data_3P1Q
# 
_entry.id   3P1Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3P1Q         
RCSB  RCSB061847   
WWPDB D_1000061847 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2O98 'Structure of the 14-3-3 / H+-ATPase plant complex'                                                       unspecified 
PDB 3IQV 'Crystal Structure of human 14-3-3 sigma in Complex with Raf1 peptide (6mer) and stabilisator Fusicoccin' unspecified 
PDB 3M50 'Structure of the 14-3-3/PMA2 complex stabilized by Epibestatin'                                          unspecified 
PDB 3P1N .                                                                                                         unspecified 
PDB 3P1O .                                                                                                         unspecified 
PDB 3P1P .                                                                                                         unspecified 
PDB 3P1R .                                                                                                         unspecified 
PDB 3P1S .                                                                                                         unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3P1Q 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Anders, C.'     1 
'Higuchi, Y.'    2 
'Schumacher, B.' 3 
'Thiel, P.'      4 
'Kato, N.'       5 
'Ottmann, C.'    6 
# 
_citation.id                        primary 
_citation.title                     
'A semisynthetic fusicoccane stabilizes a protein-protein interaction and enhances the expression of K+ channels at the cell surface' 
_citation.journal_abbrev            'Chem. Biol.' 
_citation.journal_volume            20 
_citation.page_first                583 
_citation.page_last                 593 
_citation.year                      2013 
_citation.journal_id_ASTM           CBOLE2 
_citation.country                   UK 
_citation.journal_id_ISSN           1879-1301 
_citation.journal_id_CSD            2050 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23601647 
_citation.pdbx_database_id_DOI      10.1016/j.chembiol.2013.03.015 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Anders, C.'         1  
primary 'Higuchi, Y.'        2  
primary 'Koschinsky, K.'     3  
primary 'Bartel, M.'         4  
primary 'Schumacher, B.'     5  
primary 'Thiel, P.'          6  
primary 'Nitta, H.'          7  
primary 'Preisig-Muller, R.' 8  
primary 'Schlichthorl, G.'   9  
primary 'Renigunta, V.'      10 
primary 'Ohkanda, J.'        11 
primary 'Daut, J.'           12 
primary 'Kato, N.'           13 
primary 'Ottmann, C.'        14 
# 
_cell.entry_id           3P1Q 
_cell.length_a           82.460 
_cell.length_b           110.700 
_cell.length_c           62.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3P1Q 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '14-3-3 protein sigma'                                      26577.920 1   ? C38N,N166H ? ? 
2 polymer     syn '6-mer peptide from Potassium channel subfamily K member 9' 856.950   1   ? ?          ? ? 
3 non-polymer syn FUSICOCCIN                                                  680.823   1   ? ?          ? ? 
4 non-polymer syn 'CHLORIDE ION'                                              35.453    1   ? ?          ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                             24.305    2   ? ?          ? ? 
6 non-polymer syn 'CALCIUM ION'                                               40.078    1   ? ?          ? ? 
7 water       nat water                                                       18.015    204 ? ?          ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Stratifin, Epithelial cell marker protein 1' 
2 'TASK-3 peptide'                              
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSNEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE
EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM
DISKKEMPPTHPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
;
;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSNEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE
EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM
DISKKEMPPTHPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
;
A ? 
2 'polypeptide(L)' no yes 'KRRK(SEP)V' KRRKSV P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   GLU n 
1 8   ARG n 
1 9   ALA n 
1 10  SER n 
1 11  LEU n 
1 12  ILE n 
1 13  GLN n 
1 14  LYS n 
1 15  ALA n 
1 16  LYS n 
1 17  LEU n 
1 18  ALA n 
1 19  GLU n 
1 20  GLN n 
1 21  ALA n 
1 22  GLU n 
1 23  ARG n 
1 24  TYR n 
1 25  GLU n 
1 26  ASP n 
1 27  MET n 
1 28  ALA n 
1 29  ALA n 
1 30  PHE n 
1 31  MET n 
1 32  LYS n 
1 33  GLY n 
1 34  ALA n 
1 35  VAL n 
1 36  GLU n 
1 37  LYS n 
1 38  GLY n 
1 39  GLU n 
1 40  GLU n 
1 41  LEU n 
1 42  SER n 
1 43  ASN n 
1 44  GLU n 
1 45  GLU n 
1 46  ARG n 
1 47  ASN n 
1 48  LEU n 
1 49  LEU n 
1 50  SER n 
1 51  VAL n 
1 52  ALA n 
1 53  TYR n 
1 54  LYS n 
1 55  ASN n 
1 56  VAL n 
1 57  VAL n 
1 58  GLY n 
1 59  GLY n 
1 60  GLN n 
1 61  ARG n 
1 62  ALA n 
1 63  ALA n 
1 64  TRP n 
1 65  ARG n 
1 66  VAL n 
1 67  LEU n 
1 68  SER n 
1 69  SER n 
1 70  ILE n 
1 71  GLU n 
1 72  GLN n 
1 73  LYS n 
1 74  SER n 
1 75  ASN n 
1 76  GLU n 
1 77  GLU n 
1 78  GLY n 
1 79  SER n 
1 80  GLU n 
1 81  GLU n 
1 82  LYS n 
1 83  GLY n 
1 84  PRO n 
1 85  GLU n 
1 86  VAL n 
1 87  ARG n 
1 88  GLU n 
1 89  TYR n 
1 90  ARG n 
1 91  GLU n 
1 92  LYS n 
1 93  VAL n 
1 94  GLU n 
1 95  THR n 
1 96  GLU n 
1 97  LEU n 
1 98  GLN n 
1 99  GLY n 
1 100 VAL n 
1 101 CYS n 
1 102 ASP n 
1 103 THR n 
1 104 VAL n 
1 105 LEU n 
1 106 GLY n 
1 107 LEU n 
1 108 LEU n 
1 109 ASP n 
1 110 SER n 
1 111 HIS n 
1 112 LEU n 
1 113 ILE n 
1 114 LYS n 
1 115 GLU n 
1 116 ALA n 
1 117 GLY n 
1 118 ASP n 
1 119 ALA n 
1 120 GLU n 
1 121 SER n 
1 122 ARG n 
1 123 VAL n 
1 124 PHE n 
1 125 TYR n 
1 126 LEU n 
1 127 LYS n 
1 128 MET n 
1 129 LYS n 
1 130 GLY n 
1 131 ASP n 
1 132 TYR n 
1 133 TYR n 
1 134 ARG n 
1 135 TYR n 
1 136 LEU n 
1 137 ALA n 
1 138 GLU n 
1 139 VAL n 
1 140 ALA n 
1 141 THR n 
1 142 GLY n 
1 143 ASP n 
1 144 ASP n 
1 145 LYS n 
1 146 LYS n 
1 147 ARG n 
1 148 ILE n 
1 149 ILE n 
1 150 ASP n 
1 151 SER n 
1 152 ALA n 
1 153 ARG n 
1 154 SER n 
1 155 ALA n 
1 156 TYR n 
1 157 GLN n 
1 158 GLU n 
1 159 ALA n 
1 160 MET n 
1 161 ASP n 
1 162 ILE n 
1 163 SER n 
1 164 LYS n 
1 165 LYS n 
1 166 GLU n 
1 167 MET n 
1 168 PRO n 
1 169 PRO n 
1 170 THR n 
1 171 HIS n 
1 172 PRO n 
1 173 ILE n 
1 174 ARG n 
1 175 LEU n 
1 176 GLY n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 ASN n 
1 181 PHE n 
1 182 SER n 
1 183 VAL n 
1 184 PHE n 
1 185 HIS n 
1 186 TYR n 
1 187 GLU n 
1 188 ILE n 
1 189 ALA n 
1 190 ASN n 
1 191 SER n 
1 192 PRO n 
1 193 GLU n 
1 194 GLU n 
1 195 ALA n 
1 196 ILE n 
1 197 SER n 
1 198 LEU n 
1 199 ALA n 
1 200 LYS n 
1 201 THR n 
1 202 THR n 
1 203 PHE n 
1 204 ASP n 
1 205 GLU n 
1 206 ALA n 
1 207 MET n 
1 208 ALA n 
1 209 ASP n 
1 210 LEU n 
1 211 HIS n 
1 212 THR n 
1 213 LEU n 
1 214 SER n 
1 215 GLU n 
1 216 ASP n 
1 217 SER n 
1 218 TYR n 
1 219 LYS n 
1 220 ASP n 
1 221 SER n 
1 222 THR n 
1 223 LEU n 
1 224 ILE n 
1 225 MET n 
1 226 GLN n 
1 227 LEU n 
1 228 LEU n 
1 229 ARG n 
1 230 ASP n 
1 231 ASN n 
1 232 LEU n 
1 233 THR n 
1 234 LEU n 
1 235 TRP n 
1 236 THR n 
2 1   LYS n 
2 2   ARG n 
2 3   ARG n 
2 4   LYS n 
2 5   SEP n 
2 6   VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SFN 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pPROEX HTB' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'This sequence occurs naturally in humans.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP 1433S_HUMAN P31947 1 
;MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPE
VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKK
EMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
;
1   ? 
2 UNP KCNK9_HUMAN Q9NPC2 2 KRRKSV 369 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3P1Q A 6 ? 236 ? P31947 1   ? 231 ? 1   231 
2 2 3P1Q P 1 ? 6   ? Q9NPC2 369 ? 374 ? 369 374 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3P1Q GLY A 1   ? UNP P31947 ?   ?   'EXPRESSION TAG'      -4  1 
1 3P1Q ALA A 2   ? UNP P31947 ?   ?   'EXPRESSION TAG'      -3  2 
1 3P1Q MET A 3   ? UNP P31947 ?   ?   'EXPRESSION TAG'      -2  3 
1 3P1Q GLY A 4   ? UNP P31947 ?   ?   'EXPRESSION TAG'      -1  4 
1 3P1Q SER A 5   ? UNP P31947 ?   ?   'EXPRESSION TAG'      0   5 
1 3P1Q ASN A 43  ? UNP P31947 CYS 38  'ENGINEERED MUTATION' 38  6 
1 3P1Q HIS A 171 ? UNP P31947 ASN 166 'ENGINEERED MUTATION' 166 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ?               'Ca 2'           40.078  
CL  non-polymer         . 'CHLORIDE ION'  ?               'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
FSC non-polymer         . FUSICOCCIN      ?               'C36 H56 O12'    680.823 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?               'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3P1Q 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.44 
_exptl_crystal.density_percent_sol   49.56 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    
'0.095M HEPES Na-Salt, 25.6% PEG 400, 0.19M CaCl2, 5% Glycerol, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2010-07-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'BRUKER AXS MICROSTAR' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3P1Q 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             19.6 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   31587 
_reflns.number_all                   31706 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.050 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.85 
_reflns.B_iso_Wilson_estimate        21.959 
_reflns.pdbx_redundancy              3.89 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.70 
_reflns_shell.d_res_low                   1.80 
_reflns_shell.percent_possible_all        99.4 
_reflns_shell.Rmerge_I_obs                0.198 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         8.31 
_reflns_shell.pdbx_redundancy             3.74 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           4896 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3P1Q 
_refine.ls_number_reflns_obs                     30007 
_refine.ls_number_reflns_all                     31587 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.57 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.15287 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.14955 
_refine.ls_R_factor_R_free                       0.21654 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1580 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.928 
_refine.B_iso_mean                               15.964 
_refine.aniso_B[1][1]                            0.22 
_refine.aniso_B[2][2]                            0.79 
_refine.aniso_B[3][3]                            -1.01 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB Entry 3LW1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.106 
_refine.overall_SU_ML                            0.061 
_refine.overall_SU_B                             4.004 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1899 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             204 
_refine_hist.number_atoms_total               2155 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        19.57 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.022  0.022  ? 2270 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.965  2.018  ? 3123 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.413  5.000  ? 316  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.354 24.091 ? 110  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.880 15.032 ? 462  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.314 15.000 ? 21   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.147  0.200  ? 351  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.020  ? 1722 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.029  1.500  ? 1333 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.101  2.000  ? 2185 'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.803  3.000  ? 937  'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.884  4.500  ? 894  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           2.597  3.000  ? 2270 'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.700 
_refine_ls_shell.d_res_low                        1.744 
_refine_ls_shell.number_reflns_R_work             2156 
_refine_ls_shell.R_factor_R_work                  0.215 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.331 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             114 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2156 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3P1Q 
_struct.title                     
'Crystal structure of human 14-3-3 sigma C38N/N166H in complex with TASK-3 Peptide and stabilizer fusicoccin A' 
_struct.pdbx_descriptor           '14-3-3 protein sigma/6-mer peptide from Potassium channel subfamily K member 9' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3P1Q 
_struct_keywords.pdbx_keywords   'PEPTIDE BINDING PROTEIN' 
_struct_keywords.text            'Helical protein, Phosphoprotein, Adapter protein, Peptide binding protein, Nucleus' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 7   ? ALA A 21  ? GLU A 2   ALA A 16  1 ? 15 
HELX_P HELX_P2  2  ARG A 23  ? LYS A 37  ? ARG A 18  LYS A 32  1 ? 15 
HELX_P HELX_P3  3  SER A 42  ? ASN A 75  ? SER A 37  ASN A 70  1 ? 34 
HELX_P HELX_P4  4  PRO A 84  ? SER A 110 ? PRO A 79  SER A 105 1 ? 27 
HELX_P HELX_P5  5  HIS A 111 ? ALA A 116 ? HIS A 106 ALA A 111 1 ? 6  
HELX_P HELX_P6  6  ASP A 118 ? ALA A 140 ? ASP A 113 ALA A 135 1 ? 23 
HELX_P HELX_P7  7  ASP A 144 ? MET A 167 ? ASP A 139 MET A 162 1 ? 24 
HELX_P HELX_P8  8  HIS A 171 ? ILE A 188 ? HIS A 166 ILE A 183 1 ? 18 
HELX_P HELX_P9  9  SER A 191 ? LEU A 210 ? SER A 186 LEU A 205 1 ? 20 
HELX_P HELX_P10 10 HIS A 211 ? LEU A 213 ? HIS A 206 LEU A 208 5 ? 3  
HELX_P HELX_P11 11 SER A 214 ? THR A 236 ? SER A 209 THR A 231 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B LYS 4   C   ? ? ? 1_555 B SEP 5 N  ? ? P LYS 372 P SEP 373 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale2  covale ? ? B SEP 5   C   ? ? ? 1_555 B VAL 6 N  ? ? P SEP 373 P VAL 374 1_555 ? ? ? ? ? ? ? 1.326 ? 
metalc1  metalc ? ? A GLU 115 O   ? ? ? 1_555 E MG  . MG ? ? A GLU 110 A MG  251 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc2  metalc ? ? A GLU 7   OE1 ? ? ? 1_555 F MG  . MG ? ? A GLU 2   A MG  252 1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc3  metalc ? ? A GLU 40  OE1 ? ? ? 1_555 E MG  . MG ? ? A GLU 35  A MG  251 1_555 ? ? ? ? ? ? ? 2.445 ? 
metalc4  metalc ? ? A SER 50  OG  B ? ? 1_555 G CA  . CA ? ? A SER 45  A CA  253 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc5  metalc ? ? C FSC .   O13 ? ? ? 1_555 G CA  . CA ? ? A FSC 249 A CA  253 1_555 ? ? ? ? ? ? ? 2.619 ? 
metalc6  metalc ? ? A GLU 40  OE2 ? ? ? 1_555 E MG  . MG ? ? A GLU 35  A MG  251 1_555 ? ? ? ? ? ? ? 2.678 ? 
metalc7  metalc ? ? A SER 50  OG  A ? ? 1_555 G CA  . CA ? ? A SER 45  A CA  253 1_555 ? ? ? ? ? ? ? 2.925 ? 
metalc8  metalc ? ? E MG  .   MG  ? ? ? 1_555 H HOH . O  ? ? A MG  251 A HOH 397 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc9  metalc ? ? E MG  .   MG  ? ? ? 1_555 H HOH . O  ? ? A MG  251 A HOH 423 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc10 metalc ? ? F MG  .   MG  ? ? ? 1_555 H HOH . O  ? ? A MG  252 A HOH 334 1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc11 metalc ? ? F MG  .   MG  ? ? ? 1_555 H HOH . O  ? ? A MG  252 A HOH 262 1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc12 metalc ? ? G CA  .   CA  ? ? ? 1_555 I HOH . O  ? ? A CA  253 P HOH 64  1_555 ? ? ? ? ? ? ? 2.843 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 1   A . ? GLY -4  A ALA 2   A ? ALA -3  A 1 -7.10 
2 SER 110 A . ? SER 105 A HIS 111 A ? HIS 106 A 1 7.41  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE FSC A 249' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 250'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 251'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 252'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 253'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 GLU A 19  ? GLU A 14  . ? 1_555 ? 
2  AC1 13 ASN A 47  ? ASN A 42  . ? 1_555 ? 
3  AC1 13 SER A 50  ? SER A 45  . ? 1_555 ? 
4  AC1 13 VAL A 51  ? VAL A 46  . ? 1_555 ? 
5  AC1 13 LYS A 54  ? LYS A 49  . ? 1_555 ? 
6  AC1 13 PHE A 124 ? PHE A 119 . ? 1_555 ? 
7  AC1 13 LYS A 127 ? LYS A 122 . ? 1_555 ? 
8  AC1 13 MET A 128 ? MET A 123 . ? 1_555 ? 
9  AC1 13 PRO A 172 ? PRO A 167 . ? 1_555 ? 
10 AC1 13 LEU A 223 ? LEU A 218 . ? 1_555 ? 
11 AC1 13 ILE A 224 ? ILE A 219 . ? 1_555 ? 
12 AC1 13 CA  G .   ? CA  A 253 . ? 1_555 ? 
13 AC1 13 HOH H .   ? HOH A 322 . ? 1_555 ? 
14 AC2 3  LYS A 14  ? LYS A 9   . ? 1_555 ? 
15 AC2 3  HOH H .   ? HOH A 358 . ? 1_555 ? 
16 AC2 3  HOH H .   ? HOH A 360 . ? 4_555 ? 
17 AC3 6  GLU A 40  ? GLU A 35  . ? 1_555 ? 
18 AC3 6  GLU A 115 ? GLU A 110 . ? 1_555 ? 
19 AC3 6  GLU A 193 ? GLU A 188 . ? 6_544 ? 
20 AC3 6  HOH H .   ? HOH A 338 . ? 6_544 ? 
21 AC3 6  HOH H .   ? HOH A 397 . ? 1_555 ? 
22 AC3 6  HOH H .   ? HOH A 423 . ? 1_555 ? 
23 AC4 6  GLU A 7   ? GLU A 2   . ? 1_555 ? 
24 AC4 6  GLU A 7   ? GLU A 2   . ? 3_554 ? 
25 AC4 6  HOH H .   ? HOH A 262 . ? 3_554 ? 
26 AC4 6  HOH H .   ? HOH A 262 . ? 1_555 ? 
27 AC4 6  HOH H .   ? HOH A 334 . ? 1_555 ? 
28 AC4 6  HOH H .   ? HOH A 334 . ? 3_554 ? 
29 AC5 5  SER A 50  ? SER A 45  . ? 1_555 ? 
30 AC5 5  VAL A 51  ? VAL A 46  . ? 1_555 ? 
31 AC5 5  LYS A 54  ? LYS A 49  . ? 1_555 ? 
32 AC5 5  FSC C .   ? FSC A 249 . ? 1_555 ? 
33 AC5 5  HOH I .   ? HOH P 64  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3P1Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3P1Q 
_atom_sites.fract_transf_matrix[1][1]   0.012127 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009033 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016077 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 1   ? -3.656 -13.111 -6.294  1.00 31.67  ? -4  GLY A N   1 
ATOM   2    C  CA  . GLY A 1 1   ? -3.463 -11.652 -6.270  1.00 29.73  ? -4  GLY A CA  1 
ATOM   3    C  C   . GLY A 1 1   ? -2.578 -11.397 -5.082  1.00 30.09  ? -4  GLY A C   1 
ATOM   4    O  O   . GLY A 1 1   ? -2.430 -12.290 -4.231  1.00 32.89  ? -4  GLY A O   1 
ATOM   5    N  N   . ALA A 1 2   ? -1.883 -10.269 -5.080  1.00 28.71  ? -3  ALA A N   1 
ATOM   6    C  CA  . ALA A 1 2   ? -1.879 -9.415  -6.270  1.00 27.17  ? -3  ALA A CA  1 
ATOM   7    C  C   . ALA A 1 2   ? -1.097 -10.109 -7.383  1.00 24.18  ? -3  ALA A C   1 
ATOM   8    O  O   . ALA A 1 2   ? -1.086 -9.606  -8.516  1.00 25.54  ? -3  ALA A O   1 
ATOM   9    C  CB  . ALA A 1 2   ? -1.295 -7.977  -5.953  1.00 28.75  ? -3  ALA A CB  1 
ATOM   10   N  N   . MET A 1 3   ? -0.436 -11.251 -7.091  1.00 20.54  ? -2  MET A N   1 
ATOM   11   C  CA  . MET A 1 3   ? 0.314  -11.931 -8.156  1.00 16.61  ? -2  MET A CA  1 
ATOM   12   C  C   . MET A 1 3   ? -0.429 -13.067 -8.779  1.00 14.45  ? -2  MET A C   1 
ATOM   13   O  O   . MET A 1 3   ? 0.130  -13.779 -9.629  1.00 11.88  ? -2  MET A O   1 
ATOM   14   C  CB  . MET A 1 3   ? 1.694  -12.444 -7.664  1.00 17.18  ? -2  MET A CB  1 
ATOM   15   C  CG  . MET A 1 3   ? 2.643  -11.289 -7.118  1.00 19.62  ? -2  MET A CG  1 
ATOM   16   S  SD  . MET A 1 3   ? 3.036  -10.085 -8.435  1.00 20.33  ? -2  MET A SD  1 
ATOM   17   C  CE  . MET A 1 3   ? 3.923  -8.785  -7.513  1.00 24.07  ? -2  MET A CE  1 
ATOM   18   N  N   . GLY A 1 4   ? -1.685 -13.269 -8.378  1.00 14.38  ? -1  GLY A N   1 
ATOM   19   C  CA  . GLY A 1 4   ? -2.445 -14.413 -8.888  1.00 13.36  ? -1  GLY A CA  1 
ATOM   20   C  C   . GLY A 1 4   ? -2.702 -14.449 -10.352 1.00 10.97  ? -1  GLY A C   1 
ATOM   21   O  O   . GLY A 1 4   ? -2.913 -15.556 -10.914 1.00 13.24  ? -1  GLY A O   1 
ATOM   22   N  N   . SER A 1 5   ? -2.639 -13.314 -11.035 1.00 10.07  ? 0   SER A N   1 
ATOM   23   C  CA  A SER A 1 5   ? -2.875 -13.348 -12.470 0.60 9.04   ? 0   SER A CA  1 
ATOM   24   C  CA  B SER A 1 5   ? -2.833 -13.322 -12.488 0.40 9.98   ? 0   SER A CA  1 
ATOM   25   C  C   . SER A 1 5   ? -1.577 -13.567 -13.275 1.00 8.94   ? 0   SER A C   1 
ATOM   26   O  O   . SER A 1 5   ? -1.632 -13.682 -14.502 1.00 9.89   ? 0   SER A O   1 
ATOM   27   C  CB  A SER A 1 5   ? -3.579 -12.043 -12.941 0.60 8.41   ? 0   SER A CB  1 
ATOM   28   C  CB  B SER A 1 5   ? -3.380 -11.986 -12.989 0.40 10.15  ? 0   SER A CB  1 
ATOM   29   O  OG  A SER A 1 5   ? -2.717 -10.934 -12.726 0.60 9.86   ? 0   SER A OG  1 
ATOM   30   O  OG  B SER A 1 5   ? -4.650 -11.813 -12.493 0.40 14.59  ? 0   SER A OG  1 
ATOM   31   N  N   . MET A 1 6   ? -0.412 -13.558 -12.606 1.00 8.67   ? 1   MET A N   1 
ATOM   32   C  CA  . MET A 1 6   ? 0.822  -13.678 -13.346 1.00 8.92   ? 1   MET A CA  1 
ATOM   33   C  C   . MET A 1 6   ? 1.239  -15.114 -13.418 1.00 7.99   ? 1   MET A C   1 
ATOM   34   O  O   . MET A 1 6   ? 1.211  -15.802 -12.406 1.00 9.39   ? 1   MET A O   1 
ATOM   35   C  CB  . MET A 1 6   ? 1.942  -12.871 -12.686 1.00 9.15   ? 1   MET A CB  1 
ATOM   36   C  CG  . MET A 1 6   ? 2.980  -12.527 -13.725 1.00 13.99  ? 1   MET A CG  1 
ATOM   37   S  SD  . MET A 1 6   ? 4.340  -11.521 -13.158 1.00 14.64  ? 1   MET A SD  1 
ATOM   38   C  CE  . MET A 1 6   ? 3.484  -10.122 -12.449 1.00 15.89  ? 1   MET A CE  1 
ATOM   39   N  N   . GLU A 1 7   ? 1.694  -15.538 -14.592 1.00 8.14   ? 2   GLU A N   1 
ATOM   40   C  CA  . GLU A 1 7   ? 2.246  -16.889 -14.759 1.00 9.35   ? 2   GLU A CA  1 
ATOM   41   C  C   . GLU A 1 7   ? 3.362  -17.180 -13.763 1.00 9.19   ? 2   GLU A C   1 
ATOM   42   O  O   . GLU A 1 7   ? 4.201  -16.308 -13.473 1.00 7.92   ? 2   GLU A O   1 
ATOM   43   C  CB  . GLU A 1 7   ? 2.850  -17.026 -16.144 1.00 9.28   ? 2   GLU A CB  1 
ATOM   44   C  CG  . GLU A 1 7   ? 1.852  -17.131 -17.209 1.00 10.28  ? 2   GLU A CG  1 
ATOM   45   C  CD  . GLU A 1 7   ? 1.273  -18.512 -17.339 1.00 13.09  ? 2   GLU A CD  1 
ATOM   46   O  OE1 . GLU A 1 7   ? 1.434  -19.361 -16.413 1.00 14.07  ? 2   GLU A OE1 1 
ATOM   47   O  OE2 . GLU A 1 7   ? 0.687  -18.774 -18.418 1.00 12.93  ? 2   GLU A OE2 1 
ATOM   48   N  N   . ARG A 1 8   ? 3.414  -18.411 -13.289 1.00 8.02   ? 3   ARG A N   1 
ATOM   49   C  CA  . ARG A 1 8   ? 4.521  -18.817 -12.421 1.00 8.20   ? 3   ARG A CA  1 
ATOM   50   C  C   . ARG A 1 8   ? 5.890  -18.499 -13.021 1.00 7.98   ? 3   ARG A C   1 
ATOM   51   O  O   . ARG A 1 8   ? 6.789  -17.930 -12.337 1.00 8.39   ? 3   ARG A O   1 
ATOM   52   C  CB  . ARG A 1 8   ? 4.405  -20.310 -12.082 1.00 6.89   ? 3   ARG A CB  1 
ATOM   53   C  CG  . ARG A 1 8   ? 5.407  -20.712 -11.016 1.00 6.20   ? 3   ARG A CG  1 
ATOM   54   C  CD  . ARG A 1 8   ? 5.285  -22.257 -10.814 1.00 8.81   ? 3   ARG A CD  1 
ATOM   55   N  NE  . ARG A 1 8   ? 6.078  -22.704 -9.675  1.00 9.43   ? 3   ARG A NE  1 
ATOM   56   C  CZ  . ARG A 1 8   ? 7.407  -22.871 -9.641  1.00 7.58   ? 3   ARG A CZ  1 
ATOM   57   N  NH1 . ARG A 1 8   ? 8.154  -22.659 -10.733 1.00 8.51   ? 3   ARG A NH1 1 
ATOM   58   N  NH2 . ARG A 1 8   ? 7.970  -23.318 -8.501  1.00 8.89   ? 3   ARG A NH2 1 
ATOM   59   N  N   . ALA A 1 9   ? 6.071  -18.856 -14.289 1.00 7.71   ? 4   ALA A N   1 
ATOM   60   C  CA  . ALA A 1 9   ? 7.422  -18.714 -14.884 1.00 9.03   ? 4   ALA A CA  1 
ATOM   61   C  C   . ALA A 1 9   ? 7.750  -17.204 -14.985 1.00 8.52   ? 4   ALA A C   1 
ATOM   62   O  O   . ALA A 1 9   ? 8.920  -16.814 -14.829 1.00 8.33   ? 4   ALA A O   1 
ATOM   63   C  CB  . ALA A 1 9   ? 7.469  -19.330 -16.245 1.00 11.36  ? 4   ALA A CB  1 
ATOM   64   N  N   . SER A 1 10  ? 6.720  -16.378 -15.242 1.00 7.54   ? 5   SER A N   1 
ATOM   65   C  CA  . SER A 1 10  ? 6.948  -14.911 -15.320 1.00 8.20   ? 5   SER A CA  1 
ATOM   66   C  C   . SER A 1 10  ? 7.358  -14.355 -13.954 1.00 7.50   ? 5   SER A C   1 
ATOM   67   O  O   . SER A 1 10  ? 8.203  -13.444 -13.857 1.00 7.65   ? 5   SER A O   1 
ATOM   68   C  CB  . SER A 1 10  ? 5.664  -14.216 -15.812 1.00 8.36   ? 5   SER A CB  1 
ATOM   69   O  OG  . SER A 1 10  ? 5.419  -14.701 -17.142 1.00 10.79  ? 5   SER A OG  1 
ATOM   70   N  N   . LEU A 1 11  ? 6.712  -14.839 -12.885 1.00 8.32   ? 6   LEU A N   1 
ATOM   71   C  CA  . LEU A 1 11  ? 7.054  -14.375 -11.505 1.00 8.26   ? 6   LEU A CA  1 
ATOM   72   C  C   . LEU A 1 11  ? 8.509  -14.745 -11.225 1.00 7.78   ? 6   LEU A C   1 
ATOM   73   O  O   . LEU A 1 11  ? 9.266  -13.931 -10.694 1.00 7.67   ? 6   LEU A O   1 
ATOM   74   C  CB  . LEU A 1 11  ? 6.144  -15.087 -10.494 1.00 7.66   ? 6   LEU A CB  1 
ATOM   75   C  CG  . LEU A 1 11  ? 4.696  -14.526 -10.540 1.00 7.19   ? 6   LEU A CG  1 
ATOM   76   C  CD1 . LEU A 1 11  ? 3.791  -15.479 -9.800  1.00 10.00  ? 6   LEU A CD1 1 
ATOM   77   C  CD2 . LEU A 1 11  ? 4.667  -13.119 -9.906  1.00 8.79   ? 6   LEU A CD2 1 
ATOM   78   N  N   . ILE A 1 12  ? 8.947  -15.953 -11.605 1.00 7.11   ? 7   ILE A N   1 
ATOM   79   C  CA  A ILE A 1 12  ? 10.327 -16.376 -11.422 0.60 7.38   ? 7   ILE A CA  1 
ATOM   80   C  CA  B ILE A 1 12  ? 10.328 -16.302 -11.358 0.40 7.73   ? 7   ILE A CA  1 
ATOM   81   C  C   . ILE A 1 12  ? 11.274 -15.492 -12.220 1.00 7.69   ? 7   ILE A C   1 
ATOM   82   O  O   . ILE A 1 12  ? 12.313 -15.021 -11.692 1.00 8.99   ? 7   ILE A O   1 
ATOM   83   C  CB  A ILE A 1 12  ? 10.530 -17.870 -11.809 0.60 7.32   ? 7   ILE A CB  1 
ATOM   84   C  CB  B ILE A 1 12  ? 10.576 -17.797 -11.426 0.40 8.04   ? 7   ILE A CB  1 
ATOM   85   C  CG1 A ILE A 1 12  ? 9.725  -18.802 -10.866 0.60 5.52   ? 7   ILE A CG1 1 
ATOM   86   C  CG1 B ILE A 1 12  ? 9.753  -18.452 -10.316 0.40 8.07   ? 7   ILE A CG1 1 
ATOM   87   C  CG2 A ILE A 1 12  ? 12.039 -18.222 -11.847 0.60 8.94   ? 7   ILE A CG2 1 
ATOM   88   C  CG2 B ILE A 1 12  ? 12.082 -18.109 -11.232 0.40 7.97   ? 7   ILE A CG2 1 
ATOM   89   C  CD1 A ILE A 1 12  ? 9.941  -18.634 -9.291  0.60 5.57   ? 7   ILE A CD1 1 
ATOM   90   C  CD1 B ILE A 1 12  ? 9.274  -19.794 -10.627 0.40 7.77   ? 7   ILE A CD1 1 
ATOM   91   N  N   . GLN A 1 13  ? 10.913 -15.270 -13.494 1.00 7.43   ? 8   GLN A N   1 
ATOM   92   C  CA  A GLN A 1 13  ? 11.725 -14.396 -14.367 0.60 7.49   ? 8   GLN A CA  1 
ATOM   93   C  CA  B GLN A 1 13  ? 11.724 -14.404 -14.353 0.40 8.04   ? 8   GLN A CA  1 
ATOM   94   C  C   . GLN A 1 13  ? 11.868 -13.015 -13.747 1.00 8.05   ? 8   GLN A C   1 
ATOM   95   O  O   . GLN A 1 13  ? 12.999 -12.460 -13.677 1.00 8.30   ? 8   GLN A O   1 
ATOM   96   C  CB  A GLN A 1 13  ? 11.095 -14.287 -15.757 0.60 7.25   ? 8   GLN A CB  1 
ATOM   97   C  CB  B GLN A 1 13  ? 11.115 -14.363 -15.750 0.40 8.53   ? 8   GLN A CB  1 
ATOM   98   C  CG  A GLN A 1 13  ? 11.915 -13.406 -16.708 0.60 8.14   ? 8   GLN A CG  1 
ATOM   99   C  CG  B GLN A 1 13  ? 11.553 -15.558 -16.555 0.40 10.48  ? 8   GLN A CG  1 
ATOM   100  C  CD  A GLN A 1 13  ? 11.396 -13.390 -18.197 0.60 7.97   ? 8   GLN A CD  1 
ATOM   101  C  CD  B GLN A 1 13  ? 10.583 -15.975 -17.620 0.40 15.88  ? 8   GLN A CD  1 
ATOM   102  O  OE1 A GLN A 1 13  ? 12.012 -12.760 -19.101 0.60 11.77  ? 8   GLN A OE1 1 
ATOM   103  O  OE1 B GLN A 1 13  ? 10.043 -15.115 -18.321 0.40 18.39  ? 8   GLN A OE1 1 
ATOM   104  N  NE2 A GLN A 1 13  ? 10.311 -14.102 -18.446 0.60 8.04   ? 8   GLN A NE2 1 
ATOM   105  N  NE2 B GLN A 1 13  ? 10.363 -17.319 -17.776 0.40 17.97  ? 8   GLN A NE2 1 
ATOM   106  N  N   . LYS A 1 14  ? 10.735 -12.451 -13.285 1.00 8.31   ? 9   LYS A N   1 
ATOM   107  C  CA  . LYS A 1 14  ? 10.777 -11.077 -12.652 1.00 7.46   ? 9   LYS A CA  1 
ATOM   108  C  C   . LYS A 1 14  ? 11.529 -11.059 -11.325 1.00 7.76   ? 9   LYS A C   1 
ATOM   109  O  O   . LYS A 1 14  ? 12.232 -10.063 -11.028 1.00 9.41   ? 9   LYS A O   1 
ATOM   110  C  CB  . LYS A 1 14  ? 9.395  -10.511 -12.529 1.00 7.24   ? 9   LYS A CB  1 
ATOM   111  C  CG  . LYS A 1 14  ? 8.828  -10.175 -13.975 1.00 8.68   ? 9   LYS A CG  1 
ATOM   112  C  CD  . LYS A 1 14  ? 7.374  -9.683  -13.856 1.00 9.67   ? 9   LYS A CD  1 
ATOM   113  C  CE  . LYS A 1 14  ? 6.800  -9.478  -15.242 1.00 8.11   ? 9   LYS A CE  1 
ATOM   114  N  NZ  . LYS A 1 14  ? 5.416  -8.976  -15.176 1.00 12.50  ? 9   LYS A NZ  1 
ATOM   115  N  N   . ALA A 1 15  ? 11.455 -12.151 -10.562 1.00 6.28   ? 10  ALA A N   1 
ATOM   116  C  CA  . ALA A 1 15  ? 12.230 -12.208 -9.322  1.00 6.48   ? 10  ALA A CA  1 
ATOM   117  C  C   . ALA A 1 15  ? 13.725 -12.095 -9.664  1.00 7.40   ? 10  ALA A C   1 
ATOM   118  O  O   . ALA A 1 15  ? 14.484 -11.441 -8.959  1.00 7.87   ? 10  ALA A O   1 
ATOM   119  C  CB  . ALA A 1 15  ? 11.951 -13.530 -8.551  1.00 7.20   ? 10  ALA A CB  1 
ATOM   120  N  N   . LYS A 1 16  ? 14.173 -12.800 -10.725 1.00 7.84   ? 11  LYS A N   1 
ATOM   121  C  CA  . LYS A 1 16  ? 15.572 -12.704 -11.089 1.00 7.10   ? 11  LYS A CA  1 
ATOM   122  C  C   . LYS A 1 16  ? 15.947 -11.289 -11.575 1.00 8.56   ? 11  LYS A C   1 
ATOM   123  O  O   . LYS A 1 16  ? 17.083 -10.825 -11.319 1.00 10.23  ? 11  LYS A O   1 
ATOM   124  C  CB  . LYS A 1 16  ? 15.904 -13.746 -12.208 1.00 8.70   ? 11  LYS A CB  1 
ATOM   125  C  CG  . LYS A 1 16  ? 15.757 -15.200 -11.687 1.00 8.85   ? 11  LYS A CG  1 
ATOM   126  C  CD  . LYS A 1 16  ? 15.906 -16.137 -12.871 1.00 10.57  ? 11  LYS A CD  1 
ATOM   127  C  CE  . LYS A 1 16  ? 15.618 -17.569 -12.483 1.00 13.37  ? 11  LYS A CE  1 
ATOM   128  N  NZ  . LYS A 1 16  ? 15.697 -18.513 -13.632 1.00 15.38  ? 11  LYS A NZ  1 
ATOM   129  N  N   . LEU A 1 17  ? 15.033 -10.624 -12.263 1.00 7.83   ? 12  LEU A N   1 
ATOM   130  C  CA  . LEU A 1 17  ? 15.284 -9.262  -12.746 1.00 7.65   ? 12  LEU A CA  1 
ATOM   131  C  C   . LEU A 1 17  ? 15.354 -8.339  -11.527 1.00 9.17   ? 12  LEU A C   1 
ATOM   132  O  O   . LEU A 1 17  ? 16.251 -7.493  -11.450 1.00 10.39  ? 12  LEU A O   1 
ATOM   133  C  CB  . LEU A 1 17  ? 14.138 -8.792  -13.617 1.00 7.55   ? 12  LEU A CB  1 
ATOM   134  C  CG  . LEU A 1 17  ? 14.122 -9.447  -15.021 1.00 7.13   ? 12  LEU A CG  1 
ATOM   135  C  CD1 . LEU A 1 17  ? 12.839 -9.057  -15.716 1.00 8.79   ? 12  LEU A CD1 1 
ATOM   136  C  CD2 . LEU A 1 17  ? 15.364 -9.121  -15.921 1.00 12.51  ? 12  LEU A CD2 1 
ATOM   137  N  N   . ALA A 1 18  ? 14.453 -8.556  -10.559 1.00 7.91   ? 13  ALA A N   1 
ATOM   138  C  CA  . ALA A 1 18  ? 14.405 -7.721  -9.346  1.00 7.87   ? 13  ALA A CA  1 
ATOM   139  C  C   . ALA A 1 18  ? 15.717 -7.941  -8.571  1.00 8.72   ? 13  ALA A C   1 
ATOM   140  O  O   . ALA A 1 18  ? 16.278 -6.970  -8.029  1.00 10.15  ? 13  ALA A O   1 
ATOM   141  C  CB  . ALA A 1 18  ? 13.147 -8.074  -8.482  1.00 8.20   ? 13  ALA A CB  1 
ATOM   142  N  N   . GLU A 1 19  ? 16.226 -9.192  -8.506  1.00 8.64   ? 14  GLU A N   1 
ATOM   143  C  CA  A GLU A 1 19  ? 17.520 -9.455  -7.888  0.60 8.67   ? 14  GLU A CA  1 
ATOM   144  C  CA  B GLU A 1 19  ? 17.504 -9.381  -7.855  0.40 10.02  ? 14  GLU A CA  1 
ATOM   145  C  C   . GLU A 1 19  ? 18.626 -8.583  -8.541  1.00 9.69   ? 14  GLU A C   1 
ATOM   146  O  O   . GLU A 1 19  ? 19.496 -7.973  -7.848  1.00 12.32  ? 14  GLU A O   1 
ATOM   147  C  CB  A GLU A 1 19  ? 17.863 -10.961 -8.026  0.60 6.70   ? 14  GLU A CB  1 
ATOM   148  C  CB  B GLU A 1 19  ? 17.878 -10.853 -7.797  0.40 10.13  ? 14  GLU A CB  1 
ATOM   149  C  CG  A GLU A 1 19  ? 19.080 -11.412 -7.132  0.60 7.93   ? 14  GLU A CG  1 
ATOM   150  C  CG  B GLU A 1 19  ? 18.931 -11.075 -6.725  0.40 14.45  ? 14  GLU A CG  1 
ATOM   151  C  CD  A GLU A 1 19  ? 20.440 -11.184 -7.771  0.60 6.48   ? 14  GLU A CD  1 
ATOM   152  C  CD  B GLU A 1 19  ? 19.599 -12.390 -6.876  0.40 20.55  ? 14  GLU A CD  1 
ATOM   153  O  OE1 A GLU A 1 19  ? 20.488 -11.190 -8.994  0.60 10.62  ? 14  GLU A OE1 1 
ATOM   154  O  OE1 B GLU A 1 19  ? 19.367 -13.018 -7.924  0.40 21.72  ? 14  GLU A OE1 1 
ATOM   155  O  OE2 A GLU A 1 19  ? 21.473 -10.992 -7.061  0.60 10.60  ? 14  GLU A OE2 1 
ATOM   156  O  OE2 B GLU A 1 19  ? 20.364 -12.794 -5.957  0.40 25.83  ? 14  GLU A OE2 1 
ATOM   157  N  N   . GLN A 1 20  ? 18.638 -8.554  -9.882  1.00 10.46  ? 15  GLN A N   1 
ATOM   158  C  CA  . GLN A 1 20  ? 19.712 -7.874  -10.584 1.00 12.25  ? 15  GLN A CA  1 
ATOM   159  C  C   . GLN A 1 20  ? 19.622 -6.384  -10.354 1.00 11.87  ? 15  GLN A C   1 
ATOM   160  O  O   . GLN A 1 20  ? 20.678 -5.667  -10.305 1.00 14.02  ? 15  GLN A O   1 
ATOM   161  C  CB  . GLN A 1 20  ? 19.638 -8.162  -12.059 1.00 11.45  ? 15  GLN A CB  1 
ATOM   162  C  CG  . GLN A 1 20  ? 19.987 -9.551  -12.400 1.00 14.92  ? 15  GLN A CG  1 
ATOM   163  C  CD  . GLN A 1 20  ? 19.845 -9.787  -13.881 1.00 22.59  ? 15  GLN A CD  1 
ATOM   164  O  OE1 . GLN A 1 20  ? 20.662 -9.327  -14.693 1.00 28.16  ? 15  GLN A OE1 1 
ATOM   165  N  NE2 . GLN A 1 20  ? 18.788 -10.512 -14.252 1.00 27.29  ? 15  GLN A NE2 1 
ATOM   166  N  N   . ALA A 1 21  ? 18.389 -5.918  -10.187 1.00 11.48  ? 16  ALA A N   1 
ATOM   167  C  CA  . ALA A 1 21  ? 18.121 -4.503  -9.897  1.00 12.68  ? 16  ALA A CA  1 
ATOM   168  C  C   . ALA A 1 21  ? 18.187 -4.148  -8.398  1.00 13.08  ? 16  ALA A C   1 
ATOM   169  O  O   . ALA A 1 21  ? 17.910 -2.975  -8.002  1.00 13.88  ? 16  ALA A O   1 
ATOM   170  C  CB  . ALA A 1 21  ? 16.839 -4.132  -10.471 1.00 11.44  ? 16  ALA A CB  1 
ATOM   171  N  N   . GLU A 1 22  ? 18.528 -5.133  -7.564  1.00 13.20  ? 17  GLU A N   1 
ATOM   172  C  CA  A GLU A 1 22  ? 18.496 -4.988  -6.099  0.50 13.63  ? 17  GLU A CA  1 
ATOM   173  C  CA  B GLU A 1 22  ? 18.515 -4.928  -6.105  0.50 13.78  ? 17  GLU A CA  1 
ATOM   174  C  C   . GLU A 1 22  ? 17.163 -4.395  -5.586  1.00 12.96  ? 17  GLU A C   1 
ATOM   175  O  O   . GLU A 1 22  ? 17.108 -3.598  -4.631  1.00 13.72  ? 17  GLU A O   1 
ATOM   176  C  CB  A GLU A 1 22  ? 19.741 -4.228  -5.598  0.50 15.56  ? 17  GLU A CB  1 
ATOM   177  C  CB  B GLU A 1 22  ? 19.689 -4.017  -5.667  0.50 15.63  ? 17  GLU A CB  1 
ATOM   178  C  CG  A GLU A 1 22  ? 21.007 -4.702  -6.270  0.50 16.08  ? 17  GLU A CG  1 
ATOM   179  C  CG  B GLU A 1 22  ? 21.036 -4.656  -5.868  0.50 17.48  ? 17  GLU A CG  1 
ATOM   180  C  CD  A GLU A 1 22  ? 22.216 -3.892  -5.863  0.50 20.86  ? 17  GLU A CD  1 
ATOM   181  C  CD  B GLU A 1 22  ? 22.178 -3.738  -5.454  0.50 22.05  ? 17  GLU A CD  1 
ATOM   182  O  OE1 A GLU A 1 22  ? 22.721 -4.071  -4.715  0.50 21.72  ? 17  GLU A OE1 1 
ATOM   183  O  OE1 B GLU A 1 22  ? 21.924 -2.681  -4.819  0.50 21.82  ? 17  GLU A OE1 1 
ATOM   184  O  OE2 A GLU A 1 22  ? 22.644 -3.056  -6.699  0.50 21.73  ? 17  GLU A OE2 1 
ATOM   185  O  OE2 B GLU A 1 22  ? 23.331 -4.075  -5.788  0.50 25.09  ? 17  GLU A OE2 1 
ATOM   186  N  N   . ARG A 1 23  ? 16.068 -4.840  -6.208  1.00 10.66  ? 18  ARG A N   1 
ATOM   187  C  CA  . ARG A 1 23  ? 14.732 -4.430  -5.794  1.00 9.94   ? 18  ARG A CA  1 
ATOM   188  C  C   . ARG A 1 23  ? 14.187 -5.619  -4.982  1.00 8.90   ? 18  ARG A C   1 
ATOM   189  O  O   . ARG A 1 23  ? 13.358 -6.401  -5.491  1.00 9.53   ? 18  ARG A O   1 
ATOM   190  C  CB  . ARG A 1 23  ? 13.884 -4.195  -7.017  1.00 8.89   ? 18  ARG A CB  1 
ATOM   191  C  CG  . ARG A 1 23  ? 14.387 -2.934  -7.729  1.00 11.39  ? 18  ARG A CG  1 
ATOM   192  C  CD  . ARG A 1 23  ? 13.651 -1.716  -7.162  1.00 12.53  ? 18  ARG A CD  1 
ATOM   193  N  NE  . ARG A 1 23  ? 12.197 -1.787  -7.415  1.00 13.12  ? 18  ARG A NE  1 
ATOM   194  C  CZ  . ARG A 1 23  ? 11.340 -0.767  -7.366  1.00 14.73  ? 18  ARG A CZ  1 
ATOM   195  N  NH1 . ARG A 1 23  ? 11.750 0.487   -7.086  1.00 15.52  ? 18  ARG A NH1 1 
ATOM   196  N  NH2 . ARG A 1 23  ? 10.055 -1.021  -7.608  1.00 14.03  ? 18  ARG A NH2 1 
ATOM   197  N  N   . TYR A 1 24  ? 14.636 -5.722  -3.734  1.00 8.14   ? 19  TYR A N   1 
ATOM   198  C  CA  . TYR A 1 24  ? 14.342 -6.940  -2.967  1.00 9.52   ? 19  TYR A CA  1 
ATOM   199  C  C   . TYR A 1 24  ? 12.912 -7.035  -2.540  1.00 9.17   ? 19  TYR A C   1 
ATOM   200  O  O   . TYR A 1 24  ? 12.369 -8.152  -2.433  1.00 9.54   ? 19  TYR A O   1 
ATOM   201  C  CB  . TYR A 1 24  ? 15.292 -7.105  -1.773  1.00 9.95   ? 19  TYR A CB  1 
ATOM   202  C  CG  . TYR A 1 24  ? 16.711 -7.278  -2.273  1.00 9.57   ? 19  TYR A CG  1 
ATOM   203  C  CD1 . TYR A 1 24  ? 17.102 -8.466  -2.969  1.00 11.68  ? 19  TYR A CD1 1 
ATOM   204  C  CD2 . TYR A 1 24  ? 17.644 -6.249  -2.140  1.00 12.10  ? 19  TYR A CD2 1 
ATOM   205  C  CE1 . TYR A 1 24  ? 18.379 -8.617  -3.456  1.00 11.93  ? 19  TYR A CE1 1 
ATOM   206  C  CE2 . TYR A 1 24  ? 18.917 -6.396  -2.652  1.00 15.74  ? 19  TYR A CE2 1 
ATOM   207  C  CZ  . TYR A 1 24  ? 19.275 -7.595  -3.275  1.00 13.17  ? 19  TYR A CZ  1 
ATOM   208  O  OH  . TYR A 1 24  ? 20.556 -7.725  -3.716  1.00 21.81  ? 19  TYR A OH  1 
ATOM   209  N  N   . GLU A 1 25  ? 12.249 -5.903  -2.277  1.00 9.29   ? 20  GLU A N   1 
ATOM   210  C  CA  A GLU A 1 25  ? 10.839 -6.008  -1.928  0.50 10.19  ? 20  GLU A CA  1 
ATOM   211  C  CA  B GLU A 1 25  ? 10.831 -5.965  -1.927  0.50 10.24  ? 20  GLU A CA  1 
ATOM   212  C  C   . GLU A 1 25  ? 10.025 -6.562  -3.105  1.00 9.38   ? 20  GLU A C   1 
ATOM   213  O  O   . GLU A 1 25  ? 9.143  -7.428  -2.931  1.00 8.80   ? 20  GLU A O   1 
ATOM   214  C  CB  A GLU A 1 25  ? 10.301 -4.652  -1.516  0.50 10.96  ? 20  GLU A CB  1 
ATOM   215  C  CB  B GLU A 1 25  ? 10.303 -4.570  -1.550  0.50 10.83  ? 20  GLU A CB  1 
ATOM   216  C  CG  A GLU A 1 25  ? 10.851 -4.171  -0.221  0.50 13.19  ? 20  GLU A CG  1 
ATOM   217  C  CG  B GLU A 1 25  ? 8.790  -4.553  -1.253  0.50 13.23  ? 20  GLU A CG  1 
ATOM   218  C  CD  A GLU A 1 25  ? 10.286 -2.823  0.163   0.50 21.92  ? 20  GLU A CD  1 
ATOM   219  C  CD  B GLU A 1 25  ? 8.198  -3.150  -0.958  0.50 19.97  ? 20  GLU A CD  1 
ATOM   220  O  OE1 A GLU A 1 25  ? 10.961 -2.131  0.956   0.50 26.41  ? 20  GLU A OE1 1 
ATOM   221  O  OE1 B GLU A 1 25  ? 7.970  -2.279  -1.864  0.50 22.44  ? 20  GLU A OE1 1 
ATOM   222  O  OE2 A GLU A 1 25  ? 9.180  -2.462  -0.328  0.50 23.04  ? 20  GLU A OE2 1 
ATOM   223  O  OE2 B GLU A 1 25  ? 7.892  -2.937  0.219   0.50 21.02  ? 20  GLU A OE2 1 
ATOM   224  N  N   . ASP A 1 26  ? 10.307 -6.097  -4.309  1.00 7.64   ? 21  ASP A N   1 
ATOM   225  C  CA  . ASP A 1 26  ? 9.623  -6.656  -5.481  1.00 8.53   ? 21  ASP A CA  1 
ATOM   226  C  C   . ASP A 1 26  ? 9.992  -8.131  -5.632  1.00 7.84   ? 21  ASP A C   1 
ATOM   227  O  O   . ASP A 1 26  ? 9.116  -8.963  -5.931  1.00 8.70   ? 21  ASP A O   1 
ATOM   228  C  CB  . ASP A 1 26  ? 10.059 -5.973  -6.779  1.00 8.57   ? 21  ASP A CB  1 
ATOM   229  C  CG  . ASP A 1 26  ? 9.581  -4.538  -6.898  1.00 9.15   ? 21  ASP A CG  1 
ATOM   230  O  OD1 . ASP A 1 26  ? 8.673  -4.067  -6.183  1.00 10.65  ? 21  ASP A OD1 1 
ATOM   231  O  OD2 . ASP A 1 26  ? 10.133 -3.870  -7.794  1.00 11.85  ? 21  ASP A OD2 1 
ATOM   232  N  N   . MET A 1 27  ? 11.255 -8.426  -5.437  1.00 7.88   ? 22  MET A N   1 
ATOM   233  C  CA  . MET A 1 27  ? 11.732 -9.802  -5.623  1.00 6.39   ? 22  MET A CA  1 
ATOM   234  C  C   . MET A 1 27  ? 10.932 -10.695 -4.659  1.00 7.36   ? 22  MET A C   1 
ATOM   235  O  O   . MET A 1 27  ? 10.476 -11.784 -5.041  1.00 7.26   ? 22  MET A O   1 
ATOM   236  C  CB  . MET A 1 27  ? 13.210 -9.849  -5.212  1.00 6.71   ? 22  MET A CB  1 
ATOM   237  C  CG  . MET A 1 27  ? 13.863 -11.187 -5.599  1.00 6.51   ? 22  MET A CG  1 
ATOM   238  S  SD  . MET A 1 27  ? 15.543 -11.232 -5.003  1.00 8.28   ? 22  MET A SD  1 
ATOM   239  C  CE  . MET A 1 27  ? 16.033 -12.914 -5.524  1.00 7.86   ? 22  MET A CE  1 
ATOM   240  N  N   . ALA A 1 28  ? 10.750 -10.222 -3.414  1.00 6.66   ? 23  ALA A N   1 
ATOM   241  C  CA  . ALA A 1 28  ? 10.044 -11.035 -2.393  1.00 8.46   ? 23  ALA A CA  1 
ATOM   242  C  C   . ALA A 1 28  ? 8.577  -11.203 -2.784  1.00 8.35   ? 23  ALA A C   1 
ATOM   243  O  O   . ALA A 1 28  ? 8.028  -12.299 -2.692  1.00 8.90   ? 23  ALA A O   1 
ATOM   244  C  CB  . ALA A 1 28  ? 10.172 -10.382 -1.013  1.00 8.73   ? 23  ALA A CB  1 
ATOM   245  N  N   . ALA A 1 29  ? 7.953  -10.148 -3.288  1.00 8.54   ? 24  ALA A N   1 
ATOM   246  C  CA  . ALA A 1 29  ? 6.542  -10.272 -3.673  1.00 8.94   ? 24  ALA A CA  1 
ATOM   247  C  C   . ALA A 1 29  ? 6.392  -11.203 -4.851  1.00 8.01   ? 24  ALA A C   1 
ATOM   248  O  O   . ALA A 1 29  ? 5.422  -11.970 -4.917  1.00 7.70   ? 24  ALA A O   1 
ATOM   249  C  CB  . ALA A 1 29  ? 5.987  -8.878  -4.017  1.00 10.04  ? 24  ALA A CB  1 
ATOM   250  N  N   . PHE A 1 30  ? 7.337  -11.146 -5.799  1.00 7.30   ? 25  PHE A N   1 
ATOM   251  C  CA  . PHE A 1 30  ? 7.259  -12.079 -6.956  1.00 7.61   ? 25  PHE A CA  1 
ATOM   252  C  C   . PHE A 1 30  ? 7.419  -13.506 -6.442  1.00 6.78   ? 25  PHE A C   1 
ATOM   253  O  O   . PHE A 1 30  ? 6.685  -14.443 -6.892  1.00 7.32   ? 25  PHE A O   1 
ATOM   254  C  CB  . PHE A 1 30  ? 8.362  -11.797 -7.989  1.00 7.62   ? 25  PHE A CB  1 
ATOM   255  C  CG  . PHE A 1 30  ? 8.165  -10.508 -8.739  1.00 7.13   ? 25  PHE A CG  1 
ATOM   256  C  CD1 . PHE A 1 30  ? 9.269  -9.657  -8.963  1.00 8.54   ? 25  PHE A CD1 1 
ATOM   257  C  CD2 . PHE A 1 30  ? 6.929  -10.157 -9.260  1.00 8.10   ? 25  PHE A CD2 1 
ATOM   258  C  CE1 . PHE A 1 30  ? 9.099  -8.434  -9.711  1.00 10.58  ? 25  PHE A CE1 1 
ATOM   259  C  CE2 . PHE A 1 30  ? 6.759  -8.931  -9.984  1.00 9.22   ? 25  PHE A CE2 1 
ATOM   260  C  CZ  . PHE A 1 30  ? 7.838  -8.043  -10.143 1.00 8.78   ? 25  PHE A CZ  1 
ATOM   261  N  N   . MET A 1 31  ? 8.410  -13.710 -5.567  1.00 6.76   ? 26  MET A N   1 
ATOM   262  C  CA  . MET A 1 31  ? 8.571  -15.105 -5.059  1.00 6.40   ? 26  MET A CA  1 
ATOM   263  C  C   . MET A 1 31  ? 7.423  -15.576 -4.187  1.00 6.53   ? 26  MET A C   1 
ATOM   264  O  O   . MET A 1 31  ? 7.071  -16.762 -4.218  1.00 8.38   ? 26  MET A O   1 
ATOM   265  C  CB  . MET A 1 31  ? 9.902  -15.271 -4.332  1.00 6.34   ? 26  MET A CB  1 
ATOM   266  C  CG  . MET A 1 31  ? 11.110 -15.123 -5.302  1.00 7.12   ? 26  MET A CG  1 
ATOM   267  S  SD  . MET A 1 31  ? 11.014 -16.267 -6.705  1.00 9.01   ? 26  MET A SD  1 
ATOM   268  C  CE  . MET A 1 31  ? 10.822 -17.883 -5.838  1.00 8.53   ? 26  MET A CE  1 
ATOM   269  N  N   . LYS A 1 32  ? 6.812  -14.678 -3.392  1.00 6.44   ? 27  LYS A N   1 
ATOM   270  C  CA  . LYS A 1 32  ? 5.595  -15.074 -2.695  1.00 7.28   ? 27  LYS A CA  1 
ATOM   271  C  C   . LYS A 1 32  ? 4.514  -15.487 -3.682  1.00 7.85   ? 27  LYS A C   1 
ATOM   272  O  O   . LYS A 1 32  ? 3.827  -16.502 -3.464  1.00 7.74   ? 27  LYS A O   1 
ATOM   273  C  CB  . LYS A 1 32  ? 5.109  -13.896 -1.781  1.00 6.67   ? 27  LYS A CB  1 
ATOM   274  C  CG  . LYS A 1 32  ? 3.792  -14.094 -1.096  1.00 8.60   ? 27  LYS A CG  1 
ATOM   275  C  CD  . LYS A 1 32  ? 3.508  -12.901 -0.137  1.00 12.42  ? 27  LYS A CD  1 
ATOM   276  C  CE  . LYS A 1 32  ? 2.313  -13.137 0.786   1.00 16.91  ? 27  LYS A CE  1 
ATOM   277  N  NZ  . LYS A 1 32  ? 1.042  -13.059 0.046   1.00 16.29  ? 27  LYS A NZ  1 
ATOM   278  N  N   . GLY A 1 33  ? 4.320  -14.702 -4.748  1.00 7.30   ? 28  GLY A N   1 
ATOM   279  C  CA  . GLY A 1 33  ? 3.340  -15.136 -5.747  1.00 6.85   ? 28  GLY A CA  1 
ATOM   280  C  C   . GLY A 1 33  ? 3.694  -16.487 -6.328  1.00 7.15   ? 28  GLY A C   1 
ATOM   281  O  O   . GLY A 1 33  ? 2.799  -17.298 -6.566  1.00 7.30   ? 28  GLY A O   1 
ATOM   282  N  N   . ALA A 1 34  ? 4.986  -16.737 -6.616  1.00 7.43   ? 29  ALA A N   1 
ATOM   283  C  CA  . ALA A 1 34  ? 5.391  -18.042 -7.165  1.00 6.66   ? 29  ALA A CA  1 
ATOM   284  C  C   . ALA A 1 34  ? 5.053  -19.174 -6.177  1.00 6.90   ? 29  ALA A C   1 
ATOM   285  O  O   . ALA A 1 34  ? 4.508  -20.195 -6.590  1.00 7.14   ? 29  ALA A O   1 
ATOM   286  C  CB  . ALA A 1 34  ? 6.899  -17.988 -7.486  1.00 7.47   ? 29  ALA A CB  1 
ATOM   287  N  N   . VAL A 1 35  ? 5.331  -18.975 -4.900  1.00 5.97   ? 30  VAL A N   1 
ATOM   288  C  CA  . VAL A 1 35  ? 5.057  -20.015 -3.907  1.00 6.24   ? 30  VAL A CA  1 
ATOM   289  C  C   . VAL A 1 35  ? 3.554  -20.260 -3.873  1.00 7.73   ? 30  VAL A C   1 
ATOM   290  O  O   . VAL A 1 35  ? 3.119  -21.440 -3.805  1.00 9.57   ? 30  VAL A O   1 
ATOM   291  C  CB  . VAL A 1 35  ? 5.580  -19.585 -2.509  1.00 5.36   ? 30  VAL A CB  1 
ATOM   292  C  CG1 . VAL A 1 35  ? 4.949  -20.485 -1.394  1.00 9.08   ? 30  VAL A CG1 1 
ATOM   293  C  CG2 . VAL A 1 35  ? 7.154  -19.622 -2.510  1.00 7.65   ? 30  VAL A CG2 1 
ATOM   294  N  N   . GLU A 1 36  ? 2.747  -19.200 -3.970  1.00 8.19   ? 31  GLU A N   1 
ATOM   295  C  CA  . GLU A 1 36  ? 1.318  -19.321 -3.883  1.00 8.20   ? 31  GLU A CA  1 
ATOM   296  C  C   . GLU A 1 36  ? 0.691  -20.023 -5.062  1.00 8.12   ? 31  GLU A C   1 
ATOM   297  O  O   . GLU A 1 36  ? -0.480 -20.392 -4.998  1.00 9.04   ? 31  GLU A O   1 
ATOM   298  C  CB  . GLU A 1 36  ? 0.680  -17.957 -3.566  1.00 8.33   ? 31  GLU A CB  1 
ATOM   299  C  CG  . GLU A 1 36  ? 1.045  -17.512 -2.141  1.00 11.82  ? 31  GLU A CG  1 
ATOM   300  C  CD  . GLU A 1 36  ? 0.622  -16.089 -1.837  1.00 15.49  ? 31  GLU A CD  1 
ATOM   301  O  OE1 . GLU A 1 36  ? 0.221  -15.334 -2.752  1.00 19.28  ? 31  GLU A OE1 1 
ATOM   302  O  OE2 . GLU A 1 36  ? 0.745  -15.683 -0.660  1.00 17.93  ? 31  GLU A OE2 1 
ATOM   303  N  N   . LYS A 1 37  ? 1.484  -20.274 -6.105  1.00 7.84   ? 32  LYS A N   1 
ATOM   304  C  CA  . LYS A 1 37  ? 0.970  -21.103 -7.205  1.00 8.52   ? 32  LYS A CA  1 
ATOM   305  C  C   . LYS A 1 37  ? 0.735  -22.562 -6.787  1.00 9.57   ? 32  LYS A C   1 
ATOM   306  O  O   . LYS A 1 37  ? -0.009 -23.277 -7.446  1.00 10.27  ? 32  LYS A O   1 
ATOM   307  C  CB  . LYS A 1 37  ? 1.895  -21.082 -8.386  1.00 8.08   ? 32  LYS A CB  1 
ATOM   308  C  CG  . LYS A 1 37  ? 2.058  -19.716 -8.986  1.00 7.73   ? 32  LYS A CG  1 
ATOM   309  C  CD  . LYS A 1 37  ? 0.726  -19.180 -9.565  1.00 6.95   ? 32  LYS A CD  1 
ATOM   310  C  CE  . LYS A 1 37  ? 1.019  -17.770 -10.080 1.00 8.90   ? 32  LYS A CE  1 
ATOM   311  N  NZ  . LYS A 1 37  ? -0.260 -17.063 -10.514 1.00 11.45  ? 32  LYS A NZ  1 
ATOM   312  N  N   . GLY A 1 38  ? 1.367  -22.979 -5.666  1.00 9.61   ? 33  GLY A N   1 
ATOM   313  C  CA  . GLY A 1 38  ? 1.074  -24.237 -5.021  1.00 9.68   ? 33  GLY A CA  1 
ATOM   314  C  C   . GLY A 1 38  ? 2.034  -25.375 -5.442  1.00 10.21  ? 33  GLY A C   1 
ATOM   315  O  O   . GLY A 1 38  ? 1.941  -26.479 -4.930  1.00 14.34  ? 33  GLY A O   1 
ATOM   316  N  N   . GLU A 1 39  ? 2.905  -25.131 -6.405  1.00 11.16  ? 34  GLU A N   1 
ATOM   317  C  CA  A GLU A 1 39  ? 3.870  -26.124 -6.828  0.40 11.30  ? 34  GLU A CA  1 
ATOM   318  C  CA  B GLU A 1 39  ? 3.902  -26.111 -6.844  0.60 11.34  ? 34  GLU A CA  1 
ATOM   319  C  C   . GLU A 1 39  ? 5.143  -26.024 -5.946  1.00 11.82  ? 34  GLU A C   1 
ATOM   320  O  O   . GLU A 1 39  ? 5.484  -24.955 -5.417  1.00 12.87  ? 34  GLU A O   1 
ATOM   321  C  CB  A GLU A 1 39  ? 4.151  -25.965 -8.337  0.40 12.73  ? 34  GLU A CB  1 
ATOM   322  C  CB  B GLU A 1 39  ? 4.334  -25.886 -8.312  0.60 12.90  ? 34  GLU A CB  1 
ATOM   323  C  CG  A GLU A 1 39  ? 2.848  -25.770 -9.151  0.40 13.02  ? 34  GLU A CG  1 
ATOM   324  C  CG  B GLU A 1 39  ? 3.226  -26.077 -9.329  0.60 15.25  ? 34  GLU A CG  1 
ATOM   325  C  CD  A GLU A 1 39  ? 3.050  -25.850 -10.644 0.40 17.68  ? 34  GLU A CD  1 
ATOM   326  C  CD  B GLU A 1 39  ? 2.670  -27.503 -9.415  0.60 18.53  ? 34  GLU A CD  1 
ATOM   327  O  OE1 A GLU A 1 39  ? 2.731  -24.852 -11.354 0.40 18.83  ? 34  GLU A OE1 1 
ATOM   328  O  OE1 B GLU A 1 39  ? 3.270  -28.483 -8.925  0.60 19.95  ? 34  GLU A OE1 1 
ATOM   329  O  OE2 A GLU A 1 39  ? 3.523  -26.914 -11.103 0.40 18.60  ? 34  GLU A OE2 1 
ATOM   330  O  OE2 B GLU A 1 39  ? 1.623  -27.646 -10.068 0.60 23.63  ? 34  GLU A OE2 1 
ATOM   331  N  N   . GLU A 1 40  ? 5.837  -27.134 -5.784  1.00 11.32  ? 35  GLU A N   1 
ATOM   332  C  CA  . GLU A 1 40  ? 7.092  -27.112 -5.017  1.00 9.92   ? 35  GLU A CA  1 
ATOM   333  C  C   . GLU A 1 40  ? 8.058  -26.169 -5.755  1.00 9.95   ? 35  GLU A C   1 
ATOM   334  O  O   . GLU A 1 40  ? 7.921  -25.915 -7.021  1.00 11.09  ? 35  GLU A O   1 
ATOM   335  C  CB  . GLU A 1 40  ? 7.661  -28.539 -4.965  1.00 10.83  ? 35  GLU A CB  1 
ATOM   336  C  CG  . GLU A 1 40  ? 6.598  -29.352 -4.153  1.00 14.54  ? 35  GLU A CG  1 
ATOM   337  C  CD  . GLU A 1 40  ? 6.992  -30.722 -3.741  1.00 20.01  ? 35  GLU A CD  1 
ATOM   338  O  OE1 . GLU A 1 40  ? 6.062  -31.561 -3.599  1.00 22.67  ? 35  GLU A OE1 1 
ATOM   339  O  OE2 . GLU A 1 40  ? 8.202  -30.985 -3.593  1.00 24.69  ? 35  GLU A OE2 1 
ATOM   340  N  N   . LEU A 1 41  ? 9.039  -25.671 -5.027  1.00 7.84   ? 36  LEU A N   1 
ATOM   341  C  CA  . LEU A 1 41  ? 10.073 -24.814 -5.664  1.00 8.00   ? 36  LEU A CA  1 
ATOM   342  C  C   . LEU A 1 41  ? 11.295 -25.703 -5.942  1.00 8.68   ? 36  LEU A C   1 
ATOM   343  O  O   . LEU A 1 41  ? 11.674 -26.599 -5.144  1.00 10.17  ? 36  LEU A O   1 
ATOM   344  C  CB  . LEU A 1 41  ? 10.547 -23.760 -4.683  1.00 8.97   ? 36  LEU A CB  1 
ATOM   345  C  CG  . LEU A 1 41  ? 9.487  -22.829 -4.142  1.00 12.35  ? 36  LEU A CG  1 
ATOM   346  C  CD1 . LEU A 1 41  ? 10.197 -21.633 -3.424  1.00 12.07  ? 36  LEU A CD1 1 
ATOM   347  C  CD2 . LEU A 1 41  ? 8.642  -22.310 -5.210  1.00 17.58  ? 36  LEU A CD2 1 
ATOM   348  N  N   . SER A 1 42  ? 11.987 -25.385 -7.018  1.00 8.73   ? 37  SER A N   1 
ATOM   349  C  CA  . SER A 1 42  ? 13.285 -25.962 -7.313  1.00 8.43   ? 37  SER A CA  1 
ATOM   350  C  C   . SER A 1 42  ? 14.386 -25.387 -6.419  1.00 8.68   ? 37  SER A C   1 
ATOM   351  O  O   . SER A 1 42  ? 14.182 -24.419 -5.677  1.00 7.50   ? 37  SER A O   1 
ATOM   352  C  CB  . SER A 1 42  ? 13.662 -25.671 -8.778  1.00 8.58   ? 37  SER A CB  1 
ATOM   353  O  OG  . SER A 1 42  ? 13.890 -24.267 -8.917  1.00 8.37   ? 37  SER A OG  1 
ATOM   354  N  N   . ASN A 1 43  ? 15.564 -25.998 -6.461  1.00 7.51   ? 38  ASN A N   1 
ATOM   355  C  CA  A ASN A 1 43  ? 16.683 -25.452 -5.710  0.60 8.10   ? 38  ASN A CA  1 
ATOM   356  C  CA  B ASN A 1 43  ? 16.719 -25.437 -5.746  0.40 8.66   ? 38  ASN A CA  1 
ATOM   357  C  C   . ASN A 1 43  ? 16.934 -23.954 -6.005  1.00 8.10   ? 38  ASN A C   1 
ATOM   358  O  O   . ASN A 1 43  ? 17.132 -23.150 -5.085  1.00 9.01   ? 38  ASN A O   1 
ATOM   359  C  CB  A ASN A 1 43  ? 17.959 -26.218 -6.030  0.60 7.60   ? 38  ASN A CB  1 
ATOM   360  C  CB  B ASN A 1 43  ? 17.982 -26.165 -6.173  0.40 8.46   ? 38  ASN A CB  1 
ATOM   361  C  CG  A ASN A 1 43  ? 19.106 -25.711 -5.242  0.60 8.50   ? 38  ASN A CG  1 
ATOM   362  C  CG  B ASN A 1 43  ? 17.996 -27.535 -5.684  0.40 12.15  ? 38  ASN A CG  1 
ATOM   363  O  OD1 A ASN A 1 43  ? 19.156 -25.888 -4.041  0.60 11.22  ? 38  ASN A OD1 1 
ATOM   364  O  OD1 B ASN A 1 43  ? 17.313 -27.842 -4.709  0.40 14.84  ? 38  ASN A OD1 1 
ATOM   365  N  ND2 A ASN A 1 43  ? 20.054 -25.085 -5.910  0.60 13.67  ? 38  ASN A ND2 1 
ATOM   366  N  ND2 B ASN A 1 43  ? 18.752 -28.404 -6.336  0.40 17.45  ? 38  ASN A ND2 1 
ATOM   367  N  N   . GLU A 1 44  ? 16.986 -23.605 -7.284  1.00 8.66   ? 39  GLU A N   1 
ATOM   368  C  CA  A GLU A 1 44  ? 17.321 -22.230 -7.658  0.60 7.85   ? 39  GLU A CA  1 
ATOM   369  C  CA  B GLU A 1 44  ? 17.274 -22.224 -7.692  0.40 8.99   ? 39  GLU A CA  1 
ATOM   370  C  C   . GLU A 1 44  ? 16.183 -21.304 -7.122  1.00 7.20   ? 39  GLU A C   1 
ATOM   371  O  O   . GLU A 1 44  ? 16.452 -20.194 -6.644  1.00 8.63   ? 39  GLU A O   1 
ATOM   372  C  CB  A GLU A 1 44  ? 17.386 -22.088 -9.174  0.60 8.52   ? 39  GLU A CB  1 
ATOM   373  C  CB  B GLU A 1 44  ? 17.234 -22.100 -9.216  0.40 10.09  ? 39  GLU A CB  1 
ATOM   374  C  CG  A GLU A 1 44  ? 17.561 -20.635 -9.636  0.60 9.56   ? 39  GLU A CG  1 
ATOM   375  C  CG  B GLU A 1 44  ? 18.378 -22.763 -9.898  0.40 15.84  ? 39  GLU A CG  1 
ATOM   376  C  CD  A GLU A 1 44  ? 17.727 -20.552 -11.162 0.60 16.81  ? 39  GLU A CD  1 
ATOM   377  C  CD  B GLU A 1 44  ? 18.698 -22.142 -11.251 0.40 21.97  ? 39  GLU A CD  1 
ATOM   378  O  OE1 A GLU A 1 44  ? 17.456 -21.572 -11.862 0.60 23.51  ? 39  GLU A OE1 1 
ATOM   379  O  OE1 B GLU A 1 44  ? 17.940 -21.252 -11.717 0.40 26.58  ? 39  GLU A OE1 1 
ATOM   380  O  OE2 A GLU A 1 44  ? 18.193 -19.532 -11.676 0.60 17.18  ? 39  GLU A OE2 1 
ATOM   381  O  OE2 B GLU A 1 44  ? 19.721 -22.552 -11.843 0.40 24.89  ? 39  GLU A OE2 1 
ATOM   382  N  N   . GLU A 1 45  ? 14.939 -21.767 -7.199  1.00 7.10   ? 40  GLU A N   1 
ATOM   383  C  CA  . GLU A 1 45  ? 13.766 -20.970 -6.784  1.00 7.29   ? 40  GLU A CA  1 
ATOM   384  C  C   . GLU A 1 45  ? 13.797 -20.771 -5.252  1.00 6.97   ? 40  GLU A C   1 
ATOM   385  O  O   . GLU A 1 45  ? 13.441 -19.683 -4.728  1.00 6.78   ? 40  GLU A O   1 
ATOM   386  C  CB  . GLU A 1 45  ? 12.474 -21.658 -7.224  1.00 6.79   ? 40  GLU A CB  1 
ATOM   387  C  CG  . GLU A 1 45  ? 12.322 -21.588 -8.770  1.00 7.73   ? 40  GLU A CG  1 
ATOM   388  C  CD  . GLU A 1 45  ? 11.255 -22.535 -9.287  1.00 8.93   ? 40  GLU A CD  1 
ATOM   389  O  OE1 . GLU A 1 45  ? 10.701 -23.320 -8.450  1.00 8.93   ? 40  GLU A OE1 1 
ATOM   390  O  OE2 . GLU A 1 45  ? 10.988 -22.542 -10.533 1.00 12.40  ? 40  GLU A OE2 1 
ATOM   391  N  N   . ARG A 1 46  ? 14.224 -21.808 -4.533  1.00 7.27   ? 41  ARG A N   1 
ATOM   392  C  CA  . ARG A 1 46  ? 14.304 -21.694 -3.055  1.00 7.41   ? 41  ARG A CA  1 
ATOM   393  C  C   . ARG A 1 46  ? 15.334 -20.625 -2.744  1.00 7.69   ? 41  ARG A C   1 
ATOM   394  O  O   . ARG A 1 46  ? 15.125 -19.763 -1.887  1.00 7.44   ? 41  ARG A O   1 
ATOM   395  C  CB  . ARG A 1 46  ? 14.748 -23.045 -2.418  1.00 7.61   ? 41  ARG A CB  1 
ATOM   396  C  CG  . ARG A 1 46  ? 13.558 -23.990 -2.368  1.00 11.07  ? 41  ARG A CG  1 
ATOM   397  C  CD  . ARG A 1 46  ? 13.955 -25.267 -1.570  1.00 12.16  ? 41  ARG A CD  1 
ATOM   398  N  NE  . ARG A 1 46  ? 15.112 -26.001 -2.060  1.00 12.64  ? 41  ARG A NE  1 
ATOM   399  C  CZ  . ARG A 1 46  ? 15.115 -27.045 -2.904  1.00 11.42  ? 41  ARG A CZ  1 
ATOM   400  N  NH1 . ARG A 1 46  ? 14.030 -27.417 -3.548  1.00 11.37  ? 41  ARG A NH1 1 
ATOM   401  N  NH2 . ARG A 1 46  ? 16.289 -27.673 -3.152  1.00 15.88  ? 41  ARG A NH2 1 
ATOM   402  N  N   . ASN A 1 47  ? 16.469 -20.655 -3.442  1.00 7.25   ? 42  ASN A N   1 
ATOM   403  C  CA  . ASN A 1 47  ? 17.481 -19.606 -3.206  1.00 7.49   ? 42  ASN A CA  1 
ATOM   404  C  C   . ASN A 1 47  ? 16.940 -18.238 -3.513  1.00 6.97   ? 42  ASN A C   1 
ATOM   405  O  O   . ASN A 1 47  ? 17.208 -17.310 -2.734  1.00 9.21   ? 42  ASN A O   1 
ATOM   406  C  CB  . ASN A 1 47  ? 18.721 -19.873 -4.070  1.00 7.05   ? 42  ASN A CB  1 
ATOM   407  C  CG  . ASN A 1 47  ? 19.449 -21.121 -3.643  1.00 10.46  ? 42  ASN A CG  1 
ATOM   408  O  OD1 . ASN A 1 47  ? 19.271 -21.607 -2.534  1.00 12.82  ? 42  ASN A OD1 1 
ATOM   409  N  ND2 . ASN A 1 47  ? 20.349 -21.609 -4.506  1.00 14.54  ? 42  ASN A ND2 1 
ATOM   410  N  N   . LEU A 1 48  ? 16.131 -18.090 -4.575  1.00 7.29   ? 43  LEU A N   1 
ATOM   411  C  CA  . LEU A 1 48  ? 15.565 -16.732 -4.857  1.00 6.59   ? 43  LEU A CA  1 
ATOM   412  C  C   . LEU A 1 48  ? 14.622 -16.306 -3.714  1.00 6.74   ? 43  LEU A C   1 
ATOM   413  O  O   . LEU A 1 48  ? 14.615 -15.144 -3.291  1.00 7.28   ? 43  LEU A O   1 
ATOM   414  C  CB  . LEU A 1 48  ? 14.762 -16.732 -6.142  1.00 7.41   ? 43  LEU A CB  1 
ATOM   415  C  CG  . LEU A 1 48  ? 15.556 -16.961 -7.435  1.00 7.09   ? 43  LEU A CG  1 
ATOM   416  C  CD1 . LEU A 1 48  ? 14.647 -17.268 -8.602  1.00 9.77   ? 43  LEU A CD1 1 
ATOM   417  C  CD2 . LEU A 1 48  ? 16.392 -15.738 -7.738  1.00 10.01  ? 43  LEU A CD2 1 
ATOM   418  N  N   . LEU A 1 49  ? 13.794 -17.230 -3.233  1.00 6.50   ? 44  LEU A N   1 
ATOM   419  C  CA  . LEU A 1 49  ? 12.865 -16.906 -2.176  1.00 7.11   ? 44  LEU A CA  1 
ATOM   420  C  C   . LEU A 1 49  ? 13.669 -16.413 -0.950  1.00 7.65   ? 44  LEU A C   1 
ATOM   421  O  O   . LEU A 1 49  ? 13.312 -15.399 -0.321  1.00 6.85   ? 44  LEU A O   1 
ATOM   422  C  CB  . LEU A 1 49  ? 12.050 -18.188 -1.805  1.00 7.28   ? 44  LEU A CB  1 
ATOM   423  C  CG  . LEU A 1 49  ? 11.104 -17.989 -0.592  1.00 6.77   ? 44  LEU A CG  1 
ATOM   424  C  CD1 . LEU A 1 49  ? 9.906  -16.997 -0.918  1.00 8.44   ? 44  LEU A CD1 1 
ATOM   425  C  CD2 . LEU A 1 49  ? 10.537 -19.368 -0.075  1.00 9.16   ? 44  LEU A CD2 1 
ATOM   426  N  N   . SER A 1 50  ? 14.710 -17.175 -0.569  1.00 6.44   ? 45  SER A N   1 
ATOM   427  C  CA  A SER A 1 50  ? 15.384 -16.865 0.659   0.60 7.51   ? 45  SER A CA  1 
ATOM   428  C  CA  B SER A 1 50  ? 15.425 -16.887 0.650   0.40 7.59   ? 45  SER A CA  1 
ATOM   429  C  C   . SER A 1 50  ? 16.173 -15.577 0.501   1.00 8.33   ? 45  SER A C   1 
ATOM   430  O  O   . SER A 1 50  ? 16.178 -14.741 1.433   1.00 9.36   ? 45  SER A O   1 
ATOM   431  C  CB  A SER A 1 50  ? 16.267 -18.034 1.134   0.60 6.73   ? 45  SER A CB  1 
ATOM   432  C  CB  B SER A 1 50  ? 16.369 -18.043 1.014   0.40 7.21   ? 45  SER A CB  1 
ATOM   433  O  OG  A SER A 1 50  ? 17.389 -18.189 0.285   0.60 5.94   ? 45  SER A OG  1 
ATOM   434  O  OG  B SER A 1 50  ? 17.296 -17.674 2.020   0.40 6.36   ? 45  SER A OG  1 
ATOM   435  N  N   . VAL A 1 51  ? 16.811 -15.379 -0.660  1.00 6.88   ? 46  VAL A N   1 
ATOM   436  C  CA  . VAL A 1 51  ? 17.569 -14.121 -0.844  1.00 7.89   ? 46  VAL A CA  1 
ATOM   437  C  C   . VAL A 1 51  ? 16.656 -12.892 -0.745  1.00 8.04   ? 46  VAL A C   1 
ATOM   438  O  O   . VAL A 1 51  ? 17.018 -11.856 -0.133  1.00 7.95   ? 46  VAL A O   1 
ATOM   439  C  CB  . VAL A 1 51  ? 18.335 -14.115 -2.206  1.00 7.28   ? 46  VAL A CB  1 
ATOM   440  C  CG1 . VAL A 1 51  ? 18.863 -12.681 -2.576  1.00 9.99   ? 46  VAL A CG1 1 
ATOM   441  C  CG2 . VAL A 1 51  ? 19.474 -15.207 -2.135  1.00 9.35   ? 46  VAL A CG2 1 
ATOM   442  N  N   . ALA A 1 52  ? 15.472 -13.026 -1.315  1.00 6.34   ? 47  ALA A N   1 
ATOM   443  C  CA  . ALA A 1 52  ? 14.566 -11.851 -1.389  1.00 6.17   ? 47  ALA A CA  1 
ATOM   444  C  C   . ALA A 1 52  ? 14.211 -11.458 0.045   1.00 6.77   ? 47  ALA A C   1 
