data_3P1S
# 
_entry.id   3P1S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3P1S         
RCSB  RCSB061849   
WWPDB D_1000061849 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2O98 'Structure of the 14-3-3 / H+-ATPase plant complex'                                                       unspecified 
PDB 3IQV 'Crystal Structure of human 14-3-3 sigma in Complex with Raf1 peptide (6mer) and stabilisator Fusicoccin' unspecified 
PDB 3M50 'Structure of the 14-3-3/PMA2 complex stabilized by Epibestatin'                                          unspecified 
PDB 3P1N .                                                                                                         unspecified 
PDB 3P1O .                                                                                                         unspecified 
PDB 3P1P .                                                                                                         unspecified 
PDB 3P1Q .                                                                                                         unspecified 
PDB 3P1R .                                                                                                         unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3P1S 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Anders, C.'     1 
'Higuchi, Y.'    2 
'Schumacher, B.' 3 
'Thiel, P.'      4 
'Kato, N.'       5 
'Ottmann, C.'    6 
# 
_citation.id                        primary 
_citation.title                     
'A semisynthetic fusicoccane stabilizes a protein-protein interaction and enhances the expression of K+ channels at the cell surface' 
_citation.journal_abbrev            'Chem. Biol.' 
_citation.journal_volume            20 
_citation.page_first                583 
_citation.page_last                 593 
_citation.year                      2013 
_citation.journal_id_ASTM           CBOLE2 
_citation.country                   UK 
_citation.journal_id_ISSN           1879-1301 
_citation.journal_id_CSD            2050 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23601647 
_citation.pdbx_database_id_DOI      10.1016/j.chembiol.2013.03.015 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Anders, C.'         1  
primary 'Higuchi, Y.'        2  
primary 'Koschinsky, K.'     3  
primary 'Bartel, M.'         4  
primary 'Schumacher, B.'     5  
primary 'Thiel, P.'          6  
primary 'Nitta, H.'          7  
primary 'Preisig-Muller, R.' 8  
primary 'Schlichthorl, G.'   9  
primary 'Renigunta, V.'      10 
primary 'Ohkanda, J.'        11 
primary 'Daut, J.'           12 
primary 'Kato, N.'           13 
primary 'Ottmann, C.'        14 
# 
_cell.entry_id           3P1S 
_cell.length_a           82.210 
_cell.length_b           111.180 
_cell.length_c           62.350 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3P1S 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '14-3-3 protein sigma'                                      26562.947 1   ? 'C38V, N166H' ? ? 
2 polymer     syn '6-mer peptide from Potassium channel subfamily K member 9' 856.950   1   ? ?             ? ? 
3 non-polymer syn FUSICOCCIN                                                  680.823   1   ? ?             ? ? 
4 non-polymer syn 'CHLORIDE ION'                                              35.453    1   ? ?             ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                             24.305    2   ? ?             ? ? 
6 water       nat water                                                       18.015    250 ? ?             ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Stratifin, Epithelial cell marker protein 1' 
2 'TASK-3 peptide'                              
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSVEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE
EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM
DISKKEMPPTHPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
;
;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSVEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE
EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM
DISKKEMPPTHPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
;
A ? 
2 'polypeptide(L)' no yes 'KRRK(SEP)V' KRRKSV P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   GLU n 
1 8   ARG n 
1 9   ALA n 
1 10  SER n 
1 11  LEU n 
1 12  ILE n 
1 13  GLN n 
1 14  LYS n 
1 15  ALA n 
1 16  LYS n 
1 17  LEU n 
1 18  ALA n 
1 19  GLU n 
1 20  GLN n 
1 21  ALA n 
1 22  GLU n 
1 23  ARG n 
1 24  TYR n 
1 25  GLU n 
1 26  ASP n 
1 27  MET n 
1 28  ALA n 
1 29  ALA n 
1 30  PHE n 
1 31  MET n 
1 32  LYS n 
1 33  GLY n 
1 34  ALA n 
1 35  VAL n 
1 36  GLU n 
1 37  LYS n 
1 38  GLY n 
1 39  GLU n 
1 40  GLU n 
1 41  LEU n 
1 42  SER n 
1 43  VAL n 
1 44  GLU n 
1 45  GLU n 
1 46  ARG n 
1 47  ASN n 
1 48  LEU n 
1 49  LEU n 
1 50  SER n 
1 51  VAL n 
1 52  ALA n 
1 53  TYR n 
1 54  LYS n 
1 55  ASN n 
1 56  VAL n 
1 57  VAL n 
1 58  GLY n 
1 59  GLY n 
1 60  GLN n 
1 61  ARG n 
1 62  ALA n 
1 63  ALA n 
1 64  TRP n 
1 65  ARG n 
1 66  VAL n 
1 67  LEU n 
1 68  SER n 
1 69  SER n 
1 70  ILE n 
1 71  GLU n 
1 72  GLN n 
1 73  LYS n 
1 74  SER n 
1 75  ASN n 
1 76  GLU n 
1 77  GLU n 
1 78  GLY n 
1 79  SER n 
1 80  GLU n 
1 81  GLU n 
1 82  LYS n 
1 83  GLY n 
1 84  PRO n 
1 85  GLU n 
1 86  VAL n 
1 87  ARG n 
1 88  GLU n 
1 89  TYR n 
1 90  ARG n 
1 91  GLU n 
1 92  LYS n 
1 93  VAL n 
1 94  GLU n 
1 95  THR n 
1 96  GLU n 
1 97  LEU n 
1 98  GLN n 
1 99  GLY n 
1 100 VAL n 
1 101 CYS n 
1 102 ASP n 
1 103 THR n 
1 104 VAL n 
1 105 LEU n 
1 106 GLY n 
1 107 LEU n 
1 108 LEU n 
1 109 ASP n 
1 110 SER n 
1 111 HIS n 
1 112 LEU n 
1 113 ILE n 
1 114 LYS n 
1 115 GLU n 
1 116 ALA n 
1 117 GLY n 
1 118 ASP n 
1 119 ALA n 
1 120 GLU n 
1 121 SER n 
1 122 ARG n 
1 123 VAL n 
1 124 PHE n 
1 125 TYR n 
1 126 LEU n 
1 127 LYS n 
1 128 MET n 
1 129 LYS n 
1 130 GLY n 
1 131 ASP n 
1 132 TYR n 
1 133 TYR n 
1 134 ARG n 
1 135 TYR n 
1 136 LEU n 
1 137 ALA n 
1 138 GLU n 
1 139 VAL n 
1 140 ALA n 
1 141 THR n 
1 142 GLY n 
1 143 ASP n 
1 144 ASP n 
1 145 LYS n 
1 146 LYS n 
1 147 ARG n 
1 148 ILE n 
1 149 ILE n 
1 150 ASP n 
1 151 SER n 
1 152 ALA n 
1 153 ARG n 
1 154 SER n 
1 155 ALA n 
1 156 TYR n 
1 157 GLN n 
1 158 GLU n 
1 159 ALA n 
1 160 MET n 
1 161 ASP n 
1 162 ILE n 
1 163 SER n 
1 164 LYS n 
1 165 LYS n 
1 166 GLU n 
1 167 MET n 
1 168 PRO n 
1 169 PRO n 
1 170 THR n 
1 171 HIS n 
1 172 PRO n 
1 173 ILE n 
1 174 ARG n 
1 175 LEU n 
1 176 GLY n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 ASN n 
1 181 PHE n 
1 182 SER n 
1 183 VAL n 
1 184 PHE n 
1 185 HIS n 
1 186 TYR n 
1 187 GLU n 
1 188 ILE n 
1 189 ALA n 
1 190 ASN n 
1 191 SER n 
1 192 PRO n 
1 193 GLU n 
1 194 GLU n 
1 195 ALA n 
1 196 ILE n 
1 197 SER n 
1 198 LEU n 
1 199 ALA n 
1 200 LYS n 
1 201 THR n 
1 202 THR n 
1 203 PHE n 
1 204 ASP n 
1 205 GLU n 
1 206 ALA n 
1 207 MET n 
1 208 ALA n 
1 209 ASP n 
1 210 LEU n 
1 211 HIS n 
1 212 THR n 
1 213 LEU n 
1 214 SER n 
1 215 GLU n 
1 216 ASP n 
1 217 SER n 
1 218 TYR n 
1 219 LYS n 
1 220 ASP n 
1 221 SER n 
1 222 THR n 
1 223 LEU n 
1 224 ILE n 
1 225 MET n 
1 226 GLN n 
1 227 LEU n 
1 228 LEU n 
1 229 ARG n 
1 230 ASP n 
1 231 ASN n 
1 232 LEU n 
1 233 THR n 
1 234 LEU n 
1 235 TRP n 
1 236 THR n 
2 1   LYS n 
2 2   ARG n 
2 3   ARG n 
2 4   LYS n 
2 5   SEP n 
2 6   VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SFN 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pPROEX HTB' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'This sequence occurs naturally in humans.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP 1433S_HUMAN P31947 1 
;MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPE
VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKK
EMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
;
1   ? 
2 UNP KCNK9_HUMAN Q9NPC2 2 KRRKSV 369 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3P1S A 6 ? 236 ? P31947 1   ? 231 ? 1   231 
2 2 3P1S P 1 ? 6   ? Q9NPC2 369 ? 374 ? 369 374 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3P1S GLY A 1   ? UNP P31947 ?   ?   'EXPRESSION TAG'      -4  1 
1 3P1S ALA A 2   ? UNP P31947 ?   ?   'EXPRESSION TAG'      -3  2 
1 3P1S MET A 3   ? UNP P31947 ?   ?   'EXPRESSION TAG'      -2  3 
1 3P1S GLY A 4   ? UNP P31947 ?   ?   'EXPRESSION TAG'      -1  4 
1 3P1S SER A 5   ? UNP P31947 ?   ?   'EXPRESSION TAG'      0   5 
1 3P1S VAL A 43  ? UNP P31947 CYS 38  'ENGINEERED MUTATION' 38  6 
1 3P1S HIS A 171 ? UNP P31947 ASN 166 'ENGINEERED MUTATION' 166 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ?               'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
FSC non-polymer         . FUSICOCCIN      ?               'C36 H56 O12'    680.823 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?               'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3P1S 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.78 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    
'0.095M HEPES Na-Salt, 25.6% PEG 400, 0.19M CaCl2, 5% Glycerol, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2010-06-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'BRUKER AXS MICROSTAR' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     3P1S 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             19.83 
_reflns.d_resolution_high            1.65 
_reflns.number_obs                   34326 
_reflns.number_all                   34745 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.041 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        32.80 
_reflns.B_iso_Wilson_estimate        20.899 
_reflns.pdbx_redundancy              5.54 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  1.65 
_reflns_shell.d_res_low                   1.70 
_reflns_shell.percent_possible_all        96.9 
_reflns_shell.Rmerge_I_obs                0.164 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         9.81 
_reflns_shell.pdbx_redundancy             3.88 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           2830 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3P1S 
_refine.ls_number_reflns_obs                     32608 
_refine.ls_number_reflns_all                     34326 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.83 
_refine.ls_d_res_high                            1.65 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.14797 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.14519 
_refine.ls_R_factor_R_free                       0.20096 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1717 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.940 
_refine.B_iso_mean                               14.684 
_refine.aniso_B[1][1]                            0.46 
_refine.aniso_B[2][2]                            0.49 
_refine.aniso_B[3][3]                            -0.95 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3LW1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.093 
_refine.overall_SU_ML                            0.048 
_refine.overall_SU_B                             3.020 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1898 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         51 
_refine_hist.number_atoms_solvent             250 
_refine_hist.number_atoms_total               2199 
_refine_hist.d_res_high                       1.65 
_refine_hist.d_res_low                        19.83 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.023  0.022  ? 2296 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.036  2.023  ? 3177 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.660  5.000  ? 326  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.400 24.537 ? 108  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.322 15.032 ? 465  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.078 15.000 ? 18   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.146  0.200  ? 365  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.010  0.020  ? 1743 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.200  1.500  ? 1357 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.296  2.000  ? 2234 'X-RAY DIFFRACTION' ? 
r_scbond_it                  5.109  3.000  ? 939  'X-RAY DIFFRACTION' ? 
r_scangle_it                 7.234  4.500  ? 891  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           2.668  3.000  ? 2296 'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.650 
_refine_ls_shell.d_res_low                        1.693 
_refine_ls_shell.number_reflns_R_work             2332 
_refine_ls_shell.R_factor_R_work                  0.188 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.254 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             123 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2332 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3P1S 
_struct.title                     
'Crystal structure of human 14-3-3 sigma C38N/N166H in complex with TASK-3 peptide and stabilizer fusicoccin A' 
_struct.pdbx_descriptor           '14-3-3 protein sigma, 6-mer peptide from Potassium channel subfamily K member 9' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3P1S 
_struct_keywords.pdbx_keywords   'PEPTIDE BINDING PROTEIN' 
_struct_keywords.text            'Helical protein, Phosphoprotein, Adapter protein, Peptide binding protein, Nucleus' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 7   ? ALA A 21  ? GLU A 2   ALA A 16  1 ? 15 
HELX_P HELX_P2  2  ARG A 23  ? LYS A 37  ? ARG A 18  LYS A 32  1 ? 15 
HELX_P HELX_P3  3  SER A 42  ? ASN A 75  ? SER A 37  ASN A 70  1 ? 34 
HELX_P HELX_P4  4  PRO A 84  ? SER A 110 ? PRO A 79  SER A 105 1 ? 27 
HELX_P HELX_P5  5  HIS A 111 ? ALA A 116 ? HIS A 106 ALA A 111 1 ? 6  
HELX_P HELX_P6  6  ASP A 118 ? ALA A 140 ? ASP A 113 ALA A 135 1 ? 23 
HELX_P HELX_P7  7  ASP A 144 ? MET A 167 ? ASP A 139 MET A 162 1 ? 24 
HELX_P HELX_P8  8  HIS A 171 ? ILE A 188 ? HIS A 166 ILE A 183 1 ? 18 
HELX_P HELX_P9  9  SER A 191 ? LEU A 210 ? SER A 186 LEU A 205 1 ? 20 
HELX_P HELX_P10 10 HIS A 211 ? LEU A 213 ? HIS A 206 LEU A 208 5 ? 3  
HELX_P HELX_P11 11 SER A 214 ? THR A 236 ? SER A 209 THR A 231 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B LYS 4   C   ? ? ? 1_555 B SEP 5 N  ? ? P LYS 372 P SEP 373 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale2 covale ? ? B SEP 5   C   ? ? ? 1_555 B VAL 6 N  ? ? P SEP 373 P VAL 374 1_555 ? ? ? ? ? ? ? 1.332 ? 
metalc1 metalc ? ? A GLU 166 O   ? ? ? 1_555 E MG  . MG ? ? A GLU 161 A MG  251 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc2 metalc ? ? A GLU 7   OE1 ? ? ? 1_555 F MG  . MG ? ? A GLU 2   A MG  252 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc3 metalc ? ? F MG  .   MG  ? ? ? 1_555 G HOH . O  ? ? A MG  252 A HOH 355 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc4 metalc ? ? F MG  .   MG  ? ? ? 1_555 G HOH . O  ? ? A MG  252 A HOH 280 1_555 ? ? ? ? ? ? ? 2.460 ? 
metalc5 metalc ? ? E MG  .   MG  ? ? ? 1_555 G HOH . O  ? ? A MG  251 A HOH 273 1_555 ? ? ? ? ? ? ? 2.476 ? 
metalc6 metalc ? ? E MG  .   MG  ? ? ? 1_555 G HOH . O  ? ? A MG  251 A HOH 360 1_555 ? ? ? ? ? ? ? 2.514 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 1   A . ? GLY -4  A ALA 2   A ? ALA -3  A 1 -8.28 
2 SER 110 A . ? SER 105 A HIS 111 A ? HIS 106 A 1 13.85 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE FSC A 249' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL A 250'  
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 251'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 252'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 ASN A 47  ? ASN A 42  . ? 1_555 ? 
2  AC1 17 SER A 50  ? SER A 45  . ? 1_555 ? 
3  AC1 17 VAL A 51  ? VAL A 46  . ? 1_555 ? 
4  AC1 17 PHE A 124 ? PHE A 119 . ? 1_555 ? 
5  AC1 17 LYS A 127 ? LYS A 122 . ? 1_555 ? 
6  AC1 17 MET A 128 ? MET A 123 . ? 1_555 ? 
7  AC1 17 PRO A 172 ? PRO A 167 . ? 1_555 ? 
8  AC1 17 LEU A 223 ? LEU A 218 . ? 1_555 ? 
9  AC1 17 ILE A 224 ? ILE A 219 . ? 1_555 ? 
10 AC1 17 HOH G .   ? HOH A 283 . ? 1_555 ? 
11 AC1 17 HOH G .   ? HOH A 332 . ? 1_555 ? 
12 AC1 17 HOH G .   ? HOH A 342 . ? 1_555 ? 
13 AC1 17 HOH G .   ? HOH A 345 . ? 1_555 ? 
14 AC1 17 HOH G .   ? HOH A 371 . ? 1_555 ? 
15 AC1 17 HOH G .   ? HOH A 402 . ? 1_555 ? 
16 AC1 17 HOH G .   ? HOH A 424 . ? 1_555 ? 
17 AC1 17 HOH H .   ? HOH P 35  . ? 1_555 ? 
18 AC2 4  LYS A 14  ? LYS A 9   . ? 4_555 ? 
19 AC2 4  LYS A 92  ? LYS A 87  . ? 1_555 ? 
20 AC2 4  HOH G .   ? HOH A 322 . ? 1_555 ? 
21 AC2 4  HOH G .   ? HOH A 348 . ? 1_555 ? 
22 AC3 7  GLU A 80  ? GLU A 75  . ? 7_545 ? 
23 AC3 7  GLU A 166 ? GLU A 161 . ? 1_555 ? 
24 AC3 7  HOH G .   ? HOH A 269 . ? 7_545 ? 
25 AC3 7  HOH G .   ? HOH A 273 . ? 1_555 ? 
26 AC3 7  HOH G .   ? HOH A 360 . ? 1_555 ? 
27 AC3 7  HOH G .   ? HOH A 410 . ? 7_545 ? 
28 AC3 7  HOH G .   ? HOH A 442 . ? 6_544 ? 
29 AC4 6  GLU A 7   ? GLU A 2   . ? 1_555 ? 
30 AC4 6  GLU A 7   ? GLU A 2   . ? 3_554 ? 
31 AC4 6  HOH G .   ? HOH A 280 . ? 1_555 ? 
32 AC4 6  HOH G .   ? HOH A 280 . ? 3_554 ? 
33 AC4 6  HOH G .   ? HOH A 355 . ? 3_554 ? 
34 AC4 6  HOH G .   ? HOH A 355 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3P1S 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3P1S 
_atom_sites.fract_transf_matrix[1][1]   0.012164 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008994 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016038 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 1   ? -3.618 -13.278 -6.201  1.00 28.47 ? -4  GLY A N   1 
ATOM   2    C  CA  . GLY A 1 1   ? -3.489 -11.786 -6.296  1.00 26.49 ? -4  GLY A CA  1 
ATOM   3    C  C   . GLY A 1 1   ? -2.644 -11.447 -5.097  1.00 28.56 ? -4  GLY A C   1 
ATOM   4    O  O   . GLY A 1 1   ? -2.498 -12.306 -4.217  1.00 30.90 ? -4  GLY A O   1 
ATOM   5    N  N   . ALA A 1 2   ? -1.991 -10.297 -5.113  1.00 27.71 ? -3  ALA A N   1 
ATOM   6    C  CA  . ALA A 1 2   ? -1.974 -9.519  -6.338  1.00 26.62 ? -3  ALA A CA  1 
ATOM   7    C  C   . ALA A 1 2   ? -1.151 -10.193 -7.390  1.00 23.74 ? -3  ALA A C   1 
ATOM   8    O  O   . ALA A 1 2   ? -1.112 -9.638  -8.500  1.00 25.95 ? -3  ALA A O   1 
ATOM   9    C  CB  . ALA A 1 2   ? -1.450 -8.077  -6.121  1.00 29.17 ? -3  ALA A CB  1 
ATOM   10   N  N   . MET A 1 3   ? -0.480 -11.354 -7.091  1.00 20.07 ? -2  MET A N   1 
ATOM   11   C  CA  . MET A 1 3   ? 0.266  -12.018 -8.161  1.00 14.45 ? -2  MET A CA  1 
ATOM   12   C  C   . MET A 1 3   ? -0.493 -13.157 -8.816  1.00 12.78 ? -2  MET A C   1 
ATOM   13   O  O   . MET A 1 3   ? 0.050  -13.855 -9.700  1.00 11.36 ? -2  MET A O   1 
ATOM   14   C  CB  . MET A 1 3   ? 1.674  -12.477 -7.703  1.00 14.83 ? -2  MET A CB  1 
ATOM   15   C  CG  . MET A 1 3   ? 2.522  -11.346 -7.124  1.00 17.48 ? -2  MET A CG  1 
ATOM   16   S  SD  . MET A 1 3   ? 2.951  -10.132 -8.427  1.00 18.71 ? -2  MET A SD  1 
ATOM   17   C  CE  . MET A 1 3   ? 3.954  -9.034  -7.473  1.00 21.32 ? -2  MET A CE  1 
ATOM   18   N  N   . GLY A 1 4   ? -1.759 -13.315 -8.450  1.00 12.81 ? -1  GLY A N   1 
ATOM   19   C  CA  . GLY A 1 4   ? -2.544 -14.466 -8.920  1.00 12.30 ? -1  GLY A CA  1 
ATOM   20   C  C   . GLY A 1 4   ? -2.715 -14.518 -10.416 1.00 10.43 ? -1  GLY A C   1 
ATOM   21   O  O   . GLY A 1 4   ? -2.892 -15.613 -10.986 1.00 11.66 ? -1  GLY A O   1 
ATOM   22   N  N   . SER A 1 5   ? -2.653 -13.350 -11.068 1.00 8.81  ? 0   SER A N   1 
ATOM   23   C  CA  A SER A 1 5   ? -2.889 -13.323 -12.495 0.60 7.87  ? 0   SER A CA  1 
ATOM   24   C  CA  B SER A 1 5   ? -2.845 -13.295 -12.506 0.40 8.86  ? 0   SER A CA  1 
ATOM   25   C  C   . SER A 1 5   ? -1.600 -13.536 -13.299 1.00 8.19  ? 0   SER A C   1 
ATOM   26   O  O   . SER A 1 5   ? -1.664 -13.647 -14.519 1.00 9.13  ? 0   SER A O   1 
ATOM   27   C  CB  A SER A 1 5   ? -3.610 -12.031 -12.951 0.60 8.24  ? 0   SER A CB  1 
ATOM   28   C  CB  B SER A 1 5   ? -3.404 -11.953 -12.949 0.40 9.63  ? 0   SER A CB  1 
ATOM   29   O  OG  A SER A 1 5   ? -2.740 -10.927 -12.766 0.60 11.01 ? 0   SER A OG  1 
ATOM   30   O  OG  B SER A 1 5   ? -4.708 -11.890 -12.514 0.40 14.42 ? 0   SER A OG  1 
ATOM   31   N  N   . MET A 1 6   ? -0.428 -13.553 -12.642 1.00 8.13  ? 1   MET A N   1 
ATOM   32   C  CA  . MET A 1 6   ? 0.811  -13.689 -13.394 1.00 7.60  ? 1   MET A CA  1 
ATOM   33   C  C   . MET A 1 6   ? 1.265  -15.104 -13.447 1.00 6.12  ? 1   MET A C   1 
ATOM   34   O  O   . MET A 1 6   ? 1.214  -15.813 -12.434 1.00 7.52  ? 1   MET A O   1 
ATOM   35   C  CB  . MET A 1 6   ? 1.905  -12.866 -12.753 1.00 8.70  ? 1   MET A CB  1 
ATOM   36   C  CG  . MET A 1 6   ? 2.935  -12.442 -13.801 1.00 11.07 ? 1   MET A CG  1 
ATOM   37   S  SD  . MET A 1 6   ? 4.354  -11.547 -13.178 1.00 13.05 ? 1   MET A SD  1 
ATOM   38   C  CE  . MET A 1 6   ? 3.558  -10.122 -12.366 1.00 13.50 ? 1   MET A CE  1 
ATOM   39   N  N   . GLU A 1 7   ? 1.655  -15.528 -14.633 1.00 6.18  ? 2   GLU A N   1 
ATOM   40   C  CA  . GLU A 1 7   ? 2.272  -16.857 -14.784 1.00 8.44  ? 2   GLU A CA  1 
ATOM   41   C  C   . GLU A 1 7   ? 3.375  -17.168 -13.780 1.00 7.81  ? 2   GLU A C   1 
ATOM   42   O  O   . GLU A 1 7   ? 4.206  -16.299 -13.488 1.00 7.17  ? 2   GLU A O   1 
ATOM   43   C  CB  . GLU A 1 7   ? 2.896  -17.004 -16.178 1.00 9.29  ? 2   GLU A CB  1 
ATOM   44   C  CG  . GLU A 1 7   ? 1.844  -17.081 -17.237 1.00 10.87 ? 2   GLU A CG  1 
ATOM   45   C  CD  . GLU A 1 7   ? 1.255  -18.446 -17.366 1.00 12.67 ? 2   GLU A CD  1 
ATOM   46   O  OE1 . GLU A 1 7   ? 1.410  -19.306 -16.463 1.00 13.14 ? 2   GLU A OE1 1 
ATOM   47   O  OE2 . GLU A 1 7   ? 0.608  -18.691 -18.404 1.00 14.43 ? 2   GLU A OE2 1 
ATOM   48   N  N   . ARG A 1 8   ? 3.400  -18.405 -13.291 1.00 7.31  ? 3   ARG A N   1 
ATOM   49   C  CA  . ARG A 1 8   ? 4.505  -18.812 -12.396 1.00 7.23  ? 3   ARG A CA  1 
ATOM   50   C  C   . ARG A 1 8   ? 5.863  -18.506 -13.000 1.00 6.59  ? 3   ARG A C   1 
ATOM   51   O  O   . ARG A 1 8   ? 6.765  -17.928 -12.317 1.00 6.98  ? 3   ARG A O   1 
ATOM   52   C  CB  . ARG A 1 8   ? 4.373  -20.310 -12.075 1.00 6.47  ? 3   ARG A CB  1 
ATOM   53   C  CG  . ARG A 1 8   ? 5.330  -20.776 -10.993 1.00 6.54  ? 3   ARG A CG  1 
ATOM   54   C  CD  . ARG A 1 8   ? 5.247  -22.328 -10.862 1.00 7.81  ? 3   ARG A CD  1 
ATOM   55   N  NE  . ARG A 1 8   ? 6.034  -22.785 -9.719  1.00 8.24  ? 3   ARG A NE  1 
ATOM   56   C  CZ  . ARG A 1 8   ? 7.367  -22.923 -9.686  1.00 8.31  ? 3   ARG A CZ  1 
ATOM   57   N  NH1 . ARG A 1 8   ? 8.100  -22.764 -10.792 1.00 8.56  ? 3   ARG A NH1 1 
ATOM   58   N  NH2 . ARG A 1 8   ? 7.947  -23.345 -8.535  1.00 10.38 ? 3   ARG A NH2 1 
ATOM   59   N  N   . ALA A 1 9   ? 6.040  -18.846 -14.259 1.00 6.57  ? 4   ALA A N   1 
ATOM   60   C  CA  . ALA A 1 9   ? 7.394  -18.690 -14.852 1.00 8.24  ? 4   ALA A CA  1 
ATOM   61   C  C   . ALA A 1 9   ? 7.715  -17.199 -14.955 1.00 6.54  ? 4   ALA A C   1 
ATOM   62   O  O   . ALA A 1 9   ? 8.881  -16.819 -14.843 1.00 7.65  ? 4   ALA A O   1 
ATOM   63   C  CB  . ALA A 1 9   ? 7.483  -19.323 -16.257 1.00 10.35 ? 4   ALA A CB  1 
ATOM   64   N  N   . SER A 1 10  ? 6.683  -16.380 -15.243 1.00 6.87  ? 5   SER A N   1 
ATOM   65   C  CA  . SER A 1 10  ? 6.910  -14.909 -15.353 1.00 6.83  ? 5   SER A CA  1 
ATOM   66   C  C   . SER A 1 10  ? 7.286  -14.323 -13.987 1.00 6.40  ? 5   SER A C   1 
ATOM   67   O  O   . SER A 1 10  ? 8.161  -13.427 -13.877 1.00 7.11  ? 5   SER A O   1 
ATOM   68   C  CB  . SER A 1 10  ? 5.652  -14.228 -15.905 1.00 8.37  ? 5   SER A CB  1 
ATOM   69   O  OG  . SER A 1 10  ? 5.425  -14.716 -17.219 1.00 9.10  ? 5   SER A OG  1 
ATOM   70   N  N   . LEU A 1 11  ? 6.657  -14.844 -12.926 1.00 6.34  ? 6   LEU A N   1 
ATOM   71   C  CA  . LEU A 1 11  ? 7.046  -14.407 -11.566 1.00 7.06  ? 6   LEU A CA  1 
ATOM   72   C  C   . LEU A 1 11  ? 8.489  -14.745 -11.265 1.00 6.12  ? 6   LEU A C   1 
ATOM   73   O  O   . LEU A 1 11  ? 9.223  -13.933 -10.704 1.00 7.16  ? 6   LEU A O   1 
ATOM   74   C  CB  . LEU A 1 11  ? 6.155  -15.098 -10.535 1.00 7.58  ? 6   LEU A CB  1 
ATOM   75   C  CG  . LEU A 1 11  ? 4.696  -14.509 -10.551 1.00 6.48  ? 6   LEU A CG  1 
ATOM   76   C  CD1 . LEU A 1 11  ? 3.788  -15.492 -9.844  1.00 7.67  ? 6   LEU A CD1 1 
ATOM   77   C  CD2 . LEU A 1 11  ? 4.652  -13.122 -9.881  1.00 7.35  ? 6   LEU A CD2 1 
ATOM   78   N  N   . ILE A 1 12  ? 8.931  -15.944 -11.640 1.00 6.54  ? 7   ILE A N   1 
ATOM   79   C  CA  A ILE A 1 12  ? 10.320 -16.361 -11.434 0.60 6.54  ? 7   ILE A CA  1 
ATOM   80   C  CA  B ILE A 1 12  ? 10.313 -16.296 -11.372 0.40 6.30  ? 7   ILE A CA  1 
ATOM   81   C  C   . ILE A 1 12  ? 11.280 -15.486 -12.252 1.00 5.96  ? 7   ILE A C   1 
ATOM   82   O  O   . ILE A 1 12  ? 12.303 -15.005 -11.762 1.00 7.72  ? 7   ILE A O   1 
ATOM   83   C  CB  A ILE A 1 12  ? 10.510 -17.853 -11.854 0.60 6.51  ? 7   ILE A CB  1 
ATOM   84   C  CB  B ILE A 1 12  ? 10.490 -17.812 -11.456 0.40 6.66  ? 7   ILE A CB  1 
ATOM   85   C  CG1 A ILE A 1 12  ? 9.691  -18.800 -10.933 0.60 7.23  ? 7   ILE A CG1 1 
ATOM   86   C  CG1 B ILE A 1 12  ? 9.613  -18.440 -10.369 0.40 6.24  ? 7   ILE A CG1 1 
ATOM   87   C  CG2 A ILE A 1 12  ? 12.004 -18.238 -11.818 0.60 6.63  ? 7   ILE A CG2 1 
ATOM   88   C  CG2 B ILE A 1 12  ? 11.953 -18.222 -11.242 0.40 5.26  ? 7   ILE A CG2 1 
ATOM   89   C  CD1 A ILE A 1 12  ? 9.943  -18.684 -9.382  0.60 5.44  ? 7   ILE A CD1 1 
ATOM   90   C  CD1 B ILE A 1 12  ? 9.260  -19.859 -10.607 0.40 6.57  ? 7   ILE A CD1 1 
ATOM   91   N  N   . GLN A 1 13  ? 10.930 -15.265 -13.517 1.00 5.56  ? 8   GLN A N   1 
ATOM   92   C  CA  A GLN A 1 13  ? 11.759 -14.419 -14.369 0.60 6.29  ? 8   GLN A CA  1 
ATOM   93   C  CA  B GLN A 1 13  ? 11.720 -14.404 -14.392 0.40 7.04  ? 8   GLN A CA  1 
ATOM   94   C  C   . GLN A 1 13  ? 11.885 -13.021 -13.789 1.00 7.06  ? 8   GLN A C   1 
ATOM   95   O  O   . GLN A 1 13  ? 13.000 -12.471 -13.735 1.00 7.96  ? 8   GLN A O   1 
ATOM   96   C  CB  A GLN A 1 13  ? 11.169 -14.370 -15.797 0.60 6.99  ? 8   GLN A CB  1 
ATOM   97   C  CB  B GLN A 1 13  ? 11.027 -14.307 -15.764 0.40 7.86  ? 8   GLN A CB  1 
ATOM   98   C  CG  A GLN A 1 13  ? 11.978 -13.506 -16.754 0.60 6.04  ? 8   GLN A CG  1 
ATOM   99   C  CG  B GLN A 1 13  ? 11.325 -15.485 -16.655 0.40 9.87  ? 8   GLN A CG  1 
ATOM   100  C  CD  A GLN A 1 13  ? 11.367 -13.435 -18.193 0.60 7.70  ? 8   GLN A CD  1 
ATOM   101  C  CD  B GLN A 1 13  ? 10.310 -15.612 -17.794 0.40 14.33 ? 8   GLN A CD  1 
ATOM   102  O  OE1 A GLN A 1 13  ? 11.901 -12.762 -19.098 0.60 9.72  ? 8   GLN A OE1 1 
ATOM   103  O  OE1 B GLN A 1 13  ? 10.268 -14.768 -18.682 0.40 15.00 ? 8   GLN A OE1 1 
ATOM   104  N  NE2 A GLN A 1 13  ? 10.251 -14.086 -18.373 0.60 9.08  ? 8   GLN A NE2 1 
ATOM   105  N  NE2 B GLN A 1 13  ? 9.500  -16.675 -17.772 0.40 18.05 ? 8   GLN A NE2 1 
ATOM   106  N  N   . LYS A 1 14  ? 10.754 -12.455 -13.309 1.00 7.79  ? 9   LYS A N   1 
ATOM   107  C  CA  . LYS A 1 14  ? 10.798 -11.103 -12.726 1.00 6.79  ? 9   LYS A CA  1 
ATOM   108  C  C   . LYS A 1 14  ? 11.533 -11.076 -11.398 1.00 6.34  ? 9   LYS A C   1 
ATOM   109  O  O   . LYS A 1 14  ? 12.206 -10.074 -11.087 1.00 8.52  ? 9   LYS A O   1 
ATOM   110  C  CB  . LYS A 1 14  ? 9.407  -10.530 -12.627 1.00 6.00  ? 9   LYS A CB  1 
ATOM   111  C  CG  . LYS A 1 14  ? 8.828  -10.280 -14.060 1.00 6.79  ? 9   LYS A CG  1 
ATOM   112  C  CD  . LYS A 1 14  ? 7.394  -9.693  -13.938 1.00 8.63  ? 9   LYS A CD  1 
ATOM   113  C  CE  . LYS A 1 14  ? 6.782  -9.449  -15.335 1.00 7.46  ? 9   LYS A CE  1 
ATOM   114  N  NZ  . LYS A 1 14  ? 5.377  -8.969  -15.217 1.00 9.68  ? 9   LYS A NZ  1 
ATOM   115  N  N   . ALA A 1 15  ? 11.460 -12.153 -10.616 1.00 6.99  ? 10  ALA A N   1 
ATOM   116  C  CA  . ALA A 1 15  ? 12.232 -12.173 -9.355  1.00 7.23  ? 10  ALA A CA  1 
ATOM   117  C  C   . ALA A 1 15  ? 13.717 -12.063 -9.700  1.00 6.36  ? 10  ALA A C   1 
ATOM   118  O  O   . ALA A 1 15  ? 14.492 -11.412 -8.980  1.00 7.00  ? 10  ALA A O   1 
ATOM   119  C  CB  . ALA A 1 15  ? 11.922 -13.492 -8.604  1.00 8.20  ? 10  ALA A CB  1 
ATOM   120  N  N   . LYS A 1 16  ? 14.158 -12.792 -10.746 1.00 6.95  ? 11  LYS A N   1 
ATOM   121  C  CA  . LYS A 1 16  ? 15.581 -12.728 -11.113 1.00 7.30  ? 11  LYS A CA  1 
ATOM   122  C  C   . LYS A 1 16  ? 15.961 -11.311 -11.615 1.00 6.89  ? 11  LYS A C   1 
ATOM   123  O  O   . LYS A 1 16  ? 17.097 -10.830 -11.359 1.00 9.89  ? 11  LYS A O   1 
ATOM   124  C  CB  . LYS A 1 16  ? 15.886 -13.759 -12.205 1.00 7.76  ? 11  LYS A CB  1 
ATOM   125  C  CG  . LYS A 1 16  ? 15.735 -15.224 -11.685 1.00 9.98  ? 11  LYS A CG  1 
ATOM   126  C  CD  . LYS A 1 16  ? 15.833 -16.182 -12.869 1.00 10.32 ? 11  LYS A CD  1 
ATOM   127  C  CE  . LYS A 1 16  ? 15.623 -17.610 -12.428 1.00 13.82 ? 11  LYS A CE  1 
ATOM   128  N  NZ  . LYS A 1 16  ? 15.701 -18.540 -13.628 1.00 19.05 ? 11  LYS A NZ  1 
ATOM   129  N  N   . LEU A 1 17  ? 15.048 -10.640 -12.327 1.00 6.46  ? 12  LEU A N   1 
ATOM   130  C  CA  . LEU A 1 17  ? 15.287 -9.267  -12.765 1.00 6.95  ? 12  LEU A CA  1 
ATOM   131  C  C   . LEU A 1 17  ? 15.349 -8.337  -11.566 1.00 6.87  ? 12  LEU A C   1 
ATOM   132  O  O   . LEU A 1 17  ? 16.285 -7.509  -11.481 1.00 7.96  ? 12  LEU A O   1 
ATOM   133  C  CB  . LEU A 1 17  ? 14.147 -8.814  -13.678 1.00 6.11  ? 12  LEU A CB  1 
ATOM   134  C  CG  . LEU A 1 17  ? 14.131 -9.458  -15.083 1.00 7.26  ? 12  LEU A CG  1 
ATOM   135  C  CD1 . LEU A 1 17  ? 12.833 -9.038  -15.781 1.00 10.08 ? 12  LEU A CD1 1 
ATOM   136  C  CD2 . LEU A 1 17  ? 15.383 -9.226  -15.939 1.00 10.88 ? 12  LEU A CD2 1 
ATOM   137  N  N   . ALA A 1 18  ? 14.435 -8.521  -10.587 1.00 7.20  ? 13  ALA A N   1 
ATOM   138  C  CA  . ALA A 1 18  ? 14.426 -7.689  -9.369  1.00 7.75  ? 13  ALA A CA  1 
ATOM   139  C  C   . ALA A 1 18  ? 15.739 -7.917  -8.595  1.00 7.66  ? 13  ALA A C   1 
ATOM   140  O  O   . ALA A 1 18  ? 16.343 -6.980  -8.082  1.00 9.55  ? 13  ALA A O   1 
ATOM   141  C  CB  . ALA A 1 18  ? 13.202 -8.062  -8.502  1.00 6.29  ? 13  ALA A CB  1 
ATOM   142  N  N   . GLU A 1 19  ? 16.225 -9.158  -8.573  1.00 7.18  ? 14  GLU A N   1 
ATOM   143  C  CA  . GLU A 1 19  ? 17.472 -9.429  -7.891  1.00 8.54  ? 14  GLU A CA  1 
ATOM   144  C  C   . GLU A 1 19  ? 18.615 -8.592  -8.574  1.00 9.40  ? 14  GLU A C   1 
ATOM   145  O  O   . GLU A 1 19  ? 19.469 -7.974  -7.899  1.00 12.59 ? 14  GLU A O   1 
ATOM   146  C  CB  . GLU A 1 19  ? 17.794 -10.947 -7.971  1.00 8.74  ? 14  GLU A CB  1 
ATOM   147  C  CG  . GLU A 1 19  ? 19.004 -11.295 -7.083  1.00 12.36 ? 14  GLU A CG  1 
ATOM   148  C  CD  . GLU A 1 19  ? 20.371 -11.159 -7.781  1.00 11.00 ? 14  GLU A CD  1 
ATOM   149  O  OE1 . GLU A 1 19  ? 20.460 -11.248 -9.008  1.00 16.75 ? 14  GLU A OE1 1 
ATOM   150  O  OE2 . GLU A 1 19  ? 21.406 -11.015 -7.069  1.00 18.06 ? 14  GLU A OE2 1 
ATOM   151  N  N   . GLN A 1 20  ? 18.652 -8.635  -9.912  1.00 10.67 ? 15  GLN A N   1 
ATOM   152  C  CA  . GLN A 1 20  ? 19.689 -7.881  -10.645 1.00 11.08 ? 15  GLN A CA  1 
ATOM   153  C  C   . GLN A 1 20  ? 19.623 -6.386  -10.357 1.00 10.93 ? 15  GLN A C   1 
ATOM   154  O  O   . GLN A 1 20  ? 20.691 -5.684  -10.332 1.00 13.32 ? 15  GLN A O   1 
ATOM   155  C  CB  . GLN A 1 20  ? 19.614 -8.126  -12.152 1.00 11.24 ? 15  GLN A CB  1 
ATOM   156  C  CG  . GLN A 1 20  ? 19.953 -9.527  -12.485 1.00 13.73 ? 15  GLN A CG  1 
ATOM   157  C  CD  . GLN A 1 20  ? 19.922 -9.716  -13.954 1.00 21.55 ? 15  GLN A CD  1 
ATOM   158  O  OE1 . GLN A 1 20  ? 20.778 -9.200  -14.682 1.00 29.16 ? 15  GLN A OE1 1 
ATOM   159  N  NE2 . GLN A 1 20  ? 18.918 -10.401 -14.421 1.00 25.88 ? 15  GLN A NE2 1 
ATOM   160  N  N   . ALA A 1 21  ? 18.391 -5.919  -10.188 1.00 10.38 ? 16  ALA A N   1 
ATOM   161  C  CA  . ALA A 1 21  ? 18.132 -4.497  -9.908  1.00 10.96 ? 16  ALA A CA  1 
ATOM   162  C  C   . ALA A 1 21  ? 18.219 -4.154  -8.394  1.00 10.93 ? 16  ALA A C   1 
ATOM   163  O  O   . ALA A 1 21  ? 17.982 -2.977  -8.010  1.00 12.65 ? 16  ALA A O   1 
ATOM   164  C  CB  . ALA A 1 21  ? 16.803 -4.109  -10.499 1.00 11.72 ? 16  ALA A CB  1 
ATOM   165  N  N   . GLU A 1 22  ? 18.537 -5.151  -7.565  1.00 11.89 ? 17  GLU A N   1 
ATOM   166  C  CA  A GLU A 1 22  ? 18.514 -5.051  -6.098  0.50 11.81 ? 17  GLU A CA  1 
ATOM   167  C  CA  B GLU A 1 22  ? 18.536 -4.987  -6.106  0.50 12.16 ? 17  GLU A CA  1 
ATOM   168  C  C   . GLU A 1 22  ? 17.183 -4.456  -5.592  1.00 11.58 ? 17  GLU A C   1 
ATOM   169  O  O   . GLU A 1 22  ? 17.144 -3.657  -4.641  1.00 13.87 ? 17  GLU A O   1 
ATOM   170  C  CB  A GLU A 1 22  ? 19.730 -4.231  -5.610  0.50 14.09 ? 17  GLU A CB  1 
ATOM   171  C  CB  B GLU A 1 22  ? 19.678 -4.011  -5.696  0.50 14.23 ? 17  GLU A CB  1 
ATOM   172  C  CG  A GLU A 1 22  ? 21.054 -4.802  -6.060  0.50 16.28 ? 17  GLU A CG  1 
ATOM   173  C  CG  B GLU A 1 22  ? 21.032 -4.460  -6.159  0.50 18.18 ? 17  GLU A CG  1 
ATOM   174  C  CD  A GLU A 1 22  ? 22.211 -3.872  -5.738  0.50 20.02 ? 17  GLU A CD  1 
ATOM   175  C  CD  B GLU A 1 22  ? 22.169 -3.658  -5.519  0.50 23.99 ? 17  GLU A CD  1 
ATOM   176  O  OE1 A GLU A 1 22  ? 22.701 -3.917  -4.571  0.50 20.85 ? 17  GLU A OE1 1 
ATOM   177  O  OE1 B GLU A 1 22  ? 21.913 -2.556  -4.951  0.50 24.32 ? 17  GLU A OE1 1 
ATOM   178  O  OE2 A GLU A 1 22  ? 22.609 -3.083  -6.647  0.50 20.94 ? 17  GLU A OE2 1 
ATOM   179  O  OE2 B GLU A 1 22  ? 23.325 -4.134  -5.600  0.50 27.34 ? 17  GLU A OE2 1 
ATOM   180  N  N   . ARG A 1 23  ? 16.068 -4.911  -6.208  1.00 9.32  ? 18  ARG A N   1 
ATOM   181  C  CA  . ARG A 1 23  ? 14.721 -4.459  -5.832  1.00 8.71  ? 18  ARG A CA  1 
ATOM   182  C  C   . ARG A 1 23  ? 14.162 -5.616  -4.983  1.00 9.11  ? 18  ARG A C   1 
ATOM   183  O  O   . ARG A 1 23  ? 13.339 -6.430  -5.472  1.00 7.66  ? 18  ARG A O   1 
ATOM   184  C  CB  . ARG A 1 23  ? 13.902 -4.226  -7.061  1.00 9.28  ? 18  ARG A CB  1 
ATOM   185  C  CG  . ARG A 1 23  ? 14.337 -2.936  -7.788  1.00 10.22 ? 18  ARG A CG  1 
ATOM   186  C  CD  . ARG A 1 23  ? 13.653 -1.727  -7.117  1.00 10.69 ? 18  ARG A CD  1 
ATOM   187  N  NE  . ARG A 1 23  ? 12.190 -1.811  -7.417  1.00 13.08 ? 18  ARG A NE  1 
ATOM   188  C  CZ  . ARG A 1 23  ? 11.352 -0.792  -7.414  1.00 14.77 ? 18  ARG A CZ  1 
ATOM   189  N  NH1 . ARG A 1 23  ? 11.803 0.464   -7.230  1.00 16.68 ? 18  ARG A NH1 1 
ATOM   190  N  NH2 . ARG A 1 23  ? 10.073 -1.028  -7.659  1.00 13.73 ? 18  ARG A NH2 1 
ATOM   191  N  N   . TYR A 1 24  ? 14.620 -5.722  -3.733  1.00 7.29  ? 19  TYR A N   1 
ATOM   192  C  CA  . TYR A 1 24  ? 14.355 -6.987  -2.988  1.00 8.78  ? 19  TYR A CA  1 
ATOM   193  C  C   . TYR A 1 24  ? 12.912 -7.048  -2.526  1.00 8.46  ? 19  TYR A C   1 
ATOM   194  O  O   . TYR A 1 24  ? 12.393 -8.170  -2.430  1.00 8.43  ? 19  TYR A O   1 
ATOM   195  C  CB  . TYR A 1 24  ? 15.291 -7.138  -1.788  1.00 9.73  ? 19  TYR A CB  1 
ATOM   196  C  CG  . TYR A 1 24  ? 16.706 -7.334  -2.307  1.00 9.20  ? 19  TYR A CG  1 
ATOM   197  C  CD1 . TYR A 1 24  ? 17.098 -8.543  -2.935  1.00 9.88  ? 19  TYR A CD1 1 
ATOM   198  C  CD2 . TYR A 1 24  ? 17.651 -6.289  -2.221  1.00 13.68 ? 19  TYR A CD2 1 
ATOM   199  C  CE1 . TYR A 1 24  ? 18.400 -8.702  -3.429  1.00 13.36 ? 19  TYR A CE1 1 
ATOM   200  C  CE2 . TYR A 1 24  ? 18.961 -6.459  -2.707  1.00 15.57 ? 19  TYR A CE2 1 
ATOM   201  C  CZ  . TYR A 1 24  ? 19.311 -7.661  -3.297  1.00 14.38 ? 19  TYR A CZ  1 
ATOM   202  O  OH  . TYR A 1 24  ? 20.587 -7.828  -3.761  1.00 20.02 ? 19  TYR A OH  1 
ATOM   203  N  N   . GLU A 1 25  ? 12.243 -5.899  -2.273  1.00 8.65  ? 20  GLU A N   1 
ATOM   204  C  CA  A GLU A 1 25  ? 10.823 -6.000  -1.922  0.50 9.13  ? 20  GLU A CA  1 
ATOM   205  C  CA  B GLU A 1 25  ? 10.815 -5.966  -1.935  0.50 9.37  ? 20  GLU A CA  1 
ATOM   206  C  C   . GLU A 1 25  ? 10.039 -6.582  -3.119  1.00 8.00  ? 20  GLU A C   1 
ATOM   207  O  O   . GLU A 1 25  ? 9.182  -7.440  -2.957  1.00 8.16  ? 20  GLU A O   1 
ATOM   208  C  CB  A GLU A 1 25  ? 10.259 -4.629  -1.493  0.50 10.07 ? 20  GLU A CB  1 
ATOM   209  C  CB  B GLU A 1 25  ? 10.267 -4.558  -1.618  0.50 10.23 ? 20  GLU A CB  1 
ATOM   210  C  CG  A GLU A 1 25  ? 10.803 -4.141  -0.161  0.50 11.81 ? 20  GLU A CG  1 
ATOM   211  C  CG  B GLU A 1 25  ? 8.757  -4.518  -1.337  0.50 13.74 ? 20  GLU A CG  1 
ATOM   212  C  CD  A GLU A 1 25  ? 10.392 -2.724  0.216   0.50 20.18 ? 20  GLU A CD  1 
ATOM   213  C  CD  B GLU A 1 25  ? 8.245  -3.117  -0.872  0.50 19.14 ? 20  GLU A CD  1 
ATOM   214  O  OE1 A GLU A 1 25  ? 11.221 -2.050  0.861   0.50 25.70 ? 20  GLU A OE1 1 
ATOM   215  O  OE1 B GLU A 1 25  ? 8.351  -2.093  -1.611  0.50 21.55 ? 20  GLU A OE1 1 
ATOM   216  O  OE2 A GLU A 1 25  ? 9.251  -2.296  -0.084  0.50 19.93 ? 20  GLU A OE2 1 
ATOM   217  O  OE2 B GLU A 1 25  ? 7.714  -3.031  0.258   0.50 21.95 ? 20  GLU A OE2 1 
ATOM   218  N  N   . ASP A 1 26  ? 10.325 -6.103  -4.331  1.00 6.54  ? 21  ASP A N   1 
ATOM   219  C  CA  . ASP A 1 26  ? 9.659  -6.669  -5.513  1.00 6.48  ? 21  ASP A CA  1 
ATOM   220  C  C   . ASP A 1 26  ? 10.016 -8.146  -5.664  1.00 5.95  ? 21  ASP A C   1 
ATOM   221  O  O   . ASP A 1 26  ? 9.127  -8.986  -5.943  1.00 7.90  ? 21  ASP A O   1 
ATOM   222  C  CB  . ASP A 1 26  ? 10.106 -5.964  -6.793  1.00 7.89  ? 21  ASP A CB  1 
ATOM   223  C  CG  . ASP A 1 26  ? 9.592  -4.546  -6.907  1.00 7.82  ? 21  ASP A CG  1 
ATOM   224  O  OD1 . ASP A 1 26  ? 8.662  -4.092  -6.213  1.00 10.37 ? 21  ASP A OD1 1 
ATOM   225  O  OD2 . ASP A 1 26  ? 10.164 -3.875  -7.799  1.00 11.22 ? 21  ASP A OD2 1 
ATOM   226  N  N   . MET A 1 27  ? 11.292 -8.461  -5.507  1.00 6.52  ? 22  MET A N   1 
ATOM   227  C  CA  . MET A 1 27  ? 11.744 -9.836  -5.644  1.00 5.30  ? 22  MET A CA  1 
ATOM   228  C  C   . MET A 1 27  ? 10.927 -10.736 -4.681  1.00 6.95  ? 22  MET A C   1 
ATOM   229  O  O   . MET A 1 27  ? 10.472 -11.851 -5.057  1.00 7.38  ? 22  MET A O   1 
ATOM   230  C  CB  . MET A 1 27  ? 13.223 -9.902  -5.254  1.00 5.88  ? 22  MET A CB  1 
ATOM   231  C  CG  . MET A 1 27  ? 13.837 -11.236 -5.648  1.00 6.16  ? 22  MET A CG  1 
ATOM   232  S  SD  . MET A 1 27  ? 15.531 -11.226 -5.046  1.00 8.15  ? 22  MET A SD  1 
ATOM   233  C  CE  . MET A 1 27  ? 16.047 -12.896 -5.499  1.00 7.81  ? 22  MET A CE  1 
ATOM   234  N  N   . ALA A 1 28  ? 10.754 -10.278 -3.436  1.00 6.70  ? 23  ALA A N   1 
ATOM   235  C  CA  . ALA A 1 28  ? 10.033 -11.095 -2.441  1.00 6.96  ? 23  ALA A CA  1 
ATOM   236  C  C   . ALA A 1 28  ? 8.578  -11.217 -2.835  1.00 5.67  ? 23  ALA A C   1 
ATOM   237  O  O   . ALA A 1 28  ? 8.000  -12.296 -2.714  1.00 7.59  ? 23  ALA A O   1 
ATOM   238  C  CB  . ALA A 1 28  ? 10.185 -10.455 -1.035  1.00 7.93  ? 23  ALA A CB  1 
ATOM   239  N  N   . ALA A 1 29  ? 7.979  -10.125 -3.308  1.00 6.44  ? 24  ALA A N   1 
ATOM   240  C  CA  . ALA A 1 29  ? 6.563  -10.224 -3.727  1.00 8.20  ? 24  ALA A CA  1 
ATOM   241  C  C   . ALA A 1 29  ? 6.395  -11.186 -4.885  1.00 6.93  ? 24  ALA A C   1 
ATOM   242  O  O   . ALA A 1 29  ? 5.424  -11.951 -4.933  1.00 8.12  ? 24  ALA A O   1 
ATOM   243  C  CB  . ALA A 1 29  ? 6.035  -8.836  -4.103  1.00 9.61  ? 24  ALA A CB  1 
ATOM   244  N  N   . PHE A 1 30  ? 7.317  -11.152 -5.843  1.00 6.51  ? 25  PHE A N   1 
ATOM   245  C  CA  . PHE A 1 30  ? 7.243  -12.080 -6.973  1.00 7.17  ? 25  PHE A CA  1 
ATOM   246  C  C   . PHE A 1 30  ? 7.393  -13.498 -6.457  1.00 5.83  ? 25  PHE A C   1 
ATOM   247  O  O   . PHE A 1 30  ? 6.664  -14.401 -6.923  1.00 6.63  ? 25  PHE A O   1 
ATOM   248  C  CB  . PHE A 1 30  ? 8.330  -11.787 -8.040  1.00 7.02  ? 25  PHE A CB  1 
ATOM   249  C  CG  . PHE A 1 30  ? 8.121  -10.477 -8.794  1.00 5.65  ? 25  PHE A CG  1 
ATOM   250  C  CD1 . PHE A 1 30  ? 9.203  -9.633  -9.047  1.00 7.33  ? 25  PHE A CD1 1 
ATOM   251  C  CD2 . PHE A 1 30  ? 6.879  -10.143 -9.290  1.00 8.71  ? 25  PHE A CD2 1 
ATOM   252  C  CE1 . PHE A 1 30  ? 9.028  -8.398  -9.779  1.00 8.49  ? 25  PHE A CE1 1 
ATOM   253  C  CE2 . PHE A 1 30  ? 6.697  -8.938  -10.031 1.00 6.71  ? 25  PHE A CE2 1 
ATOM   254  C  CZ  . PHE A 1 30  ? 7.771  -8.062  -10.260 1.00 8.45  ? 25  PHE A CZ  1 
ATOM   255  N  N   . MET A 1 31  ? 8.397  -13.744 -5.587  1.00 6.28  ? 26  MET A N   1 
ATOM   256  C  CA  . MET A 1 31  ? 8.569  -15.145 -5.127  1.00 5.60  ? 26  MET A CA  1 
ATOM   257  C  C   . MET A 1 31  ? 7.390  -15.604 -4.246  1.00 6.18  ? 26  MET A C   1 
ATOM   258  O  O   . MET A 1 31  ? 7.047  -16.786 -4.241  1.00 7.34  ? 26  MET A O   1 
ATOM   259  C  CB  . MET A 1 31  ? 9.870  -15.295 -4.350  1.00 5.74  ? 26  MET A CB  1 
ATOM   260  C  CG  . MET A 1 31  ? 11.144 -15.188 -5.315  1.00 8.14  ? 26  MET A CG  1 
ATOM   261  S  SD  . MET A 1 31  ? 10.960 -16.266 -6.791  1.00 8.67  ? 26  MET A SD  1 
ATOM   262  C  CE  . MET A 1 31  ? 10.721 -17.872 -5.964  1.00 8.99  ? 26  MET A CE  1 
ATOM   263  N  N   . LYS A 1 32  ? 6.794  -14.690 -3.464  1.00 6.63  ? 27  LYS A N   1 
ATOM   264  C  CA  . LYS A 1 32  ? 5.609  -15.060 -2.701  1.00 6.97  ? 27  LYS A CA  1 
ATOM   265  C  C   . LYS A 1 32  ? 4.530  -15.494 -3.685  1.00 7.02  ? 27  LYS A C   1 
ATOM   266  O  O   . LYS A 1 32  ? 3.840  -16.518 -3.477  1.00 6.93  ? 27  LYS A O   1 
ATOM   267  C  CB  . LYS A 1 32  ? 5.111  -13.860 -1.852  1.00 6.41  ? 27  LYS A CB  1 
ATOM   268  C  CG  . LYS A 1 32  ? 3.782  -14.070 -1.131  1.00 8.27  ? 27  LYS A CG  1 
ATOM   269  C  CD  . LYS A 1 32  ? 3.565  -12.871 -0.161  1.00 11.04 ? 27  LYS A CD  1 
ATOM   270  C  CE  . LYS A 1 32  ? 2.290  -12.993 0.751   1.00 16.16 ? 27  LYS A CE  1 
ATOM   271  N  NZ  . LYS A 1 32  ? 1.033  -13.133 0.030   1.00 16.51 ? 27  LYS A NZ  1 
ATOM   272  N  N   . GLY A 1 33  ? 4.338  -14.708 -4.759  1.00 6.32  ? 28  GLY A N   1 
ATOM   273  C  CA  . GLY A 1 33  ? 3.377  -15.134 -5.791  1.00 6.70  ? 28  GLY A CA  1 
ATOM   274  C  C   . GLY A 1 33  ? 3.693  -16.476 -6.379  1.00 7.37  ? 28  GLY A C   1 
ATOM   275  O  O   . GLY A 1 33  ? 2.789  -17.260 -6.593  1.00 7.43  ? 28  GLY A O   1 
ATOM   276  N  N   . ALA A 1 34  ? 4.979  -16.754 -6.611  1.00 6.38  ? 29  ALA A N   1 
ATOM   277  C  CA  . ALA A 1 34  ? 5.381  -18.053 -7.179  1.00 6.65  ? 29  ALA A CA  1 
ATOM   278  C  C   . ALA A 1 34  ? 5.020  -19.177 -6.189  1.00 6.87  ? 29  ALA A C   1 
ATOM   279  O  O   . ALA A 1 34  ? 4.498  -20.212 -6.600  1.00 6.70  ? 29  ALA A O   1 
ATOM   280  C  CB  . ALA A 1 34  ? 6.910  -18.039 -7.536  1.00 6.78  ? 29  ALA A CB  1 
ATOM   281  N  N   . VAL A 1 35  ? 5.285  -18.972 -4.908  1.00 6.72  ? 30  VAL A N   1 
ATOM   282  C  CA  . VAL A 1 35  ? 5.018  -20.028 -3.918  1.00 7.21  ? 30  VAL A CA  1 
ATOM   283  C  C   . VAL A 1 35  ? 3.539  -20.263 -3.898  1.00 6.07  ? 30  VAL A C   1 
ATOM   284  O  O   . VAL A 1 35  ? 3.086  -21.431 -3.831  1.00 8.31  ? 30  VAL A O   1 
ATOM   285  C  CB  . VAL A 1 35  ? 5.521  -19.587 -2.498  1.00 5.68  ? 30  VAL A CB  1 
ATOM   286  C  CG1 . VAL A 1 35  ? 4.923  -20.502 -1.436  1.00 8.86  ? 30  VAL A CG1 1 
ATOM   287  C  CG2 . VAL A 1 35  ? 7.057  -19.603 -2.471  1.00 8.37  ? 30  VAL A CG2 1 
ATOM   288  N  N   . GLU A 1 36  ? 2.745  -19.199 -3.970  1.00 6.83  ? 31  GLU A N   1 
ATOM   289  C  CA  . GLU A 1 36  ? 1.295  -19.319 -3.893  1.00 7.53  ? 31  GLU A CA  1 
ATOM   290  C  C   . GLU A 1 36  ? 0.658  -20.029 -5.070  1.00 7.54  ? 31  GLU A C   1 
ATOM   291  O  O   . GLU A 1 36  ? -0.519 -20.406 -5.015  1.00 9.86  ? 31  GLU A O   1 
ATOM   292  C  CB  . GLU A 1 36  ? 0.657  -17.947 -3.609  1.00 7.78  ? 31  GLU A CB  1 
ATOM   293  C  CG  . GLU A 1 36  ? 0.940  -17.537 -2.170  1.00 10.91 ? 31  GLU A CG  1 
ATOM   294  C  CD  . GLU A 1 36  ? 0.601  -16.092 -1.880  1.00 14.72 ? 31  GLU A CD  1 
ATOM   295  O  OE1 . GLU A 1 36  ? 0.282  -15.314 -2.805  1.00 20.44 ? 31  GLU A OE1 1 
ATOM   296  O  OE2 . GLU A 1 36  ? 0.716  -15.726 -0.696  1.00 20.85 ? 31  GLU A OE2 1 
ATOM   297  N  N   . LYS A 1 37  ? 1.438  -20.236 -6.146  1.00 7.68  ? 32  LYS A N   1 
ATOM   298  C  CA  . LYS A 1 37  ? 0.952  -21.112 -7.235  1.00 8.75  ? 32  LYS A CA  1 
ATOM   299  C  C   . LYS A 1 37  ? 0.729  -22.546 -6.782  1.00 9.02  ? 32  LYS A C   1 
ATOM   300  O  O   . LYS A 1 37  ? -0.023 -23.262 -7.394  1.00 8.81  ? 32  LYS A O   1 
ATOM   301  C  CB  . LYS A 1 37  ? 1.882  -21.107 -8.419  1.00 7.27  ? 32  LYS A CB  1 
ATOM   302  C  CG  . LYS A 1 37  ? 2.071  -19.730 -9.050  1.00 8.62  ? 32  LYS A CG  1 
ATOM   303  C  CD  . LYS A 1 37  ? 0.788  -19.082 -9.628  1.00 7.32  ? 32  LYS A CD  1 
ATOM   304  C  CE  . LYS A 1 37  ? 1.083  -17.679 -10.080 1.00 8.34  ? 32  LYS A CE  1 
ATOM   305  N  NZ  . LYS A 1 37  ? -0.241 -17.086 -10.537 1.00 13.04 ? 32  LYS A NZ  1 
ATOM   306  N  N   . GLY A 1 38  ? 1.350  -22.968 -5.652  1.00 9.33  ? 33  GLY A N   1 
ATOM   307  C  CA  . GLY A 1 38  ? 1.028  -24.273 -5.127  1.00 9.04  ? 33  GLY A CA  1 
ATOM   308  C  C   . GLY A 1 38  ? 1.975  -25.405 -5.518  1.00 10.13 ? 33  GLY A C   1 
ATOM   309  O  O   . GLY A 1 38  ? 1.856  -26.501 -4.991  1.00 13.61 ? 33  GLY A O   1 
ATOM   310  N  N   . GLU A 1 39  ? 2.864  -25.160 -6.471  1.00 9.87  ? 34  GLU A N   1 
ATOM   311  C  CA  . GLU A 1 39  ? 3.821  -26.151 -6.861  1.00 10.33 ? 34  GLU A CA  1 
ATOM   312  C  C   . GLU A 1 39  ? 5.075  -26.074 -5.991  1.00 10.75 ? 34  GLU A C   1 
ATOM   313  O  O   . GLU A 1 39  ? 5.447  -25.007 -5.543  1.00 12.14 ? 34  GLU A O   1 
ATOM   314  C  CB  . GLU A 1 39  ? 4.205  -25.961 -8.324  1.00 12.66 ? 34  GLU A CB  1 
ATOM   315  C  CG  . GLU A 1 39  ? 3.025  -26.068 -9.238  1.00 17.92 ? 34  GLU A CG  1 
ATOM   316  C  CD  . GLU A 1 39  ? 2.532  -27.522 -9.386  1.00 24.78 ? 34  GLU A CD  1 
ATOM   317  O  OE1 . GLU A 1 39  ? 1.524  -27.696 -10.110 1.00 32.85 ? 34  GLU A OE1 1 
ATOM   318  O  OE2 . GLU A 1 39  ? 3.145  -28.508 -8.891  1.00 27.91 ? 34  GLU A OE2 1 
ATOM   319  N  N   . GLU A 1 40  ? 5.791  -27.185 -5.839  1.00 10.99 ? 35  GLU A N   1 
ATOM   320  C  CA  . GLU A 1 40  ? 7.051  -27.132 -5.060  1.00 9.62  ? 35  GLU A CA  1 
ATOM   321  C  C   . GLU A 1 40  ? 8.057  -26.243 -5.828  1.00 10.23 ? 35  GLU A C   1 
ATOM   322  O  O   . GLU A 1 40  ? 7.912  -25.991 -7.087  1.00 11.55 ? 35  GLU A O   1 
ATOM   323  C  CB  . GLU A 1 40  ? 7.568  -28.580 -4.888  1.00 12.42 ? 35  GLU A CB  1 
ATOM   324  C  CG  . GLU A 1 40  ? 6.498  -29.326 -4.019  1.00 18.17 ? 35  GLU A CG  1 
ATOM   325  C  CD  . GLU A 1 40  ? 6.849  -30.760 -3.686  1.00 21.74 ? 35  GLU A CD  1 
ATOM   326  O  OE1 . GLU A 1 40  ? 5.942  -31.589 -3.573  1.00 23.69 ? 35  GLU A OE1 1 
ATOM   327  O  OE2 . GLU A 1 40  ? 8.042  -31.064 -3.544  1.00 26.13 ? 35  GLU A OE2 1 
ATOM   328  N  N   . LEU A 1 41  ? 8.967  -25.657 -5.058  1.00 8.97  ? 36  LEU A N   1 
ATOM   329  C  CA  A LEU A 1 41  ? 10.057 -24.854 -5.619  0.50 8.63  ? 36  LEU A CA  1 
ATOM   330  C  CA  B LEU A 1 41  ? 10.050 -24.855 -5.634  0.50 9.50  ? 36  LEU A CA  1 
ATOM   331  C  C   . LEU A 1 41  ? 11.275 -25.718 -5.930  1.00 8.94  ? 36  LEU A C   1 
ATOM   332  O  O   . LEU A 1 41  ? 11.643 -26.653 -5.154  1.00 10.03 ? 36  LEU A O   1 
ATOM   333  C  CB  A LEU A 1 41  ? 10.511 -23.824 -4.601  0.50 8.31  ? 36  LEU A CB  1 
ATOM   334  C  CB  B LEU A 1 41  ? 10.479 -23.749 -4.674  0.50 10.00 ? 36  LEU A CB  1 
ATOM   335  C  CG  A LEU A 1 41  ? 9.364  -22.952 -4.123  0.50 7.36  ? 36  LEU A CG  1 
ATOM   336  C  CG  B LEU A 1 41  ? 9.586  -22.504 -4.728  0.50 13.40 ? 36  LEU A CG  1 
ATOM   337  C  CD1 A LEU A 1 41  ? 9.964  -21.949 -3.185  0.50 7.34  ? 36  LEU A CD1 1 
ATOM   338  C  CD1 B LEU A 1 41  ? 8.127  -22.832 -4.380  0.50 14.53 ? 36  LEU A CD1 1 
ATOM   339  C  CD2 A LEU A 1 41  ? 8.764  -22.242 -5.352  0.50 9.52  ? 36  LEU A CD2 1 
ATOM   340  C  CD2 B LEU A 1 41  ? 10.186 -21.393 -3.854  0.50 12.72 ? 36  LEU A CD2 1 
ATOM   341  N  N   . SER A 1 42  ? 11.935 -25.399 -7.035  1.00 8.63  ? 37  SER A N   1 
ATOM   342  C  CA  . SER A 1 42  ? 13.239 -25.970 -7.305  1.00 7.85  ? 37  SER A CA  1 
ATOM   343  C  C   . SER A 1 42  ? 14.329 -25.399 -6.377  1.00 8.14  ? 37  SER A C   1 
ATOM   344  O  O   . SER A 1 42  ? 14.127 -24.465 -5.646  1.00 7.78  ? 37  SER A O   1 
ATOM   345  C  CB  . SER A 1 42  ? 13.620 -25.678 -8.776  1.00 7.71  ? 37  SER A CB  1 
ATOM   346  O  OG  . SER A 1 42  ? 13.879 -24.288 -8.904  1.00 7.93  ? 37  SER A OG  1 
ATOM   347  N  N   . VAL A 1 43  ? 15.522 -25.959 -6.456  1.00 7.06  ? 38  VAL A N   1 
ATOM   348  C  CA  A VAL A 1 43  ? 16.617 -25.416 -5.646  0.50 9.09  ? 38  VAL A CA  1 
ATOM   349  C  CA  B VAL A 1 43  ? 16.659 -25.435 -5.710  0.50 8.21  ? 38  VAL A CA  1 
ATOM   350  C  C   . VAL A 1 43  ? 16.889 -23.939 -6.006  1.00 7.81  ? 38  VAL A C   1 
ATOM   351  O  O   . VAL A 1 43  ? 17.090 -23.117 -5.094  1.00 9.08  ? 38  VAL A O   1 
ATOM   352  C  CB  A VAL A 1 43  ? 17.923 -26.241 -5.745  0.50 9.70  ? 38  VAL A CB  1 
ATOM   353  C  CB  B VAL A 1 43  ? 17.910 -26.234 -6.075  0.50 7.54  ? 38  VAL A CB  1 
ATOM   354  C  CG1 A VAL A 1 43  ? 18.376 -26.312 -7.123  0.50 13.61 ? 38  VAL A CG1 1 
ATOM   355  C  CG1 B VAL A 1 43  ? 19.162 -25.509 -5.591  0.50 10.49 ? 38  VAL A CG1 1 
ATOM   356  C  CG2 A VAL A 1 43  ? 19.000 -25.601 -4.841  0.50 12.07 ? 38  VAL A CG2 1 
ATOM   357  C  CG2 B VAL A 1 43  ? 17.779 -27.611 -5.479  0.50 7.83  ? 38  VAL A CG2 1 
ATOM   358  N  N   . GLU A 1 44  ? 16.920 -23.610 -7.298  1.00 7.65  ? 39  GLU A N   1 
ATOM   359  C  CA  . GLU A 1 44  ? 17.215 -22.229 -7.710  1.00 7.30  ? 39  GLU A CA  1 
ATOM   360  C  C   . GLU A 1 44  ? 16.083 -21.320 -7.172  1.00 5.15  ? 39  GLU A C   1 
ATOM   361  O  O   . GLU A 1 44  ? 16.332 -20.216 -6.699  1.00 7.61  ? 39  GLU A O   1 
ATOM   362  C  CB  . GLU A 1 44  ? 17.336 -22.122 -9.235  1.00 8.69  ? 39  GLU A CB  1 
ATOM   363  C  CG  . GLU A 1 44  ? 17.467 -20.707 -9.678  1.00 12.99 ? 39  GLU A CG  1 
ATOM   364  C  CD  . GLU A 1 44  ? 17.723 -20.624 -11.193 1.00 21.45 ? 39  GLU A CD  1 
ATOM   365  O  OE1 . GLU A 1 44  ? 17.659 -21.662 -11.885 1.00 28.76 ? 39  GLU A OE1 1 
ATOM   366  O  OE2 . GLU A 1 44  ? 18.073 -19.548 -11.693 1.00 26.25 ? 39  GLU A OE2 1 
ATOM   367  N  N   . GLU A 1 45  ? 14.841 -21.807 -7.234  1.00 5.48  ? 40  GLU A N   1 
ATOM   368  C  CA  . GLU A 1 45  ? 13.685 -20.977 -6.838  1.00 6.07  ? 40  GLU A CA  1 
ATOM   369  C  C   . GLU A 1 45  ? 13.712 -20.753 -5.325  1.00 5.86  ? 40  GLU A C   1 
ATOM   370  O  O   . GLU A 1 45  ? 13.352 -19.667 -4.823  1.00 7.37  ? 40  GLU A O   1 
ATOM   371  C  CB  . GLU A 1 45  ? 12.366 -21.663 -7.227  1.00 6.14  ? 40  GLU A CB  1 
ATOM   372  C  CG  . GLU A 1 45  ? 12.278 -21.658 -8.822  1.00 6.52  ? 40  GLU A CG  1 
ATOM   373  C  CD  . GLU A 1 45  ? 11.226 -22.622 -9.357  1.00 7.95  ? 40  GLU A CD  1 
ATOM   374  O  OE1 . GLU A 1 45  ? 10.664 -23.372 -8.525  1.00 8.56  ? 40  GLU A OE1 1 
ATOM   375  O  OE2 . GLU A 1 45  ? 10.968 -22.656 -10.578 1.00 13.09 ? 40  GLU A OE2 1 
ATOM   376  N  N   . ARG A 1 46  ? 14.085 -21.793 -4.578  1.00 8.26  ? 41  ARG A N   1 
ATOM   377  C  CA  . ARG A 1 46  ? 14.126 -21.661 -3.116  1.00 7.85  ? 41  ARG A CA  1 
ATOM   378  C  C   . ARG A 1 46  ? 15.174 -20.630 -2.757  1.00 8.08  ? 41  ARG A C   1 
ATOM   379  O  O   . ARG A 1 46  ? 14.983 -19.809 -1.841  1.00 7.47  ? 41  ARG A O   1 
ATOM   380  C  CB  . ARG A 1 46  ? 14.547 -23.035 -2.449  1.00 11.37 ? 41  ARG A CB  1 
ATOM   381  C  CG  . ARG A 1 46  ? 13.450 -23.849 -2.400  1.00 15.73 ? 41  ARG A CG  1 
ATOM   382  C  CD  . ARG A 1 46  ? 13.751 -25.079 -1.557  1.00 21.44 ? 41  ARG A CD  1 
ATOM   383  N  NE  . ARG A 1 46  ? 14.812 -25.932 -2.001  1.00 21.41 ? 41  ARG A NE  1 
ATOM   384  C  CZ  . ARG A 1 46  ? 14.711 -27.031 -2.777  1.00 20.54 ? 41  ARG A CZ  1 
ATOM   385  N  NH1 . ARG A 1 46  ? 13.592 -27.410 -3.419  1.00 17.41 ? 41  ARG A NH1 1 
ATOM   386  N  NH2 . ARG A 1 46  ? 15.796 -27.767 -2.921  1.00 21.49 ? 41  ARG A NH2 1 
ATOM   387  N  N   . ASN A 1 47  ? 16.287 -20.650 -3.486  1.00 7.40  ? 42  ASN A N   1 
ATOM   388  C  CA  . ASN A 1 47  ? 17.333 -19.661 -3.207  1.00 7.17  ? 42  ASN A CA  1 
ATOM   389  C  C   . ASN A 1 47  ? 16.822 -18.282 -3.532  1.00 6.79  ? 42  ASN A C   1 
ATOM   390  O  O   . ASN A 1 47  ? 17.084 -17.357 -2.739  1.00 8.21  ? 42  ASN A O   1 
ATOM   391  C  CB  . ASN A 1 47  ? 18.604 -19.966 -4.032  1.00 5.72  ? 42  ASN A CB  1 
ATOM   392  C  CG  . ASN A 1 47  ? 19.298 -21.221 -3.559  1.00 10.01 ? 42  ASN A CG  1 
ATOM   393  O  OD1 . ASN A 1 47  ? 19.023 -21.715 -2.464  1.00 11.71 ? 42  ASN A OD1 1 
ATOM   394  N  ND2 . ASN A 1 47  ? 20.196 -21.754 -4.391  1.00 11.04 ? 42  ASN A ND2 1 
ATOM   395  N  N   . LEU A 1 48  ? 16.049 -18.114 -4.621  1.00 6.22  ? 43  LEU A N   1 
ATOM   396  C  CA  . LEU A 1 48  ? 15.498 -16.754 -4.886  1.00 6.22  ? 43  LEU A CA  1 
ATOM   397  C  C   . LEU A 1 48  ? 14.581 -16.295 -3.736  1.00 5.67  ? 43  LEU A C   1 
ATOM   398  O  O   . LEU A 1 48  ? 14.600 -15.120 -3.303  1.00 6.89  ? 43  LEU A O   1 
ATOM   399  C  CB  . LEU A 1 48  ? 14.685 -16.716 -6.181  1.00 7.03  ? 43  LEU A CB  1 
ATOM   400  C  CG  . LEU A 1 48  ? 15.511 -16.948 -7.443  1.00 7.75  ? 43  LEU A CG  1 
ATOM   401  C  CD1 . LEU A 1 48  ? 14.567 -17.225 -8.627  1.00 9.48  ? 43  LEU A CD1 1 
ATOM   402  C  CD2 . LEU A 1 48  ? 16.344 -15.680 -7.679  1.00 11.02 ? 43  LEU A CD2 1 
ATOM   403  N  N   . LEU A 1 49  ? 13.719 -17.188 -3.282  1.00 5.65  ? 44  LEU A N   1 
ATOM   404  C  CA  . LEU A 1 49  ? 12.819 -16.902 -2.201  1.00 5.43  ? 44  LEU A CA  1 
ATOM   405  C  C   . LEU A 1 49  ? 13.590 -16.433 -0.945  1.00 6.77  ? 44  LEU A C   1 
ATOM   406  O  O   . LEU A 1 49  ? 13.272 -15.388 -0.322  1.00 6.04  ? 44  LEU A O   1 
ATOM   407  C  CB  . LEU A 1 49  ? 11.949 -18.134 -1.849  1.00 5.97  ? 44  LEU A CB  1 
ATOM   408  C  CG  . LEU A 1 49  ? 11.015 -17.966 -0.643  1.00 7.30  ? 44  LEU A CG  1 
ATOM   409  C  CD1 . LEU A 1 49  ? 9.828  -16.940 -0.958  1.00 9.18  ? 44  LEU A CD1 1 
ATOM   410  C  CD2 . LEU A 1 49  ? 10.418 -19.334 -0.227  1.00 10.15 ? 44  LEU A CD2 1 
ATOM   411  N  N   . SER A 1 50  ? 14.605 -17.190 -0.594  1.00 5.27  ? 45  SER A N   1 
ATOM   412  C  CA  A SER A 1 50  ? 15.317 -16.893 0.624   0.60 5.68  ? 45  SER A CA  1 
ATOM   413  C  CA  B SER A 1 50  ? 15.350 -16.920 0.609   0.40 6.63  ? 45  SER A CA  1 
ATOM   414  C  C   . SER A 1 50  ? 16.120 -15.610 0.509   1.00 6.79  ? 45  SER A C   1 
ATOM   415  O  O   . SER A 1 50  ? 16.158 -14.834 1.452   1.00 7.97  ? 45  SER A O   1 
ATOM   416  C  CB  A SER A 1 50  ? 16.183 -18.099 1.051   0.60 5.42  ? 45  SER A CB  1 
ATOM   417  C  CB  B SER A 1 50  ? 16.273 -18.112 0.897   0.40 6.94  ? 45  SER A CB  1 
ATOM   418  O  OG  A SER A 1 50  ? 17.319 -18.239 0.203   0.60 4.79  ? 45  SER A OG  1 
ATOM   419  O  OG  B SER A 1 50  ? 17.040 -17.899 2.057   0.40 11.35 ? 45  SER A OG  1 
ATOM   420  N  N   . VAL A 1 51  ? 16.747 -15.387 -0.639  1.00 5.67  ? 46  VAL A N   1 
ATOM   421  C  CA  . VAL A 1 51  ? 17.525 -14.158 -0.837  1.00 5.42  ? 46  VAL A CA  1 
ATOM   422  C  C   . VAL A 1 51  ? 16.628 -12.916 -0.722  1.00 6.45  ? 46  VAL A C   1 
ATOM   423  O  O   . VAL A 1 51  ? 16.993 -11.896 -0.150  1.00 7.53  ? 46  VAL A O   1 
ATOM   424  C  CB  . VAL A 1 51  ? 18.306 -14.194 -2.202  1.00 5.45  ? 46  VAL A CB  1 
ATOM   425  C  CG1 . VAL A 1 51  ? 18.854 -12.765 -2.541  1.00 9.19  ? 46  VAL A CG1 1 
ATOM   426  C  CG2 . VAL A 1 51  ? 19.400 -15.234 -2.058  1.00 8.67  ? 46  VAL A CG2 1 
ATOM   427  N  N   . ALA A 1 52  ? 15.466 -13.002 -1.329  1.00 5.91  ? 47  ALA A N   1 
ATOM   428  C  CA  . ALA A 1 52  ? 14.555 -11.863 -1.363  1.00 5.25  ? 47  ALA A CA  1 
ATOM   429  C  C   . ALA A 1 52  ? 14.203 -11.486 0.061   1.00 6.33  ? 47  ALA A C   1 
ATOM   430  O  O   . ALA A 1 52  ? 14.372 -10.325 0.472   1.00 8.17  ? 47  ALA A O   1 
ATOM   431  C  CB  . ALA A 1 52  ? 13.295 -12.228 -2.161  1.00 7.31  ? 47  ALA A CB  1 
ATOM   432  N  N   . TYR A 1 53  ? 13.637 -12.443 0.802   1.00 5.92  ? 48  TYR A N   1 
ATOM   433  C  CA  . TYR A 1 53  ? 13.200 -12.070 2.148   1.00 6.17  ? 48  TYR A CA  1 
ATOM   434  C  C   . TYR A 1 53  ? 14.369 -11.767 3.047   1.00 6.76  ? 48  TYR A C   1 
ATOM   435  O  O   . TYR A 1 53  ? 14.238 -10.917 3.917   1.00 7.01  ? 48  TYR A O   1 
ATOM   436  C  CB  . TYR A 1 53  ? 12.259 -13.140 2.736   1.00 6.60  ? 48  TYR A CB  1 
ATOM   437  C  CG  . TYR A 1 53  ? 10.907 -12.993 2.171   1.00 6.19  ? 48  TYR A CG  1 
ATOM   438  C  CD1 . TYR A 1 53  ? 10.052 -11.959 2.609   1.00 6.31  ? 48  TYR A CD1 1 
ATOM   439  C  CD2 . TYR A 1 53  ? 10.433 -13.889 1.221   1.00 6.10  ? 48  TYR A CD2 1 
ATOM   440  C  CE1 . TYR A 1 53  ? 8.761  -11.820 2.065   1.00 7.48  ? 48  TYR A CE1 1 
ATOM   441  C  CE2 . TYR A 1 53  ? 9.134  -13.772 0.708   1.00 8.05  ? 48  TYR A CE2 1 
ATOM   442  C  CZ  . TYR A 1 53  ? 8.305  -12.757 1.153   1.00 8.93  ? 48  TYR A CZ  1 
ATOM   443  O  OH  . TYR A 1 53  ? 7.025  -12.605 0.619   1.00 9.95  ? 48  TYR A OH  1 
ATOM   444  N  N   . LYS A 1 54  ? 15.525 -12.435 2.887   1.00 6.74  ? 49  LYS A N   1 
ATOM   445  C  CA  A LYS A 1 54  ? 16.652 -12.173 3.778   0.25 8.00  ? 49  LYS A CA  1 
ATOM   446  C  CA  B LYS A 1 54  ? 16.708 -12.184 3.722   0.25 7.31  ? 49  LYS A CA  1 
ATOM   447  C  CA  C LYS A 1 54  ? 16.671 -12.182 3.744   0.50 8.56  ? 49  LYS A CA  1 
ATOM   448  C  C   . LYS A 1 54  ? 17.097 -10.733 3.612   1.00 7.90  ? 49  LYS A C   1 
ATOM   449  O  O   . LYS A 1 54  ? 17.492 -10.091 4.606   1.00 9.03  ? 49  LYS A O   1 
ATOM   450  C  CB  A LYS A 1 54  ? 17.812 -13.153 3.496   0.25 8.00  ? 49  LYS A CB  1 
ATOM   451  C  CB  B LYS A 1 54  ? 17.888 -13.073 3.253   0.25 6.76  ? 49  LYS A CB  1 
ATOM   452  C  CB  C LYS A 1 54  ? 17.800 -13.168 3.323   0.50 8.28  ? 49  LYS A CB  1 
ATOM   453  C  CG  A LYS A 1 54  ? 18.868 -13.228 4.630   0.25 9.84  ? 49  LYS A CG  1 
ATOM   454  C  CG  B LYS A 1 54  ? 19.275 -12.568 3.735   0.25 4.45  ? 49  LYS A CG  1 
ATOM   455  C  CG  C LYS A 1 54  ? 18.747 -13.505 4.480   0.50 14.95 ? 49  LYS A CG  1 
ATOM   456  C  CD  A LYS A 1 54  ? 18.466 -14.316 5.717   0.25 10.65 ? 49  LYS A CD  1 
ATOM   457  C  CD  B LYS A 1 54  ? 20.378 -13.602 3.519   0.25 7.84  ? 49  LYS A CD  1 
ATOM   458  C  CD  C LYS A 1 54  ? 17.935 -13.929 5.813   0.50 17.35 ? 49  LYS A CD  1 
ATOM   459  C  CE  A LYS A 1 54  ? 19.648 -14.813 6.520   0.25 8.21  ? 49  LYS A CE  1 
ATOM   460  C  CE  B LYS A 1 54  ? 21.739 -13.014 3.999   0.25 9.97  ? 49  LYS A CE  1 
ATOM   461  C  CE  C LYS A 1 54  ? 18.375 -15.278 6.396   0.50 20.17 ? 49  LYS A CE  1 
ATOM   462  N  NZ  A LYS A 1 54  ? 20.392 -13.706 7.086   0.25 10.25 ? 49  LYS A NZ  1 
ATOM   463  N  NZ  B LYS A 1 54  ? 22.047 -12.995 5.470   0.25 7.58  ? 49  LYS A NZ  1 
ATOM   464  N  NZ  C LYS A 1 54  ? 17.468 -16.493 6.012   0.50 14.99 ? 49  LYS A NZ  1 
ATOM   465  N  N   . ASN A 1 55  ? 17.023 -10.212 2.370   1.00 7.80  ? 50  ASN A N   1 
ATOM   466  C  CA  . ASN A 1 55  ? 17.416 -8.841  2.156   1.00 6.31  ? 50  ASN A CA  1 
ATOM   467  C  C   . ASN A 1 55  ? 16.384 -7.858  2.695   1.00 7.03  ? 50  ASN A C   1 
ATOM   468  O  O   . ASN A 1 55  ? 16.758 -6.805  3.232   1.00 9.77  ? 50  ASN A O   1 
ATOM   469  C  CB  . ASN A 1 55  ? 17.647 -8.580  0.680   1.00 7.02  ? 50  ASN A CB  1 
ATOM   470  C  CG  . ASN A 1 55  ? 19.015 -8.976  0.283   1.00 12.25 ? 50  ASN A CG  1 
ATOM   471  O  OD1 . ASN A 1 55  ? 19.273 -10.170 -0.068  1.00 19.39 ? 50  ASN A OD1 1 
