data_3PDZ
# 
_entry.id   3PDZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3PDZ         
RCSB  RCSB001032   
WWPDB D_1000001032 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3PDZ 
_pdbx_database_status.recvd_initial_deposition_date   1999-05-10 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kozlov, G.'  1 
'Gehring, K.' 2 
'Ekiel, I.'   3 
# 
_citation.id                        primary 
_citation.title                     
;Solution structure of the PDZ2 domain from human phosphatase hPTP1E and its interactions with C-terminal peptides from the Fas receptor.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            39 
_citation.page_first                2572 
_citation.page_last                 2580 
_citation.year                      2000 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10704206 
_citation.pdbx_database_id_DOI      10.1021/bi991913c 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kozlov, G.'  1 
primary 'Gehring, K.' 2 
primary 'Ekiel, I.'   3 
# 
_cell.entry_id           3PDZ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3PDZ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PROTEIN (TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1))' 
_entity.formula_weight             10020.252 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.1.3.48 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PDZ2 DOMAIN' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  LYS n 
1 3  PRO n 
1 4  GLY n 
1 5  ASP n 
1 6  ILE n 
1 7  PHE n 
1 8  GLU n 
1 9  VAL n 
1 10 GLU n 
1 11 LEU n 
1 12 ALA n 
1 13 LYS n 
1 14 ASN n 
1 15 ASP n 
1 16 ASN n 
1 17 SER n 
1 18 LEU n 
1 19 GLY n 
1 20 ILE n 
1 21 SER n 
1 22 VAL n 
1 23 THR n 
1 24 GLY n 
1 25 GLY n 
1 26 VAL n 
1 27 ASN n 
1 28 THR n 
1 29 SER n 
1 30 VAL n 
1 31 ARG n 
1 32 HIS n 
1 33 GLY n 
1 34 GLY n 
1 35 ILE n 
1 36 TYR n 
1 37 VAL n 
1 38 LYS n 
1 39 ALA n 
1 40 VAL n 
1 41 ILE n 
1 42 PRO n 
1 43 GLN n 
1 44 GLY n 
1 45 ALA n 
1 46 ALA n 
1 47 GLU n 
1 48 SER n 
1 49 ASP n 
1 50 GLY n 
1 51 ARG n 
1 52 ILE n 
1 53 HIS n 
1 54 LYS n 
1 55 GLY n 
1 56 ASP n 
1 57 ARG n 
1 58 VAL n 
1 59 LEU n 
1 60 ALA n 
1 61 VAL n 
1 62 ASN n 
1 63 GLY n 
1 64 VAL n 
1 65 SER n 
1 66 LEU n 
1 67 GLU n 
1 68 GLY n 
1 69 ALA n 
1 70 THR n 
1 71 HIS n 
1 72 LYS n 
1 73 GLN n 
1 74 ALA n 
1 75 VAL n 
1 76 GLU n 
1 77 THR n 
1 78 LEU n 
1 79 ARG n 
1 80 ASN n 
1 81 THR n 
1 82 GLY n 
1 83 GLN n 
1 84 VAL n 
1 85 VAL n 
1 86 HIS n 
1 87 LEU n 
1 88 LEU n 
1 89 LEU n 
1 90 GLU n 
1 91 LYS n 
1 92 GLY n 
1 93 GLN n 
1 94 SER n 
1 95 PRO n 
1 96 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PBR322 
_entity_src_gen.pdbx_host_org_vector               PGEX 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTN13_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q12923 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3PDZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 96 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q12923 
_struct_ref_seq.db_align_beg                  1361 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1456 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       96 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY 1 
2 1 TOCSY 1 
3 1 COSY  1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '10% D2O/90% WATER' 
_pdbx_nmr_sample_details.solvent_system   ? 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DMX500 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    500 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           3PDZ 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            'REFINEMENT DETAILS CAN BE FOUND IN PRIMARY REFERENCE' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   3PDZ 
_pdbx_nmr_details.text       
'THE STRUCTURE WAS DETERMINED USING 2D AND 3D EXPERIMENTS USING UNLABELED, 15N- LABELED, AND DOUBLE-LABELED PROTEIN' 
# 
_pdbx_nmr_ensemble.entry_id                                      3PDZ 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             30 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'LOWEST ENERGY' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             3PDZ 
_pdbx_nmr_representative.conformer_id         2 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           ,RICE,SIMONSON,WARREN ? 
'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE-KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ' 1 
'structure solution' CNS                   ? ? 2 
# 
_exptl.entry_id          3PDZ 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  3PDZ 
_struct.title                     'SOLUTION STRUCTURE OF THE PDZ2 DOMAIN FROM HUMAN PHOSPHATASE HPTP1E' 
_struct.pdbx_descriptor           'TYROSINE PHOSPHATASE (PTP-BAS, TYPE 1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3PDZ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'PDZ DOMAIN, HUMAN PHOSPHATASE, HPTP1E, PTP-BAS, SPECIFICITY OF BINDING, HYDROLASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 45 ? ASP A 49 ? ALA A 45 ASP A 49 1 ? 5 
HELX_P HELX_P2 2 HIS A 71 ? ARG A 79 ? HIS A 71 ARG A 79 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 6  ? LEU A 11 ? ILE A 6  LEU A 11 
A 2 VAL A 85 ? GLU A 90 ? VAL A 85 GLU A 90 
A 3 ARG A 57 ? VAL A 61 ? ARG A 57 VAL A 61 
B 1 ILE A 20 ? THR A 23 ? ILE A 20 THR A 23 
B 2 TYR A 36 ? VAL A 40 ? TYR A 36 VAL A 40 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 7  ? O PHE A 7  N LEU A 89 ? N LEU A 89 
A 2 3 O LEU A 88 ? O LEU A 88 N ALA A 60 ? N ALA A 60 
B 1 2 O SER A 21 ? O SER A 21 N ALA A 39 ? N ALA A 39 
# 
_database_PDB_matrix.entry_id          3PDZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3PDZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . PRO A 1 1  ? -22.277 1.764   -4.086  1.00 15.00 ? 1  PRO A N    1  
ATOM 2     C CA   . PRO A 1 1  ? -22.132 2.484   -2.791  1.00 15.00 ? 1  PRO A CA   1  
ATOM 3     C C    . PRO A 1 1  ? -21.695 1.544   -1.668  1.00 15.00 ? 1  PRO A C    1  
ATOM 4     O O    . PRO A 1 1  ? -22.330 1.477   -0.615  1.00 15.00 ? 1  PRO A O    1  
ATOM 5     C CB   . PRO A 1 1  ? -23.482 3.117   -2.464  1.00 15.00 ? 1  PRO A CB   1  
ATOM 6     C CG   . PRO A 1 1  ? -24.301 2.893   -3.690  1.00 15.00 ? 1  PRO A CG   1  
ATOM 7     C CD   . PRO A 1 1  ? -23.719 1.680   -4.373  1.00 15.00 ? 1  PRO A CD   1  
ATOM 8     H H2   . PRO A 1 1  ? -21.755 0.888   -3.919  1.00 15.00 ? 1  PRO A H2   1  
ATOM 9     H H3   . PRO A 1 1  ? -21.650 2.327   -4.708  1.00 15.00 ? 1  PRO A H3   1  
ATOM 10    H HA   . PRO A 1 1  ? -21.394 3.262   -2.909  1.00 15.00 ? 1  PRO A HA   1  
ATOM 11    H HB2  . PRO A 1 1  ? -23.916 2.630   -1.602  1.00 15.00 ? 1  PRO A HB2  1  
ATOM 12    H HB3  . PRO A 1 1  ? -23.352 4.170   -2.264  1.00 15.00 ? 1  PRO A HB3  1  
ATOM 13    H HG2  . PRO A 1 1  ? -25.329 2.710   -3.415  1.00 15.00 ? 1  PRO A HG2  1  
ATOM 14    H HG3  . PRO A 1 1  ? -24.234 3.754   -4.338  1.00 15.00 ? 1  PRO A HG3  1  
ATOM 15    H HD2  . PRO A 1 1  ? -24.139 0.776   -3.957  1.00 15.00 ? 1  PRO A HD2  1  
ATOM 16    H HD3  . PRO A 1 1  ? -23.899 1.724   -5.437  1.00 15.00 ? 1  PRO A HD3  1  
ATOM 17    N N    . LYS A 1 2  ? -20.604 0.820   -1.901  1.00 15.00 ? 2  LYS A N    1  
ATOM 18    C CA   . LYS A 1 2  ? -20.082 -0.115  -0.911  1.00 15.00 ? 2  LYS A CA   1  
ATOM 19    C C    . LYS A 1 2  ? -18.587 -0.346  -1.117  1.00 15.00 ? 2  LYS A C    1  
ATOM 20    O O    . LYS A 1 2  ? -18.085 -0.260  -2.238  1.00 15.00 ? 2  LYS A O    1  
ATOM 21    C CB   . LYS A 1 2  ? -20.831 -1.446  -0.992  1.00 15.00 ? 2  LYS A CB   1  
ATOM 22    C CG   . LYS A 1 2  ? -20.808 -2.072  -2.377  1.00 15.00 ? 2  LYS A CG   1  
ATOM 23    C CD   . LYS A 1 2  ? -21.944 -3.066  -2.558  1.00 15.00 ? 2  LYS A CD   1  
ATOM 24    C CE   . LYS A 1 2  ? -21.889 -3.732  -3.923  1.00 15.00 ? 2  LYS A CE   1  
ATOM 25    N NZ   . LYS A 1 2  ? -21.041 -4.956  -3.911  1.00 15.00 ? 2  LYS A NZ   1  
ATOM 26    H H    . LYS A 1 2  ? -20.140 0.917   -2.758  1.00 15.00 ? 2  LYS A H    1  
ATOM 27    H HA   . LYS A 1 2  ? -20.236 0.316   0.067   1.00 15.00 ? 2  LYS A HA   1  
ATOM 28    H HB2  . LYS A 1 2  ? -20.382 -2.141  -0.299  1.00 15.00 ? 2  LYS A HB2  1  
ATOM 29    H HB3  . LYS A 1 2  ? -21.861 -1.284  -0.711  1.00 15.00 ? 2  LYS A HB3  1  
ATOM 30    H HG2  . LYS A 1 2  ? -20.906 -1.292  -3.117  1.00 15.00 ? 2  LYS A HG2  1  
ATOM 31    H HG3  . LYS A 1 2  ? -19.867 -2.585  -2.514  1.00 15.00 ? 2  LYS A HG3  1  
ATOM 32    H HD2  . LYS A 1 2  ? -21.869 -3.826  -1.795  1.00 15.00 ? 2  LYS A HD2  1  
ATOM 33    H HD3  . LYS A 1 2  ? -22.885 -2.545  -2.459  1.00 15.00 ? 2  LYS A HD3  1  
ATOM 34    H HE2  . LYS A 1 2  ? -22.892 -4.003  -4.218  1.00 15.00 ? 2  LYS A HE2  1  
ATOM 35    H HE3  . LYS A 1 2  ? -21.482 -3.030  -4.636  1.00 15.00 ? 2  LYS A HE3  1  
ATOM 36    H HZ1  . LYS A 1 2  ? -20.035 -4.695  -3.955  1.00 15.00 ? 2  LYS A HZ1  1  
ATOM 37    H HZ2  . LYS A 1 2  ? -21.208 -5.499  -3.039  1.00 15.00 ? 2  LYS A HZ2  1  
ATOM 38    H HZ3  . LYS A 1 2  ? -21.269 -5.557  -4.729  1.00 15.00 ? 2  LYS A HZ3  1  
ATOM 39    N N    . PRO A 1 3  ? -17.852 -0.648  -0.032  1.00 15.00 ? 3  PRO A N    1  
ATOM 40    C CA   . PRO A 1 3  ? -16.408 -0.896  -0.101  1.00 15.00 ? 3  PRO A CA   1  
ATOM 41    C C    . PRO A 1 3  ? -16.076 -2.128  -0.935  1.00 15.00 ? 3  PRO A C    1  
ATOM 42    O O    . PRO A 1 3  ? -16.901 -2.601  -1.715  1.00 15.00 ? 3  PRO A O    1  
ATOM 43    C CB   . PRO A 1 3  ? -16.006 -1.114  1.361   1.00 15.00 ? 3  PRO A CB   1  
ATOM 44    C CG   . PRO A 1 3  ? -17.266 -1.498  2.057   1.00 15.00 ? 3  PRO A CG   1  
ATOM 45    C CD   . PRO A 1 3  ? -18.370 -0.774  1.341   1.00 15.00 ? 3  PRO A CD   1  
ATOM 46    H HA   . PRO A 1 3  ? -15.880 -0.041  -0.499  1.00 15.00 ? 3  PRO A HA   1  
ATOM 47    H HB2  . PRO A 1 3  ? -15.268 -1.901  1.418   1.00 15.00 ? 3  PRO A HB2  1  
ATOM 48    H HB3  . PRO A 1 3  ? -15.596 -0.200  1.764   1.00 15.00 ? 3  PRO A HB3  1  
ATOM 49    H HG2  . PRO A 1 3  ? -17.412 -2.566  1.989   1.00 15.00 ? 3  PRO A HG2  1  
ATOM 50    H HG3  . PRO A 1 3  ? -17.224 -1.189  3.091   1.00 15.00 ? 3  PRO A HG3  1  
ATOM 51    H HD2  . PRO A 1 3  ? -19.279 -1.358  1.359   1.00 15.00 ? 3  PRO A HD2  1  
ATOM 52    H HD3  . PRO A 1 3  ? -18.534 0.197   1.782   1.00 15.00 ? 3  PRO A HD3  1  
ATOM 53    N N    . GLY A 1 4  ? -14.860 -2.640  -0.774  1.00 15.00 ? 4  GLY A N    1  
ATOM 54    C CA   . GLY A 1 4  ? -14.447 -3.808  -1.528  1.00 15.00 ? 4  GLY A CA   1  
ATOM 55    C C    . GLY A 1 4  ? -13.835 -3.446  -2.866  1.00 15.00 ? 4  GLY A C    1  
ATOM 56    O O    . GLY A 1 4  ? -13.104 -4.240  -3.457  1.00 15.00 ? 4  GLY A O    1  
ATOM 57    H H    . GLY A 1 4  ? -14.237 -2.219  -0.145  1.00 15.00 ? 4  GLY A H    1  
ATOM 58    H HA2  . GLY A 1 4  ? -13.720 -4.358  -0.948  1.00 15.00 ? 4  GLY A HA2  1  
ATOM 59    H HA3  . GLY A 1 4  ? -15.308 -4.437  -1.696  1.00 15.00 ? 4  GLY A HA3  1  
ATOM 60    N N    . ASP A 1 5  ? -14.132 -2.241  -3.343  1.00 15.00 ? 5  ASP A N    1  
ATOM 61    C CA   . ASP A 1 5  ? -13.603 -1.776  -4.619  1.00 15.00 ? 5  ASP A CA   1  
ATOM 62    C C    . ASP A 1 5  ? -12.087 -1.701  -4.577  1.00 15.00 ? 5  ASP A C    1  
ATOM 63    O O    . ASP A 1 5  ? -11.493 -1.381  -3.548  1.00 15.00 ? 5  ASP A O    1  
ATOM 64    C CB   . ASP A 1 5  ? -14.187 -0.408  -4.975  1.00 15.00 ? 5  ASP A CB   1  
ATOM 65    C CG   . ASP A 1 5  ? -14.020 0.601   -3.855  1.00 15.00 ? 5  ASP A CG   1  
ATOM 66    O OD1  . ASP A 1 5  ? -14.788 0.530   -2.873  1.00 15.00 ? 5  ASP A OD1  1  
ATOM 67    O OD2  . ASP A 1 5  ? -13.121 1.461   -3.960  1.00 15.00 ? 5  ASP A OD2  1  
ATOM 68    H H    . ASP A 1 5  ? -14.719 -1.651  -2.826  1.00 15.00 ? 5  ASP A H    1  
ATOM 69    H HA   . ASP A 1 5  ? -13.884 -2.490  -5.381  1.00 15.00 ? 5  ASP A HA   1  
ATOM 70    H HB2  . ASP A 1 5  ? -13.688 -0.027  -5.853  1.00 15.00 ? 5  ASP A HB2  1  
ATOM 71    H HB3  . ASP A 1 5  ? -15.241 -0.516  -5.184  1.00 15.00 ? 5  ASP A HB3  1  
ATOM 72    N N    . ILE A 1 6  ? -11.474 -2.016  -5.704  1.00 15.00 ? 6  ILE A N    1  
ATOM 73    C CA   . ILE A 1 6  ? -10.028 -2.010  -5.821  1.00 15.00 ? 6  ILE A CA   1  
ATOM 74    C C    . ILE A 1 6  ? -9.541  -0.787  -6.591  1.00 15.00 ? 6  ILE A C    1  
ATOM 75    O O    . ILE A 1 6  ? -10.168 -0.360  -7.560  1.00 15.00 ? 6  ILE A O    1  
ATOM 76    C CB   . ILE A 1 6  ? -9.549  -3.294  -6.532  1.00 15.00 ? 6  ILE A CB   1  
ATOM 77    C CG1  . ILE A 1 6  ? -9.189  -4.367  -5.505  1.00 15.00 ? 6  ILE A CG1  1  
ATOM 78    C CG2  . ILE A 1 6  ? -8.359  -3.014  -7.449  1.00 15.00 ? 6  ILE A CG2  1  
ATOM 79    C CD1  . ILE A 1 6  ? -10.327 -4.712  -4.568  1.00 15.00 ? 6  ILE A CD1  1  
ATOM 80    H H    . ILE A 1 6  ? -12.012 -2.273  -6.482  1.00 15.00 ? 6  ILE A H    1  
ATOM 81    H HA   . ILE A 1 6  ? -9.609  -1.996  -4.825  1.00 15.00 ? 6  ILE A HA   1  
ATOM 82    H HB   . ILE A 1 6  ? -10.368 -3.653  -7.139  1.00 15.00 ? 6  ILE A HB   1  
ATOM 83    H HG12 . ILE A 1 6  ? -8.903  -5.270  -6.023  1.00 15.00 ? 6  ILE A HG12 1  
ATOM 84    H HG13 . ILE A 1 6  ? -8.359  -4.021  -4.908  1.00 15.00 ? 6  ILE A HG13 1  
ATOM 85    H HG21 . ILE A 1 6  ? -7.565  -2.552  -6.879  1.00 15.00 ? 6  ILE A HG21 1  
ATOM 86    H HG22 . ILE A 1 6  ? -8.004  -3.941  -7.874  1.00 15.00 ? 6  ILE A HG22 1  
ATOM 87    H HG23 . ILE A 1 6  ? -8.663  -2.347  -8.244  1.00 15.00 ? 6  ILE A HG23 1  
ATOM 88    H HD11 . ILE A 1 6  ? -10.380 -3.975  -3.780  1.00 15.00 ? 6  ILE A HD11 1  
ATOM 89    H HD12 . ILE A 1 6  ? -11.256 -4.719  -5.118  1.00 15.00 ? 6  ILE A HD12 1  
ATOM 90    H HD13 . ILE A 1 6  ? -10.156 -5.687  -4.137  1.00 15.00 ? 6  ILE A HD13 1  
ATOM 91    N N    . PHE A 1 7  ? -8.406  -0.246  -6.169  1.00 15.00 ? 7  PHE A N    1  
ATOM 92    C CA   . PHE A 1 7  ? -7.820  0.906   -6.837  1.00 15.00 ? 7  PHE A CA   1  
ATOM 93    C C    . PHE A 1 7  ? -6.304  0.761   -6.907  1.00 15.00 ? 7  PHE A C    1  
ATOM 94    O O    . PHE A 1 7  ? -5.724  -0.080  -6.223  1.00 15.00 ? 7  PHE A O    1  
ATOM 95    C CB   . PHE A 1 7  ? -8.216  2.210   -6.132  1.00 15.00 ? 7  PHE A CB   1  
ATOM 96    C CG   . PHE A 1 7  ? -7.414  2.524   -4.898  1.00 15.00 ? 7  PHE A CG   1  
ATOM 97    C CD1  . PHE A 1 7  ? -6.101  2.962   -4.998  1.00 15.00 ? 7  PHE A CD1  1  
ATOM 98    C CD2  . PHE A 1 7  ? -7.978  2.392   -3.640  1.00 15.00 ? 7  PHE A CD2  1  
ATOM 99    C CE1  . PHE A 1 7  ? -5.369  3.261   -3.866  1.00 15.00 ? 7  PHE A CE1  1  
ATOM 100   C CE2  . PHE A 1 7  ? -7.250  2.692   -2.505  1.00 15.00 ? 7  PHE A CE2  1  
ATOM 101   C CZ   . PHE A 1 7  ? -5.944  3.126   -2.619  1.00 15.00 ? 7  PHE A CZ   1  
ATOM 102   H H    . PHE A 1 7  ? -7.943  -0.642  -5.401  1.00 15.00 ? 7  PHE A H    1  
ATOM 103   H HA   . PHE A 1 7  ? -8.207  0.921   -7.846  1.00 15.00 ? 7  PHE A HA   1  
ATOM 104   H HB2  . PHE A 1 7  ? -8.091  3.032   -6.821  1.00 15.00 ? 7  PHE A HB2  1  
ATOM 105   H HB3  . PHE A 1 7  ? -9.256  2.149   -5.844  1.00 15.00 ? 7  PHE A HB3  1  
ATOM 106   H HD1  . PHE A 1 7  ? -5.649  3.066   -5.972  1.00 15.00 ? 7  PHE A HD1  1  
ATOM 107   H HD2  . PHE A 1 7  ? -8.999  2.051   -3.550  1.00 15.00 ? 7  PHE A HD2  1  
ATOM 108   H HE1  . PHE A 1 7  ? -4.348  3.600   -3.957  1.00 15.00 ? 7  PHE A HE1  1  
ATOM 109   H HE2  . PHE A 1 7  ? -7.702  2.585   -1.530  1.00 15.00 ? 7  PHE A HE2  1  
ATOM 110   H HZ   . PHE A 1 7  ? -5.374  3.363   -1.735  1.00 15.00 ? 7  PHE A HZ   1  
ATOM 111   N N    . GLU A 1 8  ? -5.668  1.568   -7.747  1.00 15.00 ? 8  GLU A N    1  
ATOM 112   C CA   . GLU A 1 8  ? -4.220  1.503   -7.911  1.00 15.00 ? 8  GLU A CA   1  
ATOM 113   C C    . GLU A 1 8  ? -3.574  2.877   -7.796  1.00 15.00 ? 8  GLU A C    1  
ATOM 114   O O    . GLU A 1 8  ? -4.107  3.878   -8.276  1.00 15.00 ? 8  GLU A O    1  
ATOM 115   C CB   . GLU A 1 8  ? -3.879  0.893   -9.266  1.00 15.00 ? 8  GLU A CB   1  
ATOM 116   C CG   . GLU A 1 8  ? -4.565  1.585   -10.426 1.00 15.00 ? 8  GLU A CG   1  
ATOM 117   C CD   . GLU A 1 8  ? -4.646  0.713   -11.663 1.00 15.00 ? 8  GLU A CD   1  
ATOM 118   O OE1  . GLU A 1 8  ? -5.115  -0.439  -11.548 1.00 15.00 ? 8  GLU A OE1  1  
ATOM 119   O OE2  . GLU A 1 8  ? -4.242  1.182   -12.747 1.00 15.00 ? 8  GLU A OE2  1  
ATOM 120   H H    . GLU A 1 8  ? -6.183  2.211   -8.278  1.00 15.00 ? 8  GLU A H    1  
ATOM 121   H HA   . GLU A 1 8  ? -3.819  0.867   -7.133  1.00 15.00 ? 8  GLU A HA   1  
ATOM 122   H HB2  . GLU A 1 8  ? -2.812  0.956   -9.417  1.00 15.00 ? 8  GLU A HB2  1  
ATOM 123   H HB3  . GLU A 1 8  ? -4.176  -0.145  -9.265  1.00 15.00 ? 8  GLU A HB3  1  
ATOM 124   H HG2  . GLU A 1 8  ? -5.566  1.849   -10.124 1.00 15.00 ? 8  GLU A HG2  1  
ATOM 125   H HG3  . GLU A 1 8  ? -4.012  2.480   -10.666 1.00 15.00 ? 8  GLU A HG3  1  
ATOM 126   N N    . VAL A 1 9  ? -2.408  2.897   -7.171  1.00 15.00 ? 9  VAL A N    1  
ATOM 127   C CA   . VAL A 1 9  ? -1.639  4.121   -6.991  1.00 15.00 ? 9  VAL A CA   1  
ATOM 128   C C    . VAL A 1 9  ? -0.507  4.171   -8.008  1.00 15.00 ? 9  VAL A C    1  
ATOM 129   O O    . VAL A 1 9  ? 0.397   3.336   -7.986  1.00 15.00 ? 9  VAL A O    1  
ATOM 130   C CB   . VAL A 1 9  ? -1.075  4.244   -5.547  1.00 15.00 ? 9  VAL A CB   1  
ATOM 131   C CG1  . VAL A 1 9  ? -1.100  2.899   -4.832  1.00 15.00 ? 9  VAL A CG1  1  
ATOM 132   C CG2  . VAL A 1 9  ? 0.337   4.821   -5.545  1.00 15.00 ? 9  VAL A CG2  1  
ATOM 133   H H    . VAL A 1 9  ? -2.042  2.054   -6.838  1.00 15.00 ? 9  VAL A H    1  
ATOM 134   H HA   . VAL A 1 9  ? -2.300  4.957   -7.174  1.00 15.00 ? 9  VAL A HA   1  
ATOM 135   H HB   . VAL A 1 9  ? -1.713  4.922   -4.998  1.00 15.00 ? 9  VAL A HB   1  
ATOM 136   H HG11 . VAL A 1 9  ? -2.065  2.431   -4.975  1.00 15.00 ? 9  VAL A HG11 1  
ATOM 137   H HG12 . VAL A 1 9  ? -0.329  2.263   -5.239  1.00 15.00 ? 9  VAL A HG12 1  
ATOM 138   H HG13 . VAL A 1 9  ? -0.925  3.049   -3.777  1.00 15.00 ? 9  VAL A HG13 1  
ATOM 139   H HG21 . VAL A 1 9  ? 1.034   4.068   -5.880  1.00 15.00 ? 9  VAL A HG21 1  
ATOM 140   H HG22 . VAL A 1 9  ? 0.379   5.672   -6.209  1.00 15.00 ? 9  VAL A HG22 1  
ATOM 141   H HG23 . VAL A 1 9  ? 0.597   5.133   -4.544  1.00 15.00 ? 9  VAL A HG23 1  
ATOM 142   N N    . GLU A 1 10 ? -0.575  5.138   -8.910  1.00 15.00 ? 10 GLU A N    1  
ATOM 143   C CA   . GLU A 1 10 ? 0.434   5.276   -9.946  1.00 15.00 ? 10 GLU A CA   1  
ATOM 144   C C    . GLU A 1 10 ? 1.369   6.450   -9.677  1.00 15.00 ? 10 GLU A C    1  
ATOM 145   O O    . GLU A 1 10 ? 1.317   7.469   -10.364 1.00 15.00 ? 10 GLU A O    1  
ATOM 146   C CB   . GLU A 1 10 ? -0.245  5.442   -11.300 1.00 15.00 ? 10 GLU A CB   1  
ATOM 147   C CG   . GLU A 1 10 ? 0.726   5.609   -12.458 1.00 15.00 ? 10 GLU A CG   1  
ATOM 148   C CD   . GLU A 1 10 ? 0.063   5.421   -13.808 1.00 15.00 ? 10 GLU A CD   1  
ATOM 149   O OE1  . GLU A 1 10 ? -0.735  4.470   -13.949 1.00 15.00 ? 10 GLU A OE1  1  
ATOM 150   O OE2  . GLU A 1 10 ? 0.340   6.224   -14.723 1.00 15.00 ? 10 GLU A OE2  1  
ATOM 151   H H    . GLU A 1 10 ? -1.328  5.764   -8.886  1.00 15.00 ? 10 GLU A H    1  
ATOM 152   H HA   . GLU A 1 10 ? 1.017   4.368   -9.961  1.00 15.00 ? 10 GLU A HA   1  
ATOM 153   H HB2  . GLU A 1 10 ? -0.850  4.567   -11.487 1.00 15.00 ? 10 GLU A HB2  1  
ATOM 154   H HB3  . GLU A 1 10 ? -0.884  6.310   -11.262 1.00 15.00 ? 10 GLU A HB3  1  
ATOM 155   H HG2  . GLU A 1 10 ? 1.147   6.603   -12.417 1.00 15.00 ? 10 GLU A HG2  1  
ATOM 156   H HG3  . GLU A 1 10 ? 1.517   4.880   -12.356 1.00 15.00 ? 10 GLU A HG3  1  
ATOM 157   N N    . LEU A 1 11 ? 2.235   6.291   -8.684  1.00 15.00 ? 11 LEU A N    1  
ATOM 158   C CA   . LEU A 1 11 ? 3.196   7.331   -8.340  1.00 15.00 ? 11 LEU A CA   1  
ATOM 159   C C    . LEU A 1 11 ? 4.469   7.159   -9.161  1.00 15.00 ? 11 LEU A C    1  
ATOM 160   O O    . LEU A 1 11 ? 4.680   6.114   -9.772  1.00 15.00 ? 11 LEU A O    1  
ATOM 161   C CB   . LEU A 1 11 ? 3.526   7.291   -6.846  1.00 15.00 ? 11 LEU A CB   1  
ATOM 162   C CG   . LEU A 1 11 ? 3.728   8.661   -6.188  1.00 15.00 ? 11 LEU A CG   1  
ATOM 163   C CD1  . LEU A 1 11 ? 2.445   9.479   -6.234  1.00 15.00 ? 11 LEU A CD1  1  
ATOM 164   C CD2  . LEU A 1 11 ? 4.202   8.495   -4.753  1.00 15.00 ? 11 LEU A CD2  1  
ATOM 165   H H    . LEU A 1 11 ? 2.235   5.452   -8.180  1.00 15.00 ? 11 LEU A H    1  
ATOM 166   H HA   . LEU A 1 11 ? 2.752   8.281   -8.579  1.00 15.00 ? 11 LEU A HA   1  
ATOM 167   H HB2  . LEU A 1 11 ? 2.723   6.782   -6.337  1.00 15.00 ? 11 LEU A HB2  1  
ATOM 168   H HB3  . LEU A 1 11 ? 4.431   6.720   -6.714  1.00 15.00 ? 11 LEU A HB3  1  
ATOM 169   H HG   . LEU A 1 11 ? 4.488   9.204   -6.731  1.00 15.00 ? 11 LEU A HG   1  
ATOM 170   H HD11 . LEU A 1 11 ? 1.921   9.277   -7.156  1.00 15.00 ? 11 LEU A HD11 1  
ATOM 171   H HD12 . LEU A 1 11 ? 1.818   9.212   -5.397  1.00 15.00 ? 11 LEU A HD12 1  
ATOM 172   H HD13 . LEU A 1 11 ? 2.687   10.531  -6.181  1.00 15.00 ? 11 LEU A HD13 1  
ATOM 173   H HD21 . LEU A 1 11 ? 3.440   7.990   -4.178  1.00 15.00 ? 11 LEU A HD21 1  
ATOM 174   H HD22 . LEU A 1 11 ? 5.110   7.910   -4.739  1.00 15.00 ? 11 LEU A HD22 1  
ATOM 175   H HD23 . LEU A 1 11 ? 4.393   9.467   -4.322  1.00 15.00 ? 11 LEU A HD23 1  
ATOM 176   N N    . ALA A 1 12 ? 5.313   8.182   -9.179  1.00 15.00 ? 12 ALA A N    1  
ATOM 177   C CA   . ALA A 1 12 ? 6.558   8.120   -9.935  1.00 15.00 ? 12 ALA A CA   1  
ATOM 178   C C    . ALA A 1 12 ? 7.721   7.698   -9.045  1.00 15.00 ? 12 ALA A C    1  
ATOM 179   O O    . ALA A 1 12 ? 8.369   8.532   -8.413  1.00 15.00 ? 12 ALA A O    1  
ATOM 180   C CB   . ALA A 1 12 ? 6.852   9.458   -10.591 1.00 15.00 ? 12 ALA A CB   1  
ATOM 181   H H    . ALA A 1 12 ? 5.096   8.995   -8.676  1.00 15.00 ? 12 ALA A H    1  
ATOM 182   H HA   . ALA A 1 12 ? 6.435   7.383   -10.718 1.00 15.00 ? 12 ALA A HA   1  
ATOM 183   H HB1  . ALA A 1 12 ? 7.404   9.295   -11.504 1.00 15.00 ? 12 ALA A HB1  1  
ATOM 184   H HB2  . ALA A 1 12 ? 5.923   9.960   -10.816 1.00 15.00 ? 12 ALA A HB2  1  
ATOM 185   H HB3  . ALA A 1 12 ? 7.437   10.068  -9.919  1.00 15.00 ? 12 ALA A HB3  1  
ATOM 186   N N    . LYS A 1 13 ? 7.979   6.395   -9.003  1.00 15.00 ? 13 LYS A N    1  
ATOM 187   C CA   . LYS A 1 13 ? 9.064   5.852   -8.193  1.00 15.00 ? 13 LYS A CA   1  
ATOM 188   C C    . LYS A 1 13 ? 10.390  6.529   -8.531  1.00 15.00 ? 13 LYS A C    1  
ATOM 189   O O    . LYS A 1 13 ? 11.253  6.695   -7.670  1.00 15.00 ? 13 LYS A O    1  
ATOM 190   C CB   . LYS A 1 13 ? 9.173   4.342   -8.409  1.00 15.00 ? 13 LYS A CB   1  
ATOM 191   C CG   . LYS A 1 13 ? 9.590   3.578   -7.165  1.00 15.00 ? 13 LYS A CG   1  
ATOM 192   C CD   . LYS A 1 13 ? 10.977  3.983   -6.699  1.00 15.00 ? 13 LYS A CD   1  
ATOM 193   C CE   . LYS A 1 13 ? 10.913  4.817   -5.429  1.00 15.00 ? 13 LYS A CE   1  
ATOM 194   N NZ   . LYS A 1 13 ? 12.063  4.544   -4.522  1.00 15.00 ? 13 LYS A NZ   1  
ATOM 195   H H    . LYS A 1 13 ? 7.426   5.783   -9.530  1.00 15.00 ? 13 LYS A H    1  
ATOM 196   H HA   . LYS A 1 13 ? 8.830   6.042   -7.156  1.00 15.00 ? 13 LYS A HA   1  
ATOM 197   H HB2  . LYS A 1 13 ? 8.213   3.966   -8.730  1.00 15.00 ? 13 LYS A HB2  1  
ATOM 198   H HB3  . LYS A 1 13 ? 9.901   4.150   -9.184  1.00 15.00 ? 13 LYS A HB3  1  
ATOM 199   H HG2  . LYS A 1 13 ? 8.881   3.781   -6.375  1.00 15.00 ? 13 LYS A HG2  1  
ATOM 200   H HG3  . LYS A 1 13 ? 9.590   2.524   -7.387  1.00 15.00 ? 13 LYS A HG3  1  
ATOM 201   H HD2  . LYS A 1 13 ? 11.556  3.093   -6.504  1.00 15.00 ? 13 LYS A HD2  1  
ATOM 202   H HD3  . LYS A 1 13 ? 11.452  4.562   -7.477  1.00 15.00 ? 13 LYS A HD3  1  
ATOM 203   H HE2  . LYS A 1 13 ? 10.920  5.860   -5.700  1.00 15.00 ? 13 LYS A HE2  1  
ATOM 204   H HE3  . LYS A 1 13 ? 9.993   4.587   -4.910  1.00 15.00 ? 13 LYS A HE3  1  
ATOM 205   H HZ1  . LYS A 1 13 ? 11.718  4.269   -3.580  1.00 15.00 ? 13 LYS A HZ1  1  
ATOM 206   H HZ2  . LYS A 1 13 ? 12.646  3.772   -4.904  1.00 15.00 ? 13 LYS A HZ2  1  
ATOM 207   H HZ3  . LYS A 1 13 ? 12.654  5.395   -4.428  1.00 15.00 ? 13 LYS A HZ3  1  
ATOM 208   N N    . ASN A 1 14 ? 10.543  6.924   -9.788  1.00 15.00 ? 14 ASN A N    1  
ATOM 209   C CA   . ASN A 1 14 ? 11.764  7.584   -10.236 1.00 15.00 ? 14 ASN A CA   1  