ATOM   445  O  O   . ALA A 1 52  ? 14.412 -10.285 0.460   1.00 8.48   ? 47  ALA A O   1 
ATOM   446  C  CB  . ALA A 1 52  ? 13.309 -12.181 -2.175  1.00 6.74   ? 47  ALA A CB  1 
ATOM   447  N  N   . TYR A 1 53  ? 13.680 -12.409 0.804   1.00 5.87   ? 48  TYR A N   1 
ATOM   448  C  CA  . TYR A 1 53  ? 13.248 -12.068 2.150   1.00 6.62   ? 48  TYR A CA  1 
ATOM   449  C  C   . TYR A 1 53  ? 14.391 -11.757 3.063   1.00 7.16   ? 48  TYR A C   1 
ATOM   450  O  O   . TYR A 1 53  ? 14.266 -10.892 3.904   1.00 7.37   ? 48  TYR A O   1 
ATOM   451  C  CB  . TYR A 1 53  ? 12.330 -13.150 2.733   1.00 7.66   ? 48  TYR A CB  1 
ATOM   452  C  CG  . TYR A 1 53  ? 10.945 -13.016 2.186   1.00 7.46   ? 48  TYR A CG  1 
ATOM   453  C  CD1 . TYR A 1 53  ? 10.085 -11.970 2.634   1.00 6.35   ? 48  TYR A CD1 1 
ATOM   454  C  CD2 . TYR A 1 53  ? 10.445 -13.919 1.231   1.00 7.07   ? 48  TYR A CD2 1 
ATOM   455  C  CE1 . TYR A 1 53  ? 8.784  -11.858 2.137   1.00 6.92   ? 48  TYR A CE1 1 
ATOM   456  C  CE2 . TYR A 1 53  ? 9.142  -13.796 0.749   1.00 8.13   ? 48  TYR A CE2 1 
ATOM   457  C  CZ  . TYR A 1 53  ? 8.322  -12.784 1.197   1.00 6.98   ? 48  TYR A CZ  1 
ATOM   458  O  OH  . TYR A 1 53  ? 7.028  -12.680 0.682   1.00 9.99   ? 48  TYR A OH  1 
ATOM   459  N  N   . LYS A 1 54  ? 15.541 -12.405 2.896   1.00 6.51   ? 49  LYS A N   1 
ATOM   460  C  CA  A LYS A 1 54  ? 16.661 -12.130 3.785   0.25 7.28   ? 49  LYS A CA  1 
ATOM   461  C  CA  B LYS A 1 54  ? 16.708 -12.135 3.749   0.25 7.48   ? 49  LYS A CA  1 
ATOM   462  C  CA  C LYS A 1 54  ? 16.699 -12.123 3.751   0.50 7.32   ? 49  LYS A CA  1 
ATOM   463  C  C   . LYS A 1 54  ? 17.103 -10.681 3.605   1.00 7.61   ? 49  LYS A C   1 
ATOM   464  O  O   . LYS A 1 54  ? 17.455 -10.014 4.593   1.00 8.79   ? 49  LYS A O   1 
ATOM   465  C  CB  A LYS A 1 54  ? 17.805 -13.143 3.560   0.25 6.91   ? 49  LYS A CB  1 
ATOM   466  C  CB  B LYS A 1 54  ? 17.886 -13.076 3.379   0.25 7.43   ? 49  LYS A CB  1 
ATOM   467  C  CB  C LYS A 1 54  ? 17.885 -13.064 3.383   0.50 7.12   ? 49  LYS A CB  1 
ATOM   468  C  CG  A LYS A 1 54  ? 18.727 -13.281 4.746   0.25 7.45   ? 49  LYS A CG  1 
ATOM   469  C  CG  B LYS A 1 54  ? 19.268 -12.697 3.938   0.25 10.09  ? 49  LYS A CG  1 
ATOM   470  C  CG  C LYS A 1 54  ? 19.147 -12.795 4.193   0.50 11.12  ? 49  LYS A CG  1 
ATOM   471  C  CD  A LYS A 1 54  ? 18.178 -14.134 5.874   0.25 6.75   ? 49  LYS A CD  1 
ATOM   472  C  CD  B LYS A 1 54  ? 20.346 -13.478 3.146   0.25 12.65  ? 49  LYS A CD  1 
ATOM   473  C  CD  C LYS A 1 54  ? 20.395 -13.230 3.382   0.50 15.27  ? 49  LYS A CD  1 
ATOM   474  C  CE  A LYS A 1 54  ? 19.345 -14.755 6.578   0.25 5.11   ? 49  LYS A CE  1 
ATOM   475  C  CE  B LYS A 1 54  ? 21.772 -13.470 3.709   0.25 12.99  ? 49  LYS A CE  1 
ATOM   476  C  CE  C LYS A 1 54  ? 21.744 -13.452 4.118   0.50 19.36  ? 49  LYS A CE  1 
ATOM   477  N  NZ  A LYS A 1 54  ? 20.290 -13.728 7.119   0.25 6.80   ? 49  LYS A NZ  1 
ATOM   478  N  NZ  B LYS A 1 54  ? 22.586 -14.623 3.111   0.25 5.35   ? 49  LYS A NZ  1 
ATOM   479  N  NZ  C LYS A 1 54  ? 22.090 -12.786 5.405   0.50 16.76  ? 49  LYS A NZ  1 
ATOM   480  N  N   . ASN A 1 55  ? 17.106 -10.181 2.360   1.00 7.46   ? 50  ASN A N   1 
ATOM   481  C  CA  . ASN A 1 55  ? 17.428 -8.819  2.166   1.00 6.55   ? 50  ASN A CA  1 
ATOM   482  C  C   . ASN A 1 55  ? 16.382 -7.826  2.711   1.00 7.81   ? 50  ASN A C   1 
ATOM   483  O  O   . ASN A 1 55  ? 16.758 -6.786  3.223   1.00 9.91   ? 50  ASN A O   1 
ATOM   484  C  CB  . ASN A 1 55  ? 17.651 -8.585  0.684   1.00 6.39   ? 50  ASN A CB  1 
ATOM   485  C  CG  . ASN A 1 55  ? 19.088 -8.882  0.286   1.00 11.52  ? 50  ASN A CG  1 
ATOM   486  O  OD1 . ASN A 1 55  ? 19.983 -7.970  0.384   1.00 17.15  ? 50  ASN A OD1 1 
ATOM   487  N  ND2 . ASN A 1 55  ? 19.345 -10.108 -0.142  1.00 15.81  ? 50  ASN A ND2 1 
ATOM   488  N  N   . VAL A 1 56  ? 15.101 -8.106  2.509   1.00 8.45   ? 51  VAL A N   1 
ATOM   489  C  CA  . VAL A 1 56  ? 14.053 -7.220  2.996   1.00 8.09   ? 51  VAL A CA  1 
ATOM   490  C  C   . VAL A 1 56  ? 14.142 -7.165  4.514   1.00 8.41   ? 51  VAL A C   1 
ATOM   491  O  O   . VAL A 1 56  ? 14.203 -6.103  5.088   1.00 8.25   ? 51  VAL A O   1 
ATOM   492  C  CB  . VAL A 1 56  ? 12.668 -7.736  2.589   1.00 7.03   ? 51  VAL A CB  1 
ATOM   493  C  CG1 . VAL A 1 56  ? 11.519 -6.963  3.382   1.00 8.26   ? 51  VAL A CG1 1 
ATOM   494  C  CG2 . VAL A 1 56  ? 12.523 -7.587  1.013   1.00 9.72   ? 51  VAL A CG2 1 
ATOM   495  N  N   . VAL A 1 57  ? 14.177 -8.319  5.186   1.00 8.56   ? 52  VAL A N   1 
ATOM   496  C  CA  A VAL A 1 57  ? 14.150 -8.309  6.616   0.50 7.94   ? 52  VAL A CA  1 
ATOM   497  C  CA  B VAL A 1 57  ? 14.166 -8.279  6.638   0.50 9.06   ? 52  VAL A CA  1 
ATOM   498  C  C   . VAL A 1 57  ? 15.497 -7.783  7.132   1.00 8.78   ? 52  VAL A C   1 
ATOM   499  O  O   . VAL A 1 57  ? 15.583 -7.186  8.223   1.00 9.51   ? 52  VAL A O   1 
ATOM   500  C  CB  A VAL A 1 57  ? 13.724 -9.715  7.141   0.50 7.38   ? 52  VAL A CB  1 
ATOM   501  C  CB  B VAL A 1 57  ? 13.807 -9.640  7.261   0.50 9.16   ? 52  VAL A CB  1 
ATOM   502  C  CG1 A VAL A 1 57  ? 14.945 -10.704 7.234   0.50 3.61   ? 52  VAL A CG1 1 
ATOM   503  C  CG1 B VAL A 1 57  ? 13.585 -9.537  8.768   0.50 11.38  ? 52  VAL A CG1 1 
ATOM   504  C  CG2 A VAL A 1 57  ? 12.914 -9.598  8.431   0.50 8.54   ? 52  VAL A CG2 1 
ATOM   505  C  CG2 B VAL A 1 57  ? 12.583 -10.106 6.660   0.50 10.21  ? 52  VAL A CG2 1 
ATOM   506  N  N   . GLY A 1 58  ? 16.565 -7.997  6.358   1.00 9.75   ? 53  GLY A N   1 
ATOM   507  C  CA  . GLY A 1 58  ? 17.846 -7.534  6.818   1.00 10.41  ? 53  GLY A CA  1 
ATOM   508  C  C   . GLY A 1 58  ? 17.849 -6.013  6.948   1.00 10.54  ? 53  GLY A C   1 
ATOM   509  O  O   . GLY A 1 58  ? 18.423 -5.466  7.931   1.00 11.43  ? 53  GLY A O   1 
ATOM   510  N  N   . GLY A 1 59  ? 17.253 -5.333  5.951   1.00 10.35  ? 54  GLY A N   1 
ATOM   511  C  CA  . GLY A 1 59  ? 17.167 -3.887  5.966   1.00 10.52  ? 54  GLY A CA  1 
ATOM   512  C  C   . GLY A 1 59  ? 16.294 -3.414  7.157   1.00 9.61   ? 54  GLY A C   1 
ATOM   513  O  O   . GLY A 1 59  ? 16.622 -2.377  7.871   1.00 10.82  ? 54  GLY A O   1 
ATOM   514  N  N   . GLN A 1 60  ? 15.193 -4.119  7.383   1.00 9.26   ? 55  GLN A N   1 
ATOM   515  C  CA  . GLN A 1 60  ? 14.304 -3.730  8.506   1.00 9.05   ? 55  GLN A CA  1 
ATOM   516  C  C   . GLN A 1 60  ? 15.022 -3.955  9.821   1.00 9.28   ? 55  GLN A C   1 
ATOM   517  O  O   . GLN A 1 60  ? 14.891 -3.145  10.750  1.00 10.17  ? 55  GLN A O   1 
ATOM   518  C  CB  . GLN A 1 60  ? 13.061 -4.630  8.542   1.00 10.36  ? 55  GLN A CB  1 
ATOM   519  C  CG  . GLN A 1 60  ? 12.154 -4.319  7.364   1.00 10.79  ? 55  GLN A CG  1 
ATOM   520  C  CD  . GLN A 1 60  ? 11.051 -5.362  7.273   1.00 12.14  ? 55  GLN A CD  1 
ATOM   521  O  OE1 . GLN A 1 60  ? 11.256 -6.567  7.505   1.00 14.34  ? 55  GLN A OE1 1 
ATOM   522  N  NE2 . GLN A 1 60  ? 9.915  -4.922  6.913   1.00 17.16  ? 55  GLN A NE2 1 
ATOM   523  N  N   . ARG A 1 61  ? 15.767 -5.077  9.948   1.00 8.72   ? 56  ARG A N   1 
ATOM   524  C  CA  . ARG A 1 61  ? 16.449 -5.350  11.249  1.00 9.01   ? 56  ARG A CA  1 
ATOM   525  C  C   . ARG A 1 61  ? 17.526 -4.303  11.494  1.00 8.97   ? 56  ARG A C   1 
ATOM   526  O  O   . ARG A 1 61  ? 17.676 -3.831  12.630  1.00 9.69   ? 56  ARG A O   1 
ATOM   527  C  CB  . ARG A 1 61  ? 17.105 -6.720  11.191  1.00 9.60   ? 56  ARG A CB  1 
ATOM   528  C  CG  . ARG A 1 61  ? 16.022 -7.835  11.179  1.00 10.19  ? 56  ARG A CG  1 
ATOM   529  C  CD  . ARG A 1 61  ? 16.669 -9.163  10.715  1.00 11.93  ? 56  ARG A CD  1 
ATOM   530  N  NE  . ARG A 1 61  ? 17.670 -9.636  11.658  1.00 10.74  ? 56  ARG A NE  1 
ATOM   531  C  CZ  . ARG A 1 61  ? 18.771 -10.319 11.313  1.00 11.23  ? 56  ARG A CZ  1 
ATOM   532  N  NH1 . ARG A 1 61  ? 19.067 -10.564 10.023  1.00 11.49  ? 56  ARG A NH1 1 
ATOM   533  N  NH2 . ARG A 1 61  ? 19.604 -10.741 12.287  1.00 12.20  ? 56  ARG A NH2 1 
ATOM   534  N  N   . ALA A 1 62  ? 18.304 -3.973  10.459  1.00 9.95   ? 57  ALA A N   1 
ATOM   535  C  CA  . ALA A 1 62  ? 19.343 -2.950  10.628  1.00 10.84  ? 57  ALA A CA  1 
ATOM   536  C  C   . ALA A 1 62  ? 18.716 -1.628  11.046  1.00 10.98  ? 57  ALA A C   1 
ATOM   537  O  O   . ALA A 1 62  ? 19.229 -0.952  11.942  1.00 10.60  ? 57  ALA A O   1 
ATOM   538  C  CB  . ALA A 1 62  ? 20.153 -2.742  9.349   1.00 11.17  ? 57  ALA A CB  1 
ATOM   539  N  N   . ALA A 1 63  ? 17.588 -1.283  10.433  1.00 9.53   ? 58  ALA A N   1 
ATOM   540  C  CA  . ALA A 1 63  ? 16.899 -0.050  10.854  1.00 10.19  ? 58  ALA A CA  1 
ATOM   541  C  C   . ALA A 1 63  ? 16.399 -0.146  12.295  1.00 9.30   ? 58  ALA A C   1 
ATOM   542  O  O   . ALA A 1 63  ? 16.525 0.820   13.094  1.00 10.39  ? 58  ALA A O   1 
ATOM   543  C  CB  . ALA A 1 63  ? 15.754 0.348   9.913   1.00 9.45   ? 58  ALA A CB  1 
ATOM   544  N  N   . TRP A 1 64  ? 15.784 -1.275  12.628  1.00 8.70   ? 59  TRP A N   1 
ATOM   545  C  CA  . TRP A 1 64  ? 15.288 -1.468  13.996  1.00 9.93   ? 59  TRP A CA  1 
ATOM   546  C  C   . TRP A 1 64  ? 16.446 -1.319  14.992  1.00 10.75  ? 59  TRP A C   1 
ATOM   547  O  O   . TRP A 1 64  ? 16.301 -0.689  16.068  1.00 10.68  ? 59  TRP A O   1 
ATOM   548  C  CB  . TRP A 1 64  ? 14.615 -2.867  14.086  1.00 8.52   ? 59  TRP A CB  1 
ATOM   549  C  CG  . TRP A 1 64  ? 13.996 -3.109  15.419  1.00 9.94   ? 59  TRP A CG  1 
ATOM   550  C  CD1 . TRP A 1 64  ? 12.683 -2.888  15.776  1.00 12.19  ? 59  TRP A CD1 1 
ATOM   551  C  CD2 . TRP A 1 64  ? 14.658 -3.627  16.608  1.00 11.38  ? 59  TRP A CD2 1 
ATOM   552  N  NE1 . TRP A 1 64  ? 12.489 -3.287  17.122  1.00 11.09  ? 59  TRP A NE1 1 
ATOM   553  C  CE2 . TRP A 1 64  ? 13.678 -3.682  17.658  1.00 10.92  ? 59  TRP A CE2 1 
ATOM   554  C  CE3 . TRP A 1 64  ? 15.964 -4.041  16.878  1.00 9.95   ? 59  TRP A CE3 1 
ATOM   555  C  CZ2 . TRP A 1 64  ? 13.977 -4.163  18.959  1.00 12.58  ? 59  TRP A CZ2 1 
ATOM   556  C  CZ3 . TRP A 1 64  ? 16.276 -4.531  18.139  1.00 12.33  ? 59  TRP A CZ3 1 
ATOM   557  C  CH2 . TRP A 1 64  ? 15.288 -4.601  19.177  1.00 13.69  ? 59  TRP A CH2 1 
ATOM   558  N  N   . ARG A 1 65  ? 17.606 -1.856  14.662  1.00 11.42  ? 60  ARG A N   1 
ATOM   559  C  CA  . ARG A 1 65  ? 18.710 -1.728  15.617  1.00 10.86  ? 60  ARG A CA  1 
ATOM   560  C  C   . ARG A 1 65  ? 19.160 -0.279  15.814  1.00 11.54  ? 60  ARG A C   1 
ATOM   561  O  O   . ARG A 1 65  ? 19.436 0.096   16.931  1.00 12.23  ? 60  ARG A O   1 
ATOM   562  C  CB  . ARG A 1 65  ? 19.909 -2.604  15.224  1.00 11.88  ? 60  ARG A CB  1 
ATOM   563  C  CG  . ARG A 1 65  ? 19.606 -4.111  15.311  1.00 13.10  ? 60  ARG A CG  1 
ATOM   564  C  CD  . ARG A 1 65  ? 20.881 -4.956  15.160  1.00 13.94  ? 60  ARG A CD  1 
ATOM   565  N  NE  . ARG A 1 65  ? 21.509 -4.786  13.848  1.00 15.77  ? 60  ARG A NE  1 
ATOM   566  C  CZ  . ARG A 1 65  ? 21.186 -5.513  12.754  1.00 16.77  ? 60  ARG A CZ  1 
ATOM   567  N  NH1 . ARG A 1 65  ? 20.141 -6.358  12.803  1.00 17.84  ? 60  ARG A NH1 1 
ATOM   568  N  NH2 . ARG A 1 65  ? 21.851 -5.340  11.577  1.00 17.77  ? 60  ARG A NH2 1 
ATOM   569  N  N   . VAL A 1 66  ? 19.195 0.489   14.731  1.00 11.13  ? 61  VAL A N   1 
ATOM   570  C  CA  . VAL A 1 66  ? 19.526 1.890   14.815  1.00 12.32  ? 61  VAL A CA  1 
ATOM   571  C  C   . VAL A 1 66  ? 18.524 2.583   15.745  1.00 12.85  ? 61  VAL A C   1 
ATOM   572  O  O   . VAL A 1 66  ? 18.913 3.322   16.707  1.00 13.13  ? 61  VAL A O   1 
ATOM   573  C  CB  . VAL A 1 66  ? 19.485 2.575   13.419  1.00 12.82  ? 61  VAL A CB  1 
ATOM   574  C  CG1 . VAL A 1 66  ? 19.510 4.107   13.558  1.00 12.91  ? 61  VAL A CG1 1 
ATOM   575  C  CG2 . VAL A 1 66  ? 20.657 2.071   12.593  1.00 14.80  ? 61  VAL A CG2 1 
ATOM   576  N  N   . LEU A 1 67  ? 17.232 2.323   15.505  1.00 11.26  ? 62  LEU A N   1 
ATOM   577  C  CA  . LEU A 1 67  ? 16.175 3.046   16.306  1.00 11.28  ? 62  LEU A CA  1 
ATOM   578  C  C   . LEU A 1 67  ? 16.150 2.551   17.757  1.00 11.96  ? 62  LEU A C   1 
ATOM   579  O  O   . LEU A 1 67  ? 16.041 3.338   18.696  1.00 12.04  ? 62  LEU A O   1 
ATOM   580  C  CB  . LEU A 1 67  ? 14.829 2.806   15.645  1.00 9.45   ? 62  LEU A CB  1 
ATOM   581  C  CG  . LEU A 1 67  ? 14.732 3.450   14.242  1.00 9.36   ? 62  LEU A CG  1 
ATOM   582  C  CD1 . LEU A 1 67  ? 13.377 2.990   13.628  1.00 11.75  ? 62  LEU A CD1 1 
ATOM   583  C  CD2 . LEU A 1 67  ? 14.900 4.993   14.268  1.00 12.02  ? 62  LEU A CD2 1 
ATOM   584  N  N   . SER A 1 68  ? 16.316 1.243   17.960  1.00 12.78  ? 63  SER A N   1 
ATOM   585  C  CA  A SER A 1 68  ? 16.430 0.703   19.339  0.60 13.49  ? 63  SER A CA  1 
ATOM   586  C  CA  B SER A 1 68  ? 16.461 0.729   19.331  0.40 13.88  ? 63  SER A CA  1 
ATOM   587  C  C   . SER A 1 68  ? 17.602 1.326   20.126  1.00 14.40  ? 63  SER A C   1 
ATOM   588  O  O   . SER A 1 68  ? 17.470 1.581   21.339  1.00 15.10  ? 63  SER A O   1 
ATOM   589  C  CB  A SER A 1 68  ? 16.538 -0.820  19.342  0.60 13.65  ? 63  SER A CB  1 
ATOM   590  C  CB  B SER A 1 68  ? 16.631 -0.757  19.309  0.40 14.18  ? 63  SER A CB  1 
ATOM   591  O  OG  A SER A 1 68  ? 16.494 -1.346  20.671  0.60 11.40  ? 63  SER A OG  1 
ATOM   592  O  OG  B SER A 1 68  ? 15.361 -1.266  19.109  0.40 14.60  ? 63  SER A OG  1 
ATOM   593  N  N   . SER A 1 69  ? 18.733 1.525   19.476  1.00 14.55  ? 64  SER A N   1 
ATOM   594  C  CA  A SER A 1 69  ? 19.908 2.158   20.107  0.50 15.51  ? 64  SER A CA  1 
ATOM   595  C  CA  B SER A 1 69  ? 19.890 2.148   20.146  0.50 16.07  ? 64  SER A CA  1 
ATOM   596  C  C   . SER A 1 69  ? 19.575 3.573   20.569  1.00 16.48  ? 64  SER A C   1 
ATOM   597  O  O   . SER A 1 69  ? 19.911 3.994   21.702  1.00 17.62  ? 64  SER A O   1 
ATOM   598  C  CB  A SER A 1 69  ? 21.075 2.221   19.111  0.50 15.36  ? 64  SER A CB  1 
ATOM   599  C  CB  B SER A 1 69  ? 21.119 2.136   19.237  0.50 16.55  ? 64  SER A CB  1 
ATOM   600  O  OG  A SER A 1 69  ? 22.247 2.671   19.759  0.50 15.15  ? 64  SER A OG  1 
ATOM   601  O  OG  B SER A 1 69  ? 21.491 0.801   18.969  0.50 18.56  ? 64  SER A OG  1 
ATOM   602  N  N   . ILE A 1 70  ? 18.911 4.320   19.683  1.00 15.29  ? 65  ILE A N   1 
ATOM   603  C  CA  A ILE A 1 70  ? 18.515 5.696   19.965  0.60 15.75  ? 65  ILE A CA  1 
ATOM   604  C  CA  B ILE A 1 70  ? 18.536 5.690   19.995  0.40 16.75  ? 65  ILE A CA  1 
ATOM   605  C  C   . ILE A 1 70  ? 17.569 5.665   21.171  1.00 16.80  ? 65  ILE A C   1 
ATOM   606  O  O   . ILE A 1 70  ? 17.701 6.464   22.130  1.00 17.72  ? 65  ILE A O   1 
ATOM   607  C  CB  A ILE A 1 70  ? 17.920 6.349   18.708  0.60 14.74  ? 65  ILE A CB  1 
ATOM   608  C  CB  B ILE A 1 70  ? 17.981 6.420   18.771  0.40 16.68  ? 65  ILE A CB  1 
ATOM   609  C  CG1 A ILE A 1 70  ? 19.013 6.456   17.639  0.60 11.08  ? 65  ILE A CG1 1 
ATOM   610  C  CG1 B ILE A 1 70  ? 19.142 6.940   17.936  0.40 17.85  ? 65  ILE A CG1 1 
ATOM   611  C  CG2 A ILE A 1 70  ? 17.298 7.758   19.006  0.60 16.46  ? 65  ILE A CG2 1 
ATOM   612  C  CG2 B ILE A 1 70  ? 17.117 7.640   19.163  0.40 17.53  ? 65  ILE A CG2 1 
ATOM   613  C  CD1 A ILE A 1 70  ? 18.538 6.945   16.244  0.60 7.68   ? 65  ILE A CD1 1 
ATOM   614  C  CD1 B ILE A 1 70  ? 19.610 6.043   16.917  0.40 20.16  ? 65  ILE A CD1 1 
ATOM   615  N  N   . GLU A 1 71  ? 16.613 4.751   21.103  1.00 16.00  ? 66  GLU A N   1 
ATOM   616  C  CA  . GLU A 1 71  ? 15.616 4.642   22.135  1.00 16.56  ? 66  GLU A CA  1 
ATOM   617  C  C   . GLU A 1 71  ? 16.293 4.353   23.477  1.00 18.09  ? 66  GLU A C   1 
ATOM   618  O  O   . GLU A 1 71  ? 15.972 4.993   24.509  1.00 19.63  ? 66  GLU A O   1 
ATOM   619  C  CB  . GLU A 1 71  ? 14.628 3.541   21.787  1.00 16.33  ? 66  GLU A CB  1 
ATOM   620  C  CG  . GLU A 1 71  ? 13.408 3.496   22.744  1.00 16.88  ? 66  GLU A CG  1 
ATOM   621  C  CD  . GLU A 1 71  ? 12.438 2.441   22.339  1.00 19.18  ? 66  GLU A CD  1 
ATOM   622  O  OE1 . GLU A 1 71  ? 12.790 1.595   21.454  1.00 21.94  ? 66  GLU A OE1 1 
ATOM   623  O  OE2 . GLU A 1 71  ? 11.339 2.449   22.916  1.00 19.49  ? 66  GLU A OE2 1 
ATOM   624  N  N   . GLN A 1 72  ? 17.246 3.426   23.460  1.00 19.89  ? 67  GLN A N   1 
ATOM   625  C  CA  . GLN A 1 72  ? 17.927 3.030   24.706  1.00 23.19  ? 67  GLN A CA  1 
ATOM   626  C  C   . GLN A 1 72  ? 18.701 4.177   25.299  1.00 25.43  ? 67  GLN A C   1 
ATOM   627  O  O   . GLN A 1 72  ? 18.622 4.398   26.526  1.00 26.28  ? 67  GLN A O   1 
ATOM   628  C  CB  . GLN A 1 72  ? 18.786 1.774   24.483  1.00 24.71  ? 67  GLN A CB  1 
ATOM   629  C  CG  . GLN A 1 72  ? 17.916 0.515   24.314  1.00 28.76  ? 67  GLN A CG  1 
ATOM   630  N  N   . LYS A 1 73  ? 19.410 4.939   24.462  1.00 27.38  ? 68  LYS A N   1 
ATOM   631  C  CA  . LYS A 1 73  ? 20.078 6.190   24.943  1.00 29.10  ? 68  LYS A CA  1 
ATOM   632  C  C   . LYS A 1 73  ? 19.071 7.223   25.522  1.00 30.24  ? 68  LYS A C   1 
ATOM   633  O  O   . LYS A 1 73  ? 19.338 7.883   26.544  1.00 30.28  ? 68  LYS A O   1 
ATOM   634  C  CB  . LYS A 1 73  ? 20.972 6.834   23.871  1.00 29.33  ? 68  LYS A CB  1 
ATOM   635  C  CG  . LYS A 1 73  ? 22.022 5.867   23.248  1.00 31.96  ? 68  LYS A CG  1 
ATOM   636  N  N   . SER A 1 74  ? 17.909 7.363   24.902  1.00 31.38  ? 69  SER A N   1 
ATOM   637  C  CA  . SER A 1 74  ? 16.903 8.331   25.401  1.00 34.27  ? 69  SER A CA  1 
ATOM   638  C  C   . SER A 1 74  ? 16.358 7.919   26.776  1.00 36.01  ? 69  SER A C   1 
ATOM   639  O  O   . SER A 1 74  ? 15.769 8.730   27.482  1.00 37.06  ? 69  SER A O   1 
ATOM   640  C  CB  . SER A 1 74  ? 15.739 8.432   24.421  1.00 34.46  ? 69  SER A CB  1 
ATOM   641  O  OG  . SER A 1 74  ? 14.867 7.294   24.609  1.00 35.91  ? 69  SER A OG  1 
ATOM   642  N  N   . ASN A 1 75  ? 16.538 6.653   27.139  1.00 37.72  ? 70  ASN A N   1 
ATOM   643  C  CA  . ASN A 1 75  ? 16.107 6.126   28.424  1.00 39.78  ? 70  ASN A CA  1 
ATOM   644  C  C   . ASN A 1 75  ? 17.220 6.161   29.523  1.00 40.75  ? 70  ASN A C   1 
ATOM   645  O  O   . ASN A 1 75  ? 16.981 5.796   30.690  1.00 41.50  ? 70  ASN A O   1 
ATOM   646  C  CB  . ASN A 1 75  ? 15.487 4.716   28.229  1.00 39.58  ? 70  ASN A CB  1 
ATOM   647  C  CG  . ASN A 1 75  ? 14.073 4.763   27.623  1.00 40.29  ? 70  ASN A CG  1 
ATOM   648  O  OD1 . ASN A 1 75  ? 13.719 3.972   26.729  1.00 42.04  ? 70  ASN A OD1 1 
ATOM   649  N  ND2 . ASN A 1 75  ? 13.252 5.666   28.128  1.00 42.26  ? 70  ASN A ND2 1 
ATOM   650  N  N   . GLU A 1 76  ? 18.418 6.647   29.187  1.00 40.86  ? 71  GLU A N   1 
ATOM   651  C  CA  . GLU A 1 76  ? 19.513 6.683   30.169  1.00 41.12  ? 71  GLU A CA  1 
ATOM   652  C  C   . GLU A 1 76  ? 19.370 7.871   31.135  1.00 40.90  ? 71  GLU A C   1 
ATOM   653  O  O   . GLU A 1 76  ? 18.661 8.830   30.851  1.00 41.21  ? 71  GLU A O   1 
ATOM   654  C  CB  . GLU A 1 76  ? 20.886 6.716   29.494  1.00 41.47  ? 71  GLU A CB  1 
ATOM   655  C  CG  . GLU A 1 76  ? 21.226 5.441   28.766  1.00 44.51  ? 71  GLU A CG  1 
ATOM   656  C  CD  . GLU A 1 76  ? 22.577 5.519   28.047  1.00 49.96  ? 71  GLU A CD  1 
ATOM   657  O  OE1 . GLU A 1 76  ? 23.201 6.620   28.045  1.00 52.09  ? 71  GLU A OE1 1 
ATOM   658  O  OE2 . GLU A 1 76  ? 23.012 4.467   27.494  1.00 52.78  ? 71  GLU A OE2 1 
ATOM   659  N  N   . GLU A 1 77  ? 20.014 7.771   32.296  1.00 40.41  ? 72  GLU A N   1 
ATOM   660  C  CA  . GLU A 1 77  ? 20.044 8.887   33.261  1.00 40.06  ? 72  GLU A CA  1 
ATOM   661  C  C   . GLU A 1 77  ? 20.683 10.161  32.626  1.00 39.94  ? 72  GLU A C   1 
ATOM   662  O  O   . GLU A 1 77  ? 21.758 10.097  31.983  1.00 40.58  ? 72  GLU A O   1 
ATOM   663  C  CB  . GLU A 1 77  ? 20.766 8.441   34.555  1.00 40.10  ? 72  GLU A CB  1 
ATOM   664  C  CG  . GLU A 1 77  ? 21.851 7.342   34.311  1.00 41.97  ? 72  GLU A CG  1 
ATOM   665  N  N   . GLY A 1 78  ? 19.990 11.297  32.769  1.00 39.04  ? 73  GLY A N   1 
ATOM   666  C  CA  . GLY A 1 78  ? 20.481 12.574  32.232  1.00 38.50  ? 73  GLY A CA  1 
ATOM   667  C  C   . GLY A 1 78  ? 20.054 12.864  30.794  1.00 37.85  ? 73  GLY A C   1 
ATOM   668  O  O   . GLY A 1 78  ? 20.329 13.961  30.271  1.00 37.42  ? 73  GLY A O   1 
ATOM   669  N  N   . SER A 1 79  ? 19.377 11.891  30.149  1.00 36.63  ? 74  SER A N   1 
ATOM   670  C  CA  . SER A 1 79  ? 18.878 12.100  28.761  1.00 35.32  ? 74  SER A CA  1 
ATOM   671  C  C   . SER A 1 79  ? 17.629 12.981  28.737  1.00 35.33  ? 74  SER A C   1 
ATOM   672  O  O   . SER A 1 79  ? 16.709 12.766  29.535  1.00 35.30  ? 74  SER A O   1 
ATOM   673  C  CB  . SER A 1 79  ? 18.591 10.759  28.059  1.00 35.05  ? 74  SER A CB  1 
ATOM   674  O  OG  . SER A 1 79  ? 19.801 10.094  27.755  0.50 34.05  ? 74  SER A OG  1 
ATOM   675  N  N   . GLU A 1 80  ? 17.598 13.960  27.829  1.00 34.07  ? 75  GLU A N   1 
ATOM   676  C  CA  . GLU A 1 80  ? 16.467 14.874  27.737  1.00 34.36  ? 75  GLU A CA  1 
ATOM   677  C  C   . GLU A 1 80  ? 15.234 14.153  27.198  1.00 35.46  ? 75  GLU A C   1 
ATOM   678  O  O   . GLU A 1 80  ? 15.338 13.416  26.207  1.00 35.83  ? 75  GLU A O   1 
ATOM   679  C  CB  . GLU A 1 80  ? 16.829 16.066  26.834  1.00 34.90  ? 75  GLU A CB  1 
ATOM   680  C  CG  . GLU A 1 80  ? 15.962 17.305  27.037  1.00 34.04  ? 75  GLU A CG  1 
ATOM   681  C  CD  . GLU A 1 80  ? 15.756 17.770  28.515  1.00 36.05  ? 75  GLU A CD  1 
ATOM   682  O  OE1 . GLU A 1 80  ? 16.735 18.085  29.257  1.00 31.37  ? 75  GLU A OE1 1 
ATOM   683  O  OE2 . GLU A 1 80  ? 14.558 17.870  28.917  1.00 39.86  ? 75  GLU A OE2 1 
ATOM   684  N  N   . GLU A 1 81  ? 14.089 14.342  27.867  1.00 35.25  ? 76  GLU A N   1 
ATOM   685  C  CA  . GLU A 1 81  ? 12.785 13.822  27.403  1.00 35.65  ? 76  GLU A CA  1 
ATOM   686  C  C   . GLU A 1 81  ? 12.418 14.385  26.016  1.00 35.14  ? 76  GLU A C   1 
ATOM   687  O  O   . GLU A 1 81  ? 12.300 15.631  25.830  1.00 35.85  ? 76  GLU A O   1 
ATOM   688  C  CB  . GLU A 1 81  ? 11.694 14.152  28.451  1.00 37.11  ? 76  GLU A CB  1 
ATOM   689  C  CG  . GLU A 1 81  ? 10.282 13.725  28.100  1.00 39.64  ? 76  GLU A CG  1 
ATOM   690  C  CD  . GLU A 1 81  ? 10.185 12.227  27.807  1.00 44.54  ? 76  GLU A CD  1 
ATOM   691  O  OE1 . GLU A 1 81  ? 10.731 11.421  28.605  1.00 46.15  ? 76  GLU A OE1 1 
ATOM   692  O  OE2 . GLU A 1 81  ? 9.559  11.870  26.780  1.00 47.99  ? 76  GLU A OE2 1 
ATOM   693  N  N   . LYS A 1 82  ? 12.266 13.508  25.032  1.00 33.06  ? 77  LYS A N   1 
ATOM   694  C  CA  . LYS A 1 82  ? 11.953 13.984  23.677  1.00 31.65  ? 77  LYS A CA  1 
ATOM   695  C  C   . LYS A 1 82  ? 10.609 13.533  23.186  1.00 29.91  ? 77  LYS A C   1 
ATOM   696  O  O   . LYS A 1 82  ? 10.261 13.766  22.008  1.00 31.56  ? 77  LYS A O   1 
ATOM   697  C  CB  . LYS A 1 82  ? 13.049 13.667  22.680  1.00 32.07  ? 77  LYS A CB  1 
ATOM   698  C  CG  . LYS A 1 82  ? 14.254 14.611  22.884  1.00 35.40  ? 77  LYS A CG  1 
ATOM   699  C  CD  . LYS A 1 82  ? 15.419 14.188  22.006  1.00 40.80  ? 77  LYS A CD  1 
ATOM   700  C  CE  . LYS A 1 82  ? 16.460 15.313  21.887  1.00 42.01  ? 77  LYS A CE  1 
ATOM   701  N  NZ  . LYS A 1 82  ? 17.178 15.349  20.525  1.00 41.75  ? 77  LYS A NZ  1 
ATOM   702  N  N   . GLY A 1 83  ? 9.841  12.915  24.092  1.00 26.13  ? 78  GLY A N   1 
ATOM   703  C  CA  . GLY A 1 83  ? 8.493  12.495  23.769  1.00 22.34  ? 78  GLY A CA  1 
ATOM   704  C  C   . GLY A 1 83  ? 8.459  11.095  23.184  1.00 19.11  ? 78  GLY A C   1 
ATOM   705  O  O   . GLY A 1 83  ? 9.449  10.356  23.207  1.00 19.85  ? 78  GLY A O   1 
ATOM   706  N  N   . PRO A 1 84  ? 7.316  10.739  22.615  1.00 16.40  ? 79  PRO A N   1 
ATOM   707  C  CA  . PRO A 1 84  ? 7.085  9.401   22.241  1.00 14.62  ? 79  PRO A CA  1 
ATOM   708  C  C   . PRO A 1 84  ? 7.614  9.055   20.862  1.00 13.39  ? 79  PRO A C   1 
ATOM   709  O  O   . PRO A 1 84  ? 7.471  7.898   20.490  1.00 13.38  ? 79  PRO A O   1 
ATOM   710  C  CB  . PRO A 1 84  ? 5.516  9.324   22.255  1.00 15.25  ? 79  PRO A CB  1 
ATOM   711  C  CG  . PRO A 1 84  ? 5.112  10.642  21.805  1.00 16.47  ? 79  PRO A CG  1 
ATOM   712  C  CD  . PRO A 1 84  ? 6.098  11.555  22.465  1.00 16.66  ? 79  PRO A CD  1 
ATOM   713  N  N   . GLU A 1 85  ? 8.233  9.979   20.115  1.00 12.10  ? 80  GLU A N   1 
ATOM   714  C  CA  . GLU A 1 85  ? 8.417  9.694   18.690  1.00 11.91  ? 80  GLU A CA  1 
ATOM   715  C  C   . GLU A 1 85  ? 9.411  8.546   18.434  1.00 12.71  ? 80  GLU A C   1 
ATOM   716  O  O   . GLU A 1 85  ? 9.225  7.775   17.495  1.00 11.32  ? 80  GLU A O   1 
ATOM   717  C  CB  . GLU A 1 85  ? 8.894  10.925  17.888  1.00 11.16  ? 80  GLU A CB  1 
ATOM   718  C  CG  . GLU A 1 85  ? 7.866  12.100  17.806  1.00 12.48  ? 80  GLU A CG  1 
ATOM   719  C  CD  . GLU A 1 85  ? 7.677  12.974  19.086  1.00 13.68  ? 80  GLU A CD  1 
ATOM   720  O  OE1 . GLU A 1 85  ? 8.310  12.756  20.178  1.00 15.58  ? 80  GLU A OE1 1 
ATOM   721  O  OE2 . GLU A 1 85  ? 6.850  13.924  18.999  1.00 15.33  ? 80  GLU A OE2 1 
ATOM   722  N  N   . VAL A 1 86  ? 10.510 8.501   19.182  1.00 13.45  ? 81  VAL A N   1 
ATOM   723  C  CA  . VAL A 1 86  ? 11.487 7.419   18.988  1.00 12.52  ? 81  VAL A CA  1 
ATOM   724  C  C   . VAL A 1 86  ? 10.816 6.073   19.205  1.00 13.23  ? 81  VAL A C   1 
ATOM   725  O  O   . VAL A 1 86  ? 10.930 5.153   18.370  1.00 13.29  ? 81  VAL A O   1 
ATOM   726  C  CB  . VAL A 1 86  ? 12.692 7.564   19.962  1.00 12.46  ? 81  VAL A CB  1 
ATOM   727  C  CG1 . VAL A 1 86  ? 13.560 6.361   19.811  1.00 16.26  ? 81  VAL A CG1 1 
ATOM   728  C  CG2 . VAL A 1 86  ? 13.506 8.838   19.509  1.00 14.90  ? 81  VAL A CG2 1 
ATOM   729  N  N   . ARG A 1 87  ? 10.074 5.941   20.294  1.00 11.87  ? 82  ARG A N   1 
ATOM   730  C  CA  . ARG A 1 87  ? 9.426  4.651   20.589  1.00 12.26  ? 82  ARG A CA  1 
ATOM   731  C  C   . ARG A 1 87  ? 8.394  4.369   19.506  1.00 11.30  ? 82  ARG A C   1 
ATOM   732  O  O   . ARG A 1 87  ? 8.317  3.264   18.998  1.00 12.03  ? 82  ARG A O   1 
ATOM   733  C  CB  . ARG A 1 87  ? 8.748  4.716   21.993  1.00 13.32  ? 82  ARG A CB  1 
ATOM   734  C  CG  . ARG A 1 87  ? 7.846  3.489   22.199  1.00 15.31  ? 82  ARG A CG  1 
ATOM   735  C  CD  . ARG A 1 87  ? 6.993  3.515   23.442  1.00 20.22  ? 82  ARG A CD  1 
ATOM   736  N  NE  . ARG A 1 87  ? 6.124  4.712   23.506  1.00 26.00  ? 82  ARG A NE  1 
ATOM   737  C  CZ  . ARG A 1 87  ? 4.999  4.950   22.792  1.00 28.55  ? 82  ARG A CZ  1 
ATOM   738  N  NH1 . ARG A 1 87  ? 4.544  4.113   21.865  1.00 28.65  ? 82  ARG A NH1 1 
ATOM   739  N  NH2 . ARG A 1 87  ? 4.319  6.062   22.996  1.00 29.51  ? 82  ARG A NH2 1 
ATOM   740  N  N   . GLU A 1 88  ? 7.649  5.383   19.064  1.00 10.63  ? 83  GLU A N   1 
ATOM   741  C  CA  . GLU A 1 88  ? 6.605  5.182   18.033  1.00 10.58  ? 83  GLU A CA  1 
ATOM   742  C  C   . GLU A 1 88  ? 7.238  4.720   16.763  1.00 9.77   ? 83  GLU A C   1 
ATOM   743  O  O   . GLU A 1 88  ? 6.753  3.774   16.148  1.00 10.40  ? 83  GLU A O   1 
ATOM   744  C  CB  . GLU A 1 88  ? 5.841  6.479   17.734  1.00 11.38  ? 83  GLU A CB  1 
ATOM   745  C  CG  . GLU A 1 88  ? 4.900  6.829   18.869  1.00 11.27  ? 83  GLU A CG  1 
ATOM   746  C  CD  . GLU A 1 88  ? 4.318  8.220   18.709  1.00 13.57  ? 83  GLU A CD  1 
ATOM   747  O  OE1 . GLU A 1 88  ? 3.428  8.574   19.535  1.00 14.87  ? 83  GLU A OE1 1 
ATOM   748  O  OE2 . GLU A 1 88  ? 4.755  8.979   17.795  1.00 12.90  ? 83  GLU A OE2 1 
ATOM   749  N  N   . TYR A 1 89  ? 8.345  5.349   16.368  1.00 8.61   ? 84  TYR A N   1 
ATOM   750  C  CA  . TYR A 1 89  ? 8.881  4.981   15.075  1.00 9.64   ? 84  TYR A CA  1 
ATOM   751  C  C   . TYR A 1 89  ? 9.608  3.605   15.128  1.00 10.75  ? 84  TYR A C   1 
ATOM   752  O  O   . TYR A 1 89  ? 9.450  2.809   14.178  1.00 11.25  ? 84  TYR A O   1 
ATOM   753  C  CB  . TYR A 1 89  ? 9.760  6.110   14.543  1.00 9.22   ? 84  TYR A CB  1 
ATOM   754  C  CG  . TYR A 1 89  ? 10.308 5.861   13.165  1.00 9.03   ? 84  TYR A CG  1 
ATOM   755  C  CD1 . TYR A 1 89  ? 9.472  5.432   12.109  1.00 10.59  ? 84  TYR A CD1 1 
ATOM   756  C  CD2 . TYR A 1 89  ? 11.682 6.019   12.925  1.00 10.04  ? 84  TYR A CD2 1 
ATOM   757  C  CE1 . TYR A 1 89  ? 9.997  5.158   10.862  1.00 9.92   ? 84  TYR A CE1 1 
ATOM   758  C  CE2 . TYR A 1 89  ? 12.225 5.777   11.675  1.00 8.85   ? 84  TYR A CE2 1 
ATOM   759  C  CZ  . TYR A 1 89  ? 11.366 5.295   10.657  1.00 9.65   ? 84  TYR A CZ  1 
ATOM   760  O  OH  . TYR A 1 89  ? 11.857 5.034   9.428   1.00 10.90  ? 84  TYR A OH  1 
ATOM   761  N  N   . ARG A 1 90  ? 10.261 3.292   16.265  1.00 8.98   ? 85  ARG A N   1 
ATOM   762  C  CA  . ARG A 1 90  ? 10.846 1.972   16.469  1.00 9.13   ? 85  ARG A CA  1 
ATOM   763  C  C   . ARG A 1 90  ? 9.701  0.928   16.373  1.00 9.96   ? 85  ARG A C   1 
ATOM   764  O  O   . ARG A 1 90  ? 9.846  -0.137  15.744  1.00 10.31  ? 85  ARG A O   1 
ATOM   765  C  CB  . ARG A 1 90  ? 11.525 1.949   17.808  1.00 9.65   ? 85  ARG A CB  1 
ATOM   766  C  CG  . ARG A 1 90  ? 12.378 0.627   18.014  1.00 9.24   ? 85  ARG A CG  1 
ATOM   767  C  CD  . ARG A 1 90  ? 11.557 -0.423  18.776  1.00 10.11  ? 85  ARG A CD  1 
ATOM   768  N  NE  . ARG A 1 90  ? 11.131 0.066   20.085  1.00 12.89  ? 85  ARG A NE  1 
ATOM   769  C  CZ  . ARG A 1 90  ? 10.057 -0.358  20.750  1.00 15.03  ? 85  ARG A CZ  1 
ATOM   770  N  NH1 . ARG A 1 90  ? 9.252  -1.356  20.263  1.00 15.85  ? 85  ARG A NH1 1 
ATOM   771  N  NH2 . ARG A 1 90  ? 9.788  0.204   21.914  1.00 15.73  ? 85  ARG A NH2 1 
ATOM   772  N  N   . GLU A 1 91  ? 8.581  1.210   17.028  1.00 10.58  ? 86  GLU A N   1 
ATOM   773  C  CA  A GLU A 1 91  ? 7.417  0.309   16.963  0.50 10.40  ? 86  GLU A CA  1 
ATOM   774  C  CA  B GLU A 1 91  ? 7.405  0.307   16.942  0.50 11.06  ? 86  GLU A CA  1 
ATOM   775  C  C   . GLU A 1 91  ? 6.882  0.125   15.534  1.00 10.46  ? 86  GLU A C   1 
ATOM   776  O  O   . GLU A 1 91  ? 6.492  -0.958  15.180  1.00 11.63  ? 86  GLU A O   1 
ATOM   777  C  CB  A GLU A 1 91  ? 6.318  0.817   17.922  0.50 11.78  ? 86  GLU A CB  1 
ATOM   778  C  CB  B GLU A 1 91  ? 6.255  0.781   17.848  0.50 12.68  ? 86  GLU A CB  1 
ATOM   779  C  CG  A GLU A 1 91  ? 6.671  0.686   19.445  0.50 9.29   ? 86  GLU A CG  1 
ATOM   780  C  CG  B GLU A 1 91  ? 6.317  0.160   19.242  0.50 14.58  ? 86  GLU A CG  1 
ATOM   781  C  CD  A GLU A 1 91  ? 5.524  1.255   20.323  0.50 13.42  ? 86  GLU A CD  1 
ATOM   782  C  CD  B GLU A 1 91  ? 6.152  -1.409  19.242  0.50 20.01  ? 86  GLU A CD  1 
ATOM   783  O  OE1 A GLU A 1 91  ? 4.658  1.934   19.786  0.50 18.07  ? 86  GLU A OE1 1 
ATOM   784  O  OE1 B GLU A 1 91  ? 5.601  -2.031  18.268  0.50 19.89  ? 86  GLU A OE1 1 
ATOM   785  O  OE2 A GLU A 1 91  ? 5.478  1.053   21.547  0.50 15.70  ? 86  GLU A OE2 1 
ATOM   786  O  OE2 B GLU A 1 91  ? 6.599  -2.030  20.231  0.50 22.66  ? 86  GLU A OE2 1 
ATOM   787  N  N   . LYS A 1 92  ? 6.856  1.205   14.749  1.00 10.12  ? 87  LYS A N   1 
ATOM   788  C  CA  A LYS A 1 92  ? 6.391  1.149   13.361  0.60 10.95  ? 87  LYS A CA  1 
ATOM   789  C  CA  B LYS A 1 92  ? 6.383  1.131   13.381  0.40 10.89  ? 87  LYS A CA  1 
ATOM   790  C  C   . LYS A 1 92  ? 7.271  0.158   12.592  1.00 11.10  ? 87  LYS A C   1 
ATOM   791  O  O   . LYS A 1 92  ? 6.749  -0.727  11.897  1.00 11.11  ? 87  LYS A O   1 
ATOM   792  C  CB  A LYS A 1 92  ? 6.469  2.548   12.691  0.60 10.70  ? 87  LYS A CB  1 
ATOM   793  C  CB  B LYS A 1 92  ? 6.389  2.529   12.739  0.40 11.04  ? 87  LYS A CB  1 
ATOM   794  C  CG  A LYS A 1 92  ? 6.070  2.545   11.122  0.60 15.78  ? 87  LYS A CG  1 
ATOM   795  C  CG  B LYS A 1 92  ? 5.855  2.523   11.276  0.40 13.86  ? 87  LYS A CG  1 
ATOM   796  C  CD  A LYS A 1 92  ? 6.848  3.631   10.280  0.60 20.03  ? 87  LYS A CD  1 
ATOM   797  C  CD  B LYS A 1 92  ? 5.950  3.907   10.656  0.40 17.06  ? 87  LYS A CD  1 
ATOM   798  C  CE  A LYS A 1 92  ? 6.296  3.899   8.865   0.60 23.95  ? 87  LYS A CE  1 
ATOM   799  C  CE  B LYS A 1 92  ? 6.071  3.866   9.133   0.40 19.60  ? 87  LYS A CE  1 
ATOM   800  N  NZ  A LYS A 1 92  ? 4.935  4.474   8.826   0.60 25.50  ? 87  LYS A NZ  1 
ATOM   801  N  NZ  B LYS A 1 92  ? 7.197  2.976   8.675   0.40 18.10  ? 87  LYS A NZ  1 
ATOM   802  N  N   . VAL A 1 93  ? 8.595  0.364   12.677  1.00 10.22  ? 88  VAL A N   1 
ATOM   803  C  CA  . VAL A 1 93  ? 9.548  -0.489  11.976  1.00 10.00  ? 88  VAL A CA  1 
ATOM   804  C  C   . VAL A 1 93  ? 9.422  -1.906  12.505  1.00 10.66  ? 88  VAL A C   1 
ATOM   805  O  O   . VAL A 1 93  ? 9.391  -2.877  11.705  1.00 10.85  ? 88  VAL A O   1 
ATOM   806  C  CB  . VAL A 1 93  ? 11.002 0.035   12.145  1.00 9.38   ? 88  VAL A CB  1 
ATOM   807  C  CG1 . VAL A 1 93  ? 11.942 -0.998  11.447  1.00 10.96  ? 88  VAL A CG1 1 
ATOM   808  C  CG2 . VAL A 1 93  ? 11.116 1.442   11.419  1.00 10.21  ? 88  VAL A CG2 1 
ATOM   809  N  N   . GLU A 1 94  ? 9.280  -2.059  13.830  1.00 10.47  ? 89  GLU A N   1 
ATOM   810  C  CA  . GLU A 1 94  ? 9.170  -3.379  14.442  1.00 9.66   ? 89  GLU A CA  1 
ATOM   811  C  C   . GLU A 1 94  ? 7.950  -4.133  13.919  1.00 11.36  ? 89  GLU A C   1 
ATOM   812  O  O   . GLU A 1 94  ? 8.013  -5.337  13.586  1.00 11.03  ? 89  GLU A O   1 
ATOM   813  C  CB  . GLU A 1 94  ? 9.123  -3.210  15.970  1.00 10.98  ? 89  GLU A CB  1 
ATOM   814  C  CG  . GLU A 1 94  ? 9.144  -4.513  16.723  1.00 11.76  ? 89  GLU A CG  1 
ATOM   815  C  CD  . GLU A 1 94  ? 9.125  -4.245  18.182  1.00 11.57  ? 89  GLU A CD  1 
ATOM   816  O  OE1 . GLU A 1 94  ? 10.083 -3.629  18.632  1.00 11.44  ? 89  GLU A OE1 1 
ATOM   817  O  OE2 . GLU A 1 94  ? 8.177  -4.668  18.889  1.00 15.39  ? 89  GLU A OE2 1 
ATOM   818  N  N   . THR A 1 95  ? 6.837  -3.440  13.807  1.00 11.27  ? 90  THR A N   1 
ATOM   819  C  CA  A THR A 1 95  ? 5.593  -4.064  13.355  0.70 11.63  ? 90  THR A CA  1 
ATOM   820  C  CA  B THR A 1 95  ? 5.613  -4.114  13.374  0.30 11.75  ? 90  THR A CA  1 
ATOM   821  C  C   . THR A 1 95  ? 5.730  -4.498  11.899  1.00 10.82  ? 90  THR A C   1 
ATOM   822  O  O   . THR A 1 95  ? 5.288  -5.545  11.526  1.00 11.61  ? 90  THR A O   1 
ATOM   823  C  CB  A THR A 1 95  ? 4.444  -3.054  13.520  0.70 11.92  ? 90  THR A CB  1 
ATOM   824  C  CB  B THR A 1 95  ? 4.345  -3.279  13.654  0.30 12.05  ? 90  THR A CB  1 
ATOM   825  O  OG1 A THR A 1 95  ? 4.359  -2.691  14.906  0.70 13.34  ? 90  THR A OG1 1 
ATOM   826  O  OG1 B THR A 1 95  ? 4.513  -1.982  13.085  0.30 15.24  ? 90  THR A OG1 1 
ATOM   827  C  CG2 A THR A 1 95  ? 3.150  -3.613  13.037  0.70 11.59  ? 90  THR A CG2 1 
ATOM   828  C  CG2 B THR A 1 95  ? 4.121  -3.134  15.158  0.30 12.03  ? 90  THR A CG2 1 
ATOM   829  N  N   . GLU A 1 96  ? 6.376  -3.667  11.078  1.00 10.71  ? 91  GLU A N   1 
ATOM   830  C  CA  A GLU A 1 96  ? 6.549  -4.057  9.675   0.50 9.24   ? 91  GLU A CA  1 
ATOM   831  C  CA  B GLU A 1 96  ? 6.597  -4.003  9.667   0.50 9.45   ? 91  GLU A CA  1 
ATOM   832  C  C   . GLU A 1 96  ? 7.478  -5.244  9.571   1.00 9.96   ? 91  GLU A C   1 
ATOM   833  O  O   . GLU A 1 96  ? 7.232  -6.139  8.748   1.00 10.17  ? 91  GLU A O   1 
ATOM   834  C  CB  A GLU A 1 96  ? 7.060  -2.907  8.806   0.50 10.04  ? 91  GLU A CB  1 
ATOM   835  C  CB  B GLU A 1 96  ? 7.286  -2.830  8.942   0.50 10.06  ? 91  GLU A CB  1 
ATOM   836  C  CG  A GLU A 1 96  ? 6.068  -1.797  8.770   0.50 9.49   ? 91  GLU A CG  1 
ATOM   837  C  CG  B GLU A 1 96  ? 7.402  -2.989  7.446   0.50 10.61  ? 91  GLU A CG  1 
ATOM   838  C  CD  A GLU A 1 96  ? 6.537  -0.582  8.011   0.50 14.69  ? 91  GLU A CD  1 
ATOM   839  C  CD  B GLU A 1 96  ? 8.217  -1.875  6.757   0.50 11.34  ? 91  GLU A CD  1 
ATOM   840  O  OE1 A GLU A 1 96  ? 7.622  -0.689  7.413   0.50 14.96  ? 91  GLU A OE1 1 
ATOM   841  O  OE1 B GLU A 1 96  ? 7.659  -0.778  6.729   0.50 15.76  ? 91  GLU A OE1 1 
ATOM   842  O  OE2 A GLU A 1 96  ? 5.784  0.444   8.009   0.50 14.39  ? 91  GLU A OE2 1 
ATOM   843  O  OE2 B GLU A 1 96  ? 9.398  -2.083  6.260   0.50 8.83   ? 91  GLU A OE2 1 
ATOM   844  N  N   . LEU A 1 97  ? 8.536  -5.256  10.397  1.00 9.50   ? 92  LEU A N   1 
ATOM   845  C  CA  A LEU A 1 97  ? 9.470  -6.358  10.416  0.50 10.99  ? 92  LEU A CA  1 
ATOM   846  C  CA  B LEU A 1 97  ? 9.470  -6.352  10.433  0.50 11.31  ? 92  LEU A CA  1 
ATOM   847  C  C   . LEU A 1 97  ? 8.716  -7.627  10.840  1.00 11.05  ? 92  LEU A C   1 
ATOM   848  O  O   . LEU A 1 97  ? 8.864  -8.742  10.217  1.00 10.73  ? 92  LEU A O   1 
ATOM   849  C  CB  A LEU A 1 97  ? 10.589 -6.006  11.413  0.50 10.57  ? 92  LEU A CB  1 
ATOM   850  C  CB  B LEU A 1 97  ? 10.558 -5.989  11.459  0.50 11.23  ? 92  LEU A CB  1 
ATOM   851  C  CG  A LEU A 1 97  ? 11.735 -6.960  11.717  0.50 12.63  ? 92  LEU A CG  1 
ATOM   852  C  CG  B LEU A 1 97  ? 11.656 -6.996  11.722  0.50 14.48  ? 92  LEU A CG  1 
ATOM   853  C  CD1 A LEU A 1 97  ? 12.757 -6.188  12.523  0.50 13.21  ? 92  LEU A CD1 1 
ATOM   854  C  CD1 B LEU A 1 97  ? 11.988 -7.657  10.411  0.50 15.52  ? 92  LEU A CD1 1 
ATOM   855  C  CD2 A LEU A 1 97  ? 11.288 -8.243  12.443  0.50 10.12  ? 92  LEU A CD2 1 
ATOM   856  C  CD2 B LEU A 1 97  ? 12.861 -6.259  12.291  0.50 14.61  ? 92  LEU A CD2 1 
ATOM   857  N  N   . GLN A 1 98  ? 7.925  -7.507  11.903  1.00 11.25  ? 93  GLN A N   1 
ATOM   858  C  CA  . GLN A 1 98  ? 7.111  -8.695  12.349  1.00 11.50  ? 93  GLN A CA  1 
ATOM   859  C  C   . GLN A 1 98  ? 6.198  -9.213  11.248  1.00 12.37  ? 93  GLN A C   1 
ATOM   860  O  O   . GLN A 1 98  ? 5.997  -10.390 11.076  1.00 13.56  ? 93  GLN A O   1 
ATOM   861  C  CB  . GLN A 1 98  ? 6.350  -8.387  13.636  1.00 13.12  ? 93  GLN A CB  1 
ATOM   862  C  CG  . GLN A 1 98  ? 7.283  -8.202  14.842  1.00 11.45  ? 93  GLN A CG  1 
ATOM   863  C  CD  . GLN A 1 98  ? 6.527  -7.598  16.001  1.00 11.78  ? 93  GLN A CD  1 
ATOM   864  O  OE1 . GLN A 1 98  ? 5.628  -6.719  15.804  1.00 13.82  ? 93  GLN A OE1 1 
ATOM   865  N  NE2 . GLN A 1 98  ? 6.869  -8.023  17.226  1.00 14.18  ? 93  GLN A NE2 1 
ATOM   866  N  N   . GLY A 1 99  ? 5.628  -8.297  10.496  1.00 11.44  ? 94  GLY A N   1 
ATOM   867  C  CA  . GLY A 1 99  ? 4.729  -8.660  9.417   1.00 12.49  ? 94  GLY A CA  1 
ATOM   868  C  C   . GLY A 1 99  ? 5.443  -9.411  8.320   1.00 11.11  ? 94  GLY A C   1 
ATOM   869  O  O   . GLY A 1 99  ? 4.875  -10.340 7.770   1.00 11.31  ? 94  GLY A O   1 
ATOM   870  N  N   . VAL A 1 100 ? 6.677  -9.042  8.005   1.00 9.39   ? 95  VAL A N   1 
ATOM   871  C  CA  . VAL A 1 100 ? 7.429  -9.771  7.014   1.00 10.36  ? 95  VAL A CA  1 
ATOM   872  C  C   . VAL A 1 100 ? 7.752  -11.150 7.562   1.00 9.01   ? 95  VAL A C   1 
ATOM   873  O  O   . VAL A 1 100 ? 7.598  -12.159 6.837   1.00 8.97   ? 95  VAL A O   1 
ATOM   874  C  CB  . VAL A 1 100 ? 8.720  -9.059  6.633   1.00 9.68   ? 95  VAL A CB  1 
ATOM   875  C  CG1 . VAL A 1 100 ? 9.621  -9.960  5.766   1.00 13.56  ? 95  VAL A CG1 1 
ATOM   876  C  CG2 . VAL A 1 100 ? 8.341  -7.794  5.825   1.00 10.36  ? 95  VAL A CG2 1 
ATOM   877  N  N   . CYS A 1 101 ? 8.192  -11.223 8.811   1.00 8.86   ? 96  CYS A N   1 
ATOM   878  C  CA  . CYS A 1 101 ? 8.466  -12.562 9.387   1.00 9.48   ? 96  CYS A CA  1 
ATOM   879  C  C   . CYS A 1 101 ? 7.210  -13.427 9.366   1.00 10.09  ? 96  CYS A C   1 
ATOM   880  O  O   . CYS A 1 101 ? 7.256  -14.581 9.013   1.00 9.26   ? 96  CYS A O   1 
ATOM   881  C  CB  . CYS A 1 101 ? 9.013  -12.472 10.806  1.00 10.86  ? 96  CYS A CB  1 
ATOM   882  S  SG  . CYS A 1 101 ? 10.597 -11.658 10.937  1.00 11.27  ? 96  CYS A SG  1 
ATOM   883  N  N   . ASP A 1 102 ? 6.061  -12.848 9.676   1.00 9.92   ? 97  ASP A N   1 
ATOM   884  C  CA  . ASP A 1 102 ? 4.821  -13.640 9.673   1.00 11.35  ? 97  ASP A CA  1 
ATOM   885  C  C   . ASP A 1 102 ? 4.467  -14.083 8.277   1.00 11.07  ? 97  ASP A C   1 
ATOM   886  O  O   . ASP A 1 102 ? 3.935  -15.175 8.095   1.00 10.53  ? 97  ASP A O   1 
ATOM   887  C  CB  . ASP A 1 102 ? 3.652  -12.891 10.293  1.00 13.94  ? 97  ASP A CB  1 
ATOM   888  C  CG  . ASP A 1 102 ? 3.783  -12.669 11.812  1.00 15.78  ? 97  ASP A CG  1 
ATOM   889  O  OD1 . ASP A 1 102 ? 4.551  -13.326 12.509  1.00 22.40  ? 97  ASP A OD1 1 
ATOM   890  O  OD2 . ASP A 1 102 ? 3.004  -11.791 12.308  1.00 21.35  ? 97  ASP A OD2 1 
ATOM   891  N  N   . THR A 1 103 ? 4.785  -13.260 7.280   1.00 10.37  ? 98  THR A N   1 
ATOM   892  C  CA  . THR A 1 103 ? 4.484  -13.613 5.876   1.00 10.23  ? 98  THR A CA  1 
ATOM   893  C  C   . THR A 1 103 ? 5.351  -14.816 5.483   1.00 8.39   ? 98  THR A C   1 
ATOM   894  O  O   . THR A 1 103 ? 4.860  -15.798 4.912   1.00 9.58   ? 98  THR A O   1 
ATOM   895  C  CB  . THR A 1 103 ? 4.767  -12.471 4.992   1.00 9.59   ? 98  THR A CB  1 
ATOM   896  O  OG1 . THR A 1 103 ? 3.749  -11.478 5.200   1.00 14.59  ? 98  THR A OG1 1 
ATOM   897  C  CG2 . THR A 1 103 ? 4.731  -12.902 3.507   1.00 10.74  ? 98  THR A CG2 1 
ATOM   898  N  N   . VAL A 1 104 ? 6.629  -14.786 5.854   1.00 8.15   ? 99  VAL A N   1 
ATOM   899  C  CA  . VAL A 1 104 ? 7.533  -15.866 5.435   1.00 7.89   ? 99  VAL A CA  1 
ATOM   900  C  C   . VAL A 1 104 ? 7.117  -17.128 6.176   1.00 8.60   ? 99  VAL A C   1 
ATOM   901  O  O   . VAL A 1 104 ? 7.016  -18.201 5.573   1.00 9.55   ? 99  VAL A O   1 
ATOM   902  C  CB  . VAL A 1 104 ? 9.006  -15.509 5.771   1.00 7.33   ? 99  VAL A CB  1 
ATOM   903  C  CG1 . VAL A 1 104 ? 9.916  -16.708 5.463   1.00 10.49  ? 99  VAL A CG1 1 
ATOM   904  C  CG2 . VAL A 1 104 ? 9.475  -14.271 4.892   1.00 8.55   ? 99  VAL A CG2 1 
ATOM   905  N  N   . LEU A 1 105 ? 6.882  -17.003 7.488   1.00 9.04   ? 100 LEU A N   1 
ATOM   906  C  CA  . LEU A 1 105 ? 6.468  -18.163 8.289   1.00 10.26  ? 100 LEU A CA  1 
ATOM   907  C  C   . LEU A 1 105 ? 5.158  -18.746 7.764   1.00 10.94  ? 100 LEU A C   1 
ATOM   908  O  O   . LEU A 1 105 ? 4.972  -19.986 7.712   1.00 11.97  ? 100 LEU A O   1 
ATOM   909  C  CB  . LEU A 1 105 ? 6.327  -17.771 9.766   1.00 9.01   ? 100 LEU A CB  1 
ATOM   910  C  CG  . LEU A 1 105 ? 7.699  -17.508 10.372  1.00 7.53   ? 100 LEU A CG  1 
ATOM   911  C  CD1 . LEU A 1 105 ? 7.506  -16.918 11.740  1.00 10.94  ? 100 LEU A CD1 1 
ATOM   912  C  CD2 . LEU A 1 105 ? 8.570  -18.789 10.496  1.00 9.98   ? 100 LEU A CD2 1 
ATOM   913  N  N   . GLY A 1 106 ? 4.256  -17.877 7.322   1.00 10.82  ? 101 GLY A N   1 
ATOM   914  C  CA  . GLY A 1 106 ? 3.031  -18.424 6.678   1.00 12.25  ? 101 GLY A CA  1 
ATOM   915  C  C   . GLY A 1 106 ? 3.246  -19.134 5.360   1.00 12.34  ? 101 GLY A C   1 
ATOM   916  O  O   . GLY A 1 106 ? 2.564  -20.163 5.096   1.00 13.52  ? 101 GLY A O   1 
ATOM   917  N  N   . LEU A 1 107 ? 4.190  -18.653 4.535   1.00 9.43   ? 102 LEU A N   1 
ATOM   918  C  CA  . LEU A 1 107 ? 4.487  -19.396 3.297   1.00 9.45   ? 102 LEU A CA  1 
ATOM   919  C  C   . LEU A 1 107 ? 5.061  -20.775 3.666   1.00 9.63   ? 102 LEU A C   1 
ATOM   920  O  O   . LEU A 1 107 ? 4.766  -21.802 3.030   1.00 10.95  ? 102 LEU A O   1 
ATOM   921  C  CB  . LEU A 1 107 ? 5.519  -18.674 2.419   1.00 9.78   ? 102 LEU A CB  1 
ATOM   922  C  CG  . LEU A 1 107 ? 4.961  -17.371 1.839   1.00 12.68  ? 102 LEU A CG  1 
ATOM   923  C  CD1 . LEU A 1 107 ? 6.106  -16.626 1.159   1.00 14.69  ? 102 LEU A CD1 1 
ATOM   924  C  CD2 . LEU A 1 107 ? 3.808  -17.691 0.835   1.00 16.51  ? 102 LEU A CD2 1 
ATOM   925  N  N   . LEU A 1 108 ? 5.955  -20.783 4.638   1.00 9.54   ? 103 LEU A N   1 
ATOM   926  C  CA  . LEU A 1 108 ? 6.569  -22.054 5.043   1.00 10.91  ? 103 LEU A CA  1 
ATOM   927  C  C   . LEU A 1 108 ? 5.508  -22.985 5.564   1.00 10.89  ? 103 LEU A C   1 
ATOM   928  O  O   . LEU A 1 108 ? 5.539  -24.207 5.277   1.00 11.38  ? 103 LEU A O   1 
ATOM   929  C  CB  . LEU A 1 108 ? 7.650  -21.835 6.114   1.00 9.22   ? 103 LEU A CB  1 
ATOM   930  C  CG  . LEU A 1 108 ? 8.858  -21.035 5.582   1.00 10.15  ? 103 LEU A CG  1 
ATOM   931  C  CD1 . LEU A 1 108 ? 9.765  -20.541 6.726   1.00 11.91  ? 103 LEU A CD1 1 
ATOM   932  C  CD2 . LEU A 1 108 ? 9.708  -21.779 4.544   1.00 11.28  ? 103 LEU A CD2 1 
ATOM   933  N  N   . ASP A 1 109 ? 4.582  -22.452 6.343   1.00 11.76  ? 104 ASP A N   1 
ATOM   934  C  CA  . ASP A 1 109 ? 3.483  -23.314 6.858   1.00 14.63  ? 104 ASP A CA  1 
ATOM   935  C  C   . ASP A 1 109 ? 2.363  -23.659 5.886   1.00 15.37  ? 104 ASP A C   1 
ATOM   936  O  O   . ASP A 1 109 ? 1.592  -24.602 6.112   1.00 17.94  ? 104 ASP A O   1 
ATOM   937  C  CB  . ASP A 1 109 ? 2.824  -22.637 8.072   1.00 16.51  ? 104 ASP A CB  1 
ATOM   938  C  CG  . ASP A 1 109 ? 2.158  -23.634 8.955   1.00 22.25  ? 104 ASP A CG  1 
ATOM   939  O  OD1 . ASP A 1 109 ? 2.846  -24.643 9.296   1.00 28.34  ? 104 ASP A OD1 1 
ATOM   940  O  OD2 . ASP A 1 109 ? 0.989  -23.428 9.306   1.00 29.48  ? 104 ASP A OD2 1 
ATOM   941  N  N   . SER A 1 110 ? 2.226  -22.910 4.833   1.00 17.66  ? 105 SER A N   1 
ATOM   942  C  CA  . SER A 1 110 ? 1.155  -23.079 3.849   1.00 20.15  ? 105 SER A CA  1 
ATOM   943  C  C   . SER A 1 110 ? 1.700  -22.932 2.377   1.00 20.34  ? 105 SER A C   1 
ATOM   944  O  O   . SER A 1 110 ? 1.500  -21.883 1.727   1.00 20.10  ? 105 SER A O   1 
ATOM   945  C  CB  . SER A 1 110 ? 0.009  -22.063 4.099   1.00 21.49  ? 105 SER A CB  1 
ATOM   946  O  OG  . SER A 1 110 ? -0.411 -22.028 5.458   1.00 22.91  ? 105 SER A OG  1 
ATOM   947  N  N   . HIS A 1 111 ? 2.360  -23.953 1.806   1.00 18.91  ? 106 HIS A N   1 
ATOM   948  C  CA  . HIS A 1 111 ? 2.528  -25.304 2.340   1.00 19.68  ? 106 HIS A CA  1 
ATOM   949  C  C   . HIS A 1 111 ? 3.908  -25.849 2.002   1.00 18.32  ? 106 HIS A C   1 
ATOM   950  O  O   . HIS A 1 111 ? 4.064  -27.040 1.785   1.00 18.37  ? 106 HIS A O   1 
ATOM   951  C  CB  . HIS A 1 111 ? 1.402  -26.272 1.870   1.00 20.32  ? 106 HIS A CB  1 
ATOM   952  C  CG  . HIS A 1 111 ? 0.033  -25.793 2.249   1.00 22.08  ? 106 HIS A CG  1 
ATOM   953  N  ND1 . HIS A 1 111 ? -0.545 -26.065 3.482   1.00 21.32  ? 106 HIS A ND1 1 
ATOM   954  C  CD2 . HIS A 1 111 ? -0.862 -25.015 1.569   1.00 25.00  ? 106 HIS A CD2 1 
ATOM   955  C  CE1 . HIS A 1 111 ? -1.751 -25.501 3.525   1.00 23.91  ? 106 HIS A CE1 1 
ATOM   956  N  NE2 . HIS A 1 111 ? -1.970 -24.870 2.372   1.00 24.29  ? 106 HIS A NE2 1 
ATOM   957  N  N   . LEU A 1 112 ? 4.923  -24.987 2.068   1.00 15.71  ? 107 LEU A N   1 
ATOM   958  C  CA  . LEU A 1 112 ? 6.246  -25.419 1.670   1.00 13.11  ? 107 LEU A CA  1 
ATOM   959  C  C   . LEU A 1 112 ? 6.842  -26.554 2.468   1.00 13.64  ? 107 LEU A C   1 
ATOM   960  O  O   . LEU A 1 112 ? 7.454  -27.507 1.908   1.00 14.37  ? 107 LEU A O   1 
ATOM   961  C  CB  . LEU A 1 112 ? 7.201  -24.223 1.691   1.00 11.28  ? 107 LEU A CB  1 
ATOM   962  C  CG  . LEU A 1 112 ? 6.899  -23.151 0.660   1.00 9.21   ? 107 LEU A CG  1 
ATOM   963  C  CD1 . LEU A 1 112 ? 7.771  -21.915 0.951   1.00 14.18  ? 107 LEU A CD1 1 
ATOM   964  C  CD2 . LEU A 1 112 ? 7.160  -23.622 -0.800  1.00 13.46  ? 107 LEU A CD2 1 
ATOM   965  N  N   . ILE A 1 113 ? 6.802  -26.423 3.784   1.00 13.33  ? 108 ILE A N   1 
ATOM   966  C  CA  . ILE A 1 113 ? 7.444  -27.451 4.636   1.00 13.12  ? 108 ILE A CA  1 
ATOM   967  C  C   . ILE A 1 113 ? 6.713  -28.768 4.503   1.00 13.61  ? 108 ILE A C   1 
ATOM   968  O  O   . ILE A 1 113 ? 7.351  -29.812 4.273   1.00 13.20  ? 108 ILE A O   1 
ATOM   969  C  CB  . ILE A 1 113 ? 7.522  -27.017 6.111   1.00 12.47  ? 108 ILE A CB  1 
ATOM   970  C  CG1 . ILE A 1 113 ? 8.591  -25.848 6.204   1.00 11.27  ? 108 ILE A CG1 1 
ATOM   971  C  CG2 . ILE A 1 113 ? 7.914  -28.281 6.981   1.00 14.02  ? 108 ILE A CG2 1 
ATOM   972  C  CD1 . ILE A 1 113 ? 8.637  -25.230 7.589   1.00 14.42  ? 108 ILE A CD1 1 
ATOM   973  N  N   . LYS A 1 114 ? 5.387  -28.740 4.545   1.00 14.16  ? 109 LYS A N   1 
ATOM   974  C  CA  . LYS A 1 114 ? 4.680  -30.046 4.484   1.00 15.96  ? 109 LYS A CA  1 
ATOM   975  C  C   . LYS A 1 114 ? 4.903  -30.836 3.164   1.00 16.97  ? 109 LYS A C   1 
ATOM   976  O  O   . LYS A 1 114 ? 4.806  -32.104 3.183   1.00 18.83  ? 109 LYS A O   1 
ATOM   977  C  CB  . LYS A 1 114 ? 3.196  -29.881 4.774   1.00 18.39  ? 109 LYS A CB  1 
ATOM   978  C  CG  . LYS A 1 114 ? 2.396  -29.327 3.638   1.00 21.02  ? 109 LYS A CG  1 
ATOM   979  C  CD  . LYS A 1 114 ? 0.892  -29.392 4.000   1.00 27.41  ? 109 LYS A CD  1 
ATOM   980  C  CE  . LYS A 1 114 ? 0.601  -28.867 5.461   1.00 26.82  ? 109 LYS A CE  1 
ATOM   981  N  NZ  . LYS A 1 114 ? 0.848  -27.409 5.595   1.00 23.41  ? 109 LYS A NZ  1 
ATOM   982  N  N   . GLU A 1 115 ? 5.118  -30.133 2.035   1.00 15.32  ? 110 GLU A N   1 
ATOM   983  C  CA  A GLU A 1 115 ? 5.346  -30.867 0.796   0.50 15.67  ? 110 GLU A CA  1 
ATOM   984  C  CA  B GLU A 1 115 ? 5.347  -30.750 0.732   0.50 15.77  ? 110 GLU A CA  1 
ATOM   985  C  C   . GLU A 1 115 ? 6.819  -31.165 0.501   1.00 15.48  ? 110 GLU A C   1 
ATOM   986  O  O   . GLU A 1 115 ? 7.128  -31.888 -0.495  1.00 17.82  ? 110 GLU A O   1 
ATOM   987  C  CB  A GLU A 1 115 ? 4.703  -30.150 -0.386  0.50 16.55  ? 110 GLU A CB  1 
ATOM   988  C  CB  B GLU A 1 115 ? 4.852  -29.800 -0.400  0.50 16.08  ? 110 GLU A CB  1 
ATOM   989  C  CG  A GLU A 1 115 ? 3.177  -30.016 -0.232  0.50 15.36  ? 110 GLU A CG  1 
ATOM   990  C  CG  B GLU A 1 115 ? 3.274  -29.886 -0.578  0.50 17.09  ? 110 GLU A CG  1 
ATOM   991  C  CD  A GLU A 1 115 ? 2.439  -31.345 -0.311  0.50 17.31  ? 110 GLU A CD  1 
ATOM   992  C  CD  B GLU A 1 115 ? 2.617  -29.045 -1.721  0.50 19.61  ? 110 GLU A CD  1 
ATOM   993  O  OE1 A GLU A 1 115 ? 3.012  -32.366 -0.770  0.50 15.85  ? 110 GLU A OE1 1 
ATOM   994  O  OE1 B GLU A 1 115 ? 1.361  -28.965 -1.654  0.50 21.04  ? 110 GLU A OE1 1 
ATOM   995  O  OE2 A GLU A 1 115 ? 1.263  -31.366 0.087   0.50 19.41  ? 110 GLU A OE2 1 
ATOM   996  O  OE2 B GLU A 1 115 ? 3.282  -28.472 -2.665  0.50 19.80  ? 110 GLU A OE2 1 
ATOM   997  N  N   . ALA A 1 116 ? 7.723  -30.670 1.354   1.00 13.35  ? 111 ALA A N   1 
ATOM   998  C  CA  . ALA A 1 116 ? 9.195  -30.831 1.155   1.00 14.37  ? 111 ALA A CA  1 
ATOM   999  C  C   . ALA A 1 116 ? 9.717  -32.150 1.745   1.00 16.17  ? 111 ALA A C   1 
ATOM   1000 O  O   . ALA A 1 116 ? 9.742  -32.358 2.979   1.00 16.21  ? 111 ALA A O   1 
ATOM   1001 C  CB  . ALA A 1 116 ? 9.986  -29.636 1.768   1.00 13.88  ? 111 ALA A CB  1 
ATOM   1002 N  N   . GLY A 1 117 ? 10.077 -33.055 0.857   1.00 15.95  ? 112 GLY A N   1 
ATOM   1003 C  CA  . GLY A 1 117 ? 10.414 -34.415 1.241   1.00 16.60  ? 112 GLY A CA  1 
ATOM   1004 C  C   . GLY A 1 117 ? 11.893 -34.684 1.092   1.00 16.21  ? 112 GLY A C   1 
ATOM   1005 O  O   . GLY A 1 117 ? 12.446 -35.434 1.846   1.00 20.40  ? 112 GLY A O   1 
ATOM   1006 N  N   . ASP A 1 118 ? 12.556 -34.068 0.139   1.00 14.09  ? 113 ASP A N   1 
ATOM   1007 C  CA  . ASP A 1 118 ? 14.010 -34.223 0.009   1.00 13.56  ? 113 ASP A CA  1 
ATOM   1008 C  C   . ASP A 1 118 ? 14.754 -33.440 1.069   1.00 12.98  ? 113 ASP A C   1 
ATOM   1009 O  O   . ASP A 1 118 ? 14.272 -32.368 1.472   1.00 12.79  ? 113 ASP A O   1 
ATOM   1010 C  CB  . ASP A 1 118 ? 14.447 -33.759 -1.379  1.00 13.30  ? 113 ASP A CB  1 
ATOM   1011 C  CG  . ASP A 1 118 ? 13.922 -34.674 -2.464  1.00 13.87  ? 113 ASP A CG  1 
ATOM   1012 O  OD1 . ASP A 1 118 ? 13.313 -35.782 -2.144  1.00 16.33  ? 113 ASP A OD1 1 
ATOM   1013 O  OD2 . ASP A 1 118 ? 14.159 -34.304 -3.613  1.00 13.73  ? 113 ASP A OD2 1 
ATOM   1014 N  N   . ALA A 1 119 ? 15.890 -33.967 1.552   1.00 13.99  ? 114 ALA A N   1 
ATOM   1015 C  CA  . ALA A 1 119 ? 16.572 -33.253 2.609   1.00 16.04  ? 114 ALA A CA  1 
ATOM   1016 C  C   . ALA A 1 119 ? 16.946 -31.821 2.249   1.00 15.88  ? 114 ALA A C   1 
ATOM   1017 O  O   . ALA A 1 119 ? 16.824 -30.919 3.127   1.00 17.30  ? 114 ALA A O   1 
ATOM   1018 C  CB  . ALA A 1 119 ? 17.853 -34.022 3.059   1.00 17.22  ? 114 ALA A CB  1 
ATOM   1019 N  N   . GLU A 1 120 ? 17.423 -31.606 1.014   1.00 14.41  ? 115 GLU A N   1 
ATOM   1020 C  CA  A GLU A 1 120 ? 17.870 -30.272 0.578   0.60 15.63  ? 115 GLU A CA  1 
ATOM   1021 C  CA  B GLU A 1 120 ? 17.885 -30.263 0.599   0.40 15.95  ? 115 GLU A CA  1 
ATOM   1022 C  C   . GLU A 1 120 ? 16.754 -29.274 0.709   1.00 14.63  ? 115 GLU A C   1 
ATOM   1023 O  O   . GLU A 1 120 ? 16.987 -28.121 1.109   1.00 17.12  ? 115 GLU A O   1 
ATOM   1024 C  CB  A GLU A 1 120 ? 18.354 -30.329 -0.891  0.60 16.57  ? 115 GLU A CB  1 
ATOM   1025 C  CB  B GLU A 1 120 ? 18.477 -30.229 -0.838  0.40 17.28  ? 115 GLU A CB  1 
ATOM   1026 C  CG  A GLU A 1 120 ? 19.695 -31.067 -1.083  0.60 17.82  ? 115 GLU A CG  1 
ATOM   1027 C  CG  B GLU A 1 120 ? 20.028 -30.267 -0.911  0.40 21.06  ? 115 GLU A CG  1 
ATOM   1028 C  CD  A GLU A 1 120 ? 19.606 -32.537 -0.779  0.60 18.36  ? 115 GLU A CD  1 
ATOM   1029 C  CD  B GLU A 1 120 ? 20.640 -29.539 -2.133  0.40 24.55  ? 115 GLU A CD  1 
ATOM   1030 O  OE1 A GLU A 1 120 ? 18.529 -33.162 -1.061  0.60 13.41  ? 115 GLU A OE1 1 
ATOM   1031 O  OE1 B GLU A 1 120 ? 20.190 -28.414 -2.501  0.40 22.52  ? 115 GLU A OE1 1 
ATOM   1032 O  OE2 A GLU A 1 120 ? 20.635 -33.028 -0.259  0.60 21.96  ? 115 GLU A OE2 1 
ATOM   1033 O  OE2 B GLU A 1 120 ? 21.603 -30.104 -2.724  0.40 28.83  ? 115 GLU A OE2 1 
ATOM   1034 N  N   . SER A 1 121 ? 15.525 -29.676 0.393   1.00 12.81  ? 116 SER A N   1 
ATOM   1035 C  CA  . SER A 1 121 ? 14.442 -28.695 0.515   1.00 9.52   ? 116 SER A CA  1 
ATOM   1036 C  C   . SER A 1 121 ? 13.966 -28.609 1.975   1.00 10.24  ? 116 SER A C   1 
ATOM   1037 O  O   . SER A 1 121 ? 13.659 -27.493 2.471   1.00 10.98  ? 116 SER A O   1 
ATOM   1038 C  CB  . SER A 1 121 ? 13.232 -29.006 -0.372  1.00 11.69  ? 116 SER A CB  1 
ATOM   1039 O  OG  . SER A 1 121 ? 12.774 -30.287 -0.066  1.00 13.79  ? 116 SER A OG  1 
ATOM   1040 N  N   . ARG A 1 122 ? 13.819 -29.752 2.641   1.00 9.32   ? 117 ARG A N   1 
ATOM   1041 C  CA  A ARG A 1 122 ? 13.273 -29.758 3.996   0.60 10.01  ? 117 ARG A CA  1 
ATOM   1042 C  CA  B ARG A 1 122 ? 13.238 -29.710 3.993   0.40 10.35  ? 117 ARG A CA  1 
ATOM   1043 C  C   . ARG A 1 122 ? 14.164 -28.970 4.942   1.00 9.69   ? 117 ARG A C   1 
ATOM   1044 O  O   . ARG A 1 122 ? 13.694 -28.149 5.726   1.00 9.60   ? 117 ARG A O   1 
ATOM   1045 C  CB  A ARG A 1 122 ? 13.136 -31.195 4.490   0.60 11.03  ? 117 ARG A CB  1 
ATOM   1046 C  CB  B ARG A 1 122 ? 12.875 -31.101 4.538   0.40 11.92  ? 117 ARG A CB  1 
ATOM   1047 C  CG  A ARG A 1 122 ? 12.476 -31.206 5.783   0.60 12.59  ? 117 ARG A CG  1 
ATOM   1048 C  CG  B ARG A 1 122 ? 11.611 -31.072 5.379   0.40 14.73  ? 117 ARG A CG  1 
ATOM   1049 C  CD  A ARG A 1 122 ? 11.624 -32.468 5.988   0.60 15.09  ? 117 ARG A CD  1 
ATOM   1050 C  CD  B ARG A 1 122 ? 11.235 -32.457 5.974   0.40 21.56  ? 117 ARG A CD  1 
ATOM   1051 N  NE  A ARG A 1 122 ? 10.678 -32.249 7.110   0.60 17.10  ? 117 ARG A NE  1 
ATOM   1052 N  NE  B ARG A 1 122 ? 11.926 -33.611 5.393   0.40 25.60  ? 117 ARG A NE  1 
ATOM   1053 C  CZ  A ARG A 1 122 ? 9.421  -31.870 6.956   0.60 15.83  ? 117 ARG A CZ  1 
ATOM   1054 C  CZ  B ARG A 1 122 ? 12.239 -34.718 6.076   0.40 26.33  ? 117 ARG A CZ  1 
ATOM   1055 N  NH1 A ARG A 1 122 ? 8.904  -31.666 5.720   0.60 14.98  ? 117 ARG A NH1 1 
ATOM   1056 N  NH1 B ARG A 1 122 ? 11.940 -34.824 7.358   0.40 26.08  ? 117 ARG A NH1 1 
ATOM   1057 N  NH2 A ARG A 1 122 ? 8.678  -31.710 8.039   0.60 16.32  ? 117 ARG A NH2 1 
ATOM   1058 N  NH2 B ARG A 1 122 ? 12.868 -35.718 5.490   0.40 28.73  ? 117 ARG A NH2 1 
ATOM   1059 N  N   . VAL A 1 123 ? 15.465 -29.233 4.861   1.00 9.29   ? 118 VAL A N   1 
ATOM   1060 C  CA  . VAL A 1 123 ? 16.410 -28.554 5.776   1.00 8.67   ? 118 VAL A CA  1 
ATOM   1061 C  C   . VAL A 1 123 ? 16.416 -27.037 5.462   1.00 8.34   ? 118 VAL A C   1 
ATOM   1062 O  O   . VAL A 1 123 ? 16.478 -26.209 6.365   1.00 8.78   ? 118 VAL A O   1 
ATOM   1063 C  CB  . VAL A 1 123 ? 17.838 -29.156 5.644   1.00 9.34   ? 118 VAL A CB  1 
ATOM   1064 C  CG1 . VAL A 1 123 ? 18.857 -28.336 6.458   1.00 8.58   ? 118 VAL A CG1 1 
ATOM   1065 C  CG2 . VAL A 1 123 ? 17.805 -30.655 6.112   1.00 9.71   ? 118 VAL A CG2 1 
ATOM   1066 N  N   . PHE A 1 124 ? 16.445 -26.703 4.181   1.00 8.42   ? 119 PHE A N   1 
ATOM   1067 C  CA  A PHE A 1 124 ? 16.401 -25.324 3.775   0.70 7.71   ? 119 PHE A CA  1 
ATOM   1068 C  CA  B PHE A 1 124 ? 16.367 -25.324 3.741   0.30 7.81   ? 119 PHE A CA  1 
ATOM   1069 C  C   . PHE A 1 124 ? 15.197 -24.594 4.405   1.00 7.41   ? 119 PHE A C   1 
ATOM   1070 O  O   . PHE A 1 124 ? 15.351 -23.463 4.997   1.00 8.22   ? 119 PHE A O   1 
ATOM   1071 C  CB  A PHE A 1 124 ? 16.335 -25.287 2.225   0.70 6.98   ? 119 PHE A CB  1 
ATOM   1072 C  CB  B PHE A 1 124 ? 16.194 -25.305 2.210   0.30 7.37   ? 119 PHE A CB  1 
ATOM   1073 C  CG  A PHE A 1 124 ? 16.597 -23.915 1.606   0.70 7.59   ? 119 PHE A CG  1 
ATOM   1074 C  CG  B PHE A 1 124 ? 16.220 -23.923 1.601   0.30 8.65   ? 119 PHE A CG  1 
ATOM   1075 C  CD1 A PHE A 1 124 ? 15.531 -22.959 1.552   0.70 7.70   ? 119 PHE A CD1 1 
ATOM   1076 C  CD1 B PHE A 1 124 ? 17.374 -23.427 1.029   0.30 8.60   ? 119 PHE A CD1 1 
ATOM   1077 C  CD2 A PHE A 1 124 ? 17.834 -23.598 1.028   0.70 8.10   ? 119 PHE A CD2 1 
ATOM   1078 C  CD2 B PHE A 1 124 ? 15.070 -23.128 1.595   0.30 6.82   ? 119 PHE A CD2 1 
ATOM   1079 C  CE1 A PHE A 1 124 ? 15.723 -21.706 0.912   0.70 7.18   ? 119 PHE A CE1 1 
ATOM   1080 C  CE1 B PHE A 1 124 ? 17.386 -22.165 0.448   0.30 9.01   ? 119 PHE A CE1 1 
ATOM   1081 C  CE2 A PHE A 1 124 ? 18.031 -22.355 0.379   0.70 9.14   ? 119 PHE A CE2 1 
ATOM   1082 C  CE2 B PHE A 1 124 ? 15.087 -21.859 1.005   0.30 7.36   ? 119 PHE A CE2 1 
ATOM   1083 C  CZ  A PHE A 1 124 ? 16.983 -21.413 0.325   0.70 5.96   ? 119 PHE A CZ  1 
ATOM   1084 C  CZ  B PHE A 1 124 ? 16.250 -21.390 0.452   0.30 7.77   ? 119 PHE A CZ  1 
ATOM   1085 N  N   . TYR A 1 125 ? 13.993 -25.177 4.269   1.00 7.40   ? 120 TYR A N   1 
ATOM   1086 C  CA  . TYR A 1 125 ? 12.822 -24.477 4.733   1.00 6.99   ? 120 TYR A CA  1 
ATOM   1087 C  C   . TYR A 1 125 ? 12.797 -24.413 6.248   1.00 7.89   ? 120 TYR A C   1 
ATOM   1088 O  O   . TYR A 1 125 ? 12.277 -23.433 6.842   1.00 8.62   ? 120 TYR A O   1 
ATOM   1089 C  CB  . TYR A 1 125 ? 11.562 -25.137 4.245   1.00 6.80   ? 120 TYR A CB  1 
ATOM   1090 C  CG  . TYR A 1 125 ? 11.322 -25.010 2.745   1.00 5.54   ? 120 TYR A CG  1 
ATOM   1091 C  CD1 . TYR A 1 125 ? 11.490 -23.773 2.047   1.00 7.05   ? 120 TYR A CD1 1 
ATOM   1092 C  CD2 . TYR A 1 125 ? 10.896 -26.121 2.006   1.00 6.54   ? 120 TYR A CD2 1 