ATOM   472  N  ND2 . ASN A 1 55  ? 19.937 -7.982  0.316   1.00 15.42 ? 50  ASN A ND2 1 
ATOM   473  N  N   . VAL A 1 56  ? 15.105 -8.158  2.490   1.00 8.16  ? 51  VAL A N   1 
ATOM   474  C  CA  . VAL A 1 56  ? 14.053 -7.262  2.980   1.00 6.77  ? 51  VAL A CA  1 
ATOM   475  C  C   . VAL A 1 56  ? 14.166 -7.171  4.511   1.00 6.79  ? 51  VAL A C   1 
ATOM   476  O  O   . VAL A 1 56  ? 14.203 -6.121  5.104   1.00 8.20  ? 51  VAL A O   1 
ATOM   477  C  CB  . VAL A 1 56  ? 12.653 -7.736  2.574   1.00 6.58  ? 51  VAL A CB  1 
ATOM   478  C  CG1 . VAL A 1 56  ? 11.525 -6.935  3.379   1.00 8.95  ? 51  VAL A CG1 1 
ATOM   479  C  CG2 . VAL A 1 56  ? 12.479 -7.574  1.035   1.00 8.14  ? 51  VAL A CG2 1 
ATOM   480  N  N   . VAL A 1 57  ? 14.182 -8.320  5.173   1.00 8.20  ? 52  VAL A N   1 
ATOM   481  C  CA  A VAL A 1 57  ? 14.130 -8.301  6.615   0.50 7.48  ? 52  VAL A CA  1 
ATOM   482  C  CA  B VAL A 1 57  ? 14.145 -8.269  6.622   0.50 8.28  ? 52  VAL A CA  1 
ATOM   483  C  C   . VAL A 1 57  ? 15.488 -7.798  7.135   1.00 8.96  ? 52  VAL A C   1 
ATOM   484  O  O   . VAL A 1 57  ? 15.567 -7.225  8.215   1.00 9.33  ? 52  VAL A O   1 
ATOM   485  C  CB  A VAL A 1 57  ? 13.676 -9.713  7.149   0.50 7.16  ? 52  VAL A CB  1 
ATOM   486  C  CB  B VAL A 1 57  ? 13.763 -9.636  7.202   0.50 8.62  ? 52  VAL A CB  1 
ATOM   487  C  CG1 A VAL A 1 57  ? 14.871 -10.718 7.243   0.50 3.79  ? 52  VAL A CG1 1 
ATOM   488  C  CG1 B VAL A 1 57  ? 13.717 -9.613  8.690   0.50 9.78  ? 52  VAL A CG1 1 
ATOM   489  C  CG2 A VAL A 1 57  ? 12.943 -9.611  8.429   0.50 8.68  ? 52  VAL A CG2 1 
ATOM   490  C  CG2 B VAL A 1 57  ? 12.468 -10.036 6.647   0.50 8.94  ? 52  VAL A CG2 1 
ATOM   491  N  N   . GLY A 1 58  ? 16.569 -8.067  6.386   1.00 8.64  ? 53  GLY A N   1 
ATOM   492  C  CA  . GLY A 1 58  ? 17.855 -7.599  6.827   1.00 9.85  ? 53  GLY A CA  1 
ATOM   493  C  C   . GLY A 1 58  ? 17.876 -6.061  6.933   1.00 10.32 ? 53  GLY A C   1 
ATOM   494  O  O   . GLY A 1 58  ? 18.422 -5.510  7.923   1.00 11.13 ? 53  GLY A O   1 
ATOM   495  N  N   . GLY A 1 59  ? 17.316 -5.375  5.918   1.00 10.31 ? 54  GLY A N   1 
ATOM   496  C  CA  . GLY A 1 59  ? 17.218 -3.913  5.973   1.00 10.57 ? 54  GLY A CA  1 
ATOM   497  C  C   . GLY A 1 59  ? 16.325 -3.451  7.133   1.00 9.87  ? 54  GLY A C   1 
ATOM   498  O  O   . GLY A 1 59  ? 16.665 -2.465  7.852   1.00 11.51 ? 54  GLY A O   1 
ATOM   499  N  N   . GLN A 1 60  ? 15.238 -4.161  7.359   1.00 7.89  ? 55  GLN A N   1 
ATOM   500  C  CA  . GLN A 1 60  ? 14.341 -3.757  8.469   1.00 7.17  ? 55  GLN A CA  1 
ATOM   501  C  C   . GLN A 1 60  ? 15.029 -3.990  9.823   1.00 6.52  ? 55  GLN A C   1 
ATOM   502  O  O   . GLN A 1 60  ? 14.918 -3.174  10.772  1.00 8.27  ? 55  GLN A O   1 
ATOM   503  C  CB  . GLN A 1 60  ? 13.058 -4.604  8.480   1.00 8.16  ? 55  GLN A CB  1 
ATOM   504  C  CG  . GLN A 1 60  ? 12.163 -4.321  7.284   1.00 11.08 ? 55  GLN A CG  1 
ATOM   505  C  CD  . GLN A 1 60  ? 11.064 -5.304  7.228   1.00 12.05 ? 55  GLN A CD  1 
ATOM   506  O  OE1 . GLN A 1 60  ? 11.244 -6.513  7.401   1.00 13.67 ? 55  GLN A OE1 1 
ATOM   507  N  NE2 . GLN A 1 60  ? 9.935  -4.827  6.965   1.00 16.84 ? 55  GLN A NE2 1 
ATOM   508  N  N   . ARG A 1 61  ? 15.767 -5.102  9.954   1.00 6.90  ? 56  ARG A N   1 
ATOM   509  C  CA  . ARG A 1 61  ? 16.444 -5.379  11.237  1.00 7.77  ? 56  ARG A CA  1 
ATOM   510  C  C   . ARG A 1 61  ? 17.515 -4.319  11.493  1.00 7.92  ? 56  ARG A C   1 
ATOM   511  O  O   . ARG A 1 61  ? 17.664 -3.865  12.627  1.00 8.97  ? 56  ARG A O   1 
ATOM   512  C  CB  . ARG A 1 61  ? 17.111 -6.762  11.127  1.00 8.03  ? 56  ARG A CB  1 
ATOM   513  C  CG  . ARG A 1 61  ? 16.009 -7.850  11.172  1.00 8.43  ? 56  ARG A CG  1 
ATOM   514  C  CD  . ARG A 1 61  ? 16.625 -9.211  10.700  1.00 10.17 ? 56  ARG A CD  1 
ATOM   515  N  NE  . ARG A 1 61  ? 17.666 -9.664  11.644  1.00 8.31  ? 56  ARG A NE  1 
ATOM   516  C  CZ  . ARG A 1 61  ? 18.776 -10.324 11.266  1.00 8.38  ? 56  ARG A CZ  1 
ATOM   517  N  NH1 . ARG A 1 61  ? 19.028 -10.573 9.962   1.00 9.10  ? 56  ARG A NH1 1 
ATOM   518  N  NH2 . ARG A 1 61  ? 19.643 -10.767 12.194  1.00 9.40  ? 56  ARG A NH2 1 
ATOM   519  N  N   . ALA A 1 62  ? 18.345 -4.011  10.474  1.00 8.45  ? 57  ALA A N   1 
ATOM   520  C  CA  . ALA A 1 62  ? 19.376 -2.988  10.655  1.00 9.14  ? 57  ALA A CA  1 
ATOM   521  C  C   . ALA A 1 62  ? 18.747 -1.665  11.065  1.00 8.61  ? 57  ALA A C   1 
ATOM   522  O  O   . ALA A 1 62  ? 19.255 -0.969  11.970  1.00 9.63  ? 57  ALA A O   1 
ATOM   523  C  CB  . ALA A 1 62  ? 20.123 -2.801  9.367   1.00 10.75 ? 57  ALA A CB  1 
ATOM   524  N  N   . ALA A 1 63  ? 17.611 -1.313  10.455  1.00 8.54  ? 58  ALA A N   1 
ATOM   525  C  CA  . ALA A 1 63  ? 16.953 -0.046  10.850  1.00 9.42  ? 58  ALA A CA  1 
ATOM   526  C  C   . ALA A 1 63  ? 16.445 -0.133  12.293  1.00 8.84  ? 58  ALA A C   1 
ATOM   527  O  O   . ALA A 1 63  ? 16.561 0.807   13.080  1.00 9.10  ? 58  ALA A O   1 
ATOM   528  C  CB  . ALA A 1 63  ? 15.783 0.297   9.887   1.00 9.38  ? 58  ALA A CB  1 
ATOM   529  N  N   . TRP A 1 64  ? 15.822 -1.251  12.622  1.00 8.30  ? 59  TRP A N   1 
ATOM   530  C  CA  . TRP A 1 64  ? 15.329 -1.453  13.992  1.00 7.89  ? 59  TRP A CA  1 
ATOM   531  C  C   . TRP A 1 64  ? 16.475 -1.300  14.983  1.00 9.44  ? 59  TRP A C   1 
ATOM   532  O  O   . TRP A 1 64  ? 16.292 -0.673  16.058  1.00 9.66  ? 59  TRP A O   1 
ATOM   533  C  CB  . TRP A 1 64  ? 14.646 -2.864  14.070  1.00 8.06  ? 59  TRP A CB  1 
ATOM   534  C  CG  . TRP A 1 64  ? 14.027 -3.091  15.406  1.00 8.48  ? 59  TRP A CG  1 
ATOM   535  C  CD1 . TRP A 1 64  ? 12.716 -2.876  15.752  1.00 11.66 ? 59  TRP A CD1 1 
ATOM   536  C  CD2 . TRP A 1 64  ? 14.677 -3.630  16.578  1.00 10.05 ? 59  TRP A CD2 1 
ATOM   537  N  NE1 . TRP A 1 64  ? 12.516 -3.242  17.078  1.00 10.61 ? 59  TRP A NE1 1 
ATOM   538  C  CE2 . TRP A 1 64  ? 13.695 -3.700  17.616  1.00 10.84 ? 59  TRP A CE2 1 
ATOM   539  C  CE3 . TRP A 1 64  ? 15.979 -4.057  16.842  1.00 9.22  ? 59  TRP A CE3 1 
ATOM   540  C  CZ2 . TRP A 1 64  ? 14.008 -4.139  18.950  1.00 11.91 ? 59  TRP A CZ2 1 
ATOM   541  C  CZ3 . TRP A 1 64  ? 16.286 -4.552  18.122  1.00 10.28 ? 59  TRP A CZ3 1 
ATOM   542  C  CH2 . TRP A 1 64  ? 15.292 -4.592  19.170  1.00 12.54 ? 59  TRP A CH2 1 
ATOM   543  N  N   . ARG A 1 65  ? 17.652 -1.833  14.661  1.00 9.63  ? 60  ARG A N   1 
ATOM   544  C  CA  . ARG A 1 65  ? 18.744 -1.733  15.646  1.00 9.79  ? 60  ARG A CA  1 
ATOM   545  C  C   . ARG A 1 65  ? 19.190 -0.278  15.821  1.00 10.56 ? 60  ARG A C   1 
ATOM   546  O  O   . ARG A 1 65  ? 19.481 0.106   16.943  1.00 11.29 ? 60  ARG A O   1 
ATOM   547  C  CB  . ARG A 1 65  ? 19.954 -2.639  15.301  1.00 10.89 ? 60  ARG A CB  1 
ATOM   548  C  CG  . ARG A 1 65  ? 19.604 -4.145  15.356  1.00 11.30 ? 60  ARG A CG  1 
ATOM   549  C  CD  . ARG A 1 65  ? 20.883 -4.986  15.228  1.00 12.73 ? 60  ARG A CD  1 
ATOM   550  N  NE  . ARG A 1 65  ? 21.564 -4.838  13.912  1.00 12.63 ? 60  ARG A NE  1 
ATOM   551  C  CZ  . ARG A 1 65  ? 21.209 -5.539  12.806  1.00 11.92 ? 60  ARG A CZ  1 
ATOM   552  N  NH1 . ARG A 1 65  ? 20.166 -6.402  12.857  1.00 13.42 ? 60  ARG A NH1 1 
ATOM   553  N  NH2 . ARG A 1 65  ? 21.895 -5.394  11.643  1.00 14.82 ? 60  ARG A NH2 1 
ATOM   554  N  N   . VAL A 1 66  ? 19.183 0.511   14.724  1.00 9.74  ? 61  VAL A N   1 
ATOM   555  C  CA  . VAL A 1 66  ? 19.563 1.917   14.814  1.00 11.68 ? 61  VAL A CA  1 
ATOM   556  C  C   . VAL A 1 66  ? 18.558 2.604   15.770  1.00 10.29 ? 61  VAL A C   1 
ATOM   557  O  O   . VAL A 1 66  ? 18.973 3.327   16.707  1.00 11.78 ? 61  VAL A O   1 
ATOM   558  C  CB  . VAL A 1 66  ? 19.485 2.617   13.424  1.00 12.11 ? 61  VAL A CB  1 
ATOM   559  C  CG1 . VAL A 1 66  ? 19.539 4.155   13.543  1.00 13.34 ? 61  VAL A CG1 1 
ATOM   560  C  CG2 . VAL A 1 66  ? 20.643 2.115   12.561  1.00 12.74 ? 61  VAL A CG2 1 
ATOM   561  N  N   . LEU A 1 67  ? 17.262 2.348   15.535  1.00 9.83  ? 62  LEU A N   1 
ATOM   562  C  CA  . LEU A 1 67  ? 16.204 3.027   16.329  1.00 9.17  ? 62  LEU A CA  1 
ATOM   563  C  C   . LEU A 1 67  ? 16.207 2.544   17.781  1.00 10.00 ? 62  LEU A C   1 
ATOM   564  O  O   . LEU A 1 67  ? 16.054 3.316   18.709  1.00 10.46 ? 62  LEU A O   1 
ATOM   565  C  CB  . LEU A 1 67  ? 14.832 2.804   15.684  1.00 7.49  ? 62  LEU A CB  1 
ATOM   566  C  CG  . LEU A 1 67  ? 14.760 3.416   14.252  1.00 9.77  ? 62  LEU A CG  1 
ATOM   567  C  CD1 . LEU A 1 67  ? 13.418 2.986   13.608  1.00 11.93 ? 62  LEU A CD1 1 
ATOM   568  C  CD2 . LEU A 1 67  ? 14.959 4.946   14.232  1.00 11.96 ? 62  LEU A CD2 1 
ATOM   569  N  N   . SER A 1 68  ? 16.411 1.246   17.987  1.00 10.50 ? 63  SER A N   1 
ATOM   570  C  CA  A SER A 1 68  ? 16.474 0.710   19.354  0.60 11.09 ? 63  SER A CA  1 
ATOM   571  C  CA  B SER A 1 68  ? 16.498 0.739   19.360  0.40 11.61 ? 63  SER A CA  1 
ATOM   572  C  C   . SER A 1 68  ? 17.642 1.335   20.132  1.00 12.28 ? 63  SER A C   1 
ATOM   573  O  O   . SER A 1 68  ? 17.512 1.624   21.336  1.00 12.59 ? 63  SER A O   1 
ATOM   574  C  CB  A SER A 1 68  ? 16.594 -0.821  19.352  0.60 10.32 ? 63  SER A CB  1 
ATOM   575  C  CB  B SER A 1 68  ? 16.649 -0.760  19.381  0.40 11.26 ? 63  SER A CB  1 
ATOM   576  O  OG  A SER A 1 68  ? 16.497 -1.356  20.661  0.60 10.96 ? 63  SER A OG  1 
ATOM   577  O  OG  B SER A 1 68  ? 15.417 -1.279  19.025  0.40 13.84 ? 63  SER A OG  1 
ATOM   578  N  N   . SER A 1 69  ? 18.772 1.533   19.469  1.00 12.85 ? 64  SER A N   1 
ATOM   579  C  CA  A SER A 1 69  ? 19.937 2.149   20.121  0.35 13.08 ? 64  SER A CA  1 
ATOM   580  C  CA  B SER A 1 69  ? 19.918 2.131   20.151  0.35 13.53 ? 64  SER A CA  1 
ATOM   581  C  CA  C SER A 1 69  ? 19.920 2.137   20.153  0.30 13.95 ? 64  SER A CA  1 
ATOM   582  C  C   . SER A 1 69  ? 19.626 3.581   20.545  1.00 14.21 ? 64  SER A C   1 
ATOM   583  O  O   . SER A 1 69  ? 20.001 4.040   21.654  1.00 16.01 ? 64  SER A O   1 
ATOM   584  C  CB  A SER A 1 69  ? 21.168 2.107   19.197  0.35 13.08 ? 64  SER A CB  1 
ATOM   585  C  CB  B SER A 1 69  ? 21.195 2.000   19.306  0.35 13.95 ? 64  SER A CB  1 
ATOM   586  C  CB  C SER A 1 69  ? 21.198 2.049   19.307  0.30 14.57 ? 64  SER A CB  1 
ATOM   587  O  OG  A SER A 1 69  ? 22.276 2.784   19.766  0.35 10.91 ? 64  SER A OG  1 
ATOM   588  O  OG  B SER A 1 69  ? 21.524 0.629   19.119  0.35 13.70 ? 64  SER A OG  1 
ATOM   589  O  OG  C SER A 1 69  ? 21.165 2.972   18.236  0.30 16.59 ? 64  SER A OG  1 
ATOM   590  N  N   . ILE A 1 70  ? 18.942 4.303   19.670  1.00 13.37 ? 65  ILE A N   1 
ATOM   591  C  CA  A ILE A 1 70  ? 18.550 5.696   19.963  0.70 14.57 ? 65  ILE A CA  1 
ATOM   592  C  CA  B ILE A 1 70  ? 18.546 5.694   19.951  0.30 14.75 ? 65  ILE A CA  1 
ATOM   593  C  C   . ILE A 1 70  ? 17.595 5.684   21.141  1.00 14.76 ? 65  ILE A C   1 
ATOM   594  O  O   . ILE A 1 70  ? 17.724 6.486   22.073  1.00 16.26 ? 65  ILE A O   1 
ATOM   595  C  CB  A ILE A 1 70  ? 17.937 6.365   18.729  0.70 14.25 ? 65  ILE A CB  1 
ATOM   596  C  CB  B ILE A 1 70  ? 17.884 6.353   18.717  0.30 14.85 ? 65  ILE A CB  1 
ATOM   597  C  CG1 A ILE A 1 70  ? 19.030 6.569   17.665  0.70 11.57 ? 65  ILE A CG1 1 
ATOM   598  C  CG1 B ILE A 1 70  ? 18.909 6.559   17.605  0.30 15.54 ? 65  ILE A CG1 1 
ATOM   599  C  CG2 A ILE A 1 70  ? 17.232 7.714   19.149  0.70 15.70 ? 65  ILE A CG2 1 
ATOM   600  C  CG2 B ILE A 1 70  ? 17.294 7.728   19.084  0.30 15.70 ? 65  ILE A CG2 1 
ATOM   601  C  CD1 A ILE A 1 70  ? 18.488 6.920   16.235  0.70 10.25 ? 65  ILE A CD1 1 
ATOM   602  C  CD1 B ILE A 1 70  ? 20.212 5.919   17.868  0.30 19.66 ? 65  ILE A CD1 1 
ATOM   603  N  N   . GLU A 1 71  ? 16.661 4.736   21.107  1.00 14.45 ? 66  GLU A N   1 
ATOM   604  C  CA  . GLU A 1 71  ? 15.647 4.643   22.165  1.00 13.86 ? 66  GLU A CA  1 
ATOM   605  C  C   . GLU A 1 71  ? 16.347 4.341   23.492  1.00 15.01 ? 66  GLU A C   1 
ATOM   606  O  O   . GLU A 1 71  ? 16.005 4.903   24.524  1.00 17.07 ? 66  GLU A O   1 
ATOM   607  C  CB  . GLU A 1 71  ? 14.650 3.533   21.803  1.00 14.83 ? 66  GLU A CB  1 
ATOM   608  C  CG  . GLU A 1 71  ? 13.495 3.469   22.774  1.00 15.64 ? 66  GLU A CG  1 
ATOM   609  C  CD  . GLU A 1 71  ? 12.479 2.469   22.346  1.00 14.90 ? 66  GLU A CD  1 
ATOM   610  O  OE1 . GLU A 1 71  ? 12.851 1.611   21.519  1.00 18.32 ? 66  GLU A OE1 1 
ATOM   611  O  OE2 . GLU A 1 71  ? 11.360 2.468   22.882  1.00 17.58 ? 66  GLU A OE2 1 
ATOM   612  N  N   . GLN A 1 72  ? 17.312 3.427   23.465  1.00 16.17 ? 67  GLN A N   1 
ATOM   613  C  CA  . GLN A 1 72  ? 18.027 3.064   24.694  1.00 19.09 ? 67  GLN A CA  1 
ATOM   614  C  C   . GLN A 1 72  ? 18.780 4.240   25.241  1.00 21.41 ? 67  GLN A C   1 
ATOM   615  O  O   . GLN A 1 72  ? 18.763 4.454   26.471  1.00 21.64 ? 67  GLN A O   1 
ATOM   616  C  CB  . GLN A 1 72  ? 19.009 1.929   24.422  1.00 21.60 ? 67  GLN A CB  1 
ATOM   617  C  CG  . GLN A 1 72  ? 18.425 0.597   24.107  1.00 27.12 ? 67  GLN A CG  1 
ATOM   618  C  CD  . GLN A 1 72  ? 17.113 0.291   24.825  1.00 32.18 ? 67  GLN A CD  1 
ATOM   619  O  OE1 . GLN A 1 72  ? 16.059 0.019   24.170  1.00 37.80 ? 67  GLN A OE1 1 
ATOM   620  N  NE2 . GLN A 1 72  ? 17.157 0.276   26.180  1.00 35.87 ? 67  GLN A NE2 1 
ATOM   621  N  N   . LYS A 1 73  ? 19.417 5.035   24.386  1.00 22.25 ? 68  LYS A N   1 
ATOM   622  C  CA  A LYS A 1 73  ? 20.122 6.223   24.876  0.50 23.88 ? 68  LYS A CA  1 
ATOM   623  C  CA  B LYS A 1 73  ? 20.124 6.232   24.864  0.50 24.08 ? 68  LYS A CA  1 
ATOM   624  C  C   . LYS A 1 73  ? 19.115 7.202   25.502  1.00 24.76 ? 68  LYS A C   1 
ATOM   625  O  O   . LYS A 1 73  ? 19.382 7.818   26.561  1.00 24.98 ? 68  LYS A O   1 
ATOM   626  C  CB  A LYS A 1 73  ? 20.960 6.877   23.768  0.50 24.35 ? 68  LYS A CB  1 
ATOM   627  C  CB  B LYS A 1 73  ? 20.923 6.907   23.736  0.50 24.69 ? 68  LYS A CB  1 
ATOM   628  C  CG  A LYS A 1 73  ? 22.123 6.013   23.286  0.50 24.08 ? 68  LYS A CG  1 
ATOM   629  C  CG  B LYS A 1 73  ? 22.140 7.703   24.214  0.50 25.58 ? 68  LYS A CG  1 
ATOM   630  N  N   . SER A 1 74  ? 17.935 7.316   24.905  1.00 24.93 ? 69  SER A N   1 
ATOM   631  C  CA  . SER A 1 74  ? 16.910 8.252   25.424  1.00 27.88 ? 69  SER A CA  1 
ATOM   632  C  C   . SER A 1 74  ? 16.392 7.884   26.826  1.00 29.75 ? 69  SER A C   1 
ATOM   633  O  O   . SER A 1 74  ? 15.840 8.735   27.549  1.00 31.38 ? 69  SER A O   1 
ATOM   634  C  CB  . SER A 1 74  ? 15.717 8.311   24.477  1.00 27.70 ? 69  SER A CB  1 
ATOM   635  O  OG  . SER A 1 74  ? 14.797 7.220   24.747  1.00 29.22 ? 69  SER A OG  1 
ATOM   636  N  N   . ASN A 1 75  ? 16.548 6.621   27.204  1.00 31.31 ? 70  ASN A N   1 
ATOM   637  C  CA  . ASN A 1 75  ? 16.136 6.121   28.506  1.00 32.61 ? 70  ASN A CA  1 
ATOM   638  C  C   . ASN A 1 75  ? 17.248 6.129   29.598  1.00 33.96 ? 70  ASN A C   1 
ATOM   639  O  O   . ASN A 1 75  ? 16.984 5.820   30.771  1.00 35.45 ? 70  ASN A O   1 
ATOM   640  C  CB  . ASN A 1 75  ? 15.425 4.756   28.340  1.00 32.81 ? 70  ASN A CB  1 
ATOM   641  C  CG  . ASN A 1 75  ? 14.131 4.882   27.542  1.00 33.45 ? 70  ASN A CG  1 
ATOM   642  O  OD1 . ASN A 1 75  ? 13.801 4.055   26.651  1.00 36.05 ? 70  ASN A OD1 1 
ATOM   643  N  ND2 . ASN A 1 75  ? 13.399 5.930   27.827  1.00 34.33 ? 70  ASN A ND2 1 
ATOM   644  N  N   . GLU A 1 76  ? 18.456 6.571   29.248  1.00 33.24 ? 71  GLU A N   1 
ATOM   645  C  CA  . GLU A 1 76  ? 19.558 6.687   30.237  1.00 33.42 ? 71  GLU A CA  1 
ATOM   646  C  C   . GLU A 1 76  ? 19.448 7.925   31.114  1.00 33.67 ? 71  GLU A C   1 
ATOM   647  O  O   . GLU A 1 76  ? 18.866 8.901   30.719  1.00 33.02 ? 71  GLU A O   1 
ATOM   648  C  CB  . GLU A 1 76  ? 20.921 6.792   29.542  1.00 33.49 ? 71  GLU A CB  1 
ATOM   649  C  CG  . GLU A 1 76  ? 21.304 5.557   28.724  1.00 36.25 ? 71  GLU A CG  1 
ATOM   650  C  CD  . GLU A 1 76  ? 22.646 5.753   28.018  1.00 42.31 ? 71  GLU A CD  1 
ATOM   651  O  OE1 . GLU A 1 76  ? 23.210 6.895   28.056  1.00 47.07 ? 71  GLU A OE1 1 
ATOM   652  O  OE2 . GLU A 1 76  ? 23.140 4.767   27.425  1.00 45.69 ? 71  GLU A OE2 1 
ATOM   653  N  N   . GLU A 1 77  ? 20.071 7.865   32.290  1.00 35.09 ? 72  GLU A N   1 
ATOM   654  C  CA  . GLU A 1 77  ? 20.139 9.000   33.222  1.00 35.33 ? 72  GLU A CA  1 
ATOM   655  C  C   . GLU A 1 77  ? 20.780 10.279  32.583  1.00 35.71 ? 72  GLU A C   1 
ATOM   656  O  O   . GLU A 1 77  ? 21.893 10.225  31.996  1.00 37.34 ? 72  GLU A O   1 
ATOM   657  C  CB  . GLU A 1 77  ? 20.858 8.543   34.518  1.00 36.47 ? 72  GLU A CB  1 
ATOM   658  N  N   . GLY A 1 78  ? 20.060 11.411  32.681  1.00 34.10 ? 73  GLY A N   1 
ATOM   659  C  CA  . GLY A 1 78  ? 20.543 12.719  32.164  1.00 32.60 ? 73  GLY A CA  1 
ATOM   660  C  C   . GLY A 1 78  ? 20.136 12.989  30.719  1.00 31.53 ? 73  GLY A C   1 
ATOM   661  O  O   . GLY A 1 78  ? 20.431 14.064  30.152  1.00 31.83 ? 73  GLY A O   1 
ATOM   662  N  N   . SER A 1 79  ? 19.488 11.997  30.084  1.00 30.18 ? 74  SER A N   1 
ATOM   663  C  CA  . SER A 1 79  ? 18.954 12.205  28.737  1.00 28.30 ? 74  SER A CA  1 
ATOM   664  C  C   . SER A 1 79  ? 17.704 13.061  28.773  1.00 28.38 ? 74  SER A C   1 
ATOM   665  O  O   . SER A 1 79  ? 16.811 12.861  29.607  1.00 29.40 ? 74  SER A O   1 
ATOM   666  C  CB  . SER A 1 79  ? 18.635 10.850  28.091  1.00 28.43 ? 74  SER A CB  1 
ATOM   667  O  OG  . SER A 1 79  ? 19.839 10.131  27.908  0.50 28.45 ? 74  SER A OG  1 
ATOM   668  N  N   . GLU A 1 80  ? 17.620 13.997  27.840  1.00 27.65 ? 75  GLU A N   1 
ATOM   669  C  CA  . GLU A 1 80  ? 16.526 14.957  27.792  1.00 28.21 ? 75  GLU A CA  1 
ATOM   670  C  C   . GLU A 1 80  ? 15.294 14.243  27.231  1.00 29.00 ? 75  GLU A C   1 
ATOM   671  O  O   . GLU A 1 80  ? 15.437 13.461  26.292  1.00 29.59 ? 75  GLU A O   1 
ATOM   672  C  CB  . GLU A 1 80  ? 16.976 16.108  26.864  1.00 28.94 ? 75  GLU A CB  1 
ATOM   673  C  CG  . GLU A 1 80  ? 16.153 17.324  26.903  1.00 29.43 ? 75  GLU A CG  1 
ATOM   674  C  CD  . GLU A 1 80  ? 15.895 17.835  28.307  1.00 29.83 ? 75  GLU A CD  1 
ATOM   675  O  OE1 . GLU A 1 80  ? 16.857 18.036  29.124  1.00 28.15 ? 75  GLU A OE1 1 
ATOM   676  O  OE2 . GLU A 1 80  ? 14.675 18.037  28.560  1.00 31.30 ? 75  GLU A OE2 1 
ATOM   677  N  N   . GLU A 1 81  ? 14.116 14.462  27.838  1.00 28.36 ? 76  GLU A N   1 
ATOM   678  C  CA  . GLU A 1 81  ? 12.843 13.909  27.345  1.00 29.14 ? 76  GLU A CA  1 
ATOM   679  C  C   . GLU A 1 81  ? 12.532 14.445  25.974  1.00 28.90 ? 76  GLU A C   1 
ATOM   680  O  O   . GLU A 1 81  ? 12.457 15.712  25.789  1.00 28.83 ? 76  GLU A O   1 
ATOM   681  C  CB  . GLU A 1 81  ? 11.702 14.290  28.325  1.00 30.78 ? 76  GLU A CB  1 
ATOM   682  C  CG  . GLU A 1 81  ? 10.305 13.792  27.949  1.00 33.54 ? 76  GLU A CG  1 
ATOM   683  C  CD  . GLU A 1 81  ? 10.231 12.252  27.776  1.00 36.40 ? 76  GLU A CD  1 
ATOM   684  O  OE1 . GLU A 1 81  ? 10.653 11.522  28.698  1.00 36.36 ? 76  GLU A OE1 1 
ATOM   685  O  OE2 . GLU A 1 81  ? 9.742  11.772  26.721  1.00 39.15 ? 76  GLU A OE2 1 
ATOM   686  N  N   . LYS A 1 82  ? 12.380 13.546  25.002  1.00 27.85 ? 77  LYS A N   1 
ATOM   687  C  CA  . LYS A 1 82  ? 12.003 14.005  23.661  1.00 27.31 ? 77  LYS A CA  1 
ATOM   688  C  C   . LYS A 1 82  ? 10.660 13.531  23.214  1.00 26.23 ? 77  LYS A C   1 
ATOM   689  O  O   . LYS A 1 82  ? 10.305 13.703  21.996  1.00 28.30 ? 77  LYS A O   1 
ATOM   690  C  CB  . LYS A 1 82  ? 13.028 13.630  22.610  1.00 28.25 ? 77  LYS A CB  1 
ATOM   691  C  CG  . LYS A 1 82  ? 14.376 14.292  22.854  1.00 32.14 ? 77  LYS A CG  1 
ATOM   692  C  CD  . LYS A 1 82  ? 14.335 15.816  22.831  1.00 35.14 ? 77  LYS A CD  1 
ATOM   693  C  CE  . LYS A 1 82  ? 15.777 16.308  23.020  1.00 37.89 ? 77  LYS A CE  1 
ATOM   694  N  NZ  . LYS A 1 82  ? 16.747 15.172  22.647  1.00 43.93 ? 77  LYS A NZ  1 
ATOM   695  N  N   . GLY A 1 83  ? 9.901  12.952  24.154  1.00 21.87 ? 78  GLY A N   1 
ATOM   696  C  CA  . GLY A 1 83  ? 8.560  12.547  23.799  1.00 18.46 ? 78  GLY A CA  1 
ATOM   697  C  C   . GLY A 1 83  ? 8.484  11.138  23.238  1.00 15.68 ? 78  GLY A C   1 
ATOM   698  O  O   . GLY A 1 83  ? 9.453  10.405  23.240  1.00 16.61 ? 78  GLY A O   1 
ATOM   699  N  N   . PRO A 1 84  ? 7.333  10.784  22.719  1.00 13.63 ? 79  PRO A N   1 
ATOM   700  C  CA  . PRO A 1 84  ? 7.037  9.425   22.280  1.00 13.22 ? 79  PRO A CA  1 
ATOM   701  C  C   . PRO A 1 84  ? 7.578  9.045   20.891  1.00 11.96 ? 79  PRO A C   1 
ATOM   702  O  O   . PRO A 1 84  ? 7.478  7.892   20.534  1.00 11.28 ? 79  PRO A O   1 
ATOM   703  C  CB  . PRO A 1 84  ? 5.472  9.391   22.263  1.00 13.94 ? 79  PRO A CB  1 
ATOM   704  C  CG  . PRO A 1 84  ? 5.128  10.818  21.851  1.00 15.19 ? 79  PRO A CG  1 
ATOM   705  C  CD  . PRO A 1 84  ? 6.156  11.673  22.679  1.00 14.42 ? 79  PRO A CD  1 
ATOM   706  N  N   . GLU A 1 85  ? 8.215  9.960   20.155  1.00 11.55 ? 80  GLU A N   1 
ATOM   707  C  CA  . GLU A 1 85  ? 8.364  9.714   18.729  1.00 10.01 ? 80  GLU A CA  1 
ATOM   708  C  C   . GLU A 1 85  ? 9.389  8.596   18.458  1.00 10.57 ? 80  GLU A C   1 
ATOM   709  O  O   . GLU A 1 85  ? 9.226  7.849   17.512  1.00 9.13  ? 80  GLU A O   1 
ATOM   710  C  CB  . GLU A 1 85  ? 8.856  10.937  17.993  1.00 9.40  ? 80  GLU A CB  1 
ATOM   711  C  CG  . GLU A 1 85  ? 7.829  12.101  17.886  1.00 11.52 ? 80  GLU A CG  1 
ATOM   712  C  CD  . GLU A 1 85  ? 7.669  12.968  19.150  1.00 13.31 ? 80  GLU A CD  1 
ATOM   713  O  OE1 . GLU A 1 85  ? 8.309  12.743  20.232  1.00 14.16 ? 80  GLU A OE1 1 
ATOM   714  O  OE2 . GLU A 1 85  ? 6.921  13.976  19.043  1.00 16.05 ? 80  GLU A OE2 1 
ATOM   715  N  N   . VAL A 1 86  ? 10.472 8.539   19.239  1.00 9.99  ? 81  VAL A N   1 
ATOM   716  C  CA  . VAL A 1 86  ? 11.445 7.455   19.047  1.00 11.06 ? 81  VAL A CA  1 
ATOM   717  C  C   . VAL A 1 86  ? 10.808 6.110   19.262  1.00 10.76 ? 81  VAL A C   1 
ATOM   718  O  O   . VAL A 1 86  ? 10.933 5.190   18.398  1.00 11.79 ? 81  VAL A O   1 
ATOM   719  C  CB  . VAL A 1 86  ? 12.679 7.620   19.992  1.00 9.95  ? 81  VAL A CB  1 
ATOM   720  C  CG1 . VAL A 1 86  ? 13.572 6.400   19.884  1.00 15.55 ? 81  VAL A CG1 1 
ATOM   721  C  CG2 . VAL A 1 86  ? 13.468 8.872   19.532  1.00 13.79 ? 81  VAL A CG2 1 
ATOM   722  N  N   . ARG A 1 87  ? 10.124 5.944   20.380  1.00 9.72  ? 82  ARG A N   1 
ATOM   723  C  CA  . ARG A 1 87  ? 9.432  4.655   20.600  1.00 11.03 ? 82  ARG A CA  1 
ATOM   724  C  C   . ARG A 1 87  ? 8.428  4.420   19.486  1.00 8.85  ? 82  ARG A C   1 
ATOM   725  O  O   . ARG A 1 87  ? 8.322  3.300   19.007  1.00 9.92  ? 82  ARG A O   1 
ATOM   726  C  CB  . ARG A 1 87  ? 8.735  4.650   21.977  1.00 10.92 ? 82  ARG A CB  1 
ATOM   727  C  CG  . ARG A 1 87  ? 7.894  3.387   22.232  1.00 13.58 ? 82  ARG A CG  1 
ATOM   728  C  CD  . ARG A 1 87  ? 7.074  3.502   23.484  1.00 16.58 ? 82  ARG A CD  1 
ATOM   729  N  NE  . ARG A 1 87  ? 6.246  4.700   23.600  1.00 24.47 ? 82  ARG A NE  1 
ATOM   730  C  CZ  . ARG A 1 87  ? 5.120  4.994   22.903  1.00 26.16 ? 82  ARG A CZ  1 
ATOM   731  N  NH1 . ARG A 1 87  ? 4.644  4.188   21.950  1.00 25.67 ? 82  ARG A NH1 1 
ATOM   732  N  NH2 . ARG A 1 87  ? 4.443  6.115   23.200  1.00 27.40 ? 82  ARG A NH2 1 
ATOM   733  N  N   . GLU A 1 88  ? 7.622  5.436   19.109  1.00 9.16  ? 83  GLU A N   1 
ATOM   734  C  CA  . GLU A 1 88  ? 6.595  5.219   18.067  1.00 9.46  ? 83  GLU A CA  1 
ATOM   735  C  C   . GLU A 1 88  ? 7.250  4.731   16.769  1.00 9.23  ? 83  GLU A C   1 
ATOM   736  O  O   . GLU A 1 88  ? 6.760  3.826   16.127  1.00 9.66  ? 83  GLU A O   1 
ATOM   737  C  CB  . GLU A 1 88  ? 5.838  6.484   17.797  1.00 9.00  ? 83  GLU A CB  1 
ATOM   738  C  CG  . GLU A 1 88  ? 4.917  6.836   18.963  1.00 9.72  ? 83  GLU A CG  1 
ATOM   739  C  CD  . GLU A 1 88  ? 4.317  8.237   18.781  1.00 10.84 ? 83  GLU A CD  1 
ATOM   740  O  OE1 . GLU A 1 88  ? 3.435  8.598   19.624  1.00 13.86 ? 83  GLU A OE1 1 
ATOM   741  O  OE2 . GLU A 1 88  ? 4.748  8.963   17.815  1.00 12.04 ? 83  GLU A OE2 1 
ATOM   742  N  N   . TYR A 1 89  ? 8.321  5.387   16.362  1.00 7.64  ? 84  TYR A N   1 
ATOM   743  C  CA  . TYR A 1 89  ? 8.908  5.010   15.085  1.00 7.36  ? 84  TYR A CA  1 
ATOM   744  C  C   . TYR A 1 89  ? 9.642  3.636   15.144  1.00 8.93  ? 84  TYR A C   1 
ATOM   745  O  O   . TYR A 1 89  ? 9.524  2.858   14.186  1.00 9.26  ? 84  TYR A O   1 
ATOM   746  C  CB  . TYR A 1 89  ? 9.799  6.137   14.578  1.00 7.16  ? 84  TYR A CB  1 
ATOM   747  C  CG  . TYR A 1 89  ? 10.312 5.886   13.174  1.00 6.53  ? 84  TYR A CG  1 
ATOM   748  C  CD1 . TYR A 1 89  ? 9.445  5.456   12.125  1.00 8.91  ? 84  TYR A CD1 1 
ATOM   749  C  CD2 . TYR A 1 89  ? 11.676 6.017   12.907  1.00 7.49  ? 84  TYR A CD2 1 
ATOM   750  C  CE1 . TYR A 1 89  ? 9.972  5.203   10.876  1.00 9.02  ? 84  TYR A CE1 1 
ATOM   751  C  CE2 . TYR A 1 89  ? 12.191 5.772   11.656  1.00 8.55  ? 84  TYR A CE2 1 
ATOM   752  C  CZ  . TYR A 1 89  ? 11.353 5.334   10.671  1.00 8.26  ? 84  TYR A CZ  1 
ATOM   753  O  OH  . TYR A 1 89  ? 11.888 5.064   9.455   1.00 9.83  ? 84  TYR A OH  1 
ATOM   754  N  N   . ARG A 1 90  ? 10.277 3.326   16.271  1.00 7.52  ? 85  ARG A N   1 
ATOM   755  C  CA  . ARG A 1 90  ? 10.880 2.016   16.460  1.00 7.58  ? 85  ARG A CA  1 
ATOM   756  C  C   . ARG A 1 90  ? 9.739  0.944   16.386  1.00 8.92  ? 85  ARG A C   1 
ATOM   757  O  O   . ARG A 1 90  ? 9.895  -0.091  15.771  1.00 8.76  ? 85  ARG A O   1 
ATOM   758  C  CB  . ARG A 1 90  ? 11.621 1.981   17.815  1.00 8.60  ? 85  ARG A CB  1 
ATOM   759  C  CG  . ARG A 1 90  ? 12.348 0.649   17.986  1.00 9.94  ? 85  ARG A CG  1 
ATOM   760  C  CD  . ARG A 1 90  ? 11.538 -0.393  18.750  1.00 9.14  ? 85  ARG A CD  1 
ATOM   761  N  NE  . ARG A 1 90  ? 11.108 0.069   20.081  1.00 10.89 ? 85  ARG A NE  1 
ATOM   762  C  CZ  . ARG A 1 90  ? 10.060 -0.384  20.767  1.00 14.19 ? 85  ARG A CZ  1 
ATOM   763  N  NH1 . ARG A 1 90  ? 9.261  -1.405  20.325  1.00 13.42 ? 85  ARG A NH1 1 
ATOM   764  N  NH2 . ARG A 1 90  ? 9.811  0.183   21.950  1.00 13.90 ? 85  ARG A NH2 1 
ATOM   765  N  N   . GLU A 1 91  ? 8.600  1.254   17.005  1.00 9.68  ? 86  GLU A N   1 
ATOM   766  C  CA  A GLU A 1 91  ? 7.461  0.326   16.975  0.60 9.12  ? 86  GLU A CA  1 
ATOM   767  C  CA  B GLU A 1 91  ? 7.437  0.360   17.012  0.40 10.67 ? 86  GLU A CA  1 
ATOM   768  C  C   . GLU A 1 91  ? 6.925  0.167   15.581  1.00 9.25  ? 86  GLU A C   1 
ATOM   769  O  O   . GLU A 1 91  ? 6.510  -0.920  15.216  1.00 10.70 ? 86  GLU A O   1 
ATOM   770  C  CB  A GLU A 1 91  ? 6.326  0.766   17.908  0.60 9.58  ? 86  GLU A CB  1 
ATOM   771  C  CB  B GLU A 1 91  ? 6.349  0.973   17.915  0.40 11.91 ? 86  GLU A CB  1 
ATOM   772  C  CG  A GLU A 1 91  ? 6.638  0.535   19.383  0.60 5.86  ? 86  GLU A CG  1 
ATOM   773  C  CG  B GLU A 1 91  ? 5.441  0.062   18.765  0.40 16.89 ? 86  GLU A CG  1 
ATOM   774  C  CD  A GLU A 1 91  ? 5.534  1.205   20.298  0.60 13.71 ? 86  GLU A CD  1 
ATOM   775  C  CD  B GLU A 1 91  ? 5.897  -1.397  18.992  0.40 17.97 ? 86  GLU A CD  1 
ATOM   776  O  OE1 A GLU A 1 91  ? 4.742  1.997   19.784  0.60 22.02 ? 86  GLU A OE1 1 
ATOM   777  O  OE1 B GLU A 1 91  ? 5.635  -2.246  18.110  0.40 18.00 ? 86  GLU A OE1 1 
ATOM   778  O  OE2 A GLU A 1 91  ? 5.454  0.974   21.515  0.60 18.98 ? 86  GLU A OE2 1 
ATOM   779  O  OE2 B GLU A 1 91  ? 6.446  -1.732  20.088  0.40 18.93 ? 86  GLU A OE2 1 
ATOM   780  N  N   . LYS A 1 92  ? 6.911  1.257   14.789  1.00 9.01  ? 87  LYS A N   1 
ATOM   781  C  CA  A LYS A 1 92  ? 6.441  1.186   13.424  0.35 9.53  ? 87  LYS A CA  1 
ATOM   782  C  CA  B LYS A 1 92  ? 6.458  1.185   13.391  0.35 9.57  ? 87  LYS A CA  1 
ATOM   783  C  CA  C LYS A 1 92  ? 6.452  1.177   13.411  0.30 9.70  ? 87  LYS A CA  1 
ATOM   784  C  C   . LYS A 1 92  ? 7.340  0.212   12.603  1.00 9.42  ? 87  LYS A C   1 
ATOM   785  O  O   . LYS A 1 92  ? 6.844  -0.631  11.896  1.00 8.95  ? 87  LYS A O   1 
ATOM   786  C  CB  A LYS A 1 92  ? 6.428  2.606   12.838  0.35 9.55  ? 87  LYS A CB  1 
ATOM   787  C  CB  B LYS A 1 92  ? 6.493  2.557   12.684  0.35 9.84  ? 87  LYS A CB  1 
ATOM   788  C  CB  C LYS A 1 92  ? 6.455  2.559   12.745  0.30 10.12 ? 87  LYS A CB  1 
ATOM   789  C  CG  A LYS A 1 92  ? 5.770  2.724   11.461  0.35 12.41 ? 87  LYS A CG  1 
ATOM   790  C  CG  B LYS A 1 92  ? 6.163  2.470   11.127  0.35 12.05 ? 87  LYS A CG  1 
ATOM   791  C  CG  C LYS A 1 92  ? 6.178  2.468   11.223  0.30 13.15 ? 87  LYS A CG  1 
ATOM   792  C  CD  A LYS A 1 92  ? 6.233  4.023   10.780  0.35 12.47 ? 87  LYS A CD  1 
ATOM   793  C  CD  B LYS A 1 92  ? 6.775  3.662   10.331  0.35 14.72 ? 87  LYS A CD  1 
ATOM   794  C  CD  C LYS A 1 92  ? 4.720  2.725   10.863  0.30 16.88 ? 87  LYS A CD  1 
ATOM   795  C  CE  A LYS A 1 92  ? 6.233  3.875   9.299   0.35 17.12 ? 87  LYS A CE  1 
ATOM   796  C  CE  B LYS A 1 92  ? 6.624  3.533   8.814   0.35 16.10 ? 87  LYS A CE  1 
ATOM   797  C  CE  C LYS A 1 92  ? 3.787  2.601   12.056  0.30 18.44 ? 87  LYS A CE  1 
ATOM   798  N  NZ  A LYS A 1 92  ? 5.574  5.005   8.730   0.35 18.13 ? 87  LYS A NZ  1 
ATOM   799  N  NZ  B LYS A 1 92  ? 5.184  3.634   8.452   0.35 17.56 ? 87  LYS A NZ  1 
ATOM   800  N  NZ  C LYS A 1 92  ? 2.418  3.147   11.783  0.30 18.70 ? 87  LYS A NZ  1 
ATOM   801  N  N   . VAL A 1 93  ? 8.659  0.402   12.702  1.00 8.60  ? 88  VAL A N   1 
ATOM   802  C  CA  . VAL A 1 93  ? 9.611  -0.453  11.989  1.00 8.76  ? 88  VAL A CA  1 
ATOM   803  C  C   . VAL A 1 93  ? 9.475  -1.877  12.508  1.00 8.79  ? 88  VAL A C   1 
ATOM   804  O  O   . VAL A 1 93  ? 9.435  -2.803  11.707  1.00 9.47  ? 88  VAL A O   1 
ATOM   805  C  CB  . VAL A 1 93  ? 11.051 0.097   12.132  1.00 9.15  ? 88  VAL A CB  1 
ATOM   806  C  CG1 . VAL A 1 93  ? 12.046 -0.859  11.459  1.00 11.79 ? 88  VAL A CG1 1 
ATOM   807  C  CG2 . VAL A 1 93  ? 11.132 1.460   11.418  1.00 9.88  ? 88  VAL A CG2 1 
ATOM   808  N  N   . GLU A 1 94  ? 9.342  -2.023  13.830  1.00 9.62  ? 89  GLU A N   1 
ATOM   809  C  CA  . GLU A 1 94  ? 9.203  -3.313  14.430  1.00 8.23  ? 89  GLU A CA  1 
ATOM   810  C  C   . GLU A 1 94  ? 7.974  -4.057  13.883  1.00 9.60  ? 89  GLU A C   1 
ATOM   811  O  O   . GLU A 1 94  ? 8.016  -5.260  13.573  1.00 10.30 ? 89  GLU A O   1 
ATOM   812  C  CB  . GLU A 1 94  ? 9.163  -3.162  15.957  1.00 8.16  ? 89  GLU A CB  1 
ATOM   813  C  CG  . GLU A 1 94  ? 9.061  -4.492  16.700  1.00 10.68 ? 89  GLU A CG  1 
ATOM   814  C  CD  . GLU A 1 94  ? 9.131  -4.239  18.177  1.00 12.18 ? 89  GLU A CD  1 
ATOM   815  O  OE1 . GLU A 1 94  ? 10.125 -3.608  18.596  1.00 12.03 ? 89  GLU A OE1 1 
ATOM   816  O  OE2 . GLU A 1 94  ? 8.193  -4.636  18.924  1.00 15.82 ? 89  GLU A OE2 1 
ATOM   817  N  N   . THR A 1 95  ? 6.875  -3.358  13.742  1.00 9.21  ? 90  THR A N   1 
ATOM   818  C  CA  A THR A 1 95  ? 5.614  -4.015  13.355  0.70 9.63  ? 90  THR A CA  1 
ATOM   819  C  CA  B THR A 1 95  ? 5.649  -4.081  13.361  0.30 9.68  ? 90  THR A CA  1 
ATOM   820  C  C   . THR A 1 95  ? 5.718  -4.444  11.901  1.00 9.20  ? 90  THR A C   1 
ATOM   821  O  O   . THR A 1 95  ? 5.254  -5.493  11.529  1.00 10.21 ? 90  THR A O   1 
ATOM   822  C  CB  A THR A 1 95  ? 4.482  -3.008  13.529  0.70 9.71  ? 90  THR A CB  1 
ATOM   823  C  CB  B THR A 1 95  ? 4.372  -3.303  13.630  0.30 9.91  ? 90  THR A CB  1 
ATOM   824  O  OG1 A THR A 1 95  ? 4.388  -2.644  14.922  0.70 12.78 ? 90  THR A OG1 1 
ATOM   825  O  OG1 B THR A 1 95  ? 4.505  -1.997  13.086  0.30 14.32 ? 90  THR A OG1 1 
ATOM   826  C  CG2 A THR A 1 95  ? 3.171  -3.585  13.042  0.70 12.15 ? 90  THR A CG2 1 
ATOM   827  C  CG2 B THR A 1 95  ? 4.096  -3.237  15.125  0.30 9.04  ? 90  THR A CG2 1 
ATOM   828  N  N   . GLU A 1 96  ? 6.371  -3.620  11.095  1.00 9.31  ? 91  GLU A N   1 
ATOM   829  C  CA  A GLU A 1 96  ? 6.571  -3.997  9.676   0.50 8.74  ? 91  GLU A CA  1 
ATOM   830  C  CA  B GLU A 1 96  ? 6.593  -3.962  9.676   0.50 9.02  ? 91  GLU A CA  1 
ATOM   831  C  C   . GLU A 1 96  ? 7.484  -5.200  9.568   1.00 9.17  ? 91  GLU A C   1 
ATOM   832  O  O   . GLU A 1 96  ? 7.235  -6.112  8.754   1.00 10.45 ? 91  GLU A O   1 
ATOM   833  C  CB  A GLU A 1 96  ? 7.120  -2.838  8.841   0.50 9.34  ? 91  GLU A CB  1 
ATOM   834  C  CB  B GLU A 1 96  ? 7.244  -2.782  8.944   0.50 9.71  ? 91  GLU A CB  1 
ATOM   835  C  CG  A GLU A 1 96  ? 6.186  -1.675  8.848   0.50 8.04  ? 91  GLU A CG  1 
ATOM   836  C  CG  B GLU A 1 96  ? 7.337  -2.947  7.435   0.50 10.01 ? 91  GLU A CG  1 
ATOM   837  C  CD  A GLU A 1 96  ? 6.617  -0.488  8.013   0.50 14.46 ? 91  GLU A CD  1 
ATOM   838  C  CD  B GLU A 1 96  ? 8.202  -1.850  6.749   0.50 10.93 ? 91  GLU A CD  1 
ATOM   839  O  OE1 A GLU A 1 96  ? 7.697  -0.573  7.428   0.50 13.95 ? 91  GLU A OE1 1 
ATOM   840  O  OE1 B GLU A 1 96  ? 7.650  -0.746  6.649   0.50 16.74 ? 91  GLU A OE1 1 
ATOM   841  O  OE2 A GLU A 1 96  ? 5.840  0.533   7.983   0.50 15.59 ? 91  GLU A OE2 1 
ATOM   842  O  OE2 B GLU A 1 96  ? 9.397  -2.097  6.305   0.50 8.88  ? 91  GLU A OE2 1 
ATOM   843  N  N   . LEU A 1 97  ? 8.543  -5.216  10.371  1.00 8.37  ? 92  LEU A N   1 
ATOM   844  C  CA  A LEU A 1 97  ? 9.471  -6.340  10.324  0.50 8.48  ? 92  LEU A CA  1 
ATOM   845  C  CA  B LEU A 1 97  ? 9.471  -6.327  10.374  0.50 9.04  ? 92  LEU A CA  1 
ATOM   846  C  C   . LEU A 1 97  ? 8.727  -7.606  10.768  1.00 8.66  ? 92  LEU A C   1 
ATOM   847  O  O   . LEU A 1 97  ? 8.882  -8.679  10.159  1.00 9.69  ? 92  LEU A O   1 
ATOM   848  C  CB  A LEU A 1 97  ? 10.658 -6.016  11.275  0.50 8.62  ? 92  LEU A CB  1 
ATOM   849  C  CB  B LEU A 1 97  ? 10.539 -5.988  11.442  0.50 9.51  ? 92  LEU A CB  1 
ATOM   850  C  CG  A LEU A 1 97  ? 11.783 -6.971  11.641  0.50 10.36 ? 92  LEU A CG  1 
ATOM   851  C  CG  B LEU A 1 97  ? 11.621 -7.001  11.690  0.50 12.38 ? 92  LEU A CG  1 
ATOM   852  C  CD1 A LEU A 1 97  ? 12.763 -6.180  12.479  0.50 11.82 ? 92  LEU A CD1 1 
ATOM   853  C  CD1 B LEU A 1 97  ? 11.972 -7.564  10.359  0.50 11.98 ? 92  LEU A CD1 1 
ATOM   854  C  CD2 A LEU A 1 97  ? 11.258 -8.180  12.436  0.50 8.22  ? 92  LEU A CD2 1 
ATOM   855  C  CD2 B LEU A 1 97  ? 12.795 -6.299  12.354  0.50 13.91 ? 92  LEU A CD2 1 
ATOM   856  N  N   . GLN A 1 98  ? 7.950  -7.510  11.845  1.00 8.56  ? 93  GLN A N   1 
ATOM   857  C  CA  . GLN A 1 98  ? 7.073  -8.653  12.287  1.00 8.90  ? 93  GLN A CA  1 
ATOM   858  C  C   . GLN A 1 98  ? 6.163  -9.123  11.214  1.00 10.42 ? 93  GLN A C   1 
ATOM   859  O  O   . GLN A 1 98  ? 5.967  -10.313 11.060  1.00 11.98 ? 93  GLN A O   1 
ATOM   860  C  CB  . GLN A 1 98  ? 6.332  -8.277  13.540  1.00 8.91  ? 93  GLN A CB  1 
ATOM   861  C  CG  . GLN A 1 98  ? 7.253  -8.195  14.768  1.00 8.93  ? 93  GLN A CG  1 
ATOM   862  C  CD  . GLN A 1 98  ? 6.544  -7.570  15.951  1.00 7.32  ? 93  GLN A CD  1 
ATOM   863  O  OE1 . GLN A 1 98  ? 5.626  -6.689  15.809  1.00 12.79 ? 93  GLN A OE1 1 
ATOM   864  N  NE2 . GLN A 1 98  ? 6.985  -7.946  17.154  1.00 12.15 ? 93  GLN A NE2 1 
ATOM   865  N  N   . GLY A 1 99  ? 5.586  -8.194  10.455  1.00 10.29 ? 94  GLY A N   1 
ATOM   866  C  CA  . GLY A 1 99  ? 4.718  -8.600  9.394   1.00 11.11 ? 94  GLY A CA  1 
ATOM   867  C  C   . GLY A 1 99  ? 5.418  -9.387  8.293   1.00 10.07 ? 94  GLY A C   1 
ATOM   868  O  O   . GLY A 1 99  ? 4.874  -10.343 7.763   1.00 11.02 ? 94  GLY A O   1 
ATOM   869  N  N   . VAL A 1 100 ? 6.629  -9.016  7.977   1.00 9.25  ? 95  VAL A N   1 
ATOM   870  C  CA  . VAL A 1 100 ? 7.389  -9.746  6.978   1.00 9.84  ? 95  VAL A CA  1 
ATOM   871  C  C   . VAL A 1 100 ? 7.721  -11.132 7.517   1.00 7.85  ? 95  VAL A C   1 
ATOM   872  O  O   . VAL A 1 100 ? 7.569  -12.119 6.802   1.00 8.78  ? 95  VAL A O   1 
ATOM   873  C  CB  . VAL A 1 100 ? 8.645  -8.984  6.594   1.00 9.83  ? 95  VAL A CB  1 
ATOM   874  C  CG1 . VAL A 1 100 ? 9.550  -9.878  5.711   1.00 13.65 ? 95  VAL A CG1 1 
ATOM   875  C  CG2 . VAL A 1 100 ? 8.243  -7.731  5.782   1.00 12.40 ? 95  VAL A CG2 1 
ATOM   876  N  N   . CYS A 1 101 ? 8.191  -11.218 8.763   1.00 8.11  ? 96  CYS A N   1 
ATOM   877  C  CA  . CYS A 1 101 ? 8.460  -12.529 9.325   1.00 9.22  ? 96  CYS A CA  1 
ATOM   878  C  C   . CYS A 1 101 ? 7.198  -13.374 9.325   1.00 8.52  ? 96  CYS A C   1 
ATOM   879  O  O   . CYS A 1 101 ? 7.262  -14.566 9.008   1.00 9.31  ? 96  CYS A O   1 
ATOM   880  C  CB  . CYS A 1 101 ? 8.983  -12.434 10.746  1.00 10.59 ? 96  CYS A CB  1 
ATOM   881  S  SG  . CYS A 1 101 ? 10.548 -11.626 10.913  1.00 10.40 ? 96  CYS A SG  1 
ATOM   882  N  N   . ASP A 1 102 ? 6.040  -12.797 9.664   1.00 9.36  ? 97  ASP A N   1 
ATOM   883  C  CA  . ASP A 1 102 ? 4.817  -13.620 9.689   1.00 9.71  ? 97  ASP A CA  1 
ATOM   884  C  C   . ASP A 1 102 ? 4.453  -14.058 8.288   1.00 10.08 ? 97  ASP A C   1 
ATOM   885  O  O   . ASP A 1 102 ? 3.901  -15.131 8.093   1.00 10.28 ? 97  ASP A O   1 
ATOM   886  C  CB  . ASP A 1 102 ? 3.674  -12.784 10.259  1.00 12.16 ? 97  ASP A CB  1 
ATOM   887  C  CG  . ASP A 1 102 ? 3.781  -12.570 11.785  1.00 15.53 ? 97  ASP A CG  1 
ATOM   888  O  OD1 . ASP A 1 102 ? 4.585  -13.219 12.472  1.00 22.11 ? 97  ASP A OD1 1 
ATOM   889  O  OD2 . ASP A 1 102 ? 3.010  -11.714 12.299  1.00 21.88 ? 97  ASP A OD2 1 
ATOM   890  N  N   . THR A 1 103 ? 4.714  -13.197 7.300   1.00 9.40  ? 98  THR A N   1 
ATOM   891  C  CA  . THR A 1 103 ? 4.472  -13.553 5.880   1.00 9.27  ? 98  THR A CA  1 
ATOM   892  C  C   . THR A 1 103 ? 5.319  -14.767 5.485   1.00 7.83  ? 98  THR A C   1 
ATOM   893  O  O   . THR A 1 103 ? 4.818  -15.710 4.907   1.00 9.05  ? 98  THR A O   1 
ATOM   894  C  CB  . THR A 1 103 ? 4.772  -12.398 4.962   1.00 8.61  ? 98  THR A CB  1 
ATOM   895  O  OG1 . THR A 1 103 ? 3.744  -11.414 5.182   1.00 13.32 ? 98  THR A OG1 1 
ATOM   896  C  CG2 . THR A 1 103 ? 4.637  -12.862 3.481   1.00 10.51 ? 98  THR A CG2 1 
ATOM   897  N  N   . VAL A 1 104 ? 6.600  -14.740 5.820   1.00 8.29  ? 99  VAL A N   1 
ATOM   898  C  CA  . VAL A 1 104 ? 7.523  -15.838 5.422   1.00 7.07  ? 99  VAL A CA  1 
ATOM   899  C  C   . VAL A 1 104 ? 7.059  -17.084 6.161   1.00 8.32  ? 99  VAL A C   1 
ATOM   900  O  O   . VAL A 1 104 ? 6.973  -18.141 5.547   1.00 8.99  ? 99  VAL A O   1 
ATOM   901  C  CB  . VAL A 1 104 ? 8.942  -15.475 5.759   1.00 6.65  ? 99  VAL A CB  1 
ATOM   902  C  CG1 . VAL A 1 104 ? 9.825  -16.683 5.452   1.00 9.79  ? 99  VAL A CG1 1 
ATOM   903  C  CG2 . VAL A 1 104 ? 9.391  -14.294 4.822   1.00 7.88  ? 99  VAL A CG2 1 
ATOM   904  N  N   . LEU A 1 105 ? 6.816  -16.987 7.477   1.00 8.89  ? 100 LEU A N   1 
ATOM   905  C  CA  . LEU A 1 105 ? 6.410  -18.140 8.256   1.00 8.77  ? 100 LEU A CA  1 
ATOM   906  C  C   . LEU A 1 105 ? 5.109  -18.716 7.734   1.00 8.94  ? 100 LEU A C   1 
ATOM   907  O  O   . LEU A 1 105 ? 4.939  -19.931 7.666   1.00 9.82  ? 100 LEU A O   1 
ATOM   908  C  CB  . LEU A 1 105 ? 6.250  -17.750 9.756   1.00 8.97  ? 100 LEU A CB  1 
ATOM   909  C  CG  . LEU A 1 105 ? 7.623  -17.445 10.349  1.00 6.29  ? 100 LEU A CG  1 
ATOM   910  C  CD1 . LEU A 1 105 ? 7.412  -16.864 11.751  1.00 10.83 ? 100 LEU A CD1 1 
ATOM   911  C  CD2 . LEU A 1 105 ? 8.496  -18.733 10.458  1.00 8.97  ? 100 LEU A CD2 1 
ATOM   912  N  N   . GLY A 1 106 ? 4.226  -17.849 7.241   1.00 9.08  ? 101 GLY A N   1 
ATOM   913  C  CA  . GLY A 1 106 ? 3.019  -18.317 6.616   1.00 10.51 ? 101 GLY A CA  1 
ATOM   914  C  C   . GLY A 1 106 ? 3.218  -19.072 5.349   1.00 10.13 ? 101 GLY A C   1 
ATOM   915  O  O   . GLY A 1 106 ? 2.491  -20.107 5.118   1.00 11.32 ? 101 GLY A O   1 
ATOM   916  N  N   . LEU A 1 107 ? 4.159  -18.600 4.518   1.00 9.81  ? 102 LEU A N   1 
ATOM   917  C  CA  . LEU A 1 107 ? 4.455  -19.344 3.260   1.00 8.63  ? 102 LEU A CA  1 
ATOM   918  C  C   . LEU A 1 107 ? 5.032  -20.720 3.631   1.00 9.15  ? 102 LEU A C   1 
ATOM   919  O  O   . LEU A 1 107 ? 4.733  -21.749 3.007   1.00 9.98  ? 102 LEU A O   1 
ATOM   920  C  CB  . LEU A 1 107 ? 5.508  -18.584 2.412   1.00 9.65  ? 102 LEU A CB  1 
ATOM   921  C  CG  . LEU A 1 107 ? 4.967  -17.288 1.814   1.00 10.95 ? 102 LEU A CG  1 
ATOM   922  C  CD1 . LEU A 1 107 ? 6.175  -16.565 1.130   1.00 13.28 ? 102 LEU A CD1 1 
ATOM   923  C  CD2 . LEU A 1 107 ? 3.814  -17.600 0.836   1.00 14.86 ? 102 LEU A CD2 1 
ATOM   924  N  N   . LEU A 1 108 ? 5.900  -20.735 4.642   1.00 8.66  ? 103 LEU A N   1 
ATOM   925  C  CA  . LEU A 1 108 ? 6.515  -22.012 5.046   1.00 8.85  ? 103 LEU A CA  1 
ATOM   926  C  C   . LEU A 1 108 ? 5.465  -22.961 5.562   1.00 9.99  ? 103 LEU A C   1 
ATOM   927  O  O   . LEU A 1 108 ? 5.529  -24.161 5.298   1.00 10.70 ? 103 LEU A O   1 
ATOM   928  C  CB  . LEU A 1 108 ? 7.615  -21.796 6.099   1.00 8.33  ? 103 LEU A CB  1 
ATOM   929  C  CG  . LEU A 1 108 ? 8.802  -20.972 5.551   1.00 8.28  ? 103 LEU A CG  1 
ATOM   930  C  CD1 . LEU A 1 108 ? 9.700  -20.539 6.744   1.00 10.20 ? 103 LEU A CD1 1 
ATOM   931  C  CD2 . LEU A 1 108 ? 9.646  -21.739 4.531   1.00 10.54 ? 103 LEU A CD2 1 
ATOM   932  N  N   . ASP A 1 109 ? 4.483  -22.439 6.288   1.00 10.69 ? 104 ASP A N   1 
ATOM   933  C  CA  A ASP A 1 109 ? 3.382  -23.270 6.855   0.50 11.32 ? 104 ASP A CA  1 
ATOM   934  C  CA  B ASP A 1 109 ? 3.555  -23.343 6.879   0.50 14.09 ? 104 ASP A CA  1 
ATOM   935  C  C   . ASP A 1 109 ? 2.278  -23.573 5.919   1.00 14.12 ? 104 ASP A C   1 
ATOM   936  O  O   . ASP A 1 109 ? 1.367  -24.420 6.184   1.00 18.54 ? 104 ASP A O   1 
ATOM   937  C  CB  A ASP A 1 109 ? 2.693  -22.603 8.041   0.50 8.55  ? 104 ASP A CB  1 
ATOM   938  C  CB  B ASP A 1 109 ? 3.522  -22.959 8.432   0.50 16.34 ? 104 ASP A CB  1 
ATOM   939  C  CG  A ASP A 1 109 ? 2.076  -23.608 8.944   0.50 10.72 ? 104 ASP A CG  1 
ATOM   940  C  CG  B ASP A 1 109 ? 5.050  -23.049 9.150   0.50 17.66 ? 104 ASP A CG  1 
ATOM   941  O  OD1 A ASP A 1 109 ? 2.735  -24.648 9.282   0.50 13.39 ? 104 ASP A OD1 1 
ATOM   942  O  OD1 B ASP A 1 109 ? 5.431  -24.252 9.478   0.50 12.90 ? 104 ASP A OD1 1 
ATOM   943  O  OD2 A ASP A 1 109 ? 0.910  -23.386 9.262   0.50 15.33 ? 104 ASP A OD2 1 
ATOM   944  O  OD2 B ASP A 1 109 ? 5.873  -21.957 9.384   0.50 13.73 ? 104 ASP A OD2 1 
ATOM   945  N  N   . SER A 1 110 ? 2.242  -22.876 4.816   1.00 15.48 ? 105 SER A N   1 
ATOM   946  C  CA  . SER A 1 110 ? 1.167  -23.020 3.784   1.00 16.95 ? 105 SER A CA  1 
ATOM   947  C  C   . SER A 1 110 ? 1.685  -22.903 2.310   1.00 17.63 ? 105 SER A C   1 
ATOM   948  O  O   . SER A 1 110 ? 1.439  -21.846 1.633   1.00 19.31 ? 105 SER A O   1 
ATOM   949  C  CB  . SER A 1 110 ? -0.026 -22.008 3.983   1.00 19.11 ? 105 SER A CB  1 
ATOM   950  O  OG  . SER A 1 110 ? -0.557 -22.042 5.294   1.00 21.77 ? 105 SER A OG  1 
ATOM   951  N  N   . HIS A 1 111 ? 2.385  -23.911 1.754   1.00 15.64 ? 106 HIS A N   1 
ATOM   952  C  CA  . HIS A 1 111 ? 2.487  -25.273 2.300   1.00 16.25 ? 106 HIS A CA  1 
ATOM   953  C  C   . HIS A 1 111 ? 3.862  -25.816 2.003   1.00 15.65 ? 106 HIS A C   1 
ATOM   954  O  O   . HIS A 1 111 ? 4.022  -27.033 1.760   1.00 17.46 ? 106 HIS A O   1 
ATOM   955  C  CB  . HIS A 1 111 ? 1.377  -26.217 1.731   1.00 17.86 ? 106 HIS A CB  1 
ATOM   956  C  CG  . HIS A 1 111 ? 0.010  -25.727 2.057   1.00 20.17 ? 106 HIS A CG  1 
ATOM   957  N  ND1 . HIS A 1 111 ? -0.607 -26.020 3.262   1.00 19.04 ? 106 HIS A ND1 1 
ATOM   958  C  CD2 . HIS A 1 111 ? -0.864 -24.945 1.352   1.00 19.73 ? 106 HIS A CD2 1 
ATOM   959  C  CE1 . HIS A 1 111 ? -1.793 -25.427 3.294   1.00 19.64 ? 106 HIS A CE1 1 
ATOM   960  N  NE2 . HIS A 1 111 ? -1.981 -24.781 2.149   1.00 20.70 ? 106 HIS A NE2 1 
ATOM   961  N  N   . LEU A 1 112 ? 4.870  -24.940 2.103   1.00 12.26 ? 107 LEU A N   1 
ATOM   962  C  CA  . LEU A 1 112 ? 6.200  -25.379 1.666   1.00 11.40 ? 107 LEU A CA  1 
ATOM   963  C  C   . LEU A 1 112 ? 6.780  -26.501 2.494   1.00 12.66 ? 107 LEU A C   1 
ATOM   964  O  O   . LEU A 1 112 ? 7.366  -27.463 1.956   1.00 13.50 ? 107 LEU A O   1 
ATOM   965  C  CB  . LEU A 1 112 ? 7.175  -24.213 1.648   1.00 10.33 ? 107 LEU A CB  1 
ATOM   966  C  CG  . LEU A 1 112 ? 6.915  -23.150 0.612   1.00 8.13  ? 107 LEU A CG  1 
ATOM   967  C  CD1 . LEU A 1 112 ? 7.787  -21.900 0.973   1.00 10.01 ? 107 LEU A CD1 1 
ATOM   968  C  CD2 . LEU A 1 112 ? 7.169  -23.641 -0.839  1.00 11.01 ? 107 LEU A CD2 1 
ATOM   969  N  N   . ILE A 1 113 ? 6.700  -26.382 3.816   1.00 11.46 ? 108 ILE A N   1 
ATOM   970  C  CA  . ILE A 1 113 ? 7.323  -27.422 4.672   1.00 12.11 ? 108 ILE A CA  1 
ATOM   971  C  C   . ILE A 1 113 ? 6.606  -28.750 4.524   1.00 11.50 ? 108 ILE A C   1 
ATOM   972  O  O   . ILE A 1 113 ? 7.278  -29.815 4.294   1.00 11.93 ? 108 ILE A O   1 
ATOM   973  C  CB  . ILE A 1 113 ? 7.402  -26.982 6.140   1.00 10.75 ? 108 ILE A CB  1 
ATOM   974  C  CG1 . ILE A 1 113 ? 8.434  -25.844 6.218   1.00 11.88 ? 108 ILE A CG1 1 
ATOM   975  C  CG2 . ILE A 1 113 ? 7.826  -28.221 7.033   1.00 12.75 ? 108 ILE A CG2 1 
ATOM   976  C  CD1 . ILE A 1 113 ? 8.548  -25.173 7.569   1.00 15.04 ? 108 ILE A CD1 1 
ATOM   977  N  N   . LYS A 1 114 ? 5.278  -28.718 4.548   1.00 12.61 ? 109 LYS A N   1 
ATOM   978  C  CA  . LYS A 1 114 ? 4.573  -30.024 4.435   1.00 15.39 ? 109 LYS A CA  1 
ATOM   979  C  C   . LYS A 1 114 ? 4.784  -30.810 3.129   1.00 16.28 ? 109 LYS A C   1 
ATOM   980  O  O   . LYS A 1 114 ? 4.727  -32.075 3.165   1.00 17.36 ? 109 LYS A O   1 
ATOM   981  C  CB  . LYS A 1 114 ? 3.085  -29.935 4.779   1.00 17.43 ? 109 LYS A CB  1 
ATOM   982  C  CG  . LYS A 1 114 ? 2.258  -29.234 3.750   1.00 18.86 ? 109 LYS A CG  1 
ATOM   983  C  CD  . LYS A 1 114 ? 0.727  -29.275 4.096   1.00 23.70 ? 109 LYS A CD  1 
ATOM   984  C  CE  . LYS A 1 114 ? 0.456  -28.700 5.482   1.00 24.01 ? 109 LYS A CE  1 
ATOM   985  N  NZ  . LYS A 1 114 ? 0.705  -27.242 5.518   1.00 20.76 ? 109 LYS A NZ  1 
ATOM   986  N  N   . GLU A 1 115 ? 5.042  -30.107 2.010   1.00 14.83 ? 110 GLU A N   1 
ATOM   987  C  CA  A GLU A 1 115 ? 5.273  -30.842 0.775   0.50 15.76 ? 110 GLU A CA  1 
ATOM   988  C  CA  B GLU A 1 115 ? 5.266  -30.752 0.729   0.50 15.37 ? 110 GLU A CA  1 
ATOM   989  C  C   . GLU A 1 115 ? 6.741  -31.158 0.505   1.00 15.95 ? 110 GLU A C   1 
ATOM   990  O  O   . GLU A 1 115 ? 7.033  -31.852 -0.479  1.00 17.41 ? 110 GLU A O   1 
ATOM   991  C  CB  A GLU A 1 115 ? 4.664  -30.142 -0.429  0.50 16.39 ? 110 GLU A CB  1 
ATOM   992  C  CB  B GLU A 1 115 ? 4.734  -29.859 -0.415  0.50 15.85 ? 110 GLU A CB  1 
ATOM   993  C  CG  A GLU A 1 115 ? 3.128  -30.124 -0.441  0.50 17.49 ? 110 GLU A CG  1 
ATOM   994  C  CG  B GLU A 1 115 ? 3.168  -29.649 -0.365  0.50 15.46 ? 110 GLU A CG  1 
ATOM   995  C  CD  A GLU A 1 115 ? 2.454  -31.514 -0.350  0.50 18.70 ? 110 GLU A CD  1 
ATOM   996  C  CD  B GLU A 1 115 ? 2.490  -29.077 -1.655  0.50 19.05 ? 110 GLU A CD  1 
ATOM   997  O  OE1 A GLU A 1 115 ? 2.939  -32.544 -0.892  0.50 20.41 ? 110 GLU A OE1 1 
ATOM   998  O  OE1 B GLU A 1 115 ? 1.218  -29.115 -1.673  0.50 19.82 ? 110 GLU A OE1 1 
ATOM   999  O  OE2 A GLU A 1 115 ? 1.380  -31.566 0.253   0.50 22.22 ? 110 GLU A OE2 1 
ATOM   1000 O  OE2 B GLU A 1 115 ? 3.174  -28.558 -2.612  0.50 19.36 ? 110 GLU A OE2 1 
ATOM   1001 N  N   . ALA A 1 116 ? 7.653  -30.681 1.384   1.00 15.27 ? 111 ALA A N   1 
ATOM   1002 C  CA  . ALA A 1 116 ? 9.097  -30.857 1.178   1.00 16.36 ? 111 ALA A CA  1 
ATOM   1003 C  C   . ALA A 1 116 ? 9.578  -32.188 1.711   1.00 18.04 ? 111 ALA A C   1 
ATOM   1004 O  O   . ALA A 1 116 ? 9.625  -32.406 2.938   1.00 18.10 ? 111 ALA A O   1 
ATOM   1005 C  CB  . ALA A 1 116 ? 9.912  -29.711 1.821   1.00 17.16 ? 111 ALA A CB  1 
ATOM   1006 N  N   . GLY A 1 117 ? 9.953  -33.080 0.800   1.00 17.33 ? 112 GLY A N   1 
ATOM   1007 C  CA  . GLY A 1 117 ? 10.297 -34.453 1.205   1.00 17.63 ? 112 GLY A CA  1 
ATOM   1008 C  C   . GLY A 1 117 ? 11.751 -34.789 1.072   1.00 17.83 ? 112 GLY A C   1 
ATOM   1009 O  O   . GLY A 1 117 ? 12.254 -35.677 1.734   1.00 22.62 ? 112 GLY A O   1 
ATOM   1010 N  N   . ASP A 1 118 ? 12.453 -34.108 0.196   1.00 15.67 ? 113 ASP A N   1 
ATOM   1011 C  CA  . ASP A 1 118 ? 13.888 -34.363 0.057   1.00 15.19 ? 113 ASP A CA  1 
ATOM   1012 C  C   . ASP A 1 118 ? 14.609 -33.587 1.122   1.00 14.23 ? 113 ASP A C   1 
ATOM   1013 O  O   . ASP A 1 118 ? 14.126 -32.498 1.503   1.00 14.82 ? 113 ASP A O   1 
ATOM   1014 C  CB  . ASP A 1 118 ? 14.309 -33.852 -1.310  1.00 15.22 ? 113 ASP A CB  1 
ATOM   1015 C  CG  . ASP A 1 118 ? 13.845 -34.781 -2.412  1.00 16.64 ? 113 ASP A CG  1 
ATOM   1016 O  OD1 . ASP A 1 118 ? 13.204 -35.845 -2.123  1.00 21.09 ? 113 ASP A OD1 1 
ATOM   1017 O  OD2 . ASP A 1 118 ? 14.156 -34.470 -3.550  1.00 15.20 ? 113 ASP A OD2 1 
ATOM   1018 N  N   . ALA A 1 119 ? 15.743 -34.106 1.608   1.00 15.83 ? 114 ALA A N   1 
ATOM   1019 C  CA  . ALA A 1 119 ? 16.397 -33.382 2.701   1.00 17.93 ? 114 ALA A CA  1 
ATOM   1020 C  C   . ALA A 1 119 ? 16.790 -31.945 2.331   1.00 17.88 ? 114 ALA A C   1 
ATOM   1021 O  O   . ALA A 1 119 ? 16.731 -31.010 3.170   1.00 19.24 ? 114 ALA A O   1 
ATOM   1022 C  CB  . ALA A 1 119 ? 17.644 -34.180 3.118   1.00 19.45 ? 114 ALA A CB  1 
ATOM   1023 N  N   . GLU A 1 120 ? 17.236 -31.727 1.102   1.00 16.98 ? 115 GLU A N   1 
ATOM   1024 C  CA  . GLU A 1 120 ? 17.756 -30.406 0.717   1.00 18.11 ? 115 GLU A CA  1 
ATOM   1025 C  C   . GLU A 1 120 ? 16.624 -29.405 0.791   1.00 17.07 ? 115 GLU A C   1 
ATOM   1026 O  O   . GLU A 1 120 ? 16.891 -28.248 1.126   1.00 20.54 ? 115 GLU A O   1 
ATOM   1027 C  CB  . GLU A 1 120 ? 18.277 -30.451 -0.719  1.00 18.96 ? 115 GLU A CB  1 
ATOM   1028 C  CG  . GLU A 1 120 ? 19.584 -31.209 -0.847  1.00 24.52 ? 115 GLU A CG  1 
ATOM   1029 C  CD  . GLU A 1 120 ? 19.459 -32.752 -0.576  1.00 29.20 ? 115 GLU A CD  1 
ATOM   1030 O  OE1 . GLU A 1 120 ? 18.363 -33.421 -0.872  1.00 23.37 ? 115 GLU A OE1 1 
ATOM   1031 O  OE2 . GLU A 1 120 ? 20.508 -33.277 -0.096  1.00 30.76 ? 115 GLU A OE2 1 
ATOM   1032 N  N   . SER A 1 121 ? 15.370 -29.795 0.499   1.00 14.71 ? 116 SER A N   1 
ATOM   1033 C  CA  . SER A 1 121 ? 14.310 -28.799 0.558   1.00 10.82 ? 116 SER A CA  1 
ATOM   1034 C  C   . SER A 1 121 ? 13.834 -28.691 2.023   1.00 9.68  ? 116 SER A C   1 
ATOM   1035 O  O   . SER A 1 121 ? 13.581 -27.586 2.520   1.00 10.18 ? 116 SER A O   1 
ATOM   1036 C  CB  . SER A 1 121 ? 13.104 -29.144 -0.291  1.00 12.53 ? 116 SER A CB  1 
ATOM   1037 O  OG  . SER A 1 121 ? 12.689 -30.482 -0.046  1.00 13.55 ? 116 SER A OG  1 
ATOM   1038 N  N   . ARG A 1 122 ? 13.664 -29.835 2.672   1.00 9.25  ? 117 ARG A N   1 
ATOM   1039 C  CA  A ARG A 1 122 ? 13.069 -29.783 4.029   0.00 9.65  ? 117 ARG A CA  1 
ATOM   1040 C  CA  B ARG A 1 122 ? 13.082 -29.820 4.045   1.00 9.92  ? 117 ARG A CA  1 
ATOM   1041 C  C   . ARG A 1 122 ? 14.011 -29.032 4.986   1.00 9.24  ? 117 ARG A C   1 
ATOM   1042 O  O   . ARG A 1 122 ? 13.536 -28.226 5.778   1.00 8.91  ? 117 ARG A O   1 
ATOM   1043 C  CB  A ARG A 1 122 ? 12.845 -31.174 4.531   0.00 10.79 ? 117 ARG A CB  1 
ATOM   1044 C  CB  B ARG A 1 122 ? 12.895 -31.232 4.581   1.00 11.23 ? 117 ARG A CB  1 
ATOM   1045 C  CG  A ARG A 1 122 ? 12.041 -31.172 5.718   0.00 17.88 ? 117 ARG A CG  1 
ATOM   1046 C  CG  B ARG A 1 122 ? 11.625 -31.383 5.327   1.00 22.62 ? 117 ARG A CG  1 
ATOM   1047 C  CD  A ARG A 1 122 ? 11.356 -32.571 5.967   0.00 20.14 ? 117 ARG A CD  1 
ATOM   1048 C  CD  B ARG A 1 122 ? 11.316 -32.531 6.332   1.00 26.89 ? 117 ARG A CD  1 
ATOM   1049 N  NE  A ARG A 1 122 ? 10.476 -32.366 7.119   0.00 23.49 ? 117 ARG A NE  1 
ATOM   1050 N  NE  B ARG A 1 122 ? 11.464 -33.986 6.115   1.00 39.74 ? 117 ARG A NE  1 
ATOM   1051 C  CZ  A ARG A 1 122 ? 9.209  -31.950 7.011   0.00 24.39 ? 117 ARG A CZ  1 
ATOM   1052 C  CZ  B ARG A 1 122 ? 12.334 -34.731 5.394   1.00 40.71 ? 117 ARG A CZ  1 
ATOM   1053 N  NH1 A ARG A 1 122 ? 8.664  -31.741 5.787   0.00 24.77 ? 117 ARG A NH1 1 
ATOM   1054 N  NH1 B ARG A 1 122 ? 13.281 -34.251 4.600   1.00 42.98 ? 117 ARG A NH1 1 
ATOM   1055 N  NH2 A ARG A 1 122 ? 8.477  -31.736 8.124   0.00 25.73 ? 117 ARG A NH2 1 
ATOM   1056 N  NH2 B ARG A 1 122 ? 12.217 -36.066 5.486   1.00 45.08 ? 117 ARG A NH2 1 
ATOM   1057 N  N   . VAL A 1 123 ? 15.313 -29.310 4.924   1.00 8.05  ? 118 VAL A N   1 
ATOM   1058 C  CA  . VAL A 1 123 ? 16.262 -28.620 5.822   1.00 7.56  ? 118 VAL A CA  1 
ATOM   1059 C  C   . VAL A 1 123 ? 16.286 -27.130 5.495   1.00 6.97  ? 118 VAL A C   1 
ATOM   1060 O  O   . VAL A 1 123 ? 16.334 -26.303 6.394   1.00 7.82  ? 118 VAL A O   1 
ATOM   1061 C  CB  . VAL A 1 123 ? 17.686 -29.267 5.724   1.00 8.09  ? 118 VAL A CB  1 
ATOM   1062 C  CG1 . VAL A 1 123 ? 18.688 -28.433 6.576   1.00 7.52  ? 118 VAL A CG1 1 
ATOM   1063 C  CG2 . VAL A 1 123 ? 17.647 -30.681 6.182   1.00 10.66 ? 118 VAL A CG2 1 
ATOM   1064 N  N   . PHE A 1 124 ? 16.268 -26.792 4.200   1.00 7.21  ? 119 PHE A N   1 
ATOM   1065 C  CA  A PHE A 1 124 ? 16.299 -25.400 3.810   0.70 5.66  ? 119 PHE A CA  1 
ATOM   1066 C  CA  B PHE A 1 124 ? 16.247 -25.406 3.758   0.30 6.24  ? 119 PHE A CA  1 
ATOM   1067 C  C   . PHE A 1 124 ? 15.096 -24.661 4.408   1.00 6.27  ? 119 PHE A C   1 
ATOM   1068 O  O   . PHE A 1 124 ? 15.273 -23.562 5.000   1.00 6.90  ? 119 PHE A O   1 
ATOM   1069 C  CB  A PHE A 1 124 ? 16.219 -25.375 2.272   0.70 6.78  ? 119 PHE A CB  1 
ATOM   1070 C  CB  B PHE A 1 124 ? 16.025 -25.382 2.239   0.30 6.42  ? 119 PHE A CB  1 
ATOM   1071 C  CG  A PHE A 1 124 ? 16.469 -24.015 1.653   0.70 5.38  ? 119 PHE A CG  1 
ATOM   1072 C  CG  B PHE A 1 124 ? 16.119 -24.012 1.629   0.30 6.87  ? 119 PHE A CG  1 
ATOM   1073 C  CD1 A PHE A 1 124 ? 15.401 -23.063 1.608   0.70 6.45  ? 119 PHE A CD1 1 
ATOM   1074 C  CD1 B PHE A 1 124 ? 17.321 -23.549 1.134   0.30 6.37  ? 119 PHE A CD1 1 
ATOM   1075 C  CD2 A PHE A 1 124 ? 17.684 -23.721 1.039   0.70 5.51  ? 119 PHE A CD2 1 
ATOM   1076 C  CD2 B PHE A 1 124 ? 14.984 -23.192 1.537   0.30 6.30  ? 119 PHE A CD2 1 
ATOM   1077 C  CE1 A PHE A 1 124 ? 15.599 -21.791 0.960   0.70 6.20  ? 119 PHE A CE1 1 
ATOM   1078 C  CE1 B PHE A 1 124 ? 17.409 -22.296 0.552   0.30 6.91  ? 119 PHE A CE1 1 
ATOM   1079 C  CE2 A PHE A 1 124 ? 17.894 -22.498 0.414   0.70 6.49  ? 119 PHE A CE2 1 
ATOM   1080 C  CE2 B PHE A 1 124 ? 15.071 -21.924 0.932   0.30 6.36  ? 119 PHE A CE2 1 
ATOM   1081 C  CZ  A PHE A 1 124 ? 16.866 -21.529 0.367   0.70 4.63  ? 119 PHE A CZ  1 
ATOM   1082 C  CZ  B PHE A 1 124 ? 16.293 -21.490 0.460   0.30 6.58  ? 119 PHE A CZ  1 
ATOM   1083 N  N   . TYR A 1 125 ? 13.877 -25.222 4.266   1.00 6.05  ? 120 TYR A N   1 
ATOM   1084 C  CA  . TYR A 1 125 ? 12.720 -24.494 4.738   1.00 6.37  ? 120 TYR A CA  1 
ATOM   1085 C  C   . TYR A 1 125 ? 12.683 -24.445 6.259   1.00 7.04  ? 120 TYR A C   1 
ATOM   1086 O  O   . TYR A 1 125 ? 12.210 -23.463 6.840   1.00 6.41  ? 120 TYR A O   1 
ATOM   1087 C  CB  . TYR A 1 125 ? 11.419 -25.163 4.239   1.00 6.33  ? 120 TYR A CB  1 
ATOM   1088 C  CG  . TYR A 1 125 ? 11.232 -25.041 2.730   1.00 5.04  ? 120 TYR A CG  1 
ATOM   1089 C  CD1 . TYR A 1 125 ? 11.406 -23.792 2.036   1.00 6.61  ? 120 TYR A CD1 1 
ATOM   1090 C  CD2 . TYR A 1 125 ? 10.850 -26.147 1.976   1.00 7.13  ? 120 TYR A CD2 1 
ATOM   1091 C  CE1 . TYR A 1 125 ? 11.273 -23.728 0.659   1.00 8.88  ? 120 TYR A CE1 1 
ATOM   1092 C  CE2 . TYR A 1 125 ? 10.681 -26.064 0.591   1.00 7.47  ? 120 TYR A CE2 1 
ATOM   1093 C  CZ  . TYR A 1 125 ? 10.852 -24.857 -0.055  1.00 8.30  ? 120 TYR A CZ  1 
ATOM   1094 O  OH  . TYR A 1 125 ? 10.687 -24.789 -1.429  1.00 12.68 ? 120 TYR A OH  1 
ATOM   1095 N  N   . LEU A 1 126 ? 13.139 -25.522 6.924   1.00 7.14  ? 121 LEU A N   1 
ATOM   1096 C  CA  . LEU A 1 126 ? 13.134 -25.489 8.398   1.00 6.50  ? 121 LEU A CA  1 
ATOM   1097 C  C   . LEU A 1 126 ? 14.186 -24.513 8.891   1.00 6.23  ? 121 LEU A C   1 
ATOM   1098 O  O   . LEU A 1 126 ? 13.967 -23.865 9.914   1.00 8.38  ? 121 LEU A O   1 
ATOM   1099 C  CB  . LEU A 1 126 ? 13.447 -26.868 8.974   1.00 7.76  ? 121 LEU A CB  1 
ATOM   1100 C  CG  . LEU A 1 126 ? 12.241 -27.783 8.817   1.00 8.61  ? 121 LEU A CG  1 
ATOM   1101 C  CD1 . LEU A 1 126 ? 12.768 -29.253 9.076   1.00 10.26 ? 121 LEU A CD1 1 
ATOM   1102 C  CD2 . LEU A 1 126 ? 11.134 -27.365 9.849   1.00 10.79 ? 121 LEU A CD2 1 
ATOM   1103 N  N   . LYS A 1 127 ? 15.305 -24.371 8.185   1.00 7.13  ? 122 LYS A N   1 
ATOM   1104 C  CA  . LYS A 1 127 ? 16.274 -23.310 8.548   1.00 5.56  ? 122 LYS A CA  1 
ATOM   1105 C  C   . LYS A 1 127 ? 15.600 -21.920 8.413   1.00 7.59  ? 122 LYS A C   1 
ATOM   1106 O  O   . LYS A 1 127 ? 15.714 -21.119 9.321   1.00 7.29  ? 122 LYS A O   1 
ATOM   1107 C  CB  . LYS A 1 127 ? 17.487 -23.368 7.608   1.00 5.92  ? 122 LYS A CB  1 
ATOM   1108 C  CG  . LYS A 1 127 ? 18.449 -22.131 7.908   1.00 4.67  ? 122 LYS A CG  1 
ATOM   1109 C  CD  . LYS A 1 127 ? 19.700 -22.163 6.984   1.00 6.18  ? 122 LYS A CD  1 
ATOM   1110 C  CE  . LYS A 1 127 ? 20.574 -20.926 7.135   1.00 7.70  ? 122 LYS A CE  1 
ATOM   1111 N  NZ  . LYS A 1 127 ? 19.771 -19.765 6.569   1.00 7.61  ? 122 LYS A NZ  1 
ATOM   1112 N  N   . MET A 1 128 ? 14.896 -21.686 7.294   1.00 6.57  ? 123 MET A N   1 
ATOM   1113 C  CA  . MET A 1 128 ? 14.146 -20.406 7.147   1.00 5.83  ? 123 MET A CA  1 
ATOM   1114 C  C   . MET A 1 128 ? 13.187 -20.216 8.335   1.00 6.03  ? 123 MET A C   1 
ATOM   1115 O  O   . MET A 1 128 ? 13.099 -19.132 8.900   1.00 7.18  ? 123 MET A O   1 
ATOM   1116 C  CB  . MET A 1 128 ? 13.366 -20.333 5.843   1.00 6.68  ? 123 MET A CB  1 
ATOM   1117 C  CG  . MET A 1 128 ? 14.265 -20.228 4.614   1.00 7.48  ? 123 MET A CG  1 
ATOM   1118 S  SD  . MET A 1 128 ? 13.307 -19.995 3.133   1.00 8.09  ? 123 MET A SD  1 
ATOM   1119 C  CE  . MET A 1 128 ? 12.610 -18.373 3.424   1.00 8.71  ? 123 MET A CE  1 
ATOM   1120 N  N   . LYS A 1 129 ? 12.492 -21.293 8.707   1.00 6.57  ? 124 LYS A N   1 
ATOM   1121 C  CA  . LYS A 1 129 ? 11.522 -21.168 9.797   1.00 6.69  ? 124 LYS A CA  1 
ATOM   1122 C  C   . LYS A 1 129 ? 12.269 -20.746 11.087  1.00 7.69  ? 124 LYS A C   1 
ATOM   1123 O  O   . LYS A 1 129 ? 11.817 -19.813 11.805  1.00 7.91  ? 124 LYS A O   1 
ATOM   1124 C  CB  . LYS A 1 129 ? 10.763 -22.476 10.012  1.00 7.48  ? 124 LYS A CB  1 
ATOM   1125 C  CG  . LYS A 1 129 ? 9.691  -22.400 11.113  1.00 8.05  ? 124 LYS A CG  1 
ATOM   1126 C  CD  . LYS A 1 129 ? 8.870  -23.743 11.118  1.00 11.04 ? 124 LYS A CD  1 
ATOM   1127 C  CE  . LYS A 1 129 ? 7.797  -23.630 12.147  1.00 14.94 ? 124 LYS A CE  1 
ATOM   1128 N  NZ  . LYS A 1 129 ? 6.945  -24.828 12.125  1.00 17.09 ? 124 LYS A NZ  1 
ATOM   1129 N  N   . GLY A 1 130 ? 13.427 -21.390 11.353  1.00 6.14  ? 125 GLY A N   1 
ATOM   1130 C  CA  . GLY A 1 130 ? 14.223 -20.996 12.512  1.00 7.06  ? 125 GLY A CA  1 
ATOM   1131 C  C   . GLY A 1 130 ? 14.668 -19.527 12.398  1.00 7.58  ? 125 GLY A C   1 
ATOM   1132 O  O   . GLY A 1 130 ? 14.621 -18.779 13.384  1.00 8.53  ? 125 GLY A O   1 
ATOM   1133 N  N   . ASP A 1 131 ? 15.150 -19.146 11.209  1.00 7.02  ? 126 ASP A N   1 
ATOM   1134 C  CA  . ASP A 1 131 ? 15.663 -17.780 11.019  1.00 5.46  ? 126 ASP A CA  1 
ATOM   1135 C  C   . ASP A 1 131 ? 14.553 -16.757 11.282  1.00 6.67  ? 126 ASP A C   1 
ATOM   1136 O  O   . ASP A 1 131 ? 14.819 -15.773 11.983  1.00 6.51  ? 126 ASP A O   1 
ATOM   1137 C  CB  . ASP A 1 131 ? 16.133 -17.565 9.545   1.00 6.33  ? 126 ASP A CB  1 
ATOM   1138 C  CG  . ASP A 1 131 ? 17.406 -18.333 9.252   1.00 6.35  ? 126 ASP A CG  1 
ATOM   1139 O  OD1 . ASP A 1 131 ? 18.185 -18.679 10.202  1.00 8.68  ? 126 ASP A OD1 1 
ATOM   1140 O  OD2 . ASP A 1 131 ? 17.667 -18.496 8.047   1.00 8.14  ? 126 ASP A OD2 1 
