   . ALA H  1 115 ? 80.661  14.985  57.175  1.00 44.75  ? 174 ALA H N   1 
ATOM   7593 C  CA  . ALA H  1 115 ? 80.968  13.580  56.929  1.00 44.76  ? 174 ALA H CA  1 
ATOM   7594 C  C   . ALA H  1 115 ? 79.751  12.723  57.142  1.00 46.02  ? 174 ALA H C   1 
ATOM   7595 O  O   . ALA H  1 115 ? 79.537  11.774  56.413  1.00 47.37  ? 174 ALA H O   1 
ATOM   7596 C  CB  . ALA H  1 115 ? 82.071  13.119  57.866  1.00 42.47  ? 174 ALA H CB  1 
ATOM   7597 N  N   . ARG H  1 116 ? 78.982  13.066  58.176  1.00 45.69  ? 175 ARG H N   1 
ATOM   7598 C  CA  . ARG H  1 116 ? 77.909  12.231  58.684  1.00 46.25  ? 175 ARG H CA  1 
ATOM   7599 C  C   . ARG H  1 116 ? 76.886  11.881  57.603  1.00 49.40  ? 175 ARG H C   1 
ATOM   7600 O  O   . ARG H  1 116 ? 76.523  12.733  56.788  1.00 50.81  ? 175 ARG H O   1 
ATOM   7601 C  CB  . ARG H  1 116 ? 77.224  12.955  59.850  1.00 45.33  ? 175 ARG H CB  1 
ATOM   7602 C  CG  . ARG H  1 116 ? 76.025  12.232  60.438  1.00 44.86  ? 175 ARG H CG  1 
ATOM   7603 C  CD  . ARG H  1 116 ? 75.426  13.004  61.605  1.00 44.57  ? 175 ARG H CD  1 
ATOM   7604 N  NE  . ARG H  1 116 ? 76.403  13.338  62.646  1.00 42.70  ? 175 ARG H NE  1 
ATOM   7605 C  CZ  . ARG H  1 116 ? 76.606  14.555  63.163  1.00 43.17  ? 175 ARG H CZ  1 
ATOM   7606 N  NH1 . ARG H  1 116 ? 77.541  14.724  64.103  1.00 41.81  ? 175 ARG H NH1 1 
ATOM   7607 N  NH2 . ARG H  1 116 ? 75.881  15.609  62.768  1.00 44.58  ? 175 ARG H NH2 1 
ATOM   7608 N  N   . GLN H  1 117 ? 76.444  10.626  57.603  1.00 50.58  ? 176 GLN H N   1 
ATOM   7609 C  CA  . GLN H  1 117 ? 75.416  10.150  56.672  1.00 54.28  ? 176 GLN H CA  1 
ATOM   7610 C  C   . GLN H  1 117 ? 74.087  9.830   57.360  1.00 54.44  ? 176 GLN H C   1 
ATOM   7611 O  O   . GLN H  1 117 ? 73.043  9.803   56.716  1.00 56.79  ? 176 GLN H O   1 
ATOM   7612 C  CB  . GLN H  1 117 ? 75.926  8.911   55.929  1.00 56.22  ? 176 GLN H CB  1 
ATOM   7613 C  CG  . GLN H  1 117 ? 77.346  9.108   55.368  1.00 58.27  ? 176 GLN H CG  1 
ATOM   7614 C  CD  . GLN H  1 117 ? 77.548  8.617   53.921  1.00 64.37  ? 176 GLN H CD  1 
ATOM   7615 O  OE1 . GLN H  1 117 ? 76.594  8.512   53.131  1.00 68.76  ? 176 GLN H OE1 1 
ATOM   7616 N  NE2 . GLN H  1 117 ? 78.819  8.360   53.561  1.00 65.97  ? 176 GLN H NE2 1 
ATOM   7617 N  N   . SER H  1 118 ? 74.143  9.573   58.665  1.00 51.90  ? 177 SER H N   1 
ATOM   7618 C  CA  . SER H  1 118 ? 72.957  9.343   59.462  1.00 51.91  ? 177 SER H CA  1 
ATOM   7619 C  C   . SER H  1 118 ? 73.256  9.592   60.936  1.00 48.68  ? 177 SER H C   1 
ATOM   7620 O  O   . SER H  1 118 ? 74.375  9.439   61.402  1.00 46.33  ? 177 SER H O   1 
ATOM   7621 C  CB  . SER H  1 118 ? 72.467  7.912   59.267  1.00 53.45  ? 177 SER H CB  1 
ATOM   7622 O  OG  . SER H  1 118 ? 73.526  7.003   59.525  1.00 53.27  ? 177 SER H OG  1 
ATOM   7623 N  N   . ILE H  1 119 ? 72.231  10.003  61.659  1.00 48.69  ? 178 ILE H N   1 
ATOM   7624 C  CA  . ILE H  1 119 ? 72.297  10.157  63.105  1.00 45.96  ? 178 ILE H CA  1 
ATOM   7625 C  C   . ILE H  1 119 ? 72.081  8.743   63.610  1.00 45.61  ? 178 ILE H C   1 
ATOM   7626 O  O   . ILE H  1 119 ? 71.309  7.977   63.025  1.00 47.09  ? 178 ILE H O   1 
ATOM   7627 C  CB  . ILE H  1 119 ? 71.198  11.153  63.603  1.00 46.74  ? 178 ILE H CB  1 
ATOM   7628 C  CG1 . ILE H  1 119 ? 71.475  12.539  62.968  1.00 46.83  ? 178 ILE H CG1 1 
ATOM   7629 C  CG2 . ILE H  1 119 ? 71.137  11.224  65.130  1.00 42.47  ? 178 ILE H CG2 1 
ATOM   7630 C  CD1 . ILE H  1 119 ? 70.437  13.627  63.253  1.00 47.44  ? 178 ILE H CD1 1 
ATOM   7631 N  N   . ASP H  1 120 ? 72.807  8.385   64.658  1.00 43.14  ? 179 ASP H N   1 
ATOM   7632 C  CA  . ASP H  1 120 ? 72.728  7.053   65.208  1.00 42.58  ? 179 ASP H CA  1 
ATOM   7633 C  C   . ASP H  1 120 ? 71.520  6.892   66.119  1.00 41.57  ? 179 ASP H C   1 
ATOM   7634 O  O   . ASP H  1 120 ? 71.025  7.861   66.698  1.00 39.94  ? 179 ASP H O   1 
ATOM   7635 C  CB  . ASP H  1 120 ? 73.962  6.800   66.048  1.00 41.74  ? 179 ASP H CB  1 
ATOM   7636 C  CG  . ASP H  1 120 ? 75.199  6.499   65.230  1.00 44.38  ? 179 ASP H CG  1 
ATOM   7637 O  OD1 . ASP H  1 120 ? 75.103  6.099   64.036  1.00 48.79  ? 179 ASP H OD1 1 
ATOM   7638 O  OD2 . ASP H  1 120 ? 76.292  6.649   65.818  1.00 47.60  ? 179 ASP H OD2 1 
ATOM   7639 N  N   . VAL H  1 121 ? 71.081  5.648   66.272  1.00 41.48  ? 180 VAL H N   1 
ATOM   7640 C  CA  . VAL H  1 121 ? 70.107  5.303   67.301  1.00 41.26  ? 180 VAL H CA  1 
ATOM   7641 C  C   . VAL H  1 121 ? 70.738  5.491   68.681  1.00 39.71  ? 180 VAL H C   1 
ATOM   7642 O  O   . VAL H  1 121 ? 71.700  4.826   68.989  1.00 39.46  ? 180 VAL H O   1 
ATOM   7643 C  CB  . VAL H  1 121 ? 69.672  3.834   67.191  1.00 42.32  ? 180 VAL H CB  1 
ATOM   7644 C  CG1 . VAL H  1 121 ? 68.907  3.405   68.448  1.00 41.45  ? 180 VAL H CG1 1 
ATOM   7645 C  CG2 . VAL H  1 121 ? 68.840  3.592   65.947  1.00 43.44  ? 180 VAL H CG2 1 
ATOM   7646 N  N   . GLY H  1 122 ? 70.215  6.388   69.508  1.00 39.56  ? 181 GLY H N   1 
ATOM   7647 C  CA  . GLY H  1 122 ? 70.758  6.579   70.851  1.00 38.73  ? 181 GLY H CA  1 
ATOM   7648 C  C   . GLY H  1 122 ? 70.229  5.525   71.803  1.00 39.66  ? 181 GLY H C   1 
ATOM   7649 O  O   . GLY H  1 122 ? 69.041  5.252   71.804  1.00 40.61  ? 181 GLY H O   1 
ATOM   7650 N  N   . LYS H  1 123 ? 71.083  4.900   72.603  1.00 40.19  ? 182 LYS H N   1 
ATOM   7651 C  CA  . LYS H  1 123 ? 70.575  3.982   73.667  1.00 41.39  ? 182 LYS H CA  1 
ATOM   7652 C  C   . LYS H  1 123 ? 71.299  4.160   75.005  1.00 40.85  ? 182 LYS H C   1 
ATOM   7653 O  O   . LYS H  1 123 ? 72.507  4.375   75.048  1.00 39.78  ? 182 LYS H O   1 
ATOM   7654 C  CB  . LYS H  1 123 ? 70.662  2.509   73.225  1.00 42.28  ? 182 LYS H CB  1 
ATOM   7655 C  CG  . LYS H  1 123 ? 72.047  1.934   73.253  1.00 42.46  ? 182 LYS H CG  1 
ATOM   7656 C  CD  . LYS H  1 123 ? 72.266  0.852   72.200  1.00 45.66  ? 182 LYS H CD  1 
ATOM   7657 C  CE  . LYS H  1 123 ? 73.768  0.722   71.897  1.00 47.32  ? 182 LYS H CE  1 
ATOM   7658 N  NZ  . LYS H  1 123 ? 74.131  -0.158  70.725  1.00 49.00  ? 182 LYS H NZ  1 
ATOM   7659 N  N   . THR H  1 124 ? 70.552  4.086   76.098  1.00 41.51  ? 183 THR H N   1 
ATOM   7660 C  CA  . THR H  1 124 ? 71.175  4.139   77.404  1.00 41.79  ? 183 THR H CA  1 
ATOM   7661 C  C   . THR H  1 124 ? 71.836  2.782   77.761  1.00 43.20  ? 183 THR H C   1 
ATOM   7662 O  O   . THR H  1 124 ? 72.922  2.740   78.379  1.00 43.40  ? 183 THR H O   1 
ATOM   7663 C  CB  . THR H  1 124 ? 70.167  4.474   78.423  1.00 41.70  ? 183 THR H CB  1 
ATOM   7664 O  OG1 . THR H  1 124 ? 69.398  5.552   77.931  1.00 42.42  ? 183 THR H OG1 1 
ATOM   7665 C  CG2 . THR H  1 124 ? 70.838  4.861   79.707  1.00 42.49  ? 183 THR H CG2 1 
ATOM   7666 N  N   . SER H  1 125 ? 71.210  1.689   77.315  1.00 43.84  ? 184 SER H N   1 
ATOM   7667 C  CA  . SER H  1 125 ? 71.619  0.351   77.714  1.00 44.88  ? 184 SER H CA  1 
ATOM   7668 C  C   . SER H  1 125 ? 71.089  -0.743  76.748  1.00 45.66  ? 184 SER H C   1 
ATOM   7669 O  O   . SER H  1 125 ? 70.370  -0.458  75.787  1.00 46.72  ? 184 SER H O   1 
ATOM   7670 C  CB  . SER H  1 125 ? 71.097  0.112   79.140  1.00 45.41  ? 184 SER H CB  1 
ATOM   7671 O  OG  . SER H  1 125 ? 69.771  0.636   79.301  1.00 45.15  ? 184 SER H OG  1 
ATOM   7672 N  N   . ALA H  1 126 ? 71.440  -1.991  77.016  1.00 45.80  ? 185 ALA H N   1 
ATOM   7673 C  CA  . ALA H  1 126 ? 70.866  -3.120  76.305  1.00 46.49  ? 185 ALA H CA  1 
ATOM   7674 C  C   . ALA H  1 126 ? 69.775  -3.744  77.185  1.00 46.33  ? 185 ALA H C   1 
ATOM   7675 O  O   . ALA H  1 126 ? 69.075  -3.043  77.909  1.00 45.27  ? 185 ALA H O   1 
ATOM   7676 C  CB  . ALA H  1 126 ? 71.965  -4.138  75.995  1.00 47.86  ? 185 ALA H CB  1 
ATOM   7677 N  N   . GLU H  1 127 ? 69.651  -5.060  77.157  1.00 47.48  ? 186 GLU H N   1 
ATOM   7678 C  CA  . GLU H  1 127 ? 68.689  -5.750  78.029  1.00 48.42  ? 186 GLU H CA  1 
ATOM   7679 C  C   . GLU H  1 127 ? 68.617  -5.137  79.427  1.00 46.75  ? 186 GLU H C   1 
ATOM   7680 O  O   . GLU H  1 127 ? 67.543  -4.909  79.934  1.00 46.28  ? 186 GLU H O   1 
ATOM   7681 C  CB  . GLU H  1 127 ? 69.020  -7.236  78.178  1.00 50.57  ? 186 GLU H CB  1 
ATOM   7682 C  CG  . GLU H  1 127 ? 69.242  -7.985  76.887  1.00 53.44  ? 186 GLU H CG  1 
ATOM   7683 C  CD  . GLU H  1 127 ? 70.686  -7.913  76.389  1.00 57.26  ? 186 GLU H CD  1 
ATOM   7684 O  OE1 . GLU H  1 127 ? 71.445  -6.989  76.804  1.00 56.92  ? 186 GLU H OE1 1 
ATOM   7685 O  OE2 . GLU H  1 127 ? 71.053  -8.785  75.561  1.00 60.26  ? 186 GLU H OE2 1 
ATOM   7686 N  N   . ASN H  1 128 ? 69.771  -4.878  80.032  1.00 46.14  ? 187 ASN H N   1 
ATOM   7687 C  CA  . ASN H  1 128 ? 69.823  -4.414  81.397  1.00 45.79  ? 187 ASN H CA  1 
ATOM   7688 C  C   . ASN H  1 128 ? 70.797  -3.278  81.635  1.00 44.84  ? 187 ASN H C   1 
ATOM   7689 O  O   . ASN H  1 128 ? 71.742  -3.081  80.895  1.00 45.75  ? 187 ASN H O   1 
ATOM   7690 C  CB  . ASN H  1 128 ? 70.158  -5.579  82.332  1.00 47.16  ? 187 ASN H CB  1 
ATOM   7691 C  CG  . ASN H  1 128 ? 68.942  -6.422  82.652  1.00 49.21  ? 187 ASN H CG  1 
ATOM   7692 O  OD1 . ASN H  1 128 ? 67.963  -5.940  83.251  1.00 52.19  ? 187 ASN H OD1 1 
ATOM   7693 N  ND2 . ASN H  1 128 ? 68.980  -7.674  82.252  1.00 49.40  ? 187 ASN H ND2 1 
ATOM   7694 N  N   . LEU H  1 129 ? 70.545  -2.540  82.702  1.00 44.29  ? 188 LEU H N   1 
ATOM   7695 C  CA  . LEU H  1 129 ? 71.398  -1.454  83.140  1.00 43.19  ? 188 LEU H CA  1 
ATOM   7696 C  C   . LEU H  1 129 ? 71.679  -1.748  84.612  1.00 43.02  ? 188 LEU H C   1 
ATOM   7697 O  O   . LEU H  1 129 ? 70.755  -2.102  85.339  1.00 43.11  ? 188 LEU H O   1 
ATOM   7698 C  CB  . LEU H  1 129 ? 70.606  -0.153  82.989  1.00 42.76  ? 188 LEU H CB  1 
ATOM   7699 C  CG  . LEU H  1 129 ? 71.269  1.222   82.892  1.00 43.53  ? 188 LEU H CG  1 
ATOM   7700 C  CD1 . LEU H  1 129 ? 70.149  2.229   82.653  1.00 45.31  ? 188 LEU H CD1 1 
ATOM   7701 C  CD2 . LEU H  1 129 ? 72.051  1.597   84.148  1.00 46.43  ? 188 LEU H CD2 1 
ATOM   7702 N  N   . TYR H  1 130 ? 72.930  -1.605  85.046  1.00 42.42  ? 189 TYR H N   1 
ATOM   7703 C  CA  . TYR H  1 130 ? 73.317  -1.939  86.424  1.00 43.03  ? 189 TYR H CA  1 
ATOM   7704 C  C   . TYR H  1 130 ? 73.618  -0.700  87.290  1.00 43.10  ? 189 TYR H C   1 
ATOM   7705 O  O   . TYR H  1 130 ? 74.410  0.156   86.910  1.00 42.68  ? 189 TYR H O   1 
ATOM   7706 C  CB  . TYR H  1 130 ? 74.516  -2.889  86.405  1.00 44.25  ? 189 TYR H CB  1 
ATOM   7707 C  CG  . TYR H  1 130 ? 74.282  -4.134  85.575  1.00 42.55  ? 189 TYR H CG  1 
ATOM   7708 C  CD1 . TYR H  1 130 ? 73.500  -5.172  86.050  1.00 40.58  ? 189 TYR H CD1 1 
ATOM   7709 C  CD2 . TYR H  1 130 ? 74.835  -4.268  84.312  1.00 40.12  ? 189 TYR H CD2 1 
ATOM   7710 C  CE1 . TYR H  1 130 ? 73.270  -6.305  85.301  1.00 39.96  ? 189 TYR H CE1 1 
ATOM   7711 C  CE2 . TYR H  1 130 ? 74.612  -5.418  83.558  1.00 39.59  ? 189 TYR H CE2 1 
ATOM   7712 C  CZ  . TYR H  1 130 ? 73.823  -6.416  84.060  1.00 39.22  ? 189 TYR H CZ  1 
ATOM   7713 O  OH  . TYR H  1 130 ? 73.580  -7.527  83.311  1.00 39.07  ? 189 TYR H OH  1 
ATOM   7714 N  N   . PHE H  1 131 ? 72.990  -0.621  88.454  1.00 44.24  ? 190 PHE H N   1 
ATOM   7715 C  CA  . PHE H  1 131 ? 73.166  0.520   89.358  1.00 45.46  ? 190 PHE H CA  1 
ATOM   7716 C  C   . PHE H  1 131 ? 73.687  0.050   90.706  1.00 47.82  ? 190 PHE H C   1 
ATOM   7717 O  O   . PHE H  1 131 ? 73.714  -1.140  91.002  1.00 48.47  ? 190 PHE H O   1 
ATOM   7718 C  CB  . PHE H  1 131 ? 71.830  1.225   89.641  1.00 45.03  ? 190 PHE H CB  1 
ATOM   7719 C  CG  . PHE H  1 131 ? 70.998  1.545   88.421  1.00 43.87  ? 190 PHE H CG  1 
ATOM   7720 C  CD1 . PHE H  1 131 ? 70.985  2.826   87.889  1.00 45.34  ? 190 PHE H CD1 1 
ATOM   7721 C  CD2 . PHE H  1 131 ? 70.146  0.603   87.871  1.00 44.56  ? 190 PHE H CD2 1 
ATOM   7722 C  CE1 . PHE H  1 131 ? 70.168  3.158   86.780  1.00 43.77  ? 190 PHE H CE1 1 
ATOM   7723 C  CE2 . PHE H  1 131 ? 69.337  0.913   86.769  1.00 44.89  ? 190 PHE H CE2 1 
ATOM   7724 C  CZ  . PHE H  1 131 ? 69.359  2.205   86.216  1.00 44.05  ? 190 PHE H CZ  1 
ATOM   7725 N  N   . GLN H  1 132 ? 74.038  1.008   91.552  1.00 49.14  ? 191 GLN H N   1 
ATOM   7726 C  CA  . GLN H  1 132 ? 74.431  0.711   92.945  1.00 51.88  ? 191 GLN H CA  1 
ATOM   7727 C  C   . GLN H  1 132 ? 73.413  -0.067  93.829  1.00 52.16  ? 191 GLN H C   1 
ATOM   7728 O  O   . GLN H  1 132 ? 72.263  0.323   93.981  1.00 50.69  ? 191 GLN H O   1 
ATOM   7729 C  CB  . GLN H  1 132 ? 74.882  2.005   93.629  1.00 53.00  ? 191 GLN H CB  1 
ATOM   7730 C  CG  . GLN H  1 132 ? 76.358  2.288   93.382  1.00 54.30  ? 191 GLN H CG  1 
ATOM   7731 C  CD  . GLN H  1 132 ? 76.735  3.727   93.597  1.00 55.42  ? 191 GLN H CD  1 
ATOM   7732 O  OE1 . GLN H  1 132 ? 75.986  4.477   94.232  1.00 55.26  ? 191 GLN H OE1 1 
ATOM   7733 N  NE2 . GLN H  1 132 ? 77.901  4.137   93.051  1.00 54.85  ? 191 GLN H NE2 1 
HETATM 7734 FE FE1 . FES I  2 .   ? 27.555  13.035  7.407   1.00 36.44  ? 2   FES A FE1 1 
HETATM 7735 FE FE2 . FES I  2 .   ? 25.120  11.414  7.074   1.00 33.17  ? 2   FES A FE2 1 
HETATM 7736 S  S1  . FES I  2 .   ? 26.922  11.116  8.274   1.00 34.26  ? 2   FES A S1  1 
HETATM 7737 S  S2  . FES I  2 .   ? 25.912  13.068  5.937   1.00 31.42  ? 2   FES A S2  1 
HETATM 7738 C  CAC . FLC J  3 .   ? 26.593  23.798  23.805  1.00 48.67  ? 6   FLC A CAC 1 
HETATM 7739 C  CA  . FLC J  3 .   ? 25.354  24.317  24.492  1.00 51.27  ? 6   FLC A CA  1 
HETATM 7740 C  CB  . FLC J  3 .   ? 25.353  23.980  26.003  1.00 53.47  ? 6   FLC A CB  1 
HETATM 7741 C  CBC . FLC J  3 .   ? 25.801  22.552  26.132  1.00 54.24  ? 6   FLC A CBC 1 
HETATM 7742 C  CG  . FLC J  3 .   ? 23.942  24.148  26.616  1.00 54.83  ? 6   FLC A CG  1 
HETATM 7743 C  CGC . FLC J  3 .   ? 23.834  23.728  28.087  1.00 58.91  ? 6   FLC A CGC 1 
HETATM 7744 O  OA1 . FLC J  3 .   ? 26.700  22.604  23.614  1.00 45.46  ? 6   FLC A OA1 1 
HETATM 7745 O  OA2 . FLC J  3 .   ? 27.486  24.559  23.435  1.00 48.45  ? 6   FLC A OA2 1 
HETATM 7746 O  OB1 . FLC J  3 .   ? 25.104  21.708  25.515  1.00 54.96  ? 6   FLC A OB1 1 
HETATM 7747 O  OB2 . FLC J  3 .   ? 26.834  22.299  26.833  1.00 57.23  ? 6   FLC A OB2 1 
HETATM 7748 O  OG1 . FLC J  3 .   ? 24.078  22.506  28.364  1.00 60.52  ? 6   FLC A OG1 1 
HETATM 7749 O  OG2 . FLC J  3 .   ? 23.492  24.604  28.957  1.00 58.68  ? 6   FLC A OG2 1 
HETATM 7750 O  OHB . FLC J  3 .   ? 26.319  24.760  26.743  1.00 53.37  ? 6   FLC A OHB 1 
HETATM 7751 K  K   . K   K  4 .   ? 26.478  27.003  27.175  1.00 54.39  ? 192 K   A K   1 
HETATM 7752 FE FE1 . FES L  2 .   ? 80.494  23.670  75.778  1.00 40.53  ? 3   FES B FE1 1 
HETATM 7753 FE FE2 . FES L  2 .   ? 77.961  22.627  76.758  1.00 43.05  ? 3   FES B FE2 1 
HETATM 7754 S  S1  . FES L  2 .   ? 78.585  23.402  74.766  1.00 38.86  ? 3   FES B S1  1 
HETATM 7755 S  S2  . FES L  2 .   ? 79.822  23.014  77.783  1.00 39.08  ? 3   FES B S2  1 
HETATM 7756 C  CAC . FLC M  3 .   ? 80.643  7.828   63.978  1.00 68.83  ? 192 FLC B CAC 1 
HETATM 7757 C  CA  . FLC M  3 .   ? 81.028  8.886   62.957  1.00 67.90  ? 192 FLC B CA  1 
HETATM 7758 C  CB  . FLC M  3 .   ? 79.872  9.296   62.038  1.00 67.32  ? 192 FLC B CB  1 
HETATM 7759 C  CBC . FLC M  3 .   ? 80.356  9.128   60.586  1.00 68.97  ? 192 FLC B CBC 1 
HETATM 7760 C  CG  . FLC M  3 .   ? 79.336  10.718  62.312  1.00 65.33  ? 192 FLC B CG  1 
HETATM 7761 C  CGC . FLC M  3 .   ? 79.113  11.024  63.780  1.00 61.82  ? 192 FLC B CGC 1 
HETATM 7762 O  OA1 . FLC M  3 .   ? 79.476  7.763   64.473  1.00 69.17  ? 192 FLC B OA1 1 
HETATM 7763 O  OA2 . FLC M  3 .   ? 81.550  7.019   64.295  1.00 69.40  ? 192 FLC B OA2 1 
HETATM 7764 O  OB1 . FLC M  3 .   ? 81.134  9.993   60.081  1.00 70.61  ? 192 FLC B OB1 1 
HETATM 7765 O  OB2 . FLC M  3 .   ? 79.989  8.117   59.920  1.00 68.53  ? 192 FLC B OB2 1 
HETATM 7766 O  OG1 . FLC M  3 .   ? 78.260  11.841  64.173  1.00 59.27  ? 192 FLC B OG1 1 
HETATM 7767 O  OG2 . FLC M  3 .   ? 79.822  10.468  64.607  1.00 60.35  ? 192 FLC B OG2 1 
HETATM 7768 O  OHB . FLC M  3 .   ? 78.782  8.394   62.242  1.00 67.24  ? 192 FLC B OHB 1 
HETATM 7769 K  K   . K   N  4 .   ? 76.280  7.627   62.007  1.00 66.65  ? 193 K   B K   1 
HETATM 7770 FE FE1 . FES O  2 .   ? 35.684  52.416  41.347  1.00 35.95  ? 4   FES C FE1 1 
HETATM 7771 FE FE2 . FES O  2 .   ? 35.679  49.547  41.574  1.00 31.62  ? 4   FES C FE2 1 
HETATM 7772 S  S1  . FES O  2 .   ? 34.501  50.893  40.288  1.00 35.15  ? 4   FES C S1  1 
HETATM 7773 S  S2  . FES O  2 .   ? 36.720  51.073  42.696  1.00 30.29  ? 4   FES C S2  1 
HETATM 7774 C  CAC . FLC P  3 .   ? 45.477  56.636  24.621  1.00 53.93  ? 5   FLC C CAC 1 
HETATM 7775 C  CA  . FLC P  3 .   ? 44.765  55.822  23.556  1.00 55.97  ? 5   FLC C CA  1 
HETATM 7776 C  CB  . FLC P  3 .   ? 45.295  56.082  22.118  1.00 58.12  ? 5   FLC C CB  1 
HETATM 7777 C  CBC . FLC P  3 .   ? 46.594  55.290  21.936  1.00 59.31  ? 5   FLC C CBC 1 
HETATM 7778 C  CG  . FLC P  3 .   ? 44.257  55.742  20.999  1.00 59.72  ? 5   FLC C CG  1 
HETATM 7779 C  CGC . FLC P  3 .   ? 44.133  56.791  19.867  1.00 62.91  ? 5   FLC C CGC 1 
HETATM 7780 O  OA1 . FLC P  3 .   ? 44.892  57.425  25.364  1.00 49.83  ? 5   FLC C OA1 1 
HETATM 7781 O  OA2 . FLC P  3 .   ? 46.693  56.504  24.743  1.00 55.00  ? 5   FLC C OA2 1 
HETATM 7782 O  OB1 . FLC P  3 .   ? 46.608  54.200  21.298  1.00 62.56  ? 5   FLC C OB1 1 
HETATM 7783 O  OB2 . FLC P  3 .   ? 47.651  55.776  22.431  1.00 59.63  ? 5   FLC C OB2 1 
HETATM 7784 O  OG1 . FLC P  3 .   ? 45.188  57.232  19.300  1.00 64.12  ? 5   FLC C OG1 1 
HETATM 7785 O  OG2 . FLC P  3 .   ? 42.971  57.185  19.531  1.00 61.48  ? 5   FLC C OG2 1 
HETATM 7786 O  OHB . FLC P  3 .   ? 45.651  57.478  21.972  1.00 57.82  ? 5   FLC C OHB 1 
HETATM 7787 C  CAC . FLC Q  3 .   ? 40.972  48.101  24.857  1.00 66.58  ? 8   FLC C CAC 1 
HETATM 7788 C  CA  . FLC Q  3 .   ? 41.177  49.139  23.776  1.00 67.88  ? 8   FLC C CA  1 
HETATM 7789 C  CB  . FLC Q  3 .   ? 42.025  48.592  22.609  1.00 69.41  ? 8   FLC C CB  1 
HETATM 7790 C  CBC . FLC Q  3 .   ? 42.020  49.585  21.433  1.00 69.97  ? 8   FLC C CBC 1 
HETATM 7791 C  CG  . FLC Q  3 .   ? 43.501  48.316  23.013  1.00 69.43  ? 8   FLC C CG  1 
HETATM 7792 C  CGC . FLC Q  3 .   ? 43.848  46.840  23.085  1.00 70.85  ? 8   FLC C CGC 1 
HETATM 7793 O  OA1 . FLC Q  3 .   ? 39.882  47.961  25.442  1.00 63.81  ? 8   FLC C OA1 1 
HETATM 7794 O  OA2 . FLC Q  3 .   ? 41.943  47.395  25.146  1.00 66.95  ? 8   FLC C OA2 1 
HETATM 7795 O  OB1 . FLC Q  3 .   ? 42.348  50.793  21.635  1.00 70.54  ? 8   FLC C OB1 1 
HETATM 7796 O  OB2 . FLC Q  3 .   ? 41.715  49.168  20.280  1.00 69.98  ? 8   FLC C OB2 1 
HETATM 7797 O  OG1 . FLC Q  3 .   ? 44.354  46.388  24.145  1.00 71.61  ? 8   FLC C OG1 1 
HETATM 7798 O  OG2 . FLC Q  3 .   ? 43.613  46.118  22.081  1.00 70.34  ? 8   FLC C OG2 1 
HETATM 7799 O  OHB . FLC Q  3 .   ? 41.370  47.372  22.184  1.00 69.56  ? 8   FLC C OHB 1 
HETATM 7800 K  K   . K   R  4 .   ? 48.292  58.444  21.838  1.00 53.10  ? 192 K   C K   1 
HETATM 7801 FE FE1 . FES S  2 .   ? 49.375  -5.586  57.238  1.00 45.01  ? 5   FES D FE1 1 
HETATM 7802 FE FE2 . FES S  2 .   ? 52.028  -5.852  58.637  1.00 44.11  ? 5   FES D FE2 1 
HETATM 7803 S  S1  . FES S  2 .   ? 51.353  -4.694  56.856  1.00 45.85  ? 5   FES D S1  1 
HETATM 7804 S  S2  . FES S  2 .   ? 50.101  -6.931  58.830  1.00 42.33  ? 5   FES D S2  1 
HETATM 7805 C  CAC . FLC T  3 .   ? 40.954  11.041  63.035  1.00 62.34  ? 2   FLC D CAC 1 
HETATM 7806 C  CA  . FLC T  3 .   ? 40.720  11.854  64.263  1.00 63.11  ? 2   FLC D CA  1 
HETATM 7807 C  CB  . FLC T  3 .   ? 41.270  13.285  64.072  1.00 63.58  ? 2   FLC D CB  1 
HETATM 7808 C  CBC . FLC T  3 .   ? 42.702  13.217  64.509  1.00 65.05  ? 2   FLC D CBC 1 
HETATM 7809 C  CG  . FLC T  3 .   ? 41.115  13.819  62.603  1.00 64.08  ? 2   FLC D CG  1 
HETATM 7810 C  CGC . FLC T  3 .   ? 40.774  15.295  62.268  1.00 64.95  ? 2   FLC D CGC 1 
HETATM 7811 O  OA1 . FLC T  3 .   ? 40.015  10.471  62.430  1.00 61.06  ? 2   FLC D OA1 1 
HETATM 7812 O  OA2 . FLC T  3 .   ? 42.134  11.015  62.674  1.00 63.00  ? 2   FLC D OA2 1 
HETATM 7813 O  OB1 . FLC T  3 .   ? 43.570  13.532  63.662  1.00 67.33  ? 2   FLC D OB1 1 
HETATM 7814 O  OB2 . FLC T  3 .   ? 42.950  12.846  65.698  1.00 65.95  ? 2   FLC D OB2 1 
HETATM 7815 O  OG1 . FLC T  3 .   ? 39.974  15.999  62.959  1.00 63.71  ? 2   FLC D OG1 1 
HETATM 7816 O  OG2 . FLC T  3 .   ? 41.296  15.780  61.224  1.00 64.17  ? 2   FLC D OG2 1 
HETATM 7817 O  OHB . FLC T  3 .   ? 40.641  14.125  65.053  1.00 64.06  ? 2   FLC D OHB 1 
HETATM 7818 C  CAC . FLC U  3 .   ? 49.787  -16.514 76.634  1.00 93.43  ? 9   FLC D CAC 1 
HETATM 7819 C  CA  . FLC U  3 .   ? 49.430  -15.057 76.856  1.00 93.46  ? 9   FLC D CA  1 
HETATM 7820 C  CB  . FLC U  3 .   ? 48.176  -14.806 77.719  1.00 93.63  ? 9   FLC D CB  1 
HETATM 7821 C  CBC . FLC U  3 .   ? 46.881  -14.922 76.891  1.00 93.91  ? 9   FLC D CBC 1 
HETATM 7822 C  CG  . FLC U  3 .   ? 48.289  -13.390 78.328  1.00 93.11  ? 9   FLC D CG  1 
HETATM 7823 C  CGC . FLC U  3 .   ? 49.162  -13.269 79.581  1.00 92.31  ? 9   FLC D CGC 1 
HETATM 7824 O  OA1 . FLC U  3 .   ? 49.296  -17.085 75.629  1.00 93.01  ? 9   FLC D OA1 1 
HETATM 7825 O  OA2 . FLC U  3 .   ? 50.577  -17.070 77.444  1.00 93.29  ? 9   FLC D OA2 1 
HETATM 7826 O  OB1 . FLC U  3 .   ? 46.860  -15.510 75.767  1.00 93.71  ? 9   FLC D OB1 1 
HETATM 7827 O  OB2 . FLC U  3 .   ? 45.827  -14.424 77.365  1.00 93.28  ? 9   FLC D OB2 1 
HETATM 7828 O  OG1 . FLC U  3 .   ? 50.303  -13.799 79.630  1.00 90.60  ? 9   FLC D OG1 1 
HETATM 7829 O  OG2 . FLC U  3 .   ? 48.701  -12.608 80.543  1.00 91.28  ? 9   FLC D OG2 1 
HETATM 7830 O  OHB . FLC U  3 .   ? 48.115  -15.768 78.795  1.00 94.17  ? 9   FLC D OHB 1 
HETATM 7831 K  K   . K   V  4 .   ? 37.925  14.127  64.653  1.00 58.46  ? 192 K   D K   1 
HETATM 7832 FE FE1 . FES W  2 .   ? 42.258  -1.631  51.059  1.00 42.89  ? 6   FES E FE1 1 
HETATM 7833 FE FE2 . FES W  2 .   ? 39.735  -0.516  50.044  1.00 41.59  ? 6   FES E FE2 1 
HETATM 7834 S  S1  . FES W  2 .   ? 40.399  -1.216  52.078  1.00 39.95  ? 6   FES E S1  1 
HETATM 7835 S  S2  . FES W  2 .   ? 41.601  -1.005  49.044  1.00 41.68  ? 6   FES E S2  1 
HETATM 7836 C  CAC . FLC X  3 .   ? 50.032  14.788  63.345  1.00 73.70  ? 4   FLC E CAC 1 
HETATM 7837 C  CA  . FLC X  3 .   ? 49.565  13.318  63.376  1.00 72.54  ? 4   FLC E CA  1 
HETATM 7838 C  CB  . FLC X  3 .   ? 50.045  12.499  64.592  1.00 71.80  ? 4   FLC E CB  1 
HETATM 7839 C  CBC . FLC X  3 .   ? 49.409  12.885  65.921  1.00 72.52  ? 4   FLC E CBC 1 
HETATM 7840 C  CG  . FLC X  3 .   ? 49.950  10.988  64.333  1.00 69.32  ? 4   FLC E CG  1 
HETATM 7841 C  CGC . FLC X  3 .   ? 51.007  10.509  63.354  1.00 66.38  ? 4   FLC E CGC 1 
HETATM 7842 O  OA1 . FLC X  3 .   ? 49.322  15.631  62.714  1.00 73.86  ? 4   FLC E OA1 1 
HETATM 7843 O  OA2 . FLC X  3 .   ? 51.106  15.135  63.924  1.00 72.84  ? 4   FLC E OA2 1 
HETATM 7844 O  OB1 . FLC X  3 .   ? 49.770  13.949  66.491  1.00 72.83  ? 4   FLC E OB1 1 
HETATM 7845 O  OB2 . FLC X  3 .   ? 48.570  12.119  66.443  1.00 73.40  ? 4   FLC E OB2 1 
HETATM 7846 O  OG1 . FLC X  3 .   ? 50.949  9.369   62.876  1.00 64.13  ? 4   FLC E OG1 1 
HETATM 7847 O  OG2 . FLC X  3 .   ? 51.944  11.244  63.022  1.00 65.92  ? 4   FLC E OG2 1 
HETATM 7848 O  OHB . FLC X  3 .   ? 51.398  12.832  64.721  1.00 71.81  ? 4   FLC E OHB 1 
HETATM 7849 K  K   . K   Y  4 .   ? 53.957  12.872  65.760  1.00 72.27  ? 192 K   E K   1 
HETATM 7850 FE FE1 . FES Z  2 .   ? 34.479  61.863  37.394  1.00 34.74  ? 7   FES F FE1 1 
HETATM 7851 FE FE2 . FES Z  2 .   ? 34.796  64.536  36.324  1.00 34.75  ? 7   FES F FE2 1 
HETATM 7852 S  S1  . FES Z  2 .   ? 36.227  63.170  37.150  1.00 29.93  ? 7   FES F S1  1 
HETATM 7853 S  S2  . FES Z  2 .   ? 33.066  63.363  36.807  1.00 31.78  ? 7   FES F S2  1 
HETATM 7854 K  K   . K   AA 4 .   ? 40.601  44.777  22.653  1.00 42.64  ? 8   K   F K   1 
HETATM 7855 C  C1  . GOL BA 5 .   ? 40.104  54.539  30.634  1.00 50.51  ? 1   GOL F C1  1 
HETATM 7856 O  O1  . GOL BA 5 .   ? 40.713  54.431  31.918  1.00 49.01  ? 1   GOL F O1  1 
HETATM 7857 C  C2  . GOL BA 5 .   ? 38.606  54.216  30.661  1.00 51.00  ? 1   GOL F C2  1 
HETATM 7858 O  O2  . GOL BA 5 .   ? 38.094  54.186  29.337  1.00 48.68  ? 1   GOL F O2  1 
HETATM 7859 C  C3  . GOL BA 5 .   ? 37.812  55.114  31.632  1.00 51.98  ? 1   GOL F C3  1 
HETATM 7860 O  O3  . GOL BA 5 .   ? 36.942  56.061  31.012  1.00 53.52  ? 1   GOL F O3  1 
HETATM 7861 FE FE1 . FES CA 2 .   ? 36.353  16.570  11.229  1.00 35.29  ? 1   FES G FE1 1 
HETATM 7862 FE FE2 . FES CA 2 .   ? 38.447  18.195  12.361  1.00 33.57  ? 1   FES G FE2 1 
HETATM 7863 S  S1  . FES CA 2 .   ? 36.535  18.703  11.557  1.00 30.36  ? 1   FES G S1  1 
HETATM 7864 S  S2  . FES CA 2 .   ? 38.348  16.103  11.922  1.00 31.26  ? 1   FES G S2  1 
HETATM 7865 C  CAC . FLC DA 3 .   ? 21.184  15.415  23.922  1.00 68.59  ? 192 FLC G CAC 1 
HETATM 7866 C  CA  . FLC DA 3 .   ? 22.014  16.018  25.046  1.00 70.07  ? 192 FLC G CA  1 
HETATM 7867 C  CB  . FLC DA 3 .   ? 21.176  16.555  26.240  1.00 72.00  ? 192 FLC G CB  1 
HETATM 7868 C  CBC . FLC DA 3 .   ? 22.036  17.174  27.350  1.00 72.59  ? 192 FLC G CBC 1 
HETATM 7869 C  CG  . FLC DA 3 .   ? 20.184  17.683  25.841  1.00 72.21  ? 192 FLC G CG  1 
HETATM 7870 C  CGC . FLC DA 3 .   ? 18.741  17.291  26.059  1.00 74.06  ? 192 FLC G CGC 1 
HETATM 7871 O  OA1 . FLC DA 3 .   ? 21.521  14.368  23.332  1.00 65.35  ? 192 FLC G OA1 1 
HETATM 7872 O  OA2 . FLC DA 3 .   ? 20.154  16.008  23.585  1.00 68.52  ? 192 FLC G OA2 1 
HETATM 7873 O  OB1 . FLC DA 3 .   ? 23.114  17.763  27.053  1.00 72.64  ? 192 FLC G OB1 1 
HETATM 7874 O  OB2 . FLC DA 3 .   ? 21.610  17.114  28.541  1.00 73.68  ? 192 FLC G OB2 1 
HETATM 7875 O  OG1 . FLC DA 3 .   ? 18.099  16.809  25.079  1.00 74.54  ? 192 FLC G OG1 1 
HETATM 7876 O  OG2 . FLC DA 3 .   ? 18.263  17.450  27.216  1.00 73.75  ? 192 FLC G OG2 1 
HETATM 7877 O  OHB . FLC DA 3 .   ? 20.509  15.406  26.825  1.00 71.87  ? 192 FLC G OHB 1 
HETATM 7878 K  K   . K   EA 4 .   ? 18.399  13.299  26.260  1.00 50.05  ? 193 K   G K   1 
HETATM 7879 C  C1  . GOL FA 5 .   ? 27.037  17.692  17.909  1.00 47.67  ? 194 GOL G C1  1 
HETATM 7880 O  O1  . GOL FA 5 .   ? 26.798  18.240  16.634  1.00 46.57  ? 194 GOL G O1  1 
HETATM 7881 C  C2  . GOL FA 5 .   ? 27.807  16.366  17.836  1.00 48.54  ? 194 GOL G C2  1 
HETATM 7882 O  O2  . GOL FA 5 .   ? 27.746  15.794  19.131  1.00 47.17  ? 194 GOL G O2  1 
HETATM 7883 C  C3  . GOL FA 5 .   ? 29.243  16.552  17.314  1.00 50.70  ? 194 GOL G C3  1 
HETATM 7884 O  O3  . GOL FA 5 .   ? 30.173  15.490  17.562  1.00 51.38  ? 194 GOL G O3  1 
HETATM 7885 FE FE1 . FES GA 2 .   ? 87.729  27.600  69.590  1.00 44.61  ? 8   FES H FE1 1 
HETATM 7886 FE FE2 . FES GA 2 .   ? 90.294  28.044  68.073  1.00 42.82  ? 8   FES H FE2 1 
HETATM 7887 S  S1  . FES GA 2 .   ? 89.768  26.824  69.860  1.00 45.09  ? 8   FES H S1  1 
HETATM 7888 S  S2  . FES GA 2 .   ? 88.340  29.068  68.032  1.00 41.95  ? 8   FES H S2  1 
HETATM 7889 C  CAC . FLC HA 3 .   ? 89.072  11.169  63.145  1.00 62.98  ? 7   FLC H CAC 1 
HETATM 7890 C  CA  . FLC HA 3 .   ? 87.884  10.983  62.210  1.00 64.02  ? 7   FLC H CA  1 
HETATM 7891 C  CB  . FLC HA 3 .   ? 88.000  9.766   61.270  1.00 65.15  ? 7   FLC H CB  1 
HETATM 7892 C  CBC . FLC HA 3 .   ? 87.927  8.475   62.061  1.00 65.50  ? 7   FLC H CBC 1 
HETATM 7893 C  CG  . FLC HA 3 .   ? 86.899  9.753   60.185  1.00 66.27  ? 7   FLC H CG  1 
HETATM 7894 C  CGC . FLC HA 3 .   ? 87.094  8.752   59.030  1.00 69.20  ? 7   FLC H CGC 1 
HETATM 7895 O  OA1 . FLC HA 3 .   ? 89.815  10.204  63.392  1.00 63.24  ? 7   FLC H OA1 1 
HETATM 7896 O  OA2 . FLC HA 3 .   ? 89.304  12.279  63.660  1.00 61.23  ? 7   FLC H OA2 1 
HETATM 7897 O  OB1 . FLC HA 3 .   ? 86.865  8.188   62.690  1.00 67.15  ? 7   FLC H OB1 1 
HETATM 7898 O  OB2 . FLC HA 3 .   ? 88.951  7.742   62.051  1.00 65.40  ? 7   FLC H OB2 1 
HETATM 7899 O  OG1 . FLC HA 3 .   ? 87.090  9.217   57.852  1.00 69.66  ? 7   FLC H OG1 1 
HETATM 7900 O  OG2 . FLC HA 3 .   ? 87.252  7.511   59.250  1.00 70.24  ? 7   FLC H OG2 1 
HETATM 7901 O  OHB . FLC HA 3 .   ? 89.291  9.852   60.647  1.00 65.25  ? 7   FLC H OHB 1 
HETATM 7902 K  K   . K   IA 4 .   ? 92.098  8.842   61.313  1.00 70.95  ? 192 K   H K   1 
HETATM 7903 O  O   . HOH JA 6 .   ? 14.653  -3.904  9.554   1.00 34.00  ? 30  HOH A O   1 
HETATM 7904 O  O   . HOH JA 6 .   ? 34.231  7.516   6.945   1.00 38.08  ? 46  HOH A O   1 
HETATM 7905 O  O   . HOH JA 6 .   ? 9.147   8.561   8.266   1.00 25.75  ? 54  HOH A O   1 
HETATM 7906 O  O   . HOH JA 6 .   ? 20.887  29.619  19.513  1.00 14.56  ? 193 HOH A O   1 
HETATM 7907 O  O   . HOH JA 6 .   ? 19.793  16.921  11.094  1.00 40.81  ? 194 HOH A O   1 
HETATM 7908 O  O   . HOH JA 6 .   ? 38.009  26.633  56.112  1.00 41.24  ? 195 HOH A O   1 
HETATM 7909 O  O   . HOH JA 6 .   ? 4.777   5.656   3.184   1.00 38.96  ? 196 HOH A O   1 
HETATM 7910 O  O   . HOH JA 6 .   ? 18.853  12.609  23.568  1.00 30.79  ? 197 HOH A O   1 
HETATM 7911 O  O   . HOH JA 6 .   ? 21.551  0.491   8.177   1.00 27.94  ? 198 HOH A O   1 
HETATM 7912 O  O   . HOH JA 6 .   ? 18.497  -1.146  13.554  1.00 35.50  ? 199 HOH A O   1 
HETATM 7913 O  O   . HOH JA 6 .   ? 1.592   11.364  -3.338  1.00 35.25  ? 200 HOH A O   1 
HETATM 7914 O  O   . HOH JA 6 .   ? 15.601  16.552  -8.365  1.00 48.84  ? 201 HOH A O   1 
HETATM 7915 O  O   . HOH JA 6 .   ? 30.328  7.256   19.382  1.00 37.45  ? 202 HOH A O   1 
HETATM 7916 O  O   . HOH JA 6 .   ? 13.783  22.967  -4.016  1.00 50.83  ? 203 HOH A O   1 
HETATM 7917 O  O   . HOH JA 6 .   ? 15.512  -1.386  11.686  1.00 38.17  ? 204 HOH A O   1 
HETATM 7918 O  O   . HOH JA 6 .   ? 23.897  19.414  16.454  1.00 26.88  ? 205 HOH A O   1 
HETATM 7919 O  O   . HOH JA 6 .   ? 16.193  23.684  8.458   1.00 39.83  ? 206 HOH A O   1 
HETATM 7920 O  O   . HOH JA 6 .   ? 8.160   9.455   15.363  1.00 47.91  ? 207 HOH A O   1 
HETATM 7921 O  O   . HOH JA 6 .   ? 14.858  3.028   19.453  1.00 32.12  ? 208 HOH A O   1 
HETATM 7922 O  O   . HOH JA 6 .   ? 20.869  16.389  15.775  1.00 36.13  ? 209 HOH A O   1 
HETATM 7923 O  O   . HOH JA 6 .   ? 19.914  24.921  12.278  1.00 40.37  ? 210 HOH A O   1 
HETATM 7924 O  O   . HOH JA 6 .   ? 3.189   10.939  6.436   1.00 30.56  ? 211 HOH A O   1 
HETATM 7925 O  O   . HOH JA 6 .   ? 19.973  26.055  4.062   1.00 54.29  ? 212 HOH A O   1 
HETATM 7926 O  O   . HOH JA 6 .   ? 13.534  18.299  -8.720  1.00 39.50  ? 213 HOH A O   1 
HETATM 7927 O  O   . HOH JA 6 .   ? 11.725  20.392  -8.874  1.00 47.45  ? 214 HOH A O   1 
HETATM 7928 O  O   . HOH JA 6 .   ? 16.442  1.070   18.778  1.00 35.68  ? 215 HOH A O   1 
HETATM 7929 O  O   . HOH JA 6 .   ? 45.202  19.270  51.712  1.00 30.38  ? 219 HOH A O   1 
HETATM 7930 O  O   . HOH JA 6 .   ? 23.671  18.962  13.444  1.00 26.36  ? 220 HOH A O   1 
HETATM 7931 O  O   . HOH JA 6 .   ? 17.512  18.109  18.263  1.00 33.25  ? 226 HOH A O   1 
HETATM 7932 O  O   . HOH JA 6 .   ? 6.802   22.542  0.015   1.00 27.44  ? 227 HOH A O   1 
HETATM 7933 O  O   . HOH JA 6 .   ? 31.353  4.328   20.174  1.00 51.36  ? 228 HOH A O   1 
HETATM 7934 O  O   . HOH JA 6 .   ? 25.328  3.292   23.555  1.00 41.18  ? 229 HOH A O   1 
HETATM 7935 O  O   . HOH JA 6 .   ? 18.190  5.999   19.154  1.00 19.81  ? 230 HOH A O   1 
HETATM 7936 O  O   . HOH JA 6 .   ? 17.462  4.981   16.762  1.00 21.42  ? 231 HOH A O   1 
HETATM 7937 O  O   . HOH JA 6 .   ? 20.464  5.243   19.790  1.00 26.19  ? 232 HOH A O   1 
HETATM 7938 O  O   . HOH JA 6 .   ? 19.103  2.867   16.294  1.00 30.58  ? 233 HOH A O   1 
HETATM 7939 O  O   . HOH JA 6 .   ? 24.055  20.681  10.643  1.00 35.66  ? 243 HOH A O   1 
HETATM 7940 O  O   . HOH JA 6 .   ? 23.394  23.297  10.894  1.00 48.68  ? 244 HOH A O   1 
HETATM 7941 O  O   . HOH JA 6 .   ? 31.192  22.998  28.329  1.00 31.44  ? 248 HOH A O   1 
HETATM 7942 O  O   . HOH JA 6 .   ? 28.370  16.516  13.301  1.00 41.49  ? 262 HOH A O   1 
HETATM 7943 O  O   . HOH JA 6 .   ? 24.667  30.189  6.584   1.00 49.07  ? 272 HOH A O   1 
HETATM 7944 O  O   . HOH JA 6 .   ? 21.517  -0.570  4.938   1.00 41.83  ? 279 HOH A O   1 
HETATM 7945 O  O   . HOH KA 6 .   ? 65.066  4.093   76.364  1.00 28.87  ? 14  HOH B O   1 
HETATM 7946 O  O   . HOH KA 6 .   ? 93.526  22.553  41.927  1.00 40.05  ? 27  HOH B O   1 
HETATM 7947 O  O   . HOH KA 6 .   ? 73.285  27.010  89.662  1.00 47.05  ? 31  HOH B O   1 
HETATM 7948 O  O   . HOH KA 6 .   ? 79.196  19.477  95.746  1.00 43.54  ? 53  HOH B O   1 
HETATM 7949 O  O   . HOH KA 6 .   ? 68.019  10.360  80.662  1.00 34.31  ? 195 HOH B O   1 
HETATM 7950 O  O   . HOH KA 6 .   ? 80.282  13.523  71.136  1.00 34.63  ? 196 HOH B O   1 
HETATM 7951 O  O   . HOH KA 6 .   ? 75.004  16.792  95.740  1.00 52.01  ? 197 HOH B O   1 
HETATM 7952 O  O   . HOH KA 6 .   ? 80.432  13.966  76.169  1.00 44.09  ? 198 HOH B O   1 
HETATM 7953 O  O   . HOH KA 6 .   ? 66.575  27.835  61.668  1.00 51.05  ? 199 HOH B O   1 
HETATM 7954 O  O   . HOH KA 6 .   ? 73.672  29.537  90.308  1.00 48.79  ? 200 HOH B O   1 
HETATM 7955 O  O   . HOH KA 6 .   ? 76.303  9.423   63.468  1.00 26.39  ? 201 HOH B O   1 
HETATM 7956 O  O   . HOH KA 6 .   ? 61.629  5.412   78.724  1.00 39.79  ? 205 HOH B O   1 
HETATM 7957 O  O   . HOH KA 6 .   ? 84.402  16.809  68.220  1.00 32.48  ? 211 HOH B O   1 
HETATM 7958 O  O   . HOH KA 6 .   ? 68.574  27.376  80.441  1.00 40.97  ? 214 HOH B O   1 
HETATM 7959 O  O   . HOH KA 6 .   ? 91.921  6.107   70.776  1.00 22.27  ? 222 HOH B O   1 
HETATM 7960 O  O   . HOH KA 6 .   ? 85.040  20.805  90.668  1.00 45.05  ? 241 HOH B O   1 
HETATM 7961 O  O   . HOH KA 6 .   ? 105.847 23.369  36.944  1.00 42.55  ? 246 HOH B O   1 
HETATM 7962 O  O   . HOH KA 6 .   ? 78.603  32.162  72.845  1.00 44.44  ? 258 HOH B O   1 
HETATM 7963 O  O   . HOH KA 6 .   ? 88.013  19.953  82.933  1.00 35.52  ? 259 HOH B O   1 
HETATM 7964 O  O   . HOH KA 6 .   ? 90.116  11.233  85.131  1.00 47.75  ? 260 HOH B O   1 
HETATM 7965 O  O   . HOH KA 6 .   ? 83.270  17.803  66.420  1.00 31.59  ? 261 HOH B O   1 
HETATM 7966 O  O   . HOH KA 6 .   ? 71.388  28.648  78.768  1.00 48.09  ? 280 HOH B O   1 
HETATM 7967 O  O   . HOH LA 6 .   ? 53.362  54.894  29.091  1.00 13.50  ? 1   HOH C O   1 
HETATM 7968 O  O   . HOH LA 6 .   ? 34.500  40.861  29.604  1.00 18.37  ? 3   HOH C O   1 
HETATM 7969 O  O   . HOH LA 6 .   ? 32.756  25.906  31.675  1.00 26.89  ? 18  HOH C O   1 
HETATM 7970 O  O   . HOH LA 6 .   ? 33.901  44.571  53.502  1.00 40.89  ? 20  HOH C O   1 
HETATM 7971 O  O   . HOH LA 6 .   ? 43.278  52.471  32.325  1.00 27.99  ? 23  HOH C O   1 
HETATM 7972 O  O   . HOH LA 6 .   ? 42.812  47.800  37.737  1.00 29.09  ? 29  HOH C O   1 
HETATM 7973 O  O   . HOH LA 6 .   ? 41.223  34.257  40.273  1.00 28.07  ? 42  HOH C O   1 
HETATM 7974 O  O   . HOH LA 6 .   ? 41.435  30.679  58.422  1.00 41.81  ? 45  HOH C O   1 
HETATM 7975 O  O   . HOH LA 6 .   ? 46.310  30.378  42.005  1.00 29.41  ? 52  HOH C O   1 
HETATM 7976 O  O   . HOH LA 6 .   ? 31.272  39.778  32.913  1.00 42.19  ? 193 HOH C O   1 
HETATM 7977 O  O   . HOH LA 6 .   ? 32.481  42.366  29.178  1.00 25.85  ? 194 HOH C O   1 
HETATM 7978 O  O   . HOH LA 6 .   ? 27.768  55.286  41.673  1.00 33.93  ? 195 HOH C O   1 
HETATM 7979 O  O   . HOH LA 6 .   ? 28.282  45.517  45.800  1.00 33.73  ? 196 HOH C O   1 
HETATM 7980 O  O   . HOH LA 6 .   ? 41.051  71.376  12.997  1.00 30.02  ? 197 HOH C O   1 
HETATM 7981 O  O   . HOH LA 6 .   ? 41.152  27.115  35.631  1.00 33.09  ? 198 HOH C O   1 
HETATM 7982 O  O   . HOH LA 6 .   ? 33.653  36.374  29.203  1.00 21.03  ? 199 HOH C O   1 
HETATM 7983 O  O   . HOH LA 6 .   ? 48.857  51.275  48.064  1.00 38.33  ? 200 HOH C O   1 
HETATM 7984 O  O   . HOH LA 6 .   ? 31.400  36.876  30.379  1.00 40.47  ? 201 HOH C O   1 
HETATM 7985 O  O   . HOH LA 6 .   ? 29.317  52.022  29.792  1.00 32.18  ? 202 HOH C O   1 
HETATM 7986 O  O   . HOH LA 6 .   ? 50.387  55.831  22.072  1.00 31.31  ? 203 HOH C O   1 
HETATM 7987 O  O   . HOH LA 6 .   ? 34.109  41.031  55.507  1.00 42.57  ? 204 HOH C O   1 
HETATM 7988 O  O   . HOH LA 6 .   ? 41.971  48.462  32.770  1.00 33.15  ? 205 HOH C O   1 
HETATM 7989 O  O   . HOH LA 6 .   ? 42.184  29.700  55.057  1.00 31.86  ? 206 HOH C O   1 
HETATM 7990 O  O   . HOH LA 6 .   ? 22.385  47.479  37.895  1.00 34.75  ? 207 HOH C O   1 
HETATM 7991 O  O   . HOH LA 6 .   ? 31.340  44.142  53.526  1.00 51.47  ? 208 HOH C O   1 
HETATM 7992 O  O   . HOH LA 6 .   ? 44.228  53.567  38.203  1.00 43.56  ? 209 HOH C O   1 