ATOM   1093 C  CE1 . TYR A 1 125 ? 11.270 -23.703 0.693   1.00 7.97   ? 120 TYR A CE1 1 
ATOM   1094 C  CE2 . TYR A 1 125 ? 10.662 -26.041 0.605   1.00 6.25   ? 120 TYR A CE2 1 
ATOM   1095 C  CZ  . TYR A 1 125 ? 10.879 -24.844 -0.030  1.00 8.53   ? 120 TYR A CZ  1 
ATOM   1096 O  OH  . TYR A 1 125 ? 10.637 -24.780 -1.364  1.00 11.78  ? 120 TYR A OH  1 
ATOM   1097 N  N   . LEU A 1 126 ? 13.301 -25.474 6.903   1.00 8.14   ? 121 LEU A N   1 
ATOM   1098 C  CA  . LEU A 1 126 ? 13.324 -25.467 8.360   1.00 7.88   ? 121 LEU A CA  1 
ATOM   1099 C  C   . LEU A 1 126 ? 14.337 -24.457 8.861   1.00 8.37   ? 121 LEU A C   1 
ATOM   1100 O  O   . LEU A 1 126 ? 14.079 -23.817 9.899   1.00 9.22   ? 121 LEU A O   1 
ATOM   1101 C  CB  . LEU A 1 126 ? 13.645 -26.879 8.924   1.00 7.22   ? 121 LEU A CB  1 
ATOM   1102 C  CG  . LEU A 1 126 ? 12.413 -27.779 8.807   1.00 9.30   ? 121 LEU A CG  1 
ATOM   1103 C  CD1 . LEU A 1 126 ? 12.969 -29.221 9.089   1.00 11.56  ? 121 LEU A CD1 1 
ATOM   1104 C  CD2 . LEU A 1 126 ? 11.290 -27.377 9.827   1.00 10.60  ? 121 LEU A CD2 1 
ATOM   1105 N  N   . LYS A 1 127 ? 15.480 -24.313 8.161   1.00 7.14   ? 122 LYS A N   1 
ATOM   1106 C  CA  . LYS A 1 127 ? 16.408 -23.249 8.514   1.00 6.86   ? 122 LYS A CA  1 
ATOM   1107 C  C   . LYS A 1 127 ? 15.692 -21.881 8.381   1.00 7.98   ? 122 LYS A C   1 
ATOM   1108 O  O   . LYS A 1 127 ? 15.811 -21.046 9.308   1.00 7.46   ? 122 LYS A O   1 
ATOM   1109 C  CB  . LYS A 1 127 ? 17.585 -23.253 7.590   1.00 7.29   ? 122 LYS A CB  1 
ATOM   1110 C  CG  . LYS A 1 127 ? 18.495 -22.041 7.853   1.00 7.29   ? 122 LYS A CG  1 
ATOM   1111 C  CD  . LYS A 1 127 ? 19.804 -22.094 6.944   1.00 8.11   ? 122 LYS A CD  1 
ATOM   1112 C  CE  . LYS A 1 127 ? 20.579 -20.763 7.083   1.00 10.62  ? 122 LYS A CE  1 
ATOM   1113 N  NZ  . LYS A 1 127 ? 19.844 -19.551 6.432   1.00 9.77   ? 122 LYS A NZ  1 
ATOM   1114 N  N   . MET A 1 128 ? 14.984 -21.660 7.252   1.00 8.44   ? 123 MET A N   1 
ATOM   1115 C  CA  . MET A 1 128 ? 14.257 -20.385 7.148   1.00 7.87   ? 123 MET A CA  1 
ATOM   1116 C  C   . MET A 1 128 ? 13.304 -20.235 8.294   1.00 8.44   ? 123 MET A C   1 
ATOM   1117 O  O   . MET A 1 128 ? 13.202 -19.129 8.829   1.00 8.62   ? 123 MET A O   1 
ATOM   1118 C  CB  . MET A 1 128 ? 13.452 -20.311 5.856   1.00 8.04   ? 123 MET A CB  1 
ATOM   1119 C  CG  . MET A 1 128 ? 14.377 -20.161 4.602   1.00 8.76   ? 123 MET A CG  1 
ATOM   1120 S  SD  . MET A 1 128 ? 13.400 -19.952 3.117   1.00 10.00  ? 123 MET A SD  1 
ATOM   1121 C  CE  . MET A 1 128 ? 12.620 -18.362 3.448   1.00 9.50   ? 123 MET A CE  1 
ATOM   1122 N  N   . LYS A 1 129 ? 12.593 -21.301 8.680   1.00 8.22   ? 124 LYS A N   1 
ATOM   1123 C  CA  . LYS A 1 129 ? 11.615 -21.155 9.753   1.00 7.81   ? 124 LYS A CA  1 
ATOM   1124 C  C   . LYS A 1 129 ? 12.362 -20.707 11.062  1.00 8.29   ? 124 LYS A C   1 
ATOM   1125 O  O   . LYS A 1 129 ? 11.891 -19.800 11.776  1.00 7.77   ? 124 LYS A O   1 
ATOM   1126 C  CB  . LYS A 1 129 ? 10.847 -22.470 9.963   1.00 8.31   ? 124 LYS A CB  1 
ATOM   1127 C  CG  . LYS A 1 129 ? 9.823  -22.364 11.109  1.00 10.33  ? 124 LYS A CG  1 
ATOM   1128 C  CD  . LYS A 1 129 ? 9.003  -23.684 11.133  1.00 12.09  ? 124 LYS A CD  1 
ATOM   1129 C  CE  . LYS A 1 129 ? 7.886  -23.657 12.214  1.00 14.96  ? 124 LYS A CE  1 
ATOM   1130 N  NZ  . LYS A 1 129 ? 7.002  -24.862 12.067  1.00 18.94  ? 124 LYS A NZ  1 
ATOM   1131 N  N   . GLY A 1 130 ? 13.519 -21.350 11.347  1.00 6.71   ? 125 GLY A N   1 
ATOM   1132 C  CA  . GLY A 1 130 ? 14.391 -20.990 12.462  1.00 7.15   ? 125 GLY A CA  1 
ATOM   1133 C  C   . GLY A 1 130 ? 14.782 -19.518 12.354  1.00 8.18   ? 125 GLY A C   1 
ATOM   1134 O  O   . GLY A 1 130 ? 14.715 -18.801 13.373  1.00 8.82   ? 125 GLY A O   1 
ATOM   1135 N  N   . ASP A 1 131 ? 15.210 -19.101 11.156  1.00 7.73   ? 126 ASP A N   1 
ATOM   1136 C  CA  . ASP A 1 131 ? 15.723 -17.704 10.969  1.00 7.13   ? 126 ASP A CA  1 
ATOM   1137 C  C   . ASP A 1 131 ? 14.609 -16.700 11.256  1.00 7.58   ? 126 ASP A C   1 
ATOM   1138 O  O   . ASP A 1 131 ? 14.874 -15.730 11.983  1.00 7.70   ? 126 ASP A O   1 
ATOM   1139 C  CB  . ASP A 1 131 ? 16.226 -17.472 9.521   1.00 6.40   ? 126 ASP A CB  1 
ATOM   1140 C  CG  . ASP A 1 131 ? 17.495 -18.232 9.207   1.00 7.80   ? 126 ASP A CG  1 
ATOM   1141 O  OD1 . ASP A 1 131 ? 18.263 -18.657 10.124  1.00 10.63  ? 126 ASP A OD1 1 
ATOM   1142 O  OD2 . ASP A 1 131 ? 17.698 -18.405 7.984   1.00 9.86   ? 126 ASP A OD2 1 
ATOM   1143 N  N   . TYR A 1 132 ? 13.408 -16.920 10.730  1.00 8.13   ? 127 TYR A N   1 
ATOM   1144 C  CA  . TYR A 1 132 ? 12.350 -15.887 10.853  1.00 8.12   ? 127 TYR A CA  1 
ATOM   1145 C  C   . TYR A 1 132 ? 11.809 -15.886 12.266  1.00 9.26   ? 127 TYR A C   1 
ATOM   1146 O  O   . TYR A 1 132 ? 11.439 -14.808 12.746  1.00 9.83   ? 127 TYR A O   1 
ATOM   1147 C  CB  . TYR A 1 132 ? 11.273 -15.955 9.722   1.00 7.60   ? 127 TYR A CB  1 
ATOM   1148 C  CG  . TYR A 1 132 ? 11.971 -15.421 8.460   1.00 7.95   ? 127 TYR A CG  1 
ATOM   1149 C  CD1 . TYR A 1 132 ? 12.738 -16.260 7.639   1.00 7.38   ? 127 TYR A CD1 1 
ATOM   1150 C  CD2 . TYR A 1 132 ? 11.960 -14.063 8.168   1.00 8.29   ? 127 TYR A CD2 1 
ATOM   1151 C  CE1 . TYR A 1 132 ? 13.454 -15.798 6.573   1.00 8.75   ? 127 TYR A CE1 1 
ATOM   1152 C  CE2 . TYR A 1 132 ? 12.688 -13.577 7.105   1.00 8.49   ? 127 TYR A CE2 1 
ATOM   1153 C  CZ  . TYR A 1 132 ? 13.451 -14.449 6.310   1.00 7.67   ? 127 TYR A CZ  1 
ATOM   1154 O  OH  . TYR A 1 132 ? 14.173 -14.015 5.255   1.00 9.56   ? 127 TYR A OH  1 
ATOM   1155 N  N   . TYR A 1 133 ? 11.736 -17.051 12.930  1.00 9.26   ? 128 TYR A N   1 
ATOM   1156 C  CA  . TYR A 1 133 ? 11.413 -16.977 14.364  1.00 9.32   ? 128 TYR A CA  1 
ATOM   1157 C  C   . TYR A 1 133 ? 12.554 -16.269 15.144  1.00 10.31  ? 128 TYR A C   1 
ATOM   1158 O  O   . TYR A 1 133 ? 12.304 -15.540 16.115  1.00 10.68  ? 128 TYR A O   1 
ATOM   1159 C  CB  . TYR A 1 133 ? 11.156 -18.392 14.990  1.00 8.76   ? 128 TYR A CB  1 
ATOM   1160 C  CG  . TYR A 1 133 ? 9.721  -18.820 14.807  1.00 9.56   ? 128 TYR A CG  1 
ATOM   1161 C  CD1 . TYR A 1 133 ? 8.678  -18.175 15.536  1.00 10.60  ? 128 TYR A CD1 1 
ATOM   1162 C  CD2 . TYR A 1 133 ? 9.380  -19.883 13.963  1.00 12.00  ? 128 TYR A CD2 1 
ATOM   1163 C  CE1 . TYR A 1 133 ? 7.315  -18.551 15.353  1.00 15.69  ? 128 TYR A CE1 1 
ATOM   1164 C  CE2 . TYR A 1 133 ? 8.045  -20.287 13.803  1.00 12.91  ? 128 TYR A CE2 1 
ATOM   1165 C  CZ  . TYR A 1 133 ? 7.023  -19.601 14.489  1.00 13.04  ? 128 TYR A CZ  1 
ATOM   1166 O  OH  . TYR A 1 133 ? 5.713  -19.947 14.365  1.00 16.20  ? 128 TYR A OH  1 
ATOM   1167 N  N   . ARG A 1 134 ? 13.813 -16.497 14.753  1.00 10.08  ? 129 ARG A N   1 
ATOM   1168 C  CA  . ARG A 1 134 ? 14.912 -15.827 15.447  1.00 9.25   ? 129 ARG A CA  1 
ATOM   1169 C  C   . ARG A 1 134 ? 14.774 -14.301 15.270  1.00 9.36   ? 129 ARG A C   1 
ATOM   1170 O  O   . ARG A 1 134 ? 15.042 -13.539 16.215  1.00 10.13  ? 129 ARG A O   1 
ATOM   1171 C  CB  . ARG A 1 134 ? 16.237 -16.273 14.833  1.00 9.94   ? 129 ARG A CB  1 
ATOM   1172 C  CG  . ARG A 1 134 ? 17.451 -15.488 15.363  1.00 9.58   ? 129 ARG A CG  1 
ATOM   1173 C  CD  . ARG A 1 134 ? 18.771 -16.261 15.194  1.00 7.74   ? 129 ARG A CD  1 
ATOM   1174 N  NE  . ARG A 1 134 ? 19.020 -16.574 13.756  1.00 8.67   ? 129 ARG A NE  1 
ATOM   1175 C  CZ  . ARG A 1 134 ? 19.671 -15.772 12.910  1.00 8.25   ? 129 ARG A CZ  1 
ATOM   1176 N  NH1 . ARG A 1 134 ? 20.159 -14.566 13.340  1.00 10.33  ? 129 ARG A NH1 1 
ATOM   1177 N  NH2 . ARG A 1 134 ? 19.800 -16.143 11.614  1.00 9.02   ? 129 ARG A NH2 1 
ATOM   1178 N  N   . TYR A 1 135 ? 14.440 -13.848 14.052  1.00 8.78   ? 130 TYR A N   1 
ATOM   1179 C  CA  . TYR A 1 135 ? 14.217 -12.426 13.880  1.00 8.35   ? 130 TYR A CA  1 
ATOM   1180 C  C   . TYR A 1 135 ? 13.051 -11.885 14.726  1.00 9.33   ? 130 TYR A C   1 
ATOM   1181 O  O   . TYR A 1 135 ? 13.126 -10.754 15.254  1.00 10.14  ? 130 TYR A O   1 
ATOM   1182 C  CB  . TYR A 1 135 ? 14.048 -12.029 12.383  1.00 9.80   ? 130 TYR A CB  1 
ATOM   1183 C  CG  . TYR A 1 135 ? 15.109 -12.569 11.487  1.00 9.66   ? 130 TYR A CG  1 
ATOM   1184 C  CD1 . TYR A 1 135 ? 16.432 -12.711 11.952  1.00 9.88   ? 130 TYR A CD1 1 
ATOM   1185 C  CD2 . TYR A 1 135 ? 14.792 -13.000 10.195  1.00 11.33  ? 130 TYR A CD2 1 
ATOM   1186 C  CE1 . TYR A 1 135 ? 17.408 -13.234 11.200  1.00 10.65  ? 130 TYR A CE1 1 
ATOM   1187 C  CE2 . TYR A 1 135 ? 15.782 -13.546 9.395   1.00 11.37  ? 130 TYR A CE2 1 
ATOM   1188 C  CZ  . TYR A 1 135 ? 17.081 -13.682 9.928   1.00 10.04  ? 130 TYR A CZ  1 
ATOM   1189 O  OH  . TYR A 1 135 ? 18.033 -14.177 9.121   1.00 12.97  ? 130 TYR A OH  1 
ATOM   1190 N  N   . LEU A 1 136 ? 11.972 -12.653 14.843  1.00 9.00   ? 131 LEU A N   1 
ATOM   1191 C  CA  . LEU A 1 136 ? 10.904 -12.307 15.806  1.00 10.64  ? 131 LEU A CA  1 
ATOM   1192 C  C   . LEU A 1 136 ? 11.455 -12.239 17.240  1.00 10.57  ? 131 LEU A C   1 
ATOM   1193 O  O   . LEU A 1 136 ? 11.095 -11.307 18.032  1.00 11.88  ? 131 LEU A O   1 
ATOM   1194 C  CB  . LEU A 1 136 ? 9.744  -13.324 15.750  1.00 10.27  ? 131 LEU A CB  1 
ATOM   1195 C  CG  . LEU A 1 136 ? 8.894  -13.192 14.448  1.00 10.44  ? 131 LEU A CG  1 
ATOM   1196 C  CD1 . LEU A 1 136 ? 7.741  -14.200 14.450  1.00 11.47  ? 131 LEU A CD1 1 
ATOM   1197 C  CD2 . LEU A 1 136 ? 8.248  -11.782 14.300  1.00 12.01  ? 131 LEU A CD2 1 
ATOM   1198 N  N   . ALA A 1 137 ? 12.342 -13.185 17.582  1.00 10.66  ? 132 ALA A N   1 
ATOM   1199 C  CA  . ALA A 1 137 ? 12.902 -13.214 18.959  1.00 11.44  ? 132 ALA A CA  1 
ATOM   1200 C  C   . ALA A 1 137 ? 13.770 -11.966 19.203  1.00 11.77  ? 132 ALA A C   1 
ATOM   1201 O  O   . ALA A 1 137 ? 13.844 -11.475 20.321  1.00 12.77  ? 132 ALA A O   1 
ATOM   1202 C  CB  . ALA A 1 137 ? 13.757 -14.517 19.143  1.00 12.23  ? 132 ALA A CB  1 
ATOM   1203 N  N   . GLU A 1 138 ? 14.449 -11.471 18.174  1.00 12.51  ? 133 GLU A N   1 
ATOM   1204 C  CA  . GLU A 1 138 ? 15.325 -10.292 18.353  1.00 12.45  ? 133 GLU A CA  1 
ATOM   1205 C  C   . GLU A 1 138 ? 14.585 -9.073  18.853  1.00 13.26  ? 133 GLU A C   1 
ATOM   1206 O  O   . GLU A 1 138 ? 15.189 -8.250  19.549  1.00 13.83  ? 133 GLU A O   1 
ATOM   1207 C  CB  . GLU A 1 138 ? 15.985 -9.917  17.019  1.00 11.75  ? 133 GLU A CB  1 
ATOM   1208 C  CG  . GLU A 1 138 ? 17.076 -10.921 16.601  1.00 10.22  ? 133 GLU A CG  1 
ATOM   1209 C  CD  . GLU A 1 138 ? 17.702 -10.565 15.230  1.00 9.25   ? 133 GLU A CD  1 
ATOM   1210 O  OE1 . GLU A 1 138 ? 17.120 -9.771  14.477  1.00 13.31  ? 133 GLU A OE1 1 
ATOM   1211 O  OE2 . GLU A 1 138 ? 18.772 -11.082 14.911  1.00 15.07  ? 133 GLU A OE2 1 
ATOM   1212 N  N   . VAL A 1 139 ? 13.314 -8.930  18.480  1.00 11.90  ? 134 VAL A N   1 
ATOM   1213 C  CA  . VAL A 1 139 ? 12.487 -7.800  18.910  1.00 13.64  ? 134 VAL A CA  1 
ATOM   1214 C  C   . VAL A 1 139 ? 11.423 -8.125  19.968  1.00 14.42  ? 134 VAL A C   1 
ATOM   1215 O  O   . VAL A 1 139 ? 10.707 -7.219  20.435  1.00 15.45  ? 134 VAL A O   1 
ATOM   1216 C  CB  . VAL A 1 139 ? 11.800 -7.146  17.697  1.00 11.72  ? 134 VAL A CB  1 
ATOM   1217 C  CG1 . VAL A 1 139 ? 12.881 -6.836  16.656  1.00 12.44  ? 134 VAL A CG1 1 
ATOM   1218 C  CG2 . VAL A 1 139 ? 10.715 -8.050  17.025  1.00 13.60  ? 134 VAL A CG2 1 
ATOM   1219 N  N   . ALA A 1 140 ? 11.291 -9.393  20.338  1.00 16.10  ? 135 ALA A N   1 
ATOM   1220 C  CA  . ALA A 1 140 ? 10.280 -9.813  21.310  1.00 18.10  ? 135 ALA A CA  1 
ATOM   1221 C  C   . ALA A 1 140 ? 10.686 -9.426  22.735  1.00 21.12  ? 135 ALA A C   1 
ATOM   1222 O  O   . ALA A 1 140 ? 11.859 -9.508  23.104  1.00 21.60  ? 135 ALA A O   1 
ATOM   1223 C  CB  . ALA A 1 140 ? 10.110 -11.314 21.176  1.00 18.17  ? 135 ALA A CB  1 
ATOM   1224 N  N   . THR A 1 141 ? 9.730  -8.934  23.495  1.00 25.11  ? 136 THR A N   1 
ATOM   1225 C  CA  . THR A 1 141 ? 9.984  -8.399  24.846  1.00 31.24  ? 136 THR A CA  1 
ATOM   1226 C  C   . THR A 1 141 ? 8.866  -8.795  25.776  1.00 33.59  ? 136 THR A C   1 
ATOM   1227 O  O   . THR A 1 141 ? 8.985  -8.566  27.012  1.00 36.71  ? 136 THR A O   1 
ATOM   1228 C  CB  . THR A 1 141 ? 10.020 -6.830  24.906  1.00 31.31  ? 136 THR A CB  1 
ATOM   1229 O  OG1 . THR A 1 141 ? 8.751  -6.291  24.499  1.00 29.98  ? 136 THR A OG1 1 
ATOM   1230 C  CG2 . THR A 1 141 ? 11.178 -6.226  24.083  1.00 32.74  ? 136 THR A CG2 1 
ATOM   1231 N  N   . GLY A 1 142 ? 7.792  -9.384  25.224  1.00 35.35  ? 137 GLY A N   1 
ATOM   1232 C  CA  . GLY A 1 142 ? 6.578  -9.734  26.009  1.00 36.81  ? 137 GLY A CA  1 
ATOM   1233 C  C   . GLY A 1 142 ? 6.413  -11.191 26.492  1.00 37.92  ? 137 GLY A C   1 
ATOM   1234 O  O   . GLY A 1 142 ? 7.392  -11.992 26.532  1.00 37.39  ? 137 GLY A O   1 
ATOM   1235 N  N   . ASP A 1 143 ? 5.155  -11.510 26.823  1.00 38.20  ? 138 ASP A N   1 
ATOM   1236 C  CA  . ASP A 1 143 ? 4.682  -12.827 27.324  1.00 39.23  ? 138 ASP A CA  1 
ATOM   1237 C  C   . ASP A 1 143 ? 5.117  -14.005 26.444  1.00 37.39  ? 138 ASP A C   1 
ATOM   1238 O  O   . ASP A 1 143 ? 5.215  -15.158 26.902  1.00 37.54  ? 138 ASP A O   1 
ATOM   1239 C  CB  . ASP A 1 143 ? 3.123  -12.844 27.406  1.00 40.51  ? 138 ASP A CB  1 
ATOM   1240 C  CG  . ASP A 1 143 ? 2.568  -12.320 28.754  1.00 45.60  ? 138 ASP A CG  1 
ATOM   1241 O  OD1 . ASP A 1 143 ? 3.257  -11.469 29.395  1.00 49.16  ? 138 ASP A OD1 1 
ATOM   1242 O  OD2 . ASP A 1 143 ? 1.407  -12.737 29.147  1.00 49.34  ? 138 ASP A OD2 1 
ATOM   1243 N  N   . ASP A 1 144 ? 5.350  -13.678 25.178  1.00 35.98  ? 139 ASP A N   1 
ATOM   1244 C  CA  . ASP A 1 144 ? 5.554  -14.632 24.118  1.00 34.27  ? 139 ASP A CA  1 
ATOM   1245 C  C   . ASP A 1 144 ? 7.003  -14.918 23.751  1.00 30.46  ? 139 ASP A C   1 
ATOM   1246 O  O   . ASP A 1 144 ? 7.236  -15.792 22.916  1.00 28.59  ? 139 ASP A O   1 
ATOM   1247 C  CB  . ASP A 1 144 ? 4.841  -14.133 22.842  1.00 36.86  ? 139 ASP A CB  1 
ATOM   1248 C  CG  . ASP A 1 144 ? 3.638  -14.973 22.494  1.00 41.87  ? 139 ASP A CG  1 
ATOM   1249 O  OD1 . ASP A 1 144 ? 2.750  -14.436 21.791  1.00 47.82  ? 139 ASP A OD1 1 
ATOM   1250 O  OD2 . ASP A 1 144 ? 3.591  -16.167 22.902  1.00 46.15  ? 139 ASP A OD2 1 
ATOM   1251 N  N   . LYS A 1 145 ? 7.949  -14.158 24.310  1.00 27.69  ? 140 LYS A N   1 
ATOM   1252 C  CA  A LYS A 1 145 ? 9.350  -14.260 23.940  0.60 25.39  ? 140 LYS A CA  1 
ATOM   1253 C  CA  B LYS A 1 145 ? 9.332  -14.280 23.879  0.40 25.14  ? 140 LYS A CA  1 
ATOM   1254 C  C   . LYS A 1 145 ? 9.856  -15.710 24.071  1.00 23.55  ? 140 LYS A C   1 
ATOM   1255 O  O   . LYS A 1 145 ? 10.482 -16.261 23.167  1.00 21.18  ? 140 LYS A O   1 
ATOM   1256 C  CB  A LYS A 1 145 ? 10.179 -13.337 24.817  0.60 26.55  ? 140 LYS A CB  1 
ATOM   1257 C  CB  B LYS A 1 145 ? 10.229 -13.243 24.549  0.40 25.65  ? 140 LYS A CB  1 
ATOM   1258 C  CG  A LYS A 1 145 ? 11.596 -13.131 24.372  0.60 28.17  ? 140 LYS A CG  1 
ATOM   1259 C  CG  B LYS A 1 145 ? 11.727 -13.480 24.419  0.40 26.30  ? 140 LYS A CG  1 
ATOM   1260 C  CD  A LYS A 1 145 ? 12.469 -12.551 25.534  0.60 32.28  ? 140 LYS A CD  1 
ATOM   1261 C  CD  B LYS A 1 145 ? 12.326 -12.942 23.116  0.40 26.92  ? 140 LYS A CD  1 
ATOM   1262 C  CE  A LYS A 1 145 ? 13.864 -12.071 25.026  0.60 33.42  ? 140 LYS A CE  1 
ATOM   1263 C  CE  B LYS A 1 145 ? 13.738 -12.366 23.301  0.40 27.28  ? 140 LYS A CE  1 
ATOM   1264 N  NZ  A LYS A 1 145 ? 13.927 -11.764 23.544  0.60 36.01  ? 140 LYS A NZ  1 
ATOM   1265 N  NZ  B LYS A 1 145 ? 14.512 -12.893 24.483  0.40 27.02  ? 140 LYS A NZ  1 
ATOM   1266 N  N   . LYS A 1 146 ? 9.602  -16.339 25.203  1.00 21.69  ? 141 LYS A N   1 
ATOM   1267 C  CA  A LYS A 1 146 ? 10.089 -17.716 25.360  0.50 20.12  ? 141 LYS A CA  1 
ATOM   1268 C  CA  B LYS A 1 146 ? 10.089 -17.725 25.366  0.50 20.22  ? 141 LYS A CA  1 
ATOM   1269 C  C   . LYS A 1 146 ? 9.559  -18.687 24.308  1.00 19.09  ? 141 LYS A C   1 
ATOM   1270 O  O   . LYS A 1 146 ? 10.320 -19.556 23.809  1.00 18.55  ? 141 LYS A O   1 
ATOM   1271 C  CB  A LYS A 1 146 ? 9.777  -18.224 26.766  0.50 20.10  ? 141 LYS A CB  1 
ATOM   1272 C  CB  B LYS A 1 146 ? 9.805  -18.274 26.777  0.50 20.32  ? 141 LYS A CB  1 
ATOM   1273 C  CG  A LYS A 1 146 ? 10.316 -17.295 27.825  0.50 20.51  ? 141 LYS A CG  1 
ATOM   1274 C  CG  B LYS A 1 146 ? 10.978 -18.101 27.737  0.50 21.61  ? 141 LYS A CG  1 
ATOM   1275 C  CD  A LYS A 1 146 ? 10.058 -17.862 29.234  0.50 20.78  ? 141 LYS A CD  1 
ATOM   1276 C  CD  B LYS A 1 146 ? 10.582 -18.375 29.206  0.50 22.99  ? 141 LYS A CD  1 
ATOM   1277 C  CE  A LYS A 1 146 ? 10.632 -16.963 30.313  0.50 21.93  ? 141 LYS A CE  1 
ATOM   1278 C  CE  B LYS A 1 146 ? 11.704 -17.950 30.182  0.50 24.36  ? 141 LYS A CE  1 
ATOM   1279 N  NZ  A LYS A 1 146 ? 10.800 -17.703 31.600  0.50 17.51  ? 141 LYS A NZ  1 
ATOM   1280 N  NZ  B LYS A 1 146 ? 11.912 -16.476 30.251  0.50 26.31  ? 141 LYS A NZ  1 
ATOM   1281 N  N   . ARG A 1 147 ? 8.272  -18.571 23.986  1.00 18.98  ? 142 ARG A N   1 
ATOM   1282 C  CA  A ARG A 1 147 ? 7.683  -19.475 23.002  0.60 18.60  ? 142 ARG A CA  1 
ATOM   1283 C  CA  B ARG A 1 147 ? 7.609  -19.413 22.996  0.40 19.15  ? 142 ARG A CA  1 
ATOM   1284 C  C   . ARG A 1 147 ? 8.240  -19.207 21.621  1.00 17.80  ? 142 ARG A C   1 
ATOM   1285 O  O   . ARG A 1 147 ? 8.486  -20.146 20.886  1.00 18.28  ? 142 ARG A O   1 
ATOM   1286 C  CB  A ARG A 1 147 ? 6.142  -19.465 22.999  0.60 18.57  ? 142 ARG A CB  1 
ATOM   1287 C  CB  B ARG A 1 147 ? 6.109  -19.075 22.933  0.40 19.51  ? 142 ARG A CB  1 
ATOM   1288 C  CG  A ARG A 1 147 ? 5.539  -20.571 23.964  0.60 19.25  ? 142 ARG A CG  1 
ATOM   1289 C  CG  B ARG A 1 147 ? 5.289  -19.487 24.173  0.40 23.36  ? 142 ARG A CG  1 
ATOM   1290 C  CD  A ARG A 1 147 ? 4.011  -20.498 24.028  0.60 22.83  ? 142 ARG A CD  1 
ATOM   1291 C  CD  B ARG A 1 147 ? 3.830  -19.674 23.798  0.40 28.86  ? 142 ARG A CD  1 
ATOM   1292 N  NE  A ARG A 1 147 ? 3.568  -19.253 24.661  0.60 25.96  ? 142 ARG A NE  1 
ATOM   1293 N  NE  B ARG A 1 147 ? 3.661  -20.815 22.896  0.40 32.41  ? 142 ARG A NE  1 
ATOM   1294 C  CZ  A ARG A 1 147 ? 3.216  -19.188 25.932  0.60 26.25  ? 142 ARG A CZ  1 
ATOM   1295 C  CZ  B ARG A 1 147 ? 3.229  -22.017 23.266  0.40 33.80  ? 142 ARG A CZ  1 
ATOM   1296 N  NH1 A ARG A 1 147 ? 3.265  -20.295 26.660  0.60 25.42  ? 142 ARG A NH1 1 
ATOM   1297 N  NH1 B ARG A 1 147 ? 2.894  -22.252 24.532  0.40 33.61  ? 142 ARG A NH1 1 
ATOM   1298 N  NH2 A ARG A 1 147 ? 2.824  -18.034 26.471  0.60 26.72  ? 142 ARG A NH2 1 
ATOM   1299 N  NH2 B ARG A 1 147 ? 3.116  -22.986 22.360  0.40 34.93  ? 142 ARG A NH2 1 
ATOM   1300 N  N   . ILE A 1 148 ? 8.457  -17.936 21.275  1.00 17.07  ? 143 ILE A N   1 
ATOM   1301 C  CA  . ILE A 1 148 ? 9.119  -17.583 19.996  1.00 14.87  ? 143 ILE A CA  1 
ATOM   1302 C  C   . ILE A 1 148 ? 10.531 -18.180 19.926  1.00 13.95  ? 143 ILE A C   1 
ATOM   1303 O  O   . ILE A 1 148 ? 10.919 -18.813 18.916  1.00 14.67  ? 143 ILE A O   1 
ATOM   1304 C  CB  . ILE A 1 148 ? 9.166  -16.076 19.796  1.00 14.83  ? 143 ILE A CB  1 
ATOM   1305 C  CG1 . ILE A 1 148 ? 7.727  -15.537 19.711  1.00 16.13  ? 143 ILE A CG1 1 
ATOM   1306 C  CG2 . ILE A 1 148 ? 10.117 -15.690 18.608  1.00 15.68  ? 143 ILE A CG2 1 
ATOM   1307 C  CD1 . ILE A 1 148 ? 7.628  -13.970 19.862  1.00 17.08  ? 143 ILE A CD1 1 
ATOM   1308 N  N   . ILE A 1 149 ? 11.308 -18.017 20.997  1.00 13.60  ? 144 ILE A N   1 
ATOM   1309 C  CA  . ILE A 1 149 ? 12.646 -18.605 21.065  1.00 13.73  ? 144 ILE A CA  1 
ATOM   1310 C  C   . ILE A 1 149 ? 12.569 -20.125 20.899  1.00 13.27  ? 144 ILE A C   1 
ATOM   1311 O  O   . ILE A 1 149 ? 13.361 -20.740 20.142  1.00 13.70  ? 144 ILE A O   1 
ATOM   1312 C  CB  . ILE A 1 149 ? 13.385 -18.192 22.361  1.00 14.98  ? 144 ILE A CB  1 
ATOM   1313 C  CG1 . ILE A 1 149 ? 13.660 -16.682 22.335  1.00 14.21  ? 144 ILE A CG1 1 
ATOM   1314 C  CG2 . ILE A 1 149 ? 14.630 -19.132 22.697  1.00 14.14  ? 144 ILE A CG2 1 
ATOM   1315 C  CD1 . ILE A 1 149 ? 14.277 -16.179 23.603  1.00 19.64  ? 144 ILE A CD1 1 
ATOM   1316 N  N   . ASP A 1 150 ? 11.612 -20.742 21.562  1.00 13.31  ? 145 ASP A N   1 
ATOM   1317 C  CA  . ASP A 1 150 ? 11.523 -22.183 21.436  1.00 13.87  ? 145 ASP A CA  1 
ATOM   1318 C  C   . ASP A 1 150 ? 11.107 -22.624 20.031  1.00 12.78  ? 145 ASP A C   1 
ATOM   1319 O  O   . ASP A 1 150 ? 11.525 -23.714 19.553  1.00 12.74  ? 145 ASP A O   1 
ATOM   1320 C  CB  . ASP A 1 150 ? 10.575 -22.818 22.470  1.00 13.64  ? 145 ASP A CB  1 
ATOM   1321 C  CG  . ASP A 1 150 ? 10.933 -24.311 22.675  1.00 18.23  ? 145 ASP A CG  1 
ATOM   1322 O  OD1 . ASP A 1 150 ? 12.109 -24.616 23.140  1.00 23.34  ? 145 ASP A OD1 1 
ATOM   1323 O  OD2 . ASP A 1 150 ? 10.082 -25.185 22.261  1.00 22.08  ? 145 ASP A OD2 1 
ATOM   1324 N  N   . SER A 1 151 ? 10.261 -21.820 19.384  1.00 12.09  ? 146 SER A N   1 
ATOM   1325 C  CA  . SER A 1 151 ? 9.890  -22.112 18.001  1.00 11.52  ? 146 SER A CA  1 
ATOM   1326 C  C   . SER A 1 151 ? 11.114 -22.065 17.092  1.00 11.09  ? 146 SER A C   1 
ATOM   1327 O  O   . SER A 1 151 ? 11.286 -22.904 16.208  1.00 10.97  ? 146 SER A O   1 
ATOM   1328 C  CB  . SER A 1 151 ? 8.769  -21.152 17.489  1.00 13.09  ? 146 SER A CB  1 
ATOM   1329 O  OG  . SER A 1 151 ? 7.552  -21.497 18.152  1.00 15.72  ? 146 SER A OG  1 
ATOM   1330 N  N   . ALA A 1 152 ? 11.964 -21.050 17.281  1.00 10.03  ? 147 ALA A N   1 
ATOM   1331 C  CA  . ALA A 1 152 ? 13.207 -20.979 16.491  1.00 9.75   ? 147 ALA A CA  1 
ATOM   1332 C  C   . ALA A 1 152 ? 14.066 -22.210 16.802  1.00 10.55  ? 147 ALA A C   1 
ATOM   1333 O  O   . ALA A 1 152 ? 14.530 -22.889 15.859  1.00 10.90  ? 147 ALA A O   1 
ATOM   1334 C  CB  . ALA A 1 152 ? 13.936 -19.733 16.782  1.00 9.53   ? 147 ALA A CB  1 
ATOM   1335 N  N   . ARG A 1 153 ? 14.273 -22.506 18.084  1.00 11.00  ? 148 ARG A N   1 
ATOM   1336 C  CA  A ARG A 1 153 ? 15.082 -23.641 18.475  0.50 11.48  ? 148 ARG A CA  1 
ATOM   1337 C  CA  B ARG A 1 153 ? 15.094 -23.647 18.464  0.50 11.49  ? 148 ARG A CA  1 
ATOM   1338 C  C   . ARG A 1 153 ? 14.575 -24.935 17.836  1.00 11.81  ? 148 ARG A C   1 
ATOM   1339 O  O   . ARG A 1 153 ? 15.370 -25.734 17.291  1.00 12.22  ? 148 ARG A O   1 
ATOM   1340 C  CB  A ARG A 1 153 ? 15.045 -23.782 20.002  0.50 11.18  ? 148 ARG A CB  1 
ATOM   1341 C  CB  B ARG A 1 153 ? 15.126 -23.820 19.994  0.50 11.27  ? 148 ARG A CB  1 
ATOM   1342 C  CG  A ARG A 1 153 ? 15.977 -24.891 20.507  0.50 11.80  ? 148 ARG A CG  1 
ATOM   1343 C  CG  B ARG A 1 153 ? 16.079 -24.978 20.437  0.50 12.07  ? 148 ARG A CG  1 
ATOM   1344 C  CD  A ARG A 1 153 ? 15.493 -25.408 21.857  0.50 11.12  ? 148 ARG A CD  1 
ATOM   1345 C  CD  B ARG A 1 153 ? 15.944 -25.300 21.955  0.50 13.19  ? 148 ARG A CD  1 
ATOM   1346 N  NE  A ARG A 1 153 ? 14.118 -25.883 21.779  0.50 12.09  ? 148 ARG A NE  1 
ATOM   1347 N  NE  B ARG A 1 153 ? 15.823 -24.054 22.686  0.50 14.66  ? 148 ARG A NE  1 
ATOM   1348 C  CZ  A ARG A 1 153 ? 13.693 -27.022 21.216  0.50 13.85  ? 148 ARG A CZ  1 
ATOM   1349 C  CZ  B ARG A 1 153 ? 16.840 -23.316 23.133  0.50 14.14  ? 148 ARG A CZ  1 
ATOM   1350 N  NH1 A ARG A 1 153 ? 14.516 -27.871 20.614  0.50 10.57  ? 148 ARG A NH1 1 
ATOM   1351 N  NH1 B ARG A 1 153 ? 18.117 -23.768 23.042  0.50 8.76   ? 148 ARG A NH1 1 
ATOM   1352 N  NH2 A ARG A 1 153 ? 12.398 -27.283 21.224  0.50 13.23  ? 148 ARG A NH2 1 
ATOM   1353 N  NH2 B ARG A 1 153 ? 16.542 -22.140 23.723  0.50 12.82  ? 148 ARG A NH2 1 
ATOM   1354 N  N   . SER A 1 154 ? 13.256 -25.164 17.936  1.00 12.49  ? 149 SER A N   1 
ATOM   1355 C  CA  A SER A 1 154 ? 12.654 -26.424 17.443  0.50 11.69  ? 149 SER A CA  1 
ATOM   1356 C  CA  B SER A 1 154 ? 12.686 -26.427 17.452  0.50 12.45  ? 149 SER A CA  1 
ATOM   1357 C  C   . SER A 1 154 ? 12.868 -26.583 15.940  1.00 11.76  ? 149 SER A C   1 
ATOM   1358 O  O   . SER A 1 154 ? 13.230 -27.703 15.451  1.00 11.68  ? 149 SER A O   1 
ATOM   1359 C  CB  A SER A 1 154 ? 11.150 -26.437 17.709  0.50 11.66  ? 149 SER A CB  1 
ATOM   1360 C  CB  B SER A 1 154 ? 11.215 -26.474 17.825  0.50 13.03  ? 149 SER A CB  1 
ATOM   1361 O  OG  A SER A 1 154 ? 10.622 -27.716 17.377  0.50 10.06  ? 149 SER A OG  1 
ATOM   1362 O  OG  B SER A 1 154 ? 11.114 -26.693 19.219  0.50 15.32  ? 149 SER A OG  1 
ATOM   1363 N  N   . ALA A 1 155 ? 12.650 -25.482 15.192  1.00 10.37  ? 150 ALA A N   1 
ATOM   1364 C  CA  . ALA A 1 155 ? 12.835 -25.537 13.738  1.00 10.69  ? 150 ALA A CA  1 
ATOM   1365 C  C   . ALA A 1 155 ? 14.313 -25.822 13.417  1.00 10.38  ? 150 ALA A C   1 
ATOM   1366 O  O   . ALA A 1 155 ? 14.615 -26.703 12.583  1.00 9.46   ? 150 ALA A O   1 
ATOM   1367 C  CB  . ALA A 1 155 ? 12.335 -24.256 13.047  1.00 10.40  ? 150 ALA A CB  1 
ATOM   1368 N  N   . TYR A 1 156 ? 15.232 -25.073 14.056  1.00 9.03   ? 151 TYR A N   1 
ATOM   1369 C  CA  . TYR A 1 156 ? 16.656 -25.316 13.797  1.00 10.48  ? 151 TYR A CA  1 
ATOM   1370 C  C   . TYR A 1 156 ? 17.070 -26.749 14.133  1.00 10.05  ? 151 TYR A C   1 
ATOM   1371 O  O   . TYR A 1 156 ? 17.863 -27.368 13.434  1.00 9.52   ? 151 TYR A O   1 
ATOM   1372 C  CB  . TYR A 1 156 ? 17.513 -24.367 14.610  1.00 9.86   ? 151 TYR A CB  1 
ATOM   1373 C  CG  . TYR A 1 156 ? 17.605 -22.957 14.072  1.00 8.24   ? 151 TYR A CG  1 
ATOM   1374 C  CD1 . TYR A 1 156 ? 17.876 -22.724 12.712  1.00 8.42   ? 151 TYR A CD1 1 
ATOM   1375 C  CD2 . TYR A 1 156 ? 17.494 -21.855 14.948  1.00 8.28   ? 151 TYR A CD2 1 
ATOM   1376 C  CE1 . TYR A 1 156 ? 18.030 -21.410 12.194  1.00 7.18   ? 151 TYR A CE1 1 
ATOM   1377 C  CE2 . TYR A 1 156 ? 17.651 -20.514 14.457  1.00 7.85   ? 151 TYR A CE2 1 
ATOM   1378 C  CZ  . TYR A 1 156 ? 17.939 -20.324 13.100  1.00 8.60   ? 151 TYR A CZ  1 
ATOM   1379 O  OH  . TYR A 1 156 ? 18.094 -19.074 12.621  1.00 10.23  ? 151 TYR A OH  1 
ATOM   1380 N  N   . GLN A 1 157 ? 16.557 -27.241 15.255  1.00 9.35   ? 152 GLN A N   1 
ATOM   1381 C  CA  . GLN A 1 157 ? 16.901 -28.581 15.764  1.00 10.55  ? 152 GLN A CA  1 
ATOM   1382 C  C   . GLN A 1 157 ? 16.462 -29.618 14.749  1.00 10.46  ? 152 GLN A C   1 
ATOM   1383 O  O   . GLN A 1 157 ? 17.236 -30.548 14.456  1.00 11.62  ? 152 GLN A O   1 
ATOM   1384 C  CB  . GLN A 1 157 ? 16.287 -28.864 17.176  1.00 11.19  ? 152 GLN A CB  1 
ATOM   1385 C  CG  . GLN A 1 157 ? 16.870 -30.193 17.711  1.00 16.38  ? 152 GLN A CG  1 
ATOM   1386 C  CD  . GLN A 1 157 ? 18.432 -30.099 17.855  1.00 16.06  ? 152 GLN A CD  1 
ATOM   1387 O  OE1 . GLN A 1 157 ? 18.931 -29.226 18.560  1.00 20.72  ? 152 GLN A OE1 1 
ATOM   1388 N  NE2 . GLN A 1 157 ? 19.192 -31.027 17.213  1.00 20.38  ? 152 GLN A NE2 1 
ATOM   1389 N  N   . GLU A 1 158 ? 15.218 -29.512 14.267  1.00 10.63  ? 153 GLU A N   1 
ATOM   1390 C  CA  A GLU A 1 158 ? 14.749 -30.525 13.298  0.60 11.48  ? 153 GLU A CA  1 
ATOM   1391 C  CA  B GLU A 1 158 ? 14.703 -30.469 13.263  0.40 11.90  ? 153 GLU A CA  1 
ATOM   1392 C  C   . GLU A 1 158 ? 15.588 -30.440 12.023  1.00 11.52  ? 153 GLU A C   1 
ATOM   1393 O  O   . GLU A 1 158 ? 15.923 -31.487 11.456  1.00 11.68  ? 153 GLU A O   1 
ATOM   1394 C  CB  A GLU A 1 158 ? 13.274 -30.366 12.987  0.60 11.25  ? 153 GLU A CB  1 
ATOM   1395 C  CB  B GLU A 1 158 ? 13.290 -30.086 12.859  0.40 12.41  ? 153 GLU A CB  1 
ATOM   1396 C  CG  A GLU A 1 158 ? 12.810 -31.389 11.953  0.60 11.63  ? 153 GLU A CG  1 
ATOM   1397 C  CG  B GLU A 1 158 ? 12.219 -30.358 13.898  0.40 15.47  ? 153 GLU A CG  1 
ATOM   1398 C  CD  A GLU A 1 158 ? 11.381 -31.392 11.644  0.60 14.99  ? 153 GLU A CD  1 
ATOM   1399 C  CD  B GLU A 1 158 ? 10.912 -29.577 13.625  0.40 18.11  ? 153 GLU A CD  1 
ATOM   1400 O  OE1 A GLU A 1 158 ? 10.675 -30.513 12.122  0.60 15.88  ? 153 GLU A OE1 1 
ATOM   1401 O  OE1 B GLU A 1 158 ? 10.148 -29.957 12.725  0.40 19.33  ? 153 GLU A OE1 1 
ATOM   1402 O  OE2 A GLU A 1 158 ? 10.939 -32.348 10.950  0.60 19.06  ? 153 GLU A OE2 1 
ATOM   1403 O  OE2 B GLU A 1 158 ? 10.647 -28.594 14.317  0.40 19.16  ? 153 GLU A OE2 1 
ATOM   1404 N  N   . ALA A 1 159 ? 15.939 -29.208 11.600  1.00 10.16  ? 154 ALA A N   1 
ATOM   1405 C  CA  . ALA A 1 159 ? 16.794 -29.053 10.425  1.00 9.76   ? 154 ALA A CA  1 
ATOM   1406 C  C   . ALA A 1 159 ? 18.148 -29.730 10.677  1.00 10.46  ? 154 ALA A C   1 
ATOM   1407 O  O   . ALA A 1 159 ? 18.680 -30.361 9.759   1.00 10.08  ? 154 ALA A O   1 
ATOM   1408 C  CB  . ALA A 1 159 ? 16.970 -27.604 10.088  1.00 8.84   ? 154 ALA A CB  1 
ATOM   1409 N  N   . MET A 1 160 ? 18.733 -29.537 11.874  1.00 10.00  ? 155 MET A N   1 
ATOM   1410 C  CA  . MET A 1 160 ? 20.025 -30.073 12.203  1.00 10.46  ? 155 MET A CA  1 
ATOM   1411 C  C   . MET A 1 160 ? 19.926 -31.586 12.181  1.00 11.18  ? 155 MET A C   1 
ATOM   1412 O  O   . MET A 1 160 ? 20.834 -32.253 11.631  1.00 12.79  ? 155 MET A O   1 
ATOM   1413 C  CB  . MET A 1 160 ? 20.460 -29.654 13.599  1.00 10.98  ? 155 MET A CB  1 
ATOM   1414 C  CG  . MET A 1 160 ? 20.923 -28.201 13.698  1.00 14.92  ? 155 MET A CG  1 
ATOM   1415 S  SD  . MET A 1 160 ? 22.513 -27.834 12.895  1.00 17.86  ? 155 MET A SD  1 
ATOM   1416 C  CE  . MET A 1 160 ? 23.408 -29.107 13.702  1.00 21.15  ? 155 MET A CE  1 
ATOM   1417 N  N   . ASP A 1 161 ? 18.841 -32.136 12.754  1.00 11.20  ? 156 ASP A N   1 
ATOM   1418 C  CA  . ASP A 1 161 ? 18.748 -33.628 12.814  1.00 11.59  ? 156 ASP A CA  1 
ATOM   1419 C  C   . ASP A 1 161 ? 18.750 -34.199 11.407  1.00 11.72  ? 156 ASP A C   1 
ATOM   1420 O  O   . ASP A 1 161 ? 19.480 -35.200 11.121  1.00 12.55  ? 156 ASP A O   1 
ATOM   1421 C  CB  . ASP A 1 161 ? 17.500 -34.050 13.598  1.00 12.21  ? 156 ASP A CB  1 
ATOM   1422 C  CG  . ASP A 1 161 ? 17.561 -33.649 15.075  1.00 14.46  ? 156 ASP A CG  1 
ATOM   1423 O  OD1 . ASP A 1 161 ? 18.654 -33.364 15.592  1.00 18.02  ? 156 ASP A OD1 1 
ATOM   1424 O  OD2 . ASP A 1 161 ? 16.498 -33.664 15.744  1.00 20.37  ? 156 ASP A OD2 1 
ATOM   1425 N  N   . ILE A 1 162 ? 17.958 -33.584 10.502  1.00 10.62  ? 157 ILE A N   1 
ATOM   1426 C  CA  . ILE A 1 162 ? 17.832 -34.128 9.127   1.00 10.51  ? 157 ILE A CA  1 
ATOM   1427 C  C   . ILE A 1 162 ? 19.176 -33.920 8.394   1.00 11.43  ? 157 ILE A C   1 
ATOM   1428 O  O   . ILE A 1 162 ? 19.666 -34.839 7.730   1.00 10.77  ? 157 ILE A O   1 
ATOM   1429 C  CB  . ILE A 1 162 ? 16.740 -33.418 8.388   1.00 11.36  ? 157 ILE A CB  1 
ATOM   1430 C  CG1 . ILE A 1 162 ? 15.367 -33.690 9.044   1.00 11.44  ? 157 ILE A CG1 1 
ATOM   1431 C  CG2 . ILE A 1 162 ? 16.730 -33.866 6.895   1.00 9.71   ? 157 ILE A CG2 1 
ATOM   1432 C  CD1 . ILE A 1 162 ? 14.237 -32.687 8.572   1.00 13.90  ? 157 ILE A CD1 1 
ATOM   1433 N  N   . SER A 1 163 ? 19.804 -32.743 8.560   1.00 11.32  ? 158 SER A N   1 
ATOM   1434 C  CA  . SER A 1 163 ? 21.029 -32.425 7.820   1.00 11.92  ? 158 SER A CA  1 
ATOM   1435 C  C   . SER A 1 163 ? 22.132 -33.362 8.252   1.00 12.20  ? 158 SER A C   1 
ATOM   1436 O  O   . SER A 1 163 ? 22.896 -33.799 7.432   1.00 12.55  ? 158 SER A O   1 
ATOM   1437 C  CB  . SER A 1 163 ? 21.447 -30.947 7.967   1.00 12.74  ? 158 SER A CB  1 
ATOM   1438 O  OG  . SER A 1 163 ? 21.947 -30.691 9.271   1.00 16.09  ? 158 SER A OG  1 
ATOM   1439 N  N   . LYS A 1 164 ? 22.210 -33.688 9.539   1.00 12.05  ? 159 LYS A N   1 
ATOM   1440 C  CA  A LYS A 1 164 ? 23.250 -34.619 9.963   0.50 13.20  ? 159 LYS A CA  1 
ATOM   1441 C  CA  B LYS A 1 164 ? 23.226 -34.643 10.021  0.50 13.83  ? 159 LYS A CA  1 
ATOM   1442 C  C   . LYS A 1 164 ? 23.055 -36.023 9.405   1.00 14.28  ? 159 LYS A C   1 
ATOM   1443 O  O   . LYS A 1 164 ? 24.041 -36.722 9.113   1.00 16.27  ? 159 LYS A O   1 
ATOM   1444 C  CB  A LYS A 1 164 ? 23.339 -34.629 11.471  0.50 14.47  ? 159 LYS A CB  1 
ATOM   1445 C  CB  B LYS A 1 164 ? 23.194 -34.785 11.548  0.50 15.46  ? 159 LYS A CB  1 
ATOM   1446 C  CG  A LYS A 1 164 ? 23.991 -33.386 11.991  0.50 13.53  ? 159 LYS A CG  1 
ATOM   1447 C  CG  B LYS A 1 164 ? 24.248 -35.791 12.037  0.50 18.20  ? 159 LYS A CG  1 
ATOM   1448 C  CD  A LYS A 1 164 ? 24.121 -33.526 13.475  0.50 17.51  ? 159 LYS A CD  1 
ATOM   1449 C  CD  B LYS A 1 164 ? 24.973 -35.298 13.298  0.50 22.51  ? 159 LYS A CD  1 
ATOM   1450 C  CE  A LYS A 1 164 ? 23.658 -32.272 14.119  0.50 17.16  ? 159 LYS A CE  1 
ATOM   1451 C  CE  B LYS A 1 164 ? 26.308 -35.964 13.463  0.50 23.02  ? 159 LYS A CE  1 
ATOM   1452 N  NZ  A LYS A 1 164 ? 22.374 -32.376 14.861  0.50 21.30  ? 159 LYS A NZ  1 
ATOM   1453 N  NZ  B LYS A 1 164 ? 27.011 -35.219 14.545  0.50 25.43  ? 159 LYS A NZ  1 
ATOM   1454 N  N   . LYS A 1 165 ? 21.814 -36.447 9.287   1.00 14.35  ? 160 LYS A N   1 
ATOM   1455 C  CA  A LYS A 1 165 ? 21.518 -37.778 8.779   0.50 15.35  ? 160 LYS A CA  1 
ATOM   1456 C  CA  B LYS A 1 165 ? 21.481 -37.772 8.781   0.50 15.29  ? 160 LYS A CA  1 
ATOM   1457 C  C   . LYS A 1 165 ? 21.656 -37.858 7.255   1.00 15.26  ? 160 LYS A C   1 
ATOM   1458 O  O   . LYS A 1 165 ? 22.119 -38.883 6.734   1.00 15.48  ? 160 LYS A O   1 
ATOM   1459 C  CB  A LYS A 1 165 ? 20.098 -38.175 9.175   0.50 15.69  ? 160 LYS A CB  1 
ATOM   1460 C  CB  B LYS A 1 165 ? 20.034 -38.088 9.209   0.50 15.29  ? 160 LYS A CB  1 
ATOM   1461 C  CG  A LYS A 1 165 ? 19.872 -38.570 10.631  0.50 17.12  ? 160 LYS A CG  1 
ATOM   1462 C  CG  B LYS A 1 165 ? 19.418 -39.410 8.715   0.50 16.92  ? 160 LYS A CG  1 
ATOM   1463 C  CD  A LYS A 1 165 ? 18.329 -38.666 10.879  0.50 22.39  ? 160 LYS A CD  1 
ATOM   1464 C  CD  B LYS A 1 165 ? 18.102 -39.775 9.465   0.50 21.02  ? 160 LYS A CD  1 
ATOM   1465 C  CE  A LYS A 1 165 ? 17.692 -37.314 11.274  0.50 21.81  ? 160 LYS A CE  1 
ATOM   1466 C  CE  B LYS A 1 165 ? 17.055 -38.629 9.601   0.50 24.44  ? 160 LYS A CE  1 
ATOM   1467 N  NZ  A LYS A 1 165 ? 16.279 -36.825 10.849  0.50 19.02  ? 160 LYS A NZ  1 
ATOM   1468 N  NZ  B LYS A 1 165 ? 16.468 -37.920 8.363   0.50 24.69  ? 160 LYS A NZ  1 
ATOM   1469 N  N   . GLU A 1 166 ? 21.320 -36.771 6.547   1.00 14.32  ? 161 GLU A N   1 
ATOM   1470 C  CA  . GLU A 1 166 ? 21.116 -36.819 5.107   1.00 14.21  ? 161 GLU A CA  1 
ATOM   1471 C  C   . GLU A 1 166 ? 22.065 -36.042 4.227   1.00 13.56  ? 161 GLU A C   1 
ATOM   1472 O  O   . GLU A 1 166 ? 21.997 -36.164 2.993   1.00 17.90  ? 161 GLU A O   1 
ATOM   1473 C  CB  . GLU A 1 166 ? 19.677 -36.364 4.788   1.00 14.68  ? 161 GLU A CB  1 
ATOM   1474 C  CG  . GLU A 1 166 ? 18.601 -37.240 5.442   1.00 21.14  ? 161 GLU A CG  1 
ATOM   1475 C  CD  . GLU A 1 166 ? 18.494 -38.635 4.900   1.00 27.95  ? 161 GLU A CD  1 
ATOM   1476 O  OE1 . GLU A 1 166 ? 18.980 -38.923 3.777   1.00 31.70  ? 161 GLU A OE1 1 
ATOM   1477 O  OE2 . GLU A 1 166 ? 17.862 -39.469 5.611   1.00 34.31  ? 161 GLU A OE2 1 
ATOM   1478 N  N   . MET A 1 167 ? 22.925 -35.225 4.797   1.00 11.96  ? 162 MET A N   1 
ATOM   1479 C  CA  A MET A 1 167 ? 23.757 -34.311 4.005   0.60 11.74  ? 162 MET A CA  1 
ATOM   1480 C  CA  B MET A 1 167 ? 23.734 -34.349 3.982   0.40 11.79  ? 162 MET A CA  1 
ATOM   1481 C  C   . MET A 1 167 ? 25.178 -34.433 4.458   1.00 11.90  ? 162 MET A C   1 
ATOM   1482 O  O   . MET A 1 167 ? 25.435 -34.701 5.633   1.00 12.47  ? 162 MET A O   1 
ATOM   1483 C  CB  A MET A 1 167 ? 23.352 -32.806 4.257   0.60 11.52  ? 162 MET A CB  1 
ATOM   1484 C  CB  B MET A 1 167 ? 23.146 -32.900 4.057   0.40 12.00  ? 162 MET A CB  1 
ATOM   1485 C  CG  A MET A 1 167 ? 22.091 -32.364 3.556   0.60 14.18  ? 162 MET A CG  1 
ATOM   1486 C  CG  B MET A 1 167 ? 21.669 -32.880 3.547   0.40 12.95  ? 162 MET A CG  1 
ATOM   1487 S  SD  A MET A 1 167 ? 21.818 -30.661 4.145   0.60 11.84  ? 162 MET A SD  1 
ATOM   1488 S  SD  B MET A 1 167 ? 20.692 -31.385 3.831   0.40 15.71  ? 162 MET A SD  1 
ATOM   1489 C  CE  A MET A 1 167 ? 20.482 -30.067 3.142   0.60 13.66  ? 162 MET A CE  1 
ATOM   1490 C  CE  B MET A 1 167 ? 21.652 -30.208 2.873   0.40 14.41  ? 162 MET A CE  1 
ATOM   1491 N  N   . PRO A 1 168 ? 26.129 -34.250 3.524   1.00 12.39  ? 163 PRO A N   1 
ATOM   1492 C  CA  . PRO A 1 168 ? 27.532 -34.315 3.929   1.00 13.30  ? 163 PRO A CA  1 
ATOM   1493 C  C   . PRO A 1 168 ? 27.865 -33.107 4.782   1.00 12.58  ? 163 PRO A C   1 
ATOM   1494 O  O   . PRO A 1 168 ? 27.167 -32.074 4.696   1.00 13.30  ? 163 PRO A O   1 
ATOM   1495 C  CB  . PRO A 1 168 ? 28.315 -34.243 2.583   1.00 13.99  ? 163 PRO A CB  1 
ATOM   1496 C  CG  . PRO A 1 168 ? 27.329 -33.518 1.633   1.00 15.40  ? 163 PRO A CG  1 
ATOM   1497 C  CD  . PRO A 1 168 ? 25.952 -34.026 2.081   1.00 12.59  ? 163 PRO A CD  1 
ATOM   1498 N  N   . PRO A 1 169 ? 28.930 -33.204 5.595   1.00 14.00  ? 164 PRO A N   1 
ATOM   1499 C  CA  . PRO A 1 169 ? 29.222 -32.100 6.504   1.00 14.19  ? 164 PRO A CA  1 
ATOM   1500 C  C   . PRO A 1 169 ? 29.648 -30.818 5.798   1.00 13.92  ? 164 PRO A C   1 
ATOM   1501 O  O   . PRO A 1 169 ? 29.730 -29.783 6.459   1.00 13.88  ? 164 PRO A O   1 
ATOM   1502 C  CB  . PRO A 1 169 ? 30.451 -32.572 7.321   1.00 15.14  ? 164 PRO A CB  1 
ATOM   1503 C  CG  . PRO A 1 169 ? 30.740 -33.978 6.853   1.00 16.86  ? 164 PRO A CG  1 
ATOM   1504 C  CD  . PRO A 1 169 ? 29.797 -34.391 5.786   1.00 15.03  ? 164 PRO A CD  1 
ATOM   1505 N  N   . THR A 1 170 ? 29.990 -30.907 4.495   1.00 13.06  ? 165 THR A N   1 
ATOM   1506 C  CA  A THR A 1 170 ? 30.365 -29.730 3.710   0.70 11.76  ? 165 THR A CA  1 
ATOM   1507 C  CA  B THR A 1 170 ? 30.373 -29.737 3.737   0.30 12.67  ? 165 THR A CA  1 
ATOM   1508 C  C   . THR A 1 170 ? 29.215 -29.123 2.958   1.00 11.21  ? 165 THR A C   1 
ATOM   1509 O  O   . THR A 1 170 ? 29.397 -28.082 2.253   1.00 11.82  ? 165 THR A O   1 
ATOM   1510 C  CB  A THR A 1 170 ? 31.482 -30.066 2.677   0.70 10.60  ? 165 THR A CB  1 
ATOM   1511 C  CB  B THR A 1 170 ? 31.538 -30.064 2.782   0.30 12.72  ? 165 THR A CB  1 
ATOM   1512 O  OG1 A THR A 1 170 ? 31.127 -31.295 2.029   0.70 8.80   ? 165 THR A OG1 1 
ATOM   1513 O  OG1 B THR A 1 170 ? 32.381 -31.043 3.398   0.30 14.30  ? 165 THR A OG1 1 
ATOM   1514 C  CG2 A THR A 1 170 ? 32.863 -30.195 3.456   0.70 11.61  ? 165 THR A CG2 1 
ATOM   1515 C  CG2 B THR A 1 170 ? 32.355 -28.861 2.598   0.30 13.86  ? 165 THR A CG2 1 
ATOM   1516 N  N   . HIS A 1 171 ? 28.028 -29.740 3.033   1.00 10.77  ? 166 HIS A N   1 
ATOM   1517 C  CA  . HIS A 1 171 ? 26.961 -29.206 2.231   1.00 10.09  ? 166 HIS A CA  1 
ATOM   1518 C  C   . HIS A 1 171 ? 26.664 -27.755 2.624   1.00 10.73  ? 166 HIS A C   1 
ATOM   1519 O  O   . HIS A 1 171 ? 26.525 -27.460 3.802   1.00 10.87  ? 166 HIS A O   1 
ATOM   1520 C  CB  . HIS A 1 171 ? 25.673 -29.985 2.427   1.00 10.71  ? 166 HIS A CB  1 
ATOM   1521 C  CG  . HIS A 1 171 ? 24.695 -29.724 1.335   1.00 12.60  ? 166 HIS A CG  1 
ATOM   1522 N  ND1 . HIS A 1 171 ? 24.037 -28.500 1.170   1.00 11.16  ? 166 HIS A ND1 1 
ATOM   1523 C  CD2 . HIS A 1 171 ? 24.272 -30.533 0.328   1.00 14.98  ? 166 HIS A CD2 1 
ATOM   1524 C  CE1 . HIS A 1 171 ? 23.233 -28.601 0.111   1.00 13.24  ? 166 HIS A CE1 1 
ATOM   1525 N  NE2 . HIS A 1 171 ? 23.349 -29.819 -0.410  1.00 16.24  ? 166 HIS A NE2 1 
ATOM   1526 N  N   . PRO A 1 172 ? 26.582 -26.834 1.651   1.00 10.53  ? 167 PRO A N   1 
ATOM   1527 C  CA  . PRO A 1 172 ? 26.419 -25.452 2.074   1.00 9.75   ? 167 PRO A CA  1 
ATOM   1528 C  C   . PRO A 1 172 ? 25.158 -25.183 2.900   1.00 9.69   ? 167 PRO A C   1 
ATOM   1529 O  O   . PRO A 1 172 ? 25.150 -24.292 3.744   1.00 10.21  ? 167 PRO A O   1 
ATOM   1530 C  CB  . PRO A 1 172 ? 26.306 -24.712 0.749   1.00 11.64  ? 167 PRO A CB  1 
ATOM   1531 C  CG  . PRO A 1 172 ? 27.146 -25.578 -0.238  1.00 15.56  ? 167 PRO A CG  1 
ATOM   1532 C  CD  . PRO A 1 172 ? 26.801 -26.951 0.179   1.00 12.31  ? 167 PRO A CD  1 
ATOM   1533 N  N   . ILE A 1 173 ? 24.089 -25.963 2.687   1.00 9.23   ? 168 ILE A N   1 
ATOM   1534 C  CA  . ILE A 1 173 ? 22.866 -25.696 3.477   1.00 8.50   ? 168 ILE A CA  1 
ATOM   1535 C  C   . ILE A 1 173 ? 23.158 -26.134 4.914   1.00 8.81   ? 168 ILE A C   1 
ATOM   1536 O  O   . ILE A 1 173 ? 22.731 -25.483 5.879   1.00 10.29  ? 168 ILE A O   1 
ATOM   1537 C  CB  . ILE A 1 173 ? 21.659 -26.442 2.920   1.00 7.89   ? 168 ILE A CB  1 
ATOM   1538 C  CG1 . ILE A 1 173 ? 21.271 -25.854 1.555   1.00 10.31  ? 168 ILE A CG1 1 
ATOM   1539 C  CG2 . ILE A 1 173 ? 20.493 -26.304 3.853   1.00 8.66   ? 168 ILE A CG2 1 
ATOM   1540 C  CD1 . ILE A 1 173 ? 20.310 -26.754 0.826   1.00 10.82  ? 168 ILE A CD1 1 
ATOM   1541 N  N   . ARG A 1 174 ? 23.790 -27.292 5.076   1.00 8.77   ? 169 ARG A N   1 
ATOM   1542 C  CA  A ARG A 1 174 ? 24.220 -27.781 6.369   0.40 9.53   ? 169 ARG A CA  1 
ATOM   1543 C  CA  B ARG A 1 174 ? 24.140 -27.750 6.409   0.60 9.24   ? 169 ARG A CA  1 
ATOM   1544 C  C   . ARG A 1 174 ? 25.071 -26.756 7.110   1.00 9.24   ? 169 ARG A C   1 
ATOM   1545 O  O   . ARG A 1 174 ? 24.839 -26.460 8.309   1.00 8.99   ? 169 ARG A O   1 
ATOM   1546 C  CB  A ARG A 1 174 ? 25.056 -29.032 6.151   0.40 8.58   ? 169 ARG A CB  1 
ATOM   1547 C  CB  B ARG A 1 174 ? 24.736 -29.167 6.344   0.60 6.78   ? 169 ARG A CB  1 
ATOM   1548 C  CG  A ARG A 1 174 ? 25.712 -29.442 7.393   0.40 11.36  ? 169 ARG A CG  1 
ATOM   1549 C  CG  B ARG A 1 174 ? 25.306 -29.683 7.667   0.60 9.07   ? 169 ARG A CG  1 
ATOM   1550 C  CD  A ARG A 1 174 ? 24.603 -29.776 8.264   0.40 13.68  ? 169 ARG A CD  1 
ATOM   1551 C  CD  B ARG A 1 174 ? 25.560 -31.219 7.552   0.60 8.58   ? 169 ARG A CD  1 
ATOM   1552 N  NE  A ARG A 1 174 ? 25.138 -30.384 9.441   0.40 18.58  ? 169 ARG A NE  1 
ATOM   1553 N  NE  B ARG A 1 174 ? 26.199 -31.638 8.779   0.60 6.93   ? 169 ARG A NE  1 
ATOM   1554 C  CZ  A ARG A 1 174 ? 24.936 -29.871 10.617  0.40 16.16  ? 169 ARG A CZ  1 
ATOM   1555 C  CZ  B ARG A 1 174 ? 26.695 -32.860 8.984   0.60 7.03   ? 169 ARG A CZ  1 
ATOM   1556 N  NH1 A ARG A 1 174 ? 24.151 -28.739 10.729  0.40 17.18  ? 169 ARG A NH1 1 
ATOM   1557 N  NH1 B ARG A 1 174 ? 26.664 -33.769 8.023   0.60 8.59   ? 169 ARG A NH1 1 
ATOM   1558 N  NH2 A ARG A 1 174 ? 25.478 -30.483 11.621  0.40 15.36  ? 169 ARG A NH2 1 
ATOM   1559 N  NH2 B ARG A 1 174 ? 27.271 -33.142 10.136  0.60 8.09   ? 169 ARG A NH2 1 
ATOM   1560 N  N   . LEU A 1 175 ? 26.082 -26.238 6.406   1.00 9.19   ? 170 LEU A N   1 
ATOM   1561 C  CA  . LEU A 1 175 ? 26.983 -25.277 7.013   1.00 9.24   ? 170 LEU A CA  1 
ATOM   1562 C  C   . LEU A 1 175 ? 26.247 -23.963 7.358   1.00 8.03   ? 170 LEU A C   1 
ATOM   1563 O  O   . LEU A 1 175 ? 26.454 -23.418 8.445   1.00 9.81   ? 170 LEU A O   1 
ATOM   1564 C  CB  . LEU A 1 175 ? 28.095 -24.945 6.069   1.00 10.32  ? 170 LEU A CB  1 
ATOM   1565 C  CG  . LEU A 1 175 ? 29.032 -26.103 5.770   1.00 8.42   ? 170 LEU A CG  1 
ATOM   1566 C  CD1 . LEU A 1 175 ? 29.965 -25.612 4.685   1.00 11.10  ? 170 LEU A CD1 1 
ATOM   1567 C  CD2 . LEU A 1 175 ? 29.843 -26.343 7.046   1.00 11.80  ? 170 LEU A CD2 1 
ATOM   1568 N  N   . GLY A 1 176 ? 25.389 -23.464 6.485   1.00 8.72   ? 171 GLY A N   1 
ATOM   1569 C  CA  . GLY A 1 176 ? 24.657 -22.216 6.805   1.00 8.41   ? 171 GLY A CA  1 
ATOM   1570 C  C   . GLY A 1 176 ? 23.686 -22.403 7.953   1.00 8.69   ? 171 GLY A C   1 
ATOM   1571 O  O   . GLY A 1 176 ? 23.464 -21.498 8.746   1.00 10.22  ? 171 GLY A O   1 
ATOM   1572 N  N   . LEU A 1 177 ? 23.019 -23.531 7.998   1.00 8.59   ? 172 LEU A N   1 
ATOM   1573 C  CA  . LEU A 1 177 ? 22.127 -23.805 9.106   1.00 7.68   ? 172 LEU A CA  1 
ATOM   1574 C  C   . LEU A 1 177 ? 22.918 -23.795 10.416  1.00 8.17   ? 172 LEU A C   1 
ATOM   1575 O  O   . LEU A 1 177 ? 22.477 -23.225 11.434  1.00 7.79   ? 172 LEU A O   1 
ATOM   1576 C  CB  . LEU A 1 177 ? 21.493 -25.201 8.905   1.00 7.72   ? 172 LEU A CB  1 
ATOM   1577 C  CG  . LEU A 1 177 ? 20.859 -25.831 10.108  1.00 6.41   ? 172 LEU A CG  1 
ATOM   1578 C  CD1 . LEU A 1 177 ? 19.623 -25.002 10.655  1.00 9.48   ? 172 LEU A CD1 1 
ATOM   1579 C  CD2 . LEU A 1 177 ? 20.441 -27.322 9.787   1.00 10.59  ? 172 LEU A CD2 1 
ATOM   1580 N  N   . ALA A 1 178 ? 24.080 -24.434 10.406  1.00 8.63   ? 173 ALA A N   1 
ATOM   1581 C  CA  . ALA A 1 178 ? 24.842 -24.512 11.643  1.00 8.62   ? 173 ALA A CA  1 
ATOM   1582 C  C   . ALA A 1 178 ? 25.362 -23.151 12.037  1.00 9.84   ? 173 ALA A C   1 
ATOM   1583 O  O   . ALA A 1 178 ? 25.380 -22.810 13.231  1.00 9.43   ? 173 ALA A O   1 
ATOM   1584 C  CB  . ALA A 1 178 ? 25.978 -25.492 11.486  1.00 10.22  ? 173 ALA A CB  1 
ATOM   1585 N  N   . LEU A 1 179 ? 25.816 -22.368 11.053  1.00 8.57   ? 174 LEU A N   1 
ATOM   1586 C  CA  . LEU A 1 179 ? 26.220 -20.979 11.338  1.00 9.11   ? 174 LEU A CA  1 
ATOM   1587 C  C   . LEU A 1 179 ? 25.113 -20.217 12.049  1.00 9.54   ? 174 LEU A C   1 
ATOM   1588 O  O   . LEU A 1 179 ? 25.383 -19.582 13.093  1.00 10.27  ? 174 LEU A O   1 
ATOM   1589 C  CB  . LEU A 1 179 ? 26.583 -20.279 10.008  1.00 9.47   ? 174 LEU A CB  1 
ATOM   1590 C  CG  . LEU A 1 179 ? 27.023 -18.793 10.138  1.00 8.24   ? 174 LEU A CG  1 
ATOM   1591 C  CD1 . LEU A 1 179 ? 28.470 -18.721 10.651  1.00 10.95  ? 174 LEU A CD1 1 
ATOM   1592 C  CD2 . LEU A 1 179 ? 26.960 -18.074 8.764   1.00 11.47  ? 174 LEU A CD2 1 
ATOM   1593 N  N   . ASN A 1 180 ? 23.874 -20.300 11.553  1.00 9.74   ? 175 ASN A N   1 
ATOM   1594 C  CA  . ASN A 1 180 ? 22.765 -19.469 12.097  1.00 9.20   ? 175 ASN A CA  1 
ATOM   1595 C  C   . ASN A 1 180 ? 22.279 -20.052 13.389  1.00 9.72   ? 175 ASN A C   1 
ATOM   1596 O  O   . ASN A 1 180 ? 21.913 -19.295 14.284  1.00 11.21  ? 175 ASN A O   1 
ATOM   1597 C  CB  . ASN A 1 180 ? 21.600 -19.406 11.118  1.00 8.24   ? 175 ASN A CB  1 
ATOM   1598 C  CG  . ASN A 1 180 ? 21.917 -18.482 9.932   1.00 9.32   ? 175 ASN A CG  1 
ATOM   1599 O  OD1 . ASN A 1 180 ? 23.100 -18.159 9.670   1.00 10.62  ? 175 ASN A OD1 1 
ATOM   1600 N  ND2 . ASN A 1 180 ? 20.899 -18.091 9.226   1.00 9.56   ? 175 ASN A ND2 1 
ATOM   1601 N  N   . PHE A 1 181 ? 22.267 -21.391 13.517  1.00 10.06  ? 176 PHE A N   1 
ATOM   1602 C  CA  . PHE A 1 181 ? 21.823 -21.959 14.805  1.00 9.72   ? 176 PHE A CA  1 
ATOM   1603 C  C   . PHE A 1 181 ? 22.875 -21.569 15.854  1.00 9.41   ? 176 PHE A C   1 
ATOM   1604 O  O   . PHE A 1 181 ? 22.538 -21.315 17.021  1.00 9.62   ? 176 PHE A O   1 
ATOM   1605 C  CB  . PHE A 1 181 ? 21.691 -23.478 14.663  1.00 10.23  ? 176 PHE A CB  1 
ATOM   1606 C  CG  . PHE A 1 181 ? 20.928 -24.160 15.761  1.00 9.13   ? 176 PHE A CG  1 
ATOM   1607 C  CD1 . PHE A 1 181 ? 20.095 -23.469 16.671  1.00 8.42   ? 176 PHE A CD1 1 
ATOM   1608 C  CD2 . PHE A 1 181 ? 21.150 -25.521 15.985  1.00 10.17  ? 176 PHE A CD2 1 
ATOM   1609 C  CE1 . PHE A 1 181 ? 19.429 -24.210 17.706  1.00 8.64   ? 176 PHE A CE1 1 
ATOM   1610 C  CE2 . PHE A 1 181 ? 20.452 -26.249 16.963  1.00 10.77  ? 176 PHE A CE2 1 
ATOM   1611 C  CZ  . PHE A 1 181 ? 19.616 -25.601 17.830  1.00 8.42   ? 176 PHE A CZ  1 
ATOM   1612 N  N   . SER A 1 182 ? 24.143 -21.524 15.465  1.00 8.57   ? 177 SER A N   1 
ATOM   1613 C  CA  . SER A 1 182 ? 25.189 -21.093 16.427  1.00 9.80   ? 177 SER A CA  1 
ATOM   1614 C  C   . SER A 1 182 ? 24.947 -19.626 16.849  1.00 10.45  ? 177 SER A C   1 
ATOM   1615 O  O   . SER A 1 182 ? 25.056 -19.251 18.041  1.00 10.84  ? 177 SER A O   1 
ATOM   1616 C  CB  . SER A 1 182 ? 26.531 -21.329 15.811  1.00 11.47  ? 177 SER A CB  1 
ATOM   1617 O  OG  . SER A 1 182 ? 27.499 -20.627 16.516  1.00 13.01  ? 177 SER A OG  1 
ATOM   1618 N  N   . VAL A 1 183 ? 24.632 -18.788 15.878  1.00 10.09  ? 178 VAL A N   1 
ATOM   1619 C  CA  . VAL A 1 183 ? 24.300 -17.347 16.230  1.00 9.55   ? 178 VAL A CA  1 
ATOM   1620 C  C   . VAL A 1 183 ? 23.063 -17.305 17.163  1.00 9.61   ? 178 VAL A C   1 
ATOM   1621 O  O   . VAL A 1 183 ? 23.045 -16.557 18.143  1.00 11.99  ? 178 VAL A O   1 
ATOM   1622 C  CB  . VAL A 1 183 ? 24.033 -16.485 14.953  1.00 9.17   ? 178 VAL A CB  1 
ATOM   1623 C  CG1 . VAL A 1 183 ? 23.412 -15.069 15.314  1.00 11.06  ? 178 VAL A CG1 1 
ATOM   1624 C  CG2 . VAL A 1 183 ? 25.350 -16.303 14.197  1.00 11.54  ? 178 VAL A CG2 1 
ATOM   1625 N  N   . PHE A 1 184 ? 22.035 -18.119 16.869  1.00 8.98   ? 179 PHE A N   1 
ATOM   1626 C  CA  . PHE A 1 184 ? 20.876 -18.247 17.740  1.00 9.64   ? 179 PHE A CA  1 
ATOM   1627 C  C   . PHE A 1 184 ? 21.326 -18.599 19.170  1.00 10.40  ? 179 PHE A C   1 
ATOM   1628 O  O   . PHE A 1 184 ? 20.936 -17.914 20.147  1.00 12.06  ? 179 PHE A O   1 
ATOM   1629 C  CB  . PHE A 1 184 ? 19.978 -19.385 17.240  1.00 9.88   ? 179 PHE A CB  1 
ATOM   1630 C  CG  . PHE A 1 184 ? 18.916 -19.749 18.202  1.00 9.14   ? 179 PHE A CG  1 
ATOM   1631 C  CD1 . PHE A 1 184 ? 17.731 -18.998 18.255  1.00 11.26  ? 179 PHE A CD1 1 
ATOM   1632 C  CD2 . PHE A 1 184 ? 19.088 -20.829 19.079  1.00 8.71   ? 179 PHE A CD2 1 
ATOM   1633 C  CE1 . PHE A 1 184 ? 16.706 -19.333 19.152  1.00 10.33  ? 179 PHE A CE1 1 
ATOM   1634 C  CE2 . PHE A 1 184 ? 18.067 -21.152 20.004  1.00 11.85  ? 179 PHE A CE2 1 
ATOM   1635 C  CZ  . PHE A 1 184 ? 16.888 -20.364 20.041  1.00 12.81  ? 179 PHE A CZ  1 
ATOM   1636 N  N   . HIS A 1 185 ? 22.198 -19.603 19.319  1.00 9.45   ? 180 HIS A N   1 
ATOM   1637 C  CA  . HIS A 1 185 ? 22.658 -19.911 20.672  1.00 10.18  ? 180 HIS A CA  1 
ATOM   1638 C  C   . HIS A 1 185 ? 23.377 -18.754 21.317  1.00 11.44  ? 180 HIS A C   1 
ATOM   1639 O  O   . HIS A 1 185 ? 23.179 -18.477 22.512  1.00 11.96  ? 180 HIS A O   1 
ATOM   1640 C  CB  . HIS A 1 185 ? 23.640 -21.105 20.648  1.00 9.02   ? 180 HIS A CB  1 
ATOM   1641 C  CG  . HIS A 1 185 ? 22.985 -22.416 20.354  1.00 9.91   ? 180 HIS A CG  1 
ATOM   1642 N  ND1 . HIS A 1 185 ? 21.893 -22.887 21.055  1.00 10.26  ? 180 HIS A ND1 1 
ATOM   1643 C  CD2 . HIS A 1 185 ? 23.277 -23.365 19.418  1.00 10.55  ? 180 HIS A CD2 1 
ATOM   1644 C  CE1 . HIS A 1 185 ? 21.557 -24.083 20.581  1.00 9.78   ? 180 HIS A CE1 1 
ATOM   1645 N  NE2 . HIS A 1 185 ? 22.387 -24.405 19.604  1.00 8.63   ? 180 HIS A NE2 1 
ATOM   1646 N  N   . TYR A 1 186 ? 24.231 -18.088 20.554  1.00 10.83  ? 181 TYR A N   1 
ATOM   1647 C  CA  . TYR A 1 186 ? 25.061 -17.041 21.168  1.00 12.20  ? 181 TYR A CA  1 
ATOM   1648 C  C   . TYR A 1 186 ? 24.208 -15.842 21.624  1.00 13.85  ? 181 TYR A C   1 
ATOM   1649 O  O   . TYR A 1 186 ? 24.404 -15.248 22.705  1.00 14.51  ? 181 TYR A O   1 
ATOM   1650 C  CB  . TYR A 1 186 ? 26.075 -16.533 20.143  1.00 12.18  ? 181 TYR A CB  1 
ATOM   1651 C  CG  . TYR A 1 186 ? 27.160 -15.707 20.749  1.00 11.85  ? 181 TYR A CG  1 
ATOM   1652 C  CD1 . TYR A 1 186 ? 27.039 -14.307 20.812  1.00 13.51  ? 181 TYR A CD1 1 
ATOM   1653 C  CD2 . TYR A 1 186 ? 28.321 -16.299 21.265  1.00 13.16  ? 181 TYR A CD2 1 
ATOM   1654 C  CE1 . TYR A 1 186 ? 28.014 -13.539 21.387  1.00 15.10  ? 181 TYR A CE1 1 
ATOM   1655 C  CE2 . TYR A 1 186 ? 29.312 -15.516 21.856  1.00 12.66  ? 181 TYR A CE2 1 
ATOM   1656 C  CZ  . TYR A 1 186 ? 29.160 -14.145 21.898  1.00 16.51  ? 181 TYR A CZ  1 
ATOM   1657 O  OH  . TYR A 1 186 ? 30.141 -13.371 22.499  1.00 20.23  ? 181 TYR A OH  1 
ATOM   1658 N  N   . GLU A 1 187 ? 23.278 -15.444 20.790  1.00 15.34  ? 182 GLU A N   1 
ATOM   1659 C  CA  . GLU A 1 187 ? 22.681 -14.128 21.070  1.00 17.57  ? 182 GLU A CA  1 
ATOM   1660 C  C   . GLU A 1 187 ? 21.208 -14.089 21.410  1.00 16.85  ? 182 GLU A C   1 
ATOM   1661 O  O   . GLU A 1 187 ? 20.732 -13.063 21.878  1.00 17.60  ? 182 GLU A O   1 
ATOM   1662 C  CB  . GLU A 1 187 ? 23.030 -13.111 19.991  1.00 19.63  ? 182 GLU A CB  1 
ATOM   1663 C  CG  . GLU A 1 187 ? 22.647 -13.375 18.633  1.00 20.63  ? 182 GLU A CG  1 
ATOM   1664 C  CD  . GLU A 1 187 ? 22.729 -12.095 17.742  1.00 24.97  ? 182 GLU A CD  1 
ATOM   1665 O  OE1 . GLU A 1 187 ? 23.713 -11.275 17.788  1.00 27.08  ? 182 GLU A OE1 1 
ATOM   1666 O  OE2 . GLU A 1 187 ? 21.779 -11.866 16.999  1.00 22.92  ? 182 GLU A OE2 1 
ATOM   1667 N  N   . ILE A 1 188 ? 20.520 -15.201 21.192  1.00 15.52  ? 183 ILE A N   1 
ATOM   1668 C  CA  . ILE A 1 188 ? 19.131 -15.321 21.527  1.00 15.26  ? 183 ILE A CA  1 
ATOM   1669 C  C   . ILE A 1 188 ? 18.948 -16.167 22.763  1.00 15.39  ? 183 ILE A C   1 
ATOM   1670 O  O   . ILE A 1 188 ? 18.233 -15.747 23.693  1.00 15.72  ? 183 ILE A O   1 
ATOM   1671 C  CB  . ILE A 1 188 ? 18.321 -15.901 20.347  1.00 14.16  ? 183 ILE A CB  1 
ATOM   1672 C  CG1 . ILE A 1 188 ? 18.619 -15.117 19.071  1.00 14.78  ? 183 ILE A CG1 1 
ATOM   1673 C  CG2 . ILE A 1 188 ? 16.800 -15.953 20.679  1.00 12.27  ? 183 ILE A CG2 1 
ATOM   1674 C  CD1 . ILE A 1 188 ? 18.119 -13.657 19.101  1.00 16.22  ? 183 ILE A CD1 1 
ATOM   1675 N  N   . ALA A 1 189 ? 19.612 -17.327 22.796  1.00 14.85  ? 184 ALA A N   1 
ATOM   1676 C  CA  . ALA A 1 189 ? 19.415 -18.313 23.848  1.00 14.38  ? 184 ALA A CA  1 
ATOM   1677 C  C   . ALA A 1 189 ? 20.415 -18.155 24.965  1.00 13.86  ? 184 ALA A C   1 
ATOM   1678 O  O   . ALA A 1 189 ? 20.375 -18.958 25.897  1.00 16.67  ? 184 ALA A O   1 
ATOM   1679 C  CB  . ALA A 1 189 ? 19.512 -19.781 23.287  1.00 14.98  ? 184 ALA A CB  1 
ATOM   1680 N  N   . ASN A 1 190 ? 21.281 -17.147 24.918  1.00 13.56  ? 185 ASN A N   1 
ATOM   1681 C  CA  . ASN A 1 190 ? 22.207 -16.934 26.035  1.00 15.45  ? 185 ASN A CA  1 
ATOM   1682 C  C   . ASN A 1 190 ? 23.059 -18.167 26.292  1.00 14.76  ? 185 ASN A C   1 
ATOM   1683 O  O   . ASN A 1 190 ? 23.254 -18.565 27.467  1.00 15.92  ? 185 ASN A O   1 
ATOM   1684 C  CB  . ASN A 1 190 ? 21.415 -16.607 27.317  1.00 16.58  ? 185 ASN A CB  1 
ATOM   1685 C  CG  . ASN A 1 190 ? 22.309 -16.017 28.424  1.00 24.05  ? 185 ASN A CG  1 
ATOM   1686 O  OD1 . ASN A 1 190 ? 23.344 -15.354 28.102  1.00 29.34  ? 185 ASN A OD1 1 
ATOM   1687 N  ND2 . ASN A 1 190 ? 21.951 -16.270 29.733  1.00 25.05  ? 185 ASN A ND2 1 
ATOM   1688 N  N   . SER A 1 191 ? 23.559 -18.781 25.221  1.00 12.00  ? 186 SER A N   1 
ATOM   1689 C  CA  . SER A 1 191 ? 24.314 -20.031 25.352  1.00 12.46  ? 186 SER A CA  1 
ATOM   1690 C  C   . SER A 1 191 ? 25.582 -19.913 24.507  1.00 11.07  ? 186 SER A C   1 
ATOM   1691 O  O   . SER A 1 191 ? 25.734 -20.617 23.537  1.00 10.23  ? 186 SER A O   1 
ATOM   1692 C  CB  . SER A 1 191 ? 23.459 -21.180 24.811  1.00 12.99  ? 186 SER A CB  1 
ATOM   1693 O  OG  . SER A 1 191 ? 22.276 -21.339 25.577  1.00 14.55  ? 186 SER A OG  1 
ATOM   1694 N  N   . PRO A 1 192 ? 26.492 -18.979 24.866  1.00 11.47  ? 187 PRO A N   1 
ATOM   1695 C  CA  . PRO A 1 192 ? 27.674 -18.787 24.019  1.00 10.60  ? 187 PRO A CA  1 
ATOM   1696 C  C   . PRO A 1 192 ? 28.557 -20.043 23.955  1.00 9.70   ? 187 PRO A C   1 
ATOM   1697 O  O   . PRO A 1 192 ? 29.145 -20.313 22.920  1.00 10.63  ? 187 PRO A O   1 
ATOM   1698 C  CB  . PRO A 1 192 ? 28.433 -17.661 24.720  1.00 12.10  ? 187 PRO A CB  1 
ATOM   1699 C  CG  . PRO A 1 192 ? 27.940 -17.703 26.141  1.00 12.49  ? 187 PRO A CG  1 
ATOM   1700 C  CD  . PRO A 1 192 ? 26.463 -18.052 26.032  1.00 10.93  ? 187 PRO A CD  1 
ATOM   1701 N  N   . GLU A 1 193 ? 28.602 -20.841 25.009  1.00 9.78   ? 188 GLU A N   1 
ATOM   1702 C  CA  . GLU A 1 193 ? 29.387 -22.088 24.918  1.00 9.73   ? 188 GLU A CA  1 
ATOM   1703 C  C   . GLU A 1 193 ? 28.836 -22.985 23.865  1.00 9.12   ? 188 GLU A C   1 
ATOM   1704 O  O   . GLU A 1 193 ? 29.590 -23.633 23.125  1.00 9.18   ? 188 GLU A O   1 
ATOM   1705 C  CB  . GLU A 1 193 ? 29.513 -22.818 26.289  1.00 9.03   ? 188 GLU A CB  1 
ATOM   1706 C  CG  . GLU A 1 193 ? 30.397 -21.990 27.203  1.00 13.13  ? 188 GLU A CG  1 
ATOM   1707 C  CD  . GLU A 1 193 ? 30.465 -22.577 28.614  1.00 16.45  ? 188 GLU A CD  1 
ATOM   1708 O  OE1 . GLU A 1 193 ? 29.487 -23.228 29.047  1.00 20.57  ? 188 GLU A OE1 1 
ATOM   1709 O  OE2 . GLU A 1 193 ? 31.483 -22.371 29.276  1.00 20.13  ? 188 GLU A OE2 1 
ATOM   1710 N  N   . GLU A 1 194 ? 27.521 -23.118 23.815  1.00 9.30   ? 189 GLU A N   1 
ATOM   1711 C  CA  . GLU A 1 194 ? 26.907 -24.009 22.828  1.00 9.26   ? 189 GLU A CA  1 
ATOM   1712 C  C   . GLU A 1 194 ? 27.154 -23.403 21.442  1.00 8.45   ? 189 GLU A C   1 
ATOM   1713 O  O   . GLU A 1 194 ? 27.422 -24.143 20.463  1.00 9.52   ? 189 GLU A O   1 
ATOM   1714 C  CB  . GLU A 1 194 ? 25.358 -24.123 23.064  1.00 7.93   ? 189 GLU A CB  1 
ATOM   1715 C  CG  . GLU A 1 194 ? 24.640 -25.094 22.072  1.00 8.68   ? 189 GLU A CG  1 
ATOM   1716 C  CD  . GLU A 1 194 ? 24.969 -26.546 22.353  1.00 11.17  ? 189 GLU A CD  1 
ATOM   1717 O  OE1 . GLU A 1 194 ? 24.675 -27.371 21.450  1.00 14.27  ? 189 GLU A OE1 1 
ATOM   1718 O  OE2 . GLU A 1 194 ? 25.557 -26.867 23.425  1.00 10.21  ? 189 GLU A OE2 1 
ATOM   1719 N  N   . ALA A 1 195 ? 27.066 -22.067 21.330  1.00 8.43   ? 190 ALA A N   1 
ATOM   1720 C  CA  . ALA A 1 195 ? 27.290 -21.453 20.000  1.00 7.82   ? 190 ALA A CA  1 
ATOM   1721 C  C   . ALA A 1 195 ? 28.702 -21.766 19.515  1.00 8.75   ? 190 ALA A C   1 
ATOM   1722 O  O   . ALA A 1 195 ? 28.918 -22.082 18.326  1.00 8.83   ? 190 ALA A O   1 
ATOM   1723 C  CB  . ALA A 1 195 ? 27.137 -19.898 20.153  1.00 9.22   ? 190 ALA A CB  1 
ATOM   1724 N  N   . ILE A 1 196 ? 29.670 -21.656 20.421  1.00 8.97   ? 191 ILE A N   1 
ATOM   1725 C  CA  . ILE A 1 196 ? 31.088 -21.854 20.049  1.00 11.07  ? 191 ILE A CA  1 
ATOM   1726 C  C   . ILE A 1 196 ? 31.313 -23.314 19.740  1.00 10.71  ? 191 ILE A C   1 
ATOM   1727 O  O   . ILE A 1 196 ? 31.998 -23.613 18.764  1.00 10.98  ? 191 ILE A O   1 
ATOM   1728 C  CB  . ILE A 1 196 ? 32.041 -21.408 21.210  1.00 10.86  ? 191 ILE A CB  1 
ATOM   1729 C  CG1 . ILE A 1 196 ? 32.008 -19.866 21.344  1.00 11.72  ? 191 ILE A CG1 1 
ATOM   1730 C  CG2 . ILE A 1 196 ? 33.471 -21.873 21.009  1.00 12.36  ? 191 ILE A CG2 1 
ATOM   1731 C  CD1 . ILE A 1 196 ? 32.500 -19.318 22.674  1.00 11.78  ? 191 ILE A CD1 1 
ATOM   1732 N  N   . SER A 1 197 ? 30.772 -24.218 20.572  1.00 9.63   ? 192 SER A N   1 
ATOM   1733 C  CA  A SER A 1 197 ? 30.909 -25.666 20.297  0.50 10.83  ? 192 SER A CA  1 
ATOM   1734 C  CA  B SER A 1 197 ? 30.913 -25.670 20.311  0.50 10.85  ? 192 SER A CA  1 
ATOM   1735 C  C   . SER A 1 197 ? 30.327 -26.069 18.957  1.00 10.89  ? 192 SER A C   1 
ATOM   1736 O  O   . SER A 1 197 ? 30.927 -26.811 18.205  1.00 9.95   ? 192 SER A O   1 
ATOM   1737 C  CB  A SER A 1 197 ? 30.263 -26.443 21.430  0.50 10.10  ? 192 SER A CB  1 
ATOM   1738 C  CB  B SER A 1 197 ? 30.241 -26.484 21.416  0.50 10.26  ? 192 SER A CB  1 
ATOM   1739 O  OG  A SER A 1 197 ? 31.141 -26.317 22.506  0.50 10.76  ? 192 SER A OG  1 
ATOM   1740 O  OG  B SER A 1 197 ? 30.480 -27.847 21.139  0.50 10.90  ? 192 SER A OG  1 