ATOM   1141 N  N   . TYR A 1 132 ? 13.352 -16.971 10.737  1.00 7.51  ? 127 TYR A N   1 
ATOM   1142 C  CA  . TYR A 1 132 ? 12.307 -15.924 10.886  1.00 7.04  ? 127 TYR A CA  1 
ATOM   1143 C  C   . TYR A 1 132 ? 11.717 -15.904 12.309  1.00 7.87  ? 127 TYR A C   1 
ATOM   1144 O  O   . TYR A 1 132 ? 11.372 -14.808 12.824  1.00 8.56  ? 127 TYR A O   1 
ATOM   1145 C  CB  . TYR A 1 132 ? 11.251 -15.965 9.735   1.00 6.40  ? 127 TYR A CB  1 
ATOM   1146 C  CG  . TYR A 1 132 ? 11.960 -15.441 8.475   1.00 6.86  ? 127 TYR A CG  1 
ATOM   1147 C  CD1 . TYR A 1 132 ? 12.714 -16.282 7.667   1.00 6.55  ? 127 TYR A CD1 1 
ATOM   1148 C  CD2 . TYR A 1 132 ? 11.922 -14.081 8.146   1.00 7.14  ? 127 TYR A CD2 1 
ATOM   1149 C  CE1 . TYR A 1 132 ? 13.419 -15.822 6.591   1.00 9.46  ? 127 TYR A CE1 1 
ATOM   1150 C  CE2 . TYR A 1 132 ? 12.663 -13.586 7.057   1.00 7.59  ? 127 TYR A CE2 1 
ATOM   1151 C  CZ  . TYR A 1 132 ? 13.427 -14.467 6.301   1.00 8.99  ? 127 TYR A CZ  1 
ATOM   1152 O  OH  . TYR A 1 132 ? 14.124 -14.028 5.223   1.00 9.47  ? 127 TYR A OH  1 
ATOM   1153 N  N   . TYR A 1 133 ? 11.668 -17.070 12.968  1.00 8.31  ? 128 TYR A N   1 
ATOM   1154 C  CA  . TYR A 1 133 ? 11.364 -16.990 14.399  1.00 8.49  ? 128 TYR A CA  1 
ATOM   1155 C  C   . TYR A 1 133 ? 12.479 -16.291 15.175  1.00 8.84  ? 128 TYR A C   1 
ATOM   1156 O  O   . TYR A 1 133 ? 12.219 -15.540 16.116  1.00 8.46  ? 128 TYR A O   1 
ATOM   1157 C  CB  . TYR A 1 133 ? 11.090 -18.356 15.015  1.00 8.24  ? 128 TYR A CB  1 
ATOM   1158 C  CG  . TYR A 1 133 ? 9.650  -18.770 14.822  1.00 6.67  ? 128 TYR A CG  1 
ATOM   1159 C  CD1 . TYR A 1 133 ? 8.595  -18.102 15.518  1.00 10.49 ? 128 TYR A CD1 1 
ATOM   1160 C  CD2 . TYR A 1 133 ? 9.321  -19.846 14.001  1.00 9.59  ? 128 TYR A CD2 1 
ATOM   1161 C  CE1 . TYR A 1 133 ? 7.236  -18.493 15.356  1.00 13.43 ? 128 TYR A CE1 1 
ATOM   1162 C  CE2 . TYR A 1 133 ? 7.986  -20.214 13.822  1.00 11.05 ? 128 TYR A CE2 1 
ATOM   1163 C  CZ  . TYR A 1 133 ? 6.955  -19.523 14.499  1.00 11.37 ? 128 TYR A CZ  1 
ATOM   1164 O  OH  . TYR A 1 133 ? 5.638  -19.904 14.337  1.00 16.35 ? 128 TYR A OH  1 
ATOM   1165 N  N   . ARG A 1 134 ? 13.726 -16.529 14.783  1.00 8.63  ? 129 ARG A N   1 
ATOM   1166 C  CA  . ARG A 1 134 ? 14.836 -15.857 15.440  1.00 8.54  ? 129 ARG A CA  1 
ATOM   1167 C  C   . ARG A 1 134 ? 14.718 -14.330 15.264  1.00 8.25  ? 129 ARG A C   1 
ATOM   1168 O  O   . ARG A 1 134 ? 14.980 -13.571 16.194  1.00 9.04  ? 129 ARG A O   1 
ATOM   1169 C  CB  . ARG A 1 134 ? 16.155 -16.353 14.884  1.00 8.08  ? 129 ARG A CB  1 
ATOM   1170 C  CG  . ARG A 1 134 ? 17.370 -15.581 15.438  1.00 8.29  ? 129 ARG A CG  1 
ATOM   1171 C  CD  . ARG A 1 134 ? 18.685 -16.350 15.198  1.00 7.39  ? 129 ARG A CD  1 
ATOM   1172 N  NE  . ARG A 1 134 ? 18.886 -16.622 13.769  1.00 7.20  ? 129 ARG A NE  1 
ATOM   1173 C  CZ  . ARG A 1 134 ? 19.579 -15.843 12.944  1.00 7.16  ? 129 ARG A CZ  1 
ATOM   1174 N  NH1 . ARG A 1 134 ? 20.071 -14.646 13.345  1.00 7.20  ? 129 ARG A NH1 1 
ATOM   1175 N  NH2 . ARG A 1 134 ? 19.686 -16.198 11.658  1.00 7.70  ? 129 ARG A NH2 1 
ATOM   1176 N  N   . TYR A 1 135 ? 14.329 -13.871 14.078  1.00 8.51  ? 130 TYR A N   1 
ATOM   1177 C  CA  . TYR A 1 135 ? 14.162 -12.424 13.862  1.00 8.38  ? 130 TYR A CA  1 
ATOM   1178 C  C   . TYR A 1 135 ? 13.019 -11.883 14.725  1.00 8.49  ? 130 TYR A C   1 
ATOM   1179 O  O   . TYR A 1 135 ? 13.109 -10.754 15.261  1.00 8.24  ? 130 TYR A O   1 
ATOM   1180 C  CB  . TYR A 1 135 ? 13.937 -12.068 12.383  1.00 8.87  ? 130 TYR A CB  1 
ATOM   1181 C  CG  . TYR A 1 135 ? 15.032 -12.570 11.496  1.00 7.23  ? 130 TYR A CG  1 
ATOM   1182 C  CD1 . TYR A 1 135 ? 16.339 -12.726 11.986  1.00 8.26  ? 130 TYR A CD1 1 
ATOM   1183 C  CD2 . TYR A 1 135 ? 14.749 -13.016 10.227  1.00 7.24  ? 130 TYR A CD2 1 
ATOM   1184 C  CE1 . TYR A 1 135 ? 17.387 -13.264 11.202  1.00 7.56  ? 130 TYR A CE1 1 
ATOM   1185 C  CE2 . TYR A 1 135 ? 15.769 -13.554 9.399   1.00 9.88  ? 130 TYR A CE2 1 
ATOM   1186 C  CZ  . TYR A 1 135 ? 17.084 -13.710 9.903   1.00 8.93  ? 130 TYR A CZ  1 
ATOM   1187 O  OH  . TYR A 1 135 ? 18.051 -14.218 9.088   1.00 11.07 ? 130 TYR A OH  1 
ATOM   1188 N  N   . LEU A 1 136 ? 11.929 -12.675 14.845  1.00 8.30  ? 131 LEU A N   1 
ATOM   1189 C  CA  . LEU A 1 136 ? 10.869 -12.305 15.808  1.00 9.28  ? 131 LEU A CA  1 
ATOM   1190 C  C   . LEU A 1 136 ? 11.423 -12.228 17.241  1.00 9.03  ? 131 LEU A C   1 
ATOM   1191 O  O   . LEU A 1 136 ? 11.034 -11.335 18.032  1.00 11.10 ? 131 LEU A O   1 
ATOM   1192 C  CB  . LEU A 1 136 ? 9.691  -13.282 15.777  1.00 8.42  ? 131 LEU A CB  1 
ATOM   1193 C  CG  . LEU A 1 136 ? 8.907  -13.127 14.438  1.00 8.48  ? 131 LEU A CG  1 
ATOM   1194 C  CD1 . LEU A 1 136 ? 7.777  -14.210 14.467  1.00 8.55  ? 131 LEU A CD1 1 
ATOM   1195 C  CD2 . LEU A 1 136 ? 8.278  -11.700 14.276  1.00 12.20 ? 131 LEU A CD2 1 
ATOM   1196 N  N   . ALA A 1 137 ? 12.327 -13.144 17.583  1.00 9.90  ? 132 ALA A N   1 
ATOM   1197 C  CA  . ALA A 1 137 ? 12.876 -13.176 18.959  1.00 11.14 ? 132 ALA A CA  1 
ATOM   1198 C  C   . ALA A 1 137 ? 13.767 -11.978 19.211  1.00 11.62 ? 132 ALA A C   1 
ATOM   1199 O  O   . ALA A 1 137 ? 13.845 -11.496 20.366  1.00 12.71 ? 132 ALA A O   1 
ATOM   1200 C  CB  . ALA A 1 137 ? 13.669 -14.488 19.176  1.00 11.00 ? 132 ALA A CB  1 
ATOM   1201 N  N   . GLU A 1 138 ? 14.389 -11.449 18.156  1.00 10.68 ? 133 GLU A N   1 
ATOM   1202 C  CA  . GLU A 1 138 ? 15.293 -10.298 18.320  1.00 11.91 ? 133 GLU A CA  1 
ATOM   1203 C  C   . GLU A 1 138 ? 14.552 -9.083  18.845  1.00 11.51 ? 133 GLU A C   1 
ATOM   1204 O  O   . GLU A 1 138 ? 15.166 -8.256  19.526  1.00 12.31 ? 133 GLU A O   1 
ATOM   1205 C  CB  . GLU A 1 138 ? 15.947 -9.902  16.988  1.00 10.73 ? 133 GLU A CB  1 
ATOM   1206 C  CG  . GLU A 1 138 ? 17.057 -10.911 16.541  1.00 9.34  ? 133 GLU A CG  1 
ATOM   1207 C  CD  . GLU A 1 138 ? 17.692 -10.559 15.173  1.00 8.82  ? 133 GLU A CD  1 
ATOM   1208 O  OE1 . GLU A 1 138 ? 17.152 -9.706  14.443  1.00 11.24 ? 133 GLU A OE1 1 
ATOM   1209 O  OE2 . GLU A 1 138 ? 18.724 -11.175 14.835  1.00 12.72 ? 133 GLU A OE2 1 
ATOM   1210 N  N   . VAL A 1 139 ? 13.284 -8.940  18.480  1.00 10.19 ? 134 VAL A N   1 
ATOM   1211 C  CA  . VAL A 1 139 ? 12.496 -7.772  18.897  1.00 12.54 ? 134 VAL A CA  1 
ATOM   1212 C  C   . VAL A 1 139 ? 11.449 -8.090  19.974  1.00 13.98 ? 134 VAL A C   1 
ATOM   1213 O  O   . VAL A 1 139 ? 10.764 -7.183  20.467  1.00 14.38 ? 134 VAL A O   1 
ATOM   1214 C  CB  . VAL A 1 139 ? 11.816 -7.096  17.679  1.00 11.33 ? 134 VAL A CB  1 
ATOM   1215 C  CG1 . VAL A 1 139 ? 12.903 -6.814  16.634  1.00 12.58 ? 134 VAL A CG1 1 
ATOM   1216 C  CG2 . VAL A 1 139 ? 10.713 -7.964  17.044  1.00 12.64 ? 134 VAL A CG2 1 
ATOM   1217 N  N   . ALA A 1 140 ? 11.310 -9.353  20.353  1.00 15.18 ? 135 ALA A N   1 
ATOM   1218 C  CA  . ALA A 1 140 ? 10.342 -9.742  21.370  1.00 16.69 ? 135 ALA A CA  1 
ATOM   1219 C  C   . ALA A 1 140 ? 10.799 -9.346  22.773  1.00 19.55 ? 135 ALA A C   1 
ATOM   1220 O  O   . ALA A 1 140 ? 11.990 -9.489  23.124  1.00 19.55 ? 135 ALA A O   1 
ATOM   1221 C  CB  . ALA A 1 140 ? 10.193 -11.264 21.290  1.00 18.06 ? 135 ALA A CB  1 
ATOM   1222 N  N   . THR A 1 141 ? 9.872  -8.831  23.558  1.00 23.88 ? 136 THR A N   1 
ATOM   1223 C  CA  . THR A 1 141 ? 10.170 -8.317  24.888  1.00 29.00 ? 136 THR A CA  1 
ATOM   1224 C  C   . THR A 1 141 ? 9.067  -8.679  25.847  1.00 31.07 ? 136 THR A C   1 
ATOM   1225 O  O   . THR A 1 141 ? 9.209  -8.393  27.059  1.00 34.11 ? 136 THR A O   1 
ATOM   1226 C  CB  . THR A 1 141 ? 10.189 -6.765  24.955  1.00 28.77 ? 136 THR A CB  1 
ATOM   1227 O  OG1 . THR A 1 141 ? 8.921  -6.255  24.513  1.00 29.99 ? 136 THR A OG1 1 
ATOM   1228 C  CG2 . THR A 1 141 ? 11.373 -6.157  24.162  1.00 29.03 ? 136 THR A CG2 1 
ATOM   1229 N  N   . GLY A 1 142 ? 7.992  -9.304  25.346  1.00 31.90 ? 137 GLY A N   1 
ATOM   1230 C  CA  . GLY A 1 142 ? 6.787  -9.591  26.156  1.00 33.83 ? 137 GLY A CA  1 
ATOM   1231 C  C   . GLY A 1 142 ? 6.594  -11.049 26.577  1.00 34.81 ? 137 GLY A C   1 
ATOM   1232 O  O   . GLY A 1 142 ? 7.558  -11.849 26.585  1.00 34.60 ? 137 GLY A O   1 
ATOM   1233 N  N   . ASP A 1 143 ? 5.331  -11.402 26.842  1.00 34.53 ? 138 ASP A N   1 
ATOM   1234 C  CA  A ASP A 1 143 ? 4.988  -12.717 27.397  0.60 34.93 ? 138 ASP A CA  1 
ATOM   1235 C  CA  B ASP A 1 143 ? 4.996  -12.725 27.405  0.40 34.88 ? 138 ASP A CA  1 
ATOM   1236 C  C   . ASP A 1 143 ? 5.120  -13.923 26.437  1.00 34.00 ? 138 ASP A C   1 
ATOM   1237 O  O   . ASP A 1 143 ? 5.062  -15.083 26.875  1.00 33.70 ? 138 ASP A O   1 
ATOM   1238 C  CB  A ASP A 1 143 ? 3.595  -12.638 28.037  0.60 35.32 ? 138 ASP A CB  1 
ATOM   1239 C  CB  B ASP A 1 143 ? 3.628  -12.700 28.129  0.40 35.41 ? 138 ASP A CB  1 
ATOM   1240 C  CG  A ASP A 1 143 ? 3.509  -11.529 29.088  0.60 36.64 ? 138 ASP A CG  1 
ATOM   1241 C  CG  B ASP A 1 143 ? 2.446  -12.955 27.204  0.40 37.15 ? 138 ASP A CG  1 
ATOM   1242 O  OD1 A ASP A 1 143 ? 4.546  -11.241 29.733  0.60 38.03 ? 138 ASP A OD1 1 
ATOM   1243 O  OD1 B ASP A 1 143 ? 1.736  -11.982 26.851  0.40 37.68 ? 138 ASP A OD1 1 
ATOM   1244 O  OD2 A ASP A 1 143 ? 2.430  -10.932 29.258  0.60 37.02 ? 138 ASP A OD2 1 
ATOM   1245 O  OD2 B ASP A 1 143 ? 2.204  -14.134 26.860  0.40 38.44 ? 138 ASP A OD2 1 
ATOM   1246 N  N   . ASP A 1 144 ? 5.271  -13.635 25.144  1.00 32.85 ? 139 ASP A N   1 
ATOM   1247 C  CA  . ASP A 1 144 ? 5.483  -14.648 24.120  1.00 31.68 ? 139 ASP A CA  1 
ATOM   1248 C  C   . ASP A 1 144 ? 6.959  -14.841 23.762  1.00 27.84 ? 139 ASP A C   1 
ATOM   1249 O  O   . ASP A 1 144 ? 7.246  -15.714 22.970  1.00 26.68 ? 139 ASP A O   1 
ATOM   1250 C  CB  . ASP A 1 144 ? 4.681  -14.359 22.822  1.00 34.42 ? 139 ASP A CB  1 
ATOM   1251 C  CG  . ASP A 1 144 ? 3.393  -15.198 22.718  1.00 39.98 ? 139 ASP A CG  1 
ATOM   1252 O  OD1 . ASP A 1 144 ? 2.437  -14.739 22.030  1.00 46.93 ? 139 ASP A OD1 1 
ATOM   1253 O  OD2 . ASP A 1 144 ? 3.324  -16.310 23.308  1.00 43.63 ? 139 ASP A OD2 1 
ATOM   1254 N  N   . LYS A 1 145 ? 7.881  -14.064 24.347  1.00 24.84 ? 140 LYS A N   1 
ATOM   1255 C  CA  A LYS A 1 145 ? 9.306  -14.197 24.071  0.40 23.17 ? 140 LYS A CA  1 
ATOM   1256 C  CA  B LYS A 1 145 ? 9.294  -14.217 23.988  0.20 22.60 ? 140 LYS A CA  1 
ATOM   1257 C  CA  C LYS A 1 145 ? 9.302  -14.206 24.032  0.40 23.21 ? 140 LYS A CA  1 
ATOM   1258 C  C   . LYS A 1 145 ? 9.784  -15.665 24.131  1.00 21.52 ? 140 LYS A C   1 
ATOM   1259 O  O   . LYS A 1 145 ? 10.410 -16.190 23.206  1.00 18.28 ? 140 LYS A O   1 
ATOM   1260 C  CB  A LYS A 1 145 ? 10.050 -13.356 25.096  0.40 24.32 ? 140 LYS A CB  1 
ATOM   1261 C  CB  B LYS A 1 145 ? 10.191 -13.239 24.753  0.20 22.99 ? 140 LYS A CB  1 
ATOM   1262 C  CB  C LYS A 1 145 ? 10.128 -13.318 24.948  0.40 24.45 ? 140 LYS A CB  1 
ATOM   1263 C  CG  A LYS A 1 145 ? 11.529 -13.207 24.889  0.40 24.12 ? 140 LYS A CG  1 
ATOM   1264 C  CG  B LYS A 1 145 ? 11.703 -13.426 24.559  0.20 21.44 ? 140 LYS A CG  1 
ATOM   1265 C  CG  C LYS A 1 145 ? 11.479 -12.920 24.398  0.40 24.29 ? 140 LYS A CG  1 
ATOM   1266 C  CD  A LYS A 1 145 ? 12.095 -12.401 26.084  0.40 23.70 ? 140 LYS A CD  1 
ATOM   1267 C  CD  B LYS A 1 145 ? 12.200 -12.983 23.197  0.20 20.43 ? 140 LYS A CD  1 
ATOM   1268 C  CD  C LYS A 1 145 ? 12.113 -11.861 25.332  0.40 27.20 ? 140 LYS A CD  1 
ATOM   1269 C  CE  A LYS A 1 145 ? 13.580 -12.698 26.266  0.40 23.47 ? 140 LYS A CE  1 
ATOM   1270 C  CE  B LYS A 1 145 ? 13.450 -12.102 23.292  0.20 18.64 ? 140 LYS A CE  1 
ATOM   1271 C  CE  C LYS A 1 145 ? 13.594 -11.662 25.006  0.40 27.70 ? 140 LYS A CE  1 
ATOM   1272 N  NZ  A LYS A 1 145 ? 14.337 -12.539 24.983  0.40 22.27 ? 140 LYS A NZ  1 
ATOM   1273 N  NZ  B LYS A 1 145 ? 14.654 -12.741 23.888  0.20 19.19 ? 140 LYS A NZ  1 
ATOM   1274 N  NZ  C LYS A 1 145 ? 13.794 -11.671 23.530  0.40 27.14 ? 140 LYS A NZ  1 
ATOM   1275 N  N   . LYS A 1 146 ? 9.503  -16.332 25.245  1.00 19.73 ? 141 LYS A N   1 
ATOM   1276 C  CA  A LYS A 1 146 ? 10.036 -17.688 25.398  0.50 18.06 ? 141 LYS A CA  1 
ATOM   1277 C  CA  B LYS A 1 146 ? 10.026 -17.699 25.414  0.50 18.40 ? 141 LYS A CA  1 
ATOM   1278 C  C   . LYS A 1 146 ? 9.472  -18.617 24.360  1.00 16.91 ? 141 LYS A C   1 
ATOM   1279 O  O   . LYS A 1 146 ? 10.212 -19.470 23.849  1.00 16.39 ? 141 LYS A O   1 
ATOM   1280 C  CB  A LYS A 1 146 ? 9.811  -18.226 26.814  0.50 18.34 ? 141 LYS A CB  1 
ATOM   1281 C  CB  B LYS A 1 146 ? 9.762  -18.267 26.822  0.50 18.90 ? 141 LYS A CB  1 
ATOM   1282 C  CG  A LYS A 1 146 ? 10.463 -17.339 27.865  0.50 19.23 ? 141 LYS A CG  1 
ATOM   1283 C  CG  B LYS A 1 146 ? 10.786 -17.818 27.869  0.50 21.47 ? 141 LYS A CG  1 
ATOM   1284 C  CD  A LYS A 1 146 ? 10.192 -17.909 29.295  0.50 20.60 ? 141 LYS A CD  1 
ATOM   1285 C  CD  B LYS A 1 146 ? 10.297 -18.113 29.318  0.50 24.11 ? 141 LYS A CD  1 
ATOM   1286 C  CE  A LYS A 1 146 ? 10.629 -16.983 30.409  0.50 20.52 ? 141 LYS A CE  1 
ATOM   1287 C  CE  B LYS A 1 146 ? 11.306 -17.687 30.387  0.50 24.64 ? 141 LYS A CE  1 
ATOM   1288 N  NZ  A LYS A 1 146 ? 10.745 -17.693 31.719  0.50 18.02 ? 141 LYS A NZ  1 
ATOM   1289 N  NZ  B LYS A 1 146 ? 11.916 -16.359 30.087  0.50 27.67 ? 141 LYS A NZ  1 
ATOM   1290 N  N   . ARG A 1 147 ? 8.173  -18.458 24.036  1.00 16.18 ? 142 ARG A N   1 
ATOM   1291 C  CA  . ARG A 1 147 ? 7.561  -19.320 23.040  1.00 15.67 ? 142 ARG A CA  1 
ATOM   1292 C  C   . ARG A 1 147 ? 8.136  -19.065 21.679  1.00 14.08 ? 142 ARG A C   1 
ATOM   1293 O  O   . ARG A 1 147 ? 8.339  -20.004 20.961  1.00 15.31 ? 142 ARG A O   1 
ATOM   1294 C  CB  . ARG A 1 147 ? 6.018  -19.304 23.009  1.00 16.66 ? 142 ARG A CB  1 
ATOM   1295 C  CG  . ARG A 1 147 ? 5.393  -20.515 23.871  1.00 21.13 ? 142 ARG A CG  1 
ATOM   1296 C  CD  . ARG A 1 147 ? 3.894  -20.410 24.004  1.00 27.04 ? 142 ARG A CD  1 
ATOM   1297 N  NE  . ARG A 1 147 ? 3.532  -19.194 24.757  1.00 27.77 ? 142 ARG A NE  1 
ATOM   1298 C  CZ  . ARG A 1 147 ? 3.290  -19.166 26.077  1.00 29.96 ? 142 ARG A CZ  1 
ATOM   1299 N  NH1 . ARG A 1 147 ? 3.350  -20.310 26.774  1.00 27.88 ? 142 ARG A NH1 1 
ATOM   1300 N  NH2 . ARG A 1 147 ? 2.969  -17.986 26.697  1.00 31.66 ? 142 ARG A NH2 1 
ATOM   1301 N  N   . ILE A 1 148 ? 8.347  -17.789 21.307  1.00 14.06 ? 143 ILE A N   1 
ATOM   1302 C  CA  . ILE A 1 148 ? 9.023  -17.463 20.025  1.00 11.64 ? 143 ILE A CA  1 
ATOM   1303 C  C   . ILE A 1 148 ? 10.433 -18.111 19.981  1.00 11.48 ? 143 ILE A C   1 
ATOM   1304 O  O   . ILE A 1 148 ? 10.862 -18.752 18.970  1.00 12.60 ? 143 ILE A O   1 
ATOM   1305 C  CB  . ILE A 1 148 ? 9.133  -15.990 19.844  1.00 12.07 ? 143 ILE A CB  1 
ATOM   1306 C  CG1 . ILE A 1 148 ? 7.734  -15.449 19.693  1.00 14.09 ? 143 ILE A CG1 1 
ATOM   1307 C  CG2 . ILE A 1 148 ? 9.975  -15.622 18.587  1.00 13.19 ? 143 ILE A CG2 1 
ATOM   1308 C  CD1 . ILE A 1 148 ? 7.693  -13.916 19.802  1.00 19.38 ? 143 ILE A CD1 1 
ATOM   1309 N  N   . ILE A 1 149 ? 11.196 -17.928 21.050  1.00 11.12 ? 144 ILE A N   1 
ATOM   1310 C  CA  . ILE A 1 149 ? 12.539 -18.579 21.101  1.00 10.20 ? 144 ILE A CA  1 
ATOM   1311 C  C   . ILE A 1 149 ? 12.442 -20.081 20.919  1.00 10.46 ? 144 ILE A C   1 
ATOM   1312 O  O   . ILE A 1 149 ? 13.227 -20.689 20.151  1.00 12.02 ? 144 ILE A O   1 
ATOM   1313 C  CB  . ILE A 1 149 ? 13.237 -18.161 22.410  1.00 11.28 ? 144 ILE A CB  1 
ATOM   1314 C  CG1 . ILE A 1 149 ? 13.579 -16.665 22.300  1.00 11.10 ? 144 ILE A CG1 1 
ATOM   1315 C  CG2 . ILE A 1 149 ? 14.480 -19.065 22.694  1.00 12.19 ? 144 ILE A CG2 1 
ATOM   1316 C  CD1 . ILE A 1 149 ? 14.122 -16.121 23.585  1.00 14.79 ? 144 ILE A CD1 1 
ATOM   1317 N  N   . ASP A 1 150 ? 11.493 -20.717 21.585  1.00 11.05 ? 145 ASP A N   1 
ATOM   1318 C  CA  A ASP A 1 150 ? 11.247 -22.177 21.508  0.35 11.34 ? 145 ASP A CA  1 
ATOM   1319 C  CA  B ASP A 1 150 ? 11.456 -22.167 21.467  0.35 10.25 ? 145 ASP A CA  1 
ATOM   1320 C  CA  C ASP A 1 150 ? 11.334 -22.176 21.495  0.30 11.28 ? 145 ASP A CA  1 
ATOM   1321 C  C   . ASP A 1 150 ? 10.966 -22.607 20.083  1.00 10.47 ? 145 ASP A C   1 
ATOM   1322 O  O   . ASP A 1 150 ? 11.377 -23.680 19.616  1.00 10.91 ? 145 ASP A O   1 
ATOM   1323 C  CB  A ASP A 1 150 ? 10.007 -22.560 22.346  0.35 12.33 ? 145 ASP A CB  1 
ATOM   1324 C  CB  B ASP A 1 150 ? 10.702 -22.858 22.615  0.35 10.26 ? 145 ASP A CB  1 
ATOM   1325 C  CB  C ASP A 1 150 ? 10.254 -22.673 22.462  0.30 12.19 ? 145 ASP A CB  1 
ATOM   1326 C  CG  A ASP A 1 150 ? 9.469  -23.959 22.003  0.35 15.27 ? 145 ASP A CG  1 
ATOM   1327 C  CG  B ASP A 1 150 ? 11.085 -24.331 22.749  0.35 8.11  ? 145 ASP A CG  1 
ATOM   1328 C  CG  C ASP A 1 150 ? 10.571 -22.356 23.894  0.30 14.51 ? 145 ASP A CG  1 
ATOM   1329 O  OD1 A ASP A 1 150 ? 10.020 -24.945 22.533  0.35 18.73 ? 145 ASP A OD1 1 
ATOM   1330 O  OD1 B ASP A 1 150 ? 12.183 -24.636 23.269  0.35 8.13  ? 145 ASP A OD1 1 
ATOM   1331 O  OD1 C ASP A 1 150 ? 11.615 -21.765 24.157  0.30 19.29 ? 145 ASP A OD1 1 
ATOM   1332 O  OD2 A ASP A 1 150 ? 8.480  -24.092 21.225  0.35 19.39 ? 145 ASP A OD2 1 
ATOM   1333 O  OD2 B ASP A 1 150 ? 10.276 -25.189 22.295  0.35 10.80 ? 145 ASP A OD2 1 
ATOM   1334 O  OD2 C ASP A 1 150 ? 9.743  -22.640 24.771  0.30 19.24 ? 145 ASP A OD2 1 
ATOM   1335 N  N   . SER A 1 151 ? 10.168 -21.787 19.417  1.00 10.30 ? 146 SER A N   1 
ATOM   1336 C  CA  . SER A 1 151 ? 9.765  -22.102 18.033  1.00 9.72  ? 146 SER A CA  1 
ATOM   1337 C  C   . SER A 1 151 ? 10.989 -22.055 17.125  1.00 8.94  ? 146 SER A C   1 
ATOM   1338 O  O   . SER A 1 151 ? 11.118 -22.893 16.230  1.00 10.11 ? 146 SER A O   1 
ATOM   1339 C  CB  . SER A 1 151 ? 8.690  -21.085 17.528  1.00 11.37 ? 146 SER A CB  1 
ATOM   1340 O  OG  . SER A 1 151 ? 7.449  -21.346 18.189  1.00 14.16 ? 146 SER A OG  1 
ATOM   1341 N  N   . ALA A 1 152 ? 11.857 -21.053 17.316  1.00 8.46  ? 147 ALA A N   1 
ATOM   1342 C  CA  . ALA A 1 152 ? 13.098 -20.973 16.530  1.00 8.29  ? 147 ALA A CA  1 
ATOM   1343 C  C   . ALA A 1 152 ? 13.941 -22.217 16.822  1.00 9.35  ? 147 ALA A C   1 
ATOM   1344 O  O   . ALA A 1 152 ? 14.387 -22.884 15.881  1.00 10.14 ? 147 ALA A O   1 
ATOM   1345 C  CB  . ALA A 1 152 ? 13.904 -19.711 16.835  1.00 9.78  ? 147 ALA A CB  1 
ATOM   1346 N  N   . ARG A 1 153 ? 14.158 -22.500 18.110  1.00 10.09 ? 148 ARG A N   1 
ATOM   1347 C  CA  A ARG A 1 153 ? 14.939 -23.654 18.515  0.50 9.44  ? 148 ARG A CA  1 
ATOM   1348 C  CA  B ARG A 1 153 ? 14.949 -23.660 18.509  0.50 9.28  ? 148 ARG A CA  1 
ATOM   1349 C  C   . ARG A 1 153 ? 14.402 -24.938 17.876  1.00 8.71  ? 148 ARG A C   1 
ATOM   1350 O  O   . ARG A 1 153 ? 15.182 -25.782 17.332  1.00 9.38  ? 148 ARG A O   1 
ATOM   1351 C  CB  A ARG A 1 153 ? 14.876 -23.797 20.053  0.50 9.14  ? 148 ARG A CB  1 
ATOM   1352 C  CB  B ARG A 1 153 ? 14.940 -23.824 20.051  0.50 8.99  ? 148 ARG A CB  1 
ATOM   1353 C  CG  A ARG A 1 153 ? 15.803 -24.890 20.534  0.50 10.71 ? 148 ARG A CG  1 
ATOM   1354 C  CG  B ARG A 1 153 ? 15.927 -24.906 20.505  0.50 9.64  ? 148 ARG A CG  1 
ATOM   1355 C  CD  A ARG A 1 153 ? 15.308 -25.461 21.859  0.50 11.76 ? 148 ARG A CD  1 
ATOM   1356 C  CD  B ARG A 1 153 ? 15.753 -25.223 22.013  0.50 8.85  ? 148 ARG A CD  1 
ATOM   1357 N  NE  A ARG A 1 153 ? 13.937 -25.938 21.756  0.50 13.99 ? 148 ARG A NE  1 
ATOM   1358 N  NE  B ARG A 1 153 ? 15.701 -23.993 22.774  0.50 11.92 ? 148 ARG A NE  1 
ATOM   1359 C  CZ  A ARG A 1 153 ? 13.530 -27.061 21.160  0.50 10.87 ? 148 ARG A CZ  1 
ATOM   1360 C  CZ  B ARG A 1 153 ? 16.733 -23.316 23.252  0.50 11.71 ? 148 ARG A CZ  1 
ATOM   1361 N  NH1 A ARG A 1 153 ? 14.378 -27.945 20.618  0.50 8.92  ? 148 ARG A NH1 1 
ATOM   1362 N  NH1 B ARG A 1 153 ? 17.989 -23.770 23.140  0.50 6.73  ? 148 ARG A NH1 1 
ATOM   1363 N  NH2 A ARG A 1 153 ? 12.236 -27.318 21.167  0.50 13.66 ? 148 ARG A NH2 1 
ATOM   1364 N  NH2 B ARG A 1 153 ? 16.449 -22.146 23.863  0.50 11.35 ? 148 ARG A NH2 1 
ATOM   1365 N  N   . SER A 1 154 ? 13.080 -25.111 17.955  1.00 9.51  ? 149 SER A N   1 
ATOM   1366 C  CA  A SER A 1 154 ? 12.482 -26.382 17.492  0.40 8.98  ? 149 SER A CA  1 
ATOM   1367 C  CA  B SER A 1 154 ? 12.461 -26.376 17.481  0.60 10.42 ? 149 SER A CA  1 
ATOM   1368 C  C   . SER A 1 154 ? 12.678 -26.581 15.988  1.00 9.18  ? 149 SER A C   1 
ATOM   1369 O  O   . SER A 1 154 ? 13.020 -27.697 15.540  1.00 10.36 ? 149 SER A O   1 
ATOM   1370 C  CB  A SER A 1 154 ? 10.992 -26.427 17.840  0.40 9.50  ? 149 SER A CB  1 
ATOM   1371 C  CB  B SER A 1 154 ? 10.958 -26.361 17.794  0.60 11.93 ? 149 SER A CB  1 
ATOM   1372 O  OG  A SER A 1 154 ? 10.417 -27.630 17.385  0.40 7.64  ? 149 SER A OG  1 
ATOM   1373 O  OG  B SER A 1 154 ? 10.791 -26.550 19.181  0.60 19.06 ? 149 SER A OG  1 
ATOM   1374 N  N   . ALA A 1 155 ? 12.508 -25.501 15.222  1.00 8.42  ? 150 ALA A N   1 
ATOM   1375 C  CA  . ALA A 1 155 ? 12.682 -25.560 13.768  1.00 8.04  ? 150 ALA A CA  1 
ATOM   1376 C  C   . ALA A 1 155 ? 14.152 -25.884 13.462  1.00 8.09  ? 150 ALA A C   1 
ATOM   1377 O  O   . ALA A 1 155 ? 14.435 -26.752 12.629  1.00 8.12  ? 150 ALA A O   1 
ATOM   1378 C  CB  . ALA A 1 155 ? 12.270 -24.255 13.128  1.00 8.85  ? 150 ALA A CB  1 
ATOM   1379 N  N   . TYR A 1 156 ? 15.081 -25.144 14.100  1.00 7.26  ? 151 TYR A N   1 
ATOM   1380 C  CA  . TYR A 1 156 ? 16.492 -25.379 13.801  1.00 7.83  ? 151 TYR A CA  1 
ATOM   1381 C  C   . TYR A 1 156 ? 16.895 -26.789 14.179  1.00 8.16  ? 151 TYR A C   1 
ATOM   1382 O  O   . TYR A 1 156 ? 17.664 -27.418 13.481  1.00 8.16  ? 151 TYR A O   1 
ATOM   1383 C  CB  . TYR A 1 156 ? 17.362 -24.436 14.641  1.00 7.76  ? 151 TYR A CB  1 
ATOM   1384 C  CG  . TYR A 1 156 ? 17.477 -23.026 14.096  1.00 6.48  ? 151 TYR A CG  1 
ATOM   1385 C  CD1 . TYR A 1 156 ? 17.718 -22.802 12.723  1.00 8.23  ? 151 TYR A CD1 1 
ATOM   1386 C  CD2 . TYR A 1 156 ? 17.371 -21.915 14.974  1.00 7.33  ? 151 TYR A CD2 1 
ATOM   1387 C  CE1 . TYR A 1 156 ? 17.902 -21.468 12.194  1.00 7.52  ? 151 TYR A CE1 1 
ATOM   1388 C  CE2 . TYR A 1 156 ? 17.590 -20.587 14.496  1.00 6.93  ? 151 TYR A CE2 1 
ATOM   1389 C  CZ  . TYR A 1 156 ? 17.875 -20.377 13.122  1.00 7.62  ? 151 TYR A CZ  1 
ATOM   1390 O  OH  . TYR A 1 156 ? 18.036 -19.112 12.651  1.00 8.28  ? 151 TYR A OH  1 
ATOM   1391 N  N   . GLN A 1 157 ? 16.335 -27.268 15.301  1.00 7.76  ? 152 GLN A N   1 
ATOM   1392 C  CA  . GLN A 1 157 ? 16.698 -28.600 15.823  1.00 8.60  ? 152 GLN A CA  1 
ATOM   1393 C  C   . GLN A 1 157 ? 16.219 -29.659 14.824  1.00 9.00  ? 152 GLN A C   1 
ATOM   1394 O  O   . GLN A 1 157 ? 16.979 -30.564 14.520  1.00 10.45 ? 152 GLN A O   1 
ATOM   1395 C  CB  . GLN A 1 157 ? 16.072 -28.867 17.221  1.00 9.93  ? 152 GLN A CB  1 
ATOM   1396 C  CG  . GLN A 1 157 ? 16.648 -30.210 17.752  1.00 13.16 ? 152 GLN A CG  1 
ATOM   1397 C  CD  . GLN A 1 157 ? 18.176 -30.103 17.897  1.00 13.96 ? 152 GLN A CD  1 
ATOM   1398 O  OE1 . GLN A 1 157 ? 18.695 -29.238 18.620  1.00 15.88 ? 152 GLN A OE1 1 
ATOM   1399 N  NE2 . GLN A 1 157 ? 18.896 -31.062 17.283  1.00 19.26 ? 152 GLN A NE2 1 
ATOM   1400 N  N   . GLU A 1 158 ? 14.993 -29.527 14.294  1.00 9.89  ? 153 GLU A N   1 
ATOM   1401 C  CA  A GLU A 1 158 ? 14.523 -30.540 13.314  0.60 9.98  ? 153 GLU A CA  1 
ATOM   1402 C  CA  B GLU A 1 158 ? 14.466 -30.473 13.271  0.40 10.76 ? 153 GLU A CA  1 
ATOM   1403 C  C   . GLU A 1 158 ? 15.372 -30.482 12.055  1.00 9.85  ? 153 GLU A C   1 
ATOM   1404 O  O   . GLU A 1 158 ? 15.738 -31.532 11.528  1.00 11.30 ? 153 GLU A O   1 
ATOM   1405 C  CB  A GLU A 1 158 ? 13.076 -30.346 12.969  0.60 10.04 ? 153 GLU A CB  1 
ATOM   1406 C  CB  B GLU A 1 158 ? 13.083 -30.029 12.837  0.40 11.33 ? 153 GLU A CB  1 
ATOM   1407 C  CG  A GLU A 1 158 ? 12.613 -31.375 11.977  0.60 9.42  ? 153 GLU A CG  1 
ATOM   1408 C  CG  B GLU A 1 158 ? 12.028 -30.221 13.910  0.40 15.81 ? 153 GLU A CG  1 
ATOM   1409 C  CD  A GLU A 1 158 ? 11.156 -31.349 11.632  0.60 12.77 ? 153 GLU A CD  1 
ATOM   1410 C  CD  B GLU A 1 158 ? 10.716 -29.501 13.624  0.40 19.97 ? 153 GLU A CD  1 
ATOM   1411 O  OE1 A GLU A 1 158 ? 10.427 -30.466 12.081  0.60 14.94 ? 153 GLU A OE1 1 
ATOM   1412 O  OE1 B GLU A 1 158 ? 9.843  -30.133 13.018  0.40 20.85 ? 153 GLU A OE1 1 
ATOM   1413 O  OE2 A GLU A 1 158 ? 10.737 -32.271 10.877  0.60 19.21 ? 153 GLU A OE2 1 
ATOM   1414 O  OE2 B GLU A 1 158 ? 10.546 -28.331 14.018  0.40 23.22 ? 153 GLU A OE2 1 
ATOM   1415 N  N   . ALA A 1 159 ? 15.744 -29.271 11.620  1.00 9.68  ? 154 ALA A N   1 
ATOM   1416 C  CA  . ALA A 1 159 ? 16.598 -29.128 10.444  1.00 8.79  ? 154 ALA A CA  1 
ATOM   1417 C  C   . ALA A 1 159 ? 17.946 -29.767 10.726  1.00 9.13  ? 154 ALA A C   1 
ATOM   1418 O  O   . ALA A 1 159 ? 18.493 -30.423 9.828   1.00 10.38 ? 154 ALA A O   1 
ATOM   1419 C  CB  . ALA A 1 159 ? 16.790 -27.653 10.111  1.00 7.88  ? 154 ALA A CB  1 
ATOM   1420 N  N   . MET A 1 160 ? 18.526 -29.551 11.943  1.00 8.07  ? 155 MET A N   1 
ATOM   1421 C  CA  . MET A 1 160 ? 19.829 -30.141 12.299  1.00 8.24  ? 155 MET A CA  1 
ATOM   1422 C  C   . MET A 1 160 ? 19.727 -31.669 12.258  1.00 8.97  ? 155 MET A C   1 
ATOM   1423 O  O   . MET A 1 160 ? 20.625 -32.334 11.727  1.00 10.14 ? 155 MET A O   1 
ATOM   1424 C  CB  . MET A 1 160 ? 20.266 -29.708 13.723  1.00 9.56  ? 155 MET A CB  1 
ATOM   1425 C  CG  . MET A 1 160 ? 20.678 -28.264 13.839  1.00 13.89 ? 155 MET A CG  1 
ATOM   1426 S  SD  . MET A 1 160 ? 22.286 -27.910 12.996  1.00 16.67 ? 155 MET A SD  1 
ATOM   1427 C  CE  . MET A 1 160 ? 23.181 -29.266 13.612  1.00 18.52 ? 155 MET A CE  1 
ATOM   1428 N  N   . ASP A 1 161 ? 18.645 -32.220 12.789  1.00 9.48  ? 156 ASP A N   1 
ATOM   1429 C  CA  . ASP A 1 161 ? 18.541 -33.684 12.903  1.00 10.39 ? 156 ASP A CA  1 
ATOM   1430 C  C   . ASP A 1 161 ? 18.491 -34.272 11.496  1.00 10.59 ? 156 ASP A C   1 
ATOM   1431 O  O   . ASP A 1 161 ? 19.190 -35.259 11.206  1.00 12.51 ? 156 ASP A O   1 
ATOM   1432 C  CB  . ASP A 1 161 ? 17.282 -34.054 13.663  1.00 11.33 ? 156 ASP A CB  1 
ATOM   1433 C  CG  . ASP A 1 161 ? 17.345 -33.712 15.130  1.00 13.04 ? 156 ASP A CG  1 
ATOM   1434 O  OD1 . ASP A 1 161 ? 18.433 -33.451 15.684  1.00 16.63 ? 156 ASP A OD1 1 
ATOM   1435 O  OD2 . ASP A 1 161 ? 16.253 -33.732 15.763  1.00 20.73 ? 156 ASP A OD2 1 
ATOM   1436 N  N   . ILE A 1 162 ? 17.721 -33.644 10.591  1.00 11.37 ? 157 ILE A N   1 
ATOM   1437 C  CA  . ILE A 1 162 ? 17.625 -34.166 9.209   1.00 9.99  ? 157 ILE A CA  1 
ATOM   1438 C  C   . ILE A 1 162 ? 18.979 -33.992 8.504   1.00 9.77  ? 157 ILE A C   1 
ATOM   1439 O  O   . ILE A 1 162 ? 19.447 -34.913 7.818   1.00 11.47 ? 157 ILE A O   1 
ATOM   1440 C  CB  . ILE A 1 162 ? 16.518 -33.459 8.421   1.00 11.57 ? 157 ILE A CB  1 
ATOM   1441 C  CG1 . ILE A 1 162 ? 15.193 -33.732 9.119   1.00 12.24 ? 157 ILE A CG1 1 
ATOM   1442 C  CG2 . ILE A 1 162 ? 16.512 -33.970 6.941   1.00 10.26 ? 157 ILE A CG2 1 
ATOM   1443 C  CD1 . ILE A 1 162 ? 14.112 -32.811 8.625   1.00 13.98 ? 157 ILE A CD1 1 
ATOM   1444 N  N   . SER A 1 163 ? 19.612 -32.827 8.683   1.00 10.09 ? 158 SER A N   1 
ATOM   1445 C  CA  . SER A 1 163 ? 20.836 -32.529 7.926   1.00 10.95 ? 158 SER A CA  1 
ATOM   1446 C  C   . SER A 1 163 ? 21.929 -33.501 8.355   1.00 11.51 ? 158 SER A C   1 
ATOM   1447 O  O   . SER A 1 163 ? 22.709 -33.949 7.511   1.00 12.36 ? 158 SER A O   1 
ATOM   1448 C  CB  . SER A 1 163 ? 21.257 -31.058 8.064   1.00 13.28 ? 158 SER A CB  1 
ATOM   1449 O  OG  . SER A 1 163 ? 21.703 -30.766 9.367   1.00 16.83 ? 158 SER A OG  1 
ATOM   1450 N  N   . LYS A 1 164 ? 22.022 -33.823 9.645   1.00 11.98 ? 159 LYS A N   1 
ATOM   1451 C  CA  A LYS A 1 164 ? 23.074 -34.736 10.093  0.50 12.37 ? 159 LYS A CA  1 
ATOM   1452 C  CA  B LYS A 1 164 ? 23.048 -34.742 10.151  0.50 13.36 ? 159 LYS A CA  1 
ATOM   1453 C  C   . LYS A 1 164 ? 22.868 -36.127 9.557   1.00 13.62 ? 159 LYS A C   1 
ATOM   1454 O  O   . LYS A 1 164 ? 23.819 -36.832 9.328   1.00 16.92 ? 159 LYS A O   1 
ATOM   1455 C  CB  A LYS A 1 164 ? 23.142 -34.802 11.630  0.50 12.48 ? 159 LYS A CB  1 
ATOM   1456 C  CB  B LYS A 1 164 ? 22.927 -34.863 11.695  0.50 13.89 ? 159 LYS A CB  1 
ATOM   1457 C  CG  A LYS A 1 164 ? 23.753 -33.534 12.204  0.50 13.70 ? 159 LYS A CG  1 
ATOM   1458 C  CG  B LYS A 1 164 ? 23.883 -35.839 12.357  0.50 19.00 ? 159 LYS A CG  1 
ATOM   1459 C  CD  A LYS A 1 164 ? 24.158 -33.734 13.669  0.50 17.84 ? 159 LYS A CD  1 
ATOM   1460 C  CD  B LYS A 1 164 ? 25.134 -35.170 12.940  0.50 22.50 ? 159 LYS A CD  1 
ATOM   1461 C  CE  A LYS A 1 164 ? 24.017 -32.474 14.394  0.50 19.43 ? 159 LYS A CE  1 
ATOM   1462 C  CE  B LYS A 1 164 ? 26.031 -36.196 13.618  0.50 25.39 ? 159 LYS A CE  1 
ATOM   1463 N  NZ  A LYS A 1 164 ? 22.611 -32.327 14.689  0.50 19.56 ? 159 LYS A NZ  1 
ATOM   1464 N  NZ  B LYS A 1 164 ? 27.178 -36.560 12.780  0.50 27.98 ? 159 LYS A NZ  1 
ATOM   1465 N  N   . LYS A 1 165 ? 21.623 -36.514 9.374   1.00 13.66 ? 160 LYS A N   1 
ATOM   1466 C  CA  A LYS A 1 165 ? 21.351 -37.843 8.857   0.50 13.93 ? 160 LYS A CA  1 
ATOM   1467 C  CA  B LYS A 1 165 ? 21.299 -37.842 8.876   0.50 14.10 ? 160 LYS A CA  1 
ATOM   1468 C  C   . LYS A 1 165 ? 21.476 -37.958 7.352   1.00 13.44 ? 160 LYS A C   1 
ATOM   1469 O  O   . LYS A 1 165 ? 21.884 -39.002 6.846   1.00 14.86 ? 160 LYS A O   1 
ATOM   1470 C  CB  A LYS A 1 165 ? 19.966 -38.322 9.279   0.50 13.92 ? 160 LYS A CB  1 
ATOM   1471 C  CB  B LYS A 1 165 ? 19.853 -38.185 9.287   0.50 14.16 ? 160 LYS A CB  1 
ATOM   1472 C  CG  A LYS A 1 165 ? 19.914 -38.704 10.714  0.50 14.60 ? 160 LYS A CG  1 
ATOM   1473 C  CG  B LYS A 1 165 ? 19.365 -39.597 8.990   0.50 15.53 ? 160 LYS A CG  1 
ATOM   1474 N  N   . GLU A 1 166 ? 21.119 -36.891 6.639   1.00 13.14 ? 161 GLU A N   1 
ATOM   1475 C  CA  . GLU A 1 166 ? 20.876 -37.012 5.198   1.00 13.41 ? 161 GLU A CA  1 
ATOM   1476 C  C   . GLU A 1 166 ? 21.832 -36.192 4.357   1.00 12.82 ? 161 GLU A C   1 
ATOM   1477 O  O   . GLU A 1 166 ? 21.785 -36.306 3.136   1.00 17.57 ? 161 GLU A O   1 
ATOM   1478 C  CB  . GLU A 1 166 ? 19.439 -36.519 4.914   1.00 13.54 ? 161 GLU A CB  1 
ATOM   1479 C  CG  . GLU A 1 166 ? 18.359 -37.429 5.574   1.00 20.72 ? 161 GLU A CG  1 
ATOM   1480 C  CD  . GLU A 1 166 ? 18.341 -38.866 5.101   1.00 30.77 ? 161 GLU A CD  1 
ATOM   1481 O  OE1 . GLU A 1 166 ? 18.904 -39.236 4.026   1.00 32.01 ? 161 GLU A OE1 1 
ATOM   1482 O  OE2 . GLU A 1 166 ? 17.709 -39.658 5.848   1.00 38.44 ? 161 GLU A OE2 1 
ATOM   1483 N  N   . MET A 1 167 ? 22.644 -35.316 4.928   1.00 11.81 ? 162 MET A N   1 
ATOM   1484 C  CA  A MET A 1 167 ? 23.538 -34.449 4.117   0.60 11.25 ? 162 MET A CA  1 
ATOM   1485 C  CA  B MET A 1 167 ? 23.516 -34.500 4.086   0.40 11.17 ? 162 MET A CA  1 
ATOM   1486 C  C   . MET A 1 167 ? 24.964 -34.608 4.556   1.00 10.72 ? 162 MET A C   1 
ATOM   1487 O  O   . MET A 1 167 ? 25.218 -34.892 5.735   1.00 11.44 ? 162 MET A O   1 
ATOM   1488 C  CB  A MET A 1 167 ? 23.218 -32.951 4.353   0.60 10.75 ? 162 MET A CB  1 
ATOM   1489 C  CB  B MET A 1 167 ? 23.001 -33.039 4.078   0.40 11.11 ? 162 MET A CB  1 
ATOM   1490 C  CG  A MET A 1 167 ? 21.860 -32.504 3.819   0.60 11.83 ? 162 MET A CG  1 
ATOM   1491 C  CG  B MET A 1 167 ? 21.579 -32.942 3.440   0.40 10.64 ? 162 MET A CG  1 
ATOM   1492 S  SD  A MET A 1 167 ? 21.674 -30.756 4.249   0.60 11.72 ? 162 MET A SD  1 
ATOM   1493 S  SD  B MET A 1 167 ? 20.513 -31.567 3.983   0.40 13.41 ? 162 MET A SD  1 
ATOM   1494 C  CE  A MET A 1 167 ? 20.389 -30.268 3.140   0.60 14.25 ? 162 MET A CE  1 
ATOM   1495 C  CE  B MET A 1 167 ? 21.511 -30.201 3.405   0.40 11.67 ? 162 MET A CE  1 
ATOM   1496 N  N   . PRO A 1 168 ? 25.918 -34.401 3.617   1.00 11.50 ? 163 PRO A N   1 
ATOM   1497 C  CA  . PRO A 1 168 ? 27.350 -34.454 3.985   1.00 11.03 ? 163 PRO A CA  1 
ATOM   1498 C  C   . PRO A 1 168 ? 27.677 -33.235 4.841   1.00 11.24 ? 163 PRO A C   1 
ATOM   1499 O  O   . PRO A 1 168 ? 26.972 -32.213 4.760   1.00 11.20 ? 163 PRO A O   1 
ATOM   1500 C  CB  . PRO A 1 168 ? 28.101 -34.338 2.630   1.00 13.27 ? 163 PRO A CB  1 
ATOM   1501 C  CG  . PRO A 1 168 ? 27.076 -33.718 1.681   1.00 13.88 ? 163 PRO A CG  1 
ATOM   1502 C  CD  . PRO A 1 168 ? 25.688 -34.162 2.177   1.00 12.14 ? 163 PRO A CD  1 
ATOM   1503 N  N   . PRO A 1 169 ? 28.711 -33.358 5.677   1.00 11.07 ? 164 PRO A N   1 
ATOM   1504 C  CA  . PRO A 1 169 ? 29.036 -32.289 6.579   1.00 12.62 ? 164 PRO A CA  1 
ATOM   1505 C  C   . PRO A 1 169 ? 29.482 -30.997 5.872   1.00 12.47 ? 164 PRO A C   1 
ATOM   1506 O  O   . PRO A 1 169 ? 29.556 -29.943 6.513   1.00 12.62 ? 164 PRO A O   1 
ATOM   1507 C  CB  . PRO A 1 169 ? 30.241 -32.827 7.363   1.00 14.34 ? 164 PRO A CB  1 
ATOM   1508 C  CG  . PRO A 1 169 ? 30.583 -34.111 6.824   1.00 14.53 ? 164 PRO A CG  1 
ATOM   1509 C  CD  . PRO A 1 169 ? 29.604 -34.535 5.811   1.00 13.93 ? 164 PRO A CD  1 
ATOM   1510 N  N   . THR A 1 170 ? 29.800 -31.115 4.575   1.00 11.51 ? 165 THR A N   1 
ATOM   1511 C  CA  A THR A 1 170 ? 30.221 -29.948 3.776   0.70 10.33 ? 165 THR A CA  1 
ATOM   1512 C  CA  B THR A 1 170 ? 30.226 -30.005 3.773   0.30 11.38 ? 165 THR A CA  1 
ATOM   1513 C  C   . THR A 1 170 ? 29.061 -29.299 3.044   1.00 10.27 ? 165 THR A C   1 
ATOM   1514 O  O   . THR A 1 170 ? 29.256 -28.262 2.346   1.00 11.33 ? 165 THR A O   1 
ATOM   1515 C  CB  A THR A 1 170 ? 31.267 -30.323 2.692   0.70 8.48  ? 165 THR A CB  1 
ATOM   1516 C  CB  B THR A 1 170 ? 31.248 -30.530 2.768   0.30 11.30 ? 165 THR A CB  1 
ATOM   1517 O  OG1 A THR A 1 170 ? 30.827 -31.564 2.128   0.70 8.36  ? 165 THR A OG1 1 
ATOM   1518 O  OG1 B THR A 1 170 ? 32.202 -31.352 3.470   0.30 12.69 ? 165 THR A OG1 1 
ATOM   1519 C  CG2 A THR A 1 170 ? 32.668 -30.526 3.399   0.70 9.69  ? 165 THR A CG2 1 
ATOM   1520 C  CG2 B THR A 1 170 ? 31.947 -29.439 2.213   0.30 12.22 ? 165 THR A CG2 1 
ATOM   1521 N  N   . HIS A 1 171 ? 27.856 -29.891 3.119   1.00 9.54  ? 166 HIS A N   1 
ATOM   1522 C  CA  . HIS A 1 171 ? 26.780 -29.332 2.312   1.00 7.99  ? 166 HIS A CA  1 
ATOM   1523 C  C   . HIS A 1 171 ? 26.507 -27.865 2.729   1.00 7.79  ? 166 HIS A C   1 
ATOM   1524 O  O   . HIS A 1 171 ? 26.408 -27.591 3.934   1.00 8.37  ? 166 HIS A O   1 
ATOM   1525 C  CB  . HIS A 1 171 ? 25.476 -30.116 2.530   1.00 9.02  ? 166 HIS A CB  1 
ATOM   1526 C  CG  . HIS A 1 171 ? 24.485 -29.858 1.471   1.00 9.94  ? 166 HIS A CG  1 
ATOM   1527 N  ND1 . HIS A 1 171 ? 23.837 -28.642 1.305   1.00 10.74 ? 166 HIS A ND1 1 
ATOM   1528 C  CD2 . HIS A 1 171 ? 24.051 -30.669 0.459   1.00 14.51 ? 166 HIS A CD2 1 
ATOM   1529 C  CE1 . HIS A 1 171 ? 23.067 -28.724 0.215   1.00 13.41 ? 166 HIS A CE1 1 
ATOM   1530 N  NE2 . HIS A 1 171 ? 23.135 -29.950 -0.280  1.00 15.11 ? 166 HIS A NE2 1 
ATOM   1531 N  N   . PRO A 1 172 ? 26.475 -26.917 1.770   1.00 8.83  ? 167 PRO A N   1 
ATOM   1532 C  CA  . PRO A 1 172 ? 26.256 -25.530 2.163   1.00 8.17  ? 167 PRO A CA  1 
ATOM   1533 C  C   . PRO A 1 172 ? 25.035 -25.310 3.041   1.00 8.62  ? 167 PRO A C   1 
ATOM   1534 O  O   . PRO A 1 172 ? 25.079 -24.461 3.899   1.00 9.11  ? 167 PRO A O   1 
ATOM   1535 C  CB  . PRO A 1 172 ? 26.138 -24.806 0.831   1.00 9.93  ? 167 PRO A CB  1 
ATOM   1536 C  CG  . PRO A 1 172 ? 27.167 -25.576 -0.061  1.00 14.44 ? 167 PRO A CG  1 
ATOM   1537 C  CD  . PRO A 1 172 ? 26.763 -27.023 0.326   1.00 10.36 ? 167 PRO A CD  1 
ATOM   1538 N  N   . ILE A 1 173 ? 23.949 -26.051 2.827   1.00 7.72  ? 168 ILE A N   1 
ATOM   1539 C  CA  . ILE A 1 173 ? 22.751 -25.770 3.610   1.00 7.68  ? 168 ILE A CA  1 
ATOM   1540 C  C   . ILE A 1 173 ? 23.038 -26.261 5.028   1.00 7.49  ? 168 ILE A C   1 
ATOM   1541 O  O   . ILE A 1 173 ? 22.653 -25.637 6.036   1.00 8.04  ? 168 ILE A O   1 
ATOM   1542 C  CB  . ILE A 1 173 ? 21.554 -26.551 3.018   1.00 7.08  ? 168 ILE A CB  1 
ATOM   1543 C  CG1 . ILE A 1 173 ? 21.158 -25.938 1.650   1.00 8.10  ? 168 ILE A CG1 1 
ATOM   1544 C  CG2 . ILE A 1 173 ? 20.357 -26.455 4.011   1.00 7.56  ? 168 ILE A CG2 1 
ATOM   1545 C  CD1 . ILE A 1 173 ? 20.103 -26.762 0.908   1.00 10.80 ? 168 ILE A CD1 1 
ATOM   1546 N  N   . ARG A 1 174 ? 23.643 -27.429 5.167   1.00 7.61  ? 169 ARG A N   1 
ATOM   1547 C  CA  A ARG A 1 174 ? 23.992 -27.873 6.522   0.50 7.69  ? 169 ARG A CA  1 
ATOM   1548 C  CA  B ARG A 1 174 ? 24.075 -27.896 6.486   0.50 8.38  ? 169 ARG A CA  1 
ATOM   1549 C  C   . ARG A 1 174 ? 24.941 -26.883 7.235   1.00 7.95  ? 169 ARG A C   1 
ATOM   1550 O  O   . ARG A 1 174 ? 24.743 -26.590 8.435   1.00 7.53  ? 169 ARG A O   1 
ATOM   1551 C  CB  A ARG A 1 174 ? 24.537 -29.336 6.479   0.50 6.50  ? 169 ARG A CB  1 
ATOM   1552 C  CB  B ARG A 1 174 ? 24.894 -29.185 6.290   0.50 7.73  ? 169 ARG A CB  1 
ATOM   1553 C  CG  A ARG A 1 174 ? 25.088 -29.868 7.796   0.50 7.39  ? 169 ARG A CG  1 
ATOM   1554 C  CG  B ARG A 1 174 ? 25.534 -29.590 7.527   0.50 11.54 ? 169 ARG A CG  1 
ATOM   1555 C  CD  A ARG A 1 174 ? 25.327 -31.390 7.679   0.50 6.53  ? 169 ARG A CD  1 
ATOM   1556 C  CD  B ARG A 1 174 ? 24.411 -29.889 8.304   0.50 15.12 ? 169 ARG A CD  1 
ATOM   1557 N  NE  A ARG A 1 174 ? 26.022 -31.779 8.895   0.50 5.00  ? 169 ARG A NE  1 
ATOM   1558 N  NE  B ARG A 1 174 ? 24.881 -30.469 9.477   0.50 17.98 ? 169 ARG A NE  1 
ATOM   1559 C  CZ  A ARG A 1 174 ? 26.531 -33.000 9.112   0.50 6.44  ? 169 ARG A CZ  1 
ATOM   1560 C  CZ  B ARG A 1 174 ? 24.702 -29.897 10.605  0.50 17.55 ? 169 ARG A CZ  1 
ATOM   1561 N  NH1 A ARG A 1 174 ? 26.425 -33.913 8.173   0.50 6.60  ? 169 ARG A NH1 1 
ATOM   1562 N  NH1 B ARG A 1 174 ? 23.969 -28.685 10.633  0.50 15.42 ? 169 ARG A NH1 1 
ATOM   1563 N  NH2 A ARG A 1 174 ? 27.181 -33.247 10.241  0.50 6.08  ? 169 ARG A NH2 1 
ATOM   1564 N  NH2 B ARG A 1 174 ? 25.195 -30.541 11.626  0.50 16.07 ? 169 ARG A NH2 1 
ATOM   1565 N  N   . LEU A 1 175 ? 25.949 -26.385 6.526   1.00 7.58  ? 170 LEU A N   1 
ATOM   1566 C  CA  . LEU A 1 175 ? 26.874 -25.436 7.096   1.00 8.54  ? 170 LEU A CA  1 
ATOM   1567 C  C   . LEU A 1 175 ? 26.133 -24.125 7.479   1.00 7.36  ? 170 LEU A C   1 
ATOM   1568 O  O   . LEU A 1 175 ? 26.369 -23.579 8.542   1.00 8.47  ? 170 LEU A O   1 
ATOM   1569 C  CB  . LEU A 1 175 ? 27.993 -25.077 6.121   1.00 8.08  ? 170 LEU A CB  1 
ATOM   1570 C  CG  . LEU A 1 175 ? 28.935 -26.237 5.844   1.00 7.39  ? 170 LEU A CG  1 
ATOM   1571 C  CD1 . LEU A 1 175 ? 29.889 -25.801 4.712   1.00 9.66  ? 170 LEU A CD1 1 
ATOM   1572 C  CD2 . LEU A 1 175 ? 29.747 -26.499 7.160   1.00 10.75 ? 170 LEU A CD2 1 
ATOM   1573 N  N   . GLY A 1 176 ? 25.257 -23.637 6.600   1.00 7.12  ? 171 GLY A N   1 
ATOM   1574 C  CA  . GLY A 1 176 ? 24.552 -22.383 6.873   1.00 6.66  ? 171 GLY A CA  1 
ATOM   1575 C  C   . GLY A 1 176 ? 23.575 -22.520 8.042   1.00 6.27  ? 171 GLY A C   1 
ATOM   1576 O  O   . GLY A 1 176 ? 23.408 -21.587 8.870   1.00 7.98  ? 171 GLY A O   1 
ATOM   1577 N  N   . LEU A 1 177 ? 22.909 -23.659 8.106   1.00 6.58  ? 172 LEU A N   1 
ATOM   1578 C  CA  . LEU A 1 177 ? 22.034 -23.944 9.219   1.00 6.52  ? 172 LEU A CA  1 
ATOM   1579 C  C   . LEU A 1 177 ? 22.819 -23.916 10.525  1.00 6.22  ? 172 LEU A C   1 
ATOM   1580 O  O   . LEU A 1 177 ? 22.373 -23.341 11.537  1.00 6.40  ? 172 LEU A O   1 
ATOM   1581 C  CB  . LEU A 1 177 ? 21.416 -25.331 9.022   1.00 5.30  ? 172 LEU A CB  1 
ATOM   1582 C  CG  . LEU A 1 177 ? 20.734 -25.930 10.225  1.00 5.14  ? 172 LEU A CG  1 
ATOM   1583 C  CD1 . LEU A 1 177 ? 19.524 -25.132 10.687  1.00 7.54  ? 172 LEU A CD1 1 
ATOM   1584 C  CD2 . LEU A 1 177 ? 20.258 -27.380 9.855   1.00 9.00  ? 172 LEU A CD2 1 
ATOM   1585 N  N   . ALA A 1 178 ? 23.964 -24.593 10.534  1.00 6.79  ? 173 ALA A N   1 
ATOM   1586 C  CA  . ALA A 1 178 ? 24.736 -24.616 11.751  1.00 7.20  ? 173 ALA A CA  1 
ATOM   1587 C  C   . ALA A 1 178 ? 25.246 -23.256 12.135  1.00 7.86  ? 173 ALA A C   1 
ATOM   1588 O  O   . ALA A 1 178 ? 25.247 -22.900 13.331  1.00 7.49  ? 173 ALA A O   1 
ATOM   1589 C  CB  . ALA A 1 178 ? 25.879 -25.607 11.573  1.00 8.95  ? 173 ALA A CB  1 
ATOM   1590 N  N   . LEU A 1 179 ? 25.711 -22.493 11.137  1.00 6.61  ? 174 LEU A N   1 
ATOM   1591 C  CA  . LEU A 1 179 ? 26.124 -21.102 11.395  1.00 7.13  ? 174 LEU A CA  1 
ATOM   1592 C  C   . LEU A 1 179 ? 25.005 -20.323 12.136  1.00 8.26  ? 174 LEU A C   1 
ATOM   1593 O  O   . LEU A 1 179 ? 25.257 -19.683 13.188  1.00 7.64  ? 174 LEU A O   1 
ATOM   1594 C  CB  . LEU A 1 179 ? 26.466 -20.402 10.073  1.00 6.44  ? 174 LEU A CB  1 
ATOM   1595 C  CG  . LEU A 1 179 ? 26.939 -18.923 10.240  1.00 7.07  ? 174 LEU A CG  1 
ATOM   1596 C  CD1 . LEU A 1 179 ? 28.395 -18.810 10.733  1.00 9.70  ? 174 LEU A CD1 1 
ATOM   1597 C  CD2 . LEU A 1 179 ? 26.863 -18.281 8.886   1.00 11.87 ? 174 LEU A CD2 1 
ATOM   1598 N  N   . ASN A 1 180 ? 23.776 -20.419 11.631  1.00 6.57  ? 175 ASN A N   1 
ATOM   1599 C  CA  . ASN A 1 180 ? 22.686 -19.588 12.164  1.00 6.47  ? 175 ASN A CA  1 
ATOM   1600 C  C   . ASN A 1 180 ? 22.192 -20.149 13.479  1.00 7.31  ? 175 ASN A C   1 
ATOM   1601 O  O   . ASN A 1 180 ? 21.828 -19.375 14.363  1.00 8.38  ? 175 ASN A O   1 
ATOM   1602 C  CB  . ASN A 1 180 ? 21.527 -19.512 11.168  1.00 6.77  ? 175 ASN A CB  1 
ATOM   1603 C  CG  . ASN A 1 180 ? 21.859 -18.570 10.000  1.00 5.89  ? 175 ASN A CG  1 
ATOM   1604 O  OD1 . ASN A 1 180 ? 23.048 -18.208 9.778   1.00 8.48  ? 175 ASN A OD1 1 
ATOM   1605 N  ND2 . ASN A 1 180 ? 20.841 -18.163 9.250   1.00 7.03  ? 175 ASN A ND2 1 
ATOM   1606 N  N   . PHE A 1 181 ? 22.137 -21.493 13.623  1.00 7.90  ? 176 PHE A N   1 
ATOM   1607 C  CA  . PHE A 1 181 ? 21.707 -22.049 14.901  1.00 7.91  ? 176 PHE A CA  1 
ATOM   1608 C  C   . PHE A 1 181 ? 22.724 -21.663 15.973  1.00 6.49  ? 176 PHE A C   1 
ATOM   1609 O  O   . PHE A 1 181 ? 22.370 -21.409 17.131  1.00 7.61  ? 176 PHE A O   1 
ATOM   1610 C  CB  . PHE A 1 181 ? 21.536 -23.575 14.739  1.00 7.64  ? 176 PHE A CB  1 
ATOM   1611 C  CG  . PHE A 1 181 ? 20.794 -24.257 15.852  1.00 6.85  ? 176 PHE A CG  1 
ATOM   1612 C  CD1 . PHE A 1 181 ? 19.965 -23.581 16.744  1.00 8.49  ? 176 PHE A CD1 1 
ATOM   1613 C  CD2 . PHE A 1 181 ? 20.970 -25.635 16.028  1.00 8.30  ? 176 PHE A CD2 1 
ATOM   1614 C  CE1 . PHE A 1 181 ? 19.258 -24.268 17.748  1.00 8.05  ? 176 PHE A CE1 1 
ATOM   1615 C  CE2 . PHE A 1 181 ? 20.274 -26.337 17.039  1.00 10.99 ? 176 PHE A CE2 1 
ATOM   1616 C  CZ  . PHE A 1 181 ? 19.429 -25.655 17.884  1.00 9.33  ? 176 PHE A CZ  1 
ATOM   1617 N  N   . SER A 1 182 ? 23.994 -21.615 15.585  1.00 7.26  ? 177 SER A N   1 
ATOM   1618 C  CA  . SER A 1 182 ? 25.043 -21.208 16.519  1.00 7.35  ? 177 SER A CA  1 
ATOM   1619 C  C   . SER A 1 182 ? 24.810 -19.725 16.929  1.00 7.88  ? 177 SER A C   1 
ATOM   1620 O  O   . SER A 1 182 ? 24.921 -19.370 18.126  1.00 9.20  ? 177 SER A O   1 
ATOM   1621 C  CB  . SER A 1 182 ? 26.391 -21.503 15.902  1.00 8.62  ? 177 SER A CB  1 
ATOM   1622 O  OG  . SER A 1 182 ? 27.416 -20.761 16.534  1.00 9.54  ? 177 SER A OG  1 
ATOM   1623 N  N   . VAL A 1 183 ? 24.504 -18.876 15.968  1.00 7.43  ? 178 VAL A N   1 
ATOM   1624 C  CA  . VAL A 1 183 ? 24.195 -17.460 16.302  1.00 7.95  ? 178 VAL A CA  1 
ATOM   1625 C  C   . VAL A 1 183 ? 22.973 -17.406 17.236  1.00 7.86  ? 178 VAL A C   1 
ATOM   1626 O  O   . VAL A 1 183 ? 22.969 -16.647 18.196  1.00 9.88  ? 178 VAL A O   1 
ATOM   1627 C  CB  . VAL A 1 183 ? 23.946 -16.612 15.027  1.00 7.39  ? 178 VAL A CB  1 
ATOM   1628 C  CG1 . VAL A 1 183 ? 23.309 -15.190 15.350  1.00 8.53  ? 178 VAL A CG1 1 
ATOM   1629 C  CG2 . VAL A 1 183 ? 25.295 -16.388 14.343  1.00 9.00  ? 178 VAL A CG2 1 
ATOM   1630 N  N   . PHE A 1 184 ? 21.938 -18.204 16.970  1.00 8.14  ? 179 PHE A N   1 
ATOM   1631 C  CA  . PHE A 1 184 ? 20.756 -18.299 17.847  1.00 7.76  ? 179 PHE A CA  1 
ATOM   1632 C  C   . PHE A 1 184 ? 21.208 -18.651 19.274  1.00 8.34  ? 179 PHE A C   1 
ATOM   1633 O  O   . PHE A 1 184 ? 20.814 -17.994 20.218  1.00 8.65  ? 179 PHE A O   1 
ATOM   1634 C  CB  . PHE A 1 184 ? 19.857 -19.440 17.336  1.00 7.57  ? 179 PHE A CB  1 
ATOM   1635 C  CG  . PHE A 1 184 ? 18.783 -19.823 18.303  1.00 7.25  ? 179 PHE A CG  1 
ATOM   1636 C  CD1 . PHE A 1 184 ? 17.587 -19.039 18.371  1.00 9.66  ? 179 PHE A CD1 1 
ATOM   1637 C  CD2 . PHE A 1 184 ? 18.938 -20.921 19.142  1.00 8.16  ? 179 PHE A CD2 1 
ATOM   1638 C  CE1 . PHE A 1 184 ? 16.578 -19.372 19.287  1.00 9.38  ? 179 PHE A CE1 1 
ATOM   1639 C  CE2 . PHE A 1 184 ? 17.903 -21.285 20.067  1.00 10.79 ? 179 PHE A CE2 1 
ATOM   1640 C  CZ  . PHE A 1 184 ? 16.714 -20.458 20.136  1.00 10.65 ? 179 PHE A CZ  1 
ATOM   1641 N  N   . HIS A 1 185 ? 22.102 -19.642 19.429  1.00 8.13  ? 180 HIS A N   1 
ATOM   1642 C  CA  . HIS A 1 185 ? 22.530 -20.017 20.761  1.00 8.09  ? 180 HIS A CA  1 
ATOM   1643 C  C   . HIS A 1 185 ? 23.252 -18.863 21.389  1.00 8.93  ? 180 HIS A C   1 
ATOM   1644 O  O   . HIS A 1 185 ? 23.059 -18.584 22.564  1.00 9.46  ? 180 HIS A O   1 
ATOM   1645 C  CB  . HIS A 1 185 ? 23.528 -21.229 20.678  1.00 7.32  ? 180 HIS A CB  1 
ATOM   1646 C  CG  . HIS A 1 185 ? 22.851 -22.539 20.395  1.00 8.09  ? 180 HIS A CG  1 
ATOM   1647 N  ND1 . HIS A 1 185 ? 21.757 -22.983 21.104  1.00 9.04  ? 180 HIS A ND1 1 
ATOM   1648 C  CD2 . HIS A 1 185 ? 23.164 -23.529 19.505  1.00 10.21 ? 180 HIS A CD2 1 
ATOM   1649 C  CE1 . HIS A 1 185 ? 21.408 -24.186 20.643  1.00 8.40  ? 180 HIS A CE1 1 
ATOM   1650 N  NE2 . HIS A 1 185 ? 22.243 -24.533 19.675  1.00 8.68  ? 180 HIS A NE2 1 
ATOM   1651 N  N   . TYR A 1 186 ? 24.119 -18.192 20.628  1.00 8.47  ? 181 TYR A N   1 
ATOM   1652 C  CA  . TYR A 1 186 ? 24.995 -17.175 21.252  1.00 9.28  ? 181 TYR A CA  1 
ATOM   1653 C  C   . TYR A 1 186 ? 24.174 -15.931 21.698  1.00 10.73 ? 181 TYR A C   1 
ATOM   1654 O  O   . TYR A 1 186 ? 24.361 -15.415 22.837  1.00 12.26 ? 181 TYR A O   1 
ATOM   1655 C  CB  . TYR A 1 186 ? 26.011 -16.673 20.197  1.00 9.03  ? 181 TYR A CB  1 
ATOM   1656 C  CG  . TYR A 1 186 ? 27.134 -15.849 20.811  1.00 9.95  ? 181 TYR A CG  1 
ATOM   1657 C  CD1 . TYR A 1 186 ? 27.046 -14.448 20.865  1.00 13.09 ? 181 TYR A CD1 1 
ATOM   1658 C  CD2 . TYR A 1 186 ? 28.264 -16.475 21.361  1.00 12.42 ? 181 TYR A CD2 1 
ATOM   1659 C  CE1 . TYR A 1 186 ? 28.030 -13.692 21.445  1.00 12.96 ? 181 TYR A CE1 1 
ATOM   1660 C  CE2 . TYR A 1 186 ? 29.279 -15.731 21.941  1.00 12.80 ? 181 TYR A CE2 1 
ATOM   1661 C  CZ  . TYR A 1 186 ? 29.164 -14.339 21.975  1.00 14.65 ? 181 TYR A CZ  1 
ATOM   1662 O  OH  . TYR A 1 186 ? 30.173 -13.606 22.601  1.00 19.01 ? 181 TYR A OH  1 
ATOM   1663 N  N   . GLU A 1 187 ? 23.253 -15.486 20.821  1.00 12.59 ? 182 GLU A N   1 
ATOM   1664 C  CA  . GLU A 1 187 ? 22.685 -14.106 20.915  1.00 13.56 ? 182 GLU A CA  1 
ATOM   1665 C  C   . GLU A 1 187 ? 21.235 -14.117 21.422  1.00 12.33 ? 182 GLU A C   1 
ATOM   1666 O  O   . GLU A 1 187 ? 20.750 -13.107 21.965  1.00 15.09 ? 182 GLU A O   1 
ATOM   1667 C  CB  . GLU A 1 187 ? 22.732 -13.496 19.457  1.00 15.40 ? 182 GLU A CB  1 
ATOM   1668 C  CG  . GLU A 1 187 ? 22.118 -12.297 19.182  1.00 23.42 ? 182 GLU A CG  1 
ATOM   1669 C  CD  . GLU A 1 187 ? 22.632 -11.876 17.863  1.00 21.51 ? 182 GLU A CD  1 
ATOM   1670 O  OE1 . GLU A 1 187 ? 21.824 -11.946 16.963  1.00 16.21 ? 182 GLU A OE1 1 
ATOM   1671 O  OE2 . GLU A 1 187 ? 23.817 -11.483 17.768  1.00 21.33 ? 182 GLU A OE2 1 
ATOM   1672 N  N   . ILE A 1 188 ? 20.528 -15.235 21.218  1.00 11.29 ? 183 ILE A N   1 
ATOM   1673 C  CA  . ILE A 1 188 ? 19.085 -15.308 21.534  1.00 11.08 ? 183 ILE A CA  1 
ATOM   1674 C  C   . ILE A 1 188 ? 18.883 -16.189 22.753  1.00 12.23 ? 183 ILE A C   1 
ATOM   1675 O  O   . ILE A 1 188 ? 18.172 -15.807 23.697  1.00 14.32 ? 183 ILE A O   1 
ATOM   1676 C  CB  . ILE A 1 188 ? 18.312 -15.867 20.346  1.00 11.18 ? 183 ILE A CB  1 
ATOM   1677 C  CG1 . ILE A 1 188 ? 18.586 -15.077 19.060  1.00 12.57 ? 183 ILE A CG1 1 
ATOM   1678 C  CG2 . ILE A 1 188 ? 16.731 -16.031 20.686  1.00 11.06 ? 183 ILE A CG2 1 
ATOM   1679 C  CD1 . ILE A 1 188 ? 18.153 -13.595 19.153  1.00 17.11 ? 183 ILE A CD1 1 
ATOM   1680 N  N   . ALA A 1 189 ? 19.535 -17.352 22.764  1.00 10.14 ? 184 ALA A N   1 
ATOM   1681 C  CA  . ALA A 1 189 ? 19.315 -18.322 23.843  1.00 11.21 ? 184 ALA A CA  1 
ATOM   1682 C  C   . ALA A 1 189 ? 20.277 -18.231 25.031  1.00 11.27 ? 184 ALA A C   1 
ATOM   1683 O  O   . ALA A 1 189 ? 20.235 -19.093 25.949  1.00 14.45 ? 184 ALA A O   1 
ATOM   1684 C  CB  . ALA A 1 189 ? 19.329 -19.775 23.283  1.00 13.04 ? 184 ALA A CB  1 
ATOM   1685 N  N   . ASN A 1 190 ? 21.156 -17.222 25.047  1.00 11.55 ? 185 ASN A N   1 
ATOM   1686 C  CA  . ASN A 1 190 ? 22.080 -17.045 26.179  1.00 12.70 ? 185 ASN A CA  1 
ATOM   1687 C  C   . ASN A 1 190 ? 22.898 -18.314 26.415  1.00 11.97 ? 185 ASN A C   1 
ATOM   1688 O  O   . ASN A 1 190 ? 23.107 -18.745 27.564  1.00 13.56 ? 185 ASN A O   1 
ATOM   1689 C  CB  . ASN A 1 190 ? 21.304 -16.714 27.471  1.00 14.71 ? 185 ASN A CB  1 
ATOM   1690 C  CG  . ASN A 1 190 ? 22.203 -16.147 28.557  1.00 18.55 ? 185 ASN A CG  1 
ATOM   1691 O  OD1 . ASN A 1 190 ? 23.250 -15.571 28.240  1.00 27.04 ? 185 ASN A OD1 1 
ATOM   1692 N  ND2 . ASN A 1 190 ? 21.810 -16.296 29.833  1.00 21.97 ? 185 ASN A ND2 1 
ATOM   1693 N  N   . SER A 1 191 ? 23.382 -18.909 25.322  1.00 10.70 ? 186 SER A N   1 
ATOM   1694 C  CA  . SER A 1 191 ? 24.147 -20.162 25.422  1.00 9.74  ? 186 SER A CA  1 
ATOM   1695 C  C   . SER A 1 191 ? 25.436 -20.052 24.587  1.00 10.12 ? 186 SER A C   1 
ATOM   1696 O  O   . SER A 1 191 ? 25.594 -20.741 23.583  1.00 9.63  ? 186 SER A O   1 
ATOM   1697 C  CB  . SER A 1 191 ? 23.299 -21.292 24.896  1.00 10.33 ? 186 SER A CB  1 
ATOM   1698 O  OG  . SER A 1 191 ? 22.107 -21.497 25.690  1.00 13.75 ? 186 SER A OG  1 
ATOM   1699 N  N   . PRO A 1 192 ? 26.337 -19.109 24.936  1.00 11.02 ? 187 PRO A N   1 
ATOM   1700 C  CA  . PRO A 1 192 ? 27.518 -18.957 24.104  1.00 10.21 ? 187 PRO A CA  1 
ATOM   1701 C  C   . PRO A 1 192 ? 28.387 -20.194 24.058  1.00 9.86  ? 187 PRO A C   1 
ATOM   1702 O  O   . PRO A 1 192 ? 29.011 -20.432 23.018  1.00 10.34 ? 187 PRO A O   1 
ATOM   1703 C  CB  . PRO A 1 192 ? 28.297 -17.815 24.822  1.00 11.36 ? 187 PRO A CB  1 
ATOM   1704 C  CG  . PRO A 1 192 ? 27.775 -17.890 26.270  1.00 12.39 ? 187 PRO A CG  1 
ATOM   1705 C  CD  . PRO A 1 192 ? 26.331 -18.203 26.118  1.00 12.00 ? 187 PRO A CD  1 
ATOM   1706 N  N   . GLU A 1 193 ? 28.395 -21.007 25.121  1.00 9.90  ? 188 GLU A N   1 
ATOM   1707 C  CA  . GLU A 1 193 ? 29.209 -22.232 25.023  1.00 9.22  ? 188 GLU A CA  1 
ATOM   1708 C  C   . GLU A 1 193 ? 28.686 -23.172 23.979  1.00 9.17  ? 188 GLU A C   1 
ATOM   1709 O  O   . GLU A 1 193 ? 29.458 -23.795 23.211  1.00 9.03  ? 188 GLU A O   1 
ATOM   1710 C  CB  . GLU A 1 193 ? 29.346 -22.965 26.378  1.00 10.09 ? 188 GLU A CB  1 
ATOM   1711 C  CG  . GLU A 1 193 ? 30.206 -22.194 27.313  1.00 13.04 ? 188 GLU A CG  1 
ATOM   1712 C  CD  . GLU A 1 193 ? 30.319 -22.852 28.711  1.00 17.40 ? 188 GLU A CD  1 
ATOM   1713 O  OE1 . GLU A 1 193 ? 29.357 -23.558 29.156  1.00 22.40 ? 188 GLU A OE1 1 
ATOM   1714 O  OE2 . GLU A 1 193 ? 31.356 -22.679 29.359  1.00 21.34 ? 188 GLU A OE2 1 
ATOM   1715 N  N   . GLU A 1 194 ? 27.376 -23.316 23.918  1.00 9.72  ? 189 GLU A N   1 
ATOM   1716 C  CA  . GLU A 1 194 ? 26.777 -24.182 22.912  1.00 8.99  ? 189 GLU A CA  1 
ATOM   1717 C  C   . GLU A 1 194 ? 26.999 -23.569 21.531  1.00 7.66  ? 189 GLU A C   1 
ATOM   1718 O  O   . GLU A 1 194 ? 27.271 -24.295 20.573  1.00 9.77  ? 189 GLU A O   1 
ATOM   1719 C  CB  . GLU A 1 194 ? 25.258 -24.311 23.184  1.00 8.87  ? 189 GLU A CB  1 
ATOM   1720 C  CG  . GLU A 1 194 ? 24.585 -25.255 22.189  1.00 9.54  ? 189 GLU A CG  1 
ATOM   1721 C  CD  . GLU A 1 194 ? 24.937 -26.747 22.404  1.00 11.54 ? 189 GLU A CD  1 
ATOM   1722 O  OE1 . GLU A 1 194 ? 24.579 -27.591 21.516  1.00 14.43 ? 189 GLU A OE1 1 
ATOM   1723 O  OE2 . GLU A 1 194 ? 25.546 -27.104 23.439  1.00 11.84 ? 189 GLU A OE2 1 
ATOM   1724 N  N   . ALA A 1 195 ? 26.955 -22.235 21.428  1.00 7.73  ? 190 ALA A N   1 
ATOM   1725 C  CA  . ALA A 1 195 ? 27.187 -21.599 20.087  1.00 6.59  ? 190 ALA A CA  1 
ATOM   1726 C  C   . ALA A 1 195 ? 28.601 -21.908 19.599  1.00 7.43  ? 190 ALA A C   1 
ATOM   1727 O  O   . ALA A 1 195 ? 28.810 -22.228 18.422  1.00 8.90  ? 190 ALA A O   1 
ATOM   1728 C  CB  . ALA A 1 195 ? 27.052 -20.105 20.229  1.00 8.35  ? 190 ALA A CB  1 
ATOM   1729 N  N   . ILE A 1 196 ? 29.571 -21.803 20.498  1.00 7.58  ? 191 ILE A N   1 
ATOM   1730 C  CA  . ILE A 1 196 ? 30.978 -22.009 20.142  1.00 9.90  ? 191 ILE A CA  1 
ATOM   1731 C  C   . ILE A 1 196 ? 31.170 -23.495 19.817  1.00 9.26  ? 191 ILE A C   1 
ATOM   1732 O  O   . ILE A 1 196 ? 31.836 -23.829 18.877  1.00 9.69  ? 191 ILE A O   1 
ATOM   1733 C  CB  . ILE A 1 196 ? 31.894 -21.519 21.293  1.00 10.15 ? 191 ILE A CB  1 
ATOM   1734 C  CG1 . ILE A 1 196 ? 31.813 -19.975 21.354  1.00 11.67 ? 191 ILE A CG1 1 
ATOM   1735 C  CG2 . ILE A 1 196 ? 33.339 -22.027 21.102  1.00 11.49 ? 191 ILE A CG2 1 
ATOM   1736 C  CD1 . ILE A 1 196 ? 32.326 -19.427 22.653  1.00 12.52 ? 191 ILE A CD1 1 
ATOM   1737 N  N   . SER A 1 197 ? 30.634 -24.396 20.643  1.00 8.50  ? 192 SER A N   1 
ATOM   1738 C  CA  A SER A 1 197 ? 30.798 -25.830 20.382  0.50 9.69  ? 192 SER A CA  1 
ATOM   1739 C  CA  B SER A 1 197 ? 30.799 -25.840 20.371  0.50 9.61  ? 192 SER A CA  1 
ATOM   1740 C  C   . SER A 1 197 ? 30.217 -26.222 19.015  1.00 9.73  ? 192 SER A C   1 
ATOM   1741 O  O   . SER A 1 197 ? 30.809 -26.972 18.257  1.00 9.43  ? 192 SER A O   1 
ATOM   1742 C  CB  A SER A 1 197 ? 30.138 -26.581 21.528  0.50 9.88  ? 192 SER A CB  1 
ATOM   1743 C  CB  B SER A 1 197 ? 30.120 -26.662 21.456  0.50 9.69  ? 192 SER A CB  1 
ATOM   1744 O  OG  A SER A 1 197 ? 30.906 -26.385 22.703  0.50 12.81 ? 192 SER A OG  1 
ATOM   1745 O  OG  B SER A 1 197 ? 30.202 -28.042 21.102  0.50 12.52 ? 192 SER A OG  1 
ATOM   1746 N  N   . LEU A 1 198 ? 29.043 -25.716 18.730  1.00 9.00  ? 193 LEU A N   1 
ATOM   1747 C  CA  A LEU A 1 198 ? 28.412 -26.026 17.466  0.60 8.02  ? 193 LEU A CA  1 
ATOM   1748 C  CA  B LEU A 1 198 ? 28.401 -26.010 17.464  0.40 8.84  ? 193 LEU A CA  1 
ATOM   1749 C  C   . LEU A 1 198 ? 29.260 -25.468 16.321  1.00 8.59  ? 193 LEU A C   1 
ATOM   1750 O  O   . LEU A 1 198 ? 29.499 -26.155 15.322  1.00 9.31  ? 193 LEU A O   1 
ATOM   1751 C  CB  A LEU A 1 198 ? 26.953 -25.468 17.456  0.60 7.67  ? 193 LEU A CB  1 
ATOM   1752 C  CB  B LEU A 1 198 ? 26.971 -25.406 17.447  0.40 9.12  ? 193 LEU A CB  1 
ATOM   1753 C  CG  A LEU A 1 198 ? 26.264 -25.709 16.115  0.60 6.72  ? 193 LEU A CG  1 
ATOM   1754 C  CG  B LEU A 1 198 ? 26.148 -25.893 16.256  0.40 10.11 ? 193 LEU A CG  1 
ATOM   1755 C  CD1 A LEU A 1 198 ? 26.279 -27.166 15.580  0.60 8.41  ? 193 LEU A CD1 1 
ATOM   1756 C  CD1 B LEU A 1 198 ? 26.593 -25.201 14.992  0.40 13.23 ? 193 LEU A CD1 1 
ATOM   1757 C  CD2 A LEU A 1 198 ? 24.822 -25.126 16.216  0.60 3.94  ? 193 LEU A CD2 1 
ATOM   1758 C  CD2 B LEU A 1 198 ? 26.206 -27.415 16.125  0.40 12.05 ? 193 LEU A CD2 1 
ATOM   1759 N  N   . ALA A 1 199 ? 29.727 -24.232 16.439  1.00 8.56  ? 194 ALA A N   1 
ATOM   1760 C  CA  . ALA A 1 199 ? 30.440 -23.705 15.280  1.00 9.56  ? 194 ALA A CA  1 
ATOM   1761 C  C   . ALA A 1 199 ? 31.761 -24.492 15.069  1.00 9.32  ? 194 ALA A C   1 
ATOM   1762 O  O   . ALA A 1 199 ? 32.170 -24.774 13.926  1.00 9.51  ? 194 ALA A O   1 
ATOM   1763 C  CB  . ALA A 1 199 ? 30.683 -22.210 15.481  1.00 11.52 ? 194 ALA A CB  1 
ATOM   1764 N  N   . LYS A 1 200 ? 32.462 -24.817 16.153  1.00 9.65  ? 195 LYS A N   1 
ATOM   1765 C  CA  A LYS A 1 200 ? 33.721 -25.624 16.143  0.50 10.74 ? 195 LYS A CA  1 
ATOM   1766 C  CA  B LYS A 1 200 ? 33.728 -25.571 16.037  0.50 10.03 ? 195 LYS A CA  1 
ATOM   1767 C  C   . LYS A 1 200 ? 33.550 -26.976 15.504  1.00 9.81  ? 195 LYS A C   1 
ATOM   1768 O  O   . LYS A 1 200 ? 34.255 -27.358 14.568  1.00 11.93 ? 195 LYS A O   1 
ATOM   1769 C  CB  A LYS A 1 200 ? 34.203 -25.834 17.587  0.50 11.60 ? 195 LYS A CB  1 
ATOM   1770 C  CB  B LYS A 1 200 ? 34.500 -25.555 17.355  0.50 10.87 ? 195 LYS A CB  1 
ATOM   1771 C  CG  A LYS A 1 200 ? 35.134 -24.770 18.145  0.50 15.85 ? 195 LYS A CG  1 
ATOM   1772 C  CG  B LYS A 1 200 ? 35.874 -26.149 17.248  0.50 10.68 ? 195 LYS A CG  1 
ATOM   1773 C  CD  A LYS A 1 200 ? 35.688 -25.247 19.528  0.50 18.55 ? 195 LYS A CD  1 
ATOM   1774 C  CD  B LYS A 1 200 ? 36.578 -26.236 18.564  0.50 18.38 ? 195 LYS A CD  1 
ATOM   1775 C  CE  A LYS A 1 200 ? 37.025 -24.583 19.923  0.50 23.38 ? 195 LYS A CE  1 
ATOM   1776 C  CE  B LYS A 1 200 ? 37.731 -27.259 18.513  0.50 20.84 ? 195 LYS A CE  1 
ATOM   1777 N  NZ  A LYS A 1 200 ? 36.898 -23.251 20.579  0.50 25.61 ? 195 LYS A NZ  1 
ATOM   1778 N  NZ  B LYS A 1 200 ? 38.447 -27.406 17.224  0.50 20.82 ? 195 LYS A NZ  1 
ATOM   1779 N  N   . THR A 1 201 ? 32.587 -27.712 16.007  1.00 9.40  ? 196 THR A N   1 
ATOM   1780 C  CA  A THR A 1 201 ? 32.338 -29.060 15.530  0.60 10.02 ? 196 THR A CA  1 
ATOM   1781 C  CA  B THR A 1 201 ? 32.394 -29.066 15.517  0.40 9.29  ? 196 THR A CA  1 
ATOM   1782 C  C   . THR A 1 201 ? 31.933 -29.048 14.068  1.00 9.30  ? 196 THR A C   1 
ATOM   1783 O  O   . THR A 1 201 ? 32.395 -29.894 13.256  1.00 10.60 ? 196 THR A O   1 
ATOM   1784 C  CB  A THR A 1 201 ? 31.277 -29.721 16.410  0.60 11.11 ? 196 THR A CB  1 
ATOM   1785 C  CB  B THR A 1 201 ? 31.464 -29.884 16.424  0.40 9.79  ? 196 THR A CB  1 
ATOM   1786 O  OG1 A THR A 1 201 ? 31.858 -29.910 17.717  0.60 16.01 ? 196 THR A OG1 1 
ATOM   1787 O  OG1 B THR A 1 201 ? 30.168 -29.270 16.471  0.40 7.43  ? 196 THR A OG1 1 
ATOM   1788 C  CG2 A THR A 1 201 ? 30.803 -31.061 15.812  0.60 10.32 ? 196 THR A CG2 1 
ATOM   1789 C  CG2 B THR A 1 201 ? 32.093 -29.950 17.842  0.40 11.63 ? 196 THR A CG2 1 
ATOM   1790 N  N   . THR A 1 202 ? 31.061 -28.118 13.718  1.00 8.93  ? 197 THR A N   1 
ATOM   1791 C  CA  . THR A 1 202 ? 30.648 -27.967 12.335  1.00 9.40  ? 197 THR A CA  1 
ATOM   1792 C  C   . THR A 1 202 ? 31.838 -27.728 11.432  1.00 10.04 ? 197 THR A C   1 
ATOM   1793 O  O   . THR A 1 202 ? 31.953 -28.364 10.338  1.00 9.49  ? 197 THR A O   1 
ATOM   1794 C  CB  . THR A 1 202 ? 29.577 -26.840 12.183  1.00 9.24  ? 197 THR A CB  1 
ATOM   1795 O  OG1 . THR A 1 202 ? 28.444 -27.162 13.006  1.00 10.82 ? 197 THR A OG1 1 
ATOM   1796 C  CG2 . THR A 1 202 ? 29.105 -26.795 10.730  1.00 8.71  ? 197 THR A CG2 1 
ATOM   1797 N  N   . PHE A 1 203 ? 32.640 -26.730 11.785  1.00 9.14  ? 198 PHE A N   1 
ATOM   1798 C  CA  . PHE A 1 203 ? 33.803 -26.373 10.958  1.00 9.35  ? 198 PHE A CA  1 
ATOM   1799 C  C   . PHE A 1 203 ? 34.728 -27.599 10.819  1.00 10.09 ? 198 PHE A C   1 
ATOM   1800 O  O   . PHE A 1 203 ? 35.192 -27.961 9.722   1.00 12.36 ? 198 PHE A O   1 
ATOM   1801 C  CB  . PHE A 1 203 ? 34.560 -25.237 11.636  1.00 9.30  ? 198 PHE A CB  1 
ATOM   1802 C  CG  . PHE A 1 203 ? 35.733 -24.754 10.834  1.00 10.80 ? 198 PHE A CG  1 
ATOM   1803 C  CD1 . PHE A 1 203 ? 36.971 -25.371 10.971  1.00 13.94 ? 198 PHE A CD1 1 
ATOM   1804 C  CD2 . PHE A 1 203 ? 35.602 -23.660 9.940   1.00 11.71 ? 198 PHE A CD2 1 
ATOM   1805 C  CE1 . PHE A 1 203 ? 38.074 -24.946 10.213  1.00 16.70 ? 198 PHE A CE1 1 
ATOM   1806 C  CE2 . PHE A 1 203 ? 36.699 -23.259 9.213   1.00 14.62 ? 198 PHE A CE2 1 
ATOM   1807 C  CZ  . PHE A 1 203 ? 37.942 -23.947 9.348   1.00 14.90 ? 198 PHE A CZ  1 
ATOM   1808 N  N   . ASP A 1 204 ? 34.997 -28.264 11.926  1.00 12.01 ? 199 ASP A N   1 
ATOM   1809 C  CA  . ASP A 1 204 ? 35.959 -29.374 11.916  1.00 13.01 ? 199 ASP A CA  1 
