data_3P1X
# 
_entry.id   3P1X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3P1X         
RCSB  RCSB061854   
WWPDB D_1000061854 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          HR4527E 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3P1X 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Seetharaman, J.'                                 1  
'Neely, H.'                                       2  
'Wang, D.'                                        3  
'Janjua, H.'                                      4  
'Cunningham, K.'                                  5  
'Owens, L.'                                       6  
'Xiao, R.'                                        7  
'Liu, J.'                                         8  
'Baran, M.C.'                                     9  
'Acton, T.B.'                                     10 
'Montelione, G.T.'                                11 
'Tong, L.'                                        12 
'Hunt, J.F.'                                      13 
'Northeast Structural Genomics Consortium (NESG)' 14 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of DRBM 2 domain of Interleukin enhancer-binding factor 3 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4527E
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Seetharaman, J.'  1  
primary 'Neely, H.'        2  
primary 'Wang, D.'         3  
primary 'Janjua, H.'       4  
primary 'Cunningham, K.'   5  
primary 'Owens, L.'        6  
primary 'Xiao, R.'         7  
primary 'Liu, J.'          8  
primary 'Baran, M.C.'      9  
primary 'Acton, T.B.'      10 
primary 'Montelione, G.T.' 11 
primary 'Tong, L.'         12 
primary 'Hunt, J.F.'       13 
# 
_cell.entry_id           3P1X 
_cell.length_a           107.572 
_cell.length_b           24.384 
_cell.length_c           71.626 
_cell.angle_alpha        90.00 
_cell.angle_beta         124.84 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3P1X 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'Interleukin enhancer-binding factor 3' 8409.390 2   ? ? 'DRBM 2 domain residues 520-594' ? 
2 water   nat water                                   18.015   199 ? ? ?                                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Nuclear factor of activated T-cells 90 kDa, NF-AT-90, Double-stranded RNA-binding protein 76, DRBP76, Translational control protein 80, TCP80, Nuclear factor associated with dsRNA, NFAR, M-phase phosphoprotein 4, MPP4
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;ILTKHGKNPV(MSE)ELNEKRRGLKYELISETGGSHDKRFV(MSE)EVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPD
TPL
;
_entity_poly.pdbx_seq_one_letter_code_can   ILTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPL 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         HR4527E 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ILE n 
1 2  LEU n 
1 3  THR n 
1 4  LYS n 
1 5  HIS n 
1 6  GLY n 
1 7  LYS n 
1 8  ASN n 
1 9  PRO n 
1 10 VAL n 
1 11 MSE n 
1 12 GLU n 
1 13 LEU n 
1 14 ASN n 
1 15 GLU n 
1 16 LYS n 
1 17 ARG n 
1 18 ARG n 
1 19 GLY n 
1 20 LEU n 
1 21 LYS n 
1 22 TYR n 
1 23 GLU n 
1 24 LEU n 
1 25 ILE n 
1 26 SER n 
1 27 GLU n 
1 28 THR n 
1 29 GLY n 
1 30 GLY n 
1 31 SER n 
1 32 HIS n 
1 33 ASP n 
1 34 LYS n 
1 35 ARG n 
1 36 PHE n 
1 37 VAL n 
1 38 MSE n 
1 39 GLU n 
1 40 VAL n 
1 41 GLU n 
1 42 VAL n 
1 43 ASP n 
1 44 GLY n 
1 45 GLN n 
1 46 LYS n 
1 47 PHE n 
1 48 GLN n 
1 49 GLY n 
1 50 ALA n 
1 51 GLY n 
1 52 SER n 
1 53 ASN n 
1 54 LYS n 
1 55 LYS n 
1 56 VAL n 
1 57 ALA n 
1 58 LYS n 
1 59 ALA n 
1 60 TYR n 
1 61 ALA n 
1 62 ALA n 
1 63 LEU n 
1 64 ALA n 
1 65 ALA n 
1 66 LEU n 
1 67 GLU n 
1 68 LYS n 
1 69 LEU n 
1 70 PHE n 
1 71 PRO n 
1 72 ASP n 
1 73 THR n 
1 74 PRO n 
1 75 LEU n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ILF3_HUMAN 
_struct_ref.pdbx_db_accession          Q12906 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ILTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPL 
_struct_ref.pdbx_align_begin           520 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3P1X A 1 ? 75 ? Q12906 520 ? 594 ? 520 594 
2 1 3P1X B 1 ? 75 ? Q12906 520 ? 594 ? 520 594 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3P1X 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.32 
_exptl_crystal.density_percent_sol   47.05 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'0.1M Sodium chloride, 0.1 M  Tris, pH (8, 24% (w/v) PEG 20K, microbatch under oil method, temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4r' 
_diffrn_detector.pdbx_collection_date   2010-09-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirrors 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
# 
_reflns.entry_id                     3P1X 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.3 
_reflns.number_obs                   12584 
_reflns.number_all                   12584 
_reflns.percent_possible_obs         94.0 
_reflns.pdbx_Rmerge_I_obs            0.036 
_reflns.pdbx_Rsym_value              0.039 
_reflns.pdbx_netI_over_sigmaI        33.9 
_reflns.B_iso_Wilson_estimate        16.6 
_reflns.pdbx_redundancy              2.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.34 
_reflns_shell.percent_possible_all   92.1 
_reflns_shell.Rmerge_I_obs           0.064 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3P1X 
_refine.ls_number_reflns_obs                     22466 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               241974.57 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.39 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    95.5 
_refine.ls_R_factor_obs                          0.213 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.213 
_refine.ls_R_factor_R_free                       0.250 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1091 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               31.0 
_refine.aniso_B[1][1]                            -6.23 
_refine.aniso_B[2][2]                            11.33 
_refine.aniso_B[3][3]                            -5.09 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.45 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.4 
_refine.solvent_model_param_bsol                 71.0575 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3P1X 
_refine_analyze.Luzzati_coordinate_error_obs    0.23 
_refine_analyze.Luzzati_sigma_a_obs             0.15 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.30 
_refine_analyze.Luzzati_sigma_a_free            0.23 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        998 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             199 
_refine_hist.number_atoms_total               1197 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        29.39 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.1   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.8  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.73  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   NONE 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             3299 
_refine_ls_shell.R_factor_R_work                  0.234 
_refine_ls_shell.percent_reflns_obs               88.4 
_refine_ls_shell.R_factor_R_free                  0.308 
_refine_ls_shell.R_factor_R_free_error            0.024 
_refine_ls_shell.percent_reflns_R_free            4.8 
_refine_ls_shell.number_reflns_R_free             165 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 protein_rep.param protein.top 
'X-RAY DIFFRACTION' 2 water_rep.param   water.top   
'X-RAY DIFFRACTION' 3 ion.param         ion.top     
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3P1X 
_struct.title                     
;Crystal structure of DRBM 2 domain of Interleukin enhancer-binding factor 3 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4527E
;
_struct.pdbx_descriptor           'Interleukin enhancer-binding factor 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3P1X 
_struct_keywords.pdbx_keywords   'Transcription regulator' 
_struct_keywords.text            
;Structural Genomics, PSI-Biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Transcription regulator
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 8  ? ARG A 17 ? ASN A 527 ARG A 536 1 ? 10 
HELX_P HELX_P2 2 ASN A 53 ? PHE A 70 ? ASN A 572 PHE A 589 1 ? 18 
HELX_P HELX_P3 3 ASN B 8  ? GLU B 15 ? ASN B 527 GLU B 534 1 ? 8  
HELX_P HELX_P4 4 ASN B 53 ? PHE B 70 ? ASN B 572 PHE B 589 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A VAL 10 C ? ? ? 1_555 A MSE 11 N ? ? A VAL 529 A MSE 530 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale2 covale ? ? A MSE 11 C ? ? ? 1_555 A GLU 12 N ? ? A MSE 530 A GLU 531 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3 covale ? ? A VAL 37 C ? ? ? 1_555 A MSE 38 N ? ? A VAL 556 A MSE 557 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale4 covale ? ? A MSE 38 C ? ? ? 1_555 A GLU 39 N ? ? A MSE 557 A GLU 558 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale5 covale ? ? B VAL 10 C ? ? ? 1_555 B MSE 11 N ? ? B VAL 529 B MSE 530 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale6 covale ? ? B MSE 11 C ? ? ? 1_555 B GLU 12 N ? ? B MSE 530 B GLU 531 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale7 covale ? ? B VAL 37 C ? ? ? 1_555 B MSE 38 N ? ? B VAL 556 B MSE 557 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale8 covale ? ? B MSE 38 C ? ? ? 1_555 B GLU 39 N ? ? B MSE 557 B GLU 558 1_555 ? ? ? ? ? ? ? 1.331 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 22 ? THR A 28 ? TYR A 541 THR A 547 
A 2 ARG A 35 ? VAL A 42 ? ARG A 554 VAL A 561 
A 3 GLN A 45 ? GLY A 51 ? GLN A 564 GLY A 570 
B 1 TYR B 22 ? THR B 28 ? TYR B 541 THR B 547 
B 2 ARG B 35 ? VAL B 42 ? ARG B 554 VAL B 561 
B 3 GLN B 45 ? GLY B 51 ? GLN B 564 GLY B 570 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 23 ? N GLU A 542 O GLU A 39 ? O GLU A 558 
A 2 3 N VAL A 42 ? N VAL A 561 O GLN A 45 ? O GLN A 564 
B 1 2 N GLU B 23 ? N GLU B 542 O GLU B 39 ? O GLU B 558 
B 2 3 N MSE B 38 ? N MSE B 557 O GLY B 49 ? O GLY B 568 
# 
_database_PDB_matrix.entry_id          3P1X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3P1X 
_atom_sites.fract_transf_matrix[1][1]   0.009296 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006471 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.041010 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017011 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 6  ? -29.404 16.585 -8.684  1.00 60.90 ? 525 GLY A N   1 
ATOM   2    C  CA  . GLY A 1 6  ? -28.509 17.192 -7.655  1.00 55.08 ? 525 GLY A CA  1 
ATOM   3    C  C   . GLY A 1 6  ? -29.285 17.960 -6.605  1.00 48.96 ? 525 GLY A C   1 
ATOM   4    O  O   . GLY A 1 6  ? -30.282 18.606 -6.920  1.00 59.04 ? 525 GLY A O   1 
ATOM   5    N  N   . LYS A 1 7  ? -28.833 17.886 -5.356  1.00 41.22 ? 526 LYS A N   1 
ATOM   6    C  CA  . LYS A 1 7  ? -29.493 18.578 -4.254  1.00 35.93 ? 526 LYS A CA  1 
ATOM   7    C  C   . LYS A 1 7  ? -28.792 18.297 -2.931  1.00 31.27 ? 526 LYS A C   1 
ATOM   8    O  O   . LYS A 1 7  ? -28.739 19.164 -2.060  1.00 35.27 ? 526 LYS A O   1 
ATOM   9    C  CB  . LYS A 1 7  ? -30.965 18.163 -4.168  1.00 44.42 ? 526 LYS A CB  1 
ATOM   10   N  N   . ASN A 1 8  ? -28.254 17.090 -2.772  1.00 20.97 ? 527 ASN A N   1 
ATOM   11   C  CA  . ASN A 1 8  ? -27.560 16.749 -1.535  1.00 16.75 ? 527 ASN A CA  1 
ATOM   12   C  C   . ASN A 1 8  ? -26.048 16.790 -1.767  1.00 14.81 ? 527 ASN A C   1 
ATOM   13   O  O   . ASN A 1 8  ? -25.500 15.959 -2.495  1.00 17.05 ? 527 ASN A O   1 
ATOM   14   C  CB  . ASN A 1 8  ? -27.997 15.357 -1.052  1.00 19.00 ? 527 ASN A CB  1 
ATOM   15   C  CG  . ASN A 1 8  ? -27.387 14.984 0.281   1.00 25.13 ? 527 ASN A CG  1 
ATOM   16   O  OD1 . ASN A 1 8  ? -26.190 14.731 0.375   1.00 22.72 ? 527 ASN A OD1 1 
ATOM   17   N  ND2 . ASN A 1 8  ? -28.209 14.957 1.326   1.00 26.56 ? 527 ASN A ND2 1 
ATOM   18   N  N   . PRO A 1 9  ? -25.354 17.758 -1.138  1.00 10.64 ? 528 PRO A N   1 
ATOM   19   C  CA  . PRO A 1 9  ? -23.903 17.942 -1.260  1.00 14.19 ? 528 PRO A CA  1 
ATOM   20   C  C   . PRO A 1 9  ? -23.071 16.688 -1.036  1.00 14.27 ? 528 PRO A C   1 
ATOM   21   O  O   . PRO A 1 9  ? -22.165 16.392 -1.814  1.00 13.34 ? 528 PRO A O   1 
ATOM   22   C  CB  . PRO A 1 9  ? -23.603 19.033 -0.228  1.00 22.44 ? 528 PRO A CB  1 
ATOM   23   C  CG  . PRO A 1 9  ? -24.858 19.825 -0.210  1.00 21.77 ? 528 PRO A CG  1 
ATOM   24   C  CD  . PRO A 1 9  ? -25.924 18.747 -0.209  1.00 17.09 ? 528 PRO A CD  1 
ATOM   25   N  N   . VAL A 1 10 ? -23.364 15.951 0.029   1.00 16.47 ? 529 VAL A N   1 
ATOM   26   C  CA  . VAL A 1 10 ? -22.607 14.733 0.298   1.00 17.29 ? 529 VAL A CA  1 
ATOM   27   C  C   . VAL A 1 10 ? -22.811 13.747 -0.856  1.00 15.34 ? 529 VAL A C   1 
ATOM   28   O  O   . VAL A 1 10 ? -21.860 13.126 -1.331  1.00 18.08 ? 529 VAL A O   1 
ATOM   29   C  CB  . VAL A 1 10 ? -23.043 14.090 1.638   1.00 19.61 ? 529 VAL A CB  1 
ATOM   30   C  CG1 . VAL A 1 10 ? -22.334 12.764 1.837   1.00 21.67 ? 529 VAL A CG1 1 
ATOM   31   C  CG2 . VAL A 1 10 ? -22.711 15.035 2.792   1.00 27.07 ? 529 VAL A CG2 1 
HETATM 32   N  N   . MSE A 1 11 ? -24.054 13.630 -1.316  1.00 15.73 ? 530 MSE A N   1 
HETATM 33   C  CA  . MSE A 1 11 ? -24.393 12.733 -2.426  1.00 21.51 ? 530 MSE A CA  1 
HETATM 34   C  C   . MSE A 1 11 ? -23.662 13.119 -3.718  1.00 17.73 ? 530 MSE A C   1 
HETATM 35   O  O   . MSE A 1 11 ? -23.091 12.268 -4.407  1.00 18.89 ? 530 MSE A O   1 
HETATM 36   C  CB  . MSE A 1 11 ? -25.899 12.784 -2.684  1.00 19.55 ? 530 MSE A CB  1 
HETATM 37   C  CG  . MSE A 1 11 ? -26.749 12.262 -1.551  1.00 50.36 ? 530 MSE A CG  1 
HETATM 38   SE SE  . MSE A 1 11 ? -26.963 10.364 -1.702  1.00 55.33 ? 530 MSE A SE  1 
HETATM 39   C  CE  . MSE A 1 11 ? -28.272 10.344 -3.132  1.00 40.31 ? 530 MSE A CE  1 
ATOM   40   N  N   . GLU A 1 12 ? -23.695 14.405 -4.049  1.00 17.32 ? 531 GLU A N   1 
ATOM   41   C  CA  . GLU A 1 12 ? -23.054 14.901 -5.269  1.00 15.77 ? 531 GLU A CA  1 
ATOM   42   C  C   . GLU A 1 12 ? -21.533 14.764 -5.254  1.00 17.23 ? 531 GLU A C   1 
ATOM   43   O  O   . GLU A 1 12 ? -20.919 14.408 -6.268  1.00 20.19 ? 531 GLU A O   1 
ATOM   44   C  CB  . GLU A 1 12 ? -23.440 16.367 -5.505  1.00 14.95 ? 531 GLU A CB  1 
ATOM   45   C  CG  . GLU A 1 12 ? -24.916 16.574 -5.840  1.00 14.11 ? 531 GLU A CG  1 
ATOM   46   C  CD  . GLU A 1 12 ? -25.358 15.747 -7.030  1.00 26.42 ? 531 GLU A CD  1 
ATOM   47   O  OE1 . GLU A 1 12 ? -24.657 15.774 -8.063  1.00 24.14 ? 531 GLU A OE1 1 
ATOM   48   O  OE2 . GLU A 1 12 ? -26.404 15.072 -6.928  1.00 22.05 ? 531 GLU A OE2 1 
ATOM   49   N  N   . LEU A 1 13 ? -20.916 15.043 -4.112  1.00 15.21 ? 532 LEU A N   1 
ATOM   50   C  CA  . LEU A 1 13 ? -19.472 14.927 -4.021  1.00 14.20 ? 532 LEU A CA  1 
ATOM   51   C  C   . LEU A 1 13 ? -19.083 13.459 -4.163  1.00 20.43 ? 532 LEU A C   1 
ATOM   52   O  O   . LEU A 1 13 ? -18.073 13.130 -4.785  1.00 20.32 ? 532 LEU A O   1 
ATOM   53   C  CB  . LEU A 1 13 ? -18.969 15.476 -2.686  1.00 11.15 ? 532 LEU A CB  1 
ATOM   54   C  CG  . LEU A 1 13 ? -17.453 15.439 -2.470  1.00 17.63 ? 532 LEU A CG  1 
ATOM   55   C  CD1 . LEU A 1 13 ? -16.739 16.247 -3.564  1.00 15.33 ? 532 LEU A CD1 1 
ATOM   56   C  CD2 . LEU A 1 13 ? -17.125 15.998 -1.088  1.00 13.05 ? 532 LEU A CD2 1 
ATOM   57   N  N   . ASN A 1 14 ? -19.908 12.586 -3.592  1.00 19.56 ? 533 ASN A N   1 
ATOM   58   C  CA  . ASN A 1 14 ? -19.696 11.142 -3.630  1.00 22.06 ? 533 ASN A CA  1 
ATOM   59   C  C   . ASN A 1 14 ? -19.681 10.642 -5.077  1.00 26.60 ? 533 ASN A C   1 
ATOM   60   O  O   . ASN A 1 14 ? -19.015 9.656  -5.393  1.00 25.95 ? 533 ASN A O   1 
ATOM   61   C  CB  . ASN A 1 14 ? -20.806 10.444 -2.833  1.00 19.71 ? 533 ASN A CB  1 
ATOM   62   C  CG  . ASN A 1 14 ? -20.644 8.934  -2.790  1.00 28.56 ? 533 ASN A CG  1 
ATOM   63   O  OD1 . ASN A 1 14 ? -21.470 8.188  -3.324  1.00 28.39 ? 533 ASN A OD1 1 
ATOM   64   N  ND2 . ASN A 1 14 ? -19.583 8.477  -2.149  1.00 19.50 ? 533 ASN A ND2 1 
ATOM   65   N  N   . GLU A 1 15 ? -20.426 11.316 -5.949  1.00 19.06 ? 534 GLU A N   1 
ATOM   66   C  CA  . GLU A 1 15 ? -20.462 10.948 -7.361  1.00 20.54 ? 534 GLU A CA  1 
ATOM   67   C  C   . GLU A 1 15 ? -19.102 11.248 -7.997  1.00 27.09 ? 534 GLU A C   1 
ATOM   68   O  O   . GLU A 1 15 ? -18.727 10.643 -8.998  1.00 26.74 ? 534 GLU A O   1 