ATOM   1741 N  N   . LEU A 1 198 ? 29.168 -25.533 18.643  1.00 9.91   ? 193 LEU A N   1 
ATOM   1742 C  CA  . LEU A 1 198 ? 28.557 -25.866 17.395  1.00 10.20  ? 193 LEU A CA  1 
ATOM   1743 C  C   . LEU A 1 198 ? 29.387 -25.314 16.215  1.00 9.61   ? 193 LEU A C   1 
ATOM   1744 O  O   . LEU A 1 198 ? 29.588 -25.998 15.211  1.00 10.94  ? 193 LEU A O   1 
ATOM   1745 C  CB  . LEU A 1 198 ? 27.122 -25.304 17.362  1.00 9.61   ? 193 LEU A CB  1 
ATOM   1746 C  CG  . LEU A 1 198 ? 26.405 -25.631 16.037  1.00 7.84   ? 193 LEU A CG  1 
ATOM   1747 C  CD1 . LEU A 1 198 ? 26.452 -27.128 15.602  1.00 10.98  ? 193 LEU A CD1 1 
ATOM   1748 C  CD2 . LEU A 1 198 ? 24.948 -25.052 16.132  1.00 10.30  ? 193 LEU A CD2 1 
ATOM   1749 N  N   . ALA A 1 199 ? 29.831 -24.067 16.309  1.00 9.28   ? 194 ALA A N   1 
ATOM   1750 C  CA  . ALA A 1 199 ? 30.611 -23.521 15.183  1.00 10.01  ? 194 ALA A CA  1 
ATOM   1751 C  C   . ALA A 1 199 ? 31.916 -24.332 14.954  1.00 10.51  ? 194 ALA A C   1 
ATOM   1752 O  O   . ALA A 1 199 ? 32.292 -24.606 13.827  1.00 11.86  ? 194 ALA A O   1 
ATOM   1753 C  CB  . ALA A 1 199 ? 30.884 -22.018 15.389  1.00 11.32  ? 194 ALA A CB  1 
ATOM   1754 N  N   . LYS A 1 200 ? 32.601 -24.685 16.042  1.00 10.19  ? 195 LYS A N   1 
ATOM   1755 C  CA  A LYS A 1 200 ? 33.885 -25.441 16.037  0.50 11.25  ? 195 LYS A CA  1 
ATOM   1756 C  CA  B LYS A 1 200 ? 33.885 -25.395 15.935  0.50 10.63  ? 195 LYS A CA  1 
ATOM   1757 C  C   . LYS A 1 200 ? 33.699 -26.807 15.388  1.00 10.93  ? 195 LYS A C   1 
ATOM   1758 O  O   . LYS A 1 200 ? 34.424 -27.223 14.457  1.00 12.00  ? 195 LYS A O   1 
ATOM   1759 C  CB  A LYS A 1 200 ? 34.383 -25.641 17.493  0.50 11.91  ? 195 LYS A CB  1 
ATOM   1760 C  CB  B LYS A 1 200 ? 34.620 -25.428 17.277  0.50 11.01  ? 195 LYS A CB  1 
ATOM   1761 C  CG  A LYS A 1 200 ? 35.276 -24.533 18.029  0.50 13.87  ? 195 LYS A CG  1 
ATOM   1762 C  CG  B LYS A 1 200 ? 36.016 -25.979 17.133  0.50 9.46   ? 195 LYS A CG  1 
ATOM   1763 C  CD  A LYS A 1 200 ? 35.701 -24.775 19.505  0.50 16.37  ? 195 LYS A CD  1 
ATOM   1764 C  CD  B LYS A 1 200 ? 36.727 -26.024 18.450  0.50 16.72  ? 195 LYS A CD  1 
ATOM   1765 C  CE  A LYS A 1 200 ? 36.965 -23.948 19.816  0.50 21.75  ? 195 LYS A CE  1 
ATOM   1766 C  CE  B LYS A 1 200 ? 37.801 -27.111 18.427  0.50 17.35  ? 195 LYS A CE  1 
ATOM   1767 N  NZ  A LYS A 1 200 ? 37.107 -23.403 21.186  0.50 23.49  ? 195 LYS A NZ  1 
ATOM   1768 N  NZ  B LYS A 1 200 ? 38.634 -27.220 17.210  0.50 17.37  ? 195 LYS A NZ  1 
ATOM   1769 N  N   . THR A 1 201 ? 32.747 -27.544 15.927  1.00 10.17  ? 196 THR A N   1 
ATOM   1770 C  CA  A THR A 1 201 ? 32.493 -28.892 15.451  0.60 11.34  ? 196 THR A CA  1 
ATOM   1771 C  CA  B THR A 1 201 ? 32.517 -28.899 15.446  0.40 10.68  ? 196 THR A CA  1 
ATOM   1772 C  C   . THR A 1 201 ? 32.092 -28.891 13.985  1.00 11.03  ? 196 THR A C   1 
ATOM   1773 O  O   . THR A 1 201 ? 32.579 -29.726 13.176  1.00 12.26  ? 196 THR A O   1 
ATOM   1774 C  CB  A THR A 1 201 ? 31.474 -29.581 16.384  0.60 12.77  ? 196 THR A CB  1 
ATOM   1775 C  CB  B THR A 1 201 ? 31.544 -29.661 16.365  0.40 11.29  ? 196 THR A CB  1 
ATOM   1776 O  OG1 A THR A 1 201 ? 32.175 -29.954 17.592  0.60 15.79  ? 196 THR A OG1 1 
ATOM   1777 O  OG1 B THR A 1 201 ? 30.248 -29.051 16.324  0.40 8.09   ? 196 THR A OG1 1 
ATOM   1778 C  CG2 A THR A 1 201 ? 30.856 -30.775 15.755  0.60 11.03  ? 196 THR A CG2 1 
ATOM   1779 C  CG2 B THR A 1 201 ? 32.093 -29.561 17.810  0.40 12.77  ? 196 THR A CG2 1 
ATOM   1780 N  N   . THR A 1 202 ? 31.223 -27.942 13.638  1.00 9.65   ? 197 THR A N   1 
ATOM   1781 C  CA  . THR A 1 202 ? 30.813 -27.787 12.264  1.00 10.67  ? 197 THR A CA  1 
ATOM   1782 C  C   . THR A 1 202 ? 31.998 -27.545 11.355  1.00 10.70  ? 197 THR A C   1 
ATOM   1783 O  O   . THR A 1 202 ? 32.161 -28.191 10.276  1.00 10.54  ? 197 THR A O   1 
ATOM   1784 C  CB  . THR A 1 202 ? 29.760 -26.674 12.114  1.00 9.81   ? 197 THR A CB  1 
ATOM   1785 O  OG1 . THR A 1 202 ? 28.618 -27.002 12.936  1.00 11.00  ? 197 THR A OG1 1 
ATOM   1786 C  CG2 . THR A 1 202 ? 29.277 -26.622 10.623  1.00 11.58  ? 197 THR A CG2 1 
ATOM   1787 N  N   . PHE A 1 203 ? 32.834 -26.598 11.757  1.00 11.39  ? 198 PHE A N   1 
ATOM   1788 C  CA  . PHE A 1 203 ? 33.959 -26.224 10.936  1.00 11.73  ? 198 PHE A CA  1 
ATOM   1789 C  C   . PHE A 1 203 ? 34.896 -27.416 10.800  1.00 12.98  ? 198 PHE A C   1 
ATOM   1790 O  O   . PHE A 1 203 ? 35.373 -27.746 9.682   1.00 14.34  ? 198 PHE A O   1 
ATOM   1791 C  CB  . PHE A 1 203 ? 34.677 -25.030 11.580  1.00 11.31  ? 198 PHE A CB  1 
ATOM   1792 C  CG  . PHE A 1 203 ? 35.880 -24.569 10.792  1.00 14.35  ? 198 PHE A CG  1 
ATOM   1793 C  CD1 . PHE A 1 203 ? 37.124 -25.205 10.922  1.00 14.46  ? 198 PHE A CD1 1 
ATOM   1794 C  CD2 . PHE A 1 203 ? 35.767 -23.502 9.894   1.00 13.57  ? 198 PHE A CD2 1 
ATOM   1795 C  CE1 . PHE A 1 203 ? 38.230 -24.785 10.166  1.00 16.17  ? 198 PHE A CE1 1 
ATOM   1796 C  CE2 . PHE A 1 203 ? 36.861 -23.103 9.192   1.00 15.36  ? 198 PHE A CE2 1 
ATOM   1797 C  CZ  . PHE A 1 203 ? 38.107 -23.781 9.316   1.00 15.89  ? 198 PHE A CZ  1 
ATOM   1798 N  N   . ASP A 1 204 ? 35.163 -28.071 11.919  1.00 13.04  ? 199 ASP A N   1 
ATOM   1799 C  CA  . ASP A 1 204 ? 36.139 -29.176 11.911  1.00 13.75  ? 199 ASP A CA  1 
ATOM   1800 C  C   . ASP A 1 204 ? 35.685 -30.358 11.057  1.00 14.06  ? 199 ASP A C   1 
ATOM   1801 O  O   . ASP A 1 204 ? 36.492 -30.948 10.327  1.00 15.00  ? 199 ASP A O   1 
ATOM   1802 C  CB  . ASP A 1 204 ? 36.499 -29.586 13.342  1.00 15.29  ? 199 ASP A CB  1 
ATOM   1803 C  CG  . ASP A 1 204 ? 37.261 -28.486 14.105  1.00 16.50  ? 199 ASP A CG  1 
ATOM   1804 O  OD1 . ASP A 1 204 ? 37.746 -27.435 13.526  1.00 18.48  ? 199 ASP A OD1 1 
ATOM   1805 O  OD2 . ASP A 1 204 ? 37.345 -28.633 15.337  1.00 19.82  ? 199 ASP A OD2 1 
ATOM   1806 N  N   . GLU A 1 205 ? 34.409 -30.683 11.123  1.00 13.35  ? 200 GLU A N   1 
ATOM   1807 C  CA  . GLU A 1 205 ? 33.880 -31.800 10.345  1.00 14.48  ? 200 GLU A CA  1 
ATOM   1808 C  C   . GLU A 1 205 ? 33.855 -31.481 8.849   1.00 12.94  ? 200 GLU A C   1 
ATOM   1809 O  O   . GLU A 1 205 ? 34.038 -32.372 8.019   1.00 14.36  ? 200 GLU A O   1 
ATOM   1810 C  CB  . GLU A 1 205 ? 32.515 -32.211 10.913  1.00 14.78  ? 200 GLU A CB  1 
ATOM   1811 C  CG  . GLU A 1 205 ? 32.748 -32.853 12.261  1.00 19.84  ? 200 GLU A CG  1 
ATOM   1812 C  CD  . GLU A 1 205 ? 31.553 -32.916 13.136  1.00 27.81  ? 200 GLU A CD  1 
ATOM   1813 O  OE1 . GLU A 1 205 ? 30.392 -32.964 12.633  1.00 29.47  ? 200 GLU A OE1 1 
ATOM   1814 O  OE2 . GLU A 1 205 ? 31.827 -32.980 14.368  1.00 29.60  ? 200 GLU A OE2 1 
ATOM   1815 N  N   . ALA A 1 206 ? 33.596 -30.213 8.520   1.00 11.18  ? 201 ALA A N   1 
ATOM   1816 C  CA  . ALA A 1 206 ? 33.629 -29.789 7.147   1.00 10.17  ? 201 ALA A CA  1 
ATOM   1817 C  C   . ALA A 1 206 ? 35.059 -29.883 6.655   1.00 12.53  ? 201 ALA A C   1 
ATOM   1818 O  O   . ALA A 1 206 ? 35.283 -30.440 5.548   1.00 11.22  ? 201 ALA A O   1 
ATOM   1819 C  CB  . ALA A 1 206 ? 33.010 -28.380 6.975   1.00 10.33  ? 201 ALA A CB  1 
ATOM   1820 N  N   . MET A 1 207 ? 36.031 -29.387 7.456   1.00 11.87  ? 202 MET A N   1 
ATOM   1821 C  CA  . MET A 1 207 ? 37.446 -29.465 7.020   1.00 13.64  ? 202 MET A CA  1 
ATOM   1822 C  C   . MET A 1 207 ? 37.860 -30.890 6.624   1.00 13.50  ? 202 MET A C   1 
ATOM   1823 O  O   . MET A 1 207 ? 38.578 -31.093 5.629   1.00 14.06  ? 202 MET A O   1 
ATOM   1824 C  CB  . MET A 1 207 ? 38.387 -28.980 8.165   1.00 15.60  ? 202 MET A CB  1 
ATOM   1825 C  CG  . MET A 1 207 ? 38.471 -27.488 8.271   1.00 22.27  ? 202 MET A CG  1 
ATOM   1826 S  SD  . MET A 1 207 ? 39.400 -26.747 6.893   1.00 30.28  ? 202 MET A SD  1 
ATOM   1827 C  CE  . MET A 1 207 ? 40.696 -27.847 6.781   1.00 19.47  ? 202 MET A CE  1 
ATOM   1828 N  N   . ALA A 1 208 ? 37.400 -31.877 7.390   1.00 12.28  ? 203 ALA A N   1 
ATOM   1829 C  CA  . ALA A 1 208 ? 37.819 -33.253 7.202   1.00 13.67  ? 203 ALA A CA  1 
ATOM   1830 C  C   . ALA A 1 208 ? 37.178 -33.896 5.947   1.00 13.26  ? 203 ALA A C   1 
ATOM   1831 O  O   . ALA A 1 208 ? 37.593 -34.967 5.495   1.00 13.64  ? 203 ALA A O   1 
ATOM   1832 C  CB  . ALA A 1 208 ? 37.424 -34.052 8.518   1.00 14.68  ? 203 ALA A CB  1 
ATOM   1833 N  N   . ASP A 1 209 ? 36.115 -33.266 5.412   1.00 14.44  ? 204 ASP A N   1 
ATOM   1834 C  CA  A ASP A 1 209 ? 35.339 -33.724 4.264   0.60 14.01  ? 204 ASP A CA  1 
ATOM   1835 C  CA  B ASP A 1 209 ? 35.477 -33.846 4.251   0.40 14.62  ? 204 ASP A CA  1 
ATOM   1836 C  C   . ASP A 1 209 ? 35.724 -32.999 2.968   1.00 14.50  ? 204 ASP A C   1 
ATOM   1837 O  O   . ASP A 1 209 ? 35.263 -33.359 1.859   1.00 14.60  ? 204 ASP A O   1 
ATOM   1838 C  CB  A ASP A 1 209 ? 33.831 -33.455 4.496   0.60 14.12  ? 204 ASP A CB  1 
ATOM   1839 C  CB  B ASP A 1 209 ? 33.983 -34.104 4.545   0.40 15.61  ? 204 ASP A CB  1 
ATOM   1840 C  CG  A ASP A 1 209 ? 32.931 -34.190 3.496   0.60 14.28  ? 204 ASP A CG  1 
ATOM   1841 C  CG  B ASP A 1 209 ? 33.620 -35.602 4.681   0.40 17.41  ? 204 ASP A CG  1 
ATOM   1842 O  OD1 A ASP A 1 209 ? 33.163 -35.401 3.264   0.60 14.07  ? 204 ASP A OD1 1 
ATOM   1843 O  OD1 B ASP A 1 209 ? 34.393 -36.495 5.167   0.40 18.94  ? 204 ASP A OD1 1 
ATOM   1844 O  OD2 A ASP A 1 209 ? 31.943 -33.596 2.995   0.60 14.93  ? 204 ASP A OD2 1 
ATOM   1845 O  OD2 B ASP A 1 209 ? 32.469 -35.894 4.294   0.40 22.47  ? 204 ASP A OD2 1 
ATOM   1846 N  N   . LEU A 1 210 ? 36.500 -31.917 3.091   1.00 13.69  ? 205 LEU A N   1 
ATOM   1847 C  CA  . LEU A 1 210 ? 36.826 -31.161 1.915   1.00 15.22  ? 205 LEU A CA  1 
ATOM   1848 C  C   . LEU A 1 210 ? 37.500 -32.019 0.829   1.00 13.93  ? 205 LEU A C   1 
ATOM   1849 O  O   . LEU A 1 210 ? 37.350 -31.739 -0.375  1.00 14.47  ? 205 LEU A O   1 
ATOM   1850 C  CB  . LEU A 1 210 ? 37.717 -29.975 2.249   1.00 15.70  ? 205 LEU A CB  1 
ATOM   1851 C  CG  . LEU A 1 210 ? 37.010 -28.830 2.953   1.00 15.72  ? 205 LEU A CG  1 
ATOM   1852 C  CD1 . LEU A 1 210 ? 38.082 -27.830 3.386   1.00 19.11  ? 205 LEU A CD1 1 
ATOM   1853 C  CD2 . LEU A 1 210 ? 35.951 -28.174 2.130   1.00 16.18  ? 205 LEU A CD2 1 
ATOM   1854 N  N   . HIS A 1 211 ? 38.248 -33.047 1.229   1.00 13.80  ? 206 HIS A N   1 
ATOM   1855 C  CA  . HIS A 1 211 ? 38.995 -33.849 0.249   1.00 16.01  ? 206 HIS A CA  1 
ATOM   1856 C  C   . HIS A 1 211 ? 38.099 -34.577 -0.764  1.00 16.82  ? 206 HIS A C   1 
ATOM   1857 O  O   . HIS A 1 211 ? 38.581 -35.033 -1.791  1.00 18.23  ? 206 HIS A O   1 
ATOM   1858 C  CB  . HIS A 1 211 ? 39.893 -34.879 0.980   1.00 16.52  ? 206 HIS A CB  1 
ATOM   1859 C  CG  . HIS A 1 211 ? 39.131 -36.074 1.500   1.00 20.15  ? 206 HIS A CG  1 
ATOM   1860 N  ND1 . HIS A 1 211 ? 38.514 -36.082 2.731   1.00 20.64  ? 206 HIS A ND1 1 
ATOM   1861 C  CD2 . HIS A 1 211 ? 38.848 -37.275 0.931   1.00 16.68  ? 206 HIS A CD2 1 
ATOM   1862 C  CE1 . HIS A 1 211 ? 37.923 -37.249 2.919   1.00 21.58  ? 206 HIS A CE1 1 
ATOM   1863 N  NE2 . HIS A 1 211 ? 38.107 -37.989 1.841   1.00 20.48  ? 206 HIS A NE2 1 
ATOM   1864 N  N   . THR A 1 212 ? 36.805 -34.668 -0.479  1.00 15.98  ? 207 THR A N   1 
ATOM   1865 C  CA  . THR A 1 212 ? 35.872 -35.404 -1.314  1.00 17.05  ? 207 THR A CA  1 
ATOM   1866 C  C   . THR A 1 212 ? 35.351 -34.497 -2.433  1.00 16.53  ? 207 THR A C   1 
ATOM   1867 O  O   . THR A 1 212 ? 34.624 -34.946 -3.346  1.00 18.35  ? 207 THR A O   1 
ATOM   1868 C  CB  . THR A 1 212 ? 34.658 -35.922 -0.470  1.00 15.82  ? 207 THR A CB  1 
ATOM   1869 O  OG1 . THR A 1 212 ? 33.868 -34.830 -0.017  1.00 16.51  ? 207 THR A OG1 1 
ATOM   1870 C  CG2 . THR A 1 212 ? 35.095 -36.774 0.767   1.00 16.36  ? 207 THR A CG2 1 
ATOM   1871 N  N   . LEU A 1 213 ? 35.660 -33.206 -2.338  1.00 17.62  ? 208 LEU A N   1 
ATOM   1872 C  CA  . LEU A 1 213 ? 34.969 -32.228 -3.201  1.00 17.80  ? 208 LEU A CA  1 
ATOM   1873 C  C   . LEU A 1 213 ? 35.732 -31.866 -4.446  1.00 19.67  ? 208 LEU A C   1 
ATOM   1874 O  O   . LEU A 1 213 ? 36.969 -31.889 -4.474  1.00 21.14  ? 208 LEU A O   1 
ATOM   1875 C  CB  . LEU A 1 213 ? 34.639 -30.943 -2.460  1.00 18.26  ? 208 LEU A CB  1 
ATOM   1876 C  CG  . LEU A 1 213 ? 33.838 -31.194 -1.199  1.00 16.77  ? 208 LEU A CG  1 
ATOM   1877 C  CD1 . LEU A 1 213 ? 33.664 -29.844 -0.527  1.00 16.17  ? 208 LEU A CD1 1 
ATOM   1878 C  CD2 . LEU A 1 213 ? 32.485 -31.885 -1.468  1.00 16.34  ? 208 LEU A CD2 1 
ATOM   1879 N  N   . SER A 1 214 ? 34.987 -31.552 -5.484  1.00 20.35  ? 209 SER A N   1 
ATOM   1880 C  CA  . SER A 1 214 ? 35.512 -30.898 -6.684  1.00 22.78  ? 209 SER A CA  1 
ATOM   1881 C  C   . SER A 1 214 ? 35.989 -29.461 -6.375  1.00 24.50  ? 209 SER A C   1 
ATOM   1882 O  O   . SER A 1 214 ? 35.585 -28.852 -5.338  1.00 25.30  ? 209 SER A O   1 
ATOM   1883 C  CB  . SER A 1 214 ? 34.365 -30.820 -7.704  1.00 21.88  ? 209 SER A CB  1 
ATOM   1884 O  OG  . SER A 1 214 ? 33.472 -29.739 -7.308  1.00 24.52  ? 209 SER A OG  1 
ATOM   1885 N  N   . GLU A 1 215 ? 36.845 -28.907 -7.244  1.00 26.05  ? 210 GLU A N   1 
ATOM   1886 C  CA  . GLU A 1 215 ? 37.313 -27.506 -7.030  1.00 27.19  ? 210 GLU A CA  1 
ATOM   1887 C  C   . GLU A 1 215 ? 36.124 -26.545 -6.747  1.00 27.57  ? 210 GLU A C   1 
ATOM   1888 O  O   . GLU A 1 215 ? 36.178 -25.708 -5.831  1.00 27.43  ? 210 GLU A O   1 
ATOM   1889 C  CB  . GLU A 1 215 ? 38.099 -26.979 -8.242  1.00 27.80  ? 210 GLU A CB  1 
ATOM   1890 C  CG  . GLU A 1 215 ? 39.434 -27.666 -8.476  1.00 32.32  ? 210 GLU A CG  1 
ATOM   1891 N  N   . ASP A 1 216 ? 35.036 -26.665 -7.513  1.00 27.15  ? 211 ASP A N   1 
ATOM   1892 C  CA  . ASP A 1 216 ? 33.836 -25.759 -7.299  1.00 25.51  ? 211 ASP A CA  1 
ATOM   1893 C  C   . ASP A 1 216 ? 33.111 -25.982 -5.969  1.00 26.30  ? 211 ASP A C   1 
ATOM   1894 O  O   . ASP A 1 216 ? 32.814 -25.047 -5.262  1.00 24.01  ? 211 ASP A O   1 
ATOM   1895 C  CB  . ASP A 1 216 ? 32.833 -25.915 -8.430  1.00 27.75  ? 211 ASP A CB  1 
ATOM   1896 N  N   . SER A 1 217 ? 32.870 -27.242 -5.593  1.00 26.17  ? 212 SER A N   1 
ATOM   1897 C  CA  . SER A 1 217 ? 32.297 -27.514 -4.257  1.00 25.02  ? 212 SER A CA  1 
ATOM   1898 C  C   . SER A 1 217 ? 33.212 -27.002 -3.145  1.00 24.94  ? 212 SER A C   1 
ATOM   1899 O  O   . SER A 1 217 ? 32.714 -26.428 -2.167  1.00 23.70  ? 212 SER A O   1 
ATOM   1900 C  CB  . SER A 1 217 ? 32.035 -29.005 -4.052  1.00 24.99  ? 212 SER A CB  1 
ATOM   1901 O  OG  . SER A 1 217 ? 30.989 -29.441 -4.924  1.00 27.62  ? 212 SER A OG  1 
ATOM   1902 N  N   . TYR A 1 218 ? 34.525 -27.262 -3.286  1.00 23.66  ? 213 TYR A N   1 
ATOM   1903 C  CA  A TYR A 1 218 ? 35.506 -26.826 -2.310  0.50 25.17  ? 213 TYR A CA  1 
ATOM   1904 C  CA  B TYR A 1 218 ? 35.496 -26.826 -2.311  0.50 25.29  ? 213 TYR A CA  1 
ATOM   1905 C  C   . TYR A 1 218 ? 35.359 -25.336 -2.057  1.00 26.22  ? 213 TYR A C   1 
ATOM   1906 O  O   . TYR A 1 218 ? 35.286 -24.881 -0.860  1.00 28.18  ? 213 TYR A O   1 
ATOM   1907 C  CB  A TYR A 1 218 ? 36.916 -27.149 -2.822  0.50 25.04  ? 213 TYR A CB  1 
ATOM   1908 C  CB  B TYR A 1 218 ? 36.900 -27.168 -2.816  0.50 25.10  ? 213 TYR A CB  1 
ATOM   1909 C  CG  A TYR A 1 218 ? 38.046 -26.960 -1.836  0.50 23.25  ? 213 TYR A CG  1 
ATOM   1910 C  CG  B TYR A 1 218 ? 38.028 -26.515 -2.073  0.50 24.21  ? 213 TYR A CG  1 
ATOM   1911 C  CD1 A TYR A 1 218 ? 38.336 -27.929 -0.882  0.50 22.28  ? 213 TYR A CD1 1 
ATOM   1912 C  CD1 B TYR A 1 218 ? 38.606 -27.138 -0.967  0.50 22.98  ? 213 TYR A CD1 1 
ATOM   1913 C  CD2 A TYR A 1 218 ? 38.857 -25.814 -1.884  0.50 25.07  ? 213 TYR A CD2 1 
ATOM   1914 C  CD2 B TYR A 1 218 ? 38.540 -25.271 -2.488  0.50 24.07  ? 213 TYR A CD2 1 
ATOM   1915 C  CE1 A TYR A 1 218 ? 39.405 -27.765 0.016   0.50 22.98  ? 213 TYR A CE1 1 
ATOM   1916 C  CE1 B TYR A 1 218 ? 39.666 -26.541 -0.281  0.50 23.47  ? 213 TYR A CE1 1 
ATOM   1917 C  CE2 A TYR A 1 218 ? 39.928 -25.640 -0.988  0.50 24.21  ? 213 TYR A CE2 1 
ATOM   1918 C  CE2 B TYR A 1 218 ? 39.604 -24.654 -1.788  0.50 22.89  ? 213 TYR A CE2 1 
ATOM   1919 C  CZ  A TYR A 1 218 ? 40.191 -26.629 -0.030  0.50 23.44  ? 213 TYR A CZ  1 
ATOM   1920 C  CZ  B TYR A 1 218 ? 40.159 -25.302 -0.705  0.50 23.29  ? 213 TYR A CZ  1 
ATOM   1921 O  OH  A TYR A 1 218 ? 41.240 -26.484 0.878   0.50 22.62  ? 213 TYR A OH  1 
ATOM   1922 O  OH  B TYR A 1 218 ? 41.206 -24.726 -0.022  0.50 21.40  ? 213 TYR A OH  1 
ATOM   1923 N  N   . LYS A 1 219 ? 35.317 -24.555 -3.152  1.00 26.98  ? 214 LYS A N   1 
ATOM   1924 C  CA  . LYS A 1 219 ? 35.117 -23.097 -3.015  1.00 27.36  ? 214 LYS A CA  1 
ATOM   1925 C  C   . LYS A 1 219 ? 33.805 -22.810 -2.265  1.00 28.22  ? 214 LYS A C   1 
ATOM   1926 O  O   . LYS A 1 219 ? 33.856 -21.973 -1.292  1.00 27.45  ? 214 LYS A O   1 
ATOM   1927 C  CB  . LYS A 1 219 ? 35.110 -22.418 -4.381  1.00 29.29  ? 214 LYS A CB  1 
ATOM   1928 C  CG  . LYS A 1 219 ? 34.979 -20.870 -4.371  1.00 34.54  ? 214 LYS A CG  1 
ATOM   1929 C  CD  . LYS A 1 219 ? 34.815 -20.221 -5.829  1.00 40.69  ? 214 LYS A CD  1 
ATOM   1930 C  CE  . LYS A 1 219 ? 33.382 -20.395 -6.462  1.00 42.78  ? 214 LYS A CE  1 
ATOM   1931 N  NZ  . LYS A 1 219 ? 32.252 -20.389 -5.472  1.00 45.25  ? 214 LYS A NZ  1 
ATOM   1932 N  N   . ASP A 1 220 ? 32.647 -23.426 -2.634  1.00 27.27  ? 215 ASP A N   1 
ATOM   1933 C  CA  . ASP A 1 220 ? 31.539 -22.903 -1.877  1.00 28.25  ? 215 ASP A CA  1 
ATOM   1934 C  C   . ASP A 1 220 ? 31.314 -23.391 -0.486  1.00 27.42  ? 215 ASP A C   1 
ATOM   1935 O  O   . ASP A 1 220 ? 30.575 -22.773 0.266   1.00 26.69  ? 215 ASP A O   1 
ATOM   1936 C  CB  . ASP A 1 220 ? 30.268 -22.418 -2.587  1.00 29.03  ? 215 ASP A CB  1 
ATOM   1937 N  N   . SER A 1 221 ? 31.952 -24.517 -0.136  1.00 26.16  ? 216 SER A N   1 
ATOM   1938 C  CA  . SER A 1 221 ? 31.843 -24.956 1.254   1.00 25.81  ? 216 SER A CA  1 
ATOM   1939 C  C   . SER A 1 221 ? 32.743 -23.973 2.064   1.00 26.32  ? 216 SER A C   1 
ATOM   1940 O  O   . SER A 1 221 ? 32.295 -23.405 3.111   1.00 23.39  ? 216 SER A O   1 
ATOM   1941 C  CB  . SER A 1 221 ? 32.401 -26.347 1.365   1.00 25.79  ? 216 SER A CB  1 
ATOM   1942 O  OG  . SER A 1 221 ? 31.509 -27.254 0.721   1.00 25.65  ? 216 SER A OG  1 
ATOM   1943 N  N   . THR A 1 222 ? 33.989 -23.769 1.555   1.00 26.27  ? 217 THR A N   1 
ATOM   1944 C  CA  . THR A 1 222 ? 34.976 -22.954 2.279   1.00 26.34  ? 217 THR A CA  1 
ATOM   1945 C  C   . THR A 1 222 ? 34.446 -21.506 2.533   1.00 25.05  ? 217 THR A C   1 
ATOM   1946 O  O   . THR A 1 222 ? 34.774 -20.859 3.525   1.00 24.41  ? 217 THR A O   1 
ATOM   1947 C  CB  . THR A 1 222 ? 36.366 -22.930 1.562   1.00 26.93  ? 217 THR A CB  1 
ATOM   1948 O  OG1 . THR A 1 222 ? 36.182 -22.500 0.203   1.00 28.47  ? 217 THR A OG1 1 
ATOM   1949 C  CG2 . THR A 1 222 ? 37.077 -24.338 1.619   1.00 27.18  ? 217 THR A CG2 1 
ATOM   1950 N  N   . LEU A 1 223 ? 33.575 -21.015 1.693   1.00 24.90  ? 218 LEU A N   1 
ATOM   1951 C  CA  . LEU A 1 223 ? 32.990 -19.658 1.954   1.00 23.92  ? 218 LEU A CA  1 
ATOM   1952 C  C   . LEU A 1 223 ? 32.168 -19.475 3.285   1.00 22.62  ? 218 LEU A C   1 
ATOM   1953 O  O   . LEU A 1 223 ? 32.309 -18.509 4.088   1.00 20.76  ? 218 LEU A O   1 
ATOM   1954 C  CB  . LEU A 1 223 ? 32.113 -19.279 0.807   1.00 26.40  ? 218 LEU A CB  1 
ATOM   1955 C  CG  . LEU A 1 223 ? 31.664 -17.796 0.752   1.00 28.46  ? 218 LEU A CG  1 
ATOM   1956 C  CD1 . LEU A 1 223 ? 31.355 -17.448 -0.689  1.00 33.13  ? 218 LEU A CD1 1 
ATOM   1957 C  CD2 . LEU A 1 223 ? 30.501 -17.421 1.625   1.00 31.84  ? 218 LEU A CD2 1 
ATOM   1958 N  N   . ILE A 1 224 ? 31.259 -20.422 3.496   1.00 18.77  ? 219 ILE A N   1 
ATOM   1959 C  CA  A ILE A 1 224 ? 30.477 -20.484 4.717   0.50 17.56  ? 219 ILE A CA  1 
ATOM   1960 C  CA  B ILE A 1 224 ? 30.487 -20.381 4.731   0.50 16.50  ? 219 ILE A CA  1 
ATOM   1961 C  C   . ILE A 1 224 ? 31.405 -20.866 5.840   1.00 15.88  ? 219 ILE A C   1 
ATOM   1962 O  O   . ILE A 1 224 ? 31.242 -20.443 6.977   1.00 15.09  ? 219 ILE A O   1 
ATOM   1963 C  CB  A ILE A 1 224 ? 29.452 -21.593 4.622   0.50 16.85  ? 219 ILE A CB  1 
ATOM   1964 C  CB  B ILE A 1 224 ? 29.178 -21.219 4.689   0.50 14.83  ? 219 ILE A CB  1 
ATOM   1965 C  CG1 A ILE A 1 224 ? 28.905 -21.665 3.199   0.50 17.38  ? 219 ILE A CG1 1 
ATOM   1966 C  CG1 B ILE A 1 224 ? 28.102 -20.569 3.804   0.50 13.33  ? 219 ILE A CG1 1 
ATOM   1967 C  CG2 A ILE A 1 224 ? 28.330 -21.379 5.667   0.50 17.52  ? 219 ILE A CG2 1 
ATOM   1968 C  CG2 B ILE A 1 224 ? 28.563 -21.373 6.094   0.50 13.97  ? 219 ILE A CG2 1 
ATOM   1969 C  CD1 A ILE A 1 224 ? 27.962 -20.562 3.004   0.50 16.90  ? 219 ILE A CD1 1 
ATOM   1970 C  CD1 B ILE A 1 224 ? 27.186 -21.622 3.114   0.50 14.05  ? 219 ILE A CD1 1 
ATOM   1971 N  N   . MET A 1 225 ? 32.378 -21.727 5.515   1.00 15.89  ? 220 MET A N   1 
ATOM   1972 C  CA  . MET A 1 225 ? 33.327 -22.161 6.567   1.00 14.28  ? 220 MET A CA  1 
ATOM   1973 C  C   . MET A 1 225 ? 34.047 -20.919 7.093   1.00 14.78  ? 220 MET A C   1 
ATOM   1974 O  O   . MET A 1 225 ? 34.311 -20.806 8.312   1.00 14.81  ? 220 MET A O   1 
ATOM   1975 C  CB  . MET A 1 225 ? 34.312 -23.190 6.059   1.00 14.99  ? 220 MET A CB  1 
ATOM   1976 C  CG  . MET A 1 225 ? 33.659 -24.601 5.941   1.00 11.68  ? 220 MET A CG  1 
ATOM   1977 S  SD  . MET A 1 225 ? 34.811 -25.728 5.110   1.00 20.08  ? 220 MET A SD  1 
ATOM   1978 C  CE  . MET A 1 225 ? 35.996 -26.039 6.421   1.00 22.07  ? 220 MET A CE  1 
ATOM   1979 N  N   . GLN A 1 226 ? 34.344 -19.964 6.201   1.00 15.24  ? 221 GLN A N   1 
ATOM   1980 C  CA  . GLN A 1 226 ? 34.983 -18.702 6.675   1.00 16.00  ? 221 GLN A CA  1 
ATOM   1981 C  C   . GLN A 1 226 ? 34.075 -17.888 7.593   1.00 15.28  ? 221 GLN A C   1 
ATOM   1982 O  O   . GLN A 1 226 ? 34.554 -17.206 8.522   1.00 15.31  ? 221 GLN A O   1 
ATOM   1983 C  CB  . GLN A 1 226 ? 35.402 -17.823 5.499   1.00 15.66  ? 221 GLN A CB  1 
ATOM   1984 C  CG  . GLN A 1 226 ? 36.250 -16.608 5.967   1.00 20.17  ? 221 GLN A CG  1 
ATOM   1985 C  CD  . GLN A 1 226 ? 37.510 -16.995 6.715   1.00 23.27  ? 221 GLN A CD  1 
ATOM   1986 O  OE1 . GLN A 1 226 ? 38.358 -17.784 6.199   1.00 27.71  ? 221 GLN A OE1 1 
ATOM   1987 N  NE2 . GLN A 1 226 ? 37.719 -16.357 7.903   1.00 26.43  ? 221 GLN A NE2 1 
ATOM   1988 N  N   . LEU A 1 227 ? 32.769 -17.916 7.344   1.00 14.83  ? 222 LEU A N   1 
ATOM   1989 C  CA  . LEU A 1 227 ? 31.862 -17.180 8.252   1.00 12.74  ? 222 LEU A CA  1 
ATOM   1990 C  C   . LEU A 1 227 ? 31.868 -17.869 9.624   1.00 12.48  ? 222 LEU A C   1 
ATOM   1991 O  O   . LEU A 1 227 ? 31.819 -17.175 10.652  1.00 11.95  ? 222 LEU A O   1 
ATOM   1992 C  CB  . LEU A 1 227 ? 30.397 -17.118 7.741   1.00 14.39  ? 222 LEU A CB  1 
ATOM   1993 C  CG  . LEU A 1 227 ? 30.256 -16.502 6.341   1.00 14.89  ? 222 LEU A CG  1 
ATOM   1994 C  CD1 . LEU A 1 227 ? 28.856 -16.707 5.912   1.00 18.13  ? 222 LEU A CD1 1 
ATOM   1995 C  CD2 . LEU A 1 227 ? 30.647 -14.984 6.394   1.00 18.17  ? 222 LEU A CD2 1 
ATOM   1996 N  N   . LEU A 1 228 ? 31.908 -19.224 9.662   1.00 12.05  ? 223 LEU A N   1 
ATOM   1997 C  CA  . LEU A 1 228 ? 32.047 -19.928 10.958  1.00 10.82  ? 223 LEU A CA  1 
ATOM   1998 C  C   . LEU A 1 228 ? 33.347 -19.473 11.639  1.00 13.40  ? 223 LEU A C   1 
ATOM   1999 O  O   . LEU A 1 228 ? 33.357 -19.204 12.861  1.00 13.77  ? 223 LEU A O   1 
ATOM   2000 C  CB  . LEU A 1 228 ? 32.060 -21.450 10.758  1.00 10.93  ? 223 LEU A CB  1 
ATOM   2001 C  CG  . LEU A 1 228 ? 30.717 -22.086 10.309  1.00 9.83   ? 223 LEU A CG  1 
ATOM   2002 C  CD1 . LEU A 1 228 ? 31.001 -23.456 9.719   1.00 13.61  ? 223 LEU A CD1 1 
ATOM   2003 C  CD2 . LEU A 1 228 ? 29.683 -22.200 11.503  1.00 11.93  ? 223 LEU A CD2 1 
ATOM   2004 N  N   . ARG A 1 229 ? 34.463 -19.412 10.880  1.00 14.36  ? 224 ARG A N   1 
ATOM   2005 C  CA  A ARG A 1 229 ? 35.727 -19.008 11.481  0.60 15.26  ? 224 ARG A CA  1 
ATOM   2006 C  CA  B ARG A 1 229 ? 35.728 -19.001 11.476  0.40 15.56  ? 224 ARG A CA  1 
ATOM   2007 C  C   . ARG A 1 229 ? 35.650 -17.560 11.965  1.00 15.55  ? 224 ARG A C   1 
ATOM   2008 O  O   . ARG A 1 229 ? 36.186 -17.239 13.005  1.00 16.07  ? 224 ARG A O   1 
ATOM   2009 C  CB  A ARG A 1 229 ? 36.870 -19.194 10.472  0.60 15.87  ? 224 ARG A CB  1 
ATOM   2010 C  CB  B ARG A 1 229 ? 36.873 -19.154 10.476  0.40 16.24  ? 224 ARG A CB  1 
ATOM   2011 C  CG  A ARG A 1 229 ? 38.244 -18.639 10.860  0.60 20.69  ? 224 ARG A CG  1 
ATOM   2012 C  CG  B ARG A 1 229 ? 38.260 -18.919 11.057  0.40 21.39  ? 224 ARG A CG  1 
ATOM   2013 C  CD  A ARG A 1 229 ? 38.812 -19.316 12.092  0.60 25.81  ? 224 ARG A CD  1 
ATOM   2014 C  CD  B ARG A 1 229 ? 38.438 -19.656 12.388  0.40 26.50  ? 224 ARG A CD  1 
ATOM   2015 N  NE  A ARG A 1 229 ? 38.836 -20.777 11.978  0.60 27.44  ? 224 ARG A NE  1 
ATOM   2016 N  NE  B ARG A 1 229 ? 38.675 -18.755 13.522  0.40 30.54  ? 224 ARG A NE  1 
ATOM   2017 C  CZ  A ARG A 1 229 ? 38.744 -21.614 13.016  0.60 27.66  ? 224 ARG A CZ  1 
ATOM   2018 C  CZ  B ARG A 1 229 ? 39.104 -19.166 14.711  0.40 30.93  ? 224 ARG A CZ  1 
ATOM   2019 N  NH1 A ARG A 1 229 ? 38.609 -21.155 14.248  0.60 29.48  ? 224 ARG A NH1 1 
ATOM   2020 N  NH1 B ARG A 1 229 ? 39.331 -20.455 14.929  0.40 32.61  ? 224 ARG A NH1 1 
ATOM   2021 N  NH2 A ARG A 1 229 ? 38.767 -22.918 12.829  0.60 26.75  ? 224 ARG A NH2 1 
ATOM   2022 N  NH2 B ARG A 1 229 ? 39.325 -18.300 15.679  0.40 29.68  ? 224 ARG A NH2 1 
ATOM   2023 N  N   . ASP A 1 230 ? 34.996 -16.692 11.187  1.00 15.86  ? 225 ASP A N   1 
ATOM   2024 C  CA  . ASP A 1 230 ? 34.823 -15.295 11.612  1.00 15.94  ? 225 ASP A CA  1 
ATOM   2025 C  C   . ASP A 1 230 ? 34.144 -15.197 12.962  1.00 14.80  ? 225 ASP A C   1 
ATOM   2026 O  O   . ASP A 1 230 ? 34.533 -14.349 13.805  1.00 14.39  ? 225 ASP A O   1 
ATOM   2027 C  CB  . ASP A 1 230 ? 33.989 -14.485 10.610  1.00 17.54  ? 225 ASP A CB  1 
ATOM   2028 C  CG  . ASP A 1 230 ? 34.684 -14.286 9.251   1.00 18.87  ? 225 ASP A CG  1 
ATOM   2029 O  OD1 . ASP A 1 230 ? 35.952 -14.350 9.170   1.00 19.53  ? 225 ASP A OD1 1 
ATOM   2030 O  OD2 . ASP A 1 230 ? 33.928 -13.970 8.280   1.00 23.87  ? 225 ASP A OD2 1 
ATOM   2031 N  N   . ASN A 1 231 ? 33.093 -15.995 13.144  1.00 13.13  ? 226 ASN A N   1 
ATOM   2032 C  CA  . ASN A 1 231 ? 32.392 -15.993 14.421  1.00 13.17  ? 226 ASN A CA  1 
ATOM   2033 C  C   . ASN A 1 231 ? 33.258 -16.540 15.513  1.00 13.13  ? 226 ASN A C   1 
ATOM   2034 O  O   . ASN A 1 231 ? 33.282 -15.953 16.609  1.00 13.69  ? 226 ASN A O   1 
ATOM   2035 C  CB  . ASN A 1 231 ? 31.044 -16.720 14.345  1.00 13.57  ? 226 ASN A CB  1 
ATOM   2036 C  CG  . ASN A 1 231 ? 30.019 -15.871 13.587  1.00 13.13  ? 226 ASN A CG  1 
ATOM   2037 O  OD1 . ASN A 1 231 ? 30.321 -14.689 13.243  1.00 14.83  ? 226 ASN A OD1 1 
ATOM   2038 N  ND2 . ASN A 1 231 ? 28.838 -16.435 13.323  1.00 13.71  ? 226 ASN A ND2 1 
ATOM   2039 N  N   . LEU A 1 232 ? 33.956 -17.653 15.246  1.00 12.81  ? 227 LEU A N   1 
ATOM   2040 C  CA  . LEU A 1 232 ? 34.807 -18.194 16.288  1.00 13.44  ? 227 LEU A CA  1 
ATOM   2041 C  C   . LEU A 1 232 ? 35.857 -17.173 16.711  1.00 14.24  ? 227 LEU A C   1 
ATOM   2042 O  O   . LEU A 1 232 ? 36.192 -17.062 17.926  1.00 14.97  ? 227 LEU A O   1 
ATOM   2043 C  CB  . LEU A 1 232 ? 35.533 -19.446 15.799  1.00 13.63  ? 227 LEU A CB  1 
ATOM   2044 C  CG  . LEU A 1 232 ? 34.564 -20.627 15.831  1.00 15.06  ? 227 LEU A CG  1 
ATOM   2045 C  CD1 . LEU A 1 232 ? 35.171 -21.774 14.999  1.00 17.31  ? 227 LEU A CD1 1 
ATOM   2046 C  CD2 . LEU A 1 232 ? 34.209 -21.019 17.302  1.00 13.57  ? 227 LEU A CD2 1 
ATOM   2047 N  N   . THR A 1 233 ? 36.372 -16.415 15.742  1.00 14.72  ? 228 THR A N   1 
ATOM   2048 C  CA  . THR A 1 233 ? 37.375 -15.414 16.073  1.00 17.26  ? 228 THR A CA  1 
ATOM   2049 C  C   . THR A 1 233 ? 36.792 -14.265 16.931  1.00 16.72  ? 228 THR A C   1 
ATOM   2050 O  O   . THR A 1 233 ? 37.411 -13.796 17.911  1.00 18.15  ? 228 THR A O   1 
ATOM   2051 C  CB  . THR A 1 233 ? 38.014 -14.876 14.783  1.00 17.97  ? 228 THR A CB  1 
ATOM   2052 O  OG1 . THR A 1 233 ? 38.707 -15.979 14.189  1.00 20.67  ? 228 THR A OG1 1 
ATOM   2053 C  CG2 . THR A 1 233 ? 39.088 -13.812 15.165  1.00 20.61  ? 228 THR A CG2 1 
ATOM   2054 N  N   . LEU A 1 234 ? 35.578 -13.845 16.572  1.00 16.32  ? 229 LEU A N   1 
ATOM   2055 C  CA  . LEU A 1 234 ? 34.875 -12.834 17.338  1.00 16.29  ? 229 LEU A CA  1 
ATOM   2056 C  C   . LEU A 1 234 ? 34.524 -13.288 18.780  1.00 17.05  ? 229 LEU A C   1 
ATOM   2057 O  O   . LEU A 1 234 ? 34.666 -12.535 19.773  1.00 17.99  ? 229 LEU A O   1 
ATOM   2058 C  CB  . LEU A 1 234 ? 33.664 -12.397 16.542  1.00 16.46  ? 229 LEU A CB  1 
ATOM   2059 C  CG  . LEU A 1 234 ? 32.846 -11.321 17.198  1.00 19.72  ? 229 LEU A CG  1 
ATOM   2060 C  CD1 . LEU A 1 234 ? 33.651 -9.991  17.158  1.00 24.51  ? 229 LEU A CD1 1 
ATOM   2061 C  CD2 . LEU A 1 234 ? 31.513 -11.225 16.438  1.00 25.14  ? 229 LEU A CD2 1 
ATOM   2062 N  N   . TRP A 1 235 ? 34.163 -14.559 18.917  1.00 16.61  ? 230 TRP A N   1 
ATOM   2063 C  CA  . TRP A 1 235 ? 33.655 -15.038 20.180  1.00 16.86  ? 230 TRP A CA  1 
ATOM   2064 C  C   . TRP A 1 235 ? 34.673 -15.615 21.146  1.00 18.32  ? 230 TRP A C   1 
ATOM   2065 O  O   . TRP A 1 235 ? 34.342 -15.863 22.299  1.00 20.19  ? 230 TRP A O   1 
ATOM   2066 C  CB  . TRP A 1 235 ? 32.610 -16.073 19.870  1.00 17.25  ? 230 TRP A CB  1 
ATOM   2067 C  CG  . TRP A 1 235 ? 31.421 -15.555 19.132  1.00 15.18  ? 230 TRP A CG  1 
ATOM   2068 C  CD1 . TRP A 1 235 ? 30.992 -14.247 19.053  1.00 17.81  ? 230 TRP A CD1 1 
ATOM   2069 C  CD2 . TRP A 1 235 ? 30.446 -16.341 18.437  1.00 13.99  ? 230 TRP A CD2 1 
ATOM   2070 N  NE1 . TRP A 1 235 ? 29.827 -14.183 18.335  1.00 15.76  ? 230 TRP A NE1 1 
ATOM   2071 C  CE2 . TRP A 1 235 ? 29.462 -15.439 17.933  1.00 12.35  ? 230 TRP A CE2 1 
ATOM   2072 C  CE3 . TRP A 1 235 ? 30.318 -17.713 18.169  1.00 14.97  ? 230 TRP A CE3 1 
ATOM   2073 C  CZ2 . TRP A 1 235 ? 28.341 -15.857 17.222  1.00 15.18  ? 230 TRP A CZ2 1 
ATOM   2074 C  CZ3 . TRP A 1 235 ? 29.184 -18.155 17.435  1.00 15.09  ? 230 TRP A CZ3 1 
ATOM   2075 C  CH2 . TRP A 1 235 ? 28.201 -17.222 16.987  1.00 13.46  ? 230 TRP A CH2 1 
ATOM   2076 N  N   . THR A 1 236 ? 35.900 -15.820 20.687  1.00 21.20  ? 231 THR A N   1 
ATOM   2077 C  CA  . THR A 1 236 ? 36.917 -16.461 21.521  1.00 23.51  ? 231 THR A CA  1 
ATOM   2078 C  C   . THR A 1 236 ? 38.166 -15.626 21.650  1.00 26.53  ? 231 THR A C   1 
ATOM   2079 O  O   . THR A 1 236 ? 39.118 -15.984 22.404  1.00 29.92  ? 231 THR A O   1 
ATOM   2080 C  CB  . THR A 1 236 ? 37.248 -17.897 21.027  1.00 22.43  ? 231 THR A CB  1 
ATOM   2081 O  OG1 . THR A 1 236 ? 37.755 -17.842 19.688  1.00 23.31  ? 231 THR A OG1 1 
ATOM   2082 C  CG2 . THR A 1 236 ? 35.998 -18.769 21.009  1.00 24.50  ? 231 THR A CG2 1 
ATOM   2083 O  OXT . THR A 1 236 ? 38.267 -14.562 21.031  1.00 29.39  ? 231 THR A OXT 1 
ATOM   2084 N  N   . LYS B 2 1   ? 32.817 -6.776  12.249  1.00 36.12  ? 369 LYS P N   1 
ATOM   2085 C  CA  . LYS B 2 1   ? 32.634 -6.472  13.709  1.00 35.45  ? 369 LYS P CA  1 
ATOM   2086 C  C   . LYS B 2 1   ? 31.331 -7.079  14.244  1.00 33.19  ? 369 LYS P C   1 
ATOM   2087 O  O   . LYS B 2 1   ? 31.222 -7.328  15.477  1.00 35.62  ? 369 LYS P O   1 
ATOM   2088 C  CB  . LYS B 2 1   ? 32.675 -4.946  13.942  1.00 36.75  ? 369 LYS P CB  1 
ATOM   2089 C  CG  . LYS B 2 1   ? 31.910 -4.426  15.162  1.00 39.41  ? 369 LYS P CG  1 
ATOM   2090 C  CD  . LYS B 2 1   ? 32.267 -2.979  15.499  1.00 42.99  ? 369 LYS P CD  1 
ATOM   2091 N  N   . ARG B 2 2   ? 30.346 -7.282  13.357  1.00 28.63  ? 370 ARG P N   1 
ATOM   2092 C  CA  A ARG B 2 2   ? 29.099 -7.932  13.754  0.50 25.79  ? 370 ARG P CA  1 
ATOM   2093 C  CA  B ARG B 2 2   ? 29.079 -7.923  13.726  0.50 25.36  ? 370 ARG P CA  1 
ATOM   2094 C  C   . ARG B 2 2   ? 29.199 -9.406  13.343  1.00 23.94  ? 370 ARG P C   1 
ATOM   2095 O  O   . ARG B 2 2   ? 29.716 -9.712  12.295  1.00 22.94  ? 370 ARG P O   1 
ATOM   2096 C  CB  A ARG B 2 2   ? 27.881 -7.195  13.148  0.50 26.65  ? 370 ARG P CB  1 
ATOM   2097 C  CB  B ARG B 2 2   ? 27.907 -7.228  12.996  0.50 25.71  ? 370 ARG P CB  1 
ATOM   2098 C  CG  A ARG B 2 2   ? 26.634 -8.059  12.837  0.50 25.61  ? 370 ARG P CG  1 
ATOM   2099 C  CG  B ARG B 2 2   ? 26.470 -7.738  13.330  0.50 23.06  ? 370 ARG P CG  1 
ATOM   2100 C  CD  A ARG B 2 2   ? 25.286 -7.255  12.671  0.50 26.74  ? 370 ARG P CD  1 
ATOM   2101 C  CD  B ARG B 2 2   ? 25.321 -7.076  12.449  0.50 21.81  ? 370 ARG P CD  1 
ATOM   2102 N  NE  A ARG B 2 2   ? 24.509 -7.254  13.909  0.50 25.76  ? 370 ARG P NE  1 
ATOM   2103 N  NE  B ARG B 2 2   ? 24.156 -7.952  12.164  0.50 17.50  ? 370 ARG P NE  1 
ATOM   2104 C  CZ  A ARG B 2 2   ? 23.369 -7.897  14.125  0.50 22.53  ? 370 ARG P CZ  1 
ATOM   2105 C  CZ  B ARG B 2 2   ? 23.861 -8.491  10.947  0.50 18.82  ? 370 ARG P CZ  1 
ATOM   2106 N  NH1 A ARG B 2 2   ? 22.739 -8.591  13.184  0.50 19.47  ? 370 ARG P NH1 1 
ATOM   2107 N  NH1 B ARG B 2 2   ? 24.679 -8.182  9.943   0.50 13.17  ? 370 ARG P NH1 1 
ATOM   2108 N  NH2 A ARG B 2 2   ? 22.842 -7.802  15.320  0.50 27.06  ? 370 ARG P NH2 1 
ATOM   2109 N  NH2 B ARG B 2 2   ? 22.749 -9.329  10.703  0.50 11.06  ? 370 ARG P NH2 1 
ATOM   2110 N  N   . ARG B 2 3   ? 28.734 -10.309 14.207  1.00 20.11  ? 371 ARG P N   1 
ATOM   2111 C  CA  . ARG B 2 3   ? 28.737 -11.740 13.910  1.00 18.38  ? 371 ARG P CA  1 
ATOM   2112 C  C   . ARG B 2 3   ? 27.997 -12.025 12.611  1.00 17.76  ? 371 ARG P C   1 
ATOM   2113 O  O   . ARG B 2 3   ? 27.116 -11.278 12.187  1.00 18.44  ? 371 ARG P O   1 
ATOM   2114 C  CB  . ARG B 2 3   ? 28.120 -12.513 15.084  1.00 17.24  ? 371 ARG P CB  1 
ATOM   2115 C  CG  . ARG B 2 3   ? 26.573 -12.593 15.054  1.00 19.40  ? 371 ARG P CG  1 
ATOM   2116 C  CD  . ARG B 2 3   ? 25.878 -11.206 15.182  1.00 17.19  ? 371 ARG P CD  1 
ATOM   2117 N  NE  . ARG B 2 3   ? 24.431 -11.383 15.145  1.00 16.24  ? 371 ARG P NE  1 
ATOM   2118 C  CZ  . ARG B 2 3   ? 23.746 -11.695 14.043  1.00 14.78  ? 371 ARG P CZ  1 
ATOM   2119 N  NH1 . ARG B 2 3   ? 24.404 -11.742 12.868  1.00 17.47  ? 371 ARG P NH1 1 
ATOM   2120 N  NH2 . ARG B 2 3   ? 22.421 -11.888 14.094  1.00 15.02  ? 371 ARG P NH2 1 
ATOM   2121 N  N   . LYS B 2 4   ? 28.416 -13.102 11.956  1.00 16.67  ? 372 LYS P N   1 
ATOM   2122 C  CA  . LYS B 2 4   ? 27.941 -13.435 10.624  1.00 16.04  ? 372 LYS P CA  1 
ATOM   2123 C  C   . LYS B 2 4   ? 26.786 -14.409 10.724  1.00 15.77  ? 372 LYS P C   1 
ATOM   2124 O  O   . LYS B 2 4   ? 26.809 -15.337 11.525  1.00 15.27  ? 372 LYS P O   1 
ATOM   2125 C  CB  . LYS B 2 4   ? 29.068 -14.110 9.802   1.00 16.97  ? 372 LYS P CB  1 
ATOM   2126 C  CG  . LYS B 2 4   ? 30.332 -13.230 9.676   1.00 19.84  ? 372 LYS P CG  1 
ATOM   2127 C  CD  . LYS B 2 4   ? 30.030 -11.940 8.989   1.00 20.71  ? 372 LYS P CD  1 
ATOM   2128 C  CE  . LYS B 2 4   ? 31.282 -11.050 9.064   1.00 27.55  ? 372 LYS P CE  1 
ATOM   2129 N  NZ  . LYS B 2 4   ? 32.353 -11.710 8.292   1.00 32.71  ? 372 LYS P NZ  1 
HETATM 2130 N  N   . SEP B 2 5   ? 25.799 -14.215 9.858   1.00 15.14  ? 373 SEP P N   1 
HETATM 2131 C  CA  . SEP B 2 5   ? 24.793 -15.243 9.619   1.00 13.13  ? 373 SEP P CA  1 
HETATM 2132 C  CB  . SEP B 2 5   ? 23.488 -14.884 10.313  1.00 13.57  ? 373 SEP P CB  1 
HETATM 2133 O  OG  . SEP B 2 5   ? 23.095 -13.603 9.840   1.00 13.95  ? 373 SEP P OG  1 
HETATM 2134 C  C   . SEP B 2 5   ? 24.623 -15.290 8.110   1.00 13.20  ? 373 SEP P C   1 
HETATM 2135 O  O   . SEP B 2 5   ? 25.277 -14.537 7.380   1.00 14.60  ? 373 SEP P O   1 
HETATM 2136 P  P   . SEP B 2 5   ? 21.572 -13.121 10.217  1.00 14.60  ? 373 SEP P P   1 
HETATM 2137 O  O1P . SEP B 2 5   ? 21.553 -12.791 11.786  1.00 15.53  ? 373 SEP P O1P 1 
HETATM 2138 O  O2P . SEP B 2 5   ? 21.442 -11.805 9.386   1.00 14.97  ? 373 SEP P O2P 1 
HETATM 2139 O  O3P . SEP B 2 5   ? 20.567 -14.268 9.747   1.00 13.36  ? 373 SEP P O3P 1 
ATOM   2140 N  N   . VAL B 2 6   ? 23.804 -16.200 7.600   1.00 13.70  ? 374 VAL P N   1 
ATOM   2141 C  CA  . VAL B 2 6   ? 23.716 -16.365 6.130   1.00 13.39  ? 374 VAL P CA  1 
ATOM   2142 C  C   . VAL B 2 6   ? 22.330 -16.883 5.807   1.00 14.36  ? 374 VAL P C   1 
ATOM   2143 O  O   . VAL B 2 6   ? 21.622 -17.438 6.685   1.00 15.50  ? 374 VAL P O   1 
ATOM   2144 C  CB  . VAL B 2 6   ? 24.757 -17.405 5.645   1.00 13.40  ? 374 VAL P CB  1 
ATOM   2145 C  CG1 . VAL B 2 6   ? 24.398 -18.842 6.164   1.00 11.71  ? 374 VAL P CG1 1 
ATOM   2146 C  CG2 . VAL B 2 6   ? 24.956 -17.338 4.087   1.00 16.02  ? 374 VAL P CG2 1 
ATOM   2147 O  OXT . VAL B 2 6   ? 21.894 -16.739 4.655   1.00 14.96  ? 374 VAL P OXT 1 
HETATM 2148 C  C1  . FSC C 3 .   ? 23.381 -19.042 -0.775  1.00 13.79  ? 249 FSC A C1  1 
HETATM 2149 C  C4  . FSC C 3 .   ? 24.423 -18.207 -0.402  1.00 14.95  ? 249 FSC A C4  1 
HETATM 2150 C  C11 . FSC C 3 .   ? 25.857 -18.519 -0.687  1.00 14.25  ? 249 FSC A C11 1 
HETATM 2151 C  C18 . FSC C 3 .   ? 26.568 -18.650 0.680   1.00 15.34  ? 249 FSC A C18 1 
HETATM 2152 C  C17 . FSC C 3 .   ? 26.447 -17.347 -1.478  1.00 18.25  ? 249 FSC A C17 1 
HETATM 2153 O  O24 . FSC C 3 .   ? 27.713 -17.950 -1.929  1.00 24.58  ? 249 FSC A O24 1 
HETATM 2154 C  C31 . FSC C 3 .   ? 28.505 -17.244 -2.742  1.00 30.56  ? 249 FSC A C31 1 
HETATM 2155 O  O37 . FSC C 3 .   ? 28.160 -16.123 -3.101  1.00 35.08  ? 249 FSC A O37 1 
HETATM 2156 C  C36 . FSC C 3 .   ? 29.830 -17.905 -3.191  1.00 32.86  ? 249 FSC A C36 1 
HETATM 2157 C  C10 . FSC C 3 .   ? 23.958 -16.937 0.298   1.00 15.04  ? 249 FSC A C10 1 
HETATM 2158 C  C6  . FSC C 3 .   ? 22.511 -16.887 -0.268  1.00 13.09  ? 249 FSC A C6  1 
HETATM 2159 O  O13 . FSC C 3 .   ? 21.692 -16.089 0.584   1.00 13.11  ? 249 FSC A O13 1 
HETATM 2160 C  C2  . FSC C 3 .   ? 22.052 -18.399 -0.307  1.00 11.48  ? 249 FSC A C2  1 
HETATM 2161 C  C7  . FSC C 3 .   ? 20.814 -18.618 -1.300  1.00 10.96  ? 249 FSC A C7  1 
HETATM 2162 C  C5  . FSC C 3 .   ? 21.556 -18.853 0.942   1.00 12.14  ? 249 FSC A C5  1 
HETATM 2163 C  C12 . FSC C 3 .   ? 21.930 -19.894 1.803   1.00 10.87  ? 249 FSC A C12 1 
HETATM 2164 C  C20 . FSC C 3 .   ? 21.245 -20.239 3.093   1.00 12.19  ? 249 FSC A C20 1 
HETATM 2165 C  C27 . FSC C 3 .   ? 19.701 -20.263 2.841   1.00 10.87  ? 249 FSC A C27 1 
HETATM 2166 O  O32 . FSC C 3 .   ? 19.090 -20.705 4.085   1.00 12.21  ? 249 FSC A O32 1 
HETATM 2167 C  C38 . FSC C 3 .   ? 17.661 -20.890 3.911   1.00 12.91  ? 249 FSC A C38 1 
HETATM 2168 C  C26 . FSC C 3 .   ? 21.919 -21.589 3.572   1.00 11.88  ? 249 FSC A C26 1 
HETATM 2169 C  C25 . FSC C 3 .   ? 23.382 -21.354 3.124   1.00 11.80  ? 249 FSC A C25 1 
HETATM 2170 C  C19 . FSC C 3 .   ? 23.219 -20.738 1.702   1.00 11.82  ? 249 FSC A C19 1 
HETATM 2171 C  C15 . FSC C 3 .   ? 23.108 -21.876 0.603   1.00 14.98  ? 249 FSC A C15 1 
HETATM 2172 C  C23 . FSC C 3 .   ? 21.638 -22.262 0.143   1.00 15.41  ? 249 FSC A C23 1 
HETATM 2173 C  C9  . FSC C 3 .   ? 23.967 -21.509 -0.637  1.00 16.25  ? 249 FSC A C9  1 
HETATM 2174 O  O16 . FSC C 3 .   ? 24.078 -22.644 -1.511  1.00 15.49  ? 249 FSC A O16 1 
HETATM 2175 C  C3  . FSC C 3 .   ? 23.375 -20.395 -1.530  1.00 14.93  ? 249 FSC A C3  1 
HETATM 2176 O  O8  . FSC C 3 .   ? 24.248 -20.175 -2.630  1.00 14.27  ? 249 FSC A O8  1 
HETATM 2177 C  C14 . FSC C 3 .   ? 23.635 -20.447 -3.896  1.00 16.54  ? 249 FSC A C14 1 
HETATM 2178 O  O22 . FSC C 3 .   ? 22.812 -19.301 -4.256  1.00 17.74  ? 249 FSC A O22 1 
HETATM 2179 C  C30 . FSC C 3 .   ? 23.479 -18.030 -4.299  1.00 19.33  ? 249 FSC A C30 1 
HETATM 2180 C  C33 . FSC C 3 .   ? 24.678 -18.036 -5.256  1.00 22.49  ? 249 FSC A C33 1 
HETATM 2181 O  O39 . FSC C 3 .   ? 25.396 -16.746 -5.131  1.00 26.55  ? 249 FSC A O39 1 
HETATM 2182 C  C28 . FSC C 3 .   ? 25.591 -19.259 -4.956  1.00 22.49  ? 249 FSC A C28 1 
HETATM 2183 O  O34 . FSC C 3 .   ? 26.492 -19.373 -6.101  1.00 29.00  ? 249 FSC A O34 1 
HETATM 2184 C  C40 . FSC C 3 .   ? 27.792 -19.687 -5.967  1.00 35.93  ? 249 FSC A C40 1 
HETATM 2185 O  O43 . FSC C 3 .   ? 28.224 -19.982 -4.844  1.00 42.43  ? 249 FSC A O43 1 
HETATM 2186 C  C42 . FSC C 3 .   ? 28.682 -19.717 -7.236  1.00 37.97  ? 249 FSC A C42 1 
HETATM 2187 C  C21 . FSC C 3 .   ? 24.727 -20.555 -4.933  1.00 19.96  ? 249 FSC A C21 1 
HETATM 2188 O  O29 . FSC C 3 .   ? 25.471 -21.786 -4.699  1.00 21.66  ? 249 FSC A O29 1 
HETATM 2189 C  C35 . FSC C 3 .   ? 22.357 -16.998 -4.575  1.00 20.04  ? 249 FSC A C35 1 
HETATM 2190 O  O41 . FSC C 3 .   ? 22.041 -17.178 -5.959  1.00 23.60  ? 249 FSC A O41 1 
HETATM 2191 C  C44 . FSC C 3 .   ? 21.321 -16.061 -6.601  1.00 28.74  ? 249 FSC A C44 1 
HETATM 2192 C  C47 . FSC C 3 .   ? 19.915 -15.873 -5.972  1.00 26.61  ? 249 FSC A C47 1 
HETATM 2193 C  C46 . FSC C 3 .   ? 21.180 -16.327 -8.101  1.00 30.19  ? 249 FSC A C46 1 
HETATM 2194 C  C45 . FSC C 3 .   ? 22.067 -14.873 -6.455  1.00 32.76  ? 249 FSC A C45 1 
HETATM 2195 C  C48 . FSC C 3 .   ? 23.363 -14.774 -6.979  1.00 38.94  ? 249 FSC A C48 1 
HETATM 2196 CL CL  . CL  D 4 .   ? 5.726  -6.424  -13.470 1.00 15.49  ? 250 CL  A CL  1 
HETATM 2197 MG MG  . MG  E 5 .   ? 7.360  -33.172 -2.296  1.00 11.00  ? 251 MG  A MG  1 
HETATM 2198 MG MG  . MG  F 5 .   ? 0.000  -21.067 -15.550 0.50 9.49   ? 252 MG  A MG  1 
HETATM 2199 CA CA  . CA  G 6 .   ? 19.235 -16.258 1.476   1.00 33.34  ? 253 CA  A CA  1 
HETATM 2200 O  O   . HOH H 7 .   ? 4.860  -22.831 -7.017  1.00 8.76   ? 254 HOH A O   1 
HETATM 2201 O  O   . HOH H 7 .   ? 11.758 -3.409  -4.530  1.00 11.21  ? 255 HOH A O   1 
HETATM 2202 O  O   . HOH H 7 .   ? 17.165 -25.433 -9.489  1.00 11.85  ? 256 HOH A O   1 
HETATM 2203 O  O   . HOH H 7 .   ? 22.299 -37.018 0.940   1.00 10.25  ? 257 HOH A O   1 
HETATM 2204 O  O   . HOH H 7 .   ? 3.086  -11.063 -3.619  1.00 14.21  ? 258 HOH A O   1 
HETATM 2205 O  O   . HOH H 7 .   ? -1.649 -22.485 -3.784  1.00 14.42  ? 259 HOH A O   1 
HETATM 2206 O  O   . HOH H 7 .   ? 14.629 -8.843  14.087  1.00 11.82  ? 260 HOH A O   1 
HETATM 2207 O  O   . HOH H 7 .   ? 9.355  -26.861 -2.364  1.00 12.67  ? 261 HOH A O   1 
HETATM 2208 O  O   . HOH H 7 .   ? 1.207  -20.422 -13.410 1.00 13.23  ? 262 HOH A O   1 
HETATM 2209 O  O   . HOH H 7 .   ? 39.355 -13.274 19.218  1.00 28.86  ? 263 HOH A O   1 
HETATM 2210 O  O   . HOH H 7 .   ? 0.043  -16.727 -6.960  1.00 13.80  ? 264 HOH A O   1 
HETATM 2211 O  O   . HOH H 7 .   ? 15.395 -15.928 3.987   1.00 12.84  ? 265 HOH A O   1 
HETATM 2212 O  O   . HOH H 7 .   ? 18.507 -10.802 7.149   1.00 16.19  ? 266 HOH A O   1 
HETATM 2213 O  O   . HOH H 7 .   ? 15.471 -6.310  14.481  1.00 12.58  ? 267 HOH A O   1 
HETATM 2214 O  O   . HOH H 7 .   ? 10.157 7.665   22.661  1.00 21.08  ? 268 HOH A O   1 
HETATM 2215 O  O   . HOH H 7 .   ? 17.436 -28.140 20.569  1.00 17.86  ? 269 HOH A O   1 
HETATM 2216 O  O   . HOH H 7 .   ? 30.435 -29.927 20.082  1.00 31.66  ? 270 HOH A O   1 
HETATM 2217 O  O   . HOH H 7 .   ? 10.972 -4.513  20.950  1.00 16.29  ? 271 HOH A O   1 
HETATM 2218 O  O   . HOH H 7 .   ? 27.633 -37.701 15.912  1.00 18.17  ? 272 HOH A O   1 
HETATM 2219 O  O   . HOH H 7 .   ? 14.997 -13.059 -15.670 1.00 14.96  ? 273 HOH A O   1 
HETATM 2220 O  O   . HOH H 7 .   ? 10.918 -18.573 -15.456 1.00 13.24  ? 274 HOH A O   1 
HETATM 2221 O  O   . HOH H 7 .   ? 27.588 -29.532 13.071  1.00 13.63  ? 275 HOH A O   1 
HETATM 2222 O  O   . HOH H 7 .   ? 17.609 -26.093 -1.278  1.00 15.71  ? 276 HOH A O   1 
HETATM 2223 O  O   . HOH H 7 .   ? 15.372 -32.221 -4.618  1.00 14.97  ? 277 HOH A O   1 
HETATM 2224 O  O   . HOH H 7 .   ? 12.391 -20.664 25.289  1.00 19.01  ? 278 HOH A O   1 
HETATM 2225 O  O   . HOH H 7 .   ? 4.964  -29.400 -7.273  1.00 21.10  ? 279 HOH A O   1 
HETATM 2226 O  O   . HOH H 7 .   ? 30.149 -29.654 9.134   1.00 15.18  ? 280 HOH A O   1 
HETATM 2227 O  O   . HOH H 7 .   ? 29.237 -30.985 -0.077  1.00 19.95  ? 281 HOH A O   1 
HETATM 2228 O  O   . HOH H 7 .   ? 19.090 -26.063 21.704  1.00 20.47  ? 282 HOH A O   1 
HETATM 2229 O  O   . HOH H 7 .   ? 18.735 -18.688 -7.449  1.00 19.57  ? 283 HOH A O   1 
HETATM 2230 O  O   . HOH H 7 .   ? 8.330  -10.568 17.881  1.00 14.09  ? 284 HOH A O   1 
HETATM 2231 O  O   . HOH H 7 .   ? 4.204  -23.833 -3.152  1.00 15.76  ? 285 HOH A O   1 
HETATM 2232 O  O   . HOH H 7 .   ? 7.512  -7.768  -0.708  1.00 13.29  ? 286 HOH A O   1 
HETATM 2233 O  O   . HOH H 7 .   ? 4.279  -20.610 -15.857 1.00 14.21  ? 287 HOH A O   1 
HETATM 2234 O  O   . HOH H 7 .   ? 21.969 -1.142  12.276  1.00 21.24  ? 288 HOH A O   1 
HETATM 2235 O  O   . HOH H 7 .   ? 28.074 -19.106 14.093  1.00 18.16  ? 289 HOH A O   1 
HETATM 2236 O  O   . HOH H 7 .   ? 19.942 -13.355 15.907  1.00 13.59  ? 290 HOH A O   1 
HETATM 2237 O  O   . HOH H 7 .   ? 1.572  -22.503 -11.557 1.00 15.16  ? 291 HOH A O   1 
HETATM 2238 O  O   . HOH H 7 .   ? 18.039 -7.105  14.866  1.00 17.41  ? 292 HOH A O   1 
HETATM 2239 O  O   . HOH H 7 .   ? 14.322 -29.530 -5.456  1.00 16.59  ? 293 HOH A O   1 
HETATM 2240 O  O   . HOH H 7 .   ? 3.910  -26.612 5.299   1.00 18.39  ? 294 HOH A O   1 
HETATM 2241 O  O   . HOH H 7 .   ? 32.134 -24.186 23.965  1.00 23.41  ? 295 HOH A O   1 
HETATM 2242 O  O   . HOH H 7 .   ? 6.119  -10.093 0.358   1.00 17.57  ? 296 HOH A O   1 
HETATM 2243 O  O   . HOH H 7 .   ? 19.096 -12.694 -10.795 1.00 18.71  ? 297 HOH A O   1 
HETATM 2244 O  O   . HOH H 7 .   ? 7.702  -21.651 -13.347 1.00 15.06  ? 298 HOH A O   1 
HETATM 2245 O  O   . HOH H 7 .   ? 12.244 -21.838 -12.787 1.00 15.43  ? 299 HOH A O   1 
HETATM 2246 O  O   . HOH H 7 .   ? 15.019 -23.785 -11.400 1.00 25.97  ? 300 HOH A O   1 
HETATM 2247 O  O   . HOH H 7 .   ? -2.586 -18.169 -9.315  1.00 15.55  ? 301 HOH A O   1 
HETATM 2248 O  O   . HOH H 7 .   ? 29.034 -31.105 11.353  1.00 18.07  ? 302 HOH A O   1 
HETATM 2249 O  O   . HOH H 7 .   ? 19.589 0.943   8.794   1.00 19.60  ? 303 HOH A O   1 
HETATM 2250 O  O   . HOH H 7 .   ? -2.023 -18.494 -6.752  1.00 17.38  ? 304 HOH A O   1 
HETATM 2251 O  O   . HOH H 7 .   ? 33.897 -34.981 8.342   1.00 25.53  ? 305 HOH A O   1 
HETATM 2252 O  O   . HOH H 7 .   ? 20.861 -22.978 23.657  1.00 16.18  ? 306 HOH A O   1 
HETATM 2253 O  O   . HOH H 7 .   ? 14.128 -3.628  4.000   1.00 18.99  ? 307 HOH A O   1 
HETATM 2254 O  O   . HOH H 7 .   ? 5.455  -17.010 -18.633 1.00 18.35  ? 308 HOH A O   1 
HETATM 2255 O  O   . HOH H 7 .   ? 5.320  -5.852  6.823   1.00 21.08  ? 309 HOH A O   1 
HETATM 2256 O  O   . HOH H 7 .   ? 14.512 -12.037 -18.195 1.00 26.52  ? 310 HOH A O   1 
HETATM 2257 O  O   . HOH H 7 .   ? 21.836 -14.434 24.249  1.00 34.90  ? 311 HOH A O   1 
HETATM 2258 O  O   . HOH H 7 .   ? 23.061 -27.102 19.193  1.00 19.00  ? 312 HOH A O   1 
HETATM 2259 O  O   . HOH H 7 .   ? 7.458  -27.713 -0.953  1.00 15.60  ? 313 HOH A O   1 
HETATM 2260 O  O   . HOH H 7 .   ? 29.769 -26.088 25.212  1.00 22.45  ? 314 HOH A O   1 
HETATM 2261 O  O   . HOH H 7 .   ? 9.179  -24.428 15.248  1.00 22.95  ? 315 HOH A O   1 
HETATM 2262 O  O   . HOH H 7 .   ? 17.254 -17.019 5.507   1.00 108.55 ? 316 HOH A O   1 
HETATM 2263 O  O   . HOH H 7 .   ? 2.978  -7.015  12.169  1.00 26.22  ? 317 HOH A O   1 
HETATM 2264 O  O   . HOH H 7 .   ? 16.524 -36.681 0.729   1.00 33.89  ? 318 HOH A O   1 
HETATM 2265 O  O   . HOH H 7 .   ? 21.687 4.400   16.536  1.00 27.47  ? 319 HOH A O   1 
HETATM 2266 O  O   . HOH H 7 .   ? 1.653  -21.971 -1.074  1.00 35.66  ? 320 HOH A O   1 
HETATM 2267 O  O   . HOH H 7 .   ? 11.187 -10.618 -21.200 1.00 21.33  ? 321 HOH A O   1 
HETATM 2268 O  O   . HOH H 7 .   ? 21.026 -19.955 -6.784  1.00 21.08  ? 322 HOH A O   1 
HETATM 2269 O  O   . HOH H 7 .   ? 41.034 -31.369 1.838   1.00 21.72  ? 323 HOH A O   1 
HETATM 2270 O  O   . HOH H 7 .   ? 10.106 -20.577 31.684  1.00 26.58  ? 324 HOH A O   1 
HETATM 2271 O  O   . HOH H 7 .   ? -0.569 -23.082 -9.972  1.00 29.31  ? 325 HOH A O   1 
HETATM 2272 O  O   . HOH H 7 .   ? 25.856 -11.366 19.471  1.00 27.48  ? 326 HOH A O   1 
HETATM 2273 O  O   . HOH H 7 .   ? 21.228 -10.437 -4.366  1.00 26.32  ? 327 HOH A O   1 
HETATM 2274 O  O   . HOH H 7 .   ? 34.896 -32.479 15.545  1.00 23.04  ? 328 HOH A O   1 
HETATM 2275 O  O   . HOH H 7 .   ? 19.203 -7.435  17.211  1.00 20.18  ? 329 HOH A O   1 
HETATM 2276 O  O   . HOH H 7 .   ? 4.086  3.234   16.060  1.00 19.75  ? 330 HOH A O   1 
HETATM 2277 O  O   . HOH H 7 .   ? 8.239  -7.423  1.921   1.00 20.76  ? 331 HOH A O   1 
HETATM 2278 O  O   . HOH H 7 .   ? 2.205  -15.664 4.014   1.00 19.36  ? 332 HOH A O   1 
HETATM 2279 O  O   . HOH H 7 .   ? 34.149 -13.773 5.719   1.00 28.29  ? 333 HOH A O   1 
HETATM 2280 O  O   . HOH H 7 .   ? 2.165  -22.147 -15.589 1.00 31.45  ? 334 HOH A O   1 
HETATM 2281 O  O   . HOH H 7 .   ? 20.543 -36.825 13.013  1.00 25.89  ? 335 HOH A O   1 
HETATM 2282 O  O   . HOH H 7 .   ? 38.938 -38.362 -1.721  1.00 27.73  ? 336 HOH A O   1 
HETATM 2283 O  O   . HOH H 7 .   ? 13.613 -2.838  -2.189  1.00 32.25  ? 337 HOH A O   1 
HETATM 2284 O  O   . HOH H 7 .   ? 33.199 -20.108 29.675  1.00 32.75  ? 338 HOH A O   1 
HETATM 2285 O  O   . HOH H 7 .   ? 30.779 -18.819 29.093  1.00 24.01  ? 339 HOH A O   1 
HETATM 2286 O  O   . HOH H 7 .   ? 5.394  -4.876  17.496  1.00 30.08  ? 340 HOH A O   1 
HETATM 2287 O  O   . HOH H 7 .   ? 11.678 -21.660 29.807  1.00 30.42  ? 341 HOH A O   1 
HETATM 2288 O  O   . HOH H 7 .   ? 12.769 -30.068 16.948  1.00 26.46  ? 342 HOH A O   1 
HETATM 2289 O  O   . HOH H 7 .   ? 20.517 -1.734  18.718  1.00 25.73  ? 343 HOH A O   1 
HETATM 2290 O  O   . HOH H 7 .   ? -2.361 -7.155  -9.643  1.00 27.11  ? 344 HOH A O   1 
HETATM 2291 O  O   . HOH H 7 .   ? 12.678 -3.025  22.455  1.00 26.77  ? 345 HOH A O   1 
HETATM 2292 O  O   . HOH H 7 .   ? 8.996  15.056  20.553  1.00 24.57  ? 346 HOH A O   1 
HETATM 2293 O  O   . HOH H 7 .   ? 27.232 -30.534 15.456  1.00 29.97  ? 347 HOH A O   1 
HETATM 2294 O  O   . HOH H 7 .   ? 2.281  -20.367 -19.962 1.00 22.46  ? 348 HOH A O   1 
HETATM 2295 O  O   . HOH H 7 .   ? 32.117 -32.030 -5.570  1.00 28.24  ? 349 HOH A O   1 
HETATM 2296 O  O   . HOH H 7 .   ? 6.611  -11.371 22.792  1.00 36.00  ? 350 HOH A O   1 
HETATM 2297 O  O   . HOH H 7 .   ? 19.884 -25.329 -9.020  1.00 24.37  ? 351 HOH A O   1 
HETATM 2298 O  O   . HOH H 7 .   ? 14.001 -20.278 29.357  1.00 24.49  ? 352 HOH A O   1 
HETATM 2299 O  O   . HOH H 7 .   ? -0.825 -15.023 -5.127  1.00 23.63  ? 353 HOH A O   1 
HETATM 2300 O  O   . HOH H 7 .   ? 20.447 -7.259  10.005  1.00 23.72  ? 354 HOH A O   1 
HETATM 2301 O  O   . HOH H 7 .   ? 15.048 -15.686 -16.332 1.00 20.10  ? 355 HOH A O   1 
HETATM 2302 O  O   . HOH H 7 .   ? 21.686 -38.877 1.495   1.00 53.93  ? 356 HOH A O   1 
HETATM 2303 O  O   . HOH H 7 .   ? 34.612 -24.562 -9.835  1.00 38.81  ? 357 HOH A O   1 
HETATM 2304 O  O   . HOH H 7 .   ? 4.173  -6.730  -10.899 1.00 22.04  ? 358 HOH A O   1 
HETATM 2305 O  O   . HOH H 7 .   ? 23.444 -28.979 17.375  1.00 30.00  ? 359 HOH A O   1 
HETATM 2306 O  O   . HOH H 7 .   ? 3.282  4.936   14.335  1.00 28.23  ? 360 HOH A O   1 
HETATM 2307 O  O   . HOH H 7 .   ? 8.202  6.762   24.947  1.00 35.28  ? 361 HOH A O   1 
HETATM 2308 O  O   . HOH H 7 .   ? 36.131 -30.311 16.779  1.00 23.74  ? 362 HOH A O   1 
HETATM 2309 O  O   . HOH H 7 .   ? 25.020 -33.566 16.130  1.00 55.67  ? 363 HOH A O   1 
HETATM 2310 O  O   . HOH H 7 .   ? 7.118  -4.178  4.864   1.00 34.62  ? 364 HOH A O   1 
HETATM 2311 O  O   . HOH H 7 .   ? 1.942  -10.521 7.690   1.00 22.87  ? 365 HOH A O   1 
HETATM 2312 O  O   . HOH H 7 .   ? 4.727  -11.284 15.271  1.00 41.53  ? 366 HOH A O   1 
HETATM 2313 O  O   . HOH H 7 .   ? 8.641  -4.149  22.596  1.00 27.83  ? 367 HOH A O   1 
HETATM 2314 O  O   . HOH H 7 .   ? 7.843  16.868  19.492  1.00 39.10  ? 368 HOH A O   1 
HETATM 2315 O  O   . HOH H 7 .   ? 14.105 -18.937 26.728  1.00 25.62  ? 369 HOH A O   1 
HETATM 2316 O  O   . HOH H 7 .   ? 6.848  -10.136 20.149  1.00 29.43  ? 370 HOH A O   1 
HETATM 2317 O  O   . HOH H 7 .   ? 17.951 -32.367 -3.531  1.00 19.17  ? 371 HOH A O   1 
HETATM 2318 O  O   . HOH H 7 .   ? 22.496 -7.752  -0.546  1.00 38.23  ? 372 HOH A O   1 
HETATM 2319 O  O   . HOH H 7 .   ? 11.175 -22.178 27.170  1.00 24.19  ? 373 HOH A O   1 
HETATM 2320 O  O   . HOH H 7 .   ? 19.675 14.369  26.324  1.00 32.13  ? 374 HOH A O   1 
HETATM 2321 O  O   . HOH H 7 .   ? 14.931 -20.919 -12.174 1.00 38.46  ? 375 HOH A O   1 
HETATM 2322 O  O   . HOH H 7 .   ? 30.678 -25.988 28.171  1.00 21.66  ? 376 HOH A O   1 
HETATM 2323 O  O   . HOH H 7 .   ? 22.811 -34.506 0.453   1.00 26.78  ? 377 HOH A O   1 
HETATM 2324 O  O   . HOH H 7 .   ? 4.439  -8.518  4.966   1.00 37.59  ? 378 HOH A O   1 
HETATM 2325 O  O   . HOH H 7 .   ? 32.221 -14.719 23.550  1.00 21.24  ? 379 HOH A O   1 
HETATM 2326 O  O   . HOH H 7 .   ? 4.353  -0.570  10.793  1.00 26.05  ? 380 HOH A O   1 
HETATM 2327 O  O   . HOH H 7 .   ? 21.066 -9.394  6.457   1.00 38.24  ? 381 HOH A O   1 
HETATM 2328 O  O   . HOH H 7 .   ? 13.399 -30.125 19.422  1.00 29.93  ? 382 HOH A O   1 
HETATM 2329 O  O   . HOH H 7 .   ? 14.802 -4.937  22.947  1.00 32.31  ? 383 HOH A O   1 
HETATM 2330 O  O   . HOH H 7 .   ? 6.337  15.035  21.468  1.00 27.22  ? 384 HOH A O   1 
HETATM 2331 O  O   . HOH H 7 .   ? 21.889 -11.305 -0.501  1.00 32.73  ? 385 HOH A O   1 
HETATM 2332 O  O   . HOH H 7 .   ? 14.247 -0.607  21.924  1.00 25.33  ? 386 HOH A O   1 
HETATM 2333 O  O   . HOH H 7 .   ? 18.417 -0.616  6.969   1.00 25.07  ? 387 HOH A O   1 
HETATM 2334 O  O   . HOH H 7 .   ? 37.260 -38.440 5.293   1.00 48.29  ? 388 HOH A O   1 
HETATM 2335 O  O   . HOH H 7 .   ? 5.850  -4.053  19.289  1.00 24.47  ? 389 HOH A O   1 
HETATM 2336 O  O   . HOH H 7 .   ? 0.063  -10.094 -11.299 1.00 28.88  ? 390 HOH A O   1 
HETATM 2337 O  O   . HOH H 7 .   ? 7.940  -27.365 11.386  1.00 38.53  ? 391 HOH A O   1 
HETATM 2338 O  O   . HOH H 7 .   ? 0.267  -19.293 1.828   1.00 28.81  ? 392 HOH A O   1 
HETATM 2339 O  O   . HOH H 7 .   ? 5.066  -26.836 -1.956  1.00 23.16  ? 393 HOH A O   1 
HETATM 2340 O  O   . HOH H 7 .   ? 22.900 -0.157  14.715  1.00 32.50  ? 394 HOH A O   1 
HETATM 2341 O  O   . HOH H 7 .   ? 33.089 -15.924 3.698   1.00 26.48  ? 395 HOH A O   1 
HETATM 2342 O  O   . HOH H 7 .   ? -1.819 -13.830 -1.253  1.00 33.86  ? 396 HOH A O   1 
HETATM 2343 O  O   . HOH H 7 .   ? 5.250  -33.909 -1.803  1.00 24.03  ? 397 HOH A O   1 
HETATM 2344 O  O   . HOH H 7 .   ? -1.855 -10.581 -10.430 1.00 34.67  ? 398 HOH A O   1 
HETATM 2345 O  O   . HOH H 7 .   ? 9.428  -26.697 13.565  1.00 36.85  ? 399 HOH A O   1 
HETATM 2346 O  O   . HOH H 7 .   ? 17.540 -12.182 -15.251 1.00 25.35  ? 400 HOH A O   1 
HETATM 2347 O  O   . HOH H 7 .   ? 19.424 -24.300 -2.091  1.00 24.28  ? 401 HOH A O   1 
HETATM 2348 O  O   . HOH H 7 .   ? 6.329  -9.105  3.042   1.00 24.71  ? 402 HOH A O   1 
HETATM 2349 O  O   . HOH H 7 .   ? 0.535  -16.790 1.599   1.00 30.67  ? 403 HOH A O   1 
HETATM 2350 O  O   . HOH H 7 .   ? 34.904 -17.242 24.765  1.00 32.09  ? 404 HOH A O   1 
HETATM 2351 O  O   . HOH H 7 .   ? 22.301 -23.774 -4.487  1.00 30.23  ? 405 HOH A O   1 
HETATM 2352 O  O   . HOH H 7 .   ? 18.442 9.133   22.289  1.00 34.15  ? 406 HOH A O   1 
HETATM 2353 O  O   . HOH H 7 .   ? 35.182 -29.419 19.052  1.00 41.27  ? 407 HOH A O   1 
HETATM 2354 O  O   . HOH H 7 .   ? 18.800 -17.703 -10.057 1.00 29.63  ? 408 HOH A O   1 
HETATM 2355 O  O   . HOH H 7 .   ? 18.224 -2.493  -2.275  1.00 29.25  ? 409 HOH A O   1 
HETATM 2356 O  O   . HOH H 7 .   ? 28.410 -11.542 18.582  1.00 25.34  ? 410 HOH A O   1 
HETATM 2357 O  O   . HOH H 7 .   ? 5.906  -12.158 17.105  1.00 27.75  ? 411 HOH A O   1 
HETATM 2358 O  O   . HOH H 7 .   ? 31.629 -18.419 26.519  1.00 38.44  ? 412 HOH A O   1 
HETATM 2359 O  O   . HOH H 7 .   ? 17.694 -7.661  19.645  1.00 23.70  ? 413 HOH A O   1 
HETATM 2360 O  O   . HOH H 7 .   ? 19.527 -15.221 -11.134 1.00 27.81  ? 414 HOH A O   1 
HETATM 2361 O  O   . HOH H 7 .   ? 39.389 -15.033 11.856  1.00 36.47  ? 415 HOH A O   1 
HETATM 2362 O  O   . HOH H 7 .   ? 22.435 5.320   18.950  1.00 28.32  ? 416 HOH A O   1 
HETATM 2363 O  O   . HOH H 7 .   ? 22.660 -10.613 -9.931  1.00 62.05  ? 417 HOH A O   1 
HETATM 2364 O  O   . HOH H 7 .   ? 23.219 2.493   15.464  1.00 38.94  ? 418 HOH A O   1 
HETATM 2365 O  O   . HOH H 7 .   ? 11.123 3.991   24.895  1.00 31.74  ? 419 HOH A O   1 
HETATM 2366 O  O   . HOH H 7 .   ? 34.055 -25.592 22.388  1.00 30.43  ? 420 HOH A O   1 
HETATM 2367 O  O   . HOH H 7 .   ? 5.450  7.892   25.349  1.00 80.51  ? 421 HOH A O   1 
HETATM 2368 O  O   . HOH H 7 .   ? 6.307  -17.770 26.212  1.00 28.04  ? 422 HOH A O   1 
HETATM 2369 O  O   . HOH H 7 .   ? 7.528  -34.242 -4.438  1.00 25.75  ? 423 HOH A O   1 
HETATM 2370 O  O   . HOH H 7 .   ? 25.076 -33.652 -1.245  1.00 36.72  ? 424 HOH A O   1 
HETATM 2371 O  O   . HOH H 7 .   ? 17.828 -29.821 -4.503  1.00 45.79  ? 425 HOH A O   1 
HETATM 2372 O  O   . HOH H 7 .   ? 1.053  -13.124 4.359   1.00 28.97  ? 426 HOH A O   1 
HETATM 2373 O  O   . HOH H 7 .   ? 2.122  -10.268 3.277   1.00 86.83  ? 427 HOH A O   1 
HETATM 2374 O  O   . HOH H 7 .   ? 21.796 -25.570 24.444  1.00 24.07  ? 428 HOH A O   1 
HETATM 2375 O  O   . HOH H 7 .   ? -5.047 -17.209 -9.309  1.00 41.61  ? 429 HOH A O   1 
HETATM 2376 O  O   . HOH H 7 .   ? 22.465 -8.091  -7.697  1.00 42.00  ? 430 HOH A O   1 
HETATM 2377 O  O   . HOH H 7 .   ? 9.413  16.320  22.507  1.00 77.85  ? 431 HOH A O   1 
HETATM 2378 O  O   . HOH H 7 .   ? 13.860 -22.657 24.017  1.00 25.94  ? 432 HOH A O   1 
HETATM 2379 O  O   . HOH H 7 .   ? 43.179 -24.036 5.248   1.00 21.10  ? 433 HOH A O   1 
HETATM 2380 O  O   . HOH H 7 .   ? 4.970  -21.345 11.974  1.00 29.67  ? 434 HOH A O   1 
HETATM 2381 O  O   . HOH H 7 .   ? 20.833 -8.598  3.991   1.00 37.04  ? 435 HOH A O   1 
HETATM 2382 O  O   . HOH H 7 .   ? 16.508 -0.567  -5.684  1.00 52.72  ? 436 HOH A O   1 
HETATM 2383 O  O   . HOH H 7 .   ? 10.246 -21.070 -14.458 1.00 13.63  ? 437 HOH A O   1 
HETATM 2384 O  O   . HOH H 7 .   ? 14.173 -1.281  5.671   1.00 15.99  ? 438 HOH A O   1 
HETATM 2385 O  O   . HOH H 7 .   ? 35.097 -27.807 -9.709  1.00 41.18  ? 439 HOH A O   1 
HETATM 2386 O  O   . HOH H 7 .   ? 19.300 -10.070 19.738  1.00 41.65  ? 440 HOH A O   1 
HETATM 2387 O  O   . HOH H 7 .   ? 37.049 -10.347 15.386  1.00 36.15  ? 441 HOH A O   1 
HETATM 2388 O  O   . HOH H 7 .   ? 24.207 -8.564  -9.384  1.00 48.83  ? 442 HOH A O   1 