ATOM   1810 C  C   . ASP A 1 204 ? 35.482 -30.585 11.118  1.00 13.08 ? 199 ASP A C   1 
ATOM   1811 O  O   . ASP A 1 204 ? 36.273 -31.200 10.386  1.00 13.90 ? 199 ASP A O   1 
ATOM   1812 C  CB  . ASP A 1 204 ? 36.260 -29.798 13.371  1.00 14.19 ? 199 ASP A CB  1 
ATOM   1813 C  CG  . ASP A 1 204 ? 37.053 -28.724 14.169  1.00 16.31 ? 199 ASP A CG  1 
ATOM   1814 O  OD1 . ASP A 1 204 ? 37.624 -27.730 13.591  1.00 19.47 ? 199 ASP A OD1 1 
ATOM   1815 O  OD2 . ASP A 1 204 ? 37.129 -28.881 15.401  1.00 18.80 ? 199 ASP A OD2 1 
ATOM   1816 N  N   . GLU A 1 205 ? 34.212 -30.890 11.213  1.00 12.56 ? 200 GLU A N   1 
ATOM   1817 C  CA  . GLU A 1 205 ? 33.625 -31.992 10.438  1.00 13.31 ? 200 GLU A CA  1 
ATOM   1818 C  C   . GLU A 1 205 ? 33.602 -31.685 8.969   1.00 12.62 ? 200 GLU A C   1 
ATOM   1819 O  O   . GLU A 1 205 ? 33.805 -32.581 8.180   1.00 13.04 ? 200 GLU A O   1 
ATOM   1820 C  CB  . GLU A 1 205 ? 32.249 -32.352 11.008  1.00 14.33 ? 200 GLU A CB  1 
ATOM   1821 C  CG  . GLU A 1 205 ? 32.483 -33.069 12.307  1.00 20.26 ? 200 GLU A CG  1 
ATOM   1822 C  CD  . GLU A 1 205 ? 31.269 -33.139 13.157  1.00 28.60 ? 200 GLU A CD  1 
ATOM   1823 O  OE1 . GLU A 1 205 ? 31.485 -33.248 14.399  1.00 31.57 ? 200 GLU A OE1 1 
ATOM   1824 O  OE2 . GLU A 1 205 ? 30.125 -33.102 12.616  1.00 29.75 ? 200 GLU A OE2 1 
ATOM   1825 N  N   . ALA A 1 206 ? 33.375 -30.413 8.609   1.00 10.82 ? 201 ALA A N   1 
ATOM   1826 C  CA  . ALA A 1 206 ? 33.414 -30.004 7.230   1.00 9.82  ? 201 ALA A CA  1 
ATOM   1827 C  C   . ALA A 1 206 ? 34.882 -30.108 6.707   1.00 11.66 ? 201 ALA A C   1 
ATOM   1828 O  O   . ALA A 1 206 ? 35.107 -30.643 5.609   1.00 10.09 ? 201 ALA A O   1 
ATOM   1829 C  CB  . ALA A 1 206 ? 32.781 -28.584 7.053   1.00 9.92  ? 201 ALA A CB  1 
ATOM   1830 N  N   . MET A 1 207 ? 35.879 -29.643 7.502   1.00 11.27 ? 202 MET A N   1 
ATOM   1831 C  CA  A MET A 1 207 ? 37.233 -29.661 7.023   0.50 12.40 ? 202 MET A CA  1 
ATOM   1832 C  CA  B MET A 1 207 ? 37.265 -29.674 7.052   0.50 12.17 ? 202 MET A CA  1 
ATOM   1833 C  C   . MET A 1 207 ? 37.647 -31.111 6.662   1.00 12.90 ? 202 MET A C   1 
ATOM   1834 O  O   . MET A 1 207 ? 38.290 -31.347 5.636   1.00 12.54 ? 202 MET A O   1 
ATOM   1835 C  CB  A MET A 1 207 ? 38.166 -29.130 8.118   0.50 13.79 ? 202 MET A CB  1 
ATOM   1836 C  CB  B MET A 1 207 ? 38.211 -29.209 8.188   0.50 13.12 ? 202 MET A CB  1 
ATOM   1837 C  CG  A MET A 1 207 ? 39.558 -29.446 7.808   0.50 17.24 ? 202 MET A CG  1 
ATOM   1838 C  CG  B MET A 1 207 ? 38.191 -27.730 8.405   0.50 15.02 ? 202 MET A CG  1 
ATOM   1839 S  SD  A MET A 1 207 ? 40.190 -28.240 6.663   0.50 22.60 ? 202 MET A SD  1 
ATOM   1840 S  SD  B MET A 1 207 ? 39.233 -26.991 7.103   0.50 19.21 ? 202 MET A SD  1 
ATOM   1841 C  CE  A MET A 1 207 ? 40.490 -26.922 7.864   0.50 24.44 ? 202 MET A CE  1 
ATOM   1842 C  CE  B MET A 1 207 ? 40.758 -27.774 7.669   0.50 17.04 ? 202 MET A CE  1 
ATOM   1843 N  N   . ALA A 1 208 ? 37.189 -32.071 7.482   1.00 12.20 ? 203 ALA A N   1 
ATOM   1844 C  CA  . ALA A 1 208 ? 37.601 -33.446 7.326   1.00 12.85 ? 203 ALA A CA  1 
ATOM   1845 C  C   . ALA A 1 208 ? 36.962 -34.102 6.083   1.00 12.62 ? 203 ALA A C   1 
ATOM   1846 O  O   . ALA A 1 208 ? 37.437 -35.136 5.633   1.00 13.12 ? 203 ALA A O   1 
ATOM   1847 C  CB  . ALA A 1 208 ? 37.247 -34.237 8.588   1.00 15.66 ? 203 ALA A CB  1 
ATOM   1848 N  N   . ASP A 1 209 ? 35.912 -33.490 5.500   1.00 12.49 ? 204 ASP A N   1 
ATOM   1849 C  CA  A ASP A 1 209 ? 35.182 -34.023 4.355   0.60 13.38 ? 204 ASP A CA  1 
ATOM   1850 C  CA  B ASP A 1 209 ? 35.293 -34.112 4.336   0.40 13.29 ? 204 ASP A CA  1 
ATOM   1851 C  C   . ASP A 1 209 ? 35.528 -33.266 3.048   1.00 13.54 ? 204 ASP A C   1 
ATOM   1852 O  O   . ASP A 1 209 ? 35.057 -33.640 1.946   1.00 13.44 ? 204 ASP A O   1 
ATOM   1853 C  CB  A ASP A 1 209 ? 33.656 -33.847 4.629   0.60 14.50 ? 204 ASP A CB  1 
ATOM   1854 C  CB  B ASP A 1 209 ? 33.779 -34.375 4.584   0.40 14.25 ? 204 ASP A CB  1 
ATOM   1855 C  CG  A ASP A 1 209 ? 32.743 -34.516 3.572   0.60 15.15 ? 204 ASP A CG  1 
ATOM   1856 C  CG  B ASP A 1 209 ? 33.444 -35.840 4.942   0.40 16.58 ? 204 ASP A CG  1 
ATOM   1857 O  OD1 A ASP A 1 209 ? 32.945 -35.726 3.328   0.60 18.81 ? 204 ASP A OD1 1 
ATOM   1858 O  OD1 B ASP A 1 209 ? 34.303 -36.636 5.387   0.40 18.53 ? 204 ASP A OD1 1 
ATOM   1859 O  OD2 A ASP A 1 209 ? 31.771 -33.844 3.031   0.60 14.72 ? 204 ASP A OD2 1 
ATOM   1860 O  OD2 B ASP A 1 209 ? 32.259 -36.207 4.771   0.40 18.79 ? 204 ASP A OD2 1 
ATOM   1861 N  N   . LEU A 1 210 ? 36.308 -32.174 3.150   1.00 11.66 ? 205 LEU A N   1 
ATOM   1862 C  CA  . LEU A 1 210 ? 36.662 -31.419 1.957   1.00 13.57 ? 205 LEU A CA  1 
ATOM   1863 C  C   . LEU A 1 210 ? 37.346 -32.269 0.872   1.00 12.51 ? 205 LEU A C   1 
ATOM   1864 O  O   . LEU A 1 210 ? 37.197 -31.990 -0.360  1.00 13.56 ? 205 LEU A O   1 
ATOM   1865 C  CB  . LEU A 1 210 ? 37.560 -30.268 2.305   1.00 12.89 ? 205 LEU A CB  1 
ATOM   1866 C  CG  . LEU A 1 210 ? 36.836 -29.132 3.039   1.00 13.57 ? 205 LEU A CG  1 
ATOM   1867 C  CD1 . LEU A 1 210 ? 37.893 -28.126 3.482   1.00 15.88 ? 205 LEU A CD1 1 
ATOM   1868 C  CD2 . LEU A 1 210 ? 35.759 -28.467 2.234   1.00 15.91 ? 205 LEU A CD2 1 
ATOM   1869 N  N   . HIS A 1 211 ? 38.070 -33.300 1.297   1.00 13.92 ? 206 HIS A N   1 
ATOM   1870 C  CA  . HIS A 1 211 ? 38.836 -34.154 0.375   1.00 15.15 ? 206 HIS A CA  1 
ATOM   1871 C  C   . HIS A 1 211 ? 37.940 -34.859 -0.640  1.00 16.78 ? 206 HIS A C   1 
ATOM   1872 O  O   . HIS A 1 211 ? 38.437 -35.296 -1.680  1.00 17.86 ? 206 HIS A O   1 
ATOM   1873 C  CB  . HIS A 1 211 ? 39.704 -35.175 1.153   1.00 15.29 ? 206 HIS A CB  1 
ATOM   1874 C  CG  . HIS A 1 211 ? 38.935 -36.371 1.620   1.00 18.30 ? 206 HIS A CG  1 
ATOM   1875 N  ND1 . HIS A 1 211 ? 38.291 -36.418 2.844   1.00 20.67 ? 206 HIS A ND1 1 
ATOM   1876 C  CD2 . HIS A 1 211 ? 38.667 -37.552 0.998   1.00 15.85 ? 206 HIS A CD2 1 
ATOM   1877 C  CE1 . HIS A 1 211 ? 37.716 -37.605 2.984   1.00 18.94 ? 206 HIS A CE1 1 
ATOM   1878 N  NE2 . HIS A 1 211 ? 37.897 -38.292 1.864   1.00 21.99 ? 206 HIS A NE2 1 
ATOM   1879 N  N   . THR A 1 212 ? 36.626 -34.929 -0.362  1.00 15.58 ? 207 THR A N   1 
ATOM   1880 C  CA  . THR A 1 212 ? 35.710 -35.671 -1.231  1.00 16.23 ? 207 THR A CA  1 
ATOM   1881 C  C   . THR A 1 212 ? 35.186 -34.798 -2.386  1.00 15.94 ? 207 THR A C   1 
ATOM   1882 O  O   . THR A 1 212 ? 34.468 -35.279 -3.301  1.00 18.01 ? 207 THR A O   1 
ATOM   1883 C  CB  . THR A 1 212 ? 34.497 -36.195 -0.396  1.00 13.88 ? 207 THR A CB  1 
ATOM   1884 O  OG1 . THR A 1 212 ? 33.736 -35.093 0.062   1.00 15.80 ? 207 THR A OG1 1 
ATOM   1885 C  CG2 . THR A 1 212 ? 35.004 -37.018 0.838   1.00 16.72 ? 207 THR A CG2 1 
ATOM   1886 N  N   . LEU A 1 213 ? 35.495 -33.509 -2.296  1.00 15.86 ? 208 LEU A N   1 
ATOM   1887 C  CA  . LEU A 1 213 ? 34.831 -32.524 -3.144  1.00 15.52 ? 208 LEU A CA  1 
ATOM   1888 C  C   . LEU A 1 213 ? 35.585 -32.159 -4.385  1.00 17.11 ? 208 LEU A C   1 
ATOM   1889 O  O   . LEU A 1 213 ? 36.791 -32.151 -4.387  1.00 18.86 ? 208 LEU A O   1 
ATOM   1890 C  CB  . LEU A 1 213 ? 34.540 -31.263 -2.357  1.00 15.64 ? 208 LEU A CB  1 
ATOM   1891 C  CG  . LEU A 1 213 ? 33.748 -31.454 -1.071  1.00 13.89 ? 208 LEU A CG  1 
ATOM   1892 C  CD1 . LEU A 1 213 ? 33.593 -30.029 -0.518  1.00 16.04 ? 208 LEU A CD1 1 
ATOM   1893 C  CD2 . LEU A 1 213 ? 32.343 -32.127 -1.292  1.00 14.42 ? 208 LEU A CD2 1 
ATOM   1894 N  N   . SER A 1 214 ? 34.850 -31.897 -5.463  1.00 16.52 ? 209 SER A N   1 
ATOM   1895 C  CA  . SER A 1 214 ? 35.400 -31.201 -6.613  1.00 18.60 ? 209 SER A CA  1 
ATOM   1896 C  C   . SER A 1 214 ? 35.887 -29.758 -6.266  1.00 20.98 ? 209 SER A C   1 
ATOM   1897 O  O   . SER A 1 214 ? 35.513 -29.160 -5.211  1.00 21.16 ? 209 SER A O   1 
ATOM   1898 C  CB  . SER A 1 214 ? 34.319 -31.082 -7.688  1.00 19.25 ? 209 SER A CB  1 
ATOM   1899 O  OG  . SER A 1 214 ? 33.364 -30.050 -7.270  1.00 22.75 ? 209 SER A OG  1 
ATOM   1900 N  N   . GLU A 1 215 ? 36.719 -29.200 -7.148  1.00 22.03 ? 210 GLU A N   1 
ATOM   1901 C  CA  . GLU A 1 215 ? 37.150 -27.796 -6.951  1.00 23.22 ? 210 GLU A CA  1 
ATOM   1902 C  C   . GLU A 1 215 ? 35.934 -26.808 -6.716  1.00 24.71 ? 210 GLU A C   1 
ATOM   1903 O  O   . GLU A 1 215 ? 35.971 -25.993 -5.780  1.00 23.35 ? 210 GLU A O   1 
ATOM   1904 C  CB  . GLU A 1 215 ? 38.074 -27.356 -8.095  1.00 24.86 ? 210 GLU A CB  1 
ATOM   1905 N  N   . ASP A 1 216 ? 34.850 -26.918 -7.497  1.00 24.84 ? 211 ASP A N   1 
ATOM   1906 C  CA  . ASP A 1 216 ? 33.649 -26.024 -7.302  1.00 23.61 ? 211 ASP A CA  1 
ATOM   1907 C  C   . ASP A 1 216 ? 32.965 -26.209 -5.942  1.00 23.55 ? 211 ASP A C   1 
ATOM   1908 O  O   . ASP A 1 216 ? 32.610 -25.258 -5.263  1.00 21.02 ? 211 ASP A O   1 
ATOM   1909 C  CB  . ASP A 1 216 ? 32.595 -26.230 -8.397  1.00 26.04 ? 211 ASP A CB  1 
ATOM   1910 N  N   . SER A 1 217 ? 32.720 -27.459 -5.566  1.00 24.17 ? 212 SER A N   1 
ATOM   1911 C  CA  . SER A 1 217 ? 32.131 -27.743 -4.252  1.00 22.03 ? 212 SER A CA  1 
ATOM   1912 C  C   . SER A 1 217 ? 33.019 -27.290 -3.116  1.00 20.69 ? 212 SER A C   1 
ATOM   1913 O  O   . SER A 1 217 ? 32.540 -26.768 -2.126  1.00 18.75 ? 212 SER A O   1 
ATOM   1914 C  CB  . SER A 1 217 ? 31.846 -29.225 -4.126  1.00 21.94 ? 212 SER A CB  1 
ATOM   1915 O  OG  . SER A 1 217 ? 30.819 -29.615 -5.036  1.00 26.44 ? 212 SER A OG  1 
ATOM   1916 N  N   . TYR A 1 218 ? 34.325 -27.474 -3.266  1.00 19.99 ? 213 TYR A N   1 
ATOM   1917 C  CA  A TYR A 1 218 ? 35.246 -27.070 -2.237  0.50 20.38 ? 213 TYR A CA  1 
ATOM   1918 C  CA  B TYR A 1 218 ? 35.237 -27.076 -2.224  0.50 20.60 ? 213 TYR A CA  1 
ATOM   1919 C  C   . TYR A 1 218 ? 35.105 -25.564 -1.991  1.00 21.23 ? 213 TYR A C   1 
ATOM   1920 O  O   . TYR A 1 218 ? 35.023 -25.090 -0.807  1.00 23.16 ? 213 TYR A O   1 
ATOM   1921 C  CB  A TYR A 1 218 ? 36.650 -27.460 -2.707  0.50 19.96 ? 213 TYR A CB  1 
ATOM   1922 C  CB  B TYR A 1 218 ? 36.641 -27.484 -2.673  0.50 20.41 ? 213 TYR A CB  1 
ATOM   1923 C  CG  A TYR A 1 218 ? 37.805 -26.808 -1.990  0.50 17.18 ? 213 TYR A CG  1 
ATOM   1924 C  CG  B TYR A 1 218 ? 37.771 -27.289 -1.694  0.50 18.49 ? 213 TYR A CG  1 
ATOM   1925 C  CD1 A TYR A 1 218 ? 38.380 -27.421 -0.896  0.50 14.90 ? 213 TYR A CD1 1 
ATOM   1926 C  CD1 B TYR A 1 218 ? 38.110 -28.290 -0.797  0.50 18.94 ? 213 TYR A CD1 1 
ATOM   1927 C  CD2 A TYR A 1 218 ? 38.343 -25.573 -2.423  0.50 17.30 ? 213 TYR A CD2 1 
ATOM   1928 C  CD2 B TYR A 1 218 ? 38.531 -26.118 -1.695  0.50 20.10 ? 213 TYR A CD2 1 
ATOM   1929 C  CE1 A TYR A 1 218 ? 39.467 -26.849 -0.238  0.50 16.23 ? 213 TYR A CE1 1 
ATOM   1930 C  CE1 B TYR A 1 218 ? 39.219 -28.142 0.088   0.50 19.94 ? 213 TYR A CE1 1 
ATOM   1931 C  CE2 A TYR A 1 218 ? 39.440 -24.988 -1.758  0.50 17.82 ? 213 TYR A CE2 1 
ATOM   1932 C  CE2 B TYR A 1 218 ? 39.604 -25.954 -0.822  0.50 21.70 ? 213 TYR A CE2 1 
ATOM   1933 C  CZ  A TYR A 1 218 ? 39.998 -25.633 -0.674  0.50 19.11 ? 213 TYR A CZ  1 
ATOM   1934 C  CZ  B TYR A 1 218 ? 39.950 -26.969 0.076   0.50 21.57 ? 213 TYR A CZ  1 
ATOM   1935 O  OH  A TYR A 1 218 ? 41.089 -25.064 -0.020  0.50 18.19 ? 213 TYR A OH  1 
ATOM   1936 O  OH  B TYR A 1 218 ? 41.037 -26.807 0.955   0.50 21.81 ? 213 TYR A OH  1 
ATOM   1937 N  N   . LYS A 1 219 ? 35.074 -24.780 -3.081  1.00 21.18 ? 214 LYS A N   1 
ATOM   1938 C  CA  A LYS A 1 219 ? 34.903 -23.319 -2.941  0.50 21.38 ? 214 LYS A CA  1 
ATOM   1939 C  CA  B LYS A 1 219 ? 34.904 -23.329 -2.932  0.50 21.29 ? 214 LYS A CA  1 
ATOM   1940 C  C   . LYS A 1 219 ? 33.585 -23.026 -2.250  1.00 21.63 ? 214 LYS A C   1 
ATOM   1941 O  O   . LYS A 1 219 ? 33.563 -22.145 -1.362  1.00 21.26 ? 214 LYS A O   1 
ATOM   1942 C  CB  A LYS A 1 219 ? 34.952 -22.580 -4.289  0.50 22.29 ? 214 LYS A CB  1 
ATOM   1943 C  CB  B LYS A 1 219 ? 34.980 -22.608 -4.279  0.50 22.17 ? 214 LYS A CB  1 
ATOM   1944 C  CG  A LYS A 1 219 ? 35.039 -21.057 -4.159  0.50 22.44 ? 214 LYS A CG  1 
ATOM   1945 C  CG  B LYS A 1 219 ? 36.373 -22.605 -4.853  0.50 21.73 ? 214 LYS A CG  1 
ATOM   1946 N  N   . ASP A 1 220 ? 32.472 -23.716 -2.617  1.00 20.31 ? 215 ASP A N   1 
ATOM   1947 C  CA  A ASP A 1 220 ? 31.157 -23.462 -1.982  0.60 19.93 ? 215 ASP A CA  1 
ATOM   1948 C  CA  B ASP A 1 220 ? 31.365 -23.160 -1.841  0.40 20.16 ? 215 ASP A CA  1 
ATOM   1949 C  C   . ASP A 1 220 ? 31.162 -23.714 -0.471  1.00 19.72 ? 215 ASP A C   1 
ATOM   1950 O  O   . ASP A 1 220 ? 30.492 -23.082 0.292   1.00 19.81 ? 215 ASP A O   1 
ATOM   1951 C  CB  A ASP A 1 220 ? 30.073 -24.377 -2.579  0.60 17.74 ? 215 ASP A CB  1 
ATOM   1952 C  CB  B ASP A 1 220 ? 30.120 -22.621 -2.597  0.40 19.53 ? 215 ASP A CB  1 
ATOM   1953 C  CG  A ASP A 1 220 ? 29.726 -24.065 -4.035  0.60 19.31 ? 215 ASP A CG  1 
ATOM   1954 C  CG  B ASP A 1 220 ? 28.850 -22.670 -1.780  0.40 19.23 ? 215 ASP A CG  1 
ATOM   1955 O  OD1 A ASP A 1 220 ? 29.854 -22.908 -4.538  0.60 18.46 ? 215 ASP A OD1 1 
ATOM   1956 O  OD1 B ASP A 1 220 ? 28.523 -21.666 -1.029  0.40 10.80 ? 215 ASP A OD1 1 
ATOM   1957 O  OD2 A ASP A 1 220 ? 29.269 -25.035 -4.682  0.60 21.07 ? 215 ASP A OD2 1 
ATOM   1958 O  OD2 B ASP A 1 220 ? 28.168 -23.735 -1.976  0.40 16.21 ? 215 ASP A OD2 1 
ATOM   1959 N  N   . SER A 1 221 ? 31.847 -24.818 -0.097  1.00 20.34 ? 216 SER A N   1 
ATOM   1960 C  CA  . SER A 1 221 ? 31.763 -25.248 1.324   1.00 19.96 ? 216 SER A CA  1 
ATOM   1961 C  C   . SER A 1 221 ? 32.678 -24.279 2.147   1.00 20.10 ? 216 SER A C   1 
ATOM   1962 O  O   . SER A 1 221 ? 32.237 -23.667 3.176   1.00 19.88 ? 216 SER A O   1 
ATOM   1963 C  CB  . SER A 1 221 ? 32.289 -26.663 1.456   1.00 20.64 ? 216 SER A CB  1 
ATOM   1964 O  OG  . SER A 1 221 ? 31.354 -27.556 0.854   1.00 21.04 ? 216 SER A OG  1 
ATOM   1965 N  N   . THR A 1 222 ? 33.909 -24.047 1.618   1.00 20.14 ? 217 THR A N   1 
ATOM   1966 C  CA  . THR A 1 222 ? 34.869 -23.226 2.328   1.00 19.74 ? 217 THR A CA  1 
ATOM   1967 C  C   . THR A 1 222 ? 34.343 -21.787 2.562   1.00 18.86 ? 217 THR A C   1 
ATOM   1968 O  O   . THR A 1 222 ? 34.651 -21.172 3.530   1.00 18.42 ? 217 THR A O   1 
ATOM   1969 C  CB  . THR A 1 222 ? 36.291 -23.248 1.672   1.00 20.75 ? 217 THR A CB  1 
ATOM   1970 O  OG1 . THR A 1 222 ? 36.201 -22.856 0.300   1.00 23.71 ? 217 THR A OG1 1 
ATOM   1971 C  CG2 . THR A 1 222 ? 36.898 -24.705 1.754   1.00 19.10 ? 217 THR A CG2 1 
ATOM   1972 N  N   . LEU A 1 223 ? 33.516 -21.266 1.720   1.00 18.69 ? 218 LEU A N   1 
ATOM   1973 C  CA  A LEU A 1 223 ? 32.931 -19.936 1.983   0.50 18.56 ? 218 LEU A CA  1 
ATOM   1974 C  CA  B LEU A 1 223 ? 32.901 -19.930 1.980   0.50 18.59 ? 218 LEU A CA  1 
ATOM   1975 C  C   . LEU A 1 223 ? 32.075 -19.774 3.291   1.00 18.59 ? 218 LEU A C   1 
ATOM   1976 O  O   . LEU A 1 223 ? 32.217 -18.803 4.126   1.00 16.57 ? 218 LEU A O   1 
ATOM   1977 C  CB  A LEU A 1 223 ? 32.108 -19.557 0.778   0.50 19.34 ? 218 LEU A CB  1 
ATOM   1978 C  CB  B LEU A 1 223 ? 32.007 -19.568 0.816   0.50 19.76 ? 218 LEU A CB  1 
ATOM   1979 C  CG  A LEU A 1 223 ? 31.513 -18.163 0.888   0.50 18.95 ? 218 LEU A CG  1 
ATOM   1980 C  CG  B LEU A 1 223 ? 31.641 -18.079 0.734   0.50 19.12 ? 218 LEU A CG  1 
ATOM   1981 C  CD1 A LEU A 1 223 ? 32.514 -17.173 0.292   0.50 17.63 ? 218 LEU A CD1 1 
ATOM   1982 C  CD1 B LEU A 1 223 ? 31.353 -17.757 -0.675  0.50 18.55 ? 218 LEU A CD1 1 
ATOM   1983 C  CD2 A LEU A 1 223 ? 30.270 -18.162 0.123   0.50 20.58 ? 218 LEU A CD2 1 
ATOM   1984 C  CD2 B LEU A 1 223 ? 30.507 -17.619 1.668   0.50 17.59 ? 218 LEU A CD2 1 
ATOM   1985 N  N   . ILE A 1 224 ? 31.153 -20.687 3.506   1.00 15.87 ? 219 ILE A N   1 
ATOM   1986 C  CA  A ILE A 1 224 ? 30.366 -20.701 4.737   0.50 15.28 ? 219 ILE A CA  1 
ATOM   1987 C  CA  B ILE A 1 224 ? 30.385 -20.607 4.767   0.50 14.18 ? 219 ILE A CA  1 
ATOM   1988 C  C   . ILE A 1 224 ? 31.278 -21.112 5.881   1.00 13.39 ? 219 ILE A C   1 
ATOM   1989 O  O   . ILE A 1 224 ? 31.118 -20.698 7.039   1.00 12.68 ? 219 ILE A O   1 
ATOM   1990 C  CB  A ILE A 1 224 ? 29.246 -21.716 4.564   0.50 15.02 ? 219 ILE A CB  1 
ATOM   1991 C  CB  B ILE A 1 224 ? 29.056 -21.405 4.757   0.50 12.99 ? 219 ILE A CB  1 
ATOM   1992 C  CG1 A ILE A 1 224 ? 28.615 -21.525 3.182   0.50 18.13 ? 219 ILE A CG1 1 
ATOM   1993 C  CG1 B ILE A 1 224 ? 28.012 -20.784 3.814   0.50 12.39 ? 219 ILE A CG1 1 
ATOM   1994 C  CG2 A ILE A 1 224 ? 28.167 -21.527 5.627   0.50 15.95 ? 219 ILE A CG2 1 
ATOM   1995 C  CG2 B ILE A 1 224 ? 28.419 -21.430 6.148   0.50 13.68 ? 219 ILE A CG2 1 
ATOM   1996 C  CD1 A ILE A 1 224 ? 27.813 -20.303 3.156   0.50 19.09 ? 219 ILE A CD1 1 
ATOM   1997 C  CD1 B ILE A 1 224 ? 27.051 -21.830 3.229   0.50 11.56 ? 219 ILE A CD1 1 
ATOM   1998 N  N   . MET A 1 225 ? 32.234 -21.980 5.556   1.00 13.15 ? 220 MET A N   1 
ATOM   1999 C  CA  . MET A 1 225 ? 33.189 -22.402 6.617   1.00 12.63 ? 220 MET A CA  1 
ATOM   2000 C  C   . MET A 1 225 ? 33.942 -21.162 7.136   1.00 11.80 ? 220 MET A C   1 
ATOM   2001 O  O   . MET A 1 225 ? 34.198 -21.035 8.338   1.00 12.89 ? 220 MET A O   1 
ATOM   2002 C  CB  . MET A 1 225 ? 34.175 -23.437 6.116   1.00 13.35 ? 220 MET A CB  1 
ATOM   2003 C  CG  . MET A 1 225 ? 33.520 -24.852 5.968   1.00 11.42 ? 220 MET A CG  1 
ATOM   2004 S  SD  . MET A 1 225 ? 34.703 -25.954 5.166   1.00 17.11 ? 220 MET A SD  1 
ATOM   2005 C  CE  . MET A 1 225 ? 35.833 -26.281 6.560   1.00 16.03 ? 220 MET A CE  1 
ATOM   2006 N  N   . GLN A 1 226 ? 34.246 -20.214 6.254   1.00 12.80 ? 221 GLN A N   1 
ATOM   2007 C  CA  . GLN A 1 226 ? 34.912 -19.001 6.730   1.00 13.52 ? 221 GLN A CA  1 
ATOM   2008 C  C   . GLN A 1 226 ? 34.007 -18.143 7.626   1.00 12.79 ? 221 GLN A C   1 
ATOM   2009 O  O   . GLN A 1 226 ? 34.493 -17.448 8.536   1.00 12.60 ? 221 GLN A O   1 
ATOM   2010 C  CB  . GLN A 1 226 ? 35.393 -18.166 5.522   1.00 14.28 ? 221 GLN A CB  1 
ATOM   2011 C  CG  . GLN A 1 226 ? 36.165 -16.893 5.947   1.00 17.49 ? 221 GLN A CG  1 
ATOM   2012 C  CD  . GLN A 1 226 ? 37.397 -17.209 6.802   1.00 20.50 ? 221 GLN A CD  1 
ATOM   2013 O  OE1 . GLN A 1 226 ? 38.210 -18.053 6.426   1.00 23.36 ? 221 GLN A OE1 1 
ATOM   2014 N  NE2 . GLN A 1 226 ? 37.570 -16.489 7.926   1.00 23.58 ? 221 GLN A NE2 1 
ATOM   2015 N  N   . LEU A 1 227 ? 32.702 -18.171 7.377   1.00 12.15 ? 222 LEU A N   1 
ATOM   2016 C  CA  . LEU A 1 227 ? 31.767 -17.431 8.270   1.00 11.95 ? 222 LEU A CA  1 
ATOM   2017 C  C   . LEU A 1 227 ? 31.784 -18.057 9.657   1.00 10.61 ? 222 LEU A C   1 
ATOM   2018 O  O   . LEU A 1 227 ? 31.685 -17.329 10.667  1.00 10.50 ? 222 LEU A O   1 
ATOM   2019 C  CB  . LEU A 1 227 ? 30.326 -17.432 7.724   1.00 12.33 ? 222 LEU A CB  1 
ATOM   2020 C  CG  . LEU A 1 227 ? 30.197 -16.850 6.326   1.00 12.14 ? 222 LEU A CG  1 
ATOM   2021 C  CD1 . LEU A 1 227 ? 28.749 -16.988 5.955   1.00 15.23 ? 222 LEU A CD1 1 
ATOM   2022 C  CD2 . LEU A 1 227 ? 30.566 -15.359 6.382   1.00 14.83 ? 222 LEU A CD2 1 
ATOM   2023 N  N   . LEU A 1 228 ? 31.819 -19.406 9.731   1.00 10.71 ? 223 LEU A N   1 
ATOM   2024 C  CA  . LEU A 1 228 ? 31.920 -20.090 11.029  1.00 10.20 ? 223 LEU A CA  1 
ATOM   2025 C  C   . LEU A 1 228 ? 33.208 -19.641 11.698  1.00 11.53 ? 223 LEU A C   1 
ATOM   2026 O  O   . LEU A 1 228 ? 33.201 -19.402 12.921  1.00 12.10 ? 223 LEU A O   1 
ATOM   2027 C  CB  . LEU A 1 228 ? 31.938 -21.621 10.844  1.00 11.16 ? 223 LEU A CB  1 
ATOM   2028 C  CG  . LEU A 1 228 ? 30.581 -22.192 10.416  1.00 10.04 ? 223 LEU A CG  1 
ATOM   2029 C  CD1 . LEU A 1 228 ? 30.806 -23.520 9.788   1.00 14.63 ? 223 LEU A CD1 1 
ATOM   2030 C  CD2 . LEU A 1 228 ? 29.644 -22.350 11.618  1.00 10.10 ? 223 LEU A CD2 1 
ATOM   2031 N  N   . ARG A 1 229 ? 34.337 -19.582 10.917  1.00 12.69 ? 224 ARG A N   1 
ATOM   2032 C  CA  . ARG A 1 229 ? 35.613 -19.198 11.490  1.00 13.36 ? 224 ARG A CA  1 
ATOM   2033 C  C   . ARG A 1 229 ? 35.555 -17.758 11.991  1.00 13.25 ? 224 ARG A C   1 
ATOM   2034 O  O   . ARG A 1 229 ? 36.089 -17.415 13.042  1.00 13.77 ? 224 ARG A O   1 
ATOM   2035 C  CB  . ARG A 1 229 ? 36.732 -19.405 10.478  1.00 13.52 ? 224 ARG A CB  1 
ATOM   2036 C  CG  . ARG A 1 229 ? 38.019 -18.856 10.900  1.00 20.50 ? 224 ARG A CG  1 
ATOM   2037 C  CD  . ARG A 1 229 ? 38.548 -19.524 12.178  1.00 26.53 ? 224 ARG A CD  1 
ATOM   2038 N  NE  . ARG A 1 229 ? 38.663 -20.987 12.068  1.00 32.09 ? 224 ARG A NE  1 
ATOM   2039 C  CZ  . ARG A 1 229 ? 38.601 -21.817 13.120  1.00 33.68 ? 224 ARG A CZ  1 
ATOM   2040 N  NH1 . ARG A 1 229 ? 38.440 -21.322 14.364  1.00 35.34 ? 224 ARG A NH1 1 
ATOM   2041 N  NH2 . ARG A 1 229 ? 38.688 -23.145 12.942  1.00 37.39 ? 224 ARG A NH2 1 
ATOM   2042 N  N   . ASP A 1 230 ? 34.848 -16.925 11.253  1.00 13.38 ? 225 ASP A N   1 
ATOM   2043 C  CA  . ASP A 1 230 ? 34.744 -15.524 11.637  1.00 13.18 ? 225 ASP A CA  1 
ATOM   2044 C  C   . ASP A 1 230 ? 34.051 -15.420 12.966  1.00 11.85 ? 225 ASP A C   1 
ATOM   2045 O  O   . ASP A 1 230 ? 34.457 -14.605 13.849  1.00 12.47 ? 225 ASP A O   1 
ATOM   2046 C  CB  . ASP A 1 230 ? 33.893 -14.787 10.608  1.00 14.40 ? 225 ASP A CB  1 
ATOM   2047 C  CG  . ASP A 1 230 ? 34.602 -14.580 9.250   1.00 17.94 ? 225 ASP A CG  1 
ATOM   2048 O  OD1 . ASP A 1 230 ? 35.870 -14.603 9.189   1.00 17.95 ? 225 ASP A OD1 1 
ATOM   2049 O  OD2 . ASP A 1 230 ? 33.859 -14.319 8.250   1.00 18.97 ? 225 ASP A OD2 1 
ATOM   2050 N  N   . ASN A 1 231 ? 33.000 -16.225 13.162  1.00 10.47 ? 226 ASN A N   1 
ATOM   2051 C  CA  . ASN A 1 231 ? 32.303 -16.141 14.458  1.00 10.51 ? 226 ASN A CA  1 
ATOM   2052 C  C   . ASN A 1 231 ? 33.143 -16.728 15.570  1.00 11.30 ? 226 ASN A C   1 
ATOM   2053 O  O   . ASN A 1 231 ? 33.158 -16.195 16.652  1.00 11.38 ? 226 ASN A O   1 
ATOM   2054 C  CB  . ASN A 1 231 ? 30.934 -16.821 14.413  1.00 10.88 ? 226 ASN A CB  1 
ATOM   2055 C  CG  . ASN A 1 231 ? 29.971 -16.026 13.610  1.00 10.15 ? 226 ASN A CG  1 
ATOM   2056 O  OD1 . ASN A 1 231 ? 30.274 -14.863 13.239  1.00 10.51 ? 226 ASN A OD1 1 
ATOM   2057 N  ND2 . ASN A 1 231 ? 28.792 -16.587 13.382  1.00 9.82  ? 226 ASN A ND2 1 
ATOM   2058 N  N   . LEU A 1 232 ? 33.860 -17.823 15.299  1.00 10.79 ? 227 LEU A N   1 
ATOM   2059 C  CA  . LEU A 1 232 ? 34.726 -18.375 16.347  1.00 11.91 ? 227 LEU A CA  1 
ATOM   2060 C  C   . LEU A 1 232 ? 35.784 -17.354 16.747  1.00 12.24 ? 227 LEU A C   1 
ATOM   2061 O  O   . LEU A 1 232 ? 36.112 -17.216 17.935  1.00 13.96 ? 227 LEU A O   1 
ATOM   2062 C  CB  . LEU A 1 232 ? 35.358 -19.657 15.854  1.00 10.54 ? 227 LEU A CB  1 
ATOM   2063 C  CG  . LEU A 1 232 ? 34.362 -20.822 15.925  1.00 11.60 ? 227 LEU A CG  1 
ATOM   2064 C  CD1 . LEU A 1 232 ? 34.953 -21.929 14.995  1.00 16.65 ? 227 LEU A CD1 1 
ATOM   2065 C  CD2 . LEU A 1 232 ? 34.103 -21.246 17.374  1.00 12.74 ? 227 LEU A CD2 1 
ATOM   2066 N  N   . THR A 1 233 ? 36.306 -16.605 15.778  1.00 12.46 ? 228 THR A N   1 
ATOM   2067 C  CA  . THR A 1 233 ? 37.347 -15.645 16.110  1.00 14.01 ? 228 THR A CA  1 
ATOM   2068 C  C   . THR A 1 233 ? 36.769 -14.492 16.968  1.00 14.24 ? 228 THR A C   1 
ATOM   2069 O  O   . THR A 1 233 ? 37.420 -13.983 17.944  1.00 15.17 ? 228 THR A O   1 
ATOM   2070 C  CB  . THR A 1 233 ? 37.961 -15.111 14.817  1.00 15.13 ? 228 THR A CB  1 
ATOM   2071 O  OG1 . THR A 1 233 ? 38.624 -16.225 14.187  1.00 17.20 ? 228 THR A OG1 1 
ATOM   2072 C  CG2 . THR A 1 233 ? 39.060 -14.096 15.149  1.00 17.63 ? 228 THR A CG2 1 
ATOM   2073 N  N   . LEU A 1 234 ? 35.572 -14.066 16.579  1.00 13.95 ? 229 LEU A N   1 
ATOM   2074 C  CA  A LEU A 1 234 ? 34.894 -13.042 17.342  0.50 13.09 ? 229 LEU A CA  1 
ATOM   2075 C  CA  B LEU A 1 234 ? 34.846 -13.039 17.348  0.50 14.52 ? 229 LEU A CA  1 
ATOM   2076 C  C   . LEU A 1 234 ? 34.550 -13.466 18.784  1.00 13.97 ? 229 LEU A C   1 
ATOM   2077 O  O   . LEU A 1 234 ? 34.694 -12.665 19.776  1.00 16.48 ? 229 LEU A O   1 
ATOM   2078 C  CB  A LEU A 1 234 ? 33.659 -12.616 16.567  0.50 11.62 ? 229 LEU A CB  1 
ATOM   2079 C  CB  B LEU A 1 234 ? 33.525 -12.659 16.660  0.50 14.28 ? 229 LEU A CB  1 
ATOM   2080 C  CG  A LEU A 1 234 ? 32.824 -11.543 17.211  0.50 9.34  ? 229 LEU A CG  1 
ATOM   2081 C  CG  B LEU A 1 234 ? 33.485 -11.664 15.504  0.50 18.03 ? 229 LEU A CG  1 
ATOM   2082 C  CD1 A LEU A 1 234 ? 33.599 -10.220 17.232  0.50 10.58 ? 229 LEU A CD1 1 
ATOM   2083 C  CD1 B LEU A 1 234 ? 32.052 -11.541 14.910  0.50 19.19 ? 229 LEU A CD1 1 
ATOM   2084 C  CD2 A LEU A 1 234 ? 31.533 -11.384 16.410  0.50 11.78 ? 229 LEU A CD2 1 
ATOM   2085 C  CD2 B LEU A 1 234 ? 33.973 -10.314 15.962  0.50 16.44 ? 229 LEU A CD2 1 
ATOM   2086 N  N   . TRP A 1 235 ? 34.136 -14.722 18.950  1.00 14.99 ? 230 TRP A N   1 
ATOM   2087 C  CA  . TRP A 1 235 ? 33.615 -15.154 20.239  1.00 14.05 ? 230 TRP A CA  1 
ATOM   2088 C  C   . TRP A 1 235 ? 34.637 -15.767 21.176  1.00 16.51 ? 230 TRP A C   1 
ATOM   2089 O  O   . TRP A 1 235 ? 34.297 -16.073 22.304  1.00 18.62 ? 230 TRP A O   1 
ATOM   2090 C  CB  . TRP A 1 235 ? 32.531 -16.202 19.945  1.00 14.20 ? 230 TRP A CB  1 
ATOM   2091 C  CG  . TRP A 1 235 ? 31.350 -15.625 19.221  1.00 10.30 ? 230 TRP A CG  1 
ATOM   2092 C  CD1 . TRP A 1 235 ? 30.963 -14.275 19.120  1.00 15.02 ? 230 TRP A CD1 1 
ATOM   2093 C  CD2 . TRP A 1 235 ? 30.376 -16.377 18.531  1.00 11.11 ? 230 TRP A CD2 1 
ATOM   2094 N  NE1 . TRP A 1 235 ? 29.779 -14.190 18.394  1.00 12.86 ? 230 TRP A NE1 1 
ATOM   2095 C  CE2 . TRP A 1 235 ? 29.399 -15.468 18.029  1.00 9.76  ? 230 TRP A CE2 1 
ATOM   2096 C  CE3 . TRP A 1 235 ? 30.221 -17.750 18.280  1.00 11.75 ? 230 TRP A CE3 1 
ATOM   2097 C  CZ2 . TRP A 1 235 ? 28.301 -15.887 17.283  1.00 12.60 ? 230 TRP A CZ2 1 
ATOM   2098 C  CZ3 . TRP A 1 235 ? 29.116 -18.181 17.530  1.00 12.03 ? 230 TRP A CZ3 1 
ATOM   2099 C  CH2 . TRP A 1 235 ? 28.159 -17.257 17.053  1.00 10.81 ? 230 TRP A CH2 1 
ATOM   2100 N  N   . THR A 1 236 ? 35.860 -15.997 20.706  1.00 19.09 ? 231 THR A N   1 
ATOM   2101 C  CA  . THR A 1 236 ? 36.856 -16.707 21.526  1.00 22.90 ? 231 THR A CA  1 
ATOM   2102 C  C   . THR A 1 236 ? 38.121 -15.926 21.680  1.00 25.49 ? 231 THR A C   1 
ATOM   2103 O  O   . THR A 1 236 ? 39.120 -16.313 22.361  1.00 28.17 ? 231 THR A O   1 
ATOM   2104 C  CB  . THR A 1 236 ? 37.129 -18.159 21.004  1.00 22.45 ? 231 THR A CB  1 
ATOM   2105 O  OG1 . THR A 1 236 ? 37.727 -18.113 19.707  1.00 22.41 ? 231 THR A OG1 1 
ATOM   2106 C  CG2 . THR A 1 236 ? 35.818 -18.962 20.917  1.00 23.68 ? 231 THR A CG2 1 
ATOM   2107 O  OXT . THR A 1 236 ? 38.156 -14.851 21.112  1.00 28.07 ? 231 THR A OXT 1 
ATOM   2108 N  N   . LYS B 2 1   ? 32.878 -6.669  12.458  1.00 37.48 ? 369 LYS P N   1 
ATOM   2109 C  CA  . LYS B 2 1   ? 32.539 -6.405  13.875  1.00 35.76 ? 369 LYS P CA  1 
ATOM   2110 C  C   . LYS B 2 1   ? 31.243 -7.146  14.235  1.00 31.69 ? 369 LYS P C   1 
ATOM   2111 O  O   . LYS B 2 1   ? 31.051 -7.497  15.437  1.00 34.27 ? 369 LYS P O   1 
ATOM   2112 C  CB  . LYS B 2 1   ? 32.416 -4.878  14.110  1.00 38.09 ? 369 LYS P CB  1 
ATOM   2113 C  CG  . LYS B 2 1   ? 32.081 -4.411  15.545  1.00 43.23 ? 369 LYS P CG  1 
ATOM   2114 C  CD  . LYS B 2 1   ? 33.350 -4.368  16.458  1.00 50.83 ? 369 LYS P CD  1 
ATOM   2115 C  CE  . LYS B 2 1   ? 32.998 -4.119  17.931  1.00 54.01 ? 369 LYS P CE  1 
ATOM   2116 N  NZ  . LYS B 2 1   ? 32.605 -2.681  18.211  1.00 56.77 ? 369 LYS P NZ  1 
ATOM   2117 N  N   . ARG B 2 2   ? 30.365 -7.389  13.256  1.00 25.02 ? 370 ARG P N   1 
ATOM   2118 C  CA  A ARG B 2 2   ? 29.104 -8.057  13.567  0.50 21.46 ? 370 ARG P CA  1 
ATOM   2119 C  CA  B ARG B 2 2   ? 29.085 -8.052  13.547  0.50 21.05 ? 370 ARG P CA  1 
ATOM   2120 C  C   . ARG B 2 2   ? 29.234 -9.534  13.231  1.00 18.82 ? 370 ARG P C   1 
ATOM   2121 O  O   . ARG B 2 2   ? 29.754 -9.893  12.186  1.00 19.04 ? 370 ARG P O   1 
ATOM   2122 C  CB  A ARG B 2 2   ? 27.899 -7.376  12.875  0.50 22.62 ? 370 ARG P CB  1 
ATOM   2123 C  CB  B ARG B 2 2   ? 27.910 -7.415  12.760  0.50 21.67 ? 370 ARG P CB  1 
ATOM   2124 C  CG  A ARG B 2 2   ? 26.722 -8.310  12.519  0.50 20.65 ? 370 ARG P CG  1 
ATOM   2125 C  CG  B ARG B 2 2   ? 26.470 -7.780  13.245  0.50 17.96 ? 370 ARG P CG  1 
ATOM   2126 C  CD  A ARG B 2 2   ? 25.319 -7.627  12.187  0.50 21.59 ? 370 ARG P CD  1 
ATOM   2127 C  CD  B ARG B 2 2   ? 25.265 -7.124  12.376  0.50 18.13 ? 370 ARG P CD  1 
ATOM   2128 N  NE  A ARG B 2 2   ? 24.666 -7.394  13.452  0.50 21.33 ? 370 ARG P NE  1 
ATOM   2129 N  NE  B ARG B 2 2   ? 24.094 -8.010  12.106  0.50 15.56 ? 370 ARG P NE  1 
ATOM   2130 C  CZ  A ARG B 2 2   ? 23.568 -7.945  13.933  0.50 15.38 ? 370 ARG P CZ  1 
ATOM   2131 C  CZ  B ARG B 2 2   ? 23.842 -8.647  10.911  0.50 18.56 ? 370 ARG P CZ  1 
ATOM   2132 N  NH1 A ARG B 2 2   ? 22.741 -8.703  13.250  0.50 11.34 ? 370 ARG P NH1 1 
ATOM   2133 N  NH1 B ARG B 2 2   ? 24.728 -8.407  9.924   0.50 12.68 ? 370 ARG P NH1 1 
ATOM   2134 N  NH2 A ARG B 2 2   ? 23.273 -7.610  15.148  0.50 16.79 ? 370 ARG P NH2 1 
ATOM   2135 N  NH2 B ARG B 2 2   ? 22.711 -9.516  10.654  0.50 9.39  ? 370 ARG P NH2 1 
ATOM   2136 N  N   . ARG B 2 3   ? 28.804 -10.386 14.152  1.00 14.40 ? 371 ARG P N   1 
ATOM   2137 C  CA  . ARG B 2 3   ? 28.776 -11.820 13.865  1.00 12.29 ? 371 ARG P CA  1 
ATOM   2138 C  C   . ARG B 2 3   ? 28.038 -12.148 12.552  1.00 12.21 ? 371 ARG P C   1 
ATOM   2139 O  O   . ARG B 2 3   ? 27.123 -11.437 12.141  1.00 13.17 ? 371 ARG P O   1 
ATOM   2140 C  CB  . ARG B 2 3   ? 28.191 -12.603 15.033  1.00 13.30 ? 371 ARG P CB  1 
ATOM   2141 C  CG  . ARG B 2 3   ? 26.630 -12.694 15.005  1.00 11.54 ? 371 ARG P CG  1 
ATOM   2142 C  CD  . ARG B 2 3   ? 25.912 -11.344 15.073  1.00 10.32 ? 371 ARG P CD  1 
ATOM   2143 N  NE  . ARG B 2 3   ? 24.455 -11.520 15.076  1.00 10.40 ? 371 ARG P NE  1 
ATOM   2144 C  CZ  . ARG B 2 3   ? 23.738 -11.800 13.996  1.00 10.17 ? 371 ARG P CZ  1 
ATOM   2145 N  NH1 . ARG B 2 3   ? 24.340 -11.867 12.783  1.00 10.93 ? 371 ARG P NH1 1 
ATOM   2146 N  NH2 . ARG B 2 3   ? 22.422 -11.983 14.102  1.00 9.71  ? 371 ARG P NH2 1 
ATOM   2147 N  N   . LYS B 2 4   ? 28.436 -13.263 11.931  1.00 10.92 ? 372 LYS P N   1 
ATOM   2148 C  CA  . LYS B 2 4   ? 27.975 -13.631 10.611  1.00 9.52  ? 372 LYS P CA  1 
ATOM   2149 C  C   . LYS B 2 4   ? 26.791 -14.596 10.718  1.00 10.12 ? 372 LYS P C   1 
ATOM   2150 O  O   . LYS B 2 4   ? 26.736 -15.487 11.577  1.00 10.64 ? 372 LYS P O   1 
ATOM   2151 C  CB  . LYS B 2 4   ? 29.072 -14.395 9.824   1.00 11.94 ? 372 LYS P CB  1 
ATOM   2152 C  CG  . LYS B 2 4   ? 30.393 -13.604 9.678   1.00 13.92 ? 372 LYS P CG  1 
ATOM   2153 C  CD  . LYS B 2 4   ? 30.125 -12.274 9.017   1.00 16.26 ? 372 LYS P CD  1 
ATOM   2154 C  CE  . LYS B 2 4   ? 31.415 -11.392 8.995   1.00 23.83 ? 372 LYS P CE  1 
ATOM   2155 N  NZ  . LYS B 2 4   ? 32.338 -11.928 8.039   1.00 26.56 ? 372 LYS P NZ  1 
HETATM 2156 N  N   . SEP B 2 5   ? 25.838 -14.385 9.815   1.00 9.81  ? 373 SEP P N   1 
HETATM 2157 C  CA  . SEP B 2 5   ? 24.781 -15.361 9.596   1.00 8.84  ? 373 SEP P CA  1 
HETATM 2158 C  CB  . SEP B 2 5   ? 23.488 -14.980 10.318  1.00 9.28  ? 373 SEP P CB  1 
HETATM 2159 O  OG  . SEP B 2 5   ? 23.049 -13.721 9.790   1.00 8.49  ? 373 SEP P OG  1 
HETATM 2160 C  C   . SEP B 2 5   ? 24.564 -15.441 8.106   1.00 9.13  ? 373 SEP P C   1 
HETATM 2161 O  O   . SEP B 2 5   ? 25.180 -14.674 7.377   1.00 10.96 ? 373 SEP P O   1 
HETATM 2162 P  P   . SEP B 2 5   ? 21.554 -13.219 10.178  1.00 9.59  ? 373 SEP P P   1 
HETATM 2163 O  O1P . SEP B 2 5   ? 21.493 -12.937 11.709  1.00 9.97  ? 373 SEP P O1P 1 
HETATM 2164 O  O2P . SEP B 2 5   ? 21.426 -11.905 9.393   1.00 10.99 ? 373 SEP P O2P 1 
HETATM 2165 O  O3P . SEP B 2 5   ? 20.563 -14.363 9.768   1.00 11.35 ? 373 SEP P O3P 1 
ATOM   2166 N  N   . VAL B 2 6   ? 23.774 -16.398 7.623   1.00 8.74  ? 374 VAL P N   1 
ATOM   2167 C  CA  . VAL B 2 6   ? 23.701 -16.592 6.158   1.00 10.48 ? 374 VAL P CA  1 
ATOM   2168 C  C   . VAL B 2 6   ? 22.331 -17.042 5.809   1.00 11.21 ? 374 VAL P C   1 
ATOM   2169 O  O   . VAL B 2 6   ? 21.643 -17.588 6.700   1.00 13.06 ? 374 VAL P O   1 
ATOM   2170 C  CB  . VAL B 2 6   ? 24.751 -17.601 5.636   1.00 10.97 ? 374 VAL P CB  1 
ATOM   2171 C  CG1 . VAL B 2 6   ? 24.442 -19.040 6.087   1.00 11.22 ? 374 VAL P CG1 1 
ATOM   2172 C  CG2 . VAL B 2 6   ? 24.834 -17.529 4.095   1.00 13.36 ? 374 VAL P CG2 1 
ATOM   2173 O  OXT . VAL B 2 6   ? 21.866 -16.882 4.662   1.00 13.80 ? 374 VAL P OXT 1 
HETATM 2174 C  C1  . FSC C 3 .   ? 23.323 -19.170 -0.785  1.00 9.32  ? 249 FSC A C1  1 
HETATM 2175 C  C4  . FSC C 3 .   ? 24.377 -18.365 -0.404  1.00 9.55  ? 249 FSC A C4  1 
HETATM 2176 C  C11 . FSC C 3 .   ? 25.820 -18.689 -0.709  1.00 11.17 ? 249 FSC A C11 1 
HETATM 2177 C  C18 . FSC C 3 .   ? 26.532 -18.855 0.633   1.00 12.73 ? 249 FSC A C18 1 
HETATM 2178 C  C17 . FSC C 3 .   ? 26.406 -17.510 -1.498  1.00 14.66 ? 249 FSC A C17 1 
HETATM 2179 O  O24 . FSC C 3 .   ? 27.693 -18.021 -1.970  1.00 22.38 ? 249 FSC A O24 1 
HETATM 2180 C  C31 . FSC C 3 .   ? 28.400 -17.248 -2.802  1.00 29.16 ? 249 FSC A C31 1 
HETATM 2181 O  O37 . FSC C 3 .   ? 28.032 -16.102 -3.053  1.00 33.00 ? 249 FSC A O37 1 
HETATM 2182 C  C36 . FSC C 3 .   ? 29.714 -17.863 -3.349  1.00 33.19 ? 249 FSC A C36 1 
HETATM 2183 C  C10 . FSC C 3 .   ? 23.916 -17.144 0.350   1.00 10.31 ? 249 FSC A C10 1 
HETATM 2184 C  C6  . FSC C 3 .   ? 22.453 -17.061 -0.204  1.00 10.86 ? 249 FSC A C6  1 
HETATM 2185 O  O13 . FSC C 3 .   ? 21.611 -16.215 0.614   1.00 12.01 ? 249 FSC A O13 1 
HETATM 2186 C  C2  . FSC C 3 .   ? 22.001 -18.550 -0.297  1.00 9.36  ? 249 FSC A C2  1 
HETATM 2187 C  C7  . FSC C 3 .   ? 20.827 -18.696 -1.372  1.00 8.24  ? 249 FSC A C7  1 
HETATM 2188 C  C5  . FSC C 3 .   ? 21.478 -19.001 0.944   1.00 7.80  ? 249 FSC A C5  1 
HETATM 2189 C  C12 . FSC C 3 .   ? 21.858 -20.042 1.786   1.00 7.66  ? 249 FSC A C12 1 
HETATM 2190 C  C20 . FSC C 3 .   ? 21.143 -20.399 3.129   1.00 7.48  ? 249 FSC A C20 1 
HETATM 2191 C  C27 . FSC C 3 .   ? 19.644 -20.505 2.855   1.00 9.34  ? 249 FSC A C27 1 
HETATM 2192 O  O32 . FSC C 3 .   ? 19.070 -20.834 4.112   1.00 8.37  ? 249 FSC A O32 1 
HETATM 2193 C  C38 . FSC C 3 .   ? 17.640 -20.933 3.917   1.00 9.93  ? 249 FSC A C38 1 
HETATM 2194 C  C26 . FSC C 3 .   ? 21.832 -21.728 3.626   1.00 8.40  ? 249 FSC A C26 1 
HETATM 2195 C  C25 . FSC C 3 .   ? 23.276 -21.517 3.079   1.00 10.01 ? 249 FSC A C25 1 
HETATM 2196 C  C19 . FSC C 3 .   ? 23.124 -20.894 1.658   1.00 9.18  ? 249 FSC A C19 1 
HETATM 2197 C  C15 . FSC C 3 .   ? 23.028 -22.040 0.553   1.00 10.09 ? 249 FSC A C15 1 
HETATM 2198 C  C23 . FSC C 3 .   ? 21.556 -22.440 0.148   1.00 9.74  ? 249 FSC A C23 1 
HETATM 2199 C  C9  . FSC C 3 .   ? 23.905 -21.679 -0.684  1.00 10.41 ? 249 FSC A C9  1 
HETATM 2200 O  O16 . FSC C 3 .   ? 23.976 -22.831 -1.530  1.00 12.47 ? 249 FSC A O16 1 
HETATM 2201 C  C3  . FSC C 3 .   ? 23.324 -20.511 -1.550  1.00 11.56 ? 249 FSC A C3  1 
HETATM 2202 O  O8  . FSC C 3 .   ? 24.204 -20.290 -2.683  1.00 11.95 ? 249 FSC A O8  1 
HETATM 2203 C  C14 . FSC C 3 .   ? 23.572 -20.492 -3.944  1.00 13.74 ? 249 FSC A C14 1 
HETATM 2204 O  O22 . FSC C 3 .   ? 22.788 -19.359 -4.303  1.00 15.18 ? 249 FSC A O22 1 
HETATM 2205 C  C30 . FSC C 3 .   ? 23.436 -18.110 -4.333  1.00 18.45 ? 249 FSC A C30 1 
HETATM 2206 C  C33 . FSC C 3 .   ? 24.610 -18.087 -5.263  1.00 21.12 ? 249 FSC A C33 1 
HETATM 2207 O  O39 . FSC C 3 .   ? 25.315 -16.837 -5.065  1.00 26.72 ? 249 FSC A O39 1 
HETATM 2208 C  C28 . FSC C 3 .   ? 25.528 -19.322 -4.994  1.00 19.99 ? 249 FSC A C28 1 
HETATM 2209 O  O34 . FSC C 3 .   ? 26.394 -19.480 -6.135  1.00 25.63 ? 249 FSC A O34 1 
HETATM 2210 C  C40 . FSC C 3 .   ? 27.718 -19.510 -5.967  1.00 34.18 ? 249 FSC A C40 1 
HETATM 2211 O  O43 . FSC C 3 .   ? 28.136 -19.526 -4.805  1.00 38.04 ? 249 FSC A O43 1 
HETATM 2212 C  C42 . FSC C 3 .   ? 28.651 -19.548 -7.214  1.00 37.14 ? 249 FSC A C42 1 
HETATM 2213 C  C21 . FSC C 3 .   ? 24.636 -20.590 -4.991  1.00 17.21 ? 249 FSC A C21 1 
HETATM 2214 O  O29 . FSC C 3 .   ? 25.366 -21.793 -4.760  1.00 17.84 ? 249 FSC A O29 1 
HETATM 2215 C  C35 . FSC C 3 .   ? 22.398 -17.021 -4.701  1.00 19.73 ? 249 FSC A C35 1 
HETATM 2216 O  O41 . FSC C 3 .   ? 21.908 -17.322 -6.019  1.00 23.17 ? 249 FSC A O41 1 
HETATM 2217 C  C44 . FSC C 3 .   ? 21.256 -16.212 -6.662  1.00 25.18 ? 249 FSC A C44 1 
HETATM 2218 C  C47 . FSC C 3 .   ? 19.849 -16.001 -6.053  1.00 24.79 ? 249 FSC A C47 1 
HETATM 2219 C  C46 . FSC C 3 .   ? 21.165 -16.451 -8.168  1.00 28.22 ? 249 FSC A C46 1 
HETATM 2220 C  C45 . FSC C 3 .   ? 21.983 -15.024 -6.535  1.00 29.50 ? 249 FSC A C45 1 
HETATM 2221 C  C48 . FSC C 3 .   ? 23.345 -15.020 -6.840  1.00 34.22 ? 249 FSC A C48 1 
HETATM 2222 CL CL  . CL  D 4 .   ? 5.771  6.427   13.497  1.00 14.79 ? 250 CL  A CL  1 
HETATM 2223 MG MG  . MG  E 5 .   ? 22.178 -37.211 1.082   1.00 16.80 ? 251 MG  A MG  1 
HETATM 2224 MG MG  . MG  F 5 .   ? 0.000  -21.055 -15.588 0.50 10.72 ? 252 MG  A MG  1 
HETATM 2225 O  O   . HOH G 6 .   ? 23.955 -30.136 21.660  1.00 12.23 ? 253 HOH A O   1 
HETATM 2226 O  O   . HOH G 6 .   ? 10.903 -18.597 -15.470 1.00 13.61 ? 254 HOH A O   1 
HETATM 2227 O  O   . HOH G 6 .   ? 20.606 -22.964 23.698  1.00 13.97 ? 255 HOH A O   1 
HETATM 2228 O  O   . HOH G 6 .   ? 30.173 -30.194 20.017  1.00 28.19 ? 256 HOH A O   1 
HETATM 2229 O  O   . HOH G 6 .   ? 22.053 -1.148  12.264  1.00 18.30 ? 257 HOH A O   1 
HETATM 2230 O  O   . HOH G 6 .   ? 4.098  3.184   16.073  1.00 17.74 ? 258 HOH A O   1 
HETATM 2231 O  O   . HOH G 6 .   ? 25.878 -11.484 19.409  1.00 22.48 ? 259 HOH A O   1 
HETATM 2232 O  O   . HOH G 6 .   ? 13.626 -22.654 24.133  1.00 21.94 ? 260 HOH A O   1 
HETATM 2233 O  O   . HOH G 6 .   ? 19.555 -15.259 -11.154 1.00 27.92 ? 261 HOH A O   1 
HETATM 2234 O  O   . HOH G 6 .   ? 11.056 -22.137 27.313  1.00 23.36 ? 262 HOH A O   1 
HETATM 2235 O  O   . HOH G 6 .   ? 16.610 11.576  19.789  1.00 30.34 ? 263 HOH A O   1 
HETATM 2236 O  O   . HOH G 6 .   ? 18.416 9.085   22.209  1.00 31.49 ? 264 HOH A O   1 
HETATM 2237 O  O   . HOH G 6 .   ? 3.139  -24.869 -1.025  1.00 32.64 ? 265 HOH A O   1 
HETATM 2238 O  O   . HOH G 6 .   ? 14.719 -5.014  23.035  1.00 31.01 ? 266 HOH A O   1 
HETATM 2239 O  O   . HOH G 6 .   ? 8.296  -14.889 27.757  1.00 32.00 ? 267 HOH A O   1 
HETATM 2240 O  O   . HOH G 6 .   ? 20.504 -7.382  10.077  1.00 23.16 ? 268 HOH A O   1 
HETATM 2241 O  O   . HOH G 6 .   ? 19.999 16.697  29.265  1.00 30.19 ? 269 HOH A O   1 
HETATM 2242 O  O   . HOH G 6 .   ? 39.279 -15.387 11.721  1.00 33.32 ? 270 HOH A O   1 
HETATM 2243 O  O   . HOH G 6 .   ? 11.746 -3.480  -4.585  1.00 10.61 ? 271 HOH A O   1 
HETATM 2244 O  O   . HOH G 6 .   ? 39.148 -24.255 25.934  1.00 18.48 ? 272 HOH A O   1 
HETATM 2245 O  O   . HOH G 6 .   ? 19.865 -36.392 0.753   1.00 26.60 ? 273 HOH A O   1 
HETATM 2246 O  O   . HOH G 6 .   ? 4.851  -22.879 -7.027  1.00 8.79  ? 274 HOH A O   1 
HETATM 2247 O  O   . HOH G 6 .   ? 15.365 -15.976 3.966   1.00 12.15 ? 275 HOH A O   1 
HETATM 2248 O  O   . HOH G 6 .   ? 20.661 -27.256 23.138  1.00 25.60 ? 276 HOH A O   1 
HETATM 2249 O  O   . HOH G 6 .   ? -1.660 -22.453 -3.919  1.00 12.02 ? 277 HOH A O   1 
HETATM 2250 O  O   . HOH G 6 .   ? 14.600 -8.814  14.083  1.00 10.77 ? 278 HOH A O   1 
HETATM 2251 O  O   . HOH G 6 .   ? 3.103  -11.079 -3.643  1.00 14.58 ? 279 HOH A O   1 
HETATM 2252 O  O   . HOH G 6 .   ? 1.220  -20.480 -13.531 1.00 13.04 ? 280 HOH A O   1 
HETATM 2253 O  O   . HOH G 6 .   ? 1.558  -22.528 -11.629 1.00 12.40 ? 281 HOH A O   1 
HETATM 2254 O  O   . HOH G 6 .   ? 27.988 -19.208 14.185  1.00 12.47 ? 282 HOH A O   1 
HETATM 2255 O  O   . HOH G 6 .   ? 19.141 -16.405 1.537   1.00 11.91 ? 283 HOH A O   1 
HETATM 2256 O  O   . HOH G 6 .   ? 0.067  -16.761 -6.957  1.00 14.47 ? 284 HOH A O   1 
HETATM 2257 O  O   . HOH G 6 .   ? 10.771 -18.516 -18.244 1.00 34.38 ? 285 HOH A O   1 
HETATM 2258 O  O   . HOH G 6 .   ? 15.482 -6.261  14.498  1.00 11.36 ? 286 HOH A O   1 
HETATM 2259 O  O   . HOH G 6 .   ? 30.837 -34.464 16.634  1.00 14.30 ? 287 HOH A O   1 
HETATM 2260 O  O   . HOH G 6 .   ? 12.467 -30.056 16.954  1.00 23.50 ? 288 HOH A O   1 
HETATM 2261 O  O   . HOH G 6 .   ? 21.880 -25.285 27.330  1.00 34.25 ? 289 HOH A O   1 
HETATM 2262 O  O   . HOH G 6 .   ? 10.138 7.727   22.676  1.00 18.53 ? 290 HOH A O   1 
HETATM 2263 O  O   . HOH G 6 .   ? 17.239 -28.125 20.610  1.00 17.93 ? 291 HOH A O   1 
HETATM 2264 O  O   . HOH G 6 .   ? 18.395 -10.895 7.130   1.00 16.07 ? 292 HOH A O   1 
HETATM 2265 O  O   . HOH G 6 .   ? 7.577  -7.730  -0.745  1.00 13.96 ? 293 HOH A O   1 
HETATM 2266 O  O   . HOH G 6 .   ? 5.274  -5.790  6.838   1.00 18.32 ? 294 HOH A O   1 
HETATM 2267 O  O   . HOH G 6 .   ? 8.372  -10.510 17.821  1.00 13.57 ? 295 HOH A O   1 
HETATM 2268 O  O   . HOH G 6 .   ? 9.398  -26.897 -2.400  1.00 11.71 ? 296 HOH A O   1 
HETATM 2269 O  O   . HOH G 6 .   ? 19.820 -13.411 15.906  1.00 10.91 ? 297 HOH A O   1 
HETATM 2270 O  O   . HOH G 6 .   ? 33.044 -28.403 21.719  1.00 28.15 ? 298 HOH A O   1 
HETATM 2271 O  O   . HOH G 6 .   ? 17.599 -26.444 -1.510  1.00 20.33 ? 299 HOH A O   1 
HETATM 2272 O  O   . HOH G 6 .   ? 2.303  -20.316 -19.881 1.00 19.57 ? 300 HOH A O   1 
HETATM 2273 O  O   . HOH G 6 .   ? 10.937 -4.500  20.944  1.00 15.69 ? 301 HOH A O   1 
HETATM 2274 O  O   . HOH G 6 .   ? 23.806 -3.358  11.567  1.00 41.66 ? 302 HOH A O   1 
HETATM 2275 O  O   . HOH G 6 .   ? 3.296  0.492   15.344  1.00 27.00 ? 303 HOH A O   1 
HETATM 2276 O  O   . HOH G 6 .   ? 29.921 -29.901 9.201   1.00 13.81 ? 304 HOH A O   1 
HETATM 2277 O  O   . HOH G 6 .   ? 20.991 -9.097  6.571   1.00 37.15 ? 305 HOH A O   1 
HETATM 2278 O  O   . HOH G 6 .   ? 14.495 -12.155 -18.213 1.00 24.59 ? 306 HOH A O   1 
HETATM 2279 O  O   . HOH G 6 .   ? 19.127 -12.705 -10.843 1.00 18.36 ? 307 HOH A O   1 
HETATM 2280 O  O   . HOH G 6 .   ? 14.302 -29.450 -5.518  1.00 18.99 ? 308 HOH A O   1 
HETATM 2281 O  O   . HOH G 6 .   ? 3.854  -26.556 5.358   1.00 18.89 ? 309 HOH A O   1 
HETATM 2282 O  O   . HOH G 6 .   ? 18.086 -7.124  14.813  1.00 14.04 ? 310 HOH A O   1 
HETATM 2283 O  O   . HOH G 6 .   ? 13.584 -17.698 -15.200 1.00 16.84 ? 311 HOH A O   1 
HETATM 2284 O  O   . HOH G 6 .   ? 25.583 -10.865 21.907  1.00 33.24 ? 312 HOH A O   1 
HETATM 2285 O  O   . HOH G 6 .   ? 14.810 -23.819 -11.369 1.00 23.51 ? 313 HOH A O   1 
HETATM 2286 O  O   . HOH G 6 .   ? -2.036 -18.426 -6.739  1.00 17.47 ? 314 HOH A O   1 
HETATM 2287 O  O   . HOH G 6 .   ? 22.990 -27.256 19.275  1.00 19.14 ? 315 HOH A O   1 
HETATM 2288 O  O   . HOH G 6 .   ? 14.996 -13.052 -15.647 1.00 15.13 ? 316 HOH A O   1 
HETATM 2289 O  O   . HOH G 6 .   ? 19.669 -0.941  -8.919  1.00 18.78 ? 317 HOH A O   1 
HETATM 2290 O  O   . HOH G 6 .   ? 5.315  -17.001 -18.708 1.00 18.31 ? 318 HOH A O   1 
HETATM 2291 O  O   . HOH G 6 .   ? 15.392 -32.463 -4.556  1.00 17.47 ? 319 HOH A O   1 
HETATM 2292 O  O   . HOH G 6 .   ? 4.271  -20.540 -15.847 1.00 12.77 ? 320 HOH A O   1 
HETATM 2293 O  O   . HOH G 6 .   ? 27.453 -29.689 13.163  1.00 13.64 ? 321 HOH A O   1 
HETATM 2294 O  O   . HOH G 6 .   ? 4.126  6.655   11.020  1.00 23.31 ? 322 HOH A O   1 
HETATM 2295 O  O   . HOH G 6 .   ? 12.246 -21.840 -12.786 1.00 15.16 ? 323 HOH A O   1 
HETATM 2296 O  O   . HOH G 6 .   ? 14.209 -3.599  4.003   1.00 20.92 ? 324 HOH A O   1 
HETATM 2297 O  O   . HOH G 6 .   ? 12.282 -20.564 25.372  1.00 19.34 ? 325 HOH A O   1 
HETATM 2298 O  O   . HOH G 6 .   ? -0.203 -23.962 -1.909  1.00 18.42 ? 326 HOH A O   1 
HETATM 2299 O  O   . HOH G 6 .   ? 28.812 -31.295 11.359  1.00 21.06 ? 327 HOH A O   1 
HETATM 2300 O  O   . HOH G 6 .   ? 4.961  -29.440 -7.312  1.00 22.48 ? 328 HOH A O   1 
HETATM 2301 O  O   . HOH G 6 .   ? 26.995 -30.674 15.623  1.00 25.59 ? 329 HOH A O   1 
HETATM 2302 O  O   . HOH G 6 .   ? 6.129  -10.048 0.358   1.00 15.31 ? 330 HOH A O   1 
HETATM 2303 O  O   . HOH G 6 .   ? -0.635 -23.002 -10.091 1.00 24.95 ? 331 HOH A O   1 
HETATM 2304 O  O   . HOH G 6 .   ? 20.949 -20.054 -6.758  1.00 21.85 ? 332 HOH A O   1 
HETATM 2305 O  O   . HOH G 6 .   ? 4.282  -0.470  10.778  1.00 26.30 ? 333 HOH A O   1 
HETATM 2306 O  O   . HOH G 6 .   ? 21.944 -14.654 24.277  1.00 25.08 ? 334 HOH A O   1 
HETATM 2307 O  O   . HOH G 6 .   ? 39.312 -13.571 19.003  1.00 53.82 ? 335 HOH A O   1 
HETATM 2308 O  O   . HOH G 6 .   ? -2.047 -10.571 -10.326 1.00 27.83 ? 336 HOH A O   1 
HETATM 2309 O  O   . HOH G 6 .   ? 19.229 -7.494  17.233  1.00 18.79 ? 337 HOH A O   1 
HETATM 2310 O  O   . HOH G 6 .   ? 18.942 -26.129 21.705  1.00 17.89 ? 338 HOH A O   1 
HETATM 2311 O  O   . HOH G 6 .   ? 34.373 -24.570 -9.719  1.00 42.00 ? 339 HOH A O   1 
HETATM 2312 O  O   . HOH G 6 .   ? 1.587  -21.747 -1.122  1.00 26.98 ? 340 HOH A O   1 
HETATM 2313 O  O   . HOH G 6 .   ? 29.027 -31.132 -0.072  1.00 18.33 ? 341 HOH A O   1 
HETATM 2314 O  O   . HOH G 6 .   ? 26.676 -22.830 -2.375  1.00 27.44 ? 342 HOH A O   1 
HETATM 2315 O  O   . HOH G 6 .   ? 9.005  -24.324 15.225  1.00 19.83 ? 343 HOH A O   1 
HETATM 2316 O  O   . HOH G 6 .   ? 7.431  -27.717 -0.914  1.00 15.03 ? 344 HOH A O   1 
HETATM 2317 O  O   . HOH G 6 .   ? 29.938 -20.458 -3.295  1.00 31.84 ? 345 HOH A O   1 
HETATM 2318 O  O   . HOH G 6 .   ? -0.787 -14.951 -5.309  1.00 26.42 ? 346 HOH A O   1 
HETATM 2319 O  O   . HOH G 6 .   ? 8.244  6.875   24.982  1.00 29.50 ? 347 HOH A O   1 
HETATM 2320 O  O   . HOH G 6 .   ? 3.297  4.889   14.230  1.00 26.36 ? 348 HOH A O   1 
HETATM 2321 O  O   . HOH G 6 .   ? 18.628 -18.783 -7.463  1.00 20.02 ? 349 HOH A O   1 
HETATM 2322 O  O   . HOH G 6 .   ? 4.250  -23.805 -3.201  1.00 15.93 ? 350 HOH A O   1 
HETATM 2323 O  O   . HOH G 6 .   ? 32.191 -14.874 23.619  1.00 22.22 ? 351 HOH A O   1 
HETATM 2324 O  O   . HOH G 6 .   ? 17.619 -12.237 -15.228 1.00 22.84 ? 352 HOH A O   1 
HETATM 2325 O  O   . HOH G 6 .   ? 6.974  -10.029 20.155  1.00 28.68 ? 353 HOH A O   1 
HETATM 2326 O  O   . HOH G 6 .   ? 8.972  15.152  20.567  1.00 15.40 ? 354 HOH A O   1 
HETATM 2327 O  O   . HOH G 6 .   ? 2.072  -22.131 -15.613 1.00 30.53 ? 355 HOH A O   1 
HETATM 2328 O  O   . HOH G 6 .   ? 32.000 -24.269 24.089  1.00 22.90 ? 356 HOH A O   1 
HETATM 2329 O  O   . HOH G 6 .   ? -2.598 -18.226 -9.454  1.00 15.26 ? 357 HOH A O   1 
HETATM 2330 O  O   . HOH G 6 .   ? 7.640  -21.632 -13.421 1.00 13.87 ? 358 HOH A O   1 
HETATM 2331 O  O   . HOH G 6 .   ? 11.341 -10.644 -21.246 1.00 20.72 ? 359 HOH A O   1 
HETATM 2332 O  O   . HOH G 6 .   ? 22.601 -34.782 0.593   1.00 22.62 ? 360 HOH A O   1 
HETATM 2333 O  O   . HOH G 6 .   ? 10.080 -20.510 31.749  1.00 24.69 ? 361 HOH A O   1 
HETATM 2334 O  O   . HOH G 6 .   ? -2.400 -7.126  -9.751  1.00 21.88 ? 362 HOH A O   1 
HETATM 2335 O  O   . HOH G 6 .   ? 11.364 -29.287 -5.793  1.00 21.76 ? 363 HOH A O   1 
HETATM 2336 O  O   . HOH G 6 .   ? 6.607  -11.309 22.980  1.00 33.62 ? 364 HOH A O   1 
HETATM 2337 O  O   . HOH G 6 .   ? 7.156  -29.880 -8.709  1.00 31.07 ? 365 HOH A O   1 
HETATM 2338 O  O   . HOH G 6 .   ? 19.304 -24.443 -1.811  1.00 19.19 ? 366 HOH A O   1 
HETATM 2339 O  O   . HOH G 6 .   ? 7.615  -27.367 11.232  1.00 42.49 ? 367 HOH A O   1 
HETATM 2340 O  O   . HOH G 6 .   ? 28.437 -11.632 18.553  1.00 19.24 ? 368 HOH A O   1 
HETATM 2341 O  O   . HOH G 6 .   ? 2.979  -6.970  12.190  1.00 25.06 ? 369 HOH A O   1 
HETATM 2342 O  O   . HOH G 6 .   ? 2.209  -15.567 3.929   1.00 19.16 ? 370 HOH A O   1 
HETATM 2343 O  O   . HOH G 6 .   ? 25.663 -16.385 -8.056  1.00 45.58 ? 371 HOH A O   1 
HETATM 2344 O  O   . HOH G 6 .   ? 0.205  -19.269 1.778   1.00 27.36 ? 372 HOH A O   1 
HETATM 2345 O  O   . HOH G 6 .   ? 7.618  16.851  19.823  1.00 26.54 ? 373 HOH A O   1 
HETATM 2346 O  O   . HOH G 6 .   ? 4.521  -8.325  4.842   1.00 29.38 ? 374 HOH A O   1 
HETATM 2347 O  O   . HOH G 6 .   ? 18.508 -0.680  6.921   1.00 21.67 ? 375 HOH A O   1 
HETATM 2348 O  O   . HOH G 6 .   ? 13.591 -2.877  -2.215  1.00 28.57 ? 376 HOH A O   1 
HETATM 2349 O  O   . HOH G 6 .   ? 5.376  -4.780  17.479  1.00 29.04 ? 377 HOH A O   1 
HETATM 2350 O  O   . HOH G 6 .   ? 34.086 -14.095 5.678   1.00 26.77 ? 378 HOH A O   1 
HETATM 2351 O  O   . HOH G 6 .   ? 15.078 -15.687 -16.402 1.00 18.97 ? 379 HOH A O   1 
HETATM 2352 O  O   . HOH G 6 .   ? 1.933  -10.578 7.646   1.00 23.88 ? 380 HOH A O   1 
HETATM 2353 O  O   . HOH G 6 .   ? 3.011  -1.072  17.459  1.00 37.71 ? 381 HOH A O   1 
HETATM 2354 O  O   . HOH G 6 .   ? 12.378 7.054   23.877  1.00 28.03 ? 382 HOH A O   1 
HETATM 2355 O  O   . HOH G 6 .   ? 35.860 -12.367 13.126  1.00 27.48 ? 383 HOH A O   1 
HETATM 2356 O  O   . HOH G 6 .   ? 38.744 -38.627 -1.740  1.00 29.97 ? 384 HOH A O   1 
HETATM 2357 O  O   . HOH G 6 .   ? 11.078 4.048   24.936  1.00 25.76 ? 385 HOH A O   1 
HETATM 2358 O  O   . HOH G 6 .   ? 14.215 -0.676  21.854  1.00 22.72 ? 386 HOH A O   1 
HETATM 2359 O  O   . HOH G 6 .   ? 33.062 -16.106 3.799   1.00 20.12 ? 387 HOH A O   1 
HETATM 2360 O  O   . HOH G 6 .   ? 21.559 -25.368 24.621  1.00 24.57 ? 388 HOH A O   1 
HETATM 2361 O  O   . HOH G 6 .   ? 6.286  -9.061  2.985   1.00 22.50 ? 389 HOH A O   1 
HETATM 2362 O  O   . HOH G 6 .   ? 33.581 -35.188 8.583   1.00 23.88 ? 390 HOH A O   1 
HETATM 2363 O  O   . HOH G 6 .   ? 23.157 -23.022 27.641  1.00 21.49 ? 391 HOH A O   1 
HETATM 2364 O  O   . HOH G 6 .   ? 18.685 -17.721 -10.036 1.00 27.54 ? 392 HOH A O   1 
HETATM 2365 O  O   . HOH G 6 .   ? 9.326  -26.576 13.534  1.00 27.33 ? 393 HOH A O   1 
HETATM 2366 O  O   . HOH G 6 .   ? 23.291 -29.066 17.372  1.00 33.44 ? 394 HOH A O   1 
HETATM 2367 O  O   . HOH G 6 .   ? 30.399 -26.545 -5.354  1.00 38.70 ? 395 HOH A O   1 
HETATM 2368 O  O   . HOH G 6 .   ? 30.671 -26.171 28.172  1.00 21.99 ? 396 HOH A O   1 
HETATM 2369 O  O   . HOH G 6 .   ? 17.798 -7.592  19.599  1.00 19.68 ? 397 HOH A O   1 
HETATM 2370 O  O   . HOH G 6 .   ? 0.636  -16.828 1.697   1.00 26.48 ? 398 HOH A O   1 
HETATM 2371 O  O   . HOH G 6 .   ? 25.993 -25.135 -3.881  1.00 33.15 ? 399 HOH A O   1 
HETATM 2372 O  O   . HOH G 6 .   ? 6.012  -12.004 17.166  1.00 25.35 ? 400 HOH A O   1 
HETATM 2373 O  O   . HOH G 6 .   ? 9.090  -23.304 25.741  1.00 25.02 ? 401 HOH A O   1 
HETATM 2374 O  O   . HOH G 6 .   ? 22.044 -24.050 -3.252  1.00 26.11 ? 402 HOH A O   1 
HETATM 2375 O  O   . HOH G 6 .   ? 0.787  -12.622 6.988   1.00 39.25 ? 403 HOH A O   1 
HETATM 2376 O  O   . HOH G 6 .   ? 24.075 -12.130 -7.796  1.00 47.41 ? 404 HOH A O   1 
HETATM 2377 O  O   . HOH G 6 .   ? 36.018 -30.510 16.873  1.00 24.60 ? 405 HOH A O   1 
HETATM 2378 O  O   . HOH G 6 .   ? 22.462 -7.812  -0.477  1.00 45.38 ? 406 HOH A O   1 
HETATM 2379 O  O   . HOH G 6 .   ? 21.126 -10.423 -4.408  1.00 24.85 ? 407 HOH A O   1 
HETATM 2380 O  O   . HOH G 6 .   ? 8.323  -7.482  1.859   1.00 23.24 ? 408 HOH A O   1 
HETATM 2381 O  O   . HOH G 6 .   ? 19.760 14.436  26.161  1.00 29.75 ? 409 HOH A O   1 
HETATM 2382 O  O   . HOH G 6 .   ? 18.134 16.262  30.984  1.00 41.24 ? 410 HOH A O   1 
HETATM 2383 O  O   . HOH G 6 .   ? 21.932 -31.172 17.187  1.00 28.34 ? 411 HOH A O   1 
HETATM 2384 O  O   . HOH G 6 .   ? 20.171 -36.892 13.141  1.00 24.36 ? 412 HOH A O   1 
HETATM 2385 O  O   . HOH G 6 .   ? 14.880 -20.847 -12.144 1.00 35.14 ? 413 HOH A O   1 
HETATM 2386 O  O   . HOH G 6 .   ? 20.666 -1.718  18.716  1.00 28.06 ? 414 HOH A O   1 
HETATM 2387 O  O   . HOH G 6 .   ? 36.980 -10.614 15.150  1.00 41.81 ? 415 HOH A O   1 
HETATM 2388 O  O   . HOH G 6 .   ? 40.211 -16.613 9.509   1.00 36.65 ? 416 HOH A O   1 
HETATM 2389 O  O   . HOH G 6 .   ? 22.906 -0.022  14.642  1.00 33.17 ? 417 HOH A O   1 
HETATM 2390 O  O   . HOH G 6 .   ? 16.461 -36.794 0.801   1.00 31.33 ? 418 HOH A O   1 
HETATM 2391 O  O   . HOH G 6 .   ? 18.229 -2.583  -2.449  1.00 31.78 ? 419 HOH A O   1 
HETATM 2392 O  O   . HOH G 6 .   ? 28.200 -29.441 18.595  1.00 35.96 ? 420 HOH A O   1 
HETATM 2393 O  O   . HOH G 6 .   ? 5.959  -3.986  19.357  1.00 18.31 ? 421 HOH A O   1 
HETATM 2394 O  O   . HOH G 6 .   ? 13.172 -30.191 19.409  1.00 29.48 ? 422 HOH A O   1 
HETATM 2395 O  O   . HOH G 6 .   ? 34.985 -17.432 24.747  1.00 30.84 ? 423 HOH A O   1 
HETATM 2396 O  O   . HOH G 6 .   ? 22.452 -13.367 0.000   1.00 35.25 ? 424 HOH A O   1 
HETATM 2397 O  O   . HOH G 6 .   ? 7.239  -4.178  4.779   1.00 37.73 ? 425 HOH A O   1 
HETATM 2398 O  O   . HOH G 6 .   ? 12.565 -2.897  22.385  1.00 23.35 ? 426 HOH A O   1 
HETATM 2399 O  O   . HOH G 6 .   ? 6.392  15.108  21.491  1.00 24.24 ? 427 HOH A O   1 
HETATM 2400 O  O   . HOH G 6 .   ? 13.609 9.995   22.620  1.00 29.04 ? 428 HOH A O   1 
HETATM 2401 O  O   . HOH G 6 .   ? 21.688 -26.369 -2.449  1.00 31.70 ? 429 HOH A O   1 
HETATM 2402 O  O   . HOH G 6 .   ? 29.926 -28.622 -1.295  1.00 22.38 ? 430 HOH A O   1 
HETATM 2403 O  O   . HOH G 6 .   ? 33.039 -20.361 29.654  1.00 30.57 ? 431 HOH A O   1 
HETATM 2404 O  O   . HOH G 6 .   ? 16.172 10.857  22.310  1.00 33.86 ? 432 HOH A O   1 
HETATM 2405 O  O   . HOH G 6 .   ? 9.838  -1.704  -3.987  1.00 26.30 ? 433 HOH A O   1 
HETATM 2406 O  O   . HOH G 6 .   ? 7.587  -34.393 -4.402  1.00 25.42 ? 434 HOH A O   1 
HETATM 2407 O  O   . HOH G 6 .   ? 3.868  -9.437  -1.017  1.00 22.79 ? 435 HOH A O   1 
HETATM 2408 O  O   . HOH G 6 .   ? 2.694  0.444   12.694  1.00 29.87 ? 436 HOH A O   1 
HETATM 2409 O  O   . HOH G 6 .   ? 17.023 12.309  24.382  1.00 26.92 ? 437 HOH A O   1 
HETATM 2410 O  O   . HOH G 6 .   ? 37.608 -13.493 10.989  1.00 33.58 ? 438 HOH A O   1 
HETATM 2411 O  O   . HOH G 6 .   ? 13.096 10.687  25.361  1.00 30.11 ? 439 HOH A O   1 
HETATM 2412 O  O   . HOH G 6 .   ? 5.514  14.914  24.342  1.00 27.76 ? 440 HOH A O   1 
HETATM 2413 O  O   . HOH G 6 .   ? -1.747 -13.812 -1.260  1.00 34.92 ? 441 HOH A O   1 
HETATM 2414 O  O   . HOH G 6 .   ? 19.367 -18.210 29.806  1.00 27.97 ? 442 HOH A O   1 
HETATM 2415 O  O   . HOH G 6 .   ? -3.213 -15.625 -4.879  1.00 63.85 ? 443 HOH A O   1 
HETATM 2416 O  O   . HOH G 6 .   ? 14.398 -18.145 31.378  1.00 41.47 ? 444 HOH A O   1 
HETATM 2417 O  O   . HOH G 6 .   ? 31.324 -16.132 25.843  1.00 37.77 ? 445 HOH A O   1 
HETATM 2418 O  O   . HOH G 6 .   ? 21.101 -6.477  7.886   1.00 30.01 ? 446 HOH A O   1 
HETATM 2419 O  O   . HOH G 6 .   ? 30.393 -11.001 20.638  1.00 28.76 ? 447 HOH A O   1 
HETATM 2420 O  O   . HOH G 6 .   ? 13.616 -33.978 14.516  1.00 46.12 ? 448 HOH A O   1 
HETATM 2421 O  O   . HOH G 6 .   ? 2.339  -16.596 9.726   1.00 34.86 ? 449 HOH A O   1 
HETATM 2422 O  O   . HOH G 6 .   ? 5.125  -26.785 -2.019  1.00 21.68 ? 450 HOH A O   1 
HETATM 2423 O  O   . HOH G 6 .   ? 4.935  -21.210 12.053  1.00 27.70 ? 451 HOH A O   1 
HETATM 2424 O  O   . HOH G 6 .   ? 31.590 -18.888 26.495  1.00 37.18 ? 452 HOH A O   1 
HETATM 2425 O  O   . HOH G 6 .   ? 6.284  -23.998 15.261  1.00 53.14 ? 453 HOH A O   1 
HETATM 2426 O  O   . HOH G 6 .   ? 8.691  -4.133  22.582  1.00 30.07 ? 454 HOH A O   1 
HETATM 2427 O  O   . HOH G 6 .   ? 4.670  -11.465 15.054  1.00 33.66 ? 455 HOH A O   1 
HETATM 2428 O  O   . HOH G 6 .   ? 3.673  0.957   9.054   1.00 38.74 ? 456 HOH A O   1 
HETATM 2429 O  O   . HOH G 6 .   ? 6.234  -17.768 26.301  1.00 27.14 ? 457 HOH A O   1 
HETATM 2430 O  O   . HOH G 6 .   ? 14.780 -24.118 26.445  1.00 46.91 ? 458 HOH A O   1 
HETATM 2431 O  O   . HOH G 6 .   ? 2.552  -19.247 10.365  1.00 38.08 ? 459 HOH A O   1 
HETATM 2432 O  O   . HOH G 6 .   ? 24.860 -26.984 -2.605  1.00 31.59 ? 460 HOH A O   1 
HETATM 2433 O  O   . HOH G 6 .   ? 26.694 -27.912 19.675  1.00 57.67 ? 461 HOH A O   1 
HETATM 2434 O  O   . HOH G 6 .   ? 0.830  -26.312 -2.252  1.00 34.75 ? 462 HOH A O   1 
HETATM 2435 O  O   . HOH G 6 .   ? 0.008  -10.113 -11.405 1.00 25.40 ? 463 HOH A O   1 
HETATM 2436 O  O   . HOH G 6 .   ? 17.433 -16.067 26.308  1.00 26.92 ? 464 HOH A O   1 
HETATM 2437 O  O   . HOH G 6 .   ? 22.180 -31.073 -2.578  1.00 35.20 ? 465 HOH A O   1 
HETATM 2438 O  O   . HOH G 6 .   ? 17.231 -13.179 23.870  1.00 32.07 ? 466 HOH A O   1 
HETATM 2439 O  O   . HOH G 6 .   ? 21.979 -11.230 -0.335  1.00 53.70 ? 467 HOH A O   1 
HETATM 2440 O  O   . HOH G 6 .   ? 34.969 -29.648 19.097  1.00 36.20 ? 468 HOH A O   1 
HETATM 2441 O  O   . HOH G 6 .   ? -5.019 -17.359 -9.586  1.00 37.15 ? 469 HOH A O   1 
HETATM 2442 O  O   . HOH G 6 .   ? 5.296  -33.992 -1.808  1.00 25.10 ? 470 HOH A O   1 
HETATM 2443 O  O   . HOH G 6 .   ? 28.380 -27.371 -3.399  1.00 31.97 ? 471 HOH A O   1 
HETATM 2444 O  O   . HOH G 6 .   ? 7.157  -0.673  22.666  1.00 33.06 ? 472 HOH A O   1 
HETATM 2445 O  O   . HOH G 6 .   ? 6.791  7.217   7.088   1.00 23.68 ? 473 HOH A O   1 
HETATM 2446 O  O   . HOH G 6 .   ? 20.655 -1.850  5.732   1.00 37.77 ? 474 HOH A O   1 
HETATM 2447 O  O   . HOH G 6 .   ? 8.532  -4.854  2.787   1.00 30.32 ? 475 HOH A O   1 
HETATM 2448 O  O   . HOH G 6 .   ? 0.756  -12.521 -3.514  1.00 36.72 ? 476 HOH A O   1 
HETATM 2449 O  O   . HOH G 6 .   ? 14.174 -1.286  5.673   1.00 14.76 ? 477 HOH A O   1 
HETATM 2450 O  O   . HOH G 6 .   ? 24.774 -33.761 -1.146  1.00 30.55 ? 478 HOH A O   1 
HETATM 2451 O  O   . HOH G 6 .   ? 18.935 -10.061 20.357  1.00 40.49 ? 479 HOH A O   1 
HETATM 2452 O  O   . HOH G 6 .   ? 23.300 2.580   15.318  1.00 33.47 ? 480 HOH A O   1 
HETATM 2453 O  O   . HOH G 6 .   ? 11.763 -21.642 29.932  1.00 23.80 ? 481 HOH A O   1 
HETATM 2454 O  O   . HOH G 6 .   ? 13.893 -20.263 29.427  1.00 23.77 ? 482 HOH A O   1 
HETATM 2455 O  O   . HOH G 6 .   ? 34.790 -32.694 15.685  1.00 24.68 ? 483 HOH A O   1 
HETATM 2456 O  O   . HOH G 6 .   ? 30.535 -19.118 29.235  1.00 26.72 ? 484 HOH A O   1 
HETATM 2457 O  O   . HOH G 6 .   ? 21.563 4.355   16.671  1.00 24.34 ? 485 HOH A O   1 
HETATM 2458 O  O   . HOH G 6 .   ? 20.250 -28.438 -2.543  1.00 37.46 ? 486 HOH A O   1 
HETATM 2459 O  O   . HOH G 6 .   ? 14.050 -19.024 26.773  1.00 26.55 ? 487 HOH A O   1 
HETATM 2460 O  O   . HOH G 6 .   ? 33.098 -20.192 -6.336  1.00 56.93 ? 488 HOH A O   1 
HETATM 2461 O  O   . HOH G 6 .   ? 14.168 -7.666  22.227  1.00 35.97 ? 489 HOH A O   1 
HETATM 2462 O  O   . HOH G 6 .   ? 33.762 -22.424 28.843  1.00 4.70  ? 490 HOH A O   1 
HETATM 2463 O  O   . HOH G 6 .   ? 21.291 -30.023 21.822  1.00 32.21 ? 491 HOH A O   1 
HETATM 2464 O  O   . HOH H 6 .   ? 22.580 -14.965 2.985   1.00 23.69 ? 35  HOH P O   1 
HETATM 2465 O  O   . HOH H 6 .   ? 19.249 -17.426 4.117   1.00 12.57 ? 38  HOH P O   1 
HETATM 2466 O  O   . HOH H 6 .   ? 26.155 -11.749 8.239   1.00 25.52 ? 72  HOH P O   1 
HETATM 2467 O  O   . HOH H 6 .   ? 21.071 -9.316  15.766  1.00 24.42 ? 73  HOH P O   1 
HETATM 2468 O  O   . HOH H 6 .   ? 27.094 -9.854  9.836   1.00 22.95 ? 132 HOH P O   1 
HETATM 2469 O  O   . HOH H 6 .   ? 29.440 -8.507  9.401   1.00 38.55 ? 160 HOH P O   1 
HETATM 2470 O  O   . HOH H 6 .   ? 23.473 -11.504 7.624   1.00 24.83 ? 172 HOH P O   1 
HETATM 2471 O  O   . HOH H 6 .   ? 26.202 -13.951 4.884   1.00 32.25 ? 187 HOH P O   1 
HETATM 2472 O  O   . HOH H 6 .   ? 27.798 -11.872 5.676   1.00 34.65 ? 209 HOH P O   1 
HETATM 2473 O  O   . HOH H 6 .   ? 30.667 -7.911  17.727  1.00 42.13 ? 230 HOH P O   1 
HETATM 2474 O  O   . HOH H 6 .   ? 28.355 -9.384  16.832  1.00 18.65 ? 492 HOH P O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLY A 1   ? 0.4189 0.2898 0.3731 0.0568  0.0424  0.0035  -4  GLY A N   
2    C  CA  . GLY A 1   ? 0.3951 0.2867 0.3245 0.0544  0.0218  0.0371  -4  GLY A CA  
3    C  C   . GLY A 1   ? 0.4018 0.3185 0.3648 0.0544  0.0112  0.0281  -4  GLY A C   