ATOM 210   C C    . ASN A 1 14 ? 11.702  9.081   -9.954  1.00 15.00 ? 14 ASN A C    1  
ATOM 211   O O    . ASN A 1 14 ? 10.664  9.715   -10.145 1.00 15.00 ? 14 ASN A O    1  
ATOM 212   C CB   . ASN A 1 14 ? 11.980  7.343   -11.731 1.00 15.00 ? 14 ASN A CB   1  
ATOM 213   C CG   . ASN A 1 14 ? 13.402  7.643   -12.166 1.00 15.00 ? 14 ASN A CG   1  
ATOM 214   O OD1  . ASN A 1 14 ? 14.189  6.732   -12.423 1.00 15.00 ? 14 ASN A OD1  1  
ATOM 215   N ND2  . ASN A 1 14 ? 13.738  8.925   -12.250 1.00 15.00 ? 14 ASN A ND2  1  
ATOM 216   H H    . ASN A 1 14 ? 9.821   6.767   -10.429 1.00 15.00 ? 14 ASN A H    1  
ATOM 217   H HA   . ASN A 1 14 ? 12.591  7.160   -9.688  1.00 15.00 ? 14 ASN A HA   1  
ATOM 218   H HB2  . ASN A 1 14 ? 11.765  6.310   -11.958 1.00 15.00 ? 14 ASN A HB2  1  
ATOM 219   H HB3  . ASN A 1 14 ? 11.310  7.978   -12.293 1.00 15.00 ? 14 ASN A HB3  1  
ATOM 220   H HD21 . ASN A 1 14 ? 13.060  9.597   -12.030 1.00 15.00 ? 14 ASN A HD21 1  
ATOM 221   H HD22 . ASN A 1 14 ? 14.651  9.146   -12.529 1.00 15.00 ? 14 ASN A HD22 1  
ATOM 222   N N    . ASP A 1 15 ? 12.823  9.634   -9.487  1.00 15.00 ? 15 ASP A N    1  
ATOM 223   C CA   . ASP A 1 15 ? 12.925  11.059  -9.158  1.00 15.00 ? 15 ASP A CA   1  
ATOM 224   C C    . ASP A 1 15 ? 12.514  11.323  -7.711  1.00 15.00 ? 15 ASP A C    1  
ATOM 225   O O    . ASP A 1 15 ? 12.984  12.276  -7.090  1.00 15.00 ? 15 ASP A O    1  
ATOM 226   C CB   . ASP A 1 15 ? 12.074  11.911  -10.108 1.00 15.00 ? 15 ASP A CB   1  
ATOM 227   C CG   . ASP A 1 15 ? 12.534  13.355  -10.158 1.00 15.00 ? 15 ASP A CG   1  
ATOM 228   O OD1  . ASP A 1 15 ? 13.658  13.603  -10.643 1.00 15.00 ? 15 ASP A OD1  1  
ATOM 229   O OD2  . ASP A 1 15 ? 11.770  14.237  -9.713  1.00 15.00 ? 15 ASP A OD2  1  
ATOM 230   H H    . ASP A 1 15 ? 13.609  9.064   -9.353  1.00 15.00 ? 15 ASP A H    1  
ATOM 231   H HA   . ASP A 1 15 ? 13.961  11.344  -9.274  1.00 15.00 ? 15 ASP A HA   1  
ATOM 232   H HB2  . ASP A 1 15 ? 12.135  11.498  -11.104 1.00 15.00 ? 15 ASP A HB2  1  
ATOM 233   H HB3  . ASP A 1 15 ? 11.046  11.890  -9.776  1.00 15.00 ? 15 ASP A HB3  1  
ATOM 234   N N    . ASN A 1 16 ? 11.638  10.475  -7.177  1.00 15.00 ? 16 ASN A N    1  
ATOM 235   C CA   . ASN A 1 16 ? 11.171  10.622  -5.803  1.00 15.00 ? 16 ASN A CA   1  
ATOM 236   C C    . ASN A 1 16 ? 10.551  9.322   -5.299  1.00 15.00 ? 16 ASN A C    1  
ATOM 237   O O    . ASN A 1 16 ? 9.750   8.695   -5.992  1.00 15.00 ? 16 ASN A O    1  
ATOM 238   C CB   . ASN A 1 16 ? 10.149  11.757  -5.705  1.00 15.00 ? 16 ASN A CB   1  
ATOM 239   C CG   . ASN A 1 16 ? 10.801  13.126  -5.716  1.00 15.00 ? 16 ASN A CG   1  
ATOM 240   O OD1  . ASN A 1 16 ? 10.856  13.792  -6.749  1.00 15.00 ? 16 ASN A OD1  1  
ATOM 241   N ND2  . ASN A 1 16 ? 11.300  13.553  -4.561  1.00 15.00 ? 16 ASN A ND2  1  
ATOM 242   H H    . ASN A 1 16 ? 11.299  9.734   -7.717  1.00 15.00 ? 16 ASN A H    1  
ATOM 243   H HA   . ASN A 1 16 ? 12.024  10.863  -5.187  1.00 15.00 ? 16 ASN A HA   1  
ATOM 244   H HB2  . ASN A 1 16 ? 9.471   11.696  -6.543  1.00 15.00 ? 16 ASN A HB2  1  
ATOM 245   H HB3  . ASN A 1 16 ? 9.590   11.652  -4.787  1.00 15.00 ? 16 ASN A HB3  1  
ATOM 246   H HD21 . ASN A 1 16 ? 11.221  12.968  -3.779  1.00 15.00 ? 16 ASN A HD21 1  
ATOM 247   H HD22 . ASN A 1 16 ? 11.726  14.435  -4.539  1.00 15.00 ? 16 ASN A HD22 1  
ATOM 248   N N    . SER A 1 17 ? 10.925  8.923   -4.087  1.00 15.00 ? 17 SER A N    1  
ATOM 249   C CA   . SER A 1 17 ? 10.403  7.699   -3.489  1.00 15.00 ? 17 SER A CA   1  
ATOM 250   C C    . SER A 1 17 ? 9.085   7.969   -2.776  1.00 15.00 ? 17 SER A C    1  
ATOM 251   O O    . SER A 1 17 ? 8.446   8.994   -3.006  1.00 15.00 ? 17 SER A O    1  
ATOM 252   C CB   . SER A 1 17 ? 11.411  7.113   -2.499  1.00 15.00 ? 17 SER A CB   1  
ATOM 253   O OG   . SER A 1 17 ? 12.622  7.849   -2.502  1.00 15.00 ? 17 SER A OG   1  
ATOM 254   H H    . SER A 1 17 ? 11.566  9.466   -3.582  1.00 15.00 ? 17 SER A H    1  
ATOM 255   H HA   . SER A 1 17 ? 10.232  6.987   -4.282  1.00 15.00 ? 17 SER A HA   1  
ATOM 256   H HB2  . SER A 1 17 ? 10.987  7.143   -1.504  1.00 15.00 ? 17 SER A HB2  1  
ATOM 257   H HB3  . SER A 1 17 ? 11.623  6.090   -2.769  1.00 15.00 ? 17 SER A HB3  1  
ATOM 258   H HG   . SER A 1 17 ? 13.344  7.279   -2.227  1.00 15.00 ? 17 SER A HG   1  
ATOM 259   N N    . LEU A 1 18 ? 8.684   7.050   -1.904  1.00 15.00 ? 18 LEU A N    1  
ATOM 260   C CA   . LEU A 1 18 ? 7.444   7.209   -1.161  1.00 15.00 ? 18 LEU A CA   1  
ATOM 261   C C    . LEU A 1 18 ? 7.706   7.871   0.187   1.00 15.00 ? 18 LEU A C    1  
ATOM 262   O O    . LEU A 1 18 ? 8.813   8.337   0.458   1.00 15.00 ? 18 LEU A O    1  
ATOM 263   C CB   . LEU A 1 18 ? 6.751   5.856   -0.960  1.00 15.00 ? 18 LEU A CB   1  
ATOM 264   C CG   . LEU A 1 18 ? 6.518   5.047   -2.238  1.00 15.00 ? 18 LEU A CG   1  
ATOM 265   C CD1  . LEU A 1 18 ? 5.848   5.905   -3.301  1.00 15.00 ? 18 LEU A CD1  1  
ATOM 266   C CD2  . LEU A 1 18 ? 7.831   4.479   -2.757  1.00 15.00 ? 18 LEU A CD2  1  
ATOM 267   H H    . LEU A 1 18 ? 9.235   6.253   -1.756  1.00 15.00 ? 18 LEU A H    1  
ATOM 268   H HA   . LEU A 1 18 ? 6.803   7.851   -1.742  1.00 15.00 ? 18 LEU A HA   1  
ATOM 269   H HB2  . LEU A 1 18 ? 7.354   5.263   -0.288  1.00 15.00 ? 18 LEU A HB2  1  
ATOM 270   H HB3  . LEU A 1 18 ? 5.790   6.031   -0.493  1.00 15.00 ? 18 LEU A HB3  1  
ATOM 271   H HG   . LEU A 1 18 ? 5.860   4.219   -2.016  1.00 15.00 ? 18 LEU A HG   1  
ATOM 272   H HD11 . LEU A 1 18 ? 5.372   6.753   -2.831  1.00 15.00 ? 18 LEU A HD11 1  
ATOM 273   H HD12 . LEU A 1 18 ? 6.591   6.252   -4.004  1.00 15.00 ? 18 LEU A HD12 1  
ATOM 274   H HD13 . LEU A 1 18 ? 5.106   5.318   -3.822  1.00 15.00 ? 18 LEU A HD13 1  
ATOM 275   H HD21 . LEU A 1 18 ? 8.336   5.226   -3.351  1.00 15.00 ? 18 LEU A HD21 1  
ATOM 276   H HD22 . LEU A 1 18 ? 8.456   4.199   -1.922  1.00 15.00 ? 18 LEU A HD22 1  
ATOM 277   H HD23 . LEU A 1 18 ? 7.632   3.609   -3.365  1.00 15.00 ? 18 LEU A HD23 1  
ATOM 278   N N    . GLY A 1 19 ? 6.679   7.913   1.025   1.00 15.00 ? 19 GLY A N    1  
ATOM 279   C CA   . GLY A 1 19 ? 6.810   8.523   2.333   1.00 15.00 ? 19 GLY A CA   1  
ATOM 280   C C    . GLY A 1 19 ? 5.722   8.075   3.276   1.00 15.00 ? 19 GLY A C    1  
ATOM 281   O O    . GLY A 1 19 ? 5.178   8.875   4.032   1.00 15.00 ? 19 GLY A O    1  
ATOM 282   H H    . GLY A 1 19 ? 5.821   7.529   0.752   1.00 15.00 ? 19 GLY A H    1  
ATOM 283   H HA2  . GLY A 1 19 ? 7.770   8.261   2.753   1.00 15.00 ? 19 GLY A HA2  1  
ATOM 284   H HA3  . GLY A 1 19 ? 6.754   9.594   2.223   1.00 15.00 ? 19 GLY A HA3  1  
ATOM 285   N N    . ILE A 1 20 ? 5.390   6.795   3.212   1.00 15.00 ? 20 ILE A N    1  
ATOM 286   C CA   . ILE A 1 20 ? 4.349   6.233   4.055   1.00 15.00 ? 20 ILE A CA   1  
ATOM 287   C C    . ILE A 1 20 ? 4.910   5.242   5.073   1.00 15.00 ? 20 ILE A C    1  
ATOM 288   O O    . ILE A 1 20 ? 5.767   4.419   4.750   1.00 15.00 ? 20 ILE A O    1  
ATOM 289   C CB   . ILE A 1 20 ? 3.267   5.543   3.194   1.00 15.00 ? 20 ILE A CB   1  
ATOM 290   C CG1  . ILE A 1 20 ? 1.896   6.112   3.534   1.00 15.00 ? 20 ILE A CG1  1  
ATOM 291   C CG2  . ILE A 1 20 ? 3.278   4.041   3.403   1.00 15.00 ? 20 ILE A CG2  1  
ATOM 292   C CD1  . ILE A 1 20 ? 0.750   5.173   3.243   1.00 15.00 ? 20 ILE A CD1  1  
ATOM 293   H H    . ILE A 1 20 ? 5.853   6.214   2.574   1.00 15.00 ? 20 ILE A H    1  
ATOM 294   H HA   . ILE A 1 20 ? 3.878   7.043   4.594   1.00 15.00 ? 20 ILE A HA   1  
ATOM 295   H HB   . ILE A 1 20 ? 3.483   5.742   2.156   1.00 15.00 ? 20 ILE A HB   1  
ATOM 296   H HG12 . ILE A 1 20 ? 1.873   6.335   4.583   1.00 15.00 ? 20 ILE A HG12 1  
ATOM 297   H HG13 . ILE A 1 20 ? 1.738   7.018   2.971   1.00 15.00 ? 20 ILE A HG13 1  
ATOM 298   H HG21 . ILE A 1 20 ? 4.281   3.665   3.277   1.00 15.00 ? 20 ILE A HG21 1  
ATOM 299   H HG22 . ILE A 1 20 ? 2.931   3.825   4.403   1.00 15.00 ? 20 ILE A HG22 1  
ATOM 300   H HG23 . ILE A 1 20 ? 2.622   3.574   2.685   1.00 15.00 ? 20 ILE A HG23 1  
ATOM 301   H HD11 . ILE A 1 20 ? -0.110  5.741   2.926   1.00 15.00 ? 20 ILE A HD11 1  
ATOM 302   H HD12 . ILE A 1 20 ? 1.041   4.488   2.463   1.00 15.00 ? 20 ILE A HD12 1  
ATOM 303   H HD13 . ILE A 1 20 ? 0.508   4.620   4.136   1.00 15.00 ? 20 ILE A HD13 1  
ATOM 304   N N    . SER A 1 21 ? 4.382   5.299   6.289   1.00 15.00 ? 21 SER A N    1  
ATOM 305   C CA   . SER A 1 21 ? 4.784   4.378   7.342   1.00 15.00 ? 21 SER A CA   1  
ATOM 306   C C    . SER A 1 21 ? 3.782   3.228   7.375   1.00 15.00 ? 21 SER A C    1  
ATOM 307   O O    . SER A 1 21 ? 2.637   3.407   7.789   1.00 15.00 ? 21 SER A O    1  
ATOM 308   C CB   . SER A 1 21 ? 4.840   5.097   8.694   1.00 15.00 ? 21 SER A CB   1  
ATOM 309   O OG   . SER A 1 21 ? 5.004   4.175   9.757   1.00 15.00 ? 21 SER A OG   1  
ATOM 310   H H    . SER A 1 21 ? 3.677   5.953   6.472   1.00 15.00 ? 21 SER A H    1  
ATOM 311   H HA   . SER A 1 21 ? 5.762   3.990   7.096   1.00 15.00 ? 21 SER A HA   1  
ATOM 312   H HB2  . SER A 1 21 ? 5.675   5.785   8.698   1.00 15.00 ? 21 SER A HB2  1  
ATOM 313   H HB3  . SER A 1 21 ? 3.924   5.647   8.846   1.00 15.00 ? 21 SER A HB3  1  
ATOM 314   H HG   . SER A 1 21 ? 5.697   4.483   10.345  1.00 15.00 ? 21 SER A HG   1  
ATOM 315   N N    . VAL A 1 22 ? 4.196   2.065   6.880   1.00 15.00 ? 22 VAL A N    1  
ATOM 316   C CA   . VAL A 1 22 ? 3.298   0.915   6.800   1.00 15.00 ? 22 VAL A CA   1  
ATOM 317   C C    . VAL A 1 22 ? 3.394   -0.015  8.006   1.00 15.00 ? 22 VAL A C    1  
ATOM 318   O O    . VAL A 1 22 ? 4.412   -0.068  8.696   1.00 15.00 ? 22 VAL A O    1  
ATOM 319   C CB   . VAL A 1 22 ? 3.569   0.098   5.522   1.00 15.00 ? 22 VAL A CB   1  
ATOM 320   C CG1  . VAL A 1 22 ? 3.459   0.985   4.293   1.00 15.00 ? 22 VAL A CG1  1  
ATOM 321   C CG2  . VAL A 1 22 ? 4.941   -0.560  5.579   1.00 15.00 ? 22 VAL A CG2  1  
ATOM 322   H H    . VAL A 1 22 ? 5.108   1.990   6.522   1.00 15.00 ? 22 VAL A H    1  
ATOM 323   H HA   . VAL A 1 22 ? 2.288   1.296   6.740   1.00 15.00 ? 22 VAL A HA   1  
ATOM 324   H HB   . VAL A 1 22 ? 2.822   -0.678  5.447   1.00 15.00 ? 22 VAL A HB   1  
ATOM 325   H HG11 . VAL A 1 22 ? 3.633   2.013   4.576   1.00 15.00 ? 22 VAL A HG11 1  
ATOM 326   H HG12 . VAL A 1 22 ? 4.199   0.680   3.565   1.00 15.00 ? 22 VAL A HG12 1  
ATOM 327   H HG13 . VAL A 1 22 ? 2.472   0.890   3.866   1.00 15.00 ? 22 VAL A HG13 1  
ATOM 328   H HG21 . VAL A 1 22 ? 5.688   0.136   5.228   1.00 15.00 ? 22 VAL A HG21 1  
ATOM 329   H HG22 . VAL A 1 22 ? 5.164   -0.843  6.596   1.00 15.00 ? 22 VAL A HG22 1  
ATOM 330   H HG23 . VAL A 1 22 ? 4.945   -1.438  4.951   1.00 15.00 ? 22 VAL A HG23 1  
ATOM 331   N N    . THR A 1 23 ? 2.309   -0.755  8.234   1.00 15.00 ? 23 THR A N    1  
ATOM 332   C CA   . THR A 1 23 ? 2.228   -1.707  9.335   1.00 15.00 ? 23 THR A CA   1  
ATOM 333   C C    . THR A 1 23 ? 1.315   -2.878  8.963   1.00 15.00 ? 23 THR A C    1  
ATOM 334   O O    . THR A 1 23 ? 0.865   -2.989  7.819   1.00 15.00 ? 23 THR A O    1  
ATOM 335   C CB   . THR A 1 23 ? 1.708   -1.014  10.597  1.00 15.00 ? 23 THR A CB   1  
ATOM 336   O OG1  . THR A 1 23 ? 1.685   0.389   10.421  1.00 15.00 ? 23 THR A OG1  1  
ATOM 337   C CG2  . THR A 1 23 ? 2.536   -1.310  11.828  1.00 15.00 ? 23 THR A CG2  1  
ATOM 338   H H    . THR A 1 23 ? 1.540   -0.662  7.634   1.00 15.00 ? 23 THR A H    1  
ATOM 339   H HA   . THR A 1 23 ? 3.223   -2.084  9.523   1.00 15.00 ? 23 THR A HA   1  
ATOM 340   H HB   . THR A 1 23 ? 0.699   -1.343  10.788  1.00 15.00 ? 23 THR A HB   1  
ATOM 341   H HG1  . THR A 1 23 ? 1.071   0.609   9.717   1.00 15.00 ? 23 THR A HG1  1  
ATOM 342   H HG21 . THR A 1 23 ? 2.044   -0.901  12.699  1.00 15.00 ? 23 THR A HG21 1  
ATOM 343   H HG22 . THR A 1 23 ? 2.640   -2.379  11.943  1.00 15.00 ? 23 THR A HG22 1  
ATOM 344   H HG23 . THR A 1 23 ? 3.512   -0.862  11.722  1.00 15.00 ? 23 THR A HG23 1  
ATOM 345   N N    . GLY A 1 24 ? 1.037   -3.743  9.935   1.00 15.00 ? 24 GLY A N    1  
ATOM 346   C CA   . GLY A 1 24 ? 0.172   -4.886  9.689   1.00 15.00 ? 24 GLY A CA   1  
ATOM 347   C C    . GLY A 1 24 ? 0.804   -5.911  8.769   1.00 15.00 ? 24 GLY A C    1  
ATOM 348   O O    . GLY A 1 24 ? 1.863   -6.457  9.073   1.00 15.00 ? 24 GLY A O    1  
ATOM 349   H H    . GLY A 1 24 ? 1.417   -3.602  10.827  1.00 15.00 ? 24 GLY A H    1  
ATOM 350   H HA2  . GLY A 1 24 ? -0.056  -5.360  10.632  1.00 15.00 ? 24 GLY A HA2  1  
ATOM 351   H HA3  . GLY A 1 24 ? -0.747  -4.536  9.242   1.00 15.00 ? 24 GLY A HA3  1  
ATOM 352   N N    . GLY A 1 25 ? 0.153   -6.168  7.639   1.00 15.00 ? 25 GLY A N    1  
ATOM 353   C CA   . GLY A 1 25 ? 0.674   -7.128  6.682   1.00 15.00 ? 25 GLY A CA   1  
ATOM 354   C C    . GLY A 1 25 ? 0.635   -8.558  7.183   1.00 15.00 ? 25 GLY A C    1  
ATOM 355   O O    . GLY A 1 25 ? -0.094  -9.388  6.640   1.00 15.00 ? 25 GLY A O    1  
ATOM 356   H H    . GLY A 1 25 ? -0.686  -5.698  7.450   1.00 15.00 ? 25 GLY A H    1  
ATOM 357   H HA2  . GLY A 1 25 ? 0.097   -7.065  5.776   1.00 15.00 ? 25 GLY A HA2  1  
ATOM 358   H HA3  . GLY A 1 25 ? 1.692   -6.868  6.455   1.00 15.00 ? 25 GLY A HA3  1  
ATOM 359   N N    . VAL A 1 26 ? 1.433   -8.846  8.212   1.00 15.00 ? 26 VAL A N    1  
ATOM 360   C CA   . VAL A 1 26 ? 1.511   -10.191 8.794   1.00 15.00 ? 26 VAL A CA   1  
ATOM 361   C C    . VAL A 1 26 ? 0.172   -10.922 8.728   1.00 15.00 ? 26 VAL A C    1  
ATOM 362   O O    . VAL A 1 26 ? -0.888  -10.312 8.865   1.00 15.00 ? 26 VAL A O    1  
ATOM 363   C CB   . VAL A 1 26 ? 1.973   -10.142 10.263  1.00 15.00 ? 26 VAL A CB   1  
ATOM 364   C CG1  . VAL A 1 26 ? 3.485   -10.003 10.347  1.00 15.00 ? 26 VAL A CG1  1  
ATOM 365   C CG2  . VAL A 1 26 ? 1.285   -9.005  10.998  1.00 15.00 ? 26 VAL A CG2  1  
ATOM 366   H H    . VAL A 1 26 ? 1.995   -8.136  8.586   1.00 15.00 ? 26 VAL A H    1  
ATOM 367   H HA   . VAL A 1 26 ? 2.241   -10.754 8.232   1.00 15.00 ? 26 VAL A HA   1  
ATOM 368   H HB   . VAL A 1 26 ? 1.692   -11.070 10.738  1.00 15.00 ? 26 VAL A HB   1  
ATOM 369   H HG11 . VAL A 1 26 ? 3.951   -10.784 9.764   1.00 15.00 ? 26 VAL A HG11 1  
ATOM 370   H HG12 . VAL A 1 26 ? 3.780   -9.040  9.959   1.00 15.00 ? 26 VAL A HG12 1  
ATOM 371   H HG13 . VAL A 1 26 ? 3.797   -10.088 11.377  1.00 15.00 ? 26 VAL A HG13 1  
ATOM 372   H HG21 . VAL A 1 26 ? 1.851   -8.753  11.882  1.00 15.00 ? 26 VAL A HG21 1  
ATOM 373   H HG22 . VAL A 1 26 ? 1.227   -8.144  10.350  1.00 15.00 ? 26 VAL A HG22 1  
ATOM 374   H HG23 . VAL A 1 26 ? 0.289   -9.310  11.281  1.00 15.00 ? 26 VAL A HG23 1  
ATOM 375   N N    . ASN A 1 27 ? 0.232   -12.232 8.512   1.00 15.00 ? 27 ASN A N    1  
ATOM 376   C CA   . ASN A 1 27 ? -0.972  -13.048 8.421   1.00 15.00 ? 27 ASN A CA   1  
ATOM 377   C C    . ASN A 1 27 ? -1.576  -13.288 9.802   1.00 15.00 ? 27 ASN A C    1  
ATOM 378   O O    . ASN A 1 27 ? -1.663  -14.426 10.264  1.00 15.00 ? 27 ASN A O    1  
ATOM 379   C CB   . ASN A 1 27 ? -0.655  -14.386 7.750   1.00 15.00 ? 27 ASN A CB   1  
ATOM 380   C CG   . ASN A 1 27 ? 0.470   -15.129 8.443   1.00 15.00 ? 27 ASN A CG   1  
ATOM 381   O OD1  . ASN A 1 27 ? 1.597   -14.639 8.521   1.00 15.00 ? 27 ASN A OD1  1  
ATOM 382   N ND2  . ASN A 1 27 ? 0.170   -16.318 8.950   1.00 15.00 ? 27 ASN A ND2  1  
ATOM 383   H H    . ASN A 1 27 ? 1.108   -12.659 8.408   1.00 15.00 ? 27 ASN A H    1  
ATOM 384   H HA   . ASN A 1 27 ? -1.688  -12.512 7.815   1.00 15.00 ? 27 ASN A HA   1  
ATOM 385   H HB2  . ASN A 1 27 ? -1.537  -15.009 7.770   1.00 15.00 ? 27 ASN A HB2  1  
ATOM 386   H HB3  . ASN A 1 27 ? -0.368  -14.209 6.724   1.00 15.00 ? 27 ASN A HB3  1  
ATOM 387   H HD21 . ASN A 1 27 ? -0.749  -16.646 8.851   1.00 15.00 ? 27 ASN A HD21 1  
ATOM 388   H HD22 . ASN A 1 27 ? 0.879   -16.821 9.404   1.00 15.00 ? 27 ASN A HD22 1  
ATOM 389   N N    . THR A 1 28 ? -1.993  -12.209 10.456  1.00 15.00 ? 28 THR A N    1  
ATOM 390   C CA   . THR A 1 28 ? -2.590  -12.304 11.783  1.00 15.00 ? 28 THR A CA   1  
ATOM 391   C C    . THR A 1 28 ? -3.571  -11.160 12.023  1.00 15.00 ? 28 THR A C    1  
ATOM 392   O O    . THR A 1 28 ? -4.778  -11.375 12.124  1.00 15.00 ? 28 THR A O    1  
ATOM 393   C CB   . THR A 1 28 ? -1.500  -12.292 12.857  1.00 15.00 ? 28 THR A CB   1  
ATOM 394   O OG1  . THR A 1 28 ? -0.316  -11.692 12.364  1.00 15.00 ? 28 THR A OG1  1  
ATOM 395   C CG2  . THR A 1 28 ? -1.140  -13.674 13.358  1.00 15.00 ? 28 THR A CG2  1  
ATOM 396   H H    . THR A 1 28 ? -1.898  -11.328 10.036  1.00 15.00 ? 28 THR A H    1  
ATOM 397   H HA   . THR A 1 28 ? -3.126  -13.239 11.838  1.00 15.00 ? 28 THR A HA   1  
ATOM 398   H HB   . THR A 1 28 ? -1.847  -11.714 13.702  1.00 15.00 ? 28 THR A HB   1  
ATOM 399   H HG1  . THR A 1 28 ? 0.041   -12.227 11.651  1.00 15.00 ? 28 THR A HG1  1  
ATOM 400   H HG21 . THR A 1 28 ? -1.766  -13.926 14.201  1.00 15.00 ? 28 THR A HG21 1  
ATOM 401   H HG22 . THR A 1 28 ? -1.293  -14.394 12.567  1.00 15.00 ? 28 THR A HG22 1  
ATOM 402   H HG23 . THR A 1 28 ? -0.104  -13.688 13.662  1.00 15.00 ? 28 THR A HG23 1  
ATOM 403   N N    . SER A 1 29 ? -3.042  -9.945  12.113  1.00 15.00 ? 29 SER A N    1  
ATOM 404   C CA   . SER A 1 29 ? -3.869  -8.766  12.343  1.00 15.00 ? 29 SER A CA   1  
ATOM 405   C C    . SER A 1 29 ? -4.767  -8.487  11.142  1.00 15.00 ? 29 SER A C    1  
ATOM 406   O O    . SER A 1 29 ? -5.888  -8.001  11.292  1.00 15.00 ? 29 SER A O    1  
ATOM 407   C CB   . SER A 1 29 ? -2.989  -7.548  12.629  1.00 15.00 ? 29 SER A CB   1  
ATOM 408   O OG   . SER A 1 29 ? -2.455  -7.601  13.940  1.00 15.00 ? 29 SER A OG   1  
ATOM 409   H H    . SER A 1 29 ? -2.072  -9.837  12.024  1.00 15.00 ? 29 SER A H    1  
ATOM 410   H HA   . SER A 1 29 ? -4.491  -8.960  13.204  1.00 15.00 ? 29 SER A HA   1  
ATOM 411   H HB2  . SER A 1 29 ? -2.172  -7.523  11.923  1.00 15.00 ? 29 SER A HB2  1  
ATOM 412   H HB3  . SER A 1 29 ? -3.579  -6.649  12.529  1.00 15.00 ? 29 SER A HB3  1  
ATOM 413   H HG   . SER A 1 29 ? -1.560  -7.946  13.908  1.00 15.00 ? 29 SER A HG   1  
ATOM 414   N N    . VAL A 1 30 ? -4.265  -8.794  9.950   1.00 15.00 ? 30 VAL A N    1  
ATOM 415   C CA   . VAL A 1 30 ? -5.021  -8.573  8.723   1.00 15.00 ? 30 VAL A CA   1  
ATOM 416   C C    . VAL A 1 30 ? -5.896  -9.778  8.389   1.00 15.00 ? 30 VAL A C    1  
ATOM 417   O O    . VAL A 1 30 ? -5.992  -10.724 9.170   1.00 15.00 ? 30 VAL A O    1  
ATOM 418   C CB   . VAL A 1 30 ? -4.085  -8.277  7.535   1.00 15.00 ? 30 VAL A CB   1  
ATOM 419   C CG1  . VAL A 1 30 ? -3.236  -7.047  7.821   1.00 15.00 ? 30 VAL A CG1  1  
ATOM 420   C CG2  . VAL A 1 30 ? -3.206  -9.482  7.228   1.00 15.00 ? 30 VAL A CG2  1  
ATOM 421   H H    . VAL A 1 30 ? -3.365  -9.176  9.895   1.00 15.00 ? 30 VAL A H    1  
ATOM 422   H HA   . VAL A 1 30 ? -5.656  -7.712  8.876   1.00 15.00 ? 30 VAL A HA   1  
ATOM 423   H HB   . VAL A 1 30 ? -4.693  -8.071  6.666   1.00 15.00 ? 30 VAL A HB   1  
ATOM 424   H HG11 . VAL A 1 30 ? -3.875  -6.233  8.131   1.00 15.00 ? 30 VAL A HG11 1  
ATOM 425   H HG12 . VAL A 1 30 ? -2.531  -7.271  8.607   1.00 15.00 ? 30 VAL A HG12 1  
ATOM 426   H HG13 . VAL A 1 30 ? -2.701  -6.764  6.927   1.00 15.00 ? 30 VAL A HG13 1  
ATOM 427   H HG21 . VAL A 1 30 ? -2.172  -9.229  7.408   1.00 15.00 ? 30 VAL A HG21 1  
ATOM 428   H HG22 . VAL A 1 30 ? -3.490  -10.308 7.863   1.00 15.00 ? 30 VAL A HG22 1  
ATOM 429   H HG23 . VAL A 1 30 ? -3.332  -9.764  6.193   1.00 15.00 ? 30 VAL A HG23 1  
ATOM 430   N N    . ARG A 1 31 ? -6.535  -9.734  7.224   1.00 15.00 ? 31 ARG A N    1  
ATOM 431   C CA   . ARG A 1 31 ? -7.406  -10.819 6.786   1.00 15.00 ? 31 ARG A CA   1  
ATOM 432   C C    . ARG A 1 31 ? -6.616  -12.108 6.574   1.00 15.00 ? 31 ARG A C    1  
ATOM 433   O O    . ARG A 1 31 ? -6.880  -13.122 7.220   1.00 15.00 ? 31 ARG A O    1  
ATOM 434   C CB   . ARG A 1 31 ? -8.130  -10.429 5.495   1.00 15.00 ? 31 ARG A CB   1  
ATOM 435   C CG   . ARG A 1 31 ? -9.613  -10.154 5.689   1.00 15.00 ? 31 ARG A CG   1  
ATOM 436   C CD   . ARG A 1 31 ? -10.146 -9.196  4.636   1.00 15.00 ? 31 ARG A CD   1  
ATOM 437   N NE   . ARG A 1 31 ? -11.462 -9.598  4.145   1.00 15.00 ? 31 ARG A NE   1  
ATOM 438   C CZ   . ARG A 1 31 ? -12.298 -8.780  3.510   1.00 15.00 ? 31 ARG A CZ   1  
ATOM 439   N NH1  . ARG A 1 31 ? -11.958 -7.516  3.288   1.00 15.00 ? 31 ARG A NH1  1  
ATOM 440   N NH2  . ARG A 1 31 ? -13.476 -9.226  3.096   1.00 15.00 ? 31 ARG A NH2  1  
ATOM 441   H H    . ARG A 1 31 ? -6.421  -8.951  6.646   1.00 15.00 ? 31 ARG A H    1  
ATOM 442   H HA   . ARG A 1 31 ? -8.139  -10.986 7.561   1.00 15.00 ? 31 ARG A HA   1  
ATOM 443   H HB2  . ARG A 1 31 ? -7.671  -9.538  5.094   1.00 15.00 ? 31 ARG A HB2  1  
ATOM 444   H HB3  . ARG A 1 31 ? -8.026  -11.231 4.779   1.00 15.00 ? 31 ARG A HB3  1  
ATOM 445   H HG2  . ARG A 1 31 ? -10.154 -11.086 5.619   1.00 15.00 ? 31 ARG A HG2  1  
ATOM 446   H HG3  . ARG A 1 31 ? -9.764  -9.721  6.667   1.00 15.00 ? 31 ARG A HG3  1  
ATOM 447   H HD2  . ARG A 1 31 ? -10.220 -8.210  5.069   1.00 15.00 ? 31 ARG A HD2  1  
ATOM 448   H HD3  . ARG A 1 31 ? -9.454  -9.172  3.806   1.00 15.00 ? 31 ARG A HD3  1  
ATOM 449   H HE   . ARG A 1 31 ? -11.737 -10.527 4.296   1.00 15.00 ? 31 ARG A HE   1  
ATOM 450   H HH11 . ARG A 1 31 ? -11.071 -7.174  3.597   1.00 15.00 ? 31 ARG A HH11 1  
ATOM 451   H HH12 . ARG A 1 31 ? -12.591 -6.906  2.811   1.00 15.00 ? 31 ARG A HH12 1  
ATOM 452   H HH21 . ARG A 1 31 ? -13.736 -10.178 3.261   1.00 15.00 ? 31 ARG A HH21 1  
ATOM 453   H HH22 . ARG A 1 31 ? -14.104 -8.611  2.620   1.00 15.00 ? 31 ARG A HH22 1  
ATOM 454   N N    . HIS A 1 32 ? -5.650  -12.066 5.660   1.00 15.00 ? 32 HIS A N    1  
ATOM 455   C CA   . HIS A 1 32 ? -4.831  -13.236 5.362   1.00 15.00 ? 32 HIS A CA   1  
ATOM 456   C C    . HIS A 1 32 ? -3.347  -12.877 5.324   1.00 15.00 ? 32 HIS A C    1  
ATOM 457   O O    . HIS A 1 32 ? -2.543  -13.454 6.053   1.00 15.00 ? 32 HIS A O    1  
ATOM 458   C CB   . HIS A 1 32 ? -5.252  -13.849 4.027   1.00 15.00 ? 32 HIS A CB   1  
ATOM 459   C CG   . HIS A 1 32 ? -6.715  -14.161 3.947   1.00 15.00 ? 32 HIS A CG   1  
ATOM 460   N ND1  . HIS A 1 32 ? -7.629  -13.331 3.334   1.00 15.00 ? 32 HIS A ND1  1  
ATOM 461   C CD2  . HIS A 1 32 ? -7.422  -15.220 4.409   1.00 15.00 ? 32 HIS A CD2  1  
ATOM 462   C CE1  . HIS A 1 32 ? -8.835  -13.864 3.423   1.00 15.00 ? 32 HIS A CE1  1  
ATOM 463   N NE2  . HIS A 1 32 ? -8.736  -15.010 4.069   1.00 15.00 ? 32 HIS A NE2  1  
ATOM 464   H H    . HIS A 1 32 ? -5.488  -11.231 5.173   1.00 15.00 ? 32 HIS A H    1  
ATOM 465   H HA   . HIS A 1 32 ? -4.992  -13.960 6.146   1.00 15.00 ? 32 HIS A HA   1  
ATOM 466   H HB2  . HIS A 1 32 ? -5.017  -13.159 3.231   1.00 15.00 ? 32 HIS A HB2  1  
ATOM 467   H HB3  . HIS A 1 32 ? -4.707  -14.769 3.872   1.00 15.00 ? 32 HIS A HB3  1  
ATOM 468   H HD1  . HIS A 1 32 ? -7.425  -12.477 2.898   1.00 15.00 ? 32 HIS A HD1  1  
ATOM 469   H HD2  . HIS A 1 32 ? -7.026  -16.071 4.944   1.00 15.00 ? 32 HIS A HD2  1  
ATOM 470   H HE1  . HIS A 1 32 ? -9.746  -13.436 3.032   1.00 15.00 ? 32 HIS A HE1  1  
ATOM 471   H HE2  . HIS A 1 32 ? -9.468  -15.648 4.205   1.00 15.00 ? 32 HIS A HE2  1  
ATOM 472   N N    . GLY A 1 33 ? -2.992  -11.929 4.464   1.00 15.00 ? 33 GLY A N    1  
ATOM 473   C CA   . GLY A 1 33 ? -1.603  -11.516 4.342   1.00 15.00 ? 33 GLY A CA   1  
ATOM 474   C C    . GLY A 1 33 ? -1.441  -10.230 3.552   1.00 15.00 ? 33 GLY A C    1  
ATOM 475   O O    . GLY A 1 33 ? -0.360  -9.943  3.039   1.00 15.00 ? 33 GLY A O    1  
ATOM 476   H H    . GLY A 1 33 ? -3.677  -11.510 3.903   1.00 15.00 ? 33 GLY A H    1  
ATOM 477   H HA2  . GLY A 1 33 ? -1.186  -11.368 5.332   1.00 15.00 ? 33 GLY A HA2  1  
ATOM 478   H HA3  . GLY A 1 33 ? -1.053  -12.300 3.849   1.00 15.00 ? 33 GLY A HA3  1  
ATOM 479   N N    . GLY A 1 34 ? -2.509  -9.443  3.468   1.00 15.00 ? 34 GLY A N    1  
ATOM 480   C CA   . GLY A 1 34 ? -2.440  -8.185  2.753   1.00 15.00 ? 34 GLY A CA   1  
ATOM 481   C C    . GLY A 1 34 ? -1.880  -7.093  3.635   1.00 15.00 ? 34 GLY A C    1  
ATOM 482   O O    . GLY A 1 34 ? -2.007  -7.162  4.858   1.00 15.00 ? 34 GLY A O    1  