ATOM   69   C  CB  . GLU A 1 15 ? -21.564 11.730 -8.086  1.00 20.80 ? 534 GLU A CB  1 
ATOM   70   C  CG  . GLU A 1 15 ? -22.976 11.268 -7.756  1.00 17.05 ? 534 GLU A CG  1 
ATOM   71   C  CD  . GLU A 1 15 ? -23.262 9.878  -8.295  1.00 25.25 ? 534 GLU A CD  1 
ATOM   72   O  OE1 . GLU A 1 15 ? -23.306 9.717  -9.535  1.00 26.80 ? 534 GLU A OE1 1 
ATOM   73   O  OE2 . GLU A 1 15 ? -23.437 8.947  -7.479  1.00 22.85 ? 534 GLU A OE2 1 
ATOM   74   N  N   . LYS A 1 16 ? -18.361 12.181 -7.408  1.00 25.31 ? 535 LYS A N   1 
ATOM   75   C  CA  . LYS A 1 16 ? -17.051 12.541 -7.938  1.00 25.04 ? 535 LYS A CA  1 
ATOM   76   C  C   . LYS A 1 16 ? -15.920 11.808 -7.224  1.00 29.58 ? 535 LYS A C   1 
ATOM   77   O  O   . LYS A 1 16 ? -14.887 11.514 -7.823  1.00 27.02 ? 535 LYS A O   1 
ATOM   78   C  CB  . LYS A 1 16 ? -16.822 14.051 -7.820  1.00 25.52 ? 535 LYS A CB  1 
ATOM   79   C  CG  . LYS A 1 16 ? -17.794 14.907 -8.621  1.00 27.60 ? 535 LYS A CG  1 
ATOM   80   C  CD  . LYS A 1 16 ? -17.823 14.505 -10.090 1.00 35.93 ? 535 LYS A CD  1 
ATOM   81   C  CE  . LYS A 1 16 ? -18.568 15.536 -10.936 1.00 42.75 ? 535 LYS A CE  1 
ATOM   82   N  NZ  . LYS A 1 16 ? -19.952 15.767 -10.447 1.00 54.59 ? 535 LYS A NZ  1 
ATOM   83   N  N   . ARG A 1 17 ? -16.119 11.519 -5.942  1.00 22.22 ? 536 ARG A N   1 
ATOM   84   C  CA  . ARG A 1 17 ? -15.117 10.829 -5.138  1.00 20.94 ? 536 ARG A CA  1 
ATOM   85   C  C   . ARG A 1 17 ? -15.813 9.898  -4.155  1.00 27.24 ? 536 ARG A C   1 
ATOM   86   O  O   . ARG A 1 17 ? -16.512 10.349 -3.249  1.00 28.59 ? 536 ARG A O   1 
ATOM   87   C  CB  . ARG A 1 17 ? -14.282 11.846 -4.363  1.00 22.50 ? 536 ARG A CB  1 
ATOM   88   C  CG  . ARG A 1 17 ? -13.506 12.830 -5.221  1.00 29.93 ? 536 ARG A CG  1 
ATOM   89   C  CD  . ARG A 1 17 ? -12.259 12.196 -5.816  1.00 29.84 ? 536 ARG A CD  1 
ATOM   90   N  NE  . ARG A 1 17 ? -11.358 13.216 -6.347  1.00 37.20 ? 536 ARG A NE  1 
ATOM   91   C  CZ  . ARG A 1 17 ? -11.517 13.828 -7.517  1.00 32.82 ? 536 ARG A CZ  1 
ATOM   92   N  NH1 . ARG A 1 17 ? -12.542 13.523 -8.299  1.00 28.02 ? 536 ARG A NH1 1 
ATOM   93   N  NH2 . ARG A 1 17 ? -10.658 14.763 -7.893  1.00 42.47 ? 536 ARG A NH2 1 
ATOM   94   N  N   . ARG A 1 18 ? -15.619 8.596  -4.329  1.00 28.62 ? 537 ARG A N   1 
ATOM   95   C  CA  . ARG A 1 18 ? -16.251 7.621  -3.451  1.00 32.09 ? 537 ARG A CA  1 
ATOM   96   C  C   . ARG A 1 18 ? -15.445 7.386  -2.177  1.00 27.84 ? 537 ARG A C   1 
ATOM   97   O  O   . ARG A 1 18 ? -14.261 7.712  -2.108  1.00 32.62 ? 537 ARG A O   1 
ATOM   98   C  CB  . ARG A 1 18 ? -16.446 6.296  -4.198  1.00 31.63 ? 537 ARG A CB  1 
ATOM   99   N  N   . GLY A 1 19 ? -16.111 6.831  -1.169  1.00 32.83 ? 538 GLY A N   1 
ATOM   100  C  CA  . GLY A 1 19 ? -15.464 6.511  0.092   1.00 36.82 ? 538 GLY A CA  1 
ATOM   101  C  C   . GLY A 1 19 ? -14.818 7.625  0.897   1.00 33.03 ? 538 GLY A C   1 
ATOM   102  O  O   . GLY A 1 19 ? -13.885 7.371  1.660   1.00 30.80 ? 538 GLY A O   1 
ATOM   103  N  N   . LEU A 1 20 ? -15.304 8.852  0.750   1.00 34.76 ? 539 LEU A N   1 
ATOM   104  C  CA  . LEU A 1 20 ? -14.741 9.967  1.504   1.00 30.26 ? 539 LEU A CA  1 
ATOM   105  C  C   . LEU A 1 20 ? -15.095 9.836  2.984   1.00 34.61 ? 539 LEU A C   1 
ATOM   106  O  O   . LEU A 1 20 ? -16.179 9.363  3.334   1.00 26.67 ? 539 LEU A O   1 
ATOM   107  C  CB  . LEU A 1 20 ? -15.278 11.302 0.974   1.00 30.75 ? 539 LEU A CB  1 
ATOM   108  C  CG  . LEU A 1 20 ? -14.920 11.679 -0.464  1.00 31.17 ? 539 LEU A CG  1 
ATOM   109  C  CD1 . LEU A 1 20 ? -15.543 13.025 -0.801  1.00 31.20 ? 539 LEU A CD1 1 
ATOM   110  C  CD2 . LEU A 1 20 ? -13.411 11.736 -0.622  1.00 24.25 ? 539 LEU A CD2 1 
ATOM   111  N  N   . LYS A 1 21 ? -14.183 10.267 3.848   1.00 32.95 ? 540 LYS A N   1 
ATOM   112  C  CA  . LYS A 1 21 ? -14.432 10.191 5.275   1.00 30.66 ? 540 LYS A CA  1 
ATOM   113  C  C   . LYS A 1 21 ? -14.669 11.561 5.881   1.00 24.56 ? 540 LYS A C   1 
ATOM   114  O  O   . LYS A 1 21 ? -13.875 12.479 5.683   1.00 27.68 ? 540 LYS A O   1 
ATOM   115  N  N   . TYR A 1 22 ? -15.773 11.705 6.605   1.00 25.59 ? 541 TYR A N   1 
ATOM   116  C  CA  . TYR A 1 22 ? -16.097 12.967 7.252   1.00 23.14 ? 541 TYR A CA  1 
ATOM   117  C  C   . TYR A 1 22 ? -15.759 12.873 8.731   1.00 30.44 ? 541 TYR A C   1 
ATOM   118  O  O   . TYR A 1 22 ? -16.257 11.992 9.442   1.00 27.85 ? 541 TYR A O   1 
ATOM   119  C  CB  . TYR A 1 22 ? -17.578 13.301 7.082   1.00 23.24 ? 541 TYR A CB  1 
ATOM   120  C  CG  . TYR A 1 22 ? -17.947 13.626 5.657   1.00 20.22 ? 541 TYR A CG  1 
ATOM   121  C  CD1 . TYR A 1 22 ? -18.022 12.624 4.689   1.00 21.42 ? 541 TYR A CD1 1 
ATOM   122  C  CD2 . TYR A 1 22 ? -18.185 14.943 5.265   1.00 21.31 ? 541 TYR A CD2 1 
ATOM   123  C  CE1 . TYR A 1 22 ? -18.324 12.926 3.358   1.00 26.21 ? 541 TYR A CE1 1 
ATOM   124  C  CE2 . TYR A 1 22 ? -18.487 15.260 3.938   1.00 22.48 ? 541 TYR A CE2 1 
ATOM   125  C  CZ  . TYR A 1 22 ? -18.553 14.247 2.991   1.00 19.30 ? 541 TYR A CZ  1 
ATOM   126  O  OH  . TYR A 1 22 ? -18.834 14.553 1.678   1.00 23.08 ? 541 TYR A OH  1 
ATOM   127  N  N   . GLU A 1 23 ? -14.921 13.794 9.188   1.00 22.88 ? 542 GLU A N   1 
ATOM   128  C  CA  . GLU A 1 23 ? -14.490 13.816 10.578  1.00 21.03 ? 542 GLU A CA  1 
ATOM   129  C  C   . GLU A 1 23 ? -15.050 14.994 11.362  1.00 24.46 ? 542 GLU A C   1 
ATOM   130  O  O   . GLU A 1 23 ? -15.002 16.141 10.912  1.00 24.97 ? 542 GLU A O   1 
ATOM   131  C  CB  . GLU A 1 23 ? -12.966 13.837 10.639  1.00 23.83 ? 542 GLU A CB  1 
ATOM   132  N  N   . LEU A 1 24 ? -15.593 14.699 12.538  1.00 22.86 ? 543 LEU A N   1 
ATOM   133  C  CA  . LEU A 1 24 ? -16.119 15.738 13.405  1.00 24.46 ? 543 LEU A CA  1 
ATOM   134  C  C   . LEU A 1 24 ? -14.895 16.318 14.093  1.00 29.03 ? 543 LEU A C   1 
ATOM   135  O  O   . LEU A 1 24 ? -14.196 15.617 14.829  1.00 29.92 ? 543 LEU A O   1 
ATOM   136  C  CB  . LEU A 1 24 ? -17.069 15.151 14.455  1.00 21.07 ? 543 LEU A CB  1 
ATOM   137  C  CG  . LEU A 1 24 ? -17.549 16.122 15.534  1.00 24.31 ? 543 LEU A CG  1 
ATOM   138  C  CD1 . LEU A 1 24 ? -18.245 17.323 14.890  1.00 27.06 ? 543 LEU A CD1 1 
ATOM   139  C  CD2 . LEU A 1 24 ? -18.504 15.398 16.471  1.00 30.03 ? 543 LEU A CD2 1 
ATOM   140  N  N   . ILE A 1 25 ? -14.620 17.591 13.847  1.00 22.95 ? 544 ILE A N   1 
ATOM   141  C  CA  . ILE A 1 25 ? -13.463 18.212 14.461  1.00 30.03 ? 544 ILE A CA  1 
ATOM   142  C  C   . ILE A 1 25 ? -13.821 19.179 15.577  1.00 25.81 ? 544 ILE A C   1 
ATOM   143  O  O   . ILE A 1 25 ? -12.952 19.591 16.337  1.00 22.54 ? 544 ILE A O   1 
ATOM   144  C  CB  . ILE A 1 25 ? -12.599 18.938 13.416  1.00 29.64 ? 544 ILE A CB  1 
ATOM   145  C  CG1 . ILE A 1 25 ? -13.425 19.992 12.692  1.00 30.20 ? 544 ILE A CG1 1 
ATOM   146  C  CG2 . ILE A 1 25 ? -12.033 17.929 12.426  1.00 31.25 ? 544 ILE A CG2 1 
ATOM   147  C  CD1 . ILE A 1 25 ? -12.636 20.772 11.669  1.00 33.01 ? 544 ILE A CD1 1 
ATOM   148  N  N   . SER A 1 26 ? -15.096 19.535 15.687  1.00 24.15 ? 545 SER A N   1 
ATOM   149  C  CA  . SER A 1 26 ? -15.505 20.451 16.743  1.00 22.92 ? 545 SER A CA  1 
ATOM   150  C  C   . SER A 1 26 ? -16.956 20.281 17.168  1.00 28.70 ? 545 SER A C   1 
ATOM   151  O  O   . SER A 1 26 ? -17.857 20.157 16.343  1.00 18.58 ? 545 SER A O   1 
ATOM   152  C  CB  . SER A 1 26 ? -15.276 21.900 16.315  1.00 23.39 ? 545 SER A CB  1 
ATOM   153  O  OG  . SER A 1 26 ? -15.572 22.791 17.380  1.00 31.33 ? 545 SER A OG  1 
ATOM   154  N  N   . GLU A 1 27 ? -17.162 20.278 18.477  1.00 20.97 ? 546 GLU A N   1 
ATOM   155  C  CA  . GLU A 1 27 ? -18.485 20.147 19.066  1.00 22.77 ? 546 GLU A CA  1 
ATOM   156  C  C   . GLU A 1 27 ? -18.439 21.019 20.313  1.00 33.80 ? 546 GLU A C   1 
ATOM   157  O  O   . GLU A 1 27 ? -17.803 20.662 21.308  1.00 33.94 ? 546 GLU A O   1 
ATOM   158  C  CB  . GLU A 1 27 ? -18.751 18.680 19.416  1.00 22.58 ? 546 GLU A CB  1 
ATOM   159  C  CG  . GLU A 1 27 ? -20.031 18.417 20.186  1.00 44.50 ? 546 GLU A CG  1 
ATOM   160  C  CD  . GLU A 1 27 ? -20.331 16.932 20.303  1.00 44.21 ? 546 GLU A CD  1 
ATOM   161  O  OE1 . GLU A 1 27 ? -19.394 16.156 20.594  1.00 60.57 ? 546 GLU A OE1 1 
ATOM   162  O  OE2 . GLU A 1 27 ? -21.500 16.541 20.112  1.00 57.06 ? 546 GLU A OE2 1 
ATOM   163  N  N   . THR A 1 28 ? -19.094 22.175 20.246  1.00 29.66 ? 547 THR A N   1 
ATOM   164  C  CA  . THR A 1 28 ? -19.105 23.111 21.368  1.00 32.26 ? 547 THR A CA  1 
ATOM   165  C  C   . THR A 1 28 ? -20.489 23.704 21.624  1.00 38.33 ? 547 THR A C   1 
ATOM   166  O  O   . THR A 1 28 ? -21.443 23.426 20.897  1.00 33.38 ? 547 THR A O   1 
ATOM   167  C  CB  . THR A 1 28 ? -18.127 24.275 21.118  1.00 32.31 ? 547 THR A CB  1 
ATOM   168  O  OG1 . THR A 1 28 ? -18.570 25.035 19.987  1.00 37.67 ? 547 THR A OG1 1 
ATOM   169  C  CG2 . THR A 1 28 ? -16.723 23.744 20.842  1.00 36.17 ? 547 THR A CG2 1 
ATOM   170  N  N   . GLY A 1 29 ? -20.588 24.527 22.663  1.00 41.52 ? 548 GLY A N   1 
ATOM   171  C  CA  . GLY A 1 29 ? -21.853 25.157 22.994  1.00 38.98 ? 548 GLY A CA  1 
ATOM   172  C  C   . GLY A 1 29 ? -22.804 24.278 23.784  1.00 43.42 ? 548 GLY A C   1 
ATOM   173  O  O   . GLY A 1 29 ? -22.709 23.050 23.754  1.00 37.93 ? 548 GLY A O   1 
ATOM   174  N  N   . GLY A 1 30 ? -23.732 24.916 24.492  1.00 52.73 ? 549 GLY A N   1 
ATOM   175  C  CA  . GLY A 1 30 ? -24.696 24.177 25.288  1.00 55.71 ? 549 GLY A CA  1 
ATOM   176  C  C   . GLY A 1 30 ? -25.792 23.551 24.446  1.00 59.18 ? 549 GLY A C   1 
ATOM   177  O  O   . GLY A 1 30 ? -25.850 23.759 23.232  1.00 61.44 ? 549 GLY A O   1 
ATOM   178  N  N   . SER A 1 31 ? -26.664 22.784 25.094  1.00 59.63 ? 550 SER A N   1 
ATOM   179  C  CA  . SER A 1 31 ? -27.756 22.136 24.388  1.00 58.73 ? 550 SER A CA  1 
ATOM   180  C  C   . SER A 1 31 ? -28.730 23.126 23.777  1.00 57.31 ? 550 SER A C   1 
ATOM   181  O  O   . SER A 1 31 ? -29.756 22.735 23.218  1.00 58.57 ? 550 SER A O   1 
ATOM   182  N  N   . HIS A 1 32 ? -28.405 24.411 23.883  1.00 53.97 ? 551 HIS A N   1 
ATOM   183  C  CA  . HIS A 1 32 ? -29.259 25.446 23.331  1.00 51.30 ? 551 HIS A CA  1 
ATOM   184  C  C   . HIS A 1 32 ? -28.506 26.355 22.377  1.00 53.16 ? 551 HIS A C   1 
ATOM   185  O  O   . HIS A 1 32 ? -29.043 27.355 21.902  1.00 51.13 ? 551 HIS A O   1 
ATOM   186  N  N   . ASP A 1 33 ? -27.255 26.005 22.099  1.00 50.69 ? 552 ASP A N   1 
ATOM   187  C  CA  . ASP A 1 33 ? -26.438 26.793 21.193  1.00 46.21 ? 552 ASP A CA  1 
ATOM   188  C  C   . ASP A 1 33 ? -25.320 25.934 20.636  1.00 42.81 ? 552 ASP A C   1 
ATOM   189  O  O   . ASP A 1 33 ? -24.210 26.409 20.390  1.00 44.23 ? 552 ASP A O   1 
ATOM   190  N  N   . LYS A 1 34 ? -25.623 24.654 20.443  1.00 39.52 ? 553 LYS A N   1 
ATOM   191  C  CA  . LYS A 1 34 ? -24.660 23.690 19.926  1.00 33.75 ? 553 LYS A CA  1 
ATOM   192  C  C   . LYS A 1 34 ? -24.137 24.079 18.553  1.00 31.38 ? 553 LYS A C   1 
ATOM   193  O  O   . LYS A 1 34 ? -24.873 24.601 17.718  1.00 31.12 ? 553 LYS A O   1 
ATOM   194  C  CB  . LYS A 1 34 ? -25.295 22.304 19.864  1.00 33.22 ? 553 LYS A CB  1 
ATOM   195  N  N   . ARG A 1 35 ? -22.852 23.828 18.331  1.00 26.97 ? 554 ARG A N   1 
ATOM   196  C  CA  . ARG A 1 35 ? -22.219 24.121 17.056  1.00 25.93 ? 554 ARG A CA  1 
ATOM   197  C  C   . ARG A 1 35 ? -21.300 22.968 16.704  1.00 28.74 ? 554 ARG A C   1 
ATOM   198  O  O   . ARG A 1 35 ? -20.463 22.563 17.509  1.00 30.05 ? 554 ARG A O   1 
ATOM   199  C  CB  . ARG A 1 35 ? -21.414 25.414 17.130  1.00 31.68 ? 554 ARG A CB  1 
ATOM   200  C  CG  . ARG A 1 35 ? -20.671 25.732 15.844  1.00 36.03 ? 554 ARG A CG  1 
ATOM   201  C  CD  . ARG A 1 35 ? -20.162 27.157 15.843  1.00 40.77 ? 554 ARG A CD  1 
ATOM   202  N  NE  . ARG A 1 35 ? -19.391 27.457 14.642  1.00 46.83 ? 554 ARG A NE  1 
ATOM   203  C  CZ  . ARG A 1 35 ? -18.154 27.026 14.421  1.00 50.87 ? 554 ARG A CZ  1 
ATOM   204  N  NH1 . ARG A 1 35 ? -17.540 26.272 15.323  1.00 49.84 ? 554 ARG A NH1 1 
ATOM   205  N  NH2 . ARG A 1 35 ? -17.530 27.353 13.297  1.00 61.47 ? 554 ARG A NH2 1 
ATOM   206  N  N   . PHE A 1 36 ? -21.473 22.432 15.503  1.00 23.02 ? 555 PHE A N   1 
ATOM   207  C  CA  . PHE A 1 36 ? -20.664 21.319 15.035  1.00 18.34 ? 555 PHE A CA  1 
ATOM   208  C  C   . PHE A 1 36 ? -19.842 21.756 13.841  1.00 21.51 ? 555 PHE A C   1 
ATOM   209  O  O   . PHE A 1 36 ? -20.300 22.559 13.029  1.00 22.00 ? 555 PHE A O   1 
ATOM   210  C  CB  . PHE A 1 36 ? -21.554 20.157 14.581  1.00 21.24 ? 555 PHE A CB  1 
ATOM   211  C  CG  . PHE A 1 36 ? -22.258 19.455 15.694  1.00 22.86 ? 555 PHE A CG  1 
ATOM   212  C  CD1 . PHE A 1 36 ? -21.605 18.477 16.435  1.00 29.14 ? 555 PHE A CD1 1 
ATOM   213  C  CD2 . PHE A 1 36 ? -23.578 19.768 16.003  1.00 30.73 ? 555 PHE A CD2 1 
ATOM   214  C  CE1 . PHE A 1 36 ? -22.257 17.814 17.470  1.00 25.64 ? 555 PHE A CE1 1 
ATOM   215  C  CE2 . PHE A 1 36 ? -24.244 19.111 17.040  1.00 30.45 ? 555 PHE A CE2 1 
ATOM   216  C  CZ  . PHE A 1 36 ? -23.580 18.131 17.775  1.00 33.73 ? 555 PHE A CZ  1 
ATOM   217  N  N   . VAL A 1 37 ? -18.631 21.227 13.739  1.00 18.86 ? 556 VAL A N   1 
ATOM   218  C  CA  . VAL A 1 37 ? -17.780 21.527 12.599  1.00 19.86 ? 556 VAL A CA  1 
ATOM   219  C  C   . VAL A 1 37 ? -17.291 20.194 12.068  1.00 21.98 ? 556 VAL A C   1 
ATOM   220  O  O   . VAL A 1 37 ? -16.722 19.391 12.810  1.00 22.42 ? 556 VAL A O   1 
ATOM   221  C  CB  . VAL A 1 37 ? -16.564 22.398 12.976  1.00 24.78 ? 556 VAL A CB  1 
ATOM   222  C  CG1 . VAL A 1 37 ? -15.679 22.608 11.743  1.00 22.28 ? 556 VAL A CG1 1 
ATOM   223  C  CG2 . VAL A 1 37 ? -17.034 23.743 13.511  1.00 23.89 ? 556 VAL A CG2 1 
HETATM 224  N  N   . MSE A 1 38 ? -17.542 19.960 10.785  1.00 16.15 ? 557 MSE A N   1 
HETATM 225  C  CA  . MSE A 1 38 ? -17.139 18.737 10.120  1.00 18.16 ? 557 MSE A CA  1 
HETATM 226  C  C   . MSE A 1 38 ? -16.083 19.078 9.097   1.00 17.52 ? 557 MSE A C   1 
HETATM 227  O  O   . MSE A 1 38 ? -16.071 20.178 8.545   1.00 21.87 ? 557 MSE A O   1 
HETATM 228  C  CB  . MSE A 1 38 ? -18.328 18.081 9.417   1.00 14.37 ? 557 MSE A CB  1 
HETATM 229  C  CG  . MSE A 1 38 ? -19.344 17.472 10.353  1.00 30.86 ? 557 MSE A CG  1 
HETATM 230  SE SE  . MSE A 1 38 ? -18.757 15.721 10.927  1.00 40.40 ? 557 MSE A SE  1 
HETATM 231  C  CE  . MSE A 1 38 ? -20.143 14.646 10.133  1.00 51.61 ? 557 MSE A CE  1 
ATOM   232  N  N   . GLU A 1 39 ? -15.205 18.116 8.844   1.00 18.63 ? 558 GLU A N   1 
ATOM   233  C  CA  . GLU A 1 39 ? -14.127 18.285 7.886   1.00 15.91 ? 558 GLU A CA  1 
ATOM   234  C  C   . GLU A 1 39 ? -14.054 17.079 6.962   1.00 20.13 ? 558 GLU A C   1 
ATOM   235  O  O   . GLU A 1 39 ? -14.249 15.939 7.387   1.00 27.53 ? 558 GLU A O   1 
ATOM   236  C  CB  . GLU A 1 39 ? -12.807 18.435 8.629   1.00 24.02 ? 558 GLU A CB  1 
ATOM   237  C  CG  . GLU A 1 39 ? -11.612 18.726 7.751   1.00 25.44 ? 558 GLU A CG  1 
ATOM   238  C  CD  . GLU A 1 39 ? -10.356 18.878 8.575   1.00 31.21 ? 558 GLU A CD  1 
ATOM   239  O  OE1 . GLU A 1 39 ? -9.887  17.865 9.133   1.00 38.00 ? 558 GLU A OE1 1 
ATOM   240  O  OE2 . GLU A 1 39 ? -9.849  20.013 8.678   1.00 35.00 ? 558 GLU A OE2 1 
ATOM   241  N  N   . VAL A 1 40 ? -13.796 17.337 5.688   1.00 19.49 ? 559 VAL A N   1 
ATOM   242  C  CA  . VAL A 1 40 ? -13.666 16.263 4.726   1.00 19.58 ? 559 VAL A CA  1 
ATOM   243  C  C   . VAL A 1 40 ? -12.400 16.531 3.924   1.00 23.29 ? 559 VAL A C   1 
ATOM   244  O  O   . VAL A 1 40 ? -12.107 17.670 3.570   1.00 25.09 ? 559 VAL A O   1 
ATOM   245  C  CB  . VAL A 1 40 ? -14.899 16.178 3.784   1.00 21.70 ? 559 VAL A CB  1 
ATOM   246  C  CG1 . VAL A 1 40 ? -14.984 17.416 2.899   1.00 18.60 ? 559 VAL A CG1 1 
ATOM   247  C  CG2 . VAL A 1 40 ? -14.827 14.908 2.944   1.00 22.66 ? 559 VAL A CG2 1 
ATOM   248  N  N   . GLU A 1 41 ? -11.629 15.483 3.670   1.00 25.74 ? 560 GLU A N   1 
ATOM   249  C  CA  . GLU A 1 41 ? -10.404 15.642 2.903   1.00 29.48 ? 560 GLU A CA  1 
ATOM   250  C  C   . GLU A 1 41 ? -10.598 15.111 1.486   1.00 30.44 ? 560 GLU A C   1 
ATOM   251  O  O   . GLU A 1 41 ? -11.017 13.972 1.285   1.00 24.76 ? 560 GLU A O   1 
ATOM   252  C  CB  . GLU A 1 41 ? -9.246  14.910 3.591   1.00 36.91 ? 560 GLU A CB  1 
ATOM   253  C  CG  . GLU A 1 41 ? -7.914  15.066 2.877   1.00 44.65 ? 560 GLU A CG  1 
ATOM   254  C  CD  . GLU A 1 41 ? -6.784  14.366 3.599   1.00 54.36 ? 560 GLU A CD  1 
ATOM   255  O  OE1 . GLU A 1 41 ? -6.456  14.779 4.731   1.00 58.29 ? 560 GLU A OE1 1 
ATOM   256  O  OE2 . GLU A 1 41 ? -6.229  13.400 3.036   1.00 57.25 ? 560 GLU A OE2 1 