4    O  O   . GLY A 1   ? 0.4459 0.3650 0.3631 0.0448  0.0149  0.0443  -4  GLY A O   
5    N  N   . ALA A 2   ? 0.3883 0.3099 0.3545 0.0596  0.0128  0.0316  -3  ALA A N   
6    C  CA  . ALA A 2   ? 0.3516 0.3048 0.3548 0.0623  -0.0038 0.0098  -3  ALA A CA  
7    C  C   . ALA A 2   ? 0.3323 0.2604 0.3092 0.0668  -0.0127 -0.0033 -3  ALA A C   
8    O  O   . ALA A 2   ? 0.3452 0.2717 0.3690 0.0711  -0.0171 -0.0047 -3  ALA A O   
9    C  CB  . ALA A 2   ? 0.3938 0.3286 0.3858 0.0461  0.0117  0.0049  -3  ALA A CB  
10   N  N   . MET A 3   ? 0.2351 0.2595 0.2678 0.0487  -0.0409 -0.0238 -2  MET A N   
11   C  CA  . MET A 3   ? 0.1607 0.1784 0.2096 0.0295  -0.0362 -0.0176 -2  MET A CA  
12   C  C   . MET A 3   ? 0.1447 0.1647 0.1759 0.0245  -0.0122 -0.0045 -2  MET A C   
13   O  O   . MET A 3   ? 0.1212 0.1579 0.1525 0.0299  0.0085  -0.0347 -2  MET A O   
14   C  CB  . MET A 3   ? 0.1457 0.1688 0.2489 0.0313  -0.0312 -0.0110 -2  MET A CB  
15   C  CG  . MET A 3   ? 0.2015 0.2249 0.2378 0.0118  -0.0757 -0.0024 -2  MET A CG  
16   S  SD  . MET A 3   ? 0.2530 0.1859 0.2720 -0.0060 -0.0208 -0.0404 -2  MET A SD  
17   C  CE  . MET A 3   ? 0.2039 0.2823 0.3238 -0.0259 -0.0225 -0.0578 -2  MET A CE  
18   N  N   . GLY A 4   ? 0.1501 0.1559 0.1806 0.0049  -0.0194 0.0012  -1  GLY A N   
19   C  CA  . GLY A 4   ? 0.1698 0.1346 0.1629 -0.0108 -0.0028 0.0101  -1  GLY A CA  
20   C  C   . GLY A 4   ? 0.1406 0.0871 0.1684 0.0028  -0.0083 -0.0002 -1  GLY A C   
21   O  O   . GLY A 4   ? 0.1623 0.0710 0.2094 0.0020  -0.0085 0.0190  -1  GLY A O   
22   N  N   . SER A 5   ? 0.1227 0.0547 0.1574 0.0322  0.0024  0.0100  0   SER A N   
23   C  CA  A SER A 5   ? 0.1090 0.0366 0.1532 0.0128  -0.0133 0.0119  0   SER A CA  
24   C  CA  B SER A 5   ? 0.1189 0.0568 0.1607 0.0152  -0.0205 0.0060  0   SER A CA  
25   C  C   . SER A 5   ? 0.1100 0.0471 0.1538 0.0134  -0.0165 0.0001  0   SER A C   
26   O  O   . SER A 5   ? 0.1025 0.0659 0.1782 0.0174  -0.0404 0.0098  0   SER A O   
27   C  CB  A SER A 5   ? 0.0963 0.0391 0.1773 0.0304  0.0096  -0.0068 0   SER A CB  
28   C  CB  B SER A 5   ? 0.1353 0.0511 0.1794 0.0294  -0.0133 -0.0054 0   SER A CB  
29   O  OG  A SER A 5   ? 0.1397 0.0383 0.2403 -0.0009 0.0177  0.0179  0   SER A OG  
30   O  OG  B SER A 5   ? 0.1545 0.1384 0.2547 0.0094  -0.0405 -0.0026 0   SER A OG  
31   N  N   . MET A 6   ? 0.1025 0.0658 0.1402 -0.0064 -0.0027 0.0081  1   MET A N   
32   C  CA  . MET A 6   ? 0.1042 0.0615 0.1229 -0.0010 0.0095  -0.0087 1   MET A CA  
33   C  C   . MET A 6   ? 0.0749 0.0684 0.0890 0.0073  -0.0134 -0.0021 1   MET A C   
34   O  O   . MET A 6   ? 0.1030 0.0791 0.1035 -0.0092 0.0146  0.0096  1   MET A O   
35   C  CB  . MET A 6   ? 0.1115 0.0784 0.1406 -0.0249 0.0067  0.0033  1   MET A CB  
36   C  CG  . MET A 6   ? 0.0895 0.1425 0.1882 -0.0585 0.0180  -0.0430 1   MET A CG  
37   S  SD  . MET A 6   ? 0.1619 0.1227 0.2109 -0.0509 -0.0143 0.0215  1   MET A SD  
38   C  CE  . MET A 6   ? 0.2504 0.0753 0.1871 -0.0460 0.0440  -0.0118 1   MET A CE  
39   N  N   . GLU A 7   ? 0.0742 0.0591 0.1015 0.0211  0.0068  -0.0177 2   GLU A N   
40   C  CA  . GLU A 7   ? 0.1032 0.0930 0.1242 0.0340  -0.0110 -0.0065 2   GLU A CA  
41   C  C   . GLU A 7   ? 0.1037 0.0743 0.1187 0.0200  -0.0210 0.0021  2   GLU A C   
42   O  O   . GLU A 7   ? 0.0748 0.0671 0.1306 0.0314  0.0024  -0.0038 2   GLU A O   
43   C  CB  . GLU A 7   ? 0.1415 0.1127 0.0986 0.0120  -0.0143 -0.0122 2   GLU A CB  
44   C  CG  . GLU A 7   ? 0.1618 0.0757 0.1754 0.0442  -0.0814 -0.0408 2   GLU A CG  
45   C  CD  . GLU A 7   ? 0.1864 0.1174 0.1773 0.0121  -0.0709 0.0147  2   GLU A CD  
46   O  OE1 . GLU A 7   ? 0.2092 0.1267 0.1633 -0.0773 -0.0617 0.0089  2   GLU A OE1 
47   O  OE2 . GLU A 7   ? 0.1767 0.1610 0.2103 0.0419  -0.0967 -0.0648 2   GLU A OE2 
48   N  N   . ARG A 8   ? 0.0852 0.0738 0.1187 0.0380  -0.0085 0.0217  3   ARG A N   
49   C  CA  . ARG A 8   ? 0.0943 0.0517 0.1285 0.0017  -0.0156 0.0200  3   ARG A CA  
50   C  C   . ARG A 8   ? 0.0864 0.0292 0.1346 0.0113  -0.0052 0.0070  3   ARG A C   
51   O  O   . ARG A 8   ? 0.1002 0.0462 0.1186 0.0034  -0.0175 0.0019  3   ARG A O   
52   C  CB  . ARG A 8   ? 0.0806 0.0529 0.1123 -0.0156 -0.0344 0.0487  3   ARG A CB  
53   C  CG  . ARG A 8   ? 0.1059 0.0624 0.0801 0.0049  -0.0527 -0.0035 3   ARG A CG  
54   C  CD  . ARG A 8   ? 0.1031 0.0675 0.1260 0.0211  -0.0587 0.0152  3   ARG A CD  
55   N  NE  . ARG A 8   ? 0.0806 0.0862 0.1461 0.0070  -0.0728 0.0274  3   ARG A NE  
56   C  CZ  . ARG A 8   ? 0.0910 0.1180 0.1067 -0.0037 -0.0144 -0.0288 3   ARG A CZ  
57   N  NH1 . ARG A 8   ? 0.1117 0.1174 0.0961 0.0208  0.0064  -0.0199 3   ARG A NH1 
58   N  NH2 . ARG A 8   ? 0.1096 0.1514 0.1334 -0.0348 -0.0191 0.0250  3   ARG A NH2 
59   N  N   . ALA A 9   ? 0.0766 0.0421 0.1309 -0.0025 0.0207  0.0123  4   ALA A N   
60   C  CA  . ALA A 9   ? 0.0954 0.0688 0.1485 0.0007  0.0370  -0.0067 4   ALA A CA  
61   C  C   . ALA A 9   ? 0.0678 0.0361 0.1444 0.0028  0.0238  -0.0066 4   ALA A C   
62   O  O   . ALA A 9   ? 0.0894 0.0653 0.1357 -0.0071 0.0158  0.0121  4   ALA A O   
63   C  CB  . ALA A 9   ? 0.1436 0.0972 0.1523 0.0105  0.0206  -0.0186 4   ALA A CB  
64   N  N   . SER A 10  ? 0.1060 0.0257 0.1292 0.0044  0.0060  -0.0036 5   SER A N   
65   C  CA  . SER A 10  ? 0.0968 0.0272 0.1354 0.0056  -0.0122 -0.0133 5   SER A CA  
66   C  C   . SER A 10  ? 0.0813 0.0504 0.1115 -0.0087 -0.0090 0.0002  5   SER A C   
67   O  O   . SER A 10  ? 0.0764 0.0344 0.1592 -0.0215 -0.0157 0.0091  5   SER A O   
68   C  CB  . SER A 10  ? 0.0880 0.1017 0.1282 0.0172  -0.0241 -0.0209 5   SER A CB  
69   O  OG  . SER A 10  ? 0.1224 0.0833 0.1400 0.0000  -0.0121 -0.0141 5   SER A OG  
70   N  N   . LEU A 11  ? 0.1057 0.0335 0.1016 0.0185  -0.0015 0.0043  6   LEU A N   
71   C  CA  . LEU A 11  ? 0.0746 0.0781 0.1156 0.0098  0.0014  -0.0046 6   LEU A CA  
72   C  C   . LEU A 11  ? 0.0856 0.0540 0.0929 0.0031  0.0015  0.0118  6   LEU A C   
73   O  O   . LEU A 11  ? 0.0859 0.0665 0.1197 -0.0064 -0.0050 -0.0156 6   LEU A O   
74   C  CB  . LEU A 11  ? 0.0711 0.0903 0.1265 0.0073  0.0116  0.0155  6   LEU A CB  
75   C  CG  . LEU A 11  ? 0.0755 0.0414 0.1293 0.0131  0.0149  -0.0199 6   LEU A CG  
76   C  CD1 . LEU A 11  ? 0.0530 0.1065 0.1317 -0.0416 0.0078  0.0160  6   LEU A CD1 
77   C  CD2 . LEU A 11  ? 0.0902 0.0484 0.1404 0.0084  -0.0107 -0.0488 6   LEU A CD2 
78   N  N   . ILE A 12  ? 0.0913 0.0487 0.1084 -0.0006 0.0096  0.0105  7   ILE A N   
79   C  CA  A ILE A 12  ? 0.0851 0.0678 0.0955 -0.0035 0.0175  0.0110  7   ILE A CA  
80   C  CA  B ILE A 12  ? 0.0815 0.0569 0.1010 -0.0022 0.0109  0.0131  7   ILE A CA  
81   C  C   . ILE A 12  ? 0.0781 0.0426 0.1056 -0.0033 -0.0033 0.0154  7   ILE A C   
82   O  O   . ILE A 12  ? 0.0896 0.0878 0.1155 -0.0038 0.0106  0.0062  7   ILE A O   
83   C  CB  A ILE A 12  ? 0.0724 0.0641 0.1107 0.0023  0.0047  0.0149  7   ILE A CB  
84   C  CB  B ILE A 12  ? 0.0718 0.0586 0.1226 0.0011  0.0063  0.0180  7   ILE A CB  
85   C  CG1 A ILE A 12  ? 0.1100 0.0882 0.0765 -0.0062 0.0030  0.0178  7   ILE A CG1 
86   C  CG1 B ILE A 12  ? 0.0751 0.0531 0.1088 -0.0059 -0.0049 0.0286  7   ILE A CG1 
87   C  CG2 A ILE A 12  ? 0.0338 0.1306 0.0874 -0.0137 0.0170  -0.0062 7   ILE A CG2 
88   C  CG2 B ILE A 12  ? 0.0507 0.0641 0.0851 0.0036  -0.0125 0.0143  7   ILE A CG2 
89   C  CD1 A ILE A 12  ? 0.0766 0.0586 0.0715 -0.0128 0.0205  -0.0363 7   ILE A CD1 
90   C  CD1 B ILE A 12  ? 0.0480 0.0396 0.1620 -0.0180 -0.0557 0.0442  7   ILE A CD1 
91   N  N   . GLN A 13  ? 0.0970 0.0398 0.0745 0.0115  0.0179  0.0022  8   GLN A N   
92   C  CA  A GLN A 13  ? 0.1046 0.0482 0.0861 0.0086  0.0065  0.0053  8   GLN A CA  
93   C  CA  B GLN A 13  ? 0.1120 0.0551 0.1003 0.0002  0.0047  -0.0012 8   GLN A CA  
94   C  C   . GLN A 13  ? 0.1039 0.0594 0.1048 0.0070  0.0035  -0.0034 8   GLN A C   
95   O  O   . GLN A 13  ? 0.1147 0.0497 0.1378 0.0062  0.0041  0.0077  8   GLN A O   
96   C  CB  A GLN A 13  ? 0.1268 0.0701 0.0686 -0.0066 0.0097  -0.0157 8   GLN A CB  
97   C  CB  B GLN A 13  ? 0.1328 0.0730 0.0926 -0.0146 0.0010  -0.0172 8   GLN A CB  
98   C  CG  A GLN A 13  ? 0.1010 0.0660 0.0626 0.0122  0.0212  0.0076  8   GLN A CG  
99   C  CG  B GLN A 13  ? 0.1532 0.1010 0.1206 -0.0306 0.0034  -0.0369 8   GLN A CG  
100  C  CD  A GLN A 13  ? 0.0936 0.1167 0.0823 0.0422  0.0274  -0.0377 8   GLN A CD  
101  C  CD  B GLN A 13  ? 0.1792 0.1715 0.1936 -0.0868 -0.0215 -0.0602 8   GLN A CD  
102  O  OE1 A GLN A 13  ? 0.0765 0.1468 0.1460 0.0112  0.0720  -0.0297 8   GLN A OE1 
103  O  OE1 B GLN A 13  ? 0.1857 0.1908 0.1934 -0.0619 -0.0358 -0.0624 8   GLN A OE1 
104  N  NE2 A GLN A 13  ? 0.1679 0.1122 0.0647 0.0286  -0.0310 -0.0577 8   GLN A NE2 
105  N  NE2 B GLN A 13  ? 0.2682 0.2166 0.2009 -0.1391 0.0649  -0.0399 8   GLN A NE2 
106  N  N   . LYS A 14  ? 0.1155 0.0664 0.1137 -0.0017 0.0016  -0.0101 9   LYS A N   
107  C  CA  . LYS A 14  ? 0.1043 0.0462 0.1073 0.0193  -0.0100 -0.0075 9   LYS A CA  
108  C  C   . LYS A 14  ? 0.1066 0.0446 0.0897 0.0102  -0.0017 -0.0092 9   LYS A C   
109  O  O   . LYS A 14  ? 0.1275 0.0706 0.1255 -0.0004 0.0056  0.0041  9   LYS A O   
110  C  CB  . LYS A 14  ? 0.1014 0.0283 0.0979 0.0148  0.0006  -0.0021 9   LYS A CB  
111  C  CG  . LYS A 14  ? 0.1014 0.0307 0.1258 0.0202  -0.0197 -0.0030 9   LYS A CG  
112  C  CD  . LYS A 14  ? 0.1175 0.0958 0.1144 0.0443  -0.0568 -0.0028 9   LYS A CD  
113  C  CE  . LYS A 14  ? 0.1273 0.0510 0.1051 0.0457  -0.0527 -0.0072 9   LYS A CE  
114  N  NZ  . LYS A 14  ? 0.1087 0.0670 0.1920 0.0350  -0.0195 0.0206  9   LYS A NZ  
115  N  N   . ALA A 15  ? 0.0886 0.0762 0.1007 0.0056  -0.0083 0.0000  10  ALA A N   
116  C  CA  . ALA A 15  ? 0.0954 0.0655 0.1135 -0.0083 -0.0105 0.0187  10  ALA A CA  
117  C  C   . ALA A 15  ? 0.0964 0.0412 0.1041 -0.0061 -0.0129 -0.0080 10  ALA A C   
118  O  O   . ALA A 15  ? 0.0580 0.0767 0.1313 -0.0289 -0.0184 0.0004  10  ALA A O   
119  C  CB  . ALA A 15  ? 0.1244 0.0721 0.1148 -0.0194 -0.0026 0.0241  10  ALA A CB  
120  N  N   . LYS A 16  ? 0.0858 0.0658 0.1122 0.0087  0.0069  0.0060  11  LYS A N   
121  C  CA  . LYS A 16  ? 0.1043 0.0302 0.1430 -0.0191 0.0119  -0.0079 11  LYS A CA  
122  C  C   . LYS A 16  ? 0.0907 0.0491 0.1218 -0.0286 -0.0148 0.0038  11  LYS A C   
123  O  O   . LYS A 16  ? 0.1175 0.0983 0.1600 -0.0488 -0.0060 0.0039  11  LYS A O   
124  C  CB  . LYS A 16  ? 0.1446 0.0429 0.1070 -0.0244 -0.0045 -0.0207 11  LYS A CB  
125  C  CG  . LYS A 16  ? 0.2122 0.0300 0.1368 -0.0082 -0.0230 -0.0208 11  LYS A CG  
126  C  CD  . LYS A 16  ? 0.1936 0.0347 0.1635 0.0020  -0.0003 -0.0360 11  LYS A CD  
127  C  CE  . LYS A 16  ? 0.2682 0.1047 0.1518 0.0584  0.0256  -0.0234 11  LYS A CE  
128  N  NZ  . LYS A 16  ? 0.3033 0.2089 0.2114 0.1112  0.0038  -0.1128 11  LYS A NZ  
129  N  N   . LEU A 17  ? 0.1012 0.0331 0.1109 -0.0149 -0.0186 0.0016  12  LEU A N   
130  C  CA  . LEU A 17  ? 0.0921 0.0712 0.1007 -0.0245 -0.0055 0.0037  12  LEU A CA  
131  C  C   . LEU A 17  ? 0.0688 0.0699 0.1220 -0.0258 -0.0041 0.0058  12  LEU A C   
132  O  O   . LEU A 17  ? 0.0834 0.0618 0.1569 -0.0431 -0.0145 0.0126  12  LEU A O   
133  C  CB  . LEU A 17  ? 0.0991 0.0561 0.0766 -0.0037 -0.0043 -0.0049 12  LEU A CB  
134  C  CG  . LEU A 17  ? 0.1013 0.0846 0.0897 -0.0190 0.0219  0.0101  12  LEU A CG  
135  C  CD1 . LEU A 17  ? 0.1044 0.1607 0.1176 -0.0107 0.0347  0.0451  12  LEU A CD1 
136  C  CD2 . LEU A 17  ? 0.1967 0.1225 0.0941 -0.0186 0.0279  0.0622  12  LEU A CD2 
137  N  N   . ALA A 18  ? 0.1114 0.0646 0.0974 0.0089  0.0190  0.0194  13  ALA A N   
138  C  CA  . ALA A 18  ? 0.0987 0.0887 0.1069 0.0033  -0.0049 0.0190  13  ALA A CA  
139  C  C   . ALA A 18  ? 0.0890 0.0799 0.1220 -0.0005 0.0057  0.0125  13  ALA A C   
140  O  O   . ALA A 18  ? 0.1291 0.0827 0.1511 -0.0120 -0.0092 0.0103  13  ALA A O   
141  C  CB  . ALA A 18  ? 0.0849 0.0530 0.1012 0.0329  0.0414  0.0134  13  ALA A CB  
142  N  N   . GLU A 19  ? 0.0968 0.0621 0.1137 0.0106  0.0007  0.0150  14  GLU A N   
143  C  CA  . GLU A 19  ? 0.0781 0.0859 0.1604 -0.0029 0.0064  0.0128  14  GLU A CA  
144  C  C   . GLU A 19  ? 0.1038 0.0922 0.1609 -0.0148 0.0051  0.0091  14  GLU A C   
145  O  O   . GLU A 19  ? 0.1142 0.1487 0.2155 -0.0175 -0.0040 0.0136  14  GLU A O   
146  C  CB  . GLU A 19  ? 0.0859 0.0890 0.1571 0.0246  -0.0242 0.0113  14  GLU A CB  
147  C  CG  . GLU A 19  ? 0.1040 0.1766 0.1889 -0.0121 -0.0461 0.0352  14  GLU A CG  
148  C  CD  . GLU A 19  ? 0.1196 0.1535 0.1448 0.0375  -0.0578 -0.0085 14  GLU A CD  
149  O  OE1 . GLU A 19  ? 0.2229 0.2156 0.1979 0.0089  0.0105  -0.0032 14  GLU A OE1 
150  O  OE2 . GLU A 19  ? 0.1609 0.2738 0.2512 -0.0399 -0.0686 -0.0239 14  GLU A OE2 
151  N  N   . GLN A 20  ? 0.1094 0.1144 0.1816 -0.0164 0.0102  0.0032  15  GLN A N   
152  C  CA  . GLN A 20  ? 0.1312 0.1093 0.1804 -0.0321 0.0177  -0.0024 15  GLN A CA  
153  C  C   . GLN A 20  ? 0.1253 0.1131 0.1769 -0.0431 0.0050  0.0070  15  GLN A C   
154  O  O   . GLN A 20  ? 0.1154 0.1584 0.2321 -0.0563 0.0307  0.0011  15  GLN A O   
155  C  CB  . GLN A 20  ? 0.1328 0.1049 0.1892 -0.0045 0.0281  -0.0064 15  GLN A CB  
156  C  CG  . GLN A 20  ? 0.1592 0.1068 0.2556 -0.0203 0.0733  -0.0323 15  GLN A CG  
157  C  CD  . GLN A 20  ? 0.2457 0.2285 0.3444 0.0219  0.0223  -0.0300 15  GLN A CD  
158  O  OE1 . GLN A 20  ? 0.3554 0.4043 0.3482 0.0582  0.0933  -0.0095 15  GLN A OE1 
159  N  NE2 . GLN A 20  ? 0.2619 0.2647 0.4567 0.0306  -0.0016 -0.0956 15  GLN A NE2 
160  N  N   . ALA A 21  ? 0.1417 0.0946 0.1580 -0.0345 -0.0042 -0.0014 16  ALA A N   
161  C  CA  . ALA A 21  ? 0.1377 0.0983 0.1802 -0.0383 -0.0067 -0.0215 16  ALA A CA  
162  C  C   . ALA A 21  ? 0.1450 0.0912 0.1791 -0.0502 -0.0008 -0.0289 16  ALA A C   
163  O  O   . ALA A 21  ? 0.1890 0.0933 0.1983 -0.0640 -0.0069 -0.0417 16  ALA A O   
164  C  CB  . ALA A 21  ? 0.1600 0.0820 0.2033 -0.0232 -0.0304 -0.0151 16  ALA A CB  
165  N  N   . GLU A 22  ? 0.1236 0.1285 0.1995 -0.0547 -0.0028 -0.0309 17  GLU A N   
166  C  CA  A GLU A 22  ? 0.1186 0.1369 0.1932 -0.0566 -0.0160 -0.0339 17  GLU A CA  
167  C  CA  B GLU A 22  ? 0.1220 0.1404 0.1996 -0.0549 -0.0147 -0.0368 17  GLU A CA  
168  C  C   . GLU A 22  ? 0.1304 0.1373 0.1722 -0.0472 -0.0213 -0.0332 17  GLU A C   
169  O  O   . GLU A 22  ? 0.1573 0.1570 0.2124 -0.0438 -0.0041 -0.0570 17  GLU A O   
170  C  CB  A GLU A 22  ? 0.1320 0.1848 0.2186 -0.0503 -0.0349 -0.0344 17  GLU A CB  
171  C  CB  B GLU A 22  ? 0.1317 0.1860 0.2226 -0.0512 -0.0321 -0.0409 17  GLU A CB  
172  C  CG  A GLU A 22  ? 0.1358 0.2353 0.2473 -0.0537 -0.0123 -0.0351 17  GLU A CG  
173  C  CG  B GLU A 22  ? 0.1546 0.2456 0.2904 -0.0405 -0.0021 -0.0562 17  GLU A CG  
174  C  CD  A GLU A 22  ? 0.1462 0.3661 0.2482 -0.0529 -0.0523 -0.0115 17  GLU A CD  
175  C  CD  B GLU A 22  ? 0.1711 0.3813 0.3590 -0.0100 -0.0320 -0.0858 17  GLU A CD  
176  O  OE1 A GLU A 22  ? 0.1125 0.4340 0.2456 -0.0078 -0.0850 -0.0304 17  GLU A OE1 
177  O  OE1 B GLU A 22  ? 0.2061 0.3743 0.3435 -0.0415 -0.0224 -0.0904 17  GLU A OE1 
178  O  OE2 A GLU A 22  ? 0.1473 0.4258 0.2224 -0.0928 0.0081  0.0094  17  GLU A OE2 
179  O  OE2 B GLU A 22  ? 0.1407 0.4961 0.4018 0.0063  -0.0184 -0.0709 17  GLU A OE2 
180  N  N   . ARG A 23  ? 0.1014 0.0979 0.1546 -0.0311 -0.0121 -0.0111 18  ARG A N   
181  C  CA  . ARG A 23  ? 0.1197 0.0744 0.1368 -0.0292 -0.0170 0.0049  18  ARG A CA  
182  C  C   . ARG A 23  ? 0.1400 0.0731 0.1329 -0.0274 -0.0169 0.0141  18  ARG A C   
183  O  O   . ARG A 23  ? 0.1295 0.0367 0.1249 0.0021  -0.0045 -0.0057 18  ARG A O   
184  C  CB  . ARG A 23  ? 0.1532 0.0675 0.1318 -0.0286 -0.0120 0.0197  18  ARG A CB  
185  C  CG  . ARG A 23  ? 0.1547 0.0444 0.1890 -0.0358 0.0253  0.0311  18  ARG A CG  
186  C  CD  . ARG A 23  ? 0.1342 0.0561 0.2158 -0.0047 0.0337  0.0553  18  ARG A CD  
187  N  NE  . ARG A 23  ? 0.1765 0.1240 0.1964 0.0211  0.0149  0.0649  18  ARG A NE  
188  C  CZ  . ARG A 23  ? 0.2484 0.0882 0.2245 0.0063  -0.0467 0.0119  18  ARG A CZ  
189  N  NH1 . ARG A 23  ? 0.2562 0.0290 0.3483 -0.0240 -0.0449 -0.0146 18  ARG A NH1 
190  N  NH2 . ARG A 23  ? 0.1871 0.1219 0.2124 0.0343  -0.0361 -0.0085 18  ARG A NH2 
191  N  N   . TYR A 24  ? 0.1124 0.0519 0.1126 0.0000  -0.0192 0.0463  19  TYR A N   
192  C  CA  . TYR A 24  ? 0.1340 0.0714 0.1280 -0.0006 -0.0304 0.0113  19  TYR A CA  
193  C  C   . TYR A 24  ? 0.1197 0.0650 0.1368 0.0166  -0.0349 0.0030  19  TYR A C   
194  O  O   . TYR A 24  ? 0.1216 0.0697 0.1288 -0.0046 -0.0076 -0.0114 19  TYR A O   
195  C  CB  . TYR A 24  ? 0.1182 0.1301 0.1212 0.0210  -0.0290 0.0322  19  TYR A CB  
196  C  CG  . TYR A 24  ? 0.1024 0.0736 0.1733 -0.0175 -0.0117 0.0378  19  TYR A CG  
197  C  CD1 . TYR A 24  ? 0.0994 0.1474 0.1284 -0.0172 -0.0385 0.0034  19  TYR A CD1 
198  C  CD2 . TYR A 24  ? 0.1256 0.2036 0.1902 -0.0727 -0.0300 0.0300  19  TYR A CD2 
199  C  CE1 . TYR A 24  ? 0.1053 0.1988 0.2035 -0.0356 -0.0440 0.0382  19  TYR A CE1 
200  C  CE2 . TYR A 24  ? 0.1364 0.2151 0.2401 -0.0447 -0.0278 0.0434  19  TYR A CE2 
201  C  CZ  . TYR A 24  ? 0.1122 0.2296 0.2044 -0.0345 -0.0283 0.0370  19  TYR A CZ  
202  O  OH  . TYR A 24  ? 0.1660 0.3168 0.2778 -0.0097 -0.0284 0.0401  19  TYR A OH  
203  N  N   . GLU A 25  ? 0.1236 0.0860 0.1187 0.0344  -0.0300 0.0004  20  GLU A N   
204  C  CA  A GLU A 25  ? 0.1313 0.0814 0.1340 0.0467  -0.0291 -0.0124 20  GLU A CA  
205  C  CA  B GLU A 25  ? 0.1346 0.0856 0.1357 0.0467  -0.0257 -0.0121 20  GLU A CA  
206  C  C   . GLU A 25  ? 0.1337 0.0500 0.1202 0.0319  -0.0179 -0.0126 20  GLU A C   
207  O  O   . GLU A 25  ? 0.1297 0.0612 0.1188 0.0189  -0.0197 -0.0234 20  GLU A O   
208  C  CB  A GLU A 25  ? 0.1364 0.0805 0.1654 0.0620  -0.0230 -0.0246 20  GLU A CB  
209  C  CB  B GLU A 25  ? 0.1432 0.0855 0.1600 0.0615  -0.0164 -0.0302 20  GLU A CB  
210  C  CG  A GLU A 25  ? 0.1499 0.0998 0.1989 0.0516  -0.0237 -0.0188 20  GLU A CG  
211  C  CG  B GLU A 25  ? 0.1658 0.1317 0.2246 0.0564  -0.0035 -0.0127 20  GLU A CG  
212  C  CD  A GLU A 25  ? 0.2568 0.1516 0.3583 0.0683  -0.0630 -0.0348 20  GLU A CD  
213  C  CD  B GLU A 25  ? 0.3104 0.1495 0.2670 0.0752  0.0488  -0.0488 20  GLU A CD  
214  O  OE1 A GLU A 25  ? 0.3500 0.2070 0.4192 0.0215  -0.0932 0.0074  20  GLU A OE1 
215  O  OE1 B GLU A 25  ? 0.3605 0.1553 0.3028 0.1015  0.0575  -0.0399 20  GLU A OE1 
216  O  OE2 A GLU A 25  ? 0.2458 0.1153 0.3962 0.1078  -0.0298 -0.0621 20  GLU A OE2 
217  O  OE2 B GLU A 25  ? 0.3232 0.1696 0.3410 0.1257  0.0883  -0.0705 20  GLU A OE2 
218  N  N   . ASP A 26  ? 0.1146 0.0533 0.0804 0.0283  -0.0031 -0.0006 21  ASP A N   
219  C  CA  . ASP A 26  ? 0.1268 0.0266 0.0926 0.0100  0.0052  0.0054  21  ASP A CA  
220  C  C   . ASP A 26  ? 0.0934 0.0370 0.0953 0.0159  0.0084  0.0165  21  ASP A C   
221  O  O   . ASP A 26  ? 0.1079 0.0587 0.1332 0.0068  -0.0250 0.0031  21  ASP A O   
222  C  CB  . ASP A 26  ? 0.1545 0.0354 0.1095 0.0352  0.0021  0.0030  21  ASP A CB  
223  C  CG  . ASP A 26  ? 0.0979 0.0352 0.1637 0.0227  0.0512  -0.0009 21  ASP A CG  
224  O  OD1 . ASP A 26  ? 0.1534 0.0713 0.1691 0.0751  0.0258  0.0260  21  ASP A OD1 
225  O  OD2 . ASP A 26  ? 0.2097 0.0642 0.1523 -0.0017 0.0019  0.0272  21  ASP A OD2 
226  N  N   . MET A 27  ? 0.1014 0.0326 0.1138 0.0172  -0.0083 0.0153  22  MET A N   
227  C  CA  . MET A 27  ? 0.0716 0.0273 0.1025 0.0072  0.0056  0.0093  22  MET A CA  
228  C  C   . MET A 27  ? 0.0892 0.0462 0.1286 -0.0114 0.0072  0.0042  22  MET A C   
229  O  O   . MET A 27  ? 0.0979 0.0463 0.1361 -0.0220 0.0024  -0.0035 22  MET A O   
230  C  CB  . MET A 27  ? 0.0597 0.0266 0.1371 0.0065  -0.0038 -0.0031 22  MET A CB  
231  C  CG  . MET A 27  ? 0.0748 0.0459 0.1133 0.0249  0.0212  -0.0145 22  MET A CG  
232  S  SD  . MET A 27  ? 0.1133 0.0446 0.1515 0.0201  -0.0009 -0.0020 22  MET A SD  
233  C  CE  . MET A 27  ? 0.1124 0.0391 0.1453 0.0336  0.0214  0.0180  22  MET A CE  
234  N  N   . ALA A 28  ? 0.0911 0.0526 0.1107 -0.0058 0.0002  0.0437  23  ALA A N   
235  C  CA  . ALA A 28  ? 0.0770 0.0899 0.0974 -0.0251 -0.0178 0.0193  23  ALA A CA  
236  C  C   . ALA A 28  ? 0.0656 0.0555 0.0943 -0.0109 0.0075  0.0076  23  ALA A C   
237  O  O   . ALA A 28  ? 0.0942 0.0745 0.1194 -0.0215 0.0093  0.0019  23  ALA A O   
238  C  CB  . ALA A 28  ? 0.1530 0.0590 0.0891 -0.0344 -0.0305 -0.0048 23  ALA A CB  
239  N  N   . ALA A 29  ? 0.0605 0.0693 0.1145 0.0092  0.0022  0.0085  24  ALA A N   
240  C  CA  . ALA A 29  ? 0.1017 0.0812 0.1284 0.0036  -0.0044 0.0168  24  ALA A CA  
241  C  C   . ALA A 29  ? 0.0753 0.0625 0.1255 0.0100  0.0083  0.0095  24  ALA A C   
242  O  O   . ALA A 29  ? 0.0863 0.0859 0.1363 0.0054  -0.0030 0.0059  24  ALA A O   
243  C  CB  . ALA A 29  ? 0.1271 0.0878 0.1500 0.0583  -0.0049 0.0062  24  ALA A CB  
244  N  N   . PHE A 30  ? 0.0738 0.0617 0.1115 -0.0048 0.0165  -0.0099 25  PHE A N   
245  C  CA  . PHE A 30  ? 0.1037 0.0555 0.1132 0.0134  0.0124  0.0188  25  PHE A CA  
246  C  C   . PHE A 30  ? 0.0755 0.0508 0.0952 0.0129  0.0012  0.0105  25  PHE A C   
247  O  O   . PHE A 30  ? 0.0938 0.0600 0.0981 -0.0012 -0.0063 0.0187  25  PHE A O   
248  C  CB  . PHE A 30  ? 0.0899 0.0509 0.1256 0.0318  0.0213  0.0408  25  PHE A CB  
249  C  CG  . PHE A 30  ? 0.1119 0.0265 0.0762 0.0033  -0.0260 0.0057  25  PHE A CG  
250  C  CD1 . PHE A 30  ? 0.1351 0.0274 0.1158 -0.0141 -0.0125 0.0068  25  PHE A CD1 
251  C  CD2 . PHE A 30  ? 0.1317 0.0581 0.1410 -0.0030 -0.0332 0.0596  25  PHE A CD2 
252  C  CE1 . PHE A 30  ? 0.1673 0.0575 0.0974 -0.0044 -0.0065 0.0161  25  PHE A CE1 
253  C  CE2 . PHE A 30  ? 0.0888 0.0478 0.1182 -0.0018 -0.0096 0.0455  25  PHE A CE2 
254  C  CZ  . PHE A 30  ? 0.1249 0.0630 0.1331 -0.0414 -0.0156 -0.0128 25  PHE A CZ  
255  N  N   . MET A 31  ? 0.0806 0.0522 0.1058 0.0355  -0.0077 0.0130  26  MET A N   
256  C  CA  . MET A 31  ? 0.0591 0.0444 0.1093 0.0138  -0.0112 0.0263  26  MET A CA  
257  C  C   . MET A 31  ? 0.0821 0.0512 0.1012 0.0259  -0.0004 0.0245  26  MET A C   
258  O  O   . MET A 31  ? 0.1123 0.0431 0.1232 0.0237  0.0106  0.0137  26  MET A O   
259  C  CB  . MET A 31  ? 0.0598 0.0503 0.1080 0.0263  -0.0297 -0.0060 26  MET A CB  
260  C  CG  . MET A 31  ? 0.0950 0.0886 0.1255 -0.0120 0.0360  -0.0415 26  MET A CG  
261  S  SD  . MET A 31  ? 0.1079 0.0564 0.1648 0.0134  0.0172  0.0126  26  MET A SD  
262  C  CE  . MET A 31  ? 0.1231 0.0286 0.1896 0.0170  -0.0142 0.0047  26  MET A CE  
263  N  N   . LYS A 32  ? 0.0767 0.0607 0.1144 0.0189  0.0092  0.0027  27  LYS A N   
264  C  CA  . LYS A 32  ? 0.0981 0.0720 0.0946 -0.0021 0.0107  -0.0086 27  LYS A CA  
265  C  C   . LYS A 32  ? 0.0997 0.0528 0.1141 0.0083  -0.0011 -0.0033 27  LYS A C   
266  O  O   . LYS A 32  ? 0.0913 0.0594 0.1124 -0.0093 -0.0026 0.0072  27  LYS A O   
267  C  CB  . LYS A 32  ? 0.0734 0.0701 0.1000 -0.0056 0.0238  -0.0154 27  LYS A CB  
268  C  CG  . LYS A 32  ? 0.0876 0.1125 0.1139 -0.0013 0.0353  -0.0129 27  LYS A CG  
269  C  CD  . LYS A 32  ? 0.1157 0.1853 0.1183 -0.0375 -0.0171 -0.0603 27  LYS A CD  
270  C  CE  . LYS A 32  ? 0.1488 0.2603 0.2046 -0.0094 -0.0327 -0.0300 27  LYS A CE  
271  N  NZ  . LYS A 32  ? 0.1424 0.2603 0.2244 0.0186  -0.0113 -0.0475 27  LYS A NZ  
272  N  N   . GLY A 33  ? 0.0958 0.0615 0.0827 0.0031  -0.0226 -0.0075 28  GLY A N   
273  C  CA  . GLY A 33  ? 0.0839 0.0501 0.1203 0.0328  -0.0298 0.0016  28  GLY A CA  
274  C  C   . GLY A 33  ? 0.0775 0.0718 0.1304 0.0071  -0.0169 -0.0097 28  GLY A C   
275  O  O   . GLY A 33  ? 0.0467 0.0703 0.1650 -0.0072 0.0189  -0.0052 28  GLY A O   
276  N  N   . ALA A 34  ? 0.0685 0.0477 0.1260 0.0192  -0.0118 -0.0047 29  ALA A N   
277  C  CA  . ALA A 34  ? 0.0800 0.0398 0.1328 0.0234  0.0001  0.0188  29  ALA A CA  
278  C  C   . ALA A 34  ? 0.0756 0.0553 0.1299 -0.0078 0.0111  0.0064  29  ALA A C   
279  O  O   . ALA A 34  ? 0.0620 0.0672 0.1251 -0.0175 -0.0098 0.0142  29  ALA A O   
280  C  CB  . ALA A 34  ? 0.0657 0.0394 0.1523 0.0208  0.0248  0.0025  29  ALA A CB  
281  N  N   . VAL A 35  ? 0.0898 0.0495 0.1158 0.0114  0.0123  0.0298  30  VAL A N   
282  C  CA  . VAL A 35  ? 0.0830 0.0649 0.1258 0.0071  0.0043  0.0183  30  VAL A CA  
283  C  C   . VAL A 35  ? 0.0795 0.0344 0.1165 -0.0060 -0.0023 0.0070  30  VAL A C   
284  O  O   . VAL A 35  ? 0.0936 0.0838 0.1380 -0.0324 -0.0047 0.0203  30  VAL A O   
285  C  CB  . VAL A 35  ? 0.0418 0.0526 0.1215 0.0005  -0.0129 0.0213  30  VAL A CB  
286  C  CG1 . VAL A 35  ? 0.1307 0.0892 0.1167 -0.0004 0.0037  0.0257  30  VAL A CG1 
287  C  CG2 . VAL A 35  ? 0.0518 0.0955 0.1706 0.0405  -0.0078 -0.0085 30  VAL A CG2 
288  N  N   . GLU A 36  ? 0.0599 0.0696 0.1298 0.0080  -0.0069 0.0276  31  GLU A N   
289  C  CA  . GLU A 36  ? 0.0639 0.0816 0.1404 -0.0073 -0.0040 -0.0039 31  GLU A CA  
290  C  C   . GLU A 36  ? 0.0616 0.0939 0.1310 0.0001  -0.0095 0.0147  31  GLU A C   
291  O  O   . GLU A 36  ? 0.0655 0.1728 0.1361 -0.0307 -0.0021 -0.0164 31  GLU A O   
292  C  CB  . GLU A 36  ? 0.0621 0.0623 0.1709 0.0013  -0.0089 -0.0113 31  GLU A CB  
293  C  CG  . GLU A 36  ? 0.1052 0.1063 0.2030 -0.0377 0.0008  -0.0880 31  GLU A CG  
294  C  CD  . GLU A 36  ? 0.1656 0.1501 0.2434 -0.0451 0.0173  -0.0933 31  GLU A CD  
295  O  OE1 . GLU A 36  ? 0.2230 0.1803 0.3732 0.0202  -0.0762 -0.0948 31  GLU A OE1 
296  O  OE2 . GLU A 36  ? 0.2418 0.2656 0.2846 -0.0833 0.0577  -0.1197 31  GLU A OE2 
297  N  N   . LYS A 37  ? 0.0618 0.1137 0.1161 -0.0060 -0.0159 0.0213  32  LYS A N   
298  C  CA  . LYS A 37  ? 0.1049 0.1200 0.1076 -0.0131 -0.0288 0.0301  32  LYS A CA  
299  C  C   . LYS A 37  ? 0.0995 0.1162 0.1267 -0.0142 -0.0342 0.0241  32  LYS A C   
300  O  O   . LYS A 37  ? 0.1020 0.1051 0.1274 -0.0309 -0.0304 0.0126  32  LYS A O   
301  C  CB  . LYS A 37  ? 0.0818 0.0853 0.1092 -0.0422 -0.0093 0.0173  32  LYS A CB  
302  C  CG  . LYS A 37  ? 0.0864 0.1240 0.1169 0.0104  -0.0200 0.0837  32  LYS A CG  
303  C  CD  . LYS A 37  ? 0.0741 0.0922 0.1117 -0.0132 -0.0119 0.0500  32  LYS A CD  
304  C  CE  . LYS A 37  ? 0.0938 0.0747 0.1482 -0.0514 -0.0381 0.0616  32  LYS A CE  
305  N  NZ  . LYS A 37  ? 0.0938 0.1636 0.2378 -0.0273 -0.0152 0.0394  32  LYS A NZ  
306  N  N   . GLY A 38  ? 0.1072 0.1180 0.1289 0.0077  -0.0037 0.0442  33  GLY A N   
307  C  CA  . GLY A 38  ? 0.1229 0.0685 0.1519 0.0085  0.0128  0.0196  33  GLY A CA  
308  C  C   . GLY A 38  ? 0.1331 0.0768 0.1748 0.0070  0.0099  0.0390  33  GLY A C   
309  O  O   . GLY A 38  ? 0.1841 0.1188 0.2139 0.0102  0.0128  0.0480  33  GLY A O   
310  N  N   . GLU A 39  ? 0.1200 0.0853 0.1694 -0.0058 -0.0059 0.0200  34  GLU A N   
311  C  CA  . GLU A 39  ? 0.1297 0.0850 0.1777 -0.0099 -0.0126 0.0140  34  GLU A CA  
312  C  C   . GLU A 39  ? 0.1377 0.0768 0.1939 -0.0337 -0.0044 0.0132  34  GLU A C   
313  O  O   . GLU A 39  ? 0.1654 0.1166 0.1790 -0.0348 -0.0201 -0.0306 34  GLU A O   
314  C  CB  . GLU A 39  ? 0.1430 0.1289 0.2091 -0.0245 -0.0080 0.0215  34  GLU A CB  
315  C  CG  . GLU A 39  ? 0.2431 0.1990 0.2385 -0.0234 -0.0332 0.0119  34  GLU A CG  
316  C  CD  . GLU A 39  ? 0.2961 0.2990 0.3462 -0.0283 -0.0552 0.0413  34  GLU A CD  
317  O  OE1 . GLU A 39  ? 0.3576 0.4547 0.4356 -0.0060 -0.0937 0.0402  34  GLU A OE1 
318  O  OE2 . GLU A 39  ? 0.2992 0.3644 0.3968 0.0208  -0.0679 0.0420  34  GLU A OE2 
319  N  N   . GLU A 40  ? 0.1264 0.0897 0.2011 -0.0082 -0.0090 0.0049  35  GLU A N   
320  C  CA  . GLU A 40  ? 0.1243 0.0712 0.1698 -0.0303 0.0030  0.0183  35  GLU A CA  
321  C  C   . GLU A 40  ? 0.1187 0.1051 0.1647 -0.0283 -0.0031 0.0031  35  GLU A C   
322  O  O   . GLU A 40  ? 0.1550 0.1176 0.1661 -0.0426 -0.0197 0.0050  35  GLU A O   
323  C  CB  . GLU A 40  ? 0.1847 0.0809 0.2062 -0.0298 0.0087  0.0185  35  GLU A CB  
324  C  CG  . GLU A 40  ? 0.2408 0.1849 0.2647 -0.0598 0.0381  0.0234  35  GLU A CG  
325  C  CD  . GLU A 40  ? 0.2762 0.2358 0.3137 -0.0312 0.0363  -0.0165 35  GLU A CD  
326  O  OE1 . GLU A 40  ? 0.2540 0.3122 0.3340 -0.0931 -0.0136 -0.0321 35  GLU A OE1 
327  O  OE2 . GLU A 40  ? 0.3037 0.2835 0.4055 0.0158  -0.0542 -0.0399 35  GLU A OE2 
328  N  N   . LEU A 41  ? 0.0785 0.0934 0.1687 -0.0271 0.0037  0.0036  36  LEU A N   
329  C  CA  A LEU A 41  ? 0.1029 0.0753 0.1496 -0.0186 0.0044  0.0219  36  LEU A CA  
330  C  CA  B LEU A 41  ? 0.1159 0.0817 0.1633 -0.0202 0.0046  0.0118  36  LEU A CA  
331  C  C   . LEU A 41  ? 0.1165 0.0702 0.1528 -0.0111 0.0053  0.0164  36  LEU A C   
332  O  O   . LEU A 41  ? 0.1464 0.0825 0.1521 0.0105  -0.0018 0.0353  36  LEU A O   
333  C  CB  A LEU A 41  ? 0.1122 0.0658 0.1376 0.0002  0.0026  0.0143  36  LEU A CB  
334  C  CB  B LEU A 41  ? 0.1405 0.0793 0.1600 -0.0123 0.0041  0.0010  36  LEU A CB  
335  C  CG  A LEU A 41  ? 0.0611 0.0953 0.1232 -0.0119 0.0110  0.0416  36  LEU A CG  
336  C  CG  B LEU A 41  ? 0.1546 0.1360 0.2185 -0.0140 0.0071  -0.0283 36  LEU A CG  
337  C  CD1 A LEU A 41  ? 0.1115 0.0984 0.0688 -0.0103 0.0145  0.0080  36  LEU A CD1 
338  C  CD1 B LEU A 41  ? 0.1899 0.1082 0.2539 -0.0961 0.0025  -0.0462 36  LEU A CD1 
339  C  CD2 A LEU A 41  ? 0.0922 0.1787 0.0908 0.0252  -0.0254 0.0135  36  LEU A CD2 
340  C  CD2 B LEU A 41  ? 0.1651 0.1083 0.2099 -0.0251 -0.0017 -0.0544 36  LEU A CD2 
341  N  N   . SER A 42  ? 0.1069 0.0794 0.1416 0.0045  0.0050  0.0053  37  SER A N   
342  C  CA  . SER A 42  ? 0.0777 0.0809 0.1395 0.0028  -0.0021 -0.0232 37  SER A CA  
343  C  C   . SER A 42  ? 0.1047 0.0808 0.1236 0.0209  0.0091  -0.0234 37  SER A C   
344  O  O   . SER A 42  ? 0.1143 0.0512 0.1298 0.0160  0.0071  -0.0199 37  SER A O   
345  C  CB  . SER A 42  ? 0.1045 0.0487 0.1396 -0.0040 -0.0094 0.0109  37  SER A CB  
346  O  OG  . SER A 42  ? 0.1295 0.0528 0.1188 -0.0106 -0.0074 -0.0138 37  SER A OG  
347  N  N   . VAL A 43  ? 0.0794 0.0864 0.1022 0.0356  -0.0114 -0.0055 38  VAL A N   
348  C  CA  A VAL A 43  ? 0.1044 0.0846 0.1561 0.0191  -0.0021 -0.0193 38  VAL A CA  
349  C  CA  B VAL A 43  ? 0.1002 0.0714 0.1403 0.0217  0.0034  -0.0121 38  VAL A CA  
350  C  C   . VAL A 43  ? 0.1005 0.0781 0.1182 0.0004  -0.0073 -0.0151 38  VAL A C   
351  O  O   . VAL A 43  ? 0.1451 0.0954 0.1043 -0.0044 0.0017  -0.0292 38  VAL A O   
352  C  CB  A VAL A 43  ? 0.1040 0.1077 0.1566 0.0190  -0.0003 -0.0315 38  VAL A CB  
353  C  CB  B VAL A 43  ? 0.1018 0.0800 0.1047 0.0248  0.0232  -0.0210 38  VAL A CB  
354  C  CG1 A VAL A 43  ? 0.1786 0.1344 0.2038 0.0023  0.0058  -0.0306 38  VAL A CG1 
355  C  CG1 B VAL A 43  ? 0.1197 0.1236 0.1551 0.0316  0.0249  -0.0158 38  VAL A CG1 
356  C  CG2 A VAL A 43  ? 0.0809 0.1511 0.2263 0.0423  -0.0072 -0.0437 38  VAL A CG2 
357  C  CG2 B VAL A 43  ? 0.1074 0.0424 0.1475 0.0371  0.0012  0.0062  38  VAL A CG2 
358  N  N   . GLU A 44  ? 0.1103 0.0496 0.1305 0.0184  0.0037  0.0060  39  GLU A N   
359  C  CA  . GLU A 44  ? 0.1144 0.0454 0.1176 -0.0034 0.0001  0.0021  39  GLU A CA  
360  C  C   . GLU A 44  ? 0.0754 0.0259 0.0941 0.0012  0.0023  -0.0064 39  GLU A C   
361  O  O   . GLU A 44  ? 0.1053 0.0391 0.1445 0.0089  0.0029  -0.0269 39  GLU A O   
362  C  CB  . GLU A 44  ? 0.1758 0.0456 0.1085 0.0027  0.0224  0.0394  39  GLU A CB  
363  C  CG  . GLU A 44  ? 0.2681 0.0486 0.1767 -0.0010 0.0374  0.0283  39  GLU A CG  
364  C  CD  . GLU A 44  ? 0.4728 0.1245 0.2177 -0.0205 0.0662  0.0324  39  GLU A CD  
365  O  OE1 . GLU A 44  ? 0.5917 0.2131 0.2880 -0.1039 0.0394  0.0132  39  GLU A OE1 
366  O  OE2 . GLU A 44  ? 0.4914 0.2054 0.3003 -0.0048 0.0302  0.0617  39  GLU A OE2 
367  N  N   . GLU A 45  ? 0.0615 0.0283 0.1182 0.0100  -0.0023 -0.0051 40  GLU A N   
368  C  CA  . GLU A 45  ? 0.0799 0.0370 0.1137 0.0088  -0.0104 -0.0057 40  GLU A CA  
369  C  C   . GLU A 45  ? 0.0850 0.0298 0.1078 -0.0025 -0.0107 -0.0045 40  GLU A C   
370  O  O   . GLU A 45  ? 0.1150 0.0356 0.1293 0.0201  -0.0209 -0.0261 40  GLU A O   
371  C  CB  . GLU A 45  ? 0.0893 0.0690 0.0747 -0.0001 -0.0258 -0.0255 40  GLU A CB  
372  C  CG  . GLU A 45  ? 0.0787 0.1003 0.0686 -0.0179 -0.0437 -0.0053 40  GLU A CG  
373  C  CD  . GLU A 45  ? 0.0580 0.1245 0.1194 0.0069  -0.0271 -0.0034 40  GLU A CD  
374  O  OE1 . GLU A 45  ? 0.1286 0.0881 0.1083 0.0088  -0.0304 0.0271  40  GLU A OE1 
375  O  OE2 . GLU A 45  ? 0.1431 0.2322 0.1218 0.0019  -0.0125 -0.0031 40  GLU A OE2 
376  N  N   . ARG A 46  ? 0.1401 0.0501 0.1236 0.0037  -0.0135 0.0147  41  ARG A N   
377  C  CA  . ARG A 46  ? 0.1411 0.0469 0.1103 -0.0180 -0.0038 0.0012  41  ARG A CA  
378  C  C   . ARG A 46  ? 0.1166 0.0689 0.1213 -0.0079 -0.0003 0.0042  41  ARG A C   
379  O  O   . ARG A 46  ? 0.1100 0.0481 0.1255 -0.0053 0.0011  -0.0036 41  ARG A O   
380  C  CB  . ARG A 46  ? 0.2275 0.0729 0.1315 -0.0752 -0.0090 0.0365  41  ARG A CB  
381  C  CG  . ARG A 46  ? 0.2637 0.0945 0.2396 -0.0108 0.0096  0.0692  41  ARG A CG  
382  C  CD  . ARG A 46  ? 0.3889 0.1649 0.2605 0.0021  0.0495  0.1263  41  ARG A CD  
383  N  NE  . ARG A 46  ? 0.4354 0.1003 0.2778 0.0486  -0.0016 0.1320  41  ARG A NE  
384  C  CZ  . ARG A 46  ? 0.3387 0.1740 0.2675 -0.0463 0.0116  0.0432  41  ARG A CZ  
385  N  NH1 . ARG A 46  ? 0.3508 0.0924 0.2181 -0.0205 -0.0283 0.0150  41  ARG A NH1 
386  N  NH2 . ARG A 46  ? 0.3406 0.1196 0.3560 -0.0523 -0.0055 0.0211  41  ARG A NH2 
387  N  N   . ASN A 47  ? 0.0870 0.0767 0.1173 0.0098  -0.0003 -0.0005 42  ASN A N   
388  C  CA  . ASN A 47  ? 0.0902 0.0556 0.1265 0.0204  0.0070  -0.0106 42  ASN A CA  
389  C  C   . ASN A 47  ? 0.0873 0.0645 0.1059 0.0073  -0.0035 -0.0051 42  ASN A C   
390  O  O   . ASN A 47  ? 0.1216 0.0891 0.1012 0.0129  -0.0070 -0.0219 42  ASN A O   
391  C  CB  . ASN A 47  ? 0.0660 0.0563 0.0950 0.0345  -0.0001 -0.0109 42  ASN A CB  
392  C  CG  . ASN A 47  ? 0.1255 0.0865 0.1682 0.0449  0.0056  0.0096  42  ASN A CG  
393  O  OD1 . ASN A 47  ? 0.1464 0.1582 0.1401 0.0463  -0.0366 -0.0170 42  ASN A OD1 
394  N  ND2 . ASN A 47  ? 0.1417 0.1303 0.1471 0.0582  -0.0354 -0.0387 42  ASN A ND2 
395  N  N   . LEU A 48  ? 0.0759 0.0556 0.1047 0.0259  -0.0055 0.0080  43  LEU A N   
396  C  CA  . LEU A 48  ? 0.0987 0.0495 0.0881 0.0174  -0.0063 -0.0083 43  LEU A CA  
397  C  C   . LEU A 48  ? 0.0876 0.0480 0.0796 0.0089  0.0103  -0.0053 43  LEU A C   
398  O  O   . LEU A 48  ? 0.1179 0.0406 0.1032 -0.0020 0.0076  -0.0345 43  LEU A O   
399  C  CB  . LEU A 48  ? 0.0852 0.0951 0.0865 0.0136  -0.0141 -0.0064 43  LEU A CB  
400  C  CG  . LEU A 48  ? 0.1391 0.0840 0.0712 -0.0290 0.0021  -0.0175 43  LEU A CG  
401  C  CD1 . LEU A 48  ? 0.1410 0.1236 0.0954 -0.0410 -0.0306 -0.0350 43  LEU A CD1 
402  C  CD2 . LEU A 48  ? 0.1908 0.0829 0.1450 -0.0578 0.0717  0.0175  43  LEU A CD2 
403  N  N   . LEU A 49  ? 0.0915 0.0263 0.0966 0.0029  0.0276  -0.0062 44  LEU A N   
404  C  CA  . LEU A 49  ? 0.0831 0.0322 0.0910 -0.0084 0.0370  -0.0208 44  LEU A CA  
405  C  C   . LEU A 49  ? 0.0836 0.0660 0.1075 0.0176  0.0114  0.0023  44  LEU A C   
406  O  O   . LEU A 49  ? 0.0629 0.0377 0.1289 0.0127  0.0083  0.0023  44  LEU A O   
407  C  CB  . LEU A 49  ? 0.0978 0.0335 0.0952 -0.0044 0.0686  0.0021  44  LEU A CB  
408  C  CG  . LEU A 49  ? 0.1114 0.0442 0.1214 0.0062  0.0716  -0.0090 44  LEU A CG  
409  C  CD1 . LEU A 49  ? 0.0972 0.1031 0.1485 0.0572  0.0204  -0.0451 44  LEU A CD1 
410  C  CD2 . LEU A 49  ? 0.1376 0.0265 0.2213 0.0061  0.0725  -0.0071 44  LEU A CD2 
411  N  N   . SER A 50  ? 0.0704 0.0384 0.0912 0.0211  0.0109  0.0194  45  SER A N   
412  C  CA  A SER A 50  ? 0.0864 0.0309 0.0985 0.0184  0.0060  0.0036  45  SER A CA  
413  C  CA  B SER A 50  ? 0.1019 0.0367 0.1131 0.0160  0.0029  0.0071  45  SER A CA  
414  C  C   . SER A 50  ? 0.1079 0.0464 0.1037 0.0197  0.0003  0.0007  45  SER A C   
415  O  O   . SER A 50  ? 0.1105 0.0568 0.1354 0.0042  -0.0143 -0.0237 45  SER A O   
416  C  CB  A SER A 50  ? 0.0671 0.0499 0.0889 0.0316  -0.0032 0.0040  45  SER A CB  
417  C  CB  B SER A 50  ? 0.1021 0.0420 0.1193 0.0254  0.0002  0.0083  45  SER A CB  
418  O  OG  A SER A 50  ? 0.0463 0.0490 0.0867 0.0158  0.0109  -0.0173 45  SER A OG  
419  O  OG  B SER A 50  ? 0.1661 0.0955 0.1696 0.0063  -0.0121 0.0104  45  SER A OG  
420  N  N   . VAL A 51  ? 0.0793 0.0339 0.1019 -0.0024 0.0082  0.0144  46  VAL A N   
421  C  CA  . VAL A 51  ? 0.0724 0.0259 0.1076 0.0005  0.0287  -0.0059 46  VAL A CA  
422  C  C   . VAL A 51  ? 0.0974 0.0362 0.1114 0.0088  0.0057  -0.0172 46  VAL A C   
423  O  O   . VAL A 51  ? 0.1289 0.0482 0.1087 0.0037  -0.0055 -0.0376 46  VAL A O   
424  C  CB  . VAL A 51  ? 0.0896 0.0259 0.0913 0.0003  0.0322  -0.0055 46  VAL A CB  
425  C  CG1 . VAL A 51  ? 0.1530 0.0455 0.1505 -0.0192 0.0559  0.0231  46  VAL A CG1 
426  C  CG2 . VAL A 51  ? 0.0632 0.0723 0.1939 0.0225  0.0075  0.0055  46  VAL A CG2 
427  N  N   . ALA A 52  ? 0.0645 0.0471 0.1129 0.0279  0.0035  -0.0103 47  ALA A N   
428  C  CA  . ALA A 52  ? 0.0572 0.0404 0.1017 0.0218  0.0016  -0.0025 47  ALA A CA  
429  C  C   . ALA A 52  ? 0.0832 0.0516 0.1054 0.0067  -0.0092 0.0090  47  ALA A C   
430  O  O   . ALA A 52  ? 0.1079 0.0637 0.1388 -0.0022 -0.0033 0.0040  47  ALA A O   
431  C  CB  . ALA A 52  ? 0.0974 0.0574 0.1227 0.0067  -0.0368 -0.0030 47  ALA A CB  
432  N  N   . TYR A 53  ? 0.0966 0.0482 0.0798 0.0095  0.0003  0.0243  48  TYR A N   
433  C  CA  . TYR A 53  ? 0.0920 0.0489 0.0932 -0.0021 0.0080  0.0207  48  TYR A CA  
434  C  C   . TYR A 53  ? 0.1010 0.0495 0.1063 0.0341  -0.0065 0.0054  48  TYR A C   
435  O  O   . TYR A 53  ? 0.1276 0.0566 0.0818 0.0417  0.0180  -0.0170 48  TYR A O   
436  C  CB  . TYR A 53  ? 0.0825 0.0377 0.1305 0.0038  -0.0016 0.0098  48  TYR A CB  
437  C  CG  . TYR A 53  ? 0.0770 0.0392 0.1189 0.0047  -0.0048 0.0164  48  TYR A CG  
438  C  CD1 . TYR A 53  ? 0.0891 0.0323 0.1182 0.0079  -0.0385 0.0127  48  TYR A CD1 
439  C  CD2 . TYR A 53  ? 0.0823 0.0697 0.0796 -0.0041 -0.0212 0.0235  48  TYR A CD2 
440  C  CE1 . TYR A 53  ? 0.0702 0.0797 0.1342 -0.0202 -0.0173 -0.0328 48  TYR A CE1 
441  C  CE2 . TYR A 53  ? 0.0954 0.0710 0.1393 0.0272  0.0026  0.0421  48  TYR A CE2 
442  C  CZ  . TYR A 53  ? 0.1200 0.0956 0.1235 0.0225  -0.0208 -0.0153 48  TYR A CZ  
443  O  OH  . TYR A 53  ? 0.1111 0.1186 0.1481 0.0192  -0.0082 -0.0113 48  TYR A OH  
444  N  N   . LYS A 54  ? 0.0711 0.0686 0.1162 0.0360  -0.0264 0.0096  49  LYS A N   
445  C  CA  A LYS A 54  ? 0.1000 0.0788 0.1251 0.0229  -0.0277 0.0020  49  LYS A CA  
446  C  CA  B LYS A 54  ? 0.0851 0.0686 0.1239 0.0222  -0.0232 -0.0011 49  LYS A CA  
447  C  CA  C LYS A 54  ? 0.1029 0.0862 0.1358 0.0296  -0.0240 -0.0009 49  LYS A CA  
448  C  C   . LYS A 54  ? 0.0890 0.0908 0.1203 0.0186  -0.0355 -0.0115 49  LYS A C   
449  O  O   . LYS A 54  ? 0.1220 0.0881 0.1330 0.0136  -0.0348 -0.0241 49  LYS A O   
450  C  CB  A LYS A 54  ? 0.0791 0.0887 0.1361 0.0325  -0.0356 0.0077  49  LYS A CB  
451  C  CB  B LYS A 54  ? 0.0530 0.0740 0.1296 0.0298  -0.0330 -0.0025 49  LYS A CB  
452  C  CB  C LYS A 54  ? 0.0607 0.1010 0.1528 0.0463  -0.0337 -0.0064 49  LYS A CB  
453  C  CG  A LYS A 54  ? 0.1259 0.1115 0.1362 0.0007  -0.0371 0.0157  49  LYS A CG  
454  C  CG  B LYS A 54  ? 0.0269 0.0271 0.1150 0.0016  -0.0073 -0.0051 49  LYS A CG  
455  C  CG  C LYS A 54  ? 0.1477 0.2292 0.1908 0.0496  -0.0310 -0.0117 49  LYS A CG  
456  C  CD  A LYS A 54  ? 0.1782 0.0601 0.1661 -0.0730 -0.0375 0.0168  49  LYS A CD  
457  C  CD  B LYS A 54  ? 0.0449 0.0789 0.1738 0.0227  0.0020  -0.0305 49  LYS A CD  
458  C  CD  C LYS A 54  ? 0.1543 0.2483 0.2565 0.0154  0.0066  -0.0233 49  LYS A CD  
459  C  CE  A LYS A 54  ? 0.1601 0.0722 0.0795 -0.0770 0.0259  -0.0068 49  LYS A CE  
460  C  CE  B LYS A 54  ? 0.0358 0.1515 0.1914 0.0141  0.0324  -0.0403 49  LYS A CE  
461  C  CE  C LYS A 54  ? 0.1774 0.3085 0.2802 0.0533  0.0112  -0.0045 49  LYS A CE  
462  N  NZ  A LYS A 54  ? 0.1068 0.2354 0.0472 -0.1257 -0.0083 -0.0056 49  LYS A NZ  
463  N  NZ  B LYS A 54  ? 0.0302 0.0812 0.1764 0.0047  0.0219  -0.0317 49  LYS A NZ  
464  N  NZ  C LYS A 54  ? 0.0983 0.2811 0.1902 0.0832  0.0862  0.0785  49  LYS A NZ  
465  N  N   . ASN A 55  ? 0.1117 0.0667 0.1177 -0.0052 -0.0144 0.0025  50  ASN A N   
466  C  CA  . ASN A 55  ? 0.1006 0.0487 0.0905 -0.0129 -0.0026 -0.0008 50  ASN A CA  
467  C  C   . ASN A 55  ? 0.1060 0.0525 0.1084 -0.0100 -0.0131 -0.0125 50  ASN A C   
468  O  O   . ASN A 55  ? 0.1579 0.0667 0.1466 -0.0042 0.0021  -0.0196 50  ASN A O   
469  C  CB  . ASN A 55  ? 0.1275 0.0838 0.0554 -0.0058 0.0228  -0.0257 50  ASN A CB  
470  C  CG  . ASN A 55  ? 0.1568 0.1237 0.1850 -0.0307 0.0326  -0.0181 50  ASN A CG  
471  O  OD1 . ASN A 55  ? 0.2438 0.2165 0.2761 -0.0085 0.0231  -0.0435 50  ASN A OD1 
472  N  ND2 . ASN A 55  ? 0.1475 0.1812 0.2570 -0.0800 0.0367  -0.0968 50  ASN A ND2 
473  N  N   . VAL A 56  ? 0.1244 0.0594 0.1262 -0.0060 -0.0124 0.0024  51  VAL A N   
474  C  CA  . VAL A 56  ? 0.1056 0.0444 0.1069 0.0104  -0.0221 -0.0010 51  VAL A CA  
475  C  C   . VAL A 56  ? 0.1185 0.0295 0.1099 -0.0007 -0.0019 -0.0025 51  VAL A C   
476  O  O   . VAL A 56  ? 0.1554 0.0327 0.1234 0.0146  -0.0396 -0.0208 51  VAL A O   
477  C  CB  . VAL A 56  ? 0.1260 0.0361 0.0877 0.0242  -0.0396 -0.0248 51  VAL A CB  
478  C  CG1 . VAL A 56  ? 0.1146 0.0547 0.1708 0.0278  -0.0021 -0.0182 51  VAL A CG1 
479  C  CG2 . VAL A 56  ? 0.1398 0.0968 0.0726 0.0017  -0.0386 -0.0199 51  VAL A CG2 
480  N  N   . VAL A 57  ? 0.1586 0.0546 0.0983 0.0094  -0.0165 0.0055  52  VAL A N   
481  C  CA  A VAL A 57  ? 0.1371 0.0509 0.0961 0.0007  -0.0032 0.0037  52  VAL A CA  
482  C  CA  B VAL A 57  ? 0.1512 0.0572 0.1058 0.0081  -0.0066 0.0126  52  VAL A CA  
483  C  C   . VAL A 57  ? 0.1586 0.0713 0.1104 0.0093  -0.0112 -0.0007 52  VAL A C   
484  O  O   . VAL A 57  ? 0.1598 0.0786 0.1161 0.0065  -0.0290 -0.0130 52  VAL A O   
485  C  CB  A VAL A 57  ? 0.1336 0.0521 0.0860 -0.0059 -0.0073 0.0126  52  VAL A CB  
486  C  CB  B VAL A 57  ? 0.1602 0.0637 0.1035 0.0017  -0.0055 0.0204  52  VAL A CB  
487  C  CG1 A VAL A 57  ? 0.0596 0.0258 0.0585 0.0000  0.0155  -0.0036 52  VAL A CG1 
488  C  CG1 B VAL A 57  ? 0.1758 0.0658 0.1299 0.0473  -0.0218 -0.0306 52  VAL A CG1 
489  C  CG2 A VAL A 57  ? 0.0999 0.0764 0.1534 0.0076  0.0021  -0.0341 52  VAL A CG2 
490  C  CG2 B VAL A 57  ? 0.1022 0.0749 0.1623 0.0240  0.0077  0.0781  52  VAL A CG2 
491  N  N   . GLY A 58  ? 0.1396 0.0809 0.1077 0.0152  -0.0076 0.0011  53  GLY A N   
492  C  CA  . GLY A 58  ? 0.1621 0.0525 0.1594 0.0098  -0.0141 -0.0162 53  GLY A CA  
493  C  C   . GLY A 58  ? 0.1591 0.0686 0.1643 0.0201  -0.0159 -0.0243 53  GLY A C   
494  O  O   . GLY A 58  ? 0.1606 0.0753 0.1870 0.0057  -0.0245 -0.0503 53  GLY A O   
495  N  N   . GLY A 59  ? 0.1713 0.0631 0.1571 0.0296  -0.0035 -0.0125 54  GLY A N   
496  C  CA  . GLY A 59  ? 0.1765 0.0809 0.1441 0.0370  0.0057  -0.0404 54  GLY A CA  
497  C  C   . GLY A 59  ? 0.1517 0.0825 0.1407 0.0355  -0.0037 -0.0250 54  GLY A C   
498  O  O   . GLY A 59  ? 0.2101 0.0903 0.1368 0.0576  -0.0102 -0.0284 54  GLY A O   
499  N  N   . GLN A 60  ? 0.1321 0.0672 0.1001 0.0148  -0.0216 -0.0004 55  GLN A N   
500  C  CA  . GLN A 60  ? 0.0978 0.0446 0.1299 0.0153  -0.0244 -0.0161 55  GLN A CA  
501  C  C   . GLN A 60  ? 0.1171 0.0289 0.1016 0.0180  -0.0189 -0.0062 55  GLN A C   
502  O  O   . GLN A 60  ? 0.1421 0.0400 0.1317 0.0219  -0.0375 -0.0181 55  GLN A O   
503  C  CB  . GLN A 60  ? 0.1087 0.0694 0.1318 -0.0116 -0.0616 0.0047  55  GLN A CB  
504  C  CG  . GLN A 60  ? 0.1738 0.1094 0.1378 0.0343  -0.0871 -0.0253 55  GLN A CG  
505  C  CD  . GLN A 60  ? 0.1977 0.0904 0.1697 0.0397  -0.0907 0.0201  55  GLN A CD  
506  O  OE1 . GLN A 60  ? 0.1895 0.0787 0.2511 0.0368  0.0119  0.0143  55  GLN A OE1 
507  N  NE2 . GLN A 60  ? 0.2457 0.0548 0.3393 0.0751  -0.1079 -0.0068 55  GLN A NE2 
508  N  N   . ARG A 61  ? 0.1252 0.0446 0.0924 0.0406  -0.0393 -0.0041 56  ARG A N   
509  C  CA  . ARG A 61  ? 0.1335 0.0438 0.1177 0.0389  -0.0347 0.0065  56  ARG A CA  
510  C  C   . ARG A 61  ? 0.1471 0.0422 0.1114 0.0340  -0.0296 -0.0085 56  ARG A C   
511  O  O   . ARG A 61  ? 0.1698 0.0355 0.1353 0.0354  -0.0389 -0.0218 56  ARG A O   
512  C  CB  . ARG A 61  ? 0.1564 0.0343 0.1143 0.0315  -0.0278 0.0042  56  ARG A CB  
513  C  CG  . ARG A 61  ? 0.1419 0.0352 0.1429 0.0327  -0.0125 -0.0126 56  ARG A CG  
514  C  CD  . ARG A 61  ? 0.1614 0.0695 0.1553 0.0715  -0.0755 -0.0153 56  ARG A CD  
515  N  NE  . ARG A 61  ? 0.1218 0.0528 0.1409 0.0429  -0.0372 0.0127  56  ARG A NE  
516  C  CZ  . ARG A 61  ? 0.1628 0.0395 0.1161 0.0434  0.0043  0.0076  56  ARG A CZ  
517  N  NH1 . ARG A 61  ? 0.2097 0.0390 0.0968 0.0106  -0.0242 0.0023  56  ARG A NH1 
518  N  NH2 . ARG A 61  ? 0.1889 0.0431 0.1250 0.0450  -0.0345 0.0129  56  ARG A NH2 
519  N  N   . ALA A 62  ? 0.1462 0.0406 0.1339 0.0122  -0.0226 -0.0067 57  ALA A N   
520  C  CA  . ALA A 62  ? 0.1395 0.0557 0.1519 0.0149  -0.0139 -0.0255 57  ALA A CA  
521  C  C   . ALA A 62  ? 0.1259 0.0621 0.1389 0.0193  -0.0249 -0.0373 57  ALA A C   
522  O  O   . ALA A 62  ? 0.1535 0.0568 0.1555 -0.0021 -0.0244 -0.0302 57  ALA A O   
523  C  CB  . ALA A 62  ? 0.1610 0.0805 0.1670 0.0199  0.0055  -0.0425 57  ALA A CB  
524  N  N   . ALA A 63  ? 0.1385 0.0462 0.1396 0.0401  -0.0483 -0.0248 58  ALA A N   
525  C  CA  . ALA A 63  ? 0.1338 0.0826 0.1415 0.0426  -0.0334 -0.0260 58  ALA A CA  
526  C  C   . ALA A 63  ? 0.1458 0.0691 0.1209 0.0272  -0.0394 -0.0232 58  ALA A C   
527  O  O   . ALA A 63  ? 0.1593 0.0471 0.1391 0.0026  -0.0378 -0.0155 58  ALA A O   
528  C  CB  . ALA A 63  ? 0.1707 0.0678 0.1178 0.0314  -0.0568 -0.0291 58  ALA A CB  
529  N  N   . TRP A 64  ? 0.1427 0.0657 0.1067 0.0314  -0.0057 0.0005  59  TRP A N   
530  C  CA  . TRP A 64  ? 0.1408 0.0531 0.1056 0.0195  -0.0200 -0.0152 59  TRP A CA  
531  C  C   . TRP A 64  ? 0.1513 0.0676 0.1396 0.0180  -0.0160 -0.0166 59  TRP A C   
532  O  O   . TRP A 64  ? 0.1470 0.0739 0.1459 0.0123  -0.0251 -0.0211 59  TRP A O   
533  C  CB  . TRP A 64  ? 0.1338 0.0484 0.1240 0.0101  0.0081  -0.0017 59  TRP A CB  
534  C  CG  . TRP A 64  ? 0.1595 0.0619 0.1008 0.0298  -0.0248 -0.0351 59  TRP A CG  
535  C  CD1 . TRP A 64  ? 0.2182 0.1116 0.1130 0.0836  0.0278  -0.0526 59  TRP A CD1 
536  C  CD2 . TRP A 64  ? 0.2060 0.0643 0.1114 0.0563  -0.0349 -0.0371 59  TRP A CD2 
537  N  NE1 . TRP A 64  ? 0.2396 0.0783 0.0849 0.0825  -0.0275 -0.0451 59  TRP A NE1 
538  C  CE2 . TRP A 64  ? 0.2426 0.0854 0.0837 0.0569  -0.0578 -0.0110 59  TRP A CE2 
539  C  CE3 . TRP A 64  ? 0.2041 0.0494 0.0965 0.0619  -0.0706 -0.0352 59  TRP A CE3 
540  C  CZ2 . TRP A 64  ? 0.2804 0.0382 0.1337 0.0499  -0.0587 -0.0192 59  TRP A CZ2 
541  C  CZ3 . TRP A 64  ? 0.2244 0.0998 0.0662 0.0912  -0.0472 -0.0181 59  TRP A CZ3 
542  C  CH2 . TRP A 64  ? 0.2708 0.0744 0.1310 0.1031  -0.0099 -0.0136 59  TRP A CH2 
543  N  N   . ARG A 65  ? 0.1540 0.0633 0.1483 0.0255  -0.0502 -0.0225 60  ARG A N   
544  C  CA  . ARG A 65  ? 0.1529 0.0441 0.1747 0.0291  -0.0523 -0.0175 60  ARG A CA  
545  C  C   . ARG A 65  ? 0.1723 0.0638 0.1649 0.0140  -0.0496 -0.0270 60  ARG A C   
546  O  O   . ARG A 65  ? 0.1862 0.0716 0.1711 0.0078  -0.0514 -0.0384 60  ARG A O   
547  C  CB  . ARG A 65  ? 0.1713 0.0747 0.1677 0.0379  -0.0342 -0.0245 60  ARG A CB  
548  C  CG  . ARG A 65  ? 0.1578 0.0652 0.2062 0.0557  -0.0347 -0.0162 60  ARG A CG  
549  C  CD  . ARG A 65  ? 0.1578 0.1453 0.1806 0.0889  0.0090  -0.0364 60  ARG A CD  
550  N  NE  . ARG A 65  ? 0.1797 0.1436 0.1565 0.0237  -0.0326 -0.0020 60  ARG A NE  
551  C  CZ  . ARG A 65  ? 0.1646 0.1200 0.1681 0.0398  -0.0145 -0.0229 60  ARG A CZ  
552  N  NH1 . ARG A 65  ? 0.2273 0.0452 0.2373 0.0525  -0.0025 0.0039  60  ARG A NH1 
553  N  NH2 . ARG A 65  ? 0.1796 0.1516 0.2319 0.0596  -0.0233 0.0052  60  ARG A NH2 
554  N  N   . VAL A 66  ? 0.1640 0.0510 0.1547 0.0109  -0.0476 -0.0141 61  VAL A N   
555  C  CA  . VAL A 66  ? 0.1877 0.0744 0.1815 -0.0009 -0.0356 -0.0260 61  VAL A CA  
556  C  C   . VAL A 66  ? 0.1745 0.0470 0.1691 -0.0024 -0.0414 -0.0311 61  VAL A C   
557  O  O   . VAL A 66  ? 0.2207 0.0495 0.1772 -0.0063 -0.0478 -0.0337 61  VAL A O   
558  C  CB  . VAL A 66  ? 0.1960 0.0722 0.1917 -0.0043 -0.0235 -0.0097 61  VAL A CB  
559  C  CG1 . VAL A 66  ? 0.1759 0.0951 0.2356 -0.0338 -0.0450 -0.0485 61  VAL A CG1 
560  C  CG2 . VAL A 66  ? 0.1833 0.0709 0.2297 0.0274  -0.0342 -0.0797 61  VAL A CG2 
561  N  N   . LEU A 67  ? 0.1607 0.0634 0.1491 0.0200  -0.0379 -0.0067 62  LEU A N   
562  C  CA  . LEU A 67  ? 0.1663 0.0523 0.1295 0.0209  -0.0402 0.0042  62  LEU A CA  
563  C  C   . LEU A 67  ? 0.1869 0.0691 0.1236 0.0222  -0.0361 -0.0074 62  LEU A C   
564  O  O   . LEU A 67  ? 0.1999 0.0796 0.1179 0.0066  -0.0420 -0.0311 62  LEU A O   
565  C  CB  . LEU A 67  ? 0.1523 0.0314 0.1009 0.0021  -0.0478 0.0178  62  LEU A CB  
566  C  CG  . LEU A 67  ? 0.1883 0.0570 0.1259 0.0232  -0.0680 0.0042  62  LEU A CG  
567  C  CD1 . LEU A 67  ? 0.1863 0.1203 0.1465 -0.0191 -0.0572 0.0078  62  LEU A CD1 
568  C  CD2 . LEU A 67  ? 0.1938 0.0431 0.2173 0.0271  -0.0509 -0.0310 62  LEU A CD2 
569  N  N   . SER A 68  ? 0.1992 0.0612 0.1384 0.0230  -0.0286 0.0088  63  SER A N   
570  C  CA  A SER A 68  ? 0.2208 0.0808 0.1196 0.0304  -0.0333 -0.0020 63  SER A CA  
571  C  CA  B SER A 68  ? 0.2126 0.0931 0.1352 0.0277  -0.0380 -0.0043 63  SER A CA  
572  C  C   . SER A 68  ? 0.2142 0.1005 0.1515 0.0342  -0.0445 -0.0121 63  SER A C   
573  O  O   . SER A 68  ? 0.2311 0.1107 0.1365 0.0349  -0.0409 -0.0141 63  SER A O   
574  C  CB  A SER A 68  ? 0.2203 0.0666 0.1050 0.0217  -0.0212 0.0200  63  SER A CB  
575  C  CB  B SER A 68  ? 0.2120 0.0857 0.1300 0.0238  -0.0289 0.0084  63  SER A CB  
576  O  OG  A SER A 68  ? 0.2567 0.0664 0.0934 0.0706  -0.0190 0.0302  63  SER A OG  
577  O  OG  B SER A 68  ? 0.2086 0.1541 0.1630 0.0265  -0.0487 0.0175  63  SER A OG  
578  N  N   . SER A 69  ? 0.2153 0.1033 0.1696 0.0417  -0.0515 -0.0255 64  SER A N   
579  C  CA  A SER A 69  ? 0.2053 0.1255 0.1660 0.0423  -0.0680 -0.0389 64  SER A CA  
580  C  CA  B SER A 69  ? 0.2125 0.1271 0.1745 0.0385  -0.0621 -0.0400 64  SER A CA  
581  C  CA  C SER A 69  ? 0.2279 0.1288 0.1733 0.0373  -0.0598 -0.0388 64  SER A CA  
582  C  C   . SER A 69  ? 0.2208 0.1401 0.1787 0.0397  -0.0665 -0.0385 64  SER A C   
583  O  O   . SER A 69  ? 0.2523 0.1637 0.1923 0.0434  -0.0805 -0.0460 64  SER A O   
584  C  CB  A SER A 69  ? 0.2058 0.1216 0.1694 0.0396  -0.0728 -0.0304 64  SER A CB  
585  C  CB  B SER A 69  ? 0.2189 0.1253 0.1857 0.0408  -0.0609 -0.0325 64  SER A CB  
586  C  CB  C SER A 69  ? 0.2358 0.1315 0.1862 0.0387  -0.0573 -0.0357 64  SER A CB  
587  O  OG  A SER A 69  ? 0.1285 0.1223 0.1637 0.0656  -0.0798 -0.0576 64  SER A OG  
588  O  OG  B SER A 69  ? 0.1741 0.1340 0.2122 0.0288  -0.0478 -0.0637 64  SER A OG  
589  O  OG  C SER A 69  ? 0.2894 0.1425 0.1983 0.0239  -0.0292 -0.0487 64  SER A OG  
590  N  N   . ILE A 70  ? 0.2155 0.1147 0.1776 0.0512  -0.0810 -0.0404 65  ILE A N   
591  C  CA  A ILE A 70  ? 0.2129 0.1414 0.1991 0.0382  -0.0618 -0.0465 65  ILE A CA  
592  C  CA  B ILE A 70  ? 0.2219 0.1414 0.1970 0.0379  -0.0631 -0.0491 65  ILE A CA  
593  C  C   . ILE A 70  ? 0.2263 0.1410 0.1934 0.0375  -0.0647 -0.0550 65  ILE A C   
594  O  O   . ILE A 70  ? 0.2517 0.1707 0.1952 0.0380  -0.0408 -0.0726 65  ILE A O   
595  C  CB  A ILE A 70  ? 0.2184 0.1243 0.1988 0.0392  -0.0607 -0.0334 65  ILE A CB  
596  C  CB  B ILE A 70  ? 0.2241 0.1385 0.2014 0.0395  -0.0646 -0.0436 65  ILE A CB  
597  C  CG1 A ILE A 70  ? 0.1590 0.0934 0.1870 0.0724  -0.0712 -0.0381 65  ILE A CG1 
598  C  CG1 B ILE A 70  ? 0.2174 0.1557 0.2173 0.0378  -0.0596 -0.0528 65  ILE A CG1 
599  C  CG2 A ILE A 70  ? 0.2325 0.1463 0.2175 0.0339  -0.0439 -0.0549 65  ILE A CG2 
600  C  CG2 B ILE A 70  ? 0.2321 0.1462 0.2179 0.0379  -0.0588 -0.0535 65  ILE A CG2 
601  C  CD1 A ILE A 70  ? 0.1653 0.0647 0.1594 0.0254  -0.0729 0.0446  65  ILE A CD1 
602  C  CD1 B ILE A 70  ? 0.2290 0.2373 0.2805 0.0469  -0.0548 -0.0244 65  ILE A CD1 
603  N  N   . GLU A 71  ? 0.2367 0.1349 0.1775 0.0205  -0.0563 -0.0436 66  GLU A N   
604  C  CA  . GLU A 71  ? 0.2296 0.1276 0.1692 0.0214  -0.0587 -0.0685 66  GLU A CA  
605  C  C   . GLU A 71  ? 0.2472 0.1568 0.1662 0.0373  -0.0607 -0.0797 66  GLU A C   
606  O  O   . GLU A 71  ? 0.2615 0.1934 0.1937 0.0274  -0.0563 -0.0861 66  GLU A O   
607  C  CB  . GLU A 71  ? 0.2350 0.1508 0.1774 0.0074  -0.0601 -0.0687 66  GLU A CB  
608  C  CG  . GLU A 71  ? 0.2456 0.1168 0.2317 -0.0005 -0.0485 -0.0809 66  GLU A CG  
609  C  CD  . GLU A 71  ? 0.1927 0.1267 0.2466 0.0025  -0.0515 -0.0709 66  GLU A CD  
610  O  OE1 . GLU A 71  ? 0.2771 0.1375 0.2813 0.0038  -0.0067 -0.0825 66  GLU A OE1 
611  O  OE2 . GLU A 71  ? 0.2294 0.1092 0.3291 0.0475  -0.0221 -0.0237 66  GLU A OE2 
612  N  N   . GLN A 72  ? 0.2578 0.1855 0.1708 0.0617  -0.0835 -0.0706 67  GLN A N   
613  C  CA  . GLN A 72  ? 0.2922 0.2387 0.1943 0.0464  -0.0778 -0.0849 67  GLN A CA  
614  C  C   . GLN A 72  ? 0.3145 0.2749 0.2241 0.0335  -0.0704 -0.1051 67  GLN A C   
615  O  O   . GLN A 72  ? 0.3248 0.2843 0.2130 0.0263  -0.0621 -0.1119 67  GLN A O   
616  C  CB  . GLN A 72  ? 0.3123 0.2724 0.2359 0.0605  -0.0774 -0.0697 67  GLN A CB  
617  C  CG  . GLN A 72  ? 0.3890 0.3878 0.2537 -0.0122 -0.1141 -0.0185 67  GLN A CG  
618  C  CD  . GLN A 72  ? 0.4156 0.4737 0.3333 0.0271  -0.0736 -0.0167 67  GLN A CD  
619  O  OE1 . GLN A 72  ? 0.4867 0.4655 0.4837 0.0109  -0.1228 -0.0359 67  GLN A OE1 
620  N  NE2 . GLN A 72  ? 0.5327 0.4755 0.3545 0.0098  -0.0981 -0.0218 67  GLN A NE2 
621  N  N   . LYS A 73  ? 0.3266 0.2819 0.2365 0.0179  -0.0559 -0.1311 68  LYS A N   
622  C  CA  A LYS A 73  ? 0.3384 0.2981 0.2707 0.0071  -0.0602 -0.1440 68  LYS A CA  
623  C  CA  B LYS A 73  ? 0.3504 0.2949 0.2695 0.0074  -0.0526 -0.1410 68  LYS A CA  
624  C  C   . LYS A 73  ? 0.3579 0.2950 0.2876 0.0063  -0.0522 -0.1508 68  LYS A C   
625  O  O   . LYS A 73  ? 0.3633 0.3078 0.2779 -0.0053 -0.0541 -0.1614 68  LYS A O   
626  C  CB  A LYS A 73  ? 0.3418 0.3053 0.2779 0.0035  -0.0564 -0.1506 68  LYS A CB  
627  C  CB  B LYS A 73  ? 0.3576 0.3028 0.2775 0.0061  -0.0463 -0.1462 68  LYS A CB  
628  C  CG  A LYS A 73  ? 0.2991 0.3329 0.2826 -0.0006 -0.0989 -0.1648 68  LYS A CG  
629  C  CG  B LYS A 73  ? 0.3850 0.3124 0.2743 -0.0004 -0.0474 -0.1424 68  LYS A CG  
630  N  N   . SER A 74  ? 0.3372 0.2941 0.3156 -0.0047 -0.0435 -0.1555 69  SER A N   
631  C  CA  . SER A 74  ? 0.3935 0.3006 0.3650 -0.0021 -0.0220 -0.1597 69  SER A CA  
632  C  C   . SER A 74  ? 0.4165 0.3262 0.3876 -0.0035 -0.0040 -0.1619 69  SER A C   
633  O  O   . SER A 74  ? 0.4470 0.3312 0.4140 0.0090  0.0059  -0.1816 69  SER A O   
634  C  CB  . SER A 74  ? 0.3590 0.3040 0.3895 -0.0006 -0.0248 -0.1500 69  SER A CB  
635  O  OG  . SER A 74  ? 0.4129 0.2700 0.4273 0.0069  -0.0298 -0.1481 69  SER A OG  
636  N  N   . ASN A 75  ? 0.4506 0.3459 0.3929 -0.0180 -0.0004 -0.1482 70  ASN A N   
637  C  CA  . ASN A 75  ? 0.4746 0.3679 0.3963 -0.0321 0.0094  -0.1289 70  ASN A CA  
638  C  C   . ASN A 75  ? 0.4988 0.3808 0.4105 -0.0299 0.0032  -0.1083 70  ASN A C   
639  O  O   . ASN A 75  ? 0.5373 0.4117 0.3979 -0.0406 0.0129  -0.1004 70  ASN A O   
640  C  CB  . ASN A 75  ? 0.4831 0.3700 0.3934 -0.0320 0.0196  -0.1448 70  ASN A CB  
641  C  CG  . ASN A 75  ? 0.4818 0.3741 0.4150 -0.0384 0.0215  -0.1560 70  ASN A CG  
642  O  OD1 . ASN A 75  ? 0.5316 0.4572 0.3809 -0.0306 0.0711  -0.1761 70  ASN A OD1 
643  N  ND2 . ASN A 75  ? 0.4501 0.4479 0.4063 -0.0587 0.0282  -0.2136 70  ASN A ND2 
644  N  N   . GLU A 76  ? 0.4880 0.3579 0.4167 -0.0161 -0.0041 -0.1018 71  GLU A N   
645  C  CA  . GLU A 76  ? 0.5136 0.3393 0.4168 -0.0091 -0.0269 -0.0992 71  GLU A CA  
646  C  C   . GLU A 76  ? 0.5216 0.3348 0.4229 -0.0121 -0.0374 -0.0869 71  GLU A C   
647  O  O   . GLU A 76  ? 0.5280 0.3000 0.4265 -0.0244 -0.0531 -0.0836 71  GLU A O   
648  C  CB  . GLU A 76  ? 0.5042 0.3562 0.4119 0.0058  -0.0260 -0.1041 71  GLU A CB  
649  C  CG  . GLU A 76  ? 0.5580 0.3547 0.4646 0.0174  -0.0209 -0.1223 71  GLU A CG  
650  C  CD  . GLU A 76  ? 0.6391 0.4653 0.5031 0.0263  0.0099  -0.1052 71  GLU A CD  
651  O  OE1 . GLU A 76  ? 0.6963 0.5152 0.5768 -0.0018 -0.0030 -0.1073 71  GLU A OE1 
652  O  OE2 . GLU A 76  ? 0.6944 0.5066 0.5349 0.0866  0.0074  -0.0983 71  GLU A OE2 
653  N  N   . GLU A 77  ? 0.5490 0.3480 0.4360 -0.0218 -0.0405 -0.0705 72  GLU A N   
654  C  CA  . GLU A 77  ? 0.5589 0.3351 0.4481 -0.0314 -0.0445 -0.0490 72  GLU A CA  
655  C  C   . GLU A 77  ? 0.5531 0.3464 0.4571 -0.0320 -0.0387 -0.0308 72  GLU A C   
656  O  O   . GLU A 77  ? 0.5612 0.3761 0.4814 -0.0192 -0.0373 -0.0241 72  GLU A O   
657  C  CB  . GLU A 77  ? 0.5723 0.3658 0.4474 -0.0289 -0.0476 -0.0470 72  GLU A CB  
658  N  N   . GLY A 78  ? 0.5431 0.3021 0.4502 -0.0475 -0.0447 -0.0138 73  GLY A N   
659  C  CA  . GLY A 78  ? 0.5123 0.2880 0.4384 -0.0631 -0.0534 -0.0119 73  GLY A CA  
660  C  C   . GLY A 78  ? 0.4873 0.2684 0.4419 -0.0672 -0.0653 -0.0093 73  GLY A C   
661  O  O   . GLY A 78  ? 0.4948 0.2647 0.4495 -0.0786 -0.0695 -0.0101 73  GLY A O   
662  N  N   . SER A 79  ? 0.4618 0.2641 0.4207 -0.0525 -0.0607 -0.0187 74  SER A N   
663  C  CA  . SER A 79  ? 0.4278 0.2508 0.3964 -0.0432 -0.0476 -0.0035 74  SER A CA  
664  C  C   . SER A 79  ? 0.4231 0.2537 0.4013 -0.0470 -0.0371 0.0125  74  SER A C   
665  O  O   . SER A 79  ? 0.4448 0.2704 0.4018 -0.0237 -0.0110 0.0474  74  SER A O   
666  C  CB  . SER A 79  ? 0.4299 0.2358 0.4143 -0.0456 -0.0520 -0.0164 74  SER A CB  
667  O  OG  . SER A 79  ? 0.4357 0.2672 0.3779 -0.0226 -0.0712 -0.0123 74  SER A OG  
668  N  N   . GLU A 80  ? 0.4054 0.2638 0.3814 -0.0473 -0.0373 0.0178  75  GLU A N   
669  C  CA  . GLU A 80  ? 0.3997 0.2704 0.4016 -0.0550 -0.0182 0.0023  75  GLU A CA  
670  C  C   . GLU A 80  ? 0.4014 0.2964 0.4040 -0.0477 -0.0177 -0.0150 75  GLU A C   
671  O  O   . GLU A 80  ? 0.3978 0.3142 0.4121 -0.0450 -0.0145 -0.0491 75  GLU A O   
672  C  CB  . GLU A 80  ? 0.4128 0.2792 0.4072 -0.0424 -0.0287 0.0261  75  GLU A CB  
673  C  CG  . GLU A 80  ? 0.4251 0.2238 0.4691 -0.0593 0.0025  0.0280  75  GLU A CG  
674  C  CD  . GLU A 80  ? 0.3924 0.2192 0.5215 -0.0567 -0.0033 0.0107  75  GLU A CD  
675  O  OE1 . GLU A 80  ? 0.3257 0.2100 0.5338 -0.0636 -0.0096 0.1113  75  GLU A OE1 
676  O  OE2 . GLU A 80  ? 0.3826 0.1639 0.6428 -0.0359 -0.0347 0.0060  75  GLU A OE2 
677  N  N   . GLU A 81  ? 0.3898 0.2865 0.4012 -0.0494 -0.0104 -0.0215 76  GLU A N   
678  C  CA  . GLU A 81  ? 0.4075 0.2968 0.4027 -0.0515 -0.0065 -0.0223 76  GLU A CA  
679  C  C   . GLU A 81  ? 0.3981 0.2911 0.4088 -0.0494 -0.0070 -0.0353 76  GLU A C   
680  O  O   . GLU A 81  ? 0.4264 0.2550 0.4137 -0.0473 -0.0082 -0.0306 76  GLU A O   
681  C  CB  . GLU A 81  ? 0.4233 0.3242 0.4218 -0.0387 -0.0065 -0.0343 76  GLU A CB  
682  C  CG  . GLU A 81  ? 0.4930 0.3354 0.4457 -0.0789 -0.0222 -0.0193 76  GLU A CG  
683  C  CD  . GLU A 81  ? 0.6053 0.3485 0.4290 -0.0925 -0.0537 -0.0082 76  GLU A CD  
684  O  OE1 . GLU A 81  ? 0.6141 0.3549 0.4123 -0.0832 -0.0595 0.0237  76  GLU A OE1 
685  O  OE2 . GLU A 81  ? 0.6441 0.4322 0.4111 -0.1088 -0.0714 0.0037  76  GLU A OE2 
686  N  N   . LYS A 82  ? 0.3630 0.2999 0.3952 -0.0617 -0.0037 -0.0389 77  LYS A N   
687  C  CA  . LYS A 82  ? 0.3340 0.3110 0.3927 -0.0493 -0.0045 -0.0566 77  LYS A CA  
688  C  C   . LYS A 82  ? 0.3259 0.3024 0.3683 -0.0412 -0.0025 -0.0511 77  LYS A C   