ATOM 483   H H    . GLY A 1 34 ? -3.342  -9.709  3.907   1.00 15.00 ? 34 GLY A H    1  
ATOM 484   H HA2  . GLY A 1 34 ? -1.804  -8.304  1.887   1.00 15.00 ? 34 GLY A HA2  1  
ATOM 485   H HA3  . GLY A 1 34 ? -3.431  -7.905  2.430   1.00 15.00 ? 34 GLY A HA3  1  
ATOM 486   N N    . ILE A 1 35 ? -1.250  -6.088  3.040   1.00 15.00 ? 35 ILE A N    1  
ATOM 487   C CA   . ILE A 1 35 ? -0.675  -5.011  3.832   1.00 15.00 ? 35 ILE A CA   1  
ATOM 488   C C    . ILE A 1 35 ? -1.678  -3.893  4.070   1.00 15.00 ? 35 ILE A C    1  
ATOM 489   O O    . ILE A 1 35 ? -2.597  -3.679  3.281   1.00 15.00 ? 35 ILE A O    1  
ATOM 490   C CB   . ILE A 1 35 ? 0.611   -4.438  3.188   1.00 15.00 ? 35 ILE A CB   1  
ATOM 491   C CG1  . ILE A 1 35 ? 1.773   -4.499  4.192   1.00 15.00 ? 35 ILE A CG1  1  
ATOM 492   C CG2  . ILE A 1 35 ? 0.395   -3.016  2.677   1.00 15.00 ? 35 ILE A CG2  1  
ATOM 493   C CD1  . ILE A 1 35 ? 2.538   -3.199  4.354   1.00 15.00 ? 35 ILE A CD1  1  
ATOM 494   H H    . ILE A 1 35 ? -1.164  -6.075  2.059   1.00 15.00 ? 35 ILE A H    1  
ATOM 495   H HA   . ILE A 1 35 ? -0.406  -5.429  4.791   1.00 15.00 ? 35 ILE A HA   1  
ATOM 496   H HB   . ILE A 1 35 ? 0.853   -5.055  2.343   1.00 15.00 ? 35 ILE A HB   1  
ATOM 497   H HG12 . ILE A 1 35 ? 1.385   -4.770  5.162   1.00 15.00 ? 35 ILE A HG12 1  
ATOM 498   H HG13 . ILE A 1 35 ? 2.473   -5.256  3.870   1.00 15.00 ? 35 ILE A HG13 1  
ATOM 499   H HG21 . ILE A 1 35 ? -0.495  -2.983  2.067   1.00 15.00 ? 35 ILE A HG21 1  
ATOM 500   H HG22 . ILE A 1 35 ? 0.281   -2.345  3.516   1.00 15.00 ? 35 ILE A HG22 1  
ATOM 501   H HG23 . ILE A 1 35 ? 1.248   -2.713  2.087   1.00 15.00 ? 35 ILE A HG23 1  
ATOM 502   H HD11 . ILE A 1 35 ? 3.462   -3.389  4.878   1.00 15.00 ? 35 ILE A HD11 1  
ATOM 503   H HD12 . ILE A 1 35 ? 2.754   -2.784  3.381   1.00 15.00 ? 35 ILE A HD12 1  
ATOM 504   H HD13 . ILE A 1 35 ? 1.941   -2.499  4.920   1.00 15.00 ? 35 ILE A HD13 1  
ATOM 505   N N    . TYR A 1 36 ? -1.473  -3.180  5.163   1.00 15.00 ? 36 TYR A N    1  
ATOM 506   C CA   . TYR A 1 36 ? -2.332  -2.064  5.531   1.00 15.00 ? 36 TYR A CA   1  
ATOM 507   C C    . TYR A 1 36 ? -1.490  -0.941  6.113   1.00 15.00 ? 36 TYR A C    1  
ATOM 508   O O    . TYR A 1 36 ? -0.966  -1.057  7.221   1.00 15.00 ? 36 TYR A O    1  
ATOM 509   C CB   . TYR A 1 36 ? -3.389  -2.507  6.544   1.00 15.00 ? 36 TYR A CB   1  
ATOM 510   C CG   . TYR A 1 36 ? -4.381  -3.500  5.986   1.00 15.00 ? 36 TYR A CG   1  
ATOM 511   C CD1  . TYR A 1 36 ? -3.998  -4.802  5.696   1.00 15.00 ? 36 TYR A CD1  1  
ATOM 512   C CD2  . TYR A 1 36 ? -5.700  -3.135  5.747   1.00 15.00 ? 36 TYR A CD2  1  
ATOM 513   C CE1  . TYR A 1 36 ? -4.899  -5.714  5.185   1.00 15.00 ? 36 TYR A CE1  1  
ATOM 514   C CE2  . TYR A 1 36 ? -6.609  -4.041  5.236   1.00 15.00 ? 36 TYR A CE2  1  
ATOM 515   C CZ   . TYR A 1 36 ? -6.204  -5.329  4.956   1.00 15.00 ? 36 TYR A CZ   1  
ATOM 516   O OH   . TYR A 1 36 ? -7.106  -6.236  4.446   1.00 15.00 ? 36 TYR A OH   1  
ATOM 517   H H    . TYR A 1 36 ? -0.709  -3.406  5.736   1.00 15.00 ? 36 TYR A H    1  
ATOM 518   H HA   . TYR A 1 36 ? -2.820  -1.710  4.636   1.00 15.00 ? 36 TYR A HA   1  
ATOM 519   H HB2  . TYR A 1 36 ? -2.899  -2.967  7.388   1.00 15.00 ? 36 TYR A HB2  1  
ATOM 520   H HB3  . TYR A 1 36 ? -3.939  -1.640  6.881   1.00 15.00 ? 36 TYR A HB3  1  
ATOM 521   H HD1  . TYR A 1 36 ? -2.976  -5.100  5.877   1.00 15.00 ? 36 TYR A HD1  1  
ATOM 522   H HD2  . TYR A 1 36 ? -6.014  -2.125  5.967   1.00 15.00 ? 36 TYR A HD2  1  
ATOM 523   H HE1  . TYR A 1 36 ? -4.580  -6.721  4.966   1.00 15.00 ? 36 TYR A HE1  1  
ATOM 524   H HE2  . TYR A 1 36 ? -7.630  -3.738  5.058   1.00 15.00 ? 36 TYR A HE2  1  
ATOM 525   H HH   . TYR A 1 36 ? -7.970  -6.080  4.832   1.00 15.00 ? 36 TYR A HH   1  
ATOM 526   N N    . VAL A 1 37 ? -1.344  0.136   5.355   1.00 15.00 ? 37 VAL A N    1  
ATOM 527   C CA   . VAL A 1 37 ? -0.536  1.263   5.809   1.00 15.00 ? 37 VAL A CA   1  
ATOM 528   C C    . VAL A 1 37 ? -1.017  1.791   7.154   1.00 15.00 ? 37 VAL A C    1  
ATOM 529   O O    . VAL A 1 37 ? -2.186  1.657   7.509   1.00 15.00 ? 37 VAL A O    1  
ATOM 530   C CB   . VAL A 1 37 ? -0.493  2.431   4.780   1.00 15.00 ? 37 VAL A CB   1  
ATOM 531   C CG1  . VAL A 1 37 ? -0.678  1.937   3.361   1.00 15.00 ? 37 VAL A CG1  1  
ATOM 532   C CG2  . VAL A 1 37 ? -1.515  3.514   5.083   1.00 15.00 ? 37 VAL A CG2  1  
ATOM 533   H H    . VAL A 1 37 ? -1.775  0.166   4.473   1.00 15.00 ? 37 VAL A H    1  
ATOM 534   H HA   . VAL A 1 37 ? 0.474   0.900   5.933   1.00 15.00 ? 37 VAL A HA   1  
ATOM 535   H HB   . VAL A 1 37 ? 0.473   2.878   4.844   1.00 15.00 ? 37 VAL A HB   1  
ATOM 536   H HG11 . VAL A 1 37 ? -0.439  0.886   3.307   1.00 15.00 ? 37 VAL A HG11 1  
ATOM 537   H HG12 . VAL A 1 37 ? -1.703  2.093   3.068   1.00 15.00 ? 37 VAL A HG12 1  
ATOM 538   H HG13 . VAL A 1 37 ? -0.028  2.491   2.701   1.00 15.00 ? 37 VAL A HG13 1  
ATOM 539   H HG21 . VAL A 1 37 ? -2.499  3.129   4.903   1.00 15.00 ? 37 VAL A HG21 1  
ATOM 540   H HG22 . VAL A 1 37 ? -1.428  3.825   6.113   1.00 15.00 ? 37 VAL A HG22 1  
ATOM 541   H HG23 . VAL A 1 37 ? -1.341  4.362   4.438   1.00 15.00 ? 37 VAL A HG23 1  
ATOM 542   N N    . LYS A 1 38 ? -0.110  2.418   7.883   1.00 15.00 ? 38 LYS A N    1  
ATOM 543   C CA   . LYS A 1 38 ? -0.442  3.003   9.167   1.00 15.00 ? 38 LYS A CA   1  
ATOM 544   C C    . LYS A 1 38 ? -0.994  4.401   8.929   1.00 15.00 ? 38 LYS A C    1  
ATOM 545   O O    . LYS A 1 38 ? -2.042  4.768   9.456   1.00 15.00 ? 38 LYS A O    1  
ATOM 546   C CB   . LYS A 1 38 ? 0.793   3.018   10.086  1.00 15.00 ? 38 LYS A CB   1  
ATOM 547   C CG   . LYS A 1 38 ? 1.367   4.397   10.395  1.00 15.00 ? 38 LYS A CG   1  
ATOM 548   C CD   . LYS A 1 38 ? 1.882   4.465   11.823  1.00 15.00 ? 38 LYS A CD   1  
ATOM 549   C CE   . LYS A 1 38 ? 1.005   5.356   12.689  1.00 15.00 ? 38 LYS A CE   1  
ATOM 550   N NZ   . LYS A 1 38 ? 1.301   5.184   14.138  1.00 15.00 ? 38 LYS A NZ   1  
ATOM 551   H H    . LYS A 1 38 ? 0.797   2.512   7.535   1.00 15.00 ? 38 LYS A H    1  
ATOM 552   H HA   . LYS A 1 38 ? -1.213  2.398   9.620   1.00 15.00 ? 38 LYS A HA   1  
ATOM 553   H HB2  . LYS A 1 38 ? 0.524   2.556   11.024  1.00 15.00 ? 38 LYS A HB2  1  
ATOM 554   H HB3  . LYS A 1 38 ? 1.570   2.427   9.624   1.00 15.00 ? 38 LYS A HB3  1  
ATOM 555   H HG2  . LYS A 1 38 ? 2.184   4.597   9.718   1.00 15.00 ? 38 LYS A HG2  1  
ATOM 556   H HG3  . LYS A 1 38 ? 0.599   5.143   10.265  1.00 15.00 ? 38 LYS A HG3  1  
ATOM 557   H HD2  . LYS A 1 38 ? 1.886   3.469   12.239  1.00 15.00 ? 38 LYS A HD2  1  
ATOM 558   H HD3  . LYS A 1 38 ? 2.887   4.860   11.815  1.00 15.00 ? 38 LYS A HD3  1  
ATOM 559   H HE2  . LYS A 1 38 ? 1.178   6.386   12.415  1.00 15.00 ? 38 LYS A HE2  1  
ATOM 560   H HE3  . LYS A 1 38 ? -0.030  5.104   12.508  1.00 15.00 ? 38 LYS A HE3  1  
ATOM 561   H HZ1  . LYS A 1 38 ? 0.609   4.539   14.570  1.00 15.00 ? 38 LYS A HZ1  1  
ATOM 562   H HZ2  . LYS A 1 38 ? 2.253   4.787   14.264  1.00 15.00 ? 38 LYS A HZ2  1  
ATOM 563   H HZ3  . LYS A 1 38 ? 1.254   6.103   14.624  1.00 15.00 ? 38 LYS A HZ3  1  
ATOM 564   N N    . ALA A 1 39 ? -0.278  5.164   8.106   1.00 15.00 ? 39 ALA A N    1  
ATOM 565   C CA   . ALA A 1 39 ? -0.687  6.515   7.755   1.00 15.00 ? 39 ALA A CA   1  
ATOM 566   C C    . ALA A 1 39 ? 0.214   7.070   6.663   1.00 15.00 ? 39 ALA A C    1  
ATOM 567   O O    . ALA A 1 39 ? 1.216   6.453   6.315   1.00 15.00 ? 39 ALA A O    1  
ATOM 568   C CB   . ALA A 1 39 ? -0.674  7.411   8.980   1.00 15.00 ? 39 ALA A CB   1  
ATOM 569   H H    . ALA A 1 39 ? 0.545   4.799   7.705   1.00 15.00 ? 39 ALA A H    1  
ATOM 570   H HA   . ALA A 1 39 ? -1.699  6.469   7.381   1.00 15.00 ? 39 ALA A HA   1  
ATOM 571   H HB1  . ALA A 1 39 ? -1.661  7.427   9.419   1.00 15.00 ? 39 ALA A HB1  1  
ATOM 572   H HB2  . ALA A 1 39 ? 0.035   7.029   9.698   1.00 15.00 ? 39 ALA A HB2  1  
ATOM 573   H HB3  . ALA A 1 39 ? -0.392  8.412   8.690   1.00 15.00 ? 39 ALA A HB3  1  
ATOM 574   N N    . VAL A 1 40 ? -0.130  8.242   6.141   1.00 15.00 ? 40 VAL A N    1  
ATOM 575   C CA   . VAL A 1 40 ? 0.677   8.874   5.099   1.00 15.00 ? 40 VAL A CA   1  
ATOM 576   C C    . VAL A 1 40 ? 1.614   9.893   5.737   1.00 15.00 ? 40 VAL A C    1  
ATOM 577   O O    . VAL A 1 40 ? 1.170   10.906  6.279   1.00 15.00 ? 40 VAL A O    1  
ATOM 578   C CB   . VAL A 1 40 ? -0.186  9.569   4.018   1.00 15.00 ? 40 VAL A CB   1  
ATOM 579   C CG1  . VAL A 1 40 ? -0.152  8.782   2.717   1.00 15.00 ? 40 VAL A CG1  1  
ATOM 580   C CG2  . VAL A 1 40 ? -1.620  9.749   4.492   1.00 15.00 ? 40 VAL A CG2  1  
ATOM 581   H H    . VAL A 1 40 ? -0.931  8.696   6.474   1.00 15.00 ? 40 VAL A H    1  
ATOM 582   H HA   . VAL A 1 40 ? 1.268   8.101   4.624   1.00 15.00 ? 40 VAL A HA   1  
ATOM 583   H HB   . VAL A 1 40 ? 0.231   10.548  3.828   1.00 15.00 ? 40 VAL A HB   1  
ATOM 584   H HG11 . VAL A 1 40 ? 0.871   8.672   2.390   1.00 15.00 ? 40 VAL A HG11 1  
ATOM 585   H HG12 . VAL A 1 40 ? -0.588  7.804   2.873   1.00 15.00 ? 40 VAL A HG12 1  
ATOM 586   H HG13 . VAL A 1 40 ? -0.716  9.309   1.962   1.00 15.00 ? 40 VAL A HG13 1  
ATOM 587   H HG21 . VAL A 1 40 ? -2.224  10.127  3.681   1.00 15.00 ? 40 VAL A HG21 1  
ATOM 588   H HG22 . VAL A 1 40 ? -2.010  8.797   4.819   1.00 15.00 ? 40 VAL A HG22 1  
ATOM 589   H HG23 . VAL A 1 40 ? -1.641  10.449  5.314   1.00 15.00 ? 40 VAL A HG23 1  
ATOM 590   N N    . ILE A 1 41 ? 2.906   9.588   5.719   1.00 15.00 ? 41 ILE A N    1  
ATOM 591   C CA   . ILE A 1 41 ? 3.903   10.444  6.349   1.00 15.00 ? 41 ILE A CA   1  
ATOM 592   C C    . ILE A 1 41 ? 4.260   11.677  5.515   1.00 15.00 ? 41 ILE A C    1  
ATOM 593   O O    . ILE A 1 41 ? 4.800   11.563  4.412   1.00 15.00 ? 41 ILE A O    1  
ATOM 594   C CB   . ILE A 1 41 ? 5.177   9.633   6.708   1.00 15.00 ? 41 ILE A CB   1  
ATOM 595   C CG1  . ILE A 1 41 ? 4.910   8.687   7.890   1.00 15.00 ? 41 ILE A CG1  1  
ATOM 596   C CG2  . ILE A 1 41 ? 6.347   10.549  7.030   1.00 15.00 ? 41 ILE A CG2  1  
ATOM 597   C CD1  . ILE A 1 41 ? 3.475   8.213   8.004   1.00 15.00 ? 41 ILE A CD1  1  
ATOM 598   H H    . ILE A 1 41 ? 3.192   8.745   5.308   1.00 15.00 ? 41 ILE A H    1  
ATOM 599   H HA   . ILE A 1 41 ? 3.470   10.788  7.261   1.00 15.00 ? 41 ILE A HA   1  
ATOM 600   H HB   . ILE A 1 41 ? 5.451   9.042   5.852   1.00 15.00 ? 41 ILE A HB   1  
ATOM 601   H HG12 . ILE A 1 41 ? 5.534   7.812   7.785   1.00 15.00 ? 41 ILE A HG12 1  
ATOM 602   H HG13 . ILE A 1 41 ? 5.165   9.194   8.809   1.00 15.00 ? 41 ILE A HG13 1  
ATOM 603   H HG21 . ILE A 1 41 ? 5.977   11.527  7.299   1.00 15.00 ? 41 ILE A HG21 1  
ATOM 604   H HG22 . ILE A 1 41 ? 6.909   10.136  7.856   1.00 15.00 ? 41 ILE A HG22 1  
ATOM 605   H HG23 . ILE A 1 41 ? 6.988   10.630  6.165   1.00 15.00 ? 41 ILE A HG23 1  
ATOM 606   H HD11 . ILE A 1 41 ? 2.828   9.061   8.176   1.00 15.00 ? 41 ILE A HD11 1  
ATOM 607   H HD12 . ILE A 1 41 ? 3.185   7.720   7.087   1.00 15.00 ? 41 ILE A HD12 1  
ATOM 608   H HD13 . ILE A 1 41 ? 3.388   7.521   8.828   1.00 15.00 ? 41 ILE A HD13 1  
ATOM 609   N N    . PRO A 1 42 ? 3.959   12.883  6.062   1.00 15.00 ? 42 PRO A N    1  
ATOM 610   C CA   . PRO A 1 42 ? 4.235   14.171  5.405   1.00 15.00 ? 42 PRO A CA   1  
ATOM 611   C C    . PRO A 1 42 ? 5.724   14.407  5.149   1.00 15.00 ? 42 PRO A C    1  
ATOM 612   O O    . PRO A 1 42 ? 6.305   15.360  5.667   1.00 15.00 ? 42 PRO A O    1  
ATOM 613   C CB   . PRO A 1 42 ? 3.707   15.214  6.400   1.00 15.00 ? 42 PRO A CB   1  
ATOM 614   C CG   . PRO A 1 42 ? 2.770   14.470  7.283   1.00 15.00 ? 42 PRO A CG   1  
ATOM 615   C CD   . PRO A 1 42 ? 3.320   13.080  7.377   1.00 15.00 ? 42 PRO A CD   1  
ATOM 616   H HA   . PRO A 1 42 ? 3.695   14.262  4.479   1.00 15.00 ? 42 PRO A HA   1  
ATOM 617   H HB2  . PRO A 1 42 ? 4.531   15.629  6.961   1.00 15.00 ? 42 PRO A HB2  1  
ATOM 618   H HB3  . PRO A 1 42 ? 3.199   16.001  5.862   1.00 15.00 ? 42 PRO A HB3  1  
ATOM 619   H HG2  . PRO A 1 42 ? 2.740   14.930  8.259   1.00 15.00 ? 42 PRO A HG2  1  
ATOM 620   H HG3  . PRO A 1 42 ? 1.783   14.455  6.843   1.00 15.00 ? 42 PRO A HG3  1  
ATOM 621   H HD2  . PRO A 1 42 ? 4.045   13.013  8.175   1.00 15.00 ? 42 PRO A HD2  1  
ATOM 622   H HD3  . PRO A 1 42 ? 2.521   12.370  7.529   1.00 15.00 ? 42 PRO A HD3  1  
ATOM 623   N N    . GLN A 1 43 ? 6.339   13.542  4.349   1.00 15.00 ? 43 GLN A N    1  
ATOM 624   C CA   . GLN A 1 43 ? 7.755   13.679  4.038   1.00 15.00 ? 43 GLN A CA   1  
ATOM 625   C C    . GLN A 1 43 ? 8.081   13.132  2.650   1.00 15.00 ? 43 GLN A C    1  
ATOM 626   O O    . GLN A 1 43 ? 8.772   13.783  1.866   1.00 15.00 ? 43 GLN A O    1  
ATOM 627   C CB   . GLN A 1 43 ? 8.600   12.960  5.091   1.00 15.00 ? 43 GLN A CB   1  
ATOM 628   C CG   . GLN A 1 43 ? 9.065   13.864  6.220   1.00 15.00 ? 43 GLN A CG   1  
ATOM 629   C CD   . GLN A 1 43 ? 10.513  13.624  6.601   1.00 15.00 ? 43 GLN A CD   1  
ATOM 630   O OE1  . GLN A 1 43 ? 11.428  13.952  5.846   1.00 15.00 ? 43 GLN A OE1  1  
ATOM 631   N NE2  . GLN A 1 43 ? 10.727  13.048  7.779   1.00 15.00 ? 43 GLN A NE2  1  
ATOM 632   H H    . GLN A 1 43 ? 5.831   12.800  3.961   1.00 15.00 ? 43 GLN A H    1  
ATOM 633   H HA   . GLN A 1 43 ? 7.996   14.731  4.059   1.00 15.00 ? 43 GLN A HA   1  
ATOM 634   H HB2  . GLN A 1 43 ? 8.016   12.159  5.518   1.00 15.00 ? 43 GLN A HB2  1  
ATOM 635   H HB3  . GLN A 1 43 ? 9.473   12.540  4.612   1.00 15.00 ? 43 GLN A HB3  1  
ATOM 636   H HG2  . GLN A 1 43 ? 8.957   14.892  5.909   1.00 15.00 ? 43 GLN A HG2  1  
ATOM 637   H HG3  . GLN A 1 43 ? 8.445   13.685  7.087   1.00 15.00 ? 43 GLN A HG3  1  
ATOM 638   H HE21 . GLN A 1 43 ? 9.950   12.813  8.327   1.00 15.00 ? 43 GLN A HE21 1  
ATOM 639   H HE22 . GLN A 1 43 ? 11.653  12.881  8.050   1.00 15.00 ? 43 GLN A HE22 1  
ATOM 640   N N    . GLY A 1 44 ? 7.597   11.930  2.354   1.00 15.00 ? 44 GLY A N    1  
ATOM 641   C CA   . GLY A 1 44 ? 7.874   11.325  1.061   1.00 15.00 ? 44 GLY A CA   1  
ATOM 642   C C    . GLY A 1 44 ? 6.876   11.702  -0.017  1.00 15.00 ? 44 GLY A C    1  
ATOM 643   O O    . GLY A 1 44 ? 5.817   12.266  0.262   1.00 15.00 ? 44 GLY A O    1  
ATOM 644   H H    . GLY A 1 44 ? 7.058   11.447  3.020   1.00 15.00 ? 44 GLY A H    1  
ATOM 645   H HA2  . GLY A 1 44 ? 8.855   11.643  0.740   1.00 15.00 ? 44 GLY A HA2  1  
ATOM 646   H HA3  . GLY A 1 44 ? 7.883   10.254  1.167   1.00 15.00 ? 44 GLY A HA3  1  
ATOM 647   N N    . ALA A 1 45 ? 7.229   11.376  -1.255  1.00 15.00 ? 45 ALA A N    1  
ATOM 648   C CA   . ALA A 1 45 ? 6.392   11.670  -2.418  1.00 15.00 ? 45 ALA A CA   1  
ATOM 649   C C    . ALA A 1 45 ? 4.999   11.056  -2.312  1.00 15.00 ? 45 ALA A C    1  
ATOM 650   O O    . ALA A 1 45 ? 4.105   11.405  -3.083  1.00 15.00 ? 45 ALA A O    1  
ATOM 651   C CB   . ALA A 1 45 ? 7.075   11.184  -3.685  1.00 15.00 ? 45 ALA A CB   1  
ATOM 652   H H    . ALA A 1 45 ? 8.084   10.921  -1.391  1.00 15.00 ? 45 ALA A H    1  
ATOM 653   H HA   . ALA A 1 45 ? 6.294   12.743  -2.489  1.00 15.00 ? 45 ALA A HA   1  
ATOM 654   H HB1  . ALA A 1 45 ? 6.791   11.816  -4.514  1.00 15.00 ? 45 ALA A HB1  1  
ATOM 655   H HB2  . ALA A 1 45 ? 8.146   11.222  -3.554  1.00 15.00 ? 45 ALA A HB2  1  
ATOM 656   H HB3  . ALA A 1 45 ? 6.774   10.166  -3.888  1.00 15.00 ? 45 ALA A HB3  1  
ATOM 657   N N    . ALA A 1 46 ? 4.809   10.143  -1.366  1.00 15.00 ? 46 ALA A N    1  
ATOM 658   C CA   . ALA A 1 46 ? 3.514   9.500   -1.194  1.00 15.00 ? 46 ALA A CA   1  
ATOM 659   C C    . ALA A 1 46 ? 2.506   10.473  -0.599  1.00 15.00 ? 46 ALA A C    1  
ATOM 660   O O    . ALA A 1 46 ? 1.456   10.737  -1.196  1.00 15.00 ? 46 ALA A O    1  
ATOM 661   C CB   . ALA A 1 46 ? 3.648   8.273   -0.307  1.00 15.00 ? 46 ALA A CB   1  
ATOM 662   H H    . ALA A 1 46 ? 5.551   9.893   -0.779  1.00 15.00 ? 46 ALA A H    1  
ATOM 663   H HA   . ALA A 1 46 ? 3.166   9.180   -2.165  1.00 15.00 ? 46 ALA A HA   1  
ATOM 664   H HB1  . ALA A 1 46 ? 2.731   7.704   -0.339  1.00 15.00 ? 46 ALA A HB1  1  
ATOM 665   H HB2  . ALA A 1 46 ? 4.464   7.661   -0.660  1.00 15.00 ? 46 ALA A HB2  1  
ATOM 666   H HB3  . ALA A 1 46 ? 3.843   8.584   0.710   1.00 15.00 ? 46 ALA A HB3  1  
ATOM 667   N N    . GLU A 1 47 ? 2.838   11.013  0.573   1.00 15.00 ? 47 GLU A N    1  
ATOM 668   C CA   . GLU A 1 47 ? 1.974   11.976  1.247   1.00 15.00 ? 47 GLU A CA   1  
ATOM 669   C C    . GLU A 1 47 ? 1.711   13.180  0.342   1.00 15.00 ? 47 GLU A C    1  
ATOM 670   O O    . GLU A 1 47 ? 0.588   13.677  0.257   1.00 15.00 ? 47 GLU A O    1  
ATOM 671   C CB   . GLU A 1 47 ? 2.610   12.448  2.564   1.00 15.00 ? 47 GLU A CB   1  
ATOM 672   C CG   . GLU A 1 47 ? 3.834   13.317  2.343   1.00 15.00 ? 47 GLU A CG   1  
ATOM 673   C CD   . GLU A 1 47 ? 3.486   14.778  2.127   1.00 15.00 ? 47 GLU A CD   1  
ATOM 674   O OE1  . GLU A 1 47 ? 2.339   15.166  2.434   1.00 15.00 ? 47 GLU A OE1  1  
ATOM 675   O OE2  . GLU A 1 47 ? 4.360   15.532  1.651   1.00 15.00 ? 47 GLU A OE2  1  
ATOM 676   H H    . GLU A 1 47 ? 3.698   10.773  0.983   1.00 15.00 ? 47 GLU A H    1  
ATOM 677   H HA   . GLU A 1 47 ? 1.030   11.489  1.455   1.00 15.00 ? 47 GLU A HA   1  
ATOM 678   H HB2  . GLU A 1 47 ? 1.883   13.025  3.112   1.00 15.00 ? 47 GLU A HB2  1  
ATOM 679   H HB3  . GLU A 1 47 ? 2.901   11.588  3.169   1.00 15.00 ? 47 GLU A HB3  1  
ATOM 680   H HG2  . GLU A 1 47 ? 4.470   13.241  3.200   1.00 15.00 ? 47 GLU A HG2  1  
ATOM 681   H HG3  . GLU A 1 47 ? 4.360   12.957  1.477   1.00 15.00 ? 47 GLU A HG3  1  
ATOM 682   N N    . SER A 1 48 ? 2.770   13.650  -0.323  1.00 15.00 ? 48 SER A N    1  
ATOM 683   C CA   . SER A 1 48 ? 2.676   14.802  -1.215  1.00 15.00 ? 48 SER A CA   1  
ATOM 684   C C    . SER A 1 48 ? 1.579   14.592  -2.244  1.00 15.00 ? 48 SER A C    1  
ATOM 685   O O    . SER A 1 48 ? 0.524   15.222  -2.176  1.00 15.00 ? 48 SER A O    1  
ATOM 686   C CB   . SER A 1 48 ? 4.013   15.042  -1.917  1.00 15.00 ? 48 SER A CB   1  
ATOM 687   O OG   . SER A 1 48 ? 5.031   15.357  -0.982  1.00 15.00 ? 48 SER A OG   1  
ATOM 688   H H    . SER A 1 48 ? 3.638   13.212  -0.205  1.00 15.00 ? 48 SER A H    1  
ATOM 689   H HA   . SER A 1 48 ? 2.432   15.667  -0.615  1.00 15.00 ? 48 SER A HA   1  
ATOM 690   H HB2  . SER A 1 48 ? 4.300   14.151  -2.455  1.00 15.00 ? 48 SER A HB2  1  
ATOM 691   H HB3  . SER A 1 48 ? 3.911   15.865  -2.610  1.00 15.00 ? 48 SER A HB3  1  
ATOM 692   H HG   . SER A 1 48 ? 4.979   14.754  -0.237  1.00 15.00 ? 48 SER A HG   1  
ATOM 693   N N    . ASP A 1 49 ? 1.821   13.688  -3.185  1.00 15.00 ? 49 ASP A N    1  
ATOM 694   C CA   . ASP A 1 49 ? 0.832   13.389  -4.205  1.00 15.00 ? 49 ASP A CA   1  
ATOM 695   C C    . ASP A 1 49 ? -0.451  12.926  -3.534  1.00 15.00 ? 49 ASP A C    1  
ATOM 696   O O    . ASP A 1 49 ? -1.553  13.306  -3.931  1.00 15.00 ? 49 ASP A O    1  
ATOM 697   C CB   . ASP A 1 49 ? 1.350   12.308  -5.155  1.00 15.00 ? 49 ASP A CB   1  
ATOM 698   C CG   . ASP A 1 49 ? 1.921   12.887  -6.434  1.00 15.00 ? 49 ASP A CG   1  
ATOM 699   O OD1  . ASP A 1 49 ? 3.020   13.479  -6.379  1.00 15.00 ? 49 ASP A OD1  1  
ATOM 700   O OD2  . ASP A 1 49 ? 1.269   12.750  -7.491  1.00 15.00 ? 49 ASP A OD2  1  
ATOM 701   H H    . ASP A 1 49 ? 2.673   13.203  -3.181  1.00 15.00 ? 49 ASP A H    1  
ATOM 702   H HA   . ASP A 1 49 ? 0.637   14.291  -4.763  1.00 15.00 ? 49 ASP A HA   1  
ATOM 703   H HB2  . ASP A 1 49 ? 2.126   11.744  -4.660  1.00 15.00 ? 49 ASP A HB2  1  
ATOM 704   H HB3  . ASP A 1 49 ? 0.537   11.644  -5.413  1.00 15.00 ? 49 ASP A HB3  1  
ATOM 705   N N    . GLY A 1 50 ? -0.289  12.107  -2.500  1.00 15.00 ? 50 GLY A N    1  
ATOM 706   C CA   . GLY A 1 50 ? -1.426  11.602  -1.764  1.00 15.00 ? 50 GLY A CA   1  
ATOM 707   C C    . GLY A 1 50 ? -2.074  10.434  -2.472  1.00 15.00 ? 50 GLY A C    1  
ATOM 708   O O    . GLY A 1 50 ? -3.300  10.331  -2.521  1.00 15.00 ? 50 GLY A O    1  
ATOM 709   H H    . GLY A 1 50 ? 0.618   11.850  -2.230  1.00 15.00 ? 50 GLY A H    1  
ATOM 710   H HA2  . GLY A 1 50 ? -1.093  11.285  -0.780  1.00 15.00 ? 50 GLY A HA2  1  
ATOM 711   H HA3  . GLY A 1 50 ? -2.153  12.394  -1.652  1.00 15.00 ? 50 GLY A HA3  1  
ATOM 712   N N    . ARG A 1 51 ? -1.251  9.558   -3.036  1.00 15.00 ? 51 ARG A N    1  
ATOM 713   C CA   . ARG A 1 51 ? -1.764  8.399   -3.761  1.00 15.00 ? 51 ARG A CA   1  
ATOM 714   C C    . ARG A 1 51 ? -2.175  7.299   -2.793  1.00 15.00 ? 51 ARG A C    1  
ATOM 715   O O    . ARG A 1 51 ? -3.282  6.768   -2.874  1.00 15.00 ? 51 ARG A O    1  
ATOM 716   C CB   . ARG A 1 51 ? -0.720  7.869   -4.747  1.00 15.00 ? 51 ARG A CB   1  
ATOM 717   C CG   . ARG A 1 51 ? -0.769  8.547   -6.106  1.00 15.00 ? 51 ARG A CG   1  
ATOM 718   C CD   . ARG A 1 51 ? -1.780  7.881   -7.025  1.00 15.00 ? 51 ARG A CD   1  
ATOM 719   N NE   . ARG A 1 51 ? -3.104  8.487   -6.915  1.00 15.00 ? 51 ARG A NE   1  
ATOM 720   C CZ   . ARG A 1 51 ? -4.105  8.238   -7.756  1.00 15.00 ? 51 ARG A CZ   1  
ATOM 721   N NH1  . ARG A 1 51 ? -3.936  7.398   -8.769  1.00 15.00 ? 51 ARG A NH1  1  
ATOM 722   N NH2  . ARG A 1 51 ? -5.278  8.832   -7.583  1.00 15.00 ? 51 ARG A NH2  1  
ATOM 723   H H    . ARG A 1 51 ? -0.278  9.699   -2.969  1.00 15.00 ? 51 ARG A H    1  
ATOM 724   H HA   . ARG A 1 51 ? -2.636  8.717   -4.313  1.00 15.00 ? 51 ARG A HA   1  
ATOM 725   H HB2  . ARG A 1 51 ? 0.266   8.016   -4.330  1.00 15.00 ? 51 ARG A HB2  1  
ATOM 726   H HB3  . ARG A 1 51 ? -0.886  6.813   -4.891  1.00 15.00 ? 51 ARG A HB3  1  
ATOM 727   H HG2  . ARG A 1 51 ? -1.046  9.582   -5.973  1.00 15.00 ? 51 ARG A HG2  1  
ATOM 728   H HG3  . ARG A 1 51 ? 0.209   8.490   -6.561  1.00 15.00 ? 51 ARG A HG3  1  
ATOM 729   H HD2  . ARG A 1 51 ? -1.436  7.974   -8.045  1.00 15.00 ? 51 ARG A HD2  1  
ATOM 730   H HD3  . ARG A 1 51 ? -1.849  6.835   -6.764  1.00 15.00 ? 51 ARG A HD3  1  
ATOM 731   H HE   . ARG A 1 51 ? -3.256  9.112   -6.175  1.00 15.00 ? 51 ARG A HE   1  
ATOM 732   H HH11 . ARG A 1 51 ? -3.053  6.948   -8.904  1.00 15.00 ? 51 ARG A HH11 1  
ATOM 733   H HH12 . ARG A 1 51 ? -4.692  7.215   -9.398  1.00 15.00 ? 51 ARG A HH12 1  
ATOM 734   H HH21 . ARG A 1 51 ? -5.411  9.466   -6.822  1.00 15.00 ? 51 ARG A HH21 1  
ATOM 735   H HH22 . ARG A 1 51 ? -6.031  8.645   -8.215  1.00 15.00 ? 51 ARG A HH22 1  
ATOM 736   N N    . ILE A 1 52 ? -1.280  6.970   -1.873  1.00 15.00 ? 52 ILE A N    1  
ATOM 737   C CA   . ILE A 1 52 ? -1.546  5.948   -0.883  1.00 15.00 ? 52 ILE A CA   1  
ATOM 738   C C    . ILE A 1 52 ? -2.383  6.525   0.260   1.00 15.00 ? 52 ILE A C    1  
ATOM 739   O O    . ILE A 1 52 ? -2.475  7.743   0.411   1.00 15.00 ? 52 ILE A O    1  
ATOM 740   C CB   . ILE A 1 52 ? -0.225  5.372   -0.343  1.00 15.00 ? 52 ILE A CB   1  
ATOM 741   C CG1  . ILE A 1 52 ? -0.490  4.121   0.485   1.00 15.00 ? 52 ILE A CG1  1  
ATOM 742   C CG2  . ILE A 1 52 ? 0.526   6.420   0.465   1.00 15.00 ? 52 ILE A CG2  1  
ATOM 743   C CD1  . ILE A 1 52 ? -1.261  3.062   -0.265  1.00 15.00 ? 52 ILE A CD1  1  
ATOM 744   H H    . ILE A 1 52 ? -0.419  7.431   -1.854  1.00 15.00 ? 52 ILE A H    1  
ATOM 745   H HA   . ILE A 1 52 ? -2.099  5.152   -1.361  1.00 15.00 ? 52 ILE A HA   1  
ATOM 746   H HB   . ILE A 1 52 ? 0.391   5.106   -1.189  1.00 15.00 ? 52 ILE A HB   1  
ATOM 747   H HG12 . ILE A 1 52 ? 0.452   3.690   0.782   1.00 15.00 ? 52 ILE A HG12 1  
ATOM 748   H HG13 . ILE A 1 52 ? -1.057  4.389   1.362   1.00 15.00 ? 52 ILE A HG13 1  
ATOM 749   H HG21 . ILE A 1 52 ? -0.120  6.812   1.235   1.00 15.00 ? 52 ILE A HG21 1  
ATOM 750   H HG22 . ILE A 1 52 ? 1.397   5.971   0.918   1.00 15.00 ? 52 ILE A HG22 1  
ATOM 751   H HG23 . ILE A 1 52 ? 0.834   7.223   -0.188  1.00 15.00 ? 52 ILE A HG23 1  
ATOM 752   H HD11 . ILE A 1 52 ? -2.265  3.414   -0.451  1.00 15.00 ? 52 ILE A HD11 1  
ATOM 753   H HD12 . ILE A 1 52 ? -0.770  2.863   -1.205  1.00 15.00 ? 52 ILE A HD12 1  
ATOM 754   H HD13 . ILE A 1 52 ? -1.298  2.157   0.324   1.00 15.00 ? 52 ILE A HD13 1  
ATOM 755   N N    . HIS A 1 53 ? -3.005  5.657   1.052   1.00 15.00 ? 53 HIS A N    1  