HETATM 7993 O  O   . HOH LA 6 .   ? 29.467  34.927  36.984  1.00 28.04  ? 210 HOH C O   1 
HETATM 7994 O  O   . HOH LA 6 .   ? 19.680  43.182  33.441  1.00 42.20  ? 211 HOH C O   1 
HETATM 7995 O  O   . HOH LA 6 .   ? 28.013  43.356  39.678  1.00 32.76  ? 212 HOH C O   1 
HETATM 7996 O  O   . HOH LA 6 .   ? 44.317  44.135  57.354  1.00 45.18  ? 213 HOH C O   1 
HETATM 7997 O  O   . HOH LA 6 .   ? 38.992  72.556  14.079  1.00 40.80  ? 214 HOH C O   1 
HETATM 7998 O  O   . HOH LA 6 .   ? 25.047  35.456  41.150  1.00 40.57  ? 215 HOH C O   1 
HETATM 7999 O  O   . HOH LA 6 .   ? 42.549  26.369  32.655  1.00 39.91  ? 217 HOH C O   1 
HETATM 8000 O  O   . HOH LA 6 .   ? 53.814  40.291  49.275  1.00 40.12  ? 218 HOH C O   1 
HETATM 8001 O  O   . HOH LA 6 .   ? 31.729  36.855  43.176  1.00 46.10  ? 219 HOH C O   1 
HETATM 8002 O  O   . HOH LA 6 .   ? 21.436  45.081  37.775  1.00 33.21  ? 220 HOH C O   1 
HETATM 8003 O  O   . HOH LA 6 .   ? 50.532  48.026  40.176  1.00 46.71  ? 221 HOH C O   1 
HETATM 8004 O  O   . HOH LA 6 .   ? 39.720  44.859  25.142  1.00 25.91  ? 222 HOH C O   1 
HETATM 8005 O  O   . HOH LA 6 .   ? 40.398  50.734  33.676  1.00 43.44  ? 223 HOH C O   1 
HETATM 8006 O  O   . HOH LA 6 .   ? 45.242  46.239  30.255  1.00 44.81  ? 224 HOH C O   1 
HETATM 8007 O  O   . HOH LA 6 .   ? 48.129  44.307  30.944  1.00 28.11  ? 225 HOH C O   1 
HETATM 8008 O  O   . HOH LA 6 .   ? 33.751  39.982  32.124  1.00 26.46  ? 226 HOH C O   1 
HETATM 8009 O  O   . HOH LA 6 .   ? 26.239  51.040  28.926  1.00 54.30  ? 238 HOH C O   1 
HETATM 8010 O  O   . HOH LA 6 .   ? 28.363  46.002  25.143  1.00 45.90  ? 239 HOH C O   1 
HETATM 8011 O  O   . HOH LA 6 .   ? 31.602  44.531  30.119  1.00 27.68  ? 249 HOH C O   1 
HETATM 8012 O  O   . HOH LA 6 .   ? 32.518  71.019  -3.290  1.00 40.34  ? 251 HOH C O   1 
HETATM 8013 O  O   . HOH LA 6 .   ? 43.810  30.078  33.104  1.00 43.10  ? 255 HOH C O   1 
HETATM 8014 O  O   . HOH LA 6 .   ? 38.311  54.712  35.545  1.00 35.46  ? 264 HOH C O   1 
HETATM 8015 O  O   . HOH LA 6 .   ? 39.964  53.653  34.121  1.00 43.78  ? 265 HOH C O   1 
HETATM 8016 O  O   . HOH LA 6 .   ? 36.720  56.331  34.255  1.00 35.35  ? 266 HOH C O   1 
HETATM 8017 O  O   . HOH LA 6 .   ? 30.602  29.072  31.756  1.00 37.63  ? 271 HOH C O   1 
HETATM 8018 O  O   . HOH LA 6 .   ? 46.542  42.970  57.641  1.00 44.74  ? 275 HOH C O   1 
HETATM 8019 O  O   . HOH LA 6 .   ? 42.710  60.776  20.427  1.00 28.78  ? 276 HOH C O   1 
HETATM 8020 O  O   . HOH MA 6 .   ? 38.336  6.778   70.912  1.00 37.72  ? 15  HOH D O   1 
HETATM 8021 O  O   . HOH MA 6 .   ? 34.361  17.572  31.387  1.00 31.92  ? 16  HOH D O   1 
HETATM 8022 O  O   . HOH MA 6 .   ? 70.894  -22.083 73.151  1.00 44.09  ? 21  HOH D O   1 
HETATM 8023 O  O   . HOH MA 6 .   ? 47.700  3.026   76.946  1.00 35.69  ? 25  HOH D O   1 
HETATM 8024 O  O   . HOH MA 6 .   ? 60.320  6.019   62.482  1.00 31.20  ? 48  HOH D O   1 
HETATM 8025 O  O   . HOH MA 6 .   ? 58.738  -5.433  80.257  1.00 45.83  ? 49  HOH D O   1 
HETATM 8026 O  O   . HOH MA 6 .   ? 64.119  6.009   63.710  1.00 28.31  ? 193 HOH D O   1 
HETATM 8027 O  O   . HOH MA 6 .   ? 29.174  24.506  43.224  1.00 47.71  ? 194 HOH D O   1 
HETATM 8028 O  O   . HOH MA 6 .   ? 45.601  3.280   63.560  1.00 35.45  ? 195 HOH D O   1 
HETATM 8029 O  O   . HOH MA 6 .   ? 46.123  5.299   58.393  1.00 34.18  ? 196 HOH D O   1 
HETATM 8030 O  O   . HOH MA 6 .   ? 41.756  -5.763  73.191  1.00 38.44  ? 197 HOH D O   1 
HETATM 8031 O  O   . HOH MA 6 .   ? 34.312  31.733  42.151  1.00 22.87  ? 198 HOH D O   1 
HETATM 8032 O  O   . HOH MA 6 .   ? 49.433  2.975   64.461  1.00 36.96  ? 199 HOH D O   1 
HETATM 8033 O  O   . HOH MA 6 .   ? 52.501  -15.373 80.808  1.00 48.14  ? 200 HOH D O   1 
HETATM 8034 O  O   . HOH MA 6 .   ? 45.106  -4.084  72.432  1.00 36.21  ? 201 HOH D O   1 
HETATM 8035 O  O   . HOH MA 6 .   ? 61.597  -4.497  71.732  1.00 49.11  ? 202 HOH D O   1 
HETATM 8036 O  O   . HOH MA 6 .   ? 64.795  1.537   75.347  1.00 32.99  ? 203 HOH D O   1 
HETATM 8037 O  O   . HOH MA 6 .   ? 42.223  -1.272  74.286  1.00 48.10  ? 204 HOH D O   1 
HETATM 8038 O  O   . HOH MA 6 .   ? 37.854  12.250  62.707  1.00 27.50  ? 205 HOH D O   1 
HETATM 8039 O  O   . HOH MA 6 .   ? 27.812  29.929  41.433  1.00 43.44  ? 206 HOH D O   1 
HETATM 8040 O  O   . HOH MA 6 .   ? 31.677  22.427  33.693  1.00 49.94  ? 207 HOH D O   1 
HETATM 8041 O  O   . HOH MA 6 .   ? 68.328  -22.094 73.405  1.00 52.95  ? 209 HOH D O   1 
HETATM 8042 O  O   . HOH MA 6 .   ? 41.563  9.591   74.403  1.00 41.01  ? 210 HOH D O   1 
HETATM 8043 O  O   . HOH MA 6 .   ? 49.874  5.844   68.151  1.00 36.06  ? 245 HOH D O   1 
HETATM 8044 O  O   . HOH MA 6 .   ? 27.121  23.298  32.900  1.00 42.89  ? 247 HOH D O   1 
HETATM 8045 O  O   . HOH MA 6 .   ? 24.915  26.847  46.117  1.00 50.60  ? 252 HOH D O   1 
HETATM 8046 O  O   . HOH MA 6 .   ? 39.167  21.885  55.469  1.00 35.39  ? 268 HOH D O   1 
HETATM 8047 O  O   . HOH MA 6 .   ? 30.631  23.248  31.273  1.00 55.16  ? 270 HOH D O   1 
HETATM 8048 O  O   . HOH MA 6 .   ? 29.873  22.715  52.096  1.00 37.73  ? 274 HOH D O   1 
HETATM 8049 O  O   . HOH NA 6 .   ? 45.083  4.420   60.587  1.00 29.02  ? 10  HOH E O   1 
HETATM 8050 O  O   . HOH NA 6 .   ? 27.033  17.343  49.999  1.00 28.93  ? 11  HOH E O   1 
HETATM 8051 O  O   . HOH NA 6 .   ? 34.637  -5.037  36.070  1.00 49.51  ? 13  HOH E O   1 
HETATM 8052 O  O   . HOH NA 6 .   ? 62.138  1.142   81.489  1.00 37.62  ? 24  HOH E O   1 
HETATM 8053 O  O   . HOH NA 6 .   ? 40.614  2.771   30.930  1.00 35.14  ? 32  HOH E O   1 
HETATM 8054 O  O   . HOH NA 6 .   ? 41.717  16.374  54.237  1.00 36.72  ? 38  HOH E O   1 
HETATM 8055 O  O   . HOH NA 6 .   ? 67.361  -2.358  83.789  1.00 41.60  ? 57  HOH E O   1 
HETATM 8056 O  O   . HOH NA 6 .   ? 53.684  15.957  56.221  1.00 19.38  ? 193 HOH E O   1 
HETATM 8057 O  O   . HOH NA 6 .   ? 65.791  -7.363  86.829  1.00 57.50  ? 194 HOH E O   1 
HETATM 8058 O  O   . HOH NA 6 .   ? 42.021  8.120   50.640  1.00 36.13  ? 195 HOH E O   1 
HETATM 8059 O  O   . HOH NA 6 .   ? 30.955  7.189   58.172  1.00 37.75  ? 196 HOH E O   1 
HETATM 8060 O  O   . HOH NA 6 .   ? 37.504  -8.265  47.261  1.00 43.32  ? 197 HOH E O   1 
HETATM 8061 O  O   . HOH NA 6 .   ? 23.277  16.700  47.620  1.00 39.40  ? 198 HOH E O   1 
HETATM 8062 O  O   . HOH NA 6 .   ? 42.175  8.918   55.798  1.00 37.99  ? 199 HOH E O   1 
HETATM 8063 O  O   . HOH NA 6 .   ? 53.006  18.648  57.396  1.00 55.81  ? 200 HOH E O   1 
HETATM 8064 O  O   . HOH NA 6 .   ? 41.280  16.546  49.862  1.00 40.53  ? 201 HOH E O   1 
HETATM 8065 O  O   . HOH NA 6 .   ? 46.883  14.208  63.249  1.00 36.22  ? 202 HOH E O   1 
HETATM 8066 O  O   . HOH NA 6 .   ? 29.737  11.688  46.135  1.00 41.00  ? 203 HOH E O   1 
HETATM 8067 O  O   . HOH NA 6 .   ? 40.431  -10.326 55.039  1.00 40.72  ? 204 HOH E O   1 
HETATM 8068 O  O   . HOH NA 6 .   ? 26.344  19.582  51.415  1.00 32.33  ? 234 HOH E O   1 
HETATM 8069 O  O   . HOH NA 6 .   ? 26.196  17.264  47.416  1.00 35.17  ? 257 HOH E O   1 
HETATM 8070 O  O   . HOH NA 6 .   ? 42.037  14.205  56.818  1.00 45.09  ? 269 HOH E O   1 
HETATM 8071 O  O   . HOH NA 6 .   ? 32.638  -6.189  48.319  1.00 37.79  ? 277 HOH E O   1 
HETATM 8072 O  O   . HOH NA 6 .   ? 30.358  -5.580  46.532  1.00 38.38  ? 278 HOH E O   1 
HETATM 8073 O  O   . HOH OA 6 .   ? 37.014  61.241  19.947  1.00 26.15  ? 28  HOH F O   1 
HETATM 8074 O  O   . HOH OA 6 .   ? 47.011  66.545  27.777  1.00 30.73  ? 35  HOH F O   1 
HETATM 8075 O  O   . HOH OA 6 .   ? 32.445  77.657  19.172  1.00 38.00  ? 37  HOH F O   1 
HETATM 8076 O  O   . HOH OA 6 .   ? 33.337  49.515  19.587  1.00 24.78  ? 56  HOH F O   1 
HETATM 8077 O  O   . HOH OA 6 .   ? 49.134  71.546  28.639  1.00 28.19  ? 192 HOH F O   1 
HETATM 8078 O  O   . HOH OA 6 .   ? 33.850  62.236  28.187  1.00 27.57  ? 193 HOH F O   1 
HETATM 8079 O  O   . HOH OA 6 .   ? 22.445  85.538  28.161  1.00 45.69  ? 194 HOH F O   1 
HETATM 8080 O  O   . HOH OA 6 .   ? 38.961  59.494  23.198  1.00 33.60  ? 195 HOH F O   1 
HETATM 8081 O  O   . HOH OA 6 .   ? 53.817  26.086  25.056  1.00 58.59  ? 196 HOH F O   1 
HETATM 8082 O  O   . HOH OA 6 .   ? 32.108  67.478  43.603  1.00 39.57  ? 197 HOH F O   1 
HETATM 8083 O  O   . HOH OA 6 .   ? 26.487  89.397  35.701  1.00 52.47  ? 198 HOH F O   1 
HETATM 8084 O  O   . HOH OA 6 .   ? 45.040  38.683  29.281  1.00 46.32  ? 199 HOH F O   1 
HETATM 8085 O  O   . HOH OA 6 .   ? 48.575  70.603  26.423  1.00 23.09  ? 200 HOH F O   1 
HETATM 8086 O  O   . HOH OA 6 .   ? 49.170  68.067  26.863  1.00 22.11  ? 201 HOH F O   1 
HETATM 8087 O  O   . HOH OA 6 .   ? 50.634  71.282  31.865  1.00 38.00  ? 202 HOH F O   1 
HETATM 8088 O  O   . HOH OA 6 .   ? 41.516  75.117  17.595  1.00 35.68  ? 203 HOH F O   1 
HETATM 8089 O  O   . HOH OA 6 .   ? 39.693  76.582  34.245  1.00 36.60  ? 204 HOH F O   1 
HETATM 8090 O  O   . HOH OA 6 .   ? 36.136  74.802  23.991  1.00 40.83  ? 205 HOH F O   1 
HETATM 8091 O  O   . HOH OA 6 .   ? 47.924  65.204  29.916  1.00 36.56  ? 206 HOH F O   1 
HETATM 8092 O  O   . HOH OA 6 .   ? 31.464  57.795  29.493  1.00 40.72  ? 207 HOH F O   1 
HETATM 8093 O  O   . HOH OA 6 .   ? 37.627  59.813  26.723  1.00 33.49  ? 208 HOH F O   1 
HETATM 8094 O  O   . HOH OA 6 .   ? 36.712  55.756  27.721  1.00 23.84  ? 216 HOH F O   1 
HETATM 8095 O  O   . HOH OA 6 .   ? 18.767  75.783  25.759  1.00 50.98  ? 236 HOH F O   1 
HETATM 8096 O  O   . HOH OA 6 .   ? 37.919  58.727  29.381  1.00 43.82  ? 250 HOH F O   1 
HETATM 8097 O  O   . HOH OA 6 .   ? 37.710  70.087  43.032  1.00 45.27  ? 281 HOH F O   1 
HETATM 8098 O  O   . HOH OA 6 .   ? 35.023  70.990  42.901  1.00 45.15  ? 282 HOH F O   1 
HETATM 8099 O  O   . HOH PA 6 .   ? 37.236  33.980  20.218  1.00 32.07  ? 5   HOH G O   1 
HETATM 8100 O  O   . HOH PA 6 .   ? 62.610  18.903  21.417  1.00 33.74  ? 34  HOH G O   1 
HETATM 8101 O  O   . HOH PA 6 .   ? 34.228  29.648  20.998  1.00 31.66  ? 36  HOH G O   1 
HETATM 8102 O  O   . HOH PA 6 .   ? 26.620  24.488  9.635   1.00 45.23  ? 39  HOH G O   1 
HETATM 8103 O  O   . HOH PA 6 .   ? 15.663  12.807  27.718  1.00 52.86  ? 47  HOH G O   1 
HETATM 8104 O  O   . HOH PA 6 .   ? 26.283  9.452   29.010  1.00 26.79  ? 50  HOH G O   1 
HETATM 8105 O  O   . HOH PA 6 .   ? 46.517  28.476  14.089  1.00 38.22  ? 195 HOH G O   1 
HETATM 8106 O  O   . HOH PA 6 .   ? 39.723  35.280  20.076  1.00 47.09  ? 196 HOH G O   1 
HETATM 8107 O  O   . HOH PA 6 .   ? 34.665  32.230  21.620  1.00 42.39  ? 197 HOH G O   1 
HETATM 8108 O  O   . HOH PA 6 .   ? 39.977  28.244  10.219  1.00 30.41  ? 198 HOH G O   1 
HETATM 8109 O  O   . HOH PA 6 .   ? 24.385  6.482   28.269  1.00 35.07  ? 199 HOH G O   1 
HETATM 8110 O  O   . HOH PA 6 .   ? 39.441  4.212   27.951  1.00 42.33  ? 200 HOH G O   1 
HETATM 8111 O  O   . HOH PA 6 .   ? 44.914  28.629  30.091  1.00 34.54  ? 201 HOH G O   1 
HETATM 8112 O  O   . HOH PA 6 .   ? 35.007  8.118   9.992   1.00 44.79  ? 202 HOH G O   1 
HETATM 8113 O  O   . HOH PA 6 .   ? 51.115  22.696  29.322  1.00 29.25  ? 203 HOH G O   1 
HETATM 8114 O  O   . HOH PA 6 .   ? 32.176  19.301  25.451  1.00 36.27  ? 204 HOH G O   1 
HETATM 8115 O  O   . HOH PA 6 .   ? 42.403  17.092  5.226   1.00 42.20  ? 205 HOH G O   1 
HETATM 8116 O  O   . HOH PA 6 .   ? 34.381  18.316  28.867  1.00 24.07  ? 206 HOH G O   1 
HETATM 8117 O  O   . HOH PA 6 .   ? 29.939  15.447  20.941  1.00 23.90  ? 207 HOH G O   1 
HETATM 8118 O  O   . HOH PA 6 .   ? 34.962  36.978  7.496   1.00 53.51  ? 208 HOH G O   1 
HETATM 8119 O  O   . HOH PA 6 .   ? 32.503  30.206  18.905  1.00 23.80  ? 209 HOH G O   1 
HETATM 8120 O  O   . HOH PA 6 .   ? 32.835  18.283  21.950  1.00 32.10  ? 210 HOH G O   1 
HETATM 8121 O  O   . HOH PA 6 .   ? 36.881  16.286  20.531  1.00 28.18  ? 211 HOH G O   1 
HETATM 8122 O  O   . HOH PA 6 .   ? 34.022  12.309  19.029  1.00 40.14  ? 212 HOH G O   1 
HETATM 8123 O  O   . HOH PA 6 .   ? 11.505  12.679  26.211  1.00 37.78  ? 213 HOH G O   1 
HETATM 8124 O  O   . HOH PA 6 .   ? 31.553  18.060  19.421  1.00 47.95  ? 217 HOH G O   1 
HETATM 8125 O  O   . HOH PA 6 .   ? 48.291  30.232  30.228  1.00 40.56  ? 235 HOH G O   1 
HETATM 8126 O  O   . HOH PA 6 .   ? 56.358  9.854   23.364  1.00 56.68  ? 237 HOH G O   1 
HETATM 8127 O  O   . HOH PA 6 .   ? 62.785  20.468  24.057  1.00 41.55  ? 240 HOH G O   1 
HETATM 8128 O  O   . HOH PA 6 .   ? 51.529  8.039   24.637  1.00 40.31  ? 242 HOH G O   1 
HETATM 8129 O  O   . HOH PA 6 .   ? 47.021  27.652  31.126  1.00 31.40  ? 256 HOH G O   1 
HETATM 8130 O  O   . HOH PA 6 .   ? 37.076  35.240  16.496  1.00 46.66  ? 267 HOH G O   1 
HETATM 8131 O  O   . HOH PA 6 .   ? 36.265  32.916  5.779   1.00 47.00  ? 273 HOH G O   1 
HETATM 8132 O  O   . HOH QA 6 .   ? 76.651  15.135  56.022  1.00 27.01  ? 12  HOH H O   1 
HETATM 8133 O  O   . HOH QA 6 .   ? 70.314  -0.594  95.874  1.00 21.37  ? 17  HOH H O   1 
HETATM 8134 O  O   . HOH QA 6 .   ? 69.874  -0.564  92.986  1.00 38.94  ? 26  HOH H O   1 
HETATM 8135 O  O   . HOH QA 6 .   ? 99.496  18.331  64.558  1.00 29.66  ? 43  HOH H O   1 
HETATM 8136 O  O   . HOH QA 6 .   ? 87.679  19.188  62.306  1.00 43.25  ? 51  HOH H O   1 
HETATM 8137 O  O   . HOH QA 6 .   ? 85.674  19.481  49.732  1.00 47.33  ? 55  HOH H O   1 
HETATM 8138 O  O   . HOH QA 6 .   ? 105.703 15.914  51.850  1.00 37.81  ? 58  HOH H O   1 
HETATM 8139 O  O   . HOH QA 6 .   ? 65.805  -5.444  81.491  1.00 30.72  ? 59  HOH H O   1 
HETATM 8140 O  O   . HOH QA 6 .   ? 63.239  -5.331  80.961  1.00 42.66  ? 193 HOH H O   1 
HETATM 8141 O  O   . HOH QA 6 .   ? 80.002  28.233  53.479  1.00 46.04  ? 194 HOH H O   1 
HETATM 8142 O  O   . HOH QA 6 .   ? 67.990  6.225   75.073  1.00 35.49  ? 195 HOH H O   1 
HETATM 8143 O  O   . HOH QA 6 .   ? 102.367 16.275  63.085  1.00 32.32  ? 196 HOH H O   1 
HETATM 8144 O  O   . HOH QA 6 .   ? 72.498  -9.522  84.640  1.00 28.48  ? 197 HOH H O   1 
HETATM 8145 O  O   . HOH QA 6 .   ? 88.368  35.055  47.075  1.00 37.11  ? 198 HOH H O   1 
HETATM 8146 O  O   . HOH QA 6 .   ? 100.052 20.151  54.240  1.00 28.12  ? 199 HOH H O   1 
HETATM 8147 O  O   . HOH QA 6 .   ? 84.718  40.994  61.501  1.00 53.27  ? 200 HOH H O   1 
HETATM 8148 O  O   . HOH QA 6 .   ? 105.907 23.265  65.807  1.00 38.20  ? 201 HOH H O   1 
HETATM 8149 O  O   . HOH QA 6 .   ? 74.181  -2.336  80.079  1.00 49.58  ? 202 HOH H O   1 
HETATM 8150 O  O   . HOH QA 6 .   ? 99.977  26.422  55.148  1.00 39.72  ? 203 HOH H O   1 
HETATM 8151 O  O   . HOH QA 6 .   ? 83.238  26.281  54.309  1.00 36.36  ? 204 HOH H O   1 
HETATM 8152 O  O   . HOH QA 6 .   ? 65.257  -4.873  78.253  1.00 45.32  ? 205 HOH H O   1 
HETATM 8153 O  O   . HOH QA 6 .   ? 79.471  21.903  59.655  1.00 24.98  ? 206 HOH H O   1 
HETATM 8154 O  O   . HOH QA 6 .   ? 96.985  27.568  46.877  1.00 40.14  ? 207 HOH H O   1 
HETATM 8155 O  O   . HOH QA 6 .   ? 74.774  16.395  57.088  1.00 41.60  ? 208 HOH H O   1 
HETATM 8156 O  O   . HOH QA 6 .   ? 73.337  17.993  55.856  1.00 41.01  ? 209 HOH H O   1 
HETATM 8157 O  O   . HOH QA 6 .   ? 80.104  12.582  52.124  1.00 36.07  ? 210 HOH H O   1 
HETATM 8158 O  O   . HOH QA 6 .   ? 81.260  20.996  49.884  1.00 36.87  ? 211 HOH H O   1 
HETATM 8159 O  O   . HOH QA 6 .   ? 91.275  26.540  41.691  1.00 37.98  ? 212 HOH H O   1 
HETATM 8160 O  O   . HOH QA 6 .   ? 100.976 29.295  45.668  1.00 62.76  ? 253 HOH H O   1 
HETATM 8161 O  O   . HOH QA 6 .   ? 99.818  33.219  44.828  1.00 53.31  ? 254 HOH H O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . LYS A  7   ? 1.0098 0.9338 0.3277 -0.1289 -0.1399 -0.1378 66  LYS A N   
2    C CA  . LYS A  7   ? 0.9992 0.8649 0.3125 -0.1279 -0.1333 -0.0894 66  LYS A CA  
3    C C   . LYS A  7   ? 0.9643 0.7723 0.3137 -0.1182 -0.1421 -0.0799 66  LYS A C   
4    O O   . LYS A  7   ? 0.9660 0.7807 0.3200 -0.1122 -0.1578 -0.0781 66  LYS A O   
5    C CB  . LYS A  7   ? 1.0284 0.9182 0.2967 -0.1314 -0.1372 -0.0395 66  LYS A CB  
6    N N   . ILE A  8   ? 0.9391 0.6967 0.3149 -0.1164 -0.1317 -0.0746 67  ILE A N   
7    C CA  . ILE A  8   ? 0.9140 0.6280 0.3240 -0.1070 -0.1384 -0.0670 67  ILE A CA  
8    C C   . ILE A  8   ? 0.9078 0.5814 0.3093 -0.1039 -0.1378 -0.0267 67  ILE A C   
9    O O   . ILE A  8   ? 0.9158 0.5824 0.2987 -0.1103 -0.1281 -0.0087 67  ILE A O   
10   C CB  . ILE A  8   ? 0.8836 0.5802 0.3423 -0.1052 -0.1294 -0.0942 67  ILE A CB  
11   C CG1 . ILE A  8   ? 0.8819 0.5556 0.3429 -0.1093 -0.1126 -0.0849 67  ILE A CG1 
12   C CG2 . ILE A  8   ? 0.8895 0.6249 0.3677 -0.1089 -0.1288 -0.1386 67  ILE A CG2 
13   C CD1 . ILE A  8   ? 0.8637 0.5035 0.3666 -0.1024 -0.1091 -0.0786 67  ILE A CD1 
14   N N   . THR A  9   ? 0.8894 0.5386 0.3096 -0.0941 -0.1482 -0.0150 68  THR A N   
15   C CA  . THR A  9   ? 0.8885 0.5029 0.3088 -0.0895 -0.1494 0.0162  68  THR A CA  
16   C C   . THR A  9   ? 0.8548 0.4377 0.3047 -0.0862 -0.1396 0.0099  68  THR A C   
17   O O   . THR A  9   ? 0.8259 0.4096 0.3049 -0.0810 -0.1398 -0.0071 68  THR A O   
18   C CB  . THR A  9   ? 0.8966 0.5097 0.3203 -0.0798 -0.1665 0.0324  68  THR A CB  
19   O OG1 . THR A  9   ? 0.9610 0.6069 0.3531 -0.0838 -0.1747 0.0498  68  THR A OG1 
20   C CG2 . THR A  9   ? 0.8746 0.4494 0.3144 -0.0723 -0.1675 0.0547  68  THR A CG2 
21   N N   . VAL A  10  ? 0.8551 0.4161 0.3007 -0.0897 -0.1312 0.0249  69  VAL A N   
22   C CA  . VAL A  10  ? 0.8268 0.3657 0.2977 -0.0861 -0.1236 0.0205  69  VAL A CA  
23   C C   . VAL A  10  ? 0.8295 0.3421 0.3053 -0.0823 -0.1268 0.0394  69  VAL A C   
24   O O   . VAL A  10  ? 0.8584 0.3639 0.3198 -0.0879 -0.1278 0.0594  69  VAL A O   
25   C CB  . VAL A  10  ? 0.8212 0.3623 0.2916 -0.0958 -0.1077 0.0112  69  VAL A CB  
26   C CG1 . VAL A  10  ? 0.7898 0.3212 0.2877 -0.0913 -0.1014 0.0053  69  VAL A CG1 
27   C CG2 . VAL A  10  ? 0.8065 0.3741 0.2757 -0.1009 -0.1026 -0.0089 69  VAL A CG2 
28   N N   . HIS A  11  ? 0.8032 0.3058 0.3045 -0.0729 -0.1279 0.0329  70  HIS A N   
29   C CA  . HIS A  11  ? 0.8158 0.2961 0.3329 -0.0675 -0.1301 0.0404  70  HIS A CA  
30   C C   . HIS A  11  ? 0.8052 0.2832 0.3355 -0.0713 -0.1183 0.0270  70  HIS A C   
31   O O   . HIS A  11  ? 0.7769 0.2739 0.3175 -0.0686 -0.1130 0.0130  70  HIS A O   
32   C CB  . HIS A  11  ? 0.8034 0.2852 0.3406 -0.0529 -0.1397 0.0375  70  HIS A CB  
33   C CG  . HIS A  11  ? 0.8442 0.3336 0.3723 -0.0484 -0.1526 0.0483  70  HIS A CG  
34   N ND1 . HIS A  11  ? 0.8826 0.3627 0.4010 -0.0487 -0.1614 0.0708  70  HIS A ND1 
35   C CD2 . HIS A  11  ? 0.8318 0.3408 0.3638 -0.0436 -0.1589 0.0410  70  HIS A CD2 
36   C CE1 . HIS A  11  ? 0.8818 0.3791 0.3935 -0.0441 -0.1729 0.0751  70  HIS A CE1 
37   N NE2 . HIS A  11  ? 0.8735 0.3865 0.3941 -0.0413 -0.1717 0.0550  70  HIS A NE2 
38   N N   . PHE A  12  ? 0.8268 0.2853 0.3612 -0.0778 -0.1147 0.0332  71  PHE A N   
39   C CA  . PHE A  12  ? 0.8178 0.2754 0.3686 -0.0818 -0.1054 0.0179  71  PHE A CA  
40   C C   . PHE A  12  ? 0.8260 0.2693 0.4077 -0.0735 -0.1100 0.0096  71  PHE A C   
41   O O   . PHE A  12  ? 0.8548 0.2725 0.4490 -0.0734 -0.1158 0.0238  71  PHE A O   
42   C CB  . PHE A  12  ? 0.8405 0.2863 0.3838 -0.0966 -0.0977 0.0275  71  PHE A CB  
43   C CG  . PHE A  12  ? 0.8474 0.3112 0.3642 -0.1061 -0.0900 0.0299  71  PHE A CG  
44   C CD1 . PHE A  12  ? 0.8474 0.3262 0.3663 -0.1122 -0.0789 0.0157  71  PHE A CD1 
45   C CD2 . PHE A  12  ? 0.8790 0.3499 0.3713 -0.1086 -0.0937 0.0445  71  PHE A CD2 
46   C CE1 . PHE A  12  ? 0.8743 0.3696 0.3752 -0.1201 -0.0710 0.0155  71  PHE A CE1 
47   C CE2 . PHE A  12  ? 0.8915 0.3838 0.3630 -0.1169 -0.0858 0.0404  71  PHE A CE2 
48   C CZ  . PHE A  12  ? 0.8713 0.3730 0.3490 -0.1223 -0.0741 0.0256  71  PHE A CZ  
49   N N   . ILE A  13  ? 0.8049 0.2689 0.4031 -0.0666 -0.1072 -0.0130 72  ILE A N   
50   C CA  . ILE A  13  ? 0.8165 0.2745 0.4476 -0.0596 -0.1096 -0.0308 72  ILE A CA  
51   C C   . ILE A  13  ? 0.8393 0.2931 0.4841 -0.0714 -0.1015 -0.0448 72  ILE A C   
52   O O   . ILE A  13  ? 0.8344 0.3170 0.4722 -0.0762 -0.0936 -0.0581 72  ILE A O   
53   C CB  . ILE A  13  ? 0.7898 0.2844 0.4318 -0.0457 -0.1106 -0.0498 72  ILE A CB  
54   C CG1 . ILE A  13  ? 0.7863 0.2844 0.4179 -0.0358 -0.1187 -0.0335 72  ILE A CG1 
55   C CG2 . ILE A  13  ? 0.7629 0.2590 0.4407 -0.0373 -0.1128 -0.0755 72  ILE A CG2 
56   C CD1 . ILE A  13  ? 0.7700 0.3083 0.4149 -0.0221 -0.1194 -0.0459 72  ILE A CD1 
57   N N   . ASN A  14  ? 0.8733 0.2925 0.5425 -0.0763 -0.1039 -0.0391 73  ASN A N   
58   C CA  . ASN A  14  ? 0.8946 0.3040 0.5847 -0.0890 -0.0975 -0.0497 73  ASN A CA  
59   C C   . ASN A  14  ? 0.8876 0.3202 0.6113 -0.0841 -0.0959 -0.0924 73  ASN A C   
60   O O   . ASN A  14  ? 0.8677 0.3211 0.6019 -0.0695 -0.1001 -0.1115 73  ASN A O   
61   C CB  . ASN A  14  ? 0.9510 0.3168 0.6694 -0.0938 -0.1022 -0.0256 73  ASN A CB  
62   C CG  . ASN A  14  ? 1.0074 0.3584 0.7355 -0.1119 -0.0949 -0.0143 73  ASN A CG  
63   O OD1 . ASN A  14  ? 1.0432 0.4151 0.7487 -0.1216 -0.0861 -0.0227 73  ASN A OD1 
64   N ND2 . ASN A  14  ? 1.0581 0.3740 0.8258 -0.1165 -0.0985 0.0083  73  ASN A ND2 
65   N N   . ARG A  15  ? 0.8963 0.3303 0.6387 -0.0965 -0.0898 -0.1090 74  ARG A N   
66   C CA  . ARG A  15  ? 0.8967 0.3607 0.6726 -0.0941 -0.0885 -0.1549 74  ARG A CA  
67   C C   . ARG A  15  ? 0.9260 0.3721 0.7547 -0.0833 -0.0957 -0.1791 74  ARG A C   
68   O O   . ARG A  15  ? 0.9100 0.3943 0.7591 -0.0742 -0.0963 -0.2204 74  ARG A O   
69   C CB  . ARG A  15  ? 0.9006 0.3654 0.6919 -0.1115 -0.0818 -0.1671 74  ARG A CB  
70   C CG  . ARG A  15  ? 0.8724 0.3542 0.6189 -0.1223 -0.0736 -0.1448 74  ARG A CG  
71   C CD  . ARG A  15  ? 0.8586 0.3595 0.6193 -0.1372 -0.0668 -0.1644 74  ARG A CD  
72   N NE  . ARG A  15  ? 0.8379 0.3599 0.5574 -0.1443 -0.0588 -0.1432 74  ARG A NE  
73   C CZ  . ARG A  15  ? 0.8395 0.3406 0.5481 -0.1586 -0.0525 -0.1193 74  ARG A CZ  
74   N NH1 . ARG A  15  ? 0.8920 0.3522 0.6285 -0.1695 -0.0529 -0.1088 74  ARG A NH1 
75   N NH2 . ARG A  15  ? 0.7839 0.3091 0.4591 -0.1621 -0.0452 -0.1051 74  ARG A NH2 
76   N N   . ASP A  16  ? 0.9687 0.3623 0.8216 -0.0841 -0.1010 -0.1520 75  ASP A N   
77   C CA  . ASP A  16  ? 1.0066 0.3758 0.9151 -0.0723 -0.1085 -0.1656 75  ASP A CA  
78   C C   . ASP A  16  ? 0.9898 0.3783 0.8835 -0.0526 -0.1142 -0.1681 75  ASP A C   
79   O O   . ASP A  16  ? 1.0112 0.3936 0.9524 -0.0403 -0.1192 -0.1915 75  ASP A O   
80   C CB  . ASP A  16  ? 1.0511 0.3634 0.9886 -0.0785 -0.1128 -0.1224 75  ASP A CB  
81   C CG  . ASP A  16  ? 1.1074 0.3960 1.0811 -0.0971 -0.1079 -0.1193 75  ASP A CG  
82   O OD1 . ASP A  16  ? 1.1515 0.4518 1.1671 -0.1014 -0.1051 -0.1654 75  ASP A OD1 
83   O OD2 . ASP A  16  ? 1.1832 0.4461 1.1458 -0.1077 -0.1071 -0.0703 75  ASP A OD2 
84   N N   . GLY A  17  ? 0.9609 0.3713 0.7957 -0.0497 -0.1136 -0.1442 76  GLY A N   
85   C CA  . GLY A  17  ? 0.9429 0.3745 0.7647 -0.0323 -0.1188 -0.1437 76  GLY A CA  
86   C C   . GLY A  17  ? 0.9511 0.3494 0.7581 -0.0289 -0.1265 -0.1000 76  GLY A C   
87   O O   . GLY A  17  ? 0.9301 0.3407 0.7298 -0.0153 -0.1320 -0.0955 76  GLY A O   
88   N N   . GLU A  18  ? 0.9749 0.3382 0.7765 -0.0419 -0.1266 -0.0672 77  GLU A N   
89   C CA  . GLU A  18  ? 0.9971 0.3332 0.7905 -0.0408 -0.1344 -0.0235 77  GLU A CA  
90   C C   . GLU A  18  ? 0.9715 0.3262 0.7025 -0.0465 -0.1332 0.0009  77  GLU A C   
91   O O   . GLU A  18  ? 0.9620 0.3324 0.6655 -0.0575 -0.1246 -0.0049 77  GLU A O   
92   C CB  . GLU A  18  ? 1.0426 0.3411 0.8718 -0.0528 -0.1338 -0.0018 77  GLU A CB  
93   C CG  . GLU A  18  ? 1.1013 0.3810 0.9201 -0.0562 -0.1402 0.0518  77  GLU A CG  
94   C CD  . GLU A  18  ? 1.1764 0.4217 1.0489 -0.0664 -0.1398 0.0773  77  GLU A CD  
95   O OE1 . GLU A  18  ? 1.2205 0.4525 1.1392 -0.0719 -0.1344 0.0484  77  GLU A OE1 
96   O OE2 . GLU A  18  ? 1.2106 0.4467 1.0826 -0.0691 -0.1451 0.1273  77  GLU A OE2 
97   N N   . THR A  19  ? 0.9629 0.3186 0.6752 -0.0391 -0.1418 0.0254  78  THR A N   
98   C CA  . THR A  19  ? 0.9366 0.3122 0.5972 -0.0446 -0.1415 0.0420  78  THR A CA  
99   C C   . THR A  19  ? 0.9569 0.3213 0.5996 -0.0567 -0.1423 0.0776  78  THR A C   
100  O O   . THR A  19  ? 0.9913 0.3382 0.6541 -0.0546 -0.1498 0.1051  78  THR A O   
101  C CB  . THR A  19  ? 0.9275 0.3193 0.5759 -0.0318 -0.1508 0.0465  78  THR A CB  
102  O OG1 . THR A  19  ? 0.8883 0.3055 0.5422 -0.0226 -0.1476 0.0177  78  THR A OG1 
103  C CG2 . THR A  19  ? 0.9175 0.3257 0.5227 -0.0391 -0.1524 0.0644  78  THR A CG2 
104  N N   . LEU A  20  ? 0.9460 0.3257 0.5539 -0.0691 -0.1341 0.0788  79  LEU A N   
105  C CA  . LEU A  20  ? 0.9691 0.3528 0.5525 -0.0804 -0.1337 0.1108  79  LEU A CA  
106  C C   . LEU A  20  ? 0.9542 0.3687 0.4959 -0.0791 -0.1365 0.1090  79  LEU A C   
107  O O   . LEU A  20  ? 0.9171 0.3468 0.4474 -0.0784 -0.1311 0.0835  79  LEU A O   
108  C CB  . LEU A  20  ? 0.9739 0.3568 0.5523 -0.0961 -0.1210 0.1094  79  LEU A CB  
109  C CG  . LEU A  20  ? 1.0067 0.3613 0.6308 -0.1016 -0.1168 0.1077  79  LEU A CG  
110  C CD1 . LEU A  20  ? 1.0087 0.3548 0.6662 -0.0903 -0.1186 0.0724  79  LEU A CD1 
111  C CD2 . LEU A  20  ? 1.0086 0.3698 0.6225 -0.1173 -0.1039 0.1024  79  LEU A CD2 
112  N N   . THR A  21  ? 0.9797 0.4073 0.5041 -0.0789 -0.1453 0.1361  80  THR A N   
113  C CA  . THR A  21  ? 0.9683 0.4294 0.4575 -0.0789 -0.1491 0.1301  80  THR A CA  
114  C C   . THR A  21  ? 0.9912 0.4777 0.4492 -0.0920 -0.1442 0.1474  80  THR A C   
115  O O   . THR A  21  ? 1.0188 0.5042 0.4807 -0.0965 -0.1461 0.1815  80  THR A O   
116  C CB  . THR A  21  ? 0.9728 0.4421 0.4647 -0.0675 -0.1645 0.1423  80  THR A CB  
117  O OG1 . THR A  21  ? 0.9591 0.4083 0.4821 -0.0546 -0.1679 0.1261  80  THR A OG1 
118  C CG2 . THR A  21  ? 0.9667 0.4731 0.4285 -0.0687 -0.1686 0.1290  80  THR A CG2 
119  N N   . THR A  22  ? 0.9829 0.4958 0.4152 -0.0978 -0.1374 0.1247  81  THR A N   
120  C CA  . THR A  22  ? 1.0102 0.5555 0.4122 -0.1101 -0.1307 0.1344  81  THR A CA  
121  C C   . THR A  22  ? 1.0022 0.5840 0.3822 -0.1110 -0.1298 0.1039  81  THR A C   
122  O O   . THR A  22  ? 0.9774 0.5526 0.3722 -0.1035 -0.1329 0.0782  81  THR A O   
123  C CB  . THR A  22  ? 1.0062 0.5364 0.4148 -0.1210 -0.1155 0.1351  81  THR A CB  
124  O OG1 . THR A  22  ? 1.0371 0.6020 0.4182 -0.1327 -0.1088 0.1518  81  THR A OG1 
125  C CG2 . THR A  22  ? 0.9687 0.4912 0.3857 -0.1206 -0.1060 0.0980  81  THR A CG2 
126  N N   . LYS A  23  ? 1.0299 0.6536 0.3802 -0.1202 -0.1255 0.1066  82  LYS A N   
127  C CA  . LYS A  23  ? 1.0347 0.6983 0.3698 -0.1216 -0.1246 0.0722  82  LYS A CA  
128  C C   . LYS A  23  ? 1.0344 0.7161 0.3598 -0.1320 -0.1078 0.0540  82  LYS A C   
129  O O   . LYS A  23  ? 1.0525 0.7430 0.3631 -0.1408 -0.0995 0.0778  82  LYS A O   
130  C CB  . LYS A  23  ? 1.0696 0.7845 0.3774 -0.1215 -0.1367 0.0828  82  LYS A CB  
131  C CG  . LYS A  23  ? 1.0922 0.7982 0.4128 -0.1101 -0.1542 0.0878  82  LYS A CG  
132  C CD  . LYS A  23  ? 1.1603 0.9159 0.4545 -0.1105 -0.1669 0.1164  82  LYS A CD  
133  C CE  . LYS A  23  ? 1.1811 0.9340 0.4884 -0.0991 -0.1855 0.1205  82  LYS A CE  
134  N NZ  . LYS A  23  ? 1.1784 0.9767 0.4783 -0.0980 -0.1944 0.0813  82  LYS A NZ  
135  N N   . GLY A  24  ? 1.0144 0.7017 0.3547 -0.1307 -0.1026 0.0138  83  GLY A N   
136  C CA  . GLY A  24  ? 1.0098 0.7155 0.3496 -0.1386 -0.0865 -0.0094 83  GLY A CA  
137  C C   . GLY A  24  ? 1.0157 0.7664 0.3565 -0.1389 -0.0865 -0.0508 83  GLY A C   
138  O O   . GLY A  24  ? 1.0040 0.7577 0.3624 -0.1319 -0.0976 -0.0703 83  GLY A O   
139  N N   . LYS A  25  ? 1.0323 0.8206 0.3589 -0.1470 -0.0738 -0.0667 84  LYS A N   
140  C CA  . LYS A  25  ? 1.0451 0.8777 0.3818 -0.1474 -0.0715 -0.1149 84  LYS A CA  
141  C C   . LYS A  25  ? 1.0065 0.8070 0.3979 -0.1428 -0.0654 -0.1446 84  LYS A C   
142  O O   . LYS A  25  ? 0.9938 0.7556 0.4022 -0.1430 -0.0567 -0.1289 84  LYS A O   
143  C CB  . LYS A  25  ? 1.0766 0.9627 0.3854 -0.1567 -0.0576 -0.1247 84  LYS A CB  
144  C CG  . LYS A  25  ? 1.1345 1.0658 0.3913 -0.1624 -0.0615 -0.0881 84  LYS A CG  
145  C CD  . LYS A  25  ? 1.1661 1.1213 0.4009 -0.1725 -0.0440 -0.0699 84  LYS A CD  
146  C CE  . LYS A  25  ? 1.2221 1.2604 0.4090 -0.1784 -0.0456 -0.0526 84  LYS A CE  
147  N NZ  . LYS A  25  ? 1.2355 1.3059 0.4021 -0.1887 -0.0281 -0.0309 84  LYS A NZ  
148  N N   . VAL A  26  ? 0.9965 0.8165 0.4210 -0.1390 -0.0701 -0.1862 85  VAL A N   
149  C CA  . VAL A  26  ? 0.9610 0.7582 0.4482 -0.1352 -0.0629 -0.2121 85  VAL A CA  
150  C C   . VAL A  26  ? 0.9506 0.7543 0.4431 -0.1410 -0.0435 -0.2197 85  VAL A C   
151  O O   . VAL A  26  ? 0.9707 0.8132 0.4249 -0.1481 -0.0357 -0.2245 85  VAL A O   
152  C CB  . VAL A  26  ? 0.9714 0.7952 0.5027 -0.1320 -0.0701 -0.2605 85  VAL A CB  
153  C CG1 . VAL A  26  ? 0.9447 0.7489 0.5532 -0.1288 -0.0604 -0.2845 85  VAL A CG1 
154  C CG2 . VAL A  26  ? 0.9680 0.7815 0.5017 -0.1260 -0.0895 -0.2506 85  VAL A CG2 
155  N N   . GLY A  27  ? 0.9114 0.6807 0.4504 -0.1379 -0.0358 -0.2152 86  GLY A N   
156  C CA  . GLY A  27  ? 0.9009 0.6736 0.4535 -0.1423 -0.0178 -0.2202 86  GLY A CA  
157  C C   . GLY A  27  ? 0.8917 0.6456 0.4063 -0.1480 -0.0107 -0.1809 86  GLY A C   
158  O O   . GLY A  27  ? 0.8807 0.6265 0.4155 -0.1503 0.0020  -0.1776 86  GLY A O   
159  N N   . ASP A  28  ? 0.8981 0.6462 0.3635 -0.1505 -0.0192 -0.1512 87  ASP A N   
160  C CA  . ASP A  28  ? 0.8933 0.6193 0.3342 -0.1561 -0.0140 -0.1152 87  ASP A CA  
161  C C   . ASP A  28  ? 0.8521 0.5375 0.3272 -0.1506 -0.0151 -0.1018 87  ASP A C   
162  O O   . ASP A  28  ? 0.8329 0.5038 0.3344 -0.1419 -0.0248 -0.1050 87  ASP A O   
163  C CB  . ASP A  28  ? 0.9197 0.6449 0.3156 -0.1585 -0.0245 -0.0839 87  ASP A CB  
164  C CG  . ASP A  28  ? 0.9852 0.7611 0.3406 -0.1663 -0.0204 -0.0835 87  ASP A CG  
165  O OD1 . ASP A  28  ? 1.0160 0.8179 0.3684 -0.1732 -0.0053 -0.0946 87  ASP A OD1 
166  O OD2 . ASP A  28  ? 1.0264 0.8216 0.3535 -0.1654 -0.0321 -0.0697 87  ASP A OD2 
167  N N   . SER A  29  ? 0.8354 0.5092 0.3106 -0.1561 -0.0051 -0.0865 88  SER A N   
168  C CA  . SER A  29  ? 0.8096 0.4554 0.3078 -0.1522 -0.0067 -0.0714 88  SER A CA  
169  C C   . SER A  29  ? 0.8152 0.4364 0.2897 -0.1510 -0.0183 -0.0471 88  SER A C   
170  O O   . SER A  29  ? 0.8413 0.4649 0.2832 -0.1548 -0.0231 -0.0350 88  SER A O   
171  C CB  . SER A  29  ? 0.8040 0.4518 0.3097 -0.1596 0.0069  -0.0659 88  SER A CB  
172  O OG  . SER A  29  ? 0.8524 0.4887 0.3269 -0.1682 0.0071  -0.0441 88  SER A OG  
173  N N   . LEU A  30  ? 0.7878 0.3901 0.2824 -0.1453 -0.0224 -0.0390 89  LEU A N   
174  C CA  . LEU A  30  ? 0.7943 0.3739 0.2758 -0.1428 -0.0326 -0.0219 89  LEU A CA  
175  C C   . LEU A  30  ? 0.8107 0.3798 0.2781 -0.1533 -0.0270 -0.0071 89  LEU A C   
176  O O   . LEU A  30  ? 0.8391 0.3925 0.2932 -0.1547 -0.0338 0.0094  89  LEU A O   
177  C CB  . LEU A  30  ? 0.7710 0.3429 0.2796 -0.1326 -0.0385 -0.0222 89  LEU A CB  
178  C CG  . LEU A  30  ? 0.7441 0.3207 0.2659 -0.1221 -0.0483 -0.0284 89  LEU A CG  
179  C CD1 . LEU A  30  ? 0.7304 0.3146 0.2860 -0.1139 -0.0486 -0.0282 89  LEU A CD1 
180  C CD2 . LEU A  30  ? 0.7675 0.3288 0.2697 -0.1177 -0.0614 -0.0184 89  LEU A CD2 
181  N N   . LEU A  31  ? 0.8034 0.3822 0.2790 -0.1610 -0.0146 -0.0114 90  LEU A N   
182  C CA  . LEU A  31  ? 0.8181 0.3912 0.2825 -0.1734 -0.0080 0.0028  90  LEU A CA  
183  C C   . LEU A  31  ? 0.8581 0.4426 0.2926 -0.1790 -0.0080 0.0158  90  LEU A C   
184  O O   . LEU A  31  ? 0.8741 0.4467 0.2999 -0.1845 -0.0113 0.0392  90  LEU A O   
185  C CB  . LEU A  31  ? 0.7963 0.3862 0.2725 -0.1811 0.0061  -0.0052 90  LEU A CB  
186  C CG  . LEU A  31  ? 0.8031 0.3921 0.2719 -0.1953 0.0145  0.0091  90  LEU A CG  
187  C CD1 . LEU A  31  ? 0.8095 0.3716 0.2927 -0.1983 0.0081  0.0193  90  LEU A CD1 
188  C CD2 . LEU A  31  ? 0.7587 0.3694 0.2398 -0.2017 0.0286  -0.0008 90  LEU A CD2 
189  N N   . ASP A  32  ? 0.8723 0.4850 0.2961 -0.1775 -0.0042 0.0005  91  ASP A N   
190  C CA  . ASP A  32  ? 0.9208 0.5610 0.3130 -0.1826 -0.0036 0.0094  91  ASP A CA  
191  C C   . ASP A  32  ? 0.9409 0.5669 0.3198 -0.1788 -0.0183 0.0331  91  ASP A C   
192  O O   . ASP A  32  ? 0.9691 0.5977 0.3348 -0.1861 -0.0184 0.0632  91  ASP A O   
193  C CB  . ASP A  32  ? 0.9193 0.5961 0.3073 -0.1789 -0.0003 -0.0208 91  ASP A CB  
194  C CG  . ASP A  32  ? 0.9370 0.6392 0.3337 -0.1854 0.0168  -0.0386 91  ASP A CG  
195  O OD1 . ASP A  32  ? 0.9589 0.6517 0.3606 -0.1932 0.0258  -0.0248 91  ASP A OD1 
196  O OD2 . ASP A  32  ? 0.9809 0.7141 0.3837 -0.1827 0.0215  -0.0688 91  ASP A OD2 
197  N N   . VAL A  33  ? 0.9254 0.5363 0.3150 -0.1672 -0.0302 0.0228  92  VAL A N   
198  C CA  . VAL A  33  ? 0.9387 0.5359 0.3215 -0.1614 -0.0449 0.0432  92  VAL A CA  
199  C C   . VAL A  33  ? 0.9559 0.5218 0.3507 -0.1654 -0.0468 0.0719  92  VAL A C   
200  O O   . VAL A  33  ? 0.9962 0.5663 0.3808 -0.1691 -0.0511 0.1021  92  VAL A O   
201  C CB  . VAL A  33  ? 0.9101 0.4925 0.3102 -0.1484 -0.0560 0.0278  92  VAL A CB  
202  C CG1 . VAL A  33  ? 0.9209 0.4884 0.3171 -0.1425 -0.0703 0.0506  92  VAL A CG1 
203  C CG2 . VAL A  33  ? 0.8824 0.4942 0.2812 -0.1447 -0.0565 0.0000  92  VAL A CG2 
204  N N   . VAL A  34  ? 0.9344 0.4739 0.3558 -0.1647 -0.0435 0.0624  93  VAL A N   
205  C CA  . VAL A  34  ? 0.9470 0.4570 0.3906 -0.1689 -0.0449 0.0801  93  VAL A CA  
206  C C   . VAL A  34  ? 0.9896 0.5082 0.4262 -0.1825 -0.0380 0.1092  93  VAL A C   
207  O O   . VAL A  34  ? 1.0143 0.5196 0.4620 -0.1841 -0.0443 0.1392  93  VAL A O   
208  C CB  . VAL A  34  ? 0.9214 0.4185 0.3914 -0.1697 -0.0390 0.0589  93  VAL A CB  
209  C CG1 . VAL A  34  ? 0.9218 0.3935 0.4204 -0.1778 -0.0383 0.0716  93  VAL A CG1 
210  C CG2 . VAL A  34  ? 0.8689 0.3625 0.3512 -0.1558 -0.0464 0.0379  93  VAL A CG2 
211  N N   . VAL A  35  ? 1.0005 0.5444 0.4238 -0.1918 -0.0248 0.1026  94  VAL A N   
212  C CA  . VAL A  35  ? 1.0439 0.6023 0.4633 -0.2057 -0.0159 0.1305  94  VAL A CA  
213  C C   . VAL A  35  ? 1.0969 0.6867 0.4894 -0.2067 -0.0201 0.1612  94  VAL A C   
214  O O   . VAL A  35  ? 1.1281 0.7103 0.5345 -0.2117 -0.0237 0.2001  94  VAL A O   
215  C CB  . VAL A  35  ? 1.0339 0.6184 0.4446 -0.2142 0.0000  0.1140  94  VAL A CB  
216  C CG1 . VAL A  35  ? 1.0475 0.6621 0.4457 -0.2276 0.0096  0.1449  94  VAL A CG1 
217  C CG2 . VAL A  35  ? 1.0036 0.5633 0.4454 -0.2164 0.0043  0.0950  94  VAL A CG2 
218  N N   . GLU A  36  ? 1.1131 0.7417 0.4726 -0.2020 -0.0203 0.1437  95  GLU A N   
219  C CA  . GLU A  36  ? 1.1612 0.8362 0.4897 -0.2028 -0.0246 0.1680  95  GLU A CA  
220  C C   . GLU A  36  ? 1.1858 0.8443 0.5237 -0.1969 -0.0404 0.2031  95  GLU A C   
221  O O   . GLU A  36  ? 1.2178 0.9097 0.5437 -0.2014 -0.0426 0.2430  95  GLU A O   
222  C CB  . GLU A  36  ? 1.1586 0.8763 0.4583 -0.1968 -0.0248 0.1309  95  GLU A CB  
223  C CG  . GLU A  36  ? 1.1811 0.9364 0.4691 -0.2038 -0.0078 0.1042  95  GLU A CG  
224  C CD  . GLU A  36  ? 1.2426 1.0547 0.5049 -0.1995 -0.0084 0.0712  95  GLU A CD  
225  O OE1 . GLU A  36  ? 1.2962 1.1670 0.5271 -0.2035 -0.0087 0.0877  95  GLU A OE1 
226  O OE2 . GLU A  36  ? 1.2596 1.0623 0.5375 -0.1923 -0.0086 0.0284  95  GLU A OE2 
227  N N   . ASN A  37  ? 1.1768 0.7888 0.5391 -0.1865 -0.0510 0.1906  96  ASN A N   
228  C CA  . ASN A  37  ? 1.2006 0.7926 0.5806 -0.1795 -0.0657 0.2217  96  ASN A CA  
229  C C   . ASN A  37  ? 1.2130 0.7537 0.6437 -0.1821 -0.0665 0.2428  96  ASN A C   
230  O O   . ASN A  37  ? 1.2205 0.7348 0.6784 -0.1740 -0.0783 0.2592  96  ASN A O   
231  C CB  . ASN A  37  ? 1.1787 0.7594 0.5559 -0.1646 -0.0784 0.1945  96  ASN A CB  
232  C CG  . ASN A  37  ? 1.1724 0.8017 0.5115 -0.1620 -0.0799 0.1713  96  ASN A CG  
233  O OD1 . ASN A  37  ? 1.1510 0.7746 0.4914 -0.1557 -0.0801 0.1325  96  ASN A OD1 
234  N ND2 . ASN A  37  ? 1.2041 0.8864 0.5139 -0.1669 -0.0811 0.1949  96  ASN A ND2 
235  N N   . ASN A  38  ? 1.2151 0.7430 0.6641 -0.1933 -0.0542 0.2397  97  ASN A N   
236  C CA  . ASN A  38  ? 1.2328 0.7178 0.7367 -0.1982 -0.0546 0.2573  97  ASN A CA  
237  C C   . ASN A  38  ? 1.2200 0.6610 0.7594 -0.1854 -0.0660 0.2380  97  ASN A C   
238  O O   . ASN A  38  ? 1.2384 0.6542 0.8195 -0.1827 -0.0741 0.2644  97  ASN A O   
239  C CB  . ASN A  38  ? 1.2796 0.7769 0.8026 -0.2058 -0.0562 0.3174  97  ASN A CB  
240  C CG  . ASN A  38  ? 1.3095 0.8571 0.8025 -0.2194 -0.0434 0.3406  97  ASN A CG  
241  O OD1 . ASN A  38  ? 1.3189 0.9181 0.7594 -0.2178 -0.0417 0.3362  97  ASN A OD1 
242  N ND2 . ASN A  38  ? 1.3389 0.8757 0.8685 -0.2332 -0.0342 0.3633  97  ASN A ND2 
243  N N   . LEU A  39  ? 1.1869 0.6226 0.7142 -0.1770 -0.0664 0.1932  98  LEU A N   
244  C CA  . LEU A  39  ? 1.1776 0.5815 0.7362 -0.1644 -0.0758 0.1722  98  LEU A CA  
245  C C   . LEU A  39  ? 1.1823 0.5569 0.7906 -0.1709 -0.0713 0.1593  98  LEU A C   
246  O O   . LEU A  39  ? 1.1789 0.5619 0.7834 -0.1804 -0.0608 0.1417  98  LEU A O   