689  O  O   . LYS A 82  ? 0.3513 0.3552 0.3687 -0.0394 -0.0162 -0.0872 77  LYS A O   
690  C  CB  . LYS A 82  ? 0.3402 0.3303 0.4028 -0.0534 0.0073  -0.0483 77  LYS A CB  
691  C  CG  . LYS A 82  ? 0.3613 0.3694 0.4903 -0.0887 -0.0160 -0.0605 77  LYS A CG  
692  C  CD  . LYS A 82  ? 0.3481 0.3943 0.5928 -0.1520 0.0036  -0.0262 77  LYS A CD  
693  C  CE  . LYS A 82  ? 0.3486 0.4394 0.6516 -0.1699 0.0234  -0.0645 77  LYS A CE  
694  N  NZ  . LYS A 82  ? 0.5016 0.4579 0.7094 -0.1350 0.0111  -0.1023 77  LYS A NZ  
695  N  N   . GLY A 83  ? 0.2702 0.2328 0.3278 -0.0237 0.0071  -0.0481 78  GLY A N   
696  C  CA  . GLY A 83  ? 0.2442 0.1686 0.2885 -0.0167 0.0077  -0.0521 78  GLY A CA  
697  C  C   . GLY A 83  ? 0.2119 0.1359 0.2480 -0.0046 0.0232  -0.0354 78  GLY A C   
698  O  O   . GLY A 83  ? 0.1968 0.1506 0.2834 -0.0163 -0.0037 -0.0532 78  GLY A O   
699  N  N   . PRO A 84  ? 0.2055 0.1013 0.2111 0.0080  0.0274  -0.0211 79  PRO A N   
700  C  CA  . PRO A 84  ? 0.2120 0.0921 0.1982 0.0089  0.0207  -0.0058 79  PRO A CA  
701  C  C   . PRO A 84  ? 0.2124 0.0693 0.1724 0.0168  0.0122  0.0068  79  PRO A C   
702  O  O   . PRO A 84  ? 0.2065 0.0811 0.1409 0.0173  0.0183  -0.0041 79  PRO A O   
703  C  CB  . PRO A 84  ? 0.2227 0.1026 0.2042 0.0237  0.0293  0.0046  79  PRO A CB  
704  C  CG  . PRO A 84  ? 0.2436 0.1022 0.2311 0.0232  -0.0060 -0.0146 79  PRO A CG  
705  C  CD  . PRO A 84  ? 0.2019 0.1022 0.2438 0.0111  0.0208  -0.0014 79  PRO A CD  
706  N  N   . GLU A 85  ? 0.2090 0.0840 0.1457 -0.0026 0.0020  0.0015  80  GLU A N   
707  C  CA  . GLU A 85  ? 0.1856 0.0543 0.1401 0.0281  0.0031  0.0075  80  GLU A CA  
708  C  C   . GLU A 85  ? 0.1785 0.0749 0.1482 0.0247  -0.0245 0.0216  80  GLU A C   
709  O  O   . GLU A 85  ? 0.1412 0.0695 0.1359 0.0076  -0.0208 -0.0019 80  GLU A O   
710  C  CB  . GLU A 85  ? 0.1783 0.0392 0.1395 0.0012  -0.0161 0.0109  80  GLU A CB  
711  C  CG  . GLU A 85  ? 0.1838 0.0598 0.1941 0.0414  -0.0287 -0.0320 80  GLU A CG  
712  C  CD  . GLU A 85  ? 0.1867 0.0947 0.2241 0.0056  -0.0201 -0.0016 80  GLU A CD  
713  O  OE1 . GLU A 85  ? 0.2661 0.0627 0.2091 0.0017  -0.0483 -0.0049 80  GLU A OE1 
714  O  OE2 . GLU A 85  ? 0.1960 0.1844 0.2293 0.0890  -0.0378 -0.0560 80  GLU A OE2 
715  N  N   . VAL A 86  ? 0.1455 0.0882 0.1458 0.0067  -0.0187 0.0430  81  VAL A N   
716  C  CA  . VAL A 86  ? 0.1705 0.0755 0.1740 0.0060  -0.0341 0.0199  81  VAL A CA  
717  C  C   . VAL A 86  ? 0.1457 0.0990 0.1639 0.0046  -0.0249 0.0107  81  VAL A C   
718  O  O   . VAL A 86  ? 0.1845 0.1068 0.1567 0.0271  -0.0187 0.0013  81  VAL A O   
719  C  CB  . VAL A 86  ? 0.1192 0.0392 0.2195 -0.0156 -0.0346 0.0080  81  VAL A CB  
720  C  CG1 . VAL A 86  ? 0.1856 0.1035 0.3016 0.0102  -0.0577 0.0278  81  VAL A CG1 
721  C  CG2 . VAL A 86  ? 0.2192 0.0868 0.2180 -0.0484 -0.0202 0.0358  81  VAL A CG2 
722  N  N   . ARG A 87  ? 0.1339 0.0877 0.1474 -0.0004 -0.0077 0.0236  82  ARG A N   
723  C  CA  . ARG A 87  ? 0.1769 0.0815 0.1606 0.0171  0.0158  0.0143  82  ARG A CA  
724  C  C   . ARG A 87  ? 0.1596 0.0509 0.1255 0.0437  0.0073  0.0182  82  ARG A C   
725  O  O   . ARG A 87  ? 0.1479 0.0615 0.1673 0.0379  0.0140  0.0317  82  ARG A O   
726  C  CB  . ARG A 87  ? 0.1769 0.0880 0.1500 0.0090  0.0464  0.0346  82  ARG A CB  
727  C  CG  . ARG A 87  ? 0.2751 0.0354 0.2055 -0.0159 0.0751  0.0326  82  ARG A CG  
728  C  CD  . ARG A 87  ? 0.2920 0.1364 0.2013 0.0145  0.0979  0.0203  82  ARG A CD  
729  N  NE  . ARG A 87  ? 0.3457 0.2402 0.3436 0.0199  0.1509  0.0371  82  ARG A NE  
730  C  CZ  . ARG A 87  ? 0.3654 0.2636 0.3650 0.0406  0.1469  0.0384  82  ARG A CZ  
731  N  NH1 . ARG A 87  ? 0.3267 0.2703 0.3780 0.0112  0.1186  0.0399  82  ARG A NH1 
732  N  NH2 . ARG A 87  ? 0.3961 0.2135 0.4311 0.0397  0.1846  0.0250  82  ARG A NH2 
733  N  N   . GLU A 88  ? 0.1489 0.0621 0.1368 0.0354  0.0006  0.0305  83  GLU A N   
734  C  CA  . GLU A 88  ? 0.1590 0.0830 0.1174 0.0469  0.0270  0.0099  83  GLU A CA  
735  C  C   . GLU A 88  ? 0.1647 0.0779 0.1079 0.0298  0.0251  0.0115  83  GLU A C   
736  O  O   . GLU A 88  ? 0.1805 0.0525 0.1338 0.0141  0.0326  0.0144  83  GLU A O   
737  C  CB  . GLU A 88  ? 0.1750 0.0673 0.0997 0.0413  0.0433  0.0373  83  GLU A CB  
738  C  CG  . GLU A 88  ? 0.1656 0.0604 0.1433 0.0405  0.0390  -0.0073 83  GLU A CG  
739  C  CD  . GLU A 88  ? 0.1488 0.0727 0.1901 0.0636  0.0412  0.0009  83  GLU A CD  
740  O  OE1 . GLU A 88  ? 0.1927 0.1272 0.2066 0.1018  0.0713  -0.0042 83  GLU A OE1 
741  O  OE2 . GLU A 88  ? 0.1905 0.0647 0.2023 0.0383  0.0553  0.0110  83  GLU A OE2 
742  N  N   . TYR A 89  ? 0.1183 0.0795 0.0925 0.0452  0.0328  0.0229  84  TYR A N   
743  C  CA  . TYR A 89  ? 0.1358 0.0406 0.1031 0.0286  0.0162  0.0246  84  TYR A CA  
744  C  C   . TYR A 89  ? 0.1619 0.0609 0.1165 0.0380  0.0053  0.0134  84  TYR A C   
745  O  O   . TYR A 89  ? 0.1624 0.0701 0.1193 0.0385  0.0119  0.0014  84  TYR A O   
746  C  CB  . TYR A 89  ? 0.1425 0.0482 0.0811 -0.0152 0.0222  0.0280  84  TYR A CB  
747  C  CG  . TYR A 89  ? 0.1316 0.0273 0.0889 0.0146  0.0117  0.0031  84  TYR A CG  
748  C  CD1 . TYR A 89  ? 0.2234 0.0438 0.0711 0.0010  -0.0027 0.0291  84  TYR A CD1 
749  C  CD2 . TYR A 89  ? 0.1106 0.0804 0.0936 0.0166  0.0210  0.0040  84  TYR A CD2 
750  C  CE1 . TYR A 89  ? 0.1560 0.0737 0.1129 -0.0046 0.0482  0.0563  84  TYR A CE1 
751  C  CE2 . TYR A 89  ? 0.1395 0.0730 0.1121 0.0351  -0.0026 0.0356  84  TYR A CE2 
752  C  CZ  . TYR A 89  ? 0.1747 0.0530 0.0859 0.0245  0.0005  0.0379  84  TYR A CZ  
753  O  OH  . TYR A 89  ? 0.2030 0.0975 0.0730 0.0104  0.0263  0.0179  84  TYR A OH  
754  N  N   . ARG A 90  ? 0.1335 0.0389 0.1133 0.0261  -0.0026 0.0173  85  ARG A N   
755  C  CA  . ARG A 90  ? 0.1188 0.0419 0.1270 0.0218  -0.0255 0.0206  85  ARG A CA  
756  C  C   . ARG A 90  ? 0.1497 0.0458 0.1433 0.0225  0.0003  0.0071  85  ARG A C   
757  O  O   . ARG A 90  ? 0.1479 0.0428 0.1418 0.0255  -0.0180 0.0229  85  ARG A O   
758  C  CB  . ARG A 90  ? 0.1571 0.0502 0.1193 0.0486  -0.0375 0.0102  85  ARG A CB  
759  C  CG  . ARG A 90  ? 0.1524 0.0412 0.1837 0.0217  -0.0332 0.0371  85  ARG A CG  
760  C  CD  . ARG A 90  ? 0.1837 0.0645 0.0991 0.0241  -0.0017 0.0457  85  ARG A CD  
761  N  NE  . ARG A 90  ? 0.2493 0.0933 0.0709 0.0093  0.0052  0.0068  85  ARG A NE  
762  C  CZ  . ARG A 90  ? 0.2559 0.1262 0.1571 0.0163  -0.0037 -0.0201 85  ARG A CZ  
763  N  NH1 . ARG A 90  ? 0.2591 0.0729 0.1777 0.0378  -0.0097 -0.0337 85  ARG A NH1 
764  N  NH2 . ARG A 90  ? 0.2962 0.0798 0.1522 0.0690  -0.0177 -0.0250 85  ARG A NH2 
765  N  N   . GLU A 91  ? 0.1461 0.0569 0.1647 0.0242  -0.0012 0.0093  86  GLU A N   
766  C  CA  A GLU A 91  ? 0.1417 0.0614 0.1432 0.0213  0.0174  -0.0021 86  GLU A CA  
767  C  CA  B GLU A 91  ? 0.1696 0.0702 0.1656 0.0205  0.0093  -0.0004 86  GLU A CA  
768  C  C   . GLU A 91  ? 0.1595 0.0402 0.1515 0.0393  0.0005  -0.0048 86  GLU A C   
769  O  O   . GLU A 91  ? 0.1659 0.0776 0.1631 0.0329  -0.0030 -0.0275 86  GLU A O   
770  C  CB  A GLU A 91  ? 0.1600 0.0464 0.1574 0.0240  0.0266  0.0042  86  GLU A CB  
771  C  CB  B GLU A 91  ? 0.1903 0.0719 0.1902 0.0279  0.0132  0.0028  86  GLU A CB  
772  C  CG  A GLU A 91  ? 0.0640 0.0678 0.0905 0.0290  0.0353  0.0004  86  GLU A CG  
773  C  CG  B GLU A 91  ? 0.2597 0.1406 0.2415 0.0062  0.0364  0.0153  86  GLU A CG  
774  C  CD  A GLU A 91  ? 0.1107 0.1979 0.2123 0.0484  0.0429  0.0050  86  GLU A CD  
775  C  CD  B GLU A 91  ? 0.2947 0.1476 0.2403 0.0372  0.0438  0.0417  86  GLU A CD  
776  O  OE1 A GLU A 91  ? 0.2471 0.2990 0.2903 0.0999  0.0293  0.0452  86  GLU A OE1 
777  O  OE1 B GLU A 91  ? 0.3701 0.0841 0.2294 0.0457  0.0132  0.1054  86  GLU A OE1 
778  O  OE2 A GLU A 91  ? 0.2447 0.2342 0.2419 -0.0088 0.0403  0.0043  86  GLU A OE2 
779  O  OE2 B GLU A 91  ? 0.3327 0.1680 0.2183 0.0249  0.0712  0.0112  86  GLU A OE2 
780  N  N   . LYS A 92  ? 0.1605 0.0509 0.1306 0.0353  -0.0130 -0.0096 87  LYS A N   
781  C  CA  A LYS A 92  ? 0.1666 0.0525 0.1427 0.0496  -0.0243 -0.0094 87  LYS A CA  
782  C  CA  B LYS A 92  ? 0.1650 0.0548 0.1434 0.0389  -0.0252 -0.0082 87  LYS A CA  
783  C  CA  C LYS A 92  ? 0.1671 0.0566 0.1447 0.0396  -0.0224 -0.0085 87  LYS A CA  
784  C  C   . LYS A 92  ? 0.1526 0.0624 0.1426 0.0350  -0.0227 -0.0183 87  LYS A C   
785  O  O   . LYS A 92  ? 0.1663 0.0386 0.1349 0.0424  -0.0039 -0.0034 87  LYS A O   
786  C  CB  A LYS A 92  ? 0.1760 0.0485 0.1381 0.0377  -0.0417 -0.0058 87  LYS A CB  
787  C  CB  B LYS A 92  ? 0.1746 0.0590 0.1400 0.0209  -0.0423 -0.0003 87  LYS A CB  
788  C  CB  C LYS A 92  ? 0.1768 0.0587 0.1488 0.0242  -0.0368 -0.0023 87  LYS A CB  
789  C  CG  A LYS A 92  ? 0.2113 0.0974 0.1628 0.0608  -0.0547 0.0059  87  LYS A CG  
790  C  CG  B LYS A 92  ? 0.2077 0.0867 0.1633 -0.0106 -0.0632 0.0111  87  LYS A CG  
791  C  CG  C LYS A 92  ? 0.2298 0.0913 0.1784 0.0078  -0.0455 0.0107  87  LYS A CG  
792  C  CD  A LYS A 92  ? 0.2544 0.0803 0.1392 0.1030  -0.0634 0.0003  87  LYS A CD  
793  C  CD  B LYS A 92  ? 0.2091 0.1749 0.1751 -0.0751 -0.0967 0.0507  87  LYS A CD  
794  C  CD  C LYS A 92  ? 0.2457 0.1450 0.2506 -0.0180 -0.0664 0.0307  87  LYS A CD  
795  C  CE  A LYS A 92  ? 0.3116 0.1832 0.1553 0.0806  -0.0319 -0.0184 87  LYS A CE  
796  C  CE  B LYS A 92  ? 0.2473 0.1731 0.1913 -0.1388 -0.0809 0.0542  87  LYS A CE  
797  C  CE  C LYS A 92  ? 0.2649 0.1662 0.2694 -0.0477 -0.0700 0.0578  87  LYS A CE  
798  N  NZ  A LYS A 92  ? 0.4159 0.1562 0.1167 0.0644  -0.0122 -0.0232 87  LYS A NZ  
799  N  NZ  B LYS A 92  ? 0.2641 0.1933 0.2096 -0.1751 -0.1522 0.0529  87  LYS A NZ  
800  N  NZ  C LYS A 92  ? 0.2655 0.1432 0.3018 -0.0377 -0.0793 0.0465  87  LYS A NZ  
801  N  N   . VAL A 93  ? 0.1173 0.0767 0.1324 0.0487  -0.0163 -0.0148 88  VAL A N   
802  C  CA  . VAL A 93  ? 0.1124 0.0734 0.1470 0.0212  -0.0100 0.0060  88  VAL A CA  
803  C  C   . VAL A 93  ? 0.1393 0.0669 0.1275 0.0089  -0.0107 -0.0001 88  VAL A C   
804  O  O   . VAL A 93  ? 0.1467 0.0784 0.1347 0.0266  0.0127  0.0013  88  VAL A O   
805  C  CB  . VAL A 93  ? 0.1058 0.0777 0.1640 0.0148  0.0004  -0.0200 88  VAL A CB  
806  C  CG1 . VAL A 93  ? 0.1521 0.1098 0.1860 0.0565  0.0303  -0.0277 88  VAL A CG1 
807  C  CG2 . VAL A 93  ? 0.1650 0.0936 0.1166 0.0114  -0.0033 0.0063  88  VAL A CG2 
808  N  N   . GLU A 94  ? 0.1658 0.0725 0.1271 0.0312  -0.0201 -0.0015 89  GLU A N   
809  C  CA  . GLU A 94  ? 0.1513 0.0664 0.0949 0.0167  -0.0061 0.0116  89  GLU A CA  
810  C  C   . GLU A 94  ? 0.1560 0.0713 0.1372 0.0336  -0.0020 0.0052  89  GLU A C   
811  O  O   . GLU A 94  ? 0.1978 0.0688 0.1248 0.0457  -0.0003 -0.0069 89  GLU A O   
812  C  CB  . GLU A 94  ? 0.1673 0.0457 0.0968 0.0327  -0.0096 0.0178  89  GLU A CB  
813  C  CG  . GLU A 94  ? 0.2448 0.0534 0.1076 0.0545  0.0003  0.0347  89  GLU A CG  
814  C  CD  . GLU A 94  ? 0.2230 0.1055 0.1342 0.0535  0.0170  0.0062  89  GLU A CD  
815  O  OE1 . GLU A 94  ? 0.2414 0.0835 0.1320 0.0589  0.0314  -0.0107 89  GLU A OE1 
816  O  OE2 . GLU A 94  ? 0.2335 0.1937 0.1737 0.0425  0.0427  0.0064  89  GLU A OE2 
817  N  N   . THR A 95  ? 0.1343 0.0624 0.1532 0.0369  0.0148  -0.0154 90  THR A N   
818  C  CA  A THR A 95  ? 0.1271 0.0823 0.1561 0.0501  0.0144  -0.0055 90  THR A CA  
819  C  CA  B THR A 95  ? 0.1392 0.0736 0.1549 0.0382  0.0154  -0.0081 90  THR A CA  
820  C  C   . THR A 95  ? 0.1300 0.0631 0.1562 0.0408  0.0200  -0.0158 90  THR A C   
821  O  O   . THR A 95  ? 0.1313 0.1030 0.1535 0.0228  0.0115  -0.0181 90  THR A O   
822  C  CB  A THR A 95  ? 0.1419 0.0440 0.1830 0.0459  0.0251  0.0000  90  THR A CB  
823  C  CB  B THR A 95  ? 0.1470 0.0658 0.1634 0.0371  0.0206  -0.0083 90  THR A CB  
824  O  OG1 A THR A 95  ? 0.1824 0.1224 0.1808 0.0751  0.0630  -0.0044 90  THR A OG1 
825  O  OG1 B THR A 95  ? 0.2164 0.1030 0.2247 0.0531  0.0251  0.0270  90  THR A OG1 
826  C  CG2 A THR A 95  ? 0.1074 0.1307 0.2235 0.0740  -0.0180 -0.0053 90  THR A CG2 
827  C  CG2 B THR A 95  ? 0.1213 0.0771 0.1450 0.0346  0.0254  -0.0288 90  THR A CG2 
828  N  N   . GLU A 96  ? 0.1349 0.0631 0.1555 0.0156  0.0131  -0.0125 91  GLU A N   
829  C  CA  A GLU A 96  ? 0.1320 0.0502 0.1496 0.0141  0.0124  -0.0011 91  GLU A CA  
830  C  CA  B GLU A 96  ? 0.1377 0.0532 0.1516 0.0115  0.0174  -0.0015 91  GLU A CA  
831  C  C   . GLU A 96  ? 0.1430 0.0533 0.1520 0.0147  -0.0025 0.0026  91  GLU A C   
832  O  O   . GLU A 96  ? 0.1697 0.0588 0.1685 0.0032  -0.0203 -0.0010 91  GLU A O   
833  C  CB  A GLU A 96  ? 0.1406 0.0491 0.1651 0.0078  0.0196  0.0077  91  GLU A CB  
834  C  CB  B GLU A 96  ? 0.1584 0.0460 0.1643 -0.0003 0.0250  0.0054  91  GLU A CB  
835  C  CG  A GLU A 96  ? 0.1208 0.0288 0.1558 0.0171  0.0063  -0.0061 91  GLU A CG  
836  C  CG  B GLU A 96  ? 0.1487 0.0619 0.1694 0.0004  0.0432  -0.0102 91  GLU A CG  
837  C  CD  A GLU A 96  ? 0.2113 0.0999 0.2380 0.0011  0.0293  0.0016  91  GLU A CD  
838  C  CD  B GLU A 96  ? 0.1584 0.0289 0.2279 -0.0219 0.0570  -0.0115 91  GLU A CD  
839  O  OE1 A GLU A 96  ? 0.2400 0.1217 0.1681 0.0225  0.0177  -0.0102 91  GLU A OE1 
840  O  OE1 B GLU A 96  ? 0.2405 0.0915 0.3040 -0.0332 0.0363  0.0211  91  GLU A OE1 
841  O  OE2 A GLU A 96  ? 0.2950 0.0264 0.2708 0.0012  -0.0105 0.0168  91  GLU A OE2 
842  O  OE2 B GLU A 96  ? 0.1158 0.0659 0.1556 -0.0200 0.0343  0.0209  91  GLU A OE2 
843  N  N   . LEU A 97  ? 0.1096 0.0607 0.1476 0.0219  -0.0010 -0.0064 92  LEU A N   
844  C  CA  A LEU A 97  ? 0.1112 0.0606 0.1504 0.0233  -0.0229 -0.0001 92  LEU A CA  
845  C  CA  B LEU A 97  ? 0.1208 0.0682 0.1542 0.0266  -0.0201 -0.0051 92  LEU A CA  
846  C  C   . LEU A 97  ? 0.1002 0.0761 0.1525 0.0203  -0.0109 -0.0228 92  LEU A C   
847  O  O   . LEU A 97  ? 0.1401 0.0962 0.1317 0.0136  -0.0100 -0.0308 92  LEU A O   
848  C  CB  A LEU A 97  ? 0.0934 0.0741 0.1600 0.0239  -0.0268 -0.0041 92  LEU A CB  
849  C  CB  B LEU A 97  ? 0.1178 0.0828 0.1605 0.0278  -0.0280 -0.0142 92  LEU A CB  
850  C  CG  A LEU A 97  ? 0.1317 0.0938 0.1679 0.0127  -0.0381 0.0185  92  LEU A CG  
851  C  CG  B LEU A 97  ? 0.1650 0.1328 0.1722 0.0461  -0.0169 -0.0212 92  LEU A CG  
852  C  CD1 A LEU A 97  ? 0.1178 0.1517 0.1794 -0.0062 -0.0659 0.0108  92  LEU A CD1 
853  C  CD1 B LEU A 97  ? 0.1590 0.1143 0.1817 0.0772  0.0256  -0.0280 92  LEU A CD1 
854  C  CD2 A LEU A 97  ? 0.0745 0.0509 0.1867 -0.0005 -0.0538 0.0518  92  LEU A CD2 
855  C  CD2 B LEU A 97  ? 0.1578 0.1764 0.1940 0.0224  -0.0294 -0.0261 92  LEU A CD2 
856  N  N   . GLN A 98  ? 0.1137 0.0740 0.1375 0.0172  0.0151  -0.0216 93  GLN A N   
857  C  CA  . GLN A 98  ? 0.1153 0.0900 0.1327 0.0257  0.0155  -0.0182 93  GLN A CA  
858  C  C   . GLN A 98  ? 0.1267 0.0911 0.1781 0.0382  0.0062  -0.0170 93  GLN A C   
859  O  O   . GLN A 98  ? 0.1681 0.1091 0.1776 0.0396  0.0046  -0.0198 93  GLN A O   
860  C  CB  . GLN A 98  ? 0.1272 0.0698 0.1415 0.0305  0.0144  -0.0211 93  GLN A CB  
861  C  CG  . GLN A 98  ? 0.1286 0.0745 0.1359 0.0289  0.0194  0.0095  93  GLN A CG  
862  C  CD  . GLN A 98  ? 0.0996 0.0527 0.1255 0.0282  0.0186  -0.0025 93  GLN A CD  
863  O  OE1 . GLN A 98  ? 0.2030 0.0812 0.2018 0.0864  0.0053  -0.0051 93  GLN A OE1 
864  N  NE2 . GLN A 98  ? 0.1979 0.0979 0.1656 0.0719  0.0083  -0.0046 93  GLN A NE2 
865  N  N   . GLY A 99  ? 0.1154 0.1243 0.1510 0.0374  0.0069  -0.0195 94  GLY A N   
866  C  CA  . GLY A 99  ? 0.1713 0.1076 0.1430 0.0471  0.0055  -0.0387 94  GLY A CA  
867  C  C   . GLY A 99  ? 0.1472 0.0830 0.1521 0.0370  0.0168  -0.0358 94  GLY A C   
868  O  O   . GLY A 99  ? 0.1761 0.0775 0.1648 0.0128  0.0159  -0.0392 94  GLY A O   
869  N  N   . VAL A 100 ? 0.1469 0.0721 0.1323 0.0362  0.0305  -0.0220 95  VAL A N   
870  C  CA  . VAL A 100 ? 0.1484 0.0626 0.1628 0.0179  0.0421  -0.0151 95  VAL A CA  
871  C  C   . VAL A 100 ? 0.1086 0.0620 0.1275 0.0206  0.0189  -0.0162 95  VAL A C   
872  O  O   . VAL A 100 ? 0.1522 0.0591 0.1221 0.0155  -0.0085 -0.0158 95  VAL A O   
873  C  CB  . VAL A 100 ? 0.1309 0.0624 0.1801 0.0149  0.0573  -0.0329 95  VAL A CB  
874  C  CG1 . VAL A 100 ? 0.1789 0.0764 0.2632 0.0162  0.1064  -0.0339 95  VAL A CG1 
875  C  CG2 . VAL A 100 ? 0.1498 0.1080 0.2134 0.0229  0.0274  -0.0085 95  VAL A CG2 
876  N  N   . CYS A 101 ? 0.1149 0.0632 0.1298 0.0008  -0.0140 -0.0110 96  CYS A N   
877  C  CA  . CYS A 101 ? 0.1393 0.0746 0.1363 0.0165  -0.0099 -0.0147 96  CYS A CA  
878  C  C   . CYS A 101 ? 0.1192 0.0586 0.1457 0.0295  0.0045  -0.0080 96  CYS A C   
879  O  O   . CYS A 101 ? 0.1588 0.0621 0.1328 0.0240  0.0021  -0.0099 96  CYS A O   
880  C  CB  . CYS A 101 ? 0.1653 0.0852 0.1519 0.0274  -0.0232 -0.0233 96  CYS A CB  
881  S  SG  . CYS A 101 ? 0.1428 0.0862 0.1662 0.0313  -0.0271 -0.0297 96  CYS A SG  
882  N  N   . ASP A 102 ? 0.1310 0.0865 0.1382 0.0293  0.0079  0.0059  97  ASP A N   
883  C  CA  . ASP A 102 ? 0.1258 0.1025 0.1405 0.0375  0.0168  -0.0128 97  ASP A CA  
884  C  C   . ASP A 102 ? 0.1424 0.0853 0.1552 0.0352  0.0286  -0.0217 97  ASP A C   
885  O  O   . ASP A 102 ? 0.1647 0.0727 0.1530 0.0135  0.0366  -0.0075 97  ASP A O   
886  C  CB  . ASP A 102 ? 0.1774 0.1195 0.1649 0.0499  0.0231  -0.0414 97  ASP A CB  
887  C  CG  . ASP A 102 ? 0.1997 0.1844 0.2059 0.0517  0.0453  -0.0676 97  ASP A CG  
888  O  OD1 . ASP A 102 ? 0.3070 0.3088 0.2240 0.0483  0.0404  -0.0307 97  ASP A OD1 
889  O  OD2 . ASP A 102 ? 0.2939 0.2455 0.2918 0.0564  0.1273  -0.1023 97  ASP A OD2 
890  N  N   . THR A 103 ? 0.1518 0.0688 0.1366 0.0286  0.0208  -0.0110 98  THR A N   
891  C  CA  . THR A 103 ? 0.1416 0.0748 0.1357 0.0371  0.0006  0.0009  98  THR A CA  
892  C  C   . THR A 103 ? 0.1056 0.0495 0.1423 0.0276  -0.0038 -0.0005 98  THR A C   
893  O  O   . THR A 103 ? 0.1299 0.0718 0.1421 0.0269  -0.0143 -0.0158 98  THR A O   
894  C  CB  . THR A 103 ? 0.1350 0.0646 0.1273 0.0597  -0.0056 0.0022  98  THR A CB  
895  O  OG1 . THR A 103 ? 0.1957 0.1392 0.1709 0.1211  0.0081  -0.0031 98  THR A OG1 
896  C  CG2 . THR A 103 ? 0.1917 0.1129 0.0946 0.0179  -0.0696 0.0116  98  THR A CG2 
897  N  N   . VAL A 104 ? 0.0996 0.0536 0.1616 0.0450  -0.0030 0.0024  99  VAL A N   
898  C  CA  . VAL A 104 ? 0.0670 0.0474 0.1542 0.0267  -0.0044 0.0224  99  VAL A CA  
899  C  C   . VAL A 104 ? 0.0971 0.0877 0.1314 0.0063  0.0019  -0.0001 99  VAL A C   
900  O  O   . VAL A 104 ? 0.1073 0.1080 0.1262 0.0134  0.0036  -0.0012 99  VAL A O   
901  C  CB  . VAL A 104 ? 0.0733 0.0472 0.1318 0.0289  0.0030  0.0105  99  VAL A CB  
902  C  CG1 . VAL A 104 ? 0.0994 0.0521 0.2204 0.0440  0.0157  0.0208  99  VAL A CG1 
903  C  CG2 . VAL A 104 ? 0.1340 0.0525 0.1127 0.0003  -0.0024 0.0487  99  VAL A CG2 
904  N  N   . LEU A 105 ? 0.1033 0.1042 0.1302 0.0046  0.0077  0.0141  100 LEU A N   
905  C  CA  . LEU A 105 ? 0.1116 0.0967 0.1248 0.0212  0.0051  0.0155  100 LEU A CA  
906  C  C   . LEU A 105 ? 0.1159 0.0950 0.1288 0.0159  0.0032  0.0096  100 LEU A C   
907  O  O   . LEU A 105 ? 0.1067 0.0864 0.1799 0.0156  0.0158  0.0040  100 LEU A O   
908  C  CB  . LEU A 105 ? 0.1422 0.1077 0.0909 0.0222  -0.0157 0.0177  100 LEU A CB  
909  C  CG  . LEU A 105 ? 0.1049 0.0544 0.0794 0.0299  0.0038  0.0127  100 LEU A CG  
910  C  CD1 . LEU A 105 ? 0.1754 0.1265 0.1092 0.0338  0.0142  -0.0138 100 LEU A CD1 
911  C  CD2 . LEU A 105 ? 0.1533 0.0585 0.1286 0.0642  -0.0112 -0.0160 100 LEU A CD2 
912  N  N   . GLY A 106 ? 0.0859 0.1094 0.1493 0.0314  -0.0011 -0.0270 101 GLY A N   
913  C  CA  . GLY A 106 ? 0.1013 0.1326 0.1652 0.0010  0.0154  -0.0138 101 GLY A CA  
914  C  C   . GLY A 106 ? 0.0915 0.1106 0.1825 0.0028  0.0017  -0.0151 101 GLY A C   
915  O  O   . GLY A 106 ? 0.1013 0.1286 0.2000 -0.0425 -0.0089 -0.0346 101 GLY A O   
916  N  N   . LEU A 107 ? 0.1185 0.0974 0.1566 -0.0005 0.0038  -0.0006 102 LEU A N   
917  C  CA  . LEU A 107 ? 0.0975 0.0920 0.1383 0.0015  0.0122  0.0253  102 LEU A CA  
918  C  C   . LEU A 107 ? 0.1097 0.0958 0.1421 -0.0053 0.0041  0.0266  102 LEU A C   
919  O  O   . LEU A 107 ? 0.1180 0.1020 0.1591 -0.0006 -0.0265 0.0313  102 LEU A O   
920  C  CB  . LEU A 107 ? 0.1350 0.0811 0.1505 -0.0011 0.0140  0.0531  102 LEU A CB  
921  C  CG  . LEU A 107 ? 0.0724 0.1269 0.2166 -0.0161 -0.0352 0.0531  102 LEU A CG  
922  C  CD1 . LEU A 107 ? 0.0531 0.1764 0.2749 -0.0327 0.0078  0.0293  102 LEU A CD1 
923  C  CD2 . LEU A 107 ? 0.1603 0.1448 0.2593 0.0408  -0.1139 0.0653  102 LEU A CD2 
924  N  N   . LEU A 108 ? 0.0980 0.0987 0.1323 0.0194  -0.0051 0.0308  103 LEU A N   
925  C  CA  . LEU A 108 ? 0.1049 0.0961 0.1352 -0.0024 -0.0035 0.0241  103 LEU A CA  
926  C  C   . LEU A 108 ? 0.1297 0.1049 0.1448 -0.0090 0.0238  0.0155  103 LEU A C   
927  O  O   . LEU A 108 ? 0.1638 0.0937 0.1488 0.0055  0.0131  0.0251  103 LEU A O   
928  C  CB  . LEU A 108 ? 0.0747 0.1261 0.1157 0.0033  -0.0106 0.0121  103 LEU A CB  
929  C  CG  . LEU A 108 ? 0.0858 0.1122 0.1163 -0.0169 0.0092  -0.0279 103 LEU A CG  
930  C  CD1 . LEU A 108 ? 0.1520 0.1349 0.1005 0.0285  -0.0381 -0.0244 103 LEU A CD1 
931  C  CD2 . LEU A 108 ? 0.1509 0.1234 0.1259 0.0242  0.0055  -0.0564 103 LEU A CD2 
932  N  N   . ASP A 109 ? 0.1270 0.1209 0.1582 -0.0128 0.0381  0.0062  104 ASP A N   
933  C  CA  A ASP A 109 ? 0.1286 0.1351 0.1663 -0.0270 0.0451  0.0037  104 ASP A CA  
934  C  CA  B ASP A 109 ? 0.1832 0.1557 0.1962 -0.0426 0.0321  0.0063  104 ASP A CA  
935  C  C   . ASP A 109 ? 0.1557 0.1930 0.1875 -0.0433 0.0583  0.0054  104 ASP A C   
936  O  O   . ASP A 109 ? 0.2440 0.2207 0.2397 -0.0943 0.0102  0.0033  104 ASP A O   
937  C  CB  A ASP A 109 ? 0.0531 0.1067 0.1650 -0.0114 0.0588  0.0031  104 ASP A CB  
938  C  CB  B ASP A 109 ? 0.2184 0.1785 0.2239 -0.0429 0.0445  0.0032  104 ASP A CB  
939  C  CG  A ASP A 109 ? 0.0980 0.1328 0.1764 -0.0148 0.0822  -0.0068 104 ASP A CG  
940  C  CG  B ASP A 109 ? 0.2503 0.1375 0.2829 -0.0774 -0.0069 0.0102  104 ASP A CG  
941  O  OD1 A ASP A 109 ? 0.1625 0.0850 0.2613 -0.0387 0.1076  -0.0098 104 ASP A OD1 
942  O  OD1 B ASP A 109 ? 0.2296 0.0909 0.1696 -0.0938 0.0128  0.0236  104 ASP A OD1 
943  O  OD2 A ASP A 109 ? 0.1216 0.2128 0.2480 -0.0672 0.1209  0.0151  104 ASP A OD2 
944  O  OD2 B ASP A 109 ? 0.0877 0.1709 0.2630 -0.0282 0.0005  0.0271  104 ASP A OD2 
945  N  N   . SER A 110 ? 0.1805 0.1882 0.2195 -0.0534 0.0175  0.0057  105 SER A N   
946  C  CA  . SER A 110 ? 0.1592 0.2120 0.2726 -0.0295 0.0012  -0.0010 105 SER A CA  
947  C  C   . SER A 110 ? 0.1808 0.2091 0.2798 -0.0381 -0.0094 0.0057  105 SER A C   
948  O  O   . SER A 110 ? 0.1954 0.2176 0.3206 -0.0400 -0.0188 0.0131  105 SER A O   
949  C  CB  . SER A 110 ? 0.1921 0.2626 0.2713 -0.0020 0.0216  0.0040  105 SER A CB  
950  O  OG  . SER A 110 ? 0.2221 0.3134 0.2914 0.0253  0.0099  -0.0185 105 SER A OG  
951  N  N   . HIS A 111 ? 0.1615 0.1725 0.2599 -0.0327 -0.0133 0.0097  106 HIS A N   
952  C  CA  . HIS A 111 ? 0.1610 0.1816 0.2747 -0.0342 -0.0285 -0.0043 106 HIS A CA  
953  C  C   . HIS A 111 ? 0.1787 0.1651 0.2507 -0.0257 0.0063  0.0089  106 HIS A C   
954  O  O   . HIS A 111 ? 0.2493 0.1704 0.2436 -0.0418 0.0052  -0.0098 106 HIS A O   
955  C  CB  . HIS A 111 ? 0.1649 0.2203 0.2931 -0.0563 -0.0232 -0.0107 106 HIS A CB  
956  C  CG  . HIS A 111 ? 0.1619 0.2692 0.3350 0.0032  -0.0201 -0.0051 106 HIS A CG  
957  N  ND1 . HIS A 111 ? 0.1722 0.2073 0.3438 0.0076  -0.0416 0.0150  106 HIS A ND1 
958  C  CD2 . HIS A 111 ? 0.1373 0.2479 0.3644 -0.0120 -0.0204 -0.0229 106 HIS A CD2 
959  C  CE1 . HIS A 111 ? 0.1241 0.2527 0.3694 -0.0467 -0.0102 0.0132  106 HIS A CE1 
960  N  NE2 . HIS A 111 ? 0.1181 0.3188 0.3494 -0.0451 -0.0259 0.0112  106 HIS A NE2 
961  N  N   . LEU A 112 ? 0.1519 0.1092 0.2045 -0.0176 -0.0020 0.0288  107 LEU A N   
962  C  CA  . LEU A 112 ? 0.1562 0.1136 0.1634 -0.0051 0.0146  0.0298  107 LEU A CA  
963  C  C   . LEU A 112 ? 0.1905 0.1180 0.1723 -0.0054 0.0235  0.0301  107 LEU A C   
964  O  O   . LEU A 112 ? 0.2193 0.1089 0.1844 0.0042  0.0269  0.0387  107 LEU A O   
965  C  CB  . LEU A 112 ? 0.1539 0.0718 0.1666 -0.0041 0.0171  0.0413  107 LEU A CB  
966  C  CG  . LEU A 112 ? 0.1497 0.0527 0.1062 0.0006  0.0019  0.0072  107 LEU A CG  
967  C  CD1 . LEU A 112 ? 0.1477 0.0291 0.2033 -0.0174 -0.0283 0.0190  107 LEU A CD1 
968  C  CD2 . LEU A 112 ? 0.2038 0.1022 0.1123 -0.0009 0.0288  -0.0023 107 LEU A CD2 
969  N  N   . ILE A 113 ? 0.1893 0.1006 0.1455 -0.0116 0.0112  0.0360  108 ILE A N   
970  C  CA  . ILE A 113 ? 0.1898 0.0895 0.1808 -0.0375 0.0012  0.0273  108 ILE A CA  
971  C  C   . ILE A 113 ? 0.1863 0.0586 0.1918 -0.0299 0.0013  0.0288  108 ILE A C   
972  O  O   . ILE A 113 ? 0.1942 0.0756 0.1835 -0.0204 0.0091  0.0113  108 ILE A O   
973  C  CB  . ILE A 113 ? 0.1834 0.0767 0.1482 -0.0340 0.0076  0.0390  108 ILE A CB  
974  C  CG1 . ILE A 113 ? 0.1818 0.0728 0.1964 -0.0408 0.0048  0.0111  108 ILE A CG1 
975  C  CG2 . ILE A 113 ? 0.2146 0.1130 0.1567 -0.0268 -0.0141 0.0542  108 ILE A CG2 
976  C  CD1 . ILE A 113 ? 0.2445 0.1011 0.2255 -0.0207 -0.0996 -0.0035 108 ILE A CD1 
977  N  N   . LYS A 114 ? 0.1911 0.0748 0.2129 -0.0484 0.0290  0.0412  109 LYS A N   
978  C  CA  . LYS A 114 ? 0.2191 0.1264 0.2391 -0.0395 0.0225  0.0184  109 LYS A CA  
979  C  C   . LYS A 114 ? 0.2423 0.1355 0.2406 -0.0421 0.0242  0.0177  109 LYS A C   
980  O  O   . LYS A 114 ? 0.2870 0.1407 0.2319 -0.0366 0.0317  0.0138  109 LYS A O   
981  C  CB  . LYS A 114 ? 0.2186 0.1608 0.2829 -0.0281 0.0120  0.0245  109 LYS A CB  
982  C  CG  . LYS A 114 ? 0.2272 0.1916 0.2976 -0.0304 0.0157  0.0437  109 LYS A CG  
983  C  CD  . LYS A 114 ? 0.2082 0.3317 0.3606 -0.0445 0.0282  -0.0217 109 LYS A CD  
984  C  CE  . LYS A 114 ? 0.3208 0.2040 0.3875 -0.0175 0.0089  -0.0456 109 LYS A CE  
985  N  NZ  . LYS A 114 ? 0.3012 0.1845 0.3032 -0.0911 0.0142  -0.0362 109 LYS A NZ  
986  N  N   . GLU A 115 ? 0.1927 0.1523 0.2182 -0.0253 0.0133  0.0144  110 GLU A N   
987  C  CA  A GLU A 115 ? 0.1766 0.1785 0.2434 -0.0306 0.0165  -0.0014 110 GLU A CA  
988  C  CA  B GLU A 115 ? 0.1705 0.1700 0.2434 -0.0338 0.0196  0.0053  110 GLU A CA  
989  C  C   . GLU A 115 ? 0.1846 0.1764 0.2448 -0.0250 0.0227  -0.0085 110 GLU A C   
990  O  O   . GLU A 115 ? 0.1994 0.2221 0.2399 -0.0316 0.0068  -0.0254 110 GLU A O   
991  C  CB  A GLU A 115 ? 0.1819 0.1800 0.2607 -0.0290 0.0202  0.0070  110 GLU A CB  
992  C  CB  B GLU A 115 ? 0.1683 0.1762 0.2575 -0.0308 0.0259  0.0146  110 GLU A CB  
993  C  CG  A GLU A 115 ? 0.1412 0.2097 0.3134 -0.0283 0.0179  -0.0157 110 GLU A CG  
994  C  CG  B GLU A 115 ? 0.1157 0.1496 0.3220 -0.0561 0.0450  0.0314  110 GLU A CG  
995  C  CD  A GLU A 115 ? 0.1692 0.2085 0.3325 -0.0209 0.0276  -0.0421 110 GLU A CD  
996  C  CD  B GLU A 115 ? 0.1367 0.2151 0.3719 -0.0360 0.0512  0.0579  110 GLU A CD  
997  O  OE1 A GLU A 115 ? 0.1340 0.3200 0.3212 -0.0010 0.0404  -0.0822 110 GLU A OE1 
998  O  OE1 B GLU A 115 ? 0.1497 0.2501 0.3532 0.0181  0.1074  0.0680  110 GLU A OE1 
999  O  OE2 A GLU A 115 ? 0.1980 0.2600 0.3861 -0.0180 0.0544  -0.0867 110 GLU A OE2 
1000 O  OE2 B GLU A 115 ? 0.1256 0.1762 0.4337 0.0059  0.0674  0.0516  110 GLU A OE2 
1001 N  N   . ALA A 116 ? 0.1778 0.1647 0.2377 -0.0354 0.0208  0.0031  111 ALA A N   
1002 C  CA  . ALA A 116 ? 0.2103 0.1583 0.2530 -0.0229 0.0285  -0.0103 111 ALA A CA  
1003 C  C   . ALA A 116 ? 0.2427 0.1718 0.2708 -0.0076 0.0367  0.0018  111 ALA A C   
1004 O  O   . ALA A 116 ? 0.2368 0.1806 0.2702 -0.0099 0.0329  0.0208  111 ALA A O   
1005 C  CB  . ALA A 116 ? 0.1965 0.1787 0.2767 -0.0552 0.0184  -0.0092 111 ALA A CB  
1006 N  N   . GLY A 117 ? 0.2470 0.1281 0.2830 -0.0013 0.0349  -0.0062 112 GLY A N   
1007 C  CA  . GLY A 117 ? 0.2518 0.1295 0.2885 0.0285  0.0212  0.0352  112 GLY A CA  
1008 C  C   . GLY A 117 ? 0.2736 0.1305 0.2731 0.0482  0.0171  0.0263  112 GLY A C   
1009 O  O   . GLY A 117 ? 0.3149 0.1982 0.3463 0.0673  0.0104  0.0730  112 GLY A O   
1010 N  N   . ASP A 118 ? 0.2380 0.1274 0.2297 0.0480  0.0090  -0.0022 113 ASP A N   
1011 C  CA  . ASP A 118 ? 0.2406 0.1395 0.1968 0.0632  -0.0174 -0.0207 113 ASP A CA  
1012 C  C   . ASP A 118 ? 0.2138 0.1390 0.1878 0.0878  -0.0340 -0.0317 113 ASP A C   
1013 O  O   . ASP A 118 ? 0.2621 0.1177 0.1833 0.0725  -0.0078 -0.0461 113 ASP A O   
1014 C  CB  . ASP A 118 ? 0.2397 0.1643 0.1743 0.0669  -0.0140 -0.0204 113 ASP A CB  
1015 C  CG  . ASP A 118 ? 0.2893 0.1669 0.1757 0.0528  -0.0215 -0.0012 113 ASP A CG  
1016 O  OD1 . ASP A 118 ? 0.3844 0.1941 0.2226 0.0157  -0.0431 -0.0246 113 ASP A OD1 
1017 O  OD2 . ASP A 118 ? 0.2472 0.1751 0.1552 0.0897  -0.0052 0.0013  113 ASP A OD2 
1018 N  N   . ALA A 119 ? 0.2248 0.1818 0.1946 0.1021  -0.0665 -0.0383 114 ALA A N   
1019 C  CA  . ALA A 119 ? 0.2229 0.2051 0.2532 0.1120  -0.0862 -0.0512 114 ALA A CA  
1020 C  C   . ALA A 119 ? 0.2295 0.1768 0.2727 0.1182  -0.0782 -0.0920 114 ALA A C   
1021 O  O   . ALA A 119 ? 0.2355 0.2078 0.2875 0.1184  -0.1022 -0.1150 114 ALA A O   
1022 C  CB  . ALA A 119 ? 0.2453 0.2438 0.2498 0.1385  -0.0968 -0.0311 114 ALA A CB  
1023 N  N   . GLU A 120 ? 0.2134 0.1404 0.2910 0.0828  -0.0569 -0.0704 115 GLU A N   
1024 C  CA  . GLU A 120 ? 0.2185 0.1446 0.3249 0.0707  -0.0285 -0.1009 115 GLU A CA  
1025 C  C   . GLU A 120 ? 0.2009 0.1184 0.3291 0.0489  -0.0177 -0.0929 115 GLU A C   
1026 O  O   . GLU A 120 ? 0.1977 0.1735 0.4093 0.0406  0.0230  -0.1361 115 GLU A O   
1027 C  CB  . GLU A 120 ? 0.2205 0.1472 0.3527 0.0711  -0.0082 -0.0854 115 GLU A CB  
1028 C  CG  . GLU A 120 ? 0.3167 0.2359 0.3790 0.1204  -0.0544 -0.0946 115 GLU A CG  
1029 C  CD  . GLU A 120 ? 0.3943 0.3092 0.4058 0.1136  -0.0385 -0.0381 115 GLU A CD  
1030 O  OE1 . GLU A 120 ? 0.3219 0.2598 0.3062 0.1321  -0.0091 -0.0692 115 GLU A OE1 
1031 O  OE2 . GLU A 120 ? 0.3902 0.4211 0.3571 0.1548  -0.0372 -0.0325 115 GLU A OE2 
1032 N  N   . SER A 121 ? 0.1894 0.0993 0.2701 0.0310  -0.0011 -0.0604 116 SER A N   
1033 C  CA  . SER A 121 ? 0.1481 0.0626 0.2004 0.0107  -0.0028 -0.0282 116 SER A CA  
1034 C  C   . SER A 121 ? 0.1344 0.0522 0.1810 0.0109  0.0016  -0.0312 116 SER A C   
1035 O  O   . SER A 121 ? 0.1246 0.0697 0.1923 0.0178  -0.0121 -0.0322 116 SER A O   
1036 C  CB  . SER A 121 ? 0.1858 0.0747 0.2153 -0.0054 -0.0318 -0.0131 116 SER A CB  
1037 O  OG  . SER A 121 ? 0.2132 0.1202 0.1814 -0.0092 0.0122  -0.0043 116 SER A OG  
1038 N  N   . ARG A 122 ? 0.1399 0.0760 0.1355 0.0134  -0.0028 -0.0052 117 ARG A N   
1039 C  CA  A ARG A 122 ? 0.1473 0.0641 0.1551 -0.0013 -0.0147 -0.0017 117 ARG A CA  
1040 C  CA  B ARG A 122 ? 0.1468 0.0733 0.1566 0.0033  -0.0185 0.0007  117 ARG A CA  
1041 C  C   . ARG A 122 ? 0.1308 0.0593 0.1610 0.0040  -0.0024 -0.0121 117 ARG A C   
1042 O  O   . ARG A 122 ? 0.1373 0.0426 0.1586 0.0191  -0.0200 -0.0050 117 ARG A O   
1043 C  CB  A ARG A 122 ? 0.1615 0.0807 0.1677 0.0000  0.0082  0.0223  117 ARG A CB  
1044 C  CB  B ARG A 122 ? 0.1633 0.0654 0.1979 -0.0169 0.0003  0.0272  117 ARG A CB  
1045 C  CG  A ARG A 122 ? 0.2318 0.1943 0.2529 -0.0280 0.0111  0.0285  117 ARG A CG  
1046 C  CG  B ARG A 122 ? 0.2648 0.2785 0.3159 0.0540  0.0110  0.0768  117 ARG A CG  
1047 C  CD  A ARG A 122 ? 0.1712 0.2511 0.3427 -0.0592 0.0384  0.1031  117 ARG A CD  
1048 C  CD  B ARG A 122 ? 0.3785 0.2079 0.4352 0.0360  -0.0842 0.1317  117 ARG A CD  
1049 N  NE  A ARG A 122 ? 0.2295 0.3201 0.3429 -0.0491 0.0615  0.1027  117 ARG A NE  
1050 N  NE  B ARG A 122 ? 0.5407 0.3946 0.5743 -0.0222 0.0200  -0.0125 117 ARG A NE  
1051 C  CZ  A ARG A 122 ? 0.2989 0.2824 0.3454 0.0306  0.1053  0.1353  117 ARG A CZ  
1052 C  CZ  B ARG A 122 ? 0.5550 0.4278 0.5639 -0.0512 0.0583  0.0274  117 ARG A CZ  
1053 N  NH1 A ARG A 122 ? 0.3768 0.2028 0.3614 0.0679  0.0573  0.1367  117 ARG A NH1 
1054 N  NH1 B ARG A 122 ? 0.6233 0.4794 0.5301 -0.0736 0.0585  0.0725  117 ARG A NH1 
1055 N  NH2 A ARG A 122 ? 0.3296 0.2578 0.3901 -0.0099 0.1495  0.1396  117 ARG A NH2 
1056 N  NH2 B ARG A 122 ? 0.6519 0.3985 0.6623 -0.0390 0.0907  0.0765  117 ARG A NH2 
1057 N  N   . VAL A 123 ? 0.1097 0.0453 0.1508 0.0059  -0.0383 0.0075  118 VAL A N   
1058 C  CA  . VAL A 123 ? 0.0935 0.0329 0.1609 0.0012  -0.0144 0.0086  118 VAL A CA  
1059 C  C   . VAL A 123 ? 0.1093 0.0321 0.1234 0.0202  -0.0104 0.0050  118 VAL A C   
1060 O  O   . VAL A 123 ? 0.1203 0.0368 0.1397 0.0236  -0.0199 0.0116  118 VAL A O   
1061 C  CB  . VAL A 123 ? 0.1061 0.0257 0.1754 0.0058  -0.0237 -0.0025 118 VAL A CB  
1062 C  CG1 . VAL A 123 ? 0.0675 0.0510 0.1672 0.0155  -0.0411 -0.0082 118 VAL A CG1 
1063 C  CG2 . VAL A 123 ? 0.1709 0.0410 0.1931 -0.0079 -0.0352 -0.0106 118 VAL A CG2 
1064 N  N   . PHE A 124 ? 0.1129 0.0276 0.1333 0.0072  0.0059  0.0137  119 PHE A N   
1065 C  CA  A PHE A 124 ? 0.0799 0.0349 0.1002 0.0192  0.0009  0.0146  119 PHE A CA  
1066 C  CA  B PHE A 124 ? 0.0945 0.0294 0.1132 0.0143  -0.0043 0.0092  119 PHE A CA  
1067 C  C   . PHE A 124 ? 0.0956 0.0354 0.1070 0.0015  -0.0056 0.0029  119 PHE A C   
1068 O  O   . PHE A 124 ? 0.1071 0.0285 0.1263 0.0148  -0.0147 -0.0100 119 PHE A O   
1069 C  CB  A PHE A 124 ? 0.1068 0.0546 0.0960 -0.0014 0.0139  0.0256  119 PHE A CB  
1070 C  CB  B PHE A 124 ? 0.1035 0.0325 0.1078 -0.0007 0.0011  0.0088  119 PHE A CB  
1071 C  CG  A PHE A 124 ? 0.0523 0.0287 0.1232 0.0091  0.0338  0.0074  119 PHE A CG  
1072 C  CG  B PHE A 124 ? 0.1051 0.0325 0.1232 0.0110  -0.0098 0.0060  119 PHE A CG  
1073 C  CD1 A PHE A 124 ? 0.0813 0.0313 0.1322 0.0183  -0.0148 -0.0058 119 PHE A CD1 
1074 C  CD1 B PHE A 124 ? 0.0971 0.0275 0.1172 0.0120  -0.0146 0.0017  119 PHE A CD1 
1075 C  CD2 A PHE A 124 ? 0.0784 0.0288 0.1021 0.0006  0.0139  0.0158  119 PHE A CD2 
1076 C  CD2 B PHE A 124 ? 0.0895 0.0291 0.1205 0.0147  -0.0229 -0.0113 119 PHE A CD2 
1077 C  CE1 A PHE A 124 ? 0.0995 0.0647 0.0712 -0.0131 0.0450  0.0182  119 PHE A CE1 
1078 C  CE1 B PHE A 124 ? 0.1031 0.0384 0.1209 -0.0282 -0.0028 -0.0058 119 PHE A CE1 
1079 C  CE2 A PHE A 124 ? 0.0763 0.0349 0.1351 -0.0152 0.0204  -0.0105 119 PHE A CE2 
1080 C  CE2 B PHE A 124 ? 0.1140 0.0670 0.0605 -0.0052 0.0062  0.0171  119 PHE A CE2 
1081 C  CZ  A PHE A 124 ? 0.0397 0.0685 0.0676 0.0245  0.0112  0.0122  119 PHE A CZ  
1082 C  CZ  B PHE A 124 ? 0.1203 0.0307 0.0990 -0.0162 -0.0181 0.0057  119 PHE A CZ  
1083 N  N   . TYR A 125 ? 0.0688 0.0440 0.1170 0.0199  -0.0006 0.0138  120 TYR A N   
1084 C  CA  . TYR A 125 ? 0.0657 0.0629 0.1131 0.0130  -0.0056 0.0045  120 TYR A CA  
1085 C  C   . TYR A 125 ? 0.0881 0.0637 0.1158 0.0121  -0.0068 0.0106  120 TYR A C   
1086 O  O   . TYR A 125 ? 0.0914 0.0285 0.1237 -0.0027 0.0031  0.0172  120 TYR A O   
1087 C  CB  . TYR A 125 ? 0.0938 0.0434 0.1031 -0.0124 -0.0172 -0.0134 120 TYR A CB  
1088 C  CG  . TYR A 125 ? 0.0724 0.0477 0.0712 -0.0084 -0.0112 0.0206  120 TYR A CG  
1089 C  CD1 . TYR A 125 ? 0.0680 0.0829 0.1001 0.0198  -0.0218 0.0453  120 TYR A CD1 
1090 C  CD2 . TYR A 125 ? 0.0908 0.0693 0.1104 0.0128  -0.0441 -0.0118 120 TYR A CD2 
1091 C  CE1 . TYR A 125 ? 0.1050 0.1121 0.1200 -0.0225 -0.0198 -0.0392 120 TYR A CE1 
1092 C  CE2 . TYR A 125 ? 0.1373 0.0448 0.1016 0.0000  -0.0286 0.0142  120 TYR A CE2 
1093 C  CZ  . TYR A 125 ? 0.1456 0.0875 0.0819 -0.0328 -0.0239 0.0105  120 TYR A CZ  
1094 O  OH  . TYR A 125 ? 0.2321 0.1436 0.1061 -0.0109 -0.0342 0.0179  120 TYR A OH  
1095 N  N   . LEU A 126 ? 0.1061 0.0612 0.1038 0.0093  -0.0085 0.0259  121 LEU A N   
1096 C  CA  . LEU A 126 ? 0.0893 0.0518 0.1058 0.0107  -0.0017 0.0136  121 LEU A CA  
1097 C  C   . LEU A 126 ? 0.0774 0.0451 0.1139 0.0113  0.0145  0.0094  121 LEU A C   
1098 O  O   . LEU A 126 ? 0.1236 0.0680 0.1267 0.0249  -0.0130 0.0118  121 LEU A O   
1099 C  CB  . LEU A 126 ? 0.0872 0.0537 0.1539 -0.0139 -0.0044 0.0216  121 LEU A CB  
1100 C  CG  . LEU A 126 ? 0.0911 0.0486 0.1872 0.0157  0.0192  0.0136  121 LEU A CG  
1101 C  CD1 . LEU A 126 ? 0.2130 0.0314 0.1453 0.0121  -0.0387 0.0219  121 LEU A CD1 
1102 C  CD2 . LEU A 126 ? 0.1365 0.0856 0.1875 0.0374  0.0666  0.0205  121 LEU A CD2 
1103 N  N   . LYS A 127 ? 0.0850 0.0519 0.1340 0.0083  0.0129  0.0175  122 LYS A N   
1104 C  CA  . LYS A 127 ? 0.0520 0.0427 0.1163 0.0215  0.0201  0.0131  122 LYS A CA  
1105 C  C   . LYS A 127 ? 0.1080 0.0617 0.1185 0.0192  0.0258  0.0064  122 LYS A C   
1106 O  O   . LYS A 127 ? 0.1189 0.0534 0.1046 0.0307  0.0400  -0.0004 122 LYS A O   
1107 C  CB  . LYS A 127 ? 0.0609 0.0552 0.1087 -0.0184 0.0152  -0.0096 122 LYS A CB  
1108 C  CG  . LYS A 127 ? 0.0541 0.0331 0.0901 -0.0147 0.0302  -0.0125 122 LYS A CG  
1109 C  CD  . LYS A 127 ? 0.0624 0.0461 0.1260 0.0276  0.0174  0.0091  122 LYS A CD  
1110 C  CE  . LYS A 127 ? 0.1214 0.0317 0.1394 0.0172  -0.0669 0.0029  122 LYS A CE  
1111 N  NZ  . LYS A 127 ? 0.0965 0.0349 0.1574 0.0261  0.0367  0.0107  122 LYS A NZ  
1112 N  N   . MET A 128 ? 0.0937 0.0767 0.0793 0.0291  0.0137  0.0242  123 MET A N   
1113 C  CA  . MET A 128 ? 0.0995 0.0475 0.0742 0.0356  0.0037  0.0073  123 MET A CA  
1114 C  C   . MET A 128 ? 0.0959 0.0643 0.0689 0.0039  0.0122  0.0220  123 MET A C   
1115 O  O   . MET A 128 ? 0.1116 0.0573 0.1035 0.0358  0.0170  0.0083  123 MET A O   
1116 C  CB  . MET A 128 ? 0.0978 0.0762 0.0796 0.0058  -0.0035 -0.0134 123 MET A CB  
1117 C  CG  . MET A 128 ? 0.1207 0.0771 0.0862 0.0214  -0.0007 0.0002  123 MET A CG  
1118 S  SD  . MET A 128 ? 0.1332 0.0610 0.1131 0.0181  0.0005  0.0055  123 MET A SD  
1119 C  CE  . MET A 128 ? 0.1825 0.0631 0.0850 0.0480  -0.0029 -0.0053 123 MET A CE  
1120 N  N   . LYS A 129 ? 0.0980 0.0525 0.0991 0.0004  0.0069  0.0188  124 LYS A N   
1121 C  CA  . LYS A 129 ? 0.1157 0.0510 0.0873 -0.0065 0.0009  0.0070  124 LYS A CA  
1122 C  C   . LYS A 129 ? 0.1203 0.0635 0.1083 0.0091  -0.0146 0.0176  124 LYS A C   
1123 O  O   . LYS A 129 ? 0.1125 0.0750 0.1131 -0.0027 -0.0121 0.0053  124 LYS A O   
1124 C  CB  . LYS A 129 ? 0.1162 0.0497 0.1179 -0.0059 0.0292  0.0127  124 LYS A CB  
1125 C  CG  . LYS A 129 ? 0.0862 0.0564 0.1630 -0.0093 0.0211  0.0188  124 LYS A CG  
1126 C  CD  . LYS A 129 ? 0.1472 0.1366 0.1354 -0.0909 0.0539  0.0206  124 LYS A CD  
1127 C  CE  . LYS A 129 ? 0.1952 0.1861 0.1863 -0.0986 0.1006  0.0152  124 LYS A CE  
1128 N  NZ  . LYS A 129 ? 0.2008 0.1865 0.2617 -0.0800 0.0531  0.0816  124 LYS A NZ  
1129 N  N   . GLY A 130 ? 0.0830 0.0551 0.0951 0.0106  -0.0009 0.0155  125 GLY A N   
1130 C  CA  . GLY A 130 ? 0.1079 0.0397 0.1205 0.0062  -0.0263 0.0327  125 GLY A CA  
1131 C  C   . GLY A 130 ? 0.1247 0.0471 0.1163 -0.0129 -0.0005 0.0108  125 GLY A C   
1132 O  O   . GLY A 130 ? 0.1533 0.0558 0.1151 -0.0033 -0.0197 0.0010  125 GLY A O   
1133 N  N   . ASP A 131 ? 0.1324 0.0370 0.0971 0.0080  0.0024  0.0283  126 ASP A N   
1134 C  CA  . ASP A 131 ? 0.0965 0.0336 0.0773 0.0217  0.0290  0.0169  126 ASP A CA  
1135 C  C   . ASP A 131 ? 0.1025 0.0503 0.1003 0.0393  0.0113  0.0003  126 ASP A C   
1136 O  O   . ASP A 131 ? 0.1031 0.0391 0.1049 0.0285  -0.0134 0.0054  126 ASP A O   
1137 C  CB  . ASP A 131 ? 0.1238 0.0500 0.0667 0.0468  0.0375  0.0260  126 ASP A CB  
1138 C  CG  . ASP A 131 ? 0.0988 0.0376 0.1046 0.0164  0.0223  0.0069  126 ASP A CG  
1139 O  OD1 . ASP A 131 ? 0.0839 0.0700 0.1758 0.0482  -0.0032 -0.0044 126 ASP A OD1 
1140 O  OD2 . ASP A 131 ? 0.1178 0.0737 0.1177 0.0324  0.0279  0.0021  126 ASP A OD2 
1141 N  N   . TYR A 132 ? 0.0923 0.0665 0.1264 0.0503  0.0223  -0.0013 127 TYR A N   
1142 C  CA  . TYR A 132 ? 0.0993 0.0722 0.0959 0.0394  0.0262  0.0082  127 TYR A CA  
1143 C  C   . TYR A 132 ? 0.1252 0.0728 0.1008 0.0332  0.0312  0.0188  127 TYR A C   
1144 O  O   . TYR A 132 ? 0.1315 0.0790 0.1147 0.0231  -0.0003 0.0035  127 TYR A O   
1145 C  CB  . TYR A 132 ? 0.0908 0.0586 0.0936 0.0152  0.0094  0.0131  127 TYR A CB  
1146 C  CG  . TYR A 132 ? 0.1052 0.0651 0.0902 0.0158  0.0288  0.0068  127 TYR A CG  
1147 C  CD1 . TYR A 132 ? 0.1099 0.0565 0.0822 0.0356  -0.0085 0.0111  127 TYR A CD1 
1148 C  CD2 . TYR A 132 ? 0.0966 0.0764 0.0981 0.0085  -0.0179 0.0563  127 TYR A CD2 
1149 C  CE1 . TYR A 132 ? 0.1643 0.0903 0.1046 0.0409  -0.0205 0.0574  127 TYR A CE1 
1150 C  CE2 . TYR A 132 ? 0.0888 0.0856 0.1138 -0.0323 -0.0031 0.0025  127 TYR A CE2 
1151 C  CZ  . TYR A 132 ? 0.1606 0.0747 0.1060 0.0098  0.0065  0.0292  127 TYR A CZ  
1152 O  OH  . TYR A 132 ? 0.1158 0.1109 0.1329 -0.0012 0.0040  0.0305  127 TYR A OH  
1153 N  N   . TYR A 133 ? 0.1076 0.0925 0.1156 0.0267  0.0089  0.0222  128 TYR A N   
1154 C  CA  . TYR A 133 ? 0.1279 0.0860 0.1083 0.0094  0.0198  0.0185  128 TYR A CA  
1155 C  C   . TYR A 133 ? 0.1307 0.0933 0.1119 0.0206  0.0096  0.0103  128 TYR A C   
1156 O  O   . TYR A 133 ? 0.1505 0.0581 0.1126 0.0241  0.0085  0.0029  128 TYR A O   
1157 C  CB  . TYR A 133 ? 0.1042 0.0880 0.1206 0.0253  0.0316  0.0247  128 TYR A CB  
1158 C  CG  . TYR A 133 ? 0.0945 0.0554 0.1035 0.0093  0.0324  -0.0021 128 TYR A CG  
1159 C  CD1 . TYR A 133 ? 0.1464 0.1037 0.1485 0.0348  0.0322  -0.0135 128 TYR A CD1 
1160 C  CD2 . TYR A 133 ? 0.1593 0.0688 0.1359 -0.0313 -0.0099 -0.0149 128 TYR A CD2 
1161 C  CE1 . TYR A 133 ? 0.2147 0.0956 0.1999 -0.0142 0.0142  0.0196  128 TYR A CE1 
1162 C  CE2 . TYR A 133 ? 0.1382 0.1584 0.1230 0.0017  0.0043  0.0095  128 TYR A CE2 
1163 C  CZ  . TYR A 133 ? 0.1312 0.1523 0.1483 -0.0280 -0.0063 0.0094  128 TYR A CZ  
1164 O  OH  . TYR A 133 ? 0.1719 0.2117 0.2375 -0.0569 0.0148  0.0122  128 TYR A OH  
1165 N  N   . ARG A 134 ? 0.1219 0.0774 0.1284 0.0203  -0.0057 -0.0043 129 ARG A N   
1166 C  CA  . ARG A 134 ? 0.1311 0.0618 0.1313 0.0313  -0.0132 -0.0005 129 ARG A CA  
1167 C  C   . ARG A 134 ? 0.1476 0.0551 0.1105 0.0116  0.0010  0.0056  129 ARG A C   
1168 O  O   . ARG A 134 ? 0.1702 0.0485 0.1245 0.0081  0.0008  -0.0066 129 ARG A O   
1169 C  CB  . ARG A 134 ? 0.1225 0.0770 0.1073 0.0282  -0.0092 0.0039  129 ARG A CB  
1170 C  CG  . ARG A 134 ? 0.1052 0.0318 0.1778 0.0216  -0.0322 -0.0181 129 ARG A CG  
1171 C  CD  . ARG A 134 ? 0.0839 0.0742 0.1226 0.0440  -0.0171 -0.0291 129 ARG A CD  
1172 N  NE  . ARG A 134 ? 0.1250 0.0612 0.0873 0.0133  -0.0232 0.0169  129 ARG A NE  
1173 C  CZ  . ARG A 134 ? 0.1526 0.0351 0.0842 0.0074  -0.0379 0.0189  129 ARG A CZ  
1174 N  NH1 . ARG A 134 ? 0.1163 0.0273 0.1298 0.0064  -0.0517 0.0032  129 ARG A NH1 
1175 N  NH2 . ARG A 134 ? 0.1394 0.0491 0.1038 0.0114  -0.0072 -0.0346 129 ARG A NH2 
1176 N  N   . TYR A 135 ? 0.1583 0.0450 0.1200 0.0117  -0.0216 0.0125  130 TYR A N   
1177 C  CA  . TYR A 135 ? 0.1538 0.0483 0.1163 0.0235  -0.0063 -0.0012 130 TYR A CA  
1178 C  C   . TYR A 135 ? 0.1535 0.0542 0.1147 0.0265  -0.0093 -0.0008 130 TYR A C   
1179 O  O   . TYR A 135 ? 0.1689 0.0432 0.1009 0.0233  -0.0280 -0.0062 130 TYR A O   
1180 C  CB  . TYR A 135 ? 0.1743 0.0593 0.1032 0.0286  -0.0100 -0.0040 130 TYR A CB  
1181 C  CG  . TYR A 135 ? 0.1306 0.0455 0.0985 0.0134  -0.0179 -0.0091 130 TYR A CG  
1182 C  CD1 . TYR A 135 ? 0.1357 0.0648 0.1131 0.0331  -0.0103 -0.0076 130 TYR A CD1 
1183 C  CD2 . TYR A 135 ? 0.1745 0.0483 0.0520 0.0082  0.0146  0.0247  130 TYR A CD2 
1184 C  CE1 . TYR A 135 ? 0.1215 0.0599 0.1059 0.0142  0.0030  0.0276  130 TYR A CE1 
1185 C  CE2 . TYR A 135 ? 0.0984 0.1316 0.1454 0.0099  -0.0232 -0.0178 130 TYR A CE2 
1186 C  CZ  . TYR A 135 ? 0.1084 0.1053 0.1253 -0.0252 0.0029  -0.0004 130 TYR A CZ  
1187 O  OH  . TYR A 135 ? 0.1281 0.1821 0.1103 0.0456  0.0018  -0.0418 130 TYR A OH  
1188 N  N   . LEU A 136 ? 0.1309 0.0737 0.1106 0.0256  -0.0075 0.0051  131 LEU A N   
1189 C  CA  . LEU A 136 ? 0.1480 0.0923 0.1120 0.0447  -0.0046 -0.0070 131 LEU A CA  
1190 C  C   . LEU A 136 ? 0.1697 0.0744 0.0988 0.0675  -0.0104 0.0008  131 LEU A C   
1191 O  O   . LEU A 136 ? 0.2254 0.0853 0.1108 0.0736  -0.0019 -0.0109 131 LEU A O   
1192 C  CB  . LEU A 136 ? 0.1354 0.0769 0.1074 0.0389  -0.0047 0.0205  131 LEU A CB  
1193 C  CG  . LEU A 136 ? 0.1408 0.0484 0.1329 0.0454  -0.0356 -0.0101 131 LEU A CG  
1194 C  CD1 . LEU A 136 ? 0.1457 0.0253 0.1537 0.0003  -0.0289 0.0023  131 LEU A CD1 
1195 C  CD2 . LEU A 136 ? 0.1807 0.0674 0.2153 0.0788  -0.0071 0.0166  131 LEU A CD2 
1196 N  N   . ALA A 137 ? 0.1800 0.1012 0.0950 0.0660  -0.0139 0.0423  132 ALA A N   
1197 C  CA  . ALA A 137 ? 0.2177 0.0814 0.1238 0.0571  -0.0290 0.0051  132 ALA A CA  
1198 C  C   . ALA A 137 ? 0.2322 0.0786 0.1306 0.0581  -0.0221 0.0057  132 ALA A C   
1199 O  O   . ALA A 137 ? 0.2579 0.1004 0.1246 0.0436  -0.0294 0.0104  132 ALA A O   
1200 C  CB  . ALA A 137 ? 0.2444 0.0538 0.1194 0.0673  0.0045  0.0221  132 ALA A CB  
1201 N  N   . GLU A 138 ? 0.1974 0.0704 0.1378 0.0611  -0.0217 -0.0095 133 GLU A N   
1202 C  CA  . GLU A 138 ? 0.2178 0.0863 0.1482 0.0562  -0.0126 -0.0166 133 GLU A CA  
1203 C  C   . GLU A 138 ? 0.2210 0.0705 0.1456 0.0615  -0.0124 -0.0256 133 GLU A C   
1204 O  O   . GLU A 138 ? 0.2433 0.0860 0.1384 0.0508  -0.0300 -0.0301 133 GLU A O   
1205 C  CB  . GLU A 138 ? 0.1760 0.1052 0.1262 0.0508  0.0021  -0.0149 133 GLU A CB  
1206 C  CG  . GLU A 138 ? 0.1772 0.0850 0.0927 0.0350  -0.0202 -0.0220 133 GLU A CG  
1207 C  CD  . GLU A 138 ? 0.2009 0.0634 0.0706 0.0516  -0.0139 0.0098  133 GLU A CD  
1208 O  OE1 . GLU A 138 ? 0.1943 0.0768 0.1559 0.0312  -0.0498 0.0084  133 GLU A OE1 
1209 O  OE2 . GLU A 138 ? 0.2225 0.1065 0.1540 0.0980  -0.0252 0.0229  133 GLU A OE2 
1210 N  N   . VAL A 139 ? 0.2134 0.0513 0.1222 0.0696  -0.0120 -0.0068 134 VAL A N   
1211 C  CA  . VAL A 139 ? 0.2468 0.0778 0.1517 0.0764  0.0139  -0.0188 134 VAL A CA  
1212 C  C   . VAL A 139 ? 0.2716 0.0870 0.1723 0.0744  0.0179  -0.0114 134 VAL A C   
1213 O  O   . VAL A 139 ? 0.2705 0.1031 0.1726 0.0759  0.0288  -0.0387 134 VAL A O   
1214 C  CB  . VAL A 139 ? 0.2318 0.0542 0.1445 0.0582  0.0176  -0.0093 134 VAL A CB  
1215 C  CG1 . VAL A 139 ? 0.2452 0.1015 0.1313 0.0327  0.0562  -0.0422 134 VAL A CG1 
1216 C  CG2 . VAL A 139 ? 0.2704 0.0421 0.1678 0.0400  0.0099  0.0099  134 VAL A CG2 
1217 N  N   . ALA A 140 ? 0.2875 0.0877 0.2014 0.0702  0.0251  -0.0353 135 ALA A N   
1218 C  CA  . ALA A 140 ? 0.3267 0.1022 0.2052 0.0626  0.0234  -0.0276 135 ALA A CA  
1219 C  C   . ALA A 140 ? 0.3759 0.1182 0.2485 0.0644  0.0342  -0.0476 135 ALA A C   
1220 O  O   . ALA A 140 ? 0.3997 0.1285 0.2145 0.0425  0.0144  -0.0538 135 ALA A O   
1221 C  CB  . ALA A 140 ? 0.3299 0.1034 0.2527 0.0526  0.0378  -0.0251 135 ALA A CB  
1222 N  N   . THR A 141 ? 0.4362 0.2170 0.2539 0.0558  0.0665  -0.0482 136 THR A N   
1223 C  CA  . THR A 141 ? 0.5017 0.2845 0.3154 0.0556  0.0658  -0.0609 136 THR A CA  
1224 C  C   . THR A 141 ? 0.5156 0.3321 0.3326 0.0723  0.0822  -0.0688 136 THR A C   
1225 O  O   . THR A 141 ? 0.5675 0.3608 0.3677 0.0673  0.0716  -0.1018 136 THR A O   
1226 C  CB  . THR A 141 ? 0.4980 0.2842 0.3108 0.0693  0.0721  -0.0689 136 THR A CB  
1227 O  OG1 . THR A 141 ? 0.5232 0.3040 0.3121 0.0967  0.0784  -0.0346 136 THR A OG1 
1228 C  CG2 . THR A 141 ? 0.5291 0.2477 0.3259 0.0207  0.0482  -0.0818 136 THR A CG2 
1229 N  N   . GLY A 142 ? 0.5142 0.3464 0.3512 0.0896  0.0843  -0.0694 137 GLY A N   
1230 C  CA  . GLY A 142 ? 0.5249 0.3719 0.3882 0.0935  0.0985  -0.0525 137 GLY A CA  
1231 C  C   . GLY A 142 ? 0.5235 0.4013 0.3977 0.1042  0.0936  -0.0444 137 GLY A C   
1232 O  O   . GLY A 142 ? 0.5207 0.3921 0.4016 0.1207  0.1164  -0.0543 137 GLY A O   
1233 N  N   . ASP A 143 ? 0.5130 0.4117 0.3874 0.1023  0.0949  -0.0517 138 ASP A N   
1234 C  CA  A ASP A 143 ? 0.5146 0.4230 0.3893 0.1103  0.0859  -0.0611 138 ASP A CA  
1235 C  CA  B ASP A 143 ? 0.5124 0.4225 0.3902 0.1102  0.0830  -0.0580 138 ASP A CA  
1236 C  C   . ASP A 143 ? 0.4998 0.4152 0.3767 0.1183  0.0750  -0.0562 138 ASP A C   
1237 O  O   . ASP A 143 ? 0.5022 0.4128 0.3654 0.1273  0.0803  -0.0747 138 ASP A O   
1238 C  CB  A ASP A 143 ? 0.5105 0.4384 0.3931 0.1085  0.0927  -0.0618 138 ASP A CB  
1239 C  CB  B ASP A 143 ? 0.5119 0.4349 0.3986 0.1086  0.0870  -0.0567 138 ASP A CB  
1240 C  CG  A ASP A 143 ? 0.5217 0.4684 0.4018 0.1015  0.0983  -0.0815 138 ASP A CG  
1241 C  CG  B ASP A 143 ? 0.5195 0.4749 0.4170 0.1012  0.0822  -0.0618 138 ASP A CG  
1242 O  OD1 A ASP A 143 ? 0.5281 0.5477 0.3689 0.0634  0.1348  -0.0796 138 ASP A OD1 
1243 O  OD1 B ASP A 143 ? 0.5343 0.4934 0.4040 0.0980  0.0674  -0.0566 138 ASP A OD1 
1244 O  OD2 A ASP A 143 ? 0.5108 0.5057 0.3900 0.0977  0.1214  -0.0955 138 ASP A OD2 
1245 O  OD2 B ASP A 143 ? 0.5103 0.4976 0.4526 0.1018  0.0977  -0.0521 138 ASP A OD2 
1246 N  N   . ASP A 144 ? 0.4755 0.4106 0.3617 0.1280  0.0628  -0.0540 139 ASP A N   
1247 C  CA  . ASP A 144 ? 0.4427 0.4053 0.3556 0.1228  0.0230  -0.0262 139 ASP A CA  
1248 C  C   . ASP A 144 ? 0.4040 0.3546 0.2991 0.1180  0.0155  -0.0156 139 ASP A C   
1249 O  O   . ASP A 144 ? 0.3778 0.3663 0.2695 0.1453  0.0121  -0.0227 139 ASP A O   
1250 C  CB  . ASP A 144 ? 0.4623 0.4579 0.3875 0.1213  0.0091  -0.0288 139 ASP A CB  
1251 C  CG  . ASP A 144 ? 0.5056 0.5186 0.4946 0.1004  -0.0268 0.0156  139 ASP A CG  
1252 O  OD1 . ASP A 144 ? 0.5613 0.6117 0.6100 0.1424  -0.0497 0.0467  139 ASP A OD1 
1253 O  OD2 . ASP A 144 ? 0.5359 0.5730 0.5488 0.1085  -0.0607 0.0633  139 ASP A OD2 
1254 N  N   . LYS A 145 ? 0.3781 0.2994 0.2660 0.1079  0.0223  0.0013  140 LYS A N   
1255 C  CA  A LYS A 145 ? 0.3667 0.2729 0.2406 0.0990  0.0204  0.0088  140 LYS A CA  
1256 C  CA  B LYS A 145 ? 0.3606 0.2645 0.2335 0.1029  0.0224  0.0027  140 LYS A CA  
1257 C  CA  C LYS A 145 ? 0.3646 0.2754 0.2417 0.0989  0.0189  0.0133  140 LYS A CA  
1258 C  C   . LYS A 145 ? 0.3472 0.2564 0.2137 0.0890  0.0259  0.0053  140 LYS A C   
1259 O  O   . LYS A 145 ? 0.3193 0.1952 0.1800 0.0921  0.0292  0.0045  140 LYS A O   
1260 C  CB  A LYS A 145 ? 0.3825 0.2800 0.2613 0.0928  0.0203  0.0100  140 LYS A CB  
1261 C  CB  B LYS A 145 ? 0.3649 0.2655 0.2430 0.1017  0.0208  0.0034  140 LYS A CB  
1262 C  CB  C LYS A 145 ? 0.3782 0.2836 0.2672 0.0913  0.0157  0.0159  140 LYS A CB  
1263 C  CG  A LYS A 145 ? 0.3854 0.2752 0.2556 0.1004  0.0195  0.0099  140 LYS A CG  
1264 C  CG  B LYS A 145 ? 0.3650 0.2140 0.2353 0.1283  0.0308  -0.0130 140 LYS A CG  
1265 C  CG  C LYS A 145 ? 0.3757 0.2866 0.2605 0.1020  0.0166  0.0397  140 LYS A CG  
1266 C  CD  A LYS A 145 ? 0.4262 0.2967 0.1776 0.0976  0.0221  0.0214  140 LYS A CD  
1267 C  CD  B LYS A 145 ? 0.3519 0.1699 0.2543 0.1523  0.0257  -0.0058 140 LYS A CD  
1268 C  CD  C LYS A 145 ? 0.4043 0.2814 0.3477 0.0897  -0.0054 0.0385  140 LYS A CD  
1269 C  CE  A LYS A 145 ? 0.4191 0.2933 0.1792 0.1242  0.0335  0.0008  140 LYS A CE  
1270 C  CE  B LYS A 145 ? 0.3120 0.1467 0.2495 0.1751  0.0488  -0.0121 140 LYS A CE  
1271 C  CE  C LYS A 145 ? 0.4005 0.2902 0.3614 0.1019  0.0211  0.0564  140 LYS A CE  
1272 N  NZ  A LYS A 145 ? 0.4713 0.2603 0.1144 0.1348  0.0189  -0.0648 140 LYS A NZ  
1273 N  NZ  B LYS A 145 ? 0.3277 0.1601 0.2411 0.1740  0.0466  0.0088  140 LYS A NZ  
1274 N  NZ  C LYS A 145 ? 0.3771 0.2836 0.3703 0.1211  0.0397  0.0441  140 LYS A NZ  
1275 N  N   . LYS A 146 ? 0.3179 0.2483 0.1832 0.0913  0.0243  0.0109  141 LYS A N   
1276 C  CA  A LYS A 146 ? 0.2776 0.2523 0.1562 0.0783  0.0219  0.0174  141 LYS A CA  
1277 C  CA  B LYS A 146 ? 0.2810 0.2581 0.1600 0.0777  0.0237  0.0139  141 LYS A CA  
1278 C  C   . LYS A 146 ? 0.2478 0.2463 0.1482 0.0801  0.0296  0.0194  141 LYS A C   
1279 O  O   . LYS A 146 ? 0.2295 0.2453 0.1480 0.0928  0.0247  0.0024  141 LYS A O   
1280 C  CB  A LYS A 146 ? 0.2738 0.2816 0.1414 0.0649  0.0180  0.0209  141 LYS A CB  
1281 C  CB  B LYS A 146 ? 0.2805 0.2896 0.1480 0.0652  0.0224  0.0180  141 LYS A CB  
1282 C  CG  A LYS A 146 ? 0.2707 0.2925 0.1672 0.0716  0.0096  -0.0011 141 LYS A CG  
1283 C  CG  B LYS A 146 ? 0.2933 0.3392 0.1832 0.0666  0.0213  -0.0263 141 LYS A CG  
1284 C  CD  A LYS A 146 ? 0.2995 0.3226 0.1604 0.0320  -0.0421 0.0038  141 LYS A CD  
1285 C  CD  B LYS A 146 ? 0.3092 0.3979 0.2087 0.0714  -0.0133 0.0052  141 LYS A CD  
1286 C  CE  A LYS A 146 ? 0.2913 0.3171 0.1709 0.0036  -0.0238 -0.0201 141 LYS A CE  
1287 C  CE  B LYS A 146 ? 0.3322 0.3737 0.2302 0.0637  -0.0097 -0.0470 141 LYS A CE  
1288 N  NZ  A LYS A 146 ? 0.2971 0.2077 0.1796 -0.0094 -0.0319 -0.0341 141 LYS A NZ  
1289 N  NZ  B LYS A 146 ? 0.3231 0.4006 0.3273 0.0593  0.0057  -0.0348 141 LYS A NZ  
1290 N  N   . ARG A 147 ? 0.2227 0.2343 0.1577 0.0701  0.0425  0.0266  142 ARG A N   
1291 C  CA  . ARG A 147 ? 0.1847 0.2368 0.1738 0.0618  0.0489  0.0365  142 ARG A CA  
1292 C  C   . ARG A 147 ? 0.2007 0.1825 0.1517 0.0594  0.0398  0.0322  142 ARG A C   
1293 O  O   . ARG A 147 ? 0.1991 0.1967 0.1856 0.0523  0.0460  0.0094  142 ARG A O   
1294 C  CB  . ARG A 147 ? 0.1823 0.2666 0.1841 0.0591  0.0481  0.0603  142 ARG A CB  
1295 C  CG  . ARG A 147 ? 0.1646 0.3235 0.3145 0.0972  0.0420  0.0874  142 ARG A CG  
1296 C  CD  . ARG A 147 ? 0.1945 0.4328 0.3997 0.1792  0.0857  0.0449  142 ARG A CD  
1297 N  NE  . ARG A 147 ? 0.3541 0.3363 0.3647 0.1547  0.0678  0.0777  142 ARG A NE  
1298 C  CZ  . ARG A 147 ? 0.3843 0.3632 0.3907 0.1574  0.0594  0.0721  142 ARG A CZ  
1299 N  NH1 . ARG A 147 ? 0.2995 0.4362 0.3233 0.1496  -0.0026 0.1250  142 ARG A NH1 
1300 N  NH2 . ARG A 147 ? 0.4353 0.3179 0.4497 0.1479  0.0998  0.1041  142 ARG A NH2 
1301 N  N   . ILE A 148 ? 0.2135 0.1633 0.1575 0.0543  0.0319  0.0330  143 ILE A N   
1302 C  CA  . ILE A 148 ? 0.1831 0.1138 0.1452 0.0403  0.0283  0.0215  143 ILE A CA  
1303 C  C   . ILE A 148 ? 0.1888 0.1004 0.1469 0.0303  0.0124  0.0330  143 ILE A C   
1304 O  O   . ILE A 148 ? 0.1898 0.1142 0.1746 0.0321  0.0029  0.0253  143 ILE A O   
1305 C  CB  . ILE A 148 ? 0.1716 0.1346 0.1523 0.0584  0.0162  0.0174  143 ILE A CB  
1306 C  CG1 . ILE A 148 ? 0.1841 0.1055 0.2455 0.1025  0.0050  -0.0225 143 ILE A CG1 
1307 C  CG2 . ILE A 148 ? 0.1842 0.1301 0.1868 0.0286  0.0469  0.0184  143 ILE A CG2 
1308 C  CD1 . ILE A 148 ? 0.3156 0.0982 0.3225 0.1241  -0.0404 -0.0653 143 ILE A CD1 
1309 N  N   . ILE A 149 ? 0.1644 0.1072 0.1506 0.0298  0.0075  0.0280  144 ILE A N   
1310 C  CA  . ILE A 149 ? 0.1695 0.0993 0.1184 0.0334  0.0046  0.0188  144 ILE A CA  
1311 C  C   . ILE A 149 ? 0.1573 0.1186 0.1213 0.0245  0.0084  0.0248  144 ILE A C   
1312 O  O   . ILE A 149 ? 0.1612 0.1416 0.1536 0.0273  0.0031  -0.0094 144 ILE A O   
1313 C  CB  . ILE A 149 ? 0.1801 0.0819 0.1662 0.0144  -0.0103 0.0032  144 ILE A CB  
1314 C  CG1 . ILE A 149 ? 0.1851 0.0948 0.1415 -0.0068 -0.0019 0.0013  144 ILE A CG1 
1315 C  CG2 . ILE A 149 ? 0.1708 0.1370 0.1552 0.0482  0.0313  -0.0108 144 ILE A CG2 
1316 C  CD1 . ILE A 149 ? 0.3024 0.1227 0.1365 -0.0046 -0.0179 -0.0439 144 ILE A CD1 
1317 N  N   . ASP A 150 ? 0.1621 0.1093 0.1485 0.0130  0.0228  0.0311  145 ASP A N   
1318 C  CA  A ASP A 150 ? 0.1560 0.1168 0.1578 0.0223  0.0218  0.0414  145 ASP A CA  
1319 C  CA  B ASP A 150 ? 0.1468 0.1010 0.1415 0.0147  0.0331  0.0309  145 ASP A CA  
1320 C  CA  C ASP A 150 ? 0.1612 0.1119 0.1553 0.0138  0.0226  0.0333  145 ASP A CA  
1321 C  C   . ASP A 150 ? 0.1442 0.1059 0.1475 0.0147  0.0261  0.0416  145 ASP A C   
1322 O  O   . ASP A 150 ? 0.1554 0.1179 0.1410 0.0088  0.0188  0.0311  145 ASP A O   
1323 C  CB  A ASP A 150 ? 0.1686 0.1308 0.1688 0.0316  0.0314  0.0538  145 ASP A CB  
1324 C  CB  B ASP A 150 ? 0.1449 0.0990 0.1455 0.0113  0.0394  0.0311  145 ASP A CB  
1325 C  CB  C ASP A 150 ? 0.1779 0.1168 0.1682 0.0090  0.0274  0.0367  145 ASP A CB  
1326 C  CG  A ASP A 150 ? 0.1863 0.1692 0.2246 0.0377  0.0170  0.0796  145 ASP A CG  
1327 C  CG  B ASP A 150 ? 0.1454 0.0616 0.1012 -0.0055 0.0834  0.0134  145 ASP A CG  
1328 C  CG  C ASP A 150 ? 0.2152 0.1407 0.1952 -0.0027 0.0285  0.0251  145 ASP A CG  
1329 O  OD1 A ASP A 150 ? 0.2196 0.1994 0.2925 0.1120  0.0685  0.0730  145 ASP A OD1 
1330 O  OD1 B ASP A 150 ? 0.1777 0.0266 0.1046 0.0139  0.1099  0.0100  145 ASP A OD1 
1331 O  OD1 C ASP A 150 ? 0.2411 0.2182 0.2735 0.0255  -0.0165 0.0351  145 ASP A OD1 
1332 O  OD2 A ASP A 150 ? 0.1673 0.2578 0.3114 0.1111  0.0001  0.1781  145 ASP A OD2 
1333 O  OD2 B ASP A 150 ? 0.2031 0.1182 0.0888 0.0096  0.1042  0.0046  145 ASP A OD2 
1334 O  OD2 C ASP A 150 ? 0.3221 0.1838 0.2250 -0.0224 0.0472  0.0051  145 ASP A OD2 
1335 N  N   . SER A 151 ? 0.1279 0.1196 0.1438 0.0073  0.0139  0.0511  146 SER A N   
1336 C  CA  . SER A 151 ? 0.1204 0.1206 0.1282 0.0298  0.0311  0.0452  146 SER A CA  
1337 C  C   . SER A 151 ? 0.1041 0.1021 0.1335 0.0130  0.0340  0.0350  146 SER A C   
1338 O  O   . SER A 151 ? 0.1140 0.1219 0.1479 0.0120  0.0404  0.0296  146 SER A O   
1339 C  CB  . SER A 151 ? 0.1280 0.1319 0.1722 0.0394  0.0408  0.0800  146 SER A CB  
1340 O  OG  . SER A 151 ? 0.1289 0.1924 0.2165 0.0186  0.0527  0.0587  146 SER A OG  
1341 N  N   . ALA A 152 ? 0.1228 0.0908 0.1075 0.0099  0.0344  0.0245  147 ALA A N   
1342 C  CA  . ALA A 152 ? 0.1056 0.0598 0.1493 0.0217  0.0308  0.0262  147 ALA A CA  
1343 C  C   . ALA A 152 ? 0.1487 0.0802 0.1260 0.0264  0.0196  0.0296  147 ALA A C   
1344 O  O   . ALA A 152 ? 0.1423 0.1047 0.1381 0.0176  0.0301  0.0105  147 ALA A O   
1345 C  CB  . ALA A 152 ? 0.1547 0.0732 0.1434 -0.0037 0.0064  0.0167  147 ALA A CB  
1346 N  N   . ARG A 153 ? 0.1499 0.0882 0.1451 0.0255  0.0156  0.0493  148 ARG A N   
1347 C  CA  A ARG A 153 ? 0.1670 0.0711 0.1205 0.0284  0.0015  0.0350  148 ARG A CA  
1348 C  CA  B ARG A 153 ? 0.1665 0.0707 0.1152 0.0266  -0.0002 0.0342  148 ARG A CA  
1349 C  C   . ARG A 153 ? 0.1306 0.0771 0.1233 0.0099  0.0059  0.0224  148 ARG A C   
1350 O  O   . ARG A 153 ? 0.1579 0.0636 0.1347 0.0206  0.0093  0.0131  148 ARG A O   
1351 C  CB  A ARG A 153 ? 0.1564 0.0764 0.1142 0.0247  0.0071  0.0540  148 ARG A CB  
1352 C  CB  B ARG A 153 ? 0.1558 0.0780 0.1078 0.0190  0.0028  0.0546  148 ARG A CB  
1353 C  CG  A ARG A 153 ? 0.1938 0.0747 0.1382 0.0464  -0.0180 0.0428  148 ARG A CG  
1354 C  CG  B ARG A 153 ? 0.1914 0.0692 0.1056 0.0346  -0.0279 0.0354  148 ARG A CG  
1355 C  CD  A ARG A 153 ? 0.1895 0.1050 0.1521 0.0279  -0.0073 0.0510  148 ARG A CD  
1356 C  CD  B ARG A 153 ? 0.1529 0.0781 0.1052 0.0025  -0.0356 0.0459  148 ARG A CD  
1357 N  NE  A ARG A 153 ? 0.2156 0.1311 0.1847 0.0197  -0.0337 0.0560  148 ARG A NE  
1358 N  NE  B ARG A 153 ? 0.1847 0.1101 0.1581 -0.0288 -0.0462 0.0255  148 ARG A NE  
1359 C  CZ  A ARG A 153 ? 0.1623 0.1214 0.1290 -0.0048 -0.0191 0.0535  148 ARG A CZ  
1360 C  CZ  B ARG A 153 ? 0.1535 0.0763 0.2148 -0.0319 0.0224  -0.0102 148 ARG A CZ  
1361 N  NH1 A ARG A 153 ? 0.1110 0.0519 0.1758 -0.0242 -0.0138 0.0580  148 ARG A NH1 
1362 N  NH1 B ARG A 153 ? 0.0625 0.0521 0.1408 -0.0221 0.0136  0.0308  148 ARG A NH1 
1363 N  NH2 A ARG A 153 ? 0.1631 0.2304 0.1252 -0.0002 0.0014  0.0384  148 ARG A NH2 
1364 N  NH2 B ARG A 153 ? 0.1312 0.0499 0.2499 -0.0206 0.0608  -0.0744 148 ARG A NH2 
1365 N  N   . SER A 154 ? 0.1421 0.0708 0.1482 -0.0053 0.0168  0.0192  149 SER A N   
1366 C  CA  A SER A 154 ? 0.1199 0.0725 0.1486 -0.0045 0.0232  0.0181  149 SER A CA  
1367 C  CA  B SER A 154 ? 0.1408 0.0946 0.1605 -0.0072 0.0196  0.0118  149 SER A CA  
1368 C  C   . SER A 154 ? 0.1342 0.0614 0.1530 -0.0004 0.0322  0.0185  149 SER A C   
1369 O  O   . SER A 154 ? 0.1252 0.1199 0.1485 0.0118  0.0101  0.0255  149 SER A O   
1370 C  CB  A SER A 154 ? 0.1271 0.0906 0.1430 -0.0219 0.0511  0.0182  149 SER A CB  
1371 C  CB  B SER A 154 ? 0.1490 0.1273 0.1768 -0.0296 0.0542  0.0147  149 SER A CB  
1372 O  OG  A SER A 154 ? 0.0662 0.0439 0.1800 -0.0108 0.0386  0.0329  149 SER A OG  