ATOM   257  N  N   . VAL A 1 42 ? -10.302 15.955 0.506   1.00 25.96 ? 561 VAL A N   1 
ATOM   258  C  CA  . VAL A 1 42 ? -10.430 15.579 -0.896  1.00 29.51 ? 561 VAL A CA  1 
ATOM   259  C  C   . VAL A 1 42 ? -9.143  15.999 -1.595  1.00 29.32 ? 561 VAL A C   1 
ATOM   260  O  O   . VAL A 1 42 ? -8.790  17.178 -1.600  1.00 27.43 ? 561 VAL A O   1 
ATOM   261  C  CB  . VAL A 1 42 ? -11.621 16.297 -1.568  1.00 25.17 ? 561 VAL A CB  1 
ATOM   262  C  CG1 . VAL A 1 42 ? -11.763 15.827 -3.003  1.00 29.36 ? 561 VAL A CG1 1 
ATOM   263  C  CG2 . VAL A 1 42 ? -12.906 16.026 -0.791  1.00 34.37 ? 561 VAL A CG2 1 
ATOM   264  N  N   . ASP A 1 43 ? -8.442  15.032 -2.177  1.00 32.99 ? 562 ASP A N   1 
ATOM   265  C  CA  . ASP A 1 43 ? -7.184  15.311 -2.863  1.00 40.37 ? 562 ASP A CA  1 
ATOM   266  C  C   . ASP A 1 43 ? -6.210  16.038 -1.937  1.00 38.14 ? 562 ASP A C   1 
ATOM   267  O  O   . ASP A 1 43 ? -5.666  17.085 -2.290  1.00 43.93 ? 562 ASP A O   1 
ATOM   268  C  CB  . ASP A 1 43 ? -7.430  16.170 -4.106  1.00 37.72 ? 562 ASP A CB  1 
ATOM   269  C  CG  . ASP A 1 43 ? -8.452  15.563 -5.044  1.00 40.42 ? 562 ASP A CG  1 
ATOM   270  O  OD1 . ASP A 1 43 ? -8.781  14.370 -4.884  1.00 42.70 ? 562 ASP A OD1 1 
ATOM   271  O  OD2 . ASP A 1 43 ? -8.916  16.286 -5.952  1.00 39.78 ? 562 ASP A OD2 1 
ATOM   272  N  N   . GLY A 1 44 ? -6.004  15.482 -0.747  1.00 42.08 ? 563 GLY A N   1 
ATOM   273  C  CA  . GLY A 1 44 ? -5.096  16.087 0.212   1.00 45.73 ? 563 GLY A CA  1 
ATOM   274  C  C   . GLY A 1 44 ? -5.566  17.425 0.754   1.00 49.95 ? 563 GLY A C   1 
ATOM   275  O  O   . GLY A 1 44 ? -4.951  17.980 1.665   1.00 52.83 ? 563 GLY A O   1 
ATOM   276  N  N   . GLN A 1 45 ? -6.660  17.941 0.204   1.00 42.89 ? 564 GLN A N   1 
ATOM   277  C  CA  . GLN A 1 45 ? -7.203  19.225 0.633   1.00 38.91 ? 564 GLN A CA  1 
ATOM   278  C  C   . GLN A 1 45 ? -8.334  19.066 1.652   1.00 34.12 ? 564 GLN A C   1 
ATOM   279  O  O   . GLN A 1 45 ? -9.210  18.215 1.497   1.00 31.69 ? 564 GLN A O   1 
ATOM   280  C  CB  . GLN A 1 45 ? -7.703  19.998 -0.587  1.00 37.76 ? 564 GLN A CB  1 
ATOM   281  C  CG  . GLN A 1 45 ? -6.616  20.250 -1.620  1.00 45.13 ? 564 GLN A CG  1 
ATOM   282  C  CD  . GLN A 1 45 ? -7.149  20.876 -2.888  1.00 43.79 ? 564 GLN A CD  1 
ATOM   283  O  OE1 . GLN A 1 45 ? -7.762  21.942 -2.858  1.00 42.93 ? 564 GLN A OE1 1 
ATOM   284  N  NE2 . GLN A 1 45 ? -6.915  20.216 -4.016  1.00 43.10 ? 564 GLN A NE2 1 
ATOM   285  N  N   . LYS A 1 46 ? -8.309  19.895 2.691   1.00 34.93 ? 565 LYS A N   1 
ATOM   286  C  CA  . LYS A 1 46 ? -9.321  19.842 3.736   1.00 30.47 ? 565 LYS A CA  1 
ATOM   287  C  C   . LYS A 1 46 ? -10.409 20.897 3.557   1.00 33.05 ? 565 LYS A C   1 
ATOM   288  O  O   . LYS A 1 46 ? -10.122 22.062 3.278   1.00 26.54 ? 565 LYS A O   1 
ATOM   289  C  CB  . LYS A 1 46 ? -8.660  20.000 5.107   1.00 35.61 ? 565 LYS A CB  1 
ATOM   290  C  CG  . LYS A 1 46 ? -7.780  18.820 5.495   1.00 38.12 ? 565 LYS A CG  1 
ATOM   291  C  CD  . LYS A 1 46 ? -7.252  18.962 6.911   1.00 51.49 ? 565 LYS A CD  1 
ATOM   292  C  CE  . LYS A 1 46 ? -6.443  17.745 7.326   1.00 49.29 ? 565 LYS A CE  1 
ATOM   293  N  NZ  . LYS A 1 46 ? -7.254  16.494 7.277   1.00 55.38 ? 565 LYS A NZ  1 
ATOM   294  N  N   . PHE A 1 47 ? -11.660 20.472 3.719   1.00 25.25 ? 566 PHE A N   1 
ATOM   295  C  CA  . PHE A 1 47 ? -12.814 21.354 3.587   1.00 19.02 ? 566 PHE A CA  1 
ATOM   296  C  C   . PHE A 1 47 ? -13.691 21.183 4.825   1.00 15.06 ? 566 PHE A C   1 
ATOM   297  O  O   . PHE A 1 47 ? -13.965 20.058 5.241   1.00 23.92 ? 566 PHE A O   1 
ATOM   298  C  CB  . PHE A 1 47 ? -13.605 20.981 2.327   1.00 20.33 ? 566 PHE A CB  1 
ATOM   299  C  CG  . PHE A 1 47 ? -12.831 21.170 1.059   1.00 16.42 ? 566 PHE A CG  1 
ATOM   300  C  CD1 . PHE A 1 47 ? -12.727 22.429 0.481   1.00 19.61 ? 566 PHE A CD1 1 
ATOM   301  C  CD2 . PHE A 1 47 ? -12.149 20.102 0.480   1.00 24.30 ? 566 PHE A CD2 1 
ATOM   302  C  CE1 . PHE A 1 47 ? -11.947 22.627 -0.663  1.00 27.26 ? 566 PHE A CE1 1 
ATOM   303  C  CE2 . PHE A 1 47 ? -11.367 20.287 -0.661  1.00 25.12 ? 566 PHE A CE2 1 
ATOM   304  C  CZ  . PHE A 1 47 ? -11.264 21.551 -1.233  1.00 22.87 ? 566 PHE A CZ  1 
ATOM   305  N  N   . GLN A 1 48 ? -14.129 22.290 5.413   1.00 20.59 ? 567 GLN A N   1 
ATOM   306  C  CA  . GLN A 1 48 ? -14.965 22.205 6.606   1.00 17.70 ? 567 GLN A CA  1 
ATOM   307  C  C   . GLN A 1 48 ? -16.334 22.831 6.424   1.00 21.52 ? 567 GLN A C   1 
ATOM   308  O  O   . GLN A 1 48 ? -16.557 23.641 5.517   1.00 21.88 ? 567 GLN A O   1 
ATOM   309  C  CB  . GLN A 1 48 ? -14.275 22.881 7.790   1.00 22.50 ? 567 GLN A CB  1 
ATOM   310  C  CG  . GLN A 1 48 ? -12.818 22.512 7.959   1.00 33.62 ? 567 GLN A CG  1 
ATOM   311  C  CD  . GLN A 1 48 ? -12.207 23.190 9.164   1.00 33.29 ? 567 GLN A CD  1 
ATOM   312  O  OE1 . GLN A 1 48 ? -12.630 24.276 9.552   1.00 36.55 ? 567 GLN A OE1 1 
ATOM   313  N  NE2 . GLN A 1 48 ? -11.199 22.562 9.753   1.00 44.13 ? 567 GLN A NE2 1 
ATOM   314  N  N   . GLY A 1 49 ? -17.249 22.448 7.309   1.00 18.82 ? 568 GLY A N   1 
ATOM   315  C  CA  . GLY A 1 49 ? -18.602 22.964 7.277   1.00 14.22 ? 568 GLY A CA  1 
ATOM   316  C  C   . GLY A 1 49 ? -19.104 23.008 8.701   1.00 16.39 ? 568 GLY A C   1 
ATOM   317  O  O   . GLY A 1 49 ? -18.815 22.100 9.487   1.00 20.36 ? 568 GLY A O   1 
ATOM   318  N  N   . ALA A 1 50 ? -19.844 24.057 9.042   1.00 17.81 ? 569 ALA A N   1 
ATOM   319  C  CA  . ALA A 1 50 ? -20.373 24.214 10.396  1.00 17.65 ? 569 ALA A CA  1 
ATOM   320  C  C   . ALA A 1 50 ? -21.895 24.291 10.396  1.00 21.39 ? 569 ALA A C   1 
ATOM   321  O  O   . ALA A 1 50 ? -22.510 24.571 9.370   1.00 22.90 ? 569 ALA A O   1 
ATOM   322  C  CB  . ALA A 1 50 ? -19.786 25.477 11.044  1.00 17.66 ? 569 ALA A CB  1 
ATOM   323  N  N   . GLY A 1 51 ? -22.498 24.039 11.553  1.00 20.43 ? 570 GLY A N   1 
ATOM   324  C  CA  . GLY A 1 51 ? -23.945 24.088 11.660  1.00 20.08 ? 570 GLY A CA  1 
ATOM   325  C  C   . GLY A 1 51 ? -24.434 23.733 13.050  1.00 21.15 ? 570 GLY A C   1 
ATOM   326  O  O   . GLY A 1 51 ? -23.642 23.382 13.926  1.00 19.45 ? 570 GLY A O   1 
ATOM   327  N  N   . SER A 1 52 ? -25.744 23.821 13.249  1.00 18.69 ? 571 SER A N   1 
ATOM   328  C  CA  . SER A 1 52 ? -26.356 23.516 14.542  1.00 26.67 ? 571 SER A CA  1 
ATOM   329  C  C   . SER A 1 52 ? -26.520 22.020 14.784  1.00 26.93 ? 571 SER A C   1 
ATOM   330  O  O   . SER A 1 52 ? -26.811 21.585 15.900  1.00 25.36 ? 571 SER A O   1 
ATOM   331  C  CB  . SER A 1 52 ? -27.719 24.205 14.652  1.00 27.86 ? 571 SER A CB  1 
ATOM   332  O  OG  . SER A 1 52 ? -27.564 25.610 14.739  1.00 47.94 ? 571 SER A OG  1 
ATOM   333  N  N   . ASN A 1 53 ? -26.353 21.234 13.728  1.00 21.38 ? 572 ASN A N   1 
ATOM   334  C  CA  . ASN A 1 53 ? -26.452 19.790 13.837  1.00 19.11 ? 572 ASN A CA  1 
ATOM   335  C  C   . ASN A 1 53 ? -25.396 19.173 12.925  1.00 20.84 ? 572 ASN A C   1 
ATOM   336  O  O   . ASN A 1 53 ? -24.895 19.828 12.012  1.00 19.16 ? 572 ASN A O   1 
ATOM   337  C  CB  . ASN A 1 53 ? -27.856 19.300 13.457  1.00 22.29 ? 572 ASN A CB  1 
ATOM   338  C  CG  . ASN A 1 53 ? -28.263 19.716 12.065  1.00 20.82 ? 572 ASN A CG  1 
ATOM   339  O  OD1 . ASN A 1 53 ? -28.891 20.759 11.869  1.00 29.54 ? 572 ASN A OD1 1 
ATOM   340  N  ND2 . ASN A 1 53 ? -27.892 18.910 11.084  1.00 15.92 ? 572 ASN A ND2 1 
ATOM   341  N  N   . LYS A 1 54 ? -25.061 17.915 13.182  1.00 15.21 ? 573 LYS A N   1 
ATOM   342  C  CA  . LYS A 1 54 ? -24.043 17.211 12.409  1.00 20.71 ? 573 LYS A CA  1 
ATOM   343  C  C   . LYS A 1 54 ? -24.354 17.040 10.927  1.00 16.31 ? 573 LYS A C   1 
ATOM   344  O  O   . LYS A 1 54 ? -23.466 17.167 10.082  1.00 19.41 ? 573 LYS A O   1 
ATOM   345  C  CB  . LYS A 1 54 ? -23.781 15.838 13.029  1.00 22.14 ? 573 LYS A CB  1 
ATOM   346  C  CG  . LYS A 1 54 ? -23.087 15.892 14.377  1.00 23.02 ? 573 LYS A CG  1 
ATOM   347  C  CD  . LYS A 1 54 ? -22.983 14.495 14.981  1.00 40.52 ? 573 LYS A CD  1 
ATOM   348  C  CE  . LYS A 1 54 ? -22.275 14.525 16.328  1.00 42.37 ? 573 LYS A CE  1 
ATOM   349  N  NZ  . LYS A 1 54 ? -22.258 13.182 16.973  1.00 48.43 ? 573 LYS A NZ  1 
ATOM   350  N  N   . LYS A 1 55 ? -25.610 16.746 10.617  1.00 19.04 ? 574 LYS A N   1 
ATOM   351  C  CA  . LYS A 1 55 ? -26.030 16.549 9.235   1.00 22.37 ? 574 LYS A CA  1 
ATOM   352  C  C   . LYS A 1 55 ? -25.746 17.772 8.362   1.00 17.00 ? 574 LYS A C   1 
ATOM   353  O  O   . LYS A 1 55 ? -25.175 17.645 7.277   1.00 16.15 ? 574 LYS A O   1 
ATOM   354  C  CB  . LYS A 1 55 ? -27.524 16.213 9.184   1.00 23.45 ? 574 LYS A CB  1 
ATOM   355  C  CG  . LYS A 1 55 ? -28.030 15.850 7.801   1.00 25.95 ? 574 LYS A CG  1 
ATOM   356  C  CD  . LYS A 1 55 ? -29.535 15.555 7.801   1.00 37.63 ? 574 LYS A CD  1 
ATOM   357  C  CE  . LYS A 1 55 ? -29.879 14.373 8.694   1.00 37.67 ? 574 LYS A CE  1 
ATOM   358  N  NZ  . LYS A 1 55 ? -29.140 13.147 8.286   1.00 52.23 ? 574 LYS A NZ  1 
ATOM   359  N  N   . VAL A 1 56 ? -26.140 18.957 8.823   1.00 16.10 ? 575 VAL A N   1 
ATOM   360  C  CA  . VAL A 1 56 ? -25.905 20.167 8.031   1.00 17.73 ? 575 VAL A CA  1 
ATOM   361  C  C   . VAL A 1 56 ? -24.426 20.565 8.022   1.00 17.84 ? 575 VAL A C   1 
ATOM   362  O  O   . VAL A 1 56 ? -23.927 21.140 7.044   1.00 12.43 ? 575 VAL A O   1 
ATOM   363  C  CB  . VAL A 1 56 ? -26.778 21.350 8.538   1.00 18.65 ? 575 VAL A CB  1 
ATOM   364  C  CG1 . VAL A 1 56 ? -26.214 21.920 9.824   1.00 20.49 ? 575 VAL A CG1 1 
ATOM   365  C  CG2 . VAL A 1 56 ? -26.882 22.408 7.464   1.00 23.98 ? 575 VAL A CG2 1 
ATOM   366  N  N   . ALA A 1 57 ? -23.716 20.260 9.106   1.00 16.18 ? 576 ALA A N   1 
ATOM   367  C  CA  . ALA A 1 57 ? -22.290 20.578 9.177   1.00 15.19 ? 576 ALA A CA  1 
ATOM   368  C  C   . ALA A 1 57 ? -21.585 19.731 8.123   1.00 17.32 ? 576 ALA A C   1 
ATOM   369  O  O   . ALA A 1 57 ? -20.720 20.213 7.391   1.00 18.75 ? 576 ALA A O   1 
ATOM   370  C  CB  . ALA A 1 57 ? -21.735 20.257 10.565  1.00 21.02 ? 576 ALA A CB  1 
ATOM   371  N  N   . LYS A 1 58 ? -21.967 18.463 8.039   1.00 15.44 ? 577 LYS A N   1 
ATOM   372  C  CA  . LYS A 1 58 ? -21.368 17.579 7.049   1.00 17.63 ? 577 LYS A CA  1 
ATOM   373  C  C   . LYS A 1 58 ? -21.706 18.070 5.640   1.00 12.23 ? 577 LYS A C   1 
ATOM   374  O  O   . LYS A 1 58 ? -20.846 18.100 4.760   1.00 15.38 ? 577 LYS A O   1 
ATOM   375  C  CB  . LYS A 1 58 ? -21.869 16.140 7.229   1.00 21.28 ? 577 LYS A CB  1 
ATOM   376  C  CG  . LYS A 1 58 ? -21.316 15.192 6.172   1.00 34.85 ? 577 LYS A CG  1 
ATOM   377  C  CD  . LYS A 1 58 ? -21.855 13.770 6.293   1.00 40.44 ? 577 LYS A CD  1 
ATOM   378  C  CE  . LYS A 1 58 ? -21.389 13.096 7.568   1.00 47.26 ? 577 LYS A CE  1 
ATOM   379  N  NZ  . LYS A 1 58 ? -21.820 11.668 7.622   1.00 58.29 ? 577 LYS A NZ  1 
ATOM   380  N  N   . ALA A 1 59 ? -22.960 18.460 5.431   1.00 17.67 ? 578 ALA A N   1 
ATOM   381  C  CA  . ALA A 1 59 ? -23.392 18.942 4.126   1.00 16.52 ? 578 ALA A CA  1 
ATOM   382  C  C   . ALA A 1 59 ? -22.606 20.189 3.713   1.00 20.48 ? 578 ALA A C   1 
ATOM   383  O  O   . ALA A 1 59 ? -22.236 20.338 2.547   1.00 16.18 ? 578 ALA A O   1 
ATOM   384  C  CB  . ALA A 1 59 ? -24.893 19.235 4.146   1.00 16.71 ? 578 ALA A CB  1 
ATOM   385  N  N   . TYR A 1 60 ? -22.344 21.091 4.657   1.00 13.92 ? 579 TYR A N   1 
ATOM   386  C  CA  . TYR A 1 60 ? -21.586 22.290 4.309   1.00 16.74 ? 579 TYR A CA  1 
ATOM   387  C  C   . TYR A 1 60 ? -20.137 21.951 3.980   1.00 16.09 ? 579 TYR A C   1 
ATOM   388  O  O   . TYR A 1 60 ? -19.512 22.612 3.146   1.00 17.89 ? 579 TYR A O   1 
ATOM   389  C  CB  . TYR A 1 60 ? -21.645 23.317 5.432   1.00 14.21 ? 579 TYR A CB  1 
ATOM   390  C  CG  . TYR A 1 60 ? -22.798 24.275 5.280   1.00 13.86 ? 579 TYR A CG  1 
ATOM   391  C  CD1 . TYR A 1 60 ? -23.853 24.286 6.189   1.00 13.52 ? 579 TYR A CD1 1 
ATOM   392  C  CD2 . TYR A 1 60 ? -22.826 25.184 4.223   1.00 18.29 ? 579 TYR A CD2 1 
ATOM   393  C  CE1 . TYR A 1 60 ? -24.921 25.197 6.053   1.00 15.34 ? 579 TYR A CE1 1 
ATOM   394  C  CE2 . TYR A 1 60 ? -23.874 26.090 4.068   1.00 17.21 ? 579 TYR A CE2 1 
ATOM   395  C  CZ  . TYR A 1 60 ? -24.914 26.095 4.983   1.00 14.50 ? 579 TYR A CZ  1 
ATOM   396  O  OH  . TYR A 1 60 ? -25.921 27.018 4.836   1.00 16.89 ? 579 TYR A OH  1 
ATOM   397  N  N   . ALA A 1 61 ? -19.606 20.921 4.631   1.00 13.75 ? 580 ALA A N   1 
ATOM   398  C  CA  . ALA A 1 61 ? -18.234 20.489 4.375   1.00 16.23 ? 580 ALA A CA  1 
ATOM   399  C  C   . ALA A 1 61 ? -18.140 19.994 2.939   1.00 12.99 ? 580 ALA A C   1 
ATOM   400  O  O   . ALA A 1 61 ? -17.179 20.294 2.230   1.00 17.75 ? 580 ALA A O   1 
ATOM   401  C  CB  . ALA A 1 61 ? -17.833 19.373 5.342   1.00 16.99 ? 580 ALA A CB  1 
ATOM   402  N  N   . ALA A 1 62 ? -19.141 19.234 2.505   1.00 14.64 ? 581 ALA A N   1 
ATOM   403  C  CA  . ALA A 1 62 ? -19.138 18.726 1.135   1.00 15.66 ? 581 ALA A CA  1 
ATOM   404  C  C   . ALA A 1 62 ? -19.340 19.898 0.170   1.00 15.43 ? 581 ALA A C   1 
ATOM   405  O  O   . ALA A 1 62 ? -18.678 19.988 -0.863  1.00 20.69 ? 581 ALA A O   1 
ATOM   406  C  CB  . ALA A 1 62 ? -20.247 17.676 0.951   1.00 13.60 ? 581 ALA A CB  1 
ATOM   407  N  N   . LEU A 1 63 ? -20.249 20.805 0.517   1.00 14.63 ? 582 LEU A N   1 
ATOM   408  C  CA  . LEU A 1 63 ? -20.513 21.968 -0.332  1.00 17.61 ? 582 LEU A CA  1 
ATOM   409  C  C   . LEU A 1 63 ? -19.233 22.769 -0.589  1.00 20.62 ? 582 LEU A C   1 
ATOM   410  O  O   . LEU A 1 63 ? -19.001 23.251 -1.703  1.00 17.50 ? 582 LEU A O   1 
ATOM   411  C  CB  . LEU A 1 63 ? -21.557 22.879 0.322   1.00 19.50 ? 582 LEU A CB  1 
ATOM   412  C  CG  . LEU A 1 63 ? -21.959 24.105 -0.501  1.00 21.61 ? 582 LEU A CG  1 
ATOM   413  C  CD1 . LEU A 1 63 ? -22.590 23.641 -1.808  1.00 21.93 ? 582 LEU A CD1 1 
ATOM   414  C  CD2 . LEU A 1 63 ? -22.943 24.955 0.277   1.00 29.20 ? 582 LEU A CD2 1 
ATOM   415  N  N   . ALA A 1 64 ? -18.413 22.922 0.447   1.00 16.21 ? 583 ALA A N   1 
ATOM   416  C  CA  . ALA A 1 64 ? -17.161 23.658 0.330   1.00 17.16 ? 583 ALA A CA  1 
ATOM   417  C  C   . ALA A 1 64 ? -16.230 22.950 -0.653  1.00 20.55 ? 583 ALA A C   1 
ATOM   418  O  O   . ALA A 1 64 ? -15.559 23.590 -1.464  1.00 18.95 ? 583 ALA A O   1 
ATOM   419  C  CB  . ALA A 1 64 ? -16.498 23.776 1.698   1.00 22.86 ? 583 ALA A CB  1 
ATOM   420  N  N   . ALA A 1 65 ? -16.190 21.625 -0.582  1.00 16.84 ? 584 ALA A N   1 
ATOM   421  C  CA  . ALA A 1 65 ? -15.353 20.854 -1.491  1.00 16.98 ? 584 ALA A CA  1 
ATOM   422  C  C   . ALA A 1 65 ? -15.877 21.034 -2.916  1.00 21.73 ? 584 ALA A C   1 
ATOM   423  O  O   . ALA A 1 65 ? -15.109 21.262 -3.851  1.00 19.16 ? 584 ALA A O   1 
ATOM   424  C  CB  . ALA A 1 65 ? -15.375 19.368 -1.102  1.00 16.15 ? 584 ALA A CB  1 
ATOM   425  N  N   . LEU A 1 66 ? -17.192 20.945 -3.072  1.00 13.45 ? 585 LEU A N   1 
ATOM   426  C  CA  . LEU A 1 66 ? -17.803 21.093 -4.391  1.00 16.49 ? 585 LEU A CA  1 
ATOM   427  C  C   . LEU A 1 66 ? -17.611 22.493 -4.983  1.00 19.42 ? 585 LEU A C   1 
ATOM   428  O  O   . LEU A 1 66 ? -17.409 22.633 -6.191  1.00 18.62 ? 585 LEU A O   1 
ATOM   429  C  CB  . LEU A 1 66 ? -19.299 20.770 -4.322  1.00 15.04 ? 585 LEU A CB  1 
ATOM   430  C  CG  . LEU A 1 66 ? -19.687 19.304 -4.104  1.00 18.40 ? 585 LEU A CG  1 
ATOM   431  C  CD1 . LEU A 1 66 ? -21.205 19.202 -3.926  1.00 16.49 ? 585 LEU A CD1 1 
ATOM   432  C  CD2 . LEU A 1 66 ? -19.218 18.455 -5.301  1.00 17.42 ? 585 LEU A CD2 1 
ATOM   433  N  N   . GLU A 1 67 ? -17.678 23.524 -4.145  1.00 19.86 ? 586 GLU A N   1 
ATOM   434  C  CA  . GLU A 1 67 ? -17.519 24.896 -4.633  1.00 21.75 ? 586 GLU A CA  1 
ATOM   435  C  C   . GLU A 1 67 ? -16.124 25.146 -5.168  1.00 22.72 ? 586 GLU A C   1 
ATOM   436  O  O   . GLU A 1 67 ? -15.934 25.959 -6.065  1.00 26.46 ? 586 GLU A O   1 
ATOM   437  C  CB  . GLU A 1 67 ? -17.819 25.907 -3.523  1.00 21.36 ? 586 GLU A CB  1 
ATOM   438  C  CG  . GLU A 1 67 ? -19.293 26.056 -3.202  1.00 40.00 ? 586 GLU A CG  1 
ATOM   439  C  CD  . GLU A 1 67 ? -19.553 27.070 -2.099  1.00 53.18 ? 586 GLU A CD  1 
ATOM   440  O  OE1 . GLU A 1 67 ? -19.191 28.252 -2.270  1.00 55.80 ? 586 GLU A OE1 1 
ATOM   441  O  OE2 . GLU A 1 67 ? -20.124 26.684 -1.057  1.00 64.28 ? 586 GLU A OE2 1 
ATOM   442  N  N   . LYS A 1 68 ? -15.150 24.435 -4.619  1.00 22.41 ? 587 LYS A N   1 
ATOM   443  C  CA  . LYS A 1 68 ? -13.767 24.587 -5.041  1.00 24.85 ? 587 LYS A CA  1 
ATOM   444  C  C   . LYS A 1 68 ? -13.408 23.690 -6.224  1.00 24.60 ? 587 LYS A C   1 