247  C CB  . LEU A  39  ? 1.1359 0.5516 0.6700 -0.1539 -0.0769 0.1331  98  LEU A CB  
248  C CG  . LEU A  39  ? 1.1299 0.5787 0.6187 -0.1497 -0.0794 0.1337  98  LEU A CG  
249  C CD1 . LEU A  39  ? 1.0818 0.5336 0.5677 -0.1382 -0.0819 0.0985  98  LEU A CD1 
250  C CD2 . LEU A  39  ? 1.1358 0.5925 0.6163 -0.1450 -0.0909 0.1671  98  LEU A CD2 
251  N N   . ASP A  40  ? 1.1966 0.5393 0.8562 -0.1659 -0.0794 0.1660  99  ASP A N   
252  C CA  . ASP A  40  ? 1.1993 0.5160 0.9154 -0.1722 -0.0762 0.1474  99  ASP A CA  
253  C C   . ASP A  40  ? 1.1584 0.4830 0.8696 -0.1654 -0.0746 0.0932  99  ASP A C   
254  O O   . ASP A  40  ? 1.1498 0.4654 0.8819 -0.1520 -0.0822 0.0691  99  ASP A O   
255  C CB  . ASP A  40  ? 1.2334 0.5145 1.0168 -0.1677 -0.0854 0.1657  99  ASP A CB  
256  C CG  . ASP A  40  ? 1.2708 0.5264 1.1232 -0.1811 -0.0806 0.1647  99  ASP A CG  
257  O OD1 . ASP A  40  ? 1.2757 0.5436 1.1181 -0.1957 -0.0702 0.1601  99  ASP A OD1 
258  O OD2 . ASP A  40  ? 1.3128 0.5359 1.2360 -0.1771 -0.0875 0.1679  99  ASP A OD2 
259  N N   . ILE A  41  ? 1.1275 0.4753 0.8110 -0.1741 -0.0643 0.0770  100 ILE A N   
260  C CA  . ILE A  41  ? 1.0877 0.4532 0.7704 -0.1701 -0.0614 0.0325  100 ILE A CA  
261  C C   . ILE A  41  ? 1.0858 0.4551 0.7889 -0.1862 -0.0520 0.0227  100 ILE A C   
262  O O   . ILE A  41  ? 1.0927 0.4769 0.7689 -0.1966 -0.0432 0.0383  100 ILE A O   
263  C CB  . ILE A  41  ? 1.0504 0.4484 0.6805 -0.1630 -0.0588 0.0246  100 ILE A CB  
264  C CG1 . ILE A  41  ? 1.0413 0.4371 0.6527 -0.1489 -0.0684 0.0358  100 ILE A CG1 
265  C CG2 . ILE A  41  ? 1.0199 0.4437 0.6547 -0.1576 -0.0566 -0.0130 100 ILE A CG2 
266  C CD1 . ILE A  41  ? 1.0073 0.4279 0.5735 -0.1473 -0.0656 0.0423  100 ILE A CD1 
267  N N   . ASP A  42  ? 1.0848 0.4436 0.8387 -0.1886 -0.0540 -0.0049 101 ASP A N   
268  C CA  . ASP A  42  ? 1.0883 0.4493 0.8700 -0.2056 -0.0463 -0.0133 101 ASP A CA  
269  C C   . ASP A  42  ? 1.0413 0.4420 0.7838 -0.2101 -0.0372 -0.0280 101 ASP A C   
270  O O   . ASP A  42  ? 1.0183 0.4479 0.7451 -0.2004 -0.0385 -0.0560 101 ASP A O   
271  C CB  . ASP A  42  ? 1.1018 0.4517 0.9499 -0.2064 -0.0512 -0.0520 101 ASP A CB  
272  C CG  . ASP A  42  ? 1.1636 0.4691 1.0715 -0.2048 -0.0589 -0.0359 101 ASP A CG  
273  O OD1 . ASP A  42  ? 1.2017 0.4897 1.0938 -0.1996 -0.0623 0.0058  101 ASP A OD1 
274  O OD2 . ASP A  42  ? 1.1879 0.4791 1.1641 -0.2086 -0.0619 -0.0662 101 ASP A OD2 
275  N N   . GLY A  43  ? 1.0283 0.4343 0.7590 -0.2246 -0.0276 -0.0062 102 GLY A N   
276  C CA  . GLY A  43  ? 0.9901 0.4311 0.7020 -0.2313 -0.0183 -0.0219 102 GLY A CA  
277  C C   . GLY A  43  ? 0.9453 0.4168 0.6061 -0.2220 -0.0143 -0.0211 102 GLY A C   
278  O O   . GLY A  43  ? 0.9213 0.4239 0.5739 -0.2252 -0.0074 -0.0340 102 GLY A O   
279  N N   . PHE A  44  ? 0.9268 0.3903 0.5596 -0.2111 -0.0187 -0.0050 103 PHE A N   
280  C CA  . PHE A  44  ? 0.8879 0.3766 0.4853 -0.2007 -0.0170 -0.0084 103 PHE A CA  
281  C C   . PHE A  44  ? 0.8791 0.3846 0.4505 -0.2089 -0.0056 0.0062  103 PHE A C   
282  O O   . PHE A  44  ? 0.9046 0.4012 0.4626 -0.2151 -0.0031 0.0302  103 PHE A O   
283  C CB  . PHE A  44  ? 0.8945 0.3676 0.4777 -0.1879 -0.0267 0.0021  103 PHE A CB  
284  C CG  . PHE A  44  ? 0.8412 0.3361 0.4006 -0.1760 -0.0277 -0.0042 103 PHE A CG  
285  C CD1 . PHE A  44  ? 0.8062 0.3159 0.3764 -0.1640 -0.0330 -0.0234 103 PHE A CD1 
286  C CD2 . PHE A  44  ? 0.8454 0.3496 0.3766 -0.1765 -0.0236 0.0082  103 PHE A CD2 
287  C CE1 . PHE A  44  ? 0.7711 0.3005 0.3288 -0.1533 -0.0341 -0.0246 103 PHE A CE1 
288  C CE2 . PHE A  44  ? 0.8177 0.3401 0.3388 -0.1656 -0.0252 0.0000  103 PHE A CE2 
289  C CZ  . PHE A  44  ? 0.7582 0.2907 0.2948 -0.1545 -0.0304 -0.0135 103 PHE A CZ  
290  N N   . GLY A  45  ? 0.8420 0.3774 0.4100 -0.2087 0.0016  -0.0073 104 GLY A N   
291  C CA  . GLY A  45  ? 0.8314 0.3861 0.3814 -0.2150 0.0134  0.0009  104 GLY A CA  
292  C C   . GLY A  45  ? 0.8393 0.3982 0.3988 -0.2318 0.0237  0.0090  104 GLY A C   
293  O O   . GLY A  45  ? 0.8521 0.4170 0.3942 -0.2387 0.0317  0.0253  104 GLY A O   
294  N N   . ALA A  46  ? 0.8268 0.3881 0.4148 -0.2384 0.0234  -0.0039 105 ALA A N   
295  C CA  . ALA A  46  ? 0.8327 0.4022 0.4368 -0.2548 0.0328  0.0001  105 ALA A CA  
296  C C   . ALA A  46  ? 0.8289 0.4266 0.4163 -0.2591 0.0467  0.0066  105 ALA A C   
297  O O   . ALA A  46  ? 0.8480 0.4467 0.4326 -0.2713 0.0555  0.0242  105 ALA A O   
298  C CB  . ALA A  46  ? 0.8144 0.3968 0.4499 -0.2580 0.0296  -0.0238 105 ALA A CB  
299  N N   . CYS A  47  ? 0.8071 0.4301 0.3885 -0.2490 0.0493  -0.0058 106 CYS A N   
300  C CA  . CYS A  47  ? 0.8118 0.4630 0.3891 -0.2518 0.0628  -0.0048 106 CYS A CA  
301  C C   . CYS A  47  ? 0.8323 0.4856 0.3827 -0.2481 0.0683  0.0029  106 CYS A C   
302  O O   . CYS A  47  ? 0.8230 0.5012 0.3727 -0.2485 0.0799  -0.0012 106 CYS A O   
303  C CB  . CYS A  47  ? 0.7785 0.4591 0.3731 -0.2424 0.0636  -0.0183 106 CYS A CB  
304  S SG  . CYS A  47  ? 0.7998 0.4829 0.3888 -0.2234 0.0584  -0.0225 106 CYS A SG  
305  N N   . GLU A  48  ? 0.8605 0.4921 0.3918 -0.2439 0.0597  0.0117  107 GLU A N   
306  C CA  . GLU A  48  ? 0.8865 0.5265 0.3897 -0.2412 0.0626  0.0181  107 GLU A CA  
307  C C   . GLU A  48  ? 0.8631 0.5223 0.3674 -0.2289 0.0650  -0.0021 107 GLU A C   
308  O O   . GLU A  48  ? 0.8654 0.5468 0.3564 -0.2283 0.0727  -0.0083 107 GLU A O   
309  C CB  . GLU A  48  ? 0.9207 0.5791 0.4121 -0.2551 0.0750  0.0351  107 GLU A CB  
310  C CG  . GLU A  48  ? 0.9638 0.6012 0.4613 -0.2670 0.0712  0.0629  107 GLU A CG  
311  C CD  . GLU A  48  ? 1.0133 0.6761 0.5036 -0.2814 0.0844  0.0864  107 GLU A CD  
312  O OE1 . GLU A  48  ? 1.0235 0.7022 0.5289 -0.2902 0.0957  0.0819  107 GLU A OE1 
313  O OE2 . GLU A  48  ? 1.0611 0.7327 0.5322 -0.2842 0.0836  0.1123  107 GLU A OE2 
314  N N   . GLY A  49  ? 0.8397 0.4941 0.3651 -0.2191 0.0583  -0.0128 108 GLY A N   
315  C CA  . GLY A  49  ? 0.8200 0.4871 0.3584 -0.2065 0.0579  -0.0273 108 GLY A CA  
316  C C   . GLY A  49  ? 0.8055 0.5006 0.3685 -0.2075 0.0715  -0.0370 108 GLY A C   
317  O O   . GLY A  49  ? 0.7980 0.5076 0.3664 -0.2030 0.0773  -0.0503 108 GLY A O   
318  N N   . THR A  50  ? 0.7937 0.4989 0.3758 -0.2131 0.0760  -0.0325 109 THR A N   
319  C CA  . THR A  50  ? 0.7800 0.5137 0.3918 -0.2134 0.0885  -0.0381 109 THR A CA  
320  C C   . THR A  50  ? 0.7535 0.5033 0.4011 -0.2069 0.0846  -0.0339 109 THR A C   
321  O O   . THR A  50  ? 0.7492 0.5247 0.4226 -0.2100 0.0927  -0.0314 109 THR A O   
322  C CB  . THR A  50  ? 0.7983 0.5419 0.4007 -0.2282 0.0999  -0.0331 109 THR A CB  
323  O OG1 . THR A  50  ? 0.8079 0.5384 0.4051 -0.2373 0.0934  -0.0226 109 THR A OG1 
324  C CG2 . THR A  50  ? 0.8180 0.5605 0.3873 -0.2337 0.1053  -0.0331 109 THR A CG2 
325  N N   . LEU A  51  ? 0.7359 0.4769 0.3855 -0.1974 0.0722  -0.0312 110 LEU A N   
326  C CA  . LEU A  51  ? 0.7049 0.4713 0.3857 -0.1899 0.0673  -0.0237 110 LEU A CA  
327  C C   . LEU A  51  ? 0.7061 0.4966 0.3944 -0.1992 0.0707  -0.0203 110 LEU A C   
328  O O   . LEU A  51  ? 0.6977 0.5219 0.4181 -0.1985 0.0779  -0.0143 110 LEU A O   
329  C CB  . LEU A  51  ? 0.6787 0.4659 0.4039 -0.1786 0.0719  -0.0201 110 LEU A CB  
330  C CG  . LEU A  51  ? 0.6716 0.4455 0.4038 -0.1667 0.0628  -0.0202 110 LEU A CG  
331  C CD1 . LEU A  51  ? 0.6511 0.4448 0.4422 -0.1566 0.0677  -0.0155 110 LEU A CD1 
332  C CD2 . LEU A  51  ? 0.6375 0.4158 0.3600 -0.1619 0.0502  -0.0110 110 LEU A CD2 
333  N N   . ALA A  52  ? 0.7241 0.4974 0.3874 -0.2083 0.0651  -0.0246 111 ALA A N   
334  C CA  . ALA A  52  ? 0.7207 0.5135 0.3914 -0.2193 0.0666  -0.0269 111 ALA A CA  
335  C C   . ALA A  52  ? 0.7305 0.5100 0.3900 -0.2234 0.0553  -0.0362 111 ALA A C   
336  O O   . ALA A  52  ? 0.7580 0.5449 0.4242 -0.2353 0.0558  -0.0430 111 ALA A O   
337  C CB  . ALA A  52  ? 0.7327 0.5181 0.3975 -0.2325 0.0783  -0.0259 111 ALA A CB  
338  N N   . CYS A  53  ? 0.7235 0.4852 0.3720 -0.2137 0.0453  -0.0386 112 CYS A N   
339  C CA  . CYS A  53  ? 0.7323 0.4881 0.3797 -0.2147 0.0343  -0.0518 112 CYS A CA  
340  C C   . CYS A  53  ? 0.7162 0.4780 0.3617 -0.1990 0.0255  -0.0518 112 CYS A C   
341  O O   . CYS A  53  ? 0.7022 0.4707 0.3505 -0.1891 0.0277  -0.0397 112 CYS A O   
342  C CB  . CYS A  53  ? 0.7681 0.4748 0.4021 -0.2247 0.0326  -0.0531 112 CYS A CB  
343  S SG  . CYS A  53  ? 0.7968 0.4598 0.4029 -0.2178 0.0304  -0.0394 112 CYS A SG  
344  N N   . SER A  54  ? 0.7201 0.4804 0.3662 -0.1963 0.0156  -0.0662 113 SER A N   
345  C CA  . SER A  54  ? 0.7202 0.4860 0.3634 -0.1810 0.0077  -0.0648 113 SER A CA  
346  C C   . SER A  54  ? 0.7472 0.4638 0.3766 -0.1789 0.0000  -0.0701 113 SER A C   
347  O O   . SER A  54  ? 0.7487 0.4650 0.3753 -0.1666 -0.0070 -0.0701 113 SER A O   
348  C CB  . SER A  54  ? 0.7065 0.5331 0.3664 -0.1746 0.0031  -0.0748 113 SER A CB  
349  O OG  . SER A  54  ? 0.7084 0.5832 0.3841 -0.1772 0.0102  -0.0640 113 SER A OG  
350  N N   . THR A  55  ? 0.4905 0.4145 0.3244 -0.0470 0.0399  0.0125  114 THR A N   
351  C CA  . THR A  55  ? 0.5146 0.4088 0.3166 -0.0574 0.0252  0.0266  114 THR A CA  
352  C C   . THR A  55  ? 0.5408 0.4169 0.3249 -0.0535 0.0153  0.0257  114 THR A C   
353  O O   . THR A  55  ? 0.5608 0.4097 0.3310 -0.0539 -0.0035 0.0358  114 THR A O   
354  C CB  . THR A  55  ? 0.5473 0.4413 0.3180 -0.0829 0.0307  0.0337  114 THR A CB  
355  O OG1 . THR A  55  ? 0.5853 0.4989 0.3387 -0.0941 0.0464  0.0223  114 THR A OG1 
356  C CG2 . THR A  55  ? 0.5067 0.4204 0.2971 -0.0879 0.0401  0.0341  114 THR A CG2 
357  N N   . CYS A  56  ? 0.5348 0.4250 0.3233 -0.0480 0.0251  0.0121  115 CYS A N   
358  C CA  . CYS A  56  ? 0.5496 0.4240 0.3220 -0.0447 0.0158  0.0102  115 CYS A CA  
359  C C   . CYS A  56  ? 0.5177 0.3867 0.3165 -0.0261 0.0055  0.0084  115 CYS A C   
360  O O   . CYS A  56  ? 0.5270 0.3895 0.3211 -0.0214 0.0006  0.0032  115 CYS A O   
361  C CB  . CYS A  56  ? 0.5788 0.4699 0.3400 -0.0498 0.0301  -0.0056 115 CYS A CB  
362  S SG  . CYS A  56  ? 0.5596 0.4814 0.3645 -0.0333 0.0449  -0.0277 115 CYS A SG  
363  N N   . HIS A  57  ? 0.4858 0.3592 0.3102 -0.0181 0.0024  0.0123  116 HIS A N   
364  C CA  . HIS A  57  ? 0.4506 0.3255 0.2989 -0.0057 -0.0051 0.0107  116 HIS A CA  
365  C C   . HIS A  57  ? 0.4620 0.3207 0.3012 -0.0036 -0.0209 0.0129  116 HIS A C   
366  O O   . HIS A  57  ? 0.4910 0.3351 0.3186 -0.0072 -0.0322 0.0191  116 HIS A O   
367  C CB  . HIS A  57  ? 0.4273 0.3115 0.2966 -0.0033 -0.0051 0.0148  116 HIS A CB  
368  C CG  . HIS A  57  ? 0.3960 0.2879 0.2872 0.0040  -0.0110 0.0131  116 HIS A CG  
369  N ND1 . HIS A  57  ? 0.3928 0.2940 0.2994 0.0048  -0.0131 0.0148  116 HIS A ND1 
370  C CD2 . HIS A  57  ? 0.4094 0.3029 0.3073 0.0076  -0.0150 0.0095  116 HIS A CD2 
371  C CE1 . HIS A  57  ? 0.4035 0.3150 0.3238 0.0069  -0.0167 0.0119  116 HIS A CE1 
372  N NE2 . HIS A  57  ? 0.4337 0.3399 0.3489 0.0080  -0.0184 0.0097  116 HIS A NE2 
373  N N   . LEU A  58  ? 0.4509 0.3108 0.2973 0.0020  -0.0244 0.0072  117 LEU A N   
374  C CA  . LEU A  58  ? 0.4508 0.3007 0.2946 0.0047  -0.0399 0.0068  117 LEU A CA  
375  C C   . LEU A  58  ? 0.4285 0.2925 0.2969 0.0100  -0.0420 0.0016  117 LEU A C   
376  O O   . LEU A  58  ? 0.4325 0.3052 0.3111 0.0102  -0.0343 0.0001  117 LEU A O   
377  C CB  . LEU A  58  ? 0.4820 0.3167 0.2986 0.0001  -0.0440 0.0055  117 LEU A CB  
378  C CG  . LEU A  58  ? 0.5152 0.3324 0.2979 -0.0111 -0.0477 0.0128  117 LEU A CG  
379  C CD1 . LEU A  58  ? 0.5111 0.3202 0.2648 -0.0185 -0.0468 0.0093  117 LEU A CD1 
380  C CD2 . LEU A  58  ? 0.5298 0.3288 0.3112 -0.0098 -0.0697 0.0199  117 LEU A CD2 
381  N N   . ILE A  59  ? 0.4216 0.2883 0.3001 0.0130  -0.0544 -0.0017 118 ILE A N   
382  C CA  . ILE A  59  ? 0.4006 0.2858 0.2998 0.0132  -0.0560 -0.0078 118 ILE A CA  
383  C C   . ILE A  59  ? 0.4049 0.2840 0.2989 0.0133  -0.0657 -0.0125 118 ILE A C   
384  O O   . ILE A  59  ? 0.4306 0.2984 0.3175 0.0165  -0.0784 -0.0143 118 ILE A O   
385  C CB  . ILE A  59  ? 0.3841 0.2884 0.3056 0.0155  -0.0605 -0.0142 118 ILE A CB  
386  C CG1 . ILE A  59  ? 0.3914 0.2994 0.3158 0.0149  -0.0520 -0.0095 118 ILE A CG1 
387  C CG2 . ILE A  59  ? 0.3657 0.2969 0.3061 0.0100  -0.0586 -0.0212 118 ILE A CG2 
388  C CD1 . ILE A  59  ? 0.3685 0.3016 0.3170 0.0156  -0.0530 -0.0187 118 ILE A CD1 
389  N N   . PHE A  60  ? 0.3992 0.2837 0.2970 0.0090  -0.0625 -0.0137 119 PHE A N   
390  C CA  . PHE A  60  ? 0.4120 0.2888 0.3030 0.0079  -0.0710 -0.0178 119 PHE A CA  
391  C C   . PHE A  60  ? 0.4097 0.3091 0.3219 0.0033  -0.0767 -0.0245 119 PHE A C   
392  O O   . PHE A  60  ? 0.3930 0.3150 0.3221 -0.0015 -0.0713 -0.0255 119 PHE A O   
393  C CB  . PHE A  60  ? 0.4208 0.2838 0.2996 0.0056  -0.0655 -0.0164 119 PHE A CB  
394  C CG  . PHE A  60  ? 0.4234 0.2721 0.2826 0.0085  -0.0580 -0.0153 119 PHE A CG  
395  C CD1 . PHE A  60  ? 0.4892 0.3226 0.3243 0.0078  -0.0613 -0.0187 119 PHE A CD1 
396  C CD2 . PHE A  60  ? 0.4248 0.2788 0.2888 0.0096  -0.0475 -0.0118 119 PHE A CD2 
397  C CE1 . PHE A  60  ? 0.5211 0.3482 0.3358 0.0059  -0.0519 -0.0199 119 PHE A CE1 
398  C CE2 . PHE A  60  ? 0.4481 0.2962 0.2964 0.0095  -0.0387 -0.0131 119 PHE A CE2 
399  C CZ  . PHE A  60  ? 0.4979 0.3342 0.3206 0.0066  -0.0399 -0.0177 119 PHE A CZ  
400  N N   . GLU A  61  ? 0.4373 0.3335 0.3480 0.0034  -0.0877 -0.0301 120 GLU A N   
401  C CA  . GLU A  61  ? 0.4503 0.3718 0.3815 -0.0041 -0.0921 -0.0381 120 GLU A CA  
402  C C   . GLU A  61  ? 0.4543 0.3774 0.3834 -0.0176 -0.0859 -0.0321 120 GLU A C   
403  O O   . GLU A  61  ? 0.4576 0.3554 0.3703 -0.0170 -0.0844 -0.0258 120 GLU A O   
404  C CB  . GLU A  61  ? 0.4753 0.3912 0.4055 -0.0008 -0.1073 -0.0455 120 GLU A CB  
405  C CG  . GLU A  61  ? 0.5116 0.4267 0.4502 0.0110  -0.1215 -0.0526 120 GLU A CG  
406  C CD  . GLU A  61  ? 0.5732 0.4720 0.5031 0.0146  -0.1406 -0.0562 120 GLU A CD  
407  O OE1 . GLU A  61  ? 0.6120 0.5344 0.5692 0.0162  -0.1521 -0.0696 120 GLU A OE1 
408  O OE2 . GLU A  61  ? 0.5992 0.4651 0.4958 0.0149  -0.1445 -0.0476 120 GLU A OE2 
409  N N   . ASP A  62  ? 0.4532 0.4067 0.3997 -0.0310 -0.0839 -0.0353 121 ASP A N   
410  C CA  . ASP A  62  ? 0.4688 0.4214 0.4109 -0.0487 -0.0825 -0.0267 121 ASP A CA  
411  C C   . ASP A  62  ? 0.4791 0.3981 0.4054 -0.0489 -0.0905 -0.0221 121 ASP A C   
412  O O   . ASP A  62  ? 0.4903 0.3843 0.4065 -0.0489 -0.0909 -0.0138 121 ASP A O   
413  C CB  . ASP A  62  ? 0.4730 0.4657 0.4319 -0.0677 -0.0826 -0.0340 121 ASP A CB  
414  C CG  . ASP A  62  ? 0.4968 0.5292 0.4736 -0.0706 -0.0735 -0.0427 121 ASP A CG  
415  O OD1 . ASP A  62  ? 0.5526 0.6269 0.5502 -0.0798 -0.0727 -0.0581 121 ASP A OD1 
416  O OD2 . ASP A  62  ? 0.5776 0.6031 0.5500 -0.0639 -0.0670 -0.0371 121 ASP A OD2 
417  N N   . HIS A  63  ? 0.4875 0.4069 0.4148 -0.0481 -0.0988 -0.0300 122 HIS A N   
418  C CA  . HIS A  63  ? 0.4995 0.3907 0.4135 -0.0505 -0.1075 -0.0286 122 HIS A CA  
419  C C   . HIS A  63  ? 0.4962 0.3540 0.3919 -0.0351 -0.1062 -0.0285 122 HIS A C   
420  O O   . HIS A  63  ? 0.5198 0.3531 0.4080 -0.0364 -0.1102 -0.0269 122 HIS A O   
421  C CB  . HIS A  63  ? 0.5129 0.4155 0.4330 -0.0544 -0.1173 -0.0380 122 HIS A CB  
422  C CG  . HIS A  63  ? 0.5420 0.4488 0.4638 -0.0389 -0.1215 -0.0472 122 HIS A CG  
423  N ND1 . HIS A  63  ? 0.5401 0.4778 0.4831 -0.0347 -0.1208 -0.0550 122 HIS A ND1 
424  C CD2 . HIS A  63  ? 0.5835 0.4663 0.4880 -0.0283 -0.1297 -0.0503 122 HIS A CD2 
425  C CE1 . HIS A  63  ? 0.5615 0.4888 0.5010 -0.0209 -0.1313 -0.0605 122 HIS A CE1 
426  N NE2 . HIS A  63  ? 0.5710 0.4653 0.4843 -0.0186 -0.1364 -0.0563 122 HIS A NE2 
427  N N   . ILE A  64  ? 0.4695 0.3267 0.3585 -0.0220 -0.1016 -0.0313 123 ILE A N   
428  C CA  . ILE A  64  ? 0.4752 0.3087 0.3451 -0.0120 -0.0974 -0.0328 123 ILE A CA  
429  C C   . ILE A  64  ? 0.4668 0.2955 0.3414 -0.0105 -0.0889 -0.0280 123 ILE A C   
430  O O   . ILE A  64  ? 0.4988 0.3097 0.3683 -0.0067 -0.0887 -0.0323 123 ILE A O   
431  C CB  . ILE A  64  ? 0.4740 0.3077 0.3321 -0.0039 -0.0955 -0.0335 123 ILE A CB  
432  C CG1 . ILE A  64  ? 0.4965 0.3303 0.3503 -0.0038 -0.1095 -0.0382 123 ILE A CG1 
433  C CG2 . ILE A  64  ? 0.4816 0.2983 0.3180 0.0010  -0.0875 -0.0354 123 ILE A CG2 
434  C CD1 . ILE A  64  ? 0.4808 0.2983 0.3198 -0.0069 -0.1177 -0.0442 123 ILE A CD1 
435  N N   . TYR A  65  ? 0.4417 0.2875 0.3285 -0.0129 -0.0831 -0.0213 124 TYR A N   
436  C CA  . TYR A  65  ? 0.4386 0.2811 0.3312 -0.0116 -0.0770 -0.0158 124 TYR A CA  
437  C C   . TYR A  65  ? 0.4574 0.2817 0.3543 -0.0167 -0.0858 -0.0136 124 TYR A C   
438  O O   . TYR A  65  ? 0.4548 0.2645 0.3540 -0.0085 -0.0852 -0.0170 124 TYR A O   
439  C CB  . TYR A  65  ? 0.4149 0.2809 0.3197 -0.0184 -0.0726 -0.0087 124 TYR A CB  
440  C CG  . TYR A  65  ? 0.4066 0.2699 0.3173 -0.0190 -0.0691 -0.0013 124 TYR A CG  
441  C CD1 . TYR A  65  ? 0.3725 0.2339 0.2824 -0.0081 -0.0603 -0.0024 124 TYR A CD1 
442  C CD2 . TYR A  65  ? 0.3990 0.2617 0.3149 -0.0331 -0.0764 0.0078  124 TYR A CD2 
443  C CE1 . TYR A  65  ? 0.3771 0.2374 0.2958 -0.0084 -0.0592 0.0035  124 TYR A CE1 
444  C CE2 . TYR A  65  ? 0.3738 0.2314 0.2944 -0.0346 -0.0776 0.0157  124 TYR A CE2 
445  C CZ  . TYR A  65  ? 0.3961 0.2532 0.3203 -0.0211 -0.0693 0.0130  124 TYR A CZ  
446  O OH  . TYR A  65  ? 0.3810 0.2343 0.3130 -0.0233 -0.0730 0.0211  124 TYR A OH  
447  N N   . GLU A  66  ? 0.4754 0.3017 0.3754 -0.0312 -0.0954 -0.0089 125 GLU A N   
448  C CA  . GLU A  66  ? 0.5097 0.3141 0.4121 -0.0408 -0.1092 -0.0033 125 GLU A CA  
449  C C   . GLU A  66  ? 0.5345 0.3092 0.4346 -0.0288 -0.1166 -0.0141 125 GLU A C   
450  O O   . GLU A  66  ? 0.5504 0.3026 0.4584 -0.0280 -0.1280 -0.0121 125 GLU A O   
451  C CB  . GLU A  66  ? 0.5257 0.3392 0.4274 -0.0622 -0.1180 0.0022  125 GLU A CB  
452  C CG  . GLU A  66  ? 0.5581 0.3459 0.4586 -0.0784 -0.1359 0.0127  125 GLU A CG  
453  C CD  . GLU A  66  ? 0.6058 0.4073 0.5031 -0.1051 -0.1431 0.0191  125 GLU A CD  
454  O OE1 . GLU A  66  ? 0.6761 0.4656 0.5686 -0.1279 -0.1562 0.0343  125 GLU A OE1 
455  O OE2 . GLU A  66  ? 0.5821 0.4064 0.4814 -0.1053 -0.1373 0.0094  125 GLU A OE2 
456  N N   . LYS A  67  ? 0.5429 0.3172 0.4329 -0.0201 -0.1124 -0.0267 126 LYS A N   
457  C CA  . LYS A  67  ? 0.5723 0.3231 0.4588 -0.0104 -0.1184 -0.0417 126 LYS A CA  
458  C C   . LYS A  67  ? 0.5689 0.3251 0.4506 0.0053  -0.1040 -0.0553 126 LYS A C   
459  O O   . LYS A  67  ? 0.5960 0.3438 0.4697 0.0124  -0.1033 -0.0722 126 LYS A O   
460  C CB  . LYS A  67  ? 0.5956 0.3407 0.4704 -0.0159 -0.1260 -0.0479 126 LYS A CB  
461  C CG  . LYS A  67  ? 0.6256 0.3728 0.5044 -0.0358 -0.1388 -0.0364 126 LYS A CG  
462  C CD  . LYS A  67  ? 0.6945 0.4102 0.5765 -0.0438 -0.1585 -0.0372 126 LYS A CD  
463  C CE  . LYS A  67  ? 0.7386 0.4573 0.6169 -0.0624 -0.1694 -0.0336 126 LYS A CE  
464  N NZ  . LYS A  67  ? 0.7230 0.4770 0.6063 -0.0820 -0.1645 -0.0209 126 LYS A NZ  
465  N N   . LEU A  68  ? 0.5483 0.3210 0.4334 0.0086  -0.0918 -0.0494 127 LEU A N   
466  C CA  . LEU A  68  ? 0.5450 0.3259 0.4263 0.0194  -0.0777 -0.0618 127 LEU A CA  
467  C C   . LEU A  68  ? 0.5567 0.3272 0.4583 0.0295  -0.0822 -0.0756 127 LEU A C   
468  O O   . LEU A  68  ? 0.5664 0.3200 0.4844 0.0280  -0.0980 -0.0698 127 LEU A O   
469  C CB  . LEU A  68  ? 0.5203 0.3205 0.4017 0.0187  -0.0655 -0.0509 127 LEU A CB  
470  C CG  . LEU A  68  ? 0.5015 0.3115 0.3647 0.0131  -0.0618 -0.0432 127 LEU A CG  
471  C CD1 . LEU A  68  ? 0.4356 0.2608 0.3032 0.0126  -0.0536 -0.0332 127 LEU A CD1 
472  C CD2 . LEU A  68  ? 0.5132 0.3196 0.3503 0.0136  -0.0575 -0.0540 127 LEU A CD2 
473  N N   . ASP A  69  ? 0.5696 0.3509 0.4709 0.0386  -0.0699 -0.0948 128 ASP A N   
474  C CA  . ASP A  69  ? 0.5917 0.3672 0.5192 0.0514  -0.0756 -0.1157 128 ASP A CA  
475  C C   . ASP A  69  ? 0.5753 0.3499 0.5283 0.0548  -0.0821 -0.1043 128 ASP A C   
476  O O   . ASP A  69  ? 0.5635 0.3535 0.5117 0.0498  -0.0720 -0.0892 128 ASP A O   
477  C CB  . ASP A  69  ? 0.6064 0.4057 0.5304 0.0581  -0.0567 -0.1423 128 ASP A CB  
478  C CG  . ASP A  69  ? 0.6579 0.4574 0.5536 0.0532  -0.0518 -0.1568 128 ASP A CG  
479  O OD1 . ASP A  69  ? 0.6884 0.4670 0.5717 0.0475  -0.0652 -0.1475 128 ASP A OD1 
480  O OD2 . ASP A  69  ? 0.6988 0.5217 0.5836 0.0529  -0.0345 -0.1782 128 ASP A OD2 
481  N N   . ALA A  70  ? 0.5976 0.3516 0.5778 0.0632  -0.1016 -0.1116 129 ALA A N   
482  C CA  . ALA A  70  ? 0.5941 0.3419 0.5965 0.0645  -0.1134 -0.0980 129 ALA A CA  
483  C C   . ALA A  70  ? 0.5771 0.3569 0.5888 0.0712  -0.0934 -0.1044 129 ALA A C   
484  O O   . ALA A  70  ? 0.5887 0.3888 0.6090 0.0816  -0.0796 -0.1311 129 ALA A O   
485  C CB  . ALA A  70  ? 0.6166 0.3345 0.6503 0.0757  -0.1414 -0.1100 129 ALA A CB  
486  N N   . ILE A  71  ? 0.5479 0.3346 0.5573 0.0633  -0.0913 -0.0818 130 ILE A N   
487  C CA  . ILE A  71  ? 0.5247 0.3392 0.5436 0.0678  -0.0747 -0.0858 130 ILE A CA  
488  C C   . ILE A  71  ? 0.5426 0.3591 0.6012 0.0840  -0.0847 -0.1052 130 ILE A C   
489  O O   . ILE A  71  ? 0.5575 0.3470 0.6369 0.0883  -0.1114 -0.1005 130 ILE A O   
490  C CB  . ILE A  71  ? 0.5046 0.3247 0.5138 0.0561  -0.0726 -0.0591 130 ILE A CB  
491  C CG1 . ILE A  71  ? 0.4867 0.3372 0.4975 0.0579  -0.0515 -0.0632 130 ILE A CG1 
492  C CG2 . ILE A  71  ? 0.4949 0.2942 0.5208 0.0536  -0.0965 -0.0447 130 ILE A CG2 
493  C CD1 . ILE A  71  ? 0.4582 0.3167 0.4525 0.0458  -0.0452 -0.0405 130 ILE A CD1 
494  N N   . THR A  72  ? 0.5429 0.3921 0.6124 0.0916  -0.0647 -0.1274 131 THR A N   
495  C CA  . THR A  72  ? 0.5499 0.4122 0.6637 0.1085  -0.0708 -0.1518 131 THR A CA  
496  C C   . THR A  72  ? 0.5324 0.4058 0.6601 0.1070  -0.0714 -0.1366 131 THR A C   
497  O O   . THR A  72  ? 0.5075 0.3851 0.6088 0.0929  -0.0613 -0.1117 131 THR A O   
498  C CB  . THR A  72  ? 0.5576 0.4592 0.6783 0.1142  -0.0462 -0.1870 131 THR A CB  
499  O OG1 . THR A  72  ? 0.5260 0.4567 0.6197 0.0997  -0.0193 -0.1765 131 THR A OG1 
500  C CG2 . THR A  72  ? 0.5626 0.4553 0.6659 0.1145  -0.0446 -0.2045 131 THR A CG2 
501  N N   . ASP A  73  ? 0.5505 0.4303 0.7228 0.1227  -0.0844 -0.1546 132 ASP A N   
502  C CA  . ASP A  73  ? 0.5453 0.4364 0.7340 0.1221  -0.0872 -0.1421 132 ASP A CA  
503  C C   . ASP A  73  ? 0.5166 0.4498 0.6916 0.1132  -0.0543 -0.1445 132 ASP A C   
504  O O   . ASP A  73  ? 0.4858 0.4220 0.6484 0.1029  -0.0507 -0.1210 132 ASP A O   
505  C CB  . ASP A  73  ? 0.5660 0.4581 0.8111 0.1431  -0.1098 -0.1657 132 ASP A CB  
506  C CG  . ASP A  73  ? 0.6285 0.4691 0.8853 0.1473  -0.1515 -0.1512 132 ASP A CG  
507  O OD1 . ASP A  73  ? 0.6558 0.4649 0.8746 0.1312  -0.1590 -0.1229 132 ASP A OD1 
508  O OD2 . ASP A  73  ? 0.7055 0.5375 1.0104 0.1657  -0.1784 -0.1686 132 ASP A OD2 
509  N N   . GLU A  74  ? 0.5203 0.4849 0.6970 0.1157  -0.0321 -0.1738 133 GLU A N   
510  C CA  . GLU A  74  ? 0.5130 0.5181 0.6730 0.1034  -0.0008 -0.1791 133 GLU A CA  
511  C C   . GLU A  74  ? 0.4956 0.4867 0.6033 0.0834  0.0093  -0.1460 133 GLU A C   
512  O O   . GLU A  74  ? 0.4783 0.4826 0.5745 0.0725  0.0203  -0.1312 133 GLU A O   
513  C CB  . GLU A  74  ? 0.5400 0.5764 0.7013 0.1045  0.0185  -0.2152 133 GLU A CB  
514  C CG  . GLU A  74  ? 0.5896 0.6811 0.7731 0.1018  0.0416  -0.2421 133 GLU A CG  
515  C CD  . GLU A  74  ? 0.6823 0.8096 0.8454 0.0906  0.0684  -0.2713 133 GLU A CD  
516  O OE1 . GLU A  74  ? 0.7190 0.8373 0.8836 0.0993  0.0630  -0.2922 133 GLU A OE1 
517  O OE2 . GLU A  74  ? 0.7237 0.8881 0.8671 0.0707  0.0941  -0.2730 133 GLU A OE2 
518  N N   . GLU A  75  ? 0.4965 0.4596 0.5761 0.0796  0.0027  -0.1355 134 GLU A N   
519  C CA  . GLU A  75  ? 0.4788 0.4286 0.5166 0.0640  0.0081  -0.1083 134 GLU A CA  
520  C C   . GLU A  75  ? 0.4548 0.3895 0.4957 0.0613  -0.0048 -0.0821 134 GLU A C   
521  O O   . GLU A  75  ? 0.4243 0.3638 0.4465 0.0506  0.0032  -0.0651 134 GLU A O   
522  C CB  . GLU A  75  ? 0.4942 0.4203 0.5062 0.0612  0.0021  -0.1054 134 GLU A CB  
523  C CG  . GLU A  75  ? 0.4856 0.4021 0.4597 0.0468  0.0063  -0.0809 134 GLU A CG  
524  C CD  . GLU A  75  ? 0.4857 0.3811 0.4371 0.0436  -0.0011 -0.0767 134 GLU A CD  
525  O OE1 . GLU A  75  ? 0.4832 0.3750 0.4365 0.0489  -0.0030 -0.0951 134 GLU A OE1 
526  O OE2 . GLU A  75  ? 0.4588 0.3440 0.3926 0.0358  -0.0052 -0.0570 134 GLU A OE2 
527  N N   . ASN A  76  ? 0.4633 0.3783 0.5270 0.0695  -0.0268 -0.0790 135 ASN A N   
528  C CA  . ASN A  76  ? 0.4558 0.3571 0.5176 0.0628  -0.0401 -0.0540 135 ASN A CA  
529  C C   . ASN A  76  ? 0.4327 0.3546 0.5087 0.0620  -0.0342 -0.0502 135 ASN A C   
530  O O   . ASN A  76  ? 0.4202 0.3412 0.4818 0.0518  -0.0336 -0.0310 135 ASN A O   
531  C CB  . ASN A  76  ? 0.4809 0.3526 0.5590 0.0672  -0.0685 -0.0491 135 ASN A CB  
532  C CG  . ASN A  76  ? 0.4949 0.3521 0.5576 0.0528  -0.0808 -0.0213 135 ASN A CG  
533  O OD1 . ASN A  76  ? 0.5373 0.3897 0.5727 0.0404  -0.0767 -0.0086 135 ASN A OD1 
534  N ND2 . ASN A  76  ? 0.5209 0.3750 0.6011 0.0530  -0.0953 -0.0131 135 ASN A ND2 
535  N N   . ASP A  77  ? 0.4376 0.3813 0.5434 0.0723  -0.0292 -0.0712 136 ASP A N   
536  C CA  . ASP A  77  ? 0.4319 0.3983 0.5529 0.0706  -0.0229 -0.0692 136 ASP A CA  
537  C C   . ASP A  77  ? 0.4170 0.3978 0.5068 0.0557  -0.0013 -0.0580 136 ASP A C   
538  O O   . ASP A  77  ? 0.3918 0.3763 0.4788 0.0488  -0.0013 -0.0433 136 ASP A O   
539  C CB  . ASP A  77  ? 0.4491 0.4451 0.6098 0.0835  -0.0175 -0.0998 136 ASP A CB  
540  C CG  . ASP A  77  ? 0.4856 0.4675 0.6896 0.1013  -0.0459 -0.1111 136 ASP A CG  
541  O OD1 . ASP A  77  ? 0.5494 0.4943 0.7472 0.1005  -0.0709 -0.0916 136 ASP A OD1 
542  O OD2 . ASP A  77  ? 0.4846 0.4937 0.7297 0.1148  -0.0443 -0.1407 136 ASP A OD2 
543  N N   . MET A  78  ? 0.4221 0.4080 0.4874 0.0500  0.0144  -0.0651 137 MET A N   
544  C CA  . MET A  78  ? 0.4156 0.4066 0.4490 0.0352  0.0290  -0.0533 137 MET A CA  
545  C C   . MET A  78  ? 0.3999 0.3662 0.4065 0.0290  0.0211  -0.0322 137 MET A C   
546  O O   . MET A  78  ? 0.4028 0.3692 0.3958 0.0205  0.0241  -0.0194 137 MET A O   
547  C CB  . MET A  78  ? 0.4335 0.4394 0.4484 0.0280  0.0464  -0.0680 137 MET A CB  
548  C CG  . MET A  78  ? 0.4656 0.5073 0.5079 0.0308  0.0588  -0.0937 137 MET A CG  
549  S SD  . MET A  78  ? 0.5124 0.5820 0.5606 0.0181  0.0714  -0.0887 137 MET A SD  
550  C CE  . MET A  78  ? 0.4839 0.5465 0.5728 0.0335  0.0513  -0.0812 137 MET A CE  
551  N N   . LEU A  79  ? 0.3981 0.3453 0.3990 0.0328  0.0107  -0.0307 138 LEU A N   
552  C CA  . LEU A  79  ? 0.3986 0.3298 0.3799 0.0266  0.0036  -0.0146 138 LEU A CA  
553  C C   . LEU A  79  ? 0.3937 0.3256 0.3846 0.0233  -0.0048 -0.0010 138 LEU A C   
554  O O   . LEU A  79  ? 0.3819 0.3130 0.3595 0.0163  -0.0050 0.0087  138 LEU A O   
555  C CB  . LEU A  79  ? 0.4062 0.3198 0.3822 0.0294  -0.0062 -0.0166 138 LEU A CB  
556  C CG  . LEU A  79  ? 0.4044 0.3067 0.3651 0.0225  -0.0141 -0.0042 138 LEU A CG  
557  C CD1 . LEU A  79  ? 0.3431 0.2475 0.2822 0.0174  -0.0069 -0.0014 138 LEU A CD1 
558  C CD2 . LEU A  79  ? 0.3831 0.2685 0.3436 0.0244  -0.0254 -0.0078 138 LEU A CD2 
559  N N   . ASP A  80  ? 0.3990 0.3334 0.4137 0.0281  -0.0131 -0.0022 139 ASP A N   
560  C CA  . ASP A  80  ? 0.4010 0.3381 0.4214 0.0223  -0.0208 0.0105  139 ASP A CA  
561  C C   . ASP A  80  ? 0.3756 0.3281 0.3903 0.0172  -0.0086 0.0131  139 ASP A C   
562  O O   . ASP A  80  ? 0.3784 0.3337 0.3890 0.0101  -0.0121 0.0228  139 ASP A O   
563  C CB  . ASP A  80  ? 0.4274 0.3644 0.4761 0.0291  -0.0339 0.0080  139 ASP A CB  
564  C CG  . ASP A  80  ? 0.5013 0.4151 0.5535 0.0277  -0.0568 0.0162  139 ASP A CG  
565  O OD1 . ASP A  80  ? 0.5865 0.4892 0.6174 0.0167  -0.0614 0.0275  139 ASP A OD1 
566  O OD2 . ASP A  80  ? 0.5983 0.5049 0.6767 0.0369  -0.0724 0.0106  139 ASP A OD2 
567  N N   . LEU A  81  ? 0.3622 0.3257 0.3766 0.0188  0.0048  0.0037  140 LEU A N   
568  C CA  . LEU A  81  ? 0.3439 0.3179 0.3519 0.0117  0.0137  0.0074  140 LEU A CA  
569  C C   . LEU A  81  ? 0.3541 0.3179 0.3351 0.0050  0.0172  0.0127  140 LEU A C   
570  O O   . LEU A  81  ? 0.3510 0.3173 0.3246 -0.0014 0.0214  0.0161  140 LEU A O   
571  C CB  . LEU A  81  ? 0.3408 0.3344 0.3622 0.0117  0.0250  -0.0037 140 LEU A CB  
572  C CG  . LEU A  81  ? 0.3180 0.3263 0.3747 0.0199  0.0192  -0.0114 140 LEU A CG  
573  C CD1 . LEU A  81  ? 0.2660 0.3010 0.3379 0.0192  0.0330  -0.0275 140 LEU A CD1 
574  C CD2 . LEU A  81  ? 0.3055 0.3143 0.3717 0.0173  0.0092  0.0002  140 LEU A CD2 
575  N N   . ALA A  82  ? 0.3595 0.3102 0.3278 0.0066  0.0124  0.0133  141 ALA A N   
576  C CA  . ALA A  82  ? 0.3577 0.2976 0.3059 0.0028  0.0107  0.0166  141 ALA A CA  
577  C C   . ALA A  82  ? 0.3513 0.2944 0.3039 0.0006  0.0047  0.0213  141 ALA A C   
578  O O   . ALA A  82  ? 0.3545 0.3051 0.3179 0.0002  0.0005  0.0231  141 ALA A O   
579  C CB  . ALA A  82  ? 0.3493 0.2781 0.2878 0.0058  0.0061  0.0140  141 ALA A CB  
580  N N   . TYR A  83  ? 0.3624 0.2989 0.3056 -0.0020 0.0024  0.0223  142 TYR A N   
581  C CA  . TYR A  83  ? 0.3505 0.2925 0.3012 -0.0025 -0.0035 0.0210  142 TYR A CA  
582  C C   . TYR A  83  ? 0.3486 0.2910 0.2998 0.0005  -0.0106 0.0153  142 TYR A C   
583  O O   . TYR A  83  ? 0.3654 0.2943 0.3066 0.0031  -0.0156 0.0137  142 TYR A O   
584  C CB  . TYR A  83  ? 0.3632 0.2955 0.3086 -0.0057 -0.0068 0.0224  142 TYR A CB  
585  C CG  . TYR A  83  ? 0.3526 0.2919 0.3101 -0.0039 -0.0142 0.0157  142 TYR A CG  
586  C CD1 . TYR A  83  ? 0.3331 0.2897 0.3027 -0.0069 -0.0108 0.0147  142 TYR A CD1 
587  C CD2 . TYR A  83  ? 0.3405 0.2718 0.2997 0.0013  -0.0259 0.0074  142 TYR A CD2 
588  C CE1 . TYR A  83  ? 0.3364 0.3043 0.3168 -0.0063 -0.0162 0.0045  142 TYR A CE1 
589  C CE2 . TYR A  83  ? 0.3528 0.2966 0.3283 0.0043  -0.0321 -0.0049 142 TYR A CE2 
590  C CZ  . TYR A  83  ? 0.3366 0.2999 0.3214 -0.0002 -0.0258 -0.0068 142 TYR A CZ  
591  O OH  . TYR A  83  ? 0.3597 0.3394 0.3599 0.0015  -0.0305 -0.0224 142 TYR A OH  
592  N N   . GLY A  84  ? 0.3446 0.3050 0.3070 -0.0019 -0.0116 0.0115  143 GLY A N   
593  C CA  . GLY A  84  ? 0.3380 0.3080 0.3036 -0.0023 -0.0157 0.0043  143 GLY A CA  
594  C C   . GLY A  84  ? 0.3385 0.3017 0.2973 -0.0033 -0.0155 0.0088  143 GLY A C   
595  O O   . GLY A  84  ? 0.3640 0.3231 0.3200 -0.0007 -0.0197 0.0040  143 GLY A O   
596  N N   . LEU A  85  ? 0.3255 0.2862 0.2838 -0.0063 -0.0132 0.0166  144 LEU A N   
597  C CA  . LEU A  85  ? 0.3338 0.2849 0.2880 -0.0067 -0.0162 0.0190  144 LEU A CA  
598  C C   . LEU A  85  ? 0.3336 0.2963 0.2879 -0.0150 -0.0207 0.0165  144 LEU A C   
599  O O   . LEU A  85  ? 0.3416 0.3241 0.2999 -0.0250 -0.0205 0.0158  144 LEU A O   
600  C CB  . LEU A  85  ? 0.3353 0.2811 0.2949 -0.0079 -0.0183 0.0260  144 LEU A CB  
601  C CG  . LEU A  85  ? 0.3319 0.2627 0.2910 -0.0066 -0.0250 0.0273  144 LEU A CG  
602  C CD1 . LEU A  85  ? 0.2985 0.2183 0.2528 0.0031  -0.0202 0.0196  144 LEU A CD1 
603  C CD2 . LEU A  85  ? 0.3096 0.2351 0.2802 -0.0071 -0.0327 0.0334  144 LEU A CD2 
604  N N   . THR A  86  ? 0.3346 0.2884 0.2840 -0.0129 -0.0240 0.0137  145 THR A N   
605  C CA  . THR A  86  ? 0.3256 0.2932 0.2763 -0.0227 -0.0279 0.0102  145 THR A CA  
606  C C   . THR A  86  ? 0.3364 0.2887 0.2809 -0.0285 -0.0342 0.0174  145 THR A C   
607  O O   . THR A  86  ? 0.3423 0.2727 0.2842 -0.0206 -0.0360 0.0208  145 THR A O   
608  C CB  . THR A  86  ? 0.3351 0.3063 0.2884 -0.0162 -0.0303 -0.0010 145 THR A CB  
609  O OG1 . THR A  86  ? 0.3257 0.2729 0.2686 -0.0096 -0.0337 0.0010  145 THR A OG1 
610  C CG2 . THR A  86  ? 0.2946 0.2702 0.2549 -0.0068 -0.0299 -0.0090 145 THR A CG2 
611  N N   . ASP A  87  ? 0.3270 0.2929 0.2707 -0.0429 -0.0380 0.0171  146 ASP A N   
612  C CA  . ASP A  87  ? 0.3403 0.2896 0.2774 -0.0515 -0.0471 0.0246  146 ASP A CA  
613  C C   . ASP A  87  ? 0.3450 0.2820 0.2802 -0.0421 -0.0493 0.0171  146 ASP A C   
614  O O   . ASP A  87  ? 0.3516 0.2769 0.2822 -0.0497 -0.0575 0.0202  146 ASP A O   
615  C CB  . ASP A  87  ? 0.3466 0.3156 0.2790 -0.0773 -0.0510 0.0303  146 ASP A CB  
616  C CG  . ASP A  87  ? 0.3444 0.3506 0.2840 -0.0851 -0.0442 0.0160  146 ASP A CG  
617  O OD1 . ASP A  87  ? 0.3523 0.3850 0.2882 -0.1089 -0.0433 0.0172  146 ASP A OD1 
618  O OD2 . ASP A  87  ? 0.3515 0.3624 0.3007 -0.0697 -0.0414 0.0026  146 ASP A OD2 
619  N N   . ARG A  88  ? 0.3368 0.2741 0.2735 -0.0273 -0.0440 0.0084  147 ARG A N   
620  C CA  . ARG A  88  ? 0.3488 0.2713 0.2791 -0.0184 -0.0474 0.0024  147 ARG A CA  
621  C C   . ARG A  88  ? 0.3504 0.2565 0.2725 -0.0051 -0.0429 0.0011  147 ARG A C   
622  O O   . ARG A  88  ? 0.3441 0.2403 0.2565 0.0006  -0.0454 -0.0036 147 ARG A O   
623  C CB  . ARG A  88  ? 0.3534 0.2948 0.2908 -0.0192 -0.0504 -0.0077 147 ARG A CB  
624  C CG  . ARG A  88  ? 0.3466 0.3129 0.2926 -0.0361 -0.0526 -0.0101 147 ARG A CG  
625  C CD  . ARG A  88  ? 0.3655 0.3142 0.3029 -0.0435 -0.0603 -0.0056 147 ARG A CD  
626  N NE  . ARG A  88  ? 0.3429 0.3166 0.2861 -0.0640 -0.0628 -0.0072 147 ARG A NE  
627  C CZ  . ARG A  88  ? 0.3546 0.3355 0.2930 -0.0849 -0.0635 0.0030  147 ARG A CZ  
628  N NH1 . ARG A  88  ? 0.3674 0.3285 0.2977 -0.0856 -0.0648 0.0158  147 ARG A NH1 
629  N NH2 . ARG A  88  ? 0.3798 0.3873 0.3206 -0.1076 -0.0648 0.0008  147 ARG A NH2 
630  N N   . SER A  89  ? 0.3466 0.2507 0.2712 -0.0029 -0.0372 0.0058  148 SER A N   
631  C CA  . SER A  89  ? 0.3523 0.2483 0.2701 0.0051  -0.0304 0.0043  148 SER A CA  
632  C C   . SER A  89  ? 0.3704 0.2530 0.2845 0.0099  -0.0283 0.0003  148 SER A C   
633  O O   . SER A  89  ? 0.3775 0.2555 0.3018 0.0099  -0.0326 0.0009  148 SER A O   
634  C CB  . SER A  89  ? 0.3454 0.2523 0.2716 0.0046  -0.0247 0.0086  148 SER A CB  
635  O OG  . SER A  89  ? 0.3336 0.2546 0.2650 0.0019  -0.0258 0.0078  148 SER A OG  
636  N N   . ARG A  90  ? 0.3869 0.2636 0.2862 0.0130  -0.0231 -0.0050 149 ARG A N   
637  C CA  . ARG A  90  ? 0.4028 0.2768 0.3006 0.0170  -0.0166 -0.0142 149 ARG A CA  
638  C C   . ARG A  90  ? 0.4103 0.2892 0.2916 0.0137  -0.0060 -0.0160 149 ARG A C   
639  O O   . ARG A  90  ? 0.4147 0.2907 0.2829 0.0090  -0.0081 -0.0081 149 ARG A O   
640  C CB  . ARG A  90  ? 0.4254 0.2872 0.3154 0.0187  -0.0218 -0.0233 149 ARG A CB  
641  C CG  . ARG A  90  ? 0.4319 0.2846 0.3353 0.0187  -0.0342 -0.0214 149 ARG A CG  
642  C CD  . ARG A  90  ? 0.4523 0.3028 0.3777 0.0236  -0.0378 -0.0238 149 ARG A CD  
643  N NE  . ARG A  90  ? 0.4481 0.2967 0.3796 0.0326  -0.0343 -0.0418 149 ARG A NE  
644  C CZ  . ARG A  90  ? 0.4850 0.3199 0.4167 0.0363  -0.0419 -0.0534 149 ARG A CZ  
645  N NH1 . ARG A  90  ? 0.5109 0.3307 0.4352 0.0303  -0.0540 -0.0461 149 ARG A NH1 
646  N NH2 . ARG A  90  ? 0.5080 0.3471 0.4489 0.0454  -0.0373 -0.0750 149 ARG A NH2 
647  N N   . LEU A  91  ? 0.4154 0.3022 0.2986 0.0152  0.0036  -0.0277 150 LEU A N   
648  C CA  . LEU A  91  ? 0.4310 0.3267 0.2951 0.0069  0.0155  -0.0308 150 LEU A CA  
649  C C   . LEU A  91  ? 0.4543 0.3412 0.2879 0.0002  0.0154  -0.0366 150 LEU A C   
650  O O   . LEU A  91  ? 0.4699 0.3584 0.3057 0.0042  0.0170  -0.0514 150 LEU A O   
651  C CB  . LEU A  91  ? 0.4214 0.3393 0.3060 0.0096  0.0280  -0.0440 150 LEU A CB  
652  C CG  . LEU A  91  ? 0.3864 0.3116 0.2978 0.0142  0.0259  -0.0360 150 LEU A CG  
653  C CD1 . LEU A  91  ? 0.3484 0.2982 0.2840 0.0177  0.0365  -0.0511 150 LEU A CD1 
654  C CD2 . LEU A  91  ? 0.3580 0.2788 0.2575 0.0065  0.0242  -0.0190 150 LEU A CD2 
655  N N   . GLY A  92  ? 0.4676 0.3430 0.2731 -0.0100 0.0106  -0.0248 151 GLY A N   
656  C CA  . GLY A  92  ? 0.5101 0.3734 0.2815 -0.0192 0.0064  -0.0262 151 GLY A CA  
657  C C   . GLY A  92  ? 0.5408 0.4188 0.2929 -0.0291 0.0211  -0.0420 151 GLY A C   
658  O O   . GLY A  92  ? 0.5662 0.4376 0.2976 -0.0328 0.0182  -0.0494 151 GLY A O   
659  N N   . CYS A  93  ? 0.5563 0.4583 0.3162 -0.0342 0.0374  -0.0497 152 CYS A N   
660  C CA  . CYS A  93  ? 0.5984 0.5246 0.3433 -0.0454 0.0546  -0.0704 152 CYS A CA  
661  C C   . CYS A  93  ? 0.5981 0.5349 0.3691 -0.0295 0.0575  -0.0963 152 CYS A C   
662  O O   . CYS A  93  ? 0.6204 0.5737 0.3766 -0.0369 0.0681  -0.1175 152 CYS A O   
663  C CB  . CYS A  93  ? 0.5974 0.5533 0.3476 -0.0566 0.0723  -0.0753 152 CYS A CB  
664  S SG  . CYS A  93  ? 0.5935 0.5687 0.4035 -0.0357 0.0761  -0.0830 152 CYS A SG  
665  N N   . GLN A  94  ? 0.5796 0.5058 0.3880 -0.0096 0.0464  -0.0948 153 GLN A N   
666  C CA  . GLN A  94  ? 0.5780 0.5030 0.4136 0.0064  0.0412  -0.1153 153 GLN A CA  
667  C C   . GLN A  94  ? 0.5783 0.4750 0.4012 0.0093  0.0249  -0.1082 153 GLN A C   
668  O O   . GLN A  94  ? 0.5816 0.4729 0.4216 0.0198  0.0186  -0.1240 153 GLN A O   
669  C CB  . GLN A  94  ? 0.5516 0.4772 0.4335 0.0231  0.0341  -0.1154 153 GLN A CB  
670  C CG  . GLN A  94  ? 0.5478 0.5017 0.4500 0.0227  0.0473  -0.1220 153 GLN A CG  