HETATM 2389 O  O   . HOH H 7 .   ? 13.632 9.992   22.652  1.00 28.91  ? 443 HOH A O   1 
HETATM 2390 O  O   . HOH H 7 .   ? 41.917 -28.832 2.462   1.00 41.30  ? 444 HOH A O   1 
HETATM 2391 O  O   . HOH H 7 .   ? 6.079  -21.853 9.649   1.00 28.57  ? 445 HOH A O   1 
HETATM 2392 O  O   . HOH H 7 .   ? 0.823  -26.559 8.285   1.00 46.34  ? 446 HOH A O   1 
HETATM 2393 O  O   . HOH H 7 .   ? 5.553  -24.297 9.480   1.00 19.48  ? 447 HOH A O   1 
HETATM 2394 O  O   . HOH H 7 .   ? 3.214  -16.604 12.952  1.00 49.38  ? 448 HOH A O   1 
HETATM 2395 O  O   . HOH H 7 .   ? 12.275 7.005   23.912  1.00 31.94  ? 449 HOH A O   1 
HETATM 2396 O  O   . HOH H 7 .   ? 8.329  -14.877 27.641  1.00 34.62  ? 450 HOH A O   1 
HETATM 2397 O  O   . HOH H 7 .   ? 6.970  -22.527 20.836  1.00 29.61  ? 451 HOH A O   1 
HETATM 2398 O  O   . HOH I 7 .   ? 19.289 -17.269 4.133   1.00 14.83  ? 64  HOH P O   1 
HETATM 2399 O  O   . HOH I 7 .   ? 28.361 -9.213  16.894  1.00 20.64  ? 72  HOH P O   1 
HETATM 2400 O  O   . HOH I 7 .   ? 29.316 -8.357  9.346   1.00 38.26  ? 154 HOH P O   1 
HETATM 2401 O  O   . HOH I 7 .   ? 23.345 -11.295 7.590   1.00 30.01  ? 178 HOH P O   1 
HETATM 2402 O  O   . HOH I 7 .   ? 25.990 -11.521 8.403   1.00 44.29  ? 232 HOH P O   1 
HETATM 2403 O  O   . HOH I 7 .   ? 25.871 -13.570 4.726   1.00 64.34  ? 452 HOH P O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLY A 1   ? 0.4805 0.3318 0.3910 0.0730  -0.0120 -0.0306 -4  GLY A N   
2    C  CA  . GLY A 1   ? 0.4555 0.3007 0.3731 0.0856  -0.0088 -0.0004 -4  GLY A CA  
3    C  C   . GLY A 1   ? 0.4533 0.3045 0.3854 0.0720  -0.0109 -0.0037 -4  GLY A C   
4    O  O   . GLY A 1   ? 0.4994 0.3448 0.4052 0.0677  -0.0108 0.0150  -4  GLY A O   
5    N  N   . ALA A 2   ? 0.4424 0.2788 0.3695 0.0780  -0.0041 -0.0106 -3  ALA A N   
6    C  CA  . ALA A 2   ? 0.3997 0.2698 0.3625 0.0550  -0.0004 -0.0339 -3  ALA A CA  
7    C  C   . ALA A 2   ? 0.3610 0.2341 0.3235 0.0567  -0.0184 -0.0427 -3  ALA A C   
8    O  O   . ALA A 2   ? 0.3793 0.2414 0.3494 0.0629  -0.0239 -0.0347 -3  ALA A O   
9    C  CB  . ALA A 2   ? 0.4246 0.2750 0.3927 0.0569  0.0091  -0.0522 -3  ALA A CB  
10   N  N   . MET A 3   ? 0.2873 0.2190 0.2738 0.0325  -0.0358 -0.0434 -2  MET A N   
11   C  CA  . MET A 3   ? 0.2179 0.1679 0.2452 0.0306  -0.0371 -0.0403 -2  MET A CA  
12   C  C   . MET A 3   ? 0.1907 0.1452 0.2129 0.0250  -0.0206 -0.0101 -2  MET A C   
13   O  O   . MET A 3   ? 0.1708 0.1143 0.1661 0.0349  -0.0062 -0.0126 -2  MET A O   
14   C  CB  . MET A 3   ? 0.2225 0.1611 0.2692 0.0278  -0.0588 -0.0288 -2  MET A CB  
15   C  CG  . MET A 3   ? 0.2640 0.2067 0.2746 -0.0182 -0.0529 -0.0439 -2  MET A CG  
16   S  SD  . MET A 3   ? 0.2691 0.2063 0.2970 -0.0007 0.0080  -0.0584 -2  MET A SD  
17   C  CE  . MET A 3   ? 0.2923 0.2393 0.3828 -0.0139 0.0026  -0.0707 -2  MET A CE  
18   N  N   . GLY A 4   ? 0.1964 0.1261 0.2236 0.0142  -0.0204 -0.0060 -1  GLY A N   
19   C  CA  . GLY A 4   ? 0.1957 0.1301 0.1818 -0.0064 -0.0139 -0.0030 -1  GLY A CA  
20   C  C   . GLY A 4   ? 0.1654 0.0788 0.1725 -0.0004 -0.0125 -0.0004 -1  GLY A C   
21   O  O   . GLY A 4   ? 0.2197 0.0723 0.2110 -0.0184 -0.0176 0.0038  -1  GLY A O   
22   N  N   . SER A 5   ? 0.1593 0.0533 0.1700 0.0222  -0.0203 -0.0049 0   SER A N   
23   C  CA  A SER A 5   ? 0.1390 0.0490 0.1554 0.0192  -0.0316 0.0174  0   SER A CA  
24   C  CA  B SER A 5   ? 0.1516 0.0633 0.1643 0.0181  -0.0395 0.0101  0   SER A CA  
25   C  C   . SER A 5   ? 0.1407 0.0452 0.1535 0.0128  -0.0369 0.0119  0   SER A C   
26   O  O   . SER A 5   ? 0.1580 0.0542 0.1635 0.0168  -0.0623 0.0259  0   SER A O   
27   C  CB  A SER A 5   ? 0.1094 0.0357 0.1745 0.0294  -0.0145 -0.0016 0   SER A CB  
28   C  CB  B SER A 5   ? 0.1579 0.0468 0.1809 0.0237  -0.0390 -0.0015 0   SER A CB  
29   O  OG  A SER A 5   ? 0.1434 0.0353 0.1959 0.0221  -0.0003 0.0315  0   SER A OG  
30   O  OG  B SER A 5   ? 0.1828 0.1433 0.2281 0.0277  -0.0619 -0.0015 0   SER A OG  
31   N  N   . MET A 6   ? 0.1226 0.0604 0.1463 -0.0027 -0.0233 0.0100  1   MET A N   
32   C  CA  . MET A 6   ? 0.1333 0.0582 0.1474 -0.0046 -0.0208 -0.0160 1   MET A CA  
33   C  C   . MET A 6   ? 0.1153 0.0667 0.1214 0.0000  -0.0138 -0.0037 1   MET A C   
34   O  O   . MET A 6   ? 0.1415 0.0753 0.1400 -0.0033 0.0023  0.0114  1   MET A O   
35   C  CB  . MET A 6   ? 0.1258 0.0507 0.1711 -0.0310 -0.0040 -0.0270 1   MET A CB  
36   C  CG  . MET A 6   ? 0.1847 0.1226 0.2240 -0.0568 -0.0057 -0.0448 1   MET A CG  
37   S  SD  . MET A 6   ? 0.2139 0.1197 0.2225 -0.0509 -0.0247 -0.0086 1   MET A SD  
38   C  CE  . MET A 6   ? 0.2598 0.0327 0.3113 0.0175  0.0239  -0.0397 1   MET A CE  
39   N  N   . GLU A 7   ? 0.1186 0.0605 0.1299 0.0028  -0.0047 -0.0299 2   GLU A N   
40   C  CA  . GLU A 7   ? 0.1453 0.0807 0.1290 0.0194  -0.0103 0.0050  2   GLU A CA  
41   C  C   . GLU A 7   ? 0.1287 0.0770 0.1435 0.0123  -0.0116 0.0059  2   GLU A C   
42   O  O   . GLU A 7   ? 0.1432 0.0432 0.1145 0.0214  -0.0003 0.0112  2   GLU A O   
43   C  CB  . GLU A 7   ? 0.1449 0.0800 0.1276 0.0113  -0.0010 -0.0176 2   GLU A CB  
44   C  CG  . GLU A 7   ? 0.1966 0.0487 0.1452 -0.0182 -0.0710 -0.0090 2   GLU A CG  
45   C  CD  . GLU A 7   ? 0.2047 0.1263 0.1662 -0.0185 -0.0896 -0.0134 2   GLU A CD  
46   O  OE1 . GLU A 7   ? 0.1966 0.1500 0.1878 -0.0790 -0.0864 -0.0072 2   GLU A OE1 
47   O  OE2 . GLU A 7   ? 0.1767 0.1281 0.1864 0.0264  -0.0986 -0.0816 2   GLU A OE2 
48   N  N   . ARG A 8   ? 0.1088 0.0666 0.1290 0.0301  -0.0071 0.0040  3   ARG A N   
49   C  CA  . ARG A 8   ? 0.1187 0.0503 0.1424 0.0165  -0.0060 0.0133  3   ARG A CA  
50   C  C   . ARG A 8   ? 0.1238 0.0283 0.1509 0.0169  0.0012  0.0033  3   ARG A C   
51   O  O   . ARG A 8   ? 0.1334 0.0503 0.1350 0.0096  0.0114  -0.0152 3   ARG A O   
52   C  CB  . ARG A 8   ? 0.0934 0.0371 0.1311 0.0012  -0.0379 0.0308  3   ARG A CB  
53   C  CG  . ARG A 8   ? 0.0996 0.0282 0.1077 0.0098  -0.0339 0.0051  3   ARG A CG  
54   C  CD  . ARG A 8   ? 0.1511 0.0394 0.1441 0.0175  -0.0637 0.0228  3   ARG A CD  
55   N  NE  . ARG A 8   ? 0.1194 0.0767 0.1622 0.0057  -0.0560 0.0330  3   ARG A NE  
56   C  CZ  . ARG A 8   ? 0.1191 0.0509 0.1179 0.0272  -0.0199 0.0211  3   ARG A CZ  
57   N  NH1 . ARG A 8   ? 0.1155 0.0784 0.1294 -0.0130 -0.0002 -0.0230 3   ARG A NH1 
58   N  NH2 . ARG A 8   ? 0.1215 0.0969 0.1194 0.0260  -0.0368 0.0509  3   ARG A NH2 
59   N  N   . ALA A 9   ? 0.1258 0.0334 0.1334 0.0117  0.0121  0.0072  4   ALA A N   
60   C  CA  . ALA A 9   ? 0.1374 0.0495 0.1559 -0.0010 0.0049  -0.0011 4   ALA A CA  
61   C  C   . ALA A 9   ? 0.1261 0.0425 0.1548 -0.0106 -0.0078 -0.0079 4   ALA A C   
62   O  O   . ALA A 9   ? 0.1313 0.0629 0.1223 -0.0068 0.0030  -0.0018 4   ALA A O   
63   C  CB  . ALA A 9   ? 0.1589 0.0887 0.1838 0.0064  0.0153  -0.0212 4   ALA A CB  
64   N  N   . SER A 10  ? 0.1261 0.0309 0.1295 -0.0146 -0.0137 -0.0169 5   SER A N   
65   C  CA  . SER A 10  ? 0.1343 0.0256 0.1515 0.0004  -0.0235 0.0060  5   SER A CA  
66   C  C   . SER A 10  ? 0.1229 0.0401 0.1216 -0.0267 -0.0273 0.0144  5   SER A C   
67   O  O   . SER A 10  ? 0.1287 0.0352 0.1266 -0.0248 -0.0346 0.0271  5   SER A O   
68   C  CB  . SER A 10  ? 0.1226 0.0576 0.1373 0.0043  -0.0510 0.0097  5   SER A CB  
69   O  OG  . SER A 10  ? 0.1634 0.0585 0.1881 0.0255  -0.0445 -0.0006 5   SER A OG  
70   N  N   . LEU A 11  ? 0.1430 0.0428 0.1302 0.0002  -0.0067 -0.0079 6   LEU A N   
71   C  CA  . LEU A 11  ? 0.1149 0.0665 0.1323 0.0062  -0.0038 0.0007  6   LEU A CA  
72   C  C   . LEU A 11  ? 0.1175 0.0509 0.1269 0.0003  -0.0111 0.0084  6   LEU A C   
73   O  O   . LEU A 11  ? 0.1341 0.0471 0.1099 0.0101  -0.0199 0.0080  6   LEU A O   
74   C  CB  . LEU A 11  ? 0.0903 0.0524 0.1481 0.0129  0.0116  -0.0087 6   LEU A CB  
75   C  CG  . LEU A 11  ? 0.0669 0.0487 0.1574 0.0063  -0.0219 -0.0138 6   LEU A CG  
76   C  CD1 . LEU A 11  ? 0.1040 0.1176 0.1580 -0.0615 0.0013  0.0014  6   LEU A CD1 
77   C  CD2 . LEU A 11  ? 0.1113 0.0923 0.1303 -0.0303 0.0012  -0.0773 6   LEU A CD2 
78   N  N   . ILE A 12  ? 0.1142 0.0299 0.1259 -0.0074 -0.0014 0.0133  7   ILE A N   
79   C  CA  A ILE A 12  ? 0.1077 0.0524 0.1202 -0.0030 0.0090  0.0061  7   ILE A CA  
80   C  CA  B ILE A 12  ? 0.1123 0.0460 0.1351 -0.0007 0.0096  0.0095  7   ILE A CA  
81   C  C   . ILE A 12  ? 0.1101 0.0508 0.1313 0.0069  0.0001  0.0109  7   ILE A C   
82   O  O   . ILE A 12  ? 0.1225 0.0762 0.1426 0.0008  0.0156  0.0051  7   ILE A O   
83   C  CB  A ILE A 12  ? 0.0953 0.0601 0.1225 0.0158  0.0054  0.0248  7   ILE A CB  
84   C  CB  B ILE A 12  ? 0.1078 0.0522 0.1455 0.0116  0.0048  0.0218  7   ILE A CB  
85   C  CG1 A ILE A 12  ? 0.0870 0.0506 0.0721 -0.0323 -0.0190 -0.0043 7   ILE A CG1 
86   C  CG1 B ILE A 12  ? 0.1110 0.0505 0.1449 -0.0083 0.0001  0.0242  7   ILE A CG1 
87   C  CG2 A ILE A 12  ? 0.0839 0.1317 0.1241 0.0040  0.0284  0.0028  7   ILE A CG2 
88   C  CG2 B ILE A 12  ? 0.0912 0.0510 0.1606 -0.0116 0.0308  0.0081  7   ILE A CG2 
89   C  CD1 A ILE A 12  ? 0.0753 0.0883 0.0478 -0.0397 -0.0091 -0.0124 7   ILE A CD1 
90   C  CD1 B ILE A 12  ? 0.1284 0.0501 0.1166 -0.0269 -0.0336 0.0423  7   ILE A CD1 
91   N  N   . GLN A 13  ? 0.1303 0.0493 0.1027 0.0143  0.0257  0.0026  8   GLN A N   
92   C  CA  A GLN A 13  ? 0.1253 0.0553 0.1040 0.0096  0.0077  -0.0034 8   GLN A CA  
93   C  CA  B GLN A 13  ? 0.1277 0.0598 0.1178 0.0035  0.0000  0.0011  8   GLN A CA  
94   C  C   . GLN A 13  ? 0.1272 0.0627 0.1158 0.0020  -0.0018 -0.0006 8   GLN A C   
95   O  O   . GLN A 13  ? 0.1328 0.0634 0.1191 0.0059  -0.0118 -0.0039 8   GLN A O   
96   C  CB  A GLN A 13  ? 0.1402 0.0557 0.0795 0.0021  -0.0048 -0.0087 8   GLN A CB  
97   C  CB  B GLN A 13  ? 0.1411 0.0726 0.1104 -0.0046 -0.0125 0.0048  8   GLN A CB  
98   C  CG  A GLN A 13  ? 0.1238 0.0902 0.0951 0.0040  0.0313  -0.0128 8   GLN A CG  
99   C  CG  B GLN A 13  ? 0.1389 0.0988 0.1603 -0.0201 -0.0262 0.0069  8   GLN A CG  
100  C  CD  A GLN A 13  ? 0.0942 0.0950 0.1135 0.0110  0.0150  -0.0079 8   GLN A CD  
101  C  CD  B GLN A 13  ? 0.2138 0.1907 0.1989 -0.0588 -0.0639 0.0290  8   GLN A CD  
102  O  OE1 A GLN A 13  ? 0.1435 0.1238 0.1795 -0.0249 0.0500  0.0071  8   GLN A OE1 
103  O  OE1 B GLN A 13  ? 0.2413 0.2610 0.1965 -0.0605 -0.0753 0.0635  8   GLN A OE1 
104  N  NE2 A GLN A 13  ? 0.1294 0.0260 0.1500 0.0085  -0.0277 -0.0043 8   GLN A NE2 
105  N  NE2 B GLN A 13  ? 0.2358 0.2277 0.2192 -0.1497 -0.0572 0.0671  8   GLN A NE2 
106  N  N   . LYS A 14  ? 0.1319 0.0526 0.1309 -0.0003 0.0030  -0.0129 9   LYS A N   
107  C  CA  . LYS A 14  ? 0.1184 0.0447 0.1201 0.0023  -0.0136 -0.0059 9   LYS A CA  
108  C  C   . LYS A 14  ? 0.1262 0.0451 0.1234 -0.0086 -0.0058 -0.0097 9   LYS A C   
109  O  O   . LYS A 14  ? 0.1230 0.0700 0.1645 -0.0073 0.0092  -0.0160 9   LYS A O   
110  C  CB  . LYS A 14  ? 0.1403 0.0308 0.1038 0.0231  -0.0087 0.0061  9   LYS A CB  
111  C  CG  . LYS A 14  ? 0.1621 0.0317 0.1357 0.0270  -0.0141 0.0079  9   LYS A CG  
112  C  CD  . LYS A 14  ? 0.1713 0.0705 0.1254 0.0530  -0.0694 0.0164  9   LYS A CD  
113  C  CE  . LYS A 14  ? 0.1347 0.0617 0.1115 0.0390  -0.0475 0.0213  9   LYS A CE  
114  N  NZ  . LYS A 14  ? 0.1538 0.1098 0.2112 0.0137  -0.0268 0.0411  9   LYS A NZ  
115  N  N   . ALA A 15  ? 0.0935 0.0399 0.1053 -0.0003 -0.0027 0.0048  10  ALA A N   
116  C  CA  . ALA A 15  ? 0.1058 0.0451 0.0954 -0.0098 0.0045  0.0245  10  ALA A CA  
117  C  C   . ALA A 15  ? 0.1072 0.0615 0.1125 -0.0092 0.0042  -0.0036 10  ALA A C   
118  O  O   . ALA A 15  ? 0.1033 0.0702 0.1252 -0.0231 -0.0027 0.0058  10  ALA A O   
119  C  CB  . ALA A 15  ? 0.1257 0.0455 0.1022 -0.0160 -0.0002 0.0368  10  ALA A CB  
120  N  N   . LYS A 16  ? 0.1169 0.0744 0.1065 0.0085  0.0188  0.0075  11  LYS A N   
121  C  CA  . LYS A 16  ? 0.1140 0.0355 0.1201 -0.0237 0.0252  0.0115  11  LYS A CA  
122  C  C   . LYS A 16  ? 0.1261 0.0714 0.1274 -0.0202 0.0076  0.0199  11  LYS A C   
123  O  O   . LYS A 16  ? 0.1297 0.1115 0.1474 -0.0206 0.0090  0.0158  11  LYS A O   
124  C  CB  . LYS A 16  ? 0.1577 0.0412 0.1315 -0.0225 0.0049  0.0190  11  LYS A CB  
125  C  CG  . LYS A 16  ? 0.1912 0.0296 0.1152 -0.0242 -0.0093 -0.0071 11  LYS A CG  
126  C  CD  . LYS A 16  ? 0.2781 0.0322 0.0912 -0.0304 -0.0150 -0.0126 11  LYS A CD  
127  C  CE  . LYS A 16  ? 0.2307 0.0858 0.1914 0.0013  0.0060  -0.0423 11  LYS A CE  
128  N  NZ  . LYS A 16  ? 0.2369 0.1314 0.2157 0.0285  0.0005  -0.1355 11  LYS A NZ  
129  N  N   . LEU A 17  ? 0.1303 0.0497 0.1174 0.0007  0.0019  0.0079  12  LEU A N   
130  C  CA  . LEU A 17  ? 0.1352 0.0703 0.0850 -0.0250 0.0009  0.0307  12  LEU A CA  
131  C  C   . LEU A 17  ? 0.1374 0.0777 0.1333 -0.0228 -0.0023 0.0182  12  LEU A C   
132  O  O   . LEU A 17  ? 0.1612 0.0688 0.1645 -0.0328 -0.0029 0.0391  12  LEU A O   
133  C  CB  . LEU A 17  ? 0.1208 0.0639 0.1022 -0.0105 0.0066  0.0047  12  LEU A CB  
134  C  CG  . LEU A 17  ? 0.1354 0.0735 0.0618 -0.0343 -0.0039 0.0070  12  LEU A CG  
135  C  CD1 . LEU A 17  ? 0.1276 0.1133 0.0929 -0.0288 -0.0334 0.0309  12  LEU A CD1 
136  C  CD2 . LEU A 17  ? 0.1941 0.1660 0.1152 -0.0541 0.0265  0.0562  12  LEU A CD2 
137  N  N   . ALA A 18  ? 0.1561 0.0572 0.0870 -0.0073 0.0070  0.0209  13  ALA A N   
138  C  CA  . ALA A 18  ? 0.1424 0.0644 0.0920 -0.0216 0.0107  0.0165  13  ALA A CA  
139  C  C   . ALA A 18  ? 0.1404 0.0612 0.1296 -0.0164 0.0037  0.0098  13  ALA A C   
140  O  O   . ALA A 18  ? 0.1728 0.0713 0.1412 -0.0425 -0.0179 0.0128  13  ALA A O   
141  C  CB  . ALA A 18  ? 0.1498 0.0863 0.0754 -0.0111 0.0438  0.0172  13  ALA A CB  
142  N  N   . GLU A 19  ? 0.1185 0.0790 0.1305 0.0001  -0.0042 0.0123  14  GLU A N   
143  C  CA  A GLU A 19  ? 0.1041 0.0639 0.1612 -0.0012 0.0002  0.0214  14  GLU A CA  
144  C  CA  B GLU A 19  ? 0.1223 0.0910 0.1673 -0.0024 0.0043  0.0216  14  GLU A CA  
145  C  C   . GLU A 19  ? 0.1219 0.0868 0.1594 -0.0162 -0.0014 0.0211  14  GLU A C   
146  O  O   . GLU A 19  ? 0.1435 0.1206 0.2037 -0.0190 -0.0062 0.0322  14  GLU A O   
147  C  CB  A GLU A 19  ? 0.0824 0.0383 0.1338 0.0072  -0.0046 0.0151  14  GLU A CB  
148  C  CB  B GLU A 19  ? 0.1273 0.0913 0.1662 0.0036  0.0098  0.0219  14  GLU A CB  
149  C  CG  A GLU A 19  ? 0.0889 0.0531 0.1594 0.0015  -0.0349 0.0155  14  GLU A CG  
150  C  CG  B GLU A 19  ? 0.1828 0.1644 0.2016 0.0176  -0.0054 0.0212  14  GLU A CG  
151  C  CD  A GLU A 19  ? 0.0874 0.0386 0.1201 0.0052  -0.0564 0.0168  14  GLU A CD  
152  C  CD  B GLU A 19  ? 0.2886 0.2251 0.2670 0.0579  -0.0022 -0.0057 14  GLU A CD  
153  O  OE1 A GLU A 19  ? 0.1930 0.0545 0.1560 0.0345  -0.0159 -0.0034 14  GLU A OE1 
154  O  OE1 B GLU A 19  ? 0.3265 0.2323 0.2663 0.0819  -0.0020 -0.0123 14  GLU A OE1 
155  O  OE2 A GLU A 19  ? 0.1236 0.0569 0.2223 -0.0217 -0.0789 -0.0400 14  GLU A OE2 
156  O  OE2 B GLU A 19  ? 0.3574 0.3665 0.2572 0.0536  0.0118  -0.0162 14  GLU A OE2 
157  N  N   . GLN A 20  ? 0.1209 0.0984 0.1779 -0.0111 0.0216  0.0129  15  GLN A N   
158  C  CA  . GLN A 20  ? 0.1822 0.1039 0.1790 -0.0325 0.0353  0.0124  15  GLN A CA  
159  C  C   . GLN A 20  ? 0.1751 0.1025 0.1733 -0.0621 0.0347  0.0129  15  GLN A C   
160  O  O   . GLN A 20  ? 0.1519 0.1494 0.2313 -0.0811 0.0263  0.0012  15  GLN A O   
161  C  CB  . GLN A 20  ? 0.2030 0.0798 0.1522 -0.0111 0.0428  -0.0047 15  GLN A CB  
162  C  CG  . GLN A 20  ? 0.2160 0.1123 0.2383 -0.0213 0.0708  0.0010  15  GLN A CG  
163  C  CD  . GLN A 20  ? 0.3251 0.2164 0.3168 0.0029  0.0350  0.0007  15  GLN A CD  
164  O  OE1 . GLN A 20  ? 0.3882 0.3595 0.3222 0.0389  0.1020  0.0158  15  GLN A OE1 
165  N  NE2 . GLN A 20  ? 0.3669 0.2943 0.3754 -0.0257 -0.0034 -0.0479 15  GLN A NE2 
166  N  N   . ALA A 21  ? 0.1820 0.0785 0.1756 -0.0452 0.0136  0.0029  16  ALA A N   
167  C  CA  . ALA A 21  ? 0.1945 0.1002 0.1871 -0.0592 0.0185  -0.0189 16  ALA A CA  
168  C  C   . ALA A 21  ? 0.1973 0.1189 0.1808 -0.0525 0.0134  -0.0274 16  ALA A C   
169  O  O   . ALA A 21  ? 0.2305 0.1180 0.1787 -0.0576 -0.0061 -0.0338 16  ALA A O   
170  C  CB  . ALA A 21  ? 0.2001 0.0462 0.1881 -0.0338 0.0028  -0.0143 16  ALA A CB  
171  N  N   . GLU A 22  ? 0.1834 0.1416 0.1764 -0.0502 0.0129  -0.0359 17  GLU A N   
172  C  CA  A GLU A 22  ? 0.1822 0.1585 0.1769 -0.0559 0.0012  -0.0405 17  GLU A CA  
173  C  CA  B GLU A 22  ? 0.1797 0.1613 0.1826 -0.0547 0.0021  -0.0409 17  GLU A CA  
174  C  C   . GLU A 22  ? 0.1853 0.1478 0.1592 -0.0489 -0.0044 -0.0369 17  GLU A C   
175  O  O   . GLU A 22  ? 0.2081 0.1375 0.1755 -0.0489 0.0095  -0.0609 17  GLU A O   
176  C  CB  A GLU A 22  ? 0.1946 0.1992 0.1972 -0.0506 -0.0051 -0.0399 17  GLU A CB  
177  C  CB  B GLU A 22  ? 0.1902 0.1987 0.2048 -0.0465 -0.0041 -0.0420 17  GLU A CB  
178  C  CG  A GLU A 22  ? 0.1902 0.2109 0.2099 -0.0499 0.0078  -0.0674 17  GLU A CG  
179  C  CG  B GLU A 22  ? 0.1734 0.2370 0.2537 -0.0441 0.0174  -0.0699 17  GLU A CG  
180  C  CD  A GLU A 22  ? 0.2086 0.3392 0.2447 -0.0733 -0.0092 -0.0318 17  GLU A CD  
181  C  CD  B GLU A 22  ? 0.1765 0.3345 0.3265 -0.0350 0.0030  -0.0715 17  GLU A CD  
182  O  OE1 A GLU A 22  ? 0.1980 0.3952 0.2321 -0.0704 -0.0413 -0.0971 17  GLU A OE1 
183  O  OE1 B GLU A 22  ? 0.1669 0.3488 0.3133 -0.0522 0.0002  -0.1075 17  GLU A OE1 
184  O  OE2 A GLU A 22  ? 0.2089 0.3726 0.2438 -0.1061 0.0007  -0.0078 17  GLU A OE2 
185  O  OE2 B GLU A 22  ? 0.1560 0.4214 0.3756 -0.0254 0.0093  -0.0367 17  GLU A OE2 
186  N  N   . ARG A 23  ? 0.1548 0.0916 0.1584 -0.0516 0.0076  -0.0049 18  ARG A N   
187  C  CA  . ARG A 23  ? 0.1699 0.0670 0.1407 -0.0375 -0.0057 0.0194  18  ARG A CA  
188  C  C   . ARG A 23  ? 0.1580 0.0382 0.1416 -0.0206 -0.0118 0.0185  18  ARG A C   
189  O  O   . ARG A 23  ? 0.1589 0.0588 0.1442 -0.0165 -0.0213 0.0073  18  ARG A O   
190  C  CB  . ARG A 23  ? 0.1698 0.0440 0.1237 -0.0484 0.0003  0.0153  18  ARG A CB  
191  C  CG  . ARG A 23  ? 0.2076 0.0432 0.1818 -0.0268 0.0148  0.0443  18  ARG A CG  
192  C  CD  . ARG A 23  ? 0.1868 0.0457 0.2433 -0.0306 0.0602  0.0284  18  ARG A CD  
193  N  NE  . ARG A 23  ? 0.2289 0.0660 0.2033 -0.0017 0.0118  0.0562  18  ARG A NE  
194  C  CZ  . ARG A 23  ? 0.2810 0.0493 0.2291 0.0003  0.0135  0.0069  18  ARG A CZ  
195  N  NH1 . ARG A 23  ? 0.2668 0.0287 0.2940 -0.0285 -0.0341 0.0006  18  ARG A NH1 
196  N  NH2 . ARG A 23  ? 0.2588 0.0602 0.2138 0.0551  -0.0101 0.0107  18  ARG A NH2 
197  N  N   . TYR A 24  ? 0.1486 0.0433 0.1174 -0.0030 -0.0121 0.0193  19  TYR A N   
198  C  CA  . TYR A 24  ? 0.1655 0.0696 0.1265 -0.0102 -0.0186 0.0131  19  TYR A CA  
199  C  C   . TYR A 24  ? 0.1629 0.0600 0.1255 0.0073  -0.0094 -0.0051 19  TYR A C   
200  O  O   . TYR A 24  ? 0.1699 0.0653 0.1273 -0.0157 0.0176  0.0042  19  TYR A O   
201  C  CB  . TYR A 24  ? 0.1558 0.1033 0.1188 -0.0001 -0.0242 0.0184  19  TYR A CB  
202  C  CG  . TYR A 24  ? 0.1557 0.0839 0.1237 -0.0296 -0.0197 0.0201  19  TYR A CG  
203  C  CD1 . TYR A 24  ? 0.1563 0.1267 0.1607 -0.0121 -0.0277 -0.0206 19  TYR A CD1 
204  C  CD2 . TYR A 24  ? 0.1081 0.1637 0.1878 -0.0526 -0.0236 -0.0019 19  TYR A CD2 
205  C  CE1 . TYR A 24  ? 0.1353 0.1308 0.1872 -0.0275 -0.0376 0.0361  19  TYR A CE1 
206  C  CE2 . TYR A 24  ? 0.1233 0.2137 0.2607 -0.0383 0.0017  0.0406  19  TYR A CE2 
207  C  CZ  . TYR A 24  ? 0.0926 0.1998 0.2077 -0.0440 -0.0075 0.0480  19  TYR A CZ  
208  O  OH  . TYR A 24  ? 0.1342 0.3725 0.3217 -0.0049 -0.0027 0.0854  19  TYR A OH  
209  N  N   . GLU A 25  ? 0.1624 0.0546 0.1356 0.0150  -0.0097 0.0062  20  GLU A N   
210  C  CA  A GLU A 25  ? 0.1786 0.0563 0.1520 0.0213  -0.0092 -0.0097 20  GLU A CA  
211  C  CA  B GLU A 25  ? 0.1743 0.0683 0.1465 0.0235  -0.0067 -0.0053 20  GLU A CA  
212  C  C   . GLU A 25  ? 0.1794 0.0469 0.1299 0.0137  -0.0010 -0.0102 20  GLU A C   
213  O  O   . GLU A 25  ? 0.1708 0.0344 0.1291 0.0087  -0.0056 -0.0174 20  GLU A O   
214  C  CB  A GLU A 25  ? 0.1945 0.0499 0.1717 0.0387  -0.0086 -0.0058 20  GLU A CB  
215  C  CB  B GLU A 25  ? 0.1838 0.0674 0.1601 0.0387  -0.0055 -0.0046 20  GLU A CB  
216  C  CG  A GLU A 25  ? 0.2230 0.0418 0.2362 0.0170  -0.0189 -0.0265 20  GLU A CG  
217  C  CG  B GLU A 25  ? 0.1849 0.1092 0.2084 0.0408  0.0044  0.0104  20  GLU A CG  
218  C  CD  A GLU A 25  ? 0.3326 0.1113 0.3889 0.0657  -0.0453 -0.0454 20  GLU A CD  
219  C  CD  B GLU A 25  ? 0.3300 0.1449 0.2838 0.0766  0.0060  -0.0073 20  GLU A CD  
220  O  OE1 A GLU A 25  ? 0.4358 0.1338 0.4337 0.0324  -0.0622 -0.0329 20  GLU A OE1 
221  O  OE1 B GLU A 25  ? 0.3881 0.1093 0.3552 0.1177  0.0281  0.0190  20  GLU A OE1 
222  O  OE2 A GLU A 25  ? 0.2995 0.1633 0.4123 0.0671  -0.0146 -0.0658 20  GLU A OE2 
223  O  OE2 B GLU A 25  ? 0.3608 0.1307 0.3071 0.1183  0.0082  -0.0491 20  GLU A OE2 
224  N  N   . ASP A 26  ? 0.1671 0.0321 0.0909 0.0292  0.0033  0.0077  21  ASP A N   
225  C  CA  . ASP A 26  ? 0.1785 0.0265 0.1190 0.0093  -0.0003 0.0075  21  ASP A CA  
226  C  C   . ASP A 26  ? 0.1505 0.0337 0.1136 0.0158  0.0040  0.0131  21  ASP A C   
227  O  O   . ASP A 26  ? 0.1638 0.0308 0.1359 -0.0179 -0.0135 0.0203  21  ASP A O   
228  C  CB  . ASP A 26  ? 0.1791 0.0346 0.1119 0.0334  -0.0074 0.0117  21  ASP A CB  
229  C  CG  . ASP A 26  ? 0.1660 0.0279 0.1538 0.0176  0.0361  -0.0027 21  ASP A CG  
230  O  OD1 . ASP A 26  ? 0.1956 0.0595 0.1495 0.0512  0.0189  0.0111  21  ASP A OD1 
231  O  OD2 . ASP A 26  ? 0.2353 0.0728 0.1422 0.0063  -0.0511 0.0374  21  ASP A OD2 
232  N  N   . MET A 27  ? 0.1505 0.0316 0.1173 0.0267  0.0139  0.0103  22  MET A N   
233  C  CA  . MET A 27  ? 0.0974 0.0321 0.1132 0.0204  0.0075  0.0117  22  MET A CA  
234  C  C   . MET A 27  ? 0.1193 0.0471 0.1130 -0.0002 0.0063  -0.0007 22  MET A C   
235  O  O   . MET A 27  ? 0.1273 0.0254 0.1230 -0.0032 0.0047  -0.0024 22  MET A O   
236  C  CB  . MET A 27  ? 0.0883 0.0422 0.1245 0.0301  0.0022  -0.0144 22  MET A CB  
237  C  CG  . MET A 27  ? 0.1005 0.0290 0.1176 0.0115  0.0107  -0.0117 22  MET A CG  
238  S  SD  . MET A 27  ? 0.1277 0.0320 0.1547 0.0084  0.0013  -0.0016 22  MET A SD  
239  C  CE  . MET A 27  ? 0.1244 0.0367 0.1372 0.0336  0.0324  0.0097  22  MET A CE  
240  N  N   . ALA A 28  ? 0.1002 0.0538 0.0990 0.0072  -0.0088 0.0119  23  ALA A N   
241  C  CA  . ALA A 28  ? 0.1236 0.0985 0.0992 -0.0009 -0.0205 -0.0050 23  ALA A CA  
242  C  C   . ALA A 28  ? 0.1138 0.0815 0.1217 0.0100  -0.0058 -0.0092 23  ALA A C   
243  O  O   . ALA A 28  ? 0.1302 0.0796 0.1283 -0.0040 -0.0105 -0.0079 23  ALA A O   
244  C  CB  . ALA A 28  ? 0.1554 0.0939 0.0822 0.0055  -0.0350 -0.0285 23  ALA A CB  
245  N  N   . ALA A 29  ? 0.1232 0.0599 0.1413 0.0186  -0.0080 0.0061  24  ALA A N   
246  C  CA  . ALA A 29  ? 0.1330 0.0642 0.1422 0.0159  -0.0148 -0.0025 24  ALA A CA  
247  C  C   . ALA A 29  ? 0.1229 0.0371 0.1443 0.0059  0.0031  0.0020  24  ALA A C   
248  O  O   . ALA A 29  ? 0.1275 0.0271 0.1380 0.0132  -0.0202 0.0000  24  ALA A O   
249  C  CB  . ALA A 29  ? 0.1337 0.0717 0.1757 0.0336  -0.0071 0.0180  24  ALA A CB  
250  N  N   . PHE A 30  ? 0.1144 0.0392 0.1236 0.0012  0.0060  -0.0103 25  PHE A N   
251  C  CA  . PHE A 30  ? 0.1302 0.0321 0.1267 0.0069  0.0131  0.0134  25  PHE A CA  
252  C  C   . PHE A 30  ? 0.1029 0.0375 0.1172 0.0081  0.0000  0.0323  25  PHE A C   
253  O  O   . PHE A 30  ? 0.1279 0.0317 0.1184 0.0144  0.0006  0.0203  25  PHE A O   
254  C  CB  . PHE A 30  ? 0.1306 0.0391 0.1197 0.0010  0.0128  0.0358  25  PHE A CB  
255  C  CG  . PHE A 30  ? 0.1197 0.0308 0.1201 -0.0212 -0.0313 0.0152  25  PHE A CG  
256  C  CD1 . PHE A 30  ? 0.1404 0.0518 0.1319 -0.0402 -0.0337 0.0465  25  PHE A CD1 
257  C  CD2 . PHE A 30  ? 0.1612 0.0328 0.1134 0.0034  -0.0250 0.0107  25  PHE A CD2 
258  C  CE1 . PHE A 30  ? 0.2011 0.0984 0.1022 -0.0078 -0.0363 0.0351  25  PHE A CE1 
259  C  CE2 . PHE A 30  ? 0.1242 0.0420 0.1839 -0.0068 -0.0062 0.0435  25  PHE A CE2 
260  C  CZ  . PHE A 30  ? 0.1213 0.0664 0.1459 -0.0102 -0.0243 0.0125  25  PHE A CZ  
261  N  N   . MET A 31  ? 0.1095 0.0371 0.1102 0.0155  -0.0019 0.0271  26  MET A N   
262  C  CA  . MET A 31  ? 0.0821 0.0380 0.1229 0.0125  0.0035  0.0319  26  MET A CA  
263  C  C   . MET A 31  ? 0.1067 0.0309 0.1106 0.0108  0.0115  0.0201  26  MET A C   
264  O  O   . MET A 31  ? 0.1211 0.0502 0.1468 -0.0096 -0.0045 0.0371  26  MET A O   
265  C  CB  . MET A 31  ? 0.0797 0.0402 0.1208 0.0000  -0.0117 0.0258  26  MET A CB  
266  C  CG  . MET A 31  ? 0.1160 0.0415 0.1129 0.0178  0.0468  0.0096  26  MET A CG  
267  S  SD  . MET A 31  ? 0.1524 0.0364 0.1535 0.0159  -0.0043 0.0184  26  MET A SD  
268  C  CE  . MET A 31  ? 0.1110 0.0281 0.1849 0.0136  0.0156  -0.0076 26  MET A CE  
269  N  N   . LYS A 32  ? 0.1002 0.0363 0.1081 0.0078  0.0221  0.0021  27  LYS A N   
270  C  CA  . LYS A 32  ? 0.1050 0.0693 0.1023 -0.0021 0.0068  -0.0054 27  LYS A CA  
271  C  C   . LYS A 32  ? 0.1174 0.0590 0.1219 -0.0054 0.0039  -0.0023 27  LYS A C   
272  O  O   . LYS A 32  ? 0.1116 0.0457 0.1367 -0.0015 0.0049  0.0070  27  LYS A O   
273  C  CB  . LYS A 32  ? 0.1043 0.0702 0.0789 -0.0099 0.0172  -0.0161 27  LYS A CB  
274  C  CG  . LYS A 32  ? 0.1065 0.1201 0.1001 0.0283  0.0330  -0.0089 27  LYS A CG  
275  C  CD  . LYS A 32  ? 0.1640 0.1791 0.1286 -0.0041 0.0052  -0.0170 27  LYS A CD  
276  C  CE  . LYS A 32  ? 0.1827 0.2887 0.1709 0.0225  -0.0028 -0.0103 27  LYS A CE  
277  N  NZ  . LYS A 32  ? 0.1583 0.2374 0.2232 0.0629  0.0078  -0.0144 27  LYS A NZ  
278  N  N   . GLY A 33  ? 0.1123 0.0551 0.1100 -0.0004 -0.0178 -0.0217 28  GLY A N   
279  C  CA  . GLY A 33  ? 0.1033 0.0389 0.1177 0.0236  -0.0322 -0.0172 28  GLY A CA  
280  C  C   . GLY A 33  ? 0.0898 0.0561 0.1256 0.0092  -0.0053 -0.0097 28  GLY A C   
281  O  O   . GLY A 33  ? 0.0835 0.0526 0.1410 -0.0173 0.0008  -0.0144 28  GLY A O   
282  N  N   . ALA A 34  ? 0.1114 0.0448 0.1260 0.0152  -0.0020 -0.0184 29  ALA A N   
283  C  CA  . ALA A 34  ? 0.1035 0.0276 0.1217 0.0074  0.0123  0.0047  29  ALA A CA  
284  C  C   . ALA A 34  ? 0.1060 0.0270 0.1288 -0.0105 0.0087  0.0009  29  ALA A C   
285  O  O   . ALA A 34  ? 0.0707 0.0563 0.1443 -0.0161 -0.0138 0.0111  29  ALA A O   
286  C  CB  . ALA A 34  ? 0.0953 0.0359 0.1525 0.0115  0.0203  -0.0190 29  ALA A CB  
287  N  N   . VAL A 35  ? 0.0910 0.0336 0.1020 0.0086  0.0376  0.0247  30  VAL A N   
288  C  CA  . VAL A 35  ? 0.0974 0.0507 0.0889 -0.0133 0.0234  0.0292  30  VAL A CA  
289  C  C   . VAL A 35  ? 0.1160 0.0524 0.1250 0.0000  0.0015  0.0115  30  VAL A C   
290  O  O   . VAL A 35  ? 0.1509 0.0793 0.1332 -0.0141 0.0012  0.0188  30  VAL A O   
291  C  CB  . VAL A 35  ? 0.0730 0.0545 0.0759 -0.0066 0.0192  0.0321  30  VAL A CB  
292  C  CG1 . VAL A 35  ? 0.1524 0.0801 0.1121 -0.0213 0.0357  0.0405  30  VAL A CG1 
293  C  CG2 . VAL A 35  ? 0.0706 0.0946 0.1253 -0.0163 0.0026  0.0057  30  VAL A CG2 
294  N  N   . GLU A 36  ? 0.1112 0.0766 0.1232 0.0018  -0.0031 0.0108  31  GLU A N   
295  C  CA  . GLU A 36  ? 0.0949 0.0722 0.1442 0.0043  -0.0038 -0.0206 31  GLU A CA  
296  C  C   . GLU A 36  ? 0.0857 0.0796 0.1433 0.0114  -0.0175 0.0116  31  GLU A C   
297  O  O   . GLU A 36  ? 0.0831 0.1024 0.1577 -0.0192 -0.0077 -0.0196 31  GLU A O   
298  C  CB  . GLU A 36  ? 0.0889 0.0612 0.1664 -0.0018 -0.0045 -0.0204 31  GLU A CB  
299  C  CG  . GLU A 36  ? 0.1102 0.1319 0.2071 -0.0272 -0.0085 -0.0629 31  GLU A CG  
300  C  CD  . GLU A 36  ? 0.1696 0.1626 0.2560 -0.0585 0.0023  -0.0728 31  GLU A CD  
301  O  OE1 . GLU A 36  ? 0.2156 0.1519 0.3648 0.0317  -0.0949 -0.1049 31  GLU A OE1 
302  O  OE2 . GLU A 36  ? 0.1852 0.2105 0.2853 -0.0610 0.0337  -0.1094 31  GLU A OE2 
303  N  N   . LYS A 37  ? 0.0812 0.0896 0.1271 -0.0004 -0.0142 0.0147  32  LYS A N   
304  C  CA  . LYS A 37  ? 0.1124 0.0881 0.1229 -0.0049 -0.0323 0.0280  32  LYS A CA  
305  C  C   . LYS A 37  ? 0.1171 0.0962 0.1502 -0.0112 -0.0267 0.0207  32  LYS A C   
306  O  O   . LYS A 37  ? 0.1188 0.1248 0.1463 -0.0226 -0.0278 0.0267  32  LYS A O   
307  C  CB  . LYS A 37  ? 0.0872 0.0786 0.1409 -0.0042 -0.0270 0.0200  32  LYS A CB  
308  C  CG  . LYS A 37  ? 0.1269 0.0417 0.1249 0.0109  -0.0251 0.0331  32  LYS A CG  
309  C  CD  . LYS A 37  ? 0.0903 0.0490 0.1244 -0.0205 -0.0112 0.0445  32  LYS A CD  
310  C  CE  . LYS A 37  ? 0.0823 0.0653 0.1905 -0.0220 -0.0509 0.0810  32  LYS A CE  
311  N  NZ  . LYS A 37  ? 0.1031 0.1059 0.2260 0.0171  -0.0039 0.0460  32  LYS A NZ  
312  N  N   . GLY A 38  ? 0.1270 0.0825 0.1554 -0.0055 -0.0217 0.0378  33  GLY A N   
313  C  CA  . GLY A 38  ? 0.1271 0.0618 0.1788 -0.0012 0.0134  0.0426  33  GLY A CA  
314  C  C   . GLY A 38  ? 0.1512 0.0431 0.1936 -0.0050 -0.0024 0.0481  33  GLY A C   
315  O  O   . GLY A 38  ? 0.1989 0.1045 0.2412 -0.0316 -0.0057 0.0629  33  GLY A O   
316  N  N   . GLU A 39  ? 0.1464 0.0745 0.2030 -0.0190 -0.0104 0.0220  34  GLU A N   
317  C  CA  A GLU A 39  ? 0.1596 0.0680 0.2015 -0.0189 -0.0166 0.0230  34  GLU A CA  
318  C  CA  B GLU A 39  ? 0.1515 0.0837 0.1954 -0.0171 -0.0204 0.0221  34  GLU A CA  
319  C  C   . GLU A 39  ? 0.1570 0.0817 0.2102 -0.0194 -0.0228 0.0158  34  GLU A C   
320  O  O   . GLU A 39  ? 0.1809 0.0981 0.2100 -0.0289 -0.0304 -0.0060 34  GLU A O   
321  C  CB  A GLU A 39  ? 0.1790 0.0855 0.2190 -0.0137 -0.0164 0.0179  34  GLU A CB  
322  C  CB  B GLU A 39  ? 0.1603 0.1130 0.2167 -0.0120 -0.0242 0.0178  34  GLU A CB  
323  C  CG  A GLU A 39  ? 0.2198 0.0500 0.2246 -0.0130 -0.0220 0.0339  34  GLU A CG  
324  C  CG  B GLU A 39  ? 0.1919 0.1708 0.2168 0.0064  -0.0470 0.0126  34  GLU A CG  
325  C  CD  A GLU A 39  ? 0.2972 0.1138 0.2604 -0.0117 0.0065  0.0384  34  GLU A CD  
326  C  CD  B GLU A 39  ? 0.1924 0.2231 0.2885 0.0030  -0.0560 0.0241  34  GLU A CD  
327  O  OE1 A GLU A 39  ? 0.2607 0.1326 0.3222 -0.0418 -0.0085 0.0666  34  GLU A OE1 
328  O  OE1 B GLU A 39  ? 0.1625 0.2753 0.3202 0.0318  -0.0903 0.0188  34  GLU A OE1 
329  O  OE2 A GLU A 39  ? 0.3207 0.1125 0.2733 -0.0357 0.0338  0.0324  34  GLU A OE2 
330  O  OE2 B GLU A 39  ? 0.1852 0.3699 0.3428 0.0007  -0.0151 -0.0187 34  GLU A OE2 
331  N  N   . GLU A 40  ? 0.1546 0.0758 0.1997 -0.0136 -0.0115 0.0118  35  GLU A N   
332  C  CA  . GLU A 40  ? 0.1378 0.0635 0.1756 -0.0159 -0.0053 0.0173  35  GLU A CA  
333  C  C   . GLU A 40  ? 0.1454 0.0774 0.1550 -0.0217 -0.0003 0.0081  35  GLU A C   
334  O  O   . GLU A 40  ? 0.1737 0.0998 0.1478 -0.0232 -0.0172 -0.0064 35  GLU A O   
335  C  CB  . GLU A 40  ? 0.1642 0.0554 0.1915 -0.0040 0.0176  0.0256  35  GLU A CB  
336  C  CG  . GLU A 40  ? 0.2422 0.0997 0.2102 -0.0354 0.0160  0.0242  35  GLU A CG  
337  C  CD  . GLU A 40  ? 0.2947 0.1629 0.3027 -0.0253 -0.0212 0.0088  35  GLU A CD  
338  O  OE1 . GLU A 40  ? 0.2942 0.2339 0.3333 -0.0896 -0.0244 0.0360  35  GLU A OE1 
339  O  OE2 . GLU A 40  ? 0.3289 0.1695 0.4395 0.0509  -0.0657 -0.0185 35  GLU A OE2 
340  N  N   . LEU A 41  ? 0.1019 0.0535 0.1422 -0.0112 0.0151  -0.0008 36  LEU A N   
341  C  CA  . LEU A 41  ? 0.1331 0.0256 0.1453 0.0017  0.0120  -0.0045 36  LEU A CA  
342  C  C   . LEU A 41  ? 0.1461 0.0352 0.1485 0.0142  0.0093  0.0095  36  LEU A C   
343  O  O   . LEU A 41  ? 0.1904 0.0348 0.1613 0.0308  0.0134  0.0248  36  LEU A O   
344  C  CB  . LEU A 41  ? 0.1571 0.0437 0.1398 0.0276  0.0086  -0.0141 36  LEU A CB  
345  C  CG  . LEU A 41  ? 0.2106 0.0677 0.1909 0.0608  -0.0253 -0.0246 36  LEU A CG  
346  C  CD1 . LEU A 41  ? 0.1893 0.0894 0.1795 0.0403  -0.0212 -0.0958 36  LEU A CD1 
347  C  CD2 . LEU A 41  ? 0.3703 0.1042 0.1935 0.1028  -0.1062 -0.0147 36  LEU A CD2 
348  N  N   . SER A 42  ? 0.1454 0.0437 0.1424 0.0225  0.0061  0.0003  37  SER A N   
349  C  CA  . SER A 42  ? 0.1188 0.0575 0.1439 0.0231  0.0100  -0.0069 37  SER A CA  
350  C  C   . SER A 42  ? 0.1417 0.0604 0.1278 0.0309  0.0125  0.0004  37  SER A C   
351  O  O   . SER A 42  ? 0.1287 0.0296 0.1265 0.0207  0.0066  -0.0029 37  SER A O   
352  C  CB  . SER A 42  ? 0.1526 0.0339 0.1395 0.0271  0.0090  0.0200  37  SER A CB  
353  O  OG  . SER A 42  ? 0.1712 0.0423 0.1043 -0.0049 -0.0026 -0.0363 37  SER A OG  
354  N  N   . ASN A 43  ? 0.1146 0.0513 0.1193 0.0353  0.0082  0.0232  38  ASN A N   
355  C  CA  A ASN A 43  ? 0.1149 0.0408 0.1518 0.0258  0.0178  0.0147  38  ASN A CA  
356  C  CA  B ASN A 43  ? 0.1300 0.0437 0.1550 0.0198  0.0190  0.0098  38  ASN A CA  
357  C  C   . ASN A 43  ? 0.1340 0.0385 0.1350 0.0177  0.0234  0.0071  38  ASN A C   
358  O  O   . ASN A 43  ? 0.1293 0.1003 0.1124 0.0198  0.0099  -0.0201 38  ASN A O   
359  C  CB  A ASN A 43  ? 0.1174 0.0322 0.1389 0.0201  0.0276  0.0221  38  ASN A CB  
360  C  CB  B ASN A 43  ? 0.1346 0.0324 0.1542 0.0119  0.0261  0.0097  38  ASN A CB  
361  C  CG  A ASN A 43  ? 0.1109 0.0622 0.1498 0.0561  0.0267  0.0136  38  ASN A CG  
362  C  CG  B ASN A 43  ? 0.1882 0.0535 0.2199 0.0179  0.0413  0.0000  38  ASN A CG  
363  O  OD1 A ASN A 43  ? 0.1888 0.0873 0.1499 0.0611  0.0343  -0.0152 38  ASN A OD1 
364  O  OD1 B ASN A 43  ? 0.2204 0.0943 0.2491 -0.0106 0.0423  -0.0493 38  ASN A OD1 
365  N  ND2 A ASN A 43  ? 0.1787 0.0889 0.2518 0.0134  0.0215  0.0289  38  ASN A ND2 
366  N  ND2 B ASN A 43  ? 0.2424 0.1115 0.3089 0.0051  0.0634  -0.0402 38  ASN A ND2 
367  N  N   . GLU A 44  ? 0.1340 0.0479 0.1472 0.0218  0.0287  0.0142  39  GLU A N   
368  C  CA  A GLU A 44  ? 0.1463 0.0279 0.1239 0.0071  0.0216  0.0048  39  GLU A CA  
369  C  CA  B GLU A 44  ? 0.1560 0.0468 0.1388 0.0122  0.0273  0.0080  39  GLU A CA  
370  C  C   . GLU A 44  ? 0.1258 0.0274 0.1202 0.0143  0.0164  -0.0002 39  GLU A C   
371  O  O   . GLU A 44  ? 0.1281 0.0543 0.1454 0.0185  -0.0050 0.0005  39  GLU A O   
372  C  CB  A GLU A 44  ? 0.1599 0.0438 0.1198 0.0193  0.0604  0.0211  39  GLU A CB  
373  C  CB  B GLU A 44  ? 0.1772 0.0667 0.1395 0.0137  0.0461  0.0255  39  GLU A CB  
374  C  CG  A GLU A 44  ? 0.2147 0.0328 0.1158 -0.0374 0.0164  -0.0065 39  GLU A CG  
375  C  CG  B GLU A 44  ? 0.2702 0.1328 0.1986 -0.0012 0.0819  0.0093  39  GLU A CG  
376  C  CD  A GLU A 44  ? 0.4079 0.0473 0.1832 -0.0569 0.0556  0.0217  39  GLU A CD  
377  C  CD  B GLU A 44  ? 0.3872 0.2307 0.2169 -0.0217 0.0884  0.0322  39  GLU A CD  
378  O  OE1 A GLU A 44  ? 0.5079 0.1708 0.2142 -0.0737 0.0353  -0.0011 39  GLU A OE1 
379  O  OE1 B GLU A 44  ? 0.4525 0.2932 0.2643 -0.0220 0.0602  0.0432  39  GLU A OE1 
380  O  OE2 A GLU A 44  ? 0.4240 0.0544 0.1742 -0.0059 0.0499  0.0636  39  GLU A OE2 
381  O  OE2 B GLU A 44  ? 0.3803 0.2912 0.2740 -0.0452 0.1228  0.0341  39  GLU A OE2 
382  N  N   . GLU A 45  ? 0.1150 0.0494 0.1053 0.0135  0.0030  0.0037  40  GLU A N   
383  C  CA  . GLU A 45  ? 0.1044 0.0552 0.1174 0.0035  -0.0199 0.0079  40  GLU A CA  
384  C  C   . GLU A 45  ? 0.1136 0.0429 0.1080 0.0159  -0.0070 0.0055  40  GLU A C   
385  O  O   . GLU A 45  ? 0.0956 0.0291 0.1326 0.0149  -0.0112 0.0058  40  GLU A O   
386  C  CB  . GLU A 45  ? 0.1025 0.0471 0.1084 0.0004  -0.0320 0.0065  40  GLU A CB  
387  C  CG  . GLU A 45  ? 0.1016 0.0982 0.0939 -0.0521 -0.0402 0.0025  40  GLU A CG  
388  C  CD  . GLU A 45  ? 0.0692 0.1589 0.1111 -0.0254 -0.0180 -0.0169 40  GLU A CD  
389  O  OE1 . GLU A 45  ? 0.1402 0.1021 0.0968 -0.0144 -0.0251 -0.0085 40  GLU A OE1 
390  O  OE2 . GLU A 45  ? 0.1778 0.1848 0.1083 -0.0075 -0.0302 0.0001  40  GLU A OE2 
391  N  N   . ARG A 46  ? 0.1273 0.0441 0.1045 0.0155  -0.0100 0.0263  41  ARG A N   
392  C  CA  . ARG A 46  ? 0.1298 0.0384 0.1130 0.0121  0.0039  0.0182  41  ARG A CA  
393  C  C   . ARG A 46  ? 0.1294 0.0490 0.1138 0.0099  -0.0009 0.0101  41  ARG A C   
394  O  O   . ARG A 46  ? 0.1393 0.0254 0.1177 -0.0014 -0.0168 0.0024  41  ARG A O   
395  C  CB  . ARG A 46  ? 0.1372 0.0414 0.1102 -0.0144 0.0052  0.0340  41  ARG A CB  
396  C  CG  . ARG A 46  ? 0.1633 0.0523 0.2048 0.0343  0.0246  0.0629  41  ARG A CG  
397  C  CD  . ARG A 46  ? 0.1576 0.0807 0.2235 0.0414  0.0192  0.0970  41  ARG A CD  
398  N  NE  . ARG A 46  ? 0.2261 0.0728 0.1813 0.0353  0.0081  0.0360  41  ARG A NE  
399  C  CZ  . ARG A 46  ? 0.1621 0.0732 0.1986 -0.0031 0.0343  0.0523  41  ARG A CZ  
400  N  NH1 . ARG A 46  ? 0.1696 0.0978 0.1642 -0.0420 0.0028  0.0477  41  ARG A NH1 
401  N  NH2 . ARG A 46  ? 0.2756 0.0637 0.2640 0.0566  0.0650  0.0114  41  ARG A NH2 
402  N  N   . ASN A 47  ? 0.1047 0.0643 0.1065 0.0056  0.0016  -0.0028 42  ASN A N   
403  C  CA  . ASN A 47  ? 0.1132 0.0521 0.1191 0.0146  -0.0038 -0.0064 42  ASN A CA  
404  C  C   . ASN A 47  ? 0.1074 0.0515 0.1060 0.0043  -0.0113 -0.0070 42  ASN A C   
405  O  O   . ASN A 47  ? 0.1614 0.0480 0.1406 0.0111  -0.0071 -0.0128 42  ASN A O   
406  C  CB  . ASN A 47  ? 0.0884 0.0546 0.1246 0.0385  0.0023  -0.0011 42  ASN A CB  
407  C  CG  . ASN A 47  ? 0.1647 0.0785 0.1541 0.0431  -0.0032 0.0049  42  ASN A CG  
408  O  OD1 . ASN A 47  ? 0.1460 0.1977 0.1431 0.0818  -0.0068 0.0112  42  ASN A OD1 
409  N  ND2 . ASN A 47  ? 0.2050 0.1748 0.1724 0.0664  -0.0323 -0.0361 42  ASN A ND2 
410  N  N   . LEU A 48  ? 0.1163 0.0534 0.1073 0.0115  -0.0073 0.0134  43  LEU A N   
411  C  CA  . LEU A 48  ? 0.1049 0.0425 0.1030 0.0261  0.0019  0.0145  43  LEU A CA  
412  C  C   . LEU A 48  ? 0.1022 0.0375 0.1160 0.0127  0.0107  0.0200  43  LEU A C   
413  O  O   . LEU A 48  ? 0.1145 0.0432 0.1188 0.0127  0.0172  -0.0183 43  LEU A O   
414  C  CB  . LEU A 48  ? 0.1103 0.0658 0.1054 0.0097  0.0023  0.0247  43  LEU A CB  
415  C  CG  . LEU A 48  ? 0.1161 0.0600 0.0931 -0.0271 -0.0001 -0.0081 43  LEU A CG  
416  C  CD1 . LEU A 48  ? 0.1940 0.0736 0.1034 -0.0337 -0.0759 -0.0274 43  LEU A CD1 
417  C  CD2 . LEU A 48  ? 0.1859 0.0681 0.1260 -0.0482 0.0231  0.0454  43  LEU A CD2 
418  N  N   . LEU A 49  ? 0.0883 0.0342 0.1245 0.0063  0.0206  0.0195  44  LEU A N   
419  C  CA  . LEU A 49  ? 0.1059 0.0420 0.1222 -0.0067 0.0196  0.0040  44  LEU A CA  
420  C  C   . LEU A 49  ? 0.1161 0.0535 0.1210 0.0238  0.0009  0.0083  44  LEU A C   
421  O  O   . LEU A 49  ? 0.0924 0.0412 0.1267 0.0118  0.0088  0.0086  44  LEU A O   
422  C  CB  . LEU A 49  ? 0.0966 0.0520 0.1279 -0.0151 0.0419  0.0307  44  LEU A CB  
423  C  CG  . LEU A 49  ? 0.1091 0.0291 0.1191 0.0175  0.0524  0.0139  44  LEU A CG  
424  C  CD1 . LEU A 49  ? 0.0970 0.1125 0.1112 0.0761  -0.0030 -0.0252 44  LEU A CD1 
425  C  CD2 . LEU A 49  ? 0.1666 0.0387 0.1424 -0.0152 0.0341  0.0321  44  LEU A CD2 
426  N  N   . SER A 50  ? 0.1007 0.0507 0.0932 0.0160  -0.0026 0.0133  45  SER A N   
427  C  CA  A SER A 50  ? 0.1179 0.0430 0.1243 0.0056  0.0004  0.0069  45  SER A CA  
428  C  CA  B SER A 50  ? 0.1303 0.0437 0.1143 -0.0002 -0.0073 0.0049  45  SER A CA  
429  C  C   . SER A 50  ? 0.1397 0.0538 0.1228 -0.0047 0.0005  0.0022  45  SER A C   
430  O  O   . SER A 50  ? 0.1747 0.0497 0.1311 0.0080  -0.0055 -0.0116 45  SER A O   
431  C  CB  A SER A 50  ? 0.0891 0.0588 0.1077 0.0213  0.0038  -0.0069 45  SER A CB  
432  C  CB  B SER A 50  ? 0.1163 0.0543 0.1032 0.0055  -0.0143 -0.0049 45  SER A CB  
433  O  OG  A SER A 50  ? 0.0613 0.0356 0.1288 0.0189  0.0417  0.0172  45  SER A OG  
434  O  OG  B SER A 50  ? 0.1425 0.0321 0.0668 -0.0282 -0.0217 0.0064  45  SER A OG  
435  N  N   . VAL A 51  ? 0.1111 0.0259 0.1242 0.0000  0.0147  0.0075  46  VAL A N   
436  C  CA  . VAL A 51  ? 0.1001 0.0402 0.1592 -0.0007 0.0136  -0.0026 46  VAL A CA  
437  C  C   . VAL A 51  ? 0.1142 0.0356 0.1556 0.0061  0.0046  -0.0031 46  VAL A C   
438  O  O   . VAL A 51  ? 0.1305 0.0384 0.1328 0.0039  -0.0123 -0.0177 46  VAL A O   
439  C  CB  . VAL A 51  ? 0.1129 0.0268 0.1366 0.0015  0.0207  0.0072  46  VAL A CB  
440  C  CG1 . VAL A 51  ? 0.1551 0.0568 0.1673 -0.0245 0.0449  0.0102  46  VAL A CG1 
441  C  CG2 . VAL A 51  ? 0.0961 0.0517 0.2073 0.0293  0.0005  0.0014  46  VAL A CG2 
442  N  N   . ALA A 52  ? 0.0839 0.0378 0.1189 0.0123  0.0019  -0.0013 47  ALA A N   
443  C  CA  . ALA A 52  ? 0.1047 0.0281 0.1016 0.0149  -0.0072 -0.0020 47  ALA A CA  
444  C  C   . ALA A 52  ? 0.1270 0.0273 0.1029 0.0008  0.0054  -0.0004 47  ALA A C   
445  O  O   . ALA A 52  ? 0.1488 0.0398 0.1334 -0.0042 -0.0091 0.0100  47  ALA A O   
446  C  CB  . ALA A 52  ? 0.1002 0.0276 0.1280 -0.0088 -0.0216 -0.0085 47  ALA A CB  
447  N  N   . TYR A 53  ? 0.1142 0.0354 0.0735 0.0211  0.0020  0.0161  48  TYR A N   
448  C  CA  . TYR A 53  ? 0.1217 0.0372 0.0924 -0.0040 0.0152  0.0269  48  TYR A CA  
449  C  C   . TYR A 53  ? 0.1270 0.0407 0.1043 0.0156  0.0093  0.0144  48  TYR A C   
450  O  O   . TYR A 53  ? 0.1523 0.0309 0.0967 0.0233  0.0123  -0.0075 48  TYR A O   
451  C  CB  . TYR A 53  ? 0.1381 0.0320 0.1210 -0.0035 0.0099  0.0246  48  TYR A CB  
452  C  CG  . TYR A 53  ? 0.0992 0.0320 0.1519 0.0113  0.0032  -0.0009 48  TYR A CG  
453  C  CD1 . TYR A 53  ? 0.0835 0.0359 0.1217 0.0198  -0.0260 0.0092  48  TYR A CD1 
454  C  CD2 . TYR A 53  ? 0.1107 0.0491 0.1089 0.0098  -0.0079 0.0424  48  TYR A CD2 
455  C  CE1 . TYR A 53  ? 0.0772 0.0744 0.1112 -0.0012 -0.0234 -0.0121 48  TYR A CE1 
456  C  CE2 . TYR A 53  ? 0.1223 0.0607 0.1258 0.0201  0.0144  0.0144  48  TYR A CE2 
457  C  CZ  . TYR A 53  ? 0.0919 0.0524 0.1205 0.0121  -0.0056 -0.0149 48  TYR A CZ  
458  O  OH  . TYR A 53  ? 0.1252 0.0828 0.1715 0.0087  -0.0134 -0.0078 48  TYR A OH  
459  N  N   . LYS A 54  ? 0.1089 0.0388 0.0996 0.0229  -0.0109 0.0084  49  LYS A N   
460  C  CA  A LYS A 54  ? 0.1205 0.0506 0.1054 0.0187  -0.0170 0.0025  49  LYS A CA  
461  C  CA  B LYS A 54  ? 0.1152 0.0512 0.1177 0.0229  -0.0134 -0.0001 49  LYS A CA  
462  C  CA  C LYS A 54  ? 0.1134 0.0454 0.1191 0.0277  -0.0153 -0.0003 49  LYS A CA  
463  C  C   . LYS A 54  ? 0.1258 0.0602 0.1030 0.0132  -0.0184 -0.0098 49  LYS A C   
464  O  O   . LYS A 54  ? 0.1436 0.0586 0.1317 0.0127  -0.0050 -0.0262 49  LYS A O   
465  C  CB  A LYS A 54  ? 0.1030 0.0567 0.1028 0.0175  -0.0246 0.0018  49  LYS A CB  
466  C  CB  B LYS A 54  ? 0.1009 0.0593 0.1219 0.0258  -0.0159 -0.0040 49  LYS A CB  
467  C  CB  C LYS A 54  ? 0.0877 0.0589 0.1237 0.0284  -0.0213 -0.0085 49  LYS A CB  
468  C  CG  A LYS A 54  ? 0.1146 0.0855 0.0826 0.0040  -0.0189 0.0253  49  LYS A CG  
469  C  CG  B LYS A 54  ? 0.0979 0.1041 0.1812 0.0324  -0.0040 0.0033  49  LYS A CG  
470  C  CG  C LYS A 54  ? 0.1022 0.1196 0.2007 0.0424  -0.0129 0.0002  49  LYS A CG  
471  C  CD  A LYS A 54  ? 0.1195 0.0586 0.0784 -0.0555 -0.0518 0.0270  49  LYS A CD  
472  C  CD  B LYS A 54  ? 0.0975 0.1424 0.2407 0.0392  0.0266  0.0073  49  LYS A CD  
473  C  CD  C LYS A 54  ? 0.1277 0.1776 0.2746 0.0330  0.0257  -0.0232 49  LYS A CD  
474  C  CE  A LYS A 54  ? 0.1256 0.0425 0.0260 -0.0415 -0.0082 0.0034  49  LYS A CE  
475  C  CE  B LYS A 54  ? 0.1071 0.1771 0.2091 0.0169  0.0408  0.0174  49  LYS A CE  
476  C  CE  C LYS A 54  ? 0.1820 0.2690 0.2845 -0.0176 0.0153  -0.0097 49  LYS A CE  
477  N  NZ  A LYS A 54  ? 0.0725 0.1334 0.0522 -0.0714 -0.0356 0.0539  49  LYS A NZ  
478  N  NZ  B LYS A 54  ? 0.0346 0.0834 0.0852 0.0232  0.0235  0.0590  49  LYS A NZ  
479  N  NZ  C LYS A 54  ? 0.1735 0.2301 0.2330 -0.0186 0.0212  0.0169  49  LYS A NZ  
480  N  N   . ASN A 55  ? 0.1370 0.0451 0.1012 0.0086  -0.0309 0.0105  50  ASN A N   
481  C  CA  . ASN A 55  ? 0.1194 0.0301 0.0992 0.0056  -0.0130 0.0020  50  ASN A CA  
482  C  C   . ASN A 55  ? 0.1389 0.0390 0.1186 0.0011  -0.0118 -0.0035 50  ASN A C   
483  O  O   . ASN A 55  ? 0.1798 0.0431 0.1534 0.0004  -0.0141 -0.0196 50  ASN A O   
484  C  CB  . ASN A 55  ? 0.1229 0.0360 0.0838 -0.0182 -0.0018 -0.0103 50  ASN A CB  
485  C  CG  . ASN A 55  ? 0.1495 0.0963 0.1916 -0.0271 0.0005  -0.0423 50  ASN A CG  
486  O  OD1 . ASN A 55  ? 0.2452 0.1499 0.2566 -0.0935 -0.0100 -0.0675 50  ASN A OD1 
487  N  ND2 . ASN A 55  ? 0.2551 0.1487 0.1967 -0.0399 -0.0120 -0.0577 50  ASN A ND2 
488  N  N   . VAL A 56  ? 0.1551 0.0380 0.1278 0.0083  -0.0118 0.0081  51  VAL A N   
489  C  CA  . VAL A 56  ? 0.1428 0.0545 0.1097 0.0123  -0.0123 0.0005  51  VAL A CA  
490  C  C   . VAL A 56  ? 0.1711 0.0298 0.1185 0.0039  -0.0121 -0.0014 51  VAL A C   
491  O  O   . VAL A 56  ? 0.1590 0.0378 0.1166 -0.0167 -0.0222 -0.0274 51  VAL A O   
492  C  CB  . VAL A 56  ? 0.1501 0.0312 0.0855 0.0249  -0.0255 -0.0124 51  VAL A CB  
493  C  CG1 . VAL A 56  ? 0.1239 0.0532 0.1366 0.0353  0.0063  -0.0033 51  VAL A CG1 
494  C  CG2 . VAL A 56  ? 0.1843 0.0919 0.0929 0.0000  -0.0800 0.0097  51  VAL A CG2 
495  N  N   . VAL A 57  ? 0.1788 0.0351 0.1114 0.0043  -0.0007 0.0043  52  VAL A N   
496  C  CA  A VAL A 57  ? 0.1689 0.0277 0.1049 0.0048  0.0017  0.0027  52  VAL A CA  
497  C  CA  B VAL A 57  ? 0.1900 0.0378 0.1163 0.0078  -0.0029 0.0047  52  VAL A CA  
498  C  C   . VAL A 57  ? 0.1760 0.0458 0.1116 0.0220  -0.0038 -0.0009 52  VAL A C   
499  O  O   . VAL A 57  ? 0.2150 0.0479 0.0982 0.0091  -0.0212 0.0011  52  VAL A O   
500  C  CB  A VAL A 57  ? 0.1551 0.0263 0.0987 0.0047  0.0030  0.0080  52  VAL A CB  
501  C  CB  B VAL A 57  ? 0.1900 0.0423 0.1154 0.0089  0.0027  0.0122  52  VAL A CB  
502  C  CG1 A VAL A 57  ? 0.0576 0.0270 0.0525 -0.0060 0.0068  -0.0050 52  VAL A CG1 
503  C  CG1 B VAL A 57  ? 0.2097 0.0907 0.1319 0.0053  -0.0178 -0.0215 52  VAL A CG1 
504  C  CG2 A VAL A 57  ? 0.1421 0.0519 0.1304 -0.0013 0.0097  0.0033  52  VAL A CG2 
505  C  CG2 B VAL A 57  ? 0.1706 0.0597 0.1575 0.0190  -0.0027 0.0391  52  VAL A CG2 
506  N  N   . GLY A 58  ? 0.1881 0.0720 0.1104 0.0162  0.0015  -0.0016 53  GLY A N   
507  C  CA  . GLY A 58  ? 0.1812 0.0533 0.1609 0.0138  -0.0119 -0.0133 53  GLY A CA  
508  C  C   . GLY A 58  ? 0.1860 0.0579 0.1565 0.0035  -0.0190 -0.0072 53  GLY A C   
509  O  O   . GLY A 58  ? 0.1838 0.0600 0.1902 0.0164  -0.0196 -0.0234 53  GLY A O   
510  N  N   . GLY A 59  ? 0.1749 0.0416 0.1768 0.0065  0.0022  -0.0040 54  GLY A N   
511  C  CA  . GLY A 59  ? 0.2040 0.0499 0.1457 0.0139  -0.0063 -0.0237 54  GLY A CA  
512  C  C   . GLY A 59  ? 0.1665 0.0480 0.1505 0.0277  -0.0072 -0.0164 54  GLY A C   
513  O  O   . GLY A 59  ? 0.2247 0.0590 0.1273 0.0261  -0.0163 -0.0135 54  GLY A O   
514  N  N   . GLN A 60  ? 0.1733 0.0503 0.1280 0.0194  -0.0165 0.0041  55  GLN A N   
515  C  CA  . GLN A 60  ? 0.1602 0.0370 0.1464 0.0225  -0.0322 -0.0115 55  GLN A CA  
516  C  C   . GLN A 60  ? 0.1717 0.0460 0.1347 0.0207  -0.0262 -0.0024 55  GLN A C   
517  O  O   . GLN A 60  ? 0.2058 0.0253 0.1552 0.0001  -0.0306 -0.0001 55  GLN A O   
518  C  CB  . GLN A 60  ? 0.1576 0.0901 0.1459 0.0163  -0.0619 0.0014  55  GLN A CB  
519  C  CG  . GLN A 60  ? 0.1652 0.0851 0.1594 0.0376  -0.0724 -0.0078 55  GLN A CG  
520  C  CD  . GLN A 60  ? 0.1954 0.0834 0.1822 0.0431  -0.0847 -0.0048 55  GLN A CD  
521  O  OE1 . GLN A 60  ? 0.2134 0.0545 0.2769 0.0414  0.0060  -0.0220 55  GLN A OE1 
522  N  NE2 . GLN A 60  ? 0.2391 0.0765 0.3364 0.1019  -0.0914 -0.0257 55  GLN A NE2 
523  N  N   . ARG A 61  ? 0.1837 0.0321 0.1154 0.0322  -0.0384 -0.0059 56  ARG A N   
524  C  CA  . ARG A 61  ? 0.1685 0.0309 0.1429 0.0281  -0.0482 -0.0070 56  ARG A CA  
525  C  C   . ARG A 61  ? 0.1800 0.0332 0.1277 0.0327  -0.0367 -0.0171 56  ARG A C   
526  O  O   . ARG A 61  ? 0.2028 0.0317 0.1335 0.0335  -0.0601 -0.0146 56  ARG A O   
527  C  CB  . ARG A 61  ? 0.1836 0.0322 0.1487 0.0306  -0.0240 -0.0156 56  ARG A CB  
528  C  CG  . ARG A 61  ? 0.1979 0.0259 0.1630 0.0105  -0.0276 -0.0020 56  ARG A CG  
529  C  CD  . ARG A 61  ? 0.1965 0.0926 0.1639 0.0607  -0.0568 -0.0225 56  ARG A CD  
530  N  NE  . ARG A 61  ? 0.2053 0.0343 0.1683 0.0387  -0.0360 -0.0173 56  ARG A NE  
531  C  CZ  . ARG A 61  ? 0.2150 0.0503 0.1612 0.0503  -0.0257 0.0113  56  ARG A CZ  
532  N  NH1 . ARG A 61  ? 0.2747 0.0274 0.1343 0.0090  -0.0236 0.0128  56  ARG A NH1 
533  N  NH2 . ARG A 61  ? 0.2448 0.0655 0.1532 0.0693  -0.0508 -0.0198 56  ARG A NH2 
534  N  N   . ALA A 62  ? 0.1853 0.0448 0.1477 0.0212  -0.0265 -0.0057 57  ALA A N   
535  C  CA  . ALA A 62  ? 0.1929 0.0676 0.1511 0.0171  -0.0140 -0.0238 57  ALA A CA  
536  C  C   . ALA A 62  ? 0.1902 0.0756 0.1512 0.0246  -0.0241 -0.0298 57  ALA A C   
537  O  O   . ALA A 62  ? 0.2127 0.0397 0.1501 0.0001  -0.0253 -0.0418 57  ALA A O   
538  C  CB  . ALA A 62  ? 0.1976 0.0813 0.1452 0.0363  0.0163  -0.0288 57  ALA A CB  
539  N  N   . ALA A 63  ? 0.1772 0.0482 0.1367 0.0447  -0.0403 -0.0145 58  ALA A N   
540  C  CA  . ALA A 63  ? 0.1786 0.0724 0.1360 0.0381  -0.0313 -0.0373 58  ALA A CA  
541  C  C   . ALA A 63  ? 0.1813 0.0556 0.1163 0.0313  -0.0394 -0.0183 58  ALA A C   
542  O  O   . ALA A 63  ? 0.1987 0.0458 0.1503 0.0171  -0.0455 -0.0269 58  ALA A O   
543  C  CB  . ALA A 63  ? 0.1833 0.0464 0.1292 0.0254  -0.0554 -0.0273 58  ALA A CB  
544  N  N   . TRP A 64  ? 0.1654 0.0567 0.1082 0.0272  -0.0096 -0.0155 59  TRP A N   
545  C  CA  . TRP A 64  ? 0.1870 0.0592 0.1309 0.0204  -0.0170 -0.0108 59  TRP A CA  
546  C  C   . TRP A 64  ? 0.1960 0.0630 0.1492 0.0252  -0.0185 -0.0077 59  TRP A C   
547  O  O   . TRP A 64  ? 0.1975 0.0844 0.1239 0.0180  -0.0358 -0.0043 59  TRP A O   
548  C  CB  . TRP A 64  ? 0.1435 0.0390 0.1411 0.0201  0.0098  -0.0030 59  TRP A CB  
549  C  CG  . TRP A 64  ? 0.2120 0.0709 0.0947 0.0534  -0.0178 -0.0287 59  TRP A CG  
550  C  CD1 . TRP A 64  ? 0.2320 0.1208 0.1102 0.0628  0.0042  -0.0742 59  TRP A CD1 
551  C  CD2 . TRP A 64  ? 0.2532 0.0901 0.0890 0.0506  -0.0463 -0.0277 59  TRP A CD2 
552  N  NE1 . TRP A 64  ? 0.2402 0.0588 0.1224 0.0549  -0.0456 -0.0207 59  TRP A NE1 
553  C  CE2 . TRP A 64  ? 0.2512 0.0602 0.1034 0.0616  -0.0562 -0.0162 59  TRP A CE2 
554  C  CE3 . TRP A 64  ? 0.2346 0.0556 0.0877 0.0389  -0.0429 -0.0431 59  TRP A CE3 
555  C  CZ2 . TRP A 64  ? 0.2969 0.0612 0.1197 0.0438  -0.0859 -0.0278 59  TRP A CZ2 
556  C  CZ3 . TRP A 64  ? 0.3292 0.0480 0.0912 0.0431  -0.0632 -0.0385 59  TRP A CZ3 
557  C  CH2 . TRP A 64  ? 0.2674 0.0788 0.1737 0.0643  -0.0495 -0.0024 59  TRP A CH2 
558  N  N   . ARG A 65  ? 0.1975 0.0724 0.1637 0.0367  -0.0331 -0.0071 60  ARG A N   
559  C  CA  . ARG A 65  ? 0.2023 0.0347 0.1754 0.0278  -0.0406 -0.0325 60  ARG A CA  
560  C  C   . ARG A 65  ? 0.2137 0.0524 0.1724 0.0255  -0.0369 -0.0407 60  ARG A C   
561  O  O   . ARG A 65  ? 0.2239 0.0657 0.1749 0.0101  -0.0481 -0.0517 60  ARG A O   
562  C  CB  . ARG A 65  ? 0.2094 0.0705 0.1712 0.0507  -0.0366 -0.0368 60  ARG A CB  
563  C  CG  . ARG A 65  ? 0.2058 0.0612 0.2305 0.0672  -0.0448 -0.0228 60  ARG A CG  
564  C  CD  . ARG A 65  ? 0.2380 0.0665 0.2249 0.0918  -0.0192 0.0019  60  ARG A CD  
565  N  NE  . ARG A 65  ? 0.2844 0.0854 0.2292 0.0307  -0.0499 -0.0058 60  ARG A NE  
566  C  CZ  . ARG A 65  ? 0.3405 0.0726 0.2238 0.0401  -0.0365 -0.0185 60  ARG A CZ  
567  N  NH1 . ARG A 65  ? 0.3276 0.0620 0.2879 0.0718  -0.0792 0.0180  60  ARG A NH1 
568  N  NH2 . ARG A 65  ? 0.3117 0.0853 0.2778 0.0347  -0.0414 0.0197  60  ARG A NH2 
569  N  N   . VAL A 66  ? 0.2113 0.0319 0.1798 0.0240  -0.0379 -0.0275 61  VAL A N   
570  C  CA  . VAL A 66  ? 0.2219 0.0477 0.1984 0.0077  -0.0494 -0.0314 61  VAL A CA  
571  C  C   . VAL A 66  ? 0.2303 0.0681 0.1897 0.0035  -0.0426 -0.0239 61  VAL A C   
572  O  O   . VAL A 66  ? 0.2320 0.0733 0.1935 -0.0010 -0.0721 -0.0445 61  VAL A O   
573  C  CB  . VAL A 66  ? 0.2506 0.0476 0.1889 0.0010  -0.0380 -0.0442 61  VAL A CB  
574  C  CG1 . VAL A 66  ? 0.1879 0.0491 0.2532 0.0027  -0.0425 -0.0226 61  VAL A CG1 
575  C  CG2 . VAL A 66  ? 0.2074 0.1060 0.2487 0.0099  -0.0536 -0.0290 61  VAL A CG2 
576  N  N   . LEU A 67  ? 0.1984 0.0715 0.1578 0.0308  -0.0653 -0.0148 62  LEU A N   
577  C  CA  . LEU A 67  ? 0.2286 0.0618 0.1381 0.0324  -0.0605 0.0001  62  LEU A CA  
578  C  C   . LEU A 67  ? 0.2456 0.0712 0.1376 0.0286  -0.0456 -0.0133 62  LEU A C   
579  O  O   . LEU A 67  ? 0.2577 0.0625 0.1372 0.0019  -0.0559 -0.0188 62  LEU A O   
580  C  CB  . LEU A 67  ? 0.2019 0.0328 0.1243 0.0058  -0.0521 0.0123  62  LEU A CB  
581  C  CG  . LEU A 67  ? 0.2161 0.0281 0.1112 0.0216  -0.0796 -0.0047 62  LEU A CG  
582  C  CD1 . LEU A 67  ? 0.2303 0.0653 0.1507 -0.0148 -0.0499 -0.0298 62  LEU A CD1 
583  C  CD2 . LEU A 67  ? 0.2672 0.0274 0.1621 -0.0186 -0.0360 -0.0064 62  LEU A CD2 
584  N  N   . SER A 68  ? 0.2628 0.0745 0.1481 0.0356  -0.0464 0.0022  63  SER A N   
585  C  CA  A SER A 68  ? 0.2780 0.0899 0.1446 0.0401  -0.0516 -0.0112 63  SER A CA  
586  C  CA  B SER A 68  ? 0.2694 0.0935 0.1642 0.0367  -0.0536 -0.0153 63  SER A CA  
587  C  C   . SER A 68  ? 0.2638 0.1056 0.1775 0.0430  -0.0590 -0.0184 63  SER A C   
588  O  O   . SER A 68  ? 0.2680 0.1215 0.1840 0.0475  -0.0429 -0.0209 63  SER A O   
589  C  CB  A SER A 68  ? 0.2917 0.0868 0.1401 0.0349  -0.0456 0.0165  63  SER A CB  
590  C  CB  B SER A 68  ? 0.2751 0.0916 0.1720 0.0319  -0.0492 -0.0001 63  SER A CB  
591  O  OG  A SER A 68  ? 0.3018 0.0510 0.0801 0.0561  -0.0376 0.0189  63  SER A OG  
592  O  OG  B SER A 68  ? 0.2689 0.0842 0.2014 0.0284  -0.0640 -0.0193 63  SER A OG  
593  N  N   . SER A 69  ? 0.2584 0.1000 0.1943 0.0338  -0.0607 -0.0300 64  SER A N   
594  C  CA  A SER A 69  ? 0.2579 0.1376 0.1936 0.0384  -0.0806 -0.0473 64  SER A CA  
595  C  CA  B SER A 69  ? 0.2628 0.1375 0.2102 0.0357  -0.0725 -0.0467 64  SER A CA  
596  C  C   . SER A 69  ? 0.2698 0.1464 0.2100 0.0305  -0.0821 -0.0541 64  SER A C   
597  O  O   . SER A 69  ? 0.2868 0.1739 0.2085 0.0293  -0.0865 -0.0583 64  SER A O   
598  C  CB  A SER A 69  ? 0.2449 0.1247 0.2137 0.0361  -0.0821 -0.0611 64  SER A CB  
599  C  CB  B SER A 69  ? 0.2580 0.1352 0.2357 0.0334  -0.0694 -0.0567 64  SER A CB  
600  O  OG  A SER A 69  ? 0.2112 0.1828 0.1815 0.0587  -0.1122 -0.0508 64  SER A OG  
601  O  OG  B SER A 69  ? 0.2381 0.1654 0.3015 0.0393  -0.0572 -0.0510 64  SER A OG  
602  N  N   . ILE A 70  ? 0.2612 0.1220 0.1976 0.0339  -0.0827 -0.0522 65  ILE A N   
603  C  CA  A ILE A 70  ? 0.2597 0.1361 0.2026 0.0477  -0.0739 -0.0666 65  ILE A CA  
604  C  CA  B ILE A 70  ? 0.2714 0.1436 0.2211 0.0380  -0.0712 -0.0663 65  ILE A CA  
605  C  C   . ILE A 70  ? 0.2779 0.1488 0.2113 0.0362  -0.0759 -0.0651 65  ILE A C   
606  O  O   . ILE A 70  ? 0.3059 0.1452 0.2219 0.0403  -0.0689 -0.0919 65  ILE A O   
607  C  CB  A ILE A 70  ? 0.2593 0.1025 0.1983 0.0475  -0.0681 -0.0568 65  ILE A CB  
608  C  CB  B ILE A 70  ? 0.2759 0.1291 0.2288 0.0361  -0.0698 -0.0601 65  ILE A CB  
609  C  CG1 A ILE A 70  ? 0.1991 0.0737 0.1481 0.0722  -0.0761 -0.0722 65  ILE A CG1 
610  C  CG1 B ILE A 70  ? 0.2585 0.1396 0.2799 0.0324  -0.0577 -0.0700 65  ILE A CG1 
611  C  CG2 A ILE A 70  ? 0.2505 0.1241 0.2508 0.0526  -0.0592 -0.0598 65  ILE A CG2 
612  C  CG2 B ILE A 70  ? 0.2652 0.1476 0.2529 0.0309  -0.0565 -0.0607 65  ILE A CG2 
613  C  CD1 A ILE A 70  ? 0.1780 0.0276 0.0860 0.0162  -0.0528 -0.0005 65  ILE A CD1 
614  C  CD1 B ILE A 70  ? 0.2724 0.1671 0.3262 0.0000  -0.0402 -0.0820 65  ILE A CD1 
615  N  N   . GLU A 71  ? 0.2884 0.1280 0.1915 0.0337  -0.0801 -0.0577 66  GLU A N   
616  C  CA  . GLU A 71  ? 0.2918 0.1578 0.1793 0.0330  -0.0650 -0.0750 66  GLU A CA  
617  C  C   . GLU A 71  ? 0.3112 0.1955 0.1804 0.0338  -0.0697 -0.0873 66  GLU A C   
618  O  O   . GLU A 71  ? 0.3079 0.2411 0.1966 0.0279  -0.0601 -0.0931 66  GLU A O   
619  C  CB  . GLU A 71  ? 0.2827 0.1719 0.1656 0.0224  -0.0601 -0.0881 66  GLU A CB  
620  C  CG  . GLU A 71  ? 0.3216 0.1226 0.1971 0.0210  -0.0404 -0.0498 66  GLU A CG  
621  C  CD  . GLU A 71  ? 0.3121 0.1671 0.2494 0.0071  -0.0550 -0.0470 66  GLU A CD  
622  O  OE1 . GLU A 71  ? 0.4185 0.1660 0.2492 0.0048  -0.0587 -0.0206 66  GLU A OE1 
623  O  OE2 . GLU A 71  ? 0.3411 0.0958 0.3037 0.0536  -0.0272 -0.0130 66  GLU A OE2 
624  N  N   . GLN A 72  ? 0.3281 0.2304 0.1970 0.0487  -0.0749 -0.0761 67  GLN A N   
625  C  CA  . GLN A 72  ? 0.3826 0.2709 0.2275 0.0456  -0.0766 -0.1003 67  GLN A CA  
626  C  C   . GLN A 72  ? 0.4001 0.3079 0.2580 0.0339  -0.0745 -0.1084 67  GLN A C   
627  O  O   . GLN A 72  ? 0.4330 0.3121 0.2533 0.0212  -0.0632 -0.1273 67  GLN A O   
628  C  CB  . GLN A 72  ? 0.3913 0.2960 0.2516 0.0569  -0.0787 -0.0777 67  GLN A CB  
629  C  CG  . GLN A 72  ? 0.4502 0.3354 0.3068 0.0196  -0.0706 -0.0553 67  GLN A CG  
630  N  N   . LYS A 73  ? 0.4204 0.3241 0.2956 0.0212  -0.0649 -0.1276 68  LYS A N   
631  C  CA  . LYS A 73  ? 0.4344 0.3586 0.3125 0.0016  -0.0724 -0.1596 68  LYS A CA  
632  C  C   . LYS A 73  ? 0.4525 0.3659 0.3305 -0.0046 -0.0603 -0.1643 68  LYS A C   
633  O  O   . LYS A 73  ? 0.4450 0.3771 0.3283 -0.0342 -0.0844 -0.1767 68  LYS A O   
634  C  CB  . LYS A 73  ? 0.4447 0.3559 0.3137 0.0116  -0.0604 -0.1650 68  LYS A CB  
635  C  CG  . LYS A 73  ? 0.4386 0.4302 0.3455 0.0151  -0.0937 -0.1642 68  LYS A CG  
636  N  N   . SER A 74  ? 0.4496 0.3864 0.3561 -0.0059 -0.0573 -0.1702 69  SER A N   
637  C  CA  . SER A 74  ? 0.5044 0.3988 0.3987 0.0009  -0.0346 -0.1786 69  SER A CA  
638  C  C   . SER A 74  ? 0.5357 0.4172 0.4151 0.0009  -0.0176 -0.1769 69  SER A C   
639  O  O   . SER A 74  ? 0.5595 0.4211 0.4275 0.0119  0.0073  -0.1894 69  SER A O   
640  C  CB  . SER A 74  ? 0.4827 0.4014 0.4251 0.0023  -0.0437 -0.1731 69  SER A CB  
641  O  OG  . SER A 74  ? 0.5189 0.3708 0.4746 0.0308  -0.0314 -0.2087 69  SER A OG  
642  N  N   . ASN A 75  ? 0.5774 0.4376 0.4180 -0.0030 -0.0094 -0.1614 70  ASN A N   
643  C  CA  . ASN A 75  ? 0.6125 0.4568 0.4419 -0.0196 -0.0075 -0.1441 70  ASN A CA  
644  C  C   . ASN A 75  ? 0.6305 0.4665 0.4514 -0.0158 -0.0128 -0.1239 70  ASN A C   
645  O  O   . ASN A 75  ? 0.6497 0.4768 0.4501 -0.0257 -0.0027 -0.1172 70  ASN A O   
646  C  CB  . ASN A 75  ? 0.6102 0.4575 0.4359 -0.0258 -0.0056 -0.1591 70  ASN A CB  
647  C  CG  . ASN A 75  ? 0.6234 0.4720 0.4353 -0.0419 0.0027  -0.1847 70  ASN A CG  
648  O  OD1 . ASN A 75  ? 0.6536 0.5252 0.4185 -0.0811 0.0557  -0.2077 70  ASN A OD1 
649  N  ND2 . ASN A 75  ? 0.6404 0.4996 0.4655 -0.0509 -0.0347 -0.2345 70  ASN A ND2 
650  N  N   . GLU A 76  ? 0.6346 0.4561 0.4618 -0.0049 -0.0187 -0.1128 71  GLU A N   
651  C  CA  . GLU A 76  ? 0.6548 0.4443 0.4630 0.0069  -0.0365 -0.1057 71  GLU A CA  
652  C  C   . GLU A 76  ? 0.6546 0.4315 0.4678 0.0074  -0.0451 -0.0944 71  GLU A C   
653  O  O   . GLU A 76  ? 0.6757 0.4261 0.4637 0.0105  -0.0590 -0.0873 71  GLU A O   
654  C  CB  . GLU A 76  ? 0.6534 0.4587 0.4634 0.0118  -0.0371 -0.1067 71  GLU A CB  