ATOM   445  O  O   . LYS A 1 68 ? -12.922 24.166 -7.249  1.00 25.22 ? 587 LYS A O   1 
ATOM   446  C  CB  . LYS A 1 68 ? -12.835 24.270 -3.865  1.00 22.39 ? 587 LYS A CB  1 
ATOM   447  C  CG  . LYS A 1 68 ? -11.346 24.356 -4.190  1.00 35.06 ? 587 LYS A CG  1 
ATOM   448  C  CD  . LYS A 1 68 ? -10.938 25.779 -4.540  1.00 43.86 ? 587 LYS A CD  1 
ATOM   449  C  CE  . LYS A 1 68 ? -9.439  25.882 -4.798  1.00 45.75 ? 587 LYS A CE  1 
ATOM   450  N  NZ  . LYS A 1 68 ? -8.646  25.470 -3.609  1.00 46.00 ? 587 LYS A NZ  1 
ATOM   451  N  N   . LEU A 1 69 ? -13.666 22.395 -6.077  1.00 19.11 ? 588 LEU A N   1 
ATOM   452  C  CA  . LEU A 1 69 ? -13.316 21.405 -7.097  1.00 16.63 ? 588 LEU A CA  1 
ATOM   453  C  C   . LEU A 1 69 ? -14.348 21.119 -8.193  1.00 19.73 ? 588 LEU A C   1 
ATOM   454  O  O   . LEU A 1 69 ? -13.990 20.634 -9.267  1.00 21.05 ? 588 LEU A O   1 
ATOM   455  C  CB  . LEU A 1 69 ? -12.966 20.089 -6.402  1.00 20.24 ? 588 LEU A CB  1 
ATOM   456  C  CG  . LEU A 1 69 ? -12.004 20.200 -5.214  1.00 18.85 ? 588 LEU A CG  1 
ATOM   457  C  CD1 . LEU A 1 69 ? -11.924 18.869 -4.490  1.00 22.08 ? 588 LEU A CD1 1 
ATOM   458  C  CD2 . LEU A 1 69 ? -10.635 20.650 -5.699  1.00 17.95 ? 588 LEU A CD2 1 
ATOM   459  N  N   . PHE A 1 70 ? -15.621 21.401 -7.930  1.00 18.40 ? 589 PHE A N   1 
ATOM   460  C  CA  . PHE A 1 70 ? -16.668 21.130 -8.912  1.00 19.28 ? 589 PHE A CA  1 
ATOM   461  C  C   . PHE A 1 70 ? -17.677 22.264 -8.966  1.00 18.21 ? 589 PHE A C   1 
ATOM   462  O  O   . PHE A 1 70 ? -18.866 22.082 -8.675  1.00 17.46 ? 589 PHE A O   1 
ATOM   463  C  CB  . PHE A 1 70 ? -17.342 19.802 -8.562  1.00 17.76 ? 589 PHE A CB  1 
ATOM   464  C  CG  . PHE A 1 70 ? -16.374 18.650 -8.501  1.00 19.83 ? 589 PHE A CG  1 
ATOM   465  C  CD1 . PHE A 1 70 ? -15.887 18.071 -9.670  1.00 19.16 ? 589 PHE A CD1 1 
ATOM   466  C  CD2 . PHE A 1 70 ? -15.863 18.220 -7.280  1.00 21.23 ? 589 PHE A CD2 1 
ATOM   467  C  CE1 . PHE A 1 70 ? -14.904 17.086 -9.621  1.00 23.07 ? 589 PHE A CE1 1 
ATOM   468  C  CE2 . PHE A 1 70 ? -14.882 17.237 -7.219  1.00 17.62 ? 589 PHE A CE2 1 
ATOM   469  C  CZ  . PHE A 1 70 ? -14.397 16.672 -8.394  1.00 21.64 ? 589 PHE A CZ  1 
ATOM   470  N  N   . PRO A 1 71 ? -17.210 23.457 -9.357  1.00 21.65 ? 590 PRO A N   1 
ATOM   471  C  CA  . PRO A 1 71 ? -18.010 24.679 -9.468  1.00 24.16 ? 590 PRO A CA  1 
ATOM   472  C  C   . PRO A 1 71 ? -19.301 24.548 -10.266 1.00 22.14 ? 590 PRO A C   1 
ATOM   473  O  O   . PRO A 1 71 ? -20.313 25.150 -9.912  1.00 26.44 ? 590 PRO A O   1 
ATOM   474  C  CB  . PRO A 1 71 ? -17.045 25.668 -10.125 1.00 26.94 ? 590 PRO A CB  1 
ATOM   475  C  CG  . PRO A 1 71 ? -15.706 25.169 -9.718  1.00 35.88 ? 590 PRO A CG  1 
ATOM   476  C  CD  . PRO A 1 71 ? -15.848 23.688 -9.867  1.00 19.74 ? 590 PRO A CD  1 
ATOM   477  N  N   . ASP A 1 72 ? -19.269 23.767 -11.340 1.00 24.32 ? 591 ASP A N   1 
ATOM   478  C  CA  . ASP A 1 72 ? -20.449 23.619 -12.186 1.00 27.67 ? 591 ASP A CA  1 
ATOM   479  C  C   . ASP A 1 72 ? -21.507 22.649 -11.688 1.00 29.59 ? 591 ASP A C   1 
ATOM   480  O  O   . ASP A 1 72 ? -22.599 22.591 -12.250 1.00 32.75 ? 591 ASP A O   1 
ATOM   481  C  CB  . ASP A 1 72 ? -20.050 23.217 -13.607 1.00 28.34 ? 591 ASP A CB  1 
ATOM   482  C  CG  . ASP A 1 72 ? -19.113 24.210 -14.253 1.00 40.31 ? 591 ASP A CG  1 
ATOM   483  O  OD1 . ASP A 1 72 ? -19.421 25.417 -14.240 1.00 46.18 ? 591 ASP A OD1 1 
ATOM   484  O  OD2 . ASP A 1 72 ? -18.066 23.781 -14.780 1.00 49.59 ? 591 ASP A OD2 1 
ATOM   485  N  N   . THR A 1 73 ? -21.204 21.891 -10.642 1.00 26.00 ? 592 THR A N   1 
ATOM   486  C  CA  . THR A 1 73 ? -22.178 20.936 -10.119 1.00 30.99 ? 592 THR A CA  1 
ATOM   487  C  C   . THR A 1 73 ? -23.446 21.640 -9.664  1.00 33.86 ? 592 THR A C   1 
ATOM   488  O  O   . THR A 1 73 ? -23.414 22.483 -8.770  1.00 28.87 ? 592 THR A O   1 
ATOM   489  C  CB  . THR A 1 73 ? -21.620 20.139 -8.929  1.00 34.58 ? 592 THR A CB  1 
ATOM   490  O  OG1 . THR A 1 73 ? -20.441 19.441 -9.335  1.00 37.82 ? 592 THR A OG1 1 
ATOM   491  C  CG2 . THR A 1 73 ? -22.647 19.125 -8.440  1.00 37.44 ? 592 THR A CG2 1 
ATOM   492  N  N   . PRO A 1 74 ? -24.585 21.308 -10.285 1.00 36.47 ? 593 PRO A N   1 
ATOM   493  C  CA  . PRO A 1 74 ? -25.855 21.932 -9.913  1.00 44.26 ? 593 PRO A CA  1 
ATOM   494  C  C   . PRO A 1 74 ? -26.287 21.536 -8.509  1.00 47.59 ? 593 PRO A C   1 
ATOM   495  O  O   . PRO A 1 74 ? -26.306 20.354 -8.171  1.00 58.34 ? 593 PRO A O   1 
ATOM   496  C  CB  . PRO A 1 74 ? -26.817 21.411 -10.977 1.00 43.37 ? 593 PRO A CB  1 
ATOM   497  C  CG  . PRO A 1 74 ? -25.929 21.220 -12.168 1.00 45.61 ? 593 PRO A CG  1 
ATOM   498  C  CD  . PRO A 1 74 ? -24.722 20.562 -11.548 1.00 37.56 ? 593 PRO A CD  1 
ATOM   499  N  N   . LEU A 1 75 ? -26.624 22.526 -7.691  1.00 48.50 ? 594 LEU A N   1 
ATOM   500  C  CA  . LEU A 1 75 ? -27.075 22.266 -6.329  1.00 51.02 ? 594 LEU A CA  1 
ATOM   501  C  C   . LEU A 1 75 ? -28.594 22.111 -6.327  1.00 53.79 ? 594 LEU A C   1 
ATOM   502  O  O   . LEU A 1 75 ? -29.288 22.965 -5.737  1.00 52.94 ? 594 LEU A O   1 
ATOM   503  C  CB  . LEU A 1 75 ? -26.667 23.411 -5.395  1.00 52.48 ? 594 LEU A CB  1 
ATOM   504  C  CG  . LEU A 1 75 ? -27.099 23.281 -3.928  1.00 52.59 ? 594 LEU A CG  1 
ATOM   505  C  CD1 . LEU A 1 75 ? -26.493 22.023 -3.315  1.00 47.29 ? 594 LEU A CD1 1 
ATOM   506  C  CD2 . LEU A 1 75 ? -26.667 24.515 -3.156  1.00 50.64 ? 594 LEU A CD2 1 
ATOM   507  O  OXT . LEU A 1 75 ? -29.072 21.132 -6.933  1.00 67.77 ? 594 LEU A OXT 1 
ATOM   508  N  N   . GLY B 1 6  ? 15.213  21.543 31.598  1.00 47.63 ? 525 GLY B N   1 
ATOM   509  C  CA  . GLY B 1 6  ? 14.018  21.813 32.449  1.00 48.23 ? 525 GLY B CA  1 
ATOM   510  C  C   . GLY B 1 6  ? 12.748  21.218 31.873  1.00 47.81 ? 525 GLY B C   1 
ATOM   511  O  O   . GLY B 1 6  ? 12.763  20.659 30.780  1.00 51.97 ? 525 GLY B O   1 
ATOM   512  N  N   . LYS B 1 7  ? 11.647  21.341 32.610  1.00 46.55 ? 526 LYS B N   1 
ATOM   513  C  CA  . LYS B 1 7  ? 10.360  20.812 32.171  1.00 47.82 ? 526 LYS B CA  1 
ATOM   514  C  C   . LYS B 1 7  ? 9.655   21.746 31.187  1.00 37.41 ? 526 LYS B C   1 
ATOM   515  O  O   . LYS B 1 7  ? 10.266  22.634 30.612  1.00 55.97 ? 526 LYS B O   1 
ATOM   516  C  CB  . LYS B 1 7  ? 9.455   20.550 33.381  1.00 48.50 ? 526 LYS B CB  1 
ATOM   517  C  CG  . LYS B 1 7  ? 10.053  20.955 34.720  1.00 55.05 ? 526 LYS B CG  1 
ATOM   518  C  CD  . LYS B 1 7  ? 10.250  22.459 34.810  1.00 54.60 ? 526 LYS B CD  1 
ATOM   519  C  CE  . LYS B 1 7  ? 10.894  22.856 36.125  1.00 65.05 ? 526 LYS B CE  1 
ATOM   520  N  NZ  . LYS B 1 7  ? 11.051  24.333 36.226  1.00 64.34 ? 526 LYS B NZ  1 
ATOM   521  N  N   . ASN B 1 8  ? 8.363   21.533 30.998  1.00 43.29 ? 527 ASN B N   1 
ATOM   522  C  CA  . ASN B 1 8  ? 7.558   22.330 30.081  1.00 34.34 ? 527 ASN B CA  1 
ATOM   523  C  C   . ASN B 1 8  ? 8.115   22.367 28.659  1.00 30.76 ? 527 ASN B C   1 
ATOM   524  O  O   . ASN B 1 8  ? 8.897   23.252 28.290  1.00 24.00 ? 527 ASN B O   1 
ATOM   525  C  CB  . ASN B 1 8  ? 7.369   23.751 30.603  1.00 30.68 ? 527 ASN B CB  1 
ATOM   526  C  CG  . ASN B 1 8  ? 6.189   24.441 29.953  1.00 28.33 ? 527 ASN B CG  1 
ATOM   527  O  OD1 . ASN B 1 8  ? 6.182   24.666 28.745  1.00 26.85 ? 527 ASN B OD1 1 
ATOM   528  N  ND2 . ASN B 1 8  ? 5.176   24.767 30.748  1.00 32.82 ? 527 ASN B ND2 1 
ATOM   529  N  N   . PRO B 1 9  ? 7.688   21.403 27.834  1.00 19.97 ? 528 PRO B N   1 
ATOM   530  C  CA  . PRO B 1 9  ? 8.084   21.231 26.433  1.00 19.53 ? 528 PRO B CA  1 
ATOM   531  C  C   . PRO B 1 9  ? 7.853   22.477 25.593  1.00 20.06 ? 528 PRO B C   1 
ATOM   532  O  O   . PRO B 1 9  ? 8.642   22.786 24.696  1.00 21.29 ? 528 PRO B O   1 
ATOM   533  C  CB  . PRO B 1 9  ? 7.215   20.058 25.968  1.00 19.79 ? 528 PRO B CB  1 
ATOM   534  C  CG  . PRO B 1 9  ? 7.016   19.265 27.222  1.00 29.63 ? 528 PRO B CG  1 
ATOM   535  C  CD  . PRO B 1 9  ? 6.745   20.347 28.244  1.00 25.03 ? 528 PRO B CD  1 
ATOM   536  N  N   . VAL B 1 10 ? 6.768   23.189 25.883  1.00 18.81 ? 529 VAL B N   1 
ATOM   537  C  CA  . VAL B 1 10 ? 6.441   24.398 25.140  1.00 16.36 ? 529 VAL B CA  1 
ATOM   538  C  C   . VAL B 1 10 ? 7.528   25.449 25.381  1.00 21.32 ? 529 VAL B C   1 
ATOM   539  O  O   . VAL B 1 10 ? 7.992   26.104 24.444  1.00 20.28 ? 529 VAL B O   1 
ATOM   540  C  CB  . VAL B 1 10 ? 5.058   24.945 25.567  1.00 16.25 ? 529 VAL B CB  1 
ATOM   541  C  CG1 . VAL B 1 10 ? 4.803   26.311 24.932  1.00 20.40 ? 529 VAL B CG1 1 
ATOM   542  C  CG2 . VAL B 1 10 ? 3.968   23.959 25.146  1.00 23.06 ? 529 VAL B CG2 1 
HETATM 543  N  N   . MSE B 1 11 ? 7.935   25.586 26.639  1.00 16.93 ? 530 MSE B N   1 
HETATM 544  C  CA  . MSE B 1 11 ? 8.979   26.535 27.024  1.00 21.47 ? 530 MSE B CA  1 
HETATM 545  C  C   . MSE B 1 11 ? 10.324  26.161 26.397  1.00 20.24 ? 530 MSE B C   1 
HETATM 546  O  O   . MSE B 1 11 ? 11.055  27.019 25.885  1.00 20.50 ? 530 MSE B O   1 
HETATM 547  C  CB  . MSE B 1 11 ? 9.141   26.533 28.541  1.00 25.56 ? 530 MSE B CB  1 
HETATM 548  C  CG  . MSE B 1 11 ? 9.883   27.726 29.093  1.00 52.95 ? 530 MSE B CG  1 
HETATM 549  SE SE  . MSE B 1 11 ? 8.633   29.128 29.520  1.00 70.13 ? 530 MSE B SE  1 
HETATM 550  C  CE  . MSE B 1 11 ? 7.954   28.370 31.151  1.00 47.26 ? 530 MSE B CE  1 
ATOM   551  N  N   . GLU B 1 12 ? 10.659  24.877 26.454  1.00 25.40 ? 531 GLU B N   1 
ATOM   552  C  CA  . GLU B 1 12 ? 11.924  24.405 25.896  1.00 22.94 ? 531 GLU B CA  1 
ATOM   553  C  C   . GLU B 1 12 ? 11.984  24.529 24.379  1.00 23.92 ? 531 GLU B C   1 
ATOM   554  O  O   . GLU B 1 12 ? 13.019  24.894 23.826  1.00 22.25 ? 531 GLU B O   1 
ATOM   555  C  CB  . GLU B 1 12 ? 12.180  22.958 26.312  1.00 20.45 ? 531 GLU B CB  1 
ATOM   556  C  CG  . GLU B 1 12 ? 12.483  22.802 27.793  1.00 23.79 ? 531 GLU B CG  1 
ATOM   557  C  CD  . GLU B 1 12 ? 13.669  23.636 28.233  1.00 30.07 ? 531 GLU B CD  1 
ATOM   558  O  OE1 . GLU B 1 12 ? 14.721  23.577 27.558  1.00 24.86 ? 531 GLU B OE1 1 
ATOM   559  O  OE2 . GLU B 1 12 ? 13.555  24.346 29.255  1.00 25.97 ? 531 GLU B OE2 1 
ATOM   560  N  N   . LEU B 1 13 ? 10.881  24.224 23.704  1.00 18.07 ? 532 LEU B N   1 
ATOM   561  C  CA  . LEU B 1 13 ? 10.846  24.337 22.248  1.00 16.07 ? 532 LEU B CA  1 
ATOM   562  C  C   . LEU B 1 13 ? 10.993  25.813 21.866  1.00 20.92 ? 532 LEU B C   1 
ATOM   563  O  O   . LEU B 1 13 ? 11.623  26.161 20.864  1.00 21.70 ? 532 LEU B O   1 
ATOM   564  C  CB  . LEU B 1 13 ? 9.520   23.795 21.707  1.00 12.48 ? 532 LEU B CB  1 
ATOM   565  C  CG  . LEU B 1 13 ? 9.292   23.905 20.193  1.00 14.55 ? 532 LEU B CG  1 
ATOM   566  C  CD1 . LEU B 1 13 ? 10.419  23.195 19.444  1.00 16.11 ? 532 LEU B CD1 1 
ATOM   567  C  CD2 . LEU B 1 13 ? 7.937   23.300 19.833  1.00 17.16 ? 532 LEU B CD2 1 
ATOM   568  N  N   . ASN B 1 14 ? 10.401  26.677 22.680  1.00 18.19 ? 533 ASN B N   1 
ATOM   569  C  CA  . ASN B 1 14 ? 10.456  28.119 22.465  1.00 20.50 ? 533 ASN B CA  1 
ATOM   570  C  C   . ASN B 1 14 ? 11.900  28.640 22.489  1.00 23.29 ? 533 ASN B C   1 
ATOM   571  O  O   . ASN B 1 14 ? 12.207  29.662 21.877  1.00 26.54 ? 533 ASN B O   1 
ATOM   572  C  CB  . ASN B 1 14 ? 9.623   28.821 23.543  1.00 28.12 ? 533 ASN B CB  1 
ATOM   573  C  CG  . ASN B 1 14 ? 9.572   30.321 23.360  1.00 27.03 ? 533 ASN B CG  1 
ATOM   574  O  OD1 . ASN B 1 14 ? 10.060  31.078 24.200  1.00 29.03 ? 533 ASN B OD1 1 
ATOM   575  N  ND2 . ASN B 1 14 ? 8.975   30.759 22.264  1.00 20.31 ? 533 ASN B ND2 1 
ATOM   576  N  N   . GLU B 1 15 ? 12.779  27.940 23.201  1.00 25.73 ? 534 GLU B N   1 
ATOM   577  C  CA  . GLU B 1 15 ? 14.187  28.333 23.281  1.00 28.70 ? 534 GLU B CA  1 
ATOM   578  C  C   . GLU B 1 15 ? 14.897  28.013 21.958  1.00 32.28 ? 534 GLU B C   1 
ATOM   579  O  O   . GLU B 1 15 ? 15.957  28.567 21.652  1.00 24.41 ? 534 GLU B O   1 
ATOM   580  C  CB  . GLU B 1 15 ? 14.874  27.598 24.437  1.00 23.75 ? 534 GLU B CB  1 
ATOM   581  C  CG  . GLU B 1 15 ? 14.410  28.042 25.819  1.00 21.53 ? 534 GLU B CG  1 
ATOM   582  C  CD  . GLU B 1 15 ? 14.872  29.442 26.152  1.00 22.18 ? 534 GLU B CD  1 
ATOM   583  O  OE1 . GLU B 1 15 ? 16.099  29.650 26.258  1.00 27.50 ? 534 GLU B OE1 1 
ATOM   584  O  OE2 . GLU B 1 15 ? 14.014  30.336 26.301  1.00 29.89 ? 534 GLU B OE2 1 
ATOM   585  N  N   . LYS B 1 16 ? 14.300  27.120 21.174  1.00 25.44 ? 535 LYS B N   1 
ATOM   586  C  CA  . LYS B 1 16 ? 14.861  26.730 19.885  1.00 24.09 ? 535 LYS B CA  1 
ATOM   587  C  C   . LYS B 1 16 ? 14.242  27.553 18.763  1.00 27.00 ? 535 LYS B C   1 
ATOM   588  O  O   . LYS B 1 16 ? 14.928  27.974 17.829  1.00 23.35 ? 535 LYS B O   1 
ATOM   589  C  CB  . LYS B 1 16 ? 14.599  25.243 19.623  1.00 22.96 ? 535 LYS B CB  1 
ATOM   590  C  CG  . LYS B 1 16 ? 15.354  24.296 20.544  1.00 35.31 ? 535 LYS B CG  1 
ATOM   591  C  CD  . LYS B 1 16 ? 16.840  24.314 20.235  1.00 43.28 ? 535 LYS B CD  1 
ATOM   592  C  CE  . LYS B 1 16 ? 17.606  23.381 21.151  1.00 43.38 ? 535 LYS B CE  1 
ATOM   593  N  NZ  . LYS B 1 16 ? 17.517  23.809 22.572  1.00 50.34 ? 535 LYS B NZ  1 
ATOM   594  N  N   . ARG B 1 17 ? 12.937  27.775 18.862  1.00 25.54 ? 536 ARG B N   1 
ATOM   595  C  CA  . ARG B 1 17 ? 12.204  28.534 17.855  1.00 27.55 ? 536 ARG B CA  1 
ATOM   596  C  C   . ARG B 1 17 ? 11.183  29.445 18.539  1.00 32.53 ? 536 ARG B C   1 
ATOM   597  O  O   . ARG B 1 17 ? 10.224  28.972 19.145  1.00 29.47 ? 536 ARG B O   1 
ATOM   598  C  CB  . ARG B 1 17 ? 11.487  27.568 16.905  1.00 30.10 ? 536 ARG B CB  1 
ATOM   599  C  CG  . ARG B 1 17 ? 12.399  26.557 16.208  1.00 29.63 ? 536 ARG B CG  1 
ATOM   600  C  CD  . ARG B 1 17 ? 13.162  27.180 15.035  1.00 28.06 ? 536 ARG B CD  1 
ATOM   601  N  NE  . ARG B 1 17 ? 13.964  26.185 14.324  1.00 22.76 ? 536 ARG B NE  1 
ATOM   602  C  CZ  . ARG B 1 17 ? 15.146  25.732 14.731  1.00 26.76 ? 536 ARG B CZ  1 
ATOM   603  N  NH1 . ARG B 1 17 ? 15.692  26.185 15.853  1.00 26.58 ? 536 ARG B NH1 1 
ATOM   604  N  NH2 . ARG B 1 17 ? 15.778  24.804 14.019  1.00 27.79 ? 536 ARG B NH2 1 
ATOM   605  N  N   . ARG B 1 18 ? 11.391  30.753 18.438  1.00 30.60 ? 537 ARG B N   1 
ATOM   606  C  CA  . ARG B 1 18 ? 10.492  31.719 19.056  1.00 33.97 ? 537 ARG B CA  1 
ATOM   607  C  C   . ARG B 1 18 ? 9.268   32.003 18.195  1.00 31.77 ? 537 ARG B C   1 
ATOM   608  O  O   . ARG B 1 18 ? 9.304   31.847 16.977  1.00 40.07 ? 537 ARG B O   1 
ATOM   609  C  CB  . ARG B 1 18 ? 11.243  33.026 19.333  1.00 31.68 ? 537 ARG B CB  1 
ATOM   610  N  N   . GLY B 1 19 ? 8.182   32.410 18.845  1.00 30.66 ? 538 GLY B N   1 
ATOM   611  C  CA  . GLY B 1 19 ? 6.961   32.751 18.134  1.00 33.40 ? 538 GLY B CA  1 
ATOM   612  C  C   . GLY B 1 19 ? 6.202   31.660 17.400  1.00 34.99 ? 538 GLY B C   1 
ATOM   613  O  O   . GLY B 1 19 ? 5.519   31.945 16.417  1.00 37.67 ? 538 GLY B O   1 
ATOM   614  N  N   . LEU B 1 20 ? 6.301   30.419 17.865  1.00 27.07 ? 539 LEU B N   1 
ATOM   615  C  CA  . LEU B 1 20 ? 5.583   29.328 17.218  1.00 31.29 ? 539 LEU B CA  1 
ATOM   616  C  C   . LEU B 1 20 ? 4.085   29.455 17.473  1.00 31.57 ? 539 LEU B C   1 
ATOM   617  O  O   . LEU B 1 20 ? 3.654   29.948 18.520  1.00 29.70 ? 539 LEU B O   1 
ATOM   618  C  CB  . LEU B 1 20 ? 6.075   27.976 17.736  1.00 25.28 ? 539 LEU B CB  1 
ATOM   619  C  CG  . LEU B 1 20 ? 7.519   27.577 17.426  1.00 25.44 ? 539 LEU B CG  1 
ATOM   620  C  CD1 . LEU B 1 20 ? 7.800   26.225 18.059  1.00 25.50 ? 539 LEU B CD1 1 
ATOM   621  C  CD2 . LEU B 1 20 ? 7.736   27.509 15.921  1.00 23.88 ? 539 LEU B CD2 1 
ATOM   622  N  N   . LYS B 1 21 ? 3.295   29.003 16.510  1.00 27.66 ? 540 LYS B N   1 
ATOM   623  C  CA  . LYS B 1 21 ? 1.847   29.070 16.619  1.00 33.36 ? 540 LYS B CA  1 
ATOM   624  C  C   . LYS B 1 21 ? 1.248   27.696 16.863  1.00 22.69 ? 540 LYS B C   1 
ATOM   625  O  O   . LYS B 1 21 ? 1.554   26.733 16.163  1.00 30.28 ? 540 LYS B O   1 
ATOM   626  C  CB  . LYS B 1 21 ? 1.254   29.675 15.345  1.00 38.28 ? 540 LYS B CB  1 
ATOM   627  C  CG  . LYS B 1 21 ? 1.775   31.067 15.035  1.00 50.40 ? 540 LYS B CG  1 
ATOM   628  C  CD  . LYS B 1 21 ? 1.144   31.639 13.776  1.00 55.43 ? 540 LYS B CD  1 
ATOM   629  C  CE  . LYS B 1 21 ? 1.636   33.057 13.513  1.00 62.08 ? 540 LYS B CE  1 
ATOM   630  N  NZ  . LYS B 1 21 ? 1.002   33.669 12.308  1.00 66.38 ? 540 LYS B NZ  1 
ATOM   631  N  N   . TYR B 1 22 ? 0.395   27.616 17.874  1.00 24.40 ? 541 TYR B N   1 