671  C CD  . GLN A  94  ? 0.5684 0.5553 0.4782 0.0216  0.0637  -0.1548 153 GLN A CD  
672  O OE1 . GLN A  94  ? 0.5907 0.5799 0.5257 0.0356  0.0588  -0.1787 153 GLN A OE1 
673  N NE2 . GLN A  94  ? 0.5996 0.6134 0.4879 0.0037  0.0825  -0.1576 153 GLN A NE2 
674  N N   . ILE A  95  ? 0.5777 0.4562 0.3744 0.0008  0.0159  -0.0863 154 ILE A N   
675  C CA  . ILE A  95  ? 0.5878 0.4440 0.3766 0.0033  0.0000  -0.0818 154 ILE A CA  
676  C C   . ILE A  95  ? 0.6319 0.4825 0.3799 -0.0089 -0.0001 -0.0866 154 ILE A C   
677  O O   . ILE A  95  ? 0.6562 0.5004 0.3730 -0.0220 -0.0024 -0.0722 154 ILE A O   
678  C CB  . ILE A  95  ? 0.5585 0.4008 0.3524 0.0043  -0.0134 -0.0594 154 ILE A CB  
679  C CG1 . ILE A  95  ? 0.5233 0.3711 0.3529 0.0131  -0.0144 -0.0538 154 ILE A CG1 
680  C CG2 . ILE A  95  ? 0.5554 0.3813 0.3419 0.0047  -0.0282 -0.0580 154 ILE A CG2 
681  C CD1 . ILE A  95  ? 0.5018 0.3484 0.3587 0.0231  -0.0174 -0.0672 154 ILE A CD1 
682  N N   . CYS A  96  ? 0.6510 0.5011 0.3982 -0.0056 -0.0004 -0.1064 155 CYS A N   
683  C CA  . CYS A  96  ? 0.7020 0.5487 0.4078 -0.0190 -0.0003 -0.1134 155 CYS A CA  
684  C C   . CYS A  96  ? 0.6975 0.5186 0.3905 -0.0191 -0.0205 -0.1023 155 CYS A C   
685  O O   . CYS A  96  ? 0.6729 0.4833 0.3934 -0.0074 -0.0317 -0.1016 155 CYS A O   
686  C CB  . CYS A  96  ? 0.7272 0.5927 0.4358 -0.0173 0.0121  -0.1465 155 CYS A CB  
687  S SG  . CYS A  96  ? 0.7965 0.7029 0.5061 -0.0264 0.0391  -0.1632 155 CYS A SG  
688  N N   . LEU A  97  ? 0.7200 0.5317 0.3703 -0.0346 -0.0265 -0.0933 156 LEU A N   
689  C CA  . LEU A  97  ? 0.7281 0.5178 0.3639 -0.0361 -0.0472 -0.0846 156 LEU A CA  
690  C C   . LEU A  97  ? 0.7368 0.5232 0.3759 -0.0313 -0.0504 -0.1046 156 LEU A C   
691  O O   . LEU A  97  ? 0.7659 0.5650 0.3940 -0.0349 -0.0376 -0.1274 156 LEU A O   
692  C CB  . LEU A  97  ? 0.7706 0.5485 0.3558 -0.0556 -0.0554 -0.0721 156 LEU A CB  
693  C CG  . LEU A  97  ? 0.7589 0.5272 0.3384 -0.0607 -0.0638 -0.0481 156 LEU A CG  
694  C CD1 . LEU A  97  ? 0.7967 0.5457 0.3226 -0.0818 -0.0784 -0.0357 156 LEU A CD1 
695  C CD2 . LEU A  97  ? 0.6917 0.4508 0.3081 -0.0448 -0.0803 -0.0371 156 LEU A CD2 
696  N N   . THR A  98  ? 0.7178 0.4895 0.3742 -0.0239 -0.0677 -0.0981 157 THR A N   
697  C CA  . THR A  98  ? 0.7282 0.4908 0.3845 -0.0218 -0.0764 -0.1129 157 THR A CA  
698  C C   . THR A  98  ? 0.7469 0.4935 0.3829 -0.0286 -0.0974 -0.1004 157 THR A C   
699  O O   . THR A  98  ? 0.7354 0.4784 0.3738 -0.0292 -0.1072 -0.0819 157 THR A O   
700  C CB  . THR A  98  ? 0.6970 0.4568 0.3980 -0.0083 -0.0800 -0.1183 157 THR A CB  
701  O OG1 . THR A  98  ? 0.6749 0.4318 0.3969 -0.0062 -0.0907 -0.0985 157 THR A OG1 
702  C CG2 . THR A  98  ? 0.6466 0.4189 0.3717 0.0002  -0.0651 -0.1299 157 THR A CG2 
703  N N   . LYS A  99  ? 0.7872 0.5246 0.4052 -0.0329 -0.1061 -0.1123 158 LYS A N   
704  C CA  . LYS A  99  ? 0.8049 0.5281 0.4111 -0.0375 -0.1290 -0.1018 158 LYS A CA  
705  C C   . LYS A  99  ? 0.7621 0.4874 0.4092 -0.0285 -0.1403 -0.0884 158 LYS A C   
706  O O   . LYS A  99  ? 0.7534 0.4751 0.3991 -0.0299 -0.1563 -0.0759 158 LYS A O   
707  C CB  . LYS A  99  ? 0.8367 0.5509 0.4305 -0.0406 -0.1372 -0.1188 158 LYS A CB  
708  C CG  . LYS A  99  ? 0.9109 0.6285 0.4649 -0.0509 -0.1253 -0.1390 158 LYS A CG  
709  C CD  . LYS A  99  ? 0.9618 0.6695 0.5096 -0.0518 -0.1355 -0.1588 158 LYS A CD  
710  C CE  . LYS A  99  ? 1.0169 0.7334 0.5276 -0.0620 -0.1225 -0.1849 158 LYS A CE  
711  N NZ  . LYS A  99  ? 1.0269 0.7346 0.5366 -0.0606 -0.1309 -0.2095 158 LYS A NZ  
712  N N   . SER A  100 ? 0.7323 0.4649 0.4160 -0.0204 -0.1331 -0.0921 159 SER A N   
713  C CA  . SER A  100 ? 0.7104 0.4503 0.4301 -0.0169 -0.1418 -0.0826 159 SER A CA  
714  C C   . SER A  100 ? 0.6872 0.4393 0.4205 -0.0140 -0.1407 -0.0683 159 SER A C   
715  O O   . SER A  100 ? 0.6548 0.4188 0.4150 -0.0128 -0.1490 -0.0634 159 SER A O   
716  C CB  . SER A  100 ? 0.7006 0.4418 0.4489 -0.0135 -0.1354 -0.0874 159 SER A CB  
717  O OG  . SER A  100 ? 0.6943 0.4435 0.4535 -0.0083 -0.1203 -0.0838 159 SER A OG  
718  N N   . MET A  101 ? 0.6956 0.4474 0.4117 -0.0139 -0.1298 -0.0641 160 MET A N   
719  C CA  . MET A  101 ? 0.6829 0.4425 0.4096 -0.0111 -0.1293 -0.0519 160 MET A CA  
720  C C   . MET A  101 ? 0.7026 0.4522 0.4134 -0.0135 -0.1490 -0.0437 160 MET A C   
721  O O   . MET A  101 ? 0.6954 0.4482 0.4175 -0.0099 -0.1534 -0.0352 160 MET A O   
722  C CB  . MET A  101 ? 0.6860 0.4486 0.4017 -0.0117 -0.1105 -0.0505 160 MET A CB  
723  C CG  . MET A  101 ? 0.6861 0.4589 0.4274 -0.0061 -0.0956 -0.0569 160 MET A CG  
724  S SD  . MET A  101 ? 0.7397 0.5215 0.4735 -0.0063 -0.0747 -0.0581 160 MET A SD  
725  C CE  . MET A  101 ? 0.7295 0.5161 0.4909 0.0019  -0.0653 -0.0733 160 MET A CE  
726  N N   . ASP A  102 ? 0.7292 0.4645 0.4145 -0.0193 -0.1636 -0.0466 161 ASP A N   
727  C CA  . ASP A  102 ? 0.7514 0.4709 0.4183 -0.0224 -0.1881 -0.0378 161 ASP A CA  
728  C C   . ASP A  102 ? 0.7166 0.4481 0.4258 -0.0116 -0.2028 -0.0356 161 ASP A C   
729  O O   . ASP A  102 ? 0.6948 0.4463 0.4401 -0.0063 -0.2026 -0.0442 161 ASP A O   
730  C CB  . ASP A  102 ? 0.7861 0.4927 0.4302 -0.0288 -0.2044 -0.0434 161 ASP A CB  
731  C CG  . ASP A  102 ? 0.8374 0.5200 0.4490 -0.0360 -0.2320 -0.0326 161 ASP A CG  
732  O OD1 . ASP A  102 ? 0.8834 0.5530 0.4761 -0.0405 -0.2369 -0.0197 161 ASP A OD1 
733  O OD2 . ASP A  102 ? 0.9071 0.5808 0.5099 -0.0387 -0.2517 -0.0362 161 ASP A OD2 
734  N N   . ASN A  103 ? 0.7153 0.4355 0.4197 -0.0099 -0.2160 -0.0257 162 ASN A N   
735  C CA  . ASN A  103 ? 0.6847 0.4159 0.4309 0.0022  -0.2331 -0.0278 162 ASN A CA  
736  C C   . ASN A  103 ? 0.6351 0.3964 0.4229 0.0102  -0.2138 -0.0332 162 ASN A C   
737  O O   . ASN A  103 ? 0.6211 0.4022 0.4499 0.0199  -0.2245 -0.0417 162 ASN A O   
738  C CB  . ASN A  103 ? 0.6872 0.4267 0.4579 0.0075  -0.2560 -0.0381 162 ASN A CB  
739  C CG  . ASN A  103 ? 0.7277 0.4360 0.4586 -0.0001 -0.2810 -0.0322 162 ASN A CG  
740  O OD1 . ASN A  103 ? 0.7389 0.4184 0.4450 -0.0029 -0.3033 -0.0205 162 ASN A OD1 
741  N ND2 . ASN A  103 ? 0.7027 0.4144 0.4261 -0.0053 -0.2802 -0.0395 162 ASN A ND2 
742  N N   . MET A  104 ? 0.6101 0.3769 0.3888 0.0060  -0.1870 -0.0302 163 MET A N   
743  C CA  . MET A  104 ? 0.5707 0.3632 0.3831 0.0110  -0.1699 -0.0331 163 MET A CA  
744  C C   . MET A  104 ? 0.5711 0.3580 0.3864 0.0154  -0.1741 -0.0268 163 MET A C   
745  O O   . MET A  104 ? 0.6047 0.3643 0.3894 0.0114  -0.1858 -0.0170 163 MET A O   
746  C CB  . MET A  104 ? 0.5535 0.3501 0.3570 0.0060  -0.1444 -0.0317 163 MET A CB  
747  C CG  . MET A  104 ? 0.5648 0.3468 0.3391 0.0021  -0.1330 -0.0237 163 MET A CG  
748  S SD  . MET A  104 ? 0.5339 0.3232 0.3057 -0.0002 -0.1067 -0.0270 163 MET A SD  
749  C CE  . MET A  104 ? 0.5918 0.3681 0.3246 -0.0084 -0.0983 -0.0212 163 MET A CE  
750  N N   . THR A  105 ? 0.5356 0.3477 0.3846 0.0208  -0.1641 -0.0317 164 THR A N   
751  C CA  . THR A  105 ? 0.5315 0.3409 0.3887 0.0258  -0.1672 -0.0284 164 THR A CA  
752  C C   . THR A  105 ? 0.5036 0.3244 0.3609 0.0223  -0.1415 -0.0239 164 THR A C   
753  O O   . THR A  105 ? 0.4868 0.3275 0.3570 0.0197  -0.1265 -0.0279 164 THR A O   
754  C CB  . THR A  105 ? 0.5209 0.3555 0.4232 0.0362  -0.1800 -0.0434 164 THR A CB  
755  O OG1 . THR A  105 ? 0.5491 0.3759 0.4568 0.0407  -0.2057 -0.0498 164 THR A OG1 
756  C CG2 . THR A  105 ? 0.5222 0.3516 0.4362 0.0433  -0.1874 -0.0431 164 THR A CG2 
757  N N   . VAL A  106 ? 0.5073 0.3132 0.3487 0.0205  -0.1387 -0.0145 165 VAL A N   
758  C CA  . VAL A  106 ? 0.4811 0.2994 0.3277 0.0186  -0.1174 -0.0113 165 VAL A CA  
759  C C   . VAL A  106 ? 0.4872 0.3031 0.3467 0.0234  -0.1260 -0.0102 165 VAL A C   
760  O O   . VAL A  106 ? 0.5080 0.3021 0.3605 0.0256  -0.1484 -0.0078 165 VAL A O   
761  C CB  . VAL A  106 ? 0.4885 0.2928 0.3017 0.0096  -0.1034 -0.0025 165 VAL A CB  
762  C CG1 . VAL A  106 ? 0.4965 0.3021 0.2995 0.0066  -0.0960 -0.0071 165 VAL A CG1 
763  C CG2 . VAL A  106 ? 0.5174 0.2934 0.2973 0.0022  -0.1168 0.0075  165 VAL A CG2 
764  N N   . ARG A  107 ? 0.4655 0.3010 0.3438 0.0247  -0.1116 -0.0121 166 ARG A N   
765  C CA  . ARG A  107 ? 0.4802 0.3103 0.3679 0.0284  -0.1195 -0.0114 166 ARG A CA  
766  C C   . ARG A  107 ? 0.4783 0.3010 0.3480 0.0208  -0.1046 0.0001  166 ARG A C   
767  O O   . ARG A  107 ? 0.4460 0.2835 0.3149 0.0169  -0.0842 0.0017  166 ARG A O   
768  C CB  . ARG A  107 ? 0.4578 0.3198 0.3866 0.0365  -0.1194 -0.0272 166 ARG A CB  
769  C CG  . ARG A  107 ? 0.4787 0.3342 0.4182 0.0412  -0.1276 -0.0289 166 ARG A CG  
770  C CD  . ARG A  107 ? 0.5182 0.4048 0.5006 0.0514  -0.1344 -0.0514 166 ARG A CD  
771  N NE  . ARG A  107 ? 0.5262 0.4529 0.5228 0.0452  -0.1115 -0.0582 166 ARG A NE  
772  C CZ  . ARG A  107 ? 0.5446 0.4862 0.5433 0.0399  -0.0954 -0.0559 166 ARG A CZ  
773  N NH1 . ARG A  107 ? 0.5667 0.5408 0.5733 0.0310  -0.0789 -0.0596 166 ARG A NH1 
774  N NH2 . ARG A  107 ? 0.5371 0.4603 0.5282 0.0411  -0.0971 -0.0489 166 ARG A NH2 
775  N N   . VAL A  108 ? 0.4996 0.2983 0.3565 0.0182  -0.1177 0.0079  167 VAL A N   
776  C CA  . VAL A  108 ? 0.5052 0.3002 0.3492 0.0096  -0.1051 0.0175  167 VAL A CA  
777  C C   . VAL A  108 ? 0.4782 0.2918 0.3545 0.0171  -0.1024 0.0096  167 VAL A C   
778  O O   . VAL A  108 ? 0.4855 0.2918 0.3794 0.0248  -0.1214 0.0027  167 VAL A O   
779  C CB  . VAL A  108 ? 0.5544 0.3131 0.3627 -0.0028 -0.1200 0.0324  167 VAL A CB  
780  C CG1 . VAL A  108 ? 0.5436 0.3072 0.3355 -0.0162 -0.1002 0.0414  167 VAL A CG1 
781  C CG2 . VAL A  108 ? 0.5702 0.3081 0.3455 -0.0107 -0.1307 0.0385  167 VAL A CG2 
782  N N   . PRO A  109 ? 0.4536 0.2916 0.3395 0.0152  -0.0807 0.0085  168 PRO A N   
783  C CA  . PRO A  109 ? 0.4412 0.2980 0.3534 0.0197  -0.0778 0.0010  168 PRO A CA  
784  C C   . PRO A  109 ? 0.4596 0.2996 0.3631 0.0147  -0.0815 0.0090  168 PRO A C   
785  O O   . PRO A  109 ? 0.4749 0.2964 0.3507 0.0039  -0.0786 0.0220  168 PRO A O   
786  C CB  . PRO A  109 ? 0.4063 0.2886 0.3252 0.0164  -0.0567 0.0012  168 PRO A CB  
787  C CG  . PRO A  109 ? 0.4169 0.2879 0.3120 0.0101  -0.0474 0.0106  168 PRO A CG  
788  C CD  . PRO A  109 ? 0.4499 0.2966 0.3231 0.0087  -0.0605 0.0136  168 PRO A CD  
789  N N   . GLU A  110 ? 0.4615 0.3116 0.3888 0.0205  -0.0866 -0.0004 169 GLU A N   
790  C CA  . GLU A  110 ? 0.4796 0.3137 0.4031 0.0161  -0.0924 0.0052  169 GLU A CA  
791  C C   . GLU A  110 ? 0.4556 0.3015 0.3691 0.0058  -0.0707 0.0152  169 GLU A C   
792  O O   . GLU A  110 ? 0.4344 0.3050 0.3550 0.0061  -0.0537 0.0131  169 GLU A O   
793  C CB  . GLU A  110 ? 0.4729 0.3193 0.4284 0.0264  -0.1027 -0.0122 169 GLU A CB  
794  C CG  . GLU A  110 ? 0.4917 0.3802 0.4680 0.0273  -0.0832 -0.0232 169 GLU A CG  
795  C CD  . GLU A  110 ? 0.5572 0.4627 0.5620 0.0340  -0.0897 -0.0424 169 GLU A CD  
796  O OE1 . GLU A  110 ? 0.5455 0.4882 0.5644 0.0316  -0.0749 -0.0526 169 GLU A OE1 
797  O OE2 . GLU A  110 ? 0.6227 0.5031 0.6343 0.0400  -0.1110 -0.0475 169 GLU A OE2 
798  N N   . THR A  111 ? 0.4749 0.3011 0.3720 -0.0044 -0.0740 0.0262  170 THR A N   
799  C CA  . THR A  111 ? 0.4551 0.2944 0.3470 -0.0145 -0.0555 0.0334  170 THR A CA  
800  C C   . THR A  111 ? 0.4356 0.2902 0.3515 -0.0106 -0.0542 0.0263  170 THR A C   
801  O O   . THR A  111 ? 0.4431 0.2928 0.3752 -0.0023 -0.0693 0.0161  170 THR A O   
802  C CB  . THR A  111 ? 0.4891 0.3035 0.3514 -0.0319 -0.0598 0.0480  170 THR A CB  
803  O OG1 . THR A  111 ? 0.5153 0.3053 0.3803 -0.0334 -0.0804 0.0500  170 THR A OG1 
804  C CG2 . THR A  111 ? 0.4759 0.2702 0.3072 -0.0396 -0.0659 0.0556  170 THR A CG2 
805  N N   . VAL A  112 ? 0.4129 0.2859 0.3319 -0.0168 -0.0379 0.0302  171 VAL A N   
806  C CA  . VAL A  112 ? 0.3924 0.2792 0.3295 -0.0162 -0.0363 0.0255  171 VAL A CA  
807  C C   . VAL A  112 ? 0.4228 0.2848 0.3568 -0.0208 -0.0528 0.0273  171 VAL A C   
808  O O   . VAL A  112 ? 0.4184 0.2857 0.3708 -0.0150 -0.0600 0.0166  171 VAL A O   
809  C CB  . VAL A  112 ? 0.3852 0.2934 0.3258 -0.0226 -0.0188 0.0305  171 VAL A CB  
810  C CG1 . VAL A  112 ? 0.3802 0.2785 0.3026 -0.0371 -0.0138 0.0410  171 VAL A CG1 
811  C CG2 . VAL A  112 ? 0.3374 0.2644 0.2979 -0.0211 -0.0174 0.0248  171 VAL A CG2 
812  N N   . ALA A  113 ? 0.4563 0.2902 0.3655 -0.0328 -0.0603 0.0401  172 ALA A N   
813  C CA  . ALA A  113 ? 0.4914 0.2925 0.3929 -0.0401 -0.0813 0.0454  172 ALA A CA  
814  C C   . ALA A  113 ? 0.5100 0.2906 0.4256 -0.0249 -0.1069 0.0332  172 ALA A C   
815  O O   . ALA A  113 ? 0.5166 0.2845 0.4481 -0.0201 -0.1238 0.0247  172 ALA A O   
816  C CB  . ALA A  113 ? 0.5245 0.2996 0.3893 -0.0614 -0.0847 0.0643  172 ALA A CB  
817  N N   . ASP A  114 ? 0.5174 0.2964 0.4309 -0.0163 -0.1110 0.0296  173 ASP A N   
818  C CA  . ASP A  114 ? 0.5275 0.2963 0.4632 0.0008  -0.1345 0.0128  173 ASP A CA  
819  C C   . ASP A  114 ? 0.4886 0.2944 0.4615 0.0142  -0.1268 -0.0109 173 ASP A C   
820  O O   . ASP A  114 ? 0.4835 0.2831 0.4796 0.0245  -0.1454 -0.0277 173 ASP A O   
821  C CB  . ASP A  114 ? 0.5247 0.2946 0.4558 0.0076  -0.1367 0.0109  173 ASP A CB  
822  C CG  . ASP A  114 ? 0.5773 0.3126 0.4685 -0.0070 -0.1451 0.0324  173 ASP A CG  
823  O OD1 . ASP A  114 ? 0.6367 0.3340 0.5064 -0.0200 -0.1638 0.0465  173 ASP A OD1 
824  O OD2 . ASP A  114 ? 0.5790 0.3248 0.4581 -0.0077 -0.1337 0.0351  173 ASP A OD2 
825  N N   . ALA A  115 ? 0.4634 0.3077 0.4407 0.0125  -0.1006 -0.0126 174 ALA A N   
826  C CA  . ALA A  115 ? 0.4478 0.3305 0.4529 0.0194  -0.0918 -0.0331 174 ALA A CA  
827  C C   . ALA A  115 ? 0.4599 0.3422 0.4743 0.0164  -0.0950 -0.0379 174 ALA A C   
828  O O   . ALA A  115 ? 0.4538 0.3611 0.4923 0.0230  -0.0957 -0.0599 174 ALA A O   
829  C CB  . ALA A  115 ? 0.4048 0.3214 0.4062 0.0141  -0.0672 -0.0286 174 ALA A CB  
830  N N   . ARG A  116 ? 0.4845 0.3417 0.4796 0.0046  -0.0962 -0.0190 175 ARG A N   
831  C CA  . ARG A  116 ? 0.4904 0.3505 0.4908 -0.0018 -0.0948 -0.0195 175 ARG A CA  
832  C C   . ARG A  116 ? 0.5292 0.3682 0.5476 0.0062  -0.1202 -0.0360 175 ARG A C   
833  O O   . ARG A  116 ? 0.5583 0.3571 0.5716 0.0088  -0.1451 -0.0327 175 ARG A O   
834  C CB  . ARG A  116 ? 0.5015 0.3442 0.4771 -0.0192 -0.0884 0.0046  175 ARG A CB  
835  C CG  . ARG A  116 ? 0.4932 0.3444 0.4750 -0.0279 -0.0840 0.0054  175 ARG A CG  
836  C CD  . ARG A  116 ? 0.4743 0.3216 0.4364 -0.0467 -0.0728 0.0262  175 ARG A CD  
837  N NE  . ARG A  116 ? 0.4497 0.3235 0.4075 -0.0478 -0.0510 0.0321  175 ARG A NE  
838  C CZ  . ARG A  116 ? 0.4498 0.3180 0.3877 -0.0565 -0.0434 0.0439  175 ARG A CZ  
839  N NH1 . ARG A  116 ? 0.4125 0.3076 0.3543 -0.0537 -0.0253 0.0437  175 ARG A NH1 
840  N NH2 . ARG A  116 ? 0.4670 0.3036 0.3804 -0.0693 -0.0546 0.0554  175 ARG A NH2 
841  N N   . GLN A  117 ? 0.5260 0.3904 0.5650 0.0096  -0.1164 -0.0543 176 GLN A N   
842  C CA  . GLN A  117 ? 0.5661 0.4121 0.6254 0.0175  -0.1403 -0.0733 176 GLN A CA  
843  C C   . GLN A  117 ? 0.5702 0.3996 0.6207 0.0042  -0.1426 -0.0618 176 GLN A C   
844  O O   . GLN A  117 ? 0.6021 0.3927 0.6551 0.0041  -0.1680 -0.0627 176 GLN A O   
845  C CB  . GLN A  117 ? 0.5607 0.4478 0.6537 0.0320  -0.1387 -0.1100 176 GLN A CB  
846  C CG  . GLN A  117 ? 0.6054 0.4942 0.7170 0.0485  -0.1517 -0.1282 176 GLN A CG  
847  C CD  . GLN A  117 ? 0.6432 0.5892 0.7859 0.0576  -0.1409 -0.1649 176 GLN A CD  
848  O OE1 . GLN A  117 ? 0.6565 0.6241 0.8224 0.0617  -0.1436 -0.1925 176 GLN A OE1 
849  N NE2 . GLN A  117 ? 0.6673 0.6400 0.8099 0.0587  -0.1285 -0.1666 176 GLN A NE2 
850  N N   . SER A  118 ? 0.5430 0.3986 0.5832 -0.0077 -0.1189 -0.0498 177 SER A N   
851  C CA  . SER A  118 ? 0.5655 0.4055 0.5952 -0.0230 -0.1202 -0.0350 177 SER A CA  
852  C C   . SER A  118 ? 0.5350 0.3965 0.5490 -0.0376 -0.0955 -0.0140 177 SER A C   
853  O O   . SER A  118 ? 0.5107 0.4039 0.5259 -0.0347 -0.0772 -0.0140 177 SER A O   
854  C CB  . SER A  118 ? 0.5726 0.4209 0.6236 -0.0194 -0.1289 -0.0568 177 SER A CB  
855  O OG  . SER A  118 ? 0.5596 0.4567 0.6217 -0.0163 -0.1097 -0.0715 177 SER A OG  
856  N N   . ILE A  119 ? 0.5499 0.3932 0.5513 -0.0539 -0.0978 0.0024  178 ILE A N   
857  C CA  . ILE A  119 ? 0.5219 0.3887 0.5166 -0.0673 -0.0773 0.0170  178 ILE A CA  
858  C C   . ILE A  119 ? 0.4992 0.3959 0.5116 -0.0659 -0.0707 0.0061  178 ILE A C   
859  O O   . ILE A  119 ? 0.5096 0.3971 0.5322 -0.0639 -0.0845 -0.0066 178 ILE A O   
860  C CB  . ILE A  119 ? 0.5500 0.3901 0.5267 -0.0885 -0.0836 0.0350  178 ILE A CB  
861  C CG1 . ILE A  119 ? 0.5704 0.3827 0.5224 -0.0945 -0.0894 0.0483  178 ILE A CG1 
862  C CG2 . ILE A  119 ? 0.5189 0.3895 0.4981 -0.1018 -0.0643 0.0434  178 ILE A CG2 
863  C CD1 . ILE A  119 ? 0.6247 0.3956 0.5529 -0.1171 -0.1072 0.0650  178 ILE A CD1 
864  N N   . ASP A  120 ? 0.4610 0.3912 0.4773 -0.0672 -0.0525 0.0107  179 ASP A N   
865  C CA  . ASP A  120 ? 0.4423 0.4001 0.4715 -0.0681 -0.0481 0.0035  179 ASP A CA  
866  C C   . ASP A  120 ? 0.4403 0.3999 0.4729 -0.0824 -0.0479 0.0118  179 ASP A C   
867  O O   . ASP A  120 ? 0.4516 0.4010 0.4766 -0.0938 -0.0449 0.0249  179 ASP A O   
868  C CB  . ASP A  120 ? 0.4246 0.4120 0.4565 -0.0641 -0.0345 0.0067  179 ASP A CB  
869  C CG  . ASP A  120 ? 0.4450 0.4393 0.4752 -0.0534 -0.0341 -0.0034 179 ASP A CG  
870  O OD1 . ASP A  120 ? 0.5357 0.5276 0.5705 -0.0484 -0.0427 -0.0203 179 ASP A OD1 
871  O OD2 . ASP A  120 ? 0.4219 0.4258 0.4486 -0.0503 -0.0258 0.0032  179 ASP A OD2 
872  N N   . VAL A  121 ? 0.4170 0.3935 0.4602 -0.0838 -0.0504 0.0032  180 VAL A N   
873  C CA  . VAL A  121 ? 0.4089 0.3956 0.4594 -0.0965 -0.0494 0.0094  180 VAL A CA  
874  C C   . VAL A  121 ? 0.3987 0.4114 0.4558 -0.0987 -0.0357 0.0204  180 VAL A C   
875  O O   . VAL A  121 ? 0.3944 0.4252 0.4550 -0.0905 -0.0311 0.0193  180 VAL A O   
876  C CB  . VAL A  121 ? 0.4005 0.4021 0.4594 -0.0968 -0.0558 -0.0036 180 VAL A CB  
877  C CG1 . VAL A  121 ? 0.3786 0.3901 0.4465 -0.1102 -0.0567 0.0029  180 VAL A CG1 
878  C CG2 . VAL A  121 ? 0.3939 0.3749 0.4526 -0.0916 -0.0699 -0.0214 180 VAL A CG2 
879  N N   . GLY A  122 ? 0.4077 0.4231 0.4681 -0.1108 -0.0305 0.0297  181 GLY A N   
880  C CA  . GLY A  122 ? 0.3960 0.4404 0.4707 -0.1113 -0.0189 0.0342  181 GLY A CA  
881  C C   . GLY A  122 ? 0.3949 0.4632 0.4891 -0.1141 -0.0229 0.0317  181 GLY A C   
882  O O   . GLY A  122 ? 0.4069 0.4711 0.5031 -0.1244 -0.0300 0.0302  181 GLY A O   
883  N N   . LYS A  123 ? 0.3824 0.4729 0.4910 -0.1053 -0.0210 0.0317  182 LYS A N   
884  C CA  . LYS A  123 ? 0.3816 0.4938 0.5091 -0.1065 -0.0286 0.0308  182 LYS A CA  
885  C C   . LYS A  123 ? 0.3718 0.5080 0.5244 -0.1002 -0.0247 0.0313  182 LYS A C   
886  O O   . LYS A  123 ? 0.3698 0.5034 0.5206 -0.0888 -0.0242 0.0323  182 LYS A O   
887  C CB  . LYS A  123 ? 0.3818 0.4905 0.4976 -0.1006 -0.0384 0.0294  182 LYS A CB  
888  C CG  . LYS A  123 ? 0.4059 0.5033 0.5062 -0.1062 -0.0448 0.0221  182 LYS A CG  
889  C CD  . LYS A  123 ? 0.4310 0.5302 0.5154 -0.1024 -0.0490 0.0182  182 LYS A CD  
890  C CE  . LYS A  123 ? 0.4453 0.5303 0.5166 -0.0940 -0.0422 0.0146  182 LYS A CE  
891  N NZ  . LYS A  123 ? 0.4719 0.5649 0.5320 -0.0912 -0.0428 0.0160  182 LYS A NZ  
892  N N   . THR A  124 ? 0.3744 0.5351 0.5535 -0.1067 -0.0234 0.0284  183 THR A N   
893  C CA  . THR A  124 ? 0.3686 0.5559 0.5803 -0.0971 -0.0240 0.0235  183 THR A CA  
894  C C   . THR A  124 ? 0.3677 0.5521 0.5847 -0.0869 -0.0433 0.0274  183 THR A C   
895  O O   . THR A  124 ? 0.3563 0.5427 0.5858 -0.0741 -0.0487 0.0267  183 THR A O   
896  C CB  . THR A  124 ? 0.3686 0.5898 0.6141 -0.1059 -0.0204 0.0159  183 THR A CB  
897  O OG1 . THR A  124 ? 0.4046 0.6249 0.6365 -0.1236 -0.0057 0.0162  183 THR A OG1 
898  C CG2 . THR A  124 ? 0.3724 0.6226 0.6541 -0.0938 -0.0173 0.0046  183 THR A CG2 
899  N N   . SER A  125 ? 0.3715 0.5498 0.5772 -0.0945 -0.0553 0.0316  184 SER A N   
900  C CA  . SER A  125 ? 0.3748 0.5450 0.5707 -0.0911 -0.0736 0.0384  184 SER A CA  
901  C C   . SER A  125 ? 0.3874 0.5502 0.5590 -0.1031 -0.0813 0.0402  184 SER A C   
902  O O   . SER A  125 ? 0.3805 0.5447 0.5503 -0.1122 -0.0764 0.0352  184 SER A O   
903  C CB  . SER A  125 ? 0.3738 0.5609 0.6042 -0.0847 -0.0912 0.0389  184 SER A CB  
904  O OG  . SER A  125 ? 0.3786 0.5819 0.6249 -0.0938 -0.0980 0.0364  184 SER A OG  
905  N N   . ALA A  126 ? 0.4035 0.5588 0.5554 -0.1049 -0.0945 0.0467  185 ALA A N   
906  C CA  . ALA A  126 ? 0.4192 0.5719 0.5431 -0.1179 -0.1006 0.0456  185 ALA A CA  
907  C C   . ALA A  126 ? 0.4408 0.6020 0.5676 -0.1267 -0.1226 0.0526  185 ALA A C   
908  O O   . ALA A  126 ? 0.4561 0.6201 0.6039 -0.1210 -0.1378 0.0606  185 ALA A O   
909  C CB  . ALA A  126 ? 0.4204 0.5627 0.5129 -0.1194 -0.0963 0.0459  185 ALA A CB  
910  N N   . GLU A  127 ? 0.4597 0.6247 0.5664 -0.1403 -0.1264 0.0479  186 GLU A N   
911  C CA  . GLU A  127 ? 0.4832 0.6553 0.5839 -0.1528 -0.1485 0.0549  186 GLU A CA  
912  C C   . GLU A  127 ? 0.4888 0.6638 0.5488 -0.1702 -0.1484 0.0487  186 GLU A C   
913  O O   . GLU A  127 ? 0.4871 0.6633 0.5379 -0.1709 -0.1331 0.0331  186 GLU A O   
914  C CB  . GLU A  127 ? 0.4908 0.6755 0.6217 -0.1539 -0.1545 0.0509  186 GLU A CB  
915  C CG  . GLU A  127 ? 0.5062 0.6979 0.6761 -0.1416 -0.1415 0.0457  186 GLU A CG  
916  C CD  . GLU A  127 ? 0.5705 0.7787 0.7659 -0.1486 -0.1476 0.0407  186 GLU A CD  
917  O OE1 . GLU A  127 ? 0.6239 0.8470 0.8521 -0.1444 -0.1625 0.0440  186 GLU A OE1 
918  O OE2 . GLU A  127 ? 0.5842 0.7902 0.7690 -0.1581 -0.1400 0.0324  186 GLU A OE2 
919  N N   . ASN A  128 ? 0.5049 0.6818 0.5411 -0.1854 -0.1673 0.0596  187 ASN A N   
920  C CA  . ASN A  128 ? 0.5164 0.7044 0.5143 -0.2064 -0.1677 0.0512  187 ASN A CA  
921  C C   . ASN A  128 ? 0.5310 0.7261 0.5262 -0.2206 -0.1891 0.0563  187 ASN A C   
922  O O   . ASN A  128 ? 0.5605 0.7542 0.5309 -0.2375 -0.2102 0.0714  187 ASN A O   
923  C CB  . ASN A  128 ? 0.5308 0.7178 0.4916 -0.2198 -0.1695 0.0593  187 ASN A CB  
924  C CG  . ASN A  128 ? 0.4992 0.6802 0.4642 -0.2057 -0.1492 0.0533  187 ASN A CG  
925  O OD1 . ASN A  128 ? 0.5175 0.7096 0.4677 -0.2087 -0.1318 0.0351  187 ASN A OD1 
926  N ND2 . ASN A  128 ? 0.4822 0.6474 0.4712 -0.1888 -0.1517 0.0655  187 ASN A ND2 
927  N N   . LEU A  129 ? 0.5224 0.7234 0.5418 -0.2155 -0.1854 0.0448  188 LEU A N   
928  C CA  . LEU A  129 ? 0.5416 0.7500 0.5660 -0.2268 -0.2065 0.0489  188 LEU A CA  
929  C C   . LEU A  129 ? 0.5777 0.7974 0.5570 -0.2526 -0.2140 0.0431  188 LEU A C   
930  O O   . LEU A  129 ? 0.5897 0.8156 0.5651 -0.2657 -0.2335 0.0468  188 LEU A O   
931  C CB  . LEU A  129 ? 0.5135 0.7264 0.5767 -0.2170 -0.2007 0.0384  188 LEU A CB  
932  C CG  . LEU A  129 ? 0.4807 0.6901 0.5876 -0.1965 -0.1926 0.0427  188 LEU A CG  
933  C CD1 . LEU A  129 ? 0.4307 0.6493 0.5719 -0.1946 -0.1889 0.0342  188 LEU A CD1 
934  C CD2 . LEU A  129 ? 0.4769 0.6841 0.6028 -0.1885 -0.2115 0.0599  188 LEU A CD2 
935  N N   . TYR A  130 ? 0.5984 0.8242 0.5435 -0.2616 -0.1994 0.0333  189 TYR A N   
936  C CA  . TYR A  130 ? 0.6530 0.8945 0.5498 -0.2909 -0.2075 0.0308  189 TYR A CA  
937  C C   . TYR A  130 ? 0.6961 0.9280 0.5754 -0.3075 -0.2400 0.0606  189 TYR A C   
938  O O   . TYR A  130 ? 0.7287 0.9713 0.5744 -0.3335 -0.2554 0.0624  189 TYR A O   
939  C CB  . TYR A  130 ? 0.6566 0.9109 0.5217 -0.2998 -0.1879 0.0183  189 TYR A CB  
940  C CG  . TYR A  130 ? 0.7164 0.9957 0.5296 -0.3346 -0.1922 0.0111  189 TYR A CG  
941  C CD1 . TYR A  130 ? 0.7668 1.0494 0.5382 -0.3587 -0.1996 0.0284  189 TYR A CD1 
942  C CD2 . TYR A  130 ? 0.7562 1.0559 0.5601 -0.3462 -0.1904 -0.0125 189 TYR A CD2 
943  C CE1 . TYR A  130 ? 0.8124 1.1210 0.5318 -0.3957 -0.2028 0.0228  189 TYR A CE1 
944  C CE2 . TYR A  130 ? 0.8036 1.1307 0.5581 -0.3804 -0.1931 -0.0213 189 TYR A CE2 
945  C CZ  . TYR A  130 ? 0.8346 1.1677 0.5453 -0.4066 -0.1985 -0.0030 189 TYR A CZ  
946  O OH  . TYR A  130 ? 0.8971 1.2612 0.5524 -0.4468 -0.2004 -0.0107 189 TYR A OH  
947  N N   . PHE A  131 ? 0.6994 0.9103 0.6029 -0.2920 -0.2521 0.0821  190 PHE A N   
948  C CA  . PHE A  131 ? 0.7463 0.9396 0.6447 -0.3010 -0.2892 0.1113  190 PHE A CA  
949  C C   . PHE A  131 ? 0.7490 0.9337 0.7002 -0.2820 -0.3121 0.1196  190 PHE A C   
950  O O   . PHE A  131 ? 0.7639 0.9297 0.7326 -0.2743 -0.3383 0.1392  190 PHE A O   
951  C CB  . PHE A  131 ? 0.7543 0.9287 0.6422 -0.2984 -0.2920 0.1280  190 PHE A CB  
952  C CG  . PHE A  131 ? 0.7694 0.9559 0.6070 -0.3203 -0.2731 0.1216  190 PHE A CG  
953  C CD1 . PHE A  131 ? 0.8030 0.9992 0.5831 -0.3588 -0.2866 0.1293  190 PHE A CD1 
954  C CD2 . PHE A  131 ? 0.7232 0.9154 0.5703 -0.3048 -0.2416 0.1057  190 PHE A CD2 
955  C CE1 . PHE A  131 ? 0.8130 1.0293 0.5493 -0.3815 -0.2667 0.1193  190 PHE A CE1 
956  C CE2 . PHE A  131 ? 0.7400 0.9496 0.5465 -0.3247 -0.2240 0.0960  190 PHE A CE2 
957  C CZ  . PHE A  131 ? 0.7838 1.0081 0.5361 -0.3632 -0.2352 0.1015  190 PHE A CZ  
958  N N   . GLN A  132 ? 0.7383 0.9381 0.7175 -0.2747 -0.3038 0.1032  191 GLN A N   
959  C CA  . GLN A  132 ? 0.7374 0.9383 0.7673 -0.2605 -0.3234 0.1070  191 GLN A CA  
960  C C   . GLN A  132 ? 0.7830 0.9798 0.7925 -0.2815 -0.3623 0.1231  191 GLN A C   
961  O O   . GLN A  132 ? 0.8098 1.0166 0.7798 -0.3052 -0.3627 0.1176  191 GLN A O   
962  C CB  . GLN A  132 ? 0.7137 0.9323 0.7725 -0.2523 -0.3014 0.0848  191 GLN A CB  
963  C CG  . GLN A  132 ? 0.7274 0.9565 0.8406 -0.2413 -0.3168 0.0840  191 GLN A CG  
964  C CD  . GLN A  132 ? 0.7029 0.9459 0.8478 -0.2317 -0.2895 0.0643  191 GLN A CD  
965  O OE1 . GLN A  132 ? 0.7271 0.9800 0.8711 -0.2427 -0.2900 0.0541  191 GLN A OE1 
966  N NE2 . GLN A  132 ? 0.6533 0.8951 0.8233 -0.2136 -0.2671 0.0597  191 GLN A NE2 
967  N N   . LYS B  7   ? 0.9139 0.9259 0.7518 0.0432  0.1306  0.1151  66  LYS B N   
968  C CA  . LYS B  7   ? 0.9033 0.9717 0.7652 0.0618  0.1518  0.1277  66  LYS B CA  
969  C C   . LYS B  7   ? 0.8356 0.9614 0.7585 0.0580  0.1230  0.1513  66  LYS B C   
970  O O   . LYS B  7   ? 0.8320 1.0006 0.7579 0.0446  0.1198  0.1666  66  LYS B O   
971  C CB  . LYS B  7   ? 0.9223 0.9859 0.7894 0.1047  0.1938  0.1195  66  LYS B CB  
972  N N   . ILE B  8   ? 0.7937 0.9189 0.7591 0.0662  0.1025  0.1543  67  ILE B N   
973  C CA  . ILE B  8   ? 0.7357 0.9051 0.7507 0.0604  0.0759  0.1737  67  ILE B CA  
974  C C   . ILE B  8   ? 0.7024 0.8536 0.7368 0.0422  0.0374  0.1737  67  ILE B C   
975  O O   . ILE B  8   ? 0.7095 0.8237 0.7359 0.0407  0.0309  0.1607  67  ILE B O   
976  C CB  . ILE B  8   ? 0.7008 0.9058 0.7586 0.0888  0.0896  0.1831  67  ILE B CB  
977  C CG1 . ILE B  8   ? 0.6829 0.8578 0.7555 0.1048  0.0891  0.1712  67  ILE B CG1 
978  C CG2 . ILE B  8   ? 0.7256 0.9579 0.7778 0.1122  0.1276  0.1877  67  ILE B CG2 
979  C CD1 . ILE B  8   ? 0.6389 0.8492 0.7576 0.1137  0.0800  0.1845  67  ILE B CD1 
980  N N   . THR B  9   ? 0.6722 0.8505 0.7330 0.0292  0.0128  0.1895  68  THR B N   
981  C CA  . THR B  9   ? 0.6531 0.8146 0.7344 0.0150  -0.0218 0.1907  68  THR B CA  
982  C C   . THR B  9   ? 0.6146 0.7825 0.7350 0.0312  -0.0260 0.1880  68  THR B C   
983  O O   . THR B  9   ? 0.5963 0.7944 0.7327 0.0384  -0.0193 0.1975  68  THR B O   
984  C CB  . THR B  9   ? 0.6589 0.8341 0.7400 -0.0111 -0.0489 0.2092  68  THR B CB  
985  O OG1 . THR B  9   ? 0.7042 0.8739 0.7448 -0.0315 -0.0469 0.2123  68  THR B OG1 
986  C CG2 . THR B  9   ? 0.6434 0.7971 0.7508 -0.0199 -0.0835 0.2111  68  THR B CG2 
987  N N   . VAL B  10  ? 0.6048 0.7474 0.7390 0.0343  -0.0371 0.1761  69  VAL B N   
988  C CA  . VAL B  10  ? 0.5740 0.7197 0.7412 0.0460  -0.0416 0.1705  69  VAL B CA  
989  C C   . VAL B  10  ? 0.5705 0.6991 0.7587 0.0370  -0.0697 0.1687  69  VAL B C   
990  O O   . VAL B  10  ? 0.5783 0.6897 0.7627 0.0297  -0.0804 0.1662  69  VAL B O   
991  C CB  . VAL B  10  ? 0.5664 0.7020 0.7339 0.0630  -0.0223 0.1565  69  VAL B CB  
992  C CG1 . VAL B  10  ? 0.5381 0.6811 0.7359 0.0712  -0.0260 0.1509  69  VAL B CG1 
993  C CG2 . VAL B  10  ? 0.5764 0.7218 0.7251 0.0764  0.0060  0.1590  69  VAL B CG2 
994  N N   . HIS B  11  ? 0.5608 0.6938 0.7707 0.0373  -0.0813 0.1710  70  HIS B N   
995  C CA  . HIS B  11  ? 0.5638 0.6776 0.7989 0.0365  -0.1029 0.1664  70  HIS B CA  
996  C C   . HIS B  11  ? 0.5445 0.6572 0.8019 0.0528  -0.0922 0.1489  70  HIS B C   
997  O O   . HIS B  11  ? 0.5341 0.6593 0.7901 0.0584  -0.0781 0.1449  70  HIS B O   
998  C CB  . HIS B  11  ? 0.5792 0.6873 0.8169 0.0252  -0.1218 0.1772  70  HIS B CB  
999  C CG  . HIS B  11  ? 0.6025 0.7184 0.8172 0.0052  -0.1325 0.1970  70  HIS B CG  
1000 N ND1 . HIS B  11  ? 0.6196 0.7234 0.8273 -0.0080 -0.1503 0.2063  70  HIS B ND1 
1001 C CD2 . HIS B  11  ? 0.6059 0.7456 0.8029 -0.0063 -0.1284 0.2115  70  HIS B CD2 
1002 C CE1 . HIS B  11  ? 0.6389 0.7566 0.8219 -0.0276 -0.1553 0.2235  70  HIS B CE1 
1003 N NE2 . HIS B  11  ? 0.6295 0.7711 0.8075 -0.0259 -0.1415 0.2270  70  HIS B NE2 
1004 N N   . PHE B  12  ? 0.5415 0.6441 0.8204 0.0584  -0.0997 0.1408  71  PHE B N   
1005 C CA  . PHE B  12  ? 0.5271 0.6329 0.8296 0.0720  -0.0905 0.1244  71  PHE B CA  
1006 C C   . PHE B  12  ? 0.5379 0.6284 0.8691 0.0778  -0.1055 0.1195  71  PHE B C   
1007 O O   . PHE B  12  ? 0.5523 0.6315 0.8980 0.0753  -0.1253 0.1287  71  PHE B O   
1008 C CB  . PHE B  12  ? 0.5214 0.6333 0.8304 0.0748  -0.0853 0.1195  71  PHE B CB  
1009 C CG  . PHE B  12  ? 0.5169 0.6329 0.7959 0.0726  -0.0673 0.1192  71  PHE B CG  
1010 C CD1 . PHE B  12  ? 0.5064 0.6308 0.7868 0.0799  -0.0504 0.1087  71  PHE B CD1 
1011 C CD2 . PHE B  12  ? 0.5353 0.6435 0.7829 0.0629  -0.0667 0.1290  71  PHE B CD2 
1012 C CE1 . PHE B  12  ? 0.5204 0.6404 0.7732 0.0797  -0.0350 0.1094  71  PHE B CE1 
1013 C CE2 . PHE B  12  ? 0.5492 0.6527 0.7678 0.0646  -0.0476 0.1264  71  PHE B CE2 
1014 C CZ  . PHE B  12  ? 0.5372 0.6441 0.7593 0.0741  -0.0325 0.1172  71  PHE B CZ  
1015 N N   . ILE B  13  ? 0.5390 0.6266 0.8773 0.0854  -0.0959 0.1052  72  ILE B N   
1016 C CA  . ILE B  13  ? 0.5593 0.6287 0.9259 0.0970  -0.1027 0.0939  72  ILE B CA  
1017 C C   . ILE B  13  ? 0.5478 0.6373 0.9411 0.1114  -0.0870 0.0782  72  ILE B C   
1018 O O   . ILE B  13  ? 0.5356 0.6398 0.9189 0.1117  -0.0678 0.0663  72  ILE B O   
1019 C CB  . ILE B  13  ? 0.5801 0.6273 0.9311 0.0934  -0.1011 0.0850  72  ILE B CB  
1020 C CG1 . ILE B  13  ? 0.5968 0.6286 0.9225 0.0751  -0.1195 0.1042  72  ILE B CG1 
1021 C CG2 . ILE B  13  ? 0.6001 0.6210 0.9769 0.1093  -0.1025 0.0681  72  ILE B CG2 
1022 C CD1 . ILE B  13  ? 0.6232 0.6312 0.9254 0.0638  -0.1220 0.0996  72  ILE B CD1 
1023 N N   . ASN B  14  ? 0.5550 0.6489 0.9841 0.1215  -0.0968 0.0812  73  ASN B N   
1024 C CA  . ASN B  14  ? 0.5442 0.6666 1.0035 0.1330  -0.0840 0.0712  73  ASN B CA  
1025 C C   . ASN B  14  ? 0.5576 0.6767 1.0361 0.1499  -0.0676 0.0477  73  ASN B C   
1026 O O   . ASN B  14  ? 0.5783 0.6641 1.0481 0.1536  -0.0696 0.0393  73  ASN B O   
1027 C CB  . ASN B  14  ? 0.5546 0.6888 1.0511 0.1368  -0.1029 0.0874  73  ASN B CB  
1028 C CG  . ASN B  14  ? 0.5510 0.7224 1.0570 0.1310  -0.0969 0.0914  73  ASN B CG  
1029 O OD1 . ASN B  14  ? 0.5405 0.7311 1.0393 0.1311  -0.0764 0.0780  73  ASN B OD1 
1030 N ND2 . ASN B  14  ? 0.5502 0.7307 1.0691 0.1216  -0.1174 0.1124  73  ASN B ND2 
1031 N N   . ARG B  15  ? 0.5479 0.7002 1.0497 0.1581  -0.0511 0.0369  74  ARG B N   
1032 C CA  . ARG B  15  ? 0.5675 0.7226 1.0906 0.1755  -0.0318 0.0129  74  ARG B CA  
1033 C C   . ARG B  15  ? 0.6046 0.7359 1.1659 0.1980  -0.0416 0.0113  74  ARG B C   
1034 O O   . ARG B  15  ? 0.6390 0.7432 1.1990 0.2108  -0.0288 -0.0102 74  ARG B O   
1035 C CB  . ARG B  15  ? 0.5503 0.7556 1.0985 0.1790  -0.0147 0.0068  74  ARG B CB  
1036 C CG  . ARG B  15  ? 0.5289 0.7504 1.0374 0.1587  -0.0014 0.0036  74  ARG B CG  
1037 C CD  . ARG B  15  ? 0.5062 0.7748 1.0321 0.1531  0.0056  0.0083  74  ARG B CD  
1038 N NE  . ARG B  15  ? 0.4944 0.7659 0.9776 0.1320  0.0112  0.0118  74  ARG B NE  
1039 C CZ  . ARG B  15  ? 0.4858 0.7762 0.9614 0.1179  0.0075  0.0247  74  ARG B CZ  
1040 N NH1 . ARG B  15  ? 0.4945 0.8086 1.0006 0.1181  -0.0028 0.0366  74  ARG B NH1 
1041 N NH2 . ARG B  15  ? 0.4710 0.7544 0.9073 0.1022  0.0128  0.0276  74  ARG B NH2 
1042 N N   . ASP B  16  ? 0.6053 0.7445 1.1981 0.2012  -0.0646 0.0350  75  ASP B N   
1043 C CA  . ASP B  16  ? 0.6396 0.7561 1.2747 0.2219  -0.0819 0.0434  75  ASP B CA  
1044 C C   . ASP B  16  ? 0.6733 0.7269 1.2771 0.2180  -0.0955 0.0419  75  ASP B C   
1045 O O   . ASP B  16  ? 0.7118 0.7311 1.3419 0.2380  -0.1034 0.0398  75  ASP B O   
1046 C CB  . ASP B  16  ? 0.6275 0.7677 1.2903 0.2141  -0.1097 0.0765  75  ASP B CB  
1047 C CG  . ASP B  16  ? 0.6183 0.8209 1.3270 0.2203  -0.1027 0.0833  75  ASP B CG  
1048 O OD1 . ASP B  16  ? 0.6228 0.8546 1.3390 0.2288  -0.0751 0.0627  75  ASP B OD1 
1049 O OD2 . ASP B  16  ? 0.6122 0.8370 1.3470 0.2127  -0.1264 0.1115  75  ASP B OD2 
1050 N N   . GLY B  17  ? 0.6612 0.7003 1.2098 0.1919  -0.0992 0.0456  76  GLY B N   
1051 C CA  . GLY B  17  ? 0.6942 0.6819 1.2093 0.1803  -0.1158 0.0505  76  GLY B CA  
1052 C C   . GLY B  17  ? 0.6881 0.6732 1.1990 0.1637  -0.1463 0.0820  76  GLY B C   
1053 O O   . GLY B  17  ? 0.7183 0.6655 1.2044 0.1507  -0.1651 0.0923  76  GLY B O   
1054 N N   . GLU B  18  ? 0.6549 0.6799 1.1839 0.1594  -0.1515 0.0977  77  GLU B N   
1055 C CA  . GLU B  18  ? 0.6554 0.6803 1.1768 0.1404  -0.1790 0.1267  77  GLU B CA  
1056 C C   . GLU B  18  ? 0.6283 0.6643 1.0969 0.1147  -0.1734 0.1318  77  GLU B C   
1057 O O   . GLU B  18  ? 0.6001 0.6603 1.0546 0.1139  -0.1511 0.1198  77  GLU B O   
1058 C CB  . GLU B  18  ? 0.6479 0.7076 1.2121 0.1454  -0.1888 0.1421  77  GLU B CB  
1059 C CG  . GLU B  18  ? 0.6624 0.7260 1.2116 0.1194  -0.2166 0.1724  77  GLU B CG  
1060 N N   . THR B  19  ? 0.6413 0.6599 1.0817 0.0943  -0.1931 0.1504  78  THR B N   
1061 C CA  . THR B  19  ? 0.6244 0.6550 1.0173 0.0733  -0.1850 0.1556  78  THR B CA  
1062 C C   . THR B  19  ? 0.6151 0.6645 0.9971 0.0577  -0.1927 0.1717  78  THR B C   
1063 O O   . THR B  19  ? 0.6330 0.6756 1.0251 0.0476  -0.2179 0.1909  78  THR B O   
1064 C CB  . THR B  19  ? 0.6477 0.6549 1.0113 0.0570  -0.1981 0.1659  78  THR B CB  
1065 O OG1 . THR B  19  ? 0.6631 0.6413 1.0340 0.0681  -0.1962 0.1516  78  THR B OG1 
1066 C CG2 . THR B  19  ? 0.6330 0.6628 0.9550 0.0419  -0.1815 0.1683  78  THR B CG2 
1067 N N   . LEU B  20  ? 0.5944 0.6640 0.9534 0.0546  -0.1711 0.1638  79  LEU B N   
1068 C CA  . LEU B  20  ? 0.5979 0.6769 0.9330 0.0374  -0.1735 0.1743  79  LEU B CA  
1069 C C   . LEU B  20  ? 0.6015 0.6806 0.8882 0.0249  -0.1599 0.1759  79  LEU B C   
1070 O O   . LEU B  20  ? 0.5858 0.6721 0.8612 0.0345  -0.1369 0.1639  79  LEU B O   
1071 C CB  . LEU B  20  ? 0.5815 0.6769 0.9237 0.0439  -0.1578 0.1632  79  LEU B CB  
1072 C CG  . LEU B  20  ? 0.5796 0.6891 0.9738 0.0620  -0.1595 0.1566  79  LEU B CG  
1073 C CD1 . LEU B  20  ? 0.5635 0.6919 0.9534 0.0624  -0.1418 0.1466  79  LEU B CD1 
1074 C CD2 . LEU B  20  ? 0.6034 0.7162 1.0353 0.0591  -0.1887 0.1764  79  LEU B CD2 
1075 N N   . THR B  21  ? 0.6222 0.6971 0.8818 0.0031  -0.1733 0.1922  80  THR B N   
1076 C CA  . THR B  21  ? 0.6266 0.7076 0.8422 -0.0074 -0.1572 0.1942  80  THR B CA  
1077 C C   . THR B  21  ? 0.6380 0.7164 0.8183 -0.0183 -0.1454 0.1914  80  THR B C   
1078 O O   . THR B  21  ? 0.6585 0.7296 0.8337 -0.0358 -0.1640 0.2012  80  THR B O   
1079 C CB  . THR B  21  ? 0.6516 0.7304 0.8531 -0.0281 -0.1777 0.2138  80  THR B CB  
1080 O OG1 . THR B  21  ? 0.6393 0.7123 0.8637 -0.0213 -0.1884 0.2160  80  THR B OG1 
1081 C CG2 . THR B  21  ? 0.6653 0.7593 0.8232 -0.0394 -0.1584 0.2170  80  THR B CG2 
1082 N N   . THR B  22  ? 0.6359 0.7172 0.7902 -0.0090 -0.1153 0.1792  81  THR B N   
1083 C CA  . THR B  22  ? 0.6620 0.7289 0.7753 -0.0171 -0.0999 0.1720  81  THR B CA  
1084 C C   . THR B  22  ? 0.6762 0.7463 0.7540 -0.0101 -0.0694 0.1667  81  THR B C   
1085 O O   . THR B  22  ? 0.6612 0.7527 0.7520 0.0004  -0.0617 0.1711  81  THR B O   
1086 C CB  . THR B  22  ? 0.6508 0.7099 0.7770 -0.0058 -0.0924 0.1589  81  THR B CB  
1087 O OG1 . THR B  22  ? 0.6822 0.7181 0.7644 -0.0230 -0.0876 0.1555  81  THR B OG1 
1088 C CG2 . THR B  22  ? 0.6206 0.6871 0.7570 0.0192  -0.0669 0.1464  81  THR B CG2 
1089 N N   . LYS B  23  ? 0.7143 0.7623 0.7465 -0.0164 -0.0520 0.1580  82  LYS B N   
1090 C CA  . LYS B  23  ? 0.7412 0.7889 0.7377 -0.0077 -0.0202 0.1523  82  LYS B CA  
1091 C C   . LYS B  23  ? 0.7529 0.7741 0.7325 0.0101  0.0050  0.1356  82  LYS B C   
1092 O O   . LYS B  23  ? 0.7734 0.7644 0.7342 -0.0017 -0.0018 0.1284  82  LYS B O   
1093 C CB  . LYS B  23  ? 0.7922 0.8281 0.7364 -0.0352 -0.0202 0.1560  82  LYS B CB  
1094 C CG  . LYS B  23  ? 0.7902 0.8570 0.7437 -0.0516 -0.0379 0.1749  82  LYS B CG  