ATOM 756   C CA   . HIS A 1 53 ? -3.843  6.114   2.157   1.00 15.00 ? 53 HIS A CA   1  
ATOM 757   C C    . HIS A 1 53 ? -3.800  5.168   3.338   1.00 15.00 ? 53 HIS A C    1  
ATOM 758   O O    . HIS A 1 53 ? -3.422  4.006   3.219   1.00 15.00 ? 53 HIS A O    1  
ATOM 759   C CB   . HIS A 1 53 ? -5.287  6.302   1.689   1.00 15.00 ? 53 HIS A CB   1  
ATOM 760   C CG   . HIS A 1 53 ? -5.443  7.365   0.647   1.00 15.00 ? 53 HIS A CG   1  
ATOM 761   N ND1  . HIS A 1 53 ? -5.264  7.131   -0.701  1.00 15.00 ? 53 HIS A ND1  1  
ATOM 762   C CD2  . HIS A 1 53 ? -5.765  8.676   0.759   1.00 15.00 ? 53 HIS A CD2  1  
ATOM 763   C CE1  . HIS A 1 53 ? -5.468  8.251   -1.372  1.00 15.00 ? 53 HIS A CE1  1  
ATOM 764   N NE2  . HIS A 1 53 ? -5.773  9.203   -0.509  1.00 15.00 ? 53 HIS A NE2  1  
ATOM 765   H H    . HIS A 1 53 ? -2.910  4.699   0.885   1.00 15.00 ? 53 HIS A H    1  
ATOM 766   H HA   . HIS A 1 53 ? -3.460  7.062   2.493   1.00 15.00 ? 53 HIS A HA   1  
ATOM 767   H HB2  . HIS A 1 53 ? -5.647  5.374   1.272   1.00 15.00 ? 53 HIS A HB2  1  
ATOM 768   H HB3  . HIS A 1 53 ? -5.900  6.573   2.536   1.00 15.00 ? 53 HIS A HB3  1  
ATOM 769   H HD1  . HIS A 1 53 ? -5.023  6.272   -1.106  1.00 15.00 ? 53 HIS A HD1  1  
ATOM 770   H HD2  . HIS A 1 53 ? -5.976  9.208   1.676   1.00 15.00 ? 53 HIS A HD2  1  
ATOM 771   H HE1  . HIS A 1 53 ? -5.398  8.368   -2.443  1.00 15.00 ? 53 HIS A HE1  1  
ATOM 772   H HE2  . HIS A 1 53 ? -6.025  10.120  -0.744  1.00 15.00 ? 53 HIS A HE2  1  
ATOM 773   N N    . LYS A 1 54 ? -4.178  5.708   4.485   1.00 15.00 ? 54 LYS A N    1  
ATOM 774   C CA   . LYS A 1 54 ? -4.183  4.977   5.737   1.00 15.00 ? 54 LYS A CA   1  
ATOM 775   C C    . LYS A 1 54 ? -4.754  3.564   5.589   1.00 15.00 ? 54 LYS A C    1  
ATOM 776   O O    . LYS A 1 54 ? -5.807  3.367   4.983   1.00 15.00 ? 54 LYS A O    1  
ATOM 777   C CB   . LYS A 1 54 ? -4.986  5.751   6.786   1.00 15.00 ? 54 LYS A CB   1  
ATOM 778   C CG   . LYS A 1 54 ? -4.129  6.382   7.868   1.00 15.00 ? 54 LYS A CG   1  
ATOM 779   C CD   . LYS A 1 54 ? -4.921  6.606   9.146   1.00 15.00 ? 54 LYS A CD   1  
ATOM 780   C CE   . LYS A 1 54 ? -5.075  5.318   9.938   1.00 15.00 ? 54 LYS A CE   1  
ATOM 781   N NZ   . LYS A 1 54 ? -6.358  4.627   9.631   1.00 15.00 ? 54 LYS A NZ   1  
ATOM 782   H H    . LYS A 1 54 ? -4.448  6.647   4.491   1.00 15.00 ? 54 LYS A H    1  
ATOM 783   H HA   . LYS A 1 54 ? -3.160  4.912   6.059   1.00 15.00 ? 54 LYS A HA   1  
ATOM 784   H HB2  . LYS A 1 54 ? -5.536  6.538   6.291   1.00 15.00 ? 54 LYS A HB2  1  
ATOM 785   H HB3  . LYS A 1 54 ? -5.687  5.078   7.259   1.00 15.00 ? 54 LYS A HB3  1  
ATOM 786   H HG2  . LYS A 1 54 ? -3.301  5.728   8.081   1.00 15.00 ? 54 LYS A HG2  1  
ATOM 787   H HG3  . LYS A 1 54 ? -3.759  7.333   7.513   1.00 15.00 ? 54 LYS A HG3  1  
ATOM 788   H HD2  . LYS A 1 54 ? -4.405  7.332   9.756   1.00 15.00 ? 54 LYS A HD2  1  
ATOM 789   H HD3  . LYS A 1 54 ? -5.902  6.980   8.890   1.00 15.00 ? 54 LYS A HD3  1  
ATOM 790   H HE2  . LYS A 1 54 ? -4.255  4.659   9.693   1.00 15.00 ? 54 LYS A HE2  1  
ATOM 791   H HE3  . LYS A 1 54 ? -5.045  5.552   10.992  1.00 15.00 ? 54 LYS A HE3  1  
ATOM 792   H HZ1  . LYS A 1 54 ? -6.760  4.217   10.498  1.00 15.00 ? 54 LYS A HZ1  1  
ATOM 793   H HZ2  . LYS A 1 54 ? -7.040  5.302   9.230   1.00 15.00 ? 54 LYS A HZ2  1  
ATOM 794   H HZ3  . LYS A 1 54 ? -6.198  3.864   8.943   1.00 15.00 ? 54 LYS A HZ3  1  
ATOM 795   N N    . GLY A 1 55 ? -4.050  2.588   6.162   1.00 15.00 ? 55 GLY A N    1  
ATOM 796   C CA   . GLY A 1 55 ? -4.494  1.205   6.105   1.00 15.00 ? 55 GLY A CA   1  
ATOM 797   C C    . GLY A 1 55 ? -4.852  0.746   4.707   1.00 15.00 ? 55 GLY A C    1  
ATOM 798   O O    . GLY A 1 55 ? -5.771  -0.054  4.533   1.00 15.00 ? 55 GLY A O    1  
ATOM 799   H H    . GLY A 1 55 ? -3.219  2.812   6.639   1.00 15.00 ? 55 GLY A H    1  
ATOM 800   H HA2  . GLY A 1 55 ? -3.707  0.570   6.483   1.00 15.00 ? 55 GLY A HA2  1  
ATOM 801   H HA3  . GLY A 1 55 ? -5.361  1.094   6.739   1.00 15.00 ? 55 GLY A HA3  1  
ATOM 802   N N    . ASP A 1 56 ? -4.129  1.237   3.705   1.00 15.00 ? 56 ASP A N    1  
ATOM 803   C CA   . ASP A 1 56 ? -4.402  0.841   2.328   1.00 15.00 ? 56 ASP A CA   1  
ATOM 804   C C    . ASP A 1 56 ? -4.098  -0.638  2.123   1.00 15.00 ? 56 ASP A C    1  
ATOM 805   O O    . ASP A 1 56 ? -3.039  -1.124  2.527   1.00 15.00 ? 56 ASP A O    1  
ATOM 806   C CB   . ASP A 1 56 ? -3.597  1.687   1.340   1.00 15.00 ? 56 ASP A CB   1  
ATOM 807   C CG   . ASP A 1 56 ? -4.485  2.383   0.330   1.00 15.00 ? 56 ASP A CG   1  
ATOM 808   O OD1  . ASP A 1 56 ? -5.287  1.690   -0.331  1.00 15.00 ? 56 ASP A OD1  1  
ATOM 809   O OD2  . ASP A 1 56 ? -4.381  3.621   0.202   1.00 15.00 ? 56 ASP A OD2  1  
ATOM 810   H H    . ASP A 1 56 ? -3.396  1.866   3.896   1.00 15.00 ? 56 ASP A H    1  
ATOM 811   H HA   . ASP A 1 56 ? -5.455  1.001   2.147   1.00 15.00 ? 56 ASP A HA   1  
ATOM 812   H HB2  . ASP A 1 56 ? -3.046  2.438   1.879   1.00 15.00 ? 56 ASP A HB2  1  
ATOM 813   H HB3  . ASP A 1 56 ? -2.906  1.051   0.806   1.00 15.00 ? 56 ASP A HB3  1  
ATOM 814   N N    . ARG A 1 57 ? -5.032  -1.344  1.493   1.00 15.00 ? 57 ARG A N    1  
ATOM 815   C CA   . ARG A 1 57 ? -4.872  -2.769  1.225   1.00 15.00 ? 57 ARG A CA   1  
ATOM 816   C C    . ARG A 1 57 ? -4.101  -2.988  -0.071  1.00 15.00 ? 57 ARG A C    1  
ATOM 817   O O    . ARG A 1 57 ? -4.694  -3.150  -1.138  1.00 15.00 ? 57 ARG A O    1  
ATOM 818   C CB   . ARG A 1 57 ? -6.241  -3.448  1.140   1.00 15.00 ? 57 ARG A CB   1  
ATOM 819   C CG   . ARG A 1 57 ? -6.289  -4.809  1.815   1.00 15.00 ? 57 ARG A CG   1  
ATOM 820   C CD   . ARG A 1 57 ? -6.055  -5.935  0.820   1.00 15.00 ? 57 ARG A CD   1  
ATOM 821   N NE   . ARG A 1 57 ? -7.042  -7.002  0.960   1.00 15.00 ? 57 ARG A NE   1  
ATOM 822   C CZ   . ARG A 1 57 ? -6.987  -7.945  1.898   1.00 15.00 ? 57 ARG A CZ   1  
ATOM 823   N NH1  . ARG A 1 57 ? -5.994  -7.954  2.779   1.00 15.00 ? 57 ARG A NH1  1  
ATOM 824   N NH2  . ARG A 1 57 ? -7.926  -8.879  1.956   1.00 15.00 ? 57 ARG A NH2  1  
ATOM 825   H H    . ARG A 1 57 ? -5.851  -0.894  1.197   1.00 15.00 ? 57 ARG A H    1  
ATOM 826   H HA   . ARG A 1 57 ? -4.315  -3.203  2.040   1.00 15.00 ? 57 ARG A HA   1  
ATOM 827   H HB2  . ARG A 1 57 ? -6.975  -2.811  1.610   1.00 15.00 ? 57 ARG A HB2  1  
ATOM 828   H HB3  . ARG A 1 57 ? -6.503  -3.577  0.100   1.00 15.00 ? 57 ARG A HB3  1  
ATOM 829   H HG2  . ARG A 1 57 ? -5.523  -4.850  2.575   1.00 15.00 ? 57 ARG A HG2  1  
ATOM 830   H HG3  . ARG A 1 57 ? -7.260  -4.939  2.271   1.00 15.00 ? 57 ARG A HG3  1  
ATOM 831   H HD2  . ARG A 1 57 ? -6.113  -5.533  -0.181  1.00 15.00 ? 57 ARG A HD2  1  
ATOM 832   H HD3  . ARG A 1 57 ? -5.069  -6.345  0.986   1.00 15.00 ? 57 ARG A HD3  1  
ATOM 833   H HE   . ARG A 1 57 ? -7.786  -7.018  0.321   1.00 15.00 ? 57 ARG A HE   1  
ATOM 834   H HH11 . ARG A 1 57 ? -5.284  -7.252  2.741   1.00 15.00 ? 57 ARG A HH11 1  
ATOM 835   H HH12 . ARG A 1 57 ? -5.957  -8.665  3.482   1.00 15.00 ? 57 ARG A HH12 1  
ATOM 836   H HH21 . ARG A 1 57 ? -8.676  -8.876  1.295   1.00 15.00 ? 57 ARG A HH21 1  
ATOM 837   H HH22 . ARG A 1 57 ? -7.883  -9.587  2.661   1.00 15.00 ? 57 ARG A HH22 1  
ATOM 838   N N    . VAL A 1 58 ? -2.775  -2.988  0.025   1.00 15.00 ? 58 VAL A N    1  
ATOM 839   C CA   . VAL A 1 58 ? -1.930  -3.183  -1.146  1.00 15.00 ? 58 VAL A CA   1  
ATOM 840   C C    . VAL A 1 58 ? -1.841  -4.662  -1.515  1.00 15.00 ? 58 VAL A C    1  
ATOM 841   O O    . VAL A 1 58 ? -1.348  -5.484  -0.735  1.00 15.00 ? 58 VAL A O    1  
ATOM 842   C CB   . VAL A 1 58 ? -0.514  -2.591  -0.935  1.00 15.00 ? 58 VAL A CB   1  
ATOM 843   C CG1  . VAL A 1 58 ? -0.590  -1.293  -0.142  1.00 15.00 ? 58 VAL A CG1  1  
ATOM 844   C CG2  . VAL A 1 58 ? 0.412   -3.585  -0.245  1.00 15.00 ? 58 VAL A CG2  1  
ATOM 845   H H    . VAL A 1 58 ? -2.358  -2.852  0.901   1.00 15.00 ? 58 VAL A H    1  
ATOM 846   H HA   . VAL A 1 58 ? -2.393  -2.658  -1.968  1.00 15.00 ? 58 VAL A HA   1  
ATOM 847   H HB   . VAL A 1 58 ? -0.099  -2.362  -1.906  1.00 15.00 ? 58 VAL A HB   1  
ATOM 848   H HG11 . VAL A 1 58 ? -1.273  -0.613  -0.629  1.00 15.00 ? 58 VAL A HG11 1  
ATOM 849   H HG12 . VAL A 1 58 ? -0.941  -1.500  0.859   1.00 15.00 ? 58 VAL A HG12 1  
ATOM 850   H HG13 . VAL A 1 58 ? 0.391   -0.843  -0.093  1.00 15.00 ? 58 VAL A HG13 1  
ATOM 851   H HG21 . VAL A 1 58 ? 1.243   -3.056  0.195   1.00 15.00 ? 58 VAL A HG21 1  
ATOM 852   H HG22 . VAL A 1 58 ? -0.133  -4.108  0.527   1.00 15.00 ? 58 VAL A HG22 1  
ATOM 853   H HG23 . VAL A 1 58 ? 0.780   -4.295  -0.969  1.00 15.00 ? 58 VAL A HG23 1  
ATOM 854   N N    . LEU A 1 59 ? -2.347  -4.995  -2.700  1.00 15.00 ? 59 LEU A N    1  
ATOM 855   C CA   . LEU A 1 59 ? -2.346  -6.376  -3.173  1.00 15.00 ? 59 LEU A CA   1  
ATOM 856   C C    . LEU A 1 59 ? -1.321  -6.609  -4.283  1.00 15.00 ? 59 LEU A C    1  
ATOM 857   O O    . LEU A 1 59 ? -0.972  -7.752  -4.575  1.00 15.00 ? 59 LEU A O    1  
ATOM 858   C CB   . LEU A 1 59 ? -3.740  -6.766  -3.668  1.00 15.00 ? 59 LEU A CB   1  
ATOM 859   C CG   . LEU A 1 59 ? -4.845  -6.728  -2.610  1.00 15.00 ? 59 LEU A CG   1  
ATOM 860   C CD1  . LEU A 1 59 ? -6.077  -7.469  -3.105  1.00 15.00 ? 59 LEU A CD1  1  
ATOM 861   C CD2  . LEU A 1 59 ? -4.354  -7.325  -1.298  1.00 15.00 ? 59 LEU A CD2  1  
ATOM 862   H H    . LEU A 1 59 ? -2.741  -4.295  -3.265  1.00 15.00 ? 59 LEU A H    1  
ATOM 863   H HA   . LEU A 1 59 ? -2.091  -7.006  -2.334  1.00 15.00 ? 59 LEU A HA   1  
ATOM 864   H HB2  . LEU A 1 59 ? -4.014  -6.095  -4.469  1.00 15.00 ? 59 LEU A HB2  1  
ATOM 865   H HB3  . LEU A 1 59 ? -3.688  -7.769  -4.065  1.00 15.00 ? 59 LEU A HB3  1  
ATOM 866   H HG   . LEU A 1 59 ? -5.125  -5.701  -2.428  1.00 15.00 ? 59 LEU A HG   1  
ATOM 867   H HD11 . LEU A 1 59 ? -5.783  -8.199  -3.846  1.00 15.00 ? 59 LEU A HD11 1  
ATOM 868   H HD12 . LEU A 1 59 ? -6.553  -7.971  -2.275  1.00 15.00 ? 59 LEU A HD12 1  
ATOM 869   H HD13 . LEU A 1 59 ? -6.767  -6.766  -3.546  1.00 15.00 ? 59 LEU A HD13 1  
ATOM 870   H HD21 . LEU A 1 59 ? -5.173  -7.823  -0.800  1.00 15.00 ? 59 LEU A HD21 1  
ATOM 871   H HD22 . LEU A 1 59 ? -3.568  -8.038  -1.499  1.00 15.00 ? 59 LEU A HD22 1  
ATOM 872   H HD23 . LEU A 1 59 ? -3.973  -6.537  -0.664  1.00 15.00 ? 59 LEU A HD23 1  
ATOM 873   N N    . ALA A 1 60 ? -0.857  -5.537  -4.919  1.00 15.00 ? 60 ALA A N    1  
ATOM 874   C CA   . ALA A 1 60 ? 0.106   -5.670  -6.009  1.00 15.00 ? 60 ALA A CA   1  
ATOM 875   C C    . ALA A 1 60 ? 1.068   -4.488  -6.082  1.00 15.00 ? 60 ALA A C    1  
ATOM 876   O O    . ALA A 1 60 ? 0.718   -3.358  -5.742  1.00 15.00 ? 60 ALA A O    1  
ATOM 877   C CB   . ALA A 1 60 ? -0.629  -5.828  -7.331  1.00 15.00 ? 60 ALA A CB   1  
ATOM 878   H H    . ALA A 1 60 ? -1.177  -4.648  -4.664  1.00 15.00 ? 60 ALA A H    1  
ATOM 879   H HA   . ALA A 1 60 ? 0.676   -6.571  -5.844  1.00 15.00 ? 60 ALA A HA   1  
ATOM 880   H HB1  . ALA A 1 60 ? -0.933  -6.857  -7.454  1.00 15.00 ? 60 ALA A HB1  1  
ATOM 881   H HB2  . ALA A 1 60 ? -1.501  -5.191  -7.336  1.00 15.00 ? 60 ALA A HB2  1  
ATOM 882   H HB3  . ALA A 1 60 ? 0.027   -5.547  -8.142  1.00 15.00 ? 60 ALA A HB3  1  
ATOM 883   N N    . VAL A 1 61 ? 2.279   -4.769  -6.553  1.00 15.00 ? 61 VAL A N    1  
ATOM 884   C CA   . VAL A 1 61 ? 3.316   -3.756  -6.713  1.00 15.00 ? 61 VAL A CA   1  
ATOM 885   C C    . VAL A 1 61 ? 4.045   -3.993  -8.022  1.00 15.00 ? 61 VAL A C    1  
ATOM 886   O O    . VAL A 1 61 ? 4.870   -4.900  -8.126  1.00 15.00 ? 61 VAL A O    1  
ATOM 887   C CB   . VAL A 1 61 ? 4.334   -3.781  -5.559  1.00 15.00 ? 61 VAL A CB   1  
ATOM 888   C CG1  . VAL A 1 61 ? 5.255   -2.573  -5.633  1.00 15.00 ? 61 VAL A CG1  1  
ATOM 889   C CG2  . VAL A 1 61 ? 3.622   -3.842  -4.216  1.00 15.00 ? 61 VAL A CG2  1  
ATOM 890   H H    . VAL A 1 61 ? 2.478   -5.692  -6.820  1.00 15.00 ? 61 VAL A H    1  
ATOM 891   H HA   . VAL A 1 61 ? 2.845   -2.784  -6.741  1.00 15.00 ? 61 VAL A HA   1  
ATOM 892   H HB   . VAL A 1 61 ? 4.940   -4.668  -5.660  1.00 15.00 ? 61 VAL A HB   1  
ATOM 893   H HG11 . VAL A 1 61 ? 4.978   -1.959  -6.478  1.00 15.00 ? 61 VAL A HG11 1  
ATOM 894   H HG12 . VAL A 1 61 ? 5.165   -1.996  -4.726  1.00 15.00 ? 61 VAL A HG12 1  
ATOM 895   H HG13 . VAL A 1 61 ? 6.275   -2.905  -5.749  1.00 15.00 ? 61 VAL A HG13 1  
ATOM 896   H HG21 . VAL A 1 61 ? 4.068   -3.129  -3.540  1.00 15.00 ? 61 VAL A HG21 1  
ATOM 897   H HG22 . VAL A 1 61 ? 2.578   -3.604  -4.352  1.00 15.00 ? 61 VAL A HG22 1  
ATOM 898   H HG23 . VAL A 1 61 ? 3.714   -4.836  -3.804  1.00 15.00 ? 61 VAL A HG23 1  
ATOM 899   N N    . ASN A 1 62 ? 3.708   -3.203  -9.034  1.00 15.00 ? 62 ASN A N    1  
ATOM 900   C CA   . ASN A 1 62 ? 4.307   -3.365  -10.348 1.00 15.00 ? 62 ASN A CA   1  
ATOM 901   C C    . ASN A 1 62 ? 3.901   -4.719  -10.935 1.00 15.00 ? 62 ASN A C    1  
ATOM 902   O O    . ASN A 1 62 ? 4.498   -5.196  -11.900 1.00 15.00 ? 62 ASN A O    1  
ATOM 903   C CB   . ASN A 1 62 ? 5.832   -3.249  -10.269 1.00 15.00 ? 62 ASN A CB   1  
ATOM 904   C CG   . ASN A 1 62 ? 6.304   -1.809  -10.341 1.00 15.00 ? 62 ASN A CG   1  
ATOM 905   O OD1  . ASN A 1 62 ? 7.201   -1.476  -11.115 1.00 15.00 ? 62 ASN A OD1  1  
ATOM 906   N ND2  . ASN A 1 62 ? 5.702   -0.945  -9.530  1.00 15.00 ? 62 ASN A ND2  1  
ATOM 907   H H    . ASN A 1 62 ? 3.022   -2.514  -8.900  1.00 15.00 ? 62 ASN A H    1  
ATOM 908   H HA   . ASN A 1 62 ? 3.924   -2.582  -10.986 1.00 15.00 ? 62 ASN A HA   1  
ATOM 909   H HB2  . ASN A 1 62 ? 6.173   -3.673  -9.337  1.00 15.00 ? 62 ASN A HB2  1  
ATOM 910   H HB3  . ASN A 1 62 ? 6.272   -3.795  -11.090 1.00 15.00 ? 62 ASN A HB3  1  
ATOM 911   H HD21 . ASN A 1 62 ? 4.996   -1.279  -8.938  1.00 15.00 ? 62 ASN A HD21 1  
ATOM 912   H HD22 . ASN A 1 62 ? 5.987   -0.008  -9.557  1.00 15.00 ? 62 ASN A HD22 1  
ATOM 913   N N    . GLY A 1 63 ? 2.870   -5.327  -10.338 1.00 15.00 ? 63 GLY A N    1  
ATOM 914   C CA   . GLY A 1 63 ? 2.380   -6.612  -10.800 1.00 15.00 ? 63 GLY A CA   1  
ATOM 915   C C    . GLY A 1 63 ? 2.734   -7.763  -9.874  1.00 15.00 ? 63 GLY A C    1  
ATOM 916   O O    . GLY A 1 63 ? 2.460   -8.920  -10.190 1.00 15.00 ? 63 GLY A O    1  
ATOM 917   H H    . GLY A 1 63 ? 2.433   -4.893  -9.579  1.00 15.00 ? 63 GLY A H    1  
ATOM 918   H HA2  . GLY A 1 63 ? 1.304   -6.558  -10.875 1.00 15.00 ? 63 GLY A HA2  1  
ATOM 919   H HA3  . GLY A 1 63 ? 2.790   -6.812  -11.779 1.00 15.00 ? 63 GLY A HA3  1  
ATOM 920   N N    . VAL A 1 64 ? 3.333   -7.455  -8.726  1.00 15.00 ? 64 VAL A N    1  
ATOM 921   C CA   . VAL A 1 64 ? 3.703   -8.491  -7.767  1.00 15.00 ? 64 VAL A CA   1  
ATOM 922   C C    . VAL A 1 64 ? 2.607   -8.685  -6.717  1.00 15.00 ? 64 VAL A C    1  
ATOM 923   O O    . VAL A 1 64 ? 2.416   -7.846  -5.838  1.00 15.00 ? 64 VAL A O    1  
ATOM 924   C CB   . VAL A 1 64 ? 5.049   -8.175  -7.076  1.00 15.00 ? 64 VAL A CB   1  
ATOM 925   C CG1  . VAL A 1 64 ? 4.897   -7.070  -6.043  1.00 15.00 ? 64 VAL A CG1  1  
ATOM 926   C CG2  . VAL A 1 64 ? 5.628   -9.430  -6.441  1.00 15.00 ? 64 VAL A CG2  1  
ATOM 927   H H    . VAL A 1 64 ? 3.524   -6.518  -8.517  1.00 15.00 ? 64 VAL A H    1  
ATOM 928   H HA   . VAL A 1 64 ? 3.818   -9.415  -8.316  1.00 15.00 ? 64 VAL A HA   1  
ATOM 929   H HB   . VAL A 1 64 ? 5.739   -7.830  -7.829  1.00 15.00 ? 64 VAL A HB   1  
ATOM 930   H HG11 . VAL A 1 64 ? 4.227   -6.314  -6.422  1.00 15.00 ? 64 VAL A HG11 1  
ATOM 931   H HG12 . VAL A 1 64 ? 4.494   -7.484  -5.130  1.00 15.00 ? 64 VAL A HG12 1  
ATOM 932   H HG13 . VAL A 1 64 ? 5.862   -6.628  -5.843  1.00 15.00 ? 64 VAL A HG13 1  
ATOM 933   H HG21 . VAL A 1 64 ? 6.216   -9.157  -5.577  1.00 15.00 ? 64 VAL A HG21 1  
ATOM 934   H HG22 . VAL A 1 64 ? 4.825   -10.084 -6.138  1.00 15.00 ? 64 VAL A HG22 1  
ATOM 935   H HG23 . VAL A 1 64 ? 6.256   -9.938  -7.157  1.00 15.00 ? 64 VAL A HG23 1  
ATOM 936   N N    . SER A 1 65 ? 1.887   -9.796  -6.819  1.00 15.00 ? 65 SER A N    1  
ATOM 937   C CA   . SER A 1 65 ? 0.808   -10.099 -5.884  1.00 15.00 ? 65 SER A CA   1  
ATOM 938   C C    . SER A 1 65 ? 1.317   -10.116 -4.446  1.00 15.00 ? 65 SER A C    1  
ATOM 939   O O    . SER A 1 65 ? 2.363   -10.694 -4.153  1.00 15.00 ? 65 SER A O    1  
ATOM 940   C CB   . SER A 1 65 ? 0.171   -11.446 -6.227  1.00 15.00 ? 65 SER A CB   1  
ATOM 941   O OG   . SER A 1 65 ? 0.126   -11.647 -7.629  1.00 15.00 ? 65 SER A OG   1  
ATOM 942   H H    . SER A 1 65 ? 2.083   -10.426 -7.543  1.00 15.00 ? 65 SER A H    1  
ATOM 943   H HA   . SER A 1 65 ? 0.059   -9.324  -5.976  1.00 15.00 ? 65 SER A HA   1  
ATOM 944   H HB2  . SER A 1 65 ? 0.752   -12.240 -5.782  1.00 15.00 ? 65 SER A HB2  1  
ATOM 945   H HB3  . SER A 1 65 ? -0.836  -11.476 -5.838  1.00 15.00 ? 65 SER A HB3  1  
ATOM 946   H HG   . SER A 1 65 ? -0.214  -10.857 -8.055  1.00 15.00 ? 65 SER A HG   1  
ATOM 947   N N    . LEU A 1 66 ? 0.567   -9.477  -3.555  1.00 15.00 ? 66 LEU A N    1  
ATOM 948   C CA   . LEU A 1 66 ? 0.935   -9.414  -2.147  1.00 15.00 ? 66 LEU A CA   1  
ATOM 949   C C    . LEU A 1 66 ? 0.192   -10.472 -1.335  1.00 15.00 ? 66 LEU A C    1  
ATOM 950   O O    . LEU A 1 66 ? 0.617   -10.836 -0.239  1.00 15.00 ? 66 LEU A O    1  
ATOM 951   C CB   . LEU A 1 66 ? 0.639   -8.022  -1.584  1.00 15.00 ? 66 LEU A CB   1  
ATOM 952   C CG   . LEU A 1 66 ? 1.674   -7.493  -0.591  1.00 15.00 ? 66 LEU A CG   1  
ATOM 953   C CD1  . LEU A 1 66 ? 1.793   -8.427  0.604   1.00 15.00 ? 66 LEU A CD1  1  
ATOM 954   C CD2  . LEU A 1 66 ? 3.025   -7.317  -1.272  1.00 15.00 ? 66 LEU A CD2  1  
ATOM 955   H H    . LEU A 1 66 ? -0.256  -9.036  -3.853  1.00 15.00 ? 66 LEU A H    1  
ATOM 956   H HA   . LEU A 1 66 ? 1.996   -9.601  -2.075  1.00 15.00 ? 66 LEU A HA   1  
ATOM 957   H HB2  . LEU A 1 66 ? 0.574   -7.329  -2.410  1.00 15.00 ? 66 LEU A HB2  1  
ATOM 958   H HB3  . LEU A 1 66 ? -0.320  -8.054  -1.087  1.00 15.00 ? 66 LEU A HB3  1  
ATOM 959   H HG   . LEU A 1 66 ? 1.354   -6.527  -0.228  1.00 15.00 ? 66 LEU A HG   1  
ATOM 960   H HD11 . LEU A 1 66 ? 0.830   -8.871  0.810   1.00 15.00 ? 66 LEU A HD11 1  
ATOM 961   H HD12 . LEU A 1 66 ? 2.509   -9.205  0.383   1.00 15.00 ? 66 LEU A HD12 1  
ATOM 962   H HD13 . LEU A 1 66 ? 2.124   -7.867  1.467   1.00 15.00 ? 66 LEU A HD13 1  
ATOM 963   H HD21 . LEU A 1 66 ? 3.726   -8.036  -0.874  1.00 15.00 ? 66 LEU A HD21 1  
ATOM 964   H HD22 . LEU A 1 66 ? 2.916   -7.470  -2.335  1.00 15.00 ? 66 LEU A HD22 1  
ATOM 965   H HD23 . LEU A 1 66 ? 3.392   -6.318  -1.089  1.00 15.00 ? 66 LEU A HD23 1  
ATOM 966   N N    . GLU A 1 67 ? -0.922  -10.962 -1.879  1.00 15.00 ? 67 GLU A N    1  
ATOM 967   C CA   . GLU A 1 67 ? -1.727  -11.979 -1.203  1.00 15.00 ? 67 GLU A CA   1  
ATOM 968   C C    . GLU A 1 67 ? -0.847  -13.092 -0.639  1.00 15.00 ? 67 GLU A C    1  
ATOM 969   O O    . GLU A 1 67 ? -0.259  -13.872 -1.388  1.00 15.00 ? 67 GLU A O    1  
ATOM 970   C CB   . GLU A 1 67 ? -2.759  -12.565 -2.169  1.00 15.00 ? 67 GLU A CB   1  
ATOM 971   C CG   . GLU A 1 67 ? -4.195  -12.229 -1.802  1.00 15.00 ? 67 GLU A CG   1  
ATOM 972   C CD   . GLU A 1 67 ? -4.953  -13.423 -1.255  1.00 15.00 ? 67 GLU A CD   1  
ATOM 973   O OE1  . GLU A 1 67 ? -4.800  -13.723 -0.053  1.00 15.00 ? 67 GLU A OE1  1  
ATOM 974   O OE2  . GLU A 1 67 ? -5.701  -14.057 -2.030  1.00 15.00 ? 67 GLU A OE2  1  
ATOM 975   H H    . GLU A 1 67 ? -1.213  -10.631 -2.754  1.00 15.00 ? 67 GLU A H    1  
ATOM 976   H HA   . GLU A 1 67 ? -2.245  -11.499 -0.386  1.00 15.00 ? 67 GLU A HA   1  
ATOM 977   H HB2  . GLU A 1 67 ? -2.565  -12.183 -3.160  1.00 15.00 ? 67 GLU A HB2  1  
ATOM 978   H HB3  . GLU A 1 67 ? -2.656  -13.641 -2.182  1.00 15.00 ? 67 GLU A HB3  1  
ATOM 979   H HG2  . GLU A 1 67 ? -4.189  -11.452 -1.053  1.00 15.00 ? 67 GLU A HG2  1  
ATOM 980   H HG3  . GLU A 1 67 ? -4.704  -11.871 -2.686  1.00 15.00 ? 67 GLU A HG3  1  
ATOM 981   N N    . GLY A 1 68 ? -0.760  -13.155 0.686   1.00 15.00 ? 68 GLY A N    1  
ATOM 982   C CA   . GLY A 1 68 ? 0.052   -14.170 1.329   1.00 15.00 ? 68 GLY A CA   1  
ATOM 983   C C    . GLY A 1 68 ? 1.421   -13.648 1.719   1.00 15.00 ? 68 GLY A C    1  
ATOM 984   O O    . GLY A 1 68 ? 2.439   -14.105 1.199   1.00 15.00 ? 68 GLY A O    1  
ATOM 985   H H    . GLY A 1 68 ? -1.249  -12.503 1.231   1.00 15.00 ? 68 GLY A H    1  
ATOM 986   H HA2  . GLY A 1 68 ? -0.457  -14.515 2.216   1.00 15.00 ? 68 GLY A HA2  1  
ATOM 987   H HA3  . GLY A 1 68 ? 0.176   -15.001 0.650   1.00 15.00 ? 68 GLY A HA3  1  
ATOM 988   N N    . ALA A 1 69 ? 1.445   -12.684 2.633   1.00 15.00 ? 69 ALA A N    1  
ATOM 989   C CA   . ALA A 1 69 ? 2.696   -12.094 3.089   1.00 15.00 ? 69 ALA A CA   1  
ATOM 990   C C    . ALA A 1 69 ? 2.461   -11.138 4.256   1.00 15.00 ? 69 ALA A C    1  
ATOM 991   O O    . ALA A 1 69 ? 1.327   -10.762 4.546   1.00 15.00 ? 69 ALA A O    1  
ATOM 992   C CB   . ALA A 1 69 ? 3.380   -11.373 1.938   1.00 15.00 ? 69 ALA A CB   1  
ATOM 993   H H    . ALA A 1 69 ? 0.601   -12.359 3.006   1.00 15.00 ? 69 ALA A H    1  
ATOM 994   H HA   . ALA A 1 69 ? 3.343   -12.895 3.417   1.00 15.00 ? 69 ALA A HA   1  
ATOM 995   H HB1  . ALA A 1 69 ? 4.303   -11.878 1.696   1.00 15.00 ? 69 ALA A HB1  1  
ATOM 996   H HB2  . ALA A 1 69 ? 2.731   -11.376 1.075   1.00 15.00 ? 69 ALA A HB2  1  
ATOM 997   H HB3  . ALA A 1 69 ? 3.591   -10.354 2.225   1.00 15.00 ? 69 ALA A HB3  1  
ATOM 998   N N    . THR A 1 70 ? 3.542   -10.753 4.925   1.00 15.00 ? 70 THR A N    1  
ATOM 999   C CA   . THR A 1 70 ? 3.457   -9.845  6.065   1.00 15.00 ? 70 THR A CA   1  
ATOM 1000  C C    . THR A 1 70 ? 3.656   -8.393  5.634   1.00 15.00 ? 70 THR A C    1  
ATOM 1001  O O    . THR A 1 70 ? 3.726   -8.088  4.444   1.00 15.00 ? 70 THR A O    1  
ATOM 1002  C CB   . THR A 1 70 ? 4.509   -10.215 7.110   1.00 15.00 ? 70 THR A CB   1  
ATOM 1003  O OG1  . THR A 1 70 ? 5.796   -9.793  6.692   1.00 15.00 ? 70 THR A OG1  1  
ATOM 1004  C CG2  . THR A 1 70 ? 4.579   -11.701 7.388   1.00 15.00 ? 70 THR A CG2  1  
ATOM 1005  H H    . THR A 1 70 ? 4.420   -11.091 4.649   1.00 15.00 ? 70 THR A H    1  
ATOM 1006  H HA   . THR A 1 70 ? 2.472   -9.949  6.503   1.00 15.00 ? 70 THR A HA   1  
ATOM 1007  H HB   . THR A 1 70 ? 4.272   -9.715  8.037   1.00 15.00 ? 70 THR A HB   1  
ATOM 1008  H HG1  . THR A 1 70 ? 6.036   -10.251 5.883   1.00 15.00 ? 70 THR A HG1  1  
ATOM 1009  H HG21 . THR A 1 70 ? 5.057   -11.866 8.343   1.00 15.00 ? 70 THR A HG21 1  
ATOM 1010  H HG22 . THR A 1 70 ? 3.581   -12.111 7.410   1.00 15.00 ? 70 THR A HG22 1  
ATOM 1011  H HG23 . THR A 1 70 ? 5.151   -12.187 6.611   1.00 15.00 ? 70 THR A HG23 1  
ATOM 1012  N N    . HIS A 1 71 ? 3.748   -7.505  6.621   1.00 15.00 ? 71 HIS A N    1  
ATOM 1013  C CA   . HIS A 1 71 ? 3.943   -6.082  6.368   1.00 15.00 ? 71 HIS A CA   1  
ATOM 1014  C C    . HIS A 1 71 ? 5.282   -5.839  5.683   1.00 15.00 ? 71 HIS A C    1  
ATOM 1015  O O    . HIS A 1 71 ? 5.340   -5.298  4.579   1.00 15.00 ? 71 HIS A O    1  
ATOM 1016  C CB   . HIS A 1 71 ? 3.847   -5.305  7.693   1.00 15.00 ? 71 HIS A CB   1  
ATOM 1017  C CG   . HIS A 1 71 ? 4.898   -4.252  7.895   1.00 15.00 ? 71 HIS A CG   1  
ATOM 1018  N ND1  . HIS A 1 71 ? 5.637   -4.145  9.054   1.00 15.00 ? 71 HIS A ND1  1  
ATOM 1019  C CD2  . HIS A 1 71 ? 5.321   -3.250  7.089   1.00 15.00 ? 71 HIS A CD2  1  
ATOM 1020  C CE1  . HIS A 1 71 ? 6.467   -3.123  8.953   1.00 15.00 ? 71 HIS A CE1  1  
ATOM 1021  N NE2  . HIS A 1 71 ? 6.297   -2.563  7.770   1.00 15.00 ? 71 HIS A NE2  1  
ATOM 1022  H H    . HIS A 1 71 ? 3.683   -7.816  7.545   1.00 15.00 ? 71 HIS A H    1  
ATOM 1023  H HA   . HIS A 1 71 ? 3.154   -5.754  5.711   1.00 15.00 ? 71 HIS A HA   1  
ATOM 1024  H HB2  . HIS A 1 71 ? 2.886   -4.818  7.741   1.00 15.00 ? 71 HIS A HB2  1  
ATOM 1025  H HB3  . HIS A 1 71 ? 3.924   -6.007  8.511   1.00 15.00 ? 71 HIS A HB3  1  
ATOM 1026  H HD1  . HIS A 1 71 ? 5.564   -4.732  9.835   1.00 15.00 ? 71 HIS A HD1  1  
ATOM 1027  H HD2  . HIS A 1 71 ? 4.960   -3.033  6.094   1.00 15.00 ? 71 HIS A HD2  1  
ATOM 1028  H HE1  . HIS A 1 71 ? 7.165   -2.799  9.710   1.00 15.00 ? 71 HIS A HE1  1  