ATOM   632  C  CA  . TYR B 1 22 ? -0.267  26.370 18.219  1.00 23.22 ? 541 TYR B CA  1 
ATOM   633  C  C   . TYR B 1 22 ? -1.730  26.469 17.799  1.00 29.78 ? 541 TYR B C   1 
ATOM   634  O  O   . TYR B 1 22 ? -2.477  27.306 18.311  1.00 34.32 ? 541 TYR B O   1 
ATOM   635  C  CB  . TYR B 1 22 ? -0.150  26.139 19.720  1.00 28.32 ? 541 TYR B CB  1 
ATOM   636  C  CG  . TYR B 1 22 ? 1.238   25.737 20.154  1.00 23.50 ? 541 TYR B CG  1 
ATOM   637  C  CD1 . TYR B 1 22 ? 1.575   24.394 20.325  1.00 20.79 ? 541 TYR B CD1 1 
ATOM   638  C  CD2 . TYR B 1 22 ? 2.221   26.697 20.381  1.00 29.51 ? 541 TYR B CD2 1 
ATOM   639  C  CE1 . TYR B 1 22 ? 2.861   24.015 20.718  1.00 21.46 ? 541 TYR B CE1 1 
ATOM   640  C  CE2 . TYR B 1 22 ? 3.507   26.332 20.771  1.00 23.15 ? 541 TYR B CE2 1 
ATOM   641  C  CZ  . TYR B 1 22 ? 3.819   24.994 20.938  1.00 18.38 ? 541 TYR B CZ  1 
ATOM   642  O  OH  . TYR B 1 22 ? 5.087   24.642 21.337  1.00 26.00 ? 541 TYR B OH  1 
ATOM   643  N  N   . GLU B 1 23 ? -2.129  25.614 16.862  1.00 23.73 ? 542 GLU B N   1 
ATOM   644  C  CA  . GLU B 1 23 ? -3.494  25.609 16.345  1.00 26.85 ? 542 GLU B CA  1 
ATOM   645  C  C   . GLU B 1 23 ? -4.355  24.489 16.916  1.00 24.48 ? 542 GLU B C   1 
ATOM   646  O  O   . GLU B 1 23 ? -3.950  23.331 16.944  1.00 26.88 ? 542 GLU B O   1 
ATOM   647  C  CB  . GLU B 1 23 ? -3.477  25.478 14.819  1.00 28.28 ? 542 GLU B CB  1 
ATOM   648  C  CG  . GLU B 1 23 ? -2.837  26.645 14.082  1.00 52.40 ? 542 GLU B CG  1 
ATOM   649  C  CD  . GLU B 1 23 ? -3.647  27.926 14.196  1.00 63.04 ? 542 GLU B CD  1 
ATOM   650  O  OE1 . GLU B 1 23 ? -4.839  27.910 13.819  1.00 69.33 ? 542 GLU B OE1 1 
ATOM   651  O  OE2 . GLU B 1 23 ? -3.094  28.949 14.655  1.00 61.98 ? 542 GLU B OE2 1 
ATOM   652  N  N   . LEU B 1 24 ? -5.551  24.840 17.371  1.00 25.53 ? 543 LEU B N   1 
ATOM   653  C  CA  . LEU B 1 24 ? -6.464  23.841 17.901  1.00 24.06 ? 543 LEU B CA  1 
ATOM   654  C  C   . LEU B 1 24 ? -7.043  23.144 16.678  1.00 28.66 ? 543 LEU B C   1 
ATOM   655  O  O   . LEU B 1 24 ? -7.761  23.757 15.888  1.00 28.55 ? 543 LEU B O   1 
ATOM   656  C  CB  . LEU B 1 24 ? -7.576  24.504 18.709  1.00 26.41 ? 543 LEU B CB  1 
ATOM   657  C  CG  . LEU B 1 24 ? -8.670  23.573 19.230  1.00 26.64 ? 543 LEU B CG  1 
ATOM   658  C  CD1 . LEU B 1 24 ? -8.058  22.419 20.016  1.00 26.06 ? 543 LEU B CD1 1 
ATOM   659  C  CD2 . LEU B 1 24 ? -9.614  24.380 20.112  1.00 34.07 ? 543 LEU B CD2 1 
ATOM   660  N  N   . ILE B 1 25 ? -6.718  21.867 16.522  1.00 20.61 ? 544 ILE B N   1 
ATOM   661  C  CA  . ILE B 1 25 ? -7.171  21.088 15.378  1.00 29.80 ? 544 ILE B CA  1 
ATOM   662  C  C   . ILE B 1 25 ? -8.431  20.267 15.623  1.00 33.64 ? 544 ILE B C   1 
ATOM   663  O  O   . ILE B 1 25 ? -9.130  19.902 14.679  1.00 27.36 ? 544 ILE B O   1 
ATOM   664  C  CB  . ILE B 1 25 ? -6.052  20.137 14.901  1.00 31.80 ? 544 ILE B CB  1 
ATOM   665  C  CG1 . ILE B 1 25 ? -4.802  20.948 14.560  1.00 37.63 ? 544 ILE B CG1 1 
ATOM   666  C  CG2 . ILE B 1 25 ? -6.510  19.342 13.689  1.00 47.60 ? 544 ILE B CG2 1 
ATOM   667  C  CD1 . ILE B 1 25 ? -5.040  22.049 13.547  1.00 41.69 ? 544 ILE B CD1 1 
ATOM   668  N  N   . SER B 1 26 ? -8.729  19.984 16.885  1.00 24.26 ? 545 SER B N   1 
ATOM   669  C  CA  . SER B 1 26 ? -9.903  19.185 17.200  1.00 25.65 ? 545 SER B CA  1 
ATOM   670  C  C   . SER B 1 26 ? -10.339 19.386 18.648  1.00 25.81 ? 545 SER B C   1 
ATOM   671  O  O   . SER B 1 26 ? -9.511  19.562 19.542  1.00 22.96 ? 545 SER B O   1 
ATOM   672  C  CB  . SER B 1 26 ? -9.586  17.705 16.951  1.00 23.24 ? 545 SER B CB  1 
ATOM   673  O  OG  . SER B 1 26 ? -10.709 16.880 17.206  1.00 40.17 ? 545 SER B OG  1 
ATOM   674  N  N   . GLU B 1 27 ? -11.649 19.379 18.864  1.00 23.37 ? 546 GLU B N   1 
ATOM   675  C  CA  . GLU B 1 27 ? -12.224 19.522 20.197  1.00 20.50 ? 546 GLU B CA  1 
ATOM   676  C  C   . GLU B 1 27 ? -13.550 18.781 20.164  1.00 24.51 ? 546 GLU B C   1 
ATOM   677  O  O   . GLU B 1 27 ? -14.501 19.219 19.517  1.00 26.23 ? 546 GLU B O   1 
ATOM   678  C  CB  . GLU B 1 27 ? -12.458 20.992 20.553  1.00 18.98 ? 546 GLU B CB  1 
ATOM   679  C  CG  . GLU B 1 27 ? -13.287 21.161 21.824  1.00 23.84 ? 546 GLU B CG  1 
ATOM   680  C  CD  . GLU B 1 27 ? -13.480 22.607 22.239  1.00 28.26 ? 546 GLU B CD  1 
ATOM   681  O  OE1 . GLU B 1 27 ? -13.005 23.510 21.518  1.00 32.45 ? 546 GLU B OE1 1 
ATOM   682  O  OE2 . GLU B 1 27 ? -14.108 22.833 23.296  1.00 29.41 ? 546 GLU B OE2 1 
ATOM   683  N  N   . THR B 1 28 ? -13.601 17.643 20.845  1.00 22.44 ? 547 THR B N   1 
ATOM   684  C  CA  . THR B 1 28 ? -14.804 16.831 20.862  1.00 29.14 ? 547 THR B CA  1 
ATOM   685  C  C   . THR B 1 28 ? -15.074 16.294 22.255  1.00 30.50 ? 547 THR B C   1 
ATOM   686  O  O   . THR B 1 28 ? -14.303 16.541 23.184  1.00 25.84 ? 547 THR B O   1 
ATOM   687  C  CB  . THR B 1 28 ? -14.667 15.641 19.901  1.00 34.86 ? 547 THR B CB  1 
ATOM   688  O  OG1 . THR B 1 28 ? -13.569 14.817 20.317  1.00 29.36 ? 547 THR B OG1 1 
ATOM   689  C  CG2 . THR B 1 28 ? -14.420 16.133 18.477  1.00 33.52 ? 547 THR B CG2 1 
ATOM   690  N  N   . GLY B 1 29 ? -16.177 15.563 22.392  1.00 22.80 ? 548 GLY B N   1 
ATOM   691  C  CA  . GLY B 1 29 ? -16.534 14.985 23.676  1.00 28.80 ? 548 GLY B CA  1 
ATOM   692  C  C   . GLY B 1 29 ? -17.400 15.871 24.547  1.00 33.98 ? 548 GLY B C   1 
ATOM   693  O  O   . GLY B 1 29 ? -17.540 17.070 24.294  1.00 34.13 ? 548 GLY B O   1 
ATOM   694  N  N   . GLY B 1 30 ? -17.981 15.271 25.584  1.00 36.86 ? 549 GLY B N   1 
ATOM   695  C  CA  . GLY B 1 30 ? -18.836 16.008 26.495  1.00 33.80 ? 549 GLY B CA  1 
ATOM   696  C  C   . GLY B 1 30 ? -18.058 16.792 27.534  1.00 40.41 ? 549 GLY B C   1 
ATOM   697  O  O   . GLY B 1 30 ? -16.834 16.693 27.612  1.00 41.36 ? 549 GLY B O   1 
ATOM   698  N  N   . SER B 1 31 ? -18.782 17.564 28.338  1.00 36.12 ? 550 SER B N   1 
ATOM   699  C  CA  . SER B 1 31 ? -18.201 18.395 29.388  1.00 43.90 ? 550 SER B CA  1 
ATOM   700  C  C   . SER B 1 31 ? -17.189 17.680 30.283  1.00 42.61 ? 550 SER B C   1 
ATOM   701  O  O   . SER B 1 31 ? -16.208 18.280 30.722  1.00 51.88 ? 550 SER B O   1 
ATOM   702  C  CB  . SER B 1 31 ? -19.319 18.981 30.254  1.00 55.01 ? 550 SER B CB  1 
ATOM   703  O  OG  . SER B 1 31 ? -18.797 19.816 31.270  1.00 65.59 ? 550 SER B OG  1 
ATOM   704  N  N   . HIS B 1 32 ? -17.425 16.404 30.560  1.00 39.06 ? 551 HIS B N   1 
ATOM   705  C  CA  . HIS B 1 32 ? -16.506 15.666 31.405  1.00 42.91 ? 551 HIS B CA  1 
ATOM   706  C  C   . HIS B 1 32 ? -15.848 14.532 30.653  1.00 43.67 ? 551 HIS B C   1 
ATOM   707  O  O   . HIS B 1 32 ? -15.642 13.447 31.194  1.00 50.48 ? 551 HIS B O   1 
ATOM   708  N  N   . ASP B 1 33 ? -15.514 14.784 29.396  1.00 42.57 ? 552 ASP B N   1 
ATOM   709  C  CA  . ASP B 1 33 ? -14.886 13.773 28.558  1.00 42.31 ? 552 ASP B CA  1 
ATOM   710  C  C   . ASP B 1 33 ? -14.307 14.460 27.323  1.00 37.46 ? 552 ASP B C   1 
ATOM   711  O  O   . ASP B 1 33 ? -14.386 13.947 26.207  1.00 35.12 ? 552 ASP B O   1 
ATOM   712  C  CB  . ASP B 1 33 ? -15.931 12.732 28.152  1.00 53.38 ? 552 ASP B CB  1 
ATOM   713  C  CG  . ASP B 1 33 ? -15.332 11.564 27.406  1.00 63.73 ? 552 ASP B CG  1 
ATOM   714  O  OD1 . ASP B 1 33 ? -14.460 10.877 27.979  1.00 67.41 ? 552 ASP B OD1 1 
ATOM   715  O  OD2 . ASP B 1 33 ? -15.735 11.331 26.246  1.00 69.52 ? 552 ASP B OD2 1 
ATOM   716  N  N   . LYS B 1 34 ? -13.721 15.630 27.547  1.00 29.71 ? 553 LYS B N   1 
ATOM   717  C  CA  . LYS B 1 34 ? -13.138 16.431 26.479  1.00 23.85 ? 553 LYS B CA  1 
ATOM   718  C  C   . LYS B 1 34 ? -11.906 15.797 25.858  1.00 32.50 ? 553 LYS B C   1 
ATOM   719  O  O   . LYS B 1 34 ? -11.138 15.106 26.528  1.00 26.45 ? 553 LYS B O   1 
ATOM   720  C  CB  . LYS B 1 34 ? -12.760 17.809 27.015  1.00 27.49 ? 553 LYS B CB  1 
ATOM   721  C  CG  . LYS B 1 34 ? -13.919 18.573 27.615  1.00 32.63 ? 553 LYS B CG  1 
ATOM   722  C  CD  . LYS B 1 34 ? -14.891 19.035 26.548  1.00 29.64 ? 553 LYS B CD  1 
ATOM   723  C  CE  . LYS B 1 34 ? -14.277 20.131 25.694  1.00 37.56 ? 553 LYS B CE  1 
ATOM   724  N  NZ  . LYS B 1 34 ? -15.247 20.669 24.701  1.00 36.37 ? 553 LYS B NZ  1 
ATOM   725  N  N   . ARG B 1 35 ? -11.736 16.046 24.564  1.00 21.50 ? 554 ARG B N   1 
ATOM   726  C  CA  . ARG B 1 35 ? -10.591 15.561 23.816  1.00 22.18 ? 554 ARG B CA  1 
ATOM   727  C  C   . ARG B 1 35 ? -10.168 16.726 22.935  1.00 22.92 ? 554 ARG B C   1 
ATOM   728  O  O   . ARG B 1 35 ? -10.918 17.147 22.052  1.00 27.42 ? 554 ARG B O   1 
ATOM   729  C  CB  . ARG B 1 35 ? -10.975 14.363 22.955  1.00 26.42 ? 554 ARG B CB  1 
ATOM   730  N  N   . PHE B 1 36 ? -8.979  17.254 23.201  1.00 19.90 ? 555 PHE B N   1 
ATOM   731  C  CA  . PHE B 1 36 ? -8.418  18.367 22.448  1.00 13.63 ? 555 PHE B CA  1 
ATOM   732  C  C   . PHE B 1 36 ? -7.199  17.889 21.670  1.00 24.25 ? 555 PHE B C   1 
ATOM   733  O  O   . PHE B 1 36 ? -6.441  17.054 22.157  1.00 19.69 ? 555 PHE B O   1 
ATOM   734  C  CB  . PHE B 1 36 ? -7.930  19.471 23.389  1.00 17.39 ? 555 PHE B CB  1 
ATOM   735  C  CG  . PHE B 1 36 ? -9.014  20.156 24.156  1.00 20.66 ? 555 PHE B CG  1 
ATOM   736  C  CD1 . PHE B 1 36 ? -9.820  21.112 23.544  1.00 24.11 ? 555 PHE B CD1 1 
ATOM   737  C  CD2 . PHE B 1 36 ? -9.213  19.868 25.499  1.00 25.39 ? 555 PHE B CD2 1 
ATOM   738  C  CE1 . PHE B 1 36 ? -10.811 21.774 24.266  1.00 25.16 ? 555 PHE B CE1 1 
ATOM   739  C  CE2 . PHE B 1 36 ? -10.202 20.525 26.232  1.00 23.12 ? 555 PHE B CE2 1 
ATOM   740  C  CZ  . PHE B 1 36 ? -10.999 21.478 25.614  1.00 24.10 ? 555 PHE B CZ  1 
ATOM   741  N  N   . VAL B 1 37 ? -7.004  18.430 20.473  1.00 18.31 ? 556 VAL B N   1 
ATOM   742  C  CA  . VAL B 1 37 ? -5.835  18.083 19.674  1.00 20.46 ? 556 VAL B CA  1 
ATOM   743  C  C   . VAL B 1 37 ? -5.210  19.387 19.209  1.00 21.23 ? 556 VAL B C   1 
ATOM   744  O  O   . VAL B 1 37 ? -5.889  20.235 18.623  1.00 21.04 ? 556 VAL B O   1 
ATOM   745  C  CB  . VAL B 1 37 ? -6.193  17.228 18.450  1.00 22.06 ? 556 VAL B CB  1 
ATOM   746  C  CG1 . VAL B 1 37 ? -4.941  16.987 17.610  1.00 19.33 ? 556 VAL B CG1 1 
ATOM   747  C  CG2 . VAL B 1 37 ? -6.792  15.896 18.903  1.00 27.89 ? 556 VAL B CG2 1 
HETATM 748  N  N   . MSE B 1 38 ? -3.922  19.552 19.497  1.00 17.53 ? 557 MSE B N   1 
HETATM 749  C  CA  . MSE B 1 38 ? -3.191  20.757 19.124  1.00 18.70 ? 557 MSE B CA  1 
HETATM 750  C  C   . MSE B 1 38 ? -2.148  20.413 18.078  1.00 22.41 ? 557 MSE B C   1 
HETATM 751  O  O   . MSE B 1 38 ? -1.642  19.289 18.040  1.00 21.54 ? 557 MSE B O   1 
HETATM 752  C  CB  . MSE B 1 38 ? -2.468  21.370 20.338  1.00 20.12 ? 557 MSE B CB  1 
HETATM 753  C  CG  . MSE B 1 38 ? -3.344  22.106 21.346  1.00 29.41 ? 557 MSE B CG  1 
HETATM 754  SE SE  . MSE B 1 38 ? -4.092  23.773 20.674  1.00 39.17 ? 557 MSE B SE  1 
HETATM 755  C  CE  . MSE B 1 38 ? -2.681  25.010 20.981  1.00 45.51 ? 557 MSE B CE  1 
ATOM   756  N  N   . GLU B 1 39 ? -1.823  21.397 17.242  1.00 19.31 ? 558 GLU B N   1 
ATOM   757  C  CA  . GLU B 1 39 ? -0.825  21.219 16.196  1.00 20.53 ? 558 GLU B CA  1 
ATOM   758  C  C   . GLU B 1 39 ? 0.100   22.424 16.124  1.00 23.24 ? 558 GLU B C   1 
ATOM   759  O  O   . GLU B 1 39 ? -0.347  23.569 16.218  1.00 27.27 ? 558 GLU B O   1 
ATOM   760  C  CB  . GLU B 1 39 ? -1.505  21.038 14.843  1.00 21.36 ? 558 GLU B CB  1 
ATOM   761  C  CG  . GLU B 1 39 ? -0.544  20.804 13.688  1.00 21.79 ? 558 GLU B CG  1 
ATOM   762  C  CD  . GLU B 1 39 ? -1.275  20.564 12.383  1.00 26.71 ? 558 GLU B CD  1 
ATOM   763  O  OE1 . GLU B 1 39 ? -1.724  21.547 11.758  1.00 41.73 ? 558 GLU B OE1 1 
ATOM   764  O  OE2 . GLU B 1 39 ? -1.415  19.388 11.988  1.00 28.38 ? 558 GLU B OE2 1 
ATOM   765  N  N   . VAL B 1 40 ? 1.392   22.159 15.963  1.00 18.02 ? 559 VAL B N   1 
ATOM   766  C  CA  . VAL B 1 40 ? 2.370   23.228 15.837  1.00 22.51 ? 559 VAL B CA  1 
ATOM   767  C  C   . VAL B 1 40 ? 3.272   22.881 14.662  1.00 22.65 ? 559 VAL B C   1 
ATOM   768  O  O   . VAL B 1 40 ? 3.627   21.715 14.463  1.00 17.87 ? 559 VAL B O   1 
ATOM   769  C  CB  . VAL B 1 40 ? 3.225   23.402 17.135  1.00 24.55 ? 559 VAL B CB  1 
ATOM   770  C  CG1 . VAL B 1 40 ? 4.067   22.172 17.390  1.00 22.12 ? 559 VAL B CG1 1 
ATOM   771  C  CG2 . VAL B 1 40 ? 4.116   24.644 17.021  1.00 19.97 ? 559 VAL B CG2 1 
ATOM   772  N  N   . GLU B 1 41 ? 3.606   23.888 13.862  1.00 21.20 ? 560 GLU B N   1 
ATOM   773  C  CA  . GLU B 1 41 ? 4.484   23.676 12.719  1.00 21.03 ? 560 GLU B CA  1 
ATOM   774  C  C   . GLU B 1 41 ? 5.874   24.179 13.079  1.00 20.07 ? 560 GLU B C   1 
ATOM   775  O  O   . GLU B 1 41 ? 6.050   25.329 13.488  1.00 22.00 ? 560 GLU B O   1 
ATOM   776  C  CB  . GLU B 1 41 ? 3.979   24.424 11.478  1.00 22.04 ? 560 GLU B CB  1 
ATOM   777  C  CG  . GLU B 1 41 ? 4.854   24.179 10.250  1.00 26.62 ? 560 GLU B CG  1 
ATOM   778  C  CD  . GLU B 1 41 ? 4.448   25.010 9.049   1.00 37.86 ? 560 GLU B CD  1 
ATOM   779  O  OE1 . GLU B 1 41 ? 3.259   24.976 8.676   1.00 35.37 ? 560 GLU B OE1 1 
ATOM   780  O  OE2 . GLU B 1 41 ? 5.325   25.694 8.476   1.00 47.00 ? 560 GLU B OE2 1 
ATOM   781  N  N   . VAL B 1 42 ? 6.860   23.306 12.935  1.00 21.10 ? 561 VAL B N   1 
ATOM   782  C  CA  . VAL B 1 42 ? 8.241   23.654 13.238  1.00 20.04 ? 561 VAL B CA  1 
ATOM   783  C  C   . VAL B 1 42 ? 9.101   23.177 12.074  1.00 22.62 ? 561 VAL B C   1 
ATOM   784  O  O   . VAL B 1 42 ? 8.956   22.042 11.617  1.00 22.87 ? 561 VAL B O   1 
ATOM   785  C  CB  . VAL B 1 42 ? 8.719   22.963 14.533  1.00 22.25 ? 561 VAL B CB  1 
ATOM   786  C  CG1 . VAL B 1 42 ? 10.120  23.444 14.899  1.00 17.14 ? 561 VAL B CG1 1 
ATOM   787  C  CG2 . VAL B 1 42 ? 7.726   23.232 15.666  1.00 24.34 ? 561 VAL B CG2 1 
ATOM   788  N  N   . ASP B 1 43 ? 9.978   24.051 11.592  1.00 23.87 ? 562 ASP B N   1 
ATOM   789  C  CA  . ASP B 1 43 ? 10.855  23.722 10.473  1.00 24.43 ? 562 ASP B CA  1 
ATOM   790  C  C   . ASP B 1 43 ? 10.069  23.053 9.348   1.00 25.77 ? 562 ASP B C   1 
ATOM   791  O  O   . ASP B 1 43 ? 10.446  21.991 8.854   1.00 21.21 ? 562 ASP B O   1 
ATOM   792  C  CB  . ASP B 1 43 ? 11.993  22.804 10.937  1.00 21.41 ? 562 ASP B CB  1 
ATOM   793  C  CG  . ASP B 1 43 ? 12.898  23.468 11.970  1.00 28.02 ? 562 ASP B CG  1 
ATOM   794  O  OD1 . ASP B 1 43 ? 12.803  24.703 12.146  1.00 28.57 ? 562 ASP B OD1 1 
ATOM   795  O  OD2 . ASP B 1 43 ? 13.720  22.758 12.597  1.00 28.54 ? 562 ASP B OD2 1 
ATOM   796  N  N   . GLY B 1 44 ? 8.963   23.680 8.962   1.00 22.80 ? 563 GLY B N   1 
ATOM   797  C  CA  . GLY B 1 44 ? 8.134   23.150 7.893   1.00 24.12 ? 563 GLY B CA  1 
ATOM   798  C  C   . GLY B 1 44 ? 7.542   21.770 8.120   1.00 23.72 ? 563 GLY B C   1 
ATOM   799  O  O   . GLY B 1 44 ? 7.159   21.105 7.162   1.00 23.73 ? 563 GLY B O   1 
ATOM   800  N  N   . GLN B 1 45 ? 7.447   21.340 9.377   1.00 17.95 ? 564 GLN B N   1 
ATOM   801  C  CA  . GLN B 1 45 ? 6.895   20.027 9.700   1.00 16.77 ? 564 GLN B CA  1 
ATOM   802  C  C   . GLN B 1 45 ? 5.823   20.166 10.777  1.00 19.92 ? 564 GLN B C   1 
ATOM   803  O  O   . GLN B 1 45 ? 5.970   20.965 11.692  1.00 25.97 ? 564 GLN B O   1 
ATOM   804  C  CB  . GLN B 1 45 ? 8.008   19.102 10.185  1.00 22.78 ? 564 GLN B CB  1 
ATOM   805  C  CG  . GLN B 1 45 ? 9.051   18.793 9.112   1.00 27.46 ? 564 GLN B CG  1 
ATOM   806  C  CD  . GLN B 1 45 ? 10.392  18.391 9.691   1.00 25.77 ? 564 GLN B CD  1 
ATOM   807  O  OE1 . GLN B 1 45 ? 11.356  19.166 9.659   1.00 23.54 ? 564 GLN B OE1 1 
ATOM   808  N  NE2 . GLN B 1 45 ? 10.463  17.185 10.237  1.00 15.55 ? 564 GLN B NE2 1 
ATOM   809  N  N   . LYS B 1 46 ? 4.759   19.377 10.672  1.00 25.59 ? 565 LYS B N   1 
ATOM   810  C  CA  . LYS B 1 46 ? 3.657   19.450 11.630  1.00 22.78 ? 565 LYS B CA  1 
ATOM   811  C  C   . LYS B 1 46 ? 3.747   18.422 12.757  1.00 24.07 ? 565 LYS B C   1 
ATOM   812  O  O   . LYS B 1 46 ? 4.072   17.256 12.529  1.00 20.03 ? 565 LYS B O   1 
ATOM   813  C  CB  . LYS B 1 46 ? 2.325   19.281 10.897  1.00 27.09 ? 565 LYS B CB  1 
ATOM   814  C  CG  . LYS B 1 46 ? 2.097   20.274 9.771   1.00 38.42 ? 565 LYS B CG  1 
ATOM   815  C  CD  . LYS B 1 46 ? 1.933   21.690 10.296  1.00 44.19 ? 565 LYS B CD  1 
ATOM   816  C  CE  . LYS B 1 46 ? 1.567   22.646 9.171   1.00 54.26 ? 565 LYS B CE  1 
ATOM   817  N  NZ  . LYS B 1 46 ? 0.328   22.221 8.460   1.00 53.26 ? 565 LYS B NZ  1 
ATOM   818  N  N   . PHE B 1 47 ? 3.439   18.869 13.972  1.00 19.02 ? 566 PHE B N   1 
ATOM   819  C  CA  . PHE B 1 47 ? 3.473   18.014 15.153  1.00 19.73 ? 566 PHE B CA  1 