655  C  CG  . GLU A 76  ? 0.6959 0.4805 0.5148 0.0505  -0.0407 -0.1049 71  GLU A CG  
656  C  CD  . GLU A 76  ? 0.7564 0.5639 0.5777 0.0480  -0.0236 -0.0868 71  GLU A CD  
657  O  OE1 . GLU A 76  ? 0.7754 0.5796 0.6241 0.0311  -0.0457 -0.0916 71  GLU A OE1 
658  O  OE2 . GLU A 76  ? 0.8086 0.6101 0.5866 0.0967  -0.0090 -0.0999 71  GLU A OE2 
659  N  N   . GLU A 77  ? 0.6479 0.4162 0.4713 0.0026  -0.0492 -0.0772 72  GLU A N   
660  C  CA  . GLU A 77  ? 0.6368 0.4042 0.4810 0.0016  -0.0467 -0.0533 72  GLU A CA  
661  C  C   . GLU A 77  ? 0.6277 0.3975 0.4921 -0.0035 -0.0466 -0.0449 72  GLU A C   
662  O  O   . GLU A 77  ? 0.6230 0.4082 0.5104 0.0045  -0.0448 -0.0418 72  GLU A O   
663  C  CB  . GLU A 77  ? 0.6383 0.4097 0.4754 0.0075  -0.0495 -0.0489 72  GLU A CB  
664  C  CG  . GLU A 77  ? 0.6533 0.4411 0.5000 0.0231  -0.0460 -0.0309 72  GLU A CG  
665  N  N   . GLY A 78  ? 0.6183 0.3694 0.4954 -0.0153 -0.0509 -0.0328 73  GLY A N   
666  C  CA  . GLY A 78  ? 0.5961 0.3602 0.5063 -0.0350 -0.0602 -0.0319 73  GLY A CA  
667  C  C   . GLY A 78  ? 0.5832 0.3436 0.5111 -0.0486 -0.0615 -0.0231 73  GLY A C   
668  O  O   . GLY A 78  ? 0.5761 0.3224 0.5232 -0.0645 -0.0720 -0.0291 73  GLY A O   
669  N  N   . SER A 79  ? 0.5648 0.3173 0.5095 -0.0464 -0.0549 -0.0255 74  SER A N   
670  C  CA  . SER A 79  ? 0.5354 0.2995 0.5068 -0.0427 -0.0377 -0.0135 74  SER A CA  
671  C  C   . SER A 79  ? 0.5267 0.2994 0.5159 -0.0480 -0.0217 -0.0012 74  SER A C   
672  O  O   . SER A 79  ? 0.5233 0.3021 0.5158 -0.0442 0.0003  0.0379  74  SER A O   
673  C  CB  . SER A 79  ? 0.5293 0.2879 0.5145 -0.0549 -0.0399 -0.0163 74  SER A CB  
674  O  OG  . SER A 79  ? 0.5441 0.2630 0.4864 -0.0275 -0.0504 -0.0200 74  SER A OG  
675  N  N   . GLU A 80  ? 0.5070 0.2860 0.5014 -0.0558 -0.0193 0.0010  75  GLU A N   
676  C  CA  . GLU A 80  ? 0.5162 0.2699 0.5195 -0.0652 -0.0053 -0.0224 75  GLU A CA  
677  C  C   . GLU A 80  ? 0.5187 0.3127 0.5158 -0.0553 -0.0112 -0.0332 75  GLU A C   
678  O  O   . GLU A 80  ? 0.5385 0.2995 0.5232 -0.0478 -0.0060 -0.0595 75  GLU A O   
679  C  CB  . GLU A 80  ? 0.5171 0.2880 0.5209 -0.0582 -0.0042 0.0006  75  GLU A CB  
680  C  CG  . GLU A 80  ? 0.5162 0.2060 0.5712 -0.0929 0.0302  -0.0125 75  GLU A CG  
681  C  CD  . GLU A 80  ? 0.5041 0.2667 0.5986 -0.0805 0.0358  -0.0318 75  GLU A CD  
682  O  OE1 . GLU A 80  ? 0.4035 0.2298 0.5585 -0.0459 0.0643  -0.0281 75  GLU A OE1 
683  O  OE2 . GLU A 80  ? 0.5105 0.2602 0.7437 -0.0372 0.0121  -0.0578 75  GLU A OE2 
684  N  N   . GLU A 81  ? 0.5178 0.3160 0.5055 -0.0617 -0.0047 -0.0398 76  GLU A N   
685  C  CA  . GLU A 81  ? 0.5242 0.3301 0.5001 -0.0700 -0.0090 -0.0433 76  GLU A CA  
686  C  C   . GLU A 81  ? 0.5124 0.3320 0.4906 -0.0649 -0.0080 -0.0508 76  GLU A C   
687  O  O   . GLU A 81  ? 0.5351 0.3316 0.4953 -0.0631 -0.0090 -0.0630 76  GLU A O   
688  C  CB  . GLU A 81  ? 0.5339 0.3504 0.5255 -0.0683 -0.0070 -0.0498 76  GLU A CB  
689  C  CG  . GLU A 81  ? 0.5850 0.3615 0.5594 -0.1177 -0.0130 -0.0544 76  GLU A CG  
690  C  CD  . GLU A 81  ? 0.6829 0.4035 0.6059 -0.1447 -0.0323 -0.0423 76  GLU A CD  
691  O  OE1 . GLU A 81  ? 0.6990 0.4403 0.6141 -0.1447 -0.0501 -0.0118 76  GLU A OE1 
692  O  OE2 . GLU A 81  ? 0.7396 0.4840 0.5997 -0.1766 -0.0390 -0.0544 76  GLU A OE2 
693  N  N   . LYS A 82  ? 0.4770 0.3255 0.4535 -0.0641 -0.0042 -0.0508 77  LYS A N   
694  C  CA  . LYS A 82  ? 0.4364 0.3303 0.4357 -0.0662 0.0037  -0.0533 77  LYS A CA  
695  C  C   . LYS A 82  ? 0.4290 0.3107 0.3965 -0.0529 0.0047  -0.0483 77  LYS A C   
696  O  O   . LYS A 82  ? 0.4570 0.3502 0.3919 -0.0511 0.0091  -0.0542 77  LYS A O   
697  C  CB  . LYS A 82  ? 0.4388 0.3420 0.4376 -0.0754 0.0050  -0.0500 77  LYS A CB  
698  C  CG  . LYS A 82  ? 0.4218 0.4247 0.4983 -0.1183 0.0086  -0.0648 77  LYS A CG  
699  C  CD  . LYS A 82  ? 0.4520 0.5584 0.5396 -0.1568 0.0350  -0.0968 77  LYS A CD  
700  C  CE  . LYS A 82  ? 0.4427 0.5698 0.5836 -0.2025 0.0141  -0.1105 77  LYS A CE  
701  N  NZ  . LYS A 82  ? 0.4468 0.6347 0.5048 -0.1816 -0.0451 -0.1939 77  LYS A NZ  
702  N  N   . GLY A 83  ? 0.3841 0.2574 0.3513 -0.0345 0.0110  -0.0421 78  GLY A N   
703  C  CA  . GLY A 83  ? 0.3418 0.1986 0.3084 -0.0216 0.0143  -0.0405 78  GLY A CA  
704  C  C   . GLY A 83  ? 0.2968 0.1646 0.2646 -0.0086 0.0164  -0.0264 78  GLY A C   
705  O  O   . GLY A 83  ? 0.3108 0.1860 0.2574 -0.0021 0.0057  -0.0270 78  GLY A O   
706  N  N   . PRO A 84  ? 0.2691 0.1272 0.2267 0.0042  0.0115  -0.0203 79  PRO A N   
707  C  CA  . PRO A 84  ? 0.2468 0.1016 0.2070 0.0097  0.0045  -0.0177 79  PRO A CA  
708  C  C   . PRO A 84  ? 0.2506 0.0841 0.1740 0.0117  -0.0069 -0.0071 79  PRO A C   
709  O  O   . PRO A 84  ? 0.2684 0.0881 0.1518 0.0064  -0.0143 -0.0225 79  PRO A O   
710  C  CB  . PRO A 84  ? 0.2582 0.0989 0.2222 0.0154  0.0010  -0.0128 79  PRO A CB  
711  C  CG  . PRO A 84  ? 0.2671 0.1181 0.2403 0.0280  -0.0010 -0.0133 79  PRO A CG  
712  C  CD  . PRO A 84  ? 0.2617 0.1144 0.2567 0.0099  0.0126  -0.0152 79  PRO A CD  
713  N  N   . GLU A 85  ? 0.2444 0.0603 0.1548 0.0206  -0.0153 -0.0091 80  GLU A N   
714  C  CA  . GLU A 85  ? 0.2401 0.0499 0.1623 0.0414  0.0087  0.0123  80  GLU A CA  
715  C  C   . GLU A 85  ? 0.2369 0.0610 0.1848 0.0403  -0.0184 0.0200  80  GLU A C   
716  O  O   . GLU A 85  ? 0.2292 0.0411 0.1598 0.0205  -0.0098 0.0055  80  GLU A O   
717  C  CB  . GLU A 85  ? 0.2240 0.0377 0.1621 0.0296  -0.0074 0.0319  80  GLU A CB  
718  C  CG  . GLU A 85  ? 0.2530 0.0438 0.1770 0.0632  -0.0243 -0.0189 80  GLU A CG  
719  C  CD  . GLU A 85  ? 0.2445 0.0826 0.1923 0.0581  -0.0006 0.0149  80  GLU A CD  
720  O  OE1 . GLU A 85  ? 0.3136 0.0604 0.2178 0.0123  -0.0057 0.0109  80  GLU A OE1 
721  O  OE2 . GLU A 85  ? 0.2979 0.0797 0.2048 0.0820  -0.0196 -0.0253 80  GLU A OE2 
722  N  N   . VAL A 86  ? 0.2385 0.0750 0.1974 0.0283  -0.0170 0.0230  81  VAL A N   
723  C  CA  . VAL A 86  ? 0.2196 0.0526 0.2036 0.0329  -0.0208 0.0117  81  VAL A CA  
724  C  C   . VAL A 86  ? 0.2361 0.0744 0.1919 0.0206  -0.0078 -0.0032 81  VAL A C   
725  O  O   . VAL A 86  ? 0.2601 0.0553 0.1895 0.0409  -0.0094 -0.0060 81  VAL A O   
726  C  CB  . VAL A 86  ? 0.1815 0.0271 0.2647 0.0129  -0.0237 0.0112  81  VAL A CB  
727  C  CG1 . VAL A 86  ? 0.2005 0.0816 0.3355 0.0355  -0.0324 0.0204  81  VAL A CG1 
728  C  CG2 . VAL A 86  ? 0.2217 0.0513 0.2931 -0.0156 -0.0004 0.0324  81  VAL A CG2 
729  N  N   . ARG A 87  ? 0.2164 0.0714 0.1629 0.0178  0.0066  0.0209  82  ARG A N   
730  C  CA  . ARG A 87  ? 0.2447 0.0683 0.1527 0.0273  0.0282  0.0241  82  ARG A CA  
731  C  C   . ARG A 87  ? 0.2383 0.0415 0.1492 0.0348  0.0355  0.0154  82  ARG A C   
732  O  O   . ARG A 87  ? 0.2369 0.0473 0.1727 0.0522  0.0328  0.0175  82  ARG A O   
733  C  CB  . ARG A 87  ? 0.2524 0.0953 0.1583 0.0261  0.0558  0.0218  82  ARG A CB  
734  C  CG  . ARG A 87  ? 0.3362 0.0544 0.1910 0.0308  0.0709  0.0274  82  ARG A CG  
735  C  CD  . ARG A 87  ? 0.3489 0.2037 0.2154 0.0411  0.1114  0.0286  82  ARG A CD  
736  N  NE  . ARG A 87  ? 0.4350 0.2711 0.2816 0.0599  0.1040  0.0702  82  ARG A NE  
737  C  CZ  . ARG A 87  ? 0.4597 0.2914 0.3334 0.0597  0.0800  0.0690  82  ARG A CZ  
738  N  NH1 . ARG A 87  ? 0.4493 0.2535 0.3855 0.0217  0.0420  0.1020  82  ARG A NH1 
739  N  NH2 . ARG A 87  ? 0.4632 0.2881 0.3696 0.0632  0.1264  0.0861  82  ARG A NH2 
740  N  N   . GLU A 88  ? 0.2088 0.0509 0.1439 0.0525  0.0309  0.0159  83  GLU A N   
741  C  CA  . GLU A 88  ? 0.2212 0.0389 0.1417 0.0484  0.0457  0.0053  83  GLU A CA  
742  C  C   . GLU A 88  ? 0.2111 0.0421 0.1177 0.0360  0.0370  0.0119  83  GLU A C   
743  O  O   . GLU A 88  ? 0.2251 0.0320 0.1377 0.0335  0.0192  0.0143  83  GLU A O   
744  C  CB  . GLU A 88  ? 0.2335 0.0491 0.1497 0.0697  0.0714  0.0169  83  GLU A CB  
745  C  CG  . GLU A 88  ? 0.2319 0.0355 0.1606 0.0176  0.0823  -0.0227 83  GLU A CG  
746  C  CD  . GLU A 88  ? 0.2466 0.0832 0.1857 0.0704  0.0900  -0.0158 83  GLU A CD  
747  O  OE1 . GLU A 88  ? 0.2623 0.0739 0.2287 0.0541  0.0988  -0.0108 83  GLU A OE1 
748  O  OE2 . GLU A 88  ? 0.2473 0.0551 0.1877 0.0812  0.0595  0.0247  83  GLU A OE2 
749  N  N   . TYR A 89  ? 0.1748 0.0506 0.1017 0.0569  0.0435  0.0308  84  TYR A N   
750  C  CA  . TYR A 89  ? 0.2009 0.0476 0.1177 0.0467  0.0328  0.0197  84  TYR A CA  
751  C  C   . TYR A 89  ? 0.2116 0.0632 0.1336 0.0483  0.0167  0.0166  84  TYR A C   
752  O  O   . TYR A 89  ? 0.2193 0.0824 0.1255 0.0487  0.0263  0.0177  84  TYR A O   
753  C  CB  . TYR A 89  ? 0.1981 0.0408 0.1112 0.0342  0.0440  0.0342  84  TYR A CB  
754  C  CG  . TYR A 89  ? 0.1926 0.0332 0.1171 0.0331  0.0105  0.0132  84  TYR A CG  
755  C  CD1 . TYR A 89  ? 0.2322 0.0435 0.1264 0.0255  0.0002  0.0390  84  TYR A CD1 
756  C  CD2 . TYR A 89  ? 0.2048 0.0572 0.1192 0.0291  0.0756  -0.0147 84  TYR A CD2 
757  C  CE1 . TYR A 89  ? 0.1961 0.0463 0.1343 0.0067  0.0322  0.0475  84  TYR A CE1 
758  C  CE2 . TYR A 89  ? 0.1963 0.0655 0.0742 0.0466  0.0523  0.0443  84  TYR A CE2 
759  C  CZ  . TYR A 89  ? 0.1993 0.0516 0.1157 0.0463  0.0335  0.0432  84  TYR A CZ  
760  O  OH  . TYR A 89  ? 0.2140 0.0815 0.1185 0.0147  0.0765  0.0386  84  TYR A OH  
761  N  N   . ARG A 90  ? 0.1735 0.0334 0.1341 0.0321  0.0044  0.0119  85  ARG A N   
762  C  CA  . ARG A 90  ? 0.1591 0.0416 0.1460 0.0304  -0.0205 0.0284  85  ARG A CA  
763  C  C   . ARG A 90  ? 0.1754 0.0354 0.1673 0.0358  -0.0011 0.0144  85  ARG A C   
764  O  O   . ARG A 90  ? 0.1690 0.0520 0.1707 0.0467  -0.0116 0.0133  85  ARG A O   
765  C  CB  . ARG A 90  ? 0.1830 0.0412 0.1423 0.0427  -0.0238 0.0156  85  ARG A CB  
766  C  CG  . ARG A 90  ? 0.1947 0.0343 0.1221 0.0305  -0.0418 0.0098  85  ARG A CG  
767  C  CD  . ARG A 90  ? 0.1880 0.0349 0.1610 0.0372  0.0066  0.0135  85  ARG A CD  
768  N  NE  . ARG A 90  ? 0.2629 0.0445 0.1821 0.0376  0.0073  -0.0151 85  ARG A NE  
769  C  CZ  . ARG A 90  ? 0.2966 0.0661 0.2080 0.0299  -0.0082 -0.0307 85  ARG A CZ  
770  N  NH1 . ARG A 90  ? 0.2721 0.0656 0.2644 0.0429  -0.0039 -0.0450 85  ARG A NH1 
771  N  NH2 . ARG A 90  ? 0.3247 0.0873 0.1853 0.0566  0.0237  -0.0309 85  ARG A NH2 
772  N  N   . GLU A 91  ? 0.1814 0.0339 0.1866 0.0343  0.0148  0.0161  86  GLU A N   
773  C  CA  A GLU A 91  ? 0.1872 0.0510 0.1568 0.0388  0.0151  0.0068  86  GLU A CA  
774  C  CA  B GLU A 91  ? 0.2004 0.0585 0.1613 0.0434  0.0173  0.0141  86  GLU A CA  
775  C  C   . GLU A 91  ? 0.1981 0.0383 0.1607 0.0470  0.0208  0.0002  86  GLU A C   
776  O  O   . GLU A 91  ? 0.2064 0.0629 0.1723 0.0598  0.0230  -0.0160 86  GLU A O   
777  C  CB  A GLU A 91  ? 0.2136 0.0658 0.1681 0.0420  0.0232  0.0059  86  GLU A CB  
778  C  CB  B GLU A 91  ? 0.2338 0.0739 0.1737 0.0487  0.0263  0.0184  86  GLU A CB  
779  C  CG  A GLU A 91  ? 0.1910 0.0282 0.1335 0.0219  0.0294  0.0046  86  GLU A CG  
780  C  CG  B GLU A 91  ? 0.2857 0.0949 0.1733 0.0641  0.0515  0.0555  86  GLU A CG  
781  C  CD  A GLU A 91  ? 0.1711 0.1443 0.1942 0.0416  0.0264  0.0316  86  GLU A CD  
782  C  CD  B GLU A 91  ? 0.3586 0.1533 0.2482 0.0362  0.0523  0.0833  86  GLU A CD  
783  O  OE1 A GLU A 91  ? 0.2531 0.1777 0.2556 0.0927  0.0119  0.0086  86  GLU A OE1 
784  O  OE1 B GLU A 91  ? 0.3693 0.1705 0.2159 0.0540  0.0450  0.1320  86  GLU A OE1 
785  O  OE2 A GLU A 91  ? 0.2075 0.1743 0.2145 0.0073  0.0351  0.0574  86  GLU A OE2 
786  O  OE2 B GLU A 91  ? 0.3886 0.2672 0.2049 0.0183  0.0651  0.0789  86  GLU A OE2 
787  N  N   . LYS A 92  ? 0.1882 0.0515 0.1447 0.0599  0.0174  0.0051  87  LYS A N   
788  C  CA  A LYS A 92  ? 0.2137 0.0420 0.1602 0.0552  0.0053  0.0093  87  LYS A CA  
789  C  CA  B LYS A 92  ? 0.2131 0.0396 0.1608 0.0514  0.0101  0.0086  87  LYS A CA  
790  C  C   . LYS A 92  ? 0.1989 0.0567 0.1659 0.0467  0.0042  0.0007  87  LYS A C   
791  O  O   . LYS A 92  ? 0.2242 0.0339 0.1639 0.0412  -0.0017 0.0033  87  LYS A O   
792  C  CB  A LYS A 92  ? 0.2018 0.0370 0.1678 0.0306  -0.0035 0.0285  87  LYS A CB  
793  C  CB  B LYS A 92  ? 0.2113 0.0350 0.1730 0.0350  0.0096  0.0231  87  LYS A CB  
794  C  CG  A LYS A 92  ? 0.2799 0.1242 0.1954 0.0271  -0.0152 0.0330  87  LYS A CG  
795  C  CG  B LYS A 92  ? 0.2824 0.0492 0.1949 0.0281  0.0174  0.0326  87  LYS A CG  
796  C  CD  A LYS A 92  ? 0.3037 0.2357 0.2214 0.0394  -0.0197 0.0626  87  LYS A CD  
797  C  CD  B LYS A 92  ? 0.3253 0.0592 0.2634 0.0573  0.0520  0.0483  87  LYS A CD  
798  C  CE  A LYS A 92  ? 0.3306 0.3408 0.2386 0.0566  0.0064  0.0803  87  LYS A CE  
799  C  CE  B LYS A 92  ? 0.3613 0.1072 0.2759 0.0806  0.0957  0.0514  87  LYS A CE  
800  N  NZ  A LYS A 92  ? 0.3416 0.4067 0.2204 0.0876  -0.0346 0.0572  87  LYS A NZ  
801  N  NZ  B LYS A 92  ? 0.3592 0.0366 0.2918 0.0541  0.1329  0.0448  87  LYS A NZ  
802  N  N   . VAL A 93  ? 0.1787 0.0665 0.1429 0.0435  -0.0029 -0.0008 88  VAL A N   
803  C  CA  . VAL A 93  ? 0.1567 0.0732 0.1497 0.0337  0.0036  0.0220  88  VAL A CA  
804  C  C   . VAL A 93  ? 0.1983 0.0672 0.1394 0.0376  -0.0097 0.0058  88  VAL A C   
805  O  O   . VAL A 93  ? 0.1775 0.0875 0.1471 0.0480  0.0081  0.0230  88  VAL A O   
806  C  CB  . VAL A 93  ? 0.1679 0.0432 0.1449 0.0240  0.0247  0.0037  88  VAL A CB  
807  C  CG1 . VAL A 93  ? 0.1594 0.0606 0.1965 0.0599  0.0564  0.0146  88  VAL A CG1 
808  C  CG2 . VAL A 93  ? 0.1550 0.0894 0.1434 -0.0190 0.0116  0.0316  88  VAL A CG2 
809  N  N   . GLU A 94  ? 0.2106 0.0615 0.1257 0.0516  -0.0118 0.0084  89  GLU A N   
810  C  CA  . GLU A 94  ? 0.2057 0.0636 0.0976 0.0336  -0.0222 0.0233  89  GLU A CA  
811  C  C   . GLU A 94  ? 0.2118 0.0725 0.1473 0.0446  -0.0038 0.0091  89  GLU A C   
812  O  O   . GLU A 94  ? 0.2170 0.0625 0.1393 0.0719  0.0013  0.0122  89  GLU A O   
813  C  CB  . GLU A 94  ? 0.2461 0.0678 0.1033 0.0374  -0.0094 0.0513  89  GLU A CB  
814  C  CG  . GLU A 94  ? 0.2508 0.0666 0.1291 0.0482  -0.0119 0.0524  89  GLU A CG  
815  C  CD  . GLU A 94  ? 0.2425 0.0771 0.1198 -0.0011 0.0362  0.0344  89  GLU A CD  
816  O  OE1 . GLU A 94  ? 0.2426 0.0642 0.1279 0.0326  0.0441  -0.0231 89  GLU A OE1 
817  O  OE2 . GLU A 94  ? 0.2542 0.1508 0.1798 -0.0217 0.0689  0.0193  89  GLU A OE2 
818  N  N   . THR A 95  ? 0.1933 0.0668 0.1678 0.0356  -0.0053 -0.0070 90  THR A N   
819  C  CA  A THR A 95  ? 0.1742 0.0868 0.1808 0.0465  0.0019  -0.0097 90  THR A CA  
820  C  CA  B THR A 95  ? 0.1875 0.0771 0.1816 0.0382  0.0026  0.0052  90  THR A CA  
821  C  C   . THR A 95  ? 0.1616 0.0634 0.1859 0.0392  0.0120  -0.0100 90  THR A C   
822  O  O   . THR A 95  ? 0.1663 0.0861 0.1885 0.0185  0.0020  -0.0037 90  THR A O   
823  C  CB  A THR A 95  ? 0.1942 0.0574 0.2012 0.0448  0.0074  -0.0213 90  THR A CB  
824  C  CB  B THR A 95  ? 0.1954 0.0726 0.1896 0.0380  0.0080  0.0013  90  THR A CB  
825  O  OG1 A THR A 95  ? 0.1966 0.0984 0.2117 0.0551  0.0497  -0.0497 90  THR A OG1 
826  O  OG1 B THR A 95  ? 0.2330 0.1091 0.2367 0.0513  0.0013  0.0526  90  THR A OG1 
827  C  CG2 A THR A 95  ? 0.1466 0.0855 0.2081 0.0613  -0.0111 -0.0197 90  THR A CG2 
828  C  CG2 B THR A 95  ? 0.2061 0.0566 0.1943 0.0334  0.0125  0.0063  90  THR A CG2 
829  N  N   . GLU A 96  ? 0.1829 0.0476 0.1762 0.0253  0.0080  0.0114  91  GLU A N   
830  C  CA  A GLU A 96  ? 0.1538 0.0306 0.1663 0.0196  -0.0005 0.0085  91  GLU A CA  
831  C  CA  B GLU A 96  ? 0.1611 0.0372 0.1607 0.0212  0.0053  0.0041  91  GLU A CA  
832  C  C   . GLU A 96  ? 0.1593 0.0502 0.1689 0.0192  -0.0068 0.0064  91  GLU A C   
833  O  O   . GLU A 96  ? 0.1746 0.0586 0.1532 0.0389  -0.0373 -0.0059 91  GLU A O   
834  C  CB  A GLU A 96  ? 0.1563 0.0456 0.1797 0.0041  0.0012  0.0167  91  GLU A CB  
835  C  CB  B GLU A 96  ? 0.1710 0.0473 0.1638 0.0066  0.0101  0.0130  91  GLU A CB  
836  C  CG  A GLU A 96  ? 0.1178 0.0265 0.2160 -0.0040 -0.0207 0.0148  91  GLU A CG  
837  C  CG  B GLU A 96  ? 0.1604 0.0743 0.1681 0.0013  0.0158  -0.0209 91  GLU A CG  
838  C  CD  A GLU A 96  ? 0.1829 0.0954 0.2796 -0.0212 0.0009  0.0231  91  GLU A CD  
839  C  CD  B GLU A 96  ? 0.1815 0.0273 0.2221 0.0146  0.0559  -0.0050 91  GLU A CD  
840  O  OE1 A GLU A 96  ? 0.2233 0.1331 0.2119 0.0086  -0.0018 -0.0131 91  GLU A OE1 
841  O  OE1 B GLU A 96  ? 0.2327 0.0976 0.2685 0.0158  0.0441  0.0517  91  GLU A OE1 
842  O  OE2 A GLU A 96  ? 0.2447 0.0257 0.2763 -0.0050 -0.0498 -0.0074 91  GLU A OE2 
843  O  OE2 B GLU A 96  ? 0.1576 0.0276 0.1500 -0.0129 0.0426  0.0027  91  GLU A OE2 
844  N  N   . LEU A 97  ? 0.1456 0.0505 0.1648 0.0307  -0.0069 0.0048  92  LEU A N   
845  C  CA  A LEU A 97  ? 0.1611 0.0607 0.1955 0.0299  -0.0086 0.0059  92  LEU A CA  
846  C  CA  B LEU A 97  ? 0.1661 0.0693 0.1941 0.0375  -0.0060 0.0000  92  LEU A CA  
847  C  C   . LEU A 97  ? 0.1644 0.0610 0.1943 0.0372  0.0007  -0.0063 92  LEU A C   
848  O  O   . LEU A 97  ? 0.1756 0.0657 0.1661 0.0342  -0.0106 -0.0220 92  LEU A O   
849  C  CB  A LEU A 97  ? 0.1630 0.0495 0.1891 0.0303  -0.0220 0.0115  92  LEU A CB  
850  C  CB  B LEU A 97  ? 0.1752 0.0664 0.1849 0.0453  -0.0185 0.0001  92  LEU A CB  
851  C  CG  A LEU A 97  ? 0.1801 0.0782 0.2215 0.0007  -0.0378 0.0178  92  LEU A CG  
852  C  CG  B LEU A 97  ? 0.2044 0.1371 0.2086 0.0539  -0.0214 -0.0228 92  LEU A CG  
853  C  CD1 A LEU A 97  ? 0.2067 0.1124 0.1827 -0.0346 -0.0679 -0.0127 92  LEU A CD1 
854  C  CD1 B LEU A 97  ? 0.2576 0.1283 0.2037 0.1374  0.0053  -0.0353 92  LEU A CD1 
855  C  CD2 A LEU A 97  ? 0.1408 0.0341 0.2095 -0.0041 -0.0383 0.0398  92  LEU A CD2 
856  C  CD2 B LEU A 97  ? 0.2238 0.1746 0.1565 0.0318  -0.0696 -0.0536 92  LEU A CD2 
857  N  N   . GLN A 98  ? 0.1667 0.0747 0.1859 0.0432  0.0229  -0.0079 93  GLN A N   
858  C  CA  . GLN A 98  ? 0.1687 0.1002 0.1681 0.0321  0.0226  -0.0168 93  GLN A CA  
859  C  C   . GLN A 98  ? 0.1804 0.1037 0.1858 0.0421  0.0161  -0.0189 93  GLN A C   
860  O  O   . GLN A 98  ? 0.2060 0.1221 0.1869 0.0469  0.0133  -0.0333 93  GLN A O   
861  C  CB  . GLN A 98  ? 0.1917 0.1259 0.1809 0.0419  0.0244  -0.0318 93  GLN A CB  
862  C  CG  . GLN A 98  ? 0.1896 0.0748 0.1707 0.0476  0.0137  -0.0277 93  GLN A CG  
863  C  CD  . GLN A 98  ? 0.2120 0.0876 0.1476 0.0368  0.0113  -0.0153 93  GLN A CD  
864  O  OE1 . GLN A 98  ? 0.2572 0.0939 0.1739 0.0789  -0.0048 0.0070  93  GLN A OE1 
865  N  NE2 . GLN A 98  ? 0.2385 0.1047 0.1953 0.0764  -0.0104 -0.0141 93  GLN A NE2 
866  N  N   . GLY A 99  ? 0.1675 0.1109 0.1562 0.0479  -0.0061 -0.0132 94  GLY A N   
867  C  CA  . GLY A 99  ? 0.2075 0.0972 0.1700 0.0483  -0.0052 -0.0351 94  GLY A CA  
868  C  C   . GLY A 99  ? 0.1786 0.0841 0.1594 0.0523  0.0024  -0.0184 94  GLY A C   
869  O  O   . GLY A 99  ? 0.1876 0.0573 0.1846 0.0465  0.0138  -0.0342 94  GLY A O   
870  N  N   . VAL A 100 ? 0.1793 0.0440 0.1332 0.0439  0.0229  -0.0039 95  VAL A N   
871  C  CA  . VAL A 100 ? 0.1987 0.0406 0.1542 0.0442  0.0261  -0.0097 95  VAL A CA  
872  C  C   . VAL A 100 ? 0.1707 0.0404 0.1309 0.0457  0.0166  -0.0035 95  VAL A C   
873  O  O   . VAL A 100 ? 0.1717 0.0396 0.1293 0.0316  0.0008  -0.0095 95  VAL A O   
874  C  CB  . VAL A 100 ? 0.1857 0.0419 0.1401 0.0407  0.0381  -0.0160 95  VAL A CB  
875  C  CG1 . VAL A 100 ? 0.1959 0.0838 0.2355 0.0331  0.0833  -0.0362 95  VAL A CG1 
876  C  CG2 . VAL A 100 ? 0.2375 0.0432 0.1128 0.0616  0.0138  0.0039  95  VAL A CG2 
877  N  N   . CYS A 101 ? 0.1701 0.0384 0.1280 0.0394  -0.0063 -0.0174 96  CYS A N   
878  C  CA  . CYS A 101 ? 0.1776 0.0440 0.1384 0.0382  -0.0066 -0.0175 96  CYS A CA  
879  C  C   . CYS A 101 ? 0.1763 0.0608 0.1463 0.0466  0.0154  -0.0019 96  CYS A C   
880  O  O   . CYS A 101 ? 0.1760 0.0508 0.1248 0.0605  0.0095  -0.0068 96  CYS A O   
881  C  CB  . CYS A 101 ? 0.1973 0.0806 0.1347 0.0363  -0.0043 -0.0128 96  CYS A CB  
882  S  SG  . CYS A 101 ? 0.1766 0.0688 0.1828 0.0294  -0.0205 -0.0213 96  CYS A SG  
883  N  N   . ASP A 102 ? 0.1606 0.0629 0.1531 0.0521  0.0160  0.0056  97  ASP A N   
884  C  CA  . ASP A 102 ? 0.1717 0.0914 0.1680 0.0457  0.0299  0.0031  97  ASP A CA  
885  C  C   . ASP A 102 ? 0.1834 0.0728 0.1644 0.0457  0.0273  -0.0003 97  ASP A C   
886  O  O   . ASP A 102 ? 0.1665 0.0774 0.1560 0.0341  0.0280  0.0167  97  ASP A O   
887  C  CB  . ASP A 102 ? 0.2299 0.1153 0.1842 0.0696  0.0408  -0.0215 97  ASP A CB  
888  C  CG  . ASP A 102 ? 0.2142 0.1543 0.2308 0.0665  0.0394  -0.0416 97  ASP A CG  
889  O  OD1 . ASP A 102 ? 0.3121 0.3079 0.2310 0.0536  0.0230  -0.0086 97  ASP A OD1 
890  O  OD2 . ASP A 102 ? 0.2996 0.2195 0.2918 0.0848  0.1100  -0.0871 97  ASP A OD2 
891  N  N   . THR A 103 ? 0.1749 0.0753 0.1436 0.0544  0.0249  -0.0068 98  THR A N   
892  C  CA  . THR A 103 ? 0.1661 0.0741 0.1483 0.0514  0.0106  -0.0037 98  THR A CA  
893  C  C   . THR A 103 ? 0.1317 0.0426 0.1443 0.0340  0.0109  0.0035  98  THR A C   
894  O  O   . THR A 103 ? 0.1402 0.0663 0.1574 0.0307  -0.0183 -0.0280 98  THR A O   
895  C  CB  . THR A 103 ? 0.1704 0.0660 0.1279 0.0752  0.0218  -0.0016 98  THR A CB  
896  O  OG1 . THR A 103 ? 0.2031 0.1394 0.2118 0.1023  -0.0004 0.0332  98  THR A OG1 
897  C  CG2 . THR A 103 ? 0.2104 0.0619 0.1356 0.0228  -0.0400 -0.0046 98  THR A CG2 
898  N  N   . VAL A 104 ? 0.1196 0.0584 0.1316 0.0484  0.0173  0.0149  99  VAL A N   
899  C  CA  . VAL A 104 ? 0.1151 0.0394 0.1450 0.0262  0.0227  0.0147  99  VAL A CA  
900  C  C   . VAL A 104 ? 0.1232 0.0720 0.1316 0.0251  0.0109  0.0098  99  VAL A C   
901  O  O   . VAL A 104 ? 0.1270 0.0940 0.1417 0.0175  0.0013  -0.0003 99  VAL A O   
902  C  CB  . VAL A 104 ? 0.1069 0.0482 0.1233 0.0251  0.0137  0.0182  99  VAL A CB  
903  C  CG1 . VAL A 104 ? 0.1336 0.0505 0.2143 0.0478  0.0528  -0.0024 99  VAL A CG1 
904  C  CG2 . VAL A 104 ? 0.1766 0.0336 0.1144 -0.0195 0.0355  0.0170  99  VAL A CG2 
905  N  N   . LEU A 105 ? 0.1419 0.0713 0.1303 0.0347  0.0200  0.0166  100 LEU A N   
906  C  CA  . LEU A 105 ? 0.1558 0.0892 0.1446 0.0320  0.0193  0.0183  100 LEU A CA  
907  C  C   . LEU A 105 ? 0.1665 0.0909 0.1579 0.0259  0.0057  0.0064  100 LEU A C   
908  O  O   . LEU A 105 ? 0.1772 0.0858 0.1917 0.0176  0.0229  0.0014  100 LEU A O   
909  C  CB  . LEU A 105 ? 0.1786 0.0583 0.1052 0.0292  0.0026  0.0381  100 LEU A CB  
910  C  CG  . LEU A 105 ? 0.1296 0.0533 0.1029 0.0516  0.0160  0.0202  100 LEU A CG  
911  C  CD1 . LEU A 105 ? 0.1890 0.0902 0.1363 0.0457  0.0003  -0.0249 100 LEU A CD1 
912  C  CD2 . LEU A 105 ? 0.1732 0.0732 0.1327 0.0841  -0.0075 -0.0014 100 LEU A CD2 
913  N  N   . GLY A 106 ? 0.1359 0.0990 0.1760 0.0440  -0.0013 -0.0159 101 GLY A N   
914  C  CA  . GLY A 106 ? 0.1504 0.1230 0.1917 0.0239  0.0035  -0.0122 101 GLY A CA  
915  C  C   . GLY A 106 ? 0.1589 0.0953 0.2144 0.0144  -0.0061 -0.0174 101 GLY A C   
916  O  O   . GLY A 106 ? 0.1421 0.1426 0.2289 -0.0031 -0.0092 -0.0363 101 GLY A O   
917  N  N   . LEU A 107 ? 0.1321 0.0608 0.1652 0.0069  -0.0081 -0.0175 102 LEU A N   
918  C  CA  . LEU A 107 ? 0.1354 0.0561 0.1675 0.0210  -0.0070 0.0026  102 LEU A CA  
919  C  C   . LEU A 107 ? 0.1475 0.0526 0.1656 0.0029  -0.0004 0.0200  102 LEU A C   
920  O  O   . LEU A 107 ? 0.1652 0.0763 0.1746 0.0094  -0.0100 0.0323  102 LEU A O   
921  C  CB  . LEU A 107 ? 0.1557 0.0453 0.1704 0.0070  -0.0138 0.0219  102 LEU A CB  
922  C  CG  . LEU A 107 ? 0.1518 0.1117 0.2180 0.0031  -0.0495 0.0202  102 LEU A CG  
923  C  CD1 . LEU A 107 ? 0.1468 0.1554 0.2556 -0.0015 -0.0203 0.0571  102 LEU A CD1 
924  C  CD2 . LEU A 107 ? 0.2231 0.1364 0.2676 0.0669  -0.1455 0.0304  102 LEU A CD2 
925  N  N   . LEU A 108 ? 0.1494 0.0605 0.1524 0.0248  -0.0004 0.0072  103 LEU A N   
926  C  CA  . LEU A 108 ? 0.1665 0.0780 0.1698 0.0097  0.0029  0.0135  103 LEU A CA  
927  C  C   . LEU A 108 ? 0.1701 0.0804 0.1633 -0.0033 0.0143  0.0012  103 LEU A C   
928  O  O   . LEU A 108 ? 0.1947 0.0547 0.1829 0.0295  0.0217  0.0148  103 LEU A O   
929  C  CB  . LEU A 108 ? 0.1324 0.0766 0.1410 0.0135  -0.0104 -0.0026 103 LEU A CB  
930  C  CG  . LEU A 108 ? 0.1569 0.1023 0.1263 -0.0085 0.0044  -0.0267 103 LEU A CG  
931  C  CD1 . LEU A 108 ? 0.2558 0.1130 0.0837 0.0159  -0.0401 -0.0547 103 LEU A CD1 
932  C  CD2 . LEU A 108 ? 0.2107 0.0995 0.1181 0.0260  0.0080  -0.0155 103 LEU A CD2 
933  N  N   . ASP A 109 ? 0.1605 0.1002 0.1861 -0.0038 0.0299  -0.0047 104 ASP A N   
934  C  CA  . ASP A 109 ? 0.2146 0.1300 0.2113 -0.0267 0.0554  -0.0188 104 ASP A CA  
935  C  C   . ASP A 109 ? 0.2221 0.1389 0.2229 -0.0429 0.0542  -0.0261 104 ASP A C   
936  O  O   . ASP A 109 ? 0.2821 0.1619 0.2377 -0.0935 0.0308  -0.0189 104 ASP A O   
937  C  CB  . ASP A 109 ? 0.2249 0.1690 0.2334 -0.0224 0.0742  -0.0081 104 ASP A CB  
938  C  CG  . ASP A 109 ? 0.2717 0.2660 0.3076 -0.0061 0.0779  0.0237  104 ASP A CG  
939  O  OD1 . ASP A 109 ? 0.3657 0.2679 0.4429 0.0352  0.1065  0.0664  104 ASP A OD1 
940  O  OD2 . ASP A 109 ? 0.2823 0.4448 0.3928 0.0194  0.1080  -0.0007 104 ASP A OD2 
941  N  N   . SER A 110 ? 0.2436 0.1681 0.2593 -0.0333 0.0141  -0.0196 105 SER A N   
942  C  CA  . SER A 110 ? 0.2608 0.2127 0.2921 -0.0144 -0.0022 -0.0224 105 SER A CA  
943  C  C   . SER A 110 ? 0.2643 0.2077 0.3008 -0.0222 -0.0120 0.0025  105 SER A C   
944  O  O   . SER A 110 ? 0.2620 0.1770 0.3244 0.0013  -0.0391 0.0266  105 SER A O   
945  C  CB  . SER A 110 ? 0.2826 0.2433 0.2905 0.0001  0.0059  -0.0269 105 SER A CB  
946  O  OG  . SER A 110 ? 0.3021 0.2643 0.3041 -0.0012 -0.0037 -0.0444 105 SER A OG  
947  N  N   . HIS A 111 ? 0.2364 0.1966 0.2854 -0.0059 -0.0104 0.0084  106 HIS A N   
948  C  CA  . HIS A 111 ? 0.2340 0.2062 0.3073 -0.0262 -0.0148 0.0074  106 HIS A CA  
949  C  C   . HIS A 111 ? 0.2470 0.1757 0.2732 -0.0224 0.0075  0.0072  106 HIS A C   
950  O  O   . HIS A 111 ? 0.2793 0.1871 0.2315 -0.0272 0.0097  -0.0094 106 HIS A O   
951  C  CB  . HIS A 111 ? 0.2482 0.2171 0.3068 -0.0362 -0.0117 0.0027  106 HIS A CB  
952  C  CG  . HIS A 111 ? 0.2158 0.2599 0.3629 -0.0095 -0.0288 0.0231  106 HIS A CG  
953  N  ND1 . HIS A 111 ? 0.2635 0.1934 0.3530 -0.0052 -0.0453 0.0020  106 HIS A ND1 
954  C  CD2 . HIS A 111 ? 0.2400 0.3138 0.3961 -0.0033 -0.0494 0.0171  106 HIS A CD2 
955  C  CE1 . HIS A 111 ? 0.1935 0.2907 0.4240 -0.0586 -0.0590 0.0203  106 HIS A CE1 
956  N  NE2 . HIS A 111 ? 0.1572 0.3410 0.4246 -0.0010 -0.0653 0.0177  106 HIS A NE2 
957  N  N   . LEU A 112 ? 0.2272 0.1388 0.2307 -0.0183 0.0104  0.0306  107 LEU A N   
958  C  CA  . LEU A 112 ? 0.2173 0.0930 0.1878 -0.0101 0.0187  0.0265  107 LEU A CA  
959  C  C   . LEU A 112 ? 0.2583 0.0787 0.1813 -0.0107 0.0366  0.0317  107 LEU A C   
960  O  O   . LEU A 112 ? 0.2981 0.0516 0.1960 -0.0176 0.0496  0.0316  107 LEU A O   
961  C  CB  . LEU A 112 ? 0.2126 0.0516 0.1641 -0.0161 0.0005  0.0291  107 LEU A CB  
962  C  CG  . LEU A 112 ? 0.1724 0.0685 0.1091 -0.0297 0.0115  0.0282  107 LEU A CG  
963  C  CD1 . LEU A 112 ? 0.2208 0.0678 0.2500 -0.0279 -0.0397 0.0136  107 LEU A CD1 
964  C  CD2 . LEU A 112 ? 0.1853 0.1901 0.1359 -0.0117 0.0091  0.0247  107 LEU A CD2 
965  N  N   . ILE A 113 ? 0.2435 0.0748 0.1881 -0.0038 0.0290  0.0294  108 ILE A N   
966  C  CA  . ILE A 113 ? 0.2404 0.0648 0.1930 -0.0213 0.0218  0.0243  108 ILE A CA  
967  C  C   . ILE A 113 ? 0.2412 0.0702 0.2055 -0.0214 0.0267  0.0179  108 ILE A C   
968  O  O   . ILE A 113 ? 0.2362 0.0717 0.1935 -0.0160 0.0339  -0.0005 108 ILE A O   
969  C  CB  . ILE A 113 ? 0.2314 0.0545 0.1878 -0.0349 0.0204  0.0202  108 ILE A CB  
970  C  CG1 . ILE A 113 ? 0.1979 0.0390 0.1914 -0.0476 0.0059  0.0074  108 ILE A CG1 
971  C  CG2 . ILE A 113 ? 0.2563 0.0838 0.1924 0.0137  0.0237  0.0353  108 ILE A CG2 
972  C  CD1 . ILE A 113 ? 0.2870 0.0650 0.1959 0.0105  -0.0415 0.0197  108 ILE A CD1 
973  N  N   . LYS A 114 ? 0.2446 0.0873 0.2059 -0.0439 0.0487  0.0187  109 LYS A N   
974  C  CA  . LYS A 114 ? 0.2536 0.1104 0.2423 -0.0342 0.0479  -0.0079 109 LYS A CA  
975  C  C   . LYS A 114 ? 0.2777 0.1286 0.2382 -0.0377 0.0422  0.0038  109 LYS A C   
976  O  O   . LYS A 114 ? 0.3114 0.1311 0.2727 -0.0260 0.0563  0.0201  109 LYS A O   
977  C  CB  . LYS A 114 ? 0.2753 0.1480 0.2754 -0.0301 0.0320  0.0004  109 LYS A CB  
978  C  CG  . LYS A 114 ? 0.2742 0.2151 0.3093 -0.0176 0.0181  0.0065  109 LYS A CG  
979  C  CD  . LYS A 114 ? 0.2941 0.3562 0.3911 -0.0251 0.0519  -0.0300 109 LYS A CD  
980  C  CE  . LYS A 114 ? 0.3458 0.2664 0.4068 -0.0110 0.0223  -0.0468 109 LYS A CE  
981  N  NZ  . LYS A 114 ? 0.3282 0.2117 0.3492 -0.0081 -0.0044 0.0082  109 LYS A NZ  
982  N  N   . GLU A 115 ? 0.2294 0.1261 0.2265 -0.0229 0.0447  0.0112  110 GLU A N   
983  C  CA  A GLU A 115 ? 0.2098 0.1536 0.2319 -0.0225 0.0382  0.0048  110 GLU A CA  
984  C  CA  B GLU A 115 ? 0.2084 0.1538 0.2369 -0.0209 0.0396  0.0059  110 GLU A CA  
985  C  C   . GLU A 115 ? 0.2042 0.1439 0.2400 -0.0015 0.0293  -0.0024 110 GLU A C   
986  O  O   . GLU A 115 ? 0.2272 0.2108 0.2388 -0.0130 0.0228  -0.0082 110 GLU A O   
987  C  CB  A GLU A 115 ? 0.2103 0.1665 0.2519 -0.0112 0.0321  0.0060  110 GLU A CB  
988  C  CB  B GLU A 115 ? 0.2016 0.1667 0.2427 -0.0163 0.0409  0.0132  110 GLU A CB  
989  C  CG  A GLU A 115 ? 0.1554 0.1583 0.2698 -0.0482 0.0409  -0.0116 110 GLU A CG  
990  C  CG  B GLU A 115 ? 0.1680 0.1635 0.3177 -0.0441 0.0534  -0.0041 110 GLU A CG  
991  C  CD  A GLU A 115 ? 0.1816 0.1664 0.3096 -0.0488 0.0298  -0.0172 110 GLU A CD  
992  C  CD  B GLU A 115 ? 0.1967 0.1838 0.3645 -0.0503 0.0565  -0.0033 110 GLU A CD  
993  O  OE1 A GLU A 115 ? 0.1341 0.2228 0.2452 -0.0746 0.0130  -0.0507 110 GLU A OE1 
994  O  OE1 B GLU A 115 ? 0.2228 0.2026 0.3739 -0.0245 0.1155  -0.0069 110 GLU A OE1 
995  O  OE2 A GLU A 115 ? 0.1931 0.1737 0.3706 -0.0436 0.0259  -0.0472 110 GLU A OE2 
996  O  OE2 B GLU A 115 ? 0.1832 0.1739 0.3953 -0.0369 0.0840  -0.0310 110 GLU A OE2 
997  N  N   . ALA A 116 ? 0.1816 0.1121 0.2135 -0.0221 0.0367  0.0000  111 ALA A N   
998  C  CA  . ALA A 116 ? 0.1971 0.1076 0.2412 -0.0166 0.0232  -0.0055 111 ALA A CA  
999  C  C   . ALA A 116 ? 0.2143 0.1440 0.2560 -0.0070 0.0299  0.0084  111 ALA A C   
1000 O  O   . ALA A 116 ? 0.2172 0.1591 0.2395 0.0036  0.0086  0.0088  111 ALA A O   
1001 C  CB  . ALA A 116 ? 0.1673 0.1084 0.2513 -0.0522 0.0186  -0.0043 111 ALA A CB  
1002 N  N   . GLY A 117 ? 0.2159 0.1274 0.2624 -0.0041 0.0424  0.0117  112 GLY A N   
1003 C  CA  . GLY A 117 ? 0.2384 0.1261 0.2660 0.0212  0.0208  0.0375  112 GLY A CA  
1004 C  C   . GLY A 117 ? 0.2539 0.1186 0.2432 0.0437  0.0210  0.0366  112 GLY A C   
1005 O  O   . GLY A 117 ? 0.2992 0.1621 0.3135 0.0526  0.0181  0.0772  112 GLY A O   
1006 N  N   . ASP A 118 ? 0.2425 0.0791 0.2135 0.0423  0.0191  0.0093  113 ASP A N   
1007 C  CA  . ASP A 118 ? 0.2432 0.0888 0.1832 0.0459  0.0142  0.0041  113 ASP A CA  
1008 C  C   . ASP A 118 ? 0.2174 0.1036 0.1719 0.0660  -0.0028 -0.0092 113 ASP A C   
1009 O  O   . ASP A 118 ? 0.2095 0.1005 0.1758 0.0547  0.0106  -0.0095 113 ASP A O   
1010 C  CB  . ASP A 118 ? 0.2652 0.0938 0.1463 0.0408  0.0344  -0.0150 113 ASP A CB  
1011 C  CG  . ASP A 118 ? 0.2938 0.0647 0.1684 0.0127  0.0339  0.0144  113 ASP A CG  
1012 O  OD1 . ASP A 118 ? 0.3394 0.0636 0.2172 0.0153  0.0271  -0.0109 113 ASP A OD1 
1013 O  OD2 . ASP A 118 ? 0.2330 0.1146 0.1741 0.0937  0.0254  0.0143  113 ASP A OD2 
1014 N  N   . ALA A 119 ? 0.2145 0.1254 0.1914 0.0740  -0.0205 -0.0089 114 ALA A N   
1015 C  CA  . ALA A 119 ? 0.2196 0.1632 0.2264 0.0903  -0.0431 -0.0096 114 ALA A CA  
1016 C  C   . ALA A 119 ? 0.2212 0.1407 0.2413 0.0949  -0.0403 -0.0535 114 ALA A C   
1017 O  O   . ALA A 119 ? 0.2157 0.1728 0.2687 0.1300  -0.0487 -0.0784 114 ALA A O   
1018 C  CB  . ALA A 119 ? 0.2122 0.1946 0.2474 0.1088  -0.0449 -0.0054 114 ALA A CB  
1019 N  N   . GLU A 120 ? 0.1923 0.1260 0.2291 0.0720  -0.0089 -0.0483 115 GLU A N   
1020 C  CA  A GLU A 120 ? 0.2183 0.1299 0.2455 0.0606  -0.0021 -0.0664 115 GLU A CA  
1021 C  CA  B GLU A 120 ? 0.2215 0.1397 0.2446 0.0569  -0.0077 -0.0682 115 GLU A CA  
1022 C  C   . GLU A 120 ? 0.2095 0.1081 0.2382 0.0454  -0.0057 -0.0658 115 GLU A C   
1023 O  O   . GLU A 120 ? 0.2137 0.1561 0.2805 0.0459  0.0150  -0.0941 115 GLU A O   
1024 C  CB  A GLU A 120 ? 0.2217 0.1428 0.2650 0.0662  0.0139  -0.0613 115 GLU A CB  
1025 C  CB  B GLU A 120 ? 0.2371 0.1597 0.2595 0.0602  0.0008  -0.0660 115 GLU A CB  
1026 C  CG  A GLU A 120 ? 0.2434 0.1229 0.3108 0.0644  -0.0246 -0.0805 115 GLU A CG  
1027 C  CG  B GLU A 120 ? 0.2743 0.2221 0.3037 0.0434  -0.0416 -0.1010 115 GLU A CG  
1028 C  CD  A GLU A 120 ? 0.2301 0.1504 0.3171 0.0814  -0.0058 -0.0501 115 GLU A CD  
1029 C  CD  B GLU A 120 ? 0.3572 0.2694 0.3060 0.0508  -0.0339 -0.1182 115 GLU A CD  
1030 O  OE1 A GLU A 120 ? 0.1868 0.1122 0.2102 0.0720  -0.0031 -0.1020 115 GLU A OE1 
1031 O  OE1 B GLU A 120 ? 0.3973 0.1645 0.2938 0.0224  -0.0370 -0.1933 115 GLU A OE1 
1032 O  OE2 A GLU A 120 ? 0.2398 0.2467 0.3478 0.0831  -0.0134 -0.0276 115 GLU A OE2 
1033 O  OE2 B GLU A 120 ? 0.4257 0.3026 0.3668 0.0680  -0.0275 -0.1545 115 GLU A OE2 
1034 N  N   . SER A 121 ? 0.2053 0.0846 0.1966 0.0283  0.0063  -0.0407 116 SER A N   
1035 C  CA  . SER A 121 ? 0.1705 0.0301 0.1608 0.0057  -0.0020 -0.0118 116 SER A CA  
1036 C  C   . SER A 121 ? 0.1801 0.0378 0.1709 0.0122  -0.0042 -0.0124 116 SER A C   
1037 O  O   . SER A 121 ? 0.1702 0.0524 0.1943 0.0247  -0.0276 -0.0201 116 SER A O   
1038 C  CB  . SER A 121 ? 0.2175 0.0274 0.1992 -0.0196 -0.0183 0.0051  116 SER A CB  
1039 O  OG  . SER A 121 ? 0.2283 0.1300 0.1654 -0.0231 0.0075  0.0295  116 SER A OG  
1040 N  N   . ARG A 122 ? 0.1686 0.0386 0.1467 0.0270  0.0043  0.0037  117 ARG A N   
1041 C  CA  A ARG A 122 ? 0.1874 0.0341 0.1588 0.0102  -0.0071 0.0101  117 ARG A CA  
1042 C  CA  B ARG A 122 ? 0.1849 0.0417 0.1666 0.0166  -0.0069 0.0112  117 ARG A CA  
1043 C  C   . ARG A 122 ? 0.1698 0.0290 0.1693 0.0183  -0.0027 0.0132  117 ARG A C   
1044 O  O   . ARG A 122 ? 0.1839 0.0325 0.1481 0.0065  0.0098  -0.0157 117 ARG A O   
1045 C  CB  A ARG A 122 ? 0.2008 0.0395 0.1785 0.0028  0.0099  0.0172  117 ARG A CB  
1046 C  CB  B ARG A 122 ? 0.2035 0.0610 0.1881 0.0087  -0.0015 0.0268  117 ARG A CB  
1047 C  CG  A ARG A 122 ? 0.2261 0.1029 0.1494 -0.0246 -0.0001 0.0175  117 ARG A CG  
1048 C  CG  B ARG A 122 ? 0.2237 0.1165 0.2196 0.0195  -0.0198 0.0350  117 ARG A CG  
1049 C  CD  A ARG A 122 ? 0.2619 0.1010 0.2105 -0.0163 0.0558  0.0297  117 ARG A CD  
1050 C  CD  B ARG A 122 ? 0.3107 0.1867 0.3216 -0.0409 -0.0064 0.0506  117 ARG A CD  
1051 N  NE  A ARG A 122 ? 0.2369 0.1948 0.2178 0.0066  0.0764  0.0306  117 ARG A NE  
1052 N  NE  B ARG A 122 ? 0.3446 0.2628 0.3653 -0.0351 0.0233  0.0178  117 ARG A NE  
1053 C  CZ  A ARG A 122 ? 0.2532 0.1284 0.2198 0.0576  0.1156  0.0315  117 ARG A CZ  
1054 C  CZ  B ARG A 122 ? 0.3503 0.2696 0.3802 -0.0566 0.0162  0.0209  117 ARG A CZ  
1055 N  NH1 A ARG A 122 ? 0.2025 0.1346 0.2321 0.1244  0.0855  0.0668  117 ARG A NH1 
1056 N  NH1 B ARG A 122 ? 0.3166 0.3044 0.3700 -0.0793 0.0006  0.0281  117 ARG A NH1 
1057 N  NH2 A ARG A 122 ? 0.2584 0.0921 0.2694 0.0177  0.1622  0.0847  117 ARG A NH2 
1058 N  NH2 B ARG A 122 ? 0.3616 0.2899 0.4398 -0.0396 0.0149  0.0031  117 ARG A NH2 
1059 N  N   . VAL A 123 ? 0.1605 0.0290 0.1635 0.0204  0.0043  0.0094  118 VAL A N   
1060 C  CA  . VAL A 123 ? 0.1201 0.0327 0.1766 0.0229  -0.0132 0.0133  118 VAL A CA  
1061 C  C   . VAL A 123 ? 0.1497 0.0356 0.1313 0.0299  -0.0090 0.0159  118 VAL A C   
1062 O  O   . VAL A 123 ? 0.1688 0.0381 0.1264 0.0406  -0.0214 0.0049  118 VAL A O   
1063 C  CB  . VAL A 123 ? 0.1323 0.0313 0.1910 0.0240  -0.0214 0.0054  118 VAL A CB  
1064 C  CG1 . VAL A 123 ? 0.1196 0.0408 0.1653 0.0382  -0.0290 -0.0096 118 VAL A CG1 
1065 C  CG2 . VAL A 123 ? 0.1542 0.0335 0.1809 0.0136  -0.0052 0.0319  118 VAL A CG2 
1066 N  N   . PHE A 124 ? 0.1362 0.0505 0.1332 0.0262  -0.0042 0.0268  119 PHE A N   
1067 C  CA  A PHE A 124 ? 0.1396 0.0397 0.1134 0.0297  0.0001  0.0242  119 PHE A CA  
1068 C  CA  B PHE A 124 ? 0.1396 0.0379 0.1192 0.0243  -0.0057 0.0238  119 PHE A CA  
1069 C  C   . PHE A 124 ? 0.1234 0.0423 0.1157 0.0136  -0.0130 0.0160  119 PHE A C   
1070 O  O   . PHE A 124 ? 0.1510 0.0404 0.1209 -0.0013 -0.0337 0.0365  119 PHE A O   
1071 C  CB  A PHE A 124 ? 0.1273 0.0366 0.1012 0.0270  -0.0130 0.0140  119 PHE A CB  
1072 C  CB  B PHE A 124 ? 0.1317 0.0349 0.1134 0.0241  -0.0082 0.0171  119 PHE A CB  
1073 C  CG  A PHE A 124 ? 0.1104 0.0528 0.1250 0.0312  0.0223  0.0252  119 PHE A CG  
1074 C  CG  B PHE A 124 ? 0.1564 0.0551 0.1172 0.0236  0.0083  0.0268  119 PHE A CG  
1075 C  CD1 A PHE A 124 ? 0.1130 0.0464 0.1330 0.0362  -0.0167 0.0184  119 PHE A CD1 
1076 C  CD1 B PHE A 124 ? 0.1611 0.0335 0.1319 0.0289  0.0190  0.0187  119 PHE A CD1 
1077 C  CD2 A PHE A 124 ? 0.1407 0.0307 0.1364 0.0211  -0.0038 0.0123  119 PHE A CD2 
1078 C  CD2 B PHE A 124 ? 0.1308 0.0426 0.0855 0.0379  0.0122  0.0191  119 PHE A CD2 
1079 C  CE1 A PHE A 124 ? 0.1284 0.0544 0.0899 -0.0080 0.0331  0.0365  119 PHE A CE1 
1080 C  CE1 B PHE A 124 ? 0.1817 0.0514 0.1091 0.0219  0.0041  0.0226  119 PHE A CE1 
1081 C  CE2 A PHE A 124 ? 0.1307 0.0706 0.1457 0.0344  -0.0058 0.0017  119 PHE A CE2 
1082 C  CE2 B PHE A 124 ? 0.1723 0.0465 0.0608 0.0170  0.0098  0.0146  119 PHE A CE2 
1083 C  CZ  A PHE A 124 ? 0.0896 0.0722 0.0646 0.0528  0.0021  -0.0099 119 PHE A CZ  
1084 C  CZ  B PHE A 124 ? 0.1761 0.0339 0.0851 0.0156  -0.0080 0.0195  119 PHE A CZ  
1085 N  N   . TYR A 125 ? 0.1211 0.0380 0.1218 0.0173  -0.0117 0.0197  120 TYR A N   
1086 C  CA  . TYR A 125 ? 0.1022 0.0448 0.1186 0.0175  -0.0143 0.0206  120 TYR A CA  
1087 C  C   . TYR A 125 ? 0.1282 0.0436 0.1279 0.0127  -0.0042 0.0228  120 TYR A C   
1088 O  O   . TYR A 125 ? 0.1422 0.0359 0.1494 0.0313  0.0075  0.0186  120 TYR A O   
1089 C  CB  . TYR A 125 ? 0.0964 0.0495 0.1121 0.0094  -0.0292 0.0144  120 TYR A CB  
1090 C  CG  . TYR A 125 ? 0.0984 0.0367 0.0752 -0.0073 -0.0196 0.0238  120 TYR A CG  
1091 C  CD1 . TYR A 125 ? 0.0964 0.1031 0.0683 0.0139  -0.0078 0.0547  120 TYR A CD1 
1092 C  CD2 . TYR A 125 ? 0.1273 0.0327 0.0883 0.0071  -0.0619 -0.0048 120 TYR A CD2 
1093 C  CE1 . TYR A 125 ? 0.1186 0.1092 0.0746 -0.0235 -0.0524 -0.0228 120 TYR A CE1 
1094 C  CE2 . TYR A 125 ? 0.1152 0.0326 0.0896 0.0108  -0.0379 0.0125  120 TYR A CE2 
1095 C  CZ  . TYR A 125 ? 0.1378 0.0664 0.1196 -0.0137 -0.0039 0.0027  120 TYR A CZ  
1096 O  OH  . TYR A 125 ? 0.2091 0.0776 0.1607 0.0405  -0.0501 0.0147  120 TYR A OH  
1097 N  N   . LEU A 126 ? 0.1279 0.0559 0.1255 0.0290  -0.0023 0.0245  121 LEU A N   
1098 C  CA  . LEU A 126 ? 0.1318 0.0394 0.1280 0.0107  0.0092  0.0286  121 LEU A CA  
1099 C  C   . LEU A 126 ? 0.1331 0.0537 0.1310 0.0086  0.0086  0.0201  121 LEU A C   
1100 O  O   . LEU A 126 ? 0.1551 0.0516 0.1435 0.0106  0.0115  0.0313  121 LEU A O   
1101 C  CB  . LEU A 126 ? 0.1180 0.0354 0.1207 0.0120  0.0087  0.0296  121 LEU A CB  
1102 C  CG  . LEU A 126 ? 0.1025 0.0529 0.1979 0.0458  0.0564  0.0267  121 LEU A CG  
1103 C  CD1 . LEU A 126 ? 0.2358 0.0388 0.1644 0.0335  -0.0214 0.0299  121 LEU A CD1 
1104 C  CD2 . LEU A 126 ? 0.1045 0.0988 0.1994 0.0258  0.0806  0.0369  121 LEU A CD2 
1105 N  N   . LYS A 127 ? 0.1195 0.0446 0.1069 0.0115  -0.0016 0.0196  122 LYS A N   
1106 C  CA  . LYS A 127 ? 0.1087 0.0346 0.1171 0.0198  0.0093  0.0227  122 LYS A CA  
1107 C  C   . LYS A 127 ? 0.1411 0.0597 0.1023 0.0237  0.0042  0.0246  122 LYS A C   
1108 O  O   . LYS A 127 ? 0.1576 0.0285 0.0971 0.0145  0.0275  -0.0073 122 LYS A O   
1109 C  CB  . LYS A 127 ? 0.1243 0.0260 0.1266 -0.0015 0.0068  0.0084  122 LYS A CB  
1110 C  CG  . LYS A 127 ? 0.0939 0.0471 0.1359 -0.0374 0.0299  -0.0051 122 LYS A CG  
1111 C  CD  . LYS A 127 ? 0.1152 0.0431 0.1496 -0.0028 0.0220  0.0452  122 LYS A CD  
1112 C  CE  . LYS A 127 ? 0.2101 0.0543 0.1390 -0.0303 -0.0415 0.0556  122 LYS A CE  
1113 N  NZ  . LYS A 127 ? 0.2018 0.0293 0.1399 0.0123  0.0066  0.0194  122 LYS A NZ  
1114 N  N   . MET A 128 ? 0.1514 0.0656 0.1034 0.0335  0.0176  0.0534  123 MET A N   
1115 C  CA  . MET A 128 ? 0.1523 0.0543 0.0925 0.0411  0.0096  0.0314  123 MET A CA  
1116 C  C   . MET A 128 ? 0.1613 0.0476 0.1116 0.0210  0.0083  0.0323  123 MET A C   
1117 O  O   . MET A 128 ? 0.1680 0.0697 0.0897 0.0386  0.0198  -0.0009 123 MET A O   
1118 C  CB  . MET A 128 ? 0.1544 0.0688 0.0820 0.0239  0.0043  0.0478  123 MET A CB  
1119 C  CG  . MET A 128 ? 0.1309 0.1137 0.0882 0.0393  0.0207  0.0111  123 MET A CG  
1120 S  SD  . MET A 128 ? 0.1841 0.0664 0.1293 0.0256  0.0092  0.0081  123 MET A SD  
1121 C  CE  . MET A 128 ? 0.1857 0.0754 0.0997 0.0811  -0.0043 -0.0121 123 MET A CE  
1122 N  N   . LYS A 129 ? 0.1552 0.0404 0.1164 0.0022  0.0136  0.0370  124 LYS A N   
1123 C  CA  . LYS A 129 ? 0.1586 0.0383 0.0998 -0.0158 -0.0020 0.0196  124 LYS A CA  
1124 C  C   . LYS A 129 ? 0.1651 0.0441 0.1055 0.0072  -0.0143 0.0207  124 LYS A C   
1125 O  O   . LYS A 129 ? 0.1404 0.0453 0.1095 -0.0130 -0.0206 0.0043  124 LYS A O   
1126 C  CB  . LYS A 129 ? 0.1652 0.0484 0.1021 -0.0243 0.0144  0.0352  124 LYS A CB  
1127 C  CG  . LYS A 129 ? 0.1962 0.0528 0.1432 -0.0402 0.0374  0.0356  124 LYS A CG  
1128 C  CD  . LYS A 129 ? 0.2034 0.0980 0.1577 -0.0609 0.0293  0.0713  124 LYS A CD  
1129 C  CE  . LYS A 129 ? 0.2450 0.1434 0.1799 -0.0749 0.0793  0.0736  124 LYS A CE  
1130 N  NZ  . LYS A 129 ? 0.2316 0.2283 0.2595 -0.0712 0.0237  0.0716  124 LYS A NZ  
1131 N  N   . GLY A 130 ? 0.1188 0.0458 0.0901 0.0065  -0.0069 0.0237  125 GLY A N   
1132 C  CA  . GLY A 130 ? 0.1359 0.0264 0.1091 0.0028  -0.0294 0.0083  125 GLY A CA  
1133 C  C   . GLY A 130 ? 0.1509 0.0412 0.1184 0.0091  -0.0095 0.0075  125 GLY A C   
1134 O  O   . GLY A 130 ? 0.1556 0.0519 0.1275 0.0066  -0.0405 -0.0097 125 GLY A O   
1135 N  N   . ASP A 131 ? 0.1572 0.0309 0.1056 0.0127  -0.0207 0.0163  126 ASP A N   
1136 C  CA  . ASP A 131 ? 0.1364 0.0370 0.0975 0.0335  0.0159  0.0152  126 ASP A CA  
1137 C  C   . ASP A 131 ? 0.1230 0.0442 0.1206 0.0429  -0.0067 -0.0029 126 ASP A C   
1138 O  O   . ASP A 131 ? 0.1302 0.0434 0.1188 0.0402  -0.0288 0.0035  126 ASP A O   
1139 C  CB  . ASP A 131 ? 0.1270 0.0535 0.0624 0.0500  0.0064  0.0145  126 ASP A CB  
1140 C  CG  . ASP A 131 ? 0.1495 0.0587 0.0881 0.0355  0.0122  -0.0008 126 ASP A CG  
1141 O  OD1 . ASP A 131 ? 0.1976 0.0464 0.1596 0.0290  -0.0163 -0.0013 126 ASP A OD1 
1142 O  OD2 . ASP A 131 ? 0.1718 0.1012 0.1016 -0.0024 0.0269  0.0081  126 ASP A OD2 
1143 N  N   . TYR A 132 ? 0.1267 0.0523 0.1297 0.0520  0.0111  -0.0002 127 TYR A N   
1144 C  CA  . TYR A 132 ? 0.1336 0.0617 0.1128 0.0475  0.0134  -0.0016 127 TYR A CA  
1145 C  C   . TYR A 132 ? 0.1782 0.0592 0.1142 0.0475  0.0155  0.0081  127 TYR A C   
1146 O  O   . TYR A 132 ? 0.1985 0.0470 0.1278 0.0584  -0.0114 -0.0160 127 TYR A O   
1147 C  CB  . TYR A 132 ? 0.1246 0.0552 0.1088 0.0337  0.0012  0.0124  127 TYR A CB  
1148 C  CG  . TYR A 132 ? 0.1157 0.0373 0.1489 0.0272  0.0166  0.0184  127 TYR A CG  
1149 C  CD1 . TYR A 132 ? 0.1278 0.0568 0.0958 0.0000  0.0106  -0.0004 127 TYR A CD1 
1150 C  CD2 . TYR A 132 ? 0.1130 0.0573 0.1446 0.0020  -0.0073 0.0614  127 TYR A CD2 
1151 C  CE1 . TYR A 132 ? 0.1480 0.0592 0.1250 0.0349  -0.0258 0.0402  127 TYR A CE1 
1152 C  CE2 . TYR A 132 ? 0.0853 0.0836 0.1534 0.0063  0.0187  0.0447  127 TYR A CE2 
1153 C  CZ  . TYR A 132 ? 0.1409 0.0553 0.0949 0.0077  -0.0165 0.0434  127 TYR A CZ  
1154 O  OH  . TYR A 132 ? 0.1489 0.0687 0.1456 0.0043  0.0009  0.0342  127 TYR A OH  
1155 N  N   . TYR A 133 ? 0.1818 0.0653 0.1044 0.0409  0.0053  0.0187  128 TYR A N   
1156 C  CA  . TYR A 133 ? 0.1850 0.0712 0.0976 0.0266  0.0206  0.0213  128 TYR A CA  
1157 C  C   . TYR A 133 ? 0.1822 0.0853 0.1241 0.0157  0.0165  0.0106  128 TYR A C   
1158 O  O   . TYR A 133 ? 0.1974 0.0970 0.1114 0.0207  0.0176  0.0154  128 TYR A O   
1159 C  CB  . TYR A 133 ? 0.1779 0.0418 0.1130 0.0345  0.0213  0.0276  128 TYR A CB  
1160 C  CG  . TYR A 133 ? 0.1613 0.0769 0.1250 0.0402  0.0505  -0.0224 128 TYR A CG  
1161 C  CD1 . TYR A 133 ? 0.1763 0.0940 0.1323 0.0470  0.0598  0.0090  128 TYR A CD1 
1162 C  CD2 . TYR A 133 ? 0.1698 0.1408 0.1449 0.0443  0.0104  -0.0353 128 TYR A CD2 
1163 C  CE1 . TYR A 133 ? 0.2472 0.1236 0.2251 -0.0096 0.0054  0.0006  128 TYR A CE1 
1164 C  CE2 . TYR A 133 ? 0.1799 0.1611 0.1496 0.0014  0.0059  -0.0173 128 TYR A CE2 
1165 C  CZ  . TYR A 133 ? 0.1830 0.1598 0.1527 0.0208  -0.0016 -0.0043 128 TYR A CZ  
1166 O  OH  . TYR A 133 ? 0.1879 0.2090 0.2186 -0.0060 0.0347  0.0084  128 TYR A OH  
1167 N  N   . ARG A 134 ? 0.1677 0.0724 0.1429 0.0192  -0.0134 0.0022  129 ARG A N   
1168 C  CA  . ARG A 134 ? 0.1683 0.0502 0.1328 0.0282  -0.0313 0.0181  129 ARG A CA  
1169 C  C   . ARG A 134 ? 0.1885 0.0483 0.1188 0.0177  -0.0199 -0.0003 129 ARG A C   
1170 O  O   . ARG A 134 ? 0.1982 0.0546 0.1318 0.0133  -0.0076 0.0056  129 ARG A O   
1171 C  CB  . ARG A 134 ? 0.1609 0.0804 0.1361 0.0276  -0.0373 -0.0037 129 ARG A CB  
1172 C  CG  . ARG A 134 ? 0.1420 0.0586 0.1631 0.0291  -0.0709 -0.0116 129 ARG A CG  
1173 C  CD  . ARG A 134 ? 0.1300 0.0835 0.0804 0.0609  -0.0230 -0.0066 129 ARG A CD  
1174 N  NE  . ARG A 134 ? 0.1795 0.0685 0.0812 0.0127  -0.0111 0.0473  129 ARG A NE  
1175 C  CZ  . ARG A 134 ? 0.1656 0.0699 0.0778 0.0280  -0.0393 0.0230  129 ARG A CZ  
1176 N  NH1 . ARG A 134 ? 0.1841 0.0378 0.1705 0.0094  -0.0253 0.0395  129 ARG A NH1 
1177 N  NH2 . ARG A 134 ? 0.1719 0.0432 0.1276 0.0470  -0.0461 -0.0303 129 ARG A NH2 
1178 N  N   . TYR A 135 ? 0.1600 0.0395 0.1338 0.0245  -0.0350 0.0240  130 TYR A N   
1179 C  CA  . TYR A 135 ? 0.1779 0.0371 0.1021 0.0383  -0.0175 0.0084  130 TYR A CA  
1180 C  C   . TYR A 135 ? 0.1898 0.0490 0.1155 0.0417  -0.0263 -0.0040 130 TYR A C   
1181 O  O   . TYR A 135 ? 0.2259 0.0395 0.1197 0.0442  -0.0245 -0.0191 130 TYR A O   
1182 C  CB  . TYR A 135 ? 0.1966 0.0685 0.1072 0.0517  -0.0162 0.0206  130 TYR A CB  
1183 C  CG  . TYR A 135 ? 0.1933 0.0299 0.1437 0.0235  -0.0245 0.0088  130 TYR A CG  
1184 C  CD1 . TYR A 135 ? 0.2029 0.0468 0.1257 0.0197  -0.0333 -0.0152 130 TYR A CD1 
1185 C  CD2 . TYR A 135 ? 0.2369 0.0721 0.1215 0.0361  0.0228  0.0070  130 TYR A CD2 
1186 C  CE1 . TYR A 135 ? 0.1706 0.0707 0.1634 0.0307  -0.0015 0.0112  130 TYR A CE1 
1187 C  CE2 . TYR A 135 ? 0.1350 0.0713 0.2254 0.0186  -0.0195 -0.0085 130 TYR A CE2 
1188 C  CZ  . TYR A 135 ? 0.1472 0.0493 0.1848 0.0205  0.0052  0.0131  130 TYR A CZ  
1189 O  OH  . TYR A 135 ? 0.1763 0.1099 0.2064 0.0793  0.0210  -0.0214 130 TYR A OH  
1190 N  N   . LEU A 136 ? 0.1687 0.0539 0.1191 0.0434  -0.0013 -0.0034 131 LEU A N   
1191 C  CA  . LEU A 136 ? 0.1996 0.0879 0.1167 0.0463  -0.0110 -0.0240 131 LEU A CA  
1192 C  C   . LEU A 136 ? 0.2260 0.0690 0.1064 0.0670  -0.0085 0.0031  131 LEU A C   
1193 O  O   . LEU A 136 ? 0.2648 0.0699 0.1165 0.0865  0.0121  -0.0009 131 LEU A O   
1194 C  CB  . LEU A 136 ? 0.2079 0.0665 0.1158 0.0276  -0.0156 0.0081  131 LEU A CB  
1195 C  CG  . LEU A 136 ? 0.2037 0.0528 0.1401 0.0659  -0.0444 -0.0115 131 LEU A CG  
1196 C  CD1 . LEU A 136 ? 0.2187 0.0375 0.1795 0.0433  -0.0516 -0.0303 131 LEU A CD1 
1197 C  CD2 . LEU A 136 ? 0.2236 0.0776 0.1551 0.0982  -0.0153 0.0141  131 LEU A CD2 
1198 N  N   . ALA A 137 ? 0.2063 0.0892 0.1093 0.0701  -0.0233 0.0146  132 ALA A N   
1199 C  CA  . ALA A 137 ? 0.2507 0.0577 0.1261 0.0612  -0.0307 0.0078  132 ALA A CA  
1200 C  C   . ALA A 137 ? 0.2587 0.0576 0.1307 0.0612  -0.0253 -0.0137 132 ALA A C   
1201 O  O   . ALA A 137 ? 0.2879 0.0698 0.1274 0.0411  -0.0336 -0.0274 132 ALA A O   
1202 C  CB  . ALA A 137 ? 0.2659 0.0685 0.1301 0.0811  -0.0271 0.0087  132 ALA A CB  
1203 N  N   . GLU A 138 ? 0.2613 0.0642 0.1496 0.0458  -0.0198 -0.0166 133 GLU A N   
1204 C  CA  . GLU A 138 ? 0.2578 0.0623 0.1527 0.0382  -0.0051 -0.0169 133 GLU A CA  
1205 C  C   . GLU A 138 ? 0.2628 0.0847 0.1559 0.0385  -0.0172 -0.0294 133 GLU A C   
1206 O  O   . GLU A 138 ? 0.2774 0.0513 0.1964 0.0163  -0.0424 -0.0361 133 GLU A O   
1207 C  CB  . GLU A 138 ? 0.2086 0.0947 0.1429 0.0344  -0.0009 -0.0226 133 GLU A CB  
1208 C  CG  . GLU A 138 ? 0.2162 0.0458 0.1263 0.0324  0.0033  -0.0182 133 GLU A CG  
1209 C  CD  . GLU A 138 ? 0.1743 0.0376 0.1396 0.0303  0.0061  0.0272  133 GLU A CD  
1210 O  OE1 . GLU A 138 ? 0.2162 0.1164 0.1729 0.0606  -0.0226 0.0181  133 GLU A OE1 
1211 O  OE2 . GLU A 138 ? 0.2326 0.1380 0.2016 0.0959  0.0200  0.0571  133 GLU A OE2 
1212 N  N   . VAL A 139 ? 0.2400 0.0630 0.1490 0.0583  -0.0104 -0.0097 134 VAL A N   
1213 C  CA  . VAL A 139 ? 0.2692 0.0841 0.1649 0.0684  0.0120  -0.0086 134 VAL A CA  
1214 C  C   . VAL A 139 ? 0.2879 0.0741 0.1858 0.0724  0.0244  -0.0026 134 VAL A C   
1215 O  O   . VAL A 139 ? 0.2826 0.0923 0.2122 0.0928  0.0455  -0.0175 134 VAL A O   
1216 C  CB  . VAL A 139 ? 0.2430 0.0498 0.1525 0.0529  -0.0047 0.0068  134 VAL A CB  
1217 C  CG1 . VAL A 139 ? 0.2328 0.1031 0.1368 0.0303  0.0111  -0.0258 134 VAL A CG1 
1218 C  CG2 . VAL A 139 ? 0.2630 0.0643 0.1891 0.0384  -0.0012 0.0148  134 VAL A CG2 
1219 N  N   . ALA A 140 ? 0.3191 0.0961 0.1966 0.0809  0.0220  -0.0147 135 ALA A N   
1220 C  CA  . ALA A 140 ? 0.3819 0.1154 0.1904 0.0777  0.0243  -0.0097 135 ALA A CA  
1221 C  C   . ALA A 140 ? 0.4305 0.1520 0.2200 0.0893  0.0239  -0.0192 135 ALA A C   
1222 O  O   . ALA A 140 ? 0.4738 0.1559 0.1910 0.0832  0.0057  -0.0333 135 ALA A O   
1223 C  CB  . ALA A 140 ? 0.3615 0.1108 0.2182 0.0539  0.0195  0.0020  135 ALA A CB  
1224 N  N   . THR A 141 ? 0.4997 0.2369 0.2174 0.0912  0.0566  -0.0129 136 THR A N   
1225 C  CA  . THR A 141 ? 0.5684 0.3121 0.3064 0.0977  0.0626  -0.0284 136 THR A CA  
1226 C  C   . THR A 141 ? 0.5923 0.3602 0.3237 0.1069  0.0819  -0.0365 136 THR A C   
1227 O  O   . THR A 141 ? 0.6478 0.3897 0.3571 0.1125  0.0742  -0.0682 136 THR A O   
1228 C  CB  . THR A 141 ? 0.5611 0.3129 0.3154 0.1040  0.0649  -0.0265 136 THR A CB  
1229 O  OG1 . THR A 141 ? 0.5597 0.2783 0.3011 0.1342  0.0721  0.0070  136 THR A OG1 
1230 C  CG2 . THR A 141 ? 0.5943 0.3179 0.3315 0.0969  0.0618  -0.0237 136 THR A CG2 
1231 N  N   . GLY A 142 ? 0.6022 0.3916 0.3494 0.1164  0.0867  -0.0417 137 GLY A N   
1232 C  CA  . GLY A 142 ? 0.6037 0.3988 0.3958 0.1229  0.1046  -0.0327 137 GLY A CA  
1233 C  C   . GLY A 142 ? 0.6097 0.4200 0.4109 0.1308  0.1014  -0.0326 137 GLY A C   
1234 O  O   . GLY A 142 ? 0.6085 0.4026 0.4096 0.1425  0.1134  -0.0511 137 GLY A O   
1235 N  N   . ASP A 143 ? 0.6043 0.4316 0.4154 0.1308  0.1078  -0.0318 138 ASP A N   
1236 C  CA  . ASP A 143 ? 0.6116 0.4534 0.4257 0.1356  0.0964  -0.0332 138 ASP A CA  
1237 C  C   . ASP A 143 ? 0.5807 0.4305 0.4093 0.1549  0.0815  -0.0217 138 ASP A C   
1238 O  O   . ASP A 143 ? 0.5752 0.4345 0.4164 0.1565  0.0940  -0.0259 138 ASP A O   
1239 C  CB  . ASP A 143 ? 0.6174 0.4800 0.4415 0.1310  0.1122  -0.0379 138 ASP A CB  
1240 C  CG  . ASP A 143 ? 0.6904 0.5566 0.4854 0.0899  0.1207  -0.0444 138 ASP A CG  
1241 O  OD1 . ASP A 143 ? 0.7626 0.6262 0.4789 0.0329  0.0921  -0.0704 138 ASP A OD1 
1242 O  OD2 . ASP A 143 ? 0.7249 0.6070 0.5426 0.0687  0.1805  -0.0155 138 ASP A OD2 
1243 N  N   . ASP A 144 ? 0.5630 0.4101 0.3939 0.1680  0.0581  -0.0175 139 ASP A N   
1244 C  CA  . ASP A 144 ? 0.5390 0.3946 0.3682 0.1728  0.0259  0.0052  139 ASP A CA  
1245 C  C   . ASP A 144 ? 0.5028 0.3366 0.3177 0.1739  0.0138  0.0190  139 ASP A C   
1246 O  O   . ASP A 144 ? 0.4848 0.3242 0.2771 0.1967  0.0270  0.0210  139 ASP A O   
1247 C  CB  . ASP A 144 ? 0.5530 0.4340 0.4132 0.1775  0.0045  0.0022  139 ASP A CB  
1248 C  CG  . ASP A 144 ? 0.5877 0.4984 0.5048 0.1552  -0.0402 0.0221  139 ASP A CG  
1249 O  OD1 . ASP A 144 ? 0.6346 0.5671 0.6150 0.1756  -0.0669 0.0468  139 ASP A OD1 
1250 O  OD2 . ASP A 144 ? 0.6382 0.5659 0.5493 0.1614  -0.0890 0.0739  139 ASP A OD2 
1251 N  N   . LYS A 145 ? 0.4844 0.2897 0.2780 0.1646  0.0163  0.0391  140 LYS A N   
1252 C  CA  A LYS A 145 ? 0.4625 0.2526 0.2495 0.1621  0.0190  0.0389  140 LYS A CA  
1253 C  CA  B LYS A 145 ? 0.4597 0.2490 0.2465 0.1640  0.0164  0.0370  140 LYS A CA  
1254 C  C   . LYS A 145 ? 0.4337 0.2345 0.2264 0.1504  0.0272  0.0450  140 LYS A C   
1255 O  O   . LYS A 145 ? 0.4386 0.1730 0.1930 0.1469  0.0143  0.0279  140 LYS A O   
1256 C  CB  A LYS A 145 ? 0.4814 0.2545 0.2730 0.1500  0.0200  0.0404  140 LYS A CB  
1257 C  CB  B LYS A 145 ? 0.4702 0.2513 0.2530 0.1590  0.0157  0.0400  140 LYS A CB  
1258 C  CG  A LYS A 145 ? 0.4933 0.2902 0.2866 0.1529  0.0177  0.0326  140 LYS A CG  
1259 C  CG  B LYS A 145 ? 0.4831 0.2432 0.2728 0.1754  0.0020  0.0203  140 LYS A CG  
1260 C  CD  A LYS A 145 ? 0.5784 0.3096 0.3383 0.1071  -0.0057 0.0283  140 LYS A CD  
1261 C  CD  B LYS A 145 ? 0.4987 0.2420 0.2819 0.1994  -0.0159 0.0249  140 LYS A CD  
1262 C  CE  A LYS A 145 ? 0.5915 0.3396 0.3386 0.1114  0.0054  0.0422  140 LYS A CE  
1263 C  CE  B LYS A 145 ? 0.5071 0.2267 0.3027 0.2047  -0.0132 0.0100  140 LYS A CE  
1264 N  NZ  A LYS A 145 ? 0.6690 0.3358 0.3634 0.0958  -0.0065 0.0609  140 LYS A NZ  
1265 N  NZ  B LYS A 145 ? 0.4712 0.2084 0.3467 0.2657  -0.0171 0.0043  140 LYS A NZ  
1266 N  N   . LYS A 146 ? 0.3929 0.2409 0.1901 0.1542  0.0276  0.0403  141 LYS A N   
1267 C  CA  A LYS A 146 ? 0.3557 0.2353 0.1733 0.1385  0.0331  0.0471  141 LYS A CA  
1268 C  CA  B LYS A 146 ? 0.3478 0.2483 0.1720 0.1425  0.0355  0.0500  141 LYS A CA  
1269 C  C   . LYS A 146 ? 0.3205 0.2367 0.1681 0.1367  0.0465  0.0489  141 LYS A C   
1270 O  O   . LYS A 146 ? 0.3000 0.2469 0.1579 0.1528  0.0509  0.0310  141 LYS A O   
1271 C  CB  A LYS A 146 ? 0.3515 0.2621 0.1499 0.1319  0.0326  0.0414  141 LYS A CB  
1272 C  CB  B LYS A 146 ? 0.3385 0.2835 0.1500 0.1406  0.0388  0.0481  141 LYS A CB  
1273 C  CG  A LYS A 146 ? 0.3671 0.2281 0.1840 0.1215  0.0210  0.0245  141 LYS A CG  
1274 C  CG  B LYS A 146 ? 0.3200 0.3239 0.1769 0.1424  0.0357  0.0442  141 LYS A CG  
1275 C  CD  A LYS A 146 ? 0.3910 0.2287 0.1698 0.1048  -0.0368 0.0181  141 LYS A CD  
1276 C  CD  B LYS A 146 ? 0.3121 0.3776 0.1835 0.1688  -0.0022 0.0507  141 LYS A CD  
1277 C  CE  A LYS A 146 ? 0.3929 0.2492 0.1910 0.0729  -0.0600 0.0076  141 LYS A CE  
1278 C  CE  B LYS A 146 ? 0.3300 0.3588 0.2366 0.1262  -0.0162 0.0276  141 LYS A CE  
1279 N  NZ  A LYS A 146 ? 0.3220 0.1162 0.2271 0.0654  -0.0656 0.0099  141 LYS A NZ  
1280 N  NZ  B LYS A 146 ? 0.3059 0.3567 0.3369 0.1107  -0.0048 0.0728  141 LYS A NZ  
1281 N  N   . ARG A 147 ? 0.3055 0.2385 0.1771 0.1071  0.0562  0.0598  142 ARG A N   
1282 C  CA  A ARG A 147 ? 0.2723 0.2405 0.1936 0.0913  0.0608  0.0693  142 ARG A CA  
1283 C  CA  B ARG A 147 ? 0.2864 0.2458 0.1952 0.0869  0.0618  0.0620  142 ARG A CA  
1284 C  C   . ARG A 147 ? 0.2662 0.2219 0.1880 0.0783  0.0617  0.0644  142 ARG A C   
1285 O  O   . ARG A 147 ? 0.2731 0.2032 0.2182 0.0587  0.0763  0.0528  142 ARG A O   
1286 C  CB  A ARG A 147 ? 0.2611 0.2575 0.1867 0.1056  0.0685  0.0883  142 ARG A CB  
1287 C  CB  B ARG A 147 ? 0.2851 0.2562 0.1999 0.0970  0.0617  0.0778  142 ARG A CB  
1288 C  CG  A ARG A 147 ? 0.2034 0.2508 0.2770 0.1351  0.0733  0.1067  142 ARG A CG  
1289 C  CG  B ARG A 147 ? 0.2946 0.3244 0.2685 0.0894  0.0872  0.0469  142 ARG A CG  
1290 C  CD  A ARG A 147 ? 0.2102 0.3493 0.3076 0.1815  0.0755  0.0782  142 ARG A CD  
1291 C  CD  B ARG A 147 ? 0.2987 0.4203 0.3773 0.1280  0.0726  0.0474  142 ARG A CD  
1292 N  NE  A ARG A 147 ? 0.2727 0.3528 0.3607 0.1811  0.0760  0.0482  142 ARG A NE  
1293 N  NE  B ARG A 147 ? 0.3514 0.4641 0.4158 0.1269  0.0680  0.0259  142 ARG A NE  
1294 C  CZ  A ARG A 147 ? 0.2711 0.3540 0.3720 0.2010  0.0691  0.0479  142 ARG A CZ  
1295 C  CZ  B ARG A 147 ? 0.3762 0.4712 0.4367 0.1501  0.0690  0.0461  142 ARG A CZ  
1296 N  NH1 A ARG A 147 ? 0.2298 0.3618 0.3740 0.1988  0.0400  0.0638  142 ARG A NH1 
1297 N  NH1 B ARG A 147 ? 0.3456 0.5079 0.4232 0.1794  0.0518  0.0261  142 ARG A NH1 
1298 N  NH2 A ARG A 147 ? 0.3059 0.3089 0.4004 0.2336  0.1064  0.0666  142 ARG A NH2 
1299 N  NH2 B ARG A 147 ? 0.4109 0.5012 0.4149 0.1367  0.0674  0.0383  142 ARG A NH2 
1300 N  N   . ILE A 148 ? 0.2714 0.1968 0.1803 0.0631  0.0435  0.0470  143 ILE A N   
1301 C  CA  . ILE A 148 ? 0.2534 0.1589 0.1525 0.0507  0.0446  0.0459  143 ILE A CA  
1302 C  C   . ILE A 148 ? 0.2570 0.1309 0.1421 0.0331  0.0351  0.0444  143 ILE A C   
1303 O  O   . ILE A 148 ? 0.2580 0.1511 0.1479 0.0469  0.0171  0.0324  143 ILE A O   
1304 C  CB  . ILE A 148 ? 0.2487 0.1704 0.1441 0.0601  0.0426  0.0376  143 ILE A CB  
1305 C  CG1 . ILE A 148 ? 0.2758 0.1222 0.2145 0.0826  0.0311  -0.0038 143 ILE A CG1 
1306 C  CG2 . ILE A 148 ? 0.2383 0.1989 0.1585 0.0393  0.0278  0.0562  143 ILE A CG2 
1307 C  CD1 . ILE A 148 ? 0.3306 0.0820 0.2364 0.0308  -0.0036 -0.0731 143 ILE A CD1 
1308 N  N   . ILE A 149 ? 0.2522 0.1116 0.1529 0.0125  0.0208  0.0366  144 ILE A N   
1309 C  CA  . ILE A 149 ? 0.2562 0.1103 0.1553 0.0251  0.0279  0.0091  144 ILE A CA  
1310 C  C   . ILE A 149 ? 0.2279 0.1097 0.1665 0.0074  0.0220  0.0214  144 ILE A C   
1311 O  O   . ILE A 149 ? 0.2401 0.1167 0.1636 0.0120  0.0321  0.0033  144 ILE A O   
1312 C  CB  . ILE A 149 ? 0.2673 0.1017 0.2000 0.0100  -0.0023 0.0106  144 ILE A CB  
1313 C  CG1 . ILE A 149 ? 0.2584 0.1036 0.1778 0.0005  0.0217  0.0073  144 ILE A CG1 
1314 C  CG2 . ILE A 149 ? 0.2285 0.1366 0.1720 0.0288  0.0571  -0.0394 144 ILE A CG2 
1315 C  CD1 . ILE A 149 ? 0.3847 0.1794 0.1820 0.0460  -0.0443 -0.0299 144 ILE A CD1 
1316 N  N   . ASP A 150 ? 0.2516 0.1030 0.1511 0.0200  0.0426  0.0311  145 ASP A N   
1317 C  CA  . ASP A 150 ? 0.2522 0.1100 0.1646 0.0188  0.0305  0.0412  145 ASP A CA  
1318 C  C   . ASP A 150 ? 0.2289 0.1028 0.1539 0.0300  0.0327  0.0496  145 ASP A C   
1319 O  O   . ASP A 150 ? 0.2435 0.1005 0.1399 0.0074  0.0266  0.0472  145 ASP A O   
1320 C  CB  . ASP A 150 ? 0.2278 0.1040 0.1863 0.0124  0.0395  0.0417  145 ASP A CB  
1321 C  CG  . ASP A 150 ? 0.2898 0.1781 0.2247 -0.0014 0.0201  0.0514  145 ASP A CG  
1322 O  OD1 . ASP A 150 ? 0.3402 0.2721 0.2742 -0.0158 0.0236  0.0453  145 ASP A OD1 
1323 O  OD2 . ASP A 150 ? 0.2906 0.3069 0.2414 -0.0388 0.0242  0.0041  145 ASP A OD2 
1324 N  N   . SER A 151 ? 0.2062 0.0885 0.1647 0.0292  0.0336  0.0618  146 SER A N   
1325 C  CA  . SER A 151 ? 0.1862 0.1121 0.1394 0.0376  0.0441  0.0635  146 SER A CA  