1095 C CD  . LYS B  23  ? 0.8450 0.9098 0.7411 -0.0743 -0.0250 0.1766  82  LYS B CD  
1096 C CE  . LYS B  23  ? 0.8892 0.9244 0.7448 -0.1112 -0.0464 0.1792  82  LYS B CE  
1097 N NZ  . LYS B  23  ? 0.9196 0.9139 0.7505 -0.1102 -0.0384 0.1625  82  LYS B NZ  
1098 N N   . GLY B  24  ? 0.7419 0.7751 0.7289 0.0367  0.0322  0.1324  83  GLY B N   
1099 C CA  . GLY B  24  ? 0.7644 0.7677 0.7345 0.0556  0.0564  0.1188  83  GLY B CA  
1100 C C   . GLY B  24  ? 0.8017 0.7980 0.7421 0.0746  0.0927  0.1140  83  GLY B C   
1101 O O   . GLY B  24  ? 0.7925 0.8257 0.7424 0.0798  0.1017  0.1242  83  GLY B O   
1102 N N   . LYS B  25  ? 0.8485 0.7971 0.7534 0.0851  0.1139  0.0994  84  LYS B N   
1103 C CA  . LYS B  25  ? 0.9001 0.8344 0.7787 0.1104  0.1530  0.0925  84  LYS B CA  
1104 C C   . LYS B  25  ? 0.8578 0.8287 0.7886 0.1450  0.1656  0.1041  84  LYS B C   
1105 O O   . LYS B  25  ? 0.8233 0.7965 0.7853 0.1494  0.1514  0.1076  84  LYS B O   
1106 C CB  . LYS B  25  ? 0.9779 0.8355 0.7948 0.1099  0.1709  0.0719  84  LYS B CB  
1107 C CG  . LYS B  25  ? 1.0532 0.8670 0.8042 0.0709  0.1610  0.0603  84  LYS B CG  
1108 C CD  . LYS B  25  ? 1.1209 0.8765 0.8412 0.0522  0.1458  0.0505  84  LYS B CD  
1109 C CE  . LYS B  25  ? 1.2186 0.9152 0.8565 0.0142  0.1438  0.0372  84  LYS B CE  
1110 N NZ  . LYS B  25  ? 1.2691 0.9033 0.8689 -0.0014 0.1357  0.0278  84  LYS B NZ  
1111 N N   . VAL B  26  ? 0.8672 0.8707 0.8076 0.1675  0.1922  0.1119  85  VAL B N   
1112 C CA  . VAL B  26  ? 0.8430 0.8816 0.8308 0.2019  0.2076  0.1265  85  VAL B CA  
1113 C C   . VAL B  26  ? 0.8794 0.8592 0.8508 0.2229  0.2224  0.1149  85  VAL B C   
1114 O O   . VAL B  26  ? 0.9443 0.8603 0.8603 0.2248  0.2416  0.0953  85  VAL B O   
1115 C CB  . VAL B  26  ? 0.8615 0.9459 0.8593 0.2243  0.2386  0.1376  85  VAL B CB  
1116 C CG1 . VAL B  26  ? 0.8351 0.9621 0.8869 0.2590  0.2522  0.1581  85  VAL B CG1 
1117 C CG2 . VAL B  26  ? 0.8382 0.9782 0.8469 0.1981  0.2212  0.1509  85  VAL B CG2 
1118 N N   . GLY B  27  ? 0.8382 0.8346 0.8520 0.2344  0.2117  0.1271  86  GLY B N   
1119 C CA  . GLY B  27  ? 0.8732 0.8149 0.8732 0.2497  0.2201  0.1201  86  GLY B CA  
1120 C C   . GLY B  27  ? 0.8630 0.7690 0.8473 0.2215  0.1923  0.1099  86  GLY B C   
1121 O O   . GLY B  27  ? 0.8760 0.7514 0.8602 0.2284  0.1910  0.1101  86  GLY B O   
1122 N N   . ASP B  28  ? 0.8425 0.7551 0.8160 0.1893  0.1692  0.1035  87  ASP B N   
1123 C CA  . ASP B  28  ? 0.8254 0.7198 0.7949 0.1628  0.1420  0.0974  87  ASP B CA  
1124 C C   . ASP B  28  ? 0.7562 0.7025 0.7830 0.1625  0.1229  0.1105  87  ASP B C   
1125 O O   . ASP B  28  ? 0.7118 0.7113 0.7763 0.1692  0.1204  0.1235  87  ASP B O   
1126 C CB  . ASP B  28  ? 0.8282 0.7189 0.7750 0.1306  0.1228  0.0904  87  ASP B CB  
1127 C CG  . ASP B  28  ? 0.9096 0.7338 0.7863 0.1152  0.1321  0.0743  87  ASP B CG  
1128 O OD1 . ASP B  28  ? 0.9667 0.7379 0.8080 0.1293  0.1534  0.0651  87  ASP B OD1 
1129 O OD2 . ASP B  28  ? 0.9223 0.7441 0.7766 0.0865  0.1163  0.0718  87  ASP B OD2 
1130 N N   . SER B  29  ? 0.7472 0.6780 0.7762 0.1513  0.1095  0.1071  88  SER B N   
1131 C CA  . SER B  29  ? 0.6914 0.6677 0.7665 0.1467  0.0929  0.1154  88  SER B CA  
1132 C C   . SER B  29  ? 0.6586 0.6601 0.7491 0.1257  0.0712  0.1115  88  SER B C   
1133 O O   . SER B  29  ? 0.6801 0.6588 0.7450 0.1098  0.0638  0.1038  88  SER B O   
1134 C CB  . SER B  29  ? 0.7010 0.6561 0.7717 0.1403  0.0878  0.1134  88  SER B CB  
1135 O OG  . SER B  29  ? 0.7099 0.6483 0.7640 0.1150  0.0718  0.1030  88  SER B OG  
1136 N N   . LEU B  30  ? 0.6098 0.6553 0.7403 0.1246  0.0603  0.1175  89  LEU B N   
1137 C CA  . LEU B  30  ? 0.5822 0.6465 0.7308 0.1091  0.0403  0.1137  89  LEU B CA  
1138 C C   . LEU B  30  ? 0.5896 0.6386 0.7335 0.0932  0.0282  0.1045  89  LEU B C   
1139 O O   . LEU B  30  ? 0.5862 0.6376 0.7349 0.0806  0.0130  0.1028  89  LEU B O   
1140 C CB  . LEU B  30  ? 0.5405 0.6442 0.7258 0.1107  0.0330  0.1188  89  LEU B CB  
1141 C CG  . LEU B  30  ? 0.5383 0.6629 0.7283 0.1163  0.0358  0.1307  89  LEU B CG  
1142 C CD1 . LEU B  30  ? 0.5168 0.6737 0.7288 0.1209  0.0380  0.1417  89  LEU B CD1 
1143 C CD2 . LEU B  30  ? 0.5262 0.6546 0.7212 0.1038  0.0184  0.1301  89  LEU B CD2 
1144 N N   . LEU B  31  ? 0.6032 0.6383 0.7384 0.0922  0.0333  0.1019  90  LEU B N   
1145 C CA  . LEU B  31  ? 0.6153 0.6383 0.7417 0.0737  0.0223  0.0964  90  LEU B CA  
1146 C C   . LEU B  31  ? 0.6573 0.6420 0.7423 0.0609  0.0195  0.0945  90  LEU B C   
1147 O O   . LEU B  31  ? 0.6591 0.6505 0.7485 0.0434  0.0028  0.0951  90  LEU B O   
1148 C CB  . LEU B  31  ? 0.6247 0.6357 0.7414 0.0707  0.0276  0.0962  90  LEU B CB  
1149 C CG  . LEU B  31  ? 0.6426 0.6433 0.7461 0.0472  0.0157  0.0937  90  LEU B CG  
1150 C CD1 . LEU B  31  ? 0.6015 0.6493 0.7479 0.0388  0.0009  0.0925  90  LEU B CD1 
1151 C CD2 . LEU B  31  ? 0.6496 0.6368 0.7394 0.0409  0.0196  0.0958  90  LEU B CD2 
1152 N N   . ASP B  32  ? 0.6982 0.6433 0.7431 0.0694  0.0364  0.0928  91  ASP B N   
1153 C CA  . ASP B  32  ? 0.7519 0.6539 0.7462 0.0556  0.0377  0.0881  91  ASP B CA  
1154 C C   . ASP B  32  ? 0.7333 0.6596 0.7396 0.0442  0.0229  0.0921  91  ASP B C   
1155 O O   . ASP B  32  ? 0.7612 0.6719 0.7437 0.0197  0.0087  0.0925  91  ASP B O   
1156 C CB  . ASP B  32  ? 0.7983 0.6605 0.7541 0.0745  0.0644  0.0838  91  ASP B CB  
1157 C CG  . ASP B  32  ? 0.8398 0.6628 0.7757 0.0852  0.0777  0.0815  91  ASP B CG  
1158 O OD1 . ASP B  32  ? 0.8644 0.6690 0.7882 0.0664  0.0656  0.0802  91  ASP B OD1 
1159 O OD2 . ASP B  32  ? 0.8602 0.6718 0.7938 0.1125  0.0999  0.0833  91  ASP B OD2 
1160 N N   . VAL B  33  ? 0.6927 0.6566 0.7347 0.0588  0.0235  0.0975  92  VAL B N   
1161 C CA  . VAL B  33  ? 0.6817 0.6649 0.7343 0.0483  0.0082  0.1037  92  VAL B CA  
1162 C C   . VAL B  33  ? 0.6624 0.6647 0.7453 0.0323  -0.0177 0.1076  92  VAL B C   
1163 O O   . VAL B  33  ? 0.6863 0.6827 0.7570 0.0121  -0.0342 0.1132  92  VAL B O   
1164 C CB  . VAL B  33  ? 0.6477 0.6660 0.7321 0.0644  0.0116  0.1105  92  VAL B CB  
1165 C CG1 . VAL B  33  ? 0.6298 0.6657 0.7292 0.0509  -0.0098 0.1187  92  VAL B CG1 
1166 C CG2 . VAL B  33  ? 0.6694 0.6790 0.7287 0.0801  0.0372  0.1111  92  VAL B CG2 
1167 N N   . VAL B  34  ? 0.6274 0.6550 0.7505 0.0409  -0.0207 0.1058  93  VAL B N   
1168 C CA  . VAL B  34  ? 0.6078 0.6595 0.7669 0.0313  -0.0406 0.1090  93  VAL B CA  
1169 C C   . VAL B  34  ? 0.6431 0.6769 0.7750 0.0063  -0.0516 0.1126  93  VAL B C   
1170 O O   . VAL B  34  ? 0.6442 0.6910 0.7906 -0.0091 -0.0728 0.1227  93  VAL B O   
1171 C CB  . VAL B  34  ? 0.5749 0.6546 0.7724 0.0442  -0.0349 0.1029  93  VAL B CB  
1172 C CG1 . VAL B  34  ? 0.5600 0.6693 0.7976 0.0377  -0.0504 0.1052  93  VAL B CG1 
1173 C CG2 . VAL B  34  ? 0.5442 0.6404 0.7644 0.0620  -0.0283 0.1009  93  VAL B CG2 
1174 N N   . VAL B  35  ? 0.6742 0.6760 0.7652 0.0005  -0.0391 0.1066  94  VAL B N   
1175 C CA  . VAL B  35  ? 0.7172 0.6982 0.7761 -0.0277 -0.0502 0.1103  94  VAL B CA  
1176 C C   . VAL B  35  ? 0.7727 0.7164 0.7779 -0.0500 -0.0563 0.1133  94  VAL B C   
1177 O O   . VAL B  35  ? 0.7912 0.7411 0.7920 -0.0780 -0.0786 0.1246  94  VAL B O   
1178 C CB  . VAL B  35  ? 0.7471 0.6957 0.7720 -0.0296 -0.0363 0.1031  94  VAL B CB  
1179 C CG1 . VAL B  35  ? 0.8021 0.7144 0.7759 -0.0646 -0.0479 0.1067  94  VAL B CG1 
1180 C CG2 . VAL B  35  ? 0.7008 0.6913 0.7745 -0.0188 -0.0350 0.1028  94  VAL B CG2 
1181 N N   . GLU B  36  ? 0.8015 0.7093 0.7652 -0.0393 -0.0358 0.1043  95  GLU B N   
1182 C CA  . GLU B  36  ? 0.8640 0.7316 0.7660 -0.0615 -0.0357 0.1032  95  GLU B CA  
1183 C C   . GLU B  36  ? 0.8481 0.7466 0.7713 -0.0772 -0.0594 0.1174  95  GLU B C   
1184 O O   . GLU B  36  ? 0.8936 0.7685 0.7707 -0.1089 -0.0710 0.1224  95  GLU B O   
1185 C CB  . GLU B  36  ? 0.8993 0.7301 0.7594 -0.0413 -0.0040 0.0900  95  GLU B CB  
1186 C CG  . GLU B  36  ? 0.9984 0.7602 0.7905 -0.0451 0.0160  0.0760  95  GLU B CG  
1187 C CD  . GLU B  36  ? 1.0396 0.7846 0.8305 -0.0062 0.0492  0.0663  95  GLU B CD  
1188 O OE1 . GLU B  36  ? 1.0546 0.7765 0.8431 0.0039  0.0567  0.0629  95  GLU B OE1 
1189 O OE2 . GLU B  36  ? 1.0581 0.8164 0.8528 0.0131  0.0666  0.0651  95  GLU B OE2 
1190 N N   . ASN B  37  ? 0.7865 0.7330 0.7752 -0.0575 -0.0678 0.1246  96  ASN B N   
1191 C CA  . ASN B  37  ? 0.7727 0.7460 0.7881 -0.0689 -0.0924 0.1403  96  ASN B CA  
1192 C C   . ASN B  37  ? 0.7425 0.7556 0.8188 -0.0731 -0.1194 0.1546  96  ASN B C   
1193 O O   . ASN B  37  ? 0.7296 0.7656 0.8395 -0.0771 -0.1414 0.1697  96  ASN B O   
1194 C CB  . ASN B  37  ? 0.7444 0.7353 0.7831 -0.0462 -0.0840 0.1399  96  ASN B CB  
1195 C CG  . ASN B  37  ? 0.7747 0.7384 0.7586 -0.0448 -0.0599 0.1317  96  ASN B CG  
1196 O OD1 . ASN B  37  ? 0.7585 0.7345 0.7556 -0.0210 -0.0421 0.1275  96  ASN B OD1 
1197 N ND2 . ASN B  37  ? 0.8318 0.7614 0.7542 -0.0710 -0.0585 0.1300  96  ASN B ND2 
1198 N N   . ASN B  38  ? 0.7347 0.7573 0.8269 -0.0716 -0.1173 0.1511  97  ASN B N   
1199 C CA  . ASN B  38  ? 0.7154 0.7808 0.8637 -0.0772 -0.1398 0.1656  97  ASN B CA  
1200 C C   . ASN B  38  ? 0.6688 0.7713 0.8864 -0.0526 -0.1489 0.1712  97  ASN B C   
1201 O O   . ASN B  38  ? 0.6673 0.7918 0.9187 -0.0610 -0.1740 0.1901  97  ASN B O   
1202 C CB  . ASN B  38  ? 0.7580 0.8206 0.8828 -0.1169 -0.1669 0.1859  97  ASN B CB  
1203 C CG  . ASN B  38  ? 0.8206 0.8587 0.8947 -0.1455 -0.1654 0.1842  97  ASN B CG  
1204 O OD1 . ASN B  38  ? 0.8089 0.8656 0.9050 -0.1399 -0.1598 0.1809  97  ASN B OD1 
1205 N ND2 . ASN B  38  ? 0.9007 0.8952 0.9021 -0.1803 -0.1715 0.1872  97  ASN B ND2 
1206 N N   . LEU B  39  ? 0.6374 0.7431 0.8734 -0.0234 -0.1291 0.1558  98  LEU B N   
1207 C CA  . LEU B  39  ? 0.6052 0.7340 0.8966 0.0001  -0.1339 0.1563  98  LEU B CA  
1208 C C   . LEU B  39  ? 0.5853 0.7527 0.9368 0.0140  -0.1360 0.1555  98  LEU B C   
1209 O O   . LEU B  39  ? 0.5811 0.7607 0.9302 0.0113  -0.1248 0.1488  98  LEU B O   
1210 C CB  . LEU B  39  ? 0.5854 0.7021 0.8661 0.0204  -0.1123 0.1409  98  LEU B CB  
1211 C CG  . LEU B  39  ? 0.6068 0.6957 0.8375 0.0136  -0.1049 0.1414  98  LEU B CG  
1212 C CD1 . LEU B  39  ? 0.5889 0.6780 0.8184 0.0331  -0.0850 0.1312  98  LEU B CD1 
1213 C CD2 . LEU B  39  ? 0.6277 0.7139 0.8596 0.0007  -0.1275 0.1573  98  LEU B CD2 
1214 N N   . ASP B  40  ? 0.5792 0.7639 0.9833 0.0301  -0.1485 0.1617  99  ASP B N   
1215 C CA  . ASP B  40  ? 0.5680 0.7933 1.0378 0.0467  -0.1508 0.1631  99  ASP B CA  
1216 C C   . ASP B  40  ? 0.5486 0.7840 1.0352 0.0708  -0.1242 0.1389  99  ASP B C   
1217 O O   . ASP B  40  ? 0.5531 0.7993 1.0850 0.0946  -0.1214 0.1321  99  ASP B O   
1218 C CB  . ASP B  40  ? 0.5762 0.8083 1.0956 0.0576  -0.1742 0.1796  99  ASP B CB  
1219 C CG  . ASP B  40  ? 0.5789 0.8578 1.1728 0.0760  -0.1781 0.1864  99  ASP B CG  
1220 O OD1 . ASP B  40  ? 0.5727 0.8868 1.1796 0.0742  -0.1659 0.1822  99  ASP B OD1 
1221 O OD2 . ASP B  40  ? 0.5938 0.8750 1.2351 0.0931  -0.1933 0.1974  99  ASP B OD2 
1222 N N   . ILE B  41  ? 0.5390 0.7684 0.9876 0.0636  -0.1050 0.1264  100 ILE B N   
1223 C CA  . ILE B  41  ? 0.5177 0.7579 0.9748 0.0794  -0.0815 0.1060  100 ILE B CA  
1224 C C   . ILE B  41  ? 0.5150 0.7880 0.9799 0.0708  -0.0726 0.1043  100 ILE B C   
1225 O O   . ILE B  41  ? 0.5296 0.7890 0.9520 0.0517  -0.0700 0.1069  100 ILE B O   
1226 C CB  . ILE B  41  ? 0.5154 0.7248 0.9249 0.0784  -0.0670 0.0959  100 ILE B CB  
1227 C CG1 . ILE B  41  ? 0.5211 0.7018 0.9150 0.0805  -0.0763 0.1013  100 ILE B CG1 
1228 C CG2 . ILE B  41  ? 0.5081 0.7302 0.9283 0.0916  -0.0467 0.0777  100 ILE B CG2 
1229 C CD1 . ILE B  41  ? 0.5105 0.6678 0.8566 0.0760  -0.0640 0.0987  100 ILE B CD1 
1230 N N   . ASP B  42  ? 0.5055 0.8199 1.0233 0.0853  -0.0668 0.0995  101 ASP B N   
1231 C CA  . ASP B  42  ? 0.5006 0.8590 1.0351 0.0754  -0.0602 0.1014  101 ASP B CA  
1232 C C   . ASP B  42  ? 0.4924 0.8457 0.9941 0.0713  -0.0381 0.0844  101 ASP B C   
1233 O O   . ASP B  42  ? 0.4908 0.8295 0.9868 0.0857  -0.0241 0.0680  101 ASP B O   
1234 C CB  . ASP B  42  ? 0.4995 0.9104 1.1070 0.0963  -0.0574 0.1018  101 ASP B CB  
1235 C CG  . ASP B  42  ? 0.5235 0.9372 1.1715 0.1049  -0.0818 0.1220  101 ASP B CG  
1236 O OD1 . ASP B  42  ? 0.5407 0.9199 1.1546 0.0878  -0.1019 0.1365  101 ASP B OD1 
1237 O OD2 . ASP B  42  ? 0.5220 0.9711 1.2351 0.1291  -0.0805 0.1240  101 ASP B OD2 
1238 N N   . GLY B  43  ? 0.4971 0.8590 0.9731 0.0481  -0.0379 0.0909  102 GLY B N   
1239 C CA  . GLY B  43  ? 0.4955 0.8616 0.9479 0.0413  -0.0199 0.0794  102 GLY B CA  
1240 C C   . GLY B  43  ? 0.5025 0.8171 0.9001 0.0379  -0.0145 0.0749  102 GLY B C   
1241 O O   . GLY B  43  ? 0.5173 0.8308 0.8909 0.0280  -0.0041 0.0713  102 GLY B O   
1242 N N   . PHE B  44  ? 0.5002 0.7759 0.8797 0.0450  -0.0220 0.0779  103 PHE B N   
1243 C CA  . PHE B  44  ? 0.5028 0.7379 0.8408 0.0479  -0.0148 0.0752  103 PHE B CA  
1244 C C   . PHE B  44  ? 0.5229 0.7254 0.8128 0.0308  -0.0154 0.0830  103 PHE B C   
1245 O O   . PHE B  44  ? 0.5486 0.7303 0.8182 0.0184  -0.0268 0.0915  103 PHE B O   
1246 C CB  . PHE B  44  ? 0.5028 0.7133 0.8384 0.0586  -0.0228 0.0782  103 PHE B CB  
1247 C CG  . PHE B  44  ? 0.4975 0.6815 0.8048 0.0661  -0.0136 0.0764  103 PHE B CG  
1248 C CD1 . PHE B  44  ? 0.4716 0.6653 0.7934 0.0775  -0.0066 0.0687  103 PHE B CD1 
1249 C CD2 . PHE B  44  ? 0.5151 0.6650 0.7812 0.0614  -0.0118 0.0834  103 PHE B CD2 
1250 C CE1 . PHE B  44  ? 0.4725 0.6509 0.7728 0.0816  -0.0007 0.0721  103 PHE B CE1 
1251 C CE2 . PHE B  44  ? 0.5131 0.6487 0.7620 0.0711  -0.0023 0.0852  103 PHE B CE2 
1252 C CZ  . PHE B  44  ? 0.4892 0.6431 0.7574 0.0801  0.0017  0.0816  103 PHE B CZ  
1253 N N   . GLY B  45  ? 0.5246 0.7181 0.7931 0.0291  -0.0040 0.0807  104 GLY B N   
1254 C CA  . GLY B  45  ? 0.5561 0.7074 0.7768 0.0173  -0.0032 0.0876  104 GLY B CA  
1255 C C   . GLY B  45  ? 0.5755 0.7325 0.7837 -0.0074 -0.0097 0.0931  104 GLY B C   
1256 O O   . GLY B  45  ? 0.6088 0.7266 0.7778 -0.0231 -0.0172 0.0995  104 GLY B O   
1257 N N   . ALA B  46  ? 0.5588 0.7637 0.7960 -0.0136 -0.0063 0.0906  105 ALA B N   
1258 C CA  . ALA B  46  ? 0.5779 0.8003 0.8072 -0.0409 -0.0130 0.0983  105 ALA B CA  
1259 C C   . ALA B  46  ? 0.6202 0.7899 0.7940 -0.0580 -0.0150 0.1062  105 ALA B C   
1260 O O   . ALA B  46  ? 0.6542 0.8031 0.7988 -0.0826 -0.0268 0.1150  105 ALA B O   
1261 C CB  . ALA B  46  ? 0.5505 0.8365 0.8189 -0.0428 -0.0041 0.0926  105 ALA B CB  
1262 N N   . CYS B  47  ? 0.6269 0.7722 0.7852 -0.0457 -0.0048 0.1048  106 CYS B N   
1263 C CA  . CYS B  47  ? 0.6737 0.7653 0.7835 -0.0574 -0.0063 0.1139  106 CYS B CA  
1264 C C   . CYS B  47  ? 0.7153 0.7334 0.7811 -0.0487 -0.0062 0.1145  106 CYS B C   
1265 O O   . CYS B  47  ? 0.7604 0.7216 0.7839 -0.0520 -0.0049 0.1204  106 CYS B O   
1266 C CB  . CYS B  47  ? 0.6612 0.7609 0.7765 -0.0486 0.0027  0.1169  106 CYS B CB  
1267 S SG  . CYS B  47  ? 0.6688 0.7412 0.7856 -0.0139 0.0142  0.1168  106 CYS B SG  
1268 N N   . GLU B  48  ? 0.7035 0.7212 0.7781 -0.0374 -0.0067 0.1083  107 GLU B N   
1269 C CA  . GLU B  48  ? 0.7443 0.6988 0.7761 -0.0309 -0.0041 0.1061  107 GLU B CA  
1270 C C   . GLU B  48  ? 0.7583 0.6740 0.7741 -0.0041 0.0120  0.1062  107 GLU B C   
1271 O O   . GLU B  48  ? 0.8123 0.6620 0.7806 -0.0005 0.0185  0.1052  107 GLU B O   
1272 C CB  . GLU B  48  ? 0.8089 0.7142 0.7870 -0.0624 -0.0157 0.1099  107 GLU B CB  
1273 C CG  . GLU B  48  ? 0.8006 0.7500 0.7983 -0.0886 -0.0335 0.1146  107 GLU B CG  
1274 C CD  . GLU B  48  ? 0.8786 0.7799 0.8184 -0.1257 -0.0481 0.1209  107 GLU B CD  
1275 O OE1 . GLU B  48  ? 0.9188 0.7933 0.8269 -0.1458 -0.0521 0.1265  107 GLU B OE1 
1276 O OE2 . GLU B  48  ? 0.9054 0.7955 0.8289 -0.1384 -0.0577 0.1219  107 GLU B OE2 
1277 N N   . GLY B  49  ? 0.7128 0.6707 0.7687 0.0144  0.0192  0.1079  108 GLY B N   
1278 C CA  . GLY B  49  ? 0.7191 0.6583 0.7734 0.0409  0.0330  0.1129  108 GLY B CA  
1279 C C   . GLY B  49  ? 0.7573 0.6612 0.7896 0.0417  0.0363  0.1238  108 GLY B C   
1280 O O   . GLY B  49  ? 0.7841 0.6493 0.8014 0.0641  0.0482  0.1290  108 GLY B O   
1281 N N   . THR B  50  ? 0.7586 0.6777 0.7912 0.0180  0.0260  0.1288  109 THR B N   
1282 C CA  . THR B  50  ? 0.7958 0.6851 0.8103 0.0146  0.0250  0.1429  109 THR B CA  
1283 C C   . THR B  50  ? 0.7537 0.6999 0.8051 0.0135  0.0237  0.1535  109 THR B C   
1284 O O   . THR B  50  ? 0.7759 0.7156 0.8172 -0.0012 0.0171  0.1667  109 THR B O   
1285 C CB  . THR B  50  ? 0.8407 0.6971 0.8169 -0.0185 0.0119  0.1447  109 THR B CB  
1286 O OG1 . THR B  50  ? 0.8021 0.7238 0.8046 -0.0439 0.0023  0.1410  109 THR B OG1 
1287 C CG2 . THR B  50  ? 0.8917 0.6831 0.8208 -0.0225 0.0120  0.1354  109 THR B CG2 
1288 N N   . LEU B  51  ? 0.7030 0.7011 0.7919 0.0261  0.0290  0.1485  110 LEU B N   
1289 C CA  . LEU B  51  ? 0.6699 0.7199 0.7876 0.0223  0.0285  0.1567  110 LEU B CA  
1290 C C   . LEU B  51  ? 0.6666 0.7476 0.7834 -0.0093 0.0205  0.1570  110 LEU B C   
1291 O O   . LEU B  51  ? 0.6789 0.7704 0.7942 -0.0203 0.0168  0.1721  110 LEU B O   
1292 C CB  . LEU B  51  ? 0.6859 0.7196 0.8052 0.0401  0.0318  0.1784  110 LEU B CB  
1293 C CG  . LEU B  51  ? 0.6633 0.7103 0.8047 0.0682  0.0413  0.1816  110 LEU B CG  
1294 C CD1 . LEU B  51  ? 0.6892 0.7269 0.8379 0.0852  0.0437  0.2078  110 LEU B CD1 
1295 C CD2 . LEU B  51  ? 0.6137 0.7195 0.7830 0.0607  0.0400  0.1736  110 LEU B CD2 
1296 N N   . ALA B  52  ? 0.6557 0.7559 0.7752 -0.0248 0.0177  0.1426  111 ALA B N   
1297 C CA  . ALA B  52  ? 0.6568 0.7949 0.7780 -0.0550 0.0128  0.1421  111 ALA B CA  
1298 C C   . ALA B  52  ? 0.6188 0.8168 0.7735 -0.0581 0.0185  0.1238  111 ALA B C   
1299 O O   . ALA B  52  ? 0.6210 0.8601 0.7824 -0.0805 0.0185  0.1210  111 ALA B O   
1300 C CB  . ALA B  52  ? 0.7002 0.8011 0.7877 -0.0768 0.0022  0.1488  111 ALA B CB  
1301 N N   . CYS B  53  ? 0.5932 0.7963 0.7693 -0.0354 0.0238  0.1120  112 CYS B N   
1302 C CA  . CYS B  53  ? 0.5635 0.8170 0.7739 -0.0329 0.0303  0.0948  112 CYS B CA  
1303 C C   . CYS B  53  ? 0.5405 0.7989 0.7648 -0.0139 0.0370  0.0888  112 CYS B C   
1304 O O   . CYS B  53  ? 0.5480 0.7811 0.7590 -0.0050 0.0361  0.1007  112 CYS B O   
1305 C CB  . CYS B  53  ? 0.5597 0.8140 0.7842 -0.0282 0.0254  0.0883  112 CYS B CB  
1306 S SG  . CYS B  53  ? 0.5850 0.7892 0.7998 -0.0050 0.0209  0.0898  112 CYS B SG  
1307 N N   . SER B  54  ? 0.5183 0.8086 0.7694 -0.0076 0.0436  0.0717  113 SER B N   
1308 C CA  . SER B  54  ? 0.5062 0.7928 0.7652 0.0076  0.0470  0.0660  113 SER B CA  
1309 C C   . SER B  54  ? 0.4911 0.7727 0.7724 0.0255  0.0447  0.0556  113 SER B C   
1310 O O   . SER B  54  ? 0.4834 0.7675 0.7754 0.0348  0.0476  0.0463  113 SER B O   
1311 C CB  . SER B  54  ? 0.5070 0.8251 0.7684 -0.0036 0.0569  0.0546  113 SER B CB  
1312 O OG  . SER B  54  ? 0.5359 0.8632 0.7767 -0.0251 0.0566  0.0667  113 SER B OG  
1313 N N   . THR B  55  ? 0.4299 0.6008 0.5684 -0.0653 0.0295  0.0722  114 THR B N   
1314 C CA  . THR B  55  ? 0.4043 0.6332 0.5673 -0.0622 0.0125  0.0731  114 THR B CA  
1315 C C   . THR B  55  ? 0.4004 0.6378 0.5509 -0.0464 0.0031  0.0830  114 THR B C   
1316 O O   . THR B  55  ? 0.3813 0.6584 0.5478 -0.0370 -0.0114 0.0934  114 THR B O   
1317 C CB  . THR B  55  ? 0.4205 0.6840 0.5924 -0.0874 0.0101  0.0517  114 THR B CB  
1318 O OG1 . THR B  55  ? 0.4565 0.6977 0.5956 -0.1022 0.0166  0.0352  114 THR B OG1 
1319 C CG2 . THR B  55  ? 0.4169 0.6739 0.6020 -0.1069 0.0234  0.0404  114 THR B CG2 
1320 N N   . CYS B  56  ? 0.4199 0.6190 0.5423 -0.0420 0.0131  0.0810  115 CYS B N   
1321 C CA  . CYS B  56  ? 0.4221 0.6271 0.5320 -0.0278 0.0094  0.0891  115 CYS B CA  
1322 C C   . CYS B  56  ? 0.3937 0.5964 0.5145 -0.0070 0.0071  0.1112  115 CYS B C   
1323 O O   . CYS B  56  ? 0.3912 0.5962 0.5034 0.0040  0.0079  0.1184  115 CYS B O   
1324 C CB  . CYS B  56  ? 0.4633 0.6313 0.5429 -0.0308 0.0250  0.0743  115 CYS B CB  
1325 S SG  . CYS B  56  ? 0.4982 0.6034 0.5683 -0.0216 0.0437  0.0776  115 CYS B SG  
1326 N N   . HIS B  57  ? 0.3751 0.5755 0.5139 -0.0054 0.0060  0.1193  116 HIS B N   
1327 C CA  . HIS B  57  ? 0.3534 0.5530 0.5010 0.0073  0.0045  0.1362  116 HIS B CA  
1328 C C   . HIS B  57  ? 0.3410 0.5662 0.4935 0.0152  -0.0037 0.1474  116 HIS B C   
1329 O O   . HIS B  57  ? 0.3385 0.5872 0.5005 0.0135  -0.0124 0.1490  116 HIS B O   
1330 C CB  . HIS B  57  ? 0.3359 0.5342 0.5002 0.0021  0.0053  0.1378  116 HIS B CB  
1331 C CG  . HIS B  57  ? 0.3198 0.5156 0.4899 0.0083  0.0054  0.1503  116 HIS B CG  
1332 N ND1 . HIS B  57  ? 0.3018 0.4982 0.4860 0.0034  0.0080  0.1502  116 HIS B ND1 
1333 C CD2 . HIS B  57  ? 0.3233 0.5192 0.4878 0.0161  0.0046  0.1605  116 HIS B CD2 
1334 C CE1 . HIS B  57  ? 0.3047 0.4978 0.4875 0.0054  0.0087  0.1586  116 HIS B CE1 
1335 N NE2 . HIS B  57  ? 0.3159 0.5121 0.4884 0.0124  0.0056  0.1655  116 HIS B NE2 
1336 N N   . LEU B  58  ? 0.3402 0.5629 0.4869 0.0239  -0.0006 0.1566  117 LEU B N   
1337 C CA  . LEU B  58  ? 0.3352 0.5756 0.4830 0.0285  -0.0044 0.1694  117 LEU B CA  
1338 C C   . LEU B  58  ? 0.3248 0.5628 0.4806 0.0312  -0.0004 0.1794  117 LEU B C   
1339 O O   . LEU B  58  ? 0.3288 0.5597 0.4852 0.0334  0.0036  0.1776  117 LEU B O   
1340 C CB  . LEU B  58  ? 0.3509 0.6006 0.4787 0.0298  -0.0017 0.1660  117 LEU B CB  
1341 C CG  . LEU B  58  ? 0.3653 0.6279 0.4790 0.0223  -0.0081 0.1569  117 LEU B CG  
1342 C CD1 . LEU B  58  ? 0.3749 0.6394 0.4629 0.0205  -0.0001 0.1476  117 LEU B CD1 
1343 C CD2 . LEU B  58  ? 0.3669 0.6520 0.4875 0.0233  -0.0215 0.1715  117 LEU B CD2 
1344 N N   . ILE B  59  ? 0.3273 0.5722 0.4876 0.0300  -0.0016 0.1910  118 ILE B N   
1345 C CA  . ILE B  59  ? 0.3214 0.5677 0.4877 0.0261  0.0033  0.1978  118 ILE B CA  
1346 C C   . ILE B  59  ? 0.3316 0.5931 0.4890 0.0261  0.0079  0.2046  118 ILE B C   
1347 O O   . ILE B  59  ? 0.3444 0.6079 0.4900 0.0269  0.0062  0.2109  118 ILE B O   
1348 C CB  . ILE B  59  ? 0.3238 0.5570 0.4999 0.0203  0.0043  0.2036  118 ILE B CB  
1349 C CG1 . ILE B  59  ? 0.3156 0.5369 0.5008 0.0182  0.0039  0.1942  118 ILE B CG1 
1350 C CG2 . ILE B  59  ? 0.3236 0.5579 0.5014 0.0097  0.0113  0.2082  118 ILE B CG2 
1351 C CD1 . ILE B  59  ? 0.3308 0.5363 0.5281 0.0156  0.0086  0.1961  118 ILE B CD1 
1352 N N   . PHE B  60  ? 0.3283 0.6051 0.4917 0.0249  0.0135  0.2039  119 PHE B N   
1353 C CA  . PHE B  60  ? 0.3355 0.6335 0.4944 0.0243  0.0217  0.2069  119 PHE B CA  
1354 C C   . PHE B  60  ? 0.3384 0.6479 0.5051 0.0098  0.0277  0.2146  119 PHE B C   
1355 O O   . PHE B  60  ? 0.3255 0.6292 0.5021 0.0003  0.0258  0.2146  119 PHE B O   
1356 C CB  . PHE B  60  ? 0.3355 0.6498 0.5008 0.0365  0.0263  0.1985  119 PHE B CB  
1357 C CG  . PHE B  60  ? 0.3438 0.6409 0.4949 0.0464  0.0267  0.1882  119 PHE B CG  
1358 C CD1 . PHE B  60  ? 0.3652 0.6687 0.5014 0.0495  0.0361  0.1814  119 PHE B CD1 
1359 C CD2 . PHE B  60  ? 0.3418 0.6153 0.4917 0.0486  0.0201  0.1830  119 PHE B CD2 
1360 C CE1 . PHE B  60  ? 0.3821 0.6670 0.5012 0.0533  0.0387  0.1676  119 PHE B CE1 
1361 C CE2 . PHE B  60  ? 0.3598 0.6154 0.4950 0.0518  0.0228  0.1708  119 PHE B CE2 
1362 C CZ  . PHE B  60  ? 0.3833 0.6437 0.5025 0.0536  0.0319  0.1622  119 PHE B CZ  
1363 N N   . GLU B  61  ? 0.3563 0.6801 0.5145 0.0045  0.0372  0.2194  120 GLU B N   
1364 C CA  . GLU B  61  ? 0.3689 0.7079 0.5341 -0.0135 0.0471  0.2244  120 GLU B CA  
1365 C C   . GLU B  61  ? 0.3500 0.7306 0.5421 -0.0140 0.0480  0.2164  120 GLU B C   
1366 O O   . GLU B  61  ? 0.3328 0.7342 0.5349 0.0037  0.0470  0.2105  120 GLU B O   
1367 C CB  . GLU B  61  ? 0.3977 0.7454 0.5451 -0.0201 0.0596  0.2310  120 GLU B CB  
1368 C CG  . GLU B  61  ? 0.4355 0.7496 0.5529 -0.0202 0.0574  0.2448  120 GLU B CG  
1369 C CD  . GLU B  61  ? 0.4691 0.7906 0.5626 -0.0324 0.0719  0.2545  120 GLU B CD  
1370 O OE1 . GLU B  61  ? 0.4814 0.8090 0.5804 -0.0520 0.0854  0.2582  120 GLU B OE1 
1371 O OE2 . GLU B  61  ? 0.4805 0.8030 0.5478 -0.0256 0.0705  0.2569  120 GLU B OE2 
1372 N N   . ASP B  62  ? 0.3567 0.7499 0.5603 -0.0347 0.0505  0.2166  121 ASP B N   
1373 C CA  . ASP B  62  ? 0.3466 0.7917 0.5779 -0.0388 0.0480  0.2109  121 ASP B CA  
1374 C C   . ASP B  62  ? 0.3406 0.8310 0.5899 -0.0208 0.0536  0.2087  121 ASP B C   
1375 O O   . ASP B  62  ? 0.3206 0.8279 0.5847 0.0020  0.0456  0.2069  121 ASP B O   
1376 C CB  . ASP B  62  ? 0.3626 0.8245 0.6001 -0.0725 0.0563  0.2093  121 ASP B CB  
1377 C CG  . ASP B  62  ? 0.4005 0.8198 0.6248 -0.0911 0.0534  0.2067  121 ASP B CG  
1378 O OD1 . ASP B  62  ? 0.4029 0.7911 0.6192 -0.0775 0.0432  0.2057  121 ASP B OD1 
1379 O OD2 . ASP B  62  ? 0.4501 0.8631 0.6707 -0.1215 0.0648  0.2040  121 ASP B OD2 
1380 N N   . HIS B  63  ? 0.3563 0.8614 0.6020 -0.0303 0.0698  0.2094  122 HIS B N   
1381 C CA  . HIS B  63  ? 0.3556 0.9127 0.6243 -0.0174 0.0808  0.2043  122 HIS B CA  
1382 C C   . HIS B  63  ? 0.3540 0.8934 0.6141 0.0137  0.0824  0.1997  122 HIS B C   
1383 O O   . HIS B  63  ? 0.3596 0.9358 0.6443 0.0336  0.0899  0.1941  122 HIS B O   
1384 C CB  . HIS B  63  ? 0.3837 0.9610 0.6474 -0.0405 0.1016  0.2047  122 HIS B CB  
1385 C CG  . HIS B  63  ? 0.4175 0.9508 0.6401 -0.0406 0.1110  0.2090  122 HIS B CG  
1386 N ND1 . HIS B  63  ? 0.4380 0.9150 0.6262 -0.0527 0.1058  0.2200  122 HIS B ND1 
1387 C CD2 . HIS B  63  ? 0.4381 0.9766 0.6466 -0.0290 0.1244  0.2039  122 HIS B CD2 
1388 C CE1 . HIS B  63  ? 0.4635 0.9187 0.6181 -0.0486 0.1122  0.2244  122 HIS B CE1 
1389 N NE2 . HIS B  63  ? 0.4613 0.9517 0.6244 -0.0368 0.1240  0.2130  122 HIS B NE2 
1390 N N   . ILE B  64  ? 0.3579 0.8427 0.5854 0.0178  0.0764  0.2009  123 ILE B N   
1391 C CA  . ILE B  64  ? 0.3653 0.8278 0.5810 0.0415  0.0777  0.1930  123 ILE B CA  
1392 C C   . ILE B  64  ? 0.3530 0.8077 0.5850 0.0615  0.0652  0.1924  123 ILE B C   
1393 O O   . ILE B  64  ? 0.3596 0.8181 0.6022 0.0852  0.0715  0.1867  123 ILE B O   
1394 C CB  . ILE B  64  ? 0.3749 0.7907 0.5514 0.0348  0.0733  0.1940  123 ILE B CB  
1395 C CG1 . ILE B  64  ? 0.4115 0.8322 0.5642 0.0176  0.0854  0.1989  123 ILE B CG1 
1396 C CG2 . ILE B  64  ? 0.3809 0.7727 0.5432 0.0520  0.0743  0.1821  123 ILE B CG2 
1397 C CD1 . ILE B  64  ? 0.4214 0.8710 0.5724 0.0226  0.1068  0.1878  123 ILE B CD1 
1398 N N   . TYR B  65  ? 0.3429 0.7814 0.5734 0.0513  0.0499  0.1988  124 TYR B N   
1399 C CA  . TYR B  65  ? 0.3354 0.7612 0.5722 0.0644  0.0371  0.2010  124 TYR B CA  
1400 C C   . TYR B  65  ? 0.3364 0.8074 0.6046 0.0826  0.0361  0.2050  124 TYR B C   
1401 O O   . TYR B  65  ? 0.3528 0.8109 0.6241 0.1072  0.0351  0.2066  124 TYR B O   
1402 C CB  . TYR B  65  ? 0.3195 0.7327 0.5510 0.0444  0.0248  0.2054  124 TYR B CB  
1403 C CG  . TYR B  65  ? 0.3199 0.7200 0.5508 0.0524  0.0127  0.2083  124 TYR B CG  
1404 C CD1 . TYR B  65  ? 0.3204 0.6740 0.5318 0.0590  0.0105  0.2052  124 TYR B CD1 
1405 C CD2 . TYR B  65  ? 0.3253 0.7629 0.5727 0.0504  0.0033  0.2143  124 TYR B CD2 
1406 C CE1 . TYR B  65  ? 0.3182 0.6566 0.5241 0.0638  0.0023  0.2090  124 TYR B CE1 
1407 C CE2 . TYR B  65  ? 0.3189 0.7437 0.5583 0.0566  -0.0080 0.2198  124 TYR B CE2 
1408 C CZ  . TYR B  65  ? 0.3230 0.6948 0.5403 0.0631  -0.0071 0.2175  124 TYR B CZ  
1409 O OH  . TYR B  65  ? 0.3329 0.6893 0.5376 0.0658  -0.0159 0.2239  124 TYR B OH  
1410 N N   . GLU B  66  ? 0.3300 0.8549 0.6219 0.0697  0.0372  0.2075  125 GLU B N   
1411 C CA  . GLU B  66  ? 0.3292 0.9173 0.6597 0.0856  0.0354  0.2121  125 GLU B CA  
1412 C C   . GLU B  66  ? 0.3463 0.9415 0.6929 0.1212  0.0494  0.2094  125 GLU B C   
1413 O O   . GLU B  66  ? 0.3498 0.9797 0.7264 0.1481  0.0447  0.2175  125 GLU B O   
1414 C CB  . GLU B  66  ? 0.3214 0.9675 0.6731 0.0588  0.0412  0.2097  125 GLU B CB  
1415 C CG  . GLU B  66  ? 0.3288 1.0597 0.7289 0.0709  0.0391  0.2132  125 GLU B CG  
1416 C CD  . GLU B  66  ? 0.3393 1.1287 0.7592 0.0356  0.0458  0.2080  125 GLU B CD  
1417 O OE1 . GLU B  66  ? 0.3325 1.1859 0.7812 0.0260  0.0321  0.2112  125 GLU B OE1 
1418 O OE2 . GLU B  66  ? 0.3496 1.1216 0.7535 0.0153  0.0646  0.2013  125 GLU B OE2 
1419 N N   . LYS B  67  ? 0.3598 0.9233 0.6860 0.1216  0.0674  0.1982  126 LYS B N   
1420 C CA  . LYS B  67  ? 0.3839 0.9535 0.7231 0.1501  0.0877  0.1898  126 LYS B CA  
1421 C C   . LYS B  67  ? 0.4043 0.9065 0.7176 0.1710  0.0922  0.1842  126 LYS B C   
1422 O O   . LYS B  67  ? 0.4311 0.9240 0.7501 0.1950  0.1119  0.1745  126 LYS B O   
1423 C CB  . LYS B  67  ? 0.3939 0.9761 0.7223 0.1327  0.1090  0.1776  126 LYS B CB  
1424 N N   . LEU B  68  ? 0.3975 0.8513 0.6826 0.1601  0.0767  0.1881  127 LEU B N   
1425 C CA  . LEU B  68  ? 0.4228 0.8105 0.6789 0.1704  0.0825  0.1800  127 LEU B CA  
1426 C C   . LEU B  68  ? 0.4495 0.8230 0.7218 0.2054  0.0850  0.1882  127 LEU B C   
1427 O O   . LEU B  68  ? 0.4368 0.8502 0.7379 0.2189  0.0719  0.2057  127 LEU B O   
1428 C CB  . LEU B  68  ? 0.4078 0.7564 0.6345 0.1470  0.0665  0.1816  127 LEU B CB  
1429 C CG  . LEU B  68  ? 0.3912 0.7425 0.5988 0.1179  0.0643  0.1764  127 LEU B CG  
1430 C CD1 . LEU B  68  ? 0.3757 0.6928 0.5633 0.1012  0.0495  0.1784  127 LEU B CD1 
1431 C CD2 . LEU B  68  ? 0.4035 0.7433 0.5897 0.1155  0.0815  0.1606  127 LEU B CD2 
1432 N N   . ASP B  69  ? 0.4898 0.8056 0.7414 0.2193  0.1021  0.1761  128 ASP B N   
1433 C CA  . ASP B  69  ? 0.5371 0.8223 0.7986 0.2553  0.1086  0.1857  128 ASP B CA  
1434 C C   . ASP B  69  ? 0.5273 0.8024 0.7834 0.2535  0.0843  0.2077  128 ASP B C   
1435 O O   . ASP B  69  ? 0.5144 0.7678 0.7440 0.2239  0.0720  0.2053  128 ASP B O   
1436 C CB  . ASP B  69  ? 0.5892 0.7949 0.8177 0.2606  0.1320  0.1666  128 ASP B CB  
1437 C CG  . ASP B  69  ? 0.6253 0.8341 0.8515 0.2620  0.1597  0.1415  128 ASP B CG  
1438 O OD1 . ASP B  69  ? 0.6172 0.8885 0.8761 0.2718  0.1660  0.1420  128 ASP B OD1 
1439 O OD2 . ASP B  69  ? 0.6699 0.8194 0.8596 0.2503  0.1766  0.1192  128 ASP B OD2 
1440 N N   . ALA B  70  ? 0.5482 0.8415 0.8291 0.2858  0.0777  0.2297  129 ALA B N   
1441 C CA  . ALA B  70  ? 0.5493 0.8333 0.8192 0.2854  0.0553  0.2529  129 ALA B CA  
1442 C C   . ALA B  70  ? 0.5729 0.7719 0.7957 0.2679  0.0602  0.2456  129 ALA B C   
1443 O O   . ALA B  70  ? 0.6175 0.7547 0.8219 0.2760  0.0825  0.2317  129 ALA B O   
1444 C CB  . ALA B  70  ? 0.5855 0.8847 0.8812 0.3306  0.0519  0.2790  129 ALA B CB  
1445 N N   . ILE B  71  ? 0.5468 0.7445 0.7504 0.2414  0.0415  0.2524  130 ILE B N   
1446 C CA  . ILE B  71  ? 0.5640 0.6936 0.7280 0.2198  0.0460  0.2441  130 ILE B CA  
1447 C C   . ILE B  71  ? 0.6279 0.6934 0.7698 0.2413  0.0530  0.2608  130 ILE B C   
1448 O O   . ILE B  71  ? 0.6472 0.7289 0.7929 0.2593  0.0387  0.2881  130 ILE B O   
1449 C CB  . ILE B  71  ? 0.5252 0.6766 0.6790 0.1864  0.0271  0.2456  130 ILE B CB  
1450 C CG1 . ILE B  71  ? 0.5444 0.6366 0.6646 0.1618  0.0339  0.2334  130 ILE B CG1 
1451 C CG2 . ILE B  71  ? 0.5268 0.7110 0.6850 0.1947  0.0074  0.2718  130 ILE B CG2 
1452 C CD1 . ILE B  71  ? 0.5058 0.6208 0.6227 0.1290  0.0221  0.2262  130 ILE B CD1 
1453 N N   . THR B  72  ? 0.6694 0.6614 0.7848 0.2371  0.0749  0.2450  131 THR B N   
1454 C CA  . THR B  72  ? 0.7373 0.6548 0.8267 0.2552  0.0865  0.2605  131 THR B CA  
1455 C C   . THR B  72  ? 0.7432 0.6380 0.8012 0.2294  0.0744  0.2721  131 THR B C   
1456 O O   . THR B  72  ? 0.6967 0.6218 0.7523 0.1954  0.0630  0.2601  131 THR B O   
1457 C CB  . THR B  72  ? 0.7922 0.6309 0.8589 0.2528  0.1180  0.2362  131 THR B CB  
1458 O OG1 . THR B  72  ? 0.7693 0.5894 0.8115 0.2075  0.1205  0.2105  131 THR B OG1 
1459 C CG2 . THR B  72  ? 0.7848 0.6428 0.8766 0.2732  0.1345  0.2188  131 THR B CG2 
1460 N N   . ASP B  73  ? 0.8134 0.6517 0.8463 0.2468  0.0793  0.2963  132 ASP B N   
1461 C CA  . ASP B  73  ? 0.8322 0.6400 0.8281 0.2213  0.0728  0.3078  132 ASP B CA  
1462 C C   . ASP B  73  ? 0.8218 0.5911 0.7959 0.1781  0.0881  0.2759  132 ASP B C   
1463 O O   . ASP B  73  ? 0.7873 0.5793 0.7534 0.1455  0.0782  0.2694  132 ASP B O   
1464 C CB  . ASP B  73  ? 0.9241 0.6632 0.8902 0.2493  0.0808  0.3406  132 ASP B CB  
1465 C CG  . ASP B  73  ? 0.9448 0.7374 0.9272 0.2855  0.0559  0.3799  132 ASP B CG  
1466 O OD1 . ASP B  73  ? 0.8824 0.7582 0.8832 0.2715  0.0306  0.3811  132 ASP B OD1 
1467 O OD2 . ASP B  73  ? 1.0275 0.7787 1.0033 0.3272  0.0617  0.4101  132 ASP B OD2 
1468 N N   . GLU B  74  ? 0.8589 0.5733 0.8250 0.1777  0.1132  0.2545  133 GLU B N   
1469 C CA  . GLU B  74  ? 0.8551 0.5444 0.8056 0.1361  0.1269  0.2211  133 GLU B CA  
1470 C C   . GLU B  74  ? 0.7715 0.5393 0.7472 0.1109  0.1084  0.2032  133 GLU B C   
1471 O O   . GLU B  74  ? 0.7540 0.5304 0.7218 0.0792  0.1038  0.1955  133 GLU B O   
1472 C CB  . GLU B  74  ? 0.9010 0.5414 0.8456 0.1394  0.1536  0.1955  133 GLU B CB  
1473 C CG  . GLU B  74  ? 1.0024 0.5429 0.9061 0.1259  0.1820  0.1891  133 GLU B CG  
1474 C CD  . GLU B  74  ? 1.0606 0.5639 0.9549 0.1085  0.2081  0.1496  133 GLU B CD  
1475 O OE1 . GLU B  74  ? 1.0955 0.5768 0.9968 0.1391  0.2238  0.1454  133 GLU B OE1 
1476 O OE2 . GLU B  74  ? 1.0562 0.5563 0.9365 0.0630  0.2134  0.1214  133 GLU B OE2 
1477 N N   . GLU B  75  ? 0.7246 0.5479 0.7310 0.1253  0.1000  0.1973  134 GLU B N   
1478 C CA  . GLU B  75  ? 0.6497 0.5393 0.6772 0.1038  0.0840  0.1841  134 GLU B CA  
1479 C C   . GLU B  75  ? 0.6144 0.5370 0.6452 0.0932  0.0655  0.1998  134 GLU B C   
1480 O O   . GLU B  75  ? 0.5787 0.5215 0.6125 0.0664  0.0604  0.1873  134 GLU B O   
1481 C CB  . GLU B  75  ? 0.6121 0.5542 0.6680 0.1210  0.0784  0.1811  134 GLU B CB  
1482 C CG  . GLU B  75  ? 0.5489 0.5499 0.6220 0.1000  0.0631  0.1722  134 GLU B CG  
1483 C CD  . GLU B  75  ? 0.5266 0.5735 0.6208 0.1104  0.0612  0.1678  134 GLU B CD  
1484 O OE1 . GLU B  75  ? 0.5600 0.5951 0.6559 0.1303  0.0750  0.1638  134 GLU B OE1 
1485 O OE2 . GLU B  75  ? 0.4699 0.5618 0.5778 0.0983  0.0486  0.1679  134 GLU B OE2 
1486 N N   . ASN B  76  ? 0.6281 0.5580 0.6583 0.1144  0.0560  0.2266  135 ASN B N   
1487 C CA  . ASN B  76  ? 0.6029 0.5692 0.6329 0.1025  0.0386  0.2392  135 ASN B CA  
1488 C C   . ASN B  76  ? 0.6200 0.5521 0.6220 0.0735  0.0447  0.2346  135 ASN B C   
1489 O O   . ASN B  76  ? 0.5857 0.5480 0.5911 0.0517  0.0371  0.2288  135 ASN B O   
1490 C CB  . ASN B  76  ? 0.6312 0.6144 0.6613 0.1298  0.0260  0.2696  135 ASN B CB  
1491 C CG  . ASN B  76  ? 0.6120 0.6550 0.6503 0.1171  0.0058  0.2769  135 ASN B CG  
1492 O OD1 . ASN B  76  ? 0.5898 0.6854 0.6562 0.1123  -0.0018 0.2670  135 ASN B OD1 
1493 N ND2 . ASN B  76  ? 0.6380 0.6702 0.6475 0.1082  -0.0010 0.2931  135 ASN B ND2 
1494 N N   . ASP B  77  ? 0.6798 0.5459 0.6538 0.0722  0.0618  0.2359  136 ASP B N   
1495 C CA  . ASP B  77  ? 0.7062 0.5366 0.6530 0.0409  0.0729  0.2286  136 ASP B CA  
1496 C C   . ASP B  77  ? 0.6586 0.5184 0.6250 0.0110  0.0755  0.1987  136 ASP B C   
1497 O O   . ASP B  77  ? 0.6446 0.5210 0.6092 -0.0118 0.0744  0.1937  136 ASP B O   
1498 C CB  . ASP B  77  ? 0.7870 0.5352 0.7012 0.0415  0.0954  0.2310  136 ASP B CB  
1499 C CG  . ASP B  77  ? 0.8564 0.5646 0.7415 0.0670  0.0942  0.2672  136 ASP B CG  
1500 O OD1 . ASP B  77  ? 0.8495 0.5958 0.7319 0.0731  0.0752  0.2886  136 ASP B OD1 
1501 O OD2 . ASP B  77  ? 0.9405 0.5777 0.8035 0.0805  0.1127  0.2745  136 ASP B OD2 
1502 N N   . MET B  78  ? 0.6383 0.5074 0.6234 0.0123  0.0791  0.1792  137 MET B N   
1503 C CA  . MET B  78  ? 0.5944 0.4996 0.6009 -0.0114 0.0779  0.1541  137 MET B CA  
1504 C C   . MET B  78  ? 0.5317 0.4994 0.5675 -0.0068 0.0601  0.1565  137 MET B C   
1505 O O   . MET B  78  ? 0.5027 0.4990 0.5544 -0.0245 0.0578  0.1451  137 MET B O   
1506 C CB  . MET B  78  ? 0.6046 0.5009 0.6141 -0.0136 0.0861  0.1337  137 MET B CB  
1507 C CG  . MET B  78  ? 0.6806 0.5072 0.6590 -0.0251 0.1085  0.1251  137 MET B CG  
1508 S SD  . MET B  78  ? 0.7399 0.5496 0.7054 -0.0658 0.1206  0.1135  137 MET B SD  
1509 C CE  . MET B  78  ? 0.7417 0.5041 0.6746 -0.0559 0.1249  0.1455  137 MET B CE  
1510 N N   . LEU B  79  ? 0.5191 0.5076 0.5638 0.0168  0.0494  0.1712  138 LEU B N   
1511 C CA  . LEU B  79  ? 0.4668 0.5074 0.5359 0.0187  0.0355  0.1735  138 LEU B CA  
1512 C C   . LEU B  79  ? 0.4593 0.5095 0.5239 0.0052  0.0318  0.1789  138 LEU B C   
1513 O O   . LEU B  79  ? 0.4322 0.5120 0.5146 -0.0039 0.0277  0.1718  138 LEU B O   
1514 C CB  . LEU B  79  ? 0.4560 0.5191 0.5357 0.0427  0.0277  0.1864  138 LEU B CB  
1515 C CG  . LEU B  79  ? 0.4140 0.5264 0.5170 0.0421  0.0167  0.1874  138 LEU B CG  
1516 C CD1 . LEU B  79  ? 0.3736 0.5013 0.4906 0.0329  0.0176  0.1723  138 LEU B CD1 
1517 C CD2 . LEU B  79  ? 0.3911 0.5277 0.5050 0.0635  0.0119  0.1995  138 LEU B CD2 
1518 N N   . ASP B  80  ? 0.4972 0.5192 0.5348 0.0037  0.0348  0.1915  139 ASP B N   
1519 C CA  . ASP B  80  ? 0.5024 0.5315 0.5283 -0.0140 0.0341  0.1932  139 ASP B CA  