ATOM 1029  H HE2  . HIS A 1 71 ? 6.694   -1.714  7.488   1.00 15.00 ? 71 HIS A HE2  1  
ATOM 1030  N N    . LYS A 1 72 ? 6.354   -6.248  6.347   1.00 15.00 ? 72 LYS A N    1  
ATOM 1031  C CA   . LYS A 1 72 ? 7.698   -6.084  5.807   1.00 15.00 ? 72 LYS A CA   1  
ATOM 1032  C C    . LYS A 1 72 ? 7.784   -6.657  4.400   1.00 15.00 ? 72 LYS A C    1  
ATOM 1033  O O    . LYS A 1 72 ? 8.541   -6.167  3.566   1.00 15.00 ? 72 LYS A O    1  
ATOM 1034  C CB   . LYS A 1 72 ? 8.716   -6.771  6.715   1.00 15.00 ? 72 LYS A CB   1  
ATOM 1035  C CG   . LYS A 1 72 ? 10.157  -6.438  6.371   1.00 15.00 ? 72 LYS A CG   1  
ATOM 1036  C CD   . LYS A 1 72 ? 11.122  -7.453  6.962   1.00 15.00 ? 72 LYS A CD   1  
ATOM 1037  C CE   . LYS A 1 72 ? 11.051  -8.782  6.227   1.00 15.00 ? 72 LYS A CE   1  
ATOM 1038  N NZ   . LYS A 1 72 ? 12.062  -8.869  5.136   1.00 15.00 ? 72 LYS A NZ   1  
ATOM 1039  H H    . LYS A 1 72 ? 6.238   -6.678  7.221   1.00 15.00 ? 72 LYS A H    1  
ATOM 1040  H HA   . LYS A 1 72 ? 7.918   -5.022  5.763   1.00 15.00 ? 72 LYS A HA   1  
ATOM 1041  H HB2  . LYS A 1 72 ? 8.529   -6.472  7.736   1.00 15.00 ? 72 LYS A HB2  1  
ATOM 1042  H HB3  . LYS A 1 72 ? 8.588   -7.841  6.634   1.00 15.00 ? 72 LYS A HB3  1  
ATOM 1043  H HG2  . LYS A 1 72 ? 10.267  -6.436  5.297   1.00 15.00 ? 72 LYS A HG2  1  
ATOM 1044  H HG3  . LYS A 1 72 ? 10.393  -5.459  6.762   1.00 15.00 ? 72 LYS A HG3  1  
ATOM 1045  H HD2  . LYS A 1 72 ? 12.127  -7.066  6.888   1.00 15.00 ? 72 LYS A HD2  1  
ATOM 1046  H HD3  . LYS A 1 72 ? 10.870  -7.612  8.000   1.00 15.00 ? 72 LYS A HD3  1  
ATOM 1047  H HE2  . LYS A 1 72 ? 11.229  -9.579  6.933   1.00 15.00 ? 72 LYS A HE2  1  
ATOM 1048  H HE3  . LYS A 1 72 ? 10.065  -8.892  5.802   1.00 15.00 ? 72 LYS A HE3  1  
ATOM 1049  H HZ1  . LYS A 1 72 ? 11.651  -9.340  4.305   1.00 15.00 ? 72 LYS A HZ1  1  
ATOM 1050  H HZ2  . LYS A 1 72 ? 12.375  -7.915  4.862   1.00 15.00 ? 72 LYS A HZ2  1  
ATOM 1051  H HZ3  . LYS A 1 72 ? 12.888  -9.413  5.456   1.00 15.00 ? 72 LYS A HZ3  1  
ATOM 1052  N N    . GLN A 1 73 ? 6.996   -7.693  4.139   1.00 15.00 ? 73 GLN A N    1  
ATOM 1053  C CA   . GLN A 1 73 ? 6.984   -8.316  2.824   1.00 15.00 ? 73 GLN A CA   1  
ATOM 1054  C C    . GLN A 1 73 ? 6.590   -7.292  1.768   1.00 15.00 ? 73 GLN A C    1  
ATOM 1055  O O    . GLN A 1 73 ? 7.311   -7.082  0.793   1.00 15.00 ? 73 GLN A O    1  
ATOM 1056  C CB   . GLN A 1 73 ? 6.016   -9.498  2.798   1.00 15.00 ? 73 GLN A CB   1  
ATOM 1057  C CG   . GLN A 1 73 ? 6.528   -10.678 1.990   1.00 15.00 ? 73 GLN A CG   1  
ATOM 1058  C CD   . GLN A 1 73 ? 6.648   -11.944 2.816   1.00 15.00 ? 73 GLN A CD   1  
ATOM 1059  O OE1  . GLN A 1 73 ? 5.664   -12.432 3.371   1.00 15.00 ? 73 GLN A OE1  1  
ATOM 1060  N NE2  . GLN A 1 73 ? 7.859   -12.483 2.902   1.00 15.00 ? 73 GLN A NE2  1  
ATOM 1061  H H    . GLN A 1 73 ? 6.407   -8.039  4.842   1.00 15.00 ? 73 GLN A H    1  
ATOM 1062  H HA   . GLN A 1 73 ? 7.982   -8.670  2.613   1.00 15.00 ? 73 GLN A HA   1  
ATOM 1063  H HB2  . GLN A 1 73 ? 5.842   -9.829  3.811   1.00 15.00 ? 73 GLN A HB2  1  
ATOM 1064  H HB3  . GLN A 1 73 ? 5.082   -9.172  2.368   1.00 15.00 ? 73 GLN A HB3  1  
ATOM 1065  H HG2  . GLN A 1 73 ? 5.847   -10.861 1.173   1.00 15.00 ? 73 GLN A HG2  1  
ATOM 1066  H HG3  . GLN A 1 73 ? 7.503   -10.430 1.595   1.00 15.00 ? 73 GLN A HG3  1  
ATOM 1067  H HE21 . GLN A 1 73 ? 8.597   -12.039 2.434   1.00 15.00 ? 73 GLN A HE21 1  
ATOM 1068  H HE22 . GLN A 1 73 ? 7.965   -13.301 3.430   1.00 15.00 ? 73 GLN A HE22 1  
ATOM 1069  N N    . ALA A 1 74 ? 5.452   -6.638  1.981   1.00 15.00 ? 74 ALA A N    1  
ATOM 1070  C CA   . ALA A 1 74 ? 4.985   -5.616  1.056   1.00 15.00 ? 74 ALA A CA   1  
ATOM 1071  C C    . ALA A 1 74 ? 5.926   -4.424  1.086   1.00 15.00 ? 74 ALA A C    1  
ATOM 1072  O O    . ALA A 1 74 ? 6.306   -3.895  0.043   1.00 15.00 ? 74 ALA A O    1  
ATOM 1073  C CB   . ALA A 1 74 ? 3.575   -5.181  1.394   1.00 15.00 ? 74 ALA A CB   1  
ATOM 1074  H H    . ALA A 1 74 ? 4.927   -6.835  2.784   1.00 15.00 ? 74 ALA A H    1  
ATOM 1075  H HA   . ALA A 1 74 ? 4.982   -6.039  0.062   1.00 15.00 ? 74 ALA A HA   1  
ATOM 1076  H HB1  . ALA A 1 74 ? 3.216   -4.514  0.625   1.00 15.00 ? 74 ALA A HB1  1  
ATOM 1077  H HB2  . ALA A 1 74 ? 2.934   -6.048  1.448   1.00 15.00 ? 74 ALA A HB2  1  
ATOM 1078  H HB3  . ALA A 1 74 ? 3.575   -4.670  2.343   1.00 15.00 ? 74 ALA A HB3  1  
ATOM 1079  N N    . VAL A 1 75 ? 6.322   -4.024  2.295   1.00 15.00 ? 75 VAL A N    1  
ATOM 1080  C CA   . VAL A 1 75 ? 7.253   -2.914  2.471   1.00 15.00 ? 75 VAL A CA   1  
ATOM 1081  C C    . VAL A 1 75 ? 8.363   -3.027  1.440   1.00 15.00 ? 75 VAL A C    1  
ATOM 1082  O O    . VAL A 1 75 ? 8.767   -2.044  0.821   1.00 15.00 ? 75 VAL A O    1  
ATOM 1083  C CB   . VAL A 1 75 ? 7.840   -2.923  3.905   1.00 15.00 ? 75 VAL A CB   1  
ATOM 1084  C CG1  . VAL A 1 75 ? 9.333   -3.235  3.912   1.00 15.00 ? 75 VAL A CG1  1  
ATOM 1085  C CG2  . VAL A 1 75 ? 7.570   -1.609  4.611   1.00 15.00 ? 75 VAL A CG2  1  
ATOM 1086  H H    . VAL A 1 75 ? 5.998   -4.504  3.085   1.00 15.00 ? 75 VAL A H    1  
ATOM 1087  H HA   . VAL A 1 75 ? 6.720   -1.986  2.315   1.00 15.00 ? 75 VAL A HA   1  
ATOM 1088  H HB   . VAL A 1 75 ? 7.336   -3.698  4.459   1.00 15.00 ? 75 VAL A HB   1  
ATOM 1089  H HG11 . VAL A 1 75 ? 9.502   -4.198  3.457   1.00 15.00 ? 75 VAL A HG11 1  
ATOM 1090  H HG12 . VAL A 1 75 ? 9.862   -2.476  3.356   1.00 15.00 ? 75 VAL A HG12 1  
ATOM 1091  H HG13 . VAL A 1 75 ? 9.692   -3.250  4.931   1.00 15.00 ? 75 VAL A HG13 1  
ATOM 1092  H HG21 . VAL A 1 75 ? 8.480   -1.031  4.660   1.00 15.00 ? 75 VAL A HG21 1  
ATOM 1093  H HG22 . VAL A 1 75 ? 6.817   -1.056  4.071   1.00 15.00 ? 75 VAL A HG22 1  
ATOM 1094  H HG23 . VAL A 1 75 ? 7.220   -1.816  5.612   1.00 15.00 ? 75 VAL A HG23 1  
ATOM 1095  N N    . GLU A 1 76 ? 8.822   -4.254  1.248   1.00 15.00 ? 76 GLU A N    1  
ATOM 1096  C CA   . GLU A 1 76 ? 9.857   -4.538  0.276   1.00 15.00 ? 76 GLU A CA   1  
ATOM 1097  C C    . GLU A 1 76 ? 9.331   -4.311  -1.139  1.00 15.00 ? 76 GLU A C    1  
ATOM 1098  O O    . GLU A 1 76 ? 10.007  -3.709  -1.966  1.00 15.00 ? 76 GLU A O    1  
ATOM 1099  C CB   . GLU A 1 76 ? 10.354  -5.976  0.433   1.00 15.00 ? 76 GLU A CB   1  
ATOM 1100  C CG   . GLU A 1 76 ? 10.955  -6.265  1.800   1.00 15.00 ? 76 GLU A CG   1  
ATOM 1101  C CD   . GLU A 1 76 ? 10.918  -7.739  2.154   1.00 15.00 ? 76 GLU A CD   1  
ATOM 1102  O OE1  . GLU A 1 76 ? 11.701  -8.512  1.562   1.00 15.00 ? 76 GLU A OE1  1  
ATOM 1103  O OE2  . GLU A 1 76 ? 10.107  -8.120  3.024   1.00 15.00 ? 76 GLU A OE2  1  
ATOM 1104  H H    . GLU A 1 76 ? 8.436   -4.994  1.765   1.00 15.00 ? 76 GLU A H    1  
ATOM 1105  H HA   . GLU A 1 76 ? 10.678  -3.860  0.456   1.00 15.00 ? 76 GLU A HA   1  
ATOM 1106  H HB2  . GLU A 1 76 ? 9.524   -6.650  0.278   1.00 15.00 ? 76 GLU A HB2  1  
ATOM 1107  H HB3  . GLU A 1 76 ? 11.107  -6.169  -0.316  1.00 15.00 ? 76 GLU A HB3  1  
ATOM 1108  H HG2  . GLU A 1 76 ? 11.983  -5.936  1.803   1.00 15.00 ? 76 GLU A HG2  1  
ATOM 1109  H HG3  . GLU A 1 76 ? 10.400  -5.716  2.548   1.00 15.00 ? 76 GLU A HG3  1  
ATOM 1110  N N    . THR A 1 77 ? 8.117   -4.794  -1.414  1.00 15.00 ? 77 THR A N    1  
ATOM 1111  C CA   . THR A 1 77 ? 7.519   -4.628  -2.737  1.00 15.00 ? 77 THR A CA   1  
ATOM 1112  C C    . THR A 1 77 ? 7.272   -3.156  -3.059  1.00 15.00 ? 77 THR A C    1  
ATOM 1113  O O    . THR A 1 77 ? 7.727   -2.656  -4.087  1.00 15.00 ? 77 THR A O    1  
ATOM 1114  C CB   . THR A 1 77 ? 6.216   -5.416  -2.852  1.00 15.00 ? 77 THR A CB   1  
ATOM 1115  O OG1  . THR A 1 77 ? 5.293   -5.020  -1.855  1.00 15.00 ? 77 THR A OG1  1  
ATOM 1116  C CG2  . THR A 1 77 ? 6.409   -6.912  -2.736  1.00 15.00 ? 77 THR A CG2  1  
ATOM 1117  H H    . THR A 1 77 ? 7.609   -5.264  -0.712  1.00 15.00 ? 77 THR A H    1  
ATOM 1118  H HA   . THR A 1 77 ? 8.222   -5.019  -3.458  1.00 15.00 ? 77 THR A HA   1  
ATOM 1119  H HB   . THR A 1 77 ? 5.780   -5.216  -3.819  1.00 15.00 ? 77 THR A HB   1  
ATOM 1120  H HG1  . THR A 1 77 ? 4.892   -4.184  -2.103  1.00 15.00 ? 77 THR A HG1  1  
ATOM 1121  H HG21 . THR A 1 77 ? 6.324   -7.363  -3.714  1.00 15.00 ? 77 THR A HG21 1  
ATOM 1122  H HG22 . THR A 1 77 ? 7.388   -7.118  -2.329  1.00 15.00 ? 77 THR A HG22 1  
ATOM 1123  H HG23 . THR A 1 77 ? 5.653   -7.323  -2.083  1.00 15.00 ? 77 THR A HG23 1  
ATOM 1124  N N    . LEU A 1 78 ? 6.554   -2.461  -2.175  1.00 15.00 ? 78 LEU A N    1  
ATOM 1125  C CA   . LEU A 1 78 ? 6.261   -1.043  -2.384  1.00 15.00 ? 78 LEU A CA   1  
ATOM 1126  C C    . LEU A 1 78 ? 7.551   -0.280  -2.628  1.00 15.00 ? 78 LEU A C    1  
ATOM 1127  O O    . LEU A 1 78 ? 7.661   0.507   -3.569  1.00 15.00 ? 78 LEU A O    1  
ATOM 1128  C CB   . LEU A 1 78 ? 5.540   -0.443  -1.170  1.00 15.00 ? 78 LEU A CB   1  
ATOM 1129  C CG   . LEU A 1 78 ? 4.513   -1.351  -0.492  1.00 15.00 ? 78 LEU A CG   1  
ATOM 1130  C CD1  . LEU A 1 78 ? 3.824   -0.615  0.647   1.00 15.00 ? 78 LEU A CD1  1  
ATOM 1131  C CD2  . LEU A 1 78 ? 3.491   -1.853  -1.502  1.00 15.00 ? 78 LEU A CD2  1  
ATOM 1132  H H    . LEU A 1 78 ? 6.219   -2.909  -1.371  1.00 15.00 ? 78 LEU A H    1  
ATOM 1133  H HA   . LEU A 1 78 ? 5.629   -0.953  -3.253  1.00 15.00 ? 78 LEU A HA   1  
ATOM 1134  H HB2  . LEU A 1 78 ? 6.286   -0.172  -0.437  1.00 15.00 ? 78 LEU A HB2  1  
ATOM 1135  H HB3  . LEU A 1 78 ? 5.035   0.456   -1.490  1.00 15.00 ? 78 LEU A HB3  1  
ATOM 1136  H HG   . LEU A 1 78 ? 5.021   -2.205  -0.074  1.00 15.00 ? 78 LEU A HG   1  
ATOM 1137  H HD11 . LEU A 1 78 ? 3.779   0.440   0.419   1.00 15.00 ? 78 LEU A HD11 1  
ATOM 1138  H HD12 . LEU A 1 78 ? 2.823   -1.000  0.771   1.00 15.00 ? 78 LEU A HD12 1  
ATOM 1139  H HD13 . LEU A 1 78 ? 4.383   -0.762  1.560   1.00 15.00 ? 78 LEU A HD13 1  
ATOM 1140  H HD21 . LEU A 1 78 ? 2.509   -1.492  -1.233  1.00 15.00 ? 78 LEU A HD21 1  
ATOM 1141  H HD22 . LEU A 1 78 ? 3.749   -1.493  -2.487  1.00 15.00 ? 78 LEU A HD22 1  
ATOM 1142  H HD23 . LEU A 1 78 ? 3.488   -2.933  -1.504  1.00 15.00 ? 78 LEU A HD23 1  
ATOM 1143  N N    . ARG A 1 79 ? 8.527   -0.533  -1.771  1.00 15.00 ? 79 ARG A N    1  
ATOM 1144  C CA   . ARG A 1 79 ? 9.826   0.105   -1.872  1.00 15.00 ? 79 ARG A CA   1  
ATOM 1145  C C    . ARG A 1 79 ? 10.572  -0.385  -3.112  1.00 15.00 ? 79 ARG A C    1  
ATOM 1146  O O    . ARG A 1 79 ? 10.922  0.401   -3.992  1.00 15.00 ? 79 ARG A O    1  
ATOM 1147  C CB   . ARG A 1 79 ? 10.637  -0.192  -0.610  1.00 15.00 ? 79 ARG A CB   1  
ATOM 1148  C CG   . ARG A 1 79 ? 11.633  0.899   -0.251  1.00 15.00 ? 79 ARG A CG   1  
ATOM 1149  C CD   . ARG A 1 79 ? 12.585  0.446   0.844   1.00 15.00 ? 79 ARG A CD   1  
ATOM 1150  N NE   . ARG A 1 79 ? 13.834  -0.083  0.301   1.00 15.00 ? 79 ARG A NE   1  
ATOM 1151  C CZ   . ARG A 1 79 ? 14.847  0.679   -0.107  1.00 15.00 ? 79 ARG A CZ   1  
ATOM 1152  N NH1  . ARG A 1 79 ? 14.759  2.001   -0.042  1.00 15.00 ? 79 ARG A NH1  1  
ATOM 1153  N NH2  . ARG A 1 79 ? 15.950  0.116   -0.581  1.00 15.00 ? 79 ARG A NH2  1  
ATOM 1154  H H    . ARG A 1 79 ? 8.369   -1.178  -1.050  1.00 15.00 ? 79 ARG A H    1  
ATOM 1155  H HA   . ARG A 1 79 ? 9.672   1.170   -1.952  1.00 15.00 ? 79 ARG A HA   1  
ATOM 1156  H HB2  . ARG A 1 79 ? 9.952   -0.315  0.221   1.00 15.00 ? 79 ARG A HB2  1  
ATOM 1157  H HB3  . ARG A 1 79 ? 11.181  -1.114  -0.754  1.00 15.00 ? 79 ARG A HB3  1  
ATOM 1158  H HG2  . ARG A 1 79 ? 12.205  1.154   -1.130  1.00 15.00 ? 79 ARG A HG2  1  
ATOM 1159  H HG3  . ARG A 1 79 ? 11.090  1.768   0.092   1.00 15.00 ? 79 ARG A HG3  1  
ATOM 1160  H HD2  . ARG A 1 79 ? 12.809  1.290   1.480   1.00 15.00 ? 79 ARG A HD2  1  
ATOM 1161  H HD3  . ARG A 1 79 ? 12.102  -0.324  1.427   1.00 15.00 ? 79 ARG A HD3  1  
ATOM 1162  H HE   . ARG A 1 79 ? 13.924  -1.057  0.240   1.00 15.00 ? 79 ARG A HE   1  
ATOM 1163  H HH11 . ARG A 1 79 ? 13.930  2.432   0.314   1.00 15.00 ? 79 ARG A HH11 1  
ATOM 1164  H HH12 . ARG A 1 79 ? 15.524  2.568   -0.350  1.00 15.00 ? 79 ARG A HH12 1  
ATOM 1165  H HH21 . ARG A 1 79 ? 16.022  -0.880  -0.632  1.00 15.00 ? 79 ARG A HH21 1  
ATOM 1166  H HH22 . ARG A 1 79 ? 16.711  0.688   -0.888  1.00 15.00 ? 79 ARG A HH22 1  
ATOM 1167  N N    . ASN A 1 80 ? 10.812  -1.692  -3.166  1.00 15.00 ? 80 ASN A N    1  
ATOM 1168  C CA   . ASN A 1 80 ? 11.518  -2.315  -4.286  1.00 15.00 ? 80 ASN A CA   1  
ATOM 1169  C C    . ASN A 1 80 ? 10.728  -2.233  -5.595  1.00 15.00 ? 80 ASN A C    1  
ATOM 1170  O O    . ASN A 1 80 ? 10.435  -3.259  -6.210  1.00 15.00 ? 80 ASN A O    1  
ATOM 1171  C CB   . ASN A 1 80 ? 11.818  -3.781  -3.966  1.00 15.00 ? 80 ASN A CB   1  
ATOM 1172  C CG   . ASN A 1 80 ? 12.606  -3.944  -2.680  1.00 15.00 ? 80 ASN A CG   1  
ATOM 1173  O OD1  . ASN A 1 80 ? 13.457  -3.118  -2.351  1.00 15.00 ? 80 ASN A OD1  1  
ATOM 1174  N ND2  . ASN A 1 80 ? 12.326  -5.015  -1.947  1.00 15.00 ? 80 ASN A ND2  1  
ATOM 1175  H H    . ASN A 1 80 ? 10.507  -2.259  -2.428  1.00 15.00 ? 80 ASN A H    1  
ATOM 1176  H HA   . ASN A 1 80 ? 12.453  -1.792  -4.415  1.00 15.00 ? 80 ASN A HA   1  
ATOM 1177  H HB2  . ASN A 1 80 ? 10.885  -4.320  -3.867  1.00 15.00 ? 80 ASN A HB2  1  
ATOM 1178  H HB3  . ASN A 1 80 ? 12.390  -4.210  -4.775  1.00 15.00 ? 80 ASN A HB3  1  
ATOM 1179  H HD21 . ASN A 1 80 ? 11.636  -5.631  -2.271  1.00 15.00 ? 80 ASN A HD21 1  
ATOM 1180  H HD22 . ASN A 1 80 ? 12.820  -5.145  -1.110  1.00 15.00 ? 80 ASN A HD22 1  
ATOM 1181  N N    . THR A 1 81 ? 10.401  -1.023  -6.035  1.00 15.00 ? 81 THR A N    1  
ATOM 1182  C CA   . THR A 1 81 ? 9.670   -0.853  -7.286  1.00 15.00 ? 81 THR A CA   1  
ATOM 1183  C C    . THR A 1 81 ? 10.648  -0.579  -8.426  1.00 15.00 ? 81 THR A C    1  
ATOM 1184  O O    . THR A 1 81 ? 10.879  -1.438  -9.277  1.00 15.00 ? 81 THR A O    1  
ATOM 1185  C CB   . THR A 1 81 ? 8.643   0.277   -7.173  1.00 15.00 ? 81 THR A CB   1  
ATOM 1186  O OG1  . THR A 1 81 ? 8.814   0.994   -5.963  1.00 15.00 ? 81 THR A OG1  1  
ATOM 1187  C CG2  . THR A 1 81 ? 7.210   -0.212  -7.219  1.00 15.00 ? 81 THR A CG2  1  
ATOM 1188  H H    . THR A 1 81 ? 10.670  -0.233  -5.523  1.00 15.00 ? 81 THR A H    1  
ATOM 1189  H HA   . THR A 1 81 ? 9.153   -1.779  -7.492  1.00 15.00 ? 81 THR A HA   1  
ATOM 1190  H HB   . THR A 1 81 ? 8.782   0.961   -7.997  1.00 15.00 ? 81 THR A HB   1  
ATOM 1191  H HG1  . THR A 1 81 ? 8.725   0.394   -5.219  1.00 15.00 ? 81 THR A HG1  1  
ATOM 1192  H HG21 . THR A 1 81 ? 6.604   0.502   -7.757  1.00 15.00 ? 81 THR A HG21 1  
ATOM 1193  H HG22 . THR A 1 81 ? 7.171   -1.167  -7.723  1.00 15.00 ? 81 THR A HG22 1  
ATOM 1194  H HG23 . THR A 1 81 ? 6.832   -0.321  -6.213  1.00 15.00 ? 81 THR A HG23 1  
ATOM 1195  N N    . GLY A 1 82 ? 11.236  0.615   -8.426  1.00 15.00 ? 82 GLY A N    1  
ATOM 1196  C CA   . GLY A 1 82 ? 12.197  0.966   -9.451  1.00 15.00 ? 82 GLY A CA   1  
ATOM 1197  C C    . GLY A 1 82 ? 11.802  2.191   -10.250 1.00 15.00 ? 82 GLY A C    1  
ATOM 1198  O O    . GLY A 1 82 ? 11.935  3.322   -9.782  1.00 15.00 ? 82 GLY A O    1  
ATOM 1199  H H    . GLY A 1 82 ? 11.025  1.254   -7.720  1.00 15.00 ? 82 GLY A H    1  
ATOM 1200  H HA2  . GLY A 1 82 ? 13.151  1.153   -8.980  1.00 15.00 ? 82 GLY A HA2  1  
ATOM 1201  H HA3  . GLY A 1 82 ? 12.303  0.130   -10.127 1.00 15.00 ? 82 GLY A HA3  1  
ATOM 1202  N N    . GLN A 1 83 ? 11.336  1.955   -11.467 1.00 15.00 ? 83 GLN A N    1  
ATOM 1203  C CA   . GLN A 1 83 ? 10.935  3.036   -12.367 1.00 15.00 ? 83 GLN A CA   1  
ATOM 1204  C C    . GLN A 1 83 ? 9.734   3.815   -11.831 1.00 15.00 ? 83 GLN A C    1  
ATOM 1205  O O    . GLN A 1 83 ? 9.891   4.880   -11.235 1.00 15.00 ? 83 GLN A O    1  
ATOM 1206  C CB   . GLN A 1 83 ? 10.626  2.490   -13.769 1.00 15.00 ? 83 GLN A CB   1  
ATOM 1207  C CG   . GLN A 1 83 ? 10.043  1.083   -13.779 1.00 15.00 ? 83 GLN A CG   1  
ATOM 1208  C CD   . GLN A 1 83 ? 8.961   0.908   -14.826 1.00 15.00 ? 83 GLN A CD   1  
ATOM 1209  O OE1  . GLN A 1 83 ? 7.806   1.274   -14.609 1.00 15.00 ? 83 GLN A OE1  1  
ATOM 1210  N NE2  . GLN A 1 83 ? 9.330   0.344   -15.970 1.00 15.00 ? 83 GLN A NE2  1  
ATOM 1211  H H    . GLN A 1 83 ? 11.274  1.029   -11.772 1.00 15.00 ? 83 GLN A H    1  
ATOM 1212  H HA   . GLN A 1 83 ? 11.771  3.715   -12.443 1.00 15.00 ? 83 GLN A HA   1  
ATOM 1213  H HB2  . GLN A 1 83 ? 9.918   3.149   -14.248 1.00 15.00 ? 83 GLN A HB2  1  
ATOM 1214  H HB3  . GLN A 1 83 ? 11.539  2.480   -14.345 1.00 15.00 ? 83 GLN A HB3  1  
ATOM 1215  H HG2  . GLN A 1 83 ? 10.837  0.380   -13.983 1.00 15.00 ? 83 GLN A HG2  1  
ATOM 1216  H HG3  . GLN A 1 83 ? 9.621   0.874   -12.807 1.00 15.00 ? 83 GLN A HG3  1  
ATOM 1217  H HE21 . GLN A 1 83 ? 10.267  0.076   -16.073 1.00 15.00 ? 83 GLN A HE21 1  
ATOM 1218  H HE22 . GLN A 1 83 ? 8.650   0.219   -16.665 1.00 15.00 ? 83 GLN A HE22 1  
ATOM 1219  N N    . VAL A 1 84 ? 8.535   3.289   -12.065 1.00 15.00 ? 84 VAL A N    1  
ATOM 1220  C CA   . VAL A 1 84 ? 7.309   3.942   -11.624 1.00 15.00 ? 84 VAL A CA   1  
ATOM 1221  C C    . VAL A 1 84 ? 6.649   3.168   -10.486 1.00 15.00 ? 84 VAL A C    1  
ATOM 1222  O O    . VAL A 1 84 ? 6.890   1.974   -10.305 1.00 15.00 ? 84 VAL A O    1  
ATOM 1223  C CB   . VAL A 1 84 ? 6.315   4.093   -12.796 1.00 15.00 ? 84 VAL A CB   1  
ATOM 1224  C CG1  . VAL A 1 84 ? 4.966   4.613   -12.317 1.00 15.00 ? 84 VAL A CG1  1  
ATOM 1225  C CG2  . VAL A 1 84 ? 6.893   5.015   -13.858 1.00 15.00 ? 84 VAL A CG2  1  
ATOM 1226  H H    . VAL A 1 84 ? 8.473   2.446   -12.552 1.00 15.00 ? 84 VAL A H    1  
ATOM 1227  H HA   . VAL A 1 84 ? 7.567   4.932   -11.271 1.00 15.00 ? 84 VAL A HA   1  
ATOM 1228  H HB   . VAL A 1 84 ? 6.163   3.121   -13.241 1.00 15.00 ? 84 VAL A HB   1  
ATOM 1229  H HG11 . VAL A 1 84 ? 5.102   5.564   -11.824 1.00 15.00 ? 84 VAL A HG11 1  
ATOM 1230  H HG12 . VAL A 1 84 ? 4.308   4.738   -13.164 1.00 15.00 ? 84 VAL A HG12 1  
ATOM 1231  H HG13 . VAL A 1 84 ? 4.532   3.907   -11.626 1.00 15.00 ? 84 VAL A HG13 1  
ATOM 1232  H HG21 . VAL A 1 84 ? 6.999   6.011   -13.449 1.00 15.00 ? 84 VAL A HG21 1  
ATOM 1233  H HG22 . VAL A 1 84 ? 7.860   4.648   -14.167 1.00 15.00 ? 84 VAL A HG22 1  
ATOM 1234  H HG23 . VAL A 1 84 ? 6.230   5.045   -14.710 1.00 15.00 ? 84 VAL A HG23 1  
ATOM 1235  N N    . VAL A 1 85 ? 5.810   3.856   -9.726  1.00 15.00 ? 85 VAL A N    1  
ATOM 1236  C CA   . VAL A 1 85 ? 5.114   3.240   -8.611  1.00 15.00 ? 85 VAL A CA   1  
ATOM 1237  C C    . VAL A 1 85 ? 3.701   2.830   -9.023  1.00 15.00 ? 85 VAL A C    1  
ATOM 1238  O O    . VAL A 1 85 ? 2.730   3.543   -8.766  1.00 15.00 ? 85 VAL A O    1  
ATOM 1239  C CB   . VAL A 1 85 ? 5.067   4.206   -7.403  1.00 15.00 ? 85 VAL A CB   1  
ATOM 1240  C CG1  . VAL A 1 85 ? 3.956   3.842   -6.430  1.00 15.00 ? 85 VAL A CG1  1  
ATOM 1241  C CG2  . VAL A 1 85 ? 6.413   4.230   -6.694  1.00 15.00 ? 85 VAL A CG2  1  
ATOM 1242  H H    . VAL A 1 85 ? 5.653   4.804   -9.921  1.00 15.00 ? 85 VAL A H    1  
ATOM 1243  H HA   . VAL A 1 85 ? 5.665   2.357   -8.320  1.00 15.00 ? 85 VAL A HA   1  
ATOM 1244  H HB   . VAL A 1 85 ? 4.871   5.197   -7.775  1.00 15.00 ? 85 VAL A HB   1  
ATOM 1245  H HG11 . VAL A 1 85 ? 3.678   2.808   -6.570  1.00 15.00 ? 85 VAL A HG11 1  
ATOM 1246  H HG12 . VAL A 1 85 ? 4.302   3.989   -5.418  1.00 15.00 ? 85 VAL A HG12 1  
ATOM 1247  H HG13 . VAL A 1 85 ? 3.099   4.477   -6.614  1.00 15.00 ? 85 VAL A HG13 1  
ATOM 1248  H HG21 . VAL A 1 85 ? 6.258   4.327   -5.629  1.00 15.00 ? 85 VAL A HG21 1  
ATOM 1249  H HG22 . VAL A 1 85 ? 6.945   3.313   -6.898  1.00 15.00 ? 85 VAL A HG22 1  
ATOM 1250  H HG23 . VAL A 1 85 ? 6.993   5.069   -7.051  1.00 15.00 ? 85 VAL A HG23 1  
ATOM 1251  N N    . HIS A 1 86 ? 3.600   1.670   -9.666  1.00 15.00 ? 86 HIS A N    1  
ATOM 1252  C CA   . HIS A 1 86 ? 2.312   1.150   -10.116 1.00 15.00 ? 86 HIS A CA   1  
ATOM 1253  C C    . HIS A 1 86 ? 1.788   0.111   -9.131  1.00 15.00 ? 86 HIS A C    1  
ATOM 1254  O O    . HIS A 1 86 ? 1.961   -1.092  -9.329  1.00 15.00 ? 86 HIS A O    1  
ATOM 1255  C CB   . HIS A 1 86 ? 2.446   0.531   -11.508 1.00 15.00 ? 86 HIS A CB   1  
ATOM 1256  C CG   . HIS A 1 86 ? 1.186   0.594   -12.315 1.00 15.00 ? 86 HIS A CG   1  
ATOM 1257  N ND1  . HIS A 1 86 ? -0.046  0.882   -11.766 1.00 15.00 ? 86 HIS A ND1  1  
ATOM 1258  C CD2  . HIS A 1 86 ? 0.971   0.406   -13.639 1.00 15.00 ? 86 HIS A CD2  1  
ATOM 1259  C CE1  . HIS A 1 86 ? -0.964  0.867   -12.717 1.00 15.00 ? 86 HIS A CE1  1  
ATOM 1260  N NE2  . HIS A 1 86 ? -0.372  0.581   -13.862 1.00 15.00 ? 86 HIS A NE2  1  
ATOM 1261  H H    . HIS A 1 86 ? 4.414   1.149   -9.840  1.00 15.00 ? 86 HIS A H    1  
ATOM 1262  H HA   . HIS A 1 86 ? 1.616   1.974   -10.160 1.00 15.00 ? 86 HIS A HA   1  
ATOM 1263  H HB2  . HIS A 1 86 ? 3.216   1.054   -12.054 1.00 15.00 ? 86 HIS A HB2  1  
ATOM 1264  H HB3  . HIS A 1 86 ? 2.725   -0.508  -11.407 1.00 15.00 ? 86 HIS A HB3  1  
ATOM 1265  H HD1  . HIS A 1 86 ? -0.222  1.069   -10.821 1.00 15.00 ? 86 HIS A HD1  1  
ATOM 1266  H HD2  . HIS A 1 86 ? 1.718   0.162   -14.381 1.00 15.00 ? 86 HIS A HD2  1  
ATOM 1267  H HE1  . HIS A 1 86 ? -2.018  1.058   -12.581 1.00 15.00 ? 86 HIS A HE1  1  
ATOM 1268  H HE2  . HIS A 1 86 ? -0.805  0.602   -14.741 1.00 15.00 ? 86 HIS A HE2  1  
ATOM 1269  N N    . LEU A 1 87 ? 1.165   0.586   -8.059  1.00 15.00 ? 87 LEU A N    1  
ATOM 1270  C CA   . LEU A 1 87 ? 0.635   -0.297  -7.028  1.00 15.00 ? 87 LEU A CA   1  
ATOM 1271  C C    . LEU A 1 87 ? -0.882  -0.435  -7.116  1.00 15.00 ? 87 LEU A C    1  
ATOM 1272  O O    . LEU A 1 87 ? -1.614  0.538   -6.950  1.00 15.00 ? 87 LEU A O    1  
ATOM 1273  C CB   . LEU A 1 87 ? 1.023   0.234   -5.646  1.00 15.00 ? 87 LEU A CB   1  
ATOM 1274  C CG   . LEU A 1 87 ? 1.965   -0.666  -4.852  1.00 15.00 ? 87 LEU A CG   1  
ATOM 1275  C CD1  . LEU A 1 87 ? 3.110   0.144   -4.262  1.00 15.00 ? 87 LEU A CD1  1  
ATOM 1276  C CD2  . LEU A 1 87 ? 1.202   -1.392  -3.756  1.00 15.00 ? 87 LEU A CD2  1  
ATOM 1277  H H    . LEU A 1 87 ? 1.073   1.554   -7.950  1.00 15.00 ? 87 LEU A H    1  
ATOM 1278  H HA   . LEU A 1 87 ? 1.081   -1.270  -7.164  1.00 15.00 ? 87 LEU A HA   1  
ATOM 1279  H HB2  . LEU A 1 87 ? 1.497   1.194   -5.773  1.00 15.00 ? 87 LEU A HB2  1  
ATOM 1280  H HB3  . LEU A 1 87 ? 0.122   0.371   -5.069  1.00 15.00 ? 87 LEU A HB3  1  
ATOM 1281  H HG   . LEU A 1 87 ? 2.386   -1.403  -5.517  1.00 15.00 ? 87 LEU A HG   1  
ATOM 1282  H HD11 . LEU A 1 87 ? 3.263   1.035   -4.854  1.00 15.00 ? 87 LEU A HD11 1  
ATOM 1283  H HD12 . LEU A 1 87 ? 2.868   0.423   -3.247  1.00 15.00 ? 87 LEU A HD12 1  
ATOM 1284  H HD13 . LEU A 1 87 ? 4.011   -0.451  -4.267  1.00 15.00 ? 87 LEU A HD13 1  
ATOM 1285  H HD21 . LEU A 1 87 ? 0.906   -0.684  -2.997  1.00 15.00 ? 87 LEU A HD21 1  
ATOM 1286  H HD22 . LEU A 1 87 ? 0.321   -1.857  -4.177  1.00 15.00 ? 87 LEU A HD22 1  
ATOM 1287  H HD23 . LEU A 1 87 ? 1.834   -2.148  -3.316  1.00 15.00 ? 87 LEU A HD23 1  
ATOM 1288  N N    . LEU A 1 88 ? -1.348  -1.658  -7.341  1.00 15.00 ? 88 LEU A N    1  
ATOM 1289  C CA   . LEU A 1 88 ? -2.779  -1.928  -7.409  1.00 15.00 ? 88 LEU A CA   1  
ATOM 1290  C C    . LEU A 1 88 ? -3.262  -2.405  -6.045  1.00 15.00 ? 88 LEU A C    1  
ATOM 1291  O O    . LEU A 1 88 ? -3.042  -3.556  -5.665  1.00 15.00 ? 88 LEU A O    1  
ATOM 1292  C CB   . LEU A 1 88 ? -3.086  -2.979  -8.481  1.00 15.00 ? 88 LEU A CB   1  
ATOM 1293  C CG   . LEU A 1 88 ? -2.339  -2.811  -9.811  1.00 15.00 ? 88 LEU A CG   1  
ATOM 1294  C CD1  . LEU A 1 88 ? -2.232  -1.343  -10.199 1.00 15.00 ? 88 LEU A CD1  1  
ATOM 1295  C CD2  . LEU A 1 88 ? -0.957  -3.446  -9.734  1.00 15.00 ? 88 LEU A CD2  1  
ATOM 1296  H H    . LEU A 1 88 ? -0.716  -2.400  -7.439  1.00 15.00 ? 88 LEU A H    1  
ATOM 1297  H HA   . LEU A 1 88 ? -3.284  -1.003  -7.660  1.00 15.00 ? 88 LEU A HA   1  
ATOM 1298  H HB2  . LEU A 1 88 ? -2.843  -3.951  -8.078  1.00 15.00 ? 88 LEU A HB2  1  
ATOM 1299  H HB3  . LEU A 1 88 ? -4.146  -2.951  -8.686  1.00 15.00 ? 88 LEU A HB3  1  
ATOM 1300  H HG   . LEU A 1 88 ? -2.894  -3.317  -10.588 1.00 15.00 ? 88 LEU A HG   1  
ATOM 1301  H HD11 . LEU A 1 88 ? -2.069  -0.745  -9.314  1.00 15.00 ? 88 LEU A HD11 1  