1326 C  C   . SER A 151 ? 0.1797 0.0949 0.1465 0.0208  0.0489  0.0431  146 SER A C   
1327 O  O   . SER A 151 ? 0.1826 0.0768 0.1573 0.0035  0.0572  0.0290  146 SER A O   
1328 C  CB  . SER A 151 ? 0.1787 0.1462 0.1724 0.0447  0.0546  0.0795  146 SER A CB  
1329 O  OG  . SER A 151 ? 0.1786 0.2012 0.2175 0.0290  0.0771  0.0815  146 SER A OG  
1330 N  N   . ALA A 152 ? 0.1635 0.0944 0.1230 0.0164  0.0482  0.0443  147 ALA A N   
1331 C  CA  . ALA A 152 ? 0.1496 0.0719 0.1486 0.0353  0.0340  0.0327  147 ALA A CA  
1332 C  C   . ALA A 152 ? 0.1855 0.0734 0.1419 0.0316  0.0306  0.0411  147 ALA A C   
1333 O  O   . ALA A 152 ? 0.1879 0.0930 0.1332 0.0129  0.0321  0.0194  147 ALA A O   
1334 C  CB  . ALA A 152 ? 0.1727 0.0396 0.1496 0.0339  0.0163  0.0320  147 ALA A CB  
1335 N  N   . ARG A 153 ? 0.1961 0.0708 0.1511 0.0336  0.0300  0.0596  148 ARG A N   
1336 C  CA  A ARG A 153 ? 0.2161 0.0643 0.1556 0.0304  0.0179  0.0531  148 ARG A CA  
1337 C  CA  B ARG A 153 ? 0.2195 0.0652 0.1517 0.0301  0.0168  0.0537  148 ARG A CA  
1338 C  C   . ARG A 153 ? 0.2124 0.0711 0.1652 0.0173  0.0257  0.0450  148 ARG A C   
1339 O  O   . ARG A 153 ? 0.2256 0.0580 0.1807 0.0215  0.0266  0.0440  148 ARG A O   
1340 C  CB  A ARG A 153 ? 0.2148 0.0696 0.1403 0.0384  0.0123  0.0670  148 ARG A CB  
1341 C  CB  B ARG A 153 ? 0.2206 0.0729 0.1347 0.0355  0.0120  0.0690  148 ARG A CB  
1342 C  CG  A ARG A 153 ? 0.2194 0.0576 0.1710 0.0380  0.0053  0.0611  148 ARG A CG  
1343 C  CG  B ARG A 153 ? 0.2434 0.0640 0.1513 0.0400  -0.0017 0.0625  148 ARG A CG  
1344 C  CD  A ARG A 153 ? 0.2291 0.0721 0.1212 0.0084  -0.0089 0.0419  148 ARG A CD  
1345 C  CD  B ARG A 153 ? 0.2669 0.1253 0.1090 -0.0161 -0.0029 0.0259  148 ARG A CD  
1346 N  NE  A ARG A 153 ? 0.2295 0.0609 0.1688 -0.0044 0.0149  0.0624  148 ARG A NE  
1347 N  NE  B ARG A 153 ? 0.2709 0.1310 0.1548 0.0059  0.0029  0.0588  148 ARG A NE  
1348 C  CZ  A ARG A 153 ? 0.2389 0.1059 0.1812 -0.0303 -0.0191 0.0459  148 ARG A CZ  
1349 C  CZ  B ARG A 153 ? 0.2311 0.1360 0.1699 0.0274  0.0260  -0.0041 148 ARG A CZ  
1350 N  NH1 A ARG A 153 ? 0.1599 0.0464 0.1953 -0.0369 -0.0612 0.0563  148 ARG A NH1 
1351 N  NH1 B ARG A 153 ? 0.1016 0.1145 0.1165 0.0007  -0.0156 0.0053  148 ARG A NH1 
1352 N  NH2 A ARG A 153 ? 0.2518 0.0726 0.1781 -0.0415 0.0000  0.0778  148 ARG A NH2 
1353 N  NH2 B ARG A 153 ? 0.2561 0.1124 0.1184 0.0677  0.1055  -0.0239 148 ARG A NH2 
1354 N  N   . SER A 154 ? 0.2322 0.0666 0.1757 0.0026  0.0214  0.0357  149 SER A N   
1355 C  CA  A SER A 154 ? 0.2120 0.0659 0.1662 0.0042  0.0336  0.0386  149 SER A CA  
1356 C  CA  B SER A 154 ? 0.2280 0.0702 0.1747 0.0049  0.0268  0.0428  149 SER A CA  
1357 C  C   . SER A 154 ? 0.2208 0.0611 0.1648 0.0168  0.0329  0.0374  149 SER A C   
1358 O  O   . SER A 154 ? 0.2062 0.0616 0.1758 0.0275  0.0270  0.0354  149 SER A O   
1359 C  CB  A SER A 154 ? 0.2096 0.0757 0.1574 -0.0173 0.0456  0.0459  149 SER A CB  
1360 C  CB  B SER A 154 ? 0.2308 0.0882 0.1759 -0.0121 0.0370  0.0468  149 SER A CB  
1361 O  OG  A SER A 154 ? 0.1873 0.0602 0.1346 -0.0093 0.0601  0.0199  149 SER A OG  
1362 O  OG  B SER A 154 ? 0.2955 0.0889 0.1973 -0.0106 0.0103  0.0658  149 SER A OG  
1363 N  N   . ALA A 155 ? 0.1838 0.0554 0.1545 0.0098  0.0248  0.0403  150 ALA A N   
1364 C  CA  . ALA A 155 ? 0.1711 0.0678 0.1670 0.0062  0.0129  0.0502  150 ALA A CA  
1365 C  C   . ALA A 155 ? 0.1643 0.0664 0.1635 0.0073  0.0168  0.0353  150 ALA A C   
1366 O  O   . ALA A 155 ? 0.1475 0.0505 0.1611 -0.0155 0.0186  0.0277  150 ALA A O   
1367 C  CB  . ALA A 155 ? 0.1758 0.0626 0.1568 0.0146  0.0018  0.0473  150 ALA A CB  
1368 N  N   . TYR A 156 ? 0.1328 0.0671 0.1431 0.0059  0.0123  0.0490  151 TYR A N   
1369 C  CA  . TYR A 156 ? 0.1581 0.0654 0.1745 0.0207  0.0004  0.0319  151 TYR A CA  
1370 C  C   . TYR A 156 ? 0.1689 0.0476 0.1654 0.0123  0.0198  0.0354  151 TYR A C   
1371 O  O   . TYR A 156 ? 0.1490 0.0641 0.1487 0.0208  0.0067  0.0331  151 TYR A O   
1372 C  CB  . TYR A 156 ? 0.1544 0.0546 0.1653 0.0243  -0.0054 0.0405  151 TYR A CB  
1373 C  CG  . TYR A 156 ? 0.1289 0.0489 0.1353 0.0270  0.0191  0.0175  151 TYR A CG  
1374 C  CD1 . TYR A 156 ? 0.1472 0.0625 0.1102 0.0346  0.0136  0.0516  151 TYR A CD1 
1375 C  CD2 . TYR A 156 ? 0.1529 0.0367 0.1247 0.0317  0.0009  0.0190  151 TYR A CD2 
1376 C  CE1 . TYR A 156 ? 0.1528 0.0303 0.0895 0.0251  -0.0058 -0.0004 151 TYR A CE1 
1377 C  CE2 . TYR A 156 ? 0.1346 0.0539 0.1097 0.0236  0.0260  0.0484  151 TYR A CE2 
1378 C  CZ  . TYR A 156 ? 0.1767 0.0594 0.0906 0.0710  0.0087  0.0112  151 TYR A CZ  
1379 O  OH  . TYR A 156 ? 0.1686 0.0642 0.1557 0.0474  -0.0001 0.0363  151 TYR A OH  
1380 N  N   . GLN A 157 ? 0.1830 0.0393 0.1328 0.0251  0.0083  0.0340  152 GLN A N   
1381 C  CA  . GLN A 157 ? 0.2240 0.0393 0.1374 0.0170  0.0222  0.0389  152 GLN A CA  
1382 C  C   . GLN A 157 ? 0.1993 0.0496 0.1483 0.0101  0.0222  0.0237  152 GLN A C   
1383 O  O   . GLN A 157 ? 0.2106 0.0581 0.1726 0.0237  0.0100  0.0343  152 GLN A O   
1384 C  CB  . GLN A 157 ? 0.2188 0.0589 0.1473 0.0261  0.0283  0.0540  152 GLN A CB  
1385 C  CG  . GLN A 157 ? 0.2724 0.1100 0.2398 0.0637  0.0293  0.0497  152 GLN A CG  
1386 C  CD  . GLN A 157 ? 0.2798 0.0846 0.2456 0.0694  -0.0404 0.0344  152 GLN A CD  
1387 O  OE1 . GLN A 157 ? 0.3233 0.1169 0.3467 0.0273  -0.0795 0.0451  152 GLN A OE1 
1388 N  NE2 . GLN A 157 ? 0.3674 0.1116 0.2951 0.0581  0.0032  -0.0068 152 GLN A NE2 
1389 N  N   . GLU A 158 ? 0.2090 0.0512 0.1434 0.0202  0.0058  0.0019  153 GLU A N   
1390 C  CA  A GLU A 158 ? 0.2008 0.0740 0.1612 -0.0008 0.0194  0.0062  153 GLU A CA  
1391 C  CA  B GLU A 158 ? 0.2040 0.0831 0.1648 0.0099  0.0171  0.0090  153 GLU A CA  
1392 C  C   . GLU A 158 ? 0.2101 0.0656 0.1618 0.0085  0.0144  0.0103  153 GLU A C   
1393 O  O   . GLU A 158 ? 0.2187 0.0492 0.1757 0.0160  0.0173  0.0240  153 GLU A O   
1394 C  CB  A GLU A 158 ? 0.2083 0.0584 0.1608 0.0104  0.0147  0.0113  153 GLU A CB  
1395 C  CB  B GLU A 158 ? 0.2125 0.0844 0.1743 0.0192  0.0127  0.0058  153 GLU A CB  
1396 C  CG  A GLU A 158 ? 0.2023 0.0461 0.1933 -0.0311 0.0344  -0.0309 153 GLU A CG  
1397 C  CG  B GLU A 158 ? 0.2182 0.1448 0.2245 0.0337  0.0359  -0.0082 153 GLU A CG  
1398 C  CD  A GLU A 158 ? 0.2197 0.0281 0.3216 -0.0051 0.0237  -0.0286 153 GLU A CD  
1399 C  CD  B GLU A 158 ? 0.2154 0.1864 0.2863 0.0330  -0.0125 -0.0352 153 GLU A CD  
1400 O  OE1 A GLU A 158 ? 0.1889 0.1004 0.3139 -0.0316 0.0493  -0.0610 153 GLU A OE1 
1401 O  OE1 B GLU A 158 ? 0.1756 0.2274 0.3312 0.0106  -0.0334 -0.0225 153 GLU A OE1 
1402 O  OE2 A GLU A 158 ? 0.1620 0.1702 0.3919 -0.0362 -0.0393 -0.0885 153 GLU A OE2 
1403 O  OE2 B GLU A 158 ? 0.2196 0.1541 0.3542 -0.0081 -0.0061 -0.0773 153 GLU A OE2 
1404 N  N   . ALA A 159 ? 0.1748 0.0605 0.1507 0.0049  0.0083  0.0477  154 ALA A N   
1405 C  CA  . ALA A 159 ? 0.1820 0.0373 0.1514 0.0110  0.0092  0.0382  154 ALA A CA  
1406 C  C   . ALA A 159 ? 0.1910 0.0550 0.1513 0.0078  0.0092  0.0195  154 ALA A C   
1407 O  O   . ALA A 159 ? 0.1907 0.0426 0.1495 0.0019  0.0191  0.0014  154 ALA A O   
1408 C  CB  . ALA A 159 ? 0.1899 0.0402 0.1055 -0.0183 -0.0066 0.0328  154 ALA A CB  
1409 N  N   . MET A 160 ? 0.1922 0.0420 0.1456 0.0150  0.0058  0.0355  155 MET A N   
1410 C  CA  . MET A 160 ? 0.2024 0.0381 0.1568 0.0226  -0.0121 0.0326  155 MET A CA  
1411 C  C   . MET A 160 ? 0.2178 0.0512 0.1557 0.0225  -0.0124 0.0302  155 MET A C   
1412 O  O   . MET A 160 ? 0.2345 0.0743 0.1772 0.0373  -0.0094 0.0293  155 MET A O   
1413 C  CB  . MET A 160 ? 0.2251 0.0341 0.1580 0.0127  -0.0246 0.0136  155 MET A CB  
1414 C  CG  . MET A 160 ? 0.2370 0.0842 0.2457 0.0560  -0.0207 0.0565  155 MET A CG  
1415 S  SD  . MET A 160 ? 0.2906 0.1424 0.2457 -0.0023 -0.0016 0.0085  155 MET A SD  
1416 C  CE  . MET A 160 ? 0.2439 0.2371 0.3223 0.0956  0.0242  0.1634  155 MET A CE  
1417 N  N   . ASP A 161 ? 0.2262 0.0383 0.1608 0.0190  -0.0031 0.0386  156 ASP A N   
1418 C  CA  . ASP A 161 ? 0.2267 0.0462 0.1673 0.0126  0.0039  0.0296  156 ASP A CA  
1419 C  C   . ASP A 161 ? 0.2298 0.0480 0.1673 0.0355  0.0023  0.0357  156 ASP A C   
1420 O  O   . ASP A 161 ? 0.2378 0.0647 0.1742 0.0267  0.0074  0.0365  156 ASP A O   
1421 C  CB  . ASP A 161 ? 0.2595 0.0477 0.1564 0.0001  0.0254  0.0536  156 ASP A CB  
1422 C  CG  . ASP A 161 ? 0.2687 0.0702 0.2105 -0.0128 0.0684  0.0033  156 ASP A CG  
1423 O  OD1 . ASP A 161 ? 0.3319 0.1563 0.1963 -0.0199 0.0299  0.0361  156 ASP A OD1 
1424 O  OD2 . ASP A 161 ? 0.3691 0.1659 0.2389 0.0083  0.1656  0.0289  156 ASP A OD2 
1425 N  N   . ILE A 162 ? 0.2128 0.0382 0.1523 0.0292  -0.0098 0.0212  157 ILE A N   
1426 C  CA  . ILE A 162 ? 0.1963 0.0484 0.1547 0.0324  -0.0148 0.0200  157 ILE A CA  
1427 C  C   . ILE A 162 ? 0.2094 0.0547 0.1700 0.0425  -0.0152 0.0053  157 ILE A C   
1428 O  O   . ILE A 162 ? 0.1893 0.0609 0.1587 0.0525  -0.0211 0.0013  157 ILE A O   
1429 C  CB  . ILE A 162 ? 0.1884 0.0717 0.1714 0.0363  -0.0136 0.0225  157 ILE A CB  
1430 C  CG1 . ILE A 162 ? 0.1786 0.0338 0.2222 0.0251  -0.0039 0.0288  157 ILE A CG1 
1431 C  CG2 . ILE A 162 ? 0.1435 0.0734 0.1521 0.0145  -0.0255 0.0203  157 ILE A CG2 
1432 C  CD1 . ILE A 162 ? 0.2242 0.0517 0.2522 0.0545  -0.0654 0.0305  157 ILE A CD1 
1433 N  N   . SER A 163 ? 0.2061 0.0539 0.1700 0.0270  -0.0155 0.0262  158 SER A N   
1434 C  CA  . SER A 163 ? 0.2112 0.0708 0.1707 0.0582  -0.0055 0.0270  158 SER A CA  
1435 C  C   . SER A 163 ? 0.2027 0.0866 0.1739 0.0631  -0.0127 0.0178  158 SER A C   
1436 O  O   . SER A 163 ? 0.2245 0.0717 0.1804 0.0602  -0.0041 -0.0018 158 SER A O   
1437 C  CB  . SER A 163 ? 0.2192 0.1037 0.1609 0.0256  -0.0222 -0.0002 158 SER A CB  
1438 O  OG  . SER A 163 ? 0.2937 0.0958 0.2215 0.0357  0.0145  0.0217  158 SER A OG  
1439 N  N   . LYS A 164 ? 0.2070 0.0821 0.1686 0.0925  -0.0222 0.0234  159 LYS A N   
1440 C  CA  A LYS A 164 ? 0.2290 0.0892 0.1831 0.0915  -0.0301 0.0215  159 LYS A CA  
1441 C  CA  B LYS A 164 ? 0.2279 0.1051 0.1923 0.0925  -0.0330 0.0266  159 LYS A CA  
1442 C  C   . LYS A 164 ? 0.2331 0.1061 0.2032 0.0937  -0.0302 0.0222  159 LYS A C   
1443 O  O   . LYS A 164 ? 0.2416 0.1271 0.2492 0.0975  -0.0111 0.0038  159 LYS A O   
1444 C  CB  A LYS A 164 ? 0.2416 0.1051 0.2031 0.0961  -0.0437 0.0197  159 LYS A CB  
1445 C  CB  B LYS A 164 ? 0.2419 0.1329 0.2124 0.0969  -0.0442 0.0295  159 LYS A CB  
1446 C  CG  A LYS A 164 ? 0.2730 0.0692 0.1717 0.1023  -0.0448 -0.0037 159 LYS A CG  
1447 C  CG  B LYS A 164 ? 0.2621 0.1903 0.2389 0.1095  -0.0690 0.0385  159 LYS A CG  
1448 C  CD  A LYS A 164 ? 0.3642 0.1044 0.1965 0.1031  -0.0961 0.0142  159 LYS A CD  
1449 C  CD  B LYS A 164 ? 0.2893 0.2907 0.2751 0.0811  -0.1142 0.0375  159 LYS A CD  
1450 C  CE  A LYS A 164 ? 0.3681 0.0390 0.2446 0.0633  -0.0950 0.0005  159 LYS A CE  
1451 C  CE  B LYS A 164 ? 0.3086 0.3081 0.2577 0.0946  -0.1344 0.0656  159 LYS A CE  
1452 N  NZ  A LYS A 164 ? 0.4061 0.1203 0.2829 0.0693  -0.1014 0.0023  159 LYS A NZ  
1453 N  NZ  B LYS A 164 ? 0.2723 0.3293 0.3644 0.0555  -0.1629 0.0659  159 LYS A NZ  
1454 N  N   . LYS A 165 ? 0.2486 0.0815 0.2150 0.0583  -0.0283 0.0170  160 LYS A N   
1455 C  CA  A LYS A 165 ? 0.2533 0.1062 0.2236 0.0610  -0.0164 -0.0001 160 LYS A CA  
1456 C  CA  B LYS A 165 ? 0.2555 0.0980 0.2273 0.0581  -0.0143 -0.0089 160 LYS A CA  
1457 C  C   . LYS A 165 ? 0.2518 0.0964 0.2314 0.0576  -0.0127 -0.0128 160 LYS A C   
1458 O  O   . LYS A 165 ? 0.2838 0.0745 0.2296 0.0588  0.0172  -0.0206 160 LYS A O   
1459 C  CB  A LYS A 165 ? 0.2482 0.1129 0.2348 0.0481  -0.0120 0.0000  160 LYS A CB  
1460 C  CB  B LYS A 165 ? 0.2498 0.0970 0.2341 0.0421  -0.0099 -0.0149 160 LYS A CB  
1461 C  CG  A LYS A 165 ? 0.2583 0.1521 0.2398 0.0528  -0.0525 0.0324  160 LYS A CG  
1462 C  CG  B LYS A 165 ? 0.2732 0.0970 0.2728 0.0339  -0.0392 -0.0271 160 LYS A CG  
1463 C  CD  A LYS A 165 ? 0.2815 0.2265 0.3424 0.0029  -0.0465 0.0534  160 LYS A CD  
1464 C  CD  B LYS A 165 ? 0.3328 0.1631 0.3028 0.0070  -0.0311 -0.0339 160 LYS A CD  
1465 C  CE  A LYS A 165 ? 0.2720 0.2083 0.3481 -0.0040 -0.0923 0.0720  160 LYS A CE  
1466 C  CE  B LYS A 165 ? 0.3561 0.2117 0.3606 0.0109  -0.0458 -0.0464 160 LYS A CE  
1467 N  NZ  A LYS A 165 ? 0.2108 0.1364 0.3752 -0.0387 -0.0816 0.1283  160 LYS A NZ  
1468 N  NZ  B LYS A 165 ? 0.3901 0.2132 0.3349 -0.0570 -0.0607 -0.0327 160 LYS A NZ  
1469 N  N   . GLU A 166 ? 0.2577 0.0825 0.2036 0.0547  -0.0190 -0.0107 161 GLU A N   
1470 C  CA  . GLU A 166 ? 0.2390 0.0976 0.2030 0.0552  -0.0034 -0.0283 161 GLU A CA  
1471 C  C   . GLU A 166 ? 0.2342 0.0980 0.1828 0.0486  -0.0173 -0.0177 161 GLU A C   
1472 O  O   . GLU A 166 ? 0.2850 0.1686 0.2264 0.0300  0.0025  -0.0348 161 GLU A O   
1473 C  CB  . GLU A 166 ? 0.2415 0.1272 0.1888 0.0436  -0.0192 -0.0292 161 GLU A CB  
1474 C  CG  . GLU A 166 ? 0.2948 0.1919 0.3164 0.0186  0.0332  -0.0463 161 GLU A CG  
1475 C  CD  . GLU A 166 ? 0.3756 0.2648 0.4215 -0.0275 0.0523  -0.0407 161 GLU A CD  
1476 O  OE1 . GLU A 166 ? 0.4061 0.3174 0.4809 -0.0336 0.0634  -0.1017 161 GLU A OE1 
1477 O  OE2 . GLU A 166 ? 0.4510 0.2955 0.5571 -0.0666 0.0543  -0.0223 161 GLU A OE2 
1478 N  N   . MET A 167 ? 0.2186 0.0454 0.1902 0.0543  -0.0162 -0.0114 162 MET A N   
1479 C  CA  A MET A 167 ? 0.2004 0.0505 0.1951 0.0651  -0.0128 -0.0084 162 MET A CA  
1480 C  CA  B MET A 167 ? 0.2050 0.0518 0.1909 0.0640  -0.0151 -0.0085 162 MET A CA  
1481 C  C   . MET A 167 ? 0.2063 0.0699 0.1758 0.0618  -0.0124 -0.0081 162 MET A C   
1482 O  O   . MET A 167 ? 0.1983 0.0814 0.1940 0.0663  -0.0249 0.0146  162 MET A O   
1483 C  CB  A MET A 167 ? 0.1963 0.0543 0.1869 0.0704  -0.0154 -0.0047 162 MET A CB  
1484 C  CB  B MET A 167 ? 0.2075 0.0577 0.1904 0.0765  -0.0151 0.0007  162 MET A CB  
1485 C  CG  A MET A 167 ? 0.2108 0.0758 0.2521 0.0745  -0.0245 -0.0005 162 MET A CG  
1486 C  CG  B MET A 167 ? 0.2161 0.0482 0.2276 0.0661  -0.0299 -0.0083 162 MET A CG  
1487 S  SD  A MET A 167 ? 0.1654 0.0757 0.2087 0.0248  -0.0389 -0.0090 162 MET A SD  
1488 S  SD  B MET A 167 ? 0.2505 0.0972 0.2490 0.0944  0.0057  0.0083  162 MET A SD  
1489 C  CE  A MET A 167 ? 0.2364 0.0802 0.2021 0.0419  -0.0551 0.0390  162 MET A CE  
1490 C  CE  B MET A 167 ? 0.2178 0.0851 0.2444 0.0929  -0.0354 0.0391  162 MET A CE  
1491 N  N   . PRO A 168 ? 0.2102 0.0885 0.1720 0.0464  -0.0093 -0.0112 163 PRO A N   
1492 C  CA  . PRO A 168 ? 0.2091 0.1369 0.1590 0.0476  0.0004  -0.0152 163 PRO A CA  
1493 C  C   . PRO A 168 ? 0.1949 0.1221 0.1608 0.0614  -0.0134 -0.0074 163 PRO A C   
1494 O  O   . PRO A 168 ? 0.2148 0.1424 0.1480 0.0676  -0.0168 0.0155  163 PRO A O   
1495 C  CB  . PRO A 168 ? 0.2480 0.1586 0.1248 0.0335  0.0048  -0.0182 163 PRO A CB  
1496 C  CG  . PRO A 168 ? 0.2424 0.1407 0.2020 0.0455  -0.0097 -0.0333 163 PRO A CG  
1497 C  CD  . PRO A 168 ? 0.2345 0.1123 0.1316 0.0201  -0.0152 -0.0220 163 PRO A CD  
1498 N  N   . PRO A 169 ? 0.2082 0.1376 0.1859 0.0754  -0.0104 0.0142  164 PRO A N   
1499 C  CA  . PRO A 169 ? 0.2014 0.1476 0.1899 0.0612  -0.0156 0.0080  164 PRO A CA  
1500 C  C   . PRO A 169 ? 0.1996 0.1475 0.1815 0.0499  0.0126  0.0115  164 PRO A C   
1501 O  O   . PRO A 169 ? 0.2046 0.1356 0.1872 0.0311  0.0504  0.0093  164 PRO A O   
1502 C  CB  . PRO A 169 ? 0.1897 0.1697 0.2159 0.0710  -0.0202 0.0228  164 PRO A CB  
1503 C  CG  . PRO A 169 ? 0.2056 0.1981 0.2367 0.0804  -0.0202 -0.0250 164 PRO A CG  
1504 C  CD  . PRO A 169 ? 0.1806 0.1730 0.2172 0.0984  -0.0148 0.0040  164 PRO A CD  
1505 N  N   . THR A 170 ? 0.1681 0.1424 0.1855 0.0458  -0.0025 0.0043  165 THR A N   
1506 C  CA  A THR A 170 ? 0.1523 0.1197 0.1747 0.0479  0.0005  0.0076  165 THR A CA  
1507 C  CA  B THR A 170 ? 0.1659 0.1240 0.1915 0.0501  0.0053  0.0110  165 THR A CA  
1508 C  C   . THR A 170 ? 0.1366 0.1117 0.1774 0.0380  0.0029  0.0079  165 THR A C   
1509 O  O   . THR A 170 ? 0.1684 0.0985 0.1819 0.0480  0.0023  0.0011  165 THR A O   
1510 C  CB  A THR A 170 ? 0.1193 0.1091 0.1742 0.0433  -0.0149 -0.0042 165 THR A CB  
1511 C  CB  B THR A 170 ? 0.1557 0.1283 0.1992 0.0511  0.0017  0.0074  165 THR A CB  
1512 O  OG1 A THR A 170 ? 0.1546 0.0774 0.1022 0.0763  -0.0076 -0.0204 165 THR A OG1 
1513 O  OG1 B THR A 170 ? 0.2050 0.1093 0.2288 0.0639  0.0079  0.0253  165 THR A OG1 
1514 C  CG2 A THR A 170 ? 0.1436 0.0959 0.2015 0.0719  -0.0289 0.0498  165 THR A CG2 
1515 C  CG2 B THR A 170 ? 0.1879 0.1168 0.2219 0.0750  0.0183  0.0296  165 THR A CG2 
1516 N  N   . HIS A 171 ? 0.1558 0.0914 0.1619 0.0405  -0.0032 0.0030  166 HIS A N   
1517 C  CA  . HIS A 171 ? 0.1299 0.0866 0.1667 0.0347  -0.0203 0.0135  166 HIS A CA  
1518 C  C   . HIS A 171 ? 0.1663 0.0827 0.1587 0.0431  -0.0188 0.0221  166 HIS A C   
1519 O  O   . HIS A 171 ? 0.1454 0.0965 0.1709 0.0482  0.0084  0.0462  166 HIS A O   
1520 C  CB  . HIS A 171 ? 0.1237 0.1149 0.1682 0.0408  -0.0119 0.0074  166 HIS A CB  
1521 C  CG  . HIS A 171 ? 0.1448 0.1276 0.2061 0.0368  -0.0518 0.0421  166 HIS A CG  
1522 N  ND1 . HIS A 171 ? 0.1402 0.1027 0.1811 0.0294  -0.0405 -0.0123 166 HIS A ND1 
1523 C  CD2 . HIS A 171 ? 0.2269 0.0969 0.2451 0.0452  -0.0322 0.0058  166 HIS A CD2 
1524 C  CE1 . HIS A 171 ? 0.2334 0.0533 0.2163 0.0679  -0.0683 0.0088  166 HIS A CE1 
1525 N  NE2 . HIS A 171 ? 0.2321 0.1035 0.2814 0.0587  -0.0406 0.0233  166 HIS A NE2 
1526 N  N   . PRO A 172 ? 0.1693 0.0784 0.1524 0.0381  -0.0123 0.0319  167 PRO A N   
1527 C  CA  . PRO A 172 ? 0.1394 0.0673 0.1638 0.0435  -0.0061 0.0426  167 PRO A CA  
1528 C  C   . PRO A 172 ? 0.1253 0.0738 0.1688 0.0316  -0.0086 0.0354  167 PRO A C   
1529 O  O   . PRO A 172 ? 0.1328 0.0669 0.1882 0.0378  -0.0083 0.0419  167 PRO A O   
1530 C  CB  . PRO A 172 ? 0.1546 0.1184 0.1692 0.0812  0.0084  0.0623  167 PRO A CB  
1531 C  CG  . PRO A 172 ? 0.2818 0.0895 0.2197 0.0383  -0.0270 0.0190  167 PRO A CG  
1532 C  CD  . PRO A 172 ? 0.2253 0.0551 0.1874 0.0447  -0.0027 0.0366  167 PRO A CD  
1533 N  N   . ILE A 173 ? 0.1005 0.0776 0.1723 0.0216  -0.0050 0.0234  168 ILE A N   
1534 C  CA  . ILE A 173 ? 0.0919 0.0777 0.1532 0.0145  -0.0099 0.0169  168 ILE A CA  
1535 C  C   . ILE A 173 ? 0.1160 0.0645 0.1539 0.0251  0.0007  0.0191  168 ILE A C   
1536 O  O   . ILE A 173 ? 0.1568 0.0596 0.1743 0.0467  0.0008  0.0256  168 ILE A O   
1537 C  CB  . ILE A 173 ? 0.0551 0.1094 0.1352 0.0194  -0.0141 0.0197  168 ILE A CB  
1538 C  CG1 . ILE A 173 ? 0.1080 0.1222 0.1616 -0.0126 -0.0673 0.0001  168 ILE A CG1 
1539 C  CG2 . ILE A 173 ? 0.1149 0.0957 0.1181 0.0132  0.0224  -0.0002 168 ILE A CG2 
1540 C  CD1 . ILE A 173 ? 0.1265 0.1237 0.1608 -0.0295 -0.0696 -0.0564 168 ILE A CD1 
1541 N  N   . ARG A 174 ? 0.1122 0.0750 0.1460 0.0336  -0.0024 0.0454  169 ARG A N   
1542 C  CA  A ARG A 174 ? 0.1394 0.0681 0.1545 0.0352  0.0043  0.0315  169 ARG A CA  
1543 C  CA  B ARG A 174 ? 0.1410 0.0722 0.1377 0.0330  0.0090  0.0312  169 ARG A CA  
1544 C  C   . ARG A 174 ? 0.1354 0.0709 0.1445 0.0331  0.0073  0.0317  169 ARG A C   
1545 O  O   . ARG A 174 ? 0.1621 0.0466 0.1329 0.0247  0.0102  0.0377  169 ARG A O   
1546 C  CB  A ARG A 174 ? 0.1287 0.0532 0.1438 0.0453  0.0065  0.0331  169 ARG A CB  
1547 C  CB  B ARG A 174 ? 0.1118 0.0593 0.0865 0.0448  0.0102  0.0306  169 ARG A CB  
1548 C  CG  A ARG A 174 ? 0.1585 0.0549 0.2182 0.0549  0.0152  0.0288  169 ARG A CG  
1549 C  CG  B ARG A 174 ? 0.1538 0.0689 0.1218 0.0539  0.0589  0.0629  169 ARG A CG  
1550 C  CD  A ARG A 174 ? 0.1454 0.0954 0.2790 0.0881  0.0280  -0.0155 169 ARG A CD  
1551 C  CD  B ARG A 174 ? 0.1744 0.0635 0.0877 0.0638  0.0072  0.0291  169 ARG A CD  
1552 N  NE  A ARG A 174 ? 0.2153 0.1963 0.2941 0.0586  0.0415  -0.0631 169 ARG A NE  
1553 N  NE  B ARG A 174 ? 0.1499 0.0538 0.0594 0.0588  -0.0081 0.0006  169 ARG A NE  
1554 C  CZ  A ARG A 174 ? 0.1980 0.1313 0.2847 0.0277  0.0263  -0.1568 169 ARG A CZ  
1555 C  CZ  B ARG A 174 ? 0.1340 0.0422 0.0906 0.0426  -0.0209 -0.0118 169 ARG A CZ  
1556 N  NH1 A ARG A 174 ? 0.1489 0.2147 0.2889 -0.0063 0.0505  -0.2169 169 ARG A NH1 
1557 N  NH1 B ARG A 174 ? 0.1774 0.0315 0.1173 0.0197  0.0165  -0.0160 169 ARG A NH1 
1558 N  NH2 A ARG A 174 ? 0.0963 0.1542 0.3331 0.0270  -0.0085 -0.1940 169 ARG A NH2 
1559 N  NH2 B ARG A 174 ? 0.1095 0.0732 0.1246 0.0431  -0.0116 0.0442  169 ARG A NH2 
1560 N  N   . LEU A 175 ? 0.1507 0.0529 0.1453 0.0409  0.0036  0.0416  170 LEU A N   
1561 C  CA  . LEU A 175 ? 0.1346 0.0640 0.1524 0.0355  0.0248  0.0155  170 LEU A CA  
1562 C  C   . LEU A 175 ? 0.1168 0.0512 0.1368 0.0424  0.0005  0.0266  170 LEU A C   
1563 O  O   . LEU A 175 ? 0.1566 0.0519 0.1642 0.0349  -0.0007 0.0392  170 LEU A O   
1564 C  CB  . LEU A 175 ? 0.1212 0.1001 0.1707 0.0338  0.0181  0.0172  170 LEU A CB  
1565 C  CG  . LEU A 175 ? 0.1130 0.0832 0.1236 0.0602  0.0352  0.0320  170 LEU A CG  
1566 C  CD1 . LEU A 175 ? 0.0668 0.2171 0.1375 0.0538  0.0427  0.0070  170 LEU A CD1 
1567 C  CD2 . LEU A 175 ? 0.1202 0.2095 0.1186 0.0706  0.0072  0.0416  170 LEU A CD2 
1568 N  N   . GLY A 176 ? 0.1147 0.0526 0.1637 0.0255  0.0090  0.0162  171 GLY A N   
1569 C  CA  . GLY A 176 ? 0.1268 0.0538 0.1387 0.0323  0.0172  0.0201  171 GLY A CA  
1570 C  C   . GLY A 176 ? 0.1085 0.0628 0.1586 0.0224  0.0043  0.0168  171 GLY A C   
1571 O  O   . GLY A 176 ? 0.1470 0.0804 0.1607 0.0137  0.0120  0.0158  171 GLY A O   
1572 N  N   . LEU A 177 ? 0.1352 0.0347 0.1563 0.0256  0.0177  0.0196  172 LEU A N   
1573 C  CA  . LEU A 177 ? 0.1099 0.0432 0.1385 -0.0027 0.0119  0.0087  172 LEU A CA  
1574 C  C   . LEU A 177 ? 0.1024 0.0516 0.1564 0.0104  0.0067  0.0095  172 LEU A C   
1575 O  O   . LEU A 177 ? 0.0954 0.0475 0.1531 0.0064  0.0017  -0.0005 172 LEU A O   
1576 C  CB  . LEU A 177 ? 0.1344 0.0292 0.1295 0.0010  0.0141  0.0122  172 LEU A CB  
1577 C  CG  . LEU A 177 ? 0.1312 0.0296 0.0827 -0.0054 0.0461  -0.0146 172 LEU A CG  
1578 C  CD1 . LEU A 177 ? 0.1291 0.0924 0.1387 0.0514  0.0123  -0.0245 172 LEU A CD1 
1579 C  CD2 . LEU A 177 ? 0.2225 0.0261 0.1536 0.0044  -0.0110 -0.0096 172 LEU A CD2 
1580 N  N   . ALA A 178 ? 0.1078 0.0467 0.1731 0.0087  -0.0140 0.0238  173 ALA A N   
1581 C  CA  . ALA A 178 ? 0.1105 0.0470 0.1699 0.0229  -0.0267 0.0258  173 ALA A CA  
1582 C  C   . ALA A 178 ? 0.1341 0.0644 0.1753 0.0149  -0.0170 0.0300  173 ALA A C   
1583 O  O   . ALA A 178 ? 0.1538 0.0559 0.1484 0.0164  -0.0387 0.0277  173 ALA A O   
1584 C  CB  . ALA A 178 ? 0.1352 0.0510 0.2018 0.0312  -0.0115 0.0132  173 ALA A CB  
1585 N  N   . LEU A 179 ? 0.1205 0.0475 0.1573 0.0190  -0.0165 0.0454  174 LEU A N   
1586 C  CA  . LEU A 179 ? 0.1401 0.0411 0.1647 0.0116  0.0168  0.0233  174 LEU A CA  
1587 C  C   . LEU A 179 ? 0.1519 0.0359 0.1747 0.0167  0.0000  0.0344  174 LEU A C   
1588 O  O   . LEU A 179 ? 0.1688 0.0558 0.1653 0.0547  0.0037  0.0164  174 LEU A O   
1589 C  CB  . LEU A 179 ? 0.1532 0.0327 0.1739 0.0000  0.0169  0.0329  174 LEU A CB  
1590 C  CG  . LEU A 179 ? 0.1284 0.0410 0.1436 -0.0150 -0.0180 0.0420  174 LEU A CG  
1591 C  CD1 . LEU A 179 ? 0.1165 0.0893 0.2102 -0.0420 -0.0391 0.0395  174 LEU A CD1 
1592 C  CD2 . LEU A 179 ? 0.1595 0.1184 0.1579 0.0097  -0.0380 0.0897  174 LEU A CD2 
1593 N  N   . ASN A 180 ? 0.1496 0.0485 0.1719 0.0433  -0.0077 0.0309  175 ASN A N   
1594 C  CA  . ASN A 180 ? 0.1421 0.0602 0.1473 0.0337  -0.0053 0.0270  175 ASN A CA  
1595 C  C   . ASN A 180 ? 0.1617 0.0517 0.1557 0.0352  -0.0107 0.0336  175 ASN A C   
1596 O  O   . ASN A 180 ? 0.2005 0.0556 0.1699 0.0554  0.0133  0.0332  175 ASN A O   
1597 C  CB  . ASN A 180 ? 0.1399 0.0499 0.1233 0.0287  -0.0153 0.0369  175 ASN A CB  
1598 C  CG  . ASN A 180 ? 0.1420 0.0844 0.1276 0.0278  -0.0051 0.0535  175 ASN A CG  
1599 O  OD1 . ASN A 180 ? 0.1668 0.0545 0.1819 0.0207  0.0140  0.0243  175 ASN A OD1 
1600 N  ND2 . ASN A 180 ? 0.1668 0.0683 0.1280 0.0738  -0.0464 -0.0060 175 ASN A ND2 
1601 N  N   . PHE A 181 ? 0.1686 0.0468 0.1668 0.0335  -0.0037 0.0429  176 PHE A N   
1602 C  CA  . PHE A 181 ? 0.1589 0.0627 0.1476 0.0262  -0.0118 0.0268  176 PHE A CA  
1603 C  C   . PHE A 181 ? 0.1494 0.0646 0.1433 0.0253  -0.0157 0.0307  176 PHE A C   
1604 O  O   . PHE A 181 ? 0.1383 0.0630 0.1640 0.0245  -0.0226 0.0143  176 PHE A O   
1605 C  CB  . PHE A 181 ? 0.1777 0.0545 0.1562 0.0371  0.0015  0.0517  176 PHE A CB  
1606 C  CG  . PHE A 181 ? 0.1471 0.0614 0.1382 0.0554  0.0192  0.0124  176 PHE A CG  
1607 C  CD1 . PHE A 181 ? 0.1056 0.0797 0.1345 0.0337  0.0286  0.0256  176 PHE A CD1 
1608 C  CD2 . PHE A 181 ? 0.1770 0.0676 0.1417 0.0496  -0.0015 -0.0042 176 PHE A CD2 
1609 C  CE1 . PHE A 181 ? 0.1636 0.0432 0.1214 0.0203  -0.0051 0.0268  176 PHE A CE1 
1610 C  CE2 . PHE A 181 ? 0.1886 0.0672 0.1532 0.0181  -0.0018 -0.0119 176 PHE A CE2 
1611 C  CZ  . PHE A 181 ? 0.1458 0.0524 0.1216 0.0378  -0.0106 -0.0133 176 PHE A CZ  
1612 N  N   . SER A 182 ? 0.1377 0.0543 0.1335 0.0310  -0.0316 0.0360  177 SER A N   
1613 C  CA  . SER A 182 ? 0.1642 0.0585 0.1497 0.0264  -0.0174 0.0099  177 SER A CA  
1614 C  C   . SER A 182 ? 0.1867 0.0688 0.1415 0.0335  -0.0280 0.0136  177 SER A C   
1615 O  O   . SER A 182 ? 0.1761 0.0770 0.1584 0.0188  -0.0427 0.0134  177 SER A O   
1616 C  CB  . SER A 182 ? 0.1424 0.1287 0.1644 0.0151  -0.0403 -0.0090 177 SER A CB  
1617 O  OG  . SER A 182 ? 0.1874 0.1171 0.1897 0.0185  -0.0071 -0.0027 177 SER A OG  
1618 N  N   . VAL A 183 ? 0.1863 0.0561 0.1408 0.0487  -0.0243 0.0241  178 VAL A N   
1619 C  CA  . VAL A 183 ? 0.1910 0.0341 0.1374 0.0289  -0.0056 0.0196  178 VAL A CA  
1620 C  C   . VAL A 183 ? 0.1746 0.0502 0.1404 0.0473  -0.0376 0.0205  178 VAL A C   
1621 O  O   . VAL A 183 ? 0.1965 0.0983 0.1606 0.0553  -0.0369 0.0203  178 VAL A O   
1622 C  CB  . VAL A 183 ? 0.1856 0.0391 0.1234 0.0358  -0.0063 0.0161  178 VAL A CB  
1623 C  CG1 . VAL A 183 ? 0.2110 0.0491 0.1600 0.0361  0.0413  -0.0104 178 VAL A CG1 
1624 C  CG2 . VAL A 183 ? 0.1648 0.0342 0.2394 0.0072  0.0015  0.0039  178 VAL A CG2 
1625 N  N   . PHE A 184 ? 0.1691 0.0335 0.1383 0.0162  -0.0248 0.0235  179 PHE A N   
1626 C  CA  . PHE A 184 ? 0.1692 0.0607 0.1363 0.0214  -0.0278 -0.0005 179 PHE A CA  
1627 C  C   . PHE A 184 ? 0.1736 0.0730 0.1484 0.0489  -0.0227 0.0000  179 PHE A C   
1628 O  O   . PHE A 184 ? 0.2034 0.1098 0.1447 0.0567  -0.0086 -0.0084 179 PHE A O   
1629 C  CB  . PHE A 184 ? 0.1602 0.0655 0.1496 0.0054  -0.0186 0.0027  179 PHE A CB  
1630 C  CG  . PHE A 184 ? 0.1500 0.0679 0.1291 0.0090  -0.0074 0.0091  179 PHE A CG  
1631 C  CD1 . PHE A 184 ? 0.1650 0.0983 0.1646 0.0197  0.0052  -0.0304 179 PHE A CD1 
1632 C  CD2 . PHE A 184 ? 0.1183 0.0293 0.1833 -0.0061 -0.0328 -0.0207 179 PHE A CD2 
1633 C  CE1 . PHE A 184 ? 0.1824 0.0772 0.1329 0.0351  0.0069  -0.0329 179 PHE A CE1 
1634 C  CE2 . PHE A 184 ? 0.1563 0.1064 0.1872 0.0262  -0.0031 -0.0169 179 PHE A CE2 
1635 C  CZ  . PHE A 184 ? 0.2209 0.0808 0.1849 0.0643  0.0120  -0.0215 179 PHE A CZ  
1636 N  N   . HIS A 185 ? 0.1502 0.0594 0.1493 0.0392  -0.0359 0.0180  180 HIS A N   
1637 C  CA  . HIS A 185 ? 0.1848 0.0556 0.1462 0.0457  -0.0338 -0.0002 180 HIS A CA  
1638 C  C   . HIS A 185 ? 0.2004 0.0711 0.1630 0.0567  -0.0211 -0.0088 180 HIS A C   
1639 O  O   . HIS A 185 ? 0.2148 0.1042 0.1352 0.0724  -0.0093 0.0150  180 HIS A O   
1640 C  CB  . HIS A 185 ? 0.1615 0.0454 0.1358 0.0522  -0.0299 -0.0127 180 HIS A CB  
1641 C  CG  . HIS A 185 ? 0.1965 0.0546 0.1251 0.0199  0.0029  0.0037  180 HIS A CG  
1642 N  ND1 . HIS A 185 ? 0.1857 0.0413 0.1629 0.0386  -0.0009 0.0300  180 HIS A ND1 
1643 C  CD2 . HIS A 185 ? 0.2007 0.0406 0.1594 0.0517  0.0116  0.0018  180 HIS A CD2 
1644 C  CE1 . HIS A 185 ? 0.1602 0.0951 0.1161 0.0356  -0.0005 -0.0053 180 HIS A CE1 
1645 N  NE2 . HIS A 185 ? 0.1610 0.0859 0.0811 0.0309  -0.0191 0.0131  180 HIS A NE2 
1646 N  N   . TYR A 186 ? 0.1983 0.0455 0.1678 0.0490  -0.0197 -0.0006 181 TYR A N   
1647 C  CA  . TYR A 186 ? 0.2196 0.0676 0.1762 0.0453  -0.0219 -0.0340 181 TYR A CA  
1648 C  C   . TYR A 186 ? 0.2484 0.0778 0.1998 0.0588  -0.0359 -0.0280 181 TYR A C   
1649 O  O   . TYR A 186 ? 0.2661 0.1054 0.1797 0.0894  -0.0366 -0.0587 181 TYR A O   
1650 C  CB  . TYR A 186 ? 0.2197 0.0712 0.1718 0.0187  -0.0102 -0.0166 181 TYR A CB  
1651 C  CG  . TYR A 186 ? 0.2154 0.0797 0.1551 0.0109  -0.0140 -0.0015 181 TYR A CG  
1652 C  CD1 . TYR A 186 ? 0.2521 0.0497 0.2113 0.0006  -0.0716 -0.0123 181 TYR A CD1 
1653 C  CD2 . TYR A 186 ? 0.1947 0.1130 0.1923 -0.0303 -0.0226 0.0289  181 TYR A CD2 
1654 C  CE1 . TYR A 186 ? 0.1987 0.1358 0.2390 -0.0231 -0.0893 -0.0086 181 TYR A CE1 
1655 C  CE2 . TYR A 186 ? 0.1805 0.1088 0.1916 -0.0340 -0.0304 -0.0140 181 TYR A CE2 
1656 C  CZ  . TYR A 186 ? 0.2381 0.1423 0.2468 -0.0126 -0.0861 -0.0161 181 TYR A CZ  
1657 O  OH  . TYR A 186 ? 0.2970 0.1981 0.2733 -0.0448 -0.0541 -0.0730 181 TYR A OH  
1658 N  N   . GLU A 187 ? 0.2754 0.0725 0.2348 0.0850  -0.0412 -0.0158 182 GLU A N   
1659 C  CA  . GLU A 187 ? 0.3221 0.0979 0.2474 0.0897  -0.0429 -0.0121 182 GLU A CA  
1660 C  C   . GLU A 187 ? 0.3091 0.1041 0.2270 0.1037  -0.0456 -0.0184 182 GLU A C   
1661 O  O   . GLU A 187 ? 0.3439 0.1147 0.2101 0.0996  -0.0763 -0.0600 182 GLU A O   
1662 C  CB  . GLU A 187 ? 0.3530 0.1230 0.2697 0.0913  -0.0371 -0.0022 182 GLU A CB  
1663 C  CG  . GLU A 187 ? 0.3788 0.1125 0.2925 0.0502  -0.1247 -0.0148 182 GLU A CG  
1664 C  CD  . GLU A 187 ? 0.4017 0.1832 0.3636 -0.0696 -0.1266 -0.0077 182 GLU A CD  
1665 O  OE1 . GLU A 187 ? 0.3450 0.2715 0.4123 -0.0776 -0.1077 -0.0473 182 GLU A OE1 
1666 O  OE2 . GLU A 187 ? 0.4099 0.1894 0.2712 -0.0901 -0.1335 0.0021  182 GLU A OE2 
1667 N  N   . ILE A 188 ? 0.2844 0.1258 0.1794 0.0884  -0.0405 0.0040  183 ILE A N   
1668 C  CA  . ILE A 188 ? 0.2781 0.1293 0.1723 0.1086  -0.0325 0.0074  183 ILE A CA  
1669 C  C   . ILE A 188 ? 0.2807 0.1356 0.1684 0.1042  -0.0100 -0.0060 183 ILE A C   
1670 O  O   . ILE A 188 ? 0.3050 0.1469 0.1452 0.1423  0.0029  -0.0052 183 ILE A O   
1671 C  CB  . ILE A 188 ? 0.2723 0.1170 0.1486 0.0910  -0.0314 0.0086  183 ILE A CB  
1672 C  CG1 . ILE A 188 ? 0.2946 0.1070 0.1596 0.0713  -0.0329 0.0205  183 ILE A CG1 
1673 C  CG2 . ILE A 188 ? 0.2496 0.0783 0.1382 0.1004  -0.0241 0.0188  183 ILE A CG2 
1674 C  CD1 . ILE A 188 ? 0.3061 0.1214 0.1885 0.1092  -0.0193 0.0856  183 ILE A CD1 
1675 N  N   . ALA A 189 ? 0.2658 0.1225 0.1759 0.1021  -0.0232 0.0030  184 ALA A N   
1676 C  CA  . ALA A 189 ? 0.2527 0.1252 0.1684 0.0949  -0.0251 -0.0157 184 ALA A CA  
1677 C  C   . ALA A 189 ? 0.2370 0.1242 0.1651 0.0973  -0.0253 -0.0166 184 ALA A C   
1678 O  O   . ALA A 189 ? 0.2656 0.1843 0.1833 0.0832  -0.0336 -0.0094 184 ALA A O   
1679 C  CB  . ALA A 189 ? 0.2535 0.0973 0.2183 0.0762  -0.0146 -0.0217 184 ALA A CB  
1680 N  N   . ASN A 190 ? 0.2340 0.1226 0.1585 0.1012  -0.0282 -0.0180 185 ASN A N   
1681 C  CA  . ASN A 190 ? 0.2481 0.1612 0.1777 0.0857  -0.0209 -0.0132 185 ASN A CA  
1682 C  C   . ASN A 190 ? 0.2307 0.1667 0.1633 0.0880  -0.0137 -0.0191 185 ASN A C   
1683 O  O   . ASN A 190 ? 0.2474 0.2060 0.1514 0.0841  -0.0071 -0.0097 185 ASN A O   
1684 C  CB  . ASN A 190 ? 0.2583 0.2013 0.1701 0.0925  -0.0196 -0.0277 185 ASN A CB  
1685 C  CG  . ASN A 190 ? 0.3427 0.2921 0.2790 0.0417  -0.0081 -0.0416 185 ASN A CG  
1686 O  OD1 . ASN A 190 ? 0.4236 0.3197 0.3712 -0.0159 0.0118  -0.0187 185 ASN A OD1 
1687 N  ND2 . ASN A 190 ? 0.3827 0.2797 0.2891 0.1006  0.0262  -0.0408 185 ASN A ND2 
1688 N  N   . SER A 191 ? 0.1922 0.1163 0.1474 0.0708  0.0104  -0.0219 186 SER A N   
1689 C  CA  . SER A 191 ? 0.1870 0.1124 0.1738 0.0602  -0.0024 -0.0134 186 SER A CA  
1690 C  C   . SER A 191 ? 0.1782 0.0919 0.1504 0.0550  -0.0197 -0.0080 186 SER A C   
1691 O  O   . SER A 191 ? 0.1624 0.0769 0.1492 0.0421  -0.0221 0.0114  186 SER A O   
1692 C  CB  . SER A 191 ? 0.2006 0.1135 0.1794 0.0532  0.0165  -0.0298 186 SER A CB  
1693 O  OG  . SER A 191 ? 0.2145 0.1085 0.2296 0.0813  0.0333  -0.0253 186 SER A OG  
1694 N  N   . PRO A 192 ? 0.1811 0.0992 0.1554 0.0273  -0.0200 -0.0187 187 PRO A N   
1695 C  CA  . PRO A 192 ? 0.1700 0.0842 0.1484 0.0403  -0.0211 -0.0150 187 PRO A CA  
1696 C  C   . PRO A 192 ? 0.1511 0.0802 0.1369 0.0318  -0.0249 -0.0189 187 PRO A C   
1697 O  O   . PRO A 192 ? 0.1487 0.1101 0.1448 0.0252  -0.0248 0.0050  187 PRO A O   
1698 C  CB  . PRO A 192 ? 0.2151 0.0868 0.1578 0.0247  -0.0011 -0.0221 187 PRO A CB  
1699 C  CG  . PRO A 192 ? 0.2163 0.1167 0.1415 0.0111  -0.0080 -0.0074 187 PRO A CG  
1700 C  CD  . PRO A 192 ? 0.1619 0.1182 0.1349 0.0345  -0.0323 -0.0351 187 PRO A CD  
1701 N  N   . GLU A 193 ? 0.1635 0.0715 0.1363 0.0404  -0.0276 -0.0142 188 GLU A N   
1702 C  CA  . GLU A 193 ? 0.1678 0.0644 0.1374 0.0495  -0.0375 -0.0053 188 GLU A CA  
1703 C  C   . GLU A 193 ? 0.1383 0.0817 0.1265 0.0416  -0.0336 -0.0007 188 GLU A C   
1704 O  O   . GLU A 193 ? 0.1465 0.0827 0.1193 0.0379  0.0000  0.0095  188 GLU A O   
1705 C  CB  . GLU A 193 ? 0.1639 0.0681 0.1109 0.0326  -0.0414 -0.0171 188 GLU A CB  
1706 C  CG  . GLU A 193 ? 0.2138 0.1407 0.1442 0.0545  -0.0554 -0.0233 188 GLU A CG  
1707 C  CD  . GLU A 193 ? 0.2645 0.1938 0.1664 0.0526  -0.0562 -0.0045 188 GLU A CD  
1708 O  OE1 . GLU A 193 ? 0.2427 0.3338 0.2050 0.0542  -0.0417 0.0206  188 GLU A OE1 
1709 O  OE2 . GLU A 193 ? 0.3034 0.2663 0.1950 0.0466  -0.0529 -0.0213 188 GLU A OE2 
1710 N  N   . GLU A 194 ? 0.1484 0.0804 0.1244 0.0171  -0.0264 0.0146  189 GLU A N   
1711 C  CA  . GLU A 194 ? 0.1442 0.0677 0.1396 0.0069  -0.0300 -0.0036 189 GLU A CA  
1712 C  C   . GLU A 194 ? 0.1553 0.0348 0.1308 0.0053  -0.0305 0.0029  189 GLU A C   
1713 O  O   . GLU A 194 ? 0.1666 0.0447 0.1504 0.0110  -0.0136 0.0072  189 GLU A O   
1714 C  CB  . GLU A 194 ? 0.1252 0.0411 0.1349 -0.0070 -0.0370 -0.0012 189 GLU A CB  
1715 C  CG  . GLU A 194 ? 0.1539 0.0447 0.1311 0.0498  -0.0459 -0.0143 189 GLU A CG  
1716 C  CD  . GLU A 194 ? 0.1894 0.0645 0.1702 0.0495  -0.0718 0.0009  189 GLU A CD  
1717 O  OE1 . GLU A 194 ? 0.2466 0.0773 0.2183 0.0120  -0.0740 -0.0179 189 GLU A OE1 
1718 O  OE2 . GLU A 194 ? 0.1390 0.1142 0.1345 0.0051  -0.0483 0.0059  189 GLU A OE2 
1719 N  N   . ALA A 195 ? 0.1442 0.0402 0.1356 0.0099  -0.0390 0.0323  190 ALA A N   
1720 C  CA  . ALA A 195 ? 0.1454 0.0320 0.1195 0.0228  -0.0078 0.0134  190 ALA A CA  
1721 C  C   . ALA A 195 ? 0.1522 0.0520 0.1283 0.0189  -0.0218 -0.0041 190 ALA A C   
1722 O  O   . ALA A 195 ? 0.1632 0.0623 0.1098 0.0373  0.0165  -0.0036 190 ALA A O   
1723 C  CB  . ALA A 195 ? 0.1909 0.0260 0.1332 -0.0083 -0.0480 0.0079  190 ALA A CB  
1724 N  N   . ILE A 196 ? 0.1248 0.0752 0.1405 0.0336  -0.0139 0.0054  191 ILE A N   
1725 C  CA  . ILE A 196 ? 0.1478 0.1003 0.1722 0.0302  -0.0250 -0.0147 191 ILE A CA  
1726 C  C   . ILE A 196 ? 0.1582 0.0901 0.1583 0.0224  -0.0207 -0.0100 191 ILE A C   
1727 O  O   . ILE A 196 ? 0.1449 0.1102 0.1622 0.0194  -0.0074 0.0068  191 ILE A O   
1728 C  CB  . ILE A 196 ? 0.1400 0.1097 0.1628 0.0268  -0.0278 -0.0268 191 ILE A CB  
1729 C  CG1 . ILE A 196 ? 0.1774 0.0898 0.1781 -0.0086 -0.0480 -0.0460 191 ILE A CG1 
1730 C  CG2 . ILE A 196 ? 0.1215 0.1724 0.1755 0.0211  -0.0414 -0.0085 191 ILE A CG2 
1731 C  CD1 . ILE A 196 ? 0.1775 0.1298 0.1400 0.0091  -0.0516 -0.0339 191 ILE A CD1 
1732 N  N   . SER A 197 ? 0.1575 0.0659 0.1424 0.0173  -0.0216 -0.0024 192 SER A N   
1733 C  CA  A SER A 197 ? 0.1760 0.0897 0.1454 0.0259  -0.0213 0.0000  192 SER A CA  
1734 C  CA  B SER A 197 ? 0.1746 0.0906 0.1470 0.0266  -0.0118 0.0000  192 SER A CA  
1735 C  C   . SER A 197 ? 0.1689 0.0921 0.1527 0.0360  -0.0195 -0.0136 192 SER A C   
1736 O  O   . SER A 197 ? 0.1752 0.0922 0.1106 0.0462  -0.0171 -0.0130 192 SER A O   
1737 C  CB  A SER A 197 ? 0.1859 0.0531 0.1447 0.0217  -0.0267 0.0103  192 SER A CB  
1738 C  CB  B SER A 197 ? 0.1826 0.0599 0.1472 0.0209  -0.0173 0.0107  192 SER A CB  
1739 O  OG  A SER A 197 ? 0.1771 0.0921 0.1394 0.0375  -0.0113 0.0272  192 SER A OG  
1740 O  OG  B SER A 197 ? 0.1682 0.0915 0.1542 0.0452  0.0674  0.0265  192 SER A OG  
1741 N  N   . LEU A 198 ? 0.1452 0.0775 0.1536 0.0334  -0.0364 0.0027  193 LEU A N   
1742 C  CA  . LEU A 198 ? 0.1644 0.0875 0.1354 0.0361  -0.0049 -0.0110 193 LEU A CA  
1743 C  C   . LEU A 198 ? 0.1653 0.0653 0.1345 0.0280  -0.0004 -0.0074 193 LEU A C   
1744 O  O   . LEU A 198 ? 0.1960 0.0887 0.1308 0.0385  0.0299  0.0070  193 LEU A O   
1745 C  CB  . LEU A 198 ? 0.1176 0.1097 0.1375 0.0249  -0.0231 -0.0175 193 LEU A CB  
1746 C  CG  . LEU A 198 ? 0.1344 0.0632 0.1000 0.0445  -0.0093 -0.0091 193 LEU A CG  
1747 C  CD1 . LEU A 198 ? 0.2154 0.0384 0.1631 0.0332  -0.0176 -0.0096 193 LEU A CD1 
1748 C  CD2 . LEU A 198 ? 0.1328 0.1102 0.1482 0.0921  0.0188  -0.0031 193 LEU A CD2 
1749 N  N   . ALA A 199 ? 0.1712 0.0539 0.1273 -0.0005 0.0129  0.0195  194 ALA A N   
1750 C  CA  . ALA A 199 ? 0.1588 0.0775 0.1437 0.0032  0.0100  0.0054  194 ALA A CA  
1751 C  C   . ALA A 199 ? 0.1622 0.0978 0.1392 0.0167  0.0022  -0.0102 194 ALA A C   
1752 O  O   . ALA A 199 ? 0.1912 0.0944 0.1649 -0.0041 -0.0006 -0.0008 194 ALA A O   
1753 C  CB  . ALA A 199 ? 0.1845 0.0831 0.1623 0.0024  0.0041  -0.0162 194 ALA A CB  
1754 N  N   . LYS A 200 ? 0.1372 0.1070 0.1429 0.0338  -0.0138 -0.0080 195 LYS A N   
1755 C  CA  A LYS A 200 ? 0.1414 0.1420 0.1440 0.0260  -0.0098 -0.0080 195 LYS A CA  
1756 C  CA  B LYS A 200 ? 0.1315 0.1362 0.1362 0.0279  -0.0119 -0.0117 195 LYS A CA  
1757 C  C   . LYS A 200 ? 0.1302 0.1382 0.1467 0.0243  -0.0045 -0.0111 195 LYS A C   
1758 O  O   . LYS A 200 ? 0.1495 0.1631 0.1433 0.0173  0.0083  0.0013  195 LYS A O   
1759 C  CB  A LYS A 200 ? 0.1424 0.1523 0.1576 0.0277  -0.0269 -0.0102 195 LYS A CB  
1760 C  CB  B LYS A 200 ? 0.1228 0.1457 0.1496 0.0277  -0.0240 -0.0154 195 LYS A CB  
1761 C  CG  A LYS A 200 ? 0.1685 0.1766 0.1819 0.0298  -0.0379 -0.0255 195 LYS A CG  
1762 C  CG  B LYS A 200 ? 0.1048 0.1225 0.1321 0.0600  -0.0657 -0.0516 195 LYS A CG  
1763 C  CD  A LYS A 200 ? 0.1689 0.2185 0.2344 0.0971  -0.0984 0.0326  195 LYS A CD  
1764 C  CD  B LYS A 200 ? 0.2231 0.2497 0.1621 0.0580  -0.0784 0.0093  195 LYS A CD  
1765 C  CE  A LYS A 200 ? 0.1921 0.3425 0.2916 0.0631  -0.0722 0.0087  195 LYS A CE  
1766 C  CE  B LYS A 200 ? 0.2277 0.2515 0.1798 0.0586  -0.0827 0.0055  195 LYS A CE  
1767 N  NZ  A LYS A 200 ? 0.1775 0.4138 0.3013 0.1128  -0.0749 0.0018  195 LYS A NZ  
1768 N  NZ  B LYS A 200 ? 0.2331 0.2944 0.1322 0.0143  -0.0943 0.0434  195 LYS A NZ  
1769 N  N   . THR A 201 ? 0.1243 0.1473 0.1148 0.0319  -0.0102 0.0127  196 THR A N   
1770 C  CA  A THR A 201 ? 0.1434 0.1569 0.1306 0.0361  -0.0082 0.0130  196 THR A CA  
1771 C  CA  B THR A 201 ? 0.1345 0.1456 0.1255 0.0292  -0.0144 0.0082  196 THR A CA  
1772 C  C   . THR A 201 ? 0.1328 0.1501 0.1360 0.0335  -0.0124 0.0068  196 THR A C   
1773 O  O   . THR A 201 ? 0.1558 0.1662 0.1438 0.0400  -0.0244 0.0186  196 THR A O   
1774 C  CB  A THR A 201 ? 0.1512 0.1765 0.1574 0.0282  -0.0101 0.0094  196 THR A CB  
1775 C  CB  B THR A 201 ? 0.1333 0.1579 0.1375 0.0261  -0.0175 0.0052  196 THR A CB  
1776 O  OG1 A THR A 201 ? 0.1882 0.2270 0.1847 0.0531  -0.0055 0.0352  196 THR A OG1 
1777 O  OG1 B THR A 201 ? 0.1054 0.0819 0.1198 0.0175  -0.0446 -0.0020 196 THR A OG1 
1778 C  CG2 A THR A 201 ? 0.1238 0.1624 0.1328 0.0482  -0.0186 -0.0084 196 THR A CG2 
1779 C  CG2 B THR A 201 ? 0.1584 0.1924 0.1342 0.0171  -0.0247 -0.0076 196 THR A CG2 
1780 N  N   . THR A 202 ? 0.1229 0.1298 0.1137 0.0375  -0.0258 0.0163  197 THR A N   
1781 C  CA  . THR A 202 ? 0.1376 0.1347 0.1329 0.0278  -0.0112 0.0081  197 THR A CA  
1782 C  C   . THR A 202 ? 0.1299 0.1222 0.1543 0.0132  -0.0041 -0.0069 197 THR A C   
1783 O  O   . THR A 202 ? 0.1517 0.1138 0.1350 0.0181  -0.0136 0.0008  197 THR A O   
1784 C  CB  . THR A 202 ? 0.1212 0.1296 0.1218 0.0228  -0.0110 -0.0144 197 THR A CB  
1785 O  OG1 . THR A 202 ? 0.1345 0.1295 0.1536 0.0181  0.0089  0.0006  197 THR A OG1 
1786 C  CG2 . THR A 202 ? 0.1483 0.1782 0.1134 0.0262  -0.0059 0.0152  197 THR A CG2 
1787 N  N   . PHE A 203 ? 0.1525 0.1278 0.1523 0.0084  -0.0015 -0.0088 198 PHE A N   
1788 C  CA  . PHE A 203 ? 0.1438 0.1344 0.1675 0.0077  0.0146  -0.0031 198 PHE A CA  
1789 C  C   . PHE A 203 ? 0.1496 0.1744 0.1691 0.0131  0.0223  -0.0036 198 PHE A C   
1790 O  O   . PHE A 203 ? 0.1651 0.1911 0.1885 0.0185  0.0308  -0.0203 198 PHE A O   
1791 C  CB  . PHE A 203 ? 0.1393 0.1382 0.1521 -0.0072 0.0148  0.0165  198 PHE A CB  
1792 C  CG  . PHE A 203 ? 0.1492 0.1909 0.2052 -0.0076 0.0209  0.0153  198 PHE A CG  
1793 C  CD1 . PHE A 203 ? 0.1599 0.2104 0.1790 -0.0169 0.0626  0.0206  198 PHE A CD1 
1794 C  CD2 . PHE A 203 ? 0.1640 0.1502 0.2014 0.0018  0.0427  0.0206  198 PHE A CD2 
1795 C  CE1 . PHE A 203 ? 0.1536 0.2199 0.2410 -0.0201 0.0484  0.0205  198 PHE A CE1 
1796 C  CE2 . PHE A 203 ? 0.1171 0.2056 0.2608 0.0008  0.0382  0.0004  198 PHE A CE2 
1797 C  CZ  . PHE A 203 ? 0.2133 0.1050 0.2853 0.0525  0.0238  -0.0213 198 PHE A CZ  
1798 N  N   . ASP A 204 ? 0.1577 0.1598 0.1779 0.0258  0.0133  0.0029  199 ASP A N   
1799 C  CA  . ASP A 204 ? 0.1992 0.1569 0.1662 0.0294  0.0095  0.0023  199 ASP A CA  
1800 C  C   . ASP A 204 ? 0.2124 0.1604 0.1612 0.0319  0.0138  0.0032  199 ASP A C   
1801 O  O   . ASP A 204 ? 0.2313 0.1724 0.1661 0.0349  0.0123  0.0028  199 ASP A O   
1802 C  CB  . ASP A 204 ? 0.2132 0.1870 0.1804 0.0415  -0.0001 -0.0031 199 ASP A CB  
1803 C  CG  . ASP A 204 ? 0.2312 0.1863 0.2092 -0.0024 0.0194  0.0345  199 ASP A CG  
1804 O  OD1 . ASP A 204 ? 0.2565 0.2075 0.2382 0.0081  -0.0144 0.0829  199 ASP A OD1 
1805 O  OD2 . ASP A 204 ? 0.2876 0.2372 0.2282 0.0735  -0.0402 0.0291  199 ASP A OD2 
1806 N  N   . GLU A 205 ? 0.2158 0.1383 0.1530 0.0259  -0.0024 -0.0115 200 GLU A N   
1807 C  CA  . GLU A 205 ? 0.2204 0.1678 0.1617 0.0254  0.0000  0.0118  200 GLU A CA  
1808 C  C   . GLU A 205 ? 0.2038 0.1324 0.1553 0.0431  0.0003  -0.0028 200 GLU A C   
1809 O  O   . GLU A 205 ? 0.2279 0.1430 0.1744 0.0214  0.0067  -0.0179 200 GLU A O   
1810 C  CB  . GLU A 205 ? 0.2283 0.1840 0.1490 0.0214  -0.0083 0.0325  200 GLU A CB  
1811 C  CG  . GLU A 205 ? 0.3018 0.2691 0.1827 0.0282  -0.0008 0.0768  200 GLU A CG  
1812 C  CD  . GLU A 205 ? 0.3931 0.4022 0.2612 0.0783  -0.0074 0.0667  200 GLU A CD  
1813 O  OE1 . GLU A 205 ? 0.3846 0.4157 0.3192 0.0668  -0.0461 0.1214  200 GLU A OE1 
1814 O  OE2 . GLU A 205 ? 0.4974 0.3576 0.2695 0.1172  -0.0236 0.0294  200 GLU A OE2 
1815 N  N   . ALA A 206 ? 0.1729 0.0952 0.1564 0.0450  -0.0021 0.0071  201 ALA A N   
1816 C  CA  . ALA A 206 ? 0.1423 0.0855 0.1585 0.0566  -0.0019 -0.0095 201 ALA A CA  
1817 C  C   . ALA A 206 ? 0.1629 0.1310 0.1821 0.0500  -0.0060 -0.0109 201 ALA A C   
1818 O  O   . ALA A 206 ? 0.1291 0.1215 0.1755 0.0461  -0.0028 -0.0282 201 ALA A O   
1819 C  CB  . ALA A 206 ? 0.1793 0.0629 0.1503 0.0730  0.0041  0.0099  201 ALA A CB  
1820 N  N   . MET A 207 ? 0.1256 0.1223 0.2031 0.0376  -0.0090 -0.0036 202 MET A N   
1821 C  CA  . MET A 207 ? 0.1433 0.1565 0.2185 0.0283  -0.0164 0.0041  202 MET A CA  
1822 C  C   . MET A 207 ? 0.1279 0.1756 0.2093 0.0532  -0.0058 0.0012  202 MET A C   
1823 O  O   . MET A 207 ? 0.1562 0.1782 0.1996 0.0597  -0.0154 -0.0013 202 MET A O   
1824 C  CB  . MET A 207 ? 0.2016 0.1747 0.2163 0.0204  -0.0084 0.0042  202 MET A CB  
1825 C  CG  . MET A 207 ? 0.2796 0.2439 0.3226 0.0337  -0.0055 0.0112  202 MET A CG  
1826 S  SD  . MET A 207 ? 0.2956 0.4211 0.4337 0.0098  0.0258  0.0368  202 MET A SD  
1827 C  CE  . MET A 207 ? 0.1812 0.2408 0.3175 0.0920  0.0103  0.0245  202 MET A CE  
1828 N  N   . ALA A 208 ? 0.1516 0.1249 0.1898 0.0526  -0.0229 -0.0072 203 ALA A N   
1829 C  CA  . ALA A 208 ? 0.1509 0.1592 0.2091 0.0660  -0.0259 0.0075  203 ALA A CA  
1830 C  C   . ALA A 208 ? 0.1457 0.1478 0.2101 0.0733  -0.0186 -0.0099 203 ALA A C   
1831 O  O   . ALA A 208 ? 0.1704 0.1228 0.2249 0.0534  -0.0114 -0.0062 203 ALA A O   
1832 C  CB  . ALA A 208 ? 0.1912 0.1548 0.2118 0.0635  -0.0276 0.0060  203 ALA A CB  
1833 N  N   . ASP A 209 ? 0.1511 0.1867 0.2105 0.0551  -0.0328 -0.0014 204 ASP A N   
1834 C  CA  A ASP A 209 ? 0.1369 0.1920 0.2033 0.0433  -0.0233 0.0029  204 ASP A CA  
1835 C  CA  B ASP A 209 ? 0.1390 0.1998 0.2166 0.0406  -0.0298 0.0039  204 ASP A CA  
1836 C  C   . ASP A 209 ? 0.1430 0.2006 0.2070 0.0401  -0.0246 -0.0023 204 ASP A C   
1837 O  O   . ASP A 209 ? 0.1394 0.2043 0.2109 0.0406  -0.0360 0.0209  204 ASP A O   
1838 C  CB  A ASP A 209 ? 0.1324 0.1932 0.2109 0.0469  -0.0153 0.0052  204 ASP A CB  
1839 C  CB  B ASP A 209 ? 0.1404 0.2189 0.2337 0.0384  -0.0265 -0.0004 204 ASP A CB  
1840 C  CG  A ASP A 209 ? 0.1508 0.2135 0.1780 0.0643  -0.0012 0.0153  204 ASP A CG  
1841 C  CG  B ASP A 209 ? 0.1516 0.2288 0.2810 0.0443  -0.0351 0.0237  204 ASP A CG  
1842 O  OD1 A ASP A 209 ? 0.1619 0.2136 0.1589 0.0355  0.0609  0.0492  204 ASP A OD1 
1843 O  OD1 B ASP A 209 ? 0.1826 0.1861 0.3506 0.0325  -0.0523 0.0871  204 ASP A OD1 
1844 O  OD2 A ASP A 209 ? 0.1744 0.1396 0.2532 0.0534  -0.0134 0.0487  204 ASP A OD2 
1845 O  OD2 B ASP A 209 ? 0.1928 0.2773 0.3835 -0.0051 -0.0366 -0.0111 204 ASP A OD2 
1846 N  N   . LEU A 210 ? 0.1330 0.1934 0.1936 0.0280  -0.0142 -0.0013 205 LEU A N   
1847 C  CA  . LEU A 210 ? 0.1709 0.2116 0.1955 0.0261  -0.0136 -0.0144 205 LEU A CA  
1848 C  C   . LEU A 210 ? 0.1444 0.1964 0.1885 0.0363  -0.0156 -0.0208 205 LEU A C   
1849 O  O   . LEU A 210 ? 0.1665 0.1800 0.2029 0.0221  -0.0066 -0.0067 205 LEU A O   
1850 C  CB  . LEU A 210 ? 0.1810 0.2183 0.1971 0.0149  -0.0059 -0.0253 205 LEU A CB  
1851 C  CG  . LEU A 210 ? 0.2022 0.2181 0.1770 0.0209  -0.0129 -0.0143 205 LEU A CG  
1852 C  CD1 . LEU A 210 ? 0.2467 0.2638 0.2156 -0.0106 -0.0411 -0.0373 205 LEU A CD1 
1853 C  CD2 . LEU A 210 ? 0.1959 0.1961 0.2225 -0.0038 -0.0432 0.0147  205 LEU A CD2 
1854 N  N   . HIS A 211 ? 0.1418 0.1898 0.1925 0.0397  -0.0175 -0.0255 206 HIS A N   
1855 C  CA  . HIS A 211 ? 0.1601 0.2375 0.2107 0.0401  -0.0325 -0.0342 206 HIS A CA  
1856 C  C   . HIS A 211 ? 0.1727 0.2413 0.2250 0.0337  -0.0227 -0.0390 206 HIS A C   
1857 O  O   . HIS A 211 ? 0.1910 0.2794 0.2222 0.0168  -0.0229 -0.0510 206 HIS A O   
1858 C  CB  . HIS A 211 ? 0.1736 0.2174 0.2367 0.0504  -0.0213 -0.0262 206 HIS A CB  
1859 C  CG  . HIS A 211 ? 0.2204 0.2716 0.2734 0.0318  -0.0291 -0.0082 206 HIS A CG  
1860 N  ND1 . HIS A 211 ? 0.2108 0.3095 0.2636 0.0292  -0.0321 0.0037  206 HIS A ND1 
1861 C  CD2 . HIS A 211 ? 0.1701 0.2169 0.2466 0.0313  0.0081  -0.0168 206 HIS A CD2 
1862 C  CE1 . HIS A 211 ? 0.2566 0.2916 0.2717 0.0221  -0.0440 0.0052  206 HIS A CE1 
1863 N  NE2 . HIS A 211 ? 0.2390 0.2494 0.2894 0.0393  0.0095  0.0101  206 HIS A NE2 
1864 N  N   . THR A 212 ? 0.1631 0.2188 0.2250 0.0535  -0.0412 -0.0330 207 THR A N   
1865 C  CA  . THR A 212 ? 0.1850 0.2247 0.2381 0.0448  -0.0356 -0.0173 207 THR A CA  
1866 C  C   . THR A 212 ? 0.1742 0.2377 0.2160 0.0532  -0.0268 -0.0197 207 THR A C   
1867 O  O   . THR A 212 ? 0.2260 0.2637 0.2072 0.0436  -0.0017 -0.0403 207 THR A O   
1868 C  CB  . THR A 212 ? 0.1587 0.2072 0.2349 0.0518  -0.0267 -0.0142 207 THR A CB  
1869 O  OG1 . THR A 212 ? 0.1621 0.2130 0.2522 0.0221  -0.0292 -0.0155 207 THR A OG1 
1870 C  CG2 . THR A 212 ? 0.2158 0.1655 0.2400 0.0306  -0.0388 0.0025  207 THR A CG2 
1871 N  N   . LEU A 213 ? 0.1915 0.2590 0.2187 0.0499  -0.0170 -0.0211 208 LEU A N   
1872 C  CA  . LEU A 213 ? 0.1880 0.2581 0.2300 0.0599  -0.0107 -0.0131 208 LEU A CA  
1873 C  C   . LEU A 213 ? 0.2121 0.2918 0.2433 0.0504  -0.0088 0.0009  208 LEU A C   
1874 O  O   . LEU A 213 ? 0.2178 0.3363 0.2488 0.0408  -0.0062 0.0310  208 LEU A O   
1875 C  CB  . LEU A 213 ? 0.2011 0.2644 0.2282 0.0449  -0.0049 -0.0261 208 LEU A CB  
1876 C  CG  . LEU A 213 ? 0.1981 0.2372 0.2017 0.0681  0.0007  -0.0540 208 LEU A CG  
1877 C  CD1 . LEU A 213 ? 0.2369 0.1626 0.2147 0.1397  -0.0019 -0.0390 208 LEU A CD1 
1878 C  CD2 . LEU A 213 ? 0.1534 0.2571 0.2103 0.0652  0.0168  -0.0186 208 LEU A CD2 
1879 N  N   . SER A 214 ? 0.2206 0.3011 0.2513 0.0462  -0.0178 -0.0105 209 SER A N   
1880 C  CA  . SER A 214 ? 0.2539 0.3184 0.2932 0.0429  0.0025  -0.0191 209 SER A CA  
1881 C  C   . SER A 214 ? 0.2857 0.3304 0.3147 0.0410  0.0093  -0.0160 209 SER A C   
1882 O  O   . SER A 214 ? 0.3240 0.3067 0.3306 0.0258  0.0211  -0.0165 209 SER A O   
1883 C  CB  . SER A 214 ? 0.2486 0.3130 0.2696 0.0606  -0.0025 -0.0107 209 SER A CB  
1884 O  OG  . SER A 214 ? 0.2309 0.3605 0.3400 0.0483  -0.0109 -0.0317 209 SER A OG  
1885 N  N   . GLU A 215 ? 0.3184 0.3506 0.3205 0.0500  0.0222  -0.0153 210 GLU A N   
1886 C  CA  . GLU A 215 ? 0.3367 0.3631 0.3333 0.0524  -0.0048 -0.0339 210 GLU A CA  
1887 C  C   . GLU A 215 ? 0.3521 0.3699 0.3253 0.0663  -0.0254 -0.0374 210 GLU A C   
1888 O  O   . GLU A 215 ? 0.3659 0.3578 0.3182 0.0603  -0.0581 -0.0470 210 GLU A O   
1889 C  CB  . GLU A 215 ? 0.3396 0.3844 0.3322 0.0487  0.0106  -0.0413 210 GLU A CB  
1890 C  CG  . GLU A 215 ? 0.3782 0.4437 0.4061 0.0707  0.0027  -0.0406 210 GLU A CG  
1891 N  N   . ASP A 216 ? 0.3550 0.3624 0.3141 0.0728  -0.0500 -0.0371 211 ASP A N   
1892 C  CA  . ASP A 216 ? 0.3611 0.3294 0.2785 0.0820  -0.0395 -0.0490 211 ASP A CA  
1893 C  C   . ASP A 216 ? 0.3717 0.3091 0.3183 0.0745  -0.0395 -0.0479 211 ASP A C   
1894 O  O   . ASP A 216 ? 0.3960 0.2497 0.2664 0.0931  -0.0483 -0.0788 211 ASP A O   
1895 C  CB  . ASP A 216 ? 0.3589 0.3697 0.3259 0.0847  -0.0514 -0.0234 211 ASP A CB  
1896 N  N   . SER A 217 ? 0.3692 0.3028 0.3221 0.0525  -0.0463 -0.0456 212 SER A N   
1897 C  CA  . SER A 217 ? 0.3379 0.3043 0.3084 0.0428  -0.0459 -0.0526 212 SER A CA  
1898 C  C   . SER A 217 ? 0.3331 0.3083 0.3060 0.0411  -0.0324 -0.0451 212 SER A C   
1899 O  O   . SER A 217 ? 0.3179 0.2970 0.2855 0.0345  -0.0177 -0.0583 212 SER A O   
1900 C  CB  . SER A 217 ? 0.3455 0.2836 0.3202 0.0377  -0.0542 -0.0428 212 SER A CB  
1901 O  OG  . SER A 217 ? 0.3328 0.3353 0.3812 0.0560  -0.0958 -0.0644 212 SER A OG  
1902 N  N   . TYR A 218 ? 0.2968 0.3088 0.2934 0.0364  -0.0266 -0.0356 213 TYR A N   
1903 C  CA  A TYR A 218 ? 0.3204 0.3308 0.3049 0.0380  -0.0187 -0.0329 213 TYR A CA  
1904 C  CA  B TYR A 218 ? 0.3169 0.3323 0.3115 0.0354  -0.0217 -0.0338 213 TYR A CA  
1905 C  C   . TYR A 218 ? 0.3368 0.3420 0.3172 0.0402  -0.0150 -0.0322 213 TYR A C   
1906 O  O   . TYR A 218 ? 0.3610 0.3864 0.3230 0.0432  -0.0228 -0.0209 213 TYR A O   
1907 C  CB  A TYR A 218 ? 0.3061 0.3384 0.3069 0.0304  -0.0200 -0.0376 213 TYR A CB  
1908 C  CB  B TYR A 218 ? 0.2976 0.3376 0.3182 0.0240  -0.0261 -0.0403 213 TYR A CB  
1909 C  CG  A TYR A 218 ? 0.2876 0.3342 0.2616 0.0337  -0.0081 -0.0346 213 TYR A CG  
1910 C  CG  B TYR A 218 ? 0.2674 0.3477 0.3046 0.0156  -0.0299 -0.0393 213 TYR A CG  
1911 C  CD1 A TYR A 218 ? 0.2565 0.3561 0.2338 0.0246  0.0033  -0.0172 213 TYR A CD1 
1912 C  CD1 B TYR A 218 ? 0.2194 0.3453 0.3085 0.0023  -0.0205 -0.0335 213 TYR A CD1 
1913 C  CD2 A TYR A 218 ? 0.2938 0.3730 0.2856 0.0181  -0.0124 -0.0217 213 TYR A CD2 
1914 C  CD2 B TYR A 218 ? 0.2357 0.3406 0.3381 -0.0127 -0.0577 -0.0308 213 TYR A CD2 
1915 C  CE1 A TYR A 218 ? 0.2727 0.3622 0.2380 -0.0015 -0.0039 -0.0204 213 TYR A CE1 
1916 C  CE1 B TYR A 218 ? 0.2353 0.3551 0.3011 -0.0139 -0.0472 -0.0347 213 TYR A CE1 
1917 C  CE2 A TYR A 218 ? 0.2738 0.3761 0.2698 0.0079  -0.0111 -0.0272 213 TYR A CE2 
1918 C  CE2 B TYR A 218 ? 0.2266 0.3536 0.2895 -0.0190 -0.0605 -0.0310 213 TYR A CE2 
1919 C  CZ  A TYR A 218 ? 0.2546 0.3736 0.2621 0.0064  -0.0072 -0.0183 213 TYR A CZ  
1920 C  CZ  B TYR A 218 ? 0.2183 0.3553 0.3112 -0.0293 -0.0637 -0.0363 213 TYR A CZ  
1921 O  OH  A TYR A 218 ? 0.1832 0.3868 0.2894 0.0275  0.0199  -0.0171 213 TYR A OH  
1922 O  OH  B TYR A 218 ? 0.1883 0.3063 0.3185 -0.0444 -0.0636 -0.0431 213 TYR A OH  
1923 N  N   . LYS A 219 ? 0.3483 0.3519 0.3245 0.0391  0.0047  -0.0251 214 LYS A N   
1924 C  CA  . LYS A 219 ? 0.3642 0.3402 0.3352 0.0312  0.0296  -0.0278 214 LYS A CA  
1925 C  C   . LYS A 219 ? 0.3706 0.3581 0.3434 0.0247  0.0269  -0.0313 214 LYS A C   
1926 O  O   . LYS A 219 ? 0.3695 0.3400 0.3335 0.0131  0.0553  -0.0322 214 LYS A O   
1927 C  CB  . LYS A 219 ? 0.4017 0.3630 0.3479 0.0313  0.0119  -0.0181 214 LYS A CB  
1928 C  CG  . LYS A 219 ? 0.4576 0.4159 0.4388 0.0444  0.0265  -0.0187 214 LYS A CG  
1929 C  CD  . LYS A 219 ? 0.5257 0.5292 0.4911 0.0190  -0.0232 -0.0083 214 LYS A CD  
1930 C  CE  . LYS A 219 ? 0.4908 0.5337 0.6010 0.0466  -0.0105 -0.0380 214 LYS A CE  
1931 N  NZ  . LYS A 219 ? 0.4962 0.5477 0.6751 0.0200  -0.0076 -0.0493 214 LYS A NZ  
1932 N  N   . ASP A 220 ? 0.3366 0.3591 0.3404 0.0202  0.0328  -0.0402 215 ASP A N   
1933 C  CA  . ASP A 220 ? 0.3563 0.3939 0.3228 -0.0023 0.0257  -0.0182 215 ASP A CA  
1934 C  C   . ASP A 220 ? 0.3660 0.3567 0.3190 -0.0033 0.0096  -0.0073 215 ASP A C   
1935 O  O   . ASP A 220 ? 0.3830 0.3391 0.2917 0.0344  0.0275  -0.0234 215 ASP A O   
1936 C  CB  . ASP A 220 ? 0.3588 0.4332 0.3107 0.0027  0.0283  0.0041  215 ASP A CB  
1937 N  N   . SER A 221 ? 0.3402 0.3312 0.3225 -0.0243 -0.0006 -0.0302 216 SER A N   
1938 C  CA  . SER A 221 ? 0.3635 0.3048 0.3123 -0.0636 0.0003  -0.0356 216 SER A CA  
1939 C  C   . SER A 221 ? 0.3528 0.3231 0.3242 -0.0830 0.0205  -0.0400 216 SER A C   
1940 O  O   . SER A 221 ? 0.3347 0.2789 0.2748 -0.1219 0.0525  -0.0266 216 SER A O   
1941 C  CB  . SER A 221 ? 0.3566 0.3047 0.3183 -0.0687 -0.0056 -0.0378 216 SER A CB  
1942 O  OG  . SER A 221 ? 0.3519 0.2982 0.3245 -0.0620 -0.0128 -0.0708 216 SER A OG  
1943 N  N   . THR A 222 ? 0.3606 0.3131 0.3244 -0.0883 0.0367  -0.0217 217 THR A N   
1944 C  CA  . THR A 222 ? 0.3610 0.3266 0.3130 -0.0741 0.0399  0.0071  217 THR A CA  
1945 C  C   . THR A 222 ? 0.3421 0.3052 0.3041 -0.0758 0.0296  0.0198  217 THR A C   
1946 O  O   . THR A 222 ? 0.3687 0.2744 0.2843 -0.0975 0.0329  -0.0010 217 THR A O   
1947 C  CB  . THR A 222 ? 0.3687 0.3252 0.3293 -0.0541 0.0334  0.0099  217 THR A CB  
1948 O  OG1 . THR A 222 ? 0.4574 0.3649 0.2591 -0.0639 0.1225  0.0575  217 THR A OG1 
1949 C  CG2 . THR A 222 ? 0.3342 0.3533 0.3450 -0.0353 0.0454  0.0168  217 THR A CG2 
1950 N  N   . LEU A 223 ? 0.3410 0.3214 0.2836 -0.0905 0.0215  0.0404  218 LEU A N   
1951 C  CA  . LEU A 223 ? 0.3374 0.2820 0.2893 -0.0933 -0.0047 0.0433  218 LEU A CA  
1952 C  C   . LEU A 223 ? 0.3015 0.2615 0.2961 -0.1021 -0.0143 0.0416  218 LEU A C   
1953 O  O   . LEU A 223 ? 0.3058 0.2125 0.2702 -0.1014 -0.0185 0.0616  218 LEU A O   
1954 C  CB  . LEU A 223 ? 0.3583 0.3154 0.3291 -0.0947 -0.0269 0.0395  218 LEU A CB  
1955 C  CG  . LEU A 223 ? 0.4183 0.3212 0.3417 -0.0723 -0.0585 0.0539  218 LEU A CG  
1956 C  CD1 . LEU A 223 ? 0.4988 0.3842 0.3755 -0.0877 -0.0673 0.1308  218 LEU A CD1 
1957 C  CD2 . LEU A 223 ? 0.4397 0.4372 0.3326 -0.0955 -0.0718 0.0483  218 LEU A CD2 
1958 N  N   . ILE A 224 ? 0.2394 0.2149 0.2588 -0.1051 -0.0220 0.0462  219 ILE A N   
1959 C  CA  A ILE A 224 ? 0.2112 0.2065 0.2493 -0.0617 -0.0241 0.0384  219 ILE A CA  
1960 C  CA  B ILE A 224 ? 0.1993 0.1857 0.2419 -0.0712 -0.0345 0.0344  219 ILE A CA  
1961 C  C   . ILE A 224 ? 0.1864 0.1815 0.2353 -0.0468 -0.0273 0.0303  219 ILE A C   
1962 O  O   . ILE A 224 ? 0.1649 0.1760 0.2324 -0.0390 -0.0229 0.0309  219 ILE A O   
1963 C  CB  A ILE A 224 ? 0.1987 0.1948 0.2467 -0.0626 -0.0348 0.0394  219 ILE A CB  
1964 C  CB  B ILE A 224 ? 0.1866 0.1501 0.2267 -0.0774 -0.0525 0.0374  219 ILE A CB  
1965 C  CG1 A ILE A 224 ? 0.2154 0.1895 0.2552 -0.0260 -0.0260 0.0692  219 ILE A CG1 
1966 C  CG1 B ILE A 224 ? 0.1699 0.0924 0.2442 -0.0707 -0.0747 0.0363  219 ILE A CG1 
1967 C  CG2 A ILE A 224 ? 0.2070 0.1989 0.2598 -0.0541 -0.0295 0.0313  219 ILE A CG2 
1968 C  CG2 B ILE A 224 ? 0.1730 0.1412 0.2165 -0.0703 -0.0537 0.0242  219 ILE A CG2 
1969 C  CD1 A ILE A 224 ? 0.2131 0.1912 0.2378 0.0048  -0.0814 0.0943  219 ILE A CD1 
1970 C  CD1 B ILE A 224 ? 0.1579 0.0880 0.2879 -0.0885 -0.0981 0.0917  219 ILE A CD1 
1971 N  N   . MET A 225 ? 0.1970 0.1758 0.2309 -0.0517 -0.0018 0.0069  220 MET A N   
1972 C  CA  . MET A 225 ? 0.1742 0.1415 0.2268 -0.0270 0.0092  -0.0104 220 MET A CA  
1973 C  C   . MET A 225 ? 0.1882 0.1444 0.2286 -0.0330 0.0160  -0.0021 220 MET A C   
1974 O  O   . MET A 225 ? 0.1838 0.1460 0.2329 -0.0196 0.0022  0.0106  220 MET A O   
1975 C  CB  . MET A 225 ? 0.2000 0.1448 0.2246 -0.0197 0.0223  -0.0281 220 MET A CB  
1976 C  CG  . MET A 225 ? 0.1562 0.0727 0.2147 -0.0103 0.0456  -0.0780 220 MET A CG  
1977 S  SD  . MET A 225 ? 0.3211 0.1645 0.2771 -0.0416 0.0976  -0.0271 220 MET A SD  
1978 C  CE  . MET A 225 ? 0.2623 0.2452 0.3309 -0.0106 0.0382  -0.0412 220 MET A CE  
1979 N  N   . GLN A 226 ? 0.2113 0.1392 0.2283 -0.0592 0.0185  0.0066  221 GLN A N   
1980 C  CA  . GLN A 226 ? 0.2155 0.1583 0.2338 -0.0763 0.0196  0.0082  221 GLN A CA  
1981 C  C   . GLN A 226 ? 0.2056 0.1589 0.2160 -0.0655 0.0073  0.0330  221 GLN A C   
1982 O  O   . GLN A 226 ? 0.1965 0.1664 0.2188 -0.0700 -0.0159 0.0249  221 GLN A O   
1983 C  CB  . GLN A 226 ? 0.2124 0.1521 0.2305 -0.0955 0.0185  0.0048  221 GLN A CB  
1984 C  CG  . GLN A 226 ? 0.2590 0.2186 0.2887 -0.1364 0.0455  -0.0302 221 GLN A CG  
1985 C  CD  . GLN A 226 ? 0.3063 0.2343 0.3433 -0.1061 0.0449  -0.0740 221 GLN A CD  
1986 O  OE1 . GLN A 226 ? 0.3379 0.3088 0.4060 -0.0687 0.0626  -0.1324 221 GLN A OE1 
1987 N  NE2 . GLN A 226 ? 0.3438 0.2951 0.3653 -0.1597 0.0902  -0.0917 221 GLN A NE2 
1988 N  N   . LEU A 227 ? 0.2037 0.1564 0.2032 -0.0524 0.0013  0.0626  222 LEU A N   
1989 C  CA  . LEU A 227 ? 0.1873 0.1287 0.1681 -0.0366 -0.0020 0.0459  222 LEU A CA  
1990 C  C   . LEU A 227 ? 0.1824 0.1153 0.1764 -0.0218 -0.0004 0.0411  222 LEU A C   
1991 O  O   . LEU A 227 ? 0.1557 0.1189 0.1794 -0.0172 0.0008  0.0396  222 LEU A O   
1992 C  CB  . LEU A 227 ? 0.2113 0.1619 0.1732 -0.0147 -0.0179 0.0674  222 LEU A CB  
1993 C  CG  . LEU A 227 ? 0.2264 0.1557 0.1836 -0.0628 -0.0411 0.0646  222 LEU A CG  
1994 C  CD1 . LEU A 227 ? 0.2761 0.1869 0.2256 -0.0343 -0.0668 0.0797  222 LEU A CD1 
1995 C  CD2 . LEU A 227 ? 0.3236 0.1934 0.1733 -0.0554 -0.0464 0.0455  222 LEU A CD2 
1996 N  N   . LEU A 228 ? 0.1641 0.1146 0.1789 -0.0102 0.0180  0.0356  223 LEU A N   