1520 C C   . ASP B  80  ? 0.4867 0.5189 0.5241 -0.0371 0.0451  0.1718  139 ASP B C   
1521 O O   . ASP B  80  ? 0.4743 0.5251 0.5166 -0.0500 0.0462  0.1659  139 ASP B O   
1522 C CB  . ASP B  80  ? 0.5633 0.5540 0.5495 -0.0154 0.0381  0.2108  139 ASP B CB  
1523 C CG  . ASP B  80  ? 0.5938 0.6031 0.5684 0.0011  0.0221  0.2353  139 ASP B CG  
1524 O OD1 . ASP B  80  ? 0.5721 0.6283 0.5702 0.0072  0.0093  0.2350  139 ASP B OD1 
1525 O OD2 . ASP B  80  ? 0.6706 0.6481 0.6116 0.0073  0.0225  0.2562  139 ASP B OD2 
1526 N N   . LEU B  81  ? 0.4933 0.5083 0.5349 -0.0433 0.0548  0.1591  140 LEU B N   
1527 C CA  . LEU B  81  ? 0.4847 0.5112 0.5424 -0.0645 0.0649  0.1392  140 LEU B CA  
1528 C C   . LEU B  81  ? 0.4423 0.5128 0.5397 -0.0590 0.0569  0.1280  140 LEU B C   
1529 O O   . LEU B  81  ? 0.4372 0.5288 0.5572 -0.0710 0.0623  0.1131  140 LEU B O   
1530 C CB  . LEU B  81  ? 0.5210 0.5132 0.5635 -0.0798 0.0794  0.1296  140 LEU B CB  
1531 C CG  . LEU B  81  ? 0.5824 0.5200 0.5805 -0.0874 0.0912  0.1430  140 LEU B CG  
1532 C CD1 . LEU B  81  ? 0.6109 0.5084 0.5943 -0.1040 0.1081  0.1315  140 LEU B CD1 
1533 C CD2 . LEU B  81  ? 0.5754 0.5161 0.5592 -0.1053 0.0981  0.1450  140 LEU B CD2 
1534 N N   . ALA B  82  ? 0.4192 0.5063 0.5260 -0.0403 0.0443  0.1367  141 ALA B N   
1535 C CA  . ALA B  82  ? 0.3835 0.5064 0.5211 -0.0340 0.0367  0.1315  141 ALA B CA  
1536 C C   . ALA B  82  ? 0.3684 0.5079 0.5234 -0.0392 0.0396  0.1285  141 ALA B C   
1537 O O   . ALA B  82  ? 0.3697 0.5008 0.5109 -0.0418 0.0410  0.1347  141 ALA B O   
1538 C CB  . ALA B  82  ? 0.3680 0.5007 0.5063 -0.0161 0.0262  0.1427  141 ALA B CB  
1539 N N   . TYR B  83  ? 0.3516 0.5162 0.5369 -0.0404 0.0410  0.1187  142 TYR B N   
1540 C CA  . TYR B  83  ? 0.3433 0.5192 0.5493 -0.0403 0.0470  0.1153  142 TYR B CA  
1541 C C   . TYR B  83  ? 0.3324 0.5123 0.5439 -0.0266 0.0391  0.1264  142 TYR B C   
1542 O O   . TYR B  83  ? 0.3173 0.5105 0.5373 -0.0144 0.0287  0.1337  142 TYR B O   
1543 C CB  . TYR B  83  ? 0.3430 0.5488 0.5863 -0.0398 0.0508  0.1043  142 TYR B CB  
1544 C CG  . TYR B  83  ? 0.3419 0.5532 0.6096 -0.0360 0.0621  0.0995  142 TYR B CG  
1545 C CD1 . TYR B  83  ? 0.3489 0.5484 0.6105 -0.0519 0.0806  0.0870  142 TYR B CD1 
1546 C CD2 . TYR B  83  ? 0.3245 0.5469 0.6168 -0.0170 0.0570  0.1077  142 TYR B CD2 
1547 C CE1 . TYR B  83  ? 0.3502 0.5495 0.6317 -0.0491 0.0953  0.0790  142 TYR B CE1 
1548 C CE2 . TYR B  83  ? 0.3381 0.5552 0.6511 -0.0121 0.0714  0.1025  142 TYR B CE2 
1549 C CZ  . TYR B  83  ? 0.3517 0.5576 0.6603 -0.0283 0.0915  0.0861  142 TYR B CZ  
1550 O OH  . TYR B  83  ? 0.3881 0.5850 0.7168 -0.0238 0.1105  0.0768  142 TYR B OH  
1551 N N   . GLY B  84  ? 0.3420 0.5099 0.5462 -0.0322 0.0461  0.1261  143 GLY B N   
1552 C CA  . GLY B  84  ? 0.3345 0.5010 0.5404 -0.0261 0.0427  0.1342  143 GLY B CA  
1553 C C   . GLY B  84  ? 0.3310 0.4995 0.5175 -0.0229 0.0311  0.1462  143 GLY B C   
1554 O O   . GLY B  84  ? 0.3305 0.5062 0.5231 -0.0148 0.0256  0.1546  143 GLY B O   
1555 N N   . LEU B  85  ? 0.3446 0.5068 0.5080 -0.0284 0.0287  0.1482  144 LEU B N   
1556 C CA  . LEU B  85  ? 0.3445 0.5134 0.4946 -0.0212 0.0186  0.1603  144 LEU B CA  
1557 C C   . LEU B  85  ? 0.3425 0.5251 0.4945 -0.0262 0.0161  0.1642  144 LEU B C   
1558 O O   . LEU B  85  ? 0.3600 0.5388 0.5051 -0.0419 0.0219  0.1576  144 LEU B O   
1559 C CB  . LEU B  85  ? 0.3647 0.5214 0.4893 -0.0246 0.0175  0.1652  144 LEU B CB  
1560 C CG  . LEU B  85  ? 0.3707 0.5358 0.4849 -0.0117 0.0076  0.1800  144 LEU B CG  
1561 C CD1 . LEU B  85  ? 0.3495 0.5122 0.4727 0.0054  0.0069  0.1816  144 LEU B CD1 
1562 C CD2 . LEU B  85  ? 0.3815 0.5292 0.4670 -0.0145 0.0069  0.1889  144 LEU B CD2 
1563 N N   . THR B  86  ? 0.3276 0.5263 0.4863 -0.0163 0.0097  0.1726  145 THR B N   
1564 C CA  . THR B  86  ? 0.3236 0.5396 0.4859 -0.0242 0.0086  0.1758  145 THR B CA  
1565 C C   . THR B  86  ? 0.3231 0.5669 0.4836 -0.0168 -0.0005 0.1855  145 THR B C   
1566 O O   . THR B  86  ? 0.3191 0.5613 0.4773 -0.0004 -0.0038 0.1908  145 THR B O   
1567 C CB  . THR B  86  ? 0.3209 0.5361 0.4969 -0.0195 0.0122  0.1786  145 THR B CB  
1568 O OG1 . THR B  86  ? 0.2989 0.5261 0.4769 -0.0041 0.0072  0.1854  145 THR B OG1 
1569 C CG2 . THR B  86  ? 0.3096 0.5030 0.4947 -0.0171 0.0191  0.1740  145 THR B CG2 
1570 N N   . ASP B  87  ? 0.3270 0.5970 0.4913 -0.0289 -0.0026 0.1868  146 ASP B N   
1571 C CA  . ASP B  87  ? 0.3217 0.6319 0.4940 -0.0207 -0.0113 0.1962  146 ASP B CA  
1572 C C   . ASP B  87  ? 0.3117 0.6343 0.4995 -0.0072 -0.0074 0.2000  146 ASP B C   
1573 O O   . ASP B  87  ? 0.3093 0.6714 0.5110 -0.0036 -0.0100 0.2050  146 ASP B O   
1574 C CB  . ASP B  87  ? 0.3260 0.6703 0.4991 -0.0436 -0.0154 0.1937  146 ASP B CB  
1575 C CG  . ASP B  87  ? 0.3342 0.6704 0.5120 -0.0655 -0.0037 0.1843  146 ASP B CG  
1576 O OD1 . ASP B  87  ? 0.3422 0.6930 0.5143 -0.0918 -0.0030 0.1763  146 ASP B OD1 
1577 O OD2 . ASP B  87  ? 0.2964 0.6109 0.4805 -0.0581 0.0050  0.1855  146 ASP B OD2 
1578 N N   . ARG B  88  ? 0.3044 0.5990 0.4900 -0.0012 -0.0009 0.1973  147 ARG B N   
1579 C CA  . ARG B  88  ? 0.3032 0.6064 0.4942 0.0115  0.0028  0.2002  147 ARG B CA  
1580 C C   . ARG B  88  ? 0.3073 0.5838 0.4889 0.0252  0.0037  0.1968  147 ARG B C   
1581 O O   . ARG B  88  ? 0.3106 0.5879 0.4894 0.0316  0.0076  0.1960  147 ARG B O   
1582 C CB  . ARG B  88  ? 0.3074 0.6096 0.4998 -0.0009 0.0099  0.2016  147 ARG B CB  
1583 C CG  . ARG B  88  ? 0.3058 0.6314 0.5059 -0.0210 0.0130  0.2017  147 ARG B CG  
1584 C CD  . ARG B  88  ? 0.3054 0.6772 0.5198 -0.0174 0.0143  0.2048  147 ARG B CD  
1585 N NE  . ARG B  88  ? 0.3120 0.7139 0.5360 -0.0422 0.0174  0.2026  147 ARG B NE  
1586 C CZ  . ARG B  88  ? 0.3092 0.7428 0.5409 -0.0538 0.0090  0.1994  147 ARG B CZ  
1587 N NH1 . ARG B  88  ? 0.3187 0.7564 0.5479 -0.0398 -0.0035 0.2017  147 ARG B NH1 
1588 N NH2 . ARG B  88  ? 0.3284 0.7902 0.5672 -0.0822 0.0135  0.1943  147 ARG B NH2 
1589 N N   . SER B  89  ? 0.3107 0.5656 0.4846 0.0261  0.0011  0.1934  148 SER B N   
1590 C CA  . SER B  89  ? 0.3139 0.5445 0.4791 0.0319  0.0031  0.1870  148 SER B CA  
1591 C C   . SER B  89  ? 0.3260 0.5495 0.4845 0.0472  0.0063  0.1865  148 SER B C   
1592 O O   . SER B  89  ? 0.3324 0.5612 0.4921 0.0564  0.0049  0.1938  148 SER B O   
1593 C CB  . SER B  89  ? 0.3189 0.5290 0.4788 0.0225  0.0029  0.1824  148 SER B CB  
1594 O OG  . SER B  89  ? 0.3161 0.5267 0.4843 0.0115  0.0041  0.1800  148 SER B OG  
1595 N N   . ARG B  90  ? 0.3353 0.5469 0.4862 0.0502  0.0112  0.1779  149 ARG B N   
1596 C CA  . ARG B  90  ? 0.3630 0.5516 0.5025 0.0614  0.0193  0.1720  149 ARG B CA  
1597 C C   . ARG B  90  ? 0.3756 0.5445 0.5021 0.0503  0.0225  0.1574  149 ARG B C   
1598 O O   . ARG B  90  ? 0.3562 0.5398 0.4868 0.0391  0.0161  0.1547  149 ARG B O   
1599 C CB  . ARG B  90  ? 0.3741 0.5784 0.5179 0.0760  0.0268  0.1720  149 ARG B CB  
1600 C CG  . ARG B  90  ? 0.3736 0.6093 0.5366 0.0883  0.0242  0.1853  149 ARG B CG  
1601 C CD  . ARG B  90  ? 0.3942 0.6156 0.5577 0.1035  0.0224  0.1953  149 ARG B CD  
1602 N NE  . ARG B  90  ? 0.4310 0.6155 0.5839 0.1209  0.0361  0.1896  149 ARG B NE  
1603 C CZ  . ARG B  90  ? 0.4564 0.6492 0.6216 0.1452  0.0464  0.1913  149 ARG B CZ  
1604 N NH1 . ARG B  90  ? 0.4335 0.6804 0.6261 0.1549  0.0434  0.1992  149 ARG B NH1 
1605 N NH2 . ARG B  90  ? 0.4932 0.6393 0.6445 0.1590  0.0627  0.1833  149 ARG B NH2 
1606 N N   . LEU B  91  ? 0.4106 0.5462 0.5221 0.0531  0.0326  0.1482  150 LEU B N   
1607 C CA  . LEU B  91  ? 0.4255 0.5450 0.5233 0.0374  0.0370  0.1305  150 LEU B CA  
1608 C C   . LEU B  91  ? 0.4421 0.5710 0.5300 0.0389  0.0426  0.1196  150 LEU B C   
1609 O O   . LEU B  91  ? 0.4751 0.5828 0.5542 0.0515  0.0563  0.1150  150 LEU B O   
1610 C CB  . LEU B  91  ? 0.4659 0.5366 0.5471 0.0346  0.0492  0.1242  150 LEU B CB  
1611 C CG  . LEU B  91  ? 0.4640 0.5238 0.5474 0.0274  0.0453  0.1336  150 LEU B CG  
1612 C CD1 . LEU B  91  ? 0.5000 0.5078 0.5614 0.0187  0.0594  0.1268  150 LEU B CD1 
1613 C CD2 . LEU B  91  ? 0.4258 0.5169 0.5244 0.0105  0.0355  0.1294  150 LEU B CD2 
1614 N N   . GLY B  92  ? 0.4289 0.5892 0.5169 0.0271  0.0330  0.1160  151 GLY B N   
1615 C CA  . GLY B  92  ? 0.4437 0.6230 0.5182 0.0264  0.0355  0.1099  151 GLY B CA  
1616 C C   . GLY B  92  ? 0.4913 0.6436 0.5409 0.0217  0.0522  0.0876  151 GLY B C   
1617 O O   . GLY B  92  ? 0.5147 0.6745 0.5499 0.0241  0.0612  0.0801  151 GLY B O   
1618 N N   . CYS B  93  ? 0.5180 0.6341 0.5603 0.0134  0.0598  0.0755  152 CYS B N   
1619 C CA  . CYS B  93  ? 0.5772 0.6581 0.5920 0.0030  0.0785  0.0499  152 CYS B CA  
1620 C C   . CYS B  93  ? 0.6064 0.6416 0.6178 0.0263  0.1009  0.0498  152 CYS B C   
1621 O O   . CYS B  93  ? 0.6498 0.6466 0.6378 0.0219  0.1223  0.0276  152 CYS B O   
1622 C CB  . CYS B  93  ? 0.5988 0.6605 0.6055 -0.0222 0.0787  0.0348  152 CYS B CB  
1623 S SG  . CYS B  93  ? 0.6509 0.6544 0.6625 -0.0159 0.0895  0.0445  152 CYS B SG  
1624 N N   . GLN B  94  ? 0.5781 0.6186 0.6134 0.0510  0.0961  0.0742  153 GLN B N   
1625 C CA  . GLN B  94  ? 0.6078 0.6232 0.6497 0.0809  0.1128  0.0807  153 GLN B CA  
1626 C C   . GLN B  94  ? 0.5870 0.6478 0.6453 0.0968  0.1137  0.0865  153 GLN B C   
1627 O O   . GLN B  94  ? 0.6110 0.6624 0.6790 0.1223  0.1302  0.0875  153 GLN B O   
1628 C CB  . GLN B  94  ? 0.5968 0.5965 0.6537 0.0976  0.1058  0.1049  153 GLN B CB  
1629 C CG  . GLN B  94  ? 0.6288 0.5767 0.6657 0.0813  0.1104  0.0998  153 GLN B CG  
1630 C CD  . GLN B  94  ? 0.6965 0.5787 0.7071 0.0807  0.1376  0.0795  153 GLN B CD  
1631 O OE1 . GLN B  94  ? 0.7361 0.5845 0.7479 0.1100  0.1544  0.0856  153 GLN B OE1 
1632 N NE2 . GLN B  94  ? 0.7231 0.5876 0.7112 0.0471  0.1434  0.0544  153 GLN B NE2 
1633 N N   . ILE B  95  ? 0.5476 0.6566 0.6094 0.0822  0.0978  0.0908  154 ILE B N   
1634 C CA  . ILE B  95  ? 0.5279 0.6815 0.6035 0.0912  0.0985  0.0986  154 ILE B CA  
1635 C C   . ILE B  95  ? 0.5630 0.7237 0.6120 0.0789  0.1117  0.0782  154 ILE B C   
1636 O O   . ILE B  95  ? 0.5677 0.7381 0.5939 0.0552  0.1014  0.0710  154 ILE B O   
1637 C CB  . ILE B  95  ? 0.4758 0.6697 0.5669 0.0821  0.0765  0.1183  154 ILE B CB  
1638 C CG1 . ILE B  95  ? 0.4541 0.6419 0.5657 0.0898  0.0650  0.1349  154 ILE B CG1 
1639 C CG2 . ILE B  95  ? 0.4470 0.6825 0.5494 0.0864  0.0805  0.1258  154 ILE B CG2 
1640 C CD1 . ILE B  95  ? 0.4656 0.6467 0.5947 0.1161  0.0738  0.1429  154 ILE B CD1 
1641 N N   . CYS B  96  ? 0.5903 0.7497 0.6429 0.0961  0.1345  0.0694  155 CYS B N   
1642 C CA  . CYS B  96  ? 0.6322 0.7945 0.6559 0.0852  0.1530  0.0467  155 CYS B CA  
1643 C C   . CYS B  96  ? 0.6109 0.8258 0.6417 0.0839  0.1529  0.0569  155 CYS B C   
1644 O O   . CYS B  96  ? 0.5843 0.8274 0.6511 0.1022  0.1531  0.0736  155 CYS B O   
1645 C CB  . CYS B  96  ? 0.6910 0.8119 0.7122 0.1047  0.1856  0.0259  155 CYS B CB  
1646 S SG  . CYS B  96  ? 0.7794 0.8266 0.7689 0.0905  0.1946  0.0027  155 CYS B SG  
1647 N N   . LEU B  97  ? 0.6281 0.8576 0.6220 0.0602  0.1536  0.0464  156 LEU B N   
1648 C CA  . LEU B  97  ? 0.6173 0.8903 0.6069 0.0532  0.1553  0.0568  156 LEU B CA  
1649 C C   . LEU B  97  ? 0.6407 0.9266 0.6457 0.0705  0.1862  0.0457  156 LEU B C   
1650 O O   . LEU B  97  ? 0.6869 0.9464 0.6770 0.0760  0.2119  0.0192  156 LEU B O   
1651 C CB  . LEU B  97  ? 0.6485 0.9309 0.5867 0.0243  0.1492  0.0491  156 LEU B CB  
1652 C CG  . LEU B  97  ? 0.6237 0.9100 0.5506 0.0084  0.1165  0.0639  156 LEU B CG  
1653 C CD1 . LEU B  97  ? 0.6473 0.9515 0.5240 -0.0163 0.1101  0.0584  156 LEU B CD1 
1654 C CD2 . LEU B  97  ? 0.5741 0.8787 0.5323 0.0154  0.0968  0.0965  156 LEU B CD2 
1655 N N   . THR B  98  ? 0.6119 0.9394 0.6487 0.0777  0.1855  0.0647  157 THR B N   
1656 C CA  . THR B  98  ? 0.6301 0.9891 0.6866 0.0900  0.2142  0.0565  157 THR B CA  
1657 C C   . THR B  98  ? 0.6354 1.0317 0.6691 0.0652  0.2170  0.0647  157 THR B C   
1658 O O   . THR B  98  ? 0.6122 1.0119 0.6295 0.0464  0.1935  0.0849  157 THR B O   
1659 C CB  . THR B  98  ? 0.5974 0.9848 0.7165 0.1179  0.2127  0.0717  157 THR B CB  
1660 O OG1 . THR B  98  ? 0.5518 0.9646 0.6865 0.1056  0.1864  0.0976  157 THR B OG1 
1661 C CG2 . THR B  98  ? 0.5991 0.9457 0.7367 0.1451  0.2105  0.0690  157 THR B CG2 
1662 N N   . LYS B  99  ? 0.6722 1.0940 0.7055 0.0665  0.2485  0.0497  158 LYS B N   
1663 C CA  . LYS B  99  ? 0.6887 1.1430 0.6944 0.0408  0.2576  0.0561  158 LYS B CA  
1664 C C   . LYS B  99  ? 0.6443 1.1270 0.6749 0.0313  0.2382  0.0873  158 LYS B C   
1665 O O   . LYS B  99  ? 0.6574 1.1432 0.6530 0.0060  0.2311  0.1031  158 LYS B O   
1666 C CB  . LYS B  99  ? 0.7275 1.2120 0.7430 0.0472  0.2992  0.0340  158 LYS B CB  
1667 C CG  . LYS B  99  ? 0.7937 1.2844 0.7456 0.0160  0.3171  0.0244  158 LYS B CG  
1668 C CD  . LYS B  99  ? 0.8566 1.3801 0.8196 0.0207  0.3626  0.0002  158 LYS B CD  
1669 C CE  . LYS B  99  ? 0.9129 1.4555 0.8162 -0.0159 0.3783  0.0013  158 LYS B CE  
1670 N NZ  . LYS B  99  ? 0.9578 1.5444 0.8808 -0.0142 0.4252  -0.0194 158 LYS B NZ  
1671 N N   . SER B  100 ? 0.6003 1.1004 0.6883 0.0506  0.2295  0.0968  159 SER B N   
1672 C CA  . SER B  100 ? 0.5675 1.0940 0.6791 0.0378  0.2146  0.1209  159 SER B CA  
1673 C C   . SER B  100 ? 0.5461 1.0362 0.6341 0.0247  0.1829  0.1407  159 SER B C   
1674 O O   . SER B  100 ? 0.5267 1.0266 0.6247 0.0102  0.1730  0.1595  159 SER B O   
1675 C CB  . SER B  100 ? 0.5352 1.0980 0.7133 0.0605  0.2127  0.1234  159 SER B CB  
1676 O OG  . SER B  100 ? 0.5256 1.0544 0.7146 0.0828  0.1942  0.1237  159 SER B OG  
1677 N N   . MET B  101 ? 0.5508 1.0002 0.6105 0.0292  0.1693  0.1348  160 MET B N   
1678 C CA  . MET B  101 ? 0.5330 0.9534 0.5763 0.0205  0.1407  0.1516  160 MET B CA  
1679 C C   . MET B  101 ? 0.5627 0.9748 0.5559 -0.0013 0.1350  0.1649  160 MET B C   
1680 O O   . MET B  101 ? 0.5519 0.9446 0.5348 -0.0056 0.1127  0.1816  160 MET B O   
1681 C CB  . MET B  101 ? 0.5281 0.9156 0.5684 0.0331  0.1283  0.1395  160 MET B CB  
1682 C CG  . MET B  101 ? 0.4974 0.8805 0.5818 0.0540  0.1232  0.1387  160 MET B CG  
1683 S SD  . MET B  101 ? 0.5288 0.8659 0.6024 0.0642  0.1158  0.1234  160 MET B SD  
1684 C CE  . MET B  101 ? 0.5035 0.8417 0.6246 0.0934  0.1209  0.1248  160 MET B CE  
1685 N N   . ASP B  102 ? 0.6072 1.0352 0.5692 -0.0137 0.1557  0.1591  161 ASP B N   
1686 C CA  . ASP B  102 ? 0.6457 1.0667 0.5528 -0.0340 0.1501  0.1753  161 ASP B CA  
1687 C C   . ASP B  102 ? 0.6328 1.0420 0.5445 -0.0418 0.1345  0.2079  161 ASP B C   
1688 O O   . ASP B  102 ? 0.6101 1.0301 0.5535 -0.0456 0.1440  0.2151  161 ASP B O   
1689 C CB  . ASP B  102 ? 0.6957 1.1389 0.5710 -0.0490 0.1799  0.1658  161 ASP B CB  
1690 C CG  . ASP B  102 ? 0.7545 1.1899 0.5595 -0.0691 0.1741  0.1779  161 ASP B CG  
1691 O OD1 . ASP B  102 ? 0.7631 1.1867 0.5393 -0.0687 0.1559  0.1721  161 ASP B OD1 
1692 O OD2 . ASP B  102 ? 0.8127 1.2571 0.5894 -0.0872 0.1884  0.1933  161 ASP B OD2 
1693 N N   . ASN B  103 ? 0.6452 1.0331 0.5273 -0.0437 0.1111  0.2262  162 ASN B N   
1694 C CA  . ASN B  103 ? 0.6456 1.0115 0.5291 -0.0462 0.0966  0.2576  162 ASN B CA  
1695 C C   . ASN B  103 ? 0.5927 0.9458 0.5281 -0.0353 0.0870  0.2589  162 ASN B C   
1696 O O   . ASN B  103 ? 0.5969 0.9289 0.5384 -0.0400 0.0841  0.2800  162 ASN B O   
1697 C CB  . ASN B  103 ? 0.6907 1.0547 0.5480 -0.0657 0.1152  0.2776  162 ASN B CB  
1698 C CG  . ASN B  103 ? 0.7584 1.1225 0.5501 -0.0775 0.1154  0.2910  162 ASN B CG  
1699 O OD1 . ASN B  103 ? 0.7774 1.1272 0.5413 -0.0720 0.0919  0.3114  162 ASN B OD1 
1700 N ND2 . ASN B  103 ? 0.7897 1.1744 0.5563 -0.0938 0.1422  0.2805  162 ASN B ND2 
1701 N N   . MET B  104 ? 0.5516 0.9121 0.5198 -0.0219 0.0833  0.2369  163 MET B N   
1702 C CA  . MET B  104 ? 0.5103 0.8580 0.5185 -0.0131 0.0716  0.2385  163 MET B CA  
1703 C C   . MET B  104 ? 0.5102 0.8344 0.5110 -0.0067 0.0491  0.2517  163 MET B C   
1704 O O   . MET B  104 ? 0.5321 0.8581 0.5035 -0.0057 0.0387  0.2548  163 MET B O   
1705 C CB  . MET B  104 ? 0.4748 0.8338 0.5149 0.0003  0.0734  0.2156  163 MET B CB  
1706 C CG  . MET B  104 ? 0.4785 0.8284 0.5060 0.0095  0.0651  0.1998  163 MET B CG  
1707 S SD  . MET B  104 ? 0.4469 0.7917 0.5111 0.0270  0.0663  0.1807  163 MET B SD  
1708 C CE  . MET B  104 ? 0.4588 0.7841 0.4953 0.0270  0.0593  0.1636  163 MET B CE  
1709 N N   . THR B  105 ? 0.4892 0.7964 0.5183 -0.0031 0.0424  0.2581  164 THR B N   
1710 C CA  . THR B  105 ? 0.4818 0.7704 0.5163 0.0062  0.0243  0.2675  164 THR B CA  
1711 C C   . THR B  105 ? 0.4400 0.7269 0.5078 0.0141  0.0184  0.2500  164 THR B C   
1712 O O   . THR B  105 ? 0.4222 0.7083 0.5125 0.0110  0.0257  0.2437  164 THR B O   
1713 C CB  . THR B  105 ? 0.5010 0.7611 0.5358 0.0031  0.0263  0.2912  164 THR B CB  
1714 O OG1 . THR B  105 ? 0.5519 0.8086 0.5511 -0.0060 0.0344  0.3099  164 THR B OG1 
1715 C CG2 . THR B  105 ? 0.5005 0.7448 0.5446 0.0175  0.0099  0.3023  164 THR B CG2 
1716 N N   . VAL B  106 ? 0.4297 0.7193 0.4980 0.0216  0.0053  0.2422  165 VAL B N   
1717 C CA  . VAL B  106 ? 0.3964 0.6795 0.4907 0.0266  0.0007  0.2286  165 VAL B CA  
1718 C C   . VAL B  106 ? 0.3956 0.6710 0.5017 0.0326  -0.0117 0.2384  165 VAL B C   
1719 O O   . VAL B  106 ? 0.4180 0.7022 0.5103 0.0363  -0.0218 0.2516  165 VAL B O   
1720 C CB  . VAL B  106 ? 0.3944 0.6853 0.4825 0.0278  0.0004  0.2075  165 VAL B CB  
1721 C CG1 . VAL B  106 ? 0.3962 0.6932 0.4794 0.0279  0.0157  0.1974  165 VAL B CG1 
1722 C CG2 . VAL B  106 ? 0.4097 0.7145 0.4743 0.0246  -0.0099 0.2056  165 VAL B CG2 
1723 N N   . ARG B  107 ? 0.5999 0.8637 0.7534 -0.1870 0.1346  0.1140  166 ARG B N   
1724 C CA  . ARG B  107 ? 0.6219 0.7857 0.7756 -0.1935 0.1542  0.1155  166 ARG B CA  
1725 C C   . ARG B  107 ? 0.5823 0.7428 0.7409 -0.1525 0.1189  0.1414  166 ARG B C   
1726 O O   . ARG B  107 ? 0.5584 0.8023 0.7163 -0.1408 0.0970  0.1409  166 ARG B O   
1727 C CB  . ARG B  107 ? 0.6706 0.8384 0.8157 -0.2615 0.2025  0.0683  166 ARG B CB  
1728 C CG  . ARG B  107 ? 0.7096 0.7684 0.8487 -0.2584 0.2297  0.0754  166 ARG B CG  
1729 C CD  . ARG B  107 ? 0.8054 0.8030 0.9164 -0.3258 0.3038  0.0314  166 ARG B CD  
1730 N NE  . ARG B  107 ? 0.8136 0.9210 0.9223 -0.3907 0.3099  -0.0202 166 ARG B NE  
1731 C CZ  . ARG B  107 ? 0.7970 0.9369 0.9135 -0.3930 0.2964  -0.0264 166 ARG B CZ  
1732 N NH1 . ARG B  107 ? 0.8102 1.0742 0.9230 -0.4560 0.3041  -0.0754 166 ARG B NH1 
1733 N NH2 . ARG B  107 ? 0.7667 0.8332 0.8941 -0.3361 0.2758  0.0146  166 ARG B NH2 
1734 N N   . VAL B  108 ? 0.5849 0.6575 0.7440 -0.1286 0.1183  0.1664  167 VAL B N   
1735 C CA  . VAL B  108 ? 0.5652 0.6276 0.7253 -0.1052 0.0947  0.1831  167 VAL B CA  
1736 C C   . VAL B  108 ? 0.5852 0.6352 0.7514 -0.1321 0.1182  0.1637  167 VAL B C   
1737 O O   . VAL B  108 ? 0.6269 0.6102 0.7906 -0.1420 0.1554  0.1634  167 VAL B O   
1738 C CB  . VAL B  108 ? 0.5601 0.5677 0.7172 -0.0765 0.0846  0.2144  167 VAL B CB  
1739 C CG1 . VAL B  108 ? 0.5357 0.5475 0.6845 -0.0631 0.0599  0.2241  167 VAL B CG1 
1740 C CG2 . VAL B  108 ? 0.5515 0.5563 0.7002 -0.0617 0.0760  0.2278  167 VAL B CG2 
1741 N N   . PRO B  109 ? 0.5673 0.6787 0.7354 -0.1395 0.1040  0.1501  168 PRO B N   
1742 C CA  . PRO B  109 ? 0.5852 0.6932 0.7569 -0.1705 0.1263  0.1271  168 PRO B CA  
1743 C C   . PRO B  109 ? 0.5752 0.6231 0.7505 -0.1451 0.1186  0.1509  168 PRO B C   
1744 O O   . PRO B  109 ? 0.5385 0.5766 0.7119 -0.1118 0.0898  0.1783  168 PRO B O   
1745 C CB  . PRO B  109 ? 0.5648 0.7902 0.7374 -0.1789 0.1080  0.1101  168 PRO B CB  
1746 C CG  . PRO B  109 ? 0.5377 0.7859 0.7014 -0.1262 0.0740  0.1436  168 PRO B CG  
1747 C CD  . PRO B  109 ? 0.5396 0.7229 0.6995 -0.1115 0.0732  0.1610  168 PRO B CD  
1748 N N   . GLU B  110 ? 0.6086 0.6197 0.7834 -0.1668 0.1504  0.1370  169 GLU B N   
1749 C CA  . GLU B  110 ? 0.6086 0.5768 0.7874 -0.1421 0.1479  0.1605  169 GLU B CA  
1750 C C   . GLU B  110 ? 0.5620 0.5802 0.7459 -0.1306 0.1074  0.1643  169 GLU B C   
1751 O O   . GLU B  110 ? 0.5441 0.6259 0.7264 -0.1427 0.0957  0.1461  169 GLU B O   
1752 C CB  . GLU B  110 ? 0.6705 0.5755 0.8388 -0.1633 0.2027  0.1466  169 GLU B CB  
1753 C CG  . GLU B  110 ? 0.6914 0.6360 0.8565 -0.2112 0.2140  0.1036  169 GLU B CG  
1754 C CD  . GLU B  110 ? 0.7908 0.6524 0.9353 -0.2337 0.2756  0.0889  169 GLU B CD  
1755 O OE1 . GLU B  110 ? 0.8117 0.7082 0.9485 -0.2849 0.2918  0.0461  169 GLU B OE1 
1756 O OE2 . GLU B  110 ? 0.8385 0.6088 0.9701 -0.1974 0.3119  0.1219  169 GLU B OE2 
1757 N N   . THR B  111 ? 0.5488 0.5467 0.7340 -0.1060 0.0912  0.1898  170 THR B N   
1758 C CA  . THR B  111 ? 0.5271 0.5481 0.7067 -0.0987 0.0645  0.1929  170 THR B CA  
1759 C C   . THR B  111 ? 0.5294 0.5488 0.7176 -0.1099 0.0757  0.1831  170 THR B C   
1760 O O   . THR B  111 ? 0.5580 0.5462 0.7518 -0.1200 0.1075  0.1776  170 THR B O   
1761 C CB  . THR B  111 ? 0.5207 0.5285 0.6901 -0.0837 0.0471  0.2155  170 THR B CB  
1762 O OG1 . THR B  111 ? 0.5334 0.5367 0.7156 -0.0774 0.0582  0.2312  170 THR B OG1 
1763 C CG2 . THR B  111 ? 0.5120 0.5159 0.6693 -0.0767 0.0406  0.2236  170 THR B CG2 
1764 N N   . VAL B  112 ? 0.5112 0.5525 0.6925 -0.1055 0.0573  0.1826  171 VAL B N   
1765 C CA  . VAL B  112 ? 0.5108 0.5550 0.6998 -0.1151 0.0643  0.1738  171 VAL B CA  
1766 C C   . VAL B  112 ? 0.5148 0.5234 0.7121 -0.1066 0.0745  0.1920  171 VAL B C   
1767 O O   . VAL B  112 ? 0.5311 0.5214 0.7351 -0.1131 0.0991  0.1864  171 VAL B O   
1768 C CB  . VAL B  112 ? 0.5022 0.5724 0.6765 -0.1044 0.0455  0.1761  171 VAL B CB  
1769 C CG1 . VAL B  112 ? 0.5010 0.5350 0.6546 -0.0920 0.0333  0.1955  171 VAL B CG1 
1770 C CG2 . VAL B  112 ? 0.4842 0.5709 0.6690 -0.1178 0.0532  0.1625  171 VAL B CG2 
1771 N N   . ALA B  113 ? 0.4958 0.5056 0.6882 -0.0923 0.0602  0.2140  172 ALA B N   
1772 C CA  . ALA B  113 ? 0.4999 0.5195 0.7004 -0.0767 0.0684  0.2386  172 ALA B CA  
1773 C C   . ALA B  113 ? 0.5336 0.5228 0.7401 -0.0580 0.1078  0.2523  172 ALA B C   
1774 O O   . ALA B  113 ? 0.5593 0.5378 0.7681 -0.0384 0.1352  0.2697  172 ALA B O   
1775 C CB  . ALA B  113 ? 0.4886 0.5446 0.6789 -0.0757 0.0485  0.2528  172 ALA B CB  
1776 N N   . ASP B  114 ? 0.5459 0.5126 0.7476 -0.0604 0.1183  0.2470  173 ASP B N   
1777 C CA  . ASP B  114 ? 0.6022 0.5181 0.7963 -0.0429 0.1680  0.2603  173 ASP B CA  
1778 C C   . ASP B  114 ? 0.6488 0.5035 0.8316 -0.0608 0.2149  0.2392  173 ASP B C   
1779 O O   . ASP B  114 ? 0.7229 0.5173 0.8881 -0.0344 0.2711  0.2608  173 ASP B O   
1780 C CB  . ASP B  114 ? 0.6123 0.5116 0.8001 -0.0528 0.1725  0.2502  173 ASP B CB  
1781 C CG  . ASP B  114 ? 0.5918 0.5409 0.7838 -0.0335 0.1376  0.2734  173 ASP B CG  
1782 O OD1 . ASP B  114 ? 0.6164 0.6079 0.8112 -0.0038 0.1340  0.3068  173 ASP B OD1 
1783 O OD2 . ASP B  114 ? 0.5909 0.5489 0.7802 -0.0495 0.1159  0.2577  173 ASP B OD2 
1784 N N   . ALA B  115 ? 0.6245 0.4973 0.8108 -0.1023 0.1987  0.1995  174 ALA B N   
1785 C CA  . ALA B  115 ? 0.6759 0.5048 0.8464 -0.1393 0.2451  0.1649  174 ALA B CA  
1786 C C   . ALA B  115 ? 0.6800 0.5008 0.8528 -0.1283 0.2509  0.1733  174 ALA B C   
1787 O O   . ALA B  115 ? 0.7395 0.5064 0.8923 -0.1528 0.3006  0.1509  174 ALA B O   
1788 C CB  . ALA B  115 ? 0.6470 0.5399 0.8207 -0.1900 0.2246  0.1184  174 ALA B CB  
1789 N N   . ARG B  116 ? 0.6296 0.5039 0.8218 -0.0985 0.2040  0.2012  175 ARG B N   
1790 C CA  . ARG B  116 ? 0.6258 0.5108 0.8238 -0.0900 0.2001  0.2086  175 ARG B CA  
1791 C C   . ARG B  116 ? 0.6994 0.5327 0.8837 -0.0495 0.2537  0.2434  175 ARG B C   
1792 O O   . ARG B  116 ? 0.7208 0.5542 0.9005 -0.0061 0.2698  0.2830  175 ARG B O   
1793 C CB  . ARG B  116 ? 0.5580 0.5130 0.7713 -0.0787 0.1434  0.2244  175 ARG B CB  
1794 C CG  . ARG B  116 ? 0.5488 0.5233 0.7675 -0.0837 0.1315  0.2204  175 ARG B CG  
1795 C CD  . ARG B  116 ? 0.4984 0.5259 0.7192 -0.0842 0.0883  0.2295  175 ARG B CD  
1796 N NE  . ARG B  116 ? 0.4910 0.5214 0.7004 -0.1023 0.0636  0.2095  175 ARG B NE  
1797 C CZ  . ARG B  116 ? 0.4923 0.5306 0.6877 -0.1033 0.0457  0.2144  175 ARG B CZ  
1798 N NH1 . ARG B  116 ? 0.5078 0.5371 0.6835 -0.1077 0.0354  0.2027  175 ARG B NH1 
1799 N NH2 . ARG B  116 ? 0.5011 0.5634 0.6965 -0.0976 0.0426  0.2327  175 ARG B NH2 
1800 N N   . GLN B  117 ? 0.7459 0.5399 0.9195 -0.0582 0.2861  0.2319  176 GLN B N   
1801 C CA  . GLN B  117 ? 0.8395 0.5708 0.9894 -0.0115 0.3507  0.2686  176 GLN B CA  
1802 C C   . GLN B  117 ? 0.7951 0.5950 0.9645 0.0187  0.3222  0.2968  176 GLN B C   
1803 O O   . GLN B  117 ? 0.8264 0.6506 0.9913 0.0807  0.3453  0.3501  176 GLN B O   
1804 C CB  . GLN B  117 ? 0.9467 0.5591 1.0548 -0.0475 0.4292  0.2322  176 GLN B CB  
1805 C CG  . GLN B  117 ? 1.0519 0.5770 1.1246 -0.0719 0.4859  0.2119  176 GLN B CG  
1806 C CD  . GLN B  117 ? 1.2136 0.6150 1.2310 -0.1278 0.5765  0.1635  176 GLN B CD  
1807 O OE1 . GLN B  117 ? 1.2330 0.6637 1.2545 -0.1881 0.5638  0.1137  176 GLN B OE1 
1808 N NE2 . GLN B  117 ? 1.3650 0.6258 1.3230 -0.1105 0.6759  0.1768  176 GLN B NE2 
1809 N N   . SER B  118 ? 0.7301 0.5708 0.9179 -0.0221 0.2768  0.2634  177 SER B N   
1810 C CA  . SER B  118 ? 0.6849 0.6007 0.8922 -0.0062 0.2402  0.2826  177 SER B CA  
1811 C C   . SER B  118 ? 0.5976 0.5698 0.8223 -0.0479 0.1761  0.2517  177 SER B C   
1812 O O   . SER B  118 ? 0.5759 0.5323 0.7978 -0.0833 0.1651  0.2160  177 SER B O   
1813 C CB  . SER B  118 ? 0.7393 0.6080 0.9333 0.0041  0.2841  0.2850  177 SER B CB  
1814 O OG  . SER B  118 ? 0.7648 0.5939 0.9527 -0.0520 0.2863  0.2318  177 SER B OG  
1815 N N   . ILE B  119 ? 0.5554 0.5998 0.7913 -0.0405 0.1414  0.2688  178 ILE B N   
1816 C CA  . ILE B  119 ? 0.5028 0.5788 0.7398 -0.0731 0.0977  0.2464  178 ILE B CA  
1817 C C   . ILE B  119 ? 0.4990 0.5544 0.7366 -0.0877 0.1022  0.2262  178 ILE B C   
1818 O O   . ILE B  119 ? 0.5354 0.5675 0.7744 -0.0735 0.1344  0.2334  178 ILE B O   
1819 C CB  . ILE B  119 ? 0.4843 0.6397 0.7225 -0.0717 0.0753  0.2663  178 ILE B CB  
1820 C CG1 . ILE B  119 ? 0.4710 0.6517 0.7004 -0.0811 0.0587  0.2679  178 ILE B CG1 
1821 C CG2 . ILE B  119 ? 0.4673 0.6362 0.6986 -0.0989 0.0560  0.2496  178 ILE B CG2 
1822 C CD1 . ILE B  119 ? 0.4539 0.7412 0.6809 -0.0881 0.0460  0.2848  178 ILE B CD1 
1823 N N   . ASP B  120 ? 0.4718 0.5325 0.7024 -0.1107 0.0771  0.2040  179 ASP B N   
1824 C CA  . ASP B  120 ? 0.4681 0.5253 0.6985 -0.1225 0.0796  0.1856  179 ASP B CA  
1825 C C   . ASP B  120 ? 0.4410 0.5218 0.6700 -0.1228 0.0655  0.1950  179 ASP B C   
1826 O O   . ASP B  120 ? 0.4206 0.5212 0.6384 -0.1288 0.0490  0.2038  179 ASP B O   
1827 C CB  . ASP B  120 ? 0.4648 0.5334 0.6843 -0.1356 0.0678  0.1630  179 ASP B CB  
1828 C CG  . ASP B  120 ? 0.5153 0.5838 0.7376 -0.1531 0.0910  0.1382  179 ASP B CG  
1829 O OD1 . ASP B  120 ? 0.5694 0.5970 0.7937 -0.1542 0.1208  0.1398  179 ASP B OD1 
1830 O OD2 . ASP B  120 ? 0.5411 0.6581 0.7579 -0.1664 0.0856  0.1172  179 ASP B OD2 
1831 N N   . VAL B  121 ? 0.4450 0.5226 0.6801 -0.1241 0.0771  0.1884  180 VAL B N   
1832 C CA  . VAL B  121 ? 0.4302 0.5297 0.6625 -0.1284 0.0648  0.1927  180 VAL B CA  
1833 C C   . VAL B  121 ? 0.4293 0.5214 0.6382 -0.1393 0.0483  0.1808  180 VAL B C   
1834 O O   . VAL B  121 ? 0.4333 0.5260 0.6381 -0.1377 0.0500  0.1671  180 VAL B O   
1835 C CB  . VAL B  121 ? 0.4331 0.5254 0.6739 -0.1277 0.0820  0.1847  180 VAL B CB  
1836 C CG1 . VAL B  121 ? 0.4288 0.5452 0.6660 -0.1329 0.0681  0.1893  180 VAL B CG1 
1837 C CG2 . VAL B  121 ? 0.4648 0.5379 0.7138 -0.1074 0.1166  0.2002  180 VAL B CG2 
1838 N N   . GLY B  122 ? 0.4482 0.5376 0.6340 -0.1502 0.0403  0.1864  181 GLY B N   
1839 C CA  . GLY B  122 ? 0.4847 0.5376 0.6300 -0.1515 0.0427  0.1817  181 GLY B CA  
1840 C C   . GLY B  122 ? 0.5011 0.5488 0.6348 -0.1507 0.0481  0.1795  181 GLY B C   
1841 O O   . GLY B  122 ? 0.5087 0.5709 0.6483 -0.1674 0.0479  0.1796  181 GLY B O   
1842 N N   . LYS B  123 ? 0.5181 0.5617 0.6356 -0.1279 0.0537  0.1802  182 LYS B N   
1843 C CA  . LYS B  123 ? 0.5462 0.5805 0.6417 -0.1196 0.0636  0.1835  182 LYS B CA  
1844 C C   . LYS B  123 ? 0.6061 0.6008 0.6441 -0.0861 0.0864  0.1997  182 LYS B C   
1845 O O   . LYS B  123 ? 0.6088 0.6118 0.6365 -0.0628 0.0889  0.2077  182 LYS B O   
1846 C CB  . LYS B  123 ? 0.5085 0.6012 0.6411 -0.1155 0.0557  0.1742  182 LYS B CB  
1847 C CG  . LYS B  123 ? 0.4989 0.6514 0.6433 -0.1013 0.0534  0.1666  182 LYS B CG  
1848 C CD  . LYS B  123 ? 0.4861 0.6920 0.6616 -0.1189 0.0540  0.1450  182 LYS B CD  
1849 C CE  . LYS B  123 ? 0.4910 0.7717 0.6766 -0.1281 0.0567  0.1246  182 LYS B CE  
1850 N NZ  . LYS B  123 ? 0.4899 0.7409 0.6842 -0.1390 0.0578  0.1205  182 LYS B NZ  
1851 N N   . THR B  124 ? 0.6676 0.6132 0.6615 -0.0799 0.1102  0.2082  183 THR B N   
1852 C CA  . THR B  124 ? 0.7495 0.6476 0.6774 -0.0316 0.1467  0.2337  183 THR B CA  
1853 C C   . THR B  124 ? 0.7402 0.7271 0.6837 0.0123  0.1412  0.2474  183 THR B C   
1854 O O   . THR B  124 ? 0.7721 0.8093 0.6972 0.0650  0.1513  0.2704  183 THR B O   
1855 C CB  . THR B  124 ? 0.8467 0.6211 0.6984 -0.0489 0.1933  0.2362  183 THR B CB  
1856 O OG1 . THR B  124 ? 0.8301 0.6187 0.7014 -0.0797 0.1850  0.2229  183 THR B OG1 
1857 C CG2 . THR B  124 ? 0.8687 0.5774 0.6957 -0.1013 0.2042  0.2169  183 THR B CG2 
1858 N N   . SER B  125 ? 0.7096 0.7342 0.6869 -0.0083 0.1258  0.2340  184 SER B N   
1859 C CA  . SER B  125 ? 0.6978 0.8226 0.6908 0.0231  0.1201  0.2408  184 SER B CA  
1860 C C   . SER B  125 ? 0.6289 0.8564 0.6910 -0.0115 0.0871  0.2094  184 SER B C   
1861 O O   . SER B  125 ? 0.6054 0.8064 0.7036 -0.0556 0.0734  0.1870  184 SER B O   
1862 C CB  . SER B  125 ? 0.7302 0.8168 0.6973 0.0287  0.1382  0.2492  184 SER B CB  
1863 O OG  . SER B  125 ? 0.8305 0.7896 0.7214 0.0439  0.1830  0.2698  184 SER B OG  
1864 N N   . ALA B  126 ? 0.6252 0.9755 0.6966 0.0102  0.0832  0.2092  185 ALA B N   
1865 C CA  . ALA B  126 ? 0.5847 1.0368 0.6987 -0.0253 0.0697  0.1759  185 ALA B CA  
1866 C C   . ALA B  126 ? 0.5701 0.9851 0.6952 -0.0460 0.0699  0.1664  185 ALA B C   
1867 O O   . ALA B  126 ? 0.5449 0.9546 0.7038 -0.0912 0.0652  0.1359  185 ALA B O   
1868 C CB  . ALA B  126 ? 0.5910 1.2119 0.6955 0.0077  0.0725  0.1836  185 ALA B CB  
1869 N N   . GLU B  127 ? 0.6002 0.9843 0.6903 -0.0096 0.0828  0.1945  186 GLU B N   
1870 C CA  . GLU B  127 ? 0.5962 0.9788 0.6963 -0.0239 0.0827  0.1862  186 GLU B CA  
1871 C C   . GLU B  127 ? 0.5875 0.8631 0.6995 -0.0594 0.0804  0.1779  186 GLU B C   
1872 O O   . GLU B  127 ? 0.5935 0.7904 0.6934 -0.0685 0.0830  0.1842  186 GLU B O   
1873 C CB  . GLU B  127 ? 0.6453 1.0395 0.6982 0.0318  0.1038  0.2218  186 GLU B CB  
1874 C CG  . GLU B  127 ? 0.6728 1.2128 0.7111 0.0823  0.1092  0.2412  186 GLU B CG  
1875 C CD  . GLU B  127 ? 0.7715 1.2721 0.7384 0.1654  0.1476  0.2984  186 GLU B CD  
1876 O OE1 . GLU B  127 ? 0.8299 1.2141 0.7559 0.1846  0.1701  0.3186  186 GLU B OE1 
1877 O OE2 . GLU B  127 ? 0.8017 1.3821 0.7465 0.2134  0.1626  0.3242  186 GLU B OE2 
1878 N N   . ASN B  128 ? 0.5721 0.8638 0.7058 -0.0793 0.0772  0.1638  187 ASN B N   
1879 C CA  . ASN B  128 ? 0.5769 0.7992 0.7138 -0.0994 0.0786  0.1654  187 ASN B CA  
1880 C C   . ASN B  128 ? 0.6304 0.7799 0.7163 -0.0847 0.0968  0.1877  187 ASN B C   
1881 O O   . ASN B  128 ? 0.6713 0.8148 0.7135 -0.0453 0.1160  0.2088  187 ASN B O   
1882 C CB  . ASN B  128 ? 0.5603 0.8190 0.7188 -0.1111 0.0778  0.1523  187 ASN B CB  
1883 C CG  . ASN B  128 ? 0.5368 0.8195 0.7324 -0.1394 0.0777  0.1258  187 ASN B CG  
1884 O OD1 . ASN B  128 ? 0.5372 0.7854 0.7464 -0.1504 0.0785  0.1242  187 ASN B OD1 
1885 N ND2 . ASN B  128 ? 0.5564 0.8927 0.7609 -0.1520 0.0846  0.1047  187 ASN B ND2 
1886 N N   . LEU B  129 ? 0.6404 0.7386 0.7246 -0.1169 0.0986  0.1837  188 LEU B N   
1887 C CA  . LEU B  129 ? 0.7151 0.7352 0.7411 -0.1237 0.1270  0.1931  188 LEU B CA  
1888 C C   . LEU B  129 ? 0.7423 0.7618 0.7466 -0.1011 0.1427  0.2034  188 LEU B C   
1889 O O   . LEU B  129 ? 0.8164 0.7706 0.7558 -0.0731 0.1798  0.2229  188 LEU B O   
1890 C CB  . LEU B  129 ? 0.7187 0.7240 0.7498 -0.1768 0.1251  0.1791  188 LEU B CB  
1891 C CG  . LEU B  129 ? 0.7452 0.7230 0.7604 -0.1970 0.1284  0.1746  188 LEU B CG  
1892 C CD1 . LEU B  129 ? 0.7024 0.7340 0.7458 -0.2443 0.1140  0.1620  188 LEU B CD1 
1893 C CD2 . LEU B  129 ? 0.8660 0.7322 0.7930 -0.1993 0.1760  0.1792  188 LEU B CD2 
1894 N N   . TYR B  130 ? 0.6914 0.7771 0.7430 -0.1072 0.1217  0.1932  189 TYR B N   
1895 C CA  . TYR B  130 ? 0.7224 0.8184 0.7580 -0.0880 0.1335  0.2015  189 TYR B CA  
1896 C C   . TYR B  130 ? 0.7780 0.8879 0.7704 -0.0287 0.1549  0.2280  189 TYR B C   
1897 O O   . TYR B  130 ? 0.8568 0.9128 0.7923 0.0002  0.1902  0.2508  189 TYR B O   
1898 C CB  . TYR B  130 ? 0.6570 0.8306 0.7497 -0.1004 0.1097  0.1842  189 TYR B CB  
1899 C CG  . TYR B  130 ? 0.6883 0.8886 0.7692 -0.0813 0.1186  0.1908  189 TYR B CG  
1900 C CD1 . TYR B  130 ? 0.6831 0.9712 0.7695 -0.0523 0.1152  0.1918  189 TYR B CD1 
1901 C CD2 . TYR B  130 ? 0.7175 0.8712 0.7795 -0.0958 0.1318  0.1946  189 TYR B CD2 
1902 C CE1 . TYR B  130 ? 0.7059 1.0346 0.7810 -0.0322 0.1233  0.1997  189 TYR B CE1 
1903 C CE2 . TYR B  130 ? 0.7340 0.9106 0.7841 -0.0755 0.1411  0.2025  189 TYR B CE2 
1904 C CZ  . TYR B  130 ? 0.7285 0.9921 0.7858 -0.0407 0.1362  0.2067  189 TYR B CZ  
1905 O OH  . TYR B  130 ? 0.7540 1.0577 0.7998 -0.0182 0.1449  0.2159  189 TYR B OH  
1906 N N   . PHE B  131 ? 0.7548 0.9424 0.7691 -0.0078 0.1393  0.2276  190 PHE B N   
1907 C CA  . PHE B  131 ? 0.7895 1.0473 0.7735 0.0543  0.1542  0.2555  190 PHE B CA  
1908 C C   . PHE B  131 ? 0.8851 1.0565 0.7954 0.1044  0.1959  0.2934  190 PHE B C   
1909 O O   . PHE B  131 ? 0.9602 1.1434 0.8168 0.1729  0.2312  0.3336  190 PHE B O   
1910 C CB  . PHE B  131 ? 0.7256 1.1221 0.7586 0.0459  0.1251  0.2343  190 PHE B CB  
1911 C CG  . PHE B  131 ? 0.6757 1.1552 0.7579 0.0046  0.1046  0.1989  190 PHE B CG  
1912 C CD1 . PHE B  131 ? 0.6821 1.1998 0.7564 0.0189  0.1112  0.2056  190 PHE B CD1 
1913 C CD2 . PHE B  131 ? 0.6328 1.1428 0.7603 -0.0475 0.0878  0.1591  190 PHE B CD2 
1914 C CE1 . PHE B  131 ? 0.6376 1.2245 0.7501 -0.0224 0.0987  0.1701  190 PHE B CE1 
1915 C CE2 . PHE B  131 ? 0.6029 1.1663 0.7599 -0.0882 0.0850  0.1239  190 PHE B CE2 
1916 C CZ  . PHE B  131 ? 0.6003 1.2041 0.7506 -0.0775 0.0890  0.1281  190 PHE B CZ  
1917 N N   . GLN B  132 ? 0.9021 0.9847 0.8028 0.0752  0.1993  0.2839  191 GLN B N   
1918 C CA  . GLN B  132 ? 1.0099 0.9868 0.8314 0.1146  0.2484  0.3147  191 GLN B CA  
1919 C C   . GLN B  132 ? 1.1374 1.0053 0.8716 0.1533  0.3119  0.3466  191 GLN B C   
1920 O O   . GLN B  132 ? 1.2646 1.0034 0.9117 0.1835  0.3731  0.3722  191 GLN B O   
1921 C CB  . GLN B  132 ? 1.0189 0.8976 0.8367 0.0541  0.2479  0.2892  191 GLN B CB  
1922 C CG  . GLN B  132 ? 0.9395 0.8946 0.8158 0.0396  0.2055  0.2729  191 GLN B CG  
1923 C CD  . GLN B  132 ? 0.9375 0.8282 0.8246 -0.0245 0.1962  0.2458  191 GLN B CD  
1924 O OE1 . GLN B  132 ? 1.0374 0.8145 0.8626 -0.0491 0.2353  0.2439  191 GLN B OE1 
1925 N NE2 . GLN B  132 ? 0.8241 0.7899 0.7826 -0.0540 0.1518  0.2238  191 GLN B NE2 
1926 N N   . ASP C  6   ? 1.2727 1.0613 0.4077 -0.0648 0.1160  0.2268  65  ASP C N   
1927 C CA  . ASP C  6   ? 1.1457 0.9982 0.4200 -0.0849 0.1165  0.2238  65  ASP C CA  
1928 C C   . ASP C  6   ? 1.0675 0.9542 0.3878 -0.1024 0.0722  0.1902  65  ASP C C   
1929 O O   . ASP C  6   ? 1.0240 0.9230 0.3821 -0.1089 0.0883  0.1724  65  ASP C O   
1930 C CB  . ASP C  6   ? 1.1268 0.9842 0.4550 -0.0827 0.1772  0.2337  65  ASP C CB  
1931 N N   . LYS C  7   ? 1.0464 0.9473 0.3669 -0.1088 0.0193  0.1840  66  LYS C N   
1932 C CA  . LYS C  7   ? 0.9799 0.9125 0.3483 -0.1248 -0.0219 0.1571  66  LYS C CA  
1933 C C   . LYS C  7   ? 0.8796 0.8634 0.3472 -0.1356 -0.0408 0.1643  66  LYS C C   
1934 O O   . LYS C  7   ? 0.8913 0.8816 0.3625 -0.1326 -0.0614 0.1803  66  LYS C O   
1935 C CB  . LYS C  7   ? 1.0399 0.9450 0.3346 -0.1231 -0.0700 0.1400  66  LYS C CB  
1936 N N   . ILE C  8   ? 0.7938 0.8094 0.3367 -0.1458 -0.0337 0.1524  67  ILE C N   
1937 C CA  . ILE C  8   ? 0.7130 0.7687 0.3391 -0.1518 -0.0476 0.1577  67  ILE C CA  
1938 C C   . ILE C  8   ? 0.6695 0.7484 0.3283 -0.1617 -0.0818 0.1399  67  ILE C C   
1939 O O   . ILE C  8   ? 0.6803 0.7498 0.3183 -0.1675 -0.0900 0.1201  67  ILE C O   
1940 C CB  . ILE C  8   ? 0.6602 0.7314 0.3507 -0.1523 -0.0164 0.1602  67  ILE C CB  
1941 C CG1 . ILE C  8   ? 0.6424 0.7168 0.3493 -0.1579 -0.0080 0.1374  67  ILE C CG1 
1942 C CG2 . ILE C  8   ? 0.6946 0.7440 0.3665 -0.1438 0.0212  0.1791  67  ILE C CG2 
1943 C CD1 . ILE C  8   ? 0.6048 0.7015 0.3876 -0.1587 0.0008  0.1351  67  ILE C CD1 