ATOM 1302  H HD12 . LEU A 1 88 ? -1.404  -1.210  -10.879 1.00 15.00 ? 88 LEU A HD12 1  
ATOM 1303  H HD13 . LEU A 1 88 ? -3.146  -1.030  -10.680 1.00 15.00 ? 88 LEU A HD13 1  
ATOM 1304  H HD21 . LEU A 1 88 ? -0.205  -2.703  -9.954  1.00 15.00 ? 88 LEU A HD21 1  
ATOM 1305  H HD22 . LEU A 1 88 ? -0.795  -3.838  -8.742  1.00 15.00 ? 88 LEU A HD22 1  
ATOM 1306  H HD23 . LEU A 1 88 ? -0.890  -4.249  -10.454 1.00 15.00 ? 88 LEU A HD23 1  
ATOM 1307  N N    . LEU A 1 89 ? -3.889  -1.506  -5.298  1.00 15.00 ? 89 LEU A N    1  
ATOM 1308  C CA   . LEU A 1 89 ? -4.368  -1.826  -3.958  1.00 15.00 ? 89 LEU A CA   1  
ATOM 1309  C C    . LEU A 1 89 ? -5.875  -2.032  -3.923  1.00 15.00 ? 89 LEU A C    1  
ATOM 1310  O O    . LEU A 1 89 ? -6.526  -2.186  -4.956  1.00 15.00 ? 89 LEU A O    1  
ATOM 1311  C CB   . LEU A 1 89 ? -3.995  -0.710  -2.977  1.00 15.00 ? 89 LEU A CB   1  
ATOM 1312  C CG   . LEU A 1 89 ? -2.933  0.263   -3.471  1.00 15.00 ? 89 LEU A CG   1  
ATOM 1313  C CD1  . LEU A 1 89 ? -2.880  1.488   -2.579  1.00 15.00 ? 89 LEU A CD1  1  
ATOM 1314  C CD2  . LEU A 1 89 ? -1.585  -0.423  -3.519  1.00 15.00 ? 89 LEU A CD2  1  
ATOM 1315  H H    . LEU A 1 89 ? -4.016  -0.600  -5.648  1.00 15.00 ? 89 LEU A H    1  
ATOM 1316  H HA   . LEU A 1 89 ? -3.881  -2.734  -3.645  1.00 15.00 ? 89 LEU A HA   1  
ATOM 1317  H HB2  . LEU A 1 89 ? -4.888  -0.147  -2.748  1.00 15.00 ? 89 LEU A HB2  1  
ATOM 1318  H HB3  . LEU A 1 89 ? -3.637  -1.166  -2.067  1.00 15.00 ? 89 LEU A HB3  1  
ATOM 1319  H HG   . LEU A 1 89 ? -3.183  0.583   -4.469  1.00 15.00 ? 89 LEU A HG   1  
ATOM 1320  H HD11 . LEU A 1 89 ? -3.685  1.446   -1.860  1.00 15.00 ? 89 LEU A HD11 1  
ATOM 1321  H HD12 . LEU A 1 89 ? -1.936  1.511   -2.059  1.00 15.00 ? 89 LEU A HD12 1  
ATOM 1322  H HD13 . LEU A 1 89 ? -2.983  2.377   -3.182  1.00 15.00 ? 89 LEU A HD13 1  
ATOM 1323  H HD21 . LEU A 1 89 ? -0.808  0.298   -3.315  1.00 15.00 ? 89 LEU A HD21 1  
ATOM 1324  H HD22 . LEU A 1 89 ? -1.557  -1.205  -2.778  1.00 15.00 ? 89 LEU A HD22 1  
ATOM 1325  H HD23 . LEU A 1 89 ? -1.434  -0.848  -4.500  1.00 15.00 ? 89 LEU A HD23 1  
ATOM 1326  N N    . GLU A 1 90 ? -6.416  -2.014  -2.710  1.00 15.00 ? 90 GLU A N    1  
ATOM 1327  C CA   . GLU A 1 90 ? -7.845  -2.178  -2.493  1.00 15.00 ? 90 GLU A CA   1  
ATOM 1328  C C    . GLU A 1 90 ? -8.317  -1.216  -1.407  1.00 15.00 ? 90 GLU A C    1  
ATOM 1329  O O    . GLU A 1 90 ? -7.627  -1.007  -0.409  1.00 15.00 ? 90 GLU A O    1  
ATOM 1330  C CB   . GLU A 1 90 ? -8.164  -3.633  -2.116  1.00 15.00 ? 90 GLU A CB   1  
ATOM 1331  C CG   . GLU A 1 90 ? -9.232  -3.787  -1.041  1.00 15.00 ? 90 GLU A CG   1  
ATOM 1332  C CD   . GLU A 1 90 ? -9.560  -5.239  -0.751  1.00 15.00 ? 90 GLU A CD   1  
ATOM 1333  O OE1  . GLU A 1 90 ? -8.715  -6.110  -1.049  1.00 15.00 ? 90 GLU A OE1  1  
ATOM 1334  O OE2  . GLU A 1 90 ? -10.661 -5.505  -0.226  1.00 15.00 ? 90 GLU A OE2  1  
ATOM 1335  H H    . GLU A 1 90 ? -5.830  -1.874  -1.934  1.00 15.00 ? 90 GLU A H    1  
ATOM 1336  H HA   . GLU A 1 90 ? -8.348  -1.934  -3.415  1.00 15.00 ? 90 GLU A HA   1  
ATOM 1337  H HB2  . GLU A 1 90 ? -8.504  -4.148  -3.001  1.00 15.00 ? 90 GLU A HB2  1  
ATOM 1338  H HB3  . GLU A 1 90 ? -7.259  -4.105  -1.763  1.00 15.00 ? 90 GLU A HB3  1  
ATOM 1339  H HG2  . GLU A 1 90 ? -8.878  -3.326  -0.132  1.00 15.00 ? 90 GLU A HG2  1  
ATOM 1340  H HG3  . GLU A 1 90 ? -10.131 -3.289  -1.371  1.00 15.00 ? 90 GLU A HG3  1  
ATOM 1341  N N    . LYS A 1 91 ? -9.489  -0.627  -1.609  1.00 15.00 ? 91 LYS A N    1  
ATOM 1342  C CA   . LYS A 1 91 ? -10.042 0.317   -0.647  1.00 15.00 ? 91 LYS A CA   1  
ATOM 1343  C C    . LYS A 1 91 ? -10.064 -0.280  0.756   1.00 15.00 ? 91 LYS A C    1  
ATOM 1344  O O    . LYS A 1 91 ? -10.926 -1.095  1.085   1.00 15.00 ? 91 LYS A O    1  
ATOM 1345  C CB   . LYS A 1 91 ? -11.449 0.735   -1.067  1.00 15.00 ? 91 LYS A CB   1  
ATOM 1346  C CG   . LYS A 1 91 ? -11.914 2.026   -0.415  1.00 15.00 ? 91 LYS A CG   1  
ATOM 1347  C CD   . LYS A 1 91 ? -11.360 3.245   -1.135  1.00 15.00 ? 91 LYS A CD   1  
ATOM 1348  C CE   . LYS A 1 91 ? -10.911 4.316   -0.154  1.00 15.00 ? 91 LYS A CE   1  
ATOM 1349  N NZ   . LYS A 1 91 ? -10.485 5.562   -0.848  1.00 15.00 ? 91 LYS A NZ   1  
ATOM 1350  H H    . LYS A 1 91 ? -9.993  -0.830  -2.425  1.00 15.00 ? 91 LYS A H    1  
ATOM 1351  H HA   . LYS A 1 91 ? -9.406  1.190   -0.641  1.00 15.00 ? 91 LYS A HA   1  
ATOM 1352  H HB2  . LYS A 1 91 ? -11.465 0.870   -2.140  1.00 15.00 ? 91 LYS A HB2  1  
ATOM 1353  H HB3  . LYS A 1 91 ? -12.141 -0.049  -0.799  1.00 15.00 ? 91 LYS A HB3  1  
ATOM 1354  H HG2  . LYS A 1 91 ? -12.992 2.064   -0.442  1.00 15.00 ? 91 LYS A HG2  1  
ATOM 1355  H HG3  . LYS A 1 91 ? -11.577 2.042   0.611   1.00 15.00 ? 91 LYS A HG3  1  
ATOM 1356  H HD2  . LYS A 1 91 ? -10.514 2.944   -1.735  1.00 15.00 ? 91 LYS A HD2  1  
ATOM 1357  H HD3  . LYS A 1 91 ? -12.130 3.654   -1.774  1.00 15.00 ? 91 LYS A HD3  1  
ATOM 1358  H HE2  . LYS A 1 91 ? -11.733 4.546   0.508   1.00 15.00 ? 91 LYS A HE2  1  
ATOM 1359  H HE3  . LYS A 1 91 ? -10.082 3.933   0.422   1.00 15.00 ? 91 LYS A HE3  1  
ATOM 1360  H HZ1  . LYS A 1 91 ? -9.451  5.571   -0.963  1.00 15.00 ? 91 LYS A HZ1  1  
ATOM 1361  H HZ2  . LYS A 1 91 ? -10.928 5.618   -1.787  1.00 15.00 ? 91 LYS A HZ2  1  
ATOM 1362  H HZ3  . LYS A 1 91 ? -10.769 6.395   -0.293  1.00 15.00 ? 91 LYS A HZ3  1  
ATOM 1363  N N    . GLY A 1 92 ? -9.101  0.130   1.575   1.00 15.00 ? 92 GLY A N    1  
ATOM 1364  C CA   . GLY A 1 92 ? -9.012  -0.372  2.933   1.00 15.00 ? 92 GLY A CA   1  
ATOM 1365  C C    . GLY A 1 92 ? -10.101 0.176   3.834   1.00 15.00 ? 92 GLY A C    1  
ATOM 1366  O O    . GLY A 1 92 ? -10.392 1.372   3.812   1.00 15.00 ? 92 GLY A O    1  
ATOM 1367  H H    . GLY A 1 92 ? -8.442  0.778   1.251   1.00 15.00 ? 92 GLY A H    1  
ATOM 1368  H HA2  . GLY A 1 92 ? -9.087  -1.449  2.912   1.00 15.00 ? 92 GLY A HA2  1  
ATOM 1369  H HA3  . GLY A 1 92 ? -8.051  -0.098  3.343   1.00 15.00 ? 92 GLY A HA3  1  
ATOM 1370  N N    . GLN A 1 93 ? -10.703 -0.702  4.630   1.00 15.00 ? 93 GLN A N    1  
ATOM 1371  C CA   . GLN A 1 93 ? -11.764 -0.301  5.547   1.00 15.00 ? 93 GLN A CA   1  
ATOM 1372  C C    . GLN A 1 93 ? -11.181 0.185   6.870   1.00 15.00 ? 93 GLN A C    1  
ATOM 1373  O O    . GLN A 1 93 ? -9.970  0.135   7.081   1.00 15.00 ? 93 GLN A O    1  
ATOM 1374  C CB   . GLN A 1 93 ? -12.719 -1.470  5.797   1.00 15.00 ? 93 GLN A CB   1  
ATOM 1375  C CG   . GLN A 1 93 ? -13.205 -2.141  4.523   1.00 15.00 ? 93 GLN A CG   1  
ATOM 1376  C CD   . GLN A 1 93 ? -13.773 -3.524  4.772   1.00 15.00 ? 93 GLN A CD   1  
ATOM 1377  O OE1  . GLN A 1 93 ? -14.350 -3.790  5.827   1.00 15.00 ? 93 GLN A OE1  1  
ATOM 1378  N NE2  . GLN A 1 93 ? -13.613 -4.414  3.800   1.00 15.00 ? 93 GLN A NE2  1  
ATOM 1379  H H    . GLN A 1 93 ? -10.424 -1.641  4.603   1.00 15.00 ? 93 GLN A H    1  
ATOM 1380  H HA   . GLN A 1 93 ? -12.311 0.508   5.088   1.00 15.00 ? 93 GLN A HA   1  
ATOM 1381  H HB2  . GLN A 1 93 ? -12.213 -2.211  6.398   1.00 15.00 ? 93 GLN A HB2  1  
ATOM 1382  H HB3  . GLN A 1 93 ? -13.580 -1.106  6.338   1.00 15.00 ? 93 GLN A HB3  1  
ATOM 1383  H HG2  . GLN A 1 93 ? -13.974 -1.527  4.079   1.00 15.00 ? 93 GLN A HG2  1  
ATOM 1384  H HG3  . GLN A 1 93 ? -12.374 -2.227  3.838   1.00 15.00 ? 93 GLN A HG3  1  
ATOM 1385  H HE21 . GLN A 1 93 ? -13.143 -4.132  2.987   1.00 15.00 ? 93 GLN A HE21 1  
ATOM 1386  H HE22 . GLN A 1 93 ? -13.971 -5.317  3.934   1.00 15.00 ? 93 GLN A HE22 1  
ATOM 1387  N N    . SER A 1 94 ? -12.051 0.655   7.757   1.00 15.00 ? 94 SER A N    1  
ATOM 1388  C CA   . SER A 1 94 ? -11.621 1.148   9.060   1.00 15.00 ? 94 SER A CA   1  
ATOM 1389  C C    . SER A 1 94 ? -11.616 0.024   10.093  1.00 15.00 ? 94 SER A C    1  
ATOM 1390  O O    . SER A 1 94 ? -12.188 -1.042  9.865   1.00 15.00 ? 94 SER A O    1  
ATOM 1391  C CB   . SER A 1 94 ? -12.536 2.282   9.527   1.00 15.00 ? 94 SER A CB   1  
ATOM 1392  O OG   . SER A 1 94 ? -12.006 3.546   9.170   1.00 15.00 ? 94 SER A OG   1  
ATOM 1393  H H    . SER A 1 94 ? -13.005 0.668   7.532   1.00 15.00 ? 94 SER A H    1  
ATOM 1394  H HA   . SER A 1 94 ? -10.617 1.529   8.955   1.00 15.00 ? 94 SER A HA   1  
ATOM 1395  H HB2  . SER A 1 94 ? -13.507 2.171   9.068   1.00 15.00 ? 94 SER A HB2  1  
ATOM 1396  H HB3  . SER A 1 94 ? -12.639 2.239   10.602  1.00 15.00 ? 94 SER A HB3  1  
ATOM 1397  H HG   . SER A 1 94 ? -12.307 4.209   9.796   1.00 15.00 ? 94 SER A HG   1  
ATOM 1398  N N    . PRO A 1 95 ? -10.967 0.248   11.248  1.00 15.00 ? 95 PRO A N    1  
ATOM 1399  C CA   . PRO A 1 95 ? -10.890 -0.752  12.317  1.00 15.00 ? 95 PRO A CA   1  
ATOM 1400  C C    . PRO A 1 95 ? -12.262 -1.302  12.694  1.00 15.00 ? 95 PRO A C    1  
ATOM 1401  O O    . PRO A 1 95 ? -12.503 -2.507  12.612  1.00 15.00 ? 95 PRO A O    1  
ATOM 1402  C CB   . PRO A 1 95 ? -10.284 0.025   13.488  1.00 15.00 ? 95 PRO A CB   1  
ATOM 1403  C CG   . PRO A 1 95 ? -9.506  1.123   12.850  1.00 15.00 ? 95 PRO A CG   1  
ATOM 1404  C CD   . PRO A 1 95 ? -10.258 1.493   11.601  1.00 15.00 ? 95 PRO A CD   1  
ATOM 1405  H HA   . PRO A 1 95 ? -10.238 -1.570  12.048  1.00 15.00 ? 95 PRO A HA   1  
ATOM 1406  H HB2  . PRO A 1 95 ? -11.074 0.411   14.115  1.00 15.00 ? 95 PRO A HB2  1  
ATOM 1407  H HB3  . PRO A 1 95 ? -9.645  -0.627  14.064  1.00 15.00 ? 95 PRO A HB3  1  
ATOM 1408  H HG2  . PRO A 1 95 ? -9.450  1.969   13.519  1.00 15.00 ? 95 PRO A HG2  1  
ATOM 1409  H HG3  . PRO A 1 95 ? -8.515  0.774   12.601  1.00 15.00 ? 95 PRO A HG3  1  
ATOM 1410  H HD2  . PRO A 1 95 ? -10.957 2.290   11.804  1.00 15.00 ? 95 PRO A HD2  1  
ATOM 1411  H HD3  . PRO A 1 95 ? -9.572  1.780   10.819  1.00 15.00 ? 95 PRO A HD3  1  
ATOM 1412  N N    . THR A 1 96 ? -13.158 -0.412  13.108  1.00 15.00 ? 96 THR A N    1  
ATOM 1413  C CA   . THR A 1 96 ? -14.506 -0.807  13.497  1.00 15.00 ? 96 THR A CA   1  
ATOM 1414  C C    . THR A 1 96 ? -15.489 -0.590  12.351  1.00 15.00 ? 96 THR A C    1  
ATOM 1415  O O    . THR A 1 96 ? -15.597 0.560   11.876  1.00 15.00 ? 96 THR A O    1  
ATOM 1416  C CB   . THR A 1 96 ? -14.956 -0.018  14.727  1.00 15.00 ? 96 THR A CB   1  
ATOM 1417  O OG1  . THR A 1 96 ? -16.344 -0.192  14.955  1.00 15.00 ? 96 THR A OG1  1  
ATOM 1418  C CG2  . THR A 1 96 ? -14.691 1.468   14.615  1.00 15.00 ? 96 THR A CG2  1  
ATOM 1419  O OXT  . THR A 1 96 ? -16.142 -1.571  11.938  1.00 15.00 ? 96 THR A OXT  1  
ATOM 1420  H H    . THR A 1 96 ? -12.906 0.535   13.151  1.00 15.00 ? 96 THR A H    1  
ATOM 1421  H HA   . THR A 1 96 ? -14.485 -1.859  13.742  1.00 15.00 ? 96 THR A HA   1  
ATOM 1422  H HB   . THR A 1 96 ? -14.422 -0.385  15.592  1.00 15.00 ? 96 THR A HB   1  
ATOM 1423  H HG1  . THR A 1 96 ? -16.841 0.267   14.274  1.00 15.00 ? 96 THR A HG1  1  
ATOM 1424  H HG21 . THR A 1 96 ? -13.640 1.659   14.777  1.00 15.00 ? 96 THR A HG21 1  
ATOM 1425  H HG22 . THR A 1 96 ? -14.971 1.810   13.629  1.00 15.00 ? 96 THR A HG22 1  
ATOM 1426  H HG23 . THR A 1 96 ? -15.272 1.995   15.357  1.00 15.00 ? 96 THR A HG23 1  
ATOM 1427  N N    . PRO A 1 1  ? -21.926 2.221   -5.206  1.00 15.00 ? 1  PRO A N    2  
ATOM 1428  C CA   . PRO A 1 1  ? -22.072 2.838   -3.860  1.00 15.00 ? 1  PRO A CA   2  
ATOM 1429  C C    . PRO A 1 1  ? -21.820 1.827   -2.741  1.00 15.00 ? 1  PRO A C    2  
ATOM 1430  O O    . PRO A 1 1  ? -22.642 1.663   -1.839  1.00 15.00 ? 1  PRO A O    2  
ATOM 1431  C CB   . PRO A 1 1  ? -23.487 3.401   -3.763  1.00 15.00 ? 1  PRO A CB   2  
ATOM 1432  C CG   . PRO A 1 1  ? -24.035 3.258   -5.142  1.00 15.00 ? 1  PRO A CG   2  
ATOM 1433  C CD   . PRO A 1 1  ? -23.277 2.123   -5.785  1.00 15.00 ? 1  PRO A CD   2  
ATOM 1434  H H2   . PRO A 1 1  ? -21.414 1.347   -5.001  1.00 15.00 ? 1  PRO A H2   2  
ATOM 1435  H H3   . PRO A 1 1  ? -21.211 2.847   -5.646  1.00 15.00 ? 1  PRO A H3   2  
ATOM 1436  H HA   . PRO A 1 1  ? -21.362 3.647   -3.772  1.00 15.00 ? 1  PRO A HA   2  
ATOM 1437  H HB2  . PRO A 1 1  ? -24.060 2.829   -3.047  1.00 15.00 ? 1  PRO A HB2  2  
ATOM 1438  H HB3  . PRO A 1 1  ? -23.448 4.436   -3.459  1.00 15.00 ? 1  PRO A HB3  2  
ATOM 1439  H HG2  . PRO A 1 1  ? -25.089 3.025   -5.096  1.00 15.00 ? 1  PRO A HG2  2  
ATOM 1440  H HG3  . PRO A 1 1  ? -23.878 4.173   -5.695  1.00 15.00 ? 1  PRO A HG3  2  
ATOM 1441  H HD2  . PRO A 1 1  ? -23.733 1.176   -5.533  1.00 15.00 ? 1  PRO A HD2  2  
ATOM 1442  H HD3  . PRO A 1 1  ? -23.243 2.252   -6.856  1.00 15.00 ? 1  PRO A HD3  2  
ATOM 1443  N N    . LYS A 1 2  ? -20.677 1.153   -2.807  1.00 15.00 ? 2  LYS A N    2  
ATOM 1444  C CA   . LYS A 1 2  ? -20.315 0.159   -1.802  1.00 15.00 ? 2  LYS A CA   2  
ATOM 1445  C C    . LYS A 1 2  ? -18.800 -0.014  -1.732  1.00 15.00 ? 2  LYS A C    2  
ATOM 1446  O O    . LYS A 1 2  ? -18.108 0.096   -2.744  1.00 15.00 ? 2  LYS A O    2  
ATOM 1447  C CB   . LYS A 1 2  ? -20.979 -1.182  -2.120  1.00 15.00 ? 2  LYS A CB   2  
ATOM 1448  C CG   . LYS A 1 2  ? -22.251 -1.435  -1.327  1.00 15.00 ? 2  LYS A CG   2  
ATOM 1449  C CD   . LYS A 1 2  ? -22.035 -2.478  -0.242  1.00 15.00 ? 2  LYS A CD   2  
ATOM 1450  C CE   . LYS A 1 2  ? -23.246 -3.384  -0.092  1.00 15.00 ? 2  LYS A CE   2  
ATOM 1451  N NZ   . LYS A 1 2  ? -24.473 -2.619  0.263   1.00 15.00 ? 2  LYS A NZ   2  
ATOM 1452  H H    . LYS A 1 2  ? -20.061 1.327   -3.549  1.00 15.00 ? 2  LYS A H    2  
ATOM 1453  H HA   . LYS A 1 2  ? -20.671 0.511   -0.846  1.00 15.00 ? 2  LYS A HA   2  
ATOM 1454  H HB2  . LYS A 1 2  ? -21.225 -1.209  -3.171  1.00 15.00 ? 2  LYS A HB2  2  
ATOM 1455  H HB3  . LYS A 1 2  ? -20.281 -1.978  -1.903  1.00 15.00 ? 2  LYS A HB3  2  
ATOM 1456  H HG2  . LYS A 1 2  ? -22.566 -0.511  -0.866  1.00 15.00 ? 2  LYS A HG2  2  
ATOM 1457  H HG3  . LYS A 1 2  ? -23.020 -1.784  -2.001  1.00 15.00 ? 2  LYS A HG3  2  
ATOM 1458  H HD2  . LYS A 1 2  ? -21.177 -3.080  -0.501  1.00 15.00 ? 2  LYS A HD2  2  
ATOM 1459  H HD3  . LYS A 1 2  ? -21.854 -1.974  0.697   1.00 15.00 ? 2  LYS A HD3  2  
ATOM 1460  H HE2  . LYS A 1 2  ? -23.412 -3.900  -1.026  1.00 15.00 ? 2  LYS A HE2  2  
ATOM 1461  H HE3  . LYS A 1 2  ? -23.044 -4.107  0.686   1.00 15.00 ? 2  LYS A HE3  2  
ATOM 1462  H HZ1  . LYS A 1 2  ? -24.705 -2.761  1.267   1.00 15.00 ? 2  LYS A HZ1  2  
ATOM 1463  H HZ2  . LYS A 1 2  ? -24.325 -1.604  0.093   1.00 15.00 ? 2  LYS A HZ2  2  
ATOM 1464  H HZ3  . LYS A 1 2  ? -25.275 -2.942  -0.316  1.00 15.00 ? 2  LYS A HZ3  2  
ATOM 1465  N N    . PRO A 1 3  ? -18.262 -0.291  -0.531  1.00 15.00 ? 3  PRO A N    2  
ATOM 1466  C CA   . PRO A 1 3  ? -16.821 -0.481  -0.340  1.00 15.00 ? 3  PRO A CA   2  
ATOM 1467  C C    . PRO A 1 3  ? -16.319 -1.763  -0.992  1.00 15.00 ? 3  PRO A C    2  
ATOM 1468  O O    . PRO A 1 3  ? -17.018 -2.374  -1.799  1.00 15.00 ? 3  PRO A O    2  
ATOM 1469  C CB   . PRO A 1 3  ? -16.667 -0.562  1.179   1.00 15.00 ? 3  PRO A CB   2  
ATOM 1470  C CG   . PRO A 1 3  ? -17.995 -1.024  1.672   1.00 15.00 ? 3  PRO A CG   2  
ATOM 1471  C CD   . PRO A 1 3  ? -19.013 -0.443  0.729   1.00 15.00 ? 3  PRO A CD   2  
ATOM 1472  H HA   . PRO A 1 3  ? -16.257 0.359   -0.718  1.00 15.00 ? 3  PRO A HA   2  
ATOM 1473  H HB2  . PRO A 1 3  ? -15.886 -1.266  1.425   1.00 15.00 ? 3  PRO A HB2  2  
ATOM 1474  H HB3  . PRO A 1 3  ? -16.418 0.412   1.571   1.00 15.00 ? 3  PRO A HB3  2  
ATOM 1475  H HG2  . PRO A 1 3  ? -18.039 -2.103  1.652   1.00 15.00 ? 3  PRO A HG2  2  
ATOM 1476  H HG3  . PRO A 1 3  ? -18.162 -0.660  2.675   1.00 15.00 ? 3  PRO A HG3  2  
ATOM 1477  H HD2  . PRO A 1 3  ? -19.843 -1.122  0.604   1.00 15.00 ? 3  PRO A HD2  2  
ATOM 1478  H HD3  . PRO A 1 3  ? -19.357 0.515   1.090   1.00 15.00 ? 3  PRO A HD3  2  
ATOM 1479  N N    . GLY A 1 4  ? -15.098 -2.162  -0.649  1.00 15.00 ? 4  GLY A N    2  
ATOM 1480  C CA   . GLY A 1 4  ? -14.530 -3.367  -1.223  1.00 15.00 ? 4  GLY A CA   2  
ATOM 1481  C C    . GLY A 1 4  ? -13.874 -3.112  -2.565  1.00 15.00 ? 4  GLY A C    2  
ATOM 1482  O O    . GLY A 1 4  ? -13.106 -3.939  -3.054  1.00 15.00 ? 4  GLY A O    2  
ATOM 1483  H H    . GLY A 1 4  ? -14.577 -1.633  -0.009  1.00 15.00 ? 4  GLY A H    2  
ATOM 1484  H HA2  . GLY A 1 4  ? -13.791 -3.763  -0.542  1.00 15.00 ? 4  GLY A HA2  2  
ATOM 1485  H HA3  . GLY A 1 4  ? -15.315 -4.097  -1.351  1.00 15.00 ? 4  GLY A HA3  2  
ATOM 1486  N N    . ASP A 1 5  ? -14.174 -1.960  -3.160  1.00 15.00 ? 5  ASP A N    2  
ATOM 1487  C CA   . ASP A 1 5  ? -13.602 -1.600  -4.451  1.00 15.00 ? 5  ASP A CA   2  
ATOM 1488  C C    . ASP A 1 5  ? -12.091 -1.492  -4.352  1.00 15.00 ? 5  ASP A C    2  
ATOM 1489  O O    . ASP A 1 5  ? -11.543 -1.189  -3.292  1.00 15.00 ? 5  ASP A O    2  
ATOM 1490  C CB   . ASP A 1 5  ? -14.194 -0.280  -4.948  1.00 15.00 ? 5  ASP A CB   2  
ATOM 1491  C CG   . ASP A 1 5  ? -15.657 -0.408  -5.327  1.00 15.00 ? 5  ASP A CG   2  
ATOM 1492  O OD1  . ASP A 1 5  ? -16.059 -1.501  -5.780  1.00 15.00 ? 5  ASP A OD1  2  
ATOM 1493  O OD2  . ASP A 1 5  ? -16.400 0.584   -5.172  1.00 15.00 ? 5  ASP A OD2  2  
ATOM 1494  H H    . ASP A 1 5  ? -14.790 -1.338  -2.721  1.00 15.00 ? 5  ASP A H    2  
ATOM 1495  H HA   . ASP A 1 5  ? -13.842 -2.384  -5.155  1.00 15.00 ? 5  ASP A HA   2  
ATOM 1496  H HB2  . ASP A 1 5  ? -14.108 0.463   -4.169  1.00 15.00 ? 5  ASP A HB2  2  
ATOM 1497  H HB3  . ASP A 1 5  ? -13.643 0.050   -5.817  1.00 15.00 ? 5  ASP A HB3  2  
ATOM 1498  N N    . ILE A 1 6  ? -11.424 -1.757  -5.462  1.00 15.00 ? 6  ILE A N    2  
ATOM 1499  C CA   . ILE A 1 6  ? -9.975  -1.710  -5.512  1.00 15.00 ? 6  ILE A CA   2  
ATOM 1500  C C    . ILE A 1 6  ? -9.485  -0.452  -6.222  1.00 15.00 ? 6  ILE A C    2  
ATOM 1501  O O    . ILE A 1 6  ? -10.109 0.024   -7.171  1.00 15.00 ? 6  ILE A O    2  
ATOM 1502  C CB   . ILE A 1 6  ? -9.421  -2.962  -6.229  1.00 15.00 ? 6  ILE A CB   2  
ATOM 1503  C CG1  . ILE A 1 6  ? -8.856  -3.953  -5.210  1.00 15.00 ? 6  ILE A CG1  2  
ATOM 1504  C CG2  . ILE A 1 6  ? -8.354  -2.589  -7.256  1.00 15.00 ? 6  ILE A CG2  2  
ATOM 1505  C CD1  . ILE A 1 6  ? -9.921  -4.651  -4.393  1.00 15.00 ? 6  ILE A CD1  2  
ATOM 1506  H H    . ILE A 1 6  ? -11.921 -2.004  -6.270  1.00 15.00 ? 6  ILE A H    2  
ATOM 1507  H HA   . ILE A 1 6  ? -9.605  -1.710  -4.497  1.00 15.00 ? 6  ILE A HA   2  
ATOM 1508  H HB   . ILE A 1 6  ? -10.243 -3.430  -6.752  1.00 15.00 ? 6  ILE A HB   2  
ATOM 1509  H HG12 . ILE A 1 6  ? -8.288  -4.710  -5.730  1.00 15.00 ? 6  ILE A HG12 2  
ATOM 1510  H HG13 . ILE A 1 6  ? -8.205  -3.426  -4.528  1.00 15.00 ? 6  ILE A HG13 2  
ATOM 1511  H HG21 . ILE A 1 6  ? -7.596  -1.980  -6.783  1.00 15.00 ? 6  ILE A HG21 2  
ATOM 1512  H HG22 . ILE A 1 6  ? -7.902  -3.487  -7.649  1.00 15.00 ? 6  ILE A HG22 2  
ATOM 1513  H HG23 . ILE A 1 6  ? -8.809  -2.031  -8.061  1.00 15.00 ? 6  ILE A HG23 2  
ATOM 1514  H HD11 . ILE A 1 6  ? -10.188 -4.034  -3.547  1.00 15.00 ? 6  ILE A HD11 2  
ATOM 1515  H HD12 . ILE A 1 6  ? -10.794 -4.819  -5.006  1.00 15.00 ? 6  ILE A HD12 2  
ATOM 1516  H HD13 . ILE A 1 6  ? -9.541  -5.599  -4.041  1.00 15.00 ? 6  ILE A HD13 2  
ATOM 1517  N N    . PHE A 1 7  ? -8.352  0.066   -5.767  1.00 15.00 ? 7  PHE A N    2  
ATOM 1518  C CA   . PHE A 1 7  ? -7.760  1.252   -6.367  1.00 15.00 ? 7  PHE A CA   2  
ATOM 1519  C C    . PHE A 1 7  ? -6.243  1.105   -6.438  1.00 15.00 ? 7  PHE A C    2  
ATOM 1520  O O    . PHE A 1 7  ? -5.643  0.397   -5.631  1.00 15.00 ? 7  PHE A O    2  
ATOM 1521  C CB   . PHE A 1 7  ? -8.144  2.509   -5.577  1.00 15.00 ? 7  PHE A CB   2  
ATOM 1522  C CG   . PHE A 1 7  ? -7.352  2.702   -4.313  1.00 15.00 ? 7  PHE A CG   2  
ATOM 1523  C CD1  . PHE A 1 7  ? -6.055  3.188   -4.361  1.00 15.00 ? 7  PHE A CD1  2  
ATOM 1524  C CD2  . PHE A 1 7  ? -7.906  2.399   -3.080  1.00 15.00 ? 7  PHE A CD2  2  
ATOM 1525  C CE1  . PHE A 1 7  ? -5.326  3.368   -3.203  1.00 15.00 ? 7  PHE A CE1  2  
ATOM 1526  C CE2  . PHE A 1 7  ? -7.181  2.577   -1.918  1.00 15.00 ? 7  PHE A CE2  2  
ATOM 1527  C CZ   . PHE A 1 7  ? -5.889  3.062   -1.981  1.00 15.00 ? 7  PHE A CZ   2  
ATOM 1528  H H    . PHE A 1 7  ? -7.898  -0.367  -5.014  1.00 15.00 ? 7  PHE A H    2  
ATOM 1529  H HA   . PHE A 1 7  ? -8.146  1.335   -7.372  1.00 15.00 ? 7  PHE A HA   2  
ATOM 1530  H HB2  . PHE A 1 7  ? -7.988  3.377   -6.200  1.00 15.00 ? 7  PHE A HB2  2  
ATOM 1531  H HB3  . PHE A 1 7  ? -9.189  2.450   -5.309  1.00 15.00 ? 7  PHE A HB3  2  
ATOM 1532  H HD1  . PHE A 1 7  ? -5.612  3.426   -5.316  1.00 15.00 ? 7  PHE A HD1  2  
ATOM 1533  H HD2  . PHE A 1 7  ? -8.916  2.019   -3.032  1.00 15.00 ? 7  PHE A HD2  2  
ATOM 1534  H HE1  . PHE A 1 7  ? -4.317  3.748   -3.253  1.00 15.00 ? 7  PHE A HE1  2  
ATOM 1535  H HE2  . PHE A 1 7  ? -7.623  2.337   -0.963  1.00 15.00 ? 7  PHE A HE2  2  
ATOM 1536  H HZ   . PHE A 1 7  ? -5.321  3.202   -1.076  1.00 15.00 ? 7  PHE A HZ   2  
ATOM 1537  N N    . GLU A 1 8  ? -5.630  1.764   -7.413  1.00 15.00 ? 8  GLU A N    2  
ATOM 1538  C CA   . GLU A 1 8  ? -4.184  1.687   -7.592  1.00 15.00 ? 8  GLU A CA   2  
ATOM 1539  C C    . GLU A 1 8  ? -3.531  3.059   -7.498  1.00 15.00 ? 8  GLU A C    2  
ATOM 1540  O O    . GLU A 1 8  ? -4.073  4.060   -7.966  1.00 15.00 ? 8  GLU A O    2  
ATOM 1541  C CB   . GLU A 1 8  ? -3.859  1.057   -8.941  1.00 15.00 ? 8  GLU A CB   2  
ATOM 1542  C CG   . GLU A 1 8  ? -4.579  1.711   -10.100 1.00 15.00 ? 8  GLU A CG   2  
ATOM 1543  C CD   . GLU A 1 8  ? -6.003  1.214   -10.261 1.00 15.00 ? 8  GLU A CD   2  
ATOM 1544  O OE1  . GLU A 1 8  ? -6.189  0.123   -10.839 1.00 15.00 ? 8  GLU A OE1  2  
ATOM 1545  O OE2  . GLU A 1 8  ? -6.931  1.917   -9.808  1.00 15.00 ? 8  GLU A OE2  2  
ATOM 1546  H H    . GLU A 1 8  ? -6.161  2.305   -8.034  1.00 15.00 ? 8  GLU A H    2  
ATOM 1547  H HA   . GLU A 1 8  ? -3.780  1.057   -6.811  1.00 15.00 ? 8  GLU A HA   2  
ATOM 1548  H HB2  . GLU A 1 8  ? -2.797  1.140   -9.115  1.00 15.00 ? 8  GLU A HB2  2  
ATOM 1549  H HB3  . GLU A 1 8  ? -4.133  0.013   -8.916  1.00 15.00 ? 8  GLU A HB3  2  
ATOM 1550  H HG2  . GLU A 1 8  ? -4.602  2.776   -9.932  1.00 15.00 ? 8  GLU A HG2  2  
ATOM 1551  H HG3  . GLU A 1 8  ? -4.034  1.500   -11.006 1.00 15.00 ? 8  GLU A HG3  2  
ATOM 1552  N N    . VAL A 1 9  ? -2.348  3.079   -6.903  1.00 15.00 ? 9  VAL A N    2  
ATOM 1553  C CA   . VAL A 1 9  ? -1.571  4.301   -6.746  1.00 15.00 ? 9  VAL A CA   2  
ATOM 1554  C C    . VAL A 1 9  ? -0.469  4.342   -7.794  1.00 15.00 ? 9  VAL A C    2  
ATOM 1555  O O    . VAL A 1 9  ? 0.421   3.492   -7.804  1.00 15.00 ? 9  VAL A O    2  
ATOM 1556  C CB   . VAL A 1 9  ? -0.963  4.427   -5.320  1.00 15.00 ? 9  VAL A CB   2  
ATOM 1557  C CG1  . VAL A 1 9  ? -0.978  3.088   -4.597  1.00 15.00 ? 9  VAL A CG1  2  
ATOM 1558  C CG2  . VAL A 1 9  ? 0.454   4.992   -5.364  1.00 15.00 ? 9  VAL A CG2  2  
ATOM 1559  H H    . VAL A 1 9  ? -1.977  2.235   -6.577  1.00 15.00 ? 9  VAL A H    2  
ATOM 1560  H HA   . VAL A 1 9  ? -2.233  5.140   -6.913  1.00 15.00 ? 9  VAL A HA   2  
ATOM 1561  H HB   . VAL A 1 9  ? -1.578  5.114   -4.756  1.00 15.00 ? 9  VAL A HB   2  
ATOM 1562  H HG11 . VAL A 1 9  ? -1.943  2.616   -4.727  1.00 15.00 ? 9  VAL A HG11 2  
ATOM 1563  H HG12 . VAL A 1 9  ? -0.209  2.453   -5.007  1.00 15.00 ? 9  VAL A HG12 2  
ATOM 1564  H HG13 . VAL A 1 9  ? -0.792  3.245   -3.545  1.00 15.00 ? 9  VAL A HG13 2  
ATOM 1565  H HG21 . VAL A 1 9  ? 1.114   4.274   -5.829  1.00 15.00 ? 9  VAL A HG21 2  
ATOM 1566  H HG22 . VAL A 1 9  ? 0.459   5.908   -5.936  1.00 15.00 ? 9  VAL A HG22 2  
ATOM 1567  H HG23 . VAL A 1 9  ? 0.793   5.193   -4.359  1.00 15.00 ? 9  VAL A HG23 2  
ATOM 1568  N N    . GLU A 1 10 ? -0.547  5.314   -8.688  1.00 15.00 ? 10 GLU A N    2  
ATOM 1569  C CA   . GLU A 1 10 ? 0.433   5.437   -9.754  1.00 15.00 ? 10 GLU A CA   2  
ATOM 1570  C C    . GLU A 1 10 ? 1.399   6.594   -9.522  1.00 15.00 ? 10 GLU A C    2  
ATOM 1571  O O    . GLU A 1 10 ? 1.324   7.623   -10.193 1.00 15.00 ? 10 GLU A O    2  
ATOM 1572  C CB   . GLU A 1 10 ? -0.283  5.606   -11.087 1.00 15.00 ? 10 GLU A CB   2  
ATOM 1573  C CG   . GLU A 1 10 ? 0.655   5.776   -12.272 1.00 15.00 ? 10 GLU A CG   2  
ATOM 1574  C CD   . GLU A 1 10 ? 0.298   6.975   -13.131 1.00 15.00 ? 10 GLU A CD   2  
ATOM 1575  O OE1  . GLU A 1 10 ? -0.884  7.100   -13.513 1.00 15.00 ? 10 GLU A OE1  2  