1997 C  CA  . LEU A 228 ? 0.1527 0.0810 0.1772 -0.0159 0.0044  0.0223  223 LEU A CA  
1998 C  C   . LEU A 228 ? 0.1617 0.1426 0.2049 -0.0256 0.0167  0.0125  223 LEU A C   
1999 O  O   . LEU A 228 ? 0.1718 0.1131 0.2382 -0.0185 0.0074  0.0065  223 LEU A O   
2000 C  CB  . LEU A 228 ? 0.1424 0.0799 0.1928 -0.0023 0.0114  0.0171  223 LEU A CB  
2001 C  CG  . LEU A 228 ? 0.1697 0.0681 0.1355 -0.0277 0.0158  -0.0221 223 LEU A CG  
2002 C  CD1 . LEU A 228 ? 0.2774 0.0344 0.2051 -0.0128 0.0519  -0.0404 223 LEU A CD1 
2003 C  CD2 . LEU A 228 ? 0.1693 0.0886 0.1954 0.0054  0.0561  -0.0362 223 LEU A CD2 
2004 N  N   . ARG A 229 ? 0.1803 0.1425 0.2228 -0.0440 0.0181  0.0223  224 ARG A N   
2005 C  CA  A ARG A 229 ? 0.2041 0.1441 0.2316 -0.0505 0.0145  0.0087  224 ARG A CA  
2006 C  CA  B ARG A 229 ? 0.2069 0.1531 0.2309 -0.0495 0.0150  0.0091  224 ARG A CA  
2007 C  C   . ARG A 229 ? 0.2224 0.1575 0.2109 -0.0514 0.0165  0.0057  224 ARG A C   
2008 O  O   . ARG A 229 ? 0.2266 0.1758 0.2079 -0.0635 0.0224  0.0061  224 ARG A O   
2009 C  CB  A ARG A 229 ? 0.2071 0.1685 0.2271 -0.0630 0.0174  0.0107  224 ARG A CB  
2010 C  CB  B ARG A 229 ? 0.2128 0.1709 0.2332 -0.0583 0.0190  0.0115  224 ARG A CB  
2011 C  CG  A ARG A 229 ? 0.2757 0.1716 0.3388 -0.0720 -0.0217 0.0060  224 ARG A CG  
2012 C  CG  B ARG A 229 ? 0.2638 0.2176 0.3312 -0.0605 -0.0129 0.0055  224 ARG A CG  
2013 C  CD  A ARG A 229 ? 0.3796 0.2324 0.3684 -0.0504 -0.0491 -0.0212 224 ARG A CD  
2014 C  CD  B ARG A 229 ? 0.3374 0.2878 0.3814 -0.0555 -0.0177 0.0076  224 ARG A CD  
2015 N  NE  A ARG A 229 ? 0.4335 0.2027 0.4062 -0.0080 -0.0284 -0.0991 224 ARG A NE  
2016 N  NE  B ARG A 229 ? 0.3968 0.3106 0.4527 -0.0252 -0.0126 -0.0426 224 ARG A NE  
2017 C  CZ  A ARG A 229 ? 0.4462 0.2013 0.4035 -0.0251 -0.0273 -0.1043 224 ARG A CZ  
2018 C  CZ  B ARG A 229 ? 0.4225 0.3065 0.4461 -0.0143 -0.0082 -0.0686 224 ARG A CZ  
2019 N  NH1 A ARG A 229 ? 0.4724 0.2358 0.4116 -0.0236 -0.0149 -0.1284 224 ARG A NH1 
2020 N  NH1 B ARG A 229 ? 0.4497 0.3043 0.4849 -0.0299 -0.0176 -0.0631 224 ARG A NH1 
2021 N  NH2 A ARG A 229 ? 0.4643 0.1872 0.3648 0.0203  -0.0447 -0.1721 224 ARG A NH2 
2022 N  NH2 B ARG A 229 ? 0.4062 0.2415 0.4800 0.0072  -0.0105 -0.1022 224 ARG A NH2 
2023 N  N   . ASP A 230 ? 0.2429 0.1445 0.2150 -0.0465 0.0267  0.0053  225 ASP A N   
2024 C  CA  . ASP A 230 ? 0.2696 0.1382 0.1977 -0.0540 0.0122  0.0107  225 ASP A CA  
2025 C  C   . ASP A 230 ? 0.2465 0.1225 0.1931 -0.0609 0.0071  0.0232  225 ASP A C   
2026 O  O   . ASP A 230 ? 0.2459 0.1119 0.1889 -0.0824 0.0063  0.0334  225 ASP A O   
2027 C  CB  . ASP A 230 ? 0.2869 0.1629 0.2165 -0.0620 0.0006  0.0204  225 ASP A CB  
2028 C  CG  . ASP A 230 ? 0.3098 0.1827 0.2244 -0.0589 0.0028  0.0098  225 ASP A CG  
2029 O  OD1 . ASP A 230 ? 0.2931 0.2140 0.2347 -0.1169 0.0171  0.0101  225 ASP A OD1 
2030 O  OD2 . ASP A 230 ? 0.4289 0.2593 0.2187 -0.0661 -0.0386 0.0933  225 ASP A OD2 
2031 N  N   . ASN A 231 ? 0.2087 0.1097 0.1804 -0.0437 0.0062  0.0243  226 ASN A N   
2032 C  CA  . ASN A 231 ? 0.2009 0.1242 0.1751 -0.0403 -0.0126 0.0260  226 ASN A CA  
2033 C  C   . ASN A 231 ? 0.2081 0.1101 0.1803 -0.0288 -0.0121 0.0273  226 ASN A C   
2034 O  O   . ASN A 231 ? 0.2200 0.1157 0.1843 -0.0490 -0.0200 0.0178  226 ASN A O   
2035 C  CB  . ASN A 231 ? 0.2018 0.1110 0.2028 -0.0323 -0.0185 0.0330  226 ASN A CB  
2036 C  CG  . ASN A 231 ? 0.2190 0.1070 0.1728 -0.0127 -0.0346 0.0330  226 ASN A CG  
2037 O  OD1 . ASN A 231 ? 0.2343 0.1107 0.2184 -0.0447 -0.0270 0.0394  226 ASN A OD1 
2038 N  ND2 . ASN A 231 ? 0.2113 0.1384 0.1711 0.0408  -0.0781 0.0256  226 ASN A ND2 
2039 N  N   . LEU A 232 ? 0.1884 0.1088 0.1895 -0.0411 -0.0056 0.0240  227 LEU A N   
2040 C  CA  . LEU A 232 ? 0.1934 0.0989 0.2184 -0.0272 -0.0134 0.0143  227 LEU A CA  
2041 C  C   . LEU A 232 ? 0.2009 0.1192 0.2208 -0.0349 -0.0121 0.0031  227 LEU A C   
2042 O  O   . LEU A 232 ? 0.2003 0.1330 0.2354 -0.0108 -0.0120 -0.0016 227 LEU A O   
2043 C  CB  . LEU A 232 ? 0.2083 0.0624 0.2472 -0.0277 -0.0207 0.0146  227 LEU A CB  
2044 C  CG  . LEU A 232 ? 0.2362 0.1118 0.2243 -0.0447 0.0145  0.0479  227 LEU A CG  
2045 C  CD1 . LEU A 232 ? 0.2995 0.1488 0.2094 -0.0135 0.0042  0.0419  227 LEU A CD1 
2046 C  CD2 . LEU A 232 ? 0.2267 0.1143 0.1744 0.0066  0.0460  0.0576  227 LEU A CD2 
2047 N  N   . THR A 233 ? 0.1999 0.1541 0.2050 -0.0331 -0.0001 -0.0115 228 THR A N   
2048 C  CA  . THR A 233 ? 0.2321 0.1857 0.2380 -0.0501 0.0124  -0.0251 228 THR A CA  
2049 C  C   . THR A 233 ? 0.2293 0.1830 0.2229 -0.0446 -0.0097 -0.0306 228 THR A C   
2050 O  O   . THR A 233 ? 0.2530 0.1856 0.2506 -0.0413 -0.0224 -0.0241 228 THR A O   
2051 C  CB  . THR A 233 ? 0.2409 0.2028 0.2388 -0.0571 0.0328  -0.0444 228 THR A CB  
2052 O  OG1 . THR A 233 ? 0.2392 0.2694 0.2768 -0.0778 0.0244  -0.0622 228 THR A OG1 
2053 C  CG2 . THR A 233 ? 0.2582 0.2701 0.2547 -0.0667 0.0248  -0.0746 228 THR A CG2 
2054 N  N   . LEU A 234 ? 0.2213 0.1738 0.2247 -0.0524 -0.0227 -0.0306 229 LEU A N   
2055 C  CA  . LEU A 234 ? 0.2133 0.1791 0.2263 -0.0546 -0.0352 -0.0170 229 LEU A CA  
2056 C  C   . LEU A 234 ? 0.2327 0.1797 0.2352 -0.0556 -0.0390 -0.0223 229 LEU A C   
2057 O  O   . LEU A 234 ? 0.2778 0.1777 0.2277 -0.0622 -0.0360 -0.0360 229 LEU A O   
2058 C  CB  . LEU A 234 ? 0.2109 0.1830 0.2312 -0.0576 -0.0465 -0.0164 229 LEU A CB  
2059 C  CG  . LEU A 234 ? 0.2601 0.2061 0.2829 -0.0607 -0.0334 -0.0054 229 LEU A CG  
2060 C  CD1 . LEU A 234 ? 0.3266 0.2365 0.3679 -0.1244 -0.0785 -0.0084 229 LEU A CD1 
2061 C  CD2 . LEU A 234 ? 0.2922 0.2933 0.3697 -0.0575 -0.0734 0.0373  229 LEU A CD2 
2062 N  N   . TRP A 235 ? 0.2264 0.1758 0.2289 -0.0660 -0.0385 -0.0098 230 TRP A N   
2063 C  CA  . TRP A 235 ? 0.2314 0.1967 0.2124 -0.0443 -0.0412 -0.0111 230 TRP A CA  
2064 C  C   . TRP A 235 ? 0.2510 0.2202 0.2247 -0.0407 -0.0424 0.0037  230 TRP A C   
2065 O  O   . TRP A 235 ? 0.2872 0.2648 0.2151 -0.0260 -0.0501 -0.0034 230 TRP A O   
2066 C  CB  . TRP A 235 ? 0.2101 0.2201 0.2250 -0.0649 -0.0405 0.0140  230 TRP A CB  
2067 C  CG  . TRP A 235 ? 0.2230 0.1550 0.1985 -0.0224 -0.0259 0.0417  230 TRP A CG  
2068 C  CD1 . TRP A 235 ? 0.2235 0.2101 0.2432 0.0076  -0.0331 0.0519  230 TRP A CD1 
2069 C  CD2 . TRP A 235 ? 0.1918 0.1385 0.2010 -0.0301 -0.0302 0.0411  230 TRP A CD2 
2070 N  NE1 . TRP A 235 ? 0.2171 0.1861 0.1953 -0.0541 -0.0541 0.0003  230 TRP A NE1 
2071 C  CE2 . TRP A 235 ? 0.1726 0.1304 0.1662 -0.0056 0.0192  0.0196  230 TRP A CE2 
2072 C  CE3 . TRP A 235 ? 0.2111 0.1595 0.1978 -0.0367 -0.0437 0.0471  230 TRP A CE3 
2073 C  CZ2 . TRP A 235 ? 0.2207 0.1360 0.2201 -0.0154 -0.0066 -0.0046 230 TRP A CZ2 
2074 C  CZ3 . TRP A 235 ? 0.2042 0.1881 0.1810 -0.0453 -0.0716 0.0245  230 TRP A CZ3 
2075 C  CH2 . TRP A 235 ? 0.2037 0.1150 0.1927 -0.0426 -0.0359 0.0396  230 TRP A CH2 
2076 N  N   . THR A 236 ? 0.2672 0.2795 0.2586 -0.0135 -0.0528 0.0134  231 THR A N   
2077 C  CA  . THR A 236 ? 0.2804 0.3202 0.2927 -0.0134 -0.0439 0.0338  231 THR A CA  
2078 C  C   . THR A 236 ? 0.3123 0.3571 0.3383 -0.0132 -0.0609 0.0415  231 THR A C   
2079 O  O   . THR A 236 ? 0.3435 0.4040 0.3892 -0.0288 -0.0606 0.0551  231 THR A O   
2080 C  CB  . THR A 236 ? 0.2506 0.3153 0.2861 -0.0049 -0.0333 0.0273  231 THR A CB  
2081 O  OG1 . THR A 236 ? 0.2572 0.3420 0.2865 0.0133  -0.0293 0.0448  231 THR A OG1 
2082 C  CG2 . THR A 236 ? 0.3035 0.3189 0.3084 -0.0300 0.0040  0.0247  231 THR A CG2 
2083 O  OXT . THR A 236 ? 0.3413 0.3959 0.3792 -0.0178 -0.0726 0.0479  231 THR A OXT 
2084 N  N   . LYS B 1   ? 0.4567 0.4295 0.4863 -0.0244 0.0126  -0.0242 369 LYS P N   
2085 C  CA  . LYS B 1   ? 0.4507 0.4173 0.4788 -0.0269 0.0055  -0.0059 369 LYS P CA  
2086 C  C   . LYS B 1   ? 0.4187 0.3852 0.4570 -0.0166 -0.0118 0.0020  369 LYS P C   
2087 O  O   . LYS B 1   ? 0.4623 0.4212 0.4699 -0.0061 -0.0183 0.0176  369 LYS P O   
2088 C  CB  . LYS B 1   ? 0.4769 0.4279 0.4913 -0.0208 0.0119  -0.0162 369 LYS P CB  
2089 C  CG  . LYS B 1   ? 0.4999 0.4673 0.5300 -0.0183 0.0160  -0.0195 369 LYS P CG  
2090 C  CD  . LYS B 1   ? 0.5652 0.4615 0.6065 -0.0472 -0.0003 -0.0103 369 LYS P CD  
2091 N  N   . ARG B 2   ? 0.3552 0.3040 0.4285 -0.0124 -0.0264 0.0064  370 ARG P N   
2092 C  CA  A ARG B 2   ? 0.3284 0.2494 0.4019 0.0018  -0.0294 -0.0016 370 ARG P CA  
2093 C  CA  B ARG B 2   ? 0.3173 0.2469 0.3993 -0.0050 -0.0324 0.0007  370 ARG P CA  
2094 C  C   . ARG B 2   ? 0.3006 0.2277 0.3811 -0.0036 -0.0315 0.0032  370 ARG P C   
2095 O  O   . ARG B 2   ? 0.2844 0.2011 0.3860 0.0030  -0.0191 -0.0128 370 ARG P O   
2096 C  CB  A ARG B 2   ? 0.3382 0.2670 0.4074 0.0142  -0.0347 0.0033  370 ARG P CB  
2097 C  CB  B ARG B 2   ? 0.3103 0.2626 0.4037 -0.0015 -0.0349 0.0077  370 ARG P CB  
2098 C  CG  A ARG B 2   ? 0.3340 0.2354 0.4036 0.0340  -0.0272 0.0107  370 ARG P CG  
2099 C  CG  B ARG B 2   ? 0.2707 0.2200 0.3852 -0.0138 -0.0491 0.0269  370 ARG P CG  
2100 C  CD  A ARG B 2   ? 0.4214 0.2189 0.3755 0.1166  -0.0114 0.0223  370 ARG P CD  
2101 C  CD  B ARG B 2   ? 0.2690 0.2135 0.3460 -0.0109 -0.0350 0.0534  370 ARG P CD  
2102 N  NE  A ARG B 2   ? 0.3989 0.1687 0.4112 0.2046  -0.0017 0.0370  370 ARG P NE  
2103 N  NE  B ARG B 2   ? 0.1645 0.1660 0.3343 -0.0011 -0.0505 0.0848  370 ARG P NE  
2104 C  CZ  A ARG B 2   ? 0.3879 0.1537 0.3141 0.2129  0.0123  0.0385  370 ARG P CZ  
2105 C  CZ  B ARG B 2   ? 0.2041 0.2078 0.3030 -0.0335 0.0014  0.0880  370 ARG P CZ  
2106 N  NH1 A ARG B 2   ? 0.4190 0.1466 0.1742 0.2184  0.0366  0.0222  370 ARG P NH1 
2107 N  NH1 B ARG B 2   ? 0.1098 0.0739 0.3165 -0.0271 0.0050  0.1061  370 ARG P NH1 
2108 N  NH2 A ARG B 2   ? 0.4814 0.1980 0.3488 0.2588  0.0159  -0.0414 370 ARG P NH2 
2109 N  NH2 B ARG B 2   ? 0.1272 0.0913 0.2016 0.0007  0.0224  0.1065  370 ARG P NH2 
2110 N  N   . ARG B 3   ? 0.2703 0.1498 0.3438 0.0005  -0.0476 0.0031  371 ARG P N   
2111 C  CA  . ARG B 3   ? 0.2603 0.1431 0.2949 -0.0133 -0.0552 -0.0222 371 ARG P CA  
2112 C  C   . ARG B 3   ? 0.2531 0.1328 0.2887 -0.0019 -0.0546 -0.0185 371 ARG P C   
2113 O  O   . ARG B 3   ? 0.2711 0.1472 0.2821 0.0057  -0.0522 -0.0423 371 ARG P O   
2114 C  CB  . ARG B 3   ? 0.2503 0.0882 0.3165 -0.0263 -0.0691 -0.0142 371 ARG P CB  
2115 C  CG  . ARG B 3   ? 0.2535 0.1403 0.3432 0.0319  -0.0519 -0.0166 371 ARG P CG  
2116 C  CD  . ARG B 3   ? 0.2797 0.1264 0.2468 0.0261  -0.0630 -0.0618 371 ARG P CD  
2117 N  NE  . ARG B 3   ? 0.2501 0.0935 0.2732 0.0261  -0.0878 0.0125  371 ARG P NE  
2118 C  CZ  . ARG B 3   ? 0.2341 0.1099 0.2172 0.0357  -0.0500 0.0055  371 ARG P CZ  
2119 N  NH1 . ARG B 3   ? 0.2689 0.1477 0.2469 0.0143  -0.0238 0.0326  371 ARG P NH1 
2120 N  NH2 . ARG B 3   ? 0.1903 0.1062 0.2741 0.0128  -0.1018 0.0251  371 ARG P NH2 
2121 N  N   . LYS B 4   ? 0.2296 0.1305 0.2731 -0.0089 -0.0476 -0.0115 372 LYS P N   
2122 C  CA  . LYS B 4   ? 0.2152 0.1191 0.2751 -0.0176 -0.0319 -0.0190 372 LYS P CA  
2123 C  C   . LYS B 4   ? 0.2002 0.1383 0.2605 -0.0082 -0.0328 -0.0035 372 LYS P C   
2124 O  O   . LYS B 4   ? 0.2041 0.1014 0.2744 0.0059  -0.0513 0.0050  372 LYS P O   
2125 C  CB  . LYS B 4   ? 0.1722 0.1809 0.2913 -0.0201 -0.0090 -0.0026 372 LYS P CB  
2126 C  CG  . LYS B 4   ? 0.2037 0.2062 0.3438 -0.0634 -0.0053 -0.0009 372 LYS P CG  
2127 C  CD  . LYS B 4   ? 0.2219 0.1956 0.3693 -0.0591 0.0204  -0.0364 372 LYS P CD  
2128 C  CE  . LYS B 4   ? 0.2383 0.2969 0.5116 -0.0864 0.0688  0.0037  372 LYS P CE  
2129 N  NZ  . LYS B 4   ? 0.2951 0.3937 0.5539 -0.0904 0.0722  -0.0230 372 LYS P NZ  
2130 N  N   . SEP B 5   ? 0.2114 0.1105 0.2533 0.0070  -0.0476 0.0014  373 SEP P N   
2131 C  CA  . SEP B 5   ? 0.1948 0.0809 0.2231 -0.0119 -0.0146 0.0170  373 SEP P CA  
2132 C  CB  . SEP B 5   ? 0.2160 0.0702 0.2293 0.0209  -0.0078 0.0228  373 SEP P CB  
2133 O  OG  . SEP B 5   ? 0.2328 0.0773 0.2197 0.0068  0.0016  0.0133  373 SEP P OG  
2134 C  C   . SEP B 5   ? 0.2154 0.0767 0.2094 -0.0172 -0.0005 0.0199  373 SEP P C   
2135 O  O   . SEP B 5   ? 0.2288 0.1084 0.2172 -0.0288 0.0125  0.0279  373 SEP P O   
2136 P  P   . SEP B 5   ? 0.2302 0.1200 0.2043 0.0375  0.0002  0.0206  373 SEP P P   
2137 O  O1P . SEP B 5   ? 0.2811 0.0736 0.2352 0.0473  -0.0053 0.0315  373 SEP P O1P 
2138 O  O2P . SEP B 5   ? 0.2509 0.0672 0.2505 -0.0055 -0.0669 0.0395  373 SEP P O2P 
2139 O  O3P . SEP B 5   ? 0.1872 0.0825 0.2377 -0.0014 -0.0262 -0.0333 373 SEP P O3P 
2140 N  N   . VAL B 6   ? 0.2089 0.1313 0.1801 0.0076  -0.0172 0.0142  374 VAL P N   
2141 C  CA  . VAL B 6   ? 0.2249 0.1142 0.1696 0.0155  -0.0050 0.0266  374 VAL P CA  
2142 C  C   . VAL B 6   ? 0.2410 0.1257 0.1786 0.0144  -0.0150 0.0243  374 VAL P C   
2143 O  O   . VAL B 6   ? 0.2728 0.1428 0.1732 0.0149  -0.0057 0.0146  374 VAL P O   
2144 C  CB  . VAL B 6   ? 0.2471 0.1037 0.1582 0.0380  0.0060  0.0517  374 VAL P CB  
2145 C  CG1 . VAL B 6   ? 0.2000 0.0518 0.1931 0.0524  -0.0130 0.0385  374 VAL P CG1 
2146 C  CG2 . VAL B 6   ? 0.2949 0.1568 0.1567 0.0217  -0.0330 0.0488  374 VAL P CG2 
2147 O  OXT . VAL B 6   ? 0.2296 0.1416 0.1972 -0.0144 -0.0388 0.0335  374 VAL P OXT 
2148 C  C1  . FSC C .   ? 0.1849 0.1576 0.1814 0.0316  0.0163  0.0126  249 FSC A C1  
2149 C  C4  . FSC C .   ? 0.1584 0.1986 0.2109 0.0140  0.0255  0.0400  249 FSC A C4  
2150 C  C11 . FSC C .   ? 0.1550 0.1781 0.2081 0.0295  0.0360  0.0649  249 FSC A C11 
2151 C  C18 . FSC C .   ? 0.1149 0.2468 0.2208 0.0059  -0.0427 0.0384  249 FSC A C18 
2152 C  C17 . FSC C .   ? 0.1925 0.2487 0.2520 0.0065  0.0740  0.1141  249 FSC A C17 
2153 O  O24 . FSC C .   ? 0.2824 0.3146 0.3368 -0.0362 0.1181  0.0713  249 FSC A O24 
2154 C  C31 . FSC C .   ? 0.3377 0.3591 0.4643 -0.0252 0.1350  0.1039  249 FSC A C31 
2155 O  O37 . FSC C .   ? 0.4390 0.3180 0.5757 0.0052  0.1328  0.1161  249 FSC A O37 
2156 C  C36 . FSC C .   ? 0.3623 0.3533 0.5328 0.0172  0.1441  0.0452  249 FSC A C36 
2157 C  C10 . FSC C .   ? 0.1835 0.1609 0.2271 0.0192  -0.0187 0.0049  249 FSC A C10 
2158 C  C6  . FSC C .   ? 0.1818 0.1134 0.2019 0.0142  0.0113  0.0002  249 FSC A C6  
2159 O  O13 . FSC C .   ? 0.1505 0.1646 0.1827 0.0495  0.0170  0.0305  249 FSC A O13 
2160 C  C2  . FSC C .   ? 0.1954 0.1056 0.1352 0.0531  0.0176  -0.0126 249 FSC A C2  
2161 C  C7  . FSC C .   ? 0.1760 0.0522 0.1880 0.0334  -0.0263 -0.0191 249 FSC A C7  
2162 C  C5  . FSC C .   ? 0.2511 0.0874 0.1225 0.0431  -0.0035 0.0154  249 FSC A C5  
2163 C  C12 . FSC C .   ? 0.1892 0.0799 0.1440 0.0598  -0.0004 -0.0128 249 FSC A C12 
2164 C  C20 . FSC C .   ? 0.1786 0.1095 0.1748 0.0483  -0.0142 0.0248  249 FSC A C20 
2165 C  C27 . FSC C .   ? 0.1570 0.0608 0.1950 0.0063  0.0034  0.0414  249 FSC A C27 
2166 O  O32 . FSC C .   ? 0.1248 0.1283 0.2106 0.0245  0.0533  0.0346  249 FSC A O32 
2167 C  C38 . FSC C .   ? 0.0727 0.1668 0.2508 0.0664  0.0080  0.0140  249 FSC A C38 
2168 C  C26 . FSC C .   ? 0.1533 0.1284 0.1695 0.0518  -0.0396 0.0018  249 FSC A C26 
2169 C  C25 . FSC C .   ? 0.1776 0.1594 0.1113 -0.0261 0.0202  0.0175  249 FSC A C25 
2170 C  C19 . FSC C .   ? 0.1964 0.1143 0.1381 0.0793  0.0013  -0.0325 249 FSC A C19 
2171 C  C15 . FSC C .   ? 0.2061 0.1601 0.2028 0.0169  0.0031  -0.0432 249 FSC A C15 
2172 C  C23 . FSC C .   ? 0.1598 0.1955 0.2300 0.0355  0.0139  -0.0289 249 FSC A C23 
2173 C  C9  . FSC C .   ? 0.2610 0.1514 0.2050 0.0769  0.0300  -0.0122 249 FSC A C9  
2174 O  O16 . FSC C .   ? 0.2273 0.1586 0.2026 0.0637  -0.0247 -0.0622 249 FSC A O16 
2175 C  C3  . FSC C .   ? 0.2080 0.1717 0.1876 0.1089  0.0516  -0.0035 249 FSC A C3  
2176 O  O8  . FSC C .   ? 0.2002 0.1495 0.1923 0.0473  0.0226  -0.0085 249 FSC A O8  
2177 C  C14 . FSC C .   ? 0.2214 0.2532 0.1536 0.0992  0.0027  0.0248  249 FSC A C14 
2178 O  O22 . FSC C .   ? 0.2610 0.1977 0.2153 0.0785  -0.0239 -0.0283 249 FSC A O22 
2179 C  C30 . FSC C .   ? 0.2808 0.2082 0.2451 0.0896  0.0229  0.0134  249 FSC A C30 
2180 C  C33 . FSC C .   ? 0.3204 0.2632 0.2708 0.1125  0.0616  -0.0110 249 FSC A C33 
2181 O  O39 . FSC C .   ? 0.3584 0.2666 0.3836 0.0545  0.1104  0.0603  249 FSC A O39 
2182 C  C28 . FSC C .   ? 0.2593 0.3415 0.2534 0.1284  0.0431  0.0164  249 FSC A C28 
2183 O  O34 . FSC C .   ? 0.2711 0.5530 0.2777 0.0889  0.0556  0.0156  249 FSC A O34 
2184 C  C40 . FSC C .   ? 0.3034 0.6696 0.3921 0.0934  -0.0064 0.0565  249 FSC A C40 
2185 O  O43 . FSC C .   ? 0.3443 0.8077 0.4601 0.0820  -0.0373 0.0668  249 FSC A O43 
2186 C  C42 . FSC C .   ? 0.3146 0.7254 0.4026 0.0859  -0.0086 0.0592  249 FSC A C42 
2187 C  C21 . FSC C .   ? 0.2344 0.2963 0.2274 0.1446  0.0146  0.0043  249 FSC A C21 
2188 O  O29 . FSC C .   ? 0.3171 0.2912 0.2146 0.1917  0.0222  -0.0192 249 FSC A O29 
2189 C  C35 . FSC C .   ? 0.3143 0.2469 0.2001 0.1118  -0.0720 0.0179  249 FSC A C35 
2190 O  O41 . FSC C .   ? 0.3769 0.3033 0.2165 0.1351  -0.0369 0.0493  249 FSC A O41 
2191 C  C44 . FSC C .   ? 0.3597 0.3716 0.3604 0.1064  -0.0810 0.0973  249 FSC A C44 
2192 C  C47 . FSC C .   ? 0.2602 0.3986 0.3520 0.0905  -0.1179 0.0966  249 FSC A C47 
2193 C  C46 . FSC C .   ? 0.4152 0.3782 0.3534 0.0638  -0.0827 0.0506  249 FSC A C46 
2194 C  C45 . FSC C .   ? 0.3598 0.4421 0.4426 0.0756  -0.0919 0.1165  249 FSC A C45 
2195 C  C48 . FSC C .   ? 0.4315 0.5544 0.4936 0.0439  -0.0364 0.1208  249 FSC A C48 
2196 CL CL  . CL  D .   ? 0.2485 0.0931 0.2470 -0.0121 -0.0130 -0.0124 250 CL  A CL  
2197 MG MG  . MG  E .   ? 0.1839 0.0864 0.1474 0.0111  0.0212  -0.0364 251 MG  A MG  
2198 MG MG  . MG  F .   ? 0.1492 0.0253 0.1860 0.0000  -0.0565 0.0000  252 MG  A MG  
2199 CA CA  . CA  G .   ? 0.5306 0.3808 0.3551 -0.0088 -0.0797 0.0030  253 CA  A CA  
2200 O  O   . HOH H .   ? 0.1539 0.0297 0.1490 -0.0004 -0.0011 -0.0008 254 HOH A O   
2201 O  O   . HOH H .   ? 0.1939 0.0901 0.1419 -0.0129 0.0581  0.0580  255 HOH A O   
2202 O  O   . HOH H .   ? 0.2512 0.0378 0.1612 0.0082  0.0365  -0.0179 256 HOH A O   
2203 O  O   . HOH H .   ? 0.2312 0.0809 0.0773 -0.0013 -0.0070 -0.0535 257 HOH A O   
2204 O  O   . HOH H .   ? 0.1456 0.1606 0.2337 0.0349  0.0049  0.0571  258 HOH A O   
2205 O  O   . HOH H .   ? 0.1460 0.1857 0.2161 -0.0627 0.0284  -0.0476 259 HOH A O   
2206 O  O   . HOH H .   ? 0.2355 0.0678 0.1456 0.0496  -0.0077 -0.0005 260 HOH A O   
2207 O  O   . HOH H .   ? 0.2310 0.1415 0.1088 -0.0413 -0.0508 0.0045  261 HOH A O   
2208 O  O   . HOH H .   ? 0.1379 0.1457 0.2191 -0.0224 -0.0681 0.0572  262 HOH A O   
2209 O  O   . HOH H .   ? 0.4339 0.3553 0.3070 -0.2783 -0.2601 0.0797  263 HOH A O   
2210 O  O   . HOH H .   ? 0.1363 0.1497 0.2382 0.0247  -0.0609 0.0065  264 HOH A O   
2211 O  O   . HOH H .   ? 0.2650 0.0613 0.1613 -0.0156 0.0261  0.0024  265 HOH A O   
2212 O  O   . HOH H .   ? 0.3185 0.1545 0.1420 0.1025  0.0136  -0.0369 266 HOH A O   
2213 O  O   . HOH H .   ? 0.2491 0.0670 0.1619 -0.0069 0.0107  -0.0212 267 HOH A O   
2214 O  O   . HOH H .   ? 0.3641 0.2168 0.2197 0.0695  -0.0112 -0.0558 268 HOH A O   
2215 O  O   . HOH H .   ? 0.2675 0.0958 0.3152 0.0450  -0.0428 0.0427  269 HOH A O   
2216 O  O   . HOH H .   ? 0.4654 0.1634 0.5739 0.0099  0.3986  0.0222  270 HOH A O   
2217 O  O   . HOH H .   ? 0.3030 0.1106 0.2053 0.0834  -0.0275 -0.0053 271 HOH A O   
2218 O  O   . HOH H .   ? 0.1716 0.2507 0.2680 -0.0534 -0.0616 0.1158  272 HOH A O   
2219 O  O   . HOH H .   ? 0.2209 0.1385 0.2089 0.0379  0.0283  -0.0076 273 HOH A O   
2220 O  O   . HOH H .   ? 0.1822 0.1721 0.1486 -0.0263 -0.0016 -0.0244 274 HOH A O   
2221 O  O   . HOH H .   ? 0.1446 0.1299 0.2434 0.0020  0.0578  -0.0518 275 HOH A O   
2222 O  O   . HOH H .   ? 0.1704 0.1337 0.2927 0.0471  -0.0038 -0.0178 276 HOH A O   
2223 O  O   . HOH H .   ? 0.2030 0.1669 0.1989 0.0527  -0.0107 0.0130  277 HOH A O   
2224 O  O   . HOH H .   ? 0.2566 0.1665 0.2993 0.0623  -0.0656 0.0601  278 HOH A O   
2225 O  O   . HOH H .   ? 0.3563 0.1161 0.3292 -0.0921 0.0591  -0.0708 279 HOH A O   
2226 O  O   . HOH H .   ? 0.2519 0.0984 0.2262 0.0093  0.0437  0.0219  280 HOH A O   
2227 O  O   . HOH H .   ? 0.2969 0.3188 0.1421 -0.0537 -0.0244 -0.0137 281 HOH A O   
2228 O  O   . HOH H .   ? 0.2795 0.1529 0.3451 0.0264  -0.0836 0.0301  282 HOH A O   
2229 O  O   . HOH H .   ? 0.2421 0.2527 0.2488 0.0938  -0.0388 0.0005  283 HOH A O   
2230 O  O   . HOH H .   ? 0.2648 0.1290 0.1413 0.0655  -0.0062 0.0169  284 HOH A O   
2231 O  O   . HOH H .   ? 0.2397 0.1130 0.2460 -0.0234 0.0248  0.0177  285 HOH A O   
2232 O  O   . HOH H .   ? 0.1858 0.1116 0.2075 -0.0050 0.0007  -0.0270 286 HOH A O   
2233 O  O   . HOH H .   ? 0.2174 0.1294 0.1928 0.0461  -0.0402 0.0099  287 HOH A O   
2234 O  O   . HOH H .   ? 0.2764 0.1811 0.3496 0.0484  -0.0593 -0.0804 288 HOH A O   
2235 O  O   . HOH H .   ? 0.3151 0.1553 0.2195 -0.0333 -0.0293 -0.0495 289 HOH A O   
2236 O  O   . HOH H .   ? 0.2453 0.0373 0.2337 0.0512  -0.0453 -0.0072 290 HOH A O   
2237 O  O   . HOH H .   ? 0.1633 0.1764 0.2361 -0.0488 -0.0308 -0.0051 291 HOH A O   
2238 O  O   . HOH H .   ? 0.2910 0.0795 0.2907 0.0685  0.0009  -0.0633 292 HOH A O   
2239 O  O   . HOH H .   ? 0.4071 0.0615 0.1616 0.0582  0.0389  -0.0245 293 HOH A O   
2240 O  O   . HOH H .   ? 0.2328 0.1011 0.3646 -0.0049 -0.0389 -0.0434 294 HOH A O   
2241 O  O   . HOH H .   ? 0.2856 0.3463 0.2574 0.2066  0.0175  0.0618  295 HOH A O   
2242 O  O   . HOH H .   ? 0.2082 0.1113 0.3478 0.0317  -0.0697 -0.0445 296 HOH A O   
2243 O  O   . HOH H .   ? 0.2477 0.1964 0.2667 0.0318  -0.0042 -0.0498 297 HOH A O   
2244 O  O   . HOH H .   ? 0.2069 0.2297 0.1353 -0.0019 -0.0370 0.0482  298 HOH A O   
2245 O  O   . HOH H .   ? 0.2188 0.1471 0.2203 -0.0107 0.0881  0.0336  299 HOH A O   
2246 O  O   . HOH H .   ? 0.7314 0.1314 0.1238 -0.1632 -0.0682 -0.0042 300 HOH A O   
2247 O  O   . HOH H .   ? 0.1762 0.1210 0.2934 -0.0507 -0.0171 0.0268  301 HOH A O   
2248 O  O   . HOH H .   ? 0.3163 0.1190 0.2510 -0.0150 0.0955  -0.0520 302 HOH A O   
2249 O  O   . HOH H .   ? 0.2648 0.1555 0.3241 0.0157  0.0407  0.0133  303 HOH A O   
2250 O  O   . HOH H .   ? 0.1613 0.2054 0.2936 -0.0226 0.0187  -0.0057 304 HOH A O   
2251 O  O   . HOH H .   ? 0.4417 0.0406 0.4877 0.0712  -0.0251 0.0221  305 HOH A O   
2252 O  O   . HOH H .   ? 0.2986 0.1396 0.1765 -0.0051 0.0629  -0.0034 306 HOH A O   
2253 O  O   . HOH H .   ? 0.4683 0.0448 0.2083 0.0032  -0.0668 0.0375  307 HOH A O   
2254 O  O   . HOH H .   ? 0.3951 0.1197 0.1821 -0.1032 0.0093  0.0169  308 HOH A O   
2255 O  O   . HOH H .   ? 0.2903 0.2243 0.2860 0.1170  -0.1152 -0.0393 309 HOH A O   
2256 O  O   . HOH H .   ? 0.5237 0.2731 0.2104 -0.0365 0.0593  -0.0050 310 HOH A O   
2257 O  O   . HOH H .   ? 0.6843 0.1971 0.4445 -0.1091 -0.4085 0.0718  311 HOH A O   
2258 O  O   . HOH H .   ? 0.4045 0.0744 0.2428 0.0036  -0.1309 0.0216  312 HOH A O   
2259 O  O   . HOH H .   ? 0.2678 0.1827 0.1421 -0.0675 0.0435  -0.0592 313 HOH A O   
2260 O  O   . HOH H .   ? 0.3438 0.1300 0.3789 0.0537  0.0449  0.0563  314 HOH A O   
2261 O  O   . HOH H .   ? 0.2738 0.4018 0.1961 0.0288  0.0447  -0.0003 315 HOH A O   
2262 O  O   . HOH H .   ? 1.2114 1.5618 1.3511 1.2522  1.2445  1.3080  316 HOH A O   
2263 O  O   . HOH H .   ? 0.2051 0.1978 0.5933 0.0148  0.0443  -0.1498 317 HOH A O   
2264 O  O   . HOH H .   ? 0.7102 0.3063 0.2710 0.3630  0.0660  0.0423  318 HOH A O   
2265 O  O   . HOH H .   ? 0.2627 0.3009 0.4799 -0.0494 -0.0410 0.0019  319 HOH A O   
2266 O  O   . HOH H .   ? 0.2724 0.7408 0.3415 -0.1592 -0.0342 0.0997  320 HOH A O   
2267 O  O   . HOH H .   ? 0.2943 0.1983 0.3178 0.0765  -0.0331 -0.0150 321 HOH A O   
2268 O  O   . HOH H .   ? 0.1737 0.3323 0.2948 0.0448  0.1122  -0.0446 322 HOH A O   
2269 O  O   . HOH H .   ? 0.2040 0.3700 0.2513 0.0398  -0.0239 -0.0833 323 HOH A O   
2270 O  O   . HOH H .   ? 0.1777 0.4601 0.3720 0.0886  0.0116  -0.0771 324 HOH A O   
2271 O  O   . HOH H .   ? 0.2277 0.7303 0.1554 -0.2786 -0.0467 -0.0495 325 HOH A O   
2272 O  O   . HOH H .   ? 0.3014 0.3588 0.3836 0.0735  -0.1220 0.0936  326 HOH A O   
2273 O  O   . HOH H .   ? 0.2844 0.3825 0.3331 -0.0207 -0.0170 -0.0019 327 HOH A O   
2274 O  O   . HOH H .   ? 0.3495 0.1266 0.3989 -0.0208 0.1892  -0.0941 328 HOH A O   
2275 O  O   . HOH H .   ? 0.3107 0.1844 0.2715 0.0000  -0.0339 0.0144  329 HOH A O   
2276 O  O   . HOH H .   ? 0.1922 0.2541 0.3038 -0.0405 0.0257  -0.0084 330 HOH A O   
2277 O  O   . HOH H .   ? 0.2669 0.2645 0.2574 0.0245  -0.0686 -0.0583 331 HOH A O   
2278 O  O   . HOH H .   ? 0.1842 0.1562 0.3949 0.0100  0.0065  -0.1490 332 HOH A O   
2279 O  O   . HOH H .   ? 0.3809 0.3558 0.3382 -0.0952 -0.0016 0.0678  333 HOH A O   
2280 O  O   . HOH H .   ? 0.2942 0.4927 0.4078 0.0567  -0.0589 0.0451  334 HOH A O   
2281 O  O   . HOH H .   ? 0.4210 0.1551 0.4073 0.0965  -0.1196 0.1491  335 HOH A O   
2282 O  O   . HOH H .   ? 0.3890 0.2996 0.3647 0.0789  0.0389  -0.0602 336 HOH A O   
2283 O  O   . HOH H .   ? 0.3680 0.2812 0.5761 0.0011  0.0485  -0.3063 337 HOH A O   
2284 O  O   . HOH H .   ? 0.5789 0.2684 0.3971 -0.1810 0.0761  -0.1321 338 HOH A O   
2285 O  O   . HOH H .   ? 0.4014 0.1627 0.3482 -0.0038 -0.0478 -0.0382 339 HOH A O   
2286 O  O   . HOH H .   ? 0.5153 0.1993 0.4281 0.0766  0.1154  -0.1038 340 HOH A O   
2287 O  O   . HOH H .   ? 0.2596 0.3894 0.5067 0.0571  0.0652  -0.1340 341 HOH A O   
2288 O  O   . HOH H .   ? 0.3150 0.2109 0.4794 0.0271  0.0631  0.1996  342 HOH A O   
2289 O  O   . HOH H .   ? 0.3852 0.2749 0.3173 0.0947  -0.1447 -0.0242 343 HOH A O   
2290 O  O   . HOH H .   ? 0.3376 0.3633 0.3291 0.0507  -0.0717 -0.1013 344 HOH A O   
2291 O  O   . HOH H .   ? 0.4357 0.3768 0.2047 -0.1093 0.0639  -0.0713 345 HOH A O   
2292 O  O   . HOH H .   ? 0.5179 0.1483 0.2673 -0.2455 -0.0151 0.0006  346 HOH A O   
2293 O  O   . HOH H .   ? 0.7826 0.1479 0.2079 0.1730  -0.0665 0.0399  347 HOH A O   
2294 O  O   . HOH H .   ? 0.2362 0.2523 0.3647 0.0461  -0.0644 -0.0139 348 HOH A O   
2295 O  O   . HOH H .   ? 0.2671 0.3970 0.4086 0.0743  -0.1121 0.0666  349 HOH A O   
2296 O  O   . HOH H .   ? 0.6218 0.4959 0.2501 0.3229  -0.0131 -0.0577 350 HOH A O   
2297 O  O   . HOH H .   ? 0.3635 0.2533 0.3091 -0.0270 0.1196  -0.0138 351 HOH A O   
2298 O  O   . HOH H .   ? 0.2679 0.3271 0.3352 -0.0373 0.0246  0.1035  352 HOH A O   
2299 O  O   . HOH H .   ? 0.2446 0.2982 0.3549 0.1565  -0.0403 -0.0397 353 HOH A O   
2300 O  O   . HOH H .   ? 0.4057 0.1706 0.3247 -0.0667 -0.0071 -0.1165 354 HOH A O   
2301 O  O   . HOH H .   ? 0.3068 0.1652 0.2915 0.0172  0.0116  -0.0069 355 HOH A O   
2302 O  O   . HOH H .   ? 0.9934 0.4208 0.6347 -0.2217 -0.3318 0.0620  356 HOH A O   
2303 O  O   . HOH H .   ? 0.8723 0.3787 0.2234 -0.0105 -0.0386 0.0644  357 HOH A O   
2304 O  O   . HOH H .   ? 0.4226 0.1612 0.2533 0.1100  0.0324  0.0175  358 HOH A O   
2305 O  O   . HOH H .   ? 0.4932 0.4321 0.2143 0.0522  0.0199  0.0365  359 HOH A O   
2306 O  O   . HOH H .   ? 0.3919 0.2061 0.4747 -0.0297 0.0309  0.2386  360 HOH A O   
2307 O  O   . HOH H .   ? 0.8663 0.2388 0.2354 -0.0372 0.0467  -0.0210 361 HOH A O   
2308 O  O   . HOH H .   ? 0.3784 0.1364 0.3871 0.0622  -0.0259 0.0009  362 HOH A O   
2309 O  O   . HOH H .   ? 0.8386 0.7773 0.4993 0.0533  -0.1972 -0.1956 363 HOH A O   
2310 O  O   . HOH H .   ? 0.5327 0.2689 0.5136 -0.0492 -0.2239 0.0683  364 HOH A O   
2311 O  O   . HOH H .   ? 0.2560 0.3820 0.2307 0.0499  -0.0034 -0.0097 365 HOH A O   
2312 O  O   . HOH H .   ? 0.3151 0.7282 0.5347 -0.0551 0.0386  0.2390  366 HOH A O   
2313 O  O   . HOH H .   ? 0.4386 0.1951 0.4234 0.0444  0.1521  0.0506  367 HOH A O   
2314 O  O   . HOH H .   ? 0.6801 0.1033 0.7021 0.0707  -0.4558 -0.0259 368 HOH A O   
2315 O  O   . HOH H .   ? 0.2399 0.4928 0.2405 0.0644  -0.0087 0.0728  369 HOH A O   
2316 O  O   . HOH H .   ? 0.5185 0.2930 0.3067 0.1121  0.0152  0.0123  370 HOH A O   
2317 O  O   . HOH H .   ? 0.3070 0.1492 0.2719 0.0263  -0.0164 -0.0670 371 HOH A O   
2318 O  O   . HOH H .   ? 0.2761 0.5541 0.6223 -0.0582 0.0891  -0.2083 372 HOH A O   
2319 O  O   . HOH H .   ? 0.3101 0.3262 0.2827 0.0314  -0.0613 -0.0032 373 HOH A O   
2320 O  O   . HOH H .   ? 0.4218 0.2568 0.5421 -0.0302 -0.1057 0.1213  374 HOH A O   
2321 O  O   . HOH H .   ? 0.5315 0.1757 0.7540 -0.0329 0.1295  -0.0397 375 HOH A O   
2322 O  O   . HOH H .   ? 0.3296 0.1637 0.3297 -0.0303 0.0165  0.0192  376 HOH A O   
2323 O  O   . HOH H .   ? 0.2330 0.4661 0.3185 0.0727  -0.0612 -0.0960 377 HOH A O   
2324 O  O   . HOH H .   ? 0.3697 0.3856 0.6730 0.0775  -0.1318 0.2481  378 HOH A O   
2325 O  O   . HOH H .   ? 0.2434 0.3418 0.2217 -0.0179 -0.0530 -0.0449 379 HOH A O   
2326 O  O   . HOH H .   ? 0.3275 0.2191 0.4431 0.0994  -0.0810 -0.0561 380 HOH A O   
2327 O  O   . HOH H .   ? 0.2413 0.5740 0.6374 -0.0352 0.0032  -0.0733 381 HOH A O   
2328 O  O   . HOH H .   ? 0.5893 0.2132 0.3345 -0.1085 0.0418  0.0602  382 HOH A O   
2329 O  O   . HOH H .   ? 0.5076 0.3833 0.3366 0.0442  -0.1192 -0.1182 383 HOH A O   
2330 O  O   . HOH H .   ? 0.3508 0.3401 0.3432 0.1045  0.0596  -0.2186 384 HOH A O   
2331 O  O   . HOH H .   ? 0.2769 0.4188 0.5477 0.0639  0.0185  -0.0184 385 HOH A O   
2332 O  O   . HOH H .   ? 0.3077 0.2711 0.3834 0.1056  -0.0679 0.1122  386 HOH A O   
2333 O  O   . HOH H .   ? 0.4301 0.2279 0.2942 -0.1171 0.0179  -0.0786 387 HOH A O   
2334 O  O   . HOH H .   ? 0.4706 0.9984 0.3656 -0.4203 -0.0680 0.0641  388 HOH A O   
2335 O  O   . HOH H .   ? 0.4385 0.2132 0.2779 0.0287  0.1332  0.0505  389 HOH A O   
2336 O  O   . HOH H .   ? 0.2104 0.4565 0.4303 0.0505  -0.0752 0.0493  390 HOH A O   
2337 O  O   . HOH H .   ? 0.4571 0.3185 0.6881 0.0064  0.3671  0.0478  391 HOH A O   
2338 O  O   . HOH H .   ? 0.3391 0.2314 0.5242 -0.1695 -0.0896 0.0332  392 HOH A O   
2339 O  O   . HOH H .   ? 0.3374 0.3511 0.1913 -0.0335 -0.0080 -0.0366 393 HOH A O   
2340 O  O   . HOH H .   ? 0.4453 0.4598 0.3297 -0.1139 -0.1818 0.0476  394 HOH A O   
2341 O  O   . HOH H .   ? 0.4000 0.2521 0.3539 -0.0820 -0.0737 0.0884  395 HOH A O   
2342 O  O   . HOH H .   ? 0.4375 0.2360 0.6130 0.1767  -0.0559 0.0326  396 HOH A O   
2343 O  O   . HOH H .   ? 0.3400 0.2383 0.3345 -0.0574 0.0564  0.0033  397 HOH A O   
2344 O  O   . HOH H .   ? 0.4789 0.1396 0.6988 0.0226  -0.1851 -0.0681 398 HOH A O   
2345 O  O   . HOH H .   ? 0.4047 0.4017 0.5935 -0.1952 -0.0164 0.0403  399 HOH A O   
2346 O  O   . HOH H .   ? 0.2631 0.3383 0.3616 0.0640  0.0115  0.0489  400 HOH A O   
2347 O  O   . HOH H .   ? 0.3997 0.2027 0.3202 -0.0869 0.1164  -0.0651 401 HOH A O   
2348 O  O   . HOH H .   ? 0.4803 0.2041 0.2544 0.0256  -0.0582 -0.1094 402 HOH A O   
2349 O  O   . HOH H .   ? 0.5073 0.2614 0.3965 0.0158  0.1459  -0.0054 403 HOH A O   
2350 O  O   . HOH H .   ? 0.5752 0.3456 0.2984 -0.0947 -0.1146 0.0005  404 HOH A O   
2351 O  O   . HOH H .   ? 0.2386 0.2410 0.6691 0.0557  -0.0836 0.0350  405 HOH A O   
2352 O  O   . HOH H .   ? 0.4666 0.3438 0.4871 0.0039  -0.0486 -0.1671 406 HOH A O   
2353 O  O   . HOH H .   ? 0.9839 0.1670 0.4169 -0.0330 0.0030  0.0009  407 HOH A O   
2354 O  O   . HOH H .   ? 0.4237 0.4121 0.2901 -0.0607 0.0756  0.1369  408 HOH A O   
2355 O  O   . HOH H .   ? 0.3534 0.2634 0.4945 -0.1177 -0.0755 -0.1320 409 HOH A O   
2356 O  O   . HOH H .   ? 0.5270 0.1816 0.2543 0.1423  -0.1154 -0.0657 410 HOH A O   
2357 O  O   . HOH H .   ? 0.4714 0.3285 0.2544 0.0560  0.1334  -0.0525 411 HOH A O   
2358 O  O   . HOH H .   ? 0.4954 0.6322 0.3326 -0.1546 -0.0836 -0.0637 412 HOH A O   
2359 O  O   . HOH H .   ? 0.3718 0.2017 0.3271 0.0586  -0.1225 0.0133  413 HOH A O   
2360 O  O   . HOH H .   ? 0.2523 0.2681 0.5360 0.0701  -0.0263 -0.0166 414 HOH A O   
2361 O  O   . HOH H .   ? 0.4249 0.4581 0.5027 0.0090  0.1529  0.1855  415 HOH A O   
2362 O  O   . HOH H .   ? 0.3317 0.2680 0.4761 -0.0278 -0.1636 -0.1060 416 HOH A O   
2363 O  O   . HOH H .   ? 0.1047 1.7394 0.5134 -0.1483 -0.1866 0.0826  417 HOH A O   
2364 O  O   . HOH H .   ? 0.4953 0.4706 0.5136 0.1327  -0.2113 -0.1493 418 HOH A O   
2365 O  O   . HOH H .   ? 0.4319 0.4751 0.2990 0.2050  -0.0919 -0.0117 419 HOH A O   
2366 O  O   . HOH H .   ? 0.3598 0.3591 0.4373 0.1047  0.0806  0.1336  420 HOH A O   
2367 O  O   . HOH H .   ? 1.0157 1.0247 1.0185 -0.8875 -0.9586 0.8902  421 HOH A O   
2368 O  O   . HOH H .   ? 0.2573 0.2988 0.5092 0.1030  0.0452  -0.1292 422 HOH A O   
2369 O  O   . HOH H .   ? 0.3667 0.1430 0.4685 -0.0662 -0.0511 0.0271  423 HOH A O   
2370 O  O   . HOH H .   ? 0.6058 0.4030 0.3862 0.2862  -0.1667 -0.2077 424 HOH A O   
2371 O  O   . HOH H .   ? 0.8037 0.3428 0.5931 0.2114  -0.0434 -0.2313 425 HOH A O   
2372 O  O   . HOH H .   ? 0.2727 0.3797 0.4481 0.1112  0.0281  -0.0767 426 HOH A O   
2373 O  O   . HOH H .   ? 0.7983 0.9429 1.5579 0.5965  -0.4225 -0.6116 427 HOH A O   
2374 O  O   . HOH H .   ? 0.3131 0.2178 0.3834 0.0411  -0.0306 -0.0583 428 HOH A O   
2375 O  O   . HOH H .   ? 0.3224 0.2698 0.9888 0.0832  -0.0553 -0.0726 429 HOH A O   
2376 O  O   . HOH H .   ? 0.4645 0.5171 0.6140 -0.2329 -0.2547 0.2813  430 HOH A O   
2377 O  O   . HOH H .   ? 1.1913 0.1803 1.5861 -0.3778 -0.4223 0.1755  431 HOH A O   
2378 O  O   . HOH H .   ? 0.3697 0.2468 0.3688 0.0798  0.0202  0.1082  432 HOH A O   
2379 O  O   . HOH H .   ? 0.3279 0.2265 0.2470 -0.0384 -0.0129 -0.0665 433 HOH A O   
2380 O  O   . HOH H .   ? 0.2802 0.4377 0.4092 -0.0230 -0.0106 -0.0648 434 HOH A O   
2381 O  O   . HOH H .   ? 0.3459 0.5149 0.5462 0.0022  -0.0147 0.2496  435 HOH A O   
2382 O  O   . HOH H .   ? 0.5903 0.3468 1.0658 -0.1078 -0.5368 -0.0484 436 HOH A O   
2383 O  O   . HOH H .   ? 0.1915 0.1263 0.1997 -0.0187 0.0028  0.0178  437 HOH A O   
2384 O  O   . HOH H .   ? 0.2258 0.0906 0.2910 0.0648  0.0072  0.0737  438 HOH A O   
2385 O  O   . HOH H .   ? 0.3977 0.7177 0.4490 0.1139  0.1722  0.2141  439 HOH A O   
2386 O  O   . HOH H .   ? 0.6174 0.1445 0.8203 -0.0597 -0.2097 0.0080  440 HOH A O   
2387 O  O   . HOH H .   ? 0.5611 0.2448 0.5676 -0.1749 -0.1263 -0.0086 441 HOH A O   
2388 O  O   . HOH H .   ? 0.2202 0.7712 0.8637 -0.1391 -0.0902 0.4066  442 HOH A O   
2389 O  O   . HOH H .   ? 0.4230 0.3880 0.2874 0.0009  -0.0272 -0.0435 443 HOH A O   
2390 O  O   . HOH H .   ? 0.5828 0.3181 0.6681 -0.0917 -0.3827 0.3131  444 HOH A O   
2391 O  O   . HOH H .   ? 0.4496 0.3018 0.3341 0.1360  -0.0745 -0.0012 445 HOH A O   
2392 O  O   . HOH H .   ? 0.7398 0.4408 0.5799 -0.2405 0.0515  0.0120  446 HOH A O   
2393 O  O   . HOH H .   ? 0.2880 0.1778 0.2742 -0.0895 0.0836  -0.0141 447 HOH A O   
2394 O  O   . HOH H .   ? 0.5361 0.7672 0.5727 0.0307  -0.0583 -0.0096 448 HOH A O   
2395 O  O   . HOH H .   ? 0.4853 0.3065 0.4216 0.0631  -0.1219 -0.1138 449 HOH A O   
2396 O  O   . HOH H .   ? 0.5492 0.4224 0.3437 0.0678  0.0351  -0.0484 450 HOH A O   
2397 O  O   . HOH H .   ? 0.3596 0.3457 0.4194 -0.0564 0.0423  0.1165  451 HOH A O   
2398 O  O   . HOH I .   ? 0.2002 0.0931 0.2698 0.0312  0.0307  0.0542  64  HOH P O   
2399 O  O   . HOH I .   ? 0.3664 0.1178 0.2998 -0.0025 -0.1246 -0.0069 72  HOH P O   
2400 O  O   . HOH I .   ? 0.5149 0.4461 0.4926 -0.0791 -0.0632 0.0453  154 HOH P O   
2401 O  O   . HOH I .   ? 0.6436 0.2154 0.2809 -0.1446 -0.0230 0.0249  178 HOH P O   
2402 O  O   . HOH I .   ? 0.7636 0.3787 0.5403 -0.2172 -0.2350 0.1001  232 HOH P O   
2403 O  O   . HOH I .   ? 1.2609 0.6452 0.5383 -0.3388 0.0704  -0.2188 452 HOH P O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -4  -4  GLY GLY A . n 
A 1 2   ALA 2   -3  -3  ALA ALA A . n 
A 1 3   MET 3   -2  -2  MET MET A . n 
A 1 4   GLY 4   -1  -1  GLY GLY A . n 
A 1 5   SER 5   0   0   SER SER A . n 
A 1 6   MET 6   1   1   MET MET A . n 
A 1 7   GLU 7   2   2   GLU GLU A . n 
A 1 8   ARG 8   3   3   ARG ARG A . n 
A 1 9   ALA 9   4   4   ALA ALA A . n 
A 1 10  SER 10  5   5   SER SER A . n 
A 1 11  LEU 11  6   6   LEU LEU A . n 
A 1 12  ILE 12  7   7   ILE ILE A . n 
A 1 13  GLN 13  8   8   GLN GLN A . n 
A 1 14  LYS 14  9   9   LYS LYS A . n 
A 1 15  ALA 15  10  10  ALA ALA A . n 
A 1 16  LYS 16  11  11  LYS LYS A . n 
A 1 17  LEU 17  12  12  LEU LEU A . n 
A 1 18  ALA 18  13  13  ALA ALA A . n 
A 1 19  GLU 19  14  14  GLU GLU A . n 
A 1 20  GLN 20  15  15  GLN GLN A . n 
A 1 21  ALA 21  16  16  ALA ALA A . n 
A 1 22  GLU 22  17  17  GLU GLU A . n 
A 1 23  ARG 23  18  18  ARG ARG A . n 
A 1 24  TYR 24  19  19  TYR TYR A . n 
A 1 25  GLU 25  20  20  GLU GLU A . n 
A 1 26  ASP 26  21  21  ASP ASP A . n 
A 1 27  MET 27  22  22  MET MET A . n 
A 1 28  ALA 28  23  23  ALA ALA A . n 
A 1 29  ALA 29  24  24  ALA ALA A . n 
A 1 30  PHE 30  25  25  PHE PHE A . n 
A 1 31  MET 31  26  26  MET MET A . n 
A 1 32  LYS 32  27  27  LYS LYS A . n 
A 1 33  GLY 33  28  28  GLY GLY A . n 
A 1 34  ALA 34  29  29  ALA ALA A . n 
A 1 35  VAL 35  30  30  VAL VAL A . n 
A 1 36  GLU 36  31  31  GLU GLU A . n 
A 1 37  LYS 37  32  32  LYS LYS A . n 
A 1 38  GLY 38  33  33  GLY GLY A . n 
A 1 39  GLU 39  34  34  GLU GLU A . n 
A 1 40  GLU 40  35  35  GLU GLU A . n 
A 1 41  LEU 41  36  36  LEU LEU A . n 
A 1 42  SER 42  37  37  SER SER A . n 
A 1 43  ASN 43  38  38  ASN ASN A . n 
A 1 44  GLU 44  39  39  GLU GLU A . n 
A 1 45  GLU 45  40  40  GLU GLU A . n 
A 1 46  ARG 46  41  41  ARG ARG A . n 
A 1 47  ASN 47  42  42  ASN ASN A . n 
A 1 48  LEU 48  43  43  LEU LEU A . n 
A 1 49  LEU 49  44  44  LEU LEU A . n 
A 1 50  SER 50  45  45  SER SER A . n 
A 1 51  VAL 51  46  46  VAL VAL A . n 
A 1 52  ALA 52  47  47  ALA ALA A . n 
A 1 53  TYR 53  48  48  TYR TYR A . n 
A 1 54  LYS 54  49  49  LYS LYS A . n 
A 1 55  ASN 55  50  50  ASN ASN A . n 
A 1 56  VAL 56  51  51  VAL VAL A . n 
A 1 57  VAL 57  52  52  VAL VAL A . n 
A 1 58  GLY 58  53  53  GLY GLY A . n 
A 1 59  GLY 59  54  54  GLY GLY A . n 
A 1 60  GLN 60  55  55  GLN GLN A . n 
A 1 61  ARG 61  56  56  ARG ARG A . n 
A 1 62  ALA 62  57  57  ALA ALA A . n 
A 1 63  ALA 63  58  58  ALA ALA A . n 
A 1 64  TRP 64  59  59  TRP TRP A . n 
A 1 65  ARG 65  60  60  ARG ARG A . n 
A 1 66  VAL 66  61  61  VAL VAL A . n 
A 1 67  LEU 67  62  62  LEU LEU A . n 
A 1 68  SER 68  63  63  SER SER A . n 
A 1 69  SER 69  64  64  SER SER A . n 
A 1 70  ILE 70  65  65  ILE ILE A . n 
A 1 71  GLU 71  66  66  GLU GLU A . n 
A 1 72  GLN 72  67  67  GLN GLN A . n 
A 1 73  LYS 73  68  68  LYS LYS A . n 
A 1 74  SER 74  69  69  SER SER A . n 
A 1 75  ASN 75  70  70  ASN ASN A . n 
A 1 76  GLU 76  71  71  GLU GLU A . n 
A 1 77  GLU 77  72  72  GLU GLU A . n 
A 1 78  GLY 78  73  73  GLY GLY A . n 
A 1 79  SER 79  74  74  SER SER A . n 
A 1 80  GLU 80  75  75  GLU GLU A . n 
A 1 81  GLU 81  76  76  GLU GLU A . n 
A 1 82  LYS 82  77  77  LYS LYS A . n 
A 1 83  GLY 83  78  78  GLY GLY A . n 
A 1 84  PRO 84  79  79  PRO PRO A . n 
A 1 85  GLU 85  80  80  GLU GLU A . n 
A 1 86  VAL 86  81  81  VAL VAL A . n 
A 1 87  ARG 87  82  82  ARG ARG A . n 
A 1 88  GLU 88  83  83  GLU GLU A . n 
A 1 89  TYR 89  84  84  TYR TYR A . n 
A 1 90  ARG 90  85  85  ARG ARG A . n 
A 1 91  GLU 91  86  86  GLU GLU A . n 
A 1 92  LYS 92  87  87  LYS LYS A . n 
A 1 93  VAL 93  88  88  VAL VAL A . n 
A 1 94  GLU 94  89  89  GLU GLU A . n 
A 1 95  THR 95  90  90  THR THR A . n 
A 1 96  GLU 96  91  91  GLU GLU A . n 
A 1 97  LEU 97  92  92  LEU LEU A . n 
A 1 98  GLN 98  93  93  GLN GLN A . n 
A 1 99  GLY 99  94  94  GLY GLY A . n 
A 1 100 VAL 100 95  95  VAL VAL A . n 
A 1 101 CYS 101 96  96  CYS CYS A . n 
A 1 102 ASP 102 97  97  ASP ASP A . n 
A 1 103 THR 103 98  98  THR THR A . n 
A 1 104 VAL 104 99  99  VAL VAL A . n 
A 1 105 LEU 105 100 100 LEU LEU A . n 
A 1 106 GLY 106 101 101 GLY GLY A . n 
A 1 107 LEU 107 102 102 LEU LEU A . n 
A 1 108 LEU 108 103 103 LEU LEU A . n 
A 1 109 ASP 109 104 104 ASP ASP A . n 
A 1 110 SER 110 105 105 SER SER A . n 
A 1 111 HIS 111 106 106 HIS HIS A . n 
A 1 112 LEU 112 107 107 LEU LEU A . n 
A 1 113 ILE 113 108 108 ILE ILE A . n 
A 1 114 LYS 114 109 109 LYS LYS A . n 
A 1 115 GLU 115 110 110 GLU GLU A . n 
A 1 116 ALA 116 111 111 ALA ALA A . n 
A 1 117 GLY 117 112 112 GLY GLY A . n 
A 1 118 ASP 118 113 113 ASP ASP A . n 
A 1 119 ALA 119 114 114 ALA ALA A . n 
A 1 120 GLU 120 115 115 GLU GLU A . n 
A 1 121 SER 121 116 116 SER SER A . n 
A 1 122 ARG 122 117 117 ARG ARG A . n 
A 1 123 VAL 123 118 118 VAL VAL A . n 
A 1 124 PHE 124 119 119 PHE PHE A . n 
A 1 125 TYR 125 120 120 TYR TYR A . n 
A 1 126 LEU 126 121 121 LEU LEU A . n 
A 1 127 LYS 127 122 122 LYS LYS A . n 
A 1 128 MET 128 123 123 MET MET A . n 
A 1 129 LYS 129 124 124 LYS LYS A . n 
A 1 130 GLY 130 125 125 GLY GLY A . n 
A 1 131 ASP 131 126 126 ASP ASP A . n 
A 1 132 TYR 132 127 127 TYR TYR A . n 
A 1 133 TYR 133 128 128 TYR TYR A . n 
A 1 134 ARG 134 129 129 ARG ARG A . n 
A 1 135 TYR 135 130 130 TYR TYR A . n 
A 1 136 LEU 136 131 131 LEU LEU A . n 
A 1 137 ALA 137 132 132 ALA ALA A . n 
A 1 138 GLU 138 133 133 GLU GLU A . n 
A 1 139 VAL 139 134 134 VAL VAL A . n 
A 1 140 ALA 140 135 135 ALA ALA A . n 
A 1 141 THR 141 136 136 THR THR A . n 
A 1 142 GLY 142 137 137 GLY GLY A . n 
A 1 143 ASP 143 138 138 ASP ASP A . n 
A 1 144 ASP 144 139 139 ASP ASP A . n 
A 1 145 LYS 145 140 140 LYS LYS A . n 
A 1 146 LYS 146 141 141 LYS LYS A . n 
A 1 147 ARG 147 142 142 ARG ARG A . n 
A 1 148 ILE 148 143 143 ILE ILE A . n 
A 1 149 ILE 149 144 144 ILE ILE A . n 
A 1 150 ASP 150 145 145 ASP ASP A . n 
A 1 151 SER 151 146 146 SER SER A . n 
A 1 152 ALA 152 147 147 ALA ALA A . n 
A 1 153 ARG 153 148 148 ARG ARG A . n 
A 1 154 SER 154 149 149 SER SER A . n 
A 1 155 ALA 155 150 150 ALA ALA A . n 
A 1 156 TYR 156 151 151 TYR TYR A . n 
A 1 157 GLN 157 152 152 GLN GLN A . n 
A 1 158 GLU 158 153 153 GLU GLU A . n 
A 1 159 ALA 159 154 154 ALA ALA A . n 
A 1 160 MET 160 155 155 MET MET A . n 
A 1 161 ASP 161 156 156 ASP ASP A . n 
A 1 162 ILE 162 157 157 ILE ILE A . n 
A 1 163 SER 163 158 158 SER SER A . n 
A 1 164 LYS 164 159 159 LYS LYS A . n 
A 1 165 LYS 165 160 160 LYS LYS A . n 
A 1 166 GLU 166 161 161 GLU GLU A . n 
A 1 167 MET 167 162 162 MET MET A . n 
A 1 168 PRO 168 163 163 PRO PRO A . n 
A 1 169 PRO 169 164 164 PRO PRO A . n 
A 1 170 THR 170 165 165 THR THR A . n 
A 1 171 HIS 171 166 166 HIS HIS A . n 
A 1 172 PRO 172 167 167 PRO PRO A . n 
A 1 173 ILE 173 168 168 ILE ILE A . n 
A 1 174 ARG 174 169 169 ARG ARG A . n 
A 1 175 LEU 175 170 170 LEU LEU A . n 
A 1 176 GLY 176 171 171 GLY GLY A . n 
A 1 177 LEU 177 172 172 LEU LEU A . n 
A 1 178 ALA 178 173 173 ALA ALA A . n 
A 1 179 LEU 179 174 174 LEU LEU A . n 
A 1 180 ASN 180 175 175 ASN ASN A . n 
A 1 181 PHE 181 176 176 PHE PHE A . n 
A 1 182 SER 182 177 177 SER SER A . n 
A 1 183 VAL 183 178 178 VAL VAL A . n 
A 1 184 PHE 184 179 179 PHE PHE A . n 
A 1 185 HIS 185 180 180 HIS HIS A . n 
A 1 186 TYR 186 181 181 TYR TYR A . n 
A 1 187 GLU 187 182 182 GLU GLU A . n 
A 1 188 ILE 188 183 183 ILE ILE A . n 
A 1 189 ALA 189 184 184 ALA ALA A . n 
A 1 190 ASN 190 185 185 ASN ASN A . n 
A 1 191 SER 191 186 186 SER SER A . n 
A 1 192 PRO 192 187 187 PRO PRO A . n 
A 1 193 GLU 193 188 188 GLU GLU A . n 
A 1 194 GLU 194 189 189 GLU GLU A . n 
A 1 195 ALA 195 190 190 ALA ALA A . n 
A 1 196 ILE 196 191 191 ILE ILE A . n 
A 1 197 SER 197 192 192 SER SER A . n 
A 1 198 LEU 198 193 193 LEU LEU A . n 
A 1 199 ALA 199 194 194 ALA ALA A . n 
A 1 200 LYS 200 195 195 LYS LYS A . n 
A 1 201 THR 201 196 196 THR THR A . n 
A 1 202 THR 202 197 197 THR THR A . n 
A 1 203 PHE 203 198 198 PHE PHE A . n 
A 1 204 ASP 204 199 199 ASP ASP A . n 
A 1 205 GLU 205 200 200 GLU GLU A . n 
A 1 206 ALA 206 201 201 ALA ALA A . n 
A 1 207 MET 207 202 202 MET MET A . n 
A 1 208 ALA 208 203 203 ALA ALA A . n 
A 1 209 ASP 209 204 204 ASP ASP A . n 
A 1 210 LEU 210 205 205 LEU LEU A . n 
A 1 211 HIS 211 206 206 HIS HIS A . n 
A 1 212 THR 212 207 207 THR THR A . n 
A 1 213 LEU 213 208 208 LEU LEU A . n 
A 1 214 SER 214 209 209 SER SER A . n 
A 1 215 GLU 215 210 210 GLU GLU A . n 
A 1 216 ASP 216 211 211 ASP ASP A . n 
A 1 217 SER 217 212 212 SER SER A . n 
A 1 218 TYR 218 213 213 TYR TYR A . n 
A 1 219 LYS 219 214 214 LYS LYS A . n 
A 1 220 ASP 220 215 215 ASP ASP A . n 
A 1 221 SER 221 216 216 SER SER A . n 
A 1 222 THR 222 217 217 THR THR A . n 
A 1 223 LEU 223 218 218 LEU LEU A . n 
A 1 224 ILE 224 219 219 ILE ILE A . n 
A 1 225 MET 225 220 220 MET MET A . n 
A 1 226 GLN 226 221 221 GLN GLN A . n 
A 1 227 LEU 227 222 222 LEU LEU A . n 
A 1 228 LEU 228 223 223 LEU LEU A . n 
A 1 229 ARG 229 224 224 ARG ARG A . n 
A 1 230 ASP 230 225 225 ASP ASP A . n 
A 1 231 ASN 231 226 226 ASN ASN A . n 
A 1 232 LEU 232 227 227 LEU LEU A . n 
A 1 233 THR 233 228 228 THR THR A . n 
A 1 234 LEU 234 229 229 LEU LEU A . n 
A 1 235 TRP 235 230 230 TRP TRP A . n 
A 1 236 THR 236 231 231 THR THR A . n 
B 2 1   LYS 1   369 369 LYS LYS P . n 
B 2 2   ARG 2   370 370 ARG ARG P . n 
B 2 3   ARG 3   371 371 ARG ARG P . n 
B 2 4   LYS 4   372 372 LYS LYS P . n 
B 2 5   SEP 5   373 373 SEP SEP P . n 
B 2 6   VAL 6   374 374 VAL VAL P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 FSC 1   249 249 FSC FSC A . 
D 4 CL  1   250 250 CL  CL  A . 
E 5 MG  1   251 251 MG  MG  A . 
F 5 MG  1   252 252 MG  MG  A . 
G 6 CA  1   253 253 CA  CA  A . 
H 7 HOH 1   254 254 HOH HOH A . 
H 7 HOH 2   255 255 HOH HOH A . 
H 7 HOH 3   256 256 HOH HOH A . 
H 7 HOH 4   257 257 HOH HOH A . 
H 7 HOH 5   258 258 HOH HOH A . 
H 7 HOH 6   259 259 HOH HOH A . 
H 7 HOH 7   260 260 HOH HOH A . 
H 7 HOH 8   261 261 HOH HOH A . 
H 7 HOH 9   262 262 HOH HOH A . 
H 7 HOH 10  263 263 HOH HOH A . 
H 7 HOH 11  264 264 HOH HOH A . 
H 7 HOH 12  265 265 HOH HOH A . 
H 7 HOH 13  266 266 HOH HOH A . 
H 7 HOH 14  267 267 HOH HOH A . 
H 7 HOH 15  268 268 HOH HOH A . 
H 7 HOH 16  269 269 HOH HOH A . 
H 7 HOH 17  270 270 HOH HOH A . 
H 7 HOH 18  271 271 HOH HOH A . 
H 7 HOH 19  272 272 HOH HOH A . 
H 7 HOH 20  273 273 HOH HOH A . 
H 7 HOH 21  274 274 HOH HOH A . 
H 7 HOH 22  275 275 HOH HOH A . 
H 7 HOH 23  276 276 HOH HOH A . 
H 7 HOH 24  277 277 HOH HOH A . 
H 7 HOH 25  278 278 HOH HOH A . 
H 7 HOH 26  279 279 HOH HOH A . 
H 7 HOH 27  280 280 HOH HOH A . 
H 7 HOH 28  281 281 HOH HOH A . 
H 7 HOH 29  282 282 HOH HOH A . 
H 7 HOH 30  283 283 HOH HOH A . 
H 7 HOH 31  284 284 HOH HOH A . 
H 7 HOH 32  285 285 HOH HOH A . 
H 7 HOH 33  286 286 HOH HOH A . 
H 7 HOH 34  287 287 HOH HOH A . 
H 7 HOH 35  288 288 HOH HOH A . 
H 7 HOH 36  289 289 HOH HOH A . 
H 7 HOH 37  290 290 HOH HOH A . 
H 7 HOH 38  291 291 HOH HOH A . 
H 7 HOH 39  292 292 HOH HOH A . 
H 7 HOH 40  293 293 HOH HOH A . 
H 7 HOH 41  294 294 HOH HOH A . 
H 7 HOH 42  295 295 HOH HOH A . 
H 7 HOH 43  296 296 HOH HOH A . 
H 7 HOH 44  297 297 HOH HOH A . 
H 7 HOH 45  298 298 HOH HOH A . 
H 7 HOH 46  299 299 HOH HOH A . 
H 7 HOH 47  300 300 HOH HOH A . 
H 7 HOH 48  301 301 HOH HOH A . 
H 7 HOH 49  302 302 HOH HOH A . 
H 7 HOH 50  303 303 HOH HOH A . 
H 7 HOH 51  304 304 HOH HOH A . 
H 7 HOH 52  305 305 HOH HOH A . 
H 7 HOH 53  306 306 HOH HOH A . 
H 7 HOH 54  307 307 HOH HOH A . 
H 7 HOH 55  308 308 HOH HOH A . 
H 7 HOH 56  309 309 HOH HOH A . 
H 7 HOH 57  310 310 HOH HOH A . 
H 7 HOH 58  311 311 HOH HOH A . 
H 7 HOH 59  312 312 HOH HOH A . 
H 7 HOH 60  313 313 HOH HOH A . 
H 7 HOH 61  314 314 HOH HOH A . 
H 7 HOH 62  315 315 HOH HOH A . 
H 7 HOH 63  316 316 HOH HOH A . 
H 7 HOH 64  317 317 HOH HOH A . 
H 7 HOH 65  318 318 HOH HOH A . 
H 7 HOH 66  319 319 HOH HOH A . 
H 7 HOH 67  320 320 HOH HOH A . 
H 7 HOH 68  321 321 HOH HOH A . 
H 7 HOH 69  322 322 HOH HOH A . 
H 7 HOH 70  323 323 HOH HOH A . 
H 7 HOH 71  324 324 HOH HOH A . 
H 7 HOH 72  325 325 HOH HOH A . 
H 7 HOH 73  326 326 HOH HOH A . 
H 7 HOH 74  327 327 HOH HOH A . 
H 7 HOH 75  328 328 HOH HOH A . 
H 7 HOH 76  329 329 HOH HOH A . 
H 7 HOH 77  330 330 HOH HOH A . 
H 7 HOH 78  331 331 HOH HOH A . 
H 7 HOH 79  332 332 HOH HOH A . 
H 7 HOH 80  333 333 HOH HOH A . 
H 7 HOH 81  334 334 HOH HOH A . 
H 7 HOH 82  335 335 HOH HOH A . 
H 7 HOH 83  336 336 HOH HOH A . 
H 7 HOH 84  337 337 HOH HOH A . 
H 7 HOH 85  338 338 HOH HOH A . 
H 7 HOH 86  339 339 HOH HOH A . 
H 7 HOH 87  340 340 HOH HOH A . 
H 7 HOH 88  341 341 HOH HOH A . 
H 7 HOH 89  342 342 HOH HOH A . 
H 7 HOH 90  343 343 HOH HOH A . 
H 7 HOH 91  344 344 HOH HOH A . 
H 7 HOH 92  345 345 HOH HOH A . 
H 7 HOH 93  346 346 HOH HOH A . 
H 7 HOH 94  347 347 HOH HOH A . 
H 7 HOH 95  348 348 HOH HOH A . 
H 7 HOH 96  349 349 HOH HOH A . 
H 7 HOH 97  350 350 HOH HOH A . 
H 7 HOH 98  351 351 HOH HOH A . 
H 7 HOH 99  352 352 HOH HOH A . 
H 7 HOH 100 353 353 HOH HOH A . 
H 7 HOH 101 354 354 HOH HOH A . 
H 7 HOH 102 355 355 HOH HOH A . 
H 7 HOH 103 356 356 HOH HOH A . 
H 7 HOH 104 357 357 HOH HOH A . 
H 7 HOH 105 358 358 HOH HOH A . 
H 7 HOH 106 359 359 HOH HOH A . 
H 7 HOH 107 360 360 HOH HOH A . 
H 7 HOH 108 361 361 HOH HOH A . 
H 7 HOH 109 362 362 HOH HOH A . 
H 7 HOH 110 363 363 HOH HOH A . 
H 7 HOH 111 364 364 HOH HOH A . 
H 7 HOH 112 365 365 HOH HOH A . 
H 7 HOH 113 366 366 HOH HOH A . 
H 7 HOH 114 367 367 HOH HOH A . 
H 7 HOH 115 368 368 HOH HOH A . 
H 7 HOH 116 369 369 HOH HOH A . 
H 7 HOH 117 370 370 HOH HOH A . 
H 7 HOH 118 371 371 HOH HOH A . 
H 7 HOH 119 372 372 HOH HOH A . 
H 7 HOH 120 373 373 HOH HOH A . 
H 7 HOH 121 374 374 HOH HOH A . 
H 7 HOH 122 375 375 HOH HOH A . 
H 7 HOH 123 376 376 HOH HOH A . 
H 7 HOH 124 377 377 HOH HOH A . 
H 7 HOH 125 378 378 HOH HOH A . 
H 7 HOH 126 379 379 HOH HOH A . 
H 7 HOH 127 380 380 HOH HOH A . 
H 7 HOH 128 381 381 HOH HOH A . 
H 7 HOH 129 382 382 HOH HOH A . 
H 7 HOH 130 383 383 HOH HOH A . 
H 7 HOH 131 384 384 HOH HOH A . 
H 7 HOH 132 385 385 HOH HOH A . 
H 7 HOH 133 386 386 HOH HOH A . 
H 7 HOH 134 387 387 HOH HOH A . 
H 7 HOH 135 388 388 HOH HOH A . 
H 7 HOH 136 389 389 HOH HOH A . 
H 7 HOH 137 390 390 HOH HOH A . 
H 7 HOH 138 391 391 HOH HOH A . 
H 7 HOH 139 392 392 HOH HOH A . 
H 7 HOH 140 393 393 HOH HOH A . 
H 7 HOH 141 394 394 HOH HOH A . 
H 7 HOH 142 395 395 HOH HOH A . 
H 7 HOH 143 396 396 HOH HOH A . 
H 7 HOH 144 397 397 HOH HOH A . 
H 7 HOH 145 398 398 HOH HOH A . 
H 7 HOH 146 399 399 HOH HOH A . 
H 7 HOH 147 400 400 HOH HOH A . 
H 7 HOH 148 401 401 HOH HOH A . 
H 7 HOH 149 402 402 HOH HOH A . 
H 7 HOH 150 403 403 HOH HOH A . 
H 7 HOH 151 404 404 HOH HOH A . 
H 7 HOH 152 405 405 HOH HOH A . 
H 7 HOH 153 406 406 HOH HOH A . 
H 7 HOH 154 407 407 HOH HOH A . 
H 7 HOH 155 408 408 HOH HOH A . 
H 7 HOH 156 409 409 HOH HOH A . 
H 7 HOH 157 410 410 HOH HOH A . 
H 7 HOH 158 411 411 HOH HOH A . 
H 7 HOH 159 412 412 HOH HOH A . 
H 7 HOH 160 413 413 HOH HOH A . 
H 7 HOH 161 414 414 HOH HOH A . 
H 7 HOH 162 415 415 HOH HOH A . 
H 7 HOH 163 416 416 HOH HOH A . 
H 7 HOH 164 417 417 HOH HOH A . 
H 7 HOH 165 418 418 HOH HOH A . 
H 7 HOH 166 419 419 HOH HOH A . 
H 7 HOH 167 420 420 HOH HOH A . 
H 7 HOH 168 421 421 HOH HOH A . 
H 7 HOH 169 422 422 HOH HOH A . 
H 7 HOH 170 423 423 HOH HOH A . 
H 7 HOH 171 424 424 HOH HOH A . 
H 7 HOH 172 425 425 HOH HOH A . 
H 7 HOH 173 426 426 HOH HOH A . 
H 7 HOH 174 427 427 HOH HOH A . 
H 7 HOH 175 428 428 HOH HOH A . 
H 7 HOH 176 429 429 HOH HOH A . 
H 7 HOH 177 430 430 HOH HOH A . 
H 7 HOH 178 431 431 HOH HOH A . 
H 7 HOH 179 432 432 HOH HOH A . 
H 7 HOH 180 433 433 HOH HOH A . 
H 7 HOH 181 434 434 HOH HOH A . 
H 7 HOH 182 435 435 HOH HOH A . 
H 7 HOH 183 436 436 HOH HOH A . 
H 7 HOH 184 437 437 HOH HOH A . 
H 7 HOH 185 438 438 HOH HOH A . 
H 7 HOH 186 439 439 HOH HOH A . 
H 7 HOH 187 440 440 HOH HOH A . 
H 7 HOH 188 441 441 HOH HOH A . 
H 7 HOH 189 442 442 HOH HOH A . 
H 7 HOH 190 443 443 HOH HOH A . 
H 7 HOH 191 444 444 HOH HOH A . 
H 7 HOH 192 445 445 HOH HOH A . 
H 7 HOH 193 446 446 HOH HOH A . 
H 7 HOH 194 447 447 HOH HOH A . 
H 7 HOH 195 448 448 HOH HOH A . 
H 7 HOH 196 449 449 HOH HOH A . 
H 7 HOH 197 450 450 HOH HOH A . 
H 7 HOH 198 451 451 HOH HOH A . 
I 7 HOH 1   64  64  HOH HOH P . 
I 7 HOH 2   72  72  HOH HOH P . 
I 7 HOH 3   154 154 HOH HOH P . 
I 7 HOH 4   178 178 HOH HOH P . 
I 7 HOH 5   232 232 HOH HOH P . 
I 7 HOH 6   452 452 HOH HOH P . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    SEP 
_pdbx_struct_mod_residue.label_seq_id     5 
_pdbx_struct_mod_residue.auth_asym_id     P 
_pdbx_struct_mod_residue.auth_comp_id     SEP 
_pdbx_struct_mod_residue.auth_seq_id      373 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          PHOSPHOSERINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4160  ? 
1 MORE         -10   ? 
1 'SSA (A^2)'  23410 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    MG 
_pdbx_struct_special_symmetry.auth_seq_id     252 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   MG 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A GLU 115 ? A GLU 110 ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 OE1 ? A GLU 40 ? A GLU 35  ? 1_555 89.8  ? 
2  O   ? A GLU 115 ? A GLU 110 ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 OE2 ? A GLU 40 ? A GLU 35  ? 1_555 87.3  ? 
3  OE1 ? A GLU 40  ? A GLU 35  ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 OE2 ? A GLU 40 ? A GLU 35  ? 1_555 51.0  ? 
4  O   ? A GLU 115 ? A GLU 110 ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 O   ? H HOH .  ? A HOH 397 ? 1_555 85.1  ? 
5  OE1 ? A GLU 40  ? A GLU 35  ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 O   ? H HOH .  ? A HOH 397 ? 1_555 80.7  ? 
6  OE2 ? A GLU 40  ? A GLU 35  ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 O   ? H HOH .  ? A HOH 397 ? 1_555 131.1 ? 
7  O   ? A GLU 115 ? A GLU 110 ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 O   ? H HOH .  ? A HOH 423 ? 1_555 170.9 ? 
8  OE1 ? A GLU 40  ? A GLU 35  ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 O   ? H HOH .  ? A HOH 423 ? 1_555 81.7  ? 
9  OE2 ? A GLU 40  ? A GLU 35  ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 O   ? H HOH .  ? A HOH 423 ? 1_555 84.8  ? 
10 O   ? H HOH .   ? A HOH 397 ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 O   ? H HOH .  ? A HOH 423 ? 1_555 96.5  ? 
11 OE1 ? A GLU 7   ? A GLU 2   ? 1_555 MG ? F MG . ? A MG 252 ? 1_555 O   ? H HOH .  ? A HOH 334 ? 1_555 77.1  ? 
12 OE1 ? A GLU 7   ? A GLU 2   ? 1_555 MG ? F MG . ? A MG 252 ? 1_555 O   ? H HOH .  ? A HOH 262 ? 1_555 80.7  ? 
13 O   ? H HOH .   ? A HOH 334 ? 1_555 MG ? F MG . ? A MG 252 ? 1_555 O   ? H HOH .  ? A HOH 262 ? 1_555 72.6  ? 
14 OG  B A SER 50  ? A SER 45  ? 1_555 CA ? G CA . ? A CA 253 ? 1_555 O13 ? C FSC .  ? A FSC 249 ? 1_555 148.3 ? 
15 OG  B A SER 50  ? A SER 45  ? 1_555 CA ? G CA . ? A CA 253 ? 1_555 OG  A A SER 50 ? A SER 45  ? 1_555 38.1  ? 
16 O13 ? C FSC .   ? A FSC 249 ? 1_555 CA ? G CA . ? A CA 253 ? 1_555 OG  A A SER 50 ? A SER 45  ? 1_555 119.7 ? 
17 OG  B A SER 50  ? A SER 45  ? 1_555 CA ? G CA . ? A CA 253 ? 1_555 O   ? I HOH .  ? P HOH 64  ? 1_555 66.7  ? 
18 O13 ? C FSC .   ? A FSC 249 ? 1_555 CA ? G CA . ? A CA 253 ? 1_555 O   ? I HOH .  ? P HOH 64  ? 1_555 108.9 ? 
19 OG  A A SER 50  ? A SER 45  ? 1_555 CA ? G CA . ? A CA 253 ? 1_555 O   ? I HOH .  ? P HOH 64  ? 1_555 99.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-10-12 
2 'Structure model' 1 1 2017-06-07 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345 'data collection' software ? 1 
PHASER phasing           .        ? 2 
REFMAC refinement        5.5.0102 ? 3 
XDS    'data reduction'  .        ? 4 
XSCALE 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 A ASN 38  ? B NH2 A ARG 41  ? ? 1.87 
2 1 O   A HOH 340 ? ? O   A HOH 389 ? ? 2.02 
3 1 O   A HOH 257 ? ? O   A HOH 356 ? ? 2.03 
4 1 OD1 A ASN 38  ? B O   A HOH 425 ? ? 2.06 
5 1 O   A HOH 390 ? ? O   A HOH 398 ? ? 2.16 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    ND2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ASN 
_pdbx_validate_symm_contact.auth_seq_id_1     38 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    B 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     428 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   6_544 
_pdbx_validate_symm_contact.dist              1.57 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CZ 
_pdbx_validate_rmsd_bond.auth_asym_id_1            P 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             370 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            B 
_pdbx_validate_rmsd_bond.auth_atom_id_2            NH2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            P 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             370 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            B 
_pdbx_validate_rmsd_bond.bond_value                1.414 
_pdbx_validate_rmsd_bond.bond_target_value         1.326 
_pdbx_validate_rmsd_bond.bond_deviation            0.088 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.013 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 169 ? A CZ A ARG 169 ? A NH2 A ARG 169 ? A 116.76 120.30 -3.54 0.50 N 
2 1 CB A ASP 204 ? B CG A ASP 204 ? B OD1 A ASP 204 ? B 124.64 118.30 6.34  0.90 N 
3 1 NE P ARG 370 ? B CZ P ARG 370 ? B NH1 P ARG 370 ? B 116.64 120.30 -3.66 0.50 N 
4 1 NE P ARG 370 ? B CZ P ARG 370 ? B NH2 P ARG 370 ? B 123.96 120.30 3.66  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 18  ? ? -101.71 78.29 
2 1 HIS A 106 ? ? -143.40 38.96 
3 1 THR A 136 ? ? -140.67 -8.16 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 67  ? CD  ? A GLN 72  CD  
2  1 Y 1 A GLN 67  ? OE1 ? A GLN 72  OE1 
3  1 Y 1 A GLN 67  ? NE2 ? A GLN 72  NE2 
4  1 Y 1 A LYS 68  ? CD  ? A LYS 73  CD  
5  1 Y 1 A LYS 68  ? CE  ? A LYS 73  CE  
6  1 Y 1 A LYS 68  ? NZ  ? A LYS 73  NZ  
7  1 Y 1 A GLU 72  ? CD  ? A GLU 77  CD  
8  1 Y 1 A GLU 72  ? OE1 ? A GLU 77  OE1 
9  1 Y 1 A GLU 72  ? OE2 ? A GLU 77  OE2 
10 1 Y 1 A GLU 210 ? CD  ? A GLU 215 CD  
11 1 Y 1 A GLU 210 ? OE1 ? A GLU 215 OE1 
12 1 Y 1 A GLU 210 ? OE2 ? A GLU 215 OE2 
13 1 Y 1 A ASP 211 ? CG  ? A ASP 216 CG  
14 1 Y 1 A ASP 211 ? OD1 ? A ASP 216 OD1 
15 1 Y 1 A ASP 211 ? OD2 ? A ASP 216 OD2 
16 1 Y 1 A ASP 215 ? CG  ? A ASP 220 CG  
17 1 Y 1 A ASP 215 ? OD1 ? A ASP 220 OD1 
18 1 Y 1 A ASP 215 ? OD2 ? A ASP 220 OD2 
19 1 Y 1 P LYS 369 ? CE  ? B LYS 1   CE  
20 1 Y 1 P LYS 369 ? NZ  ? B LYS 1   NZ  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 FUSICOCCIN      FSC 
4 'CHLORIDE ION'  CL  
5 'MAGNESIUM ION' MG  
6 'CALCIUM ION'   CA  
7 water           HOH 
#