1944 N N   . THR C  9   ? 0.6172 0.7247 0.3304 -0.1628 -0.0993 0.1482  68  THR C N   
1945 C CA  . THR C  9   ? 0.5804 0.7121 0.3355 -0.1703 -0.1260 0.1371  68  THR C CA  
1946 C C   . THR C  9   ? 0.5140 0.6659 0.3297 -0.1722 -0.1094 0.1298  68  THR C C   
1947 O O   . THR C  9   ? 0.4782 0.6357 0.3225 -0.1658 -0.0923 0.1381  68  THR C O   
1948 C CB  . THR C  9   ? 0.5791 0.7274 0.3551 -0.1672 -0.1554 0.1513  68  THR C CB  
1949 O OG1 . THR C  9   ? 0.6679 0.7968 0.3898 -0.1675 -0.1856 0.1492  68  THR C OG1 
1950 C CG2 . THR C  9   ? 0.5107 0.6919 0.3586 -0.1713 -0.1673 0.1472  68  THR C CG2 
1951 N N   . VAL C  10  ? 0.4930 0.6511 0.3256 -0.1798 -0.1159 0.1140  69  VAL C N   
1952 C CA  . VAL C  10  ? 0.4412 0.6120 0.3204 -0.1788 -0.1016 0.1080  69  VAL C CA  
1953 C C   . VAL C  10  ? 0.4217 0.6102 0.3383 -0.1846 -0.1183 0.1046  69  VAL C C   
1954 O O   . VAL C  10  ? 0.4564 0.6413 0.3614 -0.1941 -0.1380 0.0967  69  VAL C O   
1955 C CB  . VAL C  10  ? 0.4453 0.5987 0.3078 -0.1812 -0.0809 0.0925  69  VAL C CB  
1956 C CG1 . VAL C  10  ? 0.3946 0.5547 0.2970 -0.1753 -0.0670 0.0890  69  VAL C CG1 
1957 C CG2 . VAL C  10  ? 0.4696 0.6036 0.2950 -0.1770 -0.0623 0.0955  69  VAL C CG2 
1958 N N   . HIS C  11  ? 0.3799 0.5845 0.3422 -0.1775 -0.1105 0.1108  70  HIS C N   
1959 C CA  . HIS C  11  ? 0.3716 0.5938 0.3803 -0.1804 -0.1163 0.1117  70  HIS C CA  
1960 C C   . HIS C  11  ? 0.3565 0.5692 0.3741 -0.1788 -0.0938 0.1024  70  HIS C C   
1961 O O   . HIS C  11  ? 0.3403 0.5416 0.3482 -0.1675 -0.0761 0.1015  70  HIS C O   
1962 C CB  . HIS C  11  ? 0.3548 0.5958 0.4019 -0.1686 -0.1171 0.1276  70  HIS C CB  
1963 C CG  . HIS C  11  ? 0.4052 0.6536 0.4448 -0.1674 -0.1388 0.1390  70  HIS C CG  
1964 N ND1 . HIS C  11  ? 0.4402 0.7007 0.4925 -0.1756 -0.1677 0.1417  70  HIS C ND1 
1965 C CD2 . HIS C  11  ? 0.4188 0.6620 0.4417 -0.1582 -0.1377 0.1493  70  HIS C CD2 
1966 C CE1 . HIS C  11  ? 0.4544 0.7154 0.4918 -0.1698 -0.1828 0.1537  70  HIS C CE1 
1967 N NE2 . HIS C  11  ? 0.4465 0.6975 0.4672 -0.1598 -0.1628 0.1595  70  HIS C NE2 
1968 N N   . PHE C  12  ? 0.3657 0.5799 0.4021 -0.1898 -0.0972 0.0952  71  PHE C N   
1969 C CA  . PHE C  12  ? 0.3580 0.5622 0.4075 -0.1879 -0.0753 0.0899  71  PHE C CA  
1970 C C   . PHE C  12  ? 0.3475 0.5692 0.4555 -0.1858 -0.0683 0.1016  71  PHE C C   
1971 O O   . PHE C  12  ? 0.3499 0.5887 0.4963 -0.1979 -0.0866 0.1040  71  PHE C O   
1972 C CB  . PHE C  12  ? 0.3839 0.5732 0.4183 -0.2028 -0.0806 0.0741  71  PHE C CB  
1973 C CG  . PHE C  12  ? 0.4092 0.5768 0.3878 -0.2032 -0.0785 0.0620  71  PHE C CG  
1974 C CD1 . PHE C  12  ? 0.4350 0.5833 0.3967 -0.1985 -0.0582 0.0531  71  PHE C CD1 
1975 C CD2 . PHE C  12  ? 0.4613 0.6252 0.4042 -0.2067 -0.0951 0.0605  71  PHE C CD2 
1976 C CE1 . PHE C  12  ? 0.4738 0.6039 0.3933 -0.1981 -0.0530 0.0430  71  PHE C CE1 
1977 C CE2 . PHE C  12  ? 0.5068 0.6486 0.3994 -0.2050 -0.0861 0.0516  71  PHE C CE2 
1978 C CZ  . PHE C  12  ? 0.4883 0.6155 0.3743 -0.2012 -0.0642 0.0429  71  PHE C CZ  
1979 N N   . ILE C  13  ? 0.3418 0.5561 0.4565 -0.1689 -0.0421 0.1089  72  ILE C N   
1980 C CA  . ILE C  13  ? 0.3468 0.5710 0.5130 -0.1632 -0.0238 0.1223  72  ILE C CA  
1981 C C   . ILE C  13  ? 0.3715 0.5787 0.5434 -0.1696 -0.0066 0.1170  72  ILE C C   
1982 O O   . ILE C  13  ? 0.3939 0.5734 0.5258 -0.1587 0.0108  0.1112  72  ILE C O   
1983 C CB  . ILE C  13  ? 0.3462 0.5616 0.5035 -0.1370 -0.0020 0.1334  72  ILE C CB  
1984 C CG1 . ILE C  13  ? 0.3397 0.5701 0.4946 -0.1312 -0.0202 0.1387  72  ILE C CG1 
1985 C CG2 . ILE C  13  ? 0.3267 0.5469 0.5319 -0.1273 0.0262  0.1499  72  ILE C CG2 
1986 C CD1 . ILE C  13  ? 0.3312 0.5460 0.4679 -0.1044 -0.0046 0.1453  72  ILE C CD1 
1987 N N   . ASN C  14  ? 0.3782 0.6005 0.6031 -0.1874 -0.0149 0.1184  73  ASN C N   
1988 C CA  . ASN C  14  ? 0.3985 0.6053 0.6368 -0.1978 -0.0037 0.1129  73  ASN C CA  
1989 C C   . ASN C  14  ? 0.4019 0.5960 0.6605 -0.1812 0.0380  0.1295  73  ASN C C   
1990 O O   . ASN C  14  ? 0.3955 0.5961 0.6673 -0.1622 0.0576  0.1462  73  ASN C O   
1991 C CB  . ASN C  14  ? 0.4257 0.6536 0.7280 -0.2214 -0.0296 0.1108  73  ASN C CB  
1992 C CG  . ASN C  14  ? 0.4801 0.6874 0.7781 -0.2390 -0.0376 0.0944  73  ASN C CG  
1993 O OD1 . ASN C  14  ? 0.5252 0.7039 0.7747 -0.2331 -0.0195 0.0862  73  ASN C OD1 
1994 N ND2 . ASN C  14  ? 0.5177 0.7376 0.8698 -0.2601 -0.0682 0.0884  73  ASN C ND2 
1995 N N   . ARG C  15  ? 0.4153 0.5873 0.6736 -0.1868 0.0530  0.1256  74  ARG C N   
1996 C CA  . ARG C  15  ? 0.4349 0.5879 0.7094 -0.1715 0.0955  0.1433  74  ARG C CA  
1997 C C   . ARG C  15  ? 0.4433 0.6224 0.8019 -0.1705 0.1148  0.1673  74  ARG C C   
1998 O O   . ARG C  15  ? 0.4534 0.6178 0.8110 -0.1467 0.1555  0.1871  74  ARG C O   
1999 C CB  . ARG C  15  ? 0.4486 0.5764 0.7225 -0.1834 0.1036  0.1358  74  ARG C CB  
2000 C CG  . ARG C  15  ? 0.4446 0.5445 0.6401 -0.1798 0.0919  0.1147  74  ARG C CG  
2001 C CD  . ARG C  15  ? 0.4584 0.5242 0.6403 -0.1814 0.1086  0.1104  74  ARG C CD  
2002 N NE  . ARG C  15  ? 0.4586 0.5028 0.5720 -0.1766 0.0948  0.0898  74  ARG C NE  
2003 C CZ  . ARG C  15  ? 0.4510 0.4895 0.5522 -0.1940 0.0743  0.0693  74  ARG C CZ  
2004 N NH1 . ARG C  15  ? 0.4840 0.5319 0.6303 -0.2185 0.0595  0.0632  74  ARG C NH1 
2005 N NH2 . ARG C  15  ? 0.4353 0.4560 0.4808 -0.1856 0.0680  0.0542  74  ARG C NH2 
2006 N N   . ASP C  16  ? 0.4450 0.6593 0.8745 -0.1942 0.0853  0.1654  75  ASP C N   
2007 C CA  . ASP C  16  ? 0.4546 0.7022 0.9828 -0.1959 0.0964  0.1875  75  ASP C CA  
2008 C C   . ASP C  16  ? 0.4405 0.7041 0.9633 -0.1731 0.1057  0.2011  75  ASP C C   
2009 O O   . ASP C  16  ? 0.4377 0.7194 1.0305 -0.1641 0.1328  0.2239  75  ASP C O   
2010 C CB  . ASP C  16  ? 0.4591 0.7384 1.0583 -0.2260 0.0486  0.1772  75  ASP C CB  
2011 C CG  . ASP C  16  ? 0.5204 0.7883 1.1608 -0.2500 0.0404  0.1681  75  ASP C CG  
2012 O OD1 . ASP C  16  ? 0.5832 0.8339 1.2521 -0.2458 0.0826  0.1828  75  ASP C OD1 
2013 O OD2 . ASP C  16  ? 0.5867 0.8597 1.2310 -0.2722 -0.0093 0.1466  75  ASP C OD2 
2014 N N   . GLY C  17  ? 0.4290 0.6860 0.8753 -0.1643 0.0838  0.1874  76  GLY C N   
2015 C CA  . GLY C  17  ? 0.4221 0.6915 0.8601 -0.1442 0.0859  0.1971  76  GLY C CA  
2016 C C   . GLY C  17  ? 0.4057 0.7074 0.8653 -0.1596 0.0389  0.1896  76  GLY C C   
2017 O O   . GLY C  17  ? 0.3926 0.7094 0.8598 -0.1463 0.0356  0.1985  76  GLY C O   
2018 N N   . GLU C  18  ? 0.4087 0.7150 0.8698 -0.1853 0.0022  0.1727  77  GLU C N   
2019 C CA  . GLU C  18  ? 0.4090 0.7405 0.8937 -0.2010 -0.0452 0.1661  77  GLU C CA  
2020 C C   . GLU C  18  ? 0.4023 0.7157 0.7941 -0.2006 -0.0693 0.1490  77  GLU C C   
2021 O O   . GLU C  18  ? 0.4086 0.6945 0.7410 -0.2026 -0.0627 0.1351  77  GLU C O   
2022 C CB  . GLU C  18  ? 0.4337 0.7730 0.9773 -0.2274 -0.0704 0.1575  77  GLU C CB  
2023 C CG  . GLU C  18  ? 0.4801 0.8238 1.0081 -0.2450 -0.1287 0.1398  77  GLU C CG  
2024 C CD  . GLU C  18  ? 0.5350 0.8850 1.1349 -0.2695 -0.1598 0.1308  77  GLU C CD  
2025 O OE1 . GLU C  18  ? 0.5657 0.9143 1.2235 -0.2756 -0.1323 0.1372  77  GLU C OE1 
2026 O OE2 . GLU C  18  ? 0.5581 0.9104 1.1545 -0.2813 -0.2129 0.1173  77  GLU C OE2 
2027 N N   . THR C  19  ? 0.3886 0.7163 0.7710 -0.1972 -0.0952 0.1516  78  THR C N   
2028 C CA  . THR C  19  ? 0.3803 0.6901 0.6807 -0.1967 -0.1137 0.1393  78  THR C CA  
2029 C C   . THR C  19  ? 0.4023 0.7056 0.6813 -0.2159 -0.1527 0.1236  78  THR C C   
2030 O O   . THR C  19  ? 0.4265 0.7470 0.7473 -0.2249 -0.1855 0.1252  78  THR C O   
2031 C CB  . THR C  19  ? 0.3736 0.6941 0.6636 -0.1831 -0.1222 0.1502  78  THR C CB  
2032 O OG1 . THR C  19  ? 0.3513 0.6648 0.6341 -0.1615 -0.0882 0.1596  78  THR C OG1 
2033 C CG2 . THR C  19  ? 0.3890 0.6914 0.6048 -0.1859 -0.1422 0.1402  78  THR C CG2 
2034 N N   . LEU C  20  ? 0.4139 0.6889 0.6262 -0.2202 -0.1504 0.1075  79  LEU C N   
2035 C CA  . LEU C  20  ? 0.4535 0.7117 0.6207 -0.2325 -0.1846 0.0915  79  LEU C CA  
2036 C C   . LEU C  20  ? 0.4631 0.7077 0.5575 -0.2221 -0.1866 0.0929  79  LEU C C   
2037 O O   . LEU C  20  ? 0.4372 0.6720 0.5011 -0.2119 -0.1580 0.0948  79  LEU C O   
2038 C CB  . LEU C  20  ? 0.4671 0.6994 0.6087 -0.2424 -0.1769 0.0732  79  LEU C CB  
2039 C CG  . LEU C  20  ? 0.4713 0.7121 0.6862 -0.2537 -0.1716 0.0729  79  LEU C CG  
2040 C CD1 . LEU C  20  ? 0.4779 0.6895 0.6628 -0.2598 -0.1559 0.0571  79  LEU C CD1 
2041 C CD2 . LEU C  20  ? 0.5126 0.7662 0.7784 -0.2685 -0.2164 0.0689  79  LEU C CD2 
2042 N N   . THR C  21  ? 0.5004 0.7425 0.5705 -0.2239 -0.2211 0.0931  80  THR C N   
2043 C CA  . THR C  21  ? 0.5192 0.7445 0.5202 -0.2141 -0.2204 0.0976  80  THR C CA  
2044 C C   . THR C  21  ? 0.5792 0.7691 0.5049 -0.2190 -0.2373 0.0814  80  THR C C   
2045 O O   . THR C  21  ? 0.6060 0.7880 0.5310 -0.2274 -0.2734 0.0708  80  THR C O   
2046 C CB  . THR C  21  ? 0.5220 0.7641 0.5393 -0.2067 -0.2421 0.1144  80  THR C CB  
2047 O OG1 . THR C  21  ? 0.4706 0.7426 0.5574 -0.1998 -0.2249 0.1284  80  THR C OG1 
2048 C CG2 . THR C  21  ? 0.5491 0.7715 0.4998 -0.1960 -0.2332 0.1224  80  THR C CG2 
2049 N N   . THR C  22  ? 0.5979 0.7640 0.4622 -0.2124 -0.2110 0.0790  81  THR C N   
2050 C CA  . THR C  22  ? 0.6692 0.7960 0.4533 -0.2128 -0.2178 0.0647  81  THR C CA  
2051 C C   . THR C  22  ? 0.6943 0.8009 0.4165 -0.2002 -0.1918 0.0748  81  THR C C   
2052 O O   . THR C  22  ? 0.6614 0.7852 0.4081 -0.1933 -0.1747 0.0920  81  THR C O   
2053 C CB  . THR C  22  ? 0.6657 0.7787 0.4504 -0.2213 -0.2052 0.0447  81  THR C CB  
2054 O OG1 . THR C  22  ? 0.7411 0.8133 0.4517 -0.2220 -0.2229 0.0271  81  THR C OG1 
2055 C CG2 . THR C  22  ? 0.6215 0.7363 0.4111 -0.2155 -0.1605 0.0474  81  THR C CG2 
2056 N N   . LYS C  23  ? 0.7679 0.8351 0.4118 -0.1963 -0.1879 0.0646  82  LYS C N   
2057 C CA  . LYS C  23  ? 0.8096 0.8543 0.3967 -0.1836 -0.1580 0.0768  82  LYS C CA  
2058 C C   . LYS C  23  ? 0.8367 0.8534 0.3832 -0.1812 -0.1262 0.0633  82  LYS C C   
2059 O O   . LYS C  23  ? 0.8828 0.8730 0.3899 -0.1844 -0.1400 0.0426  82  LYS C O   
2060 C CB  . LYS C  23  ? 0.8906 0.9054 0.4034 -0.1737 -0.1819 0.0849  82  LYS C CB  
2061 C CG  . LYS C  23  ? 0.8923 0.9321 0.4401 -0.1705 -0.2000 0.1062  82  LYS C CG  
2062 C CD  . LYS C  23  ? 1.0088 1.0201 0.4918 -0.1630 -0.2424 0.1080  82  LYS C CD  
2063 C CE  . LYS C  23  ? 1.0175 1.0501 0.5310 -0.1574 -0.2596 0.1313  82  LYS C CE  
2064 N NZ  . LYS C  23  ? 1.0689 1.0733 0.5189 -0.1414 -0.2350 0.1548  82  LYS C NZ  
2065 N N   . GLY C  24  ? 0.8085 0.8301 0.3699 -0.1750 -0.0854 0.0745  83  GLY C N   
2066 C CA  . GLY C  24  ? 0.8321 0.8294 0.3634 -0.1700 -0.0500 0.0656  83  GLY C CA  
2067 C C   . GLY C  24  ? 0.8775 0.8531 0.3663 -0.1562 -0.0159 0.0843  83  GLY C C   
2068 O O   . GLY C  24  ? 0.8645 0.8521 0.3699 -0.1522 -0.0133 0.1060  83  GLY C O   
2069 N N   . LYS C  25  ? 0.9349 0.8769 0.3723 -0.1479 0.0135  0.0769  84  LYS C N   
2070 C CA  . LYS C  25  ? 0.9893 0.9080 0.3913 -0.1331 0.0568  0.0967  84  LYS C CA  
2071 C C   . LYS C  25  ? 0.9136 0.8647 0.4074 -0.1357 0.0892  0.1072  84  LYS C C   
2072 O O   . LYS C  25  ? 0.8647 0.8409 0.4194 -0.1448 0.0816  0.0930  84  LYS C O   
2073 C CB  . LYS C  25  ? 1.0839 0.9517 0.3967 -0.1208 0.0789  0.0839  84  LYS C CB  
2074 C CG  . LYS C  25  ? 1.1734 1.0057 0.4011 -0.1201 0.0342  0.0630  84  LYS C CG  
2075 C CD  . LYS C  25  ? 1.2445 1.0353 0.4117 -0.1144 0.0423  0.0363  84  LYS C CD  
2076 C CE  . LYS C  25  ? 1.3802 1.1012 0.4095 -0.0929 0.0419  0.0338  84  LYS C CE  
2077 N NZ  . LYS C  25  ? 1.4352 1.1117 0.3987 -0.0899 0.0239  0.0002  84  LYS C NZ  
2078 N N   . VAL C  26  ? 0.9197 0.8691 0.4285 -0.1273 0.1227  0.1322  85  VAL C N   
2079 C CA  . VAL C  26  ? 0.8477 0.8247 0.4508 -0.1296 0.1488  0.1393  85  VAL C CA  
2080 C C   . VAL C  26  ? 0.8517 0.8153 0.4534 -0.1257 0.1777  0.1237  85  VAL C C   
2081 O O   . VAL C  26  ? 0.9240 0.8495 0.4452 -0.1159 0.1959  0.1186  85  VAL C O   
2082 C CB  . VAL C  26  ? 0.8684 0.8447 0.4977 -0.1225 0.1794  0.1710  85  VAL C CB  
2083 C CG1 . VAL C  26  ? 0.8204 0.8157 0.5454 -0.1227 0.2118  0.1770  85  VAL C CG1 
2084 C CG2 . VAL C  26  ? 0.8365 0.8332 0.4901 -0.1279 0.1462  0.1838  85  VAL C CG2 
2085 N N   . GLY C  27  ? 0.7729 0.7634 0.4570 -0.1315 0.1781  0.1140  86  GLY C N   
2086 C CA  . GLY C  27  ? 0.7750 0.7556 0.4709 -0.1268 0.2051  0.1003  86  GLY C CA  
2087 C C   . GLY C  27  ? 0.7614 0.7371 0.4329 -0.1332 0.1791  0.0718  86  GLY C C   
2088 O O   . GLY C  27  ? 0.7502 0.7260 0.4515 -0.1316 0.1912  0.0583  86  GLY C O   
2089 N N   . ASP C  28  ? 0.7627 0.7333 0.3850 -0.1400 0.1432  0.0637  87  ASP C N   
2090 C CA  . ASP C  28  ? 0.7423 0.7134 0.3594 -0.1490 0.1145  0.0401  87  ASP C CA  
2091 C C   . ASP C  28  ? 0.6555 0.6611 0.3563 -0.1558 0.1001  0.0378  87  ASP C C   
2092 O O   . ASP C  28  ? 0.6206 0.6503 0.3677 -0.1565 0.0925  0.0523  87  ASP C O   
2093 C CB  . ASP C  28  ? 0.7694 0.7328 0.3353 -0.1558 0.0762  0.0356  87  ASP C CB  
2094 C CG  . ASP C  28  ? 0.8797 0.7972 0.3461 -0.1475 0.0787  0.0286  87  ASP C CG  
2095 O OD1 . ASP C  28  ? 0.9383 0.8262 0.3688 -0.1386 0.1063  0.0182  87  ASP C OD1 
2096 O OD2 . ASP C  28  ? 0.9306 0.8384 0.3518 -0.1481 0.0503  0.0326  87  ASP C OD2 
2097 N N   . SER C  29  ? 0.6261 0.6283 0.3396 -0.1587 0.0957  0.0194  88  SER C N   
2098 C CA  . SER C  29  ? 0.5580 0.5821 0.3299 -0.1623 0.0793  0.0157  88  SER C CA  
2099 C C   . SER C  29  ? 0.5465 0.5804 0.3101 -0.1719 0.0476  0.0145  88  SER C C   
2100 O O   . SER C  29  ? 0.5928 0.6156 0.3106 -0.1772 0.0343  0.0116  88  SER C O   
2101 C CB  . SER C  29  ? 0.5566 0.5674 0.3361 -0.1608 0.0868  -0.0019 88  SER C CB  
2102 O OG  . SER C  29  ? 0.5969 0.5888 0.3305 -0.1686 0.0734  -0.0168 88  SER C OG  
2103 N N   . LEU C  30  ? 0.4963 0.5484 0.3040 -0.1726 0.0345  0.0163  89  LEU C N   
2104 C CA  . LEU C  30  ? 0.4848 0.5472 0.2941 -0.1807 0.0105  0.0170  89  LEU C CA  
2105 C C   . LEU C  30  ? 0.4988 0.5456 0.2907 -0.1894 0.0030  0.0007  89  LEU C C   
2106 O O   . LEU C  30  ? 0.5059 0.5565 0.2930 -0.1986 -0.0176 -0.0002 89  LEU C O   
2107 C CB  . LEU C  30  ? 0.4427 0.5236 0.2974 -0.1754 0.0037  0.0253  89  LEU C CB  
2108 C CG  . LEU C  30  ? 0.4209 0.5178 0.2911 -0.1704 -0.0008 0.0416  89  LEU C CG  
2109 C CD1 . LEU C  30  ? 0.3789 0.4813 0.2867 -0.1595 -0.0022 0.0448  89  LEU C CD1 
2110 C CD2 . LEU C  30  ? 0.4198 0.5296 0.2828 -0.1771 -0.0201 0.0496  89  LEU C CD2 
2111 N N   . LEU C  31  ? 0.5032 0.5318 0.2906 -0.1865 0.0182  -0.0118 90  LEU C N   
2112 C CA  . LEU C  31  ? 0.5286 0.5359 0.2952 -0.1950 0.0116  -0.0287 90  LEU C CA  
2113 C C   . LEU C  31  ? 0.5933 0.5827 0.3052 -0.1995 0.0010  -0.0355 90  LEU C C   
2114 O O   . LEU C  31  ? 0.6096 0.5922 0.3115 -0.2101 -0.0235 -0.0436 90  LEU C O   
2115 C CB  . LEU C  31  ? 0.5254 0.5122 0.2906 -0.1887 0.0316  -0.0410 90  LEU C CB  
2116 C CG  . LEU C  31  ? 0.5619 0.5200 0.3022 -0.1960 0.0273  -0.0602 90  LEU C CG  
2117 C CD1 . LEU C  31  ? 0.5278 0.4908 0.2962 -0.2084 0.0074  -0.0611 90  LEU C CD1 
2118 C CD2 . LEU C  31  ? 0.5390 0.4777 0.2823 -0.1870 0.0491  -0.0705 90  LEU C CD2 
2119 N N   . ASP C  32  ? 0.6373 0.6162 0.3143 -0.1900 0.0191  -0.0315 91  ASP C N   
2120 C CA  . ASP C  32  ? 0.7211 0.6724 0.3280 -0.1886 0.0124  -0.0370 91  ASP C CA  
2121 C C   . ASP C  32  ? 0.7304 0.6916 0.3305 -0.1972 -0.0239 -0.0323 91  ASP C C   
2122 O O   . ASP C  32  ? 0.7749 0.7124 0.3357 -0.2029 -0.0506 -0.0468 91  ASP C O   
2123 C CB  . ASP C  32  ? 0.7510 0.6942 0.3298 -0.1748 0.0432  -0.0243 91  ASP C CB  
2124 C CG  . ASP C  32  ? 0.7978 0.7204 0.3687 -0.1648 0.0783  -0.0328 91  ASP C CG  
2125 O OD1 . ASP C  32  ? 0.8358 0.7414 0.4013 -0.1680 0.0745  -0.0520 91  ASP C OD1 
2126 O OD2 . ASP C  32  ? 0.8396 0.7627 0.4150 -0.1535 0.1109  -0.0195 91  ASP C OD2 
2127 N N   . VAL C  33  ? 0.6815 0.6757 0.3231 -0.1971 -0.0272 -0.0129 92  VAL C N   
2128 C CA  . VAL C  33  ? 0.6794 0.6894 0.3285 -0.2033 -0.0594 -0.0046 92  VAL C CA  
2129 C C   . VAL C  33  ? 0.6773 0.6935 0.3602 -0.2169 -0.0872 -0.0160 92  VAL C C   
2130 O O   . VAL C  33  ? 0.7316 0.7344 0.3903 -0.2231 -0.1192 -0.0247 92  VAL C O   
2131 C CB  . VAL C  33  ? 0.6172 0.6623 0.3173 -0.2001 -0.0551 0.0165  92  VAL C CB  
2132 C CG1 . VAL C  33  ? 0.6081 0.6725 0.3300 -0.2067 -0.0879 0.0237  92  VAL C CG1 
2133 C CG2 . VAL C  33  ? 0.6013 0.6418 0.2788 -0.1887 -0.0318 0.0311  92  VAL C CG2 
2134 N N   . VAL C  34  ? 0.6255 0.6587 0.3648 -0.2202 -0.0755 -0.0153 93  VAL C N   
2135 C CA  . VAL C  34  ? 0.6189 0.6586 0.4024 -0.2326 -0.0929 -0.0217 93  VAL C CA  
2136 C C   . VAL C  34  ? 0.6912 0.6981 0.4397 -0.2413 -0.1132 -0.0439 93  VAL C C   
2137 O O   . VAL C  34  ? 0.7138 0.7218 0.4806 -0.2524 -0.1464 -0.0491 93  VAL C O   
2138 C CB  . VAL C  34  ? 0.5788 0.6242 0.4045 -0.2304 -0.0681 -0.0201 93  VAL C CB  
2139 C CG1 . VAL C  34  ? 0.5652 0.6051 0.4277 -0.2436 -0.0795 -0.0285 93  VAL C CG1 
2140 C CG2 . VAL C  34  ? 0.5024 0.5756 0.3657 -0.2206 -0.0551 -0.0004 93  VAL C CG2 
2141 N N   . VAL C  35  ? 0.7369 0.7129 0.4381 -0.2351 -0.0943 -0.0575 94  VAL C N   
2142 C CA  . VAL C  35  ? 0.8145 0.7510 0.4750 -0.2403 -0.1100 -0.0816 94  VAL C CA  
2143 C C   . VAL C  35  ? 0.9076 0.8179 0.5015 -0.2382 -0.1413 -0.0904 94  VAL C C   
2144 O O   . VAL C  35  ? 0.9517 0.8456 0.5460 -0.2487 -0.1798 -0.1058 94  VAL C O   
2145 C CB  . VAL C  35  ? 0.8328 0.7414 0.4567 -0.2302 -0.0772 -0.0927 94  VAL C CB  
2146 C CG1 . VAL C  35  ? 0.8938 0.7529 0.4547 -0.2305 -0.0924 -0.1187 94  VAL C CG1 
2147 C CG2 . VAL C  35  ? 0.7767 0.7007 0.4619 -0.2324 -0.0559 -0.0888 94  VAL C CG2 
2148 N N   . GLU C  36  ? 0.9495 0.8529 0.4879 -0.2238 -0.1263 -0.0802 95  GLU C N   
2149 C CA  . GLU C  36  ? 1.0511 0.9193 0.5062 -0.2161 -0.1521 -0.0867 95  GLU C CA  
2150 C C   . GLU C  36  ? 1.0601 0.9452 0.5423 -0.2257 -0.2015 -0.0828 95  GLU C C   
2151 O O   . GLU C  36  ? 1.1397 0.9895 0.5689 -0.2251 -0.2419 -0.0988 95  GLU C O   
2152 C CB  . GLU C  36  ? 1.0811 0.9387 0.4769 -0.1974 -0.1183 -0.0706 95  GLU C CB  
2153 C CG  . GLU C  36  ? 1.1390 0.9652 0.4894 -0.1843 -0.0739 -0.0785 95  GLU C CG  
2154 C CD  . GLU C  36  ? 1.2430 1.0468 0.5241 -0.1644 -0.0419 -0.0632 95  GLU C CD  
2155 O OE1 . GLU C  36  ? 1.3599 1.1161 0.5450 -0.1524 -0.0559 -0.0702 95  GLU C OE1 
2156 O OE2 . GLU C  36  ? 1.2378 1.0683 0.5605 -0.1595 -0.0026 -0.0437 95  GLU C OE2 
2157 N N   . ASN C  37  ? 0.9897 0.9257 0.5549 -0.2331 -0.2003 -0.0628 96  ASN C N   
2158 C CA  . ASN C  37  ? 0.9910 0.9498 0.6000 -0.2418 -0.2440 -0.0567 96  ASN C CA  
2159 C C   . ASN C  37  ? 0.9626 0.9447 0.6657 -0.2606 -0.2647 -0.0629 96  ASN C C   
2160 O O   . ASN C  37  ? 0.9420 0.9555 0.7098 -0.2680 -0.2907 -0.0523 96  ASN C O   
2161 C CB  . ASN C  37  ? 0.9399 0.9361 0.5764 -0.2350 -0.2314 -0.0289 96  ASN C CB  
2162 C CG  . ASN C  37  ? 0.9790 0.9514 0.5313 -0.2177 -0.2134 -0.0193 96  ASN C CG  
2163 O OD1 . ASN C  37  ? 0.9369 0.9249 0.4995 -0.2103 -0.1749 -0.0034 96  ASN C OD1 
2164 N ND2 . ASN C  37  ? 1.0685 0.9990 0.5371 -0.2100 -0.2416 -0.0286 96  ASN C ND2 
2165 N N   . ASN C  38  ? 0.9668 0.9326 0.6817 -0.2676 -0.2518 -0.0785 97  ASN C N   
2166 C CA  . ASN C  38  ? 0.9515 0.9292 0.7507 -0.2858 -0.2712 -0.0853 97  ASN C CA  
2167 C C   . ASN C  38  ? 0.8784 0.9086 0.7778 -0.2918 -0.2641 -0.0611 97  ASN C C   
2168 O O   . ASN C  38  ? 0.8762 0.9233 0.8439 -0.3042 -0.2966 -0.0599 97  ASN C O   
2169 C CB  . ASN C  38  ? 1.0283 0.9776 0.8144 -0.2948 -0.3305 -0.1067 97  ASN C CB  
2170 C CG  . ASN C  38  ? 1.1261 1.0143 0.8108 -0.2875 -0.3396 -0.1343 97  ASN C CG  
2171 O OD1 . ASN C  38  ? 1.1873 1.0471 0.7737 -0.2703 -0.3349 -0.1361 97  ASN C OD1 
2172 N ND2 . ASN C  38  ? 1.1707 1.0343 0.8768 -0.2991 -0.3504 -0.1553 97  ASN C ND2 
2173 N N   . LEU C  39  ? 0.8239 0.8777 0.7332 -0.2816 -0.2221 -0.0419 98  LEU C N   
2174 C CA  . LEU C  39  ? 0.7664 0.8631 0.7588 -0.2825 -0.2093 -0.0190 98  LEU C CA  
2175 C C   . LEU C  39  ? 0.7471 0.8461 0.8055 -0.2925 -0.1928 -0.0193 98  LEU C C   
2176 O O   . LEU C  39  ? 0.7536 0.8303 0.7858 -0.2899 -0.1674 -0.0274 98  LEU C O   
2177 C CB  . LEU C  39  ? 0.7172 0.8290 0.6907 -0.2661 -0.1729 -0.0017 98  LEU C CB  
2178 C CG  . LEU C  39  ? 0.7453 0.8464 0.6456 -0.2551 -0.1773 -0.0007 98  LEU C CG  
2179 C CD1 . LEU C  39  ? 0.6867 0.8083 0.5948 -0.2415 -0.1474 0.0182  98  LEU C CD1 
2180 C CD2 . LEU C  39  ? 0.7728 0.8749 0.6620 -0.2583 -0.2211 -0.0010 98  LEU C CD2 
2181 N N   . ASP C  40  ? 0.7276 0.8522 0.8749 -0.3030 -0.2052 -0.0090 99  ASP C N   
2182 C CA  . ASP C  40  ? 0.7162 0.8400 0.9301 -0.3125 -0.1862 -0.0060 99  ASP C CA  
2183 C C   . ASP C  40  ? 0.6652 0.7991 0.8845 -0.2969 -0.1340 0.0142  99  ASP C C   
2184 O O   . ASP C  40  ? 0.6315 0.7945 0.8971 -0.2891 -0.1182 0.0362  99  ASP C O   
2185 C CB  . ASP C  40  ? 0.7248 0.8720 1.0445 -0.3291 -0.2130 0.0003  99  ASP C CB  
2186 C CG  . ASP C  40  ? 0.7503 0.8802 1.1274 -0.3455 -0.2108 -0.0074 99  ASP C CG  
2187 O OD1 . ASP C  40  ? 0.7595 0.8584 1.0909 -0.3430 -0.1873 -0.0171 99  ASP C OD1 
2188 O OD2 . ASP C  40  ? 0.7778 0.9247 1.2528 -0.3613 -0.2334 -0.0032 99  ASP C OD2 
2189 N N   . ILE C  41  ? 0.6606 0.7664 0.8255 -0.2897 -0.1099 0.0053  100 ILE C N   
2190 C CA  . ILE C  41  ? 0.6228 0.7263 0.7801 -0.2729 -0.0667 0.0197  100 ILE C CA  
2191 C C   . ILE C  41  ? 0.6399 0.7116 0.7919 -0.2773 -0.0517 0.0094  100 ILE C C   
2192 O O   . ILE C  41  ? 0.6684 0.7146 0.7639 -0.2769 -0.0569 -0.0095 100 ILE C O   
2193 C CB  . ILE C  41  ? 0.6051 0.7052 0.6918 -0.2555 -0.0577 0.0183  100 ILE C CB  
2194 C CG1 . ILE C  41  ? 0.5848 0.7115 0.6712 -0.2522 -0.0758 0.0270  100 ILE C CG1 
2195 C CG2 . ILE C  41  ? 0.5785 0.6711 0.6565 -0.2362 -0.0214 0.0304  100 ILE C CG2 
2196 C CD1 . ILE C  41  ? 0.5814 0.6996 0.5995 -0.2433 -0.0794 0.0199  100 ILE C CD1 
2197 N N   . ASP C  42  ? 0.6329 0.7040 0.8451 -0.2807 -0.0310 0.0231  101 ASP C N   
2198 C CA  . ASP C  42  ? 0.6540 0.6928 0.8701 -0.2876 -0.0202 0.0141  101 ASP C CA  
2199 C C   . ASP C  42  ? 0.6405 0.6514 0.7865 -0.2697 0.0032  0.0082  101 ASP C C   
2200 O O   . ASP C  42  ? 0.6288 0.6437 0.7510 -0.2495 0.0254  0.0216  101 ASP C O   
2201 C CB  . ASP C  42  ? 0.6580 0.7004 0.9564 -0.2924 0.0046  0.0358  101 ASP C CB  
2202 C CG  . ASP C  42  ? 0.6870 0.7563 1.0758 -0.3137 -0.0222 0.0394  101 ASP C CG  
2203 O OD1 . ASP C  42  ? 0.7046 0.7935 1.0861 -0.3200 -0.0599 0.0289  101 ASP C OD1 
2204 O OD2 . ASP C  42  ? 0.7022 0.7717 1.1726 -0.3235 -0.0059 0.0539  101 ASP C OD2 
2205 N N   . GLY C  43  ? 0.6507 0.6316 0.7645 -0.2759 -0.0049 -0.0131 102 GLY C N   
2206 C CA  . GLY C  43  ? 0.6377 0.5906 0.6994 -0.2600 0.0163  -0.0190 102 GLY C CA  
2207 C C   . GLY C  43  ? 0.6105 0.5667 0.6107 -0.2449 0.0151  -0.0267 102 GLY C C   
2208 O O   . GLY C  43  ? 0.6197 0.5531 0.5842 -0.2339 0.0270  -0.0354 102 GLY C O   
2209 N N   . PHE C  44  ? 0.5706 0.5541 0.5642 -0.2445 0.0010  -0.0229 103 PHE C N   
2210 C CA  . PHE C  44  ? 0.5388 0.5291 0.4898 -0.2293 0.0049  -0.0233 103 PHE C CA  
2211 C C   . PHE C  44  ? 0.5570 0.5261 0.4596 -0.2277 0.0029  -0.0434 103 PHE C C   
2212 O O   . PHE C  44  ? 0.5928 0.5565 0.4723 -0.2373 -0.0145 -0.0564 103 PHE C O   
2213 C CB  . PHE C  44  ? 0.5221 0.5433 0.4808 -0.2319 -0.0113 -0.0144 103 PHE C CB  
2214 C CG  . PHE C  44  ? 0.4666 0.4989 0.3987 -0.2165 -0.0056 -0.0086 103 PHE C CG  
2215 C CD1 . PHE C  44  ? 0.4259 0.4677 0.3722 -0.2013 0.0073  0.0070  103 PHE C CD1 
2216 C CD2 . PHE C  44  ? 0.4663 0.4963 0.3600 -0.2165 -0.0131 -0.0178 103 PHE C CD2 
2217 C CE1 . PHE C  44  ? 0.4141 0.4643 0.3438 -0.1883 0.0078  0.0113  103 PHE C CE1 
2218 C CE2 . PHE C  44  ? 0.4612 0.5019 0.3427 -0.2039 -0.0067 -0.0103 103 PHE C CE2 
2219 C CZ  . PHE C  44  ? 0.4123 0.4641 0.3155 -0.1910 0.0010  0.0032  103 PHE C CZ  
2220 N N   . GLY C  45  ? 0.5479 0.5018 0.4335 -0.2133 0.0210  -0.0458 104 GLY C N   
2221 C CA  . GLY C  45  ? 0.5596 0.4969 0.4070 -0.2084 0.0254  -0.0616 104 GLY C CA  
2222 C C   . GLY C  45  ? 0.5883 0.4922 0.4235 -0.2133 0.0287  -0.0791 104 GLY C C   
2223 O O   . GLY C  45  ? 0.6215 0.5087 0.4224 -0.2165 0.0244  -0.0953 104 GLY C O   
2224 N N   . ALA C  46  ? 0.5837 0.4735 0.4430 -0.2118 0.0378  -0.0750 105 ALA C N   
2225 C CA  . ALA C  46  ? 0.6143 0.4696 0.4674 -0.2150 0.0425  -0.0897 105 ALA C CA  
2226 C C   . ALA C  46  ? 0.6424 0.4779 0.4596 -0.2040 0.0525  -0.1061 105 ALA C C   
2227 O O   . ALA C  46  ? 0.6936 0.5040 0.4860 -0.2104 0.0478  -0.1251 105 ALA C O   
2228 C CB  . ALA C  46  ? 0.6064 0.4490 0.4854 -0.2082 0.0568  -0.0773 105 ALA C CB  
2229 N N   . CYS C  47  ? 0.6240 0.4688 0.4403 -0.1866 0.0655  -0.0999 106 CYS C N   
2230 C CA  . CYS C  47  ? 0.6537 0.4815 0.4508 -0.1749 0.0794  -0.1132 106 CYS C CA  
2231 C C   . CYS C  47  ? 0.6775 0.5110 0.4426 -0.1753 0.0822  -0.1205 106 CYS C C   
2232 O O   . CYS C  47  ? 0.6869 0.5093 0.4398 -0.1636 0.0998  -0.1281 106 CYS C O   
2233 C CB  . CYS C  47  ? 0.6242 0.4568 0.4437 -0.1553 0.0897  -0.1048 106 CYS C CB  
2234 S SG  . CYS C  47  ? 0.6162 0.4851 0.4523 -0.1468 0.0867  -0.0901 106 CYS C SG  
2235 N N   . GLU C  48  ? 0.6875 0.5362 0.4400 -0.1870 0.0665  -0.1164 107 GLU C N   
2236 C CA  . GLU C  48  ? 0.7265 0.5742 0.4373 -0.1867 0.0668  -0.1210 107 GLU C CA  
2237 C C   . GLU C  48  ? 0.7051 0.5714 0.4240 -0.1722 0.0876  -0.1096 107 GLU C C   
2238 O O   . GLU C  48  ? 0.7322 0.5874 0.4170 -0.1649 0.1034  -0.1134 107 GLU C O   
2239 C CB  . GLU C  48  ? 0.7988 0.6046 0.4596 -0.1869 0.0688  -0.1439 107 GLU C CB  
2240 C CG  . GLU C  48  ? 0.8456 0.6301 0.5076 -0.2029 0.0441  -0.1570 107 GLU C CG  
2241 C CD  . GLU C  48  ? 0.9474 0.6839 0.5528 -0.2020 0.0400  -0.1831 107 GLU C CD  
2242 O OE1 . GLU C  48  ? 0.9922 0.7014 0.6077 -0.2054 0.0386  -0.1964 107 GLU C OE1 
2243 O OE2 . GLU C  48  ? 1.0118 0.7331 0.5583 -0.1960 0.0385  -0.1901 107 GLU C OE2 
2244 N N   . GLY C  49  ? 0.6565 0.5473 0.4211 -0.1668 0.0877  -0.0953 108 GLY C N   
2245 C CA  . GLY C  49  ? 0.6336 0.5467 0.4207 -0.1561 0.0991  -0.0827 108 GLY C CA  
2246 C C   . GLY C  49  ? 0.6375 0.5412 0.4448 -0.1416 0.1215  -0.0875 108 GLY C C   
2247 O O   . GLY C  49  ? 0.6353 0.5464 0.4489 -0.1344 0.1397  -0.0821 108 GLY C O   
2248 N N   . THR C  50  ? 0.6402 0.5276 0.4626 -0.1365 0.1209  -0.0958 109 THR C N   
2249 C CA  . THR C  50  ? 0.6448 0.5238 0.4963 -0.1212 0.1383  -0.1007 109 THR C CA  
2250 C C   . THR C  50  ? 0.6077 0.4947 0.5057 -0.1104 0.1241  -0.0940 109 THR C C   
2251 O O   . THR C  50  ? 0.6201 0.4933 0.5414 -0.0980 0.1289  -0.1003 109 THR C O   
2252 C CB  . THR C  50  ? 0.6889 0.5323 0.5135 -0.1201 0.1485  -0.1186 109 THR C CB  
2253 O OG1 . THR C  50  ? 0.6957 0.5254 0.5108 -0.1291 0.1299  -0.1218 109 THR C OG1 
2254 C CG2 . THR C  50  ? 0.7307 0.5553 0.5003 -0.1247 0.1623  -0.1291 109 THR C CG2 
2255 N N   . LEU C  51  ? 0.5728 0.4782 0.4804 -0.1128 0.1054  -0.0820 110 LEU C N   
2256 C CA  . LEU C  51  ? 0.5453 0.4507 0.4819 -0.0995 0.0875  -0.0763 110 LEU C CA  
2257 C C   . LEU C  51  ? 0.5684 0.4437 0.4971 -0.0912 0.0852  -0.0836 110 LEU C C   
2258 O O   . LEU C  51  ? 0.5768 0.4405 0.5315 -0.0762 0.0849  -0.0888 110 LEU C O   
2259 C CB  . LEU C  51  ? 0.5254 0.4461 0.5138 -0.0868 0.0855  -0.0730 110 LEU C CB  
2260 C CG  . LEU C  51  ? 0.5024 0.4484 0.5101 -0.0887 0.0741  -0.0610 110 LEU C CG  
2261 C CD1 . LEU C  51  ? 0.4726 0.4284 0.5452 -0.0754 0.0674  -0.0597 110 LEU C CD1 
2262 C CD2 . LEU C  51  ? 0.4845 0.4272 0.4690 -0.0877 0.0519  -0.0547 110 LEU C CD2 
2263 N N   . ALA C  52  ? 0.5839 0.4457 0.4807 -0.1014 0.0841  -0.0831 111 ALA C N   
2264 C CA  . ALA C  52  ? 0.6032 0.4332 0.4896 -0.0955 0.0851  -0.0871 111 ALA C CA  
2265 C C   . ALA C  52  ? 0.6070 0.4286 0.4733 -0.1050 0.0820  -0.0784 111 ALA C C   
2266 O O   . ALA C  52  ? 0.6594 0.4538 0.5161 -0.1064 0.0878  -0.0809 111 ALA C O   
2267 C CB  . ALA C  52  ? 0.6267 0.4392 0.5063 -0.0997 0.1004  -0.1021 111 ALA C CB  
2268 N N   . CYS C  53  ? 0.5742 0.4178 0.4395 -0.1111 0.0751  -0.0674 112 CYS C N   
2269 C CA  . CYS C  53  ? 0.5822 0.4199 0.4396 -0.1164 0.0755  -0.0555 112 CYS C CA  
2270 C C   . CYS C  53  ? 0.5612 0.4169 0.4208 -0.1068 0.0663  -0.0425 112 CYS C C   
2271 O O   . CYS C  53  ? 0.5497 0.4196 0.4190 -0.0983 0.0573  -0.0449 112 CYS C O   
2272 C CB  . CYS C  53  ? 0.5915 0.4391 0.4491 -0.1414 0.0772  -0.0593 112 CYS C CB  
2273 S SG  . CYS C  53  ? 0.5853 0.4716 0.4437 -0.1550 0.0672  -0.0583 112 CYS C SG  
2274 N N   . SER C  54  ? 0.5568 0.4112 0.4118 -0.1070 0.0695  -0.0285 113 SER C N   
2275 C CA  . SER C  54  ? 0.5537 0.4258 0.4085 -0.0984 0.0610  -0.0183 113 SER C CA  
2276 C C   . SER C  54  ? 0.5424 0.4414 0.4102 -0.1162 0.0633  -0.0091 113 SER C C   
2277 O O   . SER C  54  ? 0.5372 0.4497 0.4063 -0.1098 0.0594  0.0013  113 SER C O   
2278 C CB  . SER C  54  ? 0.5815 0.4228 0.4132 -0.0713 0.0605  -0.0087 113 SER C CB  
2279 O OG  . SER C  54  ? 0.6341 0.4491 0.4570 -0.0544 0.0525  -0.0186 113 SER C OG  
2280 N N   . THR C  55  ? 0.4777 0.4422 0.3187 -0.0551 -0.0006 -0.0258 114 THR C N   
2281 C CA  . THR C  55  ? 0.4823 0.4439 0.3104 -0.0719 -0.0216 -0.0194 114 THR C CA  
2282 C C   . THR C  55  ? 0.4913 0.4660 0.3184 -0.0776 -0.0260 -0.0105 114 THR C C   
2283 O O   . THR C  55  ? 0.4978 0.4826 0.3317 -0.0894 -0.0445 0.0004  114 THR C O   
2284 C CB  . THR C  55  ? 0.5390 0.4562 0.3140 -0.0845 -0.0286 -0.0263 114 THR C CB  
2285 O OG1 . THR C  55  ? 0.5918 0.4766 0.3179 -0.0845 -0.0157 -0.0325 114 THR C OG1 
2286 C CG2 . THR C  55  ? 0.5197 0.4188 0.2922 -0.0777 -0.0219 -0.0356 114 THR C CG2 
2287 N N   . CYS C  56  ? 0.4921 0.4690 0.3158 -0.0690 -0.0091 -0.0122 115 CYS C N   
2288 C CA  . CYS C  56  ? 0.4945 0.4817 0.3151 -0.0741 -0.0118 -0.0034 115 CYS C CA  
2289 C C   . CYS C  56  ? 0.4394 0.4619 0.3067 -0.0680 -0.0125 0.0053  115 CYS C C   
2290 O O   . CYS C  56  ? 0.4325 0.4644 0.3028 -0.0684 -0.0096 0.0119  115 CYS C O   
2291 C CB  . CYS C  56  ? 0.5442 0.5110 0.3315 -0.0694 0.0083  -0.0077 115 CYS C CB  
2292 S SG  . CYS C  56  ? 0.5412 0.5236 0.3607 -0.0492 0.0370  -0.0097 115 CYS C SG  
2293 N N   . HIS C  57  ? 0.4011 0.4374 0.2992 -0.0627 -0.0159 0.0055  116 HIS C N   
2294 C CA  . HIS C  57  ? 0.3612 0.4186 0.2928 -0.0569 -0.0158 0.0119  116 HIS C CA  
2295 C C   . HIS C  57  ? 0.3668 0.4335 0.3027 -0.0628 -0.0246 0.0245  116 HIS C C   
2296 O O   . HIS C  57  ? 0.3862 0.4517 0.3161 -0.0712 -0.0369 0.0316  116 HIS C O   
2297 C CB  . HIS C  57  ? 0.3392 0.3989 0.2887 -0.0528 -0.0196 0.0104  116 HIS C CB  
2298 C CG  . HIS C  57  ? 0.2951 0.3640 0.2674 -0.0467 -0.0186 0.0155  116 HIS C CG  
2299 N ND1 . HIS C  57  ? 0.2807 0.3475 0.2638 -0.0426 -0.0203 0.0165  116 HIS C ND1 
2300 C CD2 . HIS C  57  ? 0.3252 0.3984 0.3048 -0.0446 -0.0155 0.0199  116 HIS C CD2 
2301 C CE1 . HIS C  57  ? 0.3150 0.3799 0.3056 -0.0377 -0.0173 0.0204  116 HIS C CE1 
2302 N NE2 . HIS C  57  ? 0.3510 0.4191 0.3396 -0.0397 -0.0156 0.0223  116 HIS C NE2 
2303 N N   . LEU C  58  ? 0.3528 0.4283 0.3004 -0.0593 -0.0196 0.0296  117 LEU C N   
2304 C CA  . LEU C  58  ? 0.3455 0.4289 0.3017 -0.0619 -0.0261 0.0434  117 LEU C CA  
2305 C C   . LEU C  58  ? 0.3241 0.4101 0.2981 -0.0544 -0.0202 0.0471  117 LEU C C   
2306 O O   . LEU C  58  ? 0.3269 0.4098 0.3027 -0.0517 -0.0140 0.0403  117 LEU C O   
2307 C CB  . LEU C  58  ? 0.3722 0.4528 0.3072 -0.0695 -0.0278 0.0478  117 LEU C CB  
2308 C CG  . LEU C  58  ? 0.3891 0.4588 0.2962 -0.0814 -0.0398 0.0497  117 LEU C CG  
2309 C CD1 . LEU C  58  ? 0.3775 0.4368 0.2541 -0.0881 -0.0382 0.0523  117 LEU C CD1 
2310 C CD2 . LEU C  58  ? 0.3758 0.4582 0.3041 -0.0861 -0.0557 0.0656  117 LEU C CD2 
2311 N N   . ILE C  59  ? 0.3172 0.4062 0.3033 -0.0516 -0.0221 0.0597  118 ILE C N   
2312 C CA  . ILE C  59  ? 0.3152 0.3952 0.3074 -0.0447 -0.0149 0.0635  118 ILE C CA  
2313 C C   . ILE C  59  ? 0.3205 0.4017 0.3110 -0.0467 -0.0145 0.0742  118 ILE C C   
2314 O O   . ILE C  59  ? 0.3351 0.4262 0.3307 -0.0490 -0.0199 0.0866  118 ILE C O   
2315 C CB  . ILE C  59  ? 0.3151 0.3896 0.3193 -0.0356 -0.0108 0.0712  118 ILE C CB  
2316 C CG1 . ILE C  59  ? 0.3115 0.3856 0.3171 -0.0346 -0.0120 0.0622  118 ILE C CG1 
2317 C CG2 . ILE C  59  ? 0.3237 0.3746 0.3202 -0.0282 -0.0013 0.0718  118 ILE C CG2 
2318 C CD1 . ILE C  59  ? 0.2986 0.3607 0.3109 -0.0240 -0.0033 0.0672  118 ILE C CD1 
2319 N N   . PHE C  60  ? 0.3266 0.3974 0.3111 -0.0472 -0.0099 0.0713  119 PHE C N   
2320 C CA  . PHE C  60  ? 0.3324 0.4027 0.3135 -0.0504 -0.0090 0.0803  119 PHE C CA  
2321 C C   . PHE C  60  ? 0.3531 0.4031 0.3338 -0.0438 -0.0033 0.0880  119 PHE C C   
2322 O O   . PHE C  60  ? 0.3621 0.3924 0.3381 -0.0381 0.0009  0.0834  119 PHE C O   
2323 C CB  . PHE C  60  ? 0.3351 0.4082 0.3100 -0.0578 -0.0074 0.0740  119 PHE C CB  
2324 C CG  . PHE C  60  ? 0.3265 0.4117 0.2945 -0.0617 -0.0072 0.0674  119 PHE C CG  
2325 C CD1 . PHE C  60  ? 0.3618 0.4509 0.3153 -0.0671 -0.0069 0.0723  119 PHE C CD1 
2326 C CD2 . PHE C  60  ? 0.3241 0.4108 0.2945 -0.0596 -0.0063 0.0566  119 PHE C CD2 
2327 C CE1 . PHE C  60  ? 0.3823 0.4705 0.3173 -0.0701 -0.0037 0.0652  119 PHE C CE1 
2328 C CE2 . PHE C  60  ? 0.3308 0.4201 0.2888 -0.0614 -0.0028 0.0502  119 PHE C CE2 
2329 C CZ  . PHE C  60  ? 0.3625 0.4495 0.2996 -0.0665 -0.0007 0.0540  119 PHE C CZ  
2330 N N   . GLU C  61  ? 0.3810 0.4306 0.3616 -0.0444 -0.0025 0.1000  120 GLU C N   
2331 C CA  . GLU C  61  ? 0.4156 0.4385 0.3901 -0.0379 0.0051  0.1077  120 GLU C CA  
2332 C C   . GLU C  61  ? 0.4282 0.4276 0.3858 -0.0457 0.0046  0.0989  120 GLU C C   
2333 O O   . GLU C  61  ? 0.4146 0.4277 0.3740 -0.0564 -0.0005 0.0948  120 GLU C O   
2334 C CB  . GLU C  61  ? 0.4365 0.4662 0.4173 -0.0367 0.0052  0.1250  120 GLU C CB  
2335 C CG  . GLU C  61  ? 0.4535 0.5058 0.4555 -0.0311 0.0018  0.1407  120 GLU C CG  
2336 C CD  . GLU C  61  ? 0.5012 0.5632 0.5095 -0.0331 -0.0026 0.1598  120 GLU C CD  
2337 O OE1 . GLU C  61  ? 0.5597 0.6090 0.5774 -0.0215 0.0065  0.1754  120 GLU C OE1 
2338 O OE2 . GLU C  61  ? 0.5143 0.5931 0.5153 -0.0454 -0.0141 0.1601  120 GLU C OE2 
2339 N N   . ASP C  62  ? 0.4595 0.4209 0.3995 -0.0406 0.0103  0.0984  121 ASP C N   
2340 C CA  . ASP C  62  ? 0.4862 0.4184 0.4057 -0.0514 0.0049  0.0914  121 ASP C CA  
2341 C C   . ASP C  62  ? 0.4741 0.4210 0.4008 -0.0657 -0.0023 0.0949  121 ASP C C   
2342 O O   . ASP C  62  ? 0.4659 0.4242 0.3999 -0.0774 -0.0107 0.0903  121 ASP C O   
2343 C CB  . ASP C  62  ? 0.5405 0.4191 0.4296 -0.0447 0.0139  0.0952  121 ASP C CB  
2344 C CG  . ASP C  62  ? 0.5937 0.4487 0.4706 -0.0288 0.0264  0.0937  121 ASP C CG  
2345 O OD1 . ASP C  62  ? 0.6918 0.5144 0.5546 -0.0149 0.0422  0.1029  121 ASP C OD1 
2346 O OD2 . ASP C  62  ? 0.6508 0.5169 0.5318 -0.0288 0.0228  0.0848  121 ASP C OD2 
2347 N N   . HIS C  63  ? 0.4814 0.4290 0.4093 -0.0640 0.0020  0.1060  122 HIS C N   
2348 C CA  . HIS C  63  ? 0.4756 0.4306 0.4070 -0.0768 -0.0021 0.1118  122 HIS C CA  
2349 C C   . HIS C  63  ? 0.4308 0.4284 0.3823 -0.0824 -0.0038 0.1106  122 HIS C C   
2350 O O   . HIS C  63  ? 0.4444 0.4517 0.4046 -0.0939 -0.0067 0.1123  122 HIS C O   
2351 C CB  . HIS C  63  ? 0.5020 0.4416 0.4260 -0.0728 0.0035  0.1250  122 HIS C CB  
2352 C CG  . HIS C  63  ? 0.5270 0.4902 0.4639 -0.0613 0.0084  0.1343  122 HIS C CG  
2353 N ND1 . HIS C  63  ? 0.5585 0.5164 0.4995 -0.0461 0.0147  0.1380  122 HIS C ND1 
2354 C CD2 . HIS C  63  ? 0.5161 0.5065 0.4620 -0.0643 0.0064  0.1435  122 HIS C CD2 
2355 C CE1 . HIS C  63  ? 0.5397 0.5250 0.4974 -0.0419 0.0132  0.1506  122 HIS C CE1 
2356 N NE2 . HIS C  63  ? 0.5032 0.5054 0.4595 -0.0534 0.0071  0.1530  122 HIS C NE2 
2357 N N   . ILE C  64  ? 0.3926 0.4130 0.3506 -0.0749 -0.0013 0.1090  123 ILE C N   
2358 C CA  . ILE C  64  ? 0.3750 0.4243 0.3404 -0.0789 -0.0001 0.1060  123 ILE C CA  
2359 C C   . ILE C  64  ? 0.3605 0.4184 0.3360 -0.0814 -0.0011 0.0960  123 ILE C C   
2360 O O   . ILE C  64  ? 0.3645 0.4395 0.3497 -0.0860 0.0031  0.0967  123 ILE C O   
2361 C CB  . ILE C  64  ? 0.3659 0.4285 0.3278 -0.0729 -0.0010 0.1060  123 ILE C CB  
2362 C CG1 . ILE C  64  ? 0.3878 0.4478 0.3451 -0.0711 -0.0026 0.1206  123 ILE C CG1 
2363 C CG2 . ILE C  64  ? 0.3623 0.4416 0.3190 -0.0768 0.0020  0.1004  123 ILE C CG2 
2364 C CD1 . ILE C  64  ? 0.3417 0.4041 0.2905 -0.0789 -0.0001 0.1290  123 ILE C CD1 
2365 N N   . TYR C  65  ? 0.3564 0.4018 0.3304 -0.0769 -0.0051 0.0884  124 TYR C N   
2366 C CA  . TYR C  65  ? 0.3428 0.3950 0.3265 -0.0784 -0.0082 0.0800  124 TYR C CA  
2367 C C   . TYR C  65  ? 0.3480 0.4021 0.3445 -0.0898 -0.0128 0.0850  124 TYR C C   
2368 O O   . TYR C  65  ? 0.3131 0.3900 0.3298 -0.0918 -0.0105 0.0859  124 TYR C O   