ATOM   820  C  C   . PHE B 1 47 ? 2.209   18.232 15.972  1.00 19.48 ? 566 PHE B C   1 
ATOM   821  O  O   . PHE B 1 47 ? 1.802   19.372 16.200  1.00 18.71 ? 566 PHE B O   1 
ATOM   822  C  CB  . PHE B 1 47 ? 4.705   18.340 15.997  1.00 18.60 ? 566 PHE B CB  1 
ATOM   823  C  CG  . PHE B 1 47 ? 5.990   18.164 15.257  1.00 18.84 ? 566 PHE B CG  1 
ATOM   824  C  CD1 . PHE B 1 47 ? 6.567   16.904 15.139  1.00 18.55 ? 566 PHE B CD1 1 
ATOM   825  C  CD2 . PHE B 1 47 ? 6.583   19.244 14.609  1.00 15.89 ? 566 PHE B CD2 1 
ATOM   826  C  CE1 . PHE B 1 47 ? 7.726   16.716 14.374  1.00 21.16 ? 566 PHE B CE1 1 
ATOM   827  C  CE2 . PHE B 1 47 ? 7.742   19.067 13.839  1.00 16.08 ? 566 PHE B CE2 1 
ATOM   828  C  CZ  . PHE B 1 47 ? 8.309   17.799 13.723  1.00 18.13 ? 566 PHE B CZ  1 
ATOM   829  N  N   . GLN B 1 48 ? 1.593   17.137 16.410  1.00 18.91 ? 567 GLN B N   1 
ATOM   830  C  CA  . GLN B 1 48 ? 0.368   17.227 17.197  1.00 17.18 ? 567 GLN B CA  1 
ATOM   831  C  C   . GLN B 1 48 ? 0.453   16.633 18.595  1.00 18.56 ? 567 GLN B C   1 
ATOM   832  O  O   . GLN B 1 48 ? 1.282   15.767 18.882  1.00 20.11 ? 567 GLN B O   1 
ATOM   833  C  CB  . GLN B 1 48 ? -0.782  16.546 16.459  1.00 17.94 ? 567 GLN B CB  1 
ATOM   834  C  CG  . GLN B 1 48 ? -1.053  17.093 15.074  1.00 22.58 ? 567 GLN B CG  1 
ATOM   835  C  CD  . GLN B 1 48 ? -2.343  16.548 14.509  1.00 44.34 ? 567 GLN B CD  1 
ATOM   836  O  OE1 . GLN B 1 48 ? -2.603  15.345 14.577  1.00 52.07 ? 567 GLN B OE1 1 
ATOM   837  N  NE2 . GLN B 1 48 ? -3.162  17.428 13.944  1.00 54.59 ? 567 GLN B NE2 1 
ATOM   838  N  N   . GLY B 1 49 ? -0.441  17.101 19.460  1.00 20.04 ? 568 GLY B N   1 
ATOM   839  C  CA  . GLY B 1 49 ? -0.505  16.613 20.823  1.00 19.72 ? 568 GLY B CA  1 
ATOM   840  C  C   . GLY B 1 49 ? -1.967  16.579 21.226  1.00 20.40 ? 568 GLY B C   1 
ATOM   841  O  O   . GLY B 1 49 ? -2.736  17.439 20.803  1.00 20.43 ? 568 GLY B O   1 
ATOM   842  N  N   . ALA B 1 50 ? -2.359  15.600 22.034  1.00 19.30 ? 569 ALA B N   1 
ATOM   843  C  CA  . ALA B 1 50 ? -3.754  15.491 22.458  1.00 21.85 ? 569 ALA B CA  1 
ATOM   844  C  C   . ALA B 1 50 ? -3.877  15.333 23.968  1.00 16.90 ? 569 ALA B C   1 
ATOM   845  O  O   . ALA B 1 50 ? -2.945  14.887 24.632  1.00 23.25 ? 569 ALA B O   1 
ATOM   846  C  CB  . ALA B 1 50 ? -4.427  14.307 21.756  1.00 24.54 ? 569 ALA B CB  1 
ATOM   847  N  N   . GLY B 1 51 ? -5.040  15.698 24.499  1.00 22.03 ? 570 GLY B N   1 
ATOM   848  C  CA  . GLY B 1 51 ? -5.271  15.586 25.929  1.00 20.89 ? 570 GLY B CA  1 
ATOM   849  C  C   . GLY B 1 51 ? -6.671  16.015 26.320  1.00 20.19 ? 570 GLY B C   1 
ATOM   850  O  O   . GLY B 1 51 ? -7.436  16.491 25.484  1.00 22.75 ? 570 GLY B O   1 
ATOM   851  N  N   . SER B 1 52 ? -7.006  15.853 27.595  1.00 23.59 ? 571 SER B N   1 
ATOM   852  C  CA  . SER B 1 52 ? -8.324  16.227 28.090  1.00 20.79 ? 571 SER B CA  1 
ATOM   853  C  C   . SER B 1 52 ? -8.415  17.725 28.353  1.00 21.13 ? 571 SER B C   1 
ATOM   854  O  O   . SER B 1 52 ? -9.470  18.231 28.726  1.00 24.72 ? 571 SER B O   1 
ATOM   855  C  CB  . SER B 1 52 ? -8.665  15.437 29.357  1.00 26.01 ? 571 SER B CB  1 
ATOM   856  O  OG  . SER B 1 52 ? -7.684  15.632 30.351  1.00 32.02 ? 571 SER B OG  1 
ATOM   857  N  N   . ASN B 1 53 ? -7.296  18.426 28.187  1.00 18.14 ? 572 ASN B N   1 
ATOM   858  C  CA  . ASN B 1 53 ? -7.272  19.877 28.347  1.00 20.07 ? 572 ASN B CA  1 
ATOM   859  C  C   . ASN B 1 53 ? -6.293  20.475 27.344  1.00 20.79 ? 572 ASN B C   1 
ATOM   860  O  O   . ASN B 1 53 ? -5.374  19.805 26.877  1.00 19.48 ? 572 ASN B O   1 
ATOM   861  C  CB  . ASN B 1 53 ? -6.928  20.307 29.785  1.00 25.36 ? 572 ASN B CB  1 
ATOM   862  C  CG  . ASN B 1 53 ? -5.592  19.792 30.260  1.00 29.27 ? 572 ASN B CG  1 
ATOM   863  O  OD1 . ASN B 1 53 ? -5.510  18.787 30.972  1.00 26.37 ? 572 ASN B OD1 1 
ATOM   864  N  ND2 . ASN B 1 53 ? -4.534  20.478 29.873  1.00 17.59 ? 572 ASN B ND2 1 
ATOM   865  N  N   . LYS B 1 54 ? -6.508  21.737 27.000  1.00 18.00 ? 573 LYS B N   1 
ATOM   866  C  CA  . LYS B 1 54 ? -5.678  22.414 26.011  1.00 21.66 ? 573 LYS B CA  1 
ATOM   867  C  C   . LYS B 1 54 ? -4.209  22.521 26.378  1.00 25.73 ? 573 LYS B C   1 
ATOM   868  O  O   . LYS B 1 54 ? -3.338  22.419 25.514  1.00 19.19 ? 573 LYS B O   1 
ATOM   869  C  CB  . LYS B 1 54 ? -6.226  23.815 25.749  1.00 23.04 ? 573 LYS B CB  1 
ATOM   870  C  CG  . LYS B 1 54 ? -7.584  23.827 25.060  1.00 29.60 ? 573 LYS B CG  1 
ATOM   871  C  CD  . LYS B 1 54 ? -8.066  25.244 24.817  1.00 33.63 ? 573 LYS B CD  1 
ATOM   872  C  CE  . LYS B 1 54 ? -9.378  25.234 24.055  1.00 45.48 ? 573 LYS B CE  1 
ATOM   873  N  NZ  . LYS B 1 54 ? -9.850  26.604 23.718  1.00 40.09 ? 573 LYS B NZ  1 
ATOM   874  N  N   . LYS B 1 55 ? -3.936  22.731 27.660  1.00 18.64 ? 574 LYS B N   1 
ATOM   875  C  CA  . LYS B 1 55 ? -2.568  22.882 28.118  1.00 22.40 ? 574 LYS B CA  1 
ATOM   876  C  C   . LYS B 1 55 ? -1.739  21.635 27.842  1.00 18.54 ? 574 LYS B C   1 
ATOM   877  O  O   . LYS B 1 55 ? -0.648  21.719 27.275  1.00 17.59 ? 574 LYS B O   1 
ATOM   878  C  CB  . LYS B 1 55 ? -2.558  23.203 29.615  1.00 24.80 ? 574 LYS B CB  1 
ATOM   879  C  CG  . LYS B 1 55 ? -1.187  23.549 30.176  1.00 36.77 ? 574 LYS B CG  1 
ATOM   880  C  CD  . LYS B 1 55 ? -1.270  23.967 31.642  1.00 36.22 ? 574 LYS B CD  1 
ATOM   881  C  CE  . LYS B 1 55 ? -2.290  25.081 31.840  1.00 41.39 ? 574 LYS B CE  1 
ATOM   882  N  NZ  . LYS B 1 55 ? -2.022  26.240 30.943  1.00 54.40 ? 574 LYS B NZ  1 
ATOM   883  N  N   . VAL B 1 56 ? -2.249  20.475 28.239  1.00 14.85 ? 575 VAL B N   1 
ATOM   884  C  CA  . VAL B 1 56 ? -1.493  19.251 28.024  1.00 20.29 ? 575 VAL B CA  1 
ATOM   885  C  C   . VAL B 1 56 ? -1.423  18.879 26.542  1.00 19.53 ? 575 VAL B C   1 
ATOM   886  O  O   . VAL B 1 56 ? -0.438  18.291 26.102  1.00 16.57 ? 575 VAL B O   1 
ATOM   887  C  CB  . VAL B 1 56 ? -2.063  18.080 28.849  1.00 23.80 ? 575 VAL B CB  1 
ATOM   888  C  CG1 . VAL B 1 56 ? -3.320  17.529 28.196  1.00 26.50 ? 575 VAL B CG1 1 
ATOM   889  C  CG2 . VAL B 1 56 ? -0.994  17.003 29.016  1.00 29.58 ? 575 VAL B CG2 1 
ATOM   890  N  N   . ALA B 1 57 ? -2.452  19.227 25.769  1.00 17.57 ? 576 ALA B N   1 
ATOM   891  C  CA  . ALA B 1 57 ? -2.445  18.926 24.331  1.00 17.45 ? 576 ALA B CA  1 
ATOM   892  C  C   . ALA B 1 57 ? -1.283  19.683 23.691  1.00 18.21 ? 576 ALA B C   1 
ATOM   893  O  O   . ALA B 1 57 ? -0.519  19.122 22.898  1.00 19.40 ? 576 ALA B O   1 
ATOM   894  C  CB  . ALA B 1 57 ? -3.769  19.358 23.687  1.00 14.96 ? 576 ALA B CB  1 
ATOM   895  N  N   . LYS B 1 58 ? -1.156  20.961 24.039  1.00 20.15 ? 577 LYS B N   1 
ATOM   896  C  CA  . LYS B 1 58 ? -0.078  21.800 23.514  1.00 24.53 ? 577 LYS B CA  1 
ATOM   897  C  C   . LYS B 1 58 ? 1.275   21.247 23.936  1.00 16.72 ? 577 LYS B C   1 
ATOM   898  O  O   . LYS B 1 58 ? 2.212   21.194 23.135  1.00 16.15 ? 577 LYS B O   1 
ATOM   899  C  CB  . LYS B 1 58 ? -0.196  23.230 24.035  1.00 24.43 ? 577 LYS B CB  1 
ATOM   900  C  CG  . LYS B 1 58 ? -1.369  24.002 23.502  1.00 32.92 ? 577 LYS B CG  1 
ATOM   901  C  CD  . LYS B 1 58 ? -1.437  25.392 24.130  1.00 37.64 ? 577 LYS B CD  1 
ATOM   902  C  CE  . LYS B 1 58 ? -0.153  26.177 23.902  1.00 45.04 ? 577 LYS B CE  1 
ATOM   903  N  NZ  . LYS B 1 58 ? -0.226  27.539 24.505  1.00 54.95 ? 577 LYS B NZ  1 
ATOM   904  N  N   . ALA B 1 59 ? 1.375   20.852 25.205  1.00 14.47 ? 578 ALA B N   1 
ATOM   905  C  CA  . ALA B 1 59 ? 2.612   20.298 25.735  1.00 18.27 ? 578 ALA B CA  1 
ATOM   906  C  C   . ALA B 1 59 ? 3.028   19.073 24.937  1.00 16.92 ? 578 ALA B C   1 
ATOM   907  O  O   . ALA B 1 59 ? 4.202   18.898 24.611  1.00 20.14 ? 578 ALA B O   1 
ATOM   908  C  CB  . ALA B 1 59 ? 2.434   19.931 27.198  1.00 24.62 ? 578 ALA B CB  1 
ATOM   909  N  N   . TYR B 1 60 ? 2.066   18.220 24.613  1.00 15.55 ? 579 TYR B N   1 
ATOM   910  C  CA  . TYR B 1 60 ? 2.386   17.024 23.850  1.00 13.36 ? 579 TYR B CA  1 
ATOM   911  C  C   . TYR B 1 60 ? 2.811   17.364 22.426  1.00 13.93 ? 579 TYR B C   1 
ATOM   912  O  O   . TYR B 1 60 ? 3.679   16.695 21.859  1.00 15.86 ? 579 TYR B O   1 
ATOM   913  C  CB  . TYR B 1 60 ? 1.205   16.063 23.850  1.00 13.16 ? 579 TYR B CB  1 
ATOM   914  C  CG  . TYR B 1 60 ? 1.257   15.091 25.006  1.00 13.77 ? 579 TYR B CG  1 
ATOM   915  C  CD1 . TYR B 1 60 ? 2.296   14.170 25.110  1.00 24.38 ? 579 TYR B CD1 1 
ATOM   916  C  CD2 . TYR B 1 60 ? 0.275   15.095 25.999  1.00 16.73 ? 579 TYR B CD2 1 
ATOM   917  C  CE1 . TYR B 1 60 ? 2.362   13.273 26.170  1.00 23.51 ? 579 TYR B CE1 1 
ATOM   918  C  CE2 . TYR B 1 60 ? 0.329   14.195 27.067  1.00 19.79 ? 579 TYR B CE2 1 
ATOM   919  C  CZ  . TYR B 1 60 ? 1.381   13.289 27.139  1.00 18.00 ? 579 TYR B CZ  1 
ATOM   920  O  OH  . TYR B 1 60 ? 1.446   12.384 28.166  1.00 17.30 ? 579 TYR B OH  1 
ATOM   921  N  N   . ALA B 1 61 ? 2.221   18.414 21.861  1.00 18.64 ? 580 ALA B N   1 
ATOM   922  C  CA  . ALA B 1 61 ? 2.570   18.855 20.511  1.00 16.66 ? 580 ALA B CA  1 
ATOM   923  C  C   . ALA B 1 61 ? 4.027   19.328 20.492  1.00 19.09 ? 580 ALA B C   1 
ATOM   924  O  O   . ALA B 1 61 ? 4.798   18.975 19.595  1.00 17.86 ? 580 ALA B O   1 
ATOM   925  C  CB  . ALA B 1 61 ? 1.643   19.985 20.080  1.00 16.14 ? 580 ALA B CB  1 
ATOM   926  N  N   . ALA B 1 62 ? 4.404   20.137 21.478  1.00 17.79 ? 581 ALA B N   1 
ATOM   927  C  CA  . ALA B 1 62 ? 5.781   20.621 21.550  1.00 14.09 ? 581 ALA B CA  1 
ATOM   928  C  C   . ALA B 1 62 ? 6.728   19.455 21.837  1.00 15.35 ? 581 ALA B C   1 
ATOM   929  O  O   . ALA B 1 62 ? 7.809   19.381 21.265  1.00 23.03 ? 581 ALA B O   1 
ATOM   930  C  CB  . ALA B 1 62 ? 5.916   21.687 22.625  1.00 14.47 ? 581 ALA B CB  1 
ATOM   931  N  N   . LEU B 1 63 ? 6.317   18.539 22.712  1.00 17.72 ? 582 LEU B N   1 
ATOM   932  C  CA  . LEU B 1 63 ? 7.159   17.388 23.041  1.00 21.05 ? 582 LEU B CA  1 
ATOM   933  C  C   . LEU B 1 63 ? 7.451   16.547 21.800  1.00 20.48 ? 582 LEU B C   1 
ATOM   934  O  O   . LEU B 1 63 ? 8.564   16.047 21.618  1.00 20.21 ? 582 LEU B O   1 
ATOM   935  C  CB  . LEU B 1 63 ? 6.486   16.506 24.098  1.00 19.89 ? 582 LEU B CB  1 
ATOM   936  C  CG  . LEU B 1 63 ? 7.315   15.289 24.526  1.00 28.40 ? 582 LEU B CG  1 
ATOM   937  C  CD1 . LEU B 1 63 ? 8.566   15.774 25.234  1.00 27.08 ? 582 LEU B CD1 1 
ATOM   938  C  CD2 . LEU B 1 63 ? 6.501   14.379 25.446  1.00 27.90 ? 582 LEU B CD2 1 
ATOM   939  N  N   . ALA B 1 64 ? 6.442   16.378 20.953  1.00 16.14 ? 583 ALA B N   1 
ATOM   940  C  CA  . ALA B 1 64 ? 6.604   15.599 19.738  1.00 16.16 ? 583 ALA B CA  1 
ATOM   941  C  C   . ALA B 1 64 ? 7.637   16.269 18.834  1.00 17.52 ? 583 ALA B C   1 
ATOM   942  O  O   . ALA B 1 64 ? 8.503   15.604 18.271  1.00 20.21 ? 583 ALA B O   1 
ATOM   943  C  CB  . ALA B 1 64 ? 5.274   15.467 19.018  1.00 19.91 ? 583 ALA B CB  1 
ATOM   944  N  N   . ALA B 1 65 ? 7.555   17.590 18.709  1.00 17.15 ? 584 ALA B N   1 
ATOM   945  C  CA  . ALA B 1 65 ? 8.504   18.334 17.873  1.00 18.59 ? 584 ALA B CA  1 
ATOM   946  C  C   . ALA B 1 65 ? 9.930   18.230 18.425  1.00 19.75 ? 584 ALA B C   1 
ATOM   947  O  O   . ALA B 1 65 ? 10.888  18.040 17.668  1.00 20.13 ? 584 ALA B O   1 
ATOM   948  C  CB  . ALA B 1 65 ? 8.091   19.792 17.791  1.00 15.65 ? 584 ALA B CB  1 
ATOM   949  N  N   . LEU B 1 66 ? 10.066  18.367 19.743  1.00 17.52 ? 585 LEU B N   1 
ATOM   950  C  CA  . LEU B 1 66 ? 11.379  18.278 20.386  1.00 21.59 ? 585 LEU B CA  1 
ATOM   951  C  C   . LEU B 1 66 ? 12.021  16.909 20.212  1.00 20.43 ? 585 LEU B C   1 
ATOM   952  O  O   . LEU B 1 66 ? 13.204  16.804 19.890  1.00 23.67 ? 585 LEU B O   1 
ATOM   953  C  CB  . LEU B 1 66 ? 11.270  18.583 21.878  1.00 20.51 ? 585 LEU B CB  1 
ATOM   954  C  CG  . LEU B 1 66 ? 10.957  20.009 22.322  1.00 16.31 ? 585 LEU B CG  1 
ATOM   955  C  CD1 . LEU B 1 66 ? 10.566  19.981 23.778  1.00 19.62 ? 585 LEU B CD1 1 
ATOM   956  C  CD2 . LEU B 1 66 ? 12.172  20.910 22.111  1.00 15.84 ? 585 LEU B CD2 1 
ATOM   957  N  N   . GLU B 1 67 ? 11.239  15.857 20.430  1.00 22.38 ? 586 GLU B N   1 
ATOM   958  C  CA  . GLU B 1 67 ? 11.740  14.492 20.307  1.00 23.69 ? 586 GLU B CA  1 
ATOM   959  C  C   . GLU B 1 67 ? 12.199  14.190 18.892  1.00 25.10 ? 586 GLU B C   1 
ATOM   960  O  O   . GLU B 1 67 ? 13.212  13.526 18.680  1.00 30.45 ? 586 GLU B O   1 
ATOM   961  C  CB  . GLU B 1 67 ? 10.642  13.495 20.689  1.00 29.63 ? 586 GLU B CB  1 
ATOM   962  C  CG  . GLU B 1 67 ? 10.199  13.574 22.134  1.00 48.52 ? 586 GLU B CG  1 
ATOM   963  C  CD  . GLU B 1 67 ? 11.167  12.896 23.079  1.00 66.74 ? 586 GLU B CD  1 
ATOM   964  O  OE1 . GLU B 1 67 ? 12.339  13.326 23.150  1.00 75.33 ? 586 GLU B OE1 1 
ATOM   965  O  OE2 . GLU B 1 67 ? 10.750  11.928 23.748  1.00 72.97 ? 586 GLU B OE2 1 
ATOM   966  N  N   . LYS B 1 68 ? 11.444  14.682 17.920  1.00 21.72 ? 587 LYS B N   1 
ATOM   967  C  CA  . LYS B 1 68 ? 11.753  14.439 16.524  1.00 19.55 ? 587 LYS B CA  1 
ATOM   968  C  C   . LYS B 1 68 ? 12.872  15.323 15.975  1.00 24.23 ? 587 LYS B C   1 
ATOM   969  O  O   . LYS B 1 68 ? 13.782  14.839 15.305  1.00 19.77 ? 587 LYS B O   1 
ATOM   970  C  CB  . LYS B 1 68 ? 10.486  14.642 15.684  1.00 20.42 ? 587 LYS B CB  1 
ATOM   971  C  CG  . LYS B 1 68 ? 10.643  14.370 14.195  1.00 25.20 ? 587 LYS B CG  1 
ATOM   972  C  CD  . LYS B 1 68 ? 10.822  12.881 13.932  1.00 29.11 ? 587 LYS B CD  1 
ATOM   973  C  CE  . LYS B 1 68 ? 10.850  12.562 12.444  1.00 33.68 ? 587 LYS B CE  1 
ATOM   974  N  NZ  . LYS B 1 68 ? 9.575   12.920 11.766  1.00 32.22 ? 587 LYS B NZ  1 
ATOM   975  N  N   . LEU B 1 69 ? 12.810  16.617 16.264  1.00 19.45 ? 588 LEU B N   1 
ATOM   976  C  CA  . LEU B 1 69 ? 13.798  17.540 15.722  1.00 20.48 ? 588 LEU B CA  1 
ATOM   977  C  C   . LEU B 1 69 ? 14.939  17.979 16.631  1.00 23.07 ? 588 LEU B C   1 
ATOM   978  O  O   . LEU B 1 69 ? 15.963  18.451 16.138  1.00 26.39 ? 588 LEU B O   1 
ATOM   979  C  CB  . LEU B 1 69 ? 13.079  18.786 15.196  1.00 22.16 ? 588 LEU B CB  1 
ATOM   980  C  CG  . LEU B 1 69 ? 11.921  18.517 14.231  1.00 21.40 ? 588 LEU B CG  1 
ATOM   981  C  CD1 . LEU B 1 69 ? 11.240  19.834 13.863  1.00 18.40 ? 588 LEU B CD1 1 
ATOM   982  C  CD2 . LEU B 1 69 ? 12.437  17.791 12.988  1.00 18.20 ? 588 LEU B CD2 1 
ATOM   983  N  N   . PHE B 1 70 ? 14.783  17.815 17.941  1.00 22.62 ? 589 PHE B N   1 
ATOM   984  C  CA  . PHE B 1 70 ? 15.811  18.268 18.870  1.00 27.23 ? 589 PHE B CA  1 
ATOM   985  C  C   . PHE B 1 70 ? 16.275  17.289 19.950  1.00 33.48 ? 589 PHE B C   1 
ATOM   986  O  O   . PHE B 1 70 ? 15.893  17.408 21.117  1.00 27.62 ? 589 PHE B O   1 
ATOM   987  C  CB  . PHE B 1 70 ? 15.345  19.567 19.530  1.00 21.96 ? 589 PHE B CB  1 
ATOM   988  C  CG  . PHE B 1 70 ? 15.018  20.656 18.544  1.00 26.24 ? 589 PHE B CG  1 
ATOM   989  C  CD1 . PHE B 1 70 ? 16.029  21.298 17.837  1.00 22.76 ? 589 PHE B CD1 1 
ATOM   990  C  CD2 . PHE B 1 70 ? 13.694  21.022 18.300  1.00 21.70 ? 589 PHE B CD2 1 
ATOM   991  C  CE1 . PHE B 1 70 ? 15.728  22.290 16.902  1.00 24.98 ? 589 PHE B CE1 1 
ATOM   992  C  CE2 . PHE B 1 70 ? 13.386  22.009 17.370  1.00 20.87 ? 589 PHE B CE2 1 
ATOM   993  C  CZ  . PHE B 1 70 ? 14.401  22.646 16.669  1.00 27.07 ? 589 PHE B CZ  1 
ATOM   994  N  N   . PRO B 1 71 ? 17.118  16.338 19.550  1.00 43.90 ? 590 PRO B N   1 
ATOM   995  C  CA  . PRO B 1 71 ? 17.702  15.337 20.455  1.00 47.54 ? 590 PRO B CA  1 
ATOM   996  C  C   . PRO B 1 71 ? 16.780  14.894 21.581  1.00 51.55 ? 590 PRO B C   1 
ATOM   997  O  O   . PRO B 1 71 ? 17.278  14.776 22.717  1.00 49.39 ? 590 PRO B O   1 
ATOM   998  C  CB  . PRO B 1 71 ? 19.000  15.877 21.041  1.00 36.17 ? 590 PRO B CB  1 
HETATM 999  O  O   . HOH C 2 .  ? -17.952 9.988  -0.894  1.00 28.45 ? 2   HOH A O   1 
HETATM 1000 O  O   . HOH C 2 .  ? -14.669 20.537 -11.955 1.00 21.94 ? 3   HOH A O   1 
HETATM 1001 O  O   . HOH C 2 .  ? -17.404 9.414  7.167   1.00 31.00 ? 4   HOH A O   1 
HETATM 1002 O  O   . HOH C 2 .  ? -19.618 25.374 2.592   1.00 28.99 ? 7   HOH A O   1 
HETATM 1003 O  O   . HOH C 2 .  ? -20.099 26.191 7.007   1.00 34.60 ? 10  HOH A O   1 
HETATM 1004 O  O   . HOH C 2 .  ? -25.589 17.156 -10.186 1.00 40.09 ? 14  HOH A O   1 
HETATM 1005 O  O   . HOH C 2 .  ? -11.917 11.646 2.931   1.00 44.85 ? 16  HOH A O   1 
HETATM 1006 O  O   . HOH C 2 .  ? -17.350 22.069 -12.216 1.00 33.61 ? 18  HOH A O   1 
HETATM 1007 O  O   . HOH C 2 .  ? -26.022 12.685 8.395   1.00 35.31 ? 19  HOH A O   1 