1373 O  OG  B SER A 154 ? 0.2562 0.2209 0.2468 -0.0154 0.0136  -0.0004 149 SER A OG  
1374 N  N   . ALA A 155 ? 0.1144 0.0672 0.1381 0.0057  0.0159  0.0281  150 ALA A N   
1375 C  CA  . ALA A 155 ? 0.1062 0.0478 0.1513 -0.0015 0.0078  0.0276  150 ALA A CA  
1376 C  C   . ALA A 155 ? 0.1036 0.0615 0.1423 0.0090  0.0016  0.0157  150 ALA A C   
1377 O  O   . ALA A 155 ? 0.1182 0.0473 0.1429 0.0063  0.0138  0.0083  150 ALA A O   
1378 C  CB  . ALA A 155 ? 0.1340 0.0518 0.1502 0.0024  -0.0206 0.0301  150 ALA A CB  
1379 N  N   . TYR A 156 ? 0.0787 0.0674 0.1295 0.0085  0.0117  0.0226  151 TYR A N   
1380 C  CA  . TYR A 156 ? 0.0880 0.0522 0.1571 0.0015  0.0001  0.0266  151 TYR A CA  
1381 C  C   . TYR A 156 ? 0.1038 0.0611 0.1450 0.0012  0.0149  0.0258  151 TYR A C   
1382 O  O   . TYR A 156 ? 0.1075 0.0707 0.1318 0.0148  0.0057  0.0235  151 TYR A O   
1383 C  CB  . TYR A 156 ? 0.0895 0.0466 0.1585 0.0028  -0.0170 0.0232  151 TYR A CB  
1384 C  CG  . TYR A 156 ? 0.0915 0.0428 0.1119 -0.0030 0.0202  0.0062  151 TYR A CG  
1385 C  CD1 . TYR A 156 ? 0.1380 0.0663 0.1082 0.0142  0.0148  0.0582  151 TYR A CD1 
1386 C  CD2 . TYR A 156 ? 0.1123 0.0399 0.1263 0.0279  -0.0161 0.0183  151 TYR A CD2 
1387 C  CE1 . TYR A 156 ? 0.1356 0.0530 0.0971 0.0503  -0.0142 0.0116  151 TYR A CE1 
1388 C  CE2 . TYR A 156 ? 0.0996 0.0609 0.1027 -0.0108 0.0056  0.0416  151 TYR A CE2 
1389 C  CZ  . TYR A 156 ? 0.1292 0.0748 0.0853 0.0504  -0.0235 0.0255  151 TYR A CZ  
1390 O  OH  . TYR A 156 ? 0.1264 0.0440 0.1440 0.0260  -0.0229 0.0301  151 TYR A OH  
1391 N  N   . GLN A 157 ? 0.1277 0.0545 0.1126 -0.0024 0.0121  0.0497  152 GLN A N   
1392 C  CA  . GLN A 157 ? 0.1331 0.0554 0.1380 0.0180  0.0310  0.0429  152 GLN A CA  
1393 C  C   . GLN A 157 ? 0.1240 0.0795 0.1384 0.0061  0.0246  0.0368  152 GLN A C   
1394 O  O   . GLN A 157 ? 0.1601 0.0497 0.1873 0.0190  0.0148  0.0248  152 GLN A O   
1395 C  CB  . GLN A 157 ? 0.1557 0.0854 0.1361 0.0560  0.0259  0.0728  152 GLN A CB  
1396 C  CG  . GLN A 157 ? 0.1732 0.0993 0.2272 0.0818  0.0227  0.0301  152 GLN A CG  
1397 C  CD  . GLN A 157 ? 0.1964 0.1113 0.2224 0.0552  -0.0266 0.0147  152 GLN A CD  
1398 O  OE1 . GLN A 157 ? 0.2203 0.1180 0.2650 0.0328  -0.1001 0.0289  152 GLN A OE1 
1399 N  NE2 . GLN A 157 ? 0.2449 0.1842 0.3026 0.0972  -0.0164 0.0047  152 GLN A NE2 
1400 N  N   . GLU A 158 ? 0.1290 0.0880 0.1586 -0.0061 0.0193  0.0047  153 GLU A N   
1401 C  CA  A GLU A 158 ? 0.1283 0.0839 0.1668 -0.0135 0.0115  0.0017  153 GLU A CA  
1402 C  CA  B GLU A 158 ? 0.1295 0.1066 0.1728 -0.0117 0.0188  0.0043  153 GLU A CA  
1403 C  C   . GLU A 158 ? 0.1271 0.0707 0.1765 -0.0143 0.0117  -0.0019 153 GLU A C   
1404 O  O   . GLU A 158 ? 0.1347 0.0782 0.2161 0.0222  0.0164  0.0081  153 GLU A O   
1405 C  CB  A GLU A 158 ? 0.1389 0.0719 0.1708 -0.0035 0.0043  -0.0023 153 GLU A CB  
1406 C  CB  B GLU A 158 ? 0.1320 0.1199 0.1783 -0.0162 0.0171  -0.0006 153 GLU A CB  
1407 C  CG  A GLU A 158 ? 0.1353 0.0388 0.1837 -0.0292 -0.0144 -0.0117 153 GLU A CG  
1408 C  CG  B GLU A 158 ? 0.1590 0.2235 0.2180 -0.0095 0.0432  -0.0052 153 GLU A CG  
1409 C  CD  A GLU A 158 ? 0.1526 0.0323 0.3000 0.0005  0.0298  0.0255  153 GLU A CD  
1410 C  CD  B GLU A 158 ? 0.1741 0.2741 0.3103 0.0119  0.0287  -0.0469 153 GLU A CD  
1411 O  OE1 A GLU A 158 ? 0.1410 0.1702 0.2563 0.0239  0.0510  -0.0249 153 GLU A OE1 
1412 O  OE1 B GLU A 158 ? 0.1184 0.3348 0.3388 0.0385  0.0123  -0.0760 153 GLU A OE1 
1413 O  OE2 A GLU A 158 ? 0.1225 0.2354 0.3717 -0.0364 -0.0112 -0.0619 153 GLU A OE2 
1414 O  OE2 B GLU A 158 ? 0.2369 0.3058 0.3392 0.0059  0.0463  -0.0797 153 GLU A OE2 
1415 N  N   . ALA A 159 ? 0.1229 0.0740 0.1709 -0.0098 0.0150  0.0306  154 ALA A N   
1416 C  CA  . ALA A 159 ? 0.1359 0.0427 0.1554 0.0054  0.0115  0.0293  154 ALA A CA  
1417 C  C   . ALA A 159 ? 0.1270 0.0731 0.1467 0.0058  0.0022  0.0076  154 ALA A C   
1418 O  O   . ALA A 159 ? 0.1526 0.0688 0.1727 0.0032  0.0028  -0.0069 154 ALA A O   
1419 C  CB  . ALA A 159 ? 0.1348 0.0446 0.1198 -0.0193 0.0116  0.0364  154 ALA A CB  
1420 N  N   . MET A 160 ? 0.0964 0.0754 0.1347 0.0043  -0.0080 0.0335  155 MET A N   
1421 C  CA  . MET A 160 ? 0.1311 0.0434 0.1383 0.0357  -0.0226 0.0179  155 MET A CA  
1422 C  C   . MET A 160 ? 0.1308 0.0589 0.1511 0.0111  -0.0131 0.0318  155 MET A C   
1423 O  O   . MET A 160 ? 0.1327 0.0796 0.1729 0.0139  0.0004  0.0218  155 MET A O   
1424 C  CB  . MET A 160 ? 0.1472 0.0667 0.1492 0.0148  -0.0253 0.0235  155 MET A CB  
1425 C  CG  . MET A 160 ? 0.2152 0.1040 0.2085 0.0690  0.0073  0.0302  155 MET A CG  
1426 S  SD  . MET A 160 ? 0.2439 0.1549 0.2345 0.0197  0.0076  0.0327  155 MET A SD  
1427 C  CE  . MET A 160 ? 0.1999 0.2794 0.2241 0.1492  0.1175  0.1327  155 MET A CE  
1428 N  N   . ASP A 161 ? 0.1609 0.0344 0.1645 -0.0013 -0.0142 0.0319  156 ASP A N   
1429 C  CA  . ASP A 161 ? 0.1878 0.0474 0.1596 -0.0079 -0.0072 0.0173  156 ASP A CA  
1430 C  C   . ASP A 161 ? 0.1866 0.0465 0.1693 0.0126  -0.0112 0.0150  156 ASP A C   
1431 O  O   . ASP A 161 ? 0.2340 0.0456 0.1957 0.0202  -0.0229 0.0052  156 ASP A O   
1432 C  CB  . ASP A 161 ? 0.2098 0.0730 0.1477 -0.0078 0.0104  0.0261  156 ASP A CB  
1433 C  CG  . ASP A 161 ? 0.2364 0.0930 0.1658 -0.0150 0.0182  0.0173  156 ASP A CG  
1434 O  OD1 . ASP A 161 ? 0.2737 0.1728 0.1854 -0.0461 -0.0019 0.0309  156 ASP A OD1 
1435 O  OD2 . ASP A 161 ? 0.3549 0.2348 0.1976 -0.0378 0.0969  0.0088  156 ASP A OD2 
1436 N  N   . ILE A 162 ? 0.1907 0.0698 0.1713 0.0212  -0.0227 0.0100  157 ILE A N   
1437 C  CA  . ILE A 162 ? 0.1481 0.0597 0.1717 0.0386  -0.0317 0.0104  157 ILE A CA  
1438 C  C   . ILE A 162 ? 0.1509 0.0401 0.1800 0.0410  -0.0164 -0.0016 157 ILE A C   
1439 O  O   . ILE A 162 ? 0.1589 0.0922 0.1846 0.0491  -0.0200 0.0002  157 ILE A O   
1440 C  CB  . ILE A 162 ? 0.1664 0.0918 0.1813 0.0491  -0.0243 0.0197  157 ILE A CB  
1441 C  CG1 . ILE A 162 ? 0.1538 0.0647 0.2463 0.0457  -0.0398 0.0165  157 ILE A CG1 
1442 C  CG2 . ILE A 162 ? 0.1579 0.0674 0.1644 0.0037  -0.0327 0.0055  157 ILE A CG2 
1443 C  CD1 . ILE A 162 ? 0.1251 0.1213 0.2847 0.0656  -0.0286 0.0323  157 ILE A CD1 
1444 N  N   . SER A 163 ? 0.1344 0.0599 0.1888 0.0268  -0.0069 0.0190  158 SER A N   
1445 C  CA  . SER A 163 ? 0.1550 0.0633 0.1975 0.0450  0.0138  0.0052  158 SER A CA  
1446 C  C   . SER A 163 ? 0.1743 0.0730 0.1901 0.0513  0.0034  0.0185  158 SER A C   
1447 O  O   . SER A 163 ? 0.1818 0.1126 0.1750 0.0501  0.0070  0.0020  158 SER A O   
1448 C  CB  . SER A 163 ? 0.1923 0.0883 0.2240 0.0292  -0.0092 0.0052  158 SER A CB  
1449 O  OG  . SER A 163 ? 0.2635 0.1247 0.2513 0.0169  0.0700  -0.0030 158 SER A OG  
1450 N  N   . LYS A 164 ? 0.1770 0.0867 0.1913 0.0666  -0.0098 0.0222  159 LYS A N   
1451 C  CA  A LYS A 164 ? 0.1924 0.0803 0.1972 0.0701  -0.0101 0.0122  159 LYS A CA  
1452 C  CA  B LYS A 164 ? 0.1977 0.0955 0.2144 0.0706  -0.0089 0.0184  159 LYS A CA  
1453 C  C   . LYS A 164 ? 0.2022 0.0970 0.2179 0.0716  -0.0193 0.0198  159 LYS A C   
1454 O  O   . LYS A 164 ? 0.2282 0.1371 0.2774 0.0804  0.0088  -0.0108 159 LYS A O   
1455 C  CB  A LYS A 164 ? 0.2011 0.0735 0.1993 0.0840  -0.0204 0.0130  159 LYS A CB  
1456 C  CB  B LYS A 164 ? 0.2112 0.1000 0.2163 0.0763  -0.0121 0.0248  159 LYS A CB  
1457 C  CG  A LYS A 164 ? 0.2249 0.0885 0.2071 0.0692  -0.0338 -0.0228 159 LYS A CG  
1458 C  CG  B LYS A 164 ? 0.2476 0.1771 0.2969 0.0906  -0.0247 0.0347  159 LYS A CG  
1459 C  CD  A LYS A 164 ? 0.3381 0.1168 0.2228 0.0448  -0.1035 -0.0410 159 LYS A CD  
1460 C  CD  B LYS A 164 ? 0.2842 0.2138 0.3567 0.0783  -0.0416 0.0268  159 LYS A CD  
1461 C  CE  A LYS A 164 ? 0.4008 0.0566 0.2807 0.0702  -0.1031 0.0082  159 LYS A CE  
1462 C  CE  B LYS A 164 ? 0.3635 0.2479 0.3533 0.1068  -0.0296 0.0709  159 LYS A CE  
1463 N  NZ  A LYS A 164 ? 0.3751 0.0368 0.3310 0.0234  -0.1651 -0.0201 159 LYS A NZ  
1464 N  NZ  B LYS A 164 ? 0.3848 0.2807 0.3973 0.0849  -0.0296 0.0400  159 LYS A NZ  
1465 N  N   . LYS A 165 ? 0.2178 0.0867 0.2145 0.0353  -0.0168 0.0171  160 LYS A N   
1466 C  CA  A LYS A 165 ? 0.2149 0.0933 0.2208 0.0475  -0.0202 0.0011  160 LYS A CA  
1467 C  CA  B LYS A 165 ? 0.2110 0.0976 0.2269 0.0450  -0.0147 -0.0119 160 LYS A CA  
1468 C  C   . LYS A 165 ? 0.2016 0.0879 0.2211 0.0487  -0.0205 -0.0088 160 LYS A C   
1469 O  O   . LYS A 165 ? 0.2258 0.0870 0.2515 0.0604  0.0018  -0.0150 160 LYS A O   
1470 C  CB  A LYS A 165 ? 0.2185 0.0936 0.2168 0.0312  -0.0056 0.0039  160 LYS A CB  
1471 C  CB  B LYS A 165 ? 0.2102 0.1020 0.2254 0.0279  -0.0040 -0.0111 160 LYS A CB  
1472 C  CG  A LYS A 165 ? 0.2645 0.0868 0.2031 0.0300  -0.0805 0.0394  160 LYS A CG  
1473 C  CG  B LYS A 165 ? 0.2292 0.1133 0.2474 0.0177  -0.0328 -0.0538 160 LYS A CG  
1474 N  N   . GLU A 166 ? 0.2152 0.0898 0.1942 0.0281  -0.0220 0.0053  161 GLU A N   
1475 C  CA  . GLU A 166 ? 0.1970 0.1130 0.1995 0.0435  -0.0083 -0.0250 161 GLU A CA  
1476 C  C   . GLU A 166 ? 0.2075 0.1000 0.1795 0.0339  -0.0155 -0.0260 161 GLU A C   
1477 O  O   . GLU A 166 ? 0.2656 0.1816 0.2202 0.0220  0.0156  -0.0322 161 GLU A O   
1478 C  CB  . GLU A 166 ? 0.1840 0.1281 0.2021 0.0255  -0.0248 -0.0329 161 GLU A CB  
1479 C  CG  . GLU A 166 ? 0.2728 0.1840 0.3304 -0.0241 0.0111  -0.0331 161 GLU A CG  
1480 C  CD  . GLU A 166 ? 0.4158 0.2951 0.4579 -0.0534 0.0082  -0.0458 161 GLU A CD  
1481 O  OE1 . GLU A 166 ? 0.4527 0.3026 0.4608 -0.0913 -0.0265 -0.1064 161 GLU A OE1 
1482 O  OE2 . GLU A 166 ? 0.4651 0.4021 0.5933 -0.0930 0.0186  -0.0146 161 GLU A OE2 
1483 N  N   . MET A 167 ? 0.1854 0.0751 0.1881 0.0391  -0.0185 -0.0112 162 MET A N   
1484 C  CA  A MET A 167 ? 0.1782 0.0685 0.1806 0.0534  -0.0206 -0.0091 162 MET A CA  
1485 C  CA  B MET A 167 ? 0.1732 0.0704 0.1809 0.0515  -0.0173 -0.0075 162 MET A CA  
1486 C  C   . MET A 167 ? 0.1685 0.0784 0.1602 0.0504  -0.0142 -0.0061 162 MET A C   
1487 O  O   . MET A 167 ? 0.1765 0.0756 0.1825 0.0487  -0.0209 0.0216  162 MET A O   
1488 C  CB  A MET A 167 ? 0.1767 0.0552 0.1765 0.0671  -0.0230 -0.0159 162 MET A CB  
1489 C  CB  B MET A 167 ? 0.1719 0.0670 0.1831 0.0642  -0.0135 -0.0081 162 MET A CB  
1490 C  CG  A MET A 167 ? 0.1799 0.0767 0.1927 0.0627  -0.0387 0.0022  162 MET A CG  
1491 C  CG  B MET A 167 ? 0.1467 0.0608 0.1966 0.0589  -0.0210 0.0079  162 MET A CG  
1492 S  SD  A MET A 167 ? 0.1599 0.0725 0.2129 0.0492  -0.0133 -0.0099 162 MET A SD  
1493 S  SD  B MET A 167 ? 0.1465 0.1307 0.2321 0.0678  0.0127  0.0106  162 MET A SD  
1494 C  CE  A MET A 167 ? 0.2211 0.0983 0.2217 0.0440  -0.0458 -0.0140 162 MET A CE  
1495 C  CE  B MET A 167 ? 0.1323 0.0783 0.2326 0.0721  -0.0268 0.0109  162 MET A CE  
1496 N  N   . PRO A 168 ? 0.1758 0.0896 0.1713 0.0320  -0.0151 -0.0093 163 PRO A N   
1497 C  CA  . PRO A 168 ? 0.1567 0.1108 0.1513 0.0324  -0.0028 -0.0180 163 PRO A CA  
1498 C  C   . PRO A 168 ? 0.1595 0.1046 0.1627 0.0355  -0.0164 -0.0062 163 PRO A C   
1499 O  O   . PRO A 168 ? 0.1531 0.1078 0.1646 0.0366  -0.0070 0.0026  163 PRO A O   
1500 C  CB  . PRO A 168 ? 0.2120 0.1590 0.1329 0.0108  -0.0124 -0.0279 163 PRO A CB  
1501 C  CG  . PRO A 168 ? 0.1706 0.1556 0.2009 0.0456  -0.0142 -0.0006 163 PRO A CG  
1502 C  CD  . PRO A 168 ? 0.1844 0.1198 0.1569 0.0056  -0.0117 0.0178  163 PRO A CD  
1503 N  N   . PRO A 169 ? 0.1605 0.0945 0.1656 0.0613  -0.0128 0.0090  164 PRO A N   
1504 C  CA  . PRO A 169 ? 0.1780 0.1206 0.1809 0.0450  -0.0218 0.0094  164 PRO A CA  
1505 C  C   . PRO A 169 ? 0.1614 0.1224 0.1899 0.0452  0.0059  0.0070  164 PRO A C   
1506 O  O   . PRO A 169 ? 0.1462 0.1121 0.2212 0.0176  0.0313  -0.0043 164 PRO A O   
1507 C  CB  . PRO A 169 ? 0.1978 0.1360 0.2110 0.0651  -0.0321 0.0121  164 PRO A CB  
1508 C  CG  . PRO A 169 ? 0.1854 0.1517 0.2145 0.0642  -0.0181 -0.0244 164 PRO A CG  
1509 C  CD  . PRO A 169 ? 0.1884 0.1386 0.2020 0.0760  -0.0326 0.0226  164 PRO A CD  
1510 N  N   . THR A 170 ? 0.1260 0.1260 0.1854 0.0541  0.0018  0.0034  165 THR A N   
1511 C  CA  A THR A 170 ? 0.1113 0.1062 0.1748 0.0514  0.0098  0.0033  165 THR A CA  
1512 C  CA  B THR A 170 ? 0.1151 0.1249 0.1923 0.0585  0.0010  0.0136  165 THR A CA  
1513 C  C   . THR A 170 ? 0.0900 0.1125 0.1878 0.0450  0.0030  0.0144  165 THR A C   
1514 O  O   . THR A 170 ? 0.1203 0.1052 0.2047 0.0497  0.0106  0.0116  165 THR A O   
1515 C  CB  A THR A 170 ? 0.0692 0.0964 0.1565 0.0466  0.0061  0.0022  165 THR A CB  
1516 C  CB  B THR A 170 ? 0.1025 0.1348 0.1919 0.0653  -0.0043 0.0112  165 THR A CB  
1517 O  OG1 A THR A 170 ? 0.1464 0.0679 0.1033 0.0656  -0.0136 -0.0271 165 THR A OG1 
1518 O  OG1 B THR A 170 ? 0.1253 0.1406 0.2159 0.0787  -0.0118 0.0367  165 THR A OG1 
1519 C  CG2 A THR A 170 ? 0.1155 0.0754 0.1770 0.0525  -0.0090 0.0339  165 THR A CG2 
1520 C  CG2 B THR A 170 ? 0.1253 0.1415 0.1975 0.0845  -0.0231 0.0470  165 THR A CG2 
1521 N  N   . HIS A 171 ? 0.0905 0.1061 0.1656 0.0437  -0.0024 -0.0041 166 HIS A N   
1522 C  CA  . HIS A 171 ? 0.0773 0.0803 0.1458 0.0380  -0.0266 0.0070  166 HIS A CA  
1523 C  C   . HIS A 171 ? 0.1073 0.0744 0.1142 0.0385  -0.0131 0.0071  166 HIS A C   
1524 O  O   . HIS A 171 ? 0.0918 0.0924 0.1337 0.0508  -0.0042 0.0090  166 HIS A O   
1525 C  CB  . HIS A 171 ? 0.0827 0.1040 0.1561 0.0366  -0.0279 -0.0108 166 HIS A CB  
1526 C  CG  . HIS A 171 ? 0.1292 0.0811 0.1673 0.0572  -0.0687 -0.0138 166 HIS A CG  
1527 N  ND1 . HIS A 171 ? 0.1103 0.1058 0.1921 0.0599  -0.0464 -0.0289 166 HIS A ND1 
1528 C  CD2 . HIS A 171 ? 0.2249 0.1100 0.2162 0.0450  -0.1290 -0.0572 166 HIS A CD2 
1529 C  CE1 . HIS A 171 ? 0.1938 0.0789 0.2366 0.0486  -0.0972 -0.0699 166 HIS A CE1 
1530 N  NE2 . HIS A 171 ? 0.2100 0.0980 0.2659 0.0658  -0.0662 -0.0041 166 HIS A NE2 
1531 N  N   . PRO A 172 ? 0.1081 0.1000 0.1272 0.0498  -0.0155 0.0143  167 PRO A N   
1532 C  CA  . PRO A 172 ? 0.1036 0.0836 0.1233 0.0400  0.0051  0.0449  167 PRO A CA  
1533 C  C   . PRO A 172 ? 0.0833 0.0918 0.1522 0.0372  -0.0076 0.0262  167 PRO A C   
1534 O  O   . PRO A 172 ? 0.1111 0.0942 0.1407 0.0196  -0.0005 0.0328  167 PRO A O   
1535 C  CB  . PRO A 172 ? 0.1158 0.1233 0.1380 0.0774  0.0160  0.0614  167 PRO A CB  
1536 C  CG  . PRO A 172 ? 0.2257 0.1182 0.2045 0.0531  0.0063  0.0116  167 PRO A CG  
1537 C  CD  . PRO A 172 ? 0.1828 0.0727 0.1379 0.0422  -0.0020 0.0159  167 PRO A CD  
1538 N  N   . ILE A 173 ? 0.0824 0.0575 0.1534 0.0381  -0.0025 0.0275  168 ILE A N   
1539 C  CA  . ILE A 173 ? 0.0805 0.0677 0.1433 0.0161  -0.0032 0.0153  168 ILE A CA  
1540 C  C   . ILE A 173 ? 0.0925 0.0551 0.1367 0.0209  0.0077  0.0091  168 ILE A C   
1541 O  O   . ILE A 173 ? 0.1159 0.0620 0.1274 0.0115  0.0176  0.0032  168 ILE A O   
1542 C  CB  . ILE A 173 ? 0.0487 0.1001 0.1202 0.0301  -0.0250 0.0171  168 ILE A CB  
1543 C  CG1 . ILE A 173 ? 0.1047 0.0507 0.1520 0.0076  -0.0514 0.0001  168 ILE A CG1 
1544 C  CG2 . ILE A 173 ? 0.0762 0.0983 0.1127 0.0302  0.0108  -0.0588 168 ILE A CG2 
1545 C  CD1 . ILE A 173 ? 0.1310 0.0741 0.2050 -0.0205 -0.0759 -0.0599 168 ILE A CD1 
1546 N  N   . ARG A 174 ? 0.1037 0.0474 0.1377 0.0216  0.0010  0.0229  169 ARG A N   
1547 C  CA  A ARG A 174 ? 0.1142 0.0531 0.1246 0.0330  0.0186  0.0155  169 ARG A CA  
1548 C  CA  B ARG A 174 ? 0.1258 0.0539 0.1384 0.0358  0.0172  0.0128  169 ARG A CA  
1549 C  C   . ARG A 174 ? 0.1187 0.0591 0.1240 0.0337  0.0190  0.0202  169 ARG A C   
1550 O  O   . ARG A 174 ? 0.1084 0.0392 0.1384 0.0338  0.0175  0.0035  169 ARG A O   
1551 C  CB  A ARG A 174 ? 0.1030 0.0539 0.0898 0.0417  0.0114  0.0258  169 ARG A CB  
1552 C  CB  B ARG A 174 ? 0.1220 0.0583 0.1132 0.0558  0.0230  0.0213  169 ARG A CB  
1553 C  CG  A ARG A 174 ? 0.0949 0.0574 0.1284 0.0371  0.0613  0.0572  169 ARG A CG  
1554 C  CG  B ARG A 174 ? 0.1603 0.0534 0.2246 0.0544  0.0515  0.0233  169 ARG A CG  
1555 C  CD  A ARG A 174 ? 0.1286 0.0520 0.0674 0.0495  0.0051  0.0135  169 ARG A CD  
1556 C  CD  B ARG A 174 ? 0.1488 0.1116 0.3140 0.0870  0.0740  -0.0258 169 ARG A CD  
1557 N  NE  A ARG A 174 ? 0.1013 0.0379 0.0505 0.0309  -0.0437 -0.0178 169 ARG A NE  
1558 N  NE  B ARG A 174 ? 0.1880 0.1913 0.3039 0.0521  0.1246  -0.0611 169 ARG A NE  
1559 C  CZ  A ARG A 174 ? 0.0823 0.0255 0.1368 -0.0004 -0.0292 -0.0047 169 ARG A CZ  
1560 C  CZ  B ARG A 174 ? 0.2337 0.1144 0.3184 0.0387  0.0520  -0.1418 169 ARG A CZ  
1561 N  NH1 A ARG A 174 ? 0.0716 0.0601 0.1188 0.0261  0.0038  0.0071  169 ARG A NH1 
1562 N  NH1 B ARG A 174 ? 0.1757 0.1349 0.2753 0.0362  0.0902  -0.1187 169 ARG A NH1 
1563 N  NH2 A ARG A 174 ? 0.0442 0.0563 0.1304 0.0004  0.0135  0.0546  169 ARG A NH2 
1564 N  NH2 B ARG A 174 ? 0.1031 0.1444 0.3630 0.0400  -0.0505 -0.1993 169 ARG A NH2 
1565 N  N   . LEU A 175 ? 0.1008 0.0562 0.1310 0.0327  0.0101  0.0156  170 LEU A N   
1566 C  CA  . LEU A 175 ? 0.1144 0.0566 0.1535 0.0328  0.0249  -0.0112 170 LEU A CA  
1567 C  C   . LEU A 175 ? 0.0914 0.0518 0.1364 0.0418  0.0000  -0.0013 170 LEU A C   
1568 O  O   . LEU A 175 ? 0.1366 0.0634 0.1218 0.0387  0.0136  0.0063  170 LEU A O   
1569 C  CB  . LEU A 175 ? 0.1020 0.0494 0.1553 0.0414  0.0394  0.0073  170 LEU A CB  
1570 C  CG  . LEU A 175 ? 0.1011 0.0683 0.1113 0.0568  0.0099  0.0130  170 LEU A CG  
1571 C  CD1 . LEU A 175 ? 0.1159 0.1059 0.1452 0.0318  0.0660  0.0160  170 LEU A CD1 
1572 C  CD2 . LEU A 175 ? 0.0971 0.1910 0.1204 0.0937  -0.0266 0.0258  170 LEU A CD2 
1573 N  N   . GLY A 176 ? 0.0748 0.0469 0.1487 0.0226  0.0138  -0.0017 171 GLY A N   
1574 C  CA  . GLY A 176 ? 0.0837 0.0372 0.1319 0.0213  0.0368  -0.0050 171 GLY A CA  
1575 C  C   . GLY A 176 ? 0.0808 0.0336 0.1237 0.0213  0.0111  0.0022  171 GLY A C   
1576 O  O   . GLY A 176 ? 0.1101 0.0522 0.1407 0.0217  -0.0049 -0.0031 171 GLY A O   
1577 N  N   . LEU A 177 ? 0.0792 0.0423 0.1282 0.0155  0.0049  0.0174  172 LEU A N   
1578 C  CA  . LEU A 177 ? 0.0830 0.0500 0.1145 0.0032  0.0029  0.0060  172 LEU A CA  
1579 C  C   . LEU A 177 ? 0.0681 0.0487 0.1194 0.0112  0.0029  -0.0015 172 LEU A C   
1580 O  O   . LEU A 177 ? 0.0808 0.0612 0.1009 0.0026  -0.0086 -0.0079 172 LEU A O   
1581 C  CB  . LEU A 177 ? 0.0889 0.0307 0.0816 -0.0054 0.0245  -0.0068 172 LEU A CB  
1582 C  CG  . LEU A 177 ? 0.0813 0.0352 0.0785 0.0088  0.0091  -0.0155 172 LEU A CG  
1583 C  CD1 . LEU A 177 ? 0.0780 0.0846 0.1239 0.0541  0.0276  0.0110  172 LEU A CD1 
1584 C  CD2 . LEU A 177 ? 0.1486 0.0407 0.1525 -0.0363 -0.0028 -0.0236 172 LEU A CD2 
1585 N  N   . ALA A 178 ? 0.0730 0.0391 0.1456 0.0190  -0.0278 0.0142  173 ALA A N   
1586 C  CA  . ALA A 178 ? 0.0910 0.0413 0.1411 0.0275  -0.0160 0.0154  173 ALA A CA  
1587 C  C   . ALA A 178 ? 0.1041 0.0544 0.1399 0.0238  -0.0059 0.0236  173 ALA A C   
1588 O  O   . ALA A 178 ? 0.0951 0.0424 0.1472 0.0195  -0.0237 0.0065  173 ALA A O   
1589 C  CB  . ALA A 178 ? 0.1069 0.0625 0.1706 0.0474  -0.0244 0.0157  173 ALA A CB  
1590 N  N   . LEU A 179 ? 0.0927 0.0392 0.1189 0.0171  -0.0050 0.0263  174 LEU A N   
1591 C  CA  . LEU A 179 ? 0.1099 0.0436 0.1171 0.0109  0.0176  0.0125  174 LEU A CA  
1592 C  C   . LEU A 179 ? 0.1131 0.0721 0.1284 0.0188  0.0070  0.0008  174 LEU A C   
1593 O  O   . LEU A 179 ? 0.1206 0.0419 0.1274 0.0307  0.0228  -0.0181 174 LEU A O   
1594 C  CB  . LEU A 179 ? 0.1029 0.0354 0.1064 -0.0062 0.0271  0.0240  174 LEU A CB  
1595 C  CG  . LEU A 179 ? 0.0939 0.0627 0.1118 -0.0220 -0.0360 0.0167  174 LEU A CG  
1596 C  CD1 . LEU A 179 ? 0.0661 0.1431 0.1594 -0.0030 -0.0507 0.0292  174 LEU A CD1 
1597 C  CD2 . LEU A 179 ? 0.1442 0.1679 0.1388 0.0321  -0.0085 0.0463  174 LEU A CD2 
1598 N  N   . ASN A 180 ? 0.0970 0.0487 0.1039 0.0388  -0.0003 0.0135  175 ASN A N   
1599 C  CA  . ASN A 180 ? 0.0810 0.0675 0.0972 0.0327  0.0002  0.0284  175 ASN A CA  
1600 C  C   . ASN A 180 ? 0.1051 0.0634 0.1091 0.0198  -0.0030 0.0254  175 ASN A C   
1601 O  O   . ASN A 180 ? 0.1380 0.0493 0.1309 0.0308  0.0078  0.0271  175 ASN A O   
1602 C  CB  . ASN A 180 ? 0.1138 0.0621 0.0814 0.0175  -0.0203 0.0272  175 ASN A CB  
1603 C  CG  . ASN A 180 ? 0.1015 0.0505 0.0719 0.0366  0.0054  0.0213  175 ASN A CG  
1604 O  OD1 . ASN A 180 ? 0.1224 0.0397 0.1598 0.0112  -0.0032 0.0102  175 ASN A OD1 
1605 N  ND2 . ASN A 180 ? 0.1106 0.0495 0.1067 0.0245  -0.0436 0.0058  175 ASN A ND2 
1606 N  N   . PHE A 181 ? 0.1159 0.0526 0.1315 0.0110  0.0010  0.0336  176 PHE A N   
1607 C  CA  . PHE A 181 ? 0.1075 0.0687 0.1243 0.0039  -0.0053 0.0169  176 PHE A CA  
1608 C  C   . PHE A 181 ? 0.0822 0.0576 0.1067 0.0265  0.0012  0.0209  176 PHE A C   
1609 O  O   . PHE A 181 ? 0.0933 0.0830 0.1128 0.0090  -0.0150 0.0024  176 PHE A O   
1610 C  CB  . PHE A 181 ? 0.1150 0.0487 0.1263 0.0105  0.0103  0.0411  176 PHE A CB  
1611 C  CG  . PHE A 181 ? 0.0983 0.0516 0.1103 0.0203  0.0025  0.0299  176 PHE A CG  
1612 C  CD1 . PHE A 181 ? 0.0989 0.1282 0.0955 0.0336  0.0165  0.0505  176 PHE A CD1 
1613 C  CD2 . PHE A 181 ? 0.1256 0.0818 0.1078 0.0451  0.0159  0.0166  176 PHE A CD2 
1614 C  CE1 . PHE A 181 ? 0.1443 0.0691 0.0921 0.0221  -0.0076 0.0439  176 PHE A CE1 
1615 C  CE2 . PHE A 181 ? 0.1287 0.1423 0.1463 0.0205  0.0456  0.0222  176 PHE A CE2 
1616 C  CZ  . PHE A 181 ? 0.1667 0.1051 0.0827 0.0379  0.0016  0.0119  176 PHE A CZ  
1617 N  N   . SER A 182 ? 0.0838 0.0591 0.1326 0.0124  -0.0157 0.0377  177 SER A N   
1618 C  CA  . SER A 182 ? 0.0918 0.0513 0.1359 0.0243  0.0017  -0.0097 177 SER A CA  
1619 C  C   . SER A 182 ? 0.1118 0.0567 0.1306 0.0158  -0.0044 0.0176  177 SER A C   
1620 O  O   . SER A 182 ? 0.1227 0.0977 0.1290 0.0395  -0.0191 0.0126  177 SER A O   
1621 C  CB  . SER A 182 ? 0.0766 0.0942 0.1568 -0.0011 -0.0208 -0.0007 177 SER A CB  
1622 O  OG  . SER A 182 ? 0.1129 0.0967 0.1525 -0.0111 0.0086  -0.0054 177 SER A OG  
1623 N  N   . VAL A 183 ? 0.1117 0.0544 0.1160 0.0427  -0.0010 0.0167  178 VAL A N   
1624 C  CA  . VAL A 183 ? 0.1355 0.0469 0.1194 0.0420  0.0099  0.0081  178 VAL A CA  
1625 C  C   . VAL A 183 ? 0.1295 0.0648 0.1042 0.0364  0.0003  0.0001  178 VAL A C   
1626 O  O   . VAL A 183 ? 0.1606 0.0822 0.1323 0.0501  -0.0106 -0.0030 178 VAL A O   
1627 C  CB  . VAL A 183 ? 0.1189 0.0517 0.1099 0.0467  0.0117  0.0219  178 VAL A CB  
1628 C  CG1 . VAL A 183 ? 0.1155 0.0661 0.1425 0.0396  0.0431  -0.0202 178 VAL A CG1 
1629 C  CG2 . VAL A 183 ? 0.0990 0.0381 0.2047 0.0280  0.0199  -0.0114 178 VAL A CG2 
1630 N  N   . PHE A 184 ? 0.1322 0.0610 0.1159 0.0202  0.0084  0.0246  179 PHE A N   
1631 C  CA  . PHE A 184 ? 0.1221 0.0631 0.1096 0.0222  -0.0018 0.0051  179 PHE A CA  
1632 C  C   . PHE A 184 ? 0.1281 0.0683 0.1202 0.0440  -0.0021 0.0125  179 PHE A C   
1633 O  O   . PHE A 184 ? 0.1452 0.0779 0.1053 0.0404  0.0048  0.0196  179 PHE A O   
1634 C  CB  . PHE A 184 ? 0.1059 0.0796 0.1021 0.0009  0.0017  0.0066  179 PHE A CB  
1635 C  CG  . PHE A 184 ? 0.0888 0.0623 0.1244 0.0192  0.0027  -0.0087 179 PHE A CG  
1636 C  CD1 . PHE A 184 ? 0.0997 0.1262 0.1409 0.0156  0.0170  -0.0426 179 PHE A CD1 
1637 C  CD2 . PHE A 184 ? 0.1091 0.0579 0.1431 -0.0021 0.0160  0.0137  179 PHE A CD2 
1638 C  CE1 . PHE A 184 ? 0.1638 0.0943 0.0979 0.0230  0.0374  -0.0128 179 PHE A CE1 
1639 C  CE2 . PHE A 184 ? 0.1707 0.1246 0.1145 0.0552  0.0335  -0.0127 179 PHE A CE2 
1640 C  CZ  . PHE A 184 ? 0.2043 0.0348 0.1654 0.0207  0.0084  -0.0304 179 PHE A CZ  
1641 N  N   . HIS A 185 ? 0.1119 0.0705 0.1263 0.0341  -0.0191 0.0314  180 HIS A N   
1642 C  CA  . HIS A 185 ? 0.1265 0.0508 0.1298 0.0282  -0.0139 0.0128  180 HIS A CA  
1643 C  C   . HIS A 185 ? 0.1649 0.0381 0.1363 0.0267  -0.0030 0.0127  180 HIS A C   
1644 O  O   . HIS A 185 ? 0.1805 0.0656 0.1133 0.0225  0.0002  0.0131  180 HIS A O   
1645 C  CB  . HIS A 185 ? 0.1204 0.0339 0.1237 0.0285  0.0020  -0.0007 180 HIS A CB  
1646 C  CG  . HIS A 185 ? 0.1002 0.0632 0.1440 -0.0007 -0.0082 0.0011  180 HIS A CG  
1647 N  ND1 . HIS A 185 ? 0.1215 0.0756 0.1460 0.0179  -0.0142 0.0107  180 HIS A ND1 
1648 C  CD2 . HIS A 185 ? 0.1560 0.0429 0.1889 0.0358  -0.0055 0.0057  180 HIS A CD2 
1649 C  CE1 . HIS A 185 ? 0.0879 0.0907 0.1406 0.0320  0.0113  -0.0573 180 HIS A CE1 
1650 N  NE2 . HIS A 185 ? 0.1156 0.0850 0.1291 0.0355  0.0290  0.0254  180 HIS A NE2 
1651 N  N   . TYR A 186 ? 0.1379 0.0469 0.1366 0.0259  -0.0116 0.0222  181 TYR A N   
1652 C  CA  . TYR A 186 ? 0.1638 0.0364 0.1522 0.0290  -0.0204 0.0025  181 TYR A CA  
1653 C  C   . TYR A 186 ? 0.1820 0.0573 0.1682 0.0428  -0.0291 -0.0119 181 TYR A C   
1654 O  O   . TYR A 186 ? 0.2010 0.0891 0.1757 0.0581  -0.0469 -0.0152 181 TYR A O   
1655 C  CB  . TYR A 186 ? 0.1540 0.0549 0.1340 -0.0070 -0.0196 0.0125  181 TYR A CB  
1656 C  CG  . TYR A 186 ? 0.1914 0.0682 0.1184 -0.0070 -0.0561 0.0091  181 TYR A CG  
1657 C  CD1 . TYR A 186 ? 0.2410 0.1004 0.1558 -0.0208 -0.0566 -0.0007 181 TYR A CD1 
1658 C  CD2 . TYR A 186 ? 0.2062 0.1280 0.1375 -0.0381 -0.0604 0.0416  181 TYR A CD2 
1659 C  CE1 . TYR A 186 ? 0.1749 0.1398 0.1774 -0.0028 -0.0685 -0.0166 181 TYR A CE1 
1660 C  CE2 . TYR A 186 ? 0.1961 0.1228 0.1673 -0.0417 -0.0178 0.0122  181 TYR A CE2 
1661 C  CZ  . TYR A 186 ? 0.2115 0.1349 0.2101 -0.0306 -0.0549 0.0140  181 TYR A CZ  
1662 O  OH  . TYR A 186 ? 0.2774 0.1816 0.2629 -0.0577 -0.0579 -0.0576 181 TYR A OH  
1663 N  N   . GLU A 187 ? 0.2066 0.0814 0.1902 0.0536  -0.0194 -0.0013 182 GLU A N   
1664 C  CA  . GLU A 187 ? 0.2276 0.1216 0.1659 0.0669  -0.0102 -0.0092 182 GLU A CA  
1665 C  C   . GLU A 187 ? 0.2219 0.0886 0.1579 0.0770  -0.0078 -0.0241 182 GLU A C   
1666 O  O   . GLU A 187 ? 0.2675 0.1508 0.1548 0.0782  -0.0115 -0.0622 182 GLU A O   
1667 C  CB  . GLU A 187 ? 0.2640 0.0834 0.2376 0.0758  0.0224  0.0411  182 GLU A CB  
1668 C  CG  . GLU A 187 ? 0.3362 0.2858 0.2676 0.0435  -0.0007 0.0376  182 GLU A CG  
1669 C  CD  . GLU A 187 ? 0.2727 0.3527 0.1916 -0.0318 -0.0253 0.0071  182 GLU A CD  
1670 O  OE1 . GLU A 187 ? 0.2922 0.1776 0.1460 -0.0829 -0.0666 0.0264  182 GLU A OE1 
1671 O  OE2 . GLU A 187 ? 0.2152 0.3577 0.2373 0.0097  -0.0307 -0.0297 182 GLU A OE2 
1672 N  N   . ILE A 188 ? 0.1988 0.1103 0.1198 0.0539  -0.0057 0.0114  183 ILE A N   
1673 C  CA  . ILE A 188 ? 0.2027 0.0866 0.1316 0.0792  -0.0184 0.0166  183 ILE A CA  
1674 C  C   . ILE A 188 ? 0.2199 0.1086 0.1361 0.0680  0.0002  0.0032  183 ILE A C   
1675 O  O   . ILE A 188 ? 0.2308 0.1586 0.1544 0.0915  0.0064  0.0276  183 ILE A O   
1676 C  CB  . ILE A 188 ? 0.1861 0.1020 0.1365 0.0683  -0.0237 0.0190  183 ILE A CB  
1677 C  CG1 . ILE A 188 ? 0.2494 0.0764 0.1516 0.0577  -0.0143 0.0059  183 ILE A CG1 
1678 C  CG2 . ILE A 188 ? 0.1749 0.1074 0.1380 0.0710  0.0062  0.0337  183 ILE A CG2 
1679 C  CD1 . ILE A 188 ? 0.3239 0.1556 0.1706 0.1309  -0.0710 0.0655  183 ILE A CD1 
1680 N  N   . ALA A 189 ? 0.1859 0.0763 0.1230 0.0730  -0.0301 0.0073  184 ALA A N   
1681 C  CA  . ALA A 189 ? 0.1993 0.0910 0.1356 0.0535  -0.0108 0.0038  184 ALA A CA  
1682 C  C   . ALA A 189 ? 0.2047 0.1015 0.1220 0.0662  -0.0164 0.0060  184 ALA A C   
1683 O  O   . ALA A 189 ? 0.2256 0.1571 0.1663 0.0131  -0.0188 0.0196  184 ALA A O   
1684 C  CB  . ALA A 189 ? 0.2184 0.0938 0.1831 0.0634  -0.0074 0.0017  184 ALA A CB  
1685 N  N   . ASN A 190 ? 0.2121 0.1104 0.1160 0.0759  -0.0208 0.0030  185 ASN A N   
1686 C  CA  . ASN A 190 ? 0.2100 0.1430 0.1294 0.0800  -0.0190 -0.0089 185 ASN A CA  
1687 C  C   . ASN A 190 ? 0.2009 0.1496 0.1040 0.0897  -0.0253 -0.0063 185 ASN A C   
1688 O  O   . ASN A 190 ? 0.2257 0.1687 0.1205 0.0891  -0.0236 -0.0031 185 ASN A O   
1689 C  CB  . ASN A 190 ? 0.2449 0.1827 0.1312 0.0788  -0.0257 -0.0216 185 ASN A CB  
1690 C  CG  . ASN A 190 ? 0.2749 0.2217 0.2079 0.0460  -0.0056 -0.0327 185 ASN A CG  
1691 O  OD1 . ASN A 190 ? 0.3622 0.3386 0.3264 -0.0294 0.0210  -0.0114 185 ASN A OD1 
1692 N  ND2 . ASN A 190 ? 0.3399 0.2575 0.2370 0.0629  0.0300  0.0174  185 ASN A ND2 
1693 N  N   . SER A 191 ? 0.1626 0.1281 0.1158 0.0713  -0.0137 -0.0211 186 SER A N   
1694 C  CA  . SER A 191 ? 0.1571 0.1011 0.1118 0.0511  -0.0167 0.0005  186 SER A CA  
1695 C  C   . SER A 191 ? 0.1539 0.1065 0.1241 0.0309  -0.0207 -0.0087 186 SER A C   
1696 O  O   . SER A 191 ? 0.1390 0.1131 0.1138 0.0050  -0.0068 -0.0053 186 SER A O   
1697 C  CB  . SER A 191 ? 0.1662 0.1281 0.0981 0.0327  -0.0065 -0.0247 186 SER A CB  
1698 O  OG  . SER A 191 ? 0.1835 0.1547 0.1838 0.0360  0.0158  -0.0266 186 SER A OG  
1699 N  N   . PRO A 192 ? 0.1641 0.1138 0.1405 0.0083  -0.0159 -0.0039 187 PRO A N   
1700 C  CA  . PRO A 192 ? 0.1292 0.0970 0.1615 0.0229  -0.0192 -0.0032 187 PRO A CA  
1701 C  C   . PRO A 192 ? 0.1260 0.0971 0.1515 0.0082  -0.0102 0.0035  187 PRO A C   
1702 O  O   . PRO A 192 ? 0.1010 0.1251 0.1667 -0.0090 -0.0124 -0.0029 187 PRO A O   
1703 C  CB  . PRO A 192 ? 0.1681 0.1063 0.1572 0.0063  -0.0043 -0.0156 187 PRO A CB  
1704 C  CG  . PRO A 192 ? 0.1743 0.1308 0.1657 -0.0025 0.0204  0.0095  187 PRO A CG  
1705 C  CD  . PRO A 192 ? 0.1813 0.1276 0.1470 0.0275  -0.0429 -0.0036 187 PRO A CD  
1706 N  N   . GLU A 193 ? 0.1156 0.1082 0.1523 0.0138  -0.0268 0.0135  188 GLU A N   
1707 C  CA  . GLU A 193 ? 0.1204 0.0956 0.1341 0.0366  -0.0243 0.0235  188 GLU A CA  
1708 C  C   . GLU A 193 ? 0.1019 0.1271 0.1191 0.0266  -0.0215 0.0171  188 GLU A C   
1709 O  O   . GLU A 193 ? 0.1154 0.1016 0.1260 0.0396  0.0036  0.0216  188 GLU A O   
1710 C  CB  . GLU A 193 ? 0.1602 0.1103 0.1125 0.0090  -0.0486 0.0151  188 GLU A CB  
1711 C  CG  . GLU A 193 ? 0.1759 0.1753 0.1441 0.0405  -0.0647 0.0152  188 GLU A CG  
1712 C  CD  . GLU A 193 ? 0.2056 0.2798 0.1754 0.0455  -0.0436 0.0287  188 GLU A CD  
1713 O  OE1 . GLU A 193 ? 0.2163 0.3794 0.2551 0.0381  -0.0351 0.0319  188 GLU A OE1 
1714 O  OE2 . GLU A 193 ? 0.2120 0.3392 0.2594 -0.0024 -0.0390 -0.0160 188 GLU A OE2 
1715 N  N   . GLU A 194 ? 0.1348 0.1071 0.1272 0.0030  -0.0183 0.0347  189 GLU A N   
1716 C  CA  . GLU A 194 ? 0.1227 0.0832 0.1354 0.0048  -0.0149 0.0078  189 GLU A CA  
1717 C  C   . GLU A 194 ? 0.1261 0.0443 0.1205 0.0116  -0.0211 0.0114  189 GLU A C   
1718 O  O   . GLU A 194 ? 0.1391 0.0738 0.1582 0.0195  -0.0018 0.0062  189 GLU A O   
1719 C  CB  . GLU A 194 ? 0.1020 0.0788 0.1563 -0.0133 -0.0203 0.0027  189 GLU A CB  
1720 C  CG  . GLU A 194 ? 0.1775 0.0431 0.1418 0.0276  -0.0260 0.0147  189 GLU A CG  
1721 C  CD  . GLU A 194 ? 0.2410 0.0305 0.1668 -0.0058 -0.0520 0.0268  189 GLU A CD  
1722 O  OE1 . GLU A 194 ? 0.2305 0.1092 0.2084 0.0118  -0.0751 -0.0071 189 GLU A OE1 
1723 O  OE2 . GLU A 194 ? 0.1674 0.1025 0.1799 0.0184  -0.0315 0.0389  189 GLU A OE2 
1724 N  N   . ALA A 195 ? 0.1096 0.0478 0.1362 0.0005  -0.0178 0.0296  190 ALA A N   
1725 C  CA  . ALA A 195 ? 0.1178 0.0293 0.1032 0.0192  -0.0016 0.0008  190 ALA A CA  
1726 C  C   . ALA A 195 ? 0.1119 0.0635 0.1068 0.0038  -0.0203 -0.0176 190 ALA A C   
1727 O  O   . ALA A 195 ? 0.1292 0.0958 0.1132 0.0110  -0.0061 -0.0097 190 ALA A O   
1728 C  CB  . ALA A 195 ? 0.1445 0.0265 0.1459 -0.0024 -0.0308 -0.0108 190 ALA A CB  
1729 N  N   . ILE A 196 ? 0.0898 0.0768 0.1214 0.0218  -0.0089 -0.0034 191 ILE A N   
1730 C  CA  . ILE A 196 ? 0.1215 0.1165 0.1381 0.0269  -0.0247 -0.0146 191 ILE A CA  
1731 C  C   . ILE A 196 ? 0.1185 0.1077 0.1255 0.0145  -0.0129 -0.0204 191 ILE A C   
1732 O  O   . ILE A 196 ? 0.1227 0.1281 0.1171 0.0244  0.0100  0.0072  191 ILE A O   
1733 C  CB  . ILE A 196 ? 0.1179 0.1218 0.1456 0.0310  -0.0196 -0.0291 191 ILE A CB  
1734 C  CG1 . ILE A 196 ? 0.1809 0.1173 0.1450 -0.0352 -0.0241 -0.0213 191 ILE A CG1 
1735 C  CG2 . ILE A 196 ? 0.1175 0.1873 0.1317 0.0108  -0.0462 0.0097  191 ILE A CG2 
1736 C  CD1 . ILE A 196 ? 0.1567 0.1920 0.1270 -0.0006 -0.0186 -0.0403 191 ILE A CD1 
1737 N  N   . SER A 197 ? 0.1284 0.0718 0.1228 0.0153  0.0026  -0.0098 192 SER A N   
1738 C  CA  A SER A 197 ? 0.1356 0.0995 0.1328 0.0253  -0.0008 -0.0062 192 SER A CA  
1739 C  CA  B SER A 197 ? 0.1422 0.0894 0.1334 0.0185  0.0038  -0.0053 192 SER A CA  
1740 C  C   . SER A 197 ? 0.1320 0.1027 0.1347 0.0267  0.0112  -0.0082 192 SER A C   
1741 O  O   . SER A 197 ? 0.1246 0.1065 0.1270 0.0252  0.0209  -0.0094 192 SER A O   
1742 C  CB  A SER A 197 ? 0.1479 0.0894 0.1381 0.0208  0.0000  -0.0042 192 SER A CB  
1743 C  CB  B SER A 197 ? 0.1561 0.0733 0.1385 0.0118  0.0018  -0.0040 192 SER A CB  
1744 O  OG  A SER A 197 ? 0.1871 0.1341 0.1653 0.0599  -0.0046 -0.0211 192 SER A OG  
1745 O  OG  B SER A 197 ? 0.2352 0.0580 0.1825 0.0166  0.0291  -0.0107 192 SER A OG  
1746 N  N   . LEU A 198 ? 0.1107 0.0952 0.1358 0.0224  -0.0176 0.0082  193 LEU A N   
1747 C  CA  A LEU A 198 ? 0.0945 0.0854 0.1245 0.0207  0.0092  0.0099  193 LEU A CA  
1748 C  CA  B LEU A 198 ? 0.1182 0.0862 0.1312 0.0222  0.0079  0.0055  193 LEU A CA  
1749 C  C   . LEU A 198 ? 0.1140 0.0830 0.1291 0.0196  0.0100  0.0027  193 LEU A C   
1750 O  O   . LEU A 198 ? 0.1349 0.0826 0.1362 0.0282  0.0353  0.0213  193 LEU A O   
1751 C  CB  A LEU A 198 ? 0.0590 0.0984 0.1340 0.0087  -0.0005 0.0089  193 LEU A CB  
1752 C  CB  B LEU A 198 ? 0.1081 0.0941 0.1443 0.0187  0.0022  0.0027  193 LEU A CB  
1753 C  CG  A LEU A 198 ? 0.0799 0.0826 0.0926 -0.0071 0.0332  0.0470  193 LEU A CG  
1754 C  CG  B LEU A 198 ? 0.1787 0.0764 0.1289 0.0114  0.0160  0.0070  193 LEU A CG  
1755 C  CD1 A LEU A 198 ? 0.1339 0.0869 0.0985 0.0041  0.0437  0.0601  193 LEU A CD1 
1756 C  CD1 B LEU A 198 ? 0.2655 0.0996 0.1375 0.0450  0.0434  -0.0191 193 LEU A CD1 
1757 C  CD2 A LEU A 198 ? 0.0384 0.0557 0.0555 0.0179  -0.0002 0.0129  193 LEU A CD2 
1758 C  CD2 B LEU A 198 ? 0.2321 0.0555 0.1703 0.0277  0.0152  -0.0122 193 LEU A CD2 
1759 N  N   . ALA A 199 ? 0.1112 0.0729 0.1410 0.0239  0.0255  0.0216  194 ALA A N   
1760 C  CA  . ALA A 199 ? 0.1343 0.0792 0.1496 0.0222  0.0167  0.0101  194 ALA A CA  
1761 C  C   . ALA A 199 ? 0.1236 0.0932 0.1369 0.0365  0.0027  -0.0026 194 ALA A C   
1762 O  O   . ALA A 199 ? 0.1239 0.0889 0.1485 0.0225  0.0035  0.0138  194 ALA A O   
1763 C  CB  . ALA A 199 ? 0.1790 0.0934 0.1651 0.0198  0.0191  -0.0037 194 ALA A CB  
1764 N  N   . LYS A 200 ? 0.1080 0.1132 0.1454 0.0469  -0.0105 -0.0003 195 LYS A N   
1765 C  CA  A LYS A 200 ? 0.1271 0.1290 0.1519 0.0356  -0.0110 -0.0090 195 LYS A CA  
1766 C  CA  B LYS A 200 ? 0.1105 0.1310 0.1395 0.0408  -0.0137 -0.0106 195 LYS A CA  
1767 C  C   . LYS A 200 ? 0.0909 0.1311 0.1507 0.0310  -0.0047 0.0049  195 LYS A C   
1768 O  O   . LYS A 200 ? 0.1276 0.1594 0.1661 0.0199  -0.0061 -0.0089 195 LYS A O   
1769 C  CB  A LYS A 200 ? 0.1355 0.1297 0.1754 0.0334  -0.0296 -0.0010 195 LYS A CB  
1770 C  CB  B LYS A 200 ? 0.1052 0.1498 0.1578 0.0400  -0.0340 -0.0022 195 LYS A CB  
1771 C  CG  A LYS A 200 ? 0.2247 0.1568 0.2204 0.0107  -0.0400 -0.0429 195 LYS A CG  
1772 C  CG  B LYS A 200 ? 0.1055 0.1314 0.1687 0.0671  -0.0660 -0.0501 195 LYS A CG  
1773 C  CD  A LYS A 200 ? 0.2232 0.2310 0.2505 0.0720  -0.0811 -0.0328 195 LYS A CD  
1774 C  CD  B LYS A 200 ? 0.2334 0.2707 0.1940 0.0559  -0.0866 0.0029  195 LYS A CD  
1775 C  CE  A LYS A 200 ? 0.2902 0.2578 0.3403 0.0414  -0.0397 -0.0554 195 LYS A CE  
1776 C  CE  B LYS A 200 ? 0.2211 0.3531 0.2174 0.0764  -0.1033 0.0106  195 LYS A CE  
1777 N  NZ  A LYS A 200 ? 0.3519 0.2691 0.3520 0.1032  -0.0290 -0.0574 195 LYS A NZ  
1778 N  NZ  B LYS A 200 ? 0.2189 0.3809 0.1913 0.0498  -0.1141 0.0370  195 LYS A NZ  
1779 N  N   . THR A 201 ? 0.1040 0.1396 0.1135 0.0267  -0.0042 0.0206  196 THR A N   
1780 C  CA  A THR A 201 ? 0.1108 0.1448 0.1250 0.0207  0.0029  0.0272  196 THR A CA  
1781 C  CA  B THR A 201 ? 0.0994 0.1334 0.1200 0.0216  -0.0054 0.0221  196 THR A CA  
1782 C  C   . THR A 201 ? 0.1037 0.1300 0.1195 0.0223  -0.0015 0.0155  196 THR A C   
1783 O  O   . THR A 201 ? 0.1117 0.1480 0.1430 0.0349  -0.0091 0.0127  196 THR A O   
1784 C  CB  A THR A 201 ? 0.1131 0.1634 0.1454 0.0184  0.0040  0.0239  196 THR A CB  
1785 C  CB  B THR A 201 ? 0.0938 0.1519 0.1260 0.0193  -0.0066 0.0158  196 THR A CB  
1786 O  OG1 A THR A 201 ? 0.1958 0.2568 0.1556 -0.0031 0.0079  0.0607  196 THR A OG1 
1787 O  OG1 B THR A 201 ? 0.0798 0.0683 0.1342 0.0134  -0.0158 0.0476  196 THR A OG1 
1788 C  CG2 A THR A 201 ? 0.0999 0.1298 0.1624 0.0202  0.0307  0.0406  196 THR A CG2 
1789 C  CG2 B THR A 201 ? 0.1276 0.1822 0.1319 0.0100  -0.0146 0.0304  196 THR A CG2 
1790 N  N   . THR A 202 ? 0.0964 0.1347 0.1082 0.0262  -0.0097 0.0094  197 THR A N   
1791 C  CA  . THR A 202 ? 0.1111 0.1269 0.1192 0.0313  0.0009  0.0151  197 THR A CA  
1792 C  C   . THR A 202 ? 0.1071 0.1315 0.1428 0.0182  0.0022  0.0022  197 THR A C   
1793 O  O   . THR A 202 ? 0.1199 0.1241 0.1165 0.0406  0.0093  0.0090  197 THR A O   
1794 C  CB  . THR A 202 ? 0.1003 0.1244 0.1262 0.0198  -0.0089 0.0076  197 THR A CB  
1795 O  OG1 . THR A 202 ? 0.1257 0.1520 0.1332 0.0159  0.0148  0.0014  197 THR A OG1 
1796 C  CG2 . THR A 202 ? 0.0853 0.1380 0.1075 0.0147  -0.0168 0.0256  197 THR A CG2 
1797 N  N   . PHE A 203 ? 0.1108 0.0970 0.1395 0.0115  0.0135  -0.0025 198 PHE A N   
1798 C  CA  . PHE A 203 ? 0.0897 0.1140 0.1515 0.0108  0.0164  -0.0040 198 PHE A CA  
1799 C  C   . PHE A 203 ? 0.1024 0.1291 0.1518 0.0105  0.0260  0.0095  198 PHE A C   
1800 O  O   . PHE A 203 ? 0.1304 0.1704 0.1686 0.0251  0.0243  0.0083  198 PHE A O   
1801 C  CB  . PHE A 203 ? 0.0910 0.1031 0.1591 -0.0183 0.0242  0.0119  198 PHE A CB  
1802 C  CG  . PHE A 203 ? 0.1147 0.1649 0.1306 0.0105  0.0341  0.0077  198 PHE A CG  
1803 C  CD1 . PHE A 203 ? 0.1273 0.2106 0.1917 -0.0151 0.0354  0.0113  198 PHE A CD1 
1804 C  CD2 . PHE A 203 ? 0.1440 0.1091 0.1918 -0.0166 0.0685  0.0163  198 PHE A CD2 
1805 C  CE1 . PHE A 203 ? 0.1229 0.2343 0.2771 0.0294  0.0478  0.0628  198 PHE A CE1 
1806 C  CE2 . PHE A 203 ? 0.0901 0.1976 0.2676 -0.0034 0.0245  -0.0029 198 PHE A CE2 
1807 C  CZ  . PHE A 203 ? 0.1573 0.1550 0.2538 0.0257  -0.0233 0.0096  198 PHE A CZ  
1808 N  N   . ASP A 204 ? 0.1385 0.1551 0.1624 0.0226  0.0199  0.0081  199 ASP A N   
1809 C  CA  . ASP A 204 ? 0.1975 0.1407 0.1558 0.0380  0.0162  -0.0038 199 ASP A CA  
1810 C  C   . ASP A 204 ? 0.2064 0.1435 0.1471 0.0312  0.0230  0.0006  199 ASP A C   
1811 O  O   . ASP A 204 ? 0.2336 0.1346 0.1598 0.0367  0.0147  -0.0075 199 ASP A O   
1812 C  CB  . ASP A 204 ? 0.2170 0.1710 0.1511 0.0484  0.0189  -0.0048 199 ASP A CB  
1813 C  CG  . ASP A 204 ? 0.2243 0.1802 0.2151 0.0057  0.0140  0.0345  199 ASP A CG  
1814 O  OD1 . ASP A 204 ? 0.2699 0.2366 0.2330 -0.0205 -0.0277 0.0812  199 ASP A OD1 
1815 O  OD2 . ASP A 204 ? 0.2233 0.2483 0.2427 0.0329  -0.0206 0.0128  199 ASP A OD2 
1816 N  N   . GLU A 205 ? 0.2197 0.1291 0.1284 0.0165  0.0037  -0.0072 200 GLU A N   
1817 C  CA  . GLU A 205 ? 0.2204 0.1571 0.1281 0.0268  0.0022  0.0146  200 GLU A CA  
1818 C  C   . GLU A 205 ? 0.2043 0.1411 0.1338 0.0471  0.0019  0.0028  200 GLU A C   
1819 O  O   . GLU A 205 ? 0.2252 0.1242 0.1459 0.0418  0.0133  -0.0055 200 GLU A O   
1820 C  CB  . GLU A 205 ? 0.2303 0.1866 0.1274 0.0153  -0.0161 0.0408  200 GLU A CB  
1821 C  CG  . GLU A 205 ? 0.3039 0.2752 0.1904 0.0427  -0.0247 0.0931  200 GLU A CG  
1822 C  CD  . GLU A 205 ? 0.4271 0.4051 0.2543 0.0751  0.0112  0.0811  200 GLU A CD  
1823 O  OE1 . GLU A 205 ? 0.5559 0.3733 0.2700 0.1035  0.0403  0.0717  200 GLU A OE1 
1824 O  OE2 . GLU A 205 ? 0.4055 0.3795 0.3453 0.0745  -0.0121 0.1414  200 GLU A OE2 
1825 N  N   . ALA A 206 ? 0.1591 0.1118 0.1402 0.0594  0.0087  0.0089  201 ALA A N   
1826 C  CA  . ALA A 206 ? 0.1215 0.1098 0.1417 0.0800  0.0050  0.0054  201 ALA A CA  
1827 C  C   . ALA A 206 ? 0.1380 0.1424 0.1624 0.0692  0.0018  -0.0087 201 ALA A C   
1828 O  O   . ALA A 206 ? 0.1028 0.1224 0.1580 0.0810  0.0159  -0.0001 201 ALA A O   
1829 C  CB  . ALA A 206 ? 0.1319 0.1142 0.1305 0.0923  -0.0107 0.0185  201 ALA A CB  
1830 N  N   . MET A 207 ? 0.1069 0.1430 0.1781 0.0769  -0.0060 0.0005  202 MET A N   
1831 C  CA  A MET A 207 ? 0.1235 0.1694 0.1782 0.0612  -0.0145 -0.0096 202 MET A CA  
1832 C  CA  B MET A 207 ? 0.1225 0.1525 0.1872 0.0600  -0.0119 -0.0058 202 MET A CA  
1833 C  C   . MET A 207 ? 0.1400 0.1674 0.1826 0.0704  -0.0081 -0.0027 202 MET A C   
1834 O  O   . MET A 207 ? 0.1377 0.1612 0.1775 0.0618  -0.0238 -0.0152 202 MET A O   
1835 C  CB  A MET A 207 ? 0.1555 0.1920 0.1764 0.0494  -0.0062 -0.0219 202 MET A CB  
1836 C  CB  B MET A 207 ? 0.1391 0.1670 0.1924 0.0525  -0.0048 -0.0175 202 MET A CB  
1837 C  CG  A MET A 207 ? 0.1471 0.3014 0.2063 0.0468  -0.0351 -0.0497 202 MET A CG  
1838 C  CG  B MET A 207 ? 0.1465 0.1612 0.2629 0.0476  -0.0161 -0.0204 202 MET A CG  
1839 S  SD  A MET A 207 ? 0.2666 0.3839 0.2081 0.0107  -0.0372 -0.0812 202 MET A SD  
1840 S  SD  B MET A 207 ? 0.1129 0.2656 0.3513 0.0200  -0.0100 -0.0382 202 MET A SD  
1841 C  CE  A MET A 207 ? 0.2091 0.4216 0.2979 -0.0127 -0.0596 -0.1107 202 MET A CE  
1842 C  CE  B MET A 207 ? 0.0639 0.1782 0.4051 0.0059  -0.0860 -0.1725 202 MET A CE  
1843 N  N   . ALA A 208 ? 0.1535 0.1488 0.1610 0.0707  -0.0383 0.0071  203 ALA A N   
1844 C  CA  . ALA A 208 ? 0.1515 0.1622 0.1743 0.0737  -0.0232 0.0132  203 ALA A CA  
1845 C  C   . ALA A 208 ? 0.1508 0.1584 0.1700 0.0751  -0.0185 -0.0018 203 ALA A C   
1846 O  O   . ALA A 208 ? 0.1515 0.1336 0.2131 0.0730  -0.0222 -0.0322 203 ALA A O   
1847 C  CB  . ALA A 208 ? 0.2092 0.1880 0.1977 0.0568  -0.0320 0.0252  203 ALA A CB  
1848 N  N   . ASP A 209 ? 0.1220 0.1728 0.1795 0.0788  -0.0221 -0.0063 204 ASP A N   
1849 C  CA  A ASP A 209 ? 0.1340 0.1987 0.1754 0.0603  -0.0124 0.0000  204 ASP A CA  
1850 C  CA  B ASP A 209 ? 0.1282 0.1909 0.1858 0.0534  -0.0174 0.0013  204 ASP A CA  
1851 C  C   . ASP A 209 ? 0.1404 0.1958 0.1782 0.0503  -0.0136 -0.0023 204 ASP A C   
1852 O  O   . ASP A 209 ? 0.1338 0.1923 0.1845 0.0512  -0.0104 0.0086  204 ASP A O   
1853 C  CB  A ASP A 209 ? 0.1263 0.2270 0.1976 0.0721  -0.0030 -0.0052 204 ASP A CB  
1854 C  CB  B ASP A 209 ? 0.1277 0.2005 0.2130 0.0502  -0.0113 -0.0038 204 ASP A CB  
1855 C  CG  A ASP A 209 ? 0.1563 0.2223 0.1968 0.0736  0.0076  0.0078  204 ASP A CG  
1856 C  CG  B ASP A 209 ? 0.1299 0.2259 0.2739 0.0247  -0.0150 0.0102  204 ASP A CG  
1857 O  OD1 A ASP A 209 ? 0.1958 0.2587 0.2599 0.0391  0.0557  0.0322  204 ASP A OD1 
1858 O  OD1 B ASP A 209 ? 0.1333 0.1890 0.3818 -0.0089 0.0250  0.0687  204 ASP A OD1 
1859 O  OD2 A ASP A 209 ? 0.1131 0.1743 0.2717 0.0513  0.0525  0.0493  204 ASP A OD2 
1860 O  OD2 B ASP A 209 ? 0.1630 0.2302 0.3207 0.0044  0.0101  -0.0485 204 ASP A OD2 
1861 N  N   . LEU A 210 ? 0.1362 0.1646 0.1420 0.0437  -0.0017 0.0081  205 LEU A N   
1862 C  CA  . LEU A 210 ? 0.1753 0.2075 0.1325 0.0302  -0.0033 -0.0077 205 LEU A CA  
1863 C  C   . LEU A 210 ? 0.1234 0.2242 0.1275 0.0311  0.0003  -0.0060 205 LEU A C   
1864 O  O   . LEU A 210 ? 0.1393 0.2401 0.1356 0.0090  -0.0020 0.0275  205 LEU A O   
1865 C  CB  . LEU A 210 ? 0.1768 0.1824 0.1305 0.0201  0.0205  -0.0126 205 LEU A CB  
1866 C  CG  . LEU A 210 ? 0.1785 0.2125 0.1245 0.0357  0.0040  -0.0180 205 LEU A CG  
1867 C  CD1 . LEU A 210 ? 0.2220 0.2101 0.1712 -0.0149 -0.0297 -0.0360 205 LEU A CD1 
1868 C  CD2 . LEU A 210 ? 0.1861 0.2270 0.1911 0.0265  -0.0558 0.0037  205 LEU A CD2 
1869 N  N   . HIS A 211 ? 0.1464 0.2380 0.1445 0.0392  -0.0108 -0.0144 206 HIS A N   
1870 C  CA  . HIS A 211 ? 0.1413 0.2560 0.1783 0.0430  -0.0391 -0.0316 206 HIS A CA  
1871 C  C   . HIS A 211 ? 0.1612 0.2774 0.1987 0.0447  -0.0316 -0.0392 206 HIS A C   
1872 O  O   . HIS A 211 ? 0.1746 0.3058 0.1979 0.0375  -0.0374 -0.0528 206 HIS A O   
1873 C  CB  . HIS A 211 ? 0.1459 0.2368 0.1982 0.0566  -0.0194 -0.0214 206 HIS A CB  
1874 C  CG  . HIS A 211 ? 0.1932 0.2742 0.2277 0.0576  -0.0441 0.0064  206 HIS A CG  
1875 N  ND1 . HIS A 211 ? 0.2206 0.3338 0.2306 0.0472  -0.0322 -0.0262 206 HIS A ND1 
1876 C  CD2 . HIS A 211 ? 0.1797 0.2262 0.1963 0.0788  -0.0328 -0.0075 206 HIS A CD2 
1877 C  CE1 . HIS A 211 ? 0.2525 0.2720 0.1950 0.0682  -0.0504 -0.0102 206 HIS A CE1 
1878 N  NE2 . HIS A 211 ? 0.2678 0.2901 0.2773 0.0740  0.0071  0.0032  206 HIS A NE2 
1879 N  N   . THR A 212 ? 0.1493 0.2379 0.2044 0.0427  -0.0447 -0.0365 207 THR A N   
1880 C  CA  . THR A 212 ? 0.1646 0.2425 0.2093 0.0535  -0.0369 -0.0261 207 THR A CA  
1881 C  C   . THR A 212 ? 0.1611 0.2662 0.1782 0.0563  -0.0219 -0.0334 207 THR A C   
1882 O  O   . THR A 212 ? 0.1942 0.2764 0.2136 0.0488  -0.0285 -0.0576 207 THR A O   
1883 C  CB  . THR A 212 ? 0.1191 0.2104 0.1980 0.0645  -0.0299 -0.0409 207 THR A CB  
1884 O  OG1 . THR A 212 ? 0.1556 0.2214 0.2232 0.0749  -0.0272 -0.0507 207 THR A OG1 
1885 C  CG2 . THR A 212 ? 0.1859 0.1973 0.2519 0.0538  -0.0628 0.0090  207 THR A CG2 
1886 N  N   . LEU A 213 ? 0.1532 0.2659 0.1833 0.0452  -0.0042 -0.0191 208 LEU A N   
1887 C  CA  . LEU A 213 ? 0.1378 0.2785 0.1734 0.0452  0.0011  -0.0120 208 LEU A CA  
1888 C  C   . LEU A 213 ? 0.1602 0.2966 0.1932 0.0448  0.0013  -0.0085 208 LEU A C   
1889 O  O   . LEU A 213 ? 0.1602 0.3437 0.2127 0.0361  -0.0263 0.0092  208 LEU A O   
1890 C  CB  . LEU A 213 ? 0.1484 0.2671 0.1787 0.0216  0.0081  -0.0245 208 LEU A CB  
1891 C  CG  . LEU A 213 ? 0.1192 0.2492 0.1592 0.0418  -0.0248 -0.0551 208 LEU A CG  
1892 C  CD1 . LEU A 213 ? 0.2591 0.1988 0.1514 0.1205  0.0103  -0.0237 208 LEU A CD1 
1893 C  CD2 . LEU A 213 ? 0.1344 0.1912 0.2220 0.0505  -0.0532 -0.0491 208 LEU A CD2 
1894 N  N   . SER A 214 ? 0.1652 0.2812 0.1810 0.0512  -0.0055 -0.0125 209 SER A N   
1895 C  CA  . SER A 214 ? 0.1963 0.2751 0.2353 0.0151  0.0163  -0.0135 209 SER A CA  
1896 C  C   . SER A 214 ? 0.2532 0.2881 0.2558 0.0117  0.0197  -0.0203 209 SER A C   
1897 O  O   . SER A 214 ? 0.2519 0.2596 0.2923 -0.0080 0.0417  -0.0231 209 SER A O   
1898 C  CB  . SER A 214 ? 0.2306 0.2790 0.2217 0.0421  0.0084  -0.0044 209 SER A CB  
1899 O  OG  . SER A 214 ? 0.2237 0.3465 0.2942 0.0326  0.0047  -0.0354 209 SER A OG  
1900 N  N   . GLU A 215 ? 0.2666 0.2966 0.2737 0.0012  0.0197  -0.0143 210 GLU A N   
1901 C  CA  . GLU A 215 ? 0.2938 0.3002 0.2881 0.0133  0.0003  -0.0207 210 GLU A CA  
1902 C  C   . GLU A 215 ? 0.3216 0.3254 0.2919 0.0243  -0.0226 -0.0237 210 GLU A C   
1903 O  O   . GLU A 215 ? 0.3215 0.3050 0.2606 0.0352  -0.0506 -0.0409 210 GLU A O   
1904 C  CB  . GLU A 215 ? 0.3183 0.3367 0.2894 -0.0030 0.0061  -0.0195 210 GLU A CB  
1905 N  N   . ASP A 216 ? 0.3190 0.3407 0.2839 0.0327  -0.0383 -0.0121 211 ASP A N   
1906 C  CA  . ASP A 216 ? 0.3014 0.3319 0.2635 0.0376  -0.0274 -0.0243 211 ASP A CA  
1907 C  C   . ASP A 216 ? 0.2976 0.3056 0.2914 0.0350  -0.0258 -0.0181 211 ASP A C   
1908 O  O   . ASP A 216 ? 0.2614 0.2706 0.2666 0.0529  -0.0414 -0.0482 211 ASP A O   
1909 C  CB  . ASP A 216 ? 0.3288 0.3587 0.3019 0.0343  -0.0407 -0.0109 211 ASP A CB  
1910 N  N   . SER A 217 ? 0.2908 0.3279 0.2996 0.0261  -0.0225 -0.0090 212 SER A N   
1911 C  CA  . SER A 217 ? 0.2598 0.3023 0.2747 0.0137  -0.0160 -0.0242 212 SER A CA  
1912 C  C   . SER A 217 ? 0.2337 0.2764 0.2759 0.0244  -0.0157 -0.0200 212 SER A C   
1913 O  O   . SER A 217 ? 0.2194 0.2288 0.2640 0.0009  0.0065  -0.0346 212 SER A O   
1914 C  CB  . SER A 217 ? 0.2730 0.2785 0.2819 0.0264  -0.0371 0.0029  212 SER A CB  
1915 O  OG  . SER A 217 ? 0.3115 0.3438 0.3491 0.0025  -0.0562 -0.0173 212 SER A OG  
1916 N  N   . TYR A 218 ? 0.2277 0.2631 0.2687 0.0268  -0.0186 -0.0158 213 TYR A N   
1917 C  CA  A TYR A 218 ? 0.2263 0.2747 0.2732 0.0380  -0.0198 -0.0091 213 TYR A CA  
1918 C  CA  B TYR A 218 ? 0.2251 0.2855 0.2719 0.0436  -0.0207 -0.0160 213 TYR A CA  
1919 C  C   . TYR A 218 ? 0.2471 0.2897 0.2697 0.0459  -0.0138 -0.0215 213 TYR A C   
1920 O  O   . TYR A 218 ? 0.2647 0.3385 0.2768 0.0494  -0.0215 -0.0067 213 TYR A O   
1921 C  CB  A TYR A 218 ? 0.2085 0.2836 0.2661 0.0339  -0.0169 -0.0083 213 TYR A CB  
1922 C  CB  B TYR A 218 ? 0.2069 0.3062 0.2621 0.0453  -0.0209 -0.0178 213 TYR A CB  
1923 C  CG  A TYR A 218 ? 0.1641 0.2428 0.2458 0.0201  -0.0137 0.0011  213 TYR A CG  
1924 C  CG  B TYR A 218 ? 0.1561 0.3105 0.2360 0.0521  -0.0162 -0.0445 213 TYR A CG  
1925 C  CD1 A TYR A 218 ? 0.1255 0.1986 0.2418 0.0215  0.0228  0.0053  213 TYR A CD1 
1926 C  CD1 B TYR A 218 ? 0.1249 0.3633 0.2311 0.0565  -0.0338 -0.0327 213 TYR A CD1 
1927 C  CD2 A TYR A 218 ? 0.1466 0.2505 0.2599 -0.0013 -0.0235 0.0229  213 TYR A CD2 
1928 C  CD2 B TYR A 218 ? 0.1465 0.3606 0.2563 0.0545  -0.0107 -0.0505 213 TYR A CD2 
1929 C  CE1 A TYR A 218 ? 0.1282 0.2654 0.2229 -0.0053 -0.0058 0.0225  213 TYR A CE1 
1930 C  CE1 B TYR A 218 ? 0.1577 0.3917 0.2079 0.0219  -0.0545 -0.0850 213 TYR A CE1 
1931 C  CE2 A TYR A 218 ? 0.1604 0.2637 0.2530 0.0041  -0.0327 0.0316  213 TYR A CE2 
1932 C  CE2 B TYR A 218 ? 0.1754 0.3957 0.2532 0.0323  -0.0359 -0.0791 213 TYR A CE2 
1933 C  CZ  A TYR A 218 ? 0.1782 0.2661 0.2816 -0.0142 -0.0255 0.0291  213 TYR A CZ  
1934 C  CZ  B TYR A 218 ? 0.1638 0.4113 0.2444 0.0394  -0.0219 -0.0667 213 TYR A CZ  
1935 O  OH  A TYR A 218 ? 0.1095 0.2721 0.3093 -0.0276 0.0087  0.0209  213 TYR A OH  
1936 O  OH  B TYR A 218 ? 0.1049 0.4745 0.2491 0.0660  0.0239  -0.0900 213 TYR A OH  
1937 N  N   . LYS A 219 ? 0.2628 0.2705 0.2713 0.0526  -0.0051 -0.0175 214 LYS A N   
1938 C  CA  A LYS A 219 ? 0.2723 0.2710 0.2688 0.0519  0.0236  -0.0214 214 LYS A CA  
1939 C  CA  B LYS A 219 ? 0.2639 0.2748 0.2699 0.0534  0.0199  -0.0190 214 LYS A CA  
1940 C  C   . LYS A 219 ? 0.2589 0.2808 0.2821 0.0462  0.0184  -0.0297 214 LYS A C   
1941 O  O   . LYS A 219 ? 0.2654 0.2526 0.2897 0.0518  0.0350  -0.0254 214 LYS A O   
1942 C  CB  A LYS A 219 ? 0.2930 0.2782 0.2756 0.0451  0.0130  -0.0095 214 LYS A CB  
1943 C  CB  B LYS A 219 ? 0.2804 0.2855 0.2764 0.0466  0.0101  -0.0061 214 LYS A CB  
1944 C  CG  A LYS A 219 ? 0.3223 0.2704 0.2598 0.0610  0.0373  -0.0159 214 LYS A CG  
1945 C  CG  B LYS A 219 ? 0.2621 0.2963 0.2671 0.0732  0.0106  -0.0009 214 LYS A CG  
1946 N  N   . ASP A 220 ? 0.2216 0.2675 0.2823 0.0358  0.0347  -0.0615 215 ASP A N   
1947 C  CA  A ASP A 220 ? 0.2336 0.2742 0.2493 0.0235  0.0075  -0.0494 215 ASP A CA  
1948 C  CA  B ASP A 220 ? 0.2366 0.2809 0.2485 0.0216  0.0226  -0.0451 215 ASP A CA  
1949 C  C   . ASP A 220 ? 0.2390 0.2686 0.2415 0.0155  0.0072  -0.0461 215 ASP A C   
1950 O  O   . ASP A 220 ? 0.2471 0.2869 0.2184 0.0431  0.0026  -0.0693 215 ASP A O   
1951 C  CB  A ASP A 220 ? 0.2152 0.2286 0.2302 0.0296  0.0085  -0.0686 215 ASP A CB  
1952 C  CB  B ASP A 220 ? 0.2269 0.2779 0.2371 0.0334  0.0405  -0.0368 215 ASP A CB  
1953 C  CG  A ASP A 220 ? 0.2465 0.2467 0.2402 0.0499  -0.0233 -0.0950 215 ASP A CG  
1954 C  CG  B ASP A 220 ? 0.2677 0.2395 0.2232 0.0241  0.0395  -0.0409 215 ASP A CG  
1955 O  OD1 A ASP A 220 ? 0.2353 0.2982 0.1675 0.1804  -0.0405 -0.0473 215 ASP A OD1 
1956 O  OD1 B ASP A 220 ? 0.2458 0.1095 0.0548 0.1267  0.0502  0.0146  215 ASP A OD1 
1957 O  OD2 A ASP A 220 ? 0.2546 0.3315 0.2144 0.1080  -0.0797 -0.1891 215 ASP A OD2 
1958 O  OD2 B ASP A 220 ? 0.2089 0.2223 0.1847 -0.0519 0.0459  0.0480  215 ASP A OD2 
1959 N  N   . SER A 221 ? 0.2315 0.2790 0.2622 0.0000  -0.0043 -0.0443 216 SER A N   
1960 C  CA  . SER A 221 ? 0.2614 0.2521 0.2448 -0.0536 0.0039  -0.0423 216 SER A CA  
1961 C  C   . SER A 221 ? 0.2284 0.2903 0.2449 -0.0869 0.0228  -0.0513 216 SER A C   
1962 O  O   . SER A 221 ? 0.2468 0.2893 0.2190 -0.1357 0.0461  -0.0190 216 SER A O   
1963 C  CB  . SER A 221 ? 0.2538 0.2601 0.2701 -0.0443 -0.0100 -0.0454 216 SER A CB  
1964 O  OG  . SER A 221 ? 0.2740 0.2223 0.3028 -0.0068 -0.0196 -0.0414 216 SER A OG  
1965 N  N   . THR A 222 ? 0.2464 0.2898 0.2290 -0.0929 0.0340  -0.0306 217 THR A N   
1966 C  CA  . THR A 222 ? 0.2403 0.2683 0.2414 -0.0819 0.0282  -0.0088 217 THR A CA  
1967 C  C   . THR A 222 ? 0.2216 0.2592 0.2355 -0.0868 0.0300  0.0007  217 THR A C   
1968 O  O   . THR A 222 ? 0.2362 0.2612 0.2022 -0.1103 0.0344  -0.0220 217 THR A O   
1969 C  CB  . THR A 222 ? 0.2606 0.2717 0.2560 -0.0592 0.0229  0.0047  217 THR A CB  
1970 O  OG1 . THR A 222 ? 0.3587 0.3433 0.1989 -0.0808 0.0430  0.0005  217 THR A OG1 
1971 C  CG2 . THR A 222 ? 0.2062 0.2424 0.2772 -0.0535 -0.0154 0.0165  217 THR A CG2 
1972 N  N   . LEU A 223 ? 0.2068 0.2705 0.2326 -0.0950 0.0201  0.0175  218 LEU A N   
1973 C  CA  A LEU A 223 ? 0.2145 0.2345 0.2561 -0.0959 -0.0035 0.0152  218 LEU A CA  
1974 C  CA  B LEU A 223 ? 0.2181 0.2458 0.2424 -0.0935 -0.0140 0.0249  218 LEU A CA  
1975 C  C   . LEU A 223 ? 0.2058 0.2443 0.2561 -0.0989 -0.0193 0.0211  218 LEU A C   
1976 O  O   . LEU A 223 ? 0.2103 0.2028 0.2164 -0.0929 -0.0120 0.0284  218 LEU A O   
1977 C  CB  A LEU A 223 ? 0.2154 0.2367 0.2825 -0.0885 -0.0130 -0.0026 218 LEU A CB  
1978 C  CB  B LEU A 223 ? 0.2261 0.2619 0.2624 -0.0899 -0.0295 0.0148  218 LEU A CB  
1979 C  CG  A LEU A 223 ? 0.2104 0.1787 0.3308 -0.1008 0.0044  -0.0016 218 LEU A CG  
1980 C  CG  B LEU A 223 ? 0.2300 0.2436 0.2528 -0.0822 -0.0628 0.0500  218 LEU A CG  
1981 C  CD1 A LEU A 223 ? 0.1831 0.1898 0.2969 -0.0836 0.0389  0.0209  218 LEU A CD1 
1982 C  CD1 B LEU A 223 ? 0.2255 0.2428 0.2364 -0.0706 -0.0590 0.0728  218 LEU A CD1 
1983 C  CD2 A LEU A 223 ? 0.2505 0.1722 0.3592 -0.0835 -0.0083 -0.0235 218 LEU A CD2 
1984 C  CD2 B LEU A 223 ? 0.2303 0.3003 0.1378 -0.0624 -0.1005 0.0925  218 LEU A CD2 
1985 N  N   . ILE A 224 ? 0.1593 0.2071 0.2365 -0.0957 -0.0367 0.0472  219 ILE A N   
1986 C  CA  A ILE A 224 ? 0.1430 0.2064 0.2309 -0.0602 -0.0336 0.0334  219 ILE A CA  
1987 C  CA  B ILE A 224 ? 0.1346 0.1782 0.2259 -0.0520 -0.0425 0.0307  219 ILE A CA  
1988 C  C   . ILE A 224 ? 0.1154 0.1724 0.2207 -0.0474 -0.0253 0.0319  219 ILE A C   
1989 O  O   . ILE A 224 ? 0.0923 0.1840 0.2053 -0.0219 -0.0129 0.0141  219 ILE A O   
1990 C  CB  A ILE A 224 ? 0.1384 0.2004 0.2318 -0.0654 -0.0451 0.0458  219 ILE A CB  
1991 C  CB  B ILE A 224 ? 0.1250 0.1531 0.2153 -0.0485 -0.0583 0.0520  219 ILE A CB  
1992 C  CG1 A ILE A 224 ? 0.1860 0.2411 0.2615 -0.0556 -0.0434 0.0487  219 ILE A CG1 
1993 C  CG1 B ILE A 224 ? 0.1317 0.0886 0.2502 -0.0323 -0.0992 0.0415  219 ILE A CG1 
1994 C  CG2 A ILE A 224 ? 0.1490 0.2092 0.2479 -0.0484 -0.0457 0.0260  219 ILE A CG2 
1995 C  CG2 B ILE A 224 ? 0.1505 0.1388 0.2302 -0.0058 -0.0498 0.0127  219 ILE A CG2 
1996 C  CD1 A ILE A 224 ? 0.1694 0.2121 0.3437 -0.0721 -0.0963 0.0616  219 ILE A CD1 
1997 C  CD1 B ILE A 224 ? 0.0798 0.0544 0.3051 -0.0359 -0.1232 0.0834  219 ILE A CD1 
1998 N  N   . MET A 225 ? 0.1155 0.1720 0.2120 -0.0357 0.0032  0.0122  220 MET A N   
1999 C  CA  . MET A 225 ? 0.1171 0.1596 0.2030 -0.0144 0.0134  -0.0013 220 MET A CA  
2000 C  C   . MET A 225 ? 0.1074 0.1457 0.1953 -0.0166 0.0321  0.0065  220 MET A C   
2001 O  O   . MET A 225 ? 0.1086 0.1724 0.2088 -0.0186 0.0166  0.0064  220 MET A O   
2002 C  CB  . MET A 225 ? 0.1421 0.1669 0.1982 -0.0086 0.0368  -0.0068 220 MET A CB  
2003 C  CG  . MET A 225 ? 0.1168 0.1290 0.1881 -0.0133 0.0376  -0.0366 220 MET A CG  
2004 S  SD  . MET A 225 ? 0.2467 0.1737 0.2298 -0.0452 0.0939  -0.0324 220 MET A SD  
2005 C  CE  . MET A 225 ? 0.2571 0.1312 0.2208 0.0039  0.0308  -0.0348 220 MET A CE  
2006 N  N   . GLN A 226 ? 0.1324 0.1358 0.2180 -0.0321 0.0450  -0.0008 221 GLN A N   
2007 C  CA  . GLN A 226 ? 0.1658 0.1459 0.2018 -0.0505 0.0357  -0.0015 221 GLN A CA  
2008 C  C   . GLN A 226 ? 0.1477 0.1463 0.1919 -0.0450 0.0198  0.0109  221 GLN A C   
2009 O  O   . GLN A 226 ? 0.1398 0.1553 0.1834 -0.0536 -0.0083 0.0252  221 GLN A O   
2010 C  CB  . GLN A 226 ? 0.1728 0.1538 0.2160 -0.0710 0.0329  0.0163  221 GLN A CB  
2011 C  CG  . GLN A 226 ? 0.2147 0.1847 0.2651 -0.0691 0.0226  -0.0223 221 GLN A CG  
2012 C  CD  . GLN A 226 ? 0.2361 0.2171 0.3256 -0.0711 0.0130  -0.0257 221 GLN A CD  
2013 O  OE1 . GLN A 226 ? 0.2091 0.2591 0.4193 -0.0405 -0.0195 -0.0571 221 GLN A OE1 
2014 N  NE2 . GLN A 226 ? 0.2825 0.2891 0.3241 -0.1112 0.0257  -0.0484 221 GLN A NE2 
2015 N  N   . LEU A 227 ? 0.1452 0.1442 0.1722 -0.0361 0.0083  0.0187  222 LEU A N   
2016 C  CA  . LEU A 227 ? 0.1368 0.1589 0.1583 -0.0319 -0.0025 0.0271  222 LEU A CA  
2017 C  C   . LEU A 227 ? 0.1259 0.1356 0.1413 -0.0351 -0.0040 0.0173  222 LEU A C   
2018 O  O   . LEU A 227 ? 0.1224 0.1341 0.1422 -0.0216 -0.0163 0.0010  222 LEU A O   
2019 C  CB  . LEU A 227 ? 0.1390 0.1721 0.1573 -0.0175 -0.0240 0.0470  222 LEU A CB  
2020 C  CG  . LEU A 227 ? 0.1575 0.1146 0.1890 -0.0653 -0.0311 0.0576  222 LEU A CG  
2021 C  CD1 . LEU A 227 ? 0.1417 0.2257 0.2112 -0.0691 -0.0457 0.0810  222 LEU A CD1 
2022 C  CD2 . LEU A 227 ? 0.2643 0.1000 0.1990 -0.0587 -0.0312 0.0508  222 LEU A CD2 
2023 N  N   . LEU A 228 ? 0.1221 0.1425 0.1422 -0.0031 0.0126  0.0119  223 LEU A N   
2024 C  CA  . LEU A 228 ? 0.1152 0.1119 0.1602 -0.0189 0.0132  0.0314  223 LEU A CA  
2025 C  C   . LEU A 228 ? 0.1049 0.1574 0.1755 0.0054  0.0215  0.0203  223 LEU A C   
2026 O  O   . LEU A 228 ? 0.1147 0.1274 0.2175 0.0200  0.0082  0.0092  223 LEU A O   
2027 C  CB  . LEU A 228 ? 0.1019 0.1347 0.1873 -0.0086 0.0226  0.0188  223 LEU A CB  
2028 C  CG  . LEU A 228 ? 0.0931 0.1493 0.1390 -0.0045 0.0235  -0.0083 223 LEU A CG  
2029 C  CD1 . LEU A 228 ? 0.2188 0.1468 0.1900 -0.0068 0.0675  -0.0339 223 LEU A CD1 
2030 C  CD2 . LEU A 228 ? 0.1188 0.1229 0.1418 0.0059  0.0651  0.0081  223 LEU A CD2 
2031 N  N   . ARG A 229 ? 0.1054 0.1709 0.2056 -0.0150 0.0206  0.0323  224 ARG A N   
2032 C  CA  . ARG A 229 ? 0.1382 0.1611 0.2081 -0.0143 0.0210  0.0077  224 ARG A CA  
2033 C  C   . ARG A 229 ? 0.1547 0.1587 0.1900 -0.0262 0.0182  0.0185  224 ARG A C   
2034 O  O   . ARG A 229 ? 0.1577 0.1643 0.2011 -0.0377 0.0169  0.0180  224 ARG A O   
2035 C  CB  . ARG A 229 ? 0.1354 0.1895 0.1885 -0.0485 0.0300  0.0234  224 ARG A CB  
2036 C  CG  . ARG A 229 ? 0.2212 0.2094 0.3481 -0.0430 -0.0069 0.0242  224 ARG A CG  
2037 C  CD  . ARG A 229 ? 0.3441 0.2971 0.3665 -0.0399 -0.0375 0.0244  224 ARG A CD  
2038 N  NE  . ARG A 229 ? 0.4625 0.3101 0.4464 -0.0346 -0.0193 -0.0318 224 ARG A NE  
2039 C  CZ  . ARG A 229 ? 0.5119 0.3127 0.4550 -0.0237 -0.0203 -0.0305 224 ARG A CZ  
2040 N  NH1 . ARG A 229 ? 0.5060 0.3706 0.4660 -0.0133 0.0167  -0.0360 224 ARG A NH1 
2041 N  NH2 . ARG A 229 ? 0.5776 0.3648 0.4783 -0.0109 -0.0164 -0.0963 224 ARG A NH2 
2042 N  N   . ASP A 230 ? 0.1610 0.1507 0.1966 -0.0155 0.0324  0.0082  225 ASP A N   
2043 C  CA  . ASP A 230 ? 0.1697 0.1340 0.1970 -0.0265 0.0200  0.0032  225 ASP A CA  
2044 C  C   . ASP A 230 ? 0.1452 0.1187 0.1863 -0.0438 0.0128  -0.0024 225 ASP A C   
2045 O  O   . ASP A 230 ? 0.1729 0.1089 0.1920 -0.0383 0.0081  0.0001  225 ASP A O   
2046 C  CB  . ASP A 230 ? 0.1979 0.1396 0.2095 -0.0394 0.0017  0.0199  225 ASP A CB  
2047 C  CG  . ASP A 230 ? 0.2314 0.2040 0.2463 -0.0394 0.0195  -0.0025 225 ASP A CG  
2048 O  OD1 . ASP A 230 ? 0.1938 0.2637 0.2243 -0.0724 0.0006  0.0231  225 ASP A OD1 
2049 O  OD2 . ASP A 230 ? 0.3019 0.1686 0.2501 -0.0277 0.0056  0.0316  225 ASP A OD2 
2050 N  N   . ASN A 231 ? 0.1089 0.1074 0.1813 -0.0231 0.0239  0.0066  226 ASN A N   
2051 C  CA  . ASN A 231 ? 0.0932 0.1367 0.1693 -0.0164 -0.0029 0.0019  226 ASN A CA  
2052 C  C   . ASN A 231 ? 0.1302 0.1231 0.1761 -0.0163 -0.0044 0.0156  226 ASN A C   
2053 O  O   . ASN A 231 ? 0.1320 0.1043 0.1961 -0.0267 -0.0099 -0.0113 226 ASN A O   
2054 C  CB  . ASN A 231 ? 0.0979 0.1269 0.1884 -0.0184 -0.0220 0.0033  226 ASN A CB  
2055 C  CG  . ASN A 231 ? 0.1570 0.0889 0.1397 -0.0133 -0.0301 0.0161  226 ASN A CG  
2056 O  OD1 . ASN A 231 ? 0.1525 0.0854 0.1613 -0.0015 -0.0103 0.0186  226 ASN A OD1 
2057 N  ND2 . ASN A 231 ? 0.1363 0.1197 0.1170 0.0288  -0.0435 -0.0171 226 ASN A ND2 