ATOM 1576  O OE2  . GLU A 1 10 ? 1.202   7.787   -13.420 1.00 15.00 ? 10 GLU A OE2  2  
ATOM 1577  H H    . GLU A 1 10 ? -1.290  5.951   -8.642  1.00 15.00 ? 10 GLU A H    2  
ATOM 1578  H HA   . GLU A 1 10 ? 0.999   4.519   -9.783  1.00 15.00 ? 10 GLU A HA   2  
ATOM 1579  H HB2  . GLU A 1 10 ? -0.892  4.731   -11.259 1.00 15.00 ? 10 GLU A HB2  2  
ATOM 1580  H HB3  . GLU A 1 10 ? -0.922  6.473   -11.029 1.00 15.00 ? 10 GLU A HB3  2  
ATOM 1581  H HG2  . GLU A 1 10 ? 1.661   5.905   -11.903 1.00 15.00 ? 10 GLU A HG2  2  
ATOM 1582  H HG3  . GLU A 1 10 ? 0.607   4.887   -12.884 1.00 15.00 ? 10 GLU A HG3  2  
ATOM 1583  N N    . LEU A 1 11 ? 2.325   6.406   -8.590  1.00 15.00 ? 11 LEU A N    2  
ATOM 1584  C CA   . LEU A 1 11 ? 3.327   7.424   -8.298  1.00 15.00 ? 11 LEU A CA   2  
ATOM 1585  C C    . LEU A 1 11 ? 4.529   7.227   -9.215  1.00 15.00 ? 11 LEU A C    2  
ATOM 1586  O O    . LEU A 1 11 ? 4.669   6.177   -9.838  1.00 15.00 ? 11 LEU A O    2  
ATOM 1587  C CB   . LEU A 1 11 ? 3.765   7.352   -6.832  1.00 15.00 ? 11 LEU A CB   2  
ATOM 1588  C CG   . LEU A 1 11 ? 4.050   8.701   -6.164  1.00 15.00 ? 11 LEU A CG   2  
ATOM 1589  C CD1  . LEU A 1 11 ? 2.797   9.563   -6.125  1.00 15.00 ? 11 LEU A CD1  2  
ATOM 1590  C CD2  . LEU A 1 11 ? 4.597   8.493   -4.758  1.00 15.00 ? 11 LEU A CD2  2  
ATOM 1591  H H    . LEU A 1 11 ? 2.345   5.558   -8.101  1.00 15.00 ? 11 LEU A H    2  
ATOM 1592  H HA   . LEU A 1 11 ? 2.890   8.386   -8.493  1.00 15.00 ? 11 LEU A HA   2  
ATOM 1593  H HB2  . LEU A 1 11 ? 2.989   6.854   -6.274  1.00 15.00 ? 11 LEU A HB2  2  
ATOM 1594  H HB3  . LEU A 1 11 ? 4.662   6.755   -6.775  1.00 15.00 ? 11 LEU A HB3  2  
ATOM 1595  H HG   . LEU A 1 11 ? 4.798   9.228   -6.739  1.00 15.00 ? 11 LEU A HG   2  
ATOM 1596  H HD11 . LEU A 1 11 ? 2.195   9.366   -6.999  1.00 15.00 ? 11 LEU A HD11 2  
ATOM 1597  H HD12 . LEU A 1 11 ? 2.228   9.331   -5.236  1.00 15.00 ? 11 LEU A HD12 2  
ATOM 1598  H HD13 . LEU A 1 11 ? 3.078   10.606  -6.110  1.00 15.00 ? 11 LEU A HD13 2  
ATOM 1599  H HD21 . LEU A 1 11 ? 4.596   9.434   -4.229  1.00 15.00 ? 11 LEU A HD21 2  
ATOM 1600  H HD22 . LEU A 1 11 ? 3.977   7.783   -4.231  1.00 15.00 ? 11 LEU A HD22 2  
ATOM 1601  H HD23 . LEU A 1 11 ? 5.607   8.115   -4.817  1.00 15.00 ? 11 LEU A HD23 2  
ATOM 1602  N N    . ALA A 1 12 ? 5.391   8.229   -9.306  1.00 15.00 ? 12 ALA A N    2  
ATOM 1603  C CA   . ALA A 1 12 ? 6.567   8.126   -10.163 1.00 15.00 ? 12 ALA A CA   2  
ATOM 1604  C C    . ALA A 1 12 ? 7.794   7.695   -9.372  1.00 15.00 ? 12 ALA A C    2  
ATOM 1605  O O    . ALA A 1 12 ? 8.456   8.512   -8.732  1.00 15.00 ? 12 ALA A O    2  
ATOM 1606  C CB   . ALA A 1 12 ? 6.831   9.439   -10.877 1.00 15.00 ? 12 ALA A CB   2  
ATOM 1607  H H    . ALA A 1 12 ? 5.235   9.048   -8.792  1.00 15.00 ? 12 ALA A H    2  
ATOM 1608  H HA   . ALA A 1 12 ? 6.361   7.375   -10.915 1.00 15.00 ? 12 ALA A HA   2  
ATOM 1609  H HB1  . ALA A 1 12 ? 7.291   9.235   -11.833 1.00 15.00 ? 12 ALA A HB1  2  
ATOM 1610  H HB2  . ALA A 1 12 ? 5.898   9.960   -11.029 1.00 15.00 ? 12 ALA A HB2  2  
ATOM 1611  H HB3  . ALA A 1 12 ? 7.493   10.047  -10.280 1.00 15.00 ? 12 ALA A HB3  2  
ATOM 1612  N N    . LYS A 1 13 ? 8.089   6.403   -9.424  1.00 15.00 ? 13 LYS A N    2  
ATOM 1613  C CA   . LYS A 1 13 ? 9.234   5.845   -8.719  1.00 15.00 ? 13 LYS A CA   2  
ATOM 1614  C C    . LYS A 1 13 ? 10.545  6.408   -9.268  1.00 15.00 ? 13 LYS A C    2  
ATOM 1615  O O    . LYS A 1 13 ? 11.509  6.602   -8.527  1.00 15.00 ? 13 LYS A O    2  
ATOM 1616  C CB   . LYS A 1 13 ? 9.223   4.320   -8.835  1.00 15.00 ? 13 LYS A CB   2  
ATOM 1617  C CG   . LYS A 1 13 ? 9.723   3.612   -7.589  1.00 15.00 ? 13 LYS A CG   2  
ATOM 1618  C CD   . LYS A 1 13 ? 11.151  4.010   -7.261  1.00 15.00 ? 13 LYS A CD   2  
ATOM 1619  C CE   . LYS A 1 13 ? 11.201  4.987   -6.097  1.00 15.00 ? 13 LYS A CE   2  
ATOM 1620  N NZ   . LYS A 1 13 ? 12.538  5.004   -5.443  1.00 15.00 ? 13 LYS A NZ   2  
ATOM 1621  H H    . LYS A 1 13 ? 7.520   5.806   -9.952  1.00 15.00 ? 13 LYS A H    2  
ATOM 1622  H HA   . LYS A 1 13 ? 9.147   6.118   -7.678  1.00 15.00 ? 13 LYS A HA   2  
ATOM 1623  H HB2  . LYS A 1 13 ? 8.210   3.994   -9.025  1.00 15.00 ? 13 LYS A HB2  2  
ATOM 1624  H HB3  . LYS A 1 13 ? 9.846   4.025   -9.667  1.00 15.00 ? 13 LYS A HB3  2  
ATOM 1625  H HG2  . LYS A 1 13 ? 9.086   3.874   -6.758  1.00 15.00 ? 13 LYS A HG2  2  
ATOM 1626  H HG3  . LYS A 1 13 ? 9.684   2.547   -7.753  1.00 15.00 ? 13 LYS A HG3  2  
ATOM 1627  H HD2  . LYS A 1 13 ? 11.711  3.125   -6.999  1.00 15.00 ? 13 LYS A HD2  2  
ATOM 1628  H HD3  . LYS A 1 13 ? 11.593  4.474   -8.131  1.00 15.00 ? 13 LYS A HD3  2  
ATOM 1629  H HE2  . LYS A 1 13 ? 10.978  5.978   -6.465  1.00 15.00 ? 13 LYS A HE2  2  
ATOM 1630  H HE3  . LYS A 1 13 ? 10.456  4.699   -5.370  1.00 15.00 ? 13 LYS A HE3  2  
ATOM 1631  H HZ1  . LYS A 1 13 ? 12.492  5.531   -4.548  1.00 15.00 ? 13 LYS A HZ1  2  
ATOM 1632  H HZ2  . LYS A 1 13 ? 12.850  4.032   -5.243  1.00 15.00 ? 13 LYS A HZ2  2  
ATOM 1633  H HZ3  . LYS A 1 13 ? 13.236  5.459   -6.065  1.00 15.00 ? 13 LYS A HZ3  2  
ATOM 1634  N N    . ASN A 1 14 ? 10.571  6.670   -10.570 1.00 15.00 ? 14 ASN A N    2  
ATOM 1635  C CA   . ASN A 1 14 ? 11.761  7.208   -11.221 1.00 15.00 ? 14 ASN A CA   2  
ATOM 1636  C C    . ASN A 1 14 ? 11.807  8.728   -11.096 1.00 15.00 ? 14 ASN A C    2  
ATOM 1637  O O    . ASN A 1 14 ? 11.772  9.448   -12.094 1.00 15.00 ? 14 ASN A O    2  
ATOM 1638  C CB   . ASN A 1 14 ? 11.790  6.803   -12.696 1.00 15.00 ? 14 ASN A CB   2  
ATOM 1639  C CG   . ASN A 1 14 ? 13.142  7.045   -13.336 1.00 15.00 ? 14 ASN A CG   2  
ATOM 1640  O OD1  . ASN A 1 14 ? 13.952  6.127   -13.469 1.00 15.00 ? 14 ASN A OD1  2  
ATOM 1641  N ND2  . ASN A 1 14 ? 13.394  8.286   -13.736 1.00 15.00 ? 14 ASN A ND2  2  
ATOM 1642  H H    . ASN A 1 14 ? 9.772   6.494   -11.106 1.00 15.00 ? 14 ASN A H    2  
ATOM 1643  H HA   . ASN A 1 14 ? 12.626  6.793   -10.726 1.00 15.00 ? 14 ASN A HA   2  
ATOM 1644  H HB2  . ASN A 1 14 ? 11.556  5.752   -12.778 1.00 15.00 ? 14 ASN A HB2  2  
ATOM 1645  H HB3  . ASN A 1 14 ? 11.049  7.375   -13.234 1.00 15.00 ? 14 ASN A HB3  2  
ATOM 1646  H HD21 . ASN A 1 14 ? 12.702  8.966   -13.597 1.00 15.00 ? 14 ASN A HD21 2  
ATOM 1647  H HD22 . ASN A 1 14 ? 14.261  8.471   -14.153 1.00 15.00 ? 14 ASN A HD22 2  
ATOM 1648  N N    . ASP A 1 15 ? 11.889  9.202   -9.859  1.00 15.00 ? 15 ASP A N    2  
ATOM 1649  C CA   . ASP A 1 15 ? 11.942  10.632  -9.578  1.00 15.00 ? 15 ASP A CA   2  
ATOM 1650  C C    . ASP A 1 15 ? 12.028  10.870  -8.076  1.00 15.00 ? 15 ASP A C    2  
ATOM 1651  O O    . ASP A 1 15 ? 12.734  11.765  -7.613  1.00 15.00 ? 15 ASP A O    2  
ATOM 1652  C CB   . ASP A 1 15 ? 10.709  11.338  -10.148 1.00 15.00 ? 15 ASP A CB   2  
ATOM 1653  C CG   . ASP A 1 15 ? 10.949  12.815  -10.390 1.00 15.00 ? 15 ASP A CG   2  
ATOM 1654  O OD1  . ASP A 1 15 ? 11.715  13.426  -9.615  1.00 15.00 ? 15 ASP A OD1  2  
ATOM 1655  O OD2  . ASP A 1 15 ? 10.370  13.361  -11.353 1.00 15.00 ? 15 ASP A OD2  2  
ATOM 1656  H H    . ASP A 1 15 ? 11.915  8.571   -9.110  1.00 15.00 ? 15 ASP A H    2  
ATOM 1657  H HA   . ASP A 1 15 ? 12.829  11.032  -10.048 1.00 15.00 ? 15 ASP A HA   2  
ATOM 1658  H HB2  . ASP A 1 15 ? 10.440  10.878  -11.087 1.00 15.00 ? 15 ASP A HB2  2  
ATOM 1659  H HB3  . ASP A 1 15 ? 9.889   11.233  -9.453  1.00 15.00 ? 15 ASP A HB3  2  
ATOM 1660  N N    . ASN A 1 16 ? 11.303  10.051  -7.322  1.00 15.00 ? 16 ASN A N    2  
ATOM 1661  C CA   . ASN A 1 16 ? 11.288  10.149  -5.869  1.00 15.00 ? 16 ASN A CA   2  
ATOM 1662  C C    . ASN A 1 16 ? 10.689  8.886   -5.260  1.00 15.00 ? 16 ASN A C    2  
ATOM 1663  O O    . ASN A 1 16 ? 9.833   8.241   -5.866  1.00 15.00 ? 16 ASN A O    2  
ATOM 1664  C CB   . ASN A 1 16 ? 10.489  11.376  -5.424  1.00 15.00 ? 16 ASN A CB   2  
ATOM 1665  C CG   . ASN A 1 16 ? 11.092  12.047  -4.206  1.00 15.00 ? 16 ASN A CG   2  
ATOM 1666  O OD1  . ASN A 1 16 ? 12.282  11.901  -3.928  1.00 15.00 ? 16 ASN A OD1  2  
ATOM 1667  N ND2  . ASN A 1 16 ? 10.271  12.789  -3.472  1.00 15.00 ? 16 ASN A ND2  2  
ATOM 1668  H H    . ASN A 1 16 ? 10.765  9.356   -7.756  1.00 15.00 ? 16 ASN A H    2  
ATOM 1669  H HA   . ASN A 1 16 ? 12.308  10.250  -5.532  1.00 15.00 ? 16 ASN A HA   2  
ATOM 1670  H HB2  . ASN A 1 16 ? 10.463  12.093  -6.231  1.00 15.00 ? 16 ASN A HB2  2  
ATOM 1671  H HB3  . ASN A 1 16 ? 9.479   11.074  -5.184  1.00 15.00 ? 16 ASN A HB3  2  
ATOM 1672  H HD21 . ASN A 1 16 ? 9.335   12.860  -3.754  1.00 15.00 ? 16 ASN A HD21 2  
ATOM 1673  H HD22 . ASN A 1 16 ? 10.634  13.235  -2.679  1.00 15.00 ? 16 ASN A HD22 2  
ATOM 1674  N N    . SER A 1 17 ? 11.140  8.537   -4.061  1.00 15.00 ? 17 SER A N    2  
ATOM 1675  C CA   . SER A 1 17 ? 10.641  7.350   -3.380  1.00 15.00 ? 17 SER A CA   2  
ATOM 1676  C C    . SER A 1 17 ? 9.378   7.673   -2.601  1.00 15.00 ? 17 SER A C    2  
ATOM 1677  O O    . SER A 1 17 ? 8.830   8.767   -2.717  1.00 15.00 ? 17 SER A O    2  
ATOM 1678  C CB   . SER A 1 17 ? 11.692  6.796   -2.422  1.00 15.00 ? 17 SER A CB   2  
ATOM 1679  O OG   . SER A 1 17 ? 12.310  5.636   -2.952  1.00 15.00 ? 17 SER A OG   2  
ATOM 1680  H H    . SER A 1 17 ? 11.822  9.090   -3.625  1.00 15.00 ? 17 SER A H    2  
ATOM 1681  H HA   . SER A 1 17 ? 10.413  6.604   -4.127  1.00 15.00 ? 17 SER A HA   2  
ATOM 1682  H HB2  . SER A 1 17 ? 12.449  7.546   -2.249  1.00 15.00 ? 17 SER A HB2  2  
ATOM 1683  H HB3  . SER A 1 17 ? 11.216  6.541   -1.485  1.00 15.00 ? 17 SER A HB3  2  
ATOM 1684  H HG   . SER A 1 17 ? 12.112  4.883   -2.391  1.00 15.00 ? 17 SER A HG   2  
ATOM 1685  N N    . LEU A 1 18 ? 8.925   6.720   -1.798  1.00 15.00 ? 18 LEU A N    2  
ATOM 1686  C CA   . LEU A 1 18 ? 7.732   6.925   -0.998  1.00 15.00 ? 18 LEU A CA   2  
ATOM 1687  C C    . LEU A 1 18 ? 8.088   7.545   0.346   1.00 15.00 ? 18 LEU A C    2  
ATOM 1688  O O    . LEU A 1 18 ? 9.241   7.898   0.595   1.00 15.00 ? 18 LEU A O    2  
ATOM 1689  C CB   . LEU A 1 18 ? 6.979   5.606   -0.791  1.00 15.00 ? 18 LEU A CB   2  
ATOM 1690  C CG   . LEU A 1 18 ? 6.550   4.895   -2.076  1.00 15.00 ? 18 LEU A CG   2  
ATOM 1691  C CD1  . LEU A 1 18 ? 5.774   5.844   -2.977  1.00 15.00 ? 18 LEU A CD1  2  
ATOM 1692  C CD2  . LEU A 1 18 ? 7.761   4.336   -2.806  1.00 15.00 ? 18 LEU A CD2  2  
ATOM 1693  H H    . LEU A 1 18 ? 9.405   5.869   -1.738  1.00 15.00 ? 18 LEU A H    2  
ATOM 1694  H HA   . LEU A 1 18 ? 7.101   7.610   -1.537  1.00 15.00 ? 18 LEU A HA   2  
ATOM 1695  H HB2  . LEU A 1 18 ? 7.616   4.937   -0.229  1.00 15.00 ? 18 LEU A HB2  2  
ATOM 1696  H HB3  . LEU A 1 18 ? 6.092   5.807   -0.205  1.00 15.00 ? 18 LEU A HB3  2  
ATOM 1697  H HG   . LEU A 1 18 ? 5.900   4.070   -1.823  1.00 15.00 ? 18 LEU A HG   2  
ATOM 1698  H HD11 . LEU A 1 18 ? 5.373   6.655   -2.386  1.00 15.00 ? 18 LEU A HD11 2  
ATOM 1699  H HD12 . LEU A 1 18 ? 6.433   6.242   -3.734  1.00 15.00 ? 18 LEU A HD12 2  
ATOM 1700  H HD13 . LEU A 1 18 ? 4.964   5.309   -3.450  1.00 15.00 ? 18 LEU A HD13 2  
ATOM 1701  H HD21 . LEU A 1 18 ? 8.178   5.097   -3.449  1.00 15.00 ? 18 LEU A HD21 2  
ATOM 1702  H HD22 . LEU A 1 18 ? 8.504   4.026   -2.086  1.00 15.00 ? 18 LEU A HD22 2  
ATOM 1703  H HD23 . LEU A 1 18 ? 7.462   3.486   -3.402  1.00 15.00 ? 18 LEU A HD23 2  
ATOM 1704  N N    . GLY A 1 19 ? 7.090   7.677   1.206   1.00 15.00 ? 19 GLY A N    2  
ATOM 1705  C CA   . GLY A 1 19 ? 7.307   8.257   2.515   1.00 15.00 ? 19 GLY A CA   2  
ATOM 1706  C C    . GLY A 1 19 ? 6.200   7.900   3.473   1.00 15.00 ? 19 GLY A C    2  
ATOM 1707  O O    . GLY A 1 19 ? 5.706   8.750   4.208   1.00 15.00 ? 19 GLY A O    2  
ATOM 1708  H H    . GLY A 1 19 ? 6.193   7.379   0.949   1.00 15.00 ? 19 GLY A H    2  
ATOM 1709  H HA2  . GLY A 1 19 ? 8.246   7.901   2.912   1.00 15.00 ? 19 GLY A HA2  2  
ATOM 1710  H HA3  . GLY A 1 19 ? 7.349   9.329   2.417   1.00 15.00 ? 19 GLY A HA3  2  
ATOM 1711  N N    . ILE A 1 20 ? 5.800   6.639   3.445   1.00 15.00 ? 20 ILE A N    2  
ATOM 1712  C CA   . ILE A 1 20 ? 4.735   6.154   4.303   1.00 15.00 ? 20 ILE A CA   2  
ATOM 1713  C C    . ILE A 1 20 ? 5.256   5.165   5.341   1.00 15.00 ? 20 ILE A C    2  
ATOM 1714  O O    . ILE A 1 20 ? 6.052   4.279   5.028   1.00 15.00 ? 20 ILE A O    2  
ATOM 1715  C CB   . ILE A 1 20 ? 3.620   5.488   3.464   1.00 15.00 ? 20 ILE A CB   2  
ATOM 1716  C CG1  . ILE A 1 20 ? 2.284   6.166   3.745   1.00 15.00 ? 20 ILE A CG1  2  
ATOM 1717  C CG2  . ILE A 1 20 ? 3.530   4.002   3.758   1.00 15.00 ? 20 ILE A CG2  2  
ATOM 1718  C CD1  . ILE A 1 20 ? 1.080   5.276   3.537   1.00 15.00 ? 20 ILE A CD1  2  
ATOM 1719  H H    . ILE A 1 20 ? 6.230   6.017   2.821   1.00 15.00 ? 20 ILE A H    2  
ATOM 1720  H HA   . ILE A 1 20 ? 4.305   7.000   4.821   1.00 15.00 ? 20 ILE A HA   2  
ATOM 1721  H HB   . ILE A 1 20 ? 3.864   5.611   2.422   1.00 15.00 ? 20 ILE A HB   2  
ATOM 1722  H HG12 . ILE A 1 20 ? 2.276   6.487   4.769   1.00 15.00 ? 20 ILE A HG12 2  
ATOM 1723  H HG13 . ILE A 1 20 ? 2.181   7.025   3.100   1.00 15.00 ? 20 ILE A HG13 2  
ATOM 1724  H HG21 . ILE A 1 20 ? 4.499   3.547   3.618   1.00 15.00 ? 20 ILE A HG21 2  
ATOM 1725  H HG22 . ILE A 1 20 ? 3.207   3.865   4.779   1.00 15.00 ? 20 ILE A HG22 2  
ATOM 1726  H HG23 . ILE A 1 20 ? 2.815   3.548   3.090   1.00 15.00 ? 20 ILE A HG23 2  
ATOM 1727  H HD11 . ILE A 1 20 ? 0.255   5.866   3.171   1.00 15.00 ? 20 ILE A HD11 2  
ATOM 1728  H HD12 . ILE A 1 20 ? 1.324   4.509   2.819   1.00 15.00 ? 20 ILE A HD12 2  
ATOM 1729  H HD13 . ILE A 1 20 ? 0.808   4.819   4.475   1.00 15.00 ? 20 ILE A HD13 2  
ATOM 1730  N N    . SER A 1 21 ? 4.763   5.292   6.564   1.00 15.00 ? 21 SER A N    2  
ATOM 1731  C CA   . SER A 1 21 ? 5.135   4.379   7.631   1.00 15.00 ? 21 SER A CA   2  
ATOM 1732  C C    . SER A 1 21 ? 4.122   3.241   7.645   1.00 15.00 ? 21 SER A C    2  
ATOM 1733  O O    . SER A 1 21 ? 2.981   3.422   8.069   1.00 15.00 ? 21 SER A O    2  
ATOM 1734  C CB   . SER A 1 21 ? 5.165   5.105   8.980   1.00 15.00 ? 21 SER A CB   2  
ATOM 1735  O OG   . SER A 1 21 ? 5.414   4.200   10.042  1.00 15.00 ? 21 SER A OG   2  
ATOM 1736  H H    . SER A 1 21 ? 4.104   5.994   6.744   1.00 15.00 ? 21 SER A H    2  
ATOM 1737  H HA   . SER A 1 21 ? 6.115   3.980   7.410   1.00 15.00 ? 21 SER A HA   2  
ATOM 1738  H HB2  . SER A 1 21 ? 5.949   5.850   8.967   1.00 15.00 ? 21 SER A HB2  2  
ATOM 1739  H HB3  . SER A 1 21 ? 4.215   5.588   9.149   1.00 15.00 ? 21 SER A HB3  2  
ATOM 1740  H HG   . SER A 1 21 ? 6.315   3.874   9.981   1.00 15.00 ? 21 SER A HG   2  
ATOM 1741  N N    . VAL A 1 22 ? 4.522   2.087   7.124   1.00 15.00 ? 22 VAL A N    2  
ATOM 1742  C CA   . VAL A 1 22 ? 3.614   0.949   7.026   1.00 15.00 ? 22 VAL A CA   2  
ATOM 1743  C C    . VAL A 1 22 ? 3.713   0.002   8.215   1.00 15.00 ? 22 VAL A C    2  
ATOM 1744  O O    . VAL A 1 22 ? 4.744   -0.081  8.883   1.00 15.00 ? 22 VAL A O    2  
ATOM 1745  C CB   . VAL A 1 22 ? 3.872   0.154   5.733   1.00 15.00 ? 22 VAL A CB   2  
ATOM 1746  C CG1  . VAL A 1 22 ? 3.669   1.036   4.512   1.00 15.00 ? 22 VAL A CG1  2  
ATOM 1747  C CG2  . VAL A 1 22 ? 5.274   -0.432  5.737   1.00 15.00 ? 22 VAL A CG2  2  
ATOM 1748  H H    . VAL A 1 22 ? 5.432   2.011   6.759   1.00 15.00 ? 22 VAL A H    2  
ATOM 1749  H HA   . VAL A 1 22 ? 2.607   1.338   6.980   1.00 15.00 ? 22 VAL A HA   2  
ATOM 1750  H HB   . VAL A 1 22 ? 3.164   -0.659  5.685   1.00 15.00 ? 22 VAL A HB   2  
ATOM 1751  H HG11 . VAL A 1 22 ? 3.032   1.872   4.771   1.00 15.00 ? 22 VAL A HG11 2  
ATOM 1752  H HG12 . VAL A 1 22 ? 4.627   1.402   4.173   1.00 15.00 ? 22 VAL A HG12 2  
ATOM 1753  H HG13 . VAL A 1 22 ? 3.206   0.459   3.726   1.00 15.00 ? 22 VAL A HG13 2  
ATOM 1754  H HG21 . VAL A 1 22 ? 5.972   0.304   5.366   1.00 15.00 ? 22 VAL A HG21 2  
ATOM 1755  H HG22 . VAL A 1 22 ? 5.545   -0.710  6.743   1.00 15.00 ? 22 VAL A HG22 2  
ATOM 1756  H HG23 . VAL A 1 22 ? 5.301   -1.304  5.101   1.00 15.00 ? 22 VAL A HG23 2  
ATOM 1757  N N    . THR A 1 23 ? 2.616   -0.711  8.463   1.00 15.00 ? 23 THR A N    2  
ATOM 1758  C CA   . THR A 1 23 ? 2.542   -1.665  9.561   1.00 15.00 ? 23 THR A CA   2  
ATOM 1759  C C    . THR A 1 23 ? 1.599   -2.819  9.213   1.00 15.00 ? 23 THR A C    2  
ATOM 1760  O O    . THR A 1 23 ? 1.085   -2.901  8.094   1.00 15.00 ? 23 THR A O    2  
ATOM 1761  C CB   . THR A 1 23 ? 2.065   -0.962  10.834  1.00 15.00 ? 23 THR A CB   2  
ATOM 1762  O OG1  . THR A 1 23 ? 2.108   0.445   10.677  1.00 15.00 ? 23 THR A OG1  2  
ATOM 1763  C CG2  . THR A 1 23 ? 2.888   -1.309  12.053  1.00 15.00 ? 23 THR A CG2  2  
ATOM 1764  H H    . THR A 1 23 ? 1.833   -0.591  7.886   1.00 15.00 ? 23 THR A H    2  
ATOM 1765  H HA   . THR A 1 23 ? 3.534   -2.060  9.726   1.00 15.00 ? 23 THR A HA   2  
ATOM 1766  H HB   . THR A 1 23 ? 1.043   -1.248  11.032  1.00 15.00 ? 23 THR A HB   2  
ATOM 1767  H HG1  . THR A 1 23 ? 1.862   0.868   11.504  1.00 15.00 ? 23 THR A HG1  2  
ATOM 1768  H HG21 . THR A 1 23 ? 2.718   -2.341  12.321  1.00 15.00 ? 23 THR A HG21 2  
ATOM 1769  H HG22 . THR A 1 23 ? 3.935   -1.162  11.833  1.00 15.00 ? 23 THR A HG22 2  
ATOM 1770  H HG23 . THR A 1 23 ? 2.600   -0.670  12.874  1.00 15.00 ? 23 THR A HG23 2  
ATOM 1771  N N    . GLY A 1 24 ? 1.373   -3.706  10.180  1.00 15.00 ? 24 GLY A N    2  
ATOM 1772  C CA   . GLY A 1 24 ? 0.491   -4.841  9.959   1.00 15.00 ? 24 GLY A CA   2  
ATOM 1773  C C    . GLY A 1 24 ? 1.072   -5.843  8.981   1.00 15.00 ? 24 GLY A C    2  
ATOM 1774  O O    . GLY A 1 24 ? 2.145   -6.396  9.215   1.00 15.00 ? 24 GLY A O    2  
ATOM 1775  H H    . GLY A 1 24 ? 1.807   -3.589  11.051  1.00 15.00 ? 24 GLY A H    2  
ATOM 1776  H HA2  . GLY A 1 24 ? 0.315   -5.335  10.903  1.00 15.00 ? 24 GLY A HA2  2  
ATOM 1777  H HA3  . GLY A 1 24 ? -0.451  -4.480  9.572   1.00 15.00 ? 24 GLY A HA3  2  
ATOM 1778  N N    . GLY A 1 25 ? 0.364   -6.070  7.878   1.00 15.00 ? 25 GLY A N    2  
ATOM 1779  C CA   . GLY A 1 25 ? 0.835   -7.001  6.869   1.00 15.00 ? 25 GLY A CA   2  
ATOM 1780  C C    . GLY A 1 25 ? 0.832   -8.446  7.330   1.00 15.00 ? 25 GLY A C    2  
ATOM 1781  O O    . GLY A 1 25 ? 0.113   -9.275  6.773   1.00 15.00 ? 25 GLY A O    2  
ATOM 1782  H H    . GLY A 1 25 ? -0.482  -5.593  7.744   1.00 15.00 ? 25 GLY A H    2  
ATOM 1783  H HA2  . GLY A 1 25 ? 0.208   -6.918  5.999   1.00 15.00 ? 25 GLY A HA2  2  
ATOM 1784  H HA3  . GLY A 1 25 ? 1.839   -6.729  6.593   1.00 15.00 ? 25 GLY A HA3  2  
ATOM 1785  N N    . VAL A 1 26 ? 1.652   -8.748  8.337   1.00 15.00 ? 26 VAL A N    2  
ATOM 1786  C CA   . VAL A 1 26 ? 1.770   -10.106 8.882   1.00 15.00 ? 26 VAL A CA   2  
ATOM 1787  C C    . VAL A 1 26 ? 0.466   -10.893 8.767   1.00 15.00 ? 26 VAL A C    2  
ATOM 1788  O O    . VAL A 1 26 ? -0.618  -10.360 9.003   1.00 15.00 ? 26 VAL A O    2  
ATOM 1789  C CB   . VAL A 1 26 ? 2.210   -10.084 10.360  1.00 15.00 ? 26 VAL A CB   2  
ATOM 1790  C CG1  . VAL A 1 26 ? 3.716   -10.267 10.472  1.00 15.00 ? 26 VAL A CG1  2  
ATOM 1791  C CG2  . VAL A 1 26 ? 1.774   -8.791  11.030  1.00 15.00 ? 26 VAL A CG2  2  
ATOM 1792  H H    . VAL A 1 26 ? 2.205   -8.036  8.721   1.00 15.00 ? 26 VAL A H    2  
ATOM 1793  H HA   . VAL A 1 26 ? 2.531   -10.621 8.316   1.00 15.00 ? 26 VAL A HA   2  
ATOM 1794  H HB   . VAL A 1 26 ? 1.732   -10.908 10.871  1.00 15.00 ? 26 VAL A HB   2  
ATOM 1795  H HG11 . VAL A 1 26 ? 4.016   -11.134 9.903   1.00 15.00 ? 26 VAL A HG11 2  
ATOM 1796  H HG12 . VAL A 1 26 ? 4.214   -9.391  10.085  1.00 15.00 ? 26 VAL A HG12 2  
ATOM 1797  H HG13 . VAL A 1 26 ? 3.985   -10.406 11.509  1.00 15.00 ? 26 VAL A HG13 2  
ATOM 1798  H HG21 . VAL A 1 26 ? 2.581   -8.075  10.987  1.00 15.00 ? 26 VAL A HG21 2  
ATOM 1799  H HG22 . VAL A 1 26 ? 0.913   -8.394  10.512  1.00 15.00 ? 26 VAL A HG22 2  
ATOM 1800  H HG23 . VAL A 1 26 ? 1.518   -8.986  12.060  1.00 15.00 ? 26 VAL A HG23 2  
ATOM 1801  N N    . ASN A 1 27 ? 0.586   -12.165 8.400   1.00 15.00 ? 27 ASN A N    2  
ATOM 1802  C CA   . ASN A 1 27 ? -0.574  -13.034 8.246   1.00 15.00 ? 27 ASN A CA   2  
ATOM 1803  C C    . ASN A 1 27 ? -1.120  -13.464 9.605   1.00 15.00 ? 27 ASN A C    2  
ATOM 1804  O O    . ASN A 1 27 ? -1.128  -14.650 9.936   1.00 15.00 ? 27 ASN A O    2  
ATOM 1805  C CB   . ASN A 1 27 ? -0.200  -14.268 7.421   1.00 15.00 ? 27 ASN A CB   2  
ATOM 1806  C CG   . ASN A 1 27 ? 0.991   -15.008 7.997   1.00 15.00 ? 27 ASN A CG   2  
ATOM 1807  O OD1  . ASN A 1 27 ? 1.218   -14.997 9.207   1.00 15.00 ? 27 ASN A OD1  2  
ATOM 1808  N ND2  . ASN A 1 27 ? 1.761   -15.656 7.130   1.00 15.00 ? 27 ASN A ND2  2  
ATOM 1809  H H    . ASN A 1 27 ? 1.479   -12.527 8.225   1.00 15.00 ? 27 ASN A H    2  
ATOM 1810  H HA   . ASN A 1 27 ? -1.338  -12.479 7.721   1.00 15.00 ? 27 ASN A HA   2  
ATOM 1811  H HB2  . ASN A 1 27 ? -1.041  -14.944 7.394   1.00 15.00 ? 27 ASN A HB2  2  
ATOM 1812  H HB3  . ASN A 1 27 ? 0.042   -13.960 6.414   1.00 15.00 ? 27 ASN A HB3  2  
ATOM 1813  H HD21 . ASN A 1 27 ? 1.520   -15.620 6.181   1.00 15.00 ? 27 ASN A HD21 2  
ATOM 1814  H HD22 . ASN A 1 27 ? 2.538   -16.143 7.475   1.00 15.00 ? 27 ASN A HD22 2  
ATOM 1815  N N    . THR A 1 28 ? -1.576  -12.493 10.390  1.00 15.00 ? 28 THR A N    2  
ATOM 1816  C CA   . THR A 1 28 ? -2.122  -12.776 11.713  1.00 15.00 ? 28 THR A CA   2  
ATOM 1817  C C    . THR A 1 28 ? -3.159  -11.732 12.114  1.00 15.00 ? 28 THR A C    2  
ATOM 1818  O O    . THR A 1 28 ? -4.268  -12.071 12.527  1.00 15.00 ? 28 THR A O    2  
ATOM 1819  C CB   . THR A 1 28 ? -1.000  -12.822 12.751  1.00 15.00 ? 28 THR A CB   2  
ATOM 1820  O OG1  . THR A 1 28 ? 0.128   -13.511 12.241  1.00 15.00 ? 28 THR A OG1  2  
ATOM 1821  C CG2  . THR A 1 28 ? -1.406  -13.499 14.042  1.00 15.00 ? 28 THR A CG2  2  
ATOM 1822  H H    . THR A 1 28 ? -1.544  -11.566 10.074  1.00 15.00 ? 28 THR A H    2  
ATOM 1823  H HA   . THR A 1 28 ? -2.601  -13.743 11.672  1.00 15.00 ? 28 THR A HA   2  
ATOM 1824  H HB   . THR A 1 28 ? -0.701  -11.810 12.988  1.00 15.00 ? 28 THR A HB   2  
ATOM 1825  H HG1  . THR A 1 28 ? 0.858   -12.897 12.136  1.00 15.00 ? 28 THR A HG1  2  
ATOM 1826  H HG21 . THR A 1 28 ? -1.578  -12.751 14.802  1.00 15.00 ? 28 THR A HG21 2  
ATOM 1827  H HG22 . THR A 1 28 ? -2.313  -14.064 13.882  1.00 15.00 ? 28 THR A HG22 2  
ATOM 1828  H HG23 . THR A 1 28 ? -0.619  -14.165 14.363  1.00 15.00 ? 28 THR A HG23 2  
ATOM 1829  N N    . SER A 1 29 ? -2.789  -10.461 11.996  1.00 15.00 ? 29 SER A N    2  
ATOM 1830  C CA   . SER A 1 29 ? -3.687  -9.368  12.353  1.00 15.00 ? 29 SER A CA   2  
ATOM 1831  C C    . SER A 1 29 ? -4.569  -8.971  11.173  1.00 15.00 ? 29 SER A C    2  
ATOM 1832  O O    . SER A 1 29 ? -5.757  -8.694  11.340  1.00 15.00 ? 29 SER A O    2  
ATOM 1833  C CB   . SER A 1 29 ? -2.883  -8.157  12.831  1.00 15.00 ? 29 SER A CB   2  
ATOM 1834  O OG   . SER A 1 29 ? -1.583  -8.539  13.246  1.00 15.00 ? 29 SER A OG   2  
ATOM 1835  H H    . SER A 1 29 ? -1.891  -10.253 11.665  1.00 15.00 ? 29 SER A H    2  
ATOM 1836  H HA   . SER A 1 29 ? -4.319  -9.709  13.159  1.00 15.00 ? 29 SER A HA   2  
ATOM 1837  H HB2  . SER A 1 29 ? -2.795  -7.445  12.024  1.00 15.00 ? 29 SER A HB2  2  
ATOM 1838  H HB3  . SER A 1 29 ? -3.393  -7.695  13.664  1.00 15.00 ? 29 SER A HB3  2  
ATOM 1839  H HG   . SER A 1 29 ? -1.649  -9.215  13.925  1.00 15.00 ? 29 SER A HG   2  
ATOM 1840  N N    . VAL A 1 30 ? -3.981  -8.941  9.982   1.00 15.00 ? 30 VAL A N    2  
ATOM 1841  C CA   . VAL A 1 30 ? -4.716  -8.572  8.778   1.00 15.00 ? 30 VAL A CA   2  
ATOM 1842  C C    . VAL A 1 30 ? -5.679  -9.677  8.354   1.00 15.00 ? 30 VAL A C    2  
ATOM 1843  O O    . VAL A 1 30 ? -5.839  -10.678 9.054   1.00 15.00 ? 30 VAL A O    2  
ATOM 1844  C CB   . VAL A 1 30 ? -3.760  -8.255  7.612   1.00 15.00 ? 30 VAL A CB   2  
ATOM 1845  C CG1  . VAL A 1 30 ? -2.830  -7.111  7.983   1.00 15.00 ? 30 VAL A CG1  2  
ATOM 1846  C CG2  . VAL A 1 30 ? -2.965  -9.491  7.215   1.00 15.00 ? 30 VAL A CG2  2  
ATOM 1847  H H    . VAL A 1 30 ? -3.031  -9.168  9.911   1.00 15.00 ? 30 VAL A H    2  
ATOM 1848  H HA   . VAL A 1 30 ? -5.286  -7.681  8.999   1.00 15.00 ? 30 VAL A HA   2  