HETATM 1008 O  O   . HOH C 2 .  ? -22.125 15.375 -8.787  1.00 23.16 ? 20  HOH A O   1 
HETATM 1009 O  O   . HOH C 2 .  ? -12.153 15.101 -10.722 1.00 25.85 ? 22  HOH A O   1 
HETATM 1010 O  O   . HOH C 2 .  ? -19.228 12.678 -0.038  1.00 24.80 ? 24  HOH A O   1 
HETATM 1011 O  O   . HOH C 2 .  ? -15.272 11.930 13.475  1.00 37.17 ? 26  HOH A O   1 
HETATM 1012 O  O   . HOH C 2 .  ? -27.578 15.716 12.701  1.00 32.64 ? 31  HOH A O   1 
HETATM 1013 O  O   . HOH C 2 .  ? -20.247 12.047 14.474  1.00 55.09 ? 34  HOH A O   1 
HETATM 1014 O  O   . HOH C 2 .  ? -28.082 14.423 -9.194  1.00 30.33 ? 35  HOH A O   1 
HETATM 1015 O  O   . HOH C 2 .  ? -23.801 11.788 -11.186 1.00 29.83 ? 37  HOH A O   1 
HETATM 1016 O  O   . HOH C 2 .  ? -14.313 26.948 14.052  1.00 56.97 ? 41  HOH A O   1 
HETATM 1017 O  O   . HOH C 2 .  ? -27.359 25.367 11.513  1.00 24.96 ? 42  HOH A O   1 
HETATM 1018 O  O   . HOH C 2 .  ? -18.997 30.695 -0.978  1.00 36.79 ? 46  HOH A O   1 
HETATM 1019 O  O   . HOH C 2 .  ? -19.374 22.224 -16.711 1.00 36.80 ? 47  HOH A O   1 
HETATM 1020 O  O   . HOH C 2 .  ? -27.312 23.311 27.564  1.00 64.88 ? 51  HOH A O   1 
HETATM 1021 O  O   . HOH C 2 .  ? -14.840 26.054 -1.092  1.00 35.39 ? 52  HOH A O   1 
HETATM 1022 O  O   . HOH C 2 .  ? -16.382 9.404  9.528   1.00 50.27 ? 53  HOH A O   1 
HETATM 1023 O  O   . HOH C 2 .  ? -13.417 24.156 18.680  1.00 37.48 ? 56  HOH A O   1 
HETATM 1024 O  O   . HOH C 2 .  ? -22.083 27.019 -3.547  1.00 58.36 ? 58  HOH A O   1 
HETATM 1025 O  O   . HOH C 2 .  ? -25.150 26.733 13.720  1.00 65.16 ? 60  HOH A O   1 
HETATM 1026 O  O   . HOH C 2 .  ? -7.751  13.927 6.728   1.00 57.96 ? 61  HOH A O   1 
HETATM 1027 O  O   . HOH C 2 .  ? -13.238 24.856 4.122   1.00 33.10 ? 63  HOH A O   1 
HETATM 1028 O  O   . HOH C 2 .  ? -18.727 23.903 24.757  1.00 50.64 ? 66  HOH A O   1 
HETATM 1029 O  O   . HOH C 2 .  ? -18.382 9.085  1.842   1.00 43.10 ? 68  HOH A O   1 
HETATM 1030 O  O   . HOH C 2 .  ? -20.987 26.432 -7.000  1.00 47.75 ? 69  HOH A O   1 
HETATM 1031 O  O   . HOH C 2 .  ? -26.552 16.500 15.383  1.00 25.30 ? 72  HOH A O   1 
HETATM 1032 O  O   . HOH C 2 .  ? -19.937 29.537 6.659   1.00 54.76 ? 76  HOH A O   1 
HETATM 1033 O  O   . HOH C 2 .  ? -19.041 12.663 12.184  1.00 77.31 ? 78  HOH A O   1 
HETATM 1034 O  O   . HOH C 2 .  ? -25.523 16.475 2.192   1.00 32.56 ? 81  HOH A O   1 
HETATM 1035 O  O   . HOH C 2 .  ? -28.089 21.747 29.986  1.00 50.27 ? 82  HOH A O   1 
HETATM 1036 O  O   . HOH C 2 .  ? -27.096 13.261 12.077  1.00 31.34 ? 85  HOH A O   1 
HETATM 1037 O  O   . HOH C 2 .  ? -19.095 10.481 9.510   1.00 49.48 ? 91  HOH A O   1 
HETATM 1038 O  O   . HOH C 2 .  ? -23.641 9.595  -4.955  1.00 21.68 ? 94  HOH A O   1 
HETATM 1039 O  O   . HOH C 2 .  ? -11.760 11.104 11.188  1.00 54.30 ? 96  HOH A O   1 
HETATM 1040 O  O   . HOH C 2 .  ? -25.256 15.748 5.474   1.00 26.53 ? 97  HOH A O   1 
HETATM 1041 O  O   . HOH C 2 .  ? -12.757 26.506 0.396   1.00 57.25 ? 98  HOH A O   1 
HETATM 1042 O  O   . HOH C 2 .  ? -12.598 26.718 18.571  1.00 61.77 ? 100 HOH A O   1 
HETATM 1043 O  O   . HOH C 2 .  ? -18.531 10.968 -11.633 1.00 53.35 ? 106 HOH A O   1 
HETATM 1044 O  O   . HOH C 2 .  ? -28.102 18.274 -10.375 1.00 50.17 ? 108 HOH A O   1 
HETATM 1045 O  O   . HOH C 2 .  ? -25.511 7.872  -3.898  1.00 38.48 ? 109 HOH A O   1 
HETATM 1046 O  O   . HOH C 2 .  ? -7.348  18.355 -6.086  1.00 51.98 ? 112 HOH A O   1 
HETATM 1047 O  O   . HOH C 2 .  ? -29.550 12.710 11.303  1.00 53.00 ? 113 HOH A O   1 
HETATM 1048 O  O   . HOH C 2 .  ? -17.419 7.680  10.896  1.00 64.81 ? 116 HOH A O   1 
HETATM 1049 O  O   . HOH C 2 .  ? -18.721 19.916 -12.227 1.00 58.98 ? 120 HOH A O   1 
HETATM 1050 O  O   . HOH C 2 .  ? -30.554 16.444 1.214   1.00 35.30 ? 125 HOH A O   1 
HETATM 1051 O  O   . HOH C 2 .  ? -9.727  27.042 -7.852  1.00 45.20 ? 126 HOH A O   1 
HETATM 1052 O  O   . HOH C 2 .  ? -24.845 13.073 10.478  1.00 39.38 ? 129 HOH A O   1 
HETATM 1053 O  O   . HOH C 2 .  ? -9.866  12.682 -2.604  1.00 42.18 ? 132 HOH A O   1 
HETATM 1054 O  O   . HOH C 2 .  ? -22.197 29.326 -4.614  1.00 43.17 ? 133 HOH A O   1 
HETATM 1055 O  O   . HOH C 2 .  ? -19.057 7.776  -8.595  1.00 42.93 ? 134 HOH A O   1 
HETATM 1056 O  O   . HOH C 2 .  ? -14.754 9.704  11.622  1.00 49.29 ? 136 HOH A O   1 
HETATM 1057 O  O   . HOH C 2 .  ? -18.057 24.103 17.388  1.00 31.77 ? 139 HOH A O   1 
HETATM 1058 O  O   . HOH C 2 .  ? -12.377 26.612 -8.341  1.00 41.17 ? 140 HOH A O   1 
HETATM 1059 O  O   . HOH C 2 .  ? -18.273 27.605 -6.923  1.00 42.82 ? 141 HOH A O   1 
HETATM 1060 O  O   . HOH C 2 .  ? -27.770 15.650 4.420   1.00 39.23 ? 142 HOH A O   1 
HETATM 1061 O  O   . HOH C 2 .  ? -31.605 20.952 -7.855  1.00 38.76 ? 144 HOH A O   1 
HETATM 1062 O  O   . HOH C 2 .  ? -8.118  23.551 -0.700  1.00 45.91 ? 147 HOH A O   1 
HETATM 1063 O  O   . HOH C 2 .  ? -16.815 27.330 0.262   1.00 35.47 ? 150 HOH A O   1 
HETATM 1064 O  O   . HOH C 2 .  ? -27.173 26.201 17.670  1.00 42.39 ? 152 HOH A O   1 
HETATM 1065 O  O   . HOH C 2 .  ? -11.369 6.436  2.047   1.00 64.86 ? 155 HOH A O   1 
HETATM 1066 O  O   . HOH C 2 .  ? -32.704 22.304 22.438  1.00 55.20 ? 157 HOH A O   1 
HETATM 1067 O  O   . HOH C 2 .  ? -31.423 16.246 -1.519  1.00 44.86 ? 158 HOH A O   1 
HETATM 1068 O  O   . HOH C 2 .  ? -28.364 25.031 29.526  1.00 45.72 ? 159 HOH A O   1 
HETATM 1069 O  O   . HOH C 2 .  ? -7.170  13.135 0.018   1.00 34.63 ? 160 HOH A O   1 
HETATM 1070 O  O   . HOH C 2 .  ? -13.948 28.666 11.940  1.00 58.93 ? 163 HOH A O   1 
HETATM 1071 O  O   . HOH C 2 .  ? -5.884  21.259 3.238   1.00 45.64 ? 164 HOH A O   1 
HETATM 1072 O  O   . HOH C 2 .  ? -22.273 14.188 -11.140 1.00 35.54 ? 165 HOH A O   1 
HETATM 1073 O  O   . HOH C 2 .  ? -24.034 7.626  -0.943  1.00 45.89 ? 166 HOH A O   1 
HETATM 1074 O  O   . HOH C 2 .  ? -22.060 22.282 -17.295 1.00 49.80 ? 167 HOH A O   1 
HETATM 1075 O  O   . HOH C 2 .  ? -19.655 27.801 -11.814 1.00 42.76 ? 168 HOH A O   1 
HETATM 1076 O  O   . HOH C 2 .  ? -29.984 17.029 12.353  1.00 42.71 ? 169 HOH A O   1 
HETATM 1077 O  O   . HOH C 2 .  ? -13.292 27.648 -2.343  1.00 51.38 ? 170 HOH A O   1 
HETATM 1078 O  O   . HOH C 2 .  ? -23.441 9.847  -0.038  1.00 18.85 ? 174 HOH A O   1 
HETATM 1079 O  O   . HOH C 2 .  ? -28.895 17.805 5.159   1.00 46.16 ? 175 HOH A O   1 
HETATM 1080 O  O   . HOH C 2 .  ? -30.887 18.855 14.697  1.00 43.30 ? 176 HOH A O   1 
HETATM 1081 O  O   . HOH C 2 .  ? -31.231 17.722 10.133  1.00 42.32 ? 178 HOH A O   1 
HETATM 1082 O  O   . HOH C 2 .  ? -29.044 24.615 19.212  1.00 46.79 ? 180 HOH A O   1 
HETATM 1083 O  O   . HOH C 2 .  ? -10.481 26.282 16.593  1.00 44.14 ? 181 HOH A O   1 
HETATM 1084 O  O   . HOH C 2 .  ? -11.489 13.567 6.168   1.00 44.14 ? 182 HOH A O   1 
HETATM 1085 O  O   . HOH C 2 .  ? -10.489 15.185 8.013   1.00 47.93 ? 183 HOH A O   1 
HETATM 1086 O  O   . HOH C 2 .  ? -25.831 5.661  -2.504  1.00 45.08 ? 184 HOH A O   1 
HETATM 1087 O  O   . HOH C 2 .  ? -16.798 30.098 6.574   1.00 48.68 ? 188 HOH A O   1 
HETATM 1088 O  O   . HOH C 2 .  ? -9.475  11.865 0.213   1.00 52.69 ? 190 HOH A O   1 
HETATM 1089 O  O   . HOH C 2 .  ? -28.135 18.325 17.005  1.00 52.11 ? 193 HOH A O   1 
HETATM 1090 O  O   . HOH C 2 .  ? -14.281 8.695  -8.829  1.00 56.08 ? 196 HOH A O   1 
HETATM 1091 O  O   . HOH C 2 .  ? -10.437 23.326 5.554   1.00 57.88 ? 198 HOH A O   1 
HETATM 1092 O  O   . HOH C 2 .  ? -11.824 30.330 13.920  1.00 44.77 ? 199 HOH A O   1 
HETATM 1093 O  O   . HOH D 2 .  ? 14.314  17.721 28.718  1.00 47.79 ? 1   HOH B O   1 
HETATM 1094 O  O   . HOH D 2 .  ? 17.851  27.460 26.793  1.00 32.70 ? 5   HOH B O   1 
HETATM 1095 O  O   . HOH D 2 .  ? 8.476   15.417 10.346  1.00 28.99 ? 6   HOH B O   1 
HETATM 1096 O  O   . HOH D 2 .  ? -6.456  27.547 16.989  1.00 31.03 ? 8   HOH B O   1 
HETATM 1097 O  O   . HOH D 2 .  ? 12.809  26.988 11.133  1.00 28.85 ? 9   HOH B O   1 
HETATM 1098 O  O   . HOH D 2 .  ? 1.309   23.538 27.529  1.00 21.02 ? 11  HOH B O   1 
HETATM 1099 O  O   . HOH D 2 .  ? -5.822  23.800 29.615  1.00 30.82 ? 12  HOH B O   1 
HETATM 1100 O  O   . HOH D 2 .  ? 16.225  18.808 13.267  1.00 26.11 ? 13  HOH B O   1 
HETATM 1101 O  O   . HOH D 2 .  ? 8.091   13.082 17.537  1.00 24.01 ? 15  HOH B O   1 
HETATM 1102 O  O   . HOH D 2 .  ? 11.437  29.770 26.321  1.00 22.57 ? 17  HOH B O   1 
HETATM 1103 O  O   . HOH D 2 .  ? 10.202  26.721 12.577  1.00 22.30 ? 21  HOH B O   1 
HETATM 1104 O  O   . HOH D 2 .  ? -8.776  23.108 28.314  1.00 26.21 ? 23  HOH B O   1 
HETATM 1105 O  O   . HOH D 2 .  ? 15.048  31.407 20.168  1.00 64.30 ? 25  HOH B O   1 
HETATM 1106 O  O   . HOH D 2 .  ? 2.555   35.952 12.586  1.00 54.91 ? 27  HOH B O   1 
HETATM 1107 O  O   . HOH D 2 .  ? 2.895   14.692 15.708  1.00 32.58 ? 28  HOH B O   1 
HETATM 1108 O  O   . HOH D 2 .  ? 13.425  25.555 36.468  1.00 27.96 ? 29  HOH B O   1 
HETATM 1109 O  O   . HOH D 2 .  ? -16.247 18.993 22.838  1.00 35.08 ? 30  HOH B O   1 
HETATM 1110 O  O   . HOH D 2 .  ? 1.588   26.165 13.559  1.00 41.62 ? 32  HOH B O   1 
HETATM 1111 O  O   . HOH D 2 .  ? -5.214  14.331 29.133  1.00 24.90 ? 33  HOH B O   1 
HETATM 1112 O  O   . HOH D 2 .  ? -7.898  17.493 32.232  1.00 30.68 ? 36  HOH B O   1 
HETATM 1113 O  O   . HOH D 2 .  ? 4.166   14.045 22.137  1.00 34.25 ? 38  HOH B O   1 
HETATM 1114 O  O   . HOH D 2 .  ? -1.554  28.873 22.147  1.00 68.60 ? 39  HOH B O   1 
HETATM 1115 O  O   . HOH D 2 .  ? -2.079  12.342 25.115  1.00 38.39 ? 40  HOH B O   1 
HETATM 1116 O  O   . HOH D 2 .  ? 5.901   15.550 11.516  1.00 31.24 ? 43  HOH B O   1 
HETATM 1117 O  O   . HOH D 2 .  ? 18.157  16.296 15.205  1.00 58.94 ? 44  HOH B O   1 
HETATM 1118 O  O   . HOH D 2 .  ? 14.092  16.516 23.050  1.00 40.57 ? 45  HOH B O   1 
HETATM 1119 O  O   . HOH D 2 .  ? 12.699  17.499 30.913  1.00 55.29 ? 48  HOH B O   1 
HETATM 1120 O  O   . HOH D 2 .  ? 19.592  18.619 24.684  1.00 57.75 ? 49  HOH B O   1 
HETATM 1121 O  O   . HOH D 2 .  ? -5.146  14.085 14.534  1.00 36.02 ? 50  HOH B O   1 
HETATM 1122 O  O   . HOH D 2 .  ? 14.784  12.149 23.245  1.00 54.79 ? 54  HOH B O   1 
HETATM 1123 O  O   . HOH D 2 .  ? -10.969 15.654 19.474  1.00 41.45 ? 55  HOH B O   1 
HETATM 1124 O  O   . HOH D 2 .  ? 15.786  24.806 30.510  1.00 27.22 ? 57  HOH B O   1 
HETATM 1125 O  O   . HOH D 2 .  ? 16.202  31.583 22.353  1.00 46.26 ? 59  HOH B O   1 
HETATM 1126 O  O   . HOH D 2 .  ? -9.194  13.408 25.969  1.00 53.13 ? 62  HOH B O   1 
HETATM 1127 O  O   . HOH D 2 .  ? 5.380   22.824 33.212  1.00 46.55 ? 64  HOH B O   1 
HETATM 1128 O  O   . HOH D 2 .  ? 8.062   33.445 21.721  1.00 35.74 ? 65  HOH B O   1 
HETATM 1129 O  O   . HOH D 2 .  ? 16.969  34.792 24.494  1.00 63.01 ? 67  HOH B O   1 
HETATM 1130 O  O   . HOH D 2 .  ? 6.789   26.624 21.849  1.00 17.72 ? 70  HOH B O   1 
HETATM 1131 O  O   . HOH D 2 .  ? 7.878   29.286 20.387  1.00 29.43 ? 71  HOH B O   1 
HETATM 1132 O  O   . HOH D 2 .  ? 15.647  15.892 12.851  1.00 46.97 ? 73  HOH B O   1 
HETATM 1133 O  O   . HOH D 2 .  ? -0.559  24.685 12.847  1.00 51.05 ? 74  HOH B O   1 
HETATM 1134 O  O   . HOH D 2 .  ? -0.279  30.084 19.971  1.00 31.27 ? 75  HOH B O   1 
HETATM 1135 O  O   . HOH D 2 .  ? -10.260 21.278 29.300  1.00 57.82 ? 77  HOH B O   1 
HETATM 1136 O  O   . HOH D 2 .  ? -1.529  26.562 27.651  1.00 50.33 ? 79  HOH B O   1 
HETATM 1137 O  O   . HOH D 2 .  ? 13.869  11.170 20.715  1.00 67.41 ? 80  HOH B O   1 
HETATM 1138 O  O   . HOH D 2 .  ? -11.643 15.112 15.517  1.00 47.03 ? 83  HOH B O   1 
HETATM 1139 O  O   . HOH D 2 .  ? 6.925   11.764 19.655  1.00 43.60 ? 84  HOH B O   1 
HETATM 1140 O  O   . HOH D 2 .  ? 17.119  31.356 24.614  1.00 42.35 ? 86  HOH B O   1 
HETATM 1141 O  O   . HOH D 2 .  ? 15.825  33.782 26.579  1.00 68.45 ? 87  HOH B O   1 
HETATM 1142 O  O   . HOH D 2 .  ? 2.478   12.419 17.665  1.00 58.35 ? 88  HOH B O   1 
HETATM 1143 O  O   . HOH D 2 .  ? -13.141 16.563 30.519  1.00 43.54 ? 89  HOH B O   1 
HETATM 1144 O  O   . HOH D 2 .  ? 0.673   14.749 13.705  1.00 48.40 ? 90  HOH B O   1 
HETATM 1145 O  O   . HOH D 2 .  ? -7.602  13.629 15.467  1.00 49.72 ? 92  HOH B O   1 
HETATM 1146 O  O   . HOH D 2 .  ? 8.000   26.347 9.724   1.00 25.70 ? 93  HOH B O   1 
HETATM 1147 O  O   . HOH D 2 .  ? -16.250 10.982 31.669  1.00 69.60 ? 95  HOH B O   1 
HETATM 1148 O  O   . HOH D 2 .  ? -13.490 12.793 23.899  1.00 69.20 ? 99  HOH B O   1 
HETATM 1149 O  O   . HOH D 2 .  ? -2.879  30.242 20.094  1.00 72.30 ? 101 HOH B O   1 
HETATM 1150 O  O   . HOH D 2 .  ? -5.653  10.920 22.017  1.00 65.14 ? 102 HOH B O   1 
HETATM 1151 O  O   . HOH D 2 .  ? -18.286 13.763 33.241  1.00 53.43 ? 103 HOH B O   1 
HETATM 1152 O  O   . HOH D 2 .  ? 4.239   22.794 27.893  1.00 36.91 ? 104 HOH B O   1 
HETATM 1153 O  O   . HOH D 2 .  ? -4.607  26.087 30.223  1.00 70.71 ? 105 HOH B O   1 
HETATM 1154 O  O   . HOH D 2 .  ? 18.477  27.936 21.836  1.00 66.22 ? 107 HOH B O   1 
HETATM 1155 O  O   . HOH D 2 .  ? 14.744  28.591 11.675  1.00 46.51 ? 110 HOH B O   1 
HETATM 1156 O  O   . HOH D 2 .  ? -7.363  12.705 28.037  1.00 62.91 ? 111 HOH B O   1 
HETATM 1157 O  O   . HOH D 2 .  ? 5.041   11.939 23.947  1.00 52.53 ? 114 HOH B O   1 
HETATM 1158 O  O   . HOH D 2 .  ? 4.330   27.839 14.252  1.00 33.69 ? 115 HOH B O   1 
HETATM 1159 O  O   . HOH D 2 .  ? -6.826  30.109 13.453  1.00 52.30 ? 117 HOH B O   1 
HETATM 1160 O  O   . HOH D 2 .  ? -18.273 20.591 25.592  1.00 52.86 ? 118 HOH B O   1 
HETATM 1161 O  O   . HOH D 2 .  ? -18.246 16.288 33.681  1.00 44.21 ? 119 HOH B O   1 
HETATM 1162 O  O   . HOH D 2 .  ? 1.186   26.620 26.844  1.00 56.18 ? 121 HOH B O   1 
HETATM 1163 O  O   . HOH D 2 .  ? -16.530 8.844  29.755  1.00 55.08 ? 122 HOH B O   1 
HETATM 1164 O  O   . HOH D 2 .  ? -8.895  21.521 12.259  1.00 42.52 ? 123 HOH B O   1 
HETATM 1165 O  O   . HOH D 2 .  ? 21.101  19.463 22.306  1.00 51.98 ? 124 HOH B O   1 
HETATM 1166 O  O   . HOH D 2 .  ? 16.522  13.339 19.156  1.00 34.20 ? 127 HOH B O   1 
HETATM 1167 O  O   . HOH D 2 .  ? 10.803  26.141 38.192  1.00 38.51 ? 128 HOH B O   1 
HETATM 1168 O  O   . HOH D 2 .  ? 13.029  9.124  22.016  1.00 52.61 ? 130 HOH B O   1 
HETATM 1169 O  O   . HOH D 2 .  ? 10.721  31.614 28.324  1.00 35.17 ? 131 HOH B O   1 
HETATM 1170 O  O   . HOH D 2 .  ? 19.137  34.100 25.923  1.00 56.97 ? 135 HOH B O   1 
HETATM 1171 O  O   . HOH D 2 .  ? 4.616   30.403 21.257  1.00 41.07 ? 137 HOH B O   1 
HETATM 1172 O  O   . HOH D 2 .  ? 15.930  30.106 13.598  1.00 53.05 ? 138 HOH B O   1 
HETATM 1173 O  O   . HOH D 2 .  ? 17.403  18.645 23.343  1.00 51.78 ? 143 HOH B O   1 
HETATM 1174 O  O   . HOH D 2 .  ? 15.507  18.121 25.661  1.00 51.08 ? 145 HOH B O   1 
HETATM 1175 O  O   . HOH D 2 .  ? 4.755   17.629 8.410   1.00 31.40 ? 146 HOH B O   1 
HETATM 1176 O  O   . HOH D 2 .  ? -3.099  30.444 17.418  1.00 50.41 ? 148 HOH B O   1 
HETATM 1177 O  O   . HOH D 2 .  ? -8.304  12.892 31.249  1.00 56.53 ? 149 HOH B O   1 
HETATM 1178 O  O   . HOH D 2 .  ? 10.094  9.755  24.657  1.00 47.22 ? 151 HOH B O   1 
HETATM 1179 O  O   . HOH D 2 .  ? 17.780  18.168 26.749  1.00 52.83 ? 153 HOH B O   1 
HETATM 1180 O  O   . HOH D 2 .  ? 15.815  30.436 17.857  1.00 59.97 ? 154 HOH B O   1 
HETATM 1181 O  O   . HOH D 2 .  ? -19.032 7.466  30.026  1.00 53.64 ? 156 HOH B O   1 
HETATM 1182 O  O   . HOH D 2 .  ? 14.773  11.466 18.062  1.00 61.35 ? 161 HOH B O   1 
HETATM 1183 O  O   . HOH D 2 .  ? 4.570   14.774 13.529  1.00 56.85 ? 162 HOH B O   1 
HETATM 1184 O  O   . HOH D 2 .  ? 19.764  29.759 20.441  1.00 42.48 ? 171 HOH B O   1 
HETATM 1185 O  O   . HOH D 2 .  ? 3.970   27.851 28.830  1.00 58.49 ? 172 HOH B O   1 
HETATM 1186 O  O   . HOH D 2 .  ? 19.517  17.346 18.569  1.00 53.25 ? 173 HOH B O   1 
HETATM 1187 O  O   . HOH D 2 .  ? 13.638  7.342  23.619  1.00 48.05 ? 177 HOH B O   1 
HETATM 1188 O  O   . HOH D 2 .  ? 5.746   32.507 22.131  1.00 50.05 ? 179 HOH B O   1 
HETATM 1189 O  O   . HOH D 2 .  ? 8.986   33.669 28.413  1.00 44.90 ? 185 HOH B O   1 
HETATM 1190 O  O   . HOH D 2 .  ? 15.362  24.060 24.548  1.00 44.81 ? 186 HOH B O   1 
HETATM 1191 O  O   . HOH D 2 .  ? 10.839  10.772 9.536   1.00 50.66 ? 187 HOH B O   1 
HETATM 1192 O  O   . HOH D 2 .  ? -12.163 25.708 22.562  1.00 45.70 ? 189 HOH B O   1 
HETATM 1193 O  O   . HOH D 2 .  ? -0.357  12.817 14.976  1.00 45.99 ? 191 HOH B O   1 
HETATM 1194 O  O   . HOH D 2 .  ? 10.204  11.455 17.735  1.00 52.89 ? 192 HOH B O   1 
HETATM 1195 O  O   . HOH D 2 .  ? -11.245 13.397 28.622  1.00 42.66 ? 194 HOH B O   1 