2058 N  N   . LEU A 232 ? 0.0919 0.1313 0.1866 -0.0141 -0.0222 0.0206  227 LEU A N   
2059 C  CA  . LEU A 232 ? 0.1278 0.1359 0.1886 -0.0232 -0.0127 0.0210  227 LEU A CA  
2060 C  C   . LEU A 232 ? 0.1363 0.1417 0.1867 -0.0328 -0.0212 0.0124  227 LEU A C   
2061 O  O   . LEU A 232 ? 0.1534 0.1711 0.2057 -0.0375 -0.0202 -0.0163 227 LEU A O   
2062 C  CB  . LEU A 232 ? 0.1289 0.0811 0.1903 -0.0233 -0.0401 0.0309  227 LEU A CB  
2063 C  CG  . LEU A 232 ? 0.1385 0.1098 0.1923 -0.0150 0.0268  0.0584  227 LEU A CG  
2064 C  CD1 . LEU A 232 ? 0.2154 0.1648 0.2523 0.0285  -0.0079 0.0063  227 LEU A CD1 
2065 C  CD2 . LEU A 232 ? 0.1990 0.1181 0.1668 0.0109  0.0398  0.0518  227 LEU A CD2 
2066 N  N   . THR A 233 ? 0.1293 0.1527 0.1913 -0.0461 -0.0077 -0.0041 228 THR A N   
2067 C  CA  . THR A 233 ? 0.1547 0.1647 0.2128 -0.0420 -0.0047 -0.0248 228 THR A CA  
2068 C  C   . THR A 233 ? 0.1625 0.1618 0.2167 -0.0386 -0.0299 -0.0271 228 THR A C   
2069 O  O   . THR A 233 ? 0.1752 0.1842 0.2168 -0.0177 -0.0644 -0.0312 228 THR A O   
2070 C  CB  . THR A 233 ? 0.1656 0.1835 0.2255 -0.0636 0.0232  -0.0379 228 THR A CB  
2071 O  OG1 . THR A 233 ? 0.1668 0.2330 0.2537 -0.0512 0.0132  -0.0430 228 THR A OG1 
2072 C  CG2 . THR A 233 ? 0.1783 0.2377 0.2537 -0.0649 0.0001  -0.0611 228 THR A CG2 
2073 N  N   . LEU A 234 ? 0.1594 0.1499 0.2205 -0.0460 -0.0367 -0.0148 229 LEU A N   
2074 C  CA  A LEU A 234 ? 0.1474 0.1436 0.2064 -0.0403 -0.0453 -0.0108 229 LEU A CA  
2075 C  CA  B LEU A 234 ? 0.1681 0.1602 0.2232 -0.0468 -0.0409 -0.0088 229 LEU A CA  
2076 C  C   . LEU A 234 ? 0.1673 0.1527 0.2107 -0.0560 -0.0497 -0.0086 229 LEU A C   
2077 O  O   . LEU A 234 ? 0.2351 0.1709 0.2202 -0.0429 -0.0424 -0.0089 229 LEU A O   
2078 C  CB  A LEU A 234 ? 0.1386 0.1277 0.1751 -0.0397 -0.0674 -0.0127 229 LEU A CB  
2079 C  CB  B LEU A 234 ? 0.1664 0.1629 0.2133 -0.0525 -0.0632 -0.0075 229 LEU A CB  
2080 C  CG  A LEU A 234 ? 0.0906 0.1174 0.1466 -0.0291 -0.0588 -0.0186 229 LEU A CG  
2081 C  CG  B LEU A 234 ? 0.2166 0.2116 0.2567 -0.0620 -0.0467 0.0051  229 LEU A CG  
2082 C  CD1 A LEU A 234 ? 0.1240 0.1281 0.1495 -0.0328 -0.0663 -0.0276 229 LEU A CD1 
2083 C  CD1 B LEU A 234 ? 0.2401 0.2200 0.2689 -0.0189 -0.0691 0.0191  229 LEU A CD1 
2084 C  CD2 A LEU A 234 ? 0.1220 0.1893 0.1360 0.0058  -0.0736 -0.0156 229 LEU A CD2 
2085 C  CD2 B LEU A 234 ? 0.1873 0.1907 0.2463 -0.0851 -0.0760 0.0283  229 LEU A CD2 
2086 N  N   . TRP A 235 ? 0.1886 0.1721 0.2087 -0.0705 -0.0364 0.0035  230 TRP A N   
2087 C  CA  . TRP A 235 ? 0.1623 0.1906 0.1806 -0.0605 -0.0461 0.0119  230 TRP A CA  
2088 C  C   . TRP A 235 ? 0.1816 0.2491 0.1963 -0.0541 -0.0547 0.0307  230 TRP A C   
2089 O  O   . TRP A 235 ? 0.2095 0.2965 0.2012 -0.0189 -0.0542 0.0041  230 TRP A O   
2090 C  CB  . TRP A 235 ? 0.1532 0.2104 0.1756 -0.0763 -0.0546 0.0241  230 TRP A CB  
2091 C  CG  . TRP A 235 ? 0.1690 0.1115 0.1109 -0.0257 -0.0227 0.0362  230 TRP A CG  
2092 C  CD1 . TRP A 235 ? 0.2114 0.1858 0.1733 0.0117  -0.0140 -0.0234 230 TRP A CD1 
2093 C  CD2 . TRP A 235 ? 0.1606 0.1274 0.1338 -0.0363 -0.0378 0.0168  230 TRP A CD2 
2094 N  NE1 . TRP A 235 ? 0.2055 0.1570 0.1259 -0.0181 -0.0289 -0.0344 230 TRP A NE1 
2095 C  CE2 . TRP A 235 ? 0.1378 0.0921 0.1408 -0.0235 -0.0074 0.0005  230 TRP A CE2 
2096 C  CE3 . TRP A 235 ? 0.1871 0.1322 0.1270 -0.0399 -0.0220 0.0105  230 TRP A CE3 
2097 C  CZ2 . TRP A 235 ? 0.1899 0.0876 0.2012 -0.0650 -0.0256 -0.0223 230 TRP A CZ2 
2098 C  CZ3 . TRP A 235 ? 0.1710 0.1363 0.1498 -0.0392 -0.0401 0.0403  230 TRP A CZ3 
2099 C  CH2 . TRP A 235 ? 0.1382 0.0969 0.1754 -0.0332 -0.0180 0.0369  230 TRP A CH2 
2100 N  N   . THR A 236 ? 0.1949 0.2984 0.2319 -0.0218 -0.0617 0.0465  231 THR A N   
2101 C  CA  . THR A 236 ? 0.2248 0.3628 0.2822 -0.0331 -0.0684 0.0605  231 THR A CA  
2102 C  C   . THR A 236 ? 0.2436 0.3948 0.3300 -0.0286 -0.0854 0.0687  231 THR A C   
2103 O  O   . THR A 236 ? 0.2691 0.4387 0.3624 -0.0432 -0.0888 0.0677  231 THR A O   
2104 C  CB  . THR A 236 ? 0.2110 0.3613 0.2804 -0.0209 -0.0544 0.0589  231 THR A CB  
2105 O  OG1 . THR A 236 ? 0.2124 0.4002 0.2388 -0.0066 -0.0541 0.0213  231 THR A OG1 
2106 C  CG2 . THR A 236 ? 0.2670 0.3555 0.2772 -0.0671 -0.0453 0.0735  231 THR A CG2 
2107 O  OXT . THR A 236 ? 0.2648 0.4289 0.3727 -0.0450 -0.0989 0.0822  231 THR A OXT 
2108 N  N   . LYS B 1   ? 0.4696 0.4297 0.5246 -0.0513 -0.0004 -0.0201 369 LYS P N   
2109 C  CA  . LYS B 1   ? 0.4460 0.3976 0.5148 -0.0587 0.0021  -0.0089 369 LYS P CA  
2110 C  C   . LYS B 1   ? 0.3917 0.3384 0.4740 -0.0492 -0.0190 -0.0020 369 LYS P C   
2111 O  O   . LYS B 1   ? 0.4157 0.3830 0.5034 -0.0683 -0.0187 0.0022  369 LYS P O   
2112 C  CB  . LYS B 1   ? 0.4838 0.4237 0.5394 -0.0490 -0.0034 -0.0150 369 LYS P CB  
2113 C  CG  . LYS B 1   ? 0.5587 0.5079 0.5757 -0.0406 -0.0022 -0.0288 369 LYS P CG  
2114 C  CD  . LYS B 1   ? 0.6585 0.6016 0.6710 -0.0348 -0.0455 -0.0460 369 LYS P CD  
2115 C  CE  . LYS B 1   ? 0.7388 0.6105 0.7027 -0.0089 -0.0206 -0.0695 369 LYS P CE  
2116 N  NZ  . LYS B 1   ? 0.7906 0.6120 0.7544 0.0038  -0.0182 -0.0631 369 LYS P NZ  
2117 N  N   . ARG B 2   ? 0.3141 0.2171 0.4194 -0.0372 -0.0207 -0.0030 370 ARG P N   
2118 C  CA  A ARG B 2   ? 0.2603 0.1783 0.3767 -0.0102 -0.0329 -0.0138 370 ARG P CA  
2119 C  CA  B ARG B 2   ? 0.2502 0.1775 0.3720 -0.0233 -0.0320 -0.0080 370 ARG P CA  
2120 C  C   . ARG B 2   ? 0.2250 0.1531 0.3369 -0.0132 -0.0360 -0.0091 370 ARG P C   
2121 O  O   . ARG B 2   ? 0.2356 0.1307 0.3569 -0.0028 -0.0229 -0.0041 370 ARG P O   
2122 C  CB  A ARG B 2   ? 0.2821 0.1893 0.3878 0.0097  -0.0288 -0.0040 370 ARG P CB  
2123 C  CB  B ARG B 2   ? 0.2544 0.1854 0.3834 -0.0106 -0.0166 0.0059  370 ARG P CB  
2124 C  CG  A ARG B 2   ? 0.2321 0.1809 0.3716 0.0474  -0.0489 -0.0236 370 ARG P CG  
2125 C  CG  B ARG B 2   ? 0.1723 0.1768 0.3331 -0.0483 -0.0542 0.0113  370 ARG P CG  
2126 C  CD  A ARG B 2   ? 0.3208 0.1908 0.3084 0.1086  -0.0726 0.0238  370 ARG P CD  
2127 C  CD  B ARG B 2   ? 0.2271 0.1727 0.2887 0.0241  -0.0084 0.0478  370 ARG P CD  
2128 N  NE  A ARG B 2   ? 0.3121 0.1696 0.3287 0.1573  -0.0475 0.0309  370 ARG P NE  
2129 N  NE  B ARG B 2   ? 0.1855 0.0652 0.3403 0.0077  0.0175  0.0440  370 ARG P NE  
2130 C  CZ  A ARG B 2   ? 0.2641 0.1057 0.2144 0.1311  -0.0634 0.0032  370 ARG P CZ  
2131 C  CZ  B ARG B 2   ? 0.1980 0.1888 0.3183 -0.0432 0.0308  0.0323  370 ARG P CZ  
2132 N  NH1 A ARG B 2   ? 0.2814 0.0888 0.0606 0.1227  -0.0271 -0.0006 370 ARG P NH1 
2133 N  NH1 B ARG B 2   ? 0.1083 0.0554 0.3180 -0.0376 0.0365  0.0435  370 ARG P NH1 
2134 N  NH2 A ARG B 2   ? 0.3270 0.1082 0.2025 0.1147  -0.0977 0.0038  370 ARG P NH2 
2135 N  NH2 B ARG B 2   ? 0.0913 0.0476 0.2177 0.0065  0.0480  0.0631  370 ARG P NH2 
2136 N  N   . ARG B 3   ? 0.1697 0.0968 0.2805 -0.0118 -0.0545 -0.0222 371 ARG P N   
2137 C  CA  . ARG B 3   ? 0.1662 0.0865 0.2141 -0.0184 -0.0546 -0.0277 371 ARG P CA  
2138 C  C   . ARG B 3   ? 0.1417 0.0963 0.2259 -0.0160 -0.0529 -0.0170 371 ARG P C   
2139 O  O   . ARG B 3   ? 0.1800 0.0837 0.2365 -0.0133 -0.0286 -0.0106 371 ARG P O   
2140 C  CB  . ARG B 3   ? 0.1617 0.1003 0.2434 -0.0287 -0.0603 -0.0331 371 ARG P CB  
2141 C  CG  . ARG B 3   ? 0.1359 0.0559 0.2467 0.0249  -0.0812 -0.0298 371 ARG P CG  
2142 C  CD  . ARG B 3   ? 0.1269 0.0462 0.2190 0.0407  -0.0645 -0.0088 371 ARG P CD  
2143 N  NE  . ARG B 3   ? 0.1332 0.0366 0.2251 0.0232  -0.0745 0.0124  371 ARG P NE  
2144 C  CZ  . ARG B 3   ? 0.1342 0.0792 0.1729 0.0684  -0.0420 -0.0234 371 ARG P CZ  
2145 N  NH1 . ARG B 3   ? 0.1826 0.0760 0.1565 0.0345  -0.0507 0.0120  371 ARG P NH1 
2146 N  NH2 . ARG B 3   ? 0.0939 0.0732 0.2018 0.0358  -0.0306 0.0193  371 ARG P NH2 
2147 N  N   . LYS B 4   ? 0.1306 0.0852 0.1988 -0.0319 -0.0357 -0.0234 372 LYS P N   
2148 C  CA  . LYS B 4   ? 0.1126 0.0657 0.1835 -0.0343 -0.0130 -0.0221 372 LYS P CA  
2149 C  C   . LYS B 4   ? 0.1291 0.0728 0.1825 -0.0270 -0.0117 -0.0051 372 LYS P C   
2150 O  O   . LYS B 4   ? 0.1312 0.0833 0.1897 -0.0057 -0.0154 0.0096  372 LYS P O   
2151 C  CB  . LYS B 4   ? 0.1138 0.1219 0.2177 -0.0275 0.0246  0.0004  372 LYS P CB  
2152 C  CG  . LYS B 4   ? 0.1268 0.1530 0.2492 -0.0692 0.0136  0.0361  372 LYS P CG  
2153 C  CD  . LYS B 4   ? 0.1817 0.1375 0.2983 -0.0847 0.0231  0.0649  372 LYS P CD  
2154 C  CE  . LYS B 4   ? 0.2150 0.2885 0.4020 -0.0867 0.0858  0.0827  372 LYS P CE  
2155 N  NZ  . LYS B 4   ? 0.2865 0.3218 0.4006 -0.0569 0.0499  0.0526  372 LYS P NZ  
2156 N  N   . SEP B 5   ? 0.1343 0.0556 0.1826 0.0023  -0.0200 0.0049  373 SEP P N   
2157 C  CA  . SEP B 5   ? 0.1222 0.0532 0.1604 -0.0149 0.0078  0.0050  373 SEP P CA  
2158 C  CB  . SEP B 5   ? 0.1265 0.0494 0.1765 0.0482  0.0104  0.0175  373 SEP P CB  
2159 O  OG  . SEP B 5   ? 0.1287 0.0533 0.1404 0.0465  0.0269  0.0240  373 SEP P OG  
2160 C  C   . SEP B 5   ? 0.1483 0.0439 0.1544 -0.0014 0.0094  0.0079  373 SEP P C   
2161 O  O   . SEP B 5   ? 0.1604 0.0868 0.1692 -0.0216 0.0109  0.0060  373 SEP P O   
2162 P  P   . SEP B 5   ? 0.1427 0.0646 0.1569 0.0358  -0.0162 0.0130  373 SEP P P   
2163 O  O1P . SEP B 5   ? 0.1820 0.0340 0.1626 0.0192  -0.0335 0.0246  373 SEP P O1P 
2164 O  O2P . SEP B 5   ? 0.1540 0.0571 0.2064 0.0128  -0.0312 -0.0045 373 SEP P O2P 
2165 O  O3P . SEP B 5   ? 0.1644 0.1198 0.1469 -0.0231 -0.0310 0.0016  373 SEP P O3P 
2166 N  N   . VAL B 6   ? 0.1182 0.0773 0.1366 0.0065  -0.0010 -0.0067 374 VAL P N   
2167 C  CA  . VAL B 6   ? 0.1498 0.0937 0.1544 0.0124  -0.0023 -0.0047 374 VAL P CA  
2168 C  C   . VAL B 6   ? 0.1673 0.0969 0.1617 0.0016  -0.0035 0.0018  374 VAL P C   
2169 O  O   . VAL B 6   ? 0.2309 0.0805 0.1848 0.0224  -0.0031 -0.0007 374 VAL P O   
2170 C  CB  . VAL B 6   ? 0.1827 0.0843 0.1496 0.0196  0.0036  -0.0041 374 VAL P CB  
2171 C  CG1 . VAL B 6   ? 0.1850 0.0518 0.1893 0.0231  -0.0413 0.0090  374 VAL P CG1 
2172 C  CG2 . VAL B 6   ? 0.2040 0.1875 0.1159 0.0157  -0.0204 0.0154  374 VAL P CG2 
2173 O  OXT . VAL B 6   ? 0.1764 0.1587 0.1892 -0.0127 -0.0114 0.0000  374 VAL P OXT 
2174 C  C1  . FSC C .   ? 0.0935 0.1110 0.1494 0.0139  -0.0018 -0.0020 249 FSC A C1  
2175 C  C4  . FSC C .   ? 0.0857 0.1222 0.1546 -0.0024 -0.0003 -0.0188 249 FSC A C4  
2176 C  C11 . FSC C .   ? 0.1079 0.1825 0.1337 0.0287  0.0205  0.0110  249 FSC A C11 
2177 C  C18 . FSC C .   ? 0.1221 0.2057 0.1557 -0.0066 -0.0312 -0.0144 249 FSC A C18 
2178 C  C17 . FSC C .   ? 0.0988 0.2801 0.1779 -0.0134 0.0870  0.0252  249 FSC A C17 
2179 O  O24 . FSC C .   ? 0.2119 0.3784 0.2600 -0.0372 0.1287  -0.0198 249 FSC A O24 
2180 C  C31 . FSC C .   ? 0.2826 0.4565 0.3688 -0.0421 0.1327  0.0370  249 FSC A C31 
2181 O  O37 . FSC C .   ? 0.3246 0.4510 0.4780 -0.0342 0.1271  0.0652  249 FSC A O37 
2182 C  C36 . FSC C .   ? 0.2894 0.5195 0.4520 -0.0004 0.1071  0.0119  249 FSC A C36 
2183 C  C10 . FSC C .   ? 0.0601 0.1261 0.2055 0.0089  0.0230  -0.0491 249 FSC A C10 
2184 C  C6  . FSC C .   ? 0.1157 0.0876 0.2090 -0.0018 0.0018  -0.0237 249 FSC A C6  
2185 O  O13 . FSC C .   ? 0.1543 0.1127 0.1891 0.0590  -0.0292 -0.0026 249 FSC A O13 
2186 C  C2  . FSC C .   ? 0.1207 0.0920 0.1426 0.0329  0.0261  -0.0020 249 FSC A C2  
2187 C  C7  . FSC C .   ? 0.1367 0.0313 0.1452 0.0063  -0.0120 -0.0158 249 FSC A C7  
2188 C  C5  . FSC C .   ? 0.1354 0.0552 0.1058 0.0023  -0.0113 0.0105  249 FSC A C5  
2189 C  C12 . FSC C .   ? 0.0958 0.0808 0.1142 0.0440  0.0153  -0.0106 249 FSC A C12 
2190 C  C20 . FSC C .   ? 0.0818 0.0617 0.1405 0.0433  0.0039  0.0070  249 FSC A C20 
2191 C  C27 . FSC C .   ? 0.1085 0.1105 0.1359 -0.0013 0.0032  0.0341  249 FSC A C27 
2192 O  O32 . FSC C .   ? 0.1164 0.0876 0.1138 0.0066  0.0114  0.0214  249 FSC A O32 
2193 C  C38 . FSC C .   ? 0.0829 0.1089 0.1853 0.0357  -0.0158 0.0184  249 FSC A C38 
2194 C  C26 . FSC C .   ? 0.1139 0.0689 0.1361 0.0604  -0.0080 0.0088  249 FSC A C26 
2195 C  C25 . FSC C .   ? 0.0888 0.1630 0.1283 0.0273  -0.0153 0.0064  249 FSC A C25 
2196 C  C19 . FSC C .   ? 0.1221 0.0846 0.1421 0.0694  -0.0246 -0.0245 249 FSC A C19 
2197 C  C15 . FSC C .   ? 0.1102 0.1354 0.1377 0.0098  -0.0108 -0.0362 249 FSC A C15 
2198 C  C23 . FSC C .   ? 0.1173 0.1122 0.1406 0.0549  -0.0122 -0.0356 249 FSC A C23 
2199 C  C9  . FSC C .   ? 0.1166 0.1290 0.1498 0.0490  -0.0084 -0.0223 249 FSC A C9  
2200 O  O16 . FSC C .   ? 0.1551 0.1091 0.2093 0.0529  -0.0292 -0.0168 249 FSC A O16 
2201 C  C3  . FSC C .   ? 0.1628 0.1306 0.1456 0.0690  0.0288  -0.0280 249 FSC A C3  
2202 O  O8  . FSC C .   ? 0.1532 0.1389 0.1620 0.0657  -0.0002 0.0023  249 FSC A O8  
2203 C  C14 . FSC C .   ? 0.1574 0.2315 0.1330 0.0864  0.0021  0.0127  249 FSC A C14 
2204 O  O22 . FSC C .   ? 0.2036 0.2214 0.1516 0.1042  -0.0123 -0.0038 249 FSC A O22 
2205 C  C30 . FSC C .   ? 0.2156 0.2441 0.2411 0.0866  0.0398  -0.0024 249 FSC A C30 
2206 C  C33 . FSC C .   ? 0.2758 0.2846 0.2417 0.1000  0.0813  -0.0130 249 FSC A C33 
2207 O  O39 . FSC C .   ? 0.3338 0.3311 0.3500 0.0135  0.1256  0.0112  249 FSC A O39 
2208 C  C28 . FSC C .   ? 0.1983 0.3468 0.2141 0.1080  0.0621  -0.0072 249 FSC A C28 
2209 O  O34 . FSC C .   ? 0.2148 0.5521 0.2067 0.1222  0.0891  0.0067  249 FSC A O34 
2210 C  C40 . FSC C .   ? 0.2785 0.6875 0.3323 0.1091  0.0344  0.0066  249 FSC A C40 
2211 O  O43 . FSC C .   ? 0.2572 0.8006 0.3873 0.1264  0.0358  -0.0179 249 FSC A O43 
2212 C  C42 . FSC C .   ? 0.3208 0.7409 0.3494 0.1228  0.0407  0.0142  249 FSC A C42 
2213 C  C21 . FSC C .   ? 0.1906 0.2574 0.2056 0.1408  0.0421  -0.0008 249 FSC A C21 
2214 O  O29 . FSC C .   ? 0.2386 0.2536 0.1854 0.1454  -0.0361 -0.0262 249 FSC A O29 
2215 C  C35 . FSC C .   ? 0.2489 0.2598 0.2408 0.1090  -0.0501 0.0334  249 FSC A C35 
2216 O  O41 . FSC C .   ? 0.2992 0.3224 0.2586 0.1496  -0.0314 0.0449  249 FSC A O41 
2217 C  C44 . FSC C .   ? 0.2689 0.3493 0.3382 0.1037  -0.1008 0.0983  249 FSC A C44 
2218 C  C47 . FSC C .   ? 0.1895 0.4294 0.3229 0.0169  -0.1172 0.1027  249 FSC A C47 
2219 C  C46 . FSC C .   ? 0.3288 0.4139 0.3296 0.0494  -0.0632 0.1030  249 FSC A C46 
2220 C  C45 . FSC C .   ? 0.2828 0.4039 0.4338 0.0664  -0.0852 0.1442  249 FSC A C45 
2221 C  C48 . FSC C .   ? 0.3373 0.4084 0.5544 0.0616  -0.0530 0.1730  249 FSC A C48 
2222 CL CL  . CL  D .   ? 0.2158 0.1041 0.2420 0.0147  -0.0031 -0.0164 250 CL  A CL  
2223 MG MG  . MG  E .   ? 0.2781 0.1912 0.1689 -0.0019 -0.0301 -0.0368 251 MG  A MG  
2224 MG MG  . MG  F .   ? 0.1436 0.0838 0.1797 0.0000  -0.0243 0.0000  252 MG  A MG  
2225 O  O   . HOH G .   ? 0.2227 0.0982 0.1437 -0.0079 -0.0487 0.0499  253 HOH A O   
2226 O  O   . HOH G .   ? 0.1875 0.1792 0.1501 -0.0175 -0.0313 0.0010  254 HOH A O   
2227 O  O   . HOH G .   ? 0.2308 0.1027 0.1973 0.0199  0.0638  0.0112  255 HOH A O   
2228 O  O   . HOH G .   ? 0.4216 0.1813 0.4683 0.0466  0.3199  0.0330  256 HOH A O   
2229 O  O   . HOH G .   ? 0.2148 0.1614 0.3192 0.0332  -0.0244 -0.0715 257 HOH A O   
2230 O  O   . HOH G .   ? 0.0944 0.2580 0.3213 0.0267  -0.0249 -0.0275 258 HOH A O   
2231 O  O   . HOH G .   ? 0.2290 0.2890 0.3361 0.0378  -0.1096 0.0014  259 HOH A O   
2232 O  O   . HOH G .   ? 0.2547 0.2352 0.3437 0.0113  0.0032  0.0598  260 HOH A O   
2233 O  O   . HOH G .   ? 0.3093 0.2992 0.4521 0.0666  -0.0702 -0.0853 261 HOH A O   
2234 O  O   . HOH G .   ? 0.3102 0.3097 0.2674 0.0260  0.0018  0.0561  262 HOH A O   
2235 O  O   . HOH G .   ? 0.3747 0.3805 0.3975 -0.1603 0.0256  -0.0120 263 HOH A O   
2236 O  O   . HOH G .   ? 0.4200 0.3654 0.4108 -0.0897 -0.0410 -0.1355 264 HOH A O   
2237 O  O   . HOH G .   ? 0.3584 0.7082 0.1735 -0.3953 -0.0163 0.1667  265 HOH A O   
2238 O  O   . HOH G .   ? 0.4683 0.5026 0.2073 -0.0247 -0.0503 -0.0934 266 HOH A O   
2239 O  O   . HOH G .   ? 0.5483 0.3385 0.3289 0.1077  0.0379  0.0176  267 HOH A O   
2240 O  O   . HOH G .   ? 0.3295 0.2457 0.3045 -0.1156 0.0301  -0.1590 268 HOH A O   
2241 O  O   . HOH G .   ? 0.5278 0.3451 0.2739 0.0879  -0.0727 0.0733  269 HOH A O   
2242 O  O   . HOH G .   ? 0.4424 0.3466 0.4769 -0.1257 0.1726  0.1358  270 HOH A O   
2243 O  O   . HOH G .   ? 0.1542 0.0930 0.1556 -0.0112 0.0309  0.0285  271 HOH A O   
2244 O  O   . HOH G .   ? 0.2486 0.1948 0.2588 0.0402  -0.0198 0.0575  272 HOH A O   
2245 O  O   . HOH G .   ? 0.3864 0.3260 0.2981 -0.0128 -0.0277 0.0244  273 HOH A O   
2246 O  O   . HOH G .   ? 0.1090 0.0711 0.1538 -0.0049 0.0135  -0.0201 274 HOH A O   
2247 O  O   . HOH G .   ? 0.2172 0.0981 0.1463 -0.0038 0.0296  0.0185  275 HOH A O   
2248 O  O   . HOH G .   ? 0.3475 0.1847 0.4403 0.0830  -0.1640 -0.0519 276 HOH A O   
2249 O  O   . HOH G .   ? 0.0925 0.1420 0.2219 -0.0527 0.0246  -0.0461 277 HOH A O   
2250 O  O   . HOH G .   ? 0.1912 0.0533 0.1646 0.0502  -0.0352 -0.0149 278 HOH A O   
2251 O  O   . HOH G .   ? 0.1195 0.2416 0.1928 0.0194  0.0208  0.0109  279 HOH A O   
2252 O  O   . HOH G .   ? 0.1339 0.1490 0.2125 -0.0395 -0.0931 0.0519  280 HOH A O   
2253 O  O   . HOH G .   ? 0.1579 0.1086 0.2046 -0.0436 -0.0306 0.0046  281 HOH A O   
2254 O  O   . HOH G .   ? 0.2022 0.1193 0.1520 -0.0280 -0.0222 -0.0123 282 HOH A O   
2255 O  O   . HOH G .   ? 0.1373 0.1631 0.1521 0.0249  -0.0335 -0.0339 283 HOH A O   
2256 O  O   . HOH G .   ? 0.1230 0.1614 0.2651 0.0169  -0.0726 -0.0066 284 HOH A O   
2257 O  O   . HOH G .   ? 0.2318 0.7200 0.3542 0.0501  0.0136  0.0500  285 HOH A O   
2258 O  O   . HOH G .   ? 0.2061 0.0710 0.1543 0.0481  -0.0111 0.0069  286 HOH A O   
2259 O  O   . HOH G .   ? 0.1607 0.1549 0.2276 0.0004  0.0028  -0.0207 287 HOH A O   
2260 O  O   . HOH G .   ? 0.3209 0.1704 0.4013 0.0020  0.0991  0.1097  288 HOH A O   
2261 O  O   . HOH G .   ? 0.6936 0.2139 0.3938 -0.0643 -0.0507 0.0313  289 HOH A O   
2262 O  O   . HOH G .   ? 0.2906 0.1954 0.2178 0.0071  -0.0184 -0.0447 290 HOH A O   
2263 O  O   . HOH G .   ? 0.2762 0.1494 0.2555 0.0155  0.0041  0.0812  291 HOH A O   
2264 O  O   . HOH G .   ? 0.2812 0.2065 0.1229 0.0858  -0.0281 0.0061  292 HOH A O   
2265 O  O   . HOH G .   ? 0.1227 0.2124 0.1951 -0.0106 0.0132  -0.0396 293 HOH A O   
2266 O  O   . HOH G .   ? 0.2350 0.1922 0.2689 0.0592  -0.1032 -0.0128 294 HOH A O   
2267 O  O   . HOH G .   ? 0.2456 0.1216 0.1480 0.0231  -0.0118 -0.0041 295 HOH A O   
2268 O  O   . HOH G .   ? 0.1461 0.1608 0.1381 -0.0374 -0.0264 -0.0134 296 HOH A O   
2269 O  O   . HOH G .   ? 0.2088 0.0451 0.1603 0.0280  -0.0017 0.0199  297 HOH A O   
2270 O  O   . HOH G .   ? 0.3192 0.3238 0.4265 0.2107  -0.0044 0.1073  298 HOH A O   
2271 O  O   . HOH G .   ? 0.2117 0.2662 0.2945 -0.0650 -0.0167 0.0664  299 HOH A O   
2272 O  O   . HOH G .   ? 0.1879 0.2314 0.3239 0.0447  -0.0636 -0.0770 300 HOH A O   
2273 O  O   . HOH G .   ? 0.2804 0.1156 0.2001 0.0890  -0.0410 -0.0199 301 HOH A O   
2274 O  O   . HOH G .   ? 0.3094 0.4568 0.8165 -0.1546 -0.0711 0.1578  302 HOH A O   
2275 O  O   . HOH G .   ? 0.2766 0.4340 0.3149 -0.0225 -0.0217 0.0427  303 HOH A O   
2276 O  O   . HOH G .   ? 0.1327 0.1623 0.2296 0.0275  0.0404  0.0224  304 HOH A O   
2277 O  O   . HOH G .   ? 0.2608 0.6369 0.5136 0.1085  0.0646  0.0091  305 HOH A O   
2278 O  O   . HOH G .   ? 0.3995 0.3063 0.2283 0.0218  0.0325  0.0129  306 HOH A O   
2279 O  O   . HOH G .   ? 0.1874 0.2107 0.2994 0.0117  -0.0531 -0.0402 307 HOH A O   
2280 O  O   . HOH G .   ? 0.4398 0.0881 0.1934 -0.0377 0.1248  -0.0510 308 HOH A O   
2281 O  O   . HOH G .   ? 0.1782 0.1231 0.4162 -0.0264 -0.0321 0.0147  309 HOH A O   
2282 O  O   . HOH G .   ? 0.2513 0.0616 0.2206 0.0256  0.0116  -0.0371 310 HOH A O   
2283 O  O   . HOH G .   ? 0.1345 0.2098 0.2952 -0.0278 -0.0359 -0.0800 311 HOH A O   
2284 O  O   . HOH G .   ? 0.5125 0.3938 0.3565 0.1072  -0.0794 -0.0750 312 HOH A O   
2285 O  O   . HOH G .   ? 0.5864 0.1631 0.1435 -0.1639 0.0264  -0.0446 313 HOH A O   
2286 O  O   . HOH G .   ? 0.2110 0.2010 0.2516 -0.0403 0.0060  0.0169  314 HOH A O   
2287 O  O   . HOH G .   ? 0.2916 0.0877 0.3477 -0.0051 -0.1301 0.0043  315 HOH A O   
2288 O  O   . HOH G .   ? 0.2395 0.1390 0.1964 -0.0187 0.0731  -0.0019 316 HOH A O   
2289 O  O   . HOH G .   ? 0.2546 0.1634 0.2953 -0.0269 0.0193  -0.0070 317 HOH A O   
2290 O  O   . HOH G .   ? 0.3188 0.1697 0.2070 -0.1075 0.0483  -0.0401 318 HOH A O   
2291 O  O   . HOH G .   ? 0.1982 0.2309 0.2344 0.0673  0.0330  -0.0003 319 HOH A O   
2292 O  O   . HOH G .   ? 0.1751 0.1325 0.1774 0.0049  -0.0059 -0.0018 320 HOH A O   
2293 O  O   . HOH G .   ? 0.1803 0.1445 0.1933 0.0207  0.0071  -0.0734 321 HOH A O   
2294 O  O   . HOH G .   ? 0.3681 0.2058 0.3115 -0.1637 -0.0677 0.0606  322 HOH A O   
2295 O  O   . HOH G .   ? 0.1841 0.1570 0.2348 -0.0013 0.0848  0.0136  323 HOH A O   
2296 O  O   . HOH G .   ? 0.5051 0.0583 0.2315 -0.0060 -0.0037 0.0551  324 HOH A O   
2297 O  O   . HOH G .   ? 0.2217 0.2099 0.3029 0.0746  -0.0464 0.0114  325 HOH A O   
2298 O  O   . HOH G .   ? 0.1486 0.3629 0.1881 -0.0683 -0.0048 -0.0259 326 HOH A O   
2299 O  O   . HOH G .   ? 0.3080 0.1124 0.3795 -0.0394 0.1761  -0.0578 327 HOH A O   
2300 O  O   . HOH G .   ? 0.2892 0.1760 0.3886 -0.0984 0.0182  -0.0401 328 HOH A O   
2301 O  O   . HOH G .   ? 0.5177 0.1589 0.2955 0.0244  -0.1242 0.0039  329 HOH A O   
2302 O  O   . HOH G .   ? 0.1716 0.1021 0.3078 0.0274  -0.0461 -0.0285 330 HOH A O   
2303 O  O   . HOH G .   ? 0.1719 0.6484 0.1275 -0.2302 -0.0658 0.0376  331 HOH A O   
2304 O  O   . HOH G .   ? 0.1827 0.3536 0.2939 0.0743  0.0695  0.0143  332 HOH A O   
2305 O  O   . HOH G .   ? 0.2415 0.1260 0.6315 0.0713  -0.2253 -0.0725 333 HOH A O   
2306 O  O   . HOH G .   ? 0.4756 0.2523 0.2248 -0.0614 -0.1238 0.0647  334 HOH A O   
2307 O  O   . HOH G .   ? 0.7161 0.6209 0.7076 -0.3834 -0.6552 0.2109  335 HOH A O   
2308 O  O   . HOH G .   ? 0.4478 0.1076 0.5020 0.0523  -0.1584 -0.0653 336 HOH A O   
2309 O  O   . HOH G .   ? 0.2293 0.2840 0.2007 0.0301  -0.0566 0.0334  337 HOH A O   
2310 O  O   . HOH G .   ? 0.2183 0.1604 0.3008 -0.0076 -0.0428 -0.0063 338 HOH A O   
2311 O  O   . HOH G .   ? 0.7851 0.5315 0.2790 0.1690  0.1165  0.0685  339 HOH A O   
2312 O  O   . HOH G .   ? 0.2082 0.4529 0.3639 -0.0648 -0.0580 0.0842  340 HOH A O   
2313 O  O   . HOH G .   ? 0.2486 0.2771 0.1706 -0.0319 -0.0296 0.0103  341 HOH A O   
2314 O  O   . HOH G .   ? 0.3320 0.4733 0.2373 0.3044  0.1288  0.0909  342 HOH A O   
2315 O  O   . HOH G .   ? 0.2041 0.3039 0.2453 0.0020  0.0194  -0.0231 343 HOH A O   
2316 O  O   . HOH G .   ? 0.2770 0.1599 0.1339 -0.0771 0.0844  -0.0387 344 HOH A O   
2317 O  O   . HOH G .   ? 0.5388 0.2882 0.3825 0.0330  -0.0281 0.1071  345 HOH A O   
2318 O  O   . HOH G .   ? 0.2950 0.2800 0.4289 0.1705  -0.1743 -0.1483 346 HOH A O   
2319 O  O   . HOH G .   ? 0.6850 0.2135 0.2222 -0.0827 -0.0205 -0.0199 347 HOH A O   
2320 O  O   . HOH G .   ? 0.2639 0.2786 0.4588 -0.0326 -0.1076 0.2180  348 HOH A O   
2321 O  O   . HOH G .   ? 0.2077 0.2518 0.3009 0.0588  -0.0046 0.0203  349 HOH A O   
2322 O  O   . HOH G .   ? 0.2345 0.1743 0.1961 0.0279  0.0460  -0.0121 350 HOH A O   
2323 O  O   . HOH G .   ? 0.2312 0.3064 0.3067 0.0224  -0.0813 -0.0719 351 HOH A O   
2324 O  O   . HOH G .   ? 0.1895 0.2903 0.3881 0.0479  0.0395  -0.0006 352 HOH A O   
2325 O  O   . HOH G .   ? 0.4851 0.3784 0.2261 0.1863  0.1052  -0.0215 353 HOH A O   
2326 O  O   . HOH G .   ? 0.2599 0.1383 0.1866 -0.0865 -0.0213 -0.0127 354 HOH A O   
2327 O  O   . HOH G .   ? 0.2036 0.4553 0.5010 0.0214  -0.0093 0.0945  355 HOH A O   
2328 O  O   . HOH G .   ? 0.2058 0.3548 0.3093 0.1370  0.0198  0.0688  356 HOH A O   
2329 O  O   . HOH G .   ? 0.1499 0.1298 0.3001 0.0293  -0.0191 0.0594  357 HOH A O   
2330 O  O   . HOH G .   ? 0.1543 0.1780 0.1946 -0.0151 -0.0116 0.0540  358 HOH A O   
2331 O  O   . HOH G .   ? 0.2747 0.1828 0.3298 0.0289  -0.0270 -0.1020 359 HOH A O   
2332 O  O   . HOH G .   ? 0.3195 0.2789 0.2609 0.0130  -0.0244 -0.0416 360 HOH A O   
2333 O  O   . HOH G .   ? 0.2119 0.4361 0.2899 0.0034  0.0450  -0.0640 361 HOH A O   
2334 O  O   . HOH G .   ? 0.2466 0.2456 0.3387 -0.0016 -0.0777 -0.0293 362 HOH A O   
2335 O  O   . HOH G .   ? 0.3332 0.1347 0.3586 0.0038  -0.0336 -0.0269 363 HOH A O   
2336 O  O   . HOH G .   ? 0.3921 0.5960 0.2891 0.2582  -0.0433 -0.0714 364 HOH A O   
2337 O  O   . HOH G .   ? 0.2828 0.4609 0.4366 0.1827  -0.1076 -0.1756 365 HOH A O   
2338 O  O   . HOH G .   ? 0.2874 0.1655 0.2760 -0.0032 0.0654  -0.0419 366 HOH A O   
2339 O  O   . HOH G .   ? 0.7061 0.2114 0.6966 0.2091  0.6694  0.1655  367 HOH A O   
2340 O  O   . HOH G .   ? 0.3518 0.1726 0.2064 0.0268  -0.0518 -0.0136 368 HOH A O   
2341 O  O   . HOH G .   ? 0.3005 0.1188 0.5328 0.0183  0.1277  -0.0699 369 HOH A O   
2342 O  O   . HOH G .   ? 0.1670 0.2236 0.3373 0.0676  -0.0176 -0.1170 370 HOH A O   
2343 O  O   . HOH G .   ? 0.8081 0.6161 0.3073 -0.0246 0.1503  0.1246  371 HOH A O   
2344 O  O   . HOH G .   ? 0.3503 0.3207 0.3685 -0.1239 -0.0608 -0.0423 372 HOH A O   
2345 O  O   . HOH G .   ? 0.4111 0.1236 0.4734 0.1465  -0.2443 -0.0964 373 HOH A O   
2346 O  O   . HOH G .   ? 0.2940 0.3862 0.4359 0.1402  -0.0124 0.0260  374 HOH A O   
2347 O  O   . HOH G .   ? 0.4092 0.1946 0.2195 -0.0457 -0.0560 -0.0305 375 HOH A O   
2348 O  O   . HOH G .   ? 0.2407 0.3023 0.5424 0.0599  -0.0420 -0.2895 376 HOH A O   
2349 O  O   . HOH G .   ? 0.3253 0.3205 0.4573 -0.0165 0.1208  -0.1774 377 HOH A O   
2350 O  O   . HOH G .   ? 0.3842 0.2745 0.3583 -0.1125 0.0491  0.1082  378 HOH A O   
2351 O  O   . HOH G .   ? 0.2885 0.2044 0.2278 0.0484  -0.0132 -0.0528 379 HOH A O   
2352 O  O   . HOH G .   ? 0.2610 0.3612 0.2852 0.0619  0.0754  -0.0517 380 HOH A O   
2353 O  O   . HOH G .   ? 0.4401 0.3104 0.6822 -0.1400 0.0968  0.0145  381 HOH A O   
2354 O  O   . HOH G .   ? 0.4763 0.2326 0.3559 0.1080  -0.1358 -0.0674 382 HOH A O   
2355 O  O   . HOH G .   ? 0.4674 0.2025 0.3742 -0.1783 0.0388  0.0570  383 HOH A O   
2356 O  O   . HOH G .   ? 0.3711 0.4218 0.3458 0.1401  0.0084  -0.1088 384 HOH A O   
2357 O  O   . HOH G .   ? 0.3702 0.3526 0.2559 0.1050  -0.0673 -0.1181 385 HOH A O   
2358 O  O   . HOH G .   ? 0.2786 0.2708 0.3137 0.1122  0.0610  0.1209  386 HOH A O   
2359 O  O   . HOH G .   ? 0.2248 0.2709 0.2687 -0.0936 -0.0492 0.0893  387 HOH A O   
2360 O  O   . HOH G .   ? 0.4190 0.2566 0.2580 0.0825  -0.0689 0.0222  388 HOH A O   
2361 O  O   . HOH G .   ? 0.4090 0.2027 0.2429 -0.0405 0.0055  0.0003  389 HOH A O   
2362 O  O   . HOH G .   ? 0.3975 0.0898 0.4198 0.0752  -0.1132 0.0542  390 HOH A O   
2363 O  O   . HOH G .   ? 0.2812 0.3191 0.2159 0.0559  0.0162  0.1325  391 HOH A O   
2364 O  O   . HOH G .   ? 0.3875 0.2930 0.3656 -0.1236 -0.0500 0.0847  392 HOH A O   
2365 O  O   . HOH G .   ? 0.2606 0.4191 0.3585 -0.1456 0.0000  0.0184  393 HOH A O   
2366 O  O   . HOH G .   ? 0.5379 0.5319 0.2004 -0.0200 0.0691  0.0221  394 HOH A O   
2367 O  O   . HOH G .   ? 0.8041 0.3116 0.3547 0.1126  -0.0809 -0.0864 395 HOH A O   
2368 O  O   . HOH G .   ? 0.2578 0.1612 0.4164 -0.0389 0.0390  0.0574  396 HOH A O   
2369 O  O   . HOH G .   ? 0.2579 0.1768 0.3130 -0.0082 -0.1209 0.0411  397 HOH A O   
2370 O  O   . HOH G .   ? 0.4330 0.1913 0.3817 -0.0198 0.1246  -0.0566 398 HOH A O   
2371 O  O   . HOH G .   ? 0.3783 0.4152 0.4659 0.1910  0.0980  -0.0276 399 HOH A O   
2372 O  O   . HOH G .   ? 0.4415 0.2761 0.2455 -0.0060 0.1221  0.0048  400 HOH A O   
2373 O  O   . HOH G .   ? 0.2500 0.3770 0.3235 0.0673  0.1326  0.0555  401 HOH A O   
2374 O  O   . HOH G .   ? 0.1315 0.2797 0.5807 0.1430  -0.1123 -0.1513 402 HOH A O   
2375 O  O   . HOH G .   ? 0.4078 0.5203 0.5629 -0.0130 0.1476  -0.1905 403 HOH A O   
2376 O  O   . HOH G .   ? 0.5271 0.6193 0.6547 0.1888  -0.3003 -0.0333 404 HOH A O   
2377 O  O   . HOH G .   ? 0.3657 0.1799 0.3892 0.0314  -0.0308 0.0630  405 HOH A O   
2378 O  O   . HOH G .   ? 0.3806 0.6414 0.7021 0.1188  0.0822  -0.0711 406 HOH A O   
2379 O  O   . HOH G .   ? 0.2538 0.3718 0.3184 -0.0410 -0.0237 -0.0368 407 HOH A O   
2380 O  O   . HOH G .   ? 0.2597 0.3611 0.2623 -0.0017 -0.0578 -0.0704 408 HOH A O   
2381 O  O   . HOH G .   ? 0.3826 0.3099 0.4379 0.0410  0.0192  0.0989  409 HOH A O   
2382 O  O   . HOH G .   ? 0.7024 0.3209 0.5436 0.0758  -0.0827 0.0633  410 HOH A O   
2383 O  O   . HOH G .   ? 0.1769 0.2984 0.6013 0.0173  -0.0312 -0.0189 411 HOH A O   
2384 O  O   . HOH G .   ? 0.4072 0.1584 0.3597 0.0860  -0.0213 0.1036  412 HOH A O   
2385 O  O   . HOH G .   ? 0.4346 0.2510 0.6495 -0.0397 0.1625  -0.0954 413 HOH A O   
2386 O  O   . HOH G .   ? 0.4154 0.3011 0.3496 0.1329  -0.1550 -0.0066 414 HOH A O   
2387 O  O   . HOH G .   ? 0.4835 0.3223 0.7827 -0.1777 -0.1563 -0.0126 415 HOH A O   
2388 O  O   . HOH G .   ? 0.4107 0.5399 0.4416 -0.2047 -0.1442 0.0379  416 HOH A O   
2389 O  O   . HOH G .   ? 0.4074 0.4978 0.3547 -0.1375 -0.1183 0.0008  417 HOH A O   
2390 O  O   . HOH G .   ? 0.6860 0.1645 0.3398 0.2378  0.1005  0.0292  418 HOH A O   
2391 O  O   . HOH G .   ? 0.4590 0.3625 0.3860 -0.1243 0.0562  -0.2161 419 HOH A O   
2392 O  O   . HOH G .   ? 0.6260 0.2731 0.4670 0.1266  0.2619  0.1373  420 HOH A O   
2393 O  O   . HOH G .   ? 0.2626 0.1901 0.2427 -0.0620 0.0358  0.0124  421 HOH A O   
2394 O  O   . HOH G .   ? 0.4847 0.2566 0.3787 -0.1274 0.1248  -0.0202 422 HOH A O   
2395 O  O   . HOH G .   ? 0.4729 0.3615 0.3372 -0.0670 -0.1564 0.0799  423 HOH A O   
2396 O  O   . HOH G .   ? 0.4162 0.3725 0.5507 -0.1817 0.0569  -0.0262 424 HOH A O   
2397 O  O   . HOH G .   ? 0.6889 0.2895 0.4551 -0.0854 -0.2855 0.0364  425 HOH A O   
2398 O  O   . HOH G .   ? 0.3389 0.3419 0.2065 -0.1098 0.0186  -0.0539 426 HOH A O   
2399 O  O   . HOH G .   ? 0.2787 0.2782 0.3640 0.1343  0.0513  -0.0873 427 HOH A O   
2400 O  O   . HOH G .   ? 0.4628 0.2879 0.3528 -0.0168 -0.0704 -0.0521 428 HOH A O   
2401 O  O   . HOH G .   ? 0.3971 0.4941 0.3131 -0.2519 0.0387  -0.1364 429 HOH A O   
2402 O  O   . HOH G .   ? 0.2769 0.3176 0.2555 -0.0420 -0.0151 -0.0513 430 HOH A O   
2403 O  O   . HOH G .   ? 0.4985 0.2980 0.3650 -0.1278 0.0080  -0.0770 431 HOH A O   
2404 O  O   . HOH G .   ? 0.4221 0.3345 0.5299 -0.1207 -0.1016 0.0691  432 HOH A O   
2405 O  O   . HOH G .   ? 0.4801 0.2482 0.2707 0.1424  -0.0564 0.0339  433 HOH A O   
2406 O  O   . HOH G .   ? 0.3041 0.2200 0.4416 -0.0575 -0.0136 0.0233  434 HOH A O   
2407 O  O   . HOH G .   ? 0.2851 0.1715 0.4091 0.0637  -0.0156 0.0519  435 HOH A O   
2408 O  O   . HOH G .   ? 0.4189 0.3030 0.4127 0.0924  -0.0661 -0.2205 436 HOH A O   
2409 O  O   . HOH G .   ? 0.3745 0.2228 0.4255 -0.0112 -0.0172 -0.0358 437 HOH A O   
2410 O  O   . HOH G .   ? 0.2908 0.4730 0.5119 -0.1780 0.2428  0.0395  438 HOH A O   
2411 O  O   . HOH G .   ? 0.4178 0.3236 0.4024 -0.0111 0.0241  -0.1048 439 HOH A O   
2412 O  O   . HOH G .   ? 0.3449 0.3611 0.3486 0.0252  -0.0842 -0.2072 440 HOH A O   
2413 O  O   . HOH G .   ? 0.3062 0.2100 0.8102 0.1053  0.0319  -0.0712 441 HOH A O   
2414 O  O   . HOH G .   ? 0.4317 0.3819 0.2489 0.0330  -0.0210 0.0632  442 HOH A O   
2415 O  O   . HOH G .   ? 0.2904 1.7029 0.4328 0.2196  -0.0816 0.3861  443 HOH A O   
2416 O  O   . HOH G .   ? 0.5370 0.4701 0.5684 0.1862  -0.0086 0.1680  444 HOH A O   
2417 O  O   . HOH G .   ? 0.4566 0.6795 0.2988 -0.2320 -0.1586 0.1037  445 HOH A O   
2418 O  O   . HOH G .   ? 0.4449 0.3208 0.3744 -0.0401 -0.0545 -0.0307 446 HOH A O   
2419 O  O   . HOH G .   ? 0.3066 0.4022 0.3839 -0.0125 -0.0307 -0.1081 447 HOH A O   
2420 O  O   . HOH G .   ? 0.6779 0.6926 0.3818 -0.0704 0.2346  0.0536  448 HOH A O   
2421 O  O   . HOH G .   ? 0.4371 0.3189 0.5683 -0.0793 0.2947  -0.1858 449 HOH A O   
2422 O  O   . HOH G .   ? 0.2509 0.3898 0.1829 -0.0821 -0.0245 0.0022  450 HOH A O   
2423 O  O   . HOH G .   ? 0.2776 0.5053 0.2694 -0.1268 0.0183  -0.0118 451 HOH A O   
2424 O  O   . HOH G .   ? 0.3047 0.7130 0.3949 -0.1410 -0.0951 0.0527  452 HOH A O   
2425 O  O   . HOH G .   ? 0.5107 0.5745 0.9336 0.3792  0.4822  0.4572  453 HOH A O   
2426 O  O   . HOH G .   ? 0.5314 0.2534 0.3576 0.1644  0.1501  0.0862  454 HOH A O   
2427 O  O   . HOH G .   ? 0.3536 0.5427 0.3826 -0.0234 0.0227  -0.0898 455 HOH A O   
2428 O  O   . HOH G .   ? 0.3825 0.6076 0.4818 0.1933  -0.1462 -0.2008 456 HOH A O   
2429 O  O   . HOH G .   ? 0.2334 0.3094 0.4882 -0.0426 0.1077  -0.1363 457 HOH A O   
2430 O  O   . HOH G .   ? 0.4180 0.4636 0.9006 -0.0758 0.0464  0.1726  458 HOH A O   
2431 O  O   . HOH G .   ? 0.4143 0.3714 0.6612 -0.1138 0.1152  -0.0014 459 HOH A O   
2432 O  O   . HOH G .   ? 0.2794 0.5200 0.4009 0.1054  0.0723  -0.1676 460 HOH A O   
2433 O  O   . HOH G .   ? 0.6649 0.7888 0.7372 0.2713  0.4467  0.6646  461 HOH A O   
2434 O  O   . HOH G .   ? 0.3841 0.3943 0.5420 0.1956  0.3497  0.2414  462 HOH A O   
2435 O  O   . HOH G .   ? 0.2557 0.2985 0.4109 0.1028  -0.0222 0.0042  463 HOH A O   
2436 O  O   . HOH G .   ? 0.5354 0.2378 0.2496 0.1339  -0.0107 0.0176  464 HOH A O   
2437 O  O   . HOH G .   ? 0.4796 0.5171 0.3404 0.2565  -0.1501 -0.1192 465 HOH A O   
2438 O  O   . HOH G .   ? 0.6287 0.3256 0.2642 0.2298  0.1264  0.0317  466 HOH A O   
2439 O  O   . HOH G .   ? 0.4416 0.3914 1.2071 0.1450  -0.0266 -0.0186 467 HOH A O   
2440 O  O   . HOH G .   ? 0.7193 0.2248 0.4311 -0.1815 0.0680  0.0174  468 HOH A O   
2441 O  O   . HOH G .   ? 0.2988 0.2414 0.8713 -0.0035 -0.0356 0.0092  469 HOH A O   
2442 O  O   . HOH G .   ? 0.4003 0.2314 0.3219 -0.0171 -0.0028 -0.0018 470 HOH A O   
2443 O  O   . HOH G .   ? 0.4284 0.4983 0.2877 -0.2458 -0.1153 0.0812  471 HOH A O   
2444 O  O   . HOH G .   ? 0.4318 0.4330 0.3912 0.0617  0.0838  0.2059  472 HOH A O   
2445 O  O   . HOH G .   ? 0.3500 0.2291 0.3205 0.0128  0.0431  -0.0280 473 HOH A O   
2446 O  O   . HOH G .   ? 0.5860 0.3891 0.4598 -0.2266 0.1689  -0.1036 474 HOH A O   
2447 O  O   . HOH G .   ? 0.4032 0.2526 0.4961 0.0478  -0.1070 -0.1283 475 HOH A O   
2448 O  O   . HOH G .   ? 0.1982 0.1542 1.0426 0.0353  0.3077  0.1567  476 HOH A O   
2449 O  O   . HOH G .   ? 0.2167 0.0833 0.2607 0.0602  0.0377  0.0639  477 HOH A O   
2450 O  O   . HOH G .   ? 0.5350 0.2508 0.3749 0.1812  -0.1929 -0.1135 478 HOH A O   
2451 O  O   . HOH G .   ? 0.7990 0.2122 0.5270 -0.0344 -0.1871 0.0600  479 HOH A O   
2452 O  O   . HOH G .   ? 0.3270 0.4502 0.4944 0.0651  -0.1306 -0.1469 480 HOH A O   
2453 O  O   . HOH G .   ? 0.2291 0.3043 0.3709 0.1100  -0.0091 -0.0367 481 HOH A O   
2454 O  O   . HOH G .   ? 0.2092 0.4644 0.2295 -0.0064 0.0498  0.0815  482 HOH A O   
2455 O  O   . HOH G .   ? 0.3673 0.1549 0.4155 -0.0400 0.1925  -0.0356 483 HOH A O   
2456 O  O   . HOH G .   ? 0.4058 0.2423 0.3671 -0.0195 0.0768  -0.0989 484 HOH A O   
2457 O  O   . HOH G .   ? 0.2725 0.2822 0.3700 0.0090  -0.0489 -0.0954 485 HOH A O   
2458 O  O   . HOH G .   ? 0.6729 0.3193 0.4309 0.1311  -0.2815 -0.0329 486 HOH A O   
2459 O  O   . HOH G .   ? 0.2370 0.5055 0.2663 0.0278  0.0223  0.1222  487 HOH A O   
2460 O  O   . HOH G .   ? 0.7570 0.8387 0.5671 -0.3453 0.4735  -0.6147 488 HOH A O   
2461 O  O   . HOH G .   ? 0.4698 0.6288 0.2679 0.0574  0.0246  -0.1230 489 HOH A O   
2462 O  O   . HOH G .   ? 0.0607 0.0417 0.0760 0.0076  -0.0027 0.0267  490 HOH A O   
2463 O  O   . HOH G .   ? 0.2504 0.5182 0.4550 0.0060  -0.1176 0.2516  491 HOH A O   
2464 O  O   . HOH H .   ? 0.3894 0.3515 0.1590 0.0476  -0.0276 0.0697  35  HOH P O   
2465 O  O   . HOH H .   ? 0.1970 0.0604 0.2201 -0.0002 0.0209  0.0008  38  HOH P O   
2466 O  O   . HOH H .   ? 0.4480 0.1254 0.3962 -0.1154 -0.2299 0.1492  72  HOH P O   
2467 O  O   . HOH H .   ? 0.3694 0.1471 0.4113 0.0319  -0.0396 -0.0543 73  HOH P O   
2468 O  O   . HOH H .   ? 0.4545 0.1471 0.2703 0.0794  -0.1562 0.0394  132 HOH P O   
2469 O  O   . HOH H .   ? 0.6521 0.3616 0.4511 -0.2188 0.1417  -0.0789 160 HOH P O   
2470 O  O   . HOH H .   ? 0.4961 0.2005 0.2467 -0.0097 0.0901  0.0782  172 HOH P O   
2471 O  O   . HOH H .   ? 0.6204 0.2953 0.3095 -0.2017 0.0704  0.0334  187 HOH P O   
2472 O  O   . HOH H .   ? 0.6718 0.3271 0.3177 -0.1522 -0.1005 0.0495  209 HOH P O   
2473 O  O   . HOH H .   ? 0.4963 0.3022 0.8021 -0.1342 0.1316  -0.1361 230 HOH P O   
2474 O  O   . HOH H .   ? 0.3412 0.1642 0.2032 0.0054  -0.1184 -0.0205 492 HOH P O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -4  -4  GLY GLY A . n 
A 1 2   ALA 2   -3  -3  ALA ALA A . n 
A 1 3   MET 3   -2  -2  MET MET A . n 
A 1 4   GLY 4   -1  -1  GLY GLY A . n 
A 1 5   SER 5   0   0   SER SER A . n 
A 1 6   MET 6   1   1   MET MET A . n 
A 1 7   GLU 7   2   2   GLU GLU A . n 
A 1 8   ARG 8   3   3   ARG ARG A . n 
A 1 9   ALA 9   4   4   ALA ALA A . n 
A 1 10  SER 10  5   5   SER SER A . n 
A 1 11  LEU 11  6   6   LEU LEU A . n 
A 1 12  ILE 12  7   7   ILE ILE A . n 
A 1 13  GLN 13  8   8   GLN GLN A . n 
A 1 14  LYS 14  9   9   LYS LYS A . n 
A 1 15  ALA 15  10  10  ALA ALA A . n 
A 1 16  LYS 16  11  11  LYS LYS A . n 
A 1 17  LEU 17  12  12  LEU LEU A . n 
A 1 18  ALA 18  13  13  ALA ALA A . n 
A 1 19  GLU 19  14  14  GLU GLU A . n 
A 1 20  GLN 20  15  15  GLN GLN A . n 
A 1 21  ALA 21  16  16  ALA ALA A . n 
A 1 22  GLU 22  17  17  GLU GLU A . n 
A 1 23  ARG 23  18  18  ARG ARG A . n 
A 1 24  TYR 24  19  19  TYR TYR A . n 
A 1 25  GLU 25  20  20  GLU GLU A . n 
A 1 26  ASP 26  21  21  ASP ASP A . n 
A 1 27  MET 27  22  22  MET MET A . n 
A 1 28  ALA 28  23  23  ALA ALA A . n 
A 1 29  ALA 29  24  24  ALA ALA A . n 
A 1 30  PHE 30  25  25  PHE PHE A . n 
A 1 31  MET 31  26  26  MET MET A . n 
A 1 32  LYS 32  27  27  LYS LYS A . n 
A 1 33  GLY 33  28  28  GLY GLY A . n 
A 1 34  ALA 34  29  29  ALA ALA A . n 
A 1 35  VAL 35  30  30  VAL VAL A . n 
A 1 36  GLU 36  31  31  GLU GLU A . n 
A 1 37  LYS 37  32  32  LYS LYS A . n 
A 1 38  GLY 38  33  33  GLY GLY A . n 
A 1 39  GLU 39  34  34  GLU GLU A . n 
A 1 40  GLU 40  35  35  GLU GLU A . n 
A 1 41  LEU 41  36  36  LEU LEU A . n 
A 1 42  SER 42  37  37  SER SER A . n 
A 1 43  VAL 43  38  38  VAL VAL A . n 
A 1 44  GLU 44  39  39  GLU GLU A . n 
A 1 45  GLU 45  40  40  GLU GLU A . n 
A 1 46  ARG 46  41  41  ARG ARG A . n 
A 1 47  ASN 47  42  42  ASN ASN A . n 
A 1 48  LEU 48  43  43  LEU LEU A . n 
A 1 49  LEU 49  44  44  LEU LEU A . n 
A 1 50  SER 50  45  45  SER SER A . n 
A 1 51  VAL 51  46  46  VAL VAL A . n 
A 1 52  ALA 52  47  47  ALA ALA A . n 
A 1 53  TYR 53  48  48  TYR TYR A . n 
A 1 54  LYS 54  49  49  LYS LYS A . n 
A 1 55  ASN 55  50  50  ASN ASN A . n 
A 1 56  VAL 56  51  51  VAL VAL A . n 
A 1 57  VAL 57  52  52  VAL VAL A . n 
A 1 58  GLY 58  53  53  GLY GLY A . n 
A 1 59  GLY 59  54  54  GLY GLY A . n 
A 1 60  GLN 60  55  55  GLN GLN A . n 
A 1 61  ARG 61  56  56  ARG ARG A . n 
A 1 62  ALA 62  57  57  ALA ALA A . n 
A 1 63  ALA 63  58  58  ALA ALA A . n 
A 1 64  TRP 64  59  59  TRP TRP A . n 
A 1 65  ARG 65  60  60  ARG ARG A . n 
A 1 66  VAL 66  61  61  VAL VAL A . n 
A 1 67  LEU 67  62  62  LEU LEU A . n 
A 1 68  SER 68  63  63  SER SER A . n 
A 1 69  SER 69  64  64  SER SER A . n 
A 1 70  ILE 70  65  65  ILE ILE A . n 
A 1 71  GLU 71  66  66  GLU GLU A . n 
A 1 72  GLN 72  67  67  GLN GLN A . n 
A 1 73  LYS 73  68  68  LYS LYS A . n 
A 1 74  SER 74  69  69  SER SER A . n 
A 1 75  ASN 75  70  70  ASN ASN A . n 
A 1 76  GLU 76  71  71  GLU GLU A . n 
A 1 77  GLU 77  72  72  GLU GLU A . n 
A 1 78  GLY 78  73  73  GLY GLY A . n 
A 1 79  SER 79  74  74  SER SER A . n 
A 1 80  GLU 80  75  75  GLU GLU A . n 
A 1 81  GLU 81  76  76  GLU GLU A . n 
A 1 82  LYS 82  77  77  LYS LYS A . n 
A 1 83  GLY 83  78  78  GLY GLY A . n 
A 1 84  PRO 84  79  79  PRO PRO A . n 
A 1 85  GLU 85  80  80  GLU GLU A . n 
A 1 86  VAL 86  81  81  VAL VAL A . n 
A 1 87  ARG 87  82  82  ARG ARG A . n 
A 1 88  GLU 88  83  83  GLU GLU A . n 
A 1 89  TYR 89  84  84  TYR TYR A . n 
A 1 90  ARG 90  85  85  ARG ARG A . n 
A 1 91  GLU 91  86  86  GLU GLU A . n 
A 1 92  LYS 92  87  87  LYS LYS A . n 
A 1 93  VAL 93  88  88  VAL VAL A . n 
A 1 94  GLU 94  89  89  GLU GLU A . n 
A 1 95  THR 95  90  90  THR THR A . n 
A 1 96  GLU 96  91  91  GLU GLU A . n 
A 1 97  LEU 97  92  92  LEU LEU A . n 
A 1 98  GLN 98  93  93  GLN GLN A . n 
A 1 99  GLY 99  94  94  GLY GLY A . n 
A 1 100 VAL 100 95  95  VAL VAL A . n 
A 1 101 CYS 101 96  96  CYS CYS A . n 
A 1 102 ASP 102 97  97  ASP ASP A . n 
A 1 103 THR 103 98  98  THR THR A . n 
A 1 104 VAL 104 99  99  VAL VAL A . n 
A 1 105 LEU 105 100 100 LEU LEU A . n 
A 1 106 GLY 106 101 101 GLY GLY A . n 
A 1 107 LEU 107 102 102 LEU LEU A . n 
A 1 108 LEU 108 103 103 LEU LEU A . n 
A 1 109 ASP 109 104 104 ASP ASP A . n 
A 1 110 SER 110 105 105 SER SER A . n 
A 1 111 HIS 111 106 106 HIS HIS A . n 
A 1 112 LEU 112 107 107 LEU LEU A . n 
A 1 113 ILE 113 108 108 ILE ILE A . n 
A 1 114 LYS 114 109 109 LYS LYS A . n 
A 1 115 GLU 115 110 110 GLU GLU A . n 
A 1 116 ALA 116 111 111 ALA ALA A . n 
A 1 117 GLY 117 112 112 GLY GLY A . n 
A 1 118 ASP 118 113 113 ASP ASP A . n 
A 1 119 ALA 119 114 114 ALA ALA A . n 
A 1 120 GLU 120 115 115 GLU GLU A . n 
A 1 121 SER 121 116 116 SER SER A . n 
A 1 122 ARG 122 117 117 ARG ARG A . n 
A 1 123 VAL 123 118 118 VAL VAL A . n 
A 1 124 PHE 124 119 119 PHE PHE A . n 
A 1 125 TYR 125 120 120 TYR TYR A . n 
A 1 126 LEU 126 121 121 LEU LEU A . n 
A 1 127 LYS 127 122 122 LYS LYS A . n 
A 1 128 MET 128 123 123 MET MET A . n 
A 1 129 LYS 129 124 124 LYS LYS A . n 
A 1 130 GLY 130 125 125 GLY GLY A . n 
A 1 131 ASP 131 126 126 ASP ASP A . n 
A 1 132 TYR 132 127 127 TYR TYR A . n 
A 1 133 TYR 133 128 128 TYR TYR A . n 
A 1 134 ARG 134 129 129 ARG ARG A . n 
A 1 135 TYR 135 130 130 TYR TYR A . n 
A 1 136 LEU 136 131 131 LEU LEU A . n 
A 1 137 ALA 137 132 132 ALA ALA A . n 
A 1 138 GLU 138 133 133 GLU GLU A . n 
A 1 139 VAL 139 134 134 VAL VAL A . n 
A 1 140 ALA 140 135 135 ALA ALA A . n 
A 1 141 THR 141 136 136 THR THR A . n 
A 1 142 GLY 142 137 137 GLY GLY A . n 
A 1 143 ASP 143 138 138 ASP ASP A . n 
A 1 144 ASP 144 139 139 ASP ASP A . n 
A 1 145 LYS 145 140 140 LYS LYS A . n 
A 1 146 LYS 146 141 141 LYS LYS A . n 
A 1 147 ARG 147 142 142 ARG ARG A . n 
A 1 148 ILE 148 143 143 ILE ILE A . n 
A 1 149 ILE 149 144 144 ILE ILE A . n 
A 1 150 ASP 150 145 145 ASP ASP A . n 
A 1 151 SER 151 146 146 SER SER A . n 
A 1 152 ALA 152 147 147 ALA ALA A . n 
A 1 153 ARG 153 148 148 ARG ARG A . n 
A 1 154 SER 154 149 149 SER SER A . n 
A 1 155 ALA 155 150 150 ALA ALA A . n 
A 1 156 TYR 156 151 151 TYR TYR A . n 
A 1 157 GLN 157 152 152 GLN GLN A . n 
A 1 158 GLU 158 153 153 GLU GLU A . n 
A 1 159 ALA 159 154 154 ALA ALA A . n 
A 1 160 MET 160 155 155 MET MET A . n 
A 1 161 ASP 161 156 156 ASP ASP A . n 
A 1 162 ILE 162 157 157 ILE ILE A . n 
A 1 163 SER 163 158 158 SER SER A . n 
A 1 164 LYS 164 159 159 LYS LYS A . n 
A 1 165 LYS 165 160 160 LYS LYS A . n 
A 1 166 GLU 166 161 161 GLU GLU A . n 
A 1 167 MET 167 162 162 MET MET A . n 
A 1 168 PRO 168 163 163 PRO PRO A . n 
A 1 169 PRO 169 164 164 PRO PRO A . n 
A 1 170 THR 170 165 165 THR THR A . n 
A 1 171 HIS 171 166 166 HIS HIS A . n 
A 1 172 PRO 172 167 167 PRO PRO A . n 
A 1 173 ILE 173 168 168 ILE ILE A . n 
A 1 174 ARG 174 169 169 ARG ARG A . n 
A 1 175 LEU 175 170 170 LEU LEU A . n 
A 1 176 GLY 176 171 171 GLY GLY A . n 
A 1 177 LEU 177 172 172 LEU LEU A . n 
A 1 178 ALA 178 173 173 ALA ALA A . n 
A 1 179 LEU 179 174 174 LEU LEU A . n 
A 1 180 ASN 180 175 175 ASN ASN A . n 
A 1 181 PHE 181 176 176 PHE PHE A . n 
A 1 182 SER 182 177 177 SER SER A . n 
A 1 183 VAL 183 178 178 VAL VAL A . n 
A 1 184 PHE 184 179 179 PHE PHE A . n 
A 1 185 HIS 185 180 180 HIS HIS A . n 
A 1 186 TYR 186 181 181 TYR TYR A . n 
A 1 187 GLU 187 182 182 GLU GLU A . n 
A 1 188 ILE 188 183 183 ILE ILE A . n 
A 1 189 ALA 189 184 184 ALA ALA A . n 
A 1 190 ASN 190 185 185 ASN ASN A . n 
A 1 191 SER 191 186 186 SER SER A . n 
A 1 192 PRO 192 187 187 PRO PRO A . n 
A 1 193 GLU 193 188 188 GLU GLU A . n 
A 1 194 GLU 194 189 189 GLU GLU A . n 
A 1 195 ALA 195 190 190 ALA ALA A . n 
A 1 196 ILE 196 191 191 ILE ILE A . n 
A 1 197 SER 197 192 192 SER SER A . n 
A 1 198 LEU 198 193 193 LEU LEU A . n 
A 1 199 ALA 199 194 194 ALA ALA A . n 
A 1 200 LYS 200 195 195 LYS LYS A . n 
A 1 201 THR 201 196 196 THR THR A . n 
A 1 202 THR 202 197 197 THR THR A . n 
A 1 203 PHE 203 198 198 PHE PHE A . n 
A 1 204 ASP 204 199 199 ASP ASP A . n 
A 1 205 GLU 205 200 200 GLU GLU A . n 
A 1 206 ALA 206 201 201 ALA ALA A . n 
A 1 207 MET 207 202 202 MET MET A . n 
A 1 208 ALA 208 203 203 ALA ALA A . n 
A 1 209 ASP 209 204 204 ASP ASP A . n 
A 1 210 LEU 210 205 205 LEU LEU A . n 
A 1 211 HIS 211 206 206 HIS HIS A . n 
A 1 212 THR 212 207 207 THR THR A . n 
A 1 213 LEU 213 208 208 LEU LEU A . n 
A 1 214 SER 214 209 209 SER SER A . n 
A 1 215 GLU 215 210 210 GLU GLU A . n 
A 1 216 ASP 216 211 211 ASP ASP A . n 
A 1 217 SER 217 212 212 SER SER A . n 
A 1 218 TYR 218 213 213 TYR TYR A . n 
A 1 219 LYS 219 214 214 LYS LYS A . n 
A 1 220 ASP 220 215 215 ASP ASP A . n 
A 1 221 SER 221 216 216 SER SER A . n 
A 1 222 THR 222 217 217 THR THR A . n 
A 1 223 LEU 223 218 218 LEU LEU A . n 
A 1 224 ILE 224 219 219 ILE ILE A . n 
A 1 225 MET 225 220 220 MET MET A . n 
A 1 226 GLN 226 221 221 GLN GLN A . n 
A 1 227 LEU 227 222 222 LEU LEU A . n 
A 1 228 LEU 228 223 223 LEU LEU A . n 
A 1 229 ARG 229 224 224 ARG ARG A . n 
A 1 230 ASP 230 225 225 ASP ASP A . n 
A 1 231 ASN 231 226 226 ASN ASN A . n 
A 1 232 LEU 232 227 227 LEU LEU A . n 
A 1 233 THR 233 228 228 THR THR A . n 
A 1 234 LEU 234 229 229 LEU LEU A . n 
A 1 235 TRP 235 230 230 TRP TRP A . n 
A 1 236 THR 236 231 231 THR THR A . n 
B 2 1   LYS 1   369 369 LYS LYS P . n 
B 2 2   ARG 2   370 370 ARG ARG P . n 
B 2 3   ARG 3   371 371 ARG ARG P . n 
B 2 4   LYS 4   372 372 LYS LYS P . n 
B 2 5   SEP 5   373 373 SEP SEP P . n 
B 2 6   VAL 6   374 374 VAL VAL P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 FSC 1   249 249 FSC FSC A . 
D 4 CL  1   250 250 CL  CL  A . 
E 5 MG  1   251 251 MG  MG  A . 
F 5 MG  1   252 252 MG  MG  A . 
G 6 HOH 1   253 253 HOH HOH A . 
G 6 HOH 2   254 254 HOH HOH A . 
G 6 HOH 3   255 255 HOH HOH A . 
G 6 HOH 4   256 256 HOH HOH A . 
G 6 HOH 5   257 257 HOH HOH A . 
G 6 HOH 6   258 258 HOH HOH A . 
G 6 HOH 7   259 259 HOH HOH A . 
G 6 HOH 8   260 260 HOH HOH A . 
G 6 HOH 9   261 261 HOH HOH A . 
G 6 HOH 10  262 262 HOH HOH A . 
G 6 HOH 11  263 263 HOH HOH A . 
G 6 HOH 12  264 264 HOH HOH A . 
G 6 HOH 13  265 265 HOH HOH A . 
G 6 HOH 14  266 266 HOH HOH A . 
G 6 HOH 15  267 267 HOH HOH A . 
G 6 HOH 16  268 268 HOH HOH A . 
G 6 HOH 17  269 269 HOH HOH A . 
G 6 HOH 18  270 270 HOH HOH A . 
G 6 HOH 19  271 271 HOH HOH A . 
G 6 HOH 20  272 272 HOH HOH A . 
G 6 HOH 21  273 273 HOH HOH A . 
G 6 HOH 22  274 274 HOH HOH A . 
G 6 HOH 23  275 275 HOH HOH A . 
G 6 HOH 24  276 276 HOH HOH A . 
G 6 HOH 25  277 277 HOH HOH A . 
G 6 HOH 26  278 278 HOH HOH A . 
G 6 HOH 27  279 279 HOH HOH A . 
G 6 HOH 28  280 280 HOH HOH A . 
G 6 HOH 29  281 281 HOH HOH A . 
G 6 HOH 30  282 282 HOH HOH A . 
G 6 HOH 31  283 283 HOH HOH A . 
G 6 HOH 32  284 284 HOH HOH A . 
G 6 HOH 33  285 285 HOH HOH A . 
G 6 HOH 34  286 286 HOH HOH A . 
G 6 HOH 35  287 287 HOH HOH A . 
G 6 HOH 36  288 288 HOH HOH A . 
G 6 HOH 37  289 289 HOH HOH A . 
G 6 HOH 38  290 290 HOH HOH A . 
G 6 HOH 39  291 291 HOH HOH A . 
G 6 HOH 40  292 292 HOH HOH A . 
G 6 HOH 41  293 293 HOH HOH A . 
G 6 HOH 42  294 294 HOH HOH A . 
G 6 HOH 43  295 295 HOH HOH A . 
G 6 HOH 44  296 296 HOH HOH A . 
G 6 HOH 45  297 297 HOH HOH A . 
G 6 HOH 46  298 298 HOH HOH A . 
G 6 HOH 47  299 299 HOH HOH A . 
G 6 HOH 48  300 300 HOH HOH A . 
G 6 HOH 49  301 301 HOH HOH A . 
G 6 HOH 50  302 302 HOH HOH A . 
G 6 HOH 51  303 303 HOH HOH A . 
G 6 HOH 52  304 304 HOH HOH A . 
G 6 HOH 53  305 305 HOH HOH A . 
G 6 HOH 54  306 306 HOH HOH A . 
G 6 HOH 55  307 307 HOH HOH A . 
G 6 HOH 56  308 308 HOH HOH A . 
G 6 HOH 57  309 309 HOH HOH A . 
G 6 HOH 58  310 310 HOH HOH A . 
G 6 HOH 59  311 311 HOH HOH A . 
G 6 HOH 60  312 312 HOH HOH A . 
G 6 HOH 61  313 313 HOH HOH A . 
G 6 HOH 62  314 314 HOH HOH A . 
G 6 HOH 63  315 315 HOH HOH A . 
G 6 HOH 64  316 316 HOH HOH A . 
G 6 HOH 65  317 317 HOH HOH A . 
G 6 HOH 66  318 318 HOH HOH A . 
G 6 HOH 67  319 319 HOH HOH A . 
G 6 HOH 68  320 320 HOH HOH A . 
G 6 HOH 69  321 321 HOH HOH A . 
G 6 HOH 70  322 322 HOH HOH A . 
G 6 HOH 71  323 323 HOH HOH A . 
G 6 HOH 72  324 324 HOH HOH A . 
G 6 HOH 73  325 325 HOH HOH A . 
G 6 HOH 74  326 326 HOH HOH A . 
G 6 HOH 75  327 327 HOH HOH A . 
G 6 HOH 76  328 328 HOH HOH A . 
G 6 HOH 77  329 329 HOH HOH A . 
G 6 HOH 78  330 330 HOH HOH A . 
G 6 HOH 79  331 331 HOH HOH A . 
G 6 HOH 80  332 332 HOH HOH A . 
G 6 HOH 81  333 333 HOH HOH A . 
G 6 HOH 82  334 334 HOH HOH A . 
G 6 HOH 83  335 335 HOH HOH A . 
G 6 HOH 84  336 336 HOH HOH A . 
G 6 HOH 85  337 337 HOH HOH A . 
G 6 HOH 86  338 338 HOH HOH A . 
G 6 HOH 87  339 339 HOH HOH A . 
G 6 HOH 88  340 340 HOH HOH A . 
G 6 HOH 89  341 341 HOH HOH A . 
G 6 HOH 90  342 342 HOH HOH A . 
G 6 HOH 91  343 343 HOH HOH A . 
G 6 HOH 92  344 344 HOH HOH A . 
G 6 HOH 93  345 345 HOH HOH A . 
G 6 HOH 94  346 346 HOH HOH A . 
G 6 HOH 95  347 347 HOH HOH A . 
G 6 HOH 96  348 348 HOH HOH A . 
G 6 HOH 97  349 349 HOH HOH A . 
G 6 HOH 98  350 350 HOH HOH A . 
G 6 HOH 99  351 351 HOH HOH A . 
G 6 HOH 100 352 352 HOH HOH A . 
G 6 HOH 101 353 353 HOH HOH A . 
G 6 HOH 102 354 354 HOH HOH A . 
G 6 HOH 103 355 355 HOH HOH A . 
G 6 HOH 104 356 356 HOH HOH A . 
G 6 HOH 105 357 357 HOH HOH A . 
G 6 HOH 106 358 358 HOH HOH A . 
G 6 HOH 107 359 359 HOH HOH A . 
G 6 HOH 108 360 360 HOH HOH A . 
G 6 HOH 109 361 361 HOH HOH A . 
G 6 HOH 110 362 362 HOH HOH A . 
G 6 HOH 111 363 363 HOH HOH A . 
G 6 HOH 112 364 364 HOH HOH A . 
G 6 HOH 113 365 365 HOH HOH A . 
G 6 HOH 114 366 366 HOH HOH A . 
G 6 HOH 115 367 367 HOH HOH A . 
G 6 HOH 116 368 368 HOH HOH A . 
G 6 HOH 117 369 369 HOH HOH A . 
G 6 HOH 118 370 370 HOH HOH A . 
G 6 HOH 119 371 371 HOH HOH A . 
G 6 HOH 120 372 372 HOH HOH A . 
G 6 HOH 121 373 373 HOH HOH A . 
G 6 HOH 122 374 374 HOH HOH A . 
G 6 HOH 123 375 375 HOH HOH A . 
G 6 HOH 124 376 376 HOH HOH A . 
G 6 HOH 125 377 377 HOH HOH A . 
G 6 HOH 126 378 378 HOH HOH A . 
G 6 HOH 127 379 379 HOH HOH A . 
G 6 HOH 128 380 380 HOH HOH A . 
G 6 HOH 129 381 381 HOH HOH A . 
G 6 HOH 130 382 382 HOH HOH A . 
G 6 HOH 131 383 383 HOH HOH A . 
G 6 HOH 132 384 384 HOH HOH A . 
G 6 HOH 133 385 385 HOH HOH A . 
G 6 HOH 134 386 386 HOH HOH A . 
G 6 HOH 135 387 387 HOH HOH A . 
G 6 HOH 136 388 388 HOH HOH A . 
G 6 HOH 137 389 389 HOH HOH A . 
G 6 HOH 138 390 390 HOH HOH A . 
G 6 HOH 139 391 391 HOH HOH A . 
G 6 HOH 140 392 392 HOH HOH A . 
G 6 HOH 141 393 393 HOH HOH A . 
G 6 HOH 142 394 394 HOH HOH A . 
G 6 HOH 143 395 395 HOH HOH A . 
G 6 HOH 144 396 396 HOH HOH A . 
G 6 HOH 145 397 397 HOH HOH A . 
G 6 HOH 146 398 398 HOH HOH A . 
G 6 HOH 147 399 399 HOH HOH A . 
G 6 HOH 148 400 400 HOH HOH A . 
G 6 HOH 149 401 401 HOH HOH A . 
G 6 HOH 150 402 402 HOH HOH A . 
G 6 HOH 151 403 403 HOH HOH A . 
G 6 HOH 152 404 404 HOH HOH A . 
G 6 HOH 153 405 405 HOH HOH A . 
G 6 HOH 154 406 406 HOH HOH A . 
G 6 HOH 155 407 407 HOH HOH A . 
G 6 HOH 156 408 408 HOH HOH A . 
G 6 HOH 157 409 409 HOH HOH A . 
G 6 HOH 158 410 410 HOH HOH A . 
G 6 HOH 159 411 411 HOH HOH A . 
G 6 HOH 160 412 412 HOH HOH A . 
G 6 HOH 161 413 413 HOH HOH A . 
G 6 HOH 162 414 414 HOH HOH A . 
G 6 HOH 163 415 415 HOH HOH A . 
G 6 HOH 164 416 416 HOH HOH A . 
G 6 HOH 165 417 417 HOH HOH A . 
G 6 HOH 166 418 418 HOH HOH A . 
G 6 HOH 167 419 419 HOH HOH A . 
G 6 HOH 168 420 420 HOH HOH A . 
G 6 HOH 169 421 421 HOH HOH A . 
G 6 HOH 170 422 422 HOH HOH A . 
G 6 HOH 171 423 423 HOH HOH A . 
G 6 HOH 172 424 424 HOH HOH A . 
G 6 HOH 173 425 425 HOH HOH A . 
G 6 HOH 174 426 426 HOH HOH A . 
G 6 HOH 175 427 427 HOH HOH A . 
G 6 HOH 176 428 428 HOH HOH A . 
G 6 HOH 177 429 429 HOH HOH A . 
G 6 HOH 178 430 430 HOH HOH A . 
G 6 HOH 179 431 431 HOH HOH A . 
G 6 HOH 180 432 432 HOH HOH A . 
G 6 HOH 181 433 433 HOH HOH A . 
G 6 HOH 182 434 434 HOH HOH A . 
G 6 HOH 183 435 435 HOH HOH A . 
G 6 HOH 184 436 436 HOH HOH A . 
G 6 HOH 185 437 437 HOH HOH A . 
G 6 HOH 186 438 438 HOH HOH A . 
G 6 HOH 187 439 439 HOH HOH A . 
G 6 HOH 188 440 440 HOH HOH A . 
G 6 HOH 189 441 441 HOH HOH A . 
G 6 HOH 190 442 442 HOH HOH A . 
G 6 HOH 191 443 443 HOH HOH A . 
G 6 HOH 192 444 444 HOH HOH A . 
G 6 HOH 193 445 445 HOH HOH A . 
G 6 HOH 194 446 446 HOH HOH A . 
G 6 HOH 195 447 447 HOH HOH A . 
G 6 HOH 196 448 448 HOH HOH A . 
G 6 HOH 197 449 449 HOH HOH A . 
G 6 HOH 198 450 450 HOH HOH A . 
G 6 HOH 199 451 451 HOH HOH A . 
G 6 HOH 200 452 452 HOH HOH A . 
G 6 HOH 201 453 453 HOH HOH A . 
G 6 HOH 202 454 454 HOH HOH A . 
G 6 HOH 203 455 455 HOH HOH A . 
G 6 HOH 204 456 456 HOH HOH A . 
G 6 HOH 205 457 457 HOH HOH A . 
G 6 HOH 206 458 458 HOH HOH A . 
G 6 HOH 207 459 459 HOH HOH A . 
G 6 HOH 208 460 460 HOH HOH A . 
G 6 HOH 209 461 461 HOH HOH A . 
G 6 HOH 210 462 462 HOH HOH A . 
G 6 HOH 211 463 463 HOH HOH A . 
G 6 HOH 212 464 464 HOH HOH A . 
G 6 HOH 213 465 465 HOH HOH A . 
G 6 HOH 214 466 466 HOH HOH A . 
G 6 HOH 215 467 467 HOH HOH A . 
G 6 HOH 216 468 468 HOH HOH A . 
G 6 HOH 217 469 469 HOH HOH A . 
G 6 HOH 218 470 470 HOH HOH A . 
G 6 HOH 219 471 471 HOH HOH A . 
G 6 HOH 220 472 472 HOH HOH A . 
G 6 HOH 221 473 473 HOH HOH A . 
G 6 HOH 222 474 474 HOH HOH A . 
G 6 HOH 223 475 475 HOH HOH A . 
G 6 HOH 224 476 476 HOH HOH A . 
G 6 HOH 225 477 477 HOH HOH A . 
G 6 HOH 226 478 478 HOH HOH A . 
G 6 HOH 227 479 479 HOH HOH A . 
G 6 HOH 228 480 480 HOH HOH A . 
G 6 HOH 229 481 481 HOH HOH A . 
G 6 HOH 230 482 482 HOH HOH A . 
G 6 HOH 231 483 483 HOH HOH A . 
G 6 HOH 232 484 484 HOH HOH A . 
G 6 HOH 233 485 485 HOH HOH A . 
G 6 HOH 234 486 486 HOH HOH A . 
G 6 HOH 235 487 487 HOH HOH A . 
G 6 HOH 236 488 488 HOH HOH A . 
G 6 HOH 237 489 489 HOH HOH A . 
G 6 HOH 238 490 490 HOH HOH A . 
G 6 HOH 239 491 491 HOH HOH A . 
H 6 HOH 1   35  35  HOH HOH P . 
H 6 HOH 2   38  38  HOH HOH P . 
H 6 HOH 3   72  72  HOH HOH P . 
H 6 HOH 4   73  73  HOH HOH P . 
H 6 HOH 5   132 132 HOH HOH P . 
H 6 HOH 6   160 160 HOH HOH P . 
H 6 HOH 7   172 172 HOH HOH P . 
H 6 HOH 8   187 187 HOH HOH P . 
H 6 HOH 9   209 209 HOH HOH P . 
H 6 HOH 10  230 230 HOH HOH P . 
H 6 HOH 11  492 492 HOH HOH P . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    SEP 
_pdbx_struct_mod_residue.label_seq_id     5 
_pdbx_struct_mod_residue.auth_asym_id     P 
_pdbx_struct_mod_residue.auth_comp_id     SEP 
_pdbx_struct_mod_residue.auth_seq_id      373 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          PHOSPHOSERINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4010  ? 
1 MORE         -11   ? 
1 'SSA (A^2)'  23420 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    MG 
_pdbx_struct_special_symmetry.auth_seq_id     252 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   MG 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O   ? A GLU 166 ? A GLU 161 ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 O ? G HOH . ? A HOH 273 ? 1_555 80.1 ? 
2 O   ? A GLU 166 ? A GLU 161 ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 O ? G HOH . ? A HOH 360 ? 1_555 79.7 ? 
3 O   ? G HOH .   ? A HOH 273 ? 1_555 MG ? E MG . ? A MG 251 ? 1_555 O ? G HOH . ? A HOH 360 ? 1_555 79.1 ? 
4 OE1 ? A GLU 7   ? A GLU 2   ? 1_555 MG ? F MG . ? A MG 252 ? 1_555 O ? G HOH . ? A HOH 355 ? 1_555 79.1 ? 
5 OE1 ? A GLU 7   ? A GLU 2   ? 1_555 MG ? F MG . ? A MG 252 ? 1_555 O ? G HOH . ? A HOH 280 ? 1_555 81.0 ? 
6 O   ? G HOH .   ? A HOH 355 ? 1_555 MG ? F MG . ? A MG 252 ? 1_555 O ? G HOH . ? A HOH 280 ? 1_555 71.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-10-12 
2 'Structure model' 1 1 2017-06-07 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345 'data collection' software ? 1 
PHASER phasing           .        ? 2 
REFMAC refinement        5.5.0102 ? 3 
XDS    'data reduction'  .        ? 4 
XSCALE 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD2 A ASP 145 ? C O A HOH 401 ? ? 1.34 
2 1 OD2 A ASP 215 ? B O A HOH 342 ? ? 1.79 
3 1 OD1 A ASP 145 ? C O A HOH 325 ? ? 1.83 
4 1 OD2 A ASP 215 ? A O A HOH 395 ? ? 2.00 
5 1 O   A HOH 377 ? ? O A HOH 421 ? ? 2.12 
6 1 OG  A SER 64  ? C O A HOH 485 ? ? 2.13 
7 1 OE1 A GLU 86  ? B O A HOH 421 ? ? 2.17 
8 1 OE2 A GLU 153 ? B O A HOH 393 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A ASP 104 ? B CG  A ASP 104 ? B 1.691 1.513 0.178  0.021 N 
2 1 CG A ASP 104 ? B OD2 A ASP 104 ? B 1.387 1.249 0.138  0.023 N 
3 1 CZ A ARG 169 ? B NH1 A ARG 169 ? B 1.417 1.326 0.091  0.013 N 
4 1 CB A GLU 182 ? ? CG  A GLU 182 ? ? 1.375 1.517 -0.142 0.019 N 
5 1 CZ P ARG 370 ? B NH2 P ARG 370 ? B 1.449 1.326 0.123  0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 41  ? ? CZ A ARG 41  ? ? NH1 A ARG 41  ? ? 124.51 120.30 4.21   0.50 N 
2  1 NE  A ARG 41  ? ? CZ A ARG 41  ? ? NH2 A ARG 41  ? ? 117.11 120.30 -3.19  0.50 N 
3  1 NE  A ARG 85  ? ? CZ A ARG 85  ? ? NH2 A ARG 85  ? ? 117.30 120.30 -3.00  0.50 N 
4  1 CB  A ASP 104 ? B CA A ASP 104 ? B C   A ASP 104 ? ? 126.52 110.40 16.12  2.00 N 
5  1 CB  A ASP 104 ? B CG A ASP 104 ? B OD2 A ASP 104 ? B 124.46 118.30 6.16   0.90 N 
6  1 CG  A ARG 117 ? B CD A ARG 117 ? B NE  A ARG 117 ? B 127.67 111.80 15.87  2.10 N 
7  1 CD  A ARG 117 ? B NE A ARG 117 ? B CZ  A ARG 117 ? B 133.18 123.60 9.58   1.40 N 
8  1 NE  A ARG 117 ? B CZ A ARG 117 ? B NH1 A ARG 117 ? B 125.37 120.30 5.07   0.50 N 
9  1 NE  A ARG 117 ? B CZ A ARG 117 ? B NH2 A ARG 117 ? B 117.04 120.30 -3.26  0.50 N 
10 1 NE  A ARG 148 ? B CZ A ARG 148 ? B NH2 A ARG 148 ? B 116.27 120.30 -4.03  0.50 N 
11 1 NH1 A ARG 169 ? B CZ A ARG 169 ? B NH2 A ARG 169 ? B 127.06 119.40 7.66   1.10 N 
12 1 NE  A ARG 169 ? B CZ A ARG 169 ? B NH2 A ARG 169 ? B 114.67 120.30 -5.63  0.50 N 
13 1 C   A LYS 214 ? ? N  A ASP 215 ? ? CA  A ASP 215 ? B 106.47 121.70 -15.23 2.50 Y 
14 1 NE  P ARG 370 ? A CZ P ARG 370 ? A NH1 P ARG 370 ? A 125.13 120.30 4.83   0.50 N 
15 1 NE  P ARG 370 ? B CZ P ARG 370 ? B NH1 P ARG 370 ? B 115.64 120.30 -4.66  0.50 N 
16 1 NE  P ARG 370 ? A CZ P ARG 370 ? A NH2 P ARG 370 ? A 115.08 120.30 -5.22  0.50 N 
17 1 NE  P ARG 370 ? B CZ P ARG 370 ? B NH2 P ARG 370 ? B 125.02 120.30 4.72   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 18  ? ? -102.04 76.05 
2 1 HIS A 106 ? ? -145.58 38.45 
3 1 THR A 136 ? ? -140.84 -4.27 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 68  ? CD  ? A LYS 73  CD  
2  1 Y 1 A LYS 68  ? CE  ? A LYS 73  CE  
3  1 Y 1 A LYS 68  ? NZ  ? A LYS 73  NZ  
4  1 Y 1 A GLU 72  ? CG  ? A GLU 77  CG  
5  1 Y 1 A GLU 72  ? CD  ? A GLU 77  CD  
6  1 Y 1 A GLU 72  ? OE1 ? A GLU 77  OE1 
7  1 Y 1 A GLU 72  ? OE2 ? A GLU 77  OE2 
8  1 Y 1 A LYS 160 ? CD  ? A LYS 165 CD  
9  1 Y 1 A LYS 160 ? CE  ? A LYS 165 CE  
10 1 Y 1 A LYS 160 ? NZ  ? A LYS 165 NZ  
11 1 Y 1 A GLU 210 ? CG  ? A GLU 215 CG  
12 1 Y 1 A GLU 210 ? CD  ? A GLU 215 CD  
13 1 Y 1 A GLU 210 ? OE1 ? A GLU 215 OE1 
14 1 Y 1 A GLU 210 ? OE2 ? A GLU 215 OE2 
15 1 Y 1 A ASP 211 ? CG  ? A ASP 216 CG  
16 1 Y 1 A ASP 211 ? OD1 ? A ASP 216 OD1 
17 1 Y 1 A ASP 211 ? OD2 ? A ASP 216 OD2 
18 1 Y 1 A LYS 214 ? CD  ? A LYS 219 CD  
19 1 Y 1 A LYS 214 ? CE  ? A LYS 219 CE  
20 1 Y 1 A LYS 214 ? NZ  ? A LYS 219 NZ  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 FUSICOCCIN      FSC 
4 'CHLORIDE ION'  CL  
5 'MAGNESIUM ION' MG  
6 water           HOH 
#