ATOM 1849  H HB   . VAL A 1 30 ? -4.351  -7.946  6.763   1.00 15.00 ? 30 VAL A HB   2  
ATOM 1850  H HG11 . VAL A 1 30 ? -2.387  -7.306  8.949   1.00 15.00 ? 30 VAL A HG11 2  
ATOM 1851  H HG12 . VAL A 1 30 ? -2.050  -7.025  7.241   1.00 15.00 ? 30 VAL A HG12 2  
ATOM 1852  H HG13 . VAL A 1 30 ? -3.391  -6.189  8.024   1.00 15.00 ? 30 VAL A HG13 2  
ATOM 1853  H HG21 . VAL A 1 30 ? -1.942  -9.378  7.537   1.00 15.00 ? 30 VAL A HG21 2  
ATOM 1854  H HG22 . VAL A 1 30 ? -3.395  -10.363 7.684   1.00 15.00 ? 30 VAL A HG22 2  
ATOM 1855  H HG23 . VAL A 1 30 ? -2.994  -9.607  6.142   1.00 15.00 ? 30 VAL A HG23 2  
ATOM 1856  N N    . ARG A 1 31 ? -6.323  -9.486  7.207   1.00 15.00 ? 31 ARG A N    2  
ATOM 1857  C CA   . ARG A 1 31 ? -7.275  -10.462 6.689   1.00 15.00 ? 31 ARG A CA   2  
ATOM 1858  C C    . ARG A 1 31 ? -6.605  -11.813 6.445   1.00 15.00 ? 31 ARG A C    2  
ATOM 1859  O O    . ARG A 1 31 ? -7.182  -12.860 6.740   1.00 15.00 ? 31 ARG A O    2  
ATOM 1860  C CB   . ARG A 1 31 ? -7.912  -9.945  5.397   1.00 15.00 ? 31 ARG A CB   2  
ATOM 1861  C CG   . ARG A 1 31 ? -8.891  -10.921 4.764   1.00 15.00 ? 31 ARG A CG   2  
ATOM 1862  C CD   . ARG A 1 31 ? -9.816  -10.223 3.779   1.00 15.00 ? 31 ARG A CD   2  
ATOM 1863  N NE   . ARG A 1 31 ? -11.220 -10.351 4.162   1.00 15.00 ? 31 ARG A NE   2  
ATOM 1864  C CZ   . ARG A 1 31 ? -12.183 -9.536  3.736   1.00 15.00 ? 31 ARG A CZ   2  
ATOM 1865  N NH1  . ARG A 1 31 ? -11.898 -8.535  2.912   1.00 15.00 ? 31 ARG A NH1  2  
ATOM 1866  N NH2  . ARG A 1 31 ? -13.434 -9.722  4.134   1.00 15.00 ? 31 ARG A NH2  2  
ATOM 1867  H H    . ARG A 1 31 ? -6.156  -8.666  6.697   1.00 15.00 ? 31 ARG A H    2  
ATOM 1868  H HA   . ARG A 1 31 ? -8.048  -10.590 7.431   1.00 15.00 ? 31 ARG A HA   2  
ATOM 1869  H HB2  . ARG A 1 31 ? -8.441  -9.029  5.613   1.00 15.00 ? 31 ARG A HB2  2  
ATOM 1870  H HB3  . ARG A 1 31 ? -7.131  -9.736  4.682   1.00 15.00 ? 31 ARG A HB3  2  
ATOM 1871  H HG2  . ARG A 1 31 ? -8.336  -11.685 4.241   1.00 15.00 ? 31 ARG A HG2  2  
ATOM 1872  H HG3  . ARG A 1 31 ? -9.485  -11.375 5.543   1.00 15.00 ? 31 ARG A HG3  2  
ATOM 1873  H HD2  . ARG A 1 31 ? -9.558  -9.175  3.741   1.00 15.00 ? 31 ARG A HD2  2  
ATOM 1874  H HD3  . ARG A 1 31 ? -9.678  -10.663 2.802   1.00 15.00 ? 31 ARG A HD3  2  
ATOM 1875  H HE   . ARG A 1 31 ? -11.459 -11.082 4.769   1.00 15.00 ? 31 ARG A HE   2  
ATOM 1876  H HH11 . ARG A 1 31 ? -10.957 -8.389  2.607   1.00 15.00 ? 31 ARG A HH11 2  
ATOM 1877  H HH12 . ARG A 1 31 ? -12.626 -7.926  2.596   1.00 15.00 ? 31 ARG A HH12 2  
ATOM 1878  H HH21 . ARG A 1 31 ? -13.655 -10.475 4.754   1.00 15.00 ? 31 ARG A HH21 2  
ATOM 1879  H HH22 . ARG A 1 31 ? -14.157 -9.110  3.814   1.00 15.00 ? 31 ARG A HH22 2  
ATOM 1880  N N    . HIS A 1 32 ? -5.386  -11.788 5.911   1.00 15.00 ? 32 HIS A N    2  
ATOM 1881  C CA   . HIS A 1 32 ? -4.653  -13.022 5.640   1.00 15.00 ? 32 HIS A CA   2  
ATOM 1882  C C    . HIS A 1 32 ? -3.167  -12.752 5.410   1.00 15.00 ? 32 HIS A C    2  
ATOM 1883  O O    . HIS A 1 32 ? -2.313  -13.441 5.967   1.00 15.00 ? 32 HIS A O    2  
ATOM 1884  C CB   . HIS A 1 32 ? -5.253  -13.753 4.433   1.00 15.00 ? 32 HIS A CB   2  
ATOM 1885  C CG   . HIS A 1 32 ? -5.450  -12.893 3.221   1.00 15.00 ? 32 HIS A CG   2  
ATOM 1886  N ND1  . HIS A 1 32 ? -5.409  -13.391 1.935   1.00 15.00 ? 32 HIS A ND1  2  
ATOM 1887  C CD2  . HIS A 1 32 ? -5.704  -11.567 3.097   1.00 15.00 ? 32 HIS A CD2  2  
ATOM 1888  C CE1  . HIS A 1 32 ? -5.627  -12.411 1.076   1.00 15.00 ? 32 HIS A CE1  2  
ATOM 1889  N NE2  . HIS A 1 32 ? -5.809  -11.295 1.756   1.00 15.00 ? 32 HIS A NE2  2  
ATOM 1890  H H    . HIS A 1 32 ? -4.971  -10.926 5.699   1.00 15.00 ? 32 HIS A H    2  
ATOM 1891  H HA   . HIS A 1 32 ? -4.753  -13.654 6.509   1.00 15.00 ? 32 HIS A HA   2  
ATOM 1892  H HB2  . HIS A 1 32 ? -4.597  -14.565 4.155   1.00 15.00 ? 32 HIS A HB2  2  
ATOM 1893  H HB3  . HIS A 1 32 ? -6.215  -14.158 4.713   1.00 15.00 ? 32 HIS A HB3  2  
ATOM 1894  H HD1  . HIS A 1 32 ? -5.243  -14.325 1.688   1.00 15.00 ? 32 HIS A HD1  2  
ATOM 1895  H HD2  . HIS A 1 32 ? -5.800  -10.855 3.902   1.00 15.00 ? 32 HIS A HD2  2  
ATOM 1896  H HE1  . HIS A 1 32 ? -5.655  -12.508 0.001   1.00 15.00 ? 32 HIS A HE1  2  
ATOM 1897  H HE2  . HIS A 1 32 ? -6.065  -10.433 1.367   1.00 15.00 ? 32 HIS A HE2  2  
ATOM 1898  N N    . GLY A 1 33 ? -2.861  -11.754 4.588   1.00 15.00 ? 33 GLY A N    2  
ATOM 1899  C CA   . GLY A 1 33 ? -1.473  -11.425 4.306   1.00 15.00 ? 33 GLY A CA   2  
ATOM 1900  C C    . GLY A 1 33 ? -1.316  -10.122 3.542   1.00 15.00 ? 33 GLY A C    2  
ATOM 1901  O O    . GLY A 1 33 ? -0.275  -9.878  2.932   1.00 15.00 ? 33 GLY A O    2  
ATOM 1902  H H    . GLY A 1 33 ? -3.579  -11.242 4.169   1.00 15.00 ? 33 GLY A H    2  
ATOM 1903  H HA2  . GLY A 1 33 ? -0.931  -11.343 5.242   1.00 15.00 ? 33 GLY A HA2  2  
ATOM 1904  H HA3  . GLY A 1 33 ? -1.040  -12.224 3.725   1.00 15.00 ? 33 GLY A HA3  2  
ATOM 1905  N N    . GLY A 1 34 ? -2.339  -9.274  3.588   1.00 15.00 ? 34 GLY A N    2  
ATOM 1906  C CA   . GLY A 1 34 ? -2.270  -7.996  2.906   1.00 15.00 ? 34 GLY A CA   2  
ATOM 1907  C C    . GLY A 1 34 ? -1.697  -6.929  3.811   1.00 15.00 ? 34 GLY A C    2  
ATOM 1908  O O    . GLY A 1 34 ? -1.796  -7.039  5.033   1.00 15.00 ? 34 GLY A O    2  
ATOM 1909  H H    . GLY A 1 34 ? -3.138  -9.508  4.101   1.00 15.00 ? 34 GLY A H    2  
ATOM 1910  H HA2  . GLY A 1 34 ? -1.643  -8.094  2.031   1.00 15.00 ? 34 GLY A HA2  2  
ATOM 1911  H HA3  . GLY A 1 34 ? -3.263  -7.702  2.601   1.00 15.00 ? 34 GLY A HA3  2  
ATOM 1912  N N    . ILE A 1 35 ? -1.087  -5.900  3.235   1.00 15.00 ? 35 ILE A N    2  
ATOM 1913  C CA   . ILE A 1 35 ? -0.502  -4.845  4.050   1.00 15.00 ? 35 ILE A CA   2  
ATOM 1914  C C    . ILE A 1 35 ? -1.503  -3.743  4.348   1.00 15.00 ? 35 ILE A C    2  
ATOM 1915  O O    . ILE A 1 35 ? -2.458  -3.528  3.603   1.00 15.00 ? 35 ILE A O    2  
ATOM 1916  C CB   . ILE A 1 35 ? 0.762   -4.232  3.400   1.00 15.00 ? 35 ILE A CB   2  
ATOM 1917  C CG1  . ILE A 1 35 ? 1.913   -4.208  4.417   1.00 15.00 ? 35 ILE A CG1  2  
ATOM 1918  C CG2  . ILE A 1 35 ? 0.482   -2.834  2.850   1.00 15.00 ? 35 ILE A CG2  2  
ATOM 1919  C CD1  . ILE A 1 35 ? 2.338   -2.821  4.859   1.00 15.00 ? 35 ILE A CD1  2  
ATOM 1920  H H    . ILE A 1 35 ? -1.024  -5.854  2.254   1.00 15.00 ? 35 ILE A H    2  
ATOM 1921  H HA   . ILE A 1 35 ? -0.207  -5.293  4.988   1.00 15.00 ? 35 ILE A HA   2  
ATOM 1922  H HB   . ILE A 1 35 ? 1.044   -4.860  2.573   1.00 15.00 ? 35 ILE A HB   2  
ATOM 1923  H HG12 . ILE A 1 35 ? 1.610   -4.749  5.300   1.00 15.00 ? 35 ILE A HG12 2  
ATOM 1924  H HG13 . ILE A 1 35 ? 2.774   -4.695  3.984   1.00 15.00 ? 35 ILE A HG13 2  
ATOM 1925  H HG21 . ILE A 1 35 ? -0.392  -2.864  2.218   1.00 15.00 ? 35 ILE A HG21 2  
ATOM 1926  H HG22 . ILE A 1 35 ? 0.307   -2.153  3.670   1.00 15.00 ? 35 ILE A HG22 2  
ATOM 1927  H HG23 . ILE A 1 35 ? 1.332   -2.496  2.276   1.00 15.00 ? 35 ILE A HG23 2  
ATOM 1928  H HD11 . ILE A 1 35 ? 2.928   -2.360  4.081   1.00 15.00 ? 35 ILE A HD11 2  
ATOM 1929  H HD12 . ILE A 1 35 ? 1.461   -2.220  5.051   1.00 15.00 ? 35 ILE A HD12 2  
ATOM 1930  H HD13 . ILE A 1 35 ? 2.927   -2.896  5.761   1.00 15.00 ? 35 ILE A HD13 2  
ATOM 1931  N N    . TYR A 1 36 ? -1.254  -3.040  5.439   1.00 15.00 ? 36 TYR A N    2  
ATOM 1932  C CA   . TYR A 1 36 ? -2.105  -1.939  5.849   1.00 15.00 ? 36 TYR A CA   2  
ATOM 1933  C C    . TYR A 1 36 ? -1.253  -0.800  6.378   1.00 15.00 ? 36 TYR A C    2  
ATOM 1934  O O    . TYR A 1 36 ? -0.688  -0.887  7.469   1.00 15.00 ? 36 TYR A O    2  
ATOM 1935  C CB   . TYR A 1 36 ? -3.105  -2.393  6.909   1.00 15.00 ? 36 TYR A CB   2  
ATOM 1936  C CG   . TYR A 1 36 ? -4.117  -3.383  6.387   1.00 15.00 ? 36 TYR A CG   2  
ATOM 1937  C CD1  . TYR A 1 36 ? -3.745  -4.685  6.081   1.00 15.00 ? 36 TYR A CD1  2  
ATOM 1938  C CD2  . TYR A 1 36 ? -5.442  -3.015  6.193   1.00 15.00 ? 36 TYR A CD2  2  
ATOM 1939  C CE1  . TYR A 1 36 ? -4.664  -5.594  5.598   1.00 15.00 ? 36 TYR A CE1  2  
ATOM 1940  C CE2  . TYR A 1 36 ? -6.369  -3.919  5.711   1.00 15.00 ? 36 TYR A CE2  2  
ATOM 1941  C CZ   . TYR A 1 36 ? -5.975  -5.207  5.415   1.00 15.00 ? 36 TYR A CZ   2  
ATOM 1942  O OH   . TYR A 1 36 ? -6.894  -6.112  4.935   1.00 15.00 ? 36 TYR A OH   2  
ATOM 1943  H H    . TYR A 1 36 ? -0.464  -3.261  5.977   1.00 15.00 ? 36 TYR A H    2  
ATOM 1944  H HA   . TYR A 1 36 ? -2.639  -1.596  4.976   1.00 15.00 ? 36 TYR A HA   2  
ATOM 1945  H HB2  . TYR A 1 36 ? -2.572  -2.862  7.723   1.00 15.00 ? 36 TYR A HB2  2  
ATOM 1946  H HB3  . TYR A 1 36 ? -3.642  -1.533  7.282   1.00 15.00 ? 36 TYR A HB3  2  
ATOM 1947  H HD1  . TYR A 1 36 ? -2.718  -4.986  6.227   1.00 15.00 ? 36 TYR A HD1  2  
ATOM 1948  H HD2  . TYR A 1 36 ? -5.746  -2.005  6.424   1.00 15.00 ? 36 TYR A HD2  2  
ATOM 1949  H HE1  . TYR A 1 36 ? -4.353  -6.600  5.366   1.00 15.00 ? 36 TYR A HE1  2  
ATOM 1950  H HE2  . TYR A 1 36 ? -7.394  -3.614  5.568   1.00 15.00 ? 36 TYR A HE2  2  
ATOM 1951  H HH   . TYR A 1 36 ? -7.508  -5.664  4.349   1.00 15.00 ? 36 TYR A HH   2  
ATOM 1952  N N    . VAL A 1 37 ? -1.148  0.258   5.590   1.00 15.00 ? 37 VAL A N    2  
ATOM 1953  C CA   . VAL A 1 37 ? -0.339  1.407   5.977   1.00 15.00 ? 37 VAL A CA   2  
ATOM 1954  C C    . VAL A 1 37 ? -0.765  1.954   7.334   1.00 15.00 ? 37 VAL A C    2  
ATOM 1955  O O    . VAL A 1 37 ? -1.940  1.928   7.688   1.00 15.00 ? 37 VAL A O    2  
ATOM 1956  C CB   . VAL A 1 37 ? -0.369  2.547   4.913   1.00 15.00 ? 37 VAL A CB   2  
ATOM 1957  C CG1  . VAL A 1 37 ? -0.725  2.026   3.534   1.00 15.00 ? 37 VAL A CG1  2  
ATOM 1958  C CG2  . VAL A 1 37 ? -1.306  3.681   5.291   1.00 15.00 ? 37 VAL A CG2  2  
ATOM 1959  H H    . VAL A 1 37 ? -1.612  0.257   4.726   1.00 15.00 ? 37 VAL A H    2  
ATOM 1960  H HA   . VAL A 1 37 ? 0.683   1.063   6.059   1.00 15.00 ? 37 VAL A HA   2  
ATOM 1961  H HB   . VAL A 1 37 ? 0.613   2.955   4.857   1.00 15.00 ? 37 VAL A HB   2  
ATOM 1962  H HG11 . VAL A 1 37 ? -0.085  1.193   3.284   1.00 15.00 ? 37 VAL A HG11 2  
ATOM 1963  H HG12 . VAL A 1 37 ? -1.753  1.706   3.528   1.00 15.00 ? 37 VAL A HG12 2  
ATOM 1964  H HG13 . VAL A 1 37 ? -0.591  2.816   2.809   1.00 15.00 ? 37 VAL A HG13 2  
ATOM 1965  H HG21 . VAL A 1 37 ? -2.319  3.359   5.156   1.00 15.00 ? 37 VAL A HG21 2  
ATOM 1966  H HG22 . VAL A 1 37 ? -1.147  3.963   6.320   1.00 15.00 ? 37 VAL A HG22 2  
ATOM 1967  H HG23 . VAL A 1 37 ? -1.114  4.531   4.654   1.00 15.00 ? 37 VAL A HG23 2  
ATOM 1968  N N    . LYS A 1 38 ? 0.198   2.472   8.079   1.00 15.00 ? 38 LYS A N    2  
ATOM 1969  C CA   . LYS A 1 38 ? -0.085  3.057   9.377   1.00 15.00 ? 38 LYS A CA   2  
ATOM 1970  C C    . LYS A 1 38 ? -0.619  4.467   9.164   1.00 15.00 ? 38 LYS A C    2  
ATOM 1971  O O    . LYS A 1 38 ? -1.652  4.845   9.715   1.00 15.00 ? 38 LYS A O    2  
ATOM 1972  C CB   . LYS A 1 38 ? 1.176   3.043   10.261  1.00 15.00 ? 38 LYS A CB   2  
ATOM 1973  C CG   . LYS A 1 38 ? 1.769   4.412   10.580  1.00 15.00 ? 38 LYS A CG   2  
ATOM 1974  C CD   . LYS A 1 38 ? 2.331   4.448   11.992  1.00 15.00 ? 38 LYS A CD   2  
ATOM 1975  C CE   . LYS A 1 38 ? 1.495   5.334   12.901  1.00 15.00 ? 38 LYS A CE   2  
ATOM 1976  N NZ   . LYS A 1 38 ? 1.798   5.096   14.340  1.00 15.00 ? 38 LYS A NZ   2  
ATOM 1977  H H    . LYS A 1 38 ? 1.112   2.482   7.737   1.00 15.00 ? 38 LYS A H    2  
ATOM 1978  H HA   . LYS A 1 38 ? -0.852  2.461   9.850   1.00 15.00 ? 38 LYS A HA   2  
ATOM 1979  H HB2  . LYS A 1 38 ? 0.929   2.565   11.196  1.00 15.00 ? 38 LYS A HB2  2  
ATOM 1980  H HB3  . LYS A 1 38 ? 1.935   2.456   9.765   1.00 15.00 ? 38 LYS A HB3  2  
ATOM 1981  H HG2  . LYS A 1 38 ? 2.565   4.623   9.882   1.00 15.00 ? 38 LYS A HG2  2  
ATOM 1982  H HG3  . LYS A 1 38 ? 1.002   5.165   10.492  1.00 15.00 ? 38 LYS A HG3  2  
ATOM 1983  H HD2  . LYS A 1 38 ? 2.336   3.445   12.390  1.00 15.00 ? 38 LYS A HD2  2  
ATOM 1984  H HD3  . LYS A 1 38 ? 3.341   4.830   11.958  1.00 15.00 ? 38 LYS A HD3  2  
ATOM 1985  H HE2  . LYS A 1 38 ? 1.701   6.367   12.665  1.00 15.00 ? 38 LYS A HE2  2  
ATOM 1986  H HE3  . LYS A 1 38 ? 0.450   5.125   12.722  1.00 15.00 ? 38 LYS A HE3  2  
ATOM 1987  H HZ1  . LYS A 1 38 ? 1.252   4.283   14.691  1.00 15.00 ? 38 LYS A HZ1  2  
ATOM 1988  H HZ2  . LYS A 1 38 ? 2.812   4.900   14.465  1.00 15.00 ? 38 LYS A HZ2  2  
ATOM 1989  H HZ3  . LYS A 1 38 ? 1.547   5.935   14.901  1.00 15.00 ? 38 LYS A HZ3  2  
ATOM 1990  N N    . ALA A 1 39 ? 0.092   5.228   8.335   1.00 15.00 ? 39 ALA A N    2  
ATOM 1991  C CA   . ALA A 1 39 ? -0.300  6.589   8.005   1.00 15.00 ? 39 ALA A CA   2  
ATOM 1992  C C    . ALA A 1 39 ? 0.588   7.136   6.897   1.00 15.00 ? 39 ALA A C    2  
ATOM 1993  O O    . ALA A 1 39 ? 1.559   6.492   6.509   1.00 15.00 ? 39 ALA A O    2  
ATOM 1994  C CB   . ALA A 1 39 ? -0.245  7.475   9.236   1.00 15.00 ? 39 ALA A CB   2  
ATOM 1995  H H    . ALA A 1 39 ? 0.900   4.854   7.915   1.00 15.00 ? 39 ALA A H    2  
ATOM 1996  H HA   . ALA A 1 39 ? -1.321  6.565   7.651   1.00 15.00 ? 39 ALA A HA   2  
ATOM 1997  H HB1  . ALA A 1 39 ? -1.224  7.514   9.690   1.00 15.00 ? 39 ALA A HB1  2  
ATOM 1998  H HB2  . ALA A 1 39 ? 0.464   7.068   9.940   1.00 15.00 ? 39 ALA A HB2  2  
ATOM 1999  H HB3  . ALA A 1 39 ? 0.060   8.471   8.950   1.00 15.00 ? 39 ALA A HB3  2  
ATOM 2000  N N    . VAL A 1 40 ? 0.269   8.328   6.403   1.00 15.00 ? 40 VAL A N    2  
ATOM 2001  C CA   . VAL A 1 40 ? 1.067   8.950   5.346   1.00 15.00 ? 40 VAL A CA   2  
ATOM 2002  C C    . VAL A 1 40 ? 2.055   9.933   5.961   1.00 15.00 ? 40 VAL A C    2  
ATOM 2003  O O    . VAL A 1 40 ? 1.663   10.965  6.507   1.00 15.00 ? 40 VAL A O    2  
ATOM 2004  C CB   . VAL A 1 40 ? 0.196   9.684   4.297   1.00 15.00 ? 40 VAL A CB   2  
ATOM 2005  C CG1  . VAL A 1 40 ? 0.166   8.908   2.989   1.00 15.00 ? 40 VAL A CG1  2  
ATOM 2006  C CG2  . VAL A 1 40 ? -1.216  9.909   4.814   1.00 15.00 ? 40 VAL A CG2  2  
ATOM 2007  H H    . VAL A 1 40 ? -0.508  8.802   6.764   1.00 15.00 ? 40 VAL A H    2  
ATOM 2008  H HA   . VAL A 1 40 ? 1.618   8.165   4.846   1.00 15.00 ? 40 VAL A HA   2  
ATOM 2009  H HB   . VAL A 1 40 ? 0.641   10.649  4.102   1.00 15.00 ? 40 VAL A HB   2  
ATOM 2010  H HG11 . VAL A 1 40 ? 1.176   8.672   2.688   1.00 15.00 ? 40 VAL A HG11 2  
ATOM 2011  H HG12 . VAL A 1 40 ? -0.393  7.992   3.125   1.00 15.00 ? 40 VAL A HG12 2  
ATOM 2012  H HG13 . VAL A 1 40 ? -0.307  9.508   2.226   1.00 15.00 ? 40 VAL A HG13 2  
ATOM 2013  H HG21 . VAL A 1 40 ? -1.827  10.322  4.026   1.00 15.00 ? 40 VAL A HG21 2  
ATOM 2014  H HG22 . VAL A 1 40 ? -1.632  8.966   5.137   1.00 15.00 ? 40 VAL A HG22 2  
ATOM 2015  H HG23 . VAL A 1 40 ? -1.189  10.595  5.647   1.00 15.00 ? 40 VAL A HG23 2  
ATOM 2016  N N    . ILE A 1 41 ? 3.335   9.581   5.914   1.00 15.00 ? 41 ILE A N    2  
ATOM 2017  C CA   . ILE A 1 41 ? 4.377   10.405  6.513   1.00 15.00 ? 41 ILE A CA   2  
ATOM 2018  C C    . ILE A 1 41 ? 4.760   11.616  5.659   1.00 15.00 ? 41 ILE A C    2  
ATOM 2019  O O    . ILE A 1 41 ? 5.272   11.471  4.547   1.00 15.00 ? 41 ILE A O    2  
ATOM 2020  C CB   . ILE A 1 41 ? 5.626   9.550   6.856   1.00 15.00 ? 41 ILE A CB   2  
ATOM 2021  C CG1  . ILE A 1 41 ? 5.364   8.676   8.091   1.00 15.00 ? 41 ILE A CG1  2  
ATOM 2022  C CG2  . ILE A 1 41 ? 6.853   10.422  7.085   1.00 15.00 ? 41 ILE A CG2  2  
ATOM 2023  C CD1  . ILE A 1 41 ? 3.931   8.203   8.227   1.00 15.00 ? 41 ILE A CD1  2  
ATOM 2024  H H    . ILE A 1 41 ? 3.581   8.729   5.497   1.00 15.00 ? 41 ILE A H    2  
ATOM 2025  H HA   . ILE A 1 41 ? 3.976   10.774  7.429   1.00 15.00 ? 41 ILE A HA   2  
ATOM 2026  H HB   . ILE A 1 41 ? 5.832   8.908   6.019   1.00 15.00 ? 41 ILE A HB   2  
ATOM 2027  H HG12 . ILE A 1 41 ? 5.992   7.799   8.038   1.00 15.00 ? 41 ILE A HG12 2  
ATOM 2028  H HG13 . ILE A 1 41 ? 5.615   9.237   8.979   1.00 15.00 ? 41 ILE A HG13 2  
ATOM 2029  H HG21 . ILE A 1 41 ? 6.542   11.416  7.368   1.00 15.00 ? 41 ILE A HG21 2  
ATOM 2030  H HG22 . ILE A 1 41 ? 7.454   9.993   7.873   1.00 15.00 ? 41 ILE A HG22 2  
ATOM 2031  H HG23 . ILE A 1 41 ? 7.434   10.470  6.175   1.00 15.00 ? 41 ILE A HG23 2  
ATOM 2032  H HD11 . ILE A 1 41 ? 3.293   9.047   8.443   1.00 15.00 ? 41 ILE A HD11 2  
ATOM 2033  H HD12 . ILE A 1 41 ? 3.615   7.740   7.304   1.00 15.00 ? 41 ILE A HD12 2  
ATOM 2034  H HD13 . ILE A 1 41 ? 3.863   7.486   9.031   1.00 15.00 ? 41 ILE A HD13 2  
ATOM 2035  N N    . PRO A 1 42 ? 4.515   12.837  6.199   1.00 15.00 ? 42 PRO A N    2  
ATOM 2036  C CA   . PRO A 1 42 ? 4.825   14.106  5.521   1.00 15.00 ? 42 PRO A CA   2  
ATOM 2037  C C    . PRO A 1 42 ? 6.317   14.287  5.242   1.00 15.00 ? 42 PRO A C    2  
ATOM 2038  O O    . PRO A 1 42 ? 6.931   15.244  5.714   1.00 15.00 ? 42 PRO A O    2  
ATOM 2039  C CB   . PRO A 1 42 ? 4.348   15.179  6.511   1.00 15.00 ? 42 PRO A CB   2  
ATOM 2040  C CG   . PRO A 1 42 ? 3.404   14.478  7.421   1.00 15.00 ? 42 PRO A CG   2  
ATOM 2041  C CD   . PRO A 1 42 ? 3.912   13.072  7.525   1.00 15.00 ? 42 PRO A CD   2  
ATOM 2042  H HA   . PRO A 1 42 ? 4.273   14.204  4.604   1.00 15.00 ? 42 PRO A HA   2  
ATOM 2043  H HB2  . PRO A 1 42 ? 5.195   15.575  7.051   1.00 15.00 ? 42 PRO A HB2  2  
ATOM 2044  H HB3  . PRO A 1 42 ? 3.856   15.975  5.972   1.00 15.00 ? 42 PRO A HB3  2  
ATOM 2045  H HG2  . PRO A 1 42 ? 3.407   14.952  8.391   1.00 15.00 ? 42 PRO A HG2  2  
ATOM 2046  H HG3  . PRO A 1 42 ? 2.410   14.488  6.999   1.00 15.00 ? 42 PRO A HG3  2  
ATOM 2047  H HD2  . PRO A 1 42 ? 4.653   12.994  8.308   1.00 15.00 ? 42 PRO A HD2  2  
ATOM 2048  H HD3  . PRO A 1 42 ? 3.095   12.390  7.704   1.00 15.00 ? 42 PRO A HD3  2  
ATOM 2049  N N    . GLN A 1 43 ? 6.899   13.373  4.473   1.00 15.00 ? 43 GLN A N    2  
ATOM 2050  C CA   . GLN A 1 43 ? 8.315   13.454  4.145   1.00 15.00 ? 43 GLN A CA   2  
ATOM 2051  C C    . GLN A 1 43 ? 8.602   12.895  2.753   1.00 15.00 ? 43 GLN A C    2  
ATOM 2052  O O    . GLN A 1 43 ? 9.315   13.514  1.963   1.00 15.00 ? 43 GLN A O    2  
ATOM 2053  C CB   . GLN A 1 43 ? 9.143   12.703  5.190   1.00 15.00 ? 43 GLN A CB   2  
ATOM 2054  C CG   . GLN A 1 43 ? 9.953   13.616  6.097   1.00 15.00 ? 43 GLN A CG   2  
ATOM 2055  C CD   . GLN A 1 43 ? 11.393  13.165  6.241   1.00 15.00 ? 43 GLN A CD   2  
ATOM 2056  O OE1  . GLN A 1 43 ? 11.714  11.995  6.035   1.00 15.00 ? 43 GLN A OE1  2  
ATOM 2057  N NE2  . GLN A 1 43 ? 12.272  14.096  6.597   1.00 15.00 ? 43 GLN A NE2  2  
ATOM 2058  H H    . GLN A 1 43 ? 6.367   12.630  4.121   1.00 15.00 ? 43 GLN A H    2  
ATOM 2059  H HA   . GLN A 1 43 ? 8.597   14.496  4.163   1.00 15.00 ? 43 GLN A HA   2  
ATOM 2060  H HB2  . GLN A 1 43 ? 8.476   12.119  5.808   1.00 15.00 ? 43 GLN A HB2  2  
ATOM 2061  H HB3  . GLN A 1 43 ? 9.825   12.036  4.684   1.00 15.00 ? 43 GLN A HB3  2  
ATOM 2062  H HG2  . GLN A 1 43 ? 9.943   14.613  5.683   1.00 15.00 ? 43 GLN A HG2  2  
ATOM 2063  H HG3  . GLN A 1 43 ? 9.495   13.628  7.075   1.00 15.00 ? 43 GLN A HG3  2  
ATOM 2064  H HE21 . GLN A 1 43 ? 11.945  15.008  6.745   1.00 15.00 ? 43 GLN A HE21 2  
ATOM 2065  H HE22 . GLN A 1 43 ? 13.210  13.833  6.697   1.00 15.00 ? 43 GLN A HE22 2  
ATOM 2066  N N    . GLY A 1 44 ? 8.062   11.714  2.461   1.00 15.00 ? 44 GLY A N    2  
ATOM 2067  C CA   . GLY A 1 44 ? 8.300   11.096  1.166   1.00 15.00 ? 44 GLY A CA   2  
ATOM 2068  C C    . GLY A 1 44 ? 7.312   11.511  0.092   1.00 15.00 ? 44 GLY A C    2  
ATOM 2069  O O    . GLY A 1 44 ? 6.285   12.129  0.371   1.00 15.00 ? 44 GLY A O    2  
ATOM 2070  H H    . GLY A 1 44 ? 7.509   11.256  3.133   1.00 15.00 ? 44 GLY A H    2  
ATOM 2071  H HA2  . GLY A 1 44 ? 9.291   11.370  0.837   1.00 15.00 ? 44 GLY A HA2  2  
ATOM 2072  H HA3  . GLY A 1 44 ? 8.264   10.027  1.275   1.00 15.00 ? 44 GLY A HA3  2  
ATOM 2073  N N    . ALA A 1 45 ? 7.640   11.149  -1.144  1.00 15.00 ? 45 ALA A N    2  
ATOM 2074  C CA   . ALA A 1 45 ? 6.812   11.465  -2.307  1.00 15.00 ? 45 ALA A CA   2  
ATOM 2075  C C    . ALA A 1 45 ? 5.391   10.920  -2.181  1.00 15.00 ? 45 ALA A C    2  
ATOM 2076  O O    . ALA A 1 45 ? 4.506   11.302  -2.946  1.00 15.00 ? 45 ALA A O    2  
ATOM 2077  C CB   . ALA A 1 45 ? 7.463   10.922  -3.568  1.00 15.00 ? 45 ALA A CB   2  
ATOM 2078  H H    . ALA A 1 45 ? 8.471   10.649  -1.277  1.00 15.00 ? 45 ALA A H    2  
ATOM 2079  H HA   . ALA A 1 45 ? 6.765   12.540  -2.397  1.00 15.00 ? 45 ALA A HA   2  
ATOM 2080  H HB1  . ALA A 1 45 ? 7.134   11.497  -4.421  1.00 15.00 ? 45 ALA A HB1  2  
ATOM 2081  H HB2  . ALA A 1 45 ? 8.537   10.994  -3.477  1.00 15.00 ? 45 ALA A HB2  2  
ATOM 2082  H HB3  . ALA A 1 45 ? 7.182   9.887   -3.700  1.00 15.00 ? 45 ALA A HB3  2  
ATOM 2083  N N    . ALA A 1 46 ? 5.171   10.026  -1.224  1.00 15.00 ? 46 ALA A N    2  
ATOM 2084  C CA   . ALA A 1 46 ? 3.853   9.442   -1.026  1.00 15.00 ? 46 ALA A CA   2  
ATOM 2085  C C    . ALA A 1 46 ? 2.896   10.460  -0.425  1.00 15.00 ? 46 ALA A C    2  
ATOM 2086  O O    . ALA A 1 46 ? 1.849   10.762  -1.007  1.00 15.00 ? 46 ALA A O    2  
ATOM 2087  C CB   . ALA A 1 46 ? 3.950   8.222   -0.125  1.00 15.00 ? 46 ALA A CB   2  
ATOM 2088  H H    . ALA A 1 46 ? 5.908   9.749   -0.646  1.00 15.00 ? 46 ALA A H    2  
ATOM 2089  H HA   . ALA A 1 46 ? 3.476   9.125   -1.987  1.00 15.00 ? 46 ALA A HA   2  
ATOM 2090  H HB1  . ALA A 1 46 ? 4.423   7.414   -0.663  1.00 15.00 ? 46 ALA A HB1  2  
ATOM 2091  H HB2  . ALA A 1 46 ? 4.536   8.467   0.749   1.00 15.00 ? 46 ALA A HB2  2  
ATOM 2092  H HB3  . ALA A 1 46 ? 2.959   7.921   0.180   1.00 15.00 ? 46 ALA A HB3  2  
ATOM 2093  N N    . GLU A 1 47 ? 3.270   10.990  0.738   1.00 15.00 ? 47 GLU A N    2  
ATOM 2094  C CA   . GLU A 1 47 ? 2.459   11.990  1.422   1.00 15.00 ? 47 GLU A CA   2  
ATOM 2095  C C    . GLU A 1 47 ? 2.231   13.200  0.517   1.00 15.00 ? 47 GLU A C    2  
ATOM 2096  O O    . GLU A 1 47 ? 1.129   13.745  0.453   1.00 15.00 ? 47 GLU A O    2  
ATOM 2097  C CB   . GLU A 1 47 ? 3.138   12.440  2.725   1.00 15.00 ? 47 GLU A CB   2  
ATOM 2098  C CG   . GLU A 1 47 ? 4.384   13.271  2.476   1.00 15.00 ? 47 GLU A CG   2  
ATOM 2099  C CD   . GLU A 1 47 ? 4.077   14.742  2.267   1.00 15.00 ? 47 GLU A CD   2  
ATOM 2100  O OE1  . GLU A 1 47 ? 3.085   15.230  2.849   1.00 15.00 ? 47 GLU A OE1  2  
ATOM 2101  O OE2  . GLU A 1 47 ? 4.829   15.406  1.523   1.00 15.00 ? 47 GLU A OE2  2  
ATOM 2102  H H    . GLU A 1 47 ? 4.125   10.714  1.136   1.00 15.00 ? 47 GLU A H    2  
ATOM 2103  H HA   . GLU A 1 47 ? 1.501   11.543  1.651   1.00 15.00 ? 47 GLU A HA   2  
ATOM 2104  H HB2  . GLU A 1 47 ? 2.441   13.039  3.286   1.00 15.00 ? 47 GLU A HB2  2  
ATOM 2105  H HB3  . GLU A 1 47 ? 3.415   11.572  3.324   1.00 15.00 ? 47 GLU A HB3  2  
ATOM 2106  H HG2  . GLU A 1 47 ? 5.038   13.175  3.318   1.00 15.00 ? 47 GLU A HG2  2  
ATOM 2107  H HG3  . GLU A 1 47 ? 4.879   12.896  1.598   1.00 15.00 ? 47 GLU A HG3  2  
ATOM 2108  N N    . SER A 1 48 ? 3.294   13.617  -0.175  1.00 15.00 ? 48 SER A N    2  
ATOM 2109  C CA   . SER A 1 48 ? 3.231   14.768  -1.070  1.00 15.00 ? 48 SER A CA   2  
ATOM 2110  C C    . SER A 1 48 ? 2.102   14.601  -2.072  1.00 15.00 ? 48 SER A C    2  
ATOM 2111  O O    . SER A 1 48 ? 1.073   15.271  -1.979  1.00 15.00 ? 48 SER A O    2  
ATOM 2112  C CB   . SER A 1 48 ? 4.563   14.944  -1.803  1.00 15.00 ? 48 SER A CB   2  
ATOM 2113  O OG   . SER A 1 48 ? 5.028   16.279  -1.703  1.00 15.00 ? 48 SER A OG   2  
ATOM 2114  H H    . SER A 1 48 ? 4.143   13.142  -0.074  1.00 15.00 ? 48 SER A H    2  
ATOM 2115  H HA   . SER A 1 48 ? 3.039   15.645  -0.471  1.00 15.00 ? 48 SER A HA   2  
ATOM 2116  H HB2  . SER A 1 48 ? 5.301   14.287  -1.368  1.00 15.00 ? 48 SER A HB2  2  
ATOM 2117  H HB3  . SER A 1 48 ? 4.434   14.699  -2.847  1.00 15.00 ? 48 SER A HB3  2  
ATOM 2118  H HG   . SER A 1 48 ? 5.944   16.279  -1.414  1.00 15.00 ? 48 SER A HG   2  
ATOM 2119  N N    . ASP A 1 49 ? 2.285   13.688  -3.018  1.00 15.00 ? 49 ASP A N    2  
ATOM 2120  C CA   . ASP A 1 49 ? 1.259   13.427  -4.013  1.00 15.00 ? 49 ASP A CA   2  
ATOM 2121  C C    . ASP A 1 49 ? -0.023  13.008  -3.309  1.00 15.00 ? 49 ASP A C    