2369 C CB  . TYR C  65  ? 0.3421 0.3716 0.3153 -0.0731 -0.0122 0.0733  124 TYR C CB  
2370 C CG  . TYR C  65  ? 0.3296 0.3617 0.3102 -0.0757 -0.0181 0.0662  124 TYR C CG  
2371 C CD1 . TYR C  65  ? 0.2965 0.3495 0.2879 -0.0704 -0.0151 0.0597  124 TYR C CD1 
2372 C CD2 . TYR C  65  ? 0.3549 0.3641 0.3284 -0.0848 -0.0284 0.0671  124 TYR C CD2 
2373 C CE1 . TYR C  65  ? 0.3008 0.3562 0.3013 -0.0719 -0.0206 0.0553  124 TYR C CE1 
2374 C CE2 . TYR C  65  ? 0.3277 0.3395 0.3090 -0.0885 -0.0368 0.0636  124 TYR C CE2 
2375 C CZ  . TYR C  65  ? 0.3132 0.3498 0.3104 -0.0811 -0.0322 0.0582  124 TYR C CZ  
2376 O OH  . TYR C  65  ? 0.3283 0.3663 0.3346 -0.0843 -0.0412 0.0566  124 TYR C OH  
2377 N N   . GLU C  66  ? 0.3847 0.4127 0.3699 -0.0971 -0.0191 0.0905  125 GLU C N   
2378 C CA  . GLU C  66  ? 0.4131 0.4362 0.4084 -0.1124 -0.0295 0.0981  125 GLU C CA  
2379 C C   . GLU C  66  ? 0.4068 0.4643 0.4313 -0.1183 -0.0233 0.1095  125 GLU C C   
2380 O O   . GLU C  66  ? 0.4069 0.4796 0.4573 -0.1277 -0.0298 0.1173  125 GLU C O   
2381 C CB  . GLU C  66  ? 0.4546 0.4340 0.4222 -0.1199 -0.0365 0.1018  125 GLU C CB  
2382 C CG  . GLU C  66  ? 0.4893 0.4560 0.4617 -0.1406 -0.0526 0.1113  125 GLU C CG  
2383 C CD  . GLU C  66  ? 0.5662 0.4799 0.5017 -0.1489 -0.0586 0.1141  125 GLU C CD  
2384 O OE1 . GLU C  66  ? 0.6223 0.5042 0.5428 -0.1671 -0.0772 0.1173  125 GLU C OE1 
2385 O OE2 . GLU C  66  ? 0.5580 0.4589 0.4778 -0.1379 -0.0458 0.1143  125 GLU C OE2 
2386 N N   . LYS C  67  ? 0.4067 0.4761 0.4276 -0.1125 -0.0105 0.1127  126 LYS C N   
2387 C CA  . LYS C  67  ? 0.4085 0.5049 0.4510 -0.1166 0.0000  0.1246  126 LYS C CA  
2388 C C   . LYS C  67  ? 0.3935 0.5142 0.4413 -0.1051 0.0164  0.1200  126 LYS C C   
2389 O O   . LYS C  67  ? 0.3990 0.5337 0.4501 -0.1036 0.0317  0.1277  126 LYS C O   
2390 C CB  . LYS C  67  ? 0.4309 0.5184 0.4605 -0.1205 0.0043  0.1340  126 LYS C CB  
2391 C CG  . LYS C  67  ? 0.4808 0.5337 0.4954 -0.1304 -0.0086 0.1386  126 LYS C CG  
2392 C CD  . LYS C  67  ? 0.5448 0.5978 0.5792 -0.1490 -0.0170 0.1536  126 LYS C CD  
2393 C CE  . LYS C  67  ? 0.6155 0.6321 0.6269 -0.1580 -0.0233 0.1607  126 LYS C CE  
2394 N NZ  . LYS C  67  ? 0.6389 0.6054 0.6106 -0.1526 -0.0298 0.1501  126 LYS C NZ  
2395 N N   . LEU C  68  ? 0.3797 0.5006 0.4241 -0.0970 0.0149  0.1078  127 LEU C N   
2396 C CA  . LEU C  68  ? 0.3772 0.5123 0.4204 -0.0870 0.0308  0.1030  127 LEU C CA  
2397 C C   . LEU C  68  ? 0.3701 0.5288 0.4497 -0.0867 0.0409  0.1133  127 LEU C C   
2398 O O   . LEU C  68  ? 0.3605 0.5273 0.4693 -0.0954 0.0293  0.1225  127 LEU C O   
2399 C CB  . LEU C  68  ? 0.3673 0.4936 0.3954 -0.0790 0.0260  0.0877  127 LEU C CB  
2400 C CG  . LEU C  68  ? 0.3675 0.4774 0.3663 -0.0770 0.0195  0.0815  127 LEU C CG  
2401 C CD1 . LEU C  68  ? 0.2942 0.3979 0.2866 -0.0711 0.0130  0.0699  127 LEU C CD1 
2402 C CD2 . LEU C  68  ? 0.3629 0.4719 0.3377 -0.0765 0.0296  0.0843  127 LEU C CD2 
2403 N N   . ASP C  69  ? 0.3870 0.5539 0.4635 -0.0764 0.0626  0.1134  128 ASP C N   
2404 C CA  . ASP C  69  ? 0.3919 0.5834 0.5084 -0.0716 0.0785  0.1269  128 ASP C CA  
2405 C C   . ASP C  69  ? 0.3686 0.5702 0.5161 -0.0730 0.0628  0.1266  128 ASP C C   
2406 O O   . ASP C  69  ? 0.3639 0.5512 0.4919 -0.0694 0.0530  0.1108  128 ASP C O   
2407 C CB  . ASP C  69  ? 0.4179 0.6033 0.5125 -0.0562 0.1082  0.1231  128 ASP C CB  
2408 C CG  . ASP C  69  ? 0.4801 0.6552 0.5455 -0.0563 0.1264  0.1289  128 ASP C CG  
2409 O OD1 . ASP C  69  ? 0.5074 0.6831 0.5725 -0.0679 0.1145  0.1355  128 ASP C OD1 
2410 O OD2 . ASP C  69  ? 0.5386 0.7003 0.5770 -0.0445 0.1537  0.1274  128 ASP C OD2 
2411 N N   . ALA C  70  ? 0.3681 0.5944 0.5649 -0.0802 0.0581  0.1463  129 ALA C N   
2412 C CA  . ALA C  70  ? 0.3607 0.5945 0.5851 -0.0856 0.0376  0.1491  129 ALA C CA  
2413 C C   . ALA C  70  ? 0.3579 0.5915 0.5780 -0.0686 0.0500  0.1379  129 ALA C C   
2414 O O   . ALA C  70  ? 0.3759 0.6186 0.6018 -0.0539 0.0784  0.1418  129 ALA C O   
2415 C CB  . ALA C  70  ? 0.3535 0.6206 0.6399 -0.0958 0.0325  0.1783  129 ALA C CB  
2416 N N   . ILE C  71  ? 0.3453 0.5639 0.5509 -0.0700 0.0313  0.1244  130 ILE C N   
2417 C CA  . ILE C  71  ? 0.3365 0.5513 0.5349 -0.0549 0.0419  0.1132  130 ILE C CA  
2418 C C   . ILE C  71  ? 0.3429 0.5867 0.5931 -0.0461 0.0542  0.1315  130 ILE C C   
2419 O O   . ILE C  71  ? 0.3341 0.6003 0.6299 -0.0566 0.0377  0.1512  130 ILE C O   
2420 C CB  . ILE C  71  ? 0.3285 0.5226 0.5042 -0.0584 0.0202  0.0978  130 ILE C CB  
2421 C CG1 . ILE C  71  ? 0.3399 0.5227 0.4943 -0.0434 0.0334  0.0824  130 ILE C CG1 
2422 C CG2 . ILE C  71  ? 0.3012 0.5052 0.5096 -0.0689 -0.0022 0.1105  130 ILE C CG2 
2423 C CD1 . ILE C  71  ? 0.3233 0.4824 0.4470 -0.0456 0.0163  0.0656  130 ILE C CD1 
2424 N N   . THR C  72  ? 0.3547 0.5949 0.5962 -0.0272 0.0825  0.1265  131 THR C N   
2425 C CA  . THR C  72  ? 0.3601 0.6238 0.6490 -0.0132 0.1005  0.1439  131 THR C CA  
2426 C C   . THR C  72  ? 0.3521 0.6101 0.6440 -0.0099 0.0859  0.1361  131 THR C C   
2427 O O   . THR C  72  ? 0.3514 0.5833 0.6009 -0.0147 0.0702  0.1145  131 THR C O   
2428 C CB  . THR C  72  ? 0.3903 0.6412 0.6584 0.0079  0.1423  0.1414  131 THR C CB  
2429 O OG1 . THR C  72  ? 0.4051 0.6158 0.6103 0.0138  0.1448  0.1136  131 THR C OG1 
2430 C CG2 . THR C  72  ? 0.3881 0.6399 0.6455 0.0052  0.1589  0.1487  131 THR C CG2 
2431 N N   . ASP C  73  ? 0.3642 0.6474 0.7084 0.0000  0.0939  0.1558  132 ASP C N   
2432 C CA  . ASP C  73  ? 0.3635 0.6421 0.7136 0.0041  0.0809  0.1511  132 ASP C CA  
2433 C C   . ASP C  73  ? 0.3725 0.6158 0.6714 0.0199  0.0995  0.1263  132 ASP C C   
2434 O O   . ASP C  73  ? 0.3525 0.5784 0.6293 0.0170  0.0819  0.1115  132 ASP C O   
2435 C CB  . ASP C  73  ? 0.3689 0.6854 0.7928 0.0134  0.0883  0.1825  132 ASP C CB  
2436 C CG  . ASP C  73  ? 0.3891 0.7367 0.8642 -0.0087 0.0526  0.2075  132 ASP C CG  
2437 O OD1 . ASP C  73  ? 0.4111 0.7452 0.8585 -0.0306 0.0252  0.1988  132 ASP C OD1 
2438 O OD2 . ASP C  73  ? 0.4395 0.8226 0.9822 -0.0044 0.0518  0.2377  132 ASP C OD2 
2439 N N   . GLU C  74  ? 0.3991 0.6295 0.6783 0.0358  0.1355  0.1238  133 GLU C N   
2440 C CA  . GLU C  74  ? 0.4307 0.6191 0.6523 0.0488  0.1550  0.1014  133 GLU C CA  
2441 C C   . GLU C  74  ? 0.4178 0.5787 0.5821 0.0332  0.1317  0.0763  133 GLU C C   
2442 O O   . GLU C  74  ? 0.4183 0.5562 0.5533 0.0328  0.1215  0.0598  133 GLU C O   
2443 C CB  . GLU C  74  ? 0.4838 0.6553 0.6840 0.0650  0.1967  0.1047  133 GLU C CB  
2444 C CG  . GLU C  74  ? 0.5740 0.7100 0.7454 0.0871  0.2282  0.0972  133 GLU C CG  
2445 C CD  . GLU C  74  ? 0.6914 0.7842 0.8017 0.0983  0.2659  0.0894  133 GLU C CD  
2446 O OE1 . GLU C  74  ? 0.7067 0.8122 0.8228 0.0956  0.2772  0.1003  133 GLU C OE1 
2447 O OE2 . GLU C  74  ? 0.7769 0.8180 0.8282 0.1085  0.2832  0.0724  133 GLU C OE2 
2448 N N   . GLU C  75  ? 0.4042 0.5698 0.5578 0.0200  0.1222  0.0763  134 GLU C N   
2449 C CA  . GLU C  75  ? 0.3895 0.5355 0.5009 0.0060  0.0993  0.0582  134 GLU C CA  
2450 C C   . GLU C  75  ? 0.3580 0.5104 0.4845 -0.0028 0.0703  0.0556  134 GLU C C   
2451 O O   . GLU C  75  ? 0.3462 0.4781 0.4416 -0.0058 0.0589  0.0402  134 GLU C O   
2452 C CB  . GLU C  75  ? 0.3891 0.5395 0.4904 -0.0054 0.0941  0.0613  134 GLU C CB  
2453 C CG  . GLU C  75  ? 0.3776 0.5080 0.4388 -0.0167 0.0733  0.0455  134 GLU C CG  
2454 C CD  . GLU C  75  ? 0.3724 0.5034 0.4208 -0.0268 0.0678  0.0485  134 GLU C CD  
2455 O OE1 . GLU C  75  ? 0.3546 0.4949 0.4118 -0.0255 0.0830  0.0594  134 GLU C OE1 
2456 O OE2 . GLU C  75  ? 0.3494 0.4709 0.3799 -0.0348 0.0498  0.0412  134 GLU C OE2 
2457 N N   . ASN C  76  ? 0.3453 0.5236 0.5172 -0.0087 0.0574  0.0724  135 ASN C N   
2458 C CA  . ASN C  76  ? 0.3327 0.5084 0.5083 -0.0192 0.0289  0.0703  135 ASN C CA  
2459 C C   . ASN C  76  ? 0.3248 0.4889 0.4944 -0.0109 0.0274  0.0620  135 ASN C C   
2460 O O   . ASN C  76  ? 0.3268 0.4725 0.4701 -0.0160 0.0129  0.0497  135 ASN C O   
2461 C CB  . ASN C  76  ? 0.3276 0.5270 0.5468 -0.0307 0.0116  0.0915  135 ASN C CB  
2462 C CG  . ASN C  76  ? 0.3494 0.5317 0.5516 -0.0457 -0.0182 0.0871  135 ASN C CG  
2463 O OD1 . ASN C  76  ? 0.3890 0.5495 0.5548 -0.0528 -0.0253 0.0754  135 ASN C OD1 
2464 N ND2 . ASN C  76  ? 0.3815 0.5699 0.6069 -0.0497 -0.0350 0.0974  135 ASN C ND2 
2465 N N   . ASP C  77  ? 0.3354 0.5087 0.5290 0.0034  0.0454  0.0697  136 ASP C N   
2466 C CA  . ASP C  77  ? 0.3439 0.5039 0.5316 0.0127  0.0468  0.0627  136 ASP C CA  
2467 C C   . ASP C  77  ? 0.3509 0.4774 0.4839 0.0121  0.0471  0.0391  136 ASP C C   
2468 O O   . ASP C  77  ? 0.3455 0.4591 0.4665 0.0102  0.0341  0.0310  136 ASP C O   
2469 C CB  . ASP C  77  ? 0.3679 0.5359 0.5824 0.0323  0.0753  0.0741  136 ASP C CB  
2470 C CG  . ASP C  77  ? 0.3922 0.6001 0.6769 0.0342  0.0713  0.1041  136 ASP C CG  
2471 O OD1 . ASP C  77  ? 0.4188 0.6462 0.7271 0.0170  0.0446  0.1158  136 ASP C OD1 
2472 O OD2 . ASP C  77  ? 0.4146 0.6324 0.7309 0.0528  0.0953  0.1180  136 ASP C OD2 
2473 N N   . MET C  78  ? 0.3610 0.4731 0.4612 0.0121  0.0601  0.0301  137 MET C N   
2474 C CA  . MET C  78  ? 0.3677 0.4506 0.4201 0.0083  0.0570  0.0122  137 MET C CA  
2475 C C   . MET C  78  ? 0.3436 0.4266 0.3830 -0.0053 0.0365  0.0078  137 MET C C   
2476 O O   . MET C  78  ? 0.3535 0.4216 0.3718 -0.0093 0.0271  -0.0012 137 MET C O   
2477 C CB  . MET C  78  ? 0.4075 0.4678 0.4236 0.0129  0.0779  0.0059  137 MET C CB  
2478 C CG  . MET C  78  ? 0.4517 0.5019 0.4724 0.0302  0.1053  0.0100  137 MET C CG  
2479 S SD  . MET C  78  ? 0.5234 0.5402 0.5185 0.0365  0.1063  -0.0025 137 MET C SD  
2480 C CE  . MET C  78  ? 0.4769 0.5243 0.5264 0.0380  0.0879  0.0076  137 MET C CE  
2481 N N   . LEU C  79  ? 0.3271 0.4258 0.3803 -0.0121 0.0305  0.0158  138 LEU C N   
2482 C CA  . LEU C  79  ? 0.3206 0.4157 0.3628 -0.0223 0.0137  0.0135  138 LEU C CA  
2483 C C   . LEU C  79  ? 0.3252 0.4150 0.3728 -0.0241 -0.0011 0.0125  138 LEU C C   
2484 O O   . LEU C  79  ? 0.3231 0.4004 0.3529 -0.0274 -0.0086 0.0074  138 LEU C O   
2485 C CB  . LEU C  79  ? 0.3101 0.4180 0.3650 -0.0289 0.0109  0.0232  138 LEU C CB  
2486 C CG  . LEU C  79  ? 0.2924 0.3920 0.3345 -0.0374 -0.0021 0.0229  138 LEU C CG  
2487 C CD1 . LEU C  79  ? 0.2323 0.3208 0.2480 -0.0377 -0.0008 0.0159  138 LEU C CD1 
2488 C CD2 . LEU C  79  ? 0.2425 0.3527 0.2985 -0.0444 -0.0034 0.0339  138 LEU C CD2 
2489 N N   . ASP C  80  ? 0.3300 0.4288 0.4028 -0.0219 -0.0049 0.0199  139 ASP C N   
2490 C CA  . ASP C  80  ? 0.3412 0.4300 0.4130 -0.0242 -0.0195 0.0197  139 ASP C CA  
2491 C C   . ASP C  80  ? 0.3255 0.3985 0.3776 -0.0190 -0.0165 0.0088  139 ASP C C   
2492 O O   . ASP C  80  ? 0.3340 0.3940 0.3761 -0.0211 -0.0261 0.0071  139 ASP C O   
2493 C CB  . ASP C  80  ? 0.3575 0.4606 0.4625 -0.0220 -0.0243 0.0319  139 ASP C CB  
2494 C CG  . ASP C  80  ? 0.4227 0.5314 0.5427 -0.0347 -0.0436 0.0454  139 ASP C CG  
2495 O OD1 . ASP C  80  ? 0.5077 0.6041 0.6075 -0.0445 -0.0513 0.0435  139 ASP C OD1 
2496 O OD2 . ASP C  80  ? 0.4711 0.5953 0.6239 -0.0354 -0.0518 0.0599  139 ASP C OD2 
2497 N N   . LEU C  81  ? 0.3158 0.3863 0.3602 -0.0129 -0.0032 0.0026  140 LEU C N   
2498 C CA  . LEU C  81  ? 0.3094 0.3632 0.3354 -0.0107 -0.0024 -0.0061 140 LEU C CA  
2499 C C   . LEU C  81  ? 0.3118 0.3572 0.3150 -0.0175 -0.0052 -0.0111 140 LEU C C   
2500 O O   . LEU C  81  ? 0.3181 0.3514 0.3079 -0.0188 -0.0065 -0.0158 140 LEU C O   
2501 C CB  . LEU C  81  ? 0.3235 0.3697 0.3475 -0.0017 0.0118  -0.0094 140 LEU C CB  
2502 C CG  . LEU C  81  ? 0.3011 0.3562 0.3543 0.0078  0.0156  -0.0011 140 LEU C CG  
2503 C CD1 . LEU C  81  ? 0.2400 0.2818 0.2865 0.0195  0.0354  -0.0039 140 LEU C CD1 
2504 C CD2 . LEU C  81  ? 0.3027 0.3530 0.3606 0.0064  0.0013  0.0000  140 LEU C CD2 
2505 N N   . ALA C  82  ? 0.3086 0.3613 0.3109 -0.0225 -0.0077 -0.0073 141 ALA C N   
2506 C CA  . ALA C  82  ? 0.3024 0.3523 0.2917 -0.0282 -0.0112 -0.0068 141 ALA C CA  
2507 C C   . ALA C  82  ? 0.2981 0.3427 0.2894 -0.0279 -0.0169 -0.0038 141 ALA C C   
2508 O O   . ALA C  82  ? 0.3060 0.3465 0.3007 -0.0260 -0.0191 -0.0014 141 ALA C O   
2509 C CB  . ALA C  82  ? 0.2907 0.3495 0.2805 -0.0316 -0.0102 -0.0018 141 ALA C CB  
2510 N N   . TYR C  83  ? 0.3052 0.3476 0.2925 -0.0310 -0.0193 -0.0018 142 TYR C N   
2511 C CA  . TYR C  83  ? 0.2959 0.3342 0.2881 -0.0287 -0.0199 0.0041  142 TYR C CA  
2512 C C   . TYR C  83  ? 0.2895 0.3312 0.2854 -0.0274 -0.0171 0.0132  142 TYR C C   
2513 O O   . TYR C  83  ? 0.2892 0.3414 0.2886 -0.0316 -0.0189 0.0189  142 TYR C O   
2514 C CB  . TYR C  83  ? 0.3066 0.3449 0.3010 -0.0336 -0.0238 0.0072  142 TYR C CB  
2515 C CG  . TYR C  83  ? 0.3048 0.3421 0.3102 -0.0295 -0.0203 0.0175  142 TYR C CG  
2516 C CD1 . TYR C  83  ? 0.3076 0.3319 0.3090 -0.0239 -0.0167 0.0144  142 TYR C CD1 
2517 C CD2 . TYR C  83  ? 0.2776 0.3262 0.2980 -0.0297 -0.0182 0.0324  142 TYR C CD2 
2518 C CE1 . TYR C  83  ? 0.3135 0.3325 0.3205 -0.0186 -0.0092 0.0243  142 TYR C CE1 
2519 C CE2 . TYR C  83  ? 0.2944 0.3413 0.3269 -0.0227 -0.0092 0.0443  142 TYR C CE2 
2520 C CZ  . TYR C  83  ? 0.3189 0.3491 0.3420 -0.0169 -0.0035 0.0395  142 TYR C CZ  
2521 O OH  . TYR C  83  ? 0.3568 0.3801 0.3866 -0.0085 0.0093  0.0517  142 TYR C OH  
2522 N N   . GLY C  84  ? 0.3013 0.3292 0.2922 -0.0214 -0.0124 0.0154  143 GLY C N   
2523 C CA  . GLY C  84  ? 0.3076 0.3282 0.2945 -0.0178 -0.0064 0.0229  143 GLY C CA  
2524 C C   . GLY C  84  ? 0.3087 0.3310 0.2908 -0.0219 -0.0099 0.0199  143 GLY C C   
2525 O O   . GLY C  84  ? 0.3342 0.3619 0.3195 -0.0223 -0.0075 0.0264  143 GLY C O   
2526 N N   . LEU C  85  ? 0.3009 0.3211 0.2797 -0.0253 -0.0157 0.0127  144 LEU C N   
2527 C CA  . LEU C  85  ? 0.3062 0.3299 0.2855 -0.0303 -0.0189 0.0133  144 LEU C CA  
2528 C C   . LEU C  85  ? 0.3242 0.3264 0.2877 -0.0299 -0.0167 0.0184  144 LEU C C   
2529 O O   . LEU C  85  ? 0.3641 0.3386 0.3083 -0.0262 -0.0142 0.0186  144 LEU C O   
2530 C CB  . LEU C  85  ? 0.3051 0.3291 0.2890 -0.0338 -0.0264 0.0105  144 LEU C CB  
2531 C CG  . LEU C  85  ? 0.2997 0.3333 0.2934 -0.0404 -0.0305 0.0148  144 LEU C CG  
2532 C CD1 . LEU C  85  ? 0.2368 0.2920 0.2416 -0.0395 -0.0227 0.0150  144 LEU C CD1 
2533 C CD2 . LEU C  85  ? 0.2614 0.2997 0.2691 -0.0436 -0.0397 0.0172  144 LEU C CD2 
2534 N N   . THR C  86  ? 0.3085 0.3174 0.2749 -0.0331 -0.0159 0.0225  145 THR C N   
2535 C CA  . THR C  86  ? 0.3167 0.2990 0.2644 -0.0329 -0.0132 0.0273  145 THR C CA  
2536 C C   . THR C  86  ? 0.3168 0.2966 0.2625 -0.0433 -0.0220 0.0282  145 THR C C   
2537 O O   . THR C  86  ? 0.2941 0.2985 0.2593 -0.0490 -0.0273 0.0276  145 THR C O   
2538 C CB  . THR C  86  ? 0.3223 0.3104 0.2757 -0.0267 -0.0035 0.0361  145 THR C CB  
2539 O OG1 . THR C  86  ? 0.2909 0.3028 0.2575 -0.0330 -0.0073 0.0384  145 THR C OG1 
2540 C CG2 . THR C  86  ? 0.2638 0.2643 0.2310 -0.0185 0.0030  0.0410  145 THR C CG2 
2541 N N   . ASP C  87  ? 0.3396 0.2872 0.2616 -0.0454 -0.0215 0.0314  146 ASP C N   
2542 C CA  . ASP C  87  ? 0.3496 0.2912 0.2687 -0.0578 -0.0316 0.0347  146 ASP C CA  
2543 C C   . ASP C  87  ? 0.3348 0.2972 0.2690 -0.0574 -0.0254 0.0405  146 ASP C C   
2544 O O   . ASP C  87  ? 0.3477 0.3009 0.2771 -0.0662 -0.0303 0.0453  146 ASP C O   
2545 C CB  . ASP C  87  ? 0.3902 0.2771 0.2671 -0.0639 -0.0373 0.0347  146 ASP C CB  
2546 C CG  . ASP C  87  ? 0.4371 0.2883 0.2854 -0.0517 -0.0202 0.0364  146 ASP C CG  
2547 O OD1 . ASP C  87  ? 0.4865 0.2806 0.2881 -0.0525 -0.0189 0.0346  146 ASP C OD1 
2548 O OD2 . ASP C  87  ? 0.4271 0.3041 0.2977 -0.0411 -0.0075 0.0411  146 ASP C OD2 
2549 N N   . ARG C  88  ? 0.3156 0.3042 0.2661 -0.0489 -0.0167 0.0413  147 ARG C N   
2550 C CA  . ARG C  88  ? 0.3099 0.3193 0.2722 -0.0497 -0.0130 0.0475  147 ARG C CA  
2551 C C   . ARG C  88  ? 0.2942 0.3355 0.2728 -0.0489 -0.0120 0.0448  147 ARG C C   
2552 O O   . ARG C  88  ? 0.2877 0.3426 0.2692 -0.0491 -0.0097 0.0498  147 ARG C O   
2553 C CB  . ARG C  88  ? 0.3261 0.3218 0.2808 -0.0413 -0.0045 0.0557  147 ARG C CB  
2554 C CG  . ARG C  88  ? 0.3500 0.3022 0.2783 -0.0402 -0.0010 0.0583  147 ARG C CG  
2555 C CD  . ARG C  88  ? 0.3648 0.3125 0.2895 -0.0510 -0.0065 0.0623  147 ARG C CD  
2556 N NE  . ARG C  88  ? 0.3924 0.2908 0.2850 -0.0511 -0.0034 0.0649  147 ARG C NE  
2557 C CZ  . ARG C  88  ? 0.4177 0.2768 0.2807 -0.0597 -0.0116 0.0594  147 ARG C CZ  
2558 N NH1 . ARG C  88  ? 0.4268 0.2967 0.2960 -0.0692 -0.0249 0.0533  147 ARG C NH1 
2559 N NH2 . ARG C  88  ? 0.4853 0.2902 0.3094 -0.0597 -0.0075 0.0611  147 ARG C NH2 
2560 N N   . SER C  89  ? 0.2835 0.3315 0.2679 -0.0488 -0.0145 0.0374  148 SER C N   
2561 C CA  . SER C  89  ? 0.2744 0.3408 0.2652 -0.0473 -0.0122 0.0330  148 SER C CA  
2562 C C   . SER C  89  ? 0.2762 0.3573 0.2753 -0.0506 -0.0083 0.0326  148 SER C C   
2563 O O   . SER C  89  ? 0.2801 0.3642 0.2916 -0.0537 -0.0101 0.0353  148 SER C O   
2564 C CB  . SER C  89  ? 0.2730 0.3351 0.2646 -0.0431 -0.0139 0.0260  148 SER C CB  
2565 O OG  . SER C  89  ? 0.2735 0.3229 0.2594 -0.0381 -0.0134 0.0282  148 SER C OG  
2566 N N   . ARG C  90  ? 0.2801 0.3679 0.2711 -0.0503 -0.0027 0.0312  149 ARG C N   
2567 C CA  . ARG C  90  ? 0.2956 0.3911 0.2887 -0.0492 0.0075  0.0302  149 ARG C CA  
2568 C C   . ARG C  90  ? 0.3072 0.3940 0.2778 -0.0476 0.0115  0.0231  149 ARG C C   
2569 O O   . ARG C  90  ? 0.3108 0.3908 0.2685 -0.0507 0.0028  0.0219  149 ARG C O   
2570 C CB  . ARG C  90  ? 0.3101 0.4122 0.3036 -0.0529 0.0144  0.0386  149 ARG C CB  
2571 C CG  . ARG C  90  ? 0.3143 0.4215 0.3272 -0.0582 0.0091  0.0476  149 ARG C CG  
2572 C CD  . ARG C  90  ? 0.3236 0.4422 0.3642 -0.0585 0.0090  0.0518  149 ARG C CD  
2573 N NE  . ARG C  90  ? 0.3328 0.4669 0.3868 -0.0544 0.0255  0.0578  149 ARG C NE  
2574 C CZ  . ARG C  90  ? 0.3395 0.4860 0.4088 -0.0582 0.0328  0.0702  149 ARG C CZ  
2575 N NH1 . ARG C  90  ? 0.3568 0.5012 0.4295 -0.0686 0.0218  0.0775  149 ARG C NH1 
2576 N NH2 . ARG C  90  ? 0.3479 0.5060 0.4279 -0.0509 0.0534  0.0765  149 ARG C NH2 
2577 N N   . LEU C  91  ? 0.3184 0.4033 0.2842 -0.0432 0.0253  0.0206  150 LEU C N   
2578 C CA  . LEU C  91  ? 0.3483 0.4136 0.2815 -0.0424 0.0312  0.0130  150 LEU C CA  
2579 C C   . LEU C  91  ? 0.3731 0.4283 0.2763 -0.0483 0.0352  0.0167  150 LEU C C   
2580 O O   . LEU C  91  ? 0.3855 0.4442 0.2901 -0.0451 0.0502  0.0218  150 LEU C O   
2581 C CB  . LEU C  91  ? 0.3530 0.4136 0.2913 -0.0318 0.0480  0.0091  150 LEU C CB  
2582 C CG  . LEU C  91  ? 0.3165 0.3863 0.2830 -0.0276 0.0401  0.0071  150 LEU C CG  
2583 C CD1 . LEU C  91  ? 0.3115 0.3762 0.2853 -0.0158 0.0561  0.0053  150 LEU C CD1 
2584 C CD2 . LEU C  91  ? 0.2830 0.3433 0.2372 -0.0331 0.0240  0.0009  150 LEU C CD2 
2585 N N   . GLY C  92  ? 0.3921 0.4361 0.2708 -0.0577 0.0207  0.0166  151 GLY C N   
2586 C CA  . GLY C  92  ? 0.4329 0.4660 0.2806 -0.0662 0.0184  0.0223  151 GLY C CA  
2587 C C   . GLY C  92  ? 0.4822 0.4897 0.2891 -0.0641 0.0377  0.0186  151 GLY C C   
2588 O O   . GLY C  92  ? 0.5146 0.5141 0.2984 -0.0684 0.0423  0.0245  151 GLY C O   
2589 N N   . CYS C  93  ? 0.5078 0.5001 0.3054 -0.0557 0.0523  0.0097  152 CYS C N   
2590 C CA  . CYS C  93  ? 0.5811 0.5386 0.3313 -0.0511 0.0752  0.0055  152 CYS C CA  
2591 C C   . CYS C  93  ? 0.5765 0.5496 0.3516 -0.0378 0.1034  0.0135  152 CYS C C   
2592 O O   . CYS C  93  ? 0.6184 0.5638 0.3561 -0.0315 0.1282  0.0135  152 CYS C O   
2593 C CB  . CYS C  93  ? 0.6138 0.5379 0.3333 -0.0475 0.0805  -0.0068 152 CYS C CB  
2594 S SG  . CYS C  93  ? 0.6288 0.5721 0.3991 -0.0276 0.0990  -0.0091 152 CYS C SG  
2595 N N   . GLN C  94  ? 0.5315 0.5466 0.3684 -0.0344 0.0992  0.0220  153 GLN C N   
2596 C CA  . GLN C  94  ? 0.5213 0.5608 0.3955 -0.0263 0.1188  0.0350  153 GLN C CA  
2597 C C   . GLN C  94  ? 0.5006 0.5587 0.3883 -0.0367 0.1067  0.0450  153 GLN C C   
2598 O O   . GLN C  94  ? 0.4932 0.5710 0.4101 -0.0341 0.1191  0.0578  153 GLN C O   
2599 C CB  . GLN C  94  ? 0.4838 0.5541 0.4178 -0.0186 0.1183  0.0400  153 GLN C CB  
2600 C CG  . GLN C  94  ? 0.4944 0.5496 0.4232 -0.0067 0.1305  0.0324  153 GLN C CG  
2601 C CD  . GLN C  94  ? 0.5579 0.5878 0.4584 0.0070  0.1663  0.0345  153 GLN C CD  
2602 O OE1 . GLN C  94  ? 0.5756 0.6208 0.4969 0.0128  0.1863  0.0488  153 GLN C OE1 
2603 N NE2 . GLN C  94  ? 0.6037 0.5909 0.4535 0.0122  0.1760  0.0211  153 GLN C NE2 
2604 N N   . ILE C  95  ? 0.4989 0.5514 0.3689 -0.0481 0.0830  0.0418  154 ILE C N   
2605 C CA  . ILE C  95  ? 0.4874 0.5537 0.3687 -0.0563 0.0726  0.0522  154 ILE C CA  
2606 C C   . ILE C  95  ? 0.5375 0.5803 0.3693 -0.0629 0.0751  0.0546  154 ILE C C   
2607 O O   . ILE C  95  ? 0.5627 0.5856 0.3589 -0.0705 0.0601  0.0497  154 ILE C O   
2608 C CB  . ILE C  95  ? 0.4468 0.5237 0.3471 -0.0623 0.0475  0.0519  154 ILE C CB  
2609 C CG1 . ILE C  95  ? 0.4009 0.4933 0.3401 -0.0574 0.0436  0.0491  154 ILE C CG1 
2610 C CG2 . ILE C  95  ? 0.4277 0.5122 0.3352 -0.0686 0.0407  0.0632  154 ILE C CG2 
2611 C CD1 . ILE C  95  ? 0.3711 0.4829 0.3479 -0.0566 0.0502  0.0590  154 ILE C CD1 
2612 N N   . CYS C  96  ? 0.5622 0.6073 0.3925 -0.0613 0.0928  0.0643  155 CYS C N   
2613 C CA  . CYS C  96  ? 0.6209 0.6400 0.3994 -0.0672 0.0980  0.0680  155 CYS C CA  
2614 C C   . CYS C  96  ? 0.5977 0.6279 0.3831 -0.0771 0.0815  0.0794  155 CYS C C   
2615 O O   . CYS C  96  ? 0.5523 0.6091 0.3834 -0.0770 0.0783  0.0876  155 CYS C O   
2616 C CB  . CYS C  96  ? 0.6657 0.6739 0.4300 -0.0574 0.1332  0.0731  155 CYS C CB  
2617 S SG  . CYS C  96  ? 0.7756 0.7514 0.5072 -0.0436 0.1583  0.0600  155 CYS C SG  
2618 N N   . LEU C  97  ? 0.6307 0.6356 0.3662 -0.0868 0.0702  0.0806  156 LEU C N   
2619 C CA  . LEU C  97  ? 0.6280 0.6384 0.3626 -0.0961 0.0539  0.0934  156 LEU C CA  
2620 C C   . LEU C  97  ? 0.6345 0.6491 0.3718 -0.0949 0.0723  0.1052  156 LEU C C   
2621 O O   . LEU C  97  ? 0.6794 0.6732 0.3810 -0.0920 0.0959  0.1058  156 LEU C O   
2622 C CB  . LEU C  97  ? 0.6779 0.6584 0.3556 -0.1088 0.0351  0.0948  156 LEU C CB  
2623 C CG  . LEU C  97  ? 0.6640 0.6429 0.3420 -0.1149 0.0099  0.0896  156 LEU C CG  
2624 C CD1 . LEU C  97  ? 0.7054 0.6554 0.3283 -0.1318 -0.0123 0.0967  156 LEU C CD1 
2625 C CD2 . LEU C  97  ? 0.5915 0.6061 0.3307 -0.1116 -0.0048 0.0966  156 LEU C CD2 
2626 N N   . THR C  98  ? 0.5966 0.6346 0.3746 -0.0968 0.0629  0.1153  157 THR C N   
2627 C CA  . THR C  98  ? 0.5997 0.6429 0.3841 -0.0989 0.0739  0.1291  157 THR C CA  
2628 C C   . THR C  98  ? 0.6152 0.6522 0.3846 -0.1076 0.0533  0.1402  157 THR C C   
2629 O O   . THR C  98  ? 0.6105 0.6489 0.3833 -0.1102 0.0313  0.1396  157 THR C O   
2630 C CB  . THR C  98  ? 0.5549 0.6257 0.3988 -0.0958 0.0781  0.1336  157 THR C CB  
2631 O OG1 . THR C  98  ? 0.5134 0.5918 0.3822 -0.0977 0.0559  0.1325  157 THR C OG1 
2632 C CG2 . THR C  98  ? 0.4935 0.5759 0.3615 -0.0876 0.0944  0.1270  157 THR C CG2 
2633 N N   . LYS C  99  ? 0.6483 0.6797 0.4040 -0.1117 0.0610  0.1530  158 LYS C N   
2634 C CA  . LYS C  99  ? 0.6674 0.6938 0.4122 -0.1191 0.0418  0.1662  158 LYS C CA  
2635 C C   . LYS C  99  ? 0.6222 0.6672 0.4150 -0.1161 0.0257  0.1696  158 LYS C C   
2636 O O   . LYS C  99  ? 0.6170 0.6614 0.4096 -0.1183 0.0064  0.1778  158 LYS C O   
2637 C CB  . LYS C  99  ? 0.6994 0.7189 0.4293 -0.1230 0.0549  0.1806  158 LYS C CB  
2638 C CG  . LYS C  99  ? 0.7793 0.7720 0.4517 -0.1247 0.0749  0.1797  158 LYS C CG  
2639 C CD  . LYS C  99  ? 0.8400 0.8300 0.5068 -0.1270 0.0926  0.1958  158 LYS C CD  
2640 C CE  . LYS C  99  ? 0.9090 0.8663 0.5124 -0.1268 0.1179  0.1968  158 LYS C CE  
2641 N NZ  . LYS C  99  ? 0.9361 0.8972 0.5466 -0.1272 0.1394  0.2139  158 LYS C NZ  
2642 N N   . SER C  100 ? 0.5943 0.6532 0.4268 -0.1112 0.0341  0.1648  159 SER C N   
2643 C CA  . SER C  100 ? 0.5700 0.6346 0.4369 -0.1084 0.0234  0.1677  159 SER C CA  
2644 C C   . SER C  100 ? 0.5544 0.6217 0.4312 -0.1029 0.0100  0.1602  159 SER C C   
2645 O O   . SER C  100 ? 0.5387 0.6047 0.4373 -0.0981 0.0035  0.1638  159 SER C O   
2646 C CB  . SER C  100 ? 0.5567 0.6288 0.4544 -0.1084 0.0330  0.1642  159 SER C CB  
2647 O OG  . SER C  100 ? 0.5577 0.6385 0.4664 -0.1041 0.0363  0.1502  159 SER C OG  
2648 N N   . MET C  101 ? 0.5588 0.6262 0.4178 -0.1031 0.0081  0.1503  160 MET C N   
2649 C CA  . MET C  101 ? 0.5431 0.6149 0.4129 -0.0992 -0.0041 0.1444  160 MET C CA  
2650 C C   . MET C  101 ? 0.5518 0.6232 0.4133 -0.1029 -0.0227 0.1583  160 MET C C   
2651 O O   . MET C  101 ? 0.5404 0.6192 0.4187 -0.0998 -0.0335 0.1591  160 MET C O   
2652 C CB  . MET C  101 ? 0.5453 0.6152 0.4014 -0.0987 0.0012  0.1283  160 MET C CB  
2653 C CG  . MET C  101 ? 0.5463 0.6238 0.4265 -0.0931 0.0148  0.1179  160 MET C CG  
2654 S SD  . MET C  101 ? 0.5928 0.6666 0.4584 -0.0897 0.0242  0.1015  160 MET C SD  
2655 C CE  . MET C  101 ? 0.5764 0.6652 0.4783 -0.0848 0.0412  0.1003  160 MET C CE  
2656 N N   . ASP C  102 ? 0.5737 0.6379 0.4121 -0.1100 -0.0269 0.1716  161 ASP C N   
2657 C CA  . ASP C  102 ? 0.5863 0.6515 0.4174 -0.1164 -0.0480 0.1896  161 ASP C CA  
2658 C C   . ASP C  102 ? 0.5475 0.6286 0.4245 -0.1069 -0.0560 0.2014  161 ASP C C   
2659 O O   . ASP C  102 ? 0.5307 0.6121 0.4329 -0.0967 -0.0450 0.2042  161 ASP C O   
2660 C CB  . ASP C  102 ? 0.6181 0.6745 0.4289 -0.1224 -0.0489 0.2057  161 ASP C CB  
2661 C CG  . ASP C  102 ? 0.6639 0.7158 0.4506 -0.1347 -0.0736 0.2243  161 ASP C CG  
2662 O OD1 . ASP C  102 ? 0.6994 0.7497 0.4728 -0.1427 -0.0903 0.2227  161 ASP C OD1 
2663 O OD2 . ASP C  102 ? 0.7322 0.7804 0.5115 -0.1383 -0.0784 0.2423  161 ASP C OD2 
2664 N N   . ASN C  103 ? 0.5361 0.6270 0.4215 -0.1105 -0.0739 0.2094  162 ASN C N   
2665 C CA  . ASN C  103 ? 0.5049 0.6135 0.4377 -0.1001 -0.0795 0.2258  162 ASN C CA  
2666 C C   . ASN C  103 ? 0.4681 0.5792 0.4285 -0.0857 -0.0642 0.2118  162 ASN C C   
2667 O O   . ASN C  103 ? 0.4582 0.5771 0.4547 -0.0728 -0.0603 0.2255  162 ASN C O   
2668 C CB  . ASN C  103 ? 0.5097 0.6209 0.4628 -0.0932 -0.0784 0.2495  162 ASN C CB  
2669 C CG  . ASN C  103 ? 0.5341 0.6466 0.4672 -0.1075 -0.0990 0.2703  162 ASN C CG  
2670 O OD1 . ASN C  103 ? 0.5317 0.6562 0.4696 -0.1175 -0.1222 0.2858  162 ASN C OD1 
2671 N ND2 . ASN C  103 ? 0.5314 0.6304 0.4416 -0.1102 -0.0927 0.2728  162 ASN C ND2 
2672 N N   . MET C  104 ? 0.4534 0.5560 0.3963 -0.0869 -0.0543 0.1867  163 MET C N   
2673 C CA  . MET C  104 ? 0.4270 0.5290 0.3895 -0.0760 -0.0432 0.1732  163 MET C CA  
2674 C C   . MET C  104 ? 0.4186 0.5330 0.3950 -0.0767 -0.0539 0.1753  163 MET C C   
2675 O O   . MET C  104 ? 0.4348 0.5552 0.3992 -0.0890 -0.0714 0.1825  163 MET C O   
2676 C CB  . MET C  104 ? 0.4202 0.5128 0.3647 -0.0780 -0.0319 0.1497  163 MET C CB  
2677 C CG  . MET C  104 ? 0.4240 0.5164 0.3444 -0.0866 -0.0363 0.1363  163 MET C CG  
2678 S SD  . MET C  104 ? 0.3992 0.4857 0.3115 -0.0846 -0.0196 0.1143  163 MET C SD  
2679 C CE  . MET C  104 ? 0.4342 0.5133 0.3161 -0.0910 -0.0235 0.1029  163 MET C CE  
2680 N N   . THR C  105 ? 0.3976 0.5114 0.3942 -0.0654 -0.0441 0.1683  164 THR C N   
2681 C CA  . THR C  105 ? 0.3778 0.5036 0.3933 -0.0640 -0.0506 0.1714  164 THR C CA  
2682 C C   . THR C  105 ? 0.3585 0.4751 0.3630 -0.0622 -0.0424 0.1471  164 THR C C   
2683 O O   . THR C  105 ? 0.3537 0.4571 0.3546 -0.0551 -0.0291 0.1360  164 THR C O   
2684 C CB  . THR C  105 ? 0.3750 0.5060 0.4275 -0.0479 -0.0414 0.1899  164 THR C CB  
2685 O OG1 . THR C  105 ? 0.3882 0.5326 0.4593 -0.0486 -0.0502 0.2177  164 THR C OG1 
2686 C CG2 . THR C  105 ? 0.3733 0.5163 0.4495 -0.0440 -0.0427 0.1930  164 THR C CG2 
2687 N N   . VAL C  106 ? 0.3566 0.4779 0.3545 -0.0699 -0.0521 0.1400  165 VAL C N   
2688 C CA  . VAL C  106 ? 0.3355 0.4501 0.3293 -0.0664 -0.0447 0.1202  165 VAL C CA  
2689 C C   . VAL C  106 ? 0.3324 0.4577 0.3484 -0.0651 -0.0514 0.1283  165 VAL C C   
2690 O O   . VAL C  106 ? 0.3403 0.4792 0.3685 -0.0728 -0.0664 0.1469  165 VAL C O   
2691 C CB  . VAL C  106 ? 0.3391 0.4445 0.3005 -0.0763 -0.0472 0.1035  165 VAL C CB  
2692 C CG1 . VAL C  106 ? 0.3455 0.4430 0.2919 -0.0755 -0.0361 0.0960  165 VAL C CG1 
2693 C CG2 . VAL C  106 ? 0.3422 0.4471 0.2846 -0.0908 -0.0651 0.1121  165 VAL C CG2 
2694 N N   . ARG C  107 ? 0.3224 0.4426 0.3451 -0.0571 -0.0421 0.1168  166 ARG C N   
2695 C CA  . ARG C  107 ? 0.3298 0.4601 0.3732 -0.0568 -0.0474 0.1242  166 ARG C CA  
2696 C C   . ARG C  107 ? 0.3262 0.4490 0.3512 -0.0641 -0.0523 0.1059  166 ARG C C   
2697 O O   . ARG C  107 ? 0.3169 0.4265 0.3233 -0.0613 -0.0438 0.0865  166 ARG C O   
2698 C CB  . ARG C  107 ? 0.3236 0.4528 0.3932 -0.0396 -0.0312 0.1329  166 ARG C CB  
2699 C CG  . ARG C  107 ? 0.3404 0.4820 0.4343 -0.0391 -0.0343 0.1422  166 ARG C CG  
2700 C CD  . ARG C  107 ? 0.3904 0.5328 0.5140 -0.0206 -0.0155 0.1598  166 ARG C CD  
2701 N NE  . ARG C  107 ? 0.4346 0.5462 0.5336 -0.0082 0.0034  0.1419  166 ARG C NE  
2702 C CZ  . ARG C  107 ? 0.4783 0.5758 0.5643 -0.0057 0.0088  0.1268  166 ARG C CZ  
2703 N NH1 . ARG C  107 ? 0.5295 0.5953 0.5884 0.0023  0.0218  0.1127  166 ARG C NH1 
2704 N NH2 . ARG C  107 ? 0.4666 0.5782 0.5638 -0.0129 -0.0004 0.1265  166 ARG C NH2 
2705 N N   . VAL C  108 ? 0.3389 0.4700 0.3709 -0.0744 -0.0674 0.1147  167 VAL C N   
2706 C CA  . VAL C  108 ? 0.3442 0.4637 0.3580 -0.0808 -0.0715 0.0989  167 VAL C CA  
2707 C C   . VAL C  108 ? 0.3257 0.4509 0.3669 -0.0701 -0.0625 0.1012  167 VAL C C   
2708 O O   . VAL C  108 ? 0.3195 0.4622 0.3944 -0.0692 -0.0663 0.1227  167 VAL C O   
2709 C CB  . VAL C  108 ? 0.3715 0.4872 0.3685 -0.1011 -0.0947 0.1054  167 VAL C CB  
2710 C CG1 . VAL C  108 ? 0.3741 0.4666 0.3406 -0.1052 -0.0935 0.0837  167 VAL C CG1 
2711 C CG2 . VAL C  108 ? 0.3631 0.4723 0.3328 -0.1135 -0.1067 0.1113  167 VAL C CG2 
2712 N N   . PRO C  109 ? 0.3167 0.4279 0.3454 -0.0619 -0.0502 0.0818  168 PRO C N   
2713 C CA  . PRO C  109 ? 0.3135 0.4246 0.3606 -0.0520 -0.0411 0.0835  168 PRO C CA  
2714 C C   . PRO C  109 ? 0.3187 0.4308 0.3681 -0.0610 -0.0515 0.0836  168 PRO C C   
2715 O O   . PRO C  109 ? 0.3187 0.4217 0.3443 -0.0739 -0.0637 0.0745  168 PRO C O   
2716 C CB  . PRO C  109 ? 0.3077 0.4012 0.3367 -0.0431 -0.0288 0.0641  168 PRO C CB  
2717 C CG  . PRO C  109 ? 0.3141 0.4023 0.3195 -0.0508 -0.0335 0.0507  168 PRO C CG  
2718 C CD  . PRO C  109 ? 0.3261 0.4215 0.3257 -0.0620 -0.0450 0.0605  168 PRO C CD  
2719 N N   . GLU C  110 ? 0.3293 0.4472 0.4032 -0.0533 -0.0444 0.0934  169 GLU C N   
2720 C CA  . GLU C  110 ? 0.3384 0.4576 0.4191 -0.0617 -0.0533 0.0957  169 GLU C CA  
2721 C C   . GLU C  110 ? 0.3316 0.4286 0.3811 -0.0624 -0.0519 0.0707  169 GLU C C   
2722 O O   . GLU C  110 ? 0.3291 0.4146 0.3644 -0.0522 -0.0402 0.0562  169 GLU C O   
2723 C CB  . GLU C  110 ? 0.3303 0.4602 0.4453 -0.0509 -0.0412 0.1133  169 GLU C CB  
2724 C CG  . GLU C  110 ? 0.3854 0.4954 0.4874 -0.0333 -0.0197 0.1006  169 GLU C CG  
2725 C CD  . GLU C  110 ? 0.4583 0.5695 0.5828 -0.0230 -0.0054 0.1147  169 GLU C CD  
2726 O OE1 . GLU C  110 ? 0.4828 0.5700 0.5874 -0.0101 0.0109  0.1042  169 GLU C OE1 
2727 O OE2 . GLU C  110 ? 0.4984 0.6328 0.6591 -0.0290 -0.0114 0.1378  169 GLU C OE2 
2728 N N   . THR C  111 ? 0.3446 0.4345 0.3842 -0.0757 -0.0652 0.0682  170 THR C N   
2729 C CA  . THR C  111 ? 0.3400 0.4069 0.3529 -0.0757 -0.0631 0.0477  170 THR C CA  
2730 C C   . THR C  111 ? 0.3260 0.3926 0.3558 -0.0674 -0.0550 0.0495  170 THR C C   
2731 O O   . THR C  111 ? 0.3215 0.4037 0.3811 -0.0649 -0.0525 0.0676  170 THR C O   
2732 C CB  . THR C  111 ? 0.3658 0.4154 0.3533 -0.0946 -0.0808 0.0450  170 THR C CB  
2733 O OG1 . THR C  111 ? 0.3771 0.4369 0.3889 -0.1054 -0.0935 0.0629  170 THR C OG1 
2734 C CG2 . THR C  111 ? 0.3389 0.3837 0.3033 -0.1062 -0.0917 0.0469  170 THR C CG2 
2735 N N   . VAL C  112 ? 0.3254 0.3735 0.3365 -0.0632 -0.0503 0.0328  171 VAL C N   
2736 C CA  . VAL C  112 ? 0.3150 0.3585 0.3357 -0.0564 -0.0437 0.0335  171 VAL C CA  
2737 C C   . VAL C  112 ? 0.3270 0.3754 0.3635 -0.0683 -0.0542 0.0477  171 VAL C C   
2738 O O   . VAL C  112 ? 0.3237 0.3803 0.3832 -0.0627 -0.0470 0.0602  171 VAL C O   
2739 C CB  . VAL C  112 ? 0.3316 0.3549 0.3307 -0.0504 -0.0391 0.0148  171 VAL C CB  
2740 C CG1 . VAL C  112 ? 0.3292 0.3332 0.3052 -0.0614 -0.0479 0.0060  171 VAL C CG1 
2741 C CG2 . VAL C  112 ? 0.2962 0.3139 0.3028 -0.0405 -0.0309 0.0159  171 VAL C CG2 
2742 N N   . ALA C  113 ? 0.3497 0.3906 0.3720 -0.0859 -0.0713 0.0479  172 ALA C N   
2743 C CA  . ALA C  113 ? 0.3616 0.4068 0.3993 -0.1029 -0.0873 0.0646  172 ALA C CA  
2744 C C   . ALA C  113 ? 0.3511 0.4314 0.4364 -0.1033 -0.0884 0.0937  172 ALA C C   
2745 O O   . ALA C  113 ? 0.3469 0.4412 0.4650 -0.1059 -0.0887 0.1127  172 ALA C O   
2746 C CB  . ALA C  113 ? 0.3921 0.4144 0.3950 -0.1241 -0.1081 0.0591  172 ALA C CB  
2747 N N   . ASP C  114 ? 0.3523 0.4474 0.4444 -0.0993 -0.0867 0.0994  173 ASP C N   
2748 C CA  . ASP C  114 ? 0.3410 0.4693 0.4813 -0.0949 -0.0828 0.1289  173 ASP C CA  
2749 C C   . ASP C  114 ? 0.3269 0.4598 0.4896 -0.0727 -0.0558 0.1347  173 ASP C C   
2750 O O   . ASP C  114 ? 0.3104 0.4636 0.5144 -0.0702 -0.0498 0.1604  173 ASP C O   
2751 C CB  . ASP C  114 ? 0.3377 0.4750 0.4754 -0.0915 -0.0826 0.1310  173 ASP C CB  
2752 C CG  . ASP C  114 ? 0.3596 0.4902 0.4724 -0.1147 -0.1097 0.1300  173 ASP C CG  
2753 O OD1 . ASP C  114 ? 0.3778 0.5060 0.4910 -0.1360 -0.1324 0.1402  173 ASP C OD1 
2754 O OD2 . ASP C  114 ? 0.3489 0.4727 0.4379 -0.1127 -0.1088 0.1198  173 ASP C OD2 
2755 N N   . ALA C  115 ? 0.3340 0.4451 0.4669 -0.0575 -0.0395 0.1121  174 ALA C N   
2756 C CA  . ALA C  115 ? 0.3400 0.4427 0.4776 -0.0377 -0.0147 0.1144  174 ALA C CA  
2757 C C   . ALA C  115 ? 0.3529 0.4508 0.4989 -0.0392 -0.0120 0.1191  174 ALA C C   
2758 O O   . ALA C  115 ? 0.3629 0.4579 0.5210 -0.0250 0.0087  0.1307  174 ALA C O   
2759 C CB  . ALA C  115 ? 0.3310 0.4077 0.4299 -0.0266 -0.0050 0.0899  174 ALA C CB  
2760 N N   . ARG C  116 ? 0.3676 0.4597 0.5028 -0.0558 -0.0312 0.1104  175 ARG C N   
2761 C CA  . ARG C  116 ? 0.3772 0.4568 0.5100 -0.0567 -0.0289 0.1085  175 ARG C CA  
2762 C C   . ARG C  116 ? 0.3900 0.4930 0.5689 -0.0617 -0.0276 0.1396  175 ARG C C   
2763 O O   . ARG C  116 ? 0.3881 0.5161 0.5983 -0.0763 -0.0433 0.1606  175 ARG C O   
2764 C CB  . ARG C  116 ? 0.3887 0.4478 0.4911 -0.0715 -0.0474 0.0890  175 ARG C CB  
2765 C CG  . ARG C  116 ? 0.3945 0.4360 0.4898 -0.0708 -0.0442 0.0845  175 ARG C CG  
2766 C CD  . ARG C  116 ? 0.3801 0.3944 0.4417 -0.0824 -0.0587 0.0651  175 ARG C CD  
2767 N NE  . ARG C  116 ? 0.3819 0.3812 0.4125 -0.0731 -0.0542 0.0423  175 ARG C NE  
2768 C CZ  . ARG C  116 ? 0.3951 0.3821 0.4004 -0.0811 -0.0635 0.0302  175 ARG C CZ  
2769 N NH1 . ARG C  116 ? 0.3760 0.3535 0.3616 -0.0698 -0.0549 0.0134  175 ARG C NH1 
2770 N NH2 . ARG C  116 ? 0.4005 0.3819 0.3980 -0.1011 -0.0813 0.0361  175 ARG C NH2 
2771 N N   . GLN C  117 ? 0.4044 0.4990 0.5879 -0.0501 -0.0093 0.1446  176 GLN C N   
2772 C CA  . GLN C  117 ? 0.4193 0.5356 0.6491 -0.0527 -0.0034 0.1758  176 GLN C CA  
2773 C C   . GLN C  117 ? 0.4185 0.5218 0.6417 -0.0661 -0.0149 0.1720  176 GLN C C   
2774 O O   . GLN C  117 ? 0.4137 0.5360 0.6716 -0.0840 -0.0300 0.1942  176 GLN C O   
2775 C CB  . GLN C  117 ? 0.4348 0.5504 0.6775 -0.0268 0.0324  0.1909  176 GLN C CB  
2776 C CG  . GLN C  117 ? 0.4729 0.6126 0.7463 -0.0168 0.0433  0.2112  176 GLN C CG  
2777 C CD  . GLN C  117 ? 0.5606 0.6808 0.8236 0.0123  0.0828  0.2173  176 GLN C CD  
2778 O OE1 . GLN C  117 ? 0.6141 0.7108 0.8612 0.0246  0.1048  0.2177  176 GLN C OE1 
2779 N NE2 . GLN C  117 ? 0.5928 0.7165 0.8587 0.0233  0.0925  0.2220  176 GLN C NE2 
2780 N N   . SER C  118 ? 0.4172 0.4877 0.5969 -0.0593 -0.0105 0.1455  177 SER C N   
2781 C CA  . SER C  118 ? 0.4404 0.4934 0.6073 -0.0728 -0.0241 0.1381  177 SER C CA  
2782 C C   . SER C  118 ? 0.4389 0.4589 0.5558 -0.0716 -0.0313 0.1050  177 SER C C   
2783 O O   . SER C  118 ? 0.4324 0.4427 0.5258 -0.0578 -0.0224 0.0885  177 SER C O   
2784 C CB  . SER C  118 ? 0.4504 0.5011 0.6337 -0.0643 -0.0056 0.1540  177 SER C CB  
2785 O OG  . SER C  118 ? 0.4625 0.4874 0.6113 -0.0435 0.0149  0.1380  177 SER C OG  
2786 N N   . ILE C  119 ? 0.4575 0.4590 0.5603 -0.0860 -0.0466 0.0980  178 ILE C N   
2787 C CA  . ILE C  119 ? 0.4599 0.4291 0.5211 -0.0827 -0.0497 0.0711  178 ILE C CA  
2788 C C   . ILE C  119 ? 0.4586 0.4141 0.5133 -0.0682 -0.0345 0.0690  178 ILE C C   
2789 O O   . ILE C  119 ? 0.4653 0.4261 0.5406 -0.0701 -0.0289 0.0866  178 ILE C O   
2790 C CB  . ILE C  119 ? 0.4876 0.4350 0.5324 -0.1043 -0.0705 0.0671  178 ILE C CB  
2791 C CG1 . ILE C  119 ? 0.4935 0.4423 0.5259 -0.1176 -0.0860 0.0630  178 ILE C CG1 
2792 C CG2 . ILE C  119 ? 0.4975 0.4087 0.5078 -0.0984 -0.0679 0.0470  178 ILE C CG2 
2793 C CD1 . ILE C  119