HETATM 1196 O  O   . HOH D 2 .  ? -20.219 14.129 34.894  1.00 53.50 ? 195 HOH B O   1 
HETATM 1197 O  O   . HOH D 2 .  ? 15.786  20.505 24.602  1.00 54.26 ? 197 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ILE 1  520 ?   ?   ?   A . n 
A 1 2  LEU 2  521 ?   ?   ?   A . n 
A 1 3  THR 3  522 ?   ?   ?   A . n 
A 1 4  LYS 4  523 ?   ?   ?   A . n 
A 1 5  HIS 5  524 ?   ?   ?   A . n 
A 1 6  GLY 6  525 525 GLY GLY A . n 
A 1 7  LYS 7  526 526 LYS LYS A . n 
A 1 8  ASN 8  527 527 ASN ASN A . n 
A 1 9  PRO 9  528 528 PRO PRO A . n 
A 1 10 VAL 10 529 529 VAL VAL A . n 
A 1 11 MSE 11 530 530 MSE MSE A . n 
A 1 12 GLU 12 531 531 GLU GLU A . n 
A 1 13 LEU 13 532 532 LEU LEU A . n 
A 1 14 ASN 14 533 533 ASN ASN A . n 
A 1 15 GLU 15 534 534 GLU GLU A . n 
A 1 16 LYS 16 535 535 LYS LYS A . n 
A 1 17 ARG 17 536 536 ARG ARG A . n 
A 1 18 ARG 18 537 537 ARG ARG A . n 
A 1 19 GLY 19 538 538 GLY GLY A . n 
A 1 20 LEU 20 539 539 LEU LEU A . n 
A 1 21 LYS 21 540 540 LYS LYS A . n 
A 1 22 TYR 22 541 541 TYR TYR A . n 
A 1 23 GLU 23 542 542 GLU GLU A . n 
A 1 24 LEU 24 543 543 LEU LEU A . n 
A 1 25 ILE 25 544 544 ILE ILE A . n 
A 1 26 SER 26 545 545 SER SER A . n 
A 1 27 GLU 27 546 546 GLU GLU A . n 
A 1 28 THR 28 547 547 THR THR A . n 
A 1 29 GLY 29 548 548 GLY GLY A . n 
A 1 30 GLY 30 549 549 GLY GLY A . n 
A 1 31 SER 31 550 550 SER SER A . n 
A 1 32 HIS 32 551 551 HIS HIS A . n 
A 1 33 ASP 33 552 552 ASP ASP A . n 
A 1 34 LYS 34 553 553 LYS LYS A . n 
A 1 35 ARG 35 554 554 ARG ARG A . n 
A 1 36 PHE 36 555 555 PHE PHE A . n 
A 1 37 VAL 37 556 556 VAL VAL A . n 
A 1 38 MSE 38 557 557 MSE MSE A . n 
A 1 39 GLU 39 558 558 GLU GLU A . n 
A 1 40 VAL 40 559 559 VAL VAL A . n 
A 1 41 GLU 41 560 560 GLU GLU A . n 
A 1 42 VAL 42 561 561 VAL VAL A . n 
A 1 43 ASP 43 562 562 ASP ASP A . n 
A 1 44 GLY 44 563 563 GLY GLY A . n 
A 1 45 GLN 45 564 564 GLN GLN A . n 
A 1 46 LYS 46 565 565 LYS LYS A . n 
A 1 47 PHE 47 566 566 PHE PHE A . n 
A 1 48 GLN 48 567 567 GLN GLN A . n 
A 1 49 GLY 49 568 568 GLY GLY A . n 
A 1 50 ALA 50 569 569 ALA ALA A . n 
A 1 51 GLY 51 570 570 GLY GLY A . n 
A 1 52 SER 52 571 571 SER SER A . n 
A 1 53 ASN 53 572 572 ASN ASN A . n 
A 1 54 LYS 54 573 573 LYS LYS A . n 
A 1 55 LYS 55 574 574 LYS LYS A . n 
A 1 56 VAL 56 575 575 VAL VAL A . n 
A 1 57 ALA 57 576 576 ALA ALA A . n 
A 1 58 LYS 58 577 577 LYS LYS A . n 
A 1 59 ALA 59 578 578 ALA ALA A . n 
A 1 60 TYR 60 579 579 TYR TYR A . n 
A 1 61 ALA 61 580 580 ALA ALA A . n 
A 1 62 ALA 62 581 581 ALA ALA A . n 
A 1 63 LEU 63 582 582 LEU LEU A . n 
A 1 64 ALA 64 583 583 ALA ALA A . n 
A 1 65 ALA 65 584 584 ALA ALA A . n 
A 1 66 LEU 66 585 585 LEU LEU A . n 
A 1 67 GLU 67 586 586 GLU GLU A . n 
A 1 68 LYS 68 587 587 LYS LYS A . n 
A 1 69 LEU 69 588 588 LEU LEU A . n 
A 1 70 PHE 70 589 589 PHE PHE A . n 
A 1 71 PRO 71 590 590 PRO PRO A . n 
A 1 72 ASP 72 591 591 ASP ASP A . n 
A 1 73 THR 73 592 592 THR THR A . n 
A 1 74 PRO 74 593 593 PRO PRO A . n 
A 1 75 LEU 75 594 594 LEU LEU A . n 
B 1 1  ILE 1  520 ?   ?   ?   B . n 
B 1 2  LEU 2  521 ?   ?   ?   B . n 
B 1 3  THR 3  522 ?   ?   ?   B . n 
B 1 4  LYS 4  523 ?   ?   ?   B . n 
B 1 5  HIS 5  524 ?   ?   ?   B . n 
B 1 6  GLY 6  525 525 GLY GLY B . n 
B 1 7  LYS 7  526 526 LYS LYS B . n 
B 1 8  ASN 8  527 527 ASN ASN B . n 
B 1 9  PRO 9  528 528 PRO PRO B . n 
B 1 10 VAL 10 529 529 VAL VAL B . n 
B 1 11 MSE 11 530 530 MSE MSE B . n 
B 1 12 GLU 12 531 531 GLU GLU B . n 
B 1 13 LEU 13 532 532 LEU LEU B . n 
B 1 14 ASN 14 533 533 ASN ASN B . n 
B 1 15 GLU 15 534 534 GLU GLU B . n 
B 1 16 LYS 16 535 535 LYS LYS B . n 
B 1 17 ARG 17 536 536 ARG ARG B . n 
B 1 18 ARG 18 537 537 ARG ARG B . n 
B 1 19 GLY 19 538 538 GLY GLY B . n 
B 1 20 LEU 20 539 539 LEU LEU B . n 
B 1 21 LYS 21 540 540 LYS LYS B . n 
B 1 22 TYR 22 541 541 TYR TYR B . n 
B 1 23 GLU 23 542 542 GLU GLU B . n 
B 1 24 LEU 24 543 543 LEU LEU B . n 
B 1 25 ILE 25 544 544 ILE ILE B . n 
B 1 26 SER 26 545 545 SER SER B . n 
B 1 27 GLU 27 546 546 GLU GLU B . n 
B 1 28 THR 28 547 547 THR THR B . n 
B 1 29 GLY 29 548 548 GLY GLY B . n 
B 1 30 GLY 30 549 549 GLY GLY B . n 
B 1 31 SER 31 550 550 SER SER B . n 
B 1 32 HIS 32 551 551 HIS HIS B . n 
B 1 33 ASP 33 552 552 ASP ASP B . n 
B 1 34 LYS 34 553 553 LYS LYS B . n 
B 1 35 ARG 35 554 554 ARG ARG B . n 
B 1 36 PHE 36 555 555 PHE PHE B . n 
B 1 37 VAL 37 556 556 VAL VAL B . n 
B 1 38 MSE 38 557 557 MSE MSE B . n 
B 1 39 GLU 39 558 558 GLU GLU B . n 
B 1 40 VAL 40 559 559 VAL VAL B . n 
B 1 41 GLU 41 560 560 GLU GLU B . n 
B 1 42 VAL 42 561 561 VAL VAL B . n 
B 1 43 ASP 43 562 562 ASP ASP B . n 
B 1 44 GLY 44 563 563 GLY GLY B . n 
B 1 45 GLN 45 564 564 GLN GLN B . n 
B 1 46 LYS 46 565 565 LYS LYS B . n 
B 1 47 PHE 47 566 566 PHE PHE B . n 
B 1 48 GLN 48 567 567 GLN GLN B . n 
B 1 49 GLY 49 568 568 GLY GLY B . n 
B 1 50 ALA 50 569 569 ALA ALA B . n 
B 1 51 GLY 51 570 570 GLY GLY B . n 
B 1 52 SER 52 571 571 SER SER B . n 
B 1 53 ASN 53 572 572 ASN ASN B . n 
B 1 54 LYS 54 573 573 LYS LYS B . n 
B 1 55 LYS 55 574 574 LYS LYS B . n 
B 1 56 VAL 56 575 575 VAL VAL B . n 
B 1 57 ALA 57 576 576 ALA ALA B . n 
B 1 58 LYS 58 577 577 LYS LYS B . n 
B 1 59 ALA 59 578 578 ALA ALA B . n 
B 1 60 TYR 60 579 579 TYR TYR B . n 
B 1 61 ALA 61 580 580 ALA ALA B . n 
B 1 62 ALA 62 581 581 ALA ALA B . n 
B 1 63 LEU 63 582 582 LEU LEU B . n 
B 1 64 ALA 64 583 583 ALA ALA B . n 
B 1 65 ALA 65 584 584 ALA ALA B . n 
B 1 66 LEU 66 585 585 LEU LEU B . n 
B 1 67 GLU 67 586 586 GLU GLU B . n 
B 1 68 LYS 68 587 587 LYS LYS B . n 
B 1 69 LEU 69 588 588 LEU LEU B . n 
B 1 70 PHE 70 589 589 PHE PHE B . n 
B 1 71 PRO 71 590 590 PRO PRO B . n 
B 1 72 ASP 72 591 ?   ?   ?   B . n 
B 1 73 THR 73 592 ?   ?   ?   B . n 
B 1 74 PRO 74 593 ?   ?   ?   B . n 
B 1 75 LEU 75 594 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          PSI:Biology 
_pdbx_SG_project.full_name_of_center   'Northeast Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     NESG 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 11 A MSE 530 ? MET SELENOMETHIONINE 
2 A MSE 38 A MSE 557 ? MET SELENOMETHIONINE 
3 B MSE 11 B MSE 530 ? MET SELENOMETHIONINE 
4 B MSE 38 B MSE 557 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_defined_assembly              ?    dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C     
2 1 B,D     
3 1 A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-12-29 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-02-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Structure summary'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum ? 1 
SHELXS   phasing           .       ? 2 
CNS      refinement        1.2     ? 3 
HKL-2000 'data reduction'  .       ? 4 
HKL-2000 'data scaling'    .       ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 526 ? ? 178.59  -34.06 
2 1 SER A 550 ? ? -63.72  4.75   
3 1 ASP A 552 ? ? -157.88 33.93  
4 1 ASN B 527 ? ? 55.04   89.67  
5 1 ASP B 552 ? ? -165.51 40.29  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 526 ? CG  ? A LYS 7  CG  
2  1 Y 1 A LYS 526 ? CD  ? A LYS 7  CD  
3  1 Y 1 A LYS 526 ? CE  ? A LYS 7  CE  
4  1 Y 1 A LYS 526 ? NZ  ? A LYS 7  NZ  
5  1 Y 1 A ARG 537 ? CG  ? A ARG 18 CG  
6  1 Y 1 A ARG 537 ? CD  ? A ARG 18 CD  
7  1 Y 1 A ARG 537 ? NE  ? A ARG 18 NE  
8  1 Y 1 A ARG 537 ? CZ  ? A ARG 18 CZ  
9  1 Y 1 A ARG 537 ? NH1 ? A ARG 18 NH1 
10 1 Y 1 A ARG 537 ? NH2 ? A ARG 18 NH2 
11 1 Y 1 A LYS 540 ? CB  ? A LYS 21 CB  
12 1 Y 1 A LYS 540 ? CG  ? A LYS 21 CG  
13 1 Y 1 A LYS 540 ? CD  ? A LYS 21 CD  
14 1 Y 1 A LYS 540 ? CE  ? A LYS 21 CE  
15 1 Y 1 A LYS 540 ? NZ  ? A LYS 21 NZ  
16 1 Y 1 A GLU 542 ? CG  ? A GLU 23 CG  
17 1 Y 1 A GLU 542 ? CD  ? A GLU 23 CD  
18 1 Y 1 A GLU 542 ? OE1 ? A GLU 23 OE1 
19 1 Y 1 A GLU 542 ? OE2 ? A GLU 23 OE2 
20 1 Y 1 A SER 550 ? CB  ? A SER 31 CB  
21 1 Y 1 A SER 550 ? OG  ? A SER 31 OG  
22 1 Y 1 A HIS 551 ? CB  ? A HIS 32 CB  
23 1 Y 1 A HIS 551 ? CG  ? A HIS 32 CG  
24 1 Y 1 A HIS 551 ? ND1 ? A HIS 32 ND1 
25 1 Y 1 A HIS 551 ? CD2 ? A HIS 32 CD2 
26 1 Y 1 A HIS 551 ? CE1 ? A HIS 32 CE1 
27 1 Y 1 A HIS 551 ? NE2 ? A HIS 32 NE2 
28 1 Y 1 A ASP 552 ? CB  ? A ASP 33 CB  
29 1 Y 1 A ASP 552 ? CG  ? A ASP 33 CG  
30 1 Y 1 A ASP 552 ? OD1 ? A ASP 33 OD1 
31 1 Y 1 A ASP 552 ? OD2 ? A ASP 33 OD2 
32 1 Y 1 A LYS 553 ? CG  ? A LYS 34 CG  
33 1 Y 1 A LYS 553 ? CD  ? A LYS 34 CD  
34 1 Y 1 A LYS 553 ? CE  ? A LYS 34 CE  
35 1 Y 1 A LYS 553 ? NZ  ? A LYS 34 NZ  
36 1 Y 1 B ARG 537 ? CG  ? B ARG 18 CG  
37 1 Y 1 B ARG 537 ? CD  ? B ARG 18 CD  
38 1 Y 1 B ARG 537 ? NE  ? B ARG 18 NE  
39 1 Y 1 B ARG 537 ? CZ  ? B ARG 18 CZ  
40 1 Y 1 B ARG 537 ? NH1 ? B ARG 18 NH1 
41 1 Y 1 B ARG 537 ? NH2 ? B ARG 18 NH2 
42 1 Y 1 B HIS 551 ? CB  ? B HIS 32 CB  
43 1 Y 1 B HIS 551 ? CG  ? B HIS 32 CG  
44 1 Y 1 B HIS 551 ? ND1 ? B HIS 32 ND1 
45 1 Y 1 B HIS 551 ? CD2 ? B HIS 32 CD2 
46 1 Y 1 B HIS 551 ? CE1 ? B HIS 32 CE1 
47 1 Y 1 B HIS 551 ? NE2 ? B HIS 32 NE2 
48 1 Y 1 B ARG 554 ? CG  ? B ARG 35 CG  
49 1 Y 1 B ARG 554 ? CD  ? B ARG 35 CD  
50 1 Y 1 B ARG 554 ? NE  ? B ARG 35 NE  
51 1 Y 1 B ARG 554 ? CZ  ? B ARG 35 CZ  
52 1 Y 1 B ARG 554 ? NH1 ? B ARG 35 NH1 
53 1 Y 1 B ARG 554 ? NH2 ? B ARG 35 NH2 
54 1 Y 1 B PRO 590 ? CG  ? B PRO 71 CG  
55 1 Y 1 B PRO 590 ? CD  ? B PRO 71 CD  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ILE 520 ? A ILE 1  
2  1 Y 1 A LEU 521 ? A LEU 2  
3  1 Y 1 A THR 522 ? A THR 3  
4  1 Y 1 A LYS 523 ? A LYS 4  
5  1 Y 1 A HIS 524 ? A HIS 5  
6  1 Y 1 B ILE 520 ? B ILE 1  
7  1 Y 1 B LEU 521 ? B LEU 2  
8  1 Y 1 B THR 522 ? B THR 3  
9  1 Y 1 B LYS 523 ? B LYS 4  
10 1 Y 1 B HIS 524 ? B HIS 5  
11 1 Y 1 B ASP 591 ? B ASP 72 
12 1 Y 1 B THR 592 ? B THR 73 
13 1 Y 1 B PRO 593 ? B PRO 74 
14 1 Y 1 B LEU 594 ? B LEU 75 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   2   2   HOH TIP A . 
C 2 HOH 2   3   3   HOH TIP A . 
C 2 HOH 3   4   4   HOH TIP A . 
C 2 HOH 4   7   7   HOH TIP A . 
C 2 HOH 5   10  10  HOH TIP A . 
C 2 HOH 6   14  14  HOH TIP A . 
C 2 HOH 7   16  16  HOH TIP A . 
C 2 HOH 8   18  18  HOH TIP A . 
C 2 HOH 9   19  19  HOH TIP A . 
C 2 HOH 10  20  20  HOH TIP A . 
C 2 HOH 11  22  22  HOH TIP A . 
C 2 HOH 12  24  24  HOH TIP A . 
C 2 HOH 13  26  26  HOH TIP A . 
C 2 HOH 14  31  31  HOH TIP A . 
C 2 HOH 15  34  34  HOH TIP A . 
C 2 HOH 16  35  35  HOH TIP A . 
C 2 HOH 17  37  37  HOH TIP A . 
C 2 HOH 18  41  41  HOH TIP A . 
C 2 HOH 19  42  42  HOH TIP A . 
C 2 HOH 20  46  46  HOH TIP A . 
C 2 HOH 21  47  47  HOH TIP A . 
C 2 HOH 22  51  51  HOH TIP A . 
C 2 HOH 23  52  52  HOH TIP A . 
C 2 HOH 24  53  53  HOH TIP A . 
C 2 HOH 25  56  56  HOH TIP A . 
C 2 HOH 26  58  58  HOH TIP A . 
C 2 HOH 27  60  60  HOH TIP A . 
C 2 HOH 28  61  61  HOH TIP A . 
C 2 HOH 29  63  63  HOH TIP A . 
C 2 HOH 30  66  66  HOH TIP A . 
C 2 HOH 31  68  68  HOH TIP A . 
C 2 HOH 32  69  69  HOH TIP A . 
C 2 HOH 33  72  72  HOH TIP A . 
C 2 HOH 34  76  76  HOH TIP A . 
C 2 HOH 35  78  78  HOH TIP A . 
C 2 HOH 36  81  81  HOH TIP A . 
C 2 HOH 37  82  82  HOH TIP A . 
C 2 HOH 38  85  85  HOH TIP A . 
C 2 HOH 39  91  91  HOH TIP A . 
C 2 HOH 40  94  94  HOH TIP A . 
C 2 HOH 41  96  96  HOH TIP A . 
C 2 HOH 42  97  97  HOH TIP A . 
C 2 HOH 43  98  98  HOH TIP A . 
C 2 HOH 44  100 100 HOH TIP A . 
C 2 HOH 45  106 106 HOH TIP A . 
C 2 HOH 46  108 108 HOH TIP A . 
C 2 HOH 47  109 109 HOH TIP A . 
C 2 HOH 48  112 112 HOH TIP A . 
C 2 HOH 49  113 113 HOH TIP A . 
C 2 HOH 50  116 116 HOH TIP A . 
C 2 HOH 51  120 120 HOH TIP A . 
C 2 HOH 52  125 125 HOH TIP A . 
C 2 HOH 53  126 126 HOH TIP A . 
C 2 HOH 54  129 129 HOH TIP A . 
C 2 HOH 55  132 132 HOH TIP A . 
C 2 HOH 56  133 133 HOH TIP A . 
C 2 HOH 57  134 134 HOH TIP A . 
C 2 HOH 58  136 136 HOH TIP A . 
C 2 HOH 59  139 139 HOH TIP A . 
C 2 HOH 60  140 140 HOH TIP A . 
C 2 HOH 61  141 141 HOH TIP A . 
C 2 HOH 62  142 142 HOH TIP A . 
C 2 HOH 63  144 144 HOH TIP A . 
C 2 HOH 64  147 147 HOH TIP A . 
C 2 HOH 65  150 150 HOH TIP A . 
C 2 HOH 66  152 152 HOH TIP A . 
C 2 HOH 67  155 155 HOH TIP A . 
C 2 HOH 68  157 157 HOH TIP A . 
C 2 HOH 69  158 158 HOH TIP A . 
C 2 HOH 70  159 159 HOH TIP A . 
C 2 HOH 71  160 160 HOH TIP A . 
C 2 HOH 72  163 163 HOH TIP A . 
C 2 HOH 73  164 164 HOH TIP A . 
C 2 HOH 74  165 165 HOH TIP A . 
C 2 HOH 75  166 166 HOH TIP A . 
C 2 HOH 76  167 167 HOH TIP A . 
C 2 HOH 77  168 168 HOH TIP A . 
C 2 HOH 78  169 169 HOH TIP A . 
C 2 HOH 79  170 170 HOH TIP A . 
C 2 HOH 80  174 174 HOH TIP A . 
C 2 HOH 81  175 175 HOH TIP A . 
C 2 HOH 82  176 176 HOH TIP A . 
C 2 HOH 83  178 178 HOH TIP A . 
C 2 HOH 84  180 180 HOH TIP A . 
C 2 HOH 85  181 181 HOH TIP A . 
C 2 HOH 86  182 182 HOH TIP A . 
C 2 HOH 87  183 183 HOH TIP A . 
C 2 HOH 88  184 184 HOH TIP A . 
C 2 HOH 89  188 188 HOH TIP A . 
C 2 HOH 90  190 190 HOH TIP A . 
C 2 HOH 91  193 193 HOH TIP A . 
C 2 HOH 92  196 196 HOH TIP A . 
C 2 HOH 93  198 198 HOH TIP A . 
C 2 HOH 94  199 199 HOH TIP A . 
D 2 HOH 1   1   1   HOH TIP B . 
D 2 HOH 2   5   5   HOH TIP B . 
D 2 HOH 3   6   6   HOH TIP B . 
D 2 HOH 4   8   8   HOH TIP B . 
D 2 HOH 5   9   9   HOH TIP B . 
D 2 HOH 6   11  11  HOH TIP B . 
D 2 HOH 7   12  12  HOH TIP B . 
D 2 HOH 8   13  13  HOH TIP B . 
D 2 HOH 9   15  15  HOH TIP B . 
D 2 HOH 10  17  17  HOH TIP B . 
D 2 HOH 11  21  21  HOH TIP B . 
D 2 HOH 12  23  23  HOH TIP B . 
D 2 HOH 13  25  25  HOH TIP B . 
D 2 HOH 14  27  27  HOH TIP B . 
D 2 HOH 15  28  28  HOH TIP B . 
D 2 HOH 16  29  29  HOH TIP B . 
D 2 HOH 17  30  30  HOH TIP B . 
D 2 HOH 18  32  32  HOH TIP B . 
D 2 HOH 19  33  33  HOH TIP B . 
D 2 HOH 20  36  36  HOH TIP B . 
D 2 HOH 21  38  38  HOH TIP B . 
D 2 HOH 22  39  39  HOH TIP B . 
D 2 HOH 23  40  40  HOH TIP B . 
D 2 HOH 24  43  43  HOH TIP B . 
D 2 HOH 25  44  44  HOH TIP B . 
D 2 HOH 26  45  45  HOH TIP B . 
D 2 HOH 27  48  48  HOH TIP B . 
D 2 HOH 28  49  49  HOH TIP B . 
D 2 HOH 29  50  50  HOH TIP B . 
D 2 HOH 30  54  54  HOH TIP B . 
D 2 HOH 31  55  55  HOH TIP B . 
D 2 HOH 32  57  57  HOH TIP B . 
D 2 HOH 33  59  59  HOH TIP B . 
D 2 HOH 34  62  62  HOH TIP B . 
D 2 HOH 35  64  64  HOH TIP B . 
D 2 HOH 36  65  65  HOH TIP B . 
D 2 HOH 37  67  67  HOH TIP B . 
D 2 HOH 38  70  70  HOH TIP B . 
D 2 HOH 39  71  71  HOH TIP B . 
D 2 HOH 40  73  73  HOH TIP B . 
D 2 HOH 41  74  74  HOH TIP B . 
D 2 HOH 42  75  75  HOH TIP B . 
D 2 HOH 43  77  77  HOH TIP B . 
D 2 HOH 44  79  79  HOH TIP B . 
D 2 HOH 45  80  80  HOH TIP B . 
D 2 HOH 46  83  83  HOH TIP B . 
D 2 HOH 47  84  84  HOH TIP B . 
D 2 HOH 48  86  86  HOH TIP B . 
D 2 HOH 49  87  87  HOH TIP B . 
D 2 HOH 50  88  88  HOH TIP B . 
D 2 HOH 51  89  89  HOH TIP B . 
D 2 HOH 52  90  90  HOH TIP B . 
D 2 HOH 53  92  92  HOH TIP B . 
D 2 HOH 54  93  93  HOH TIP B . 
D 2 HOH 55  95  95  HOH TIP B . 
D 2 HOH 56  99  99  HOH TIP B . 
D 2 HOH 57  101 101 HOH TIP B . 
D 2 HOH 58  102 102 HOH TIP B . 
D 2 HOH 59  103 103 HOH TIP B . 
D 2 HOH 60  104 104 HOH TIP B . 
D 2 HOH 61  105 105 HOH TIP B . 
D 2 HOH 62  107 107 HOH TIP B . 
D 2 HOH 63  110 110 HOH TIP B . 
D 2 HOH 64  111 111 HOH TIP B . 
D 2 HOH 65  114 114 HOH TIP B . 
D 2 HOH 66  115 115 HOH TIP B . 
D 2 HOH 67  117 117 HOH TIP B . 
D 2 HOH 68  118 118 HOH TIP B . 
D 2 HOH 69  119 119 HOH TIP B . 
D 2 HOH 70  121 121 HOH TIP B . 
D 2 HOH 71  122 122 HOH TIP B . 
D 2 HOH 72  123 123 HOH TIP B . 
D 2 HOH 73  124 124 HOH TIP B . 
D 2 HOH 74  127 127 HOH TIP B . 
D 2 HOH 75  128 128 HOH TIP B . 
D 2 HOH 76  130 130 HOH TIP B . 
D 2 HOH 77  131 131 HOH TIP B . 
D 2 HOH 78  135 135 HOH TIP B . 
D 2 HOH 79  137 137 HOH TIP B . 
D 2 HOH 80  138 138 HOH TIP B . 
D 2 HOH 81  143 143 HOH TIP B . 
D 2 HOH 82  145 145 HOH TIP B . 
D 2 HOH 83  146 146 HOH TIP B . 
D 2 HOH 84  148 148 HOH TIP B . 
D 2 HOH 85  149 149 HOH TIP B . 
D 2 HOH 86  151 151 HOH TIP B . 
D 2 HOH 87  153 153 HOH TIP B . 
D 2 HOH 88  154 154 HOH TIP B . 
D 2 HOH 89  156 156 HOH TIP B . 
D 2 HOH 90  161 161 HOH TIP B . 
D 2 HOH 91  162 162 HOH TIP B . 
D 2 HOH 92  171 171 HOH TIP B . 
D 2 HOH 93  172 172 HOH TIP B . 
D 2 HOH 94  173 173 HOH TIP B . 
D 2 HOH 95  177 177 HOH TIP B . 
D 2 HOH 96  179 179 HOH TIP B . 
D 2 HOH 97  185 185 HOH TIP B . 
D 2 HOH 98  186 186 HOH TIP B . 
D 2 HOH 99  187 187 HOH TIP B . 
D 2 HOH 100 189 189 HOH TIP B . 
D 2 HOH 101 191 191 HOH TIP B . 
D 2 HOH 102 192 192 HOH TIP B . 
D 2 HOH 103 194 194 HOH TIP B . 
D 2 HOH 104 195 195 HOH TIP B . 
D 2 HOH 105 197 197 HOH TIP B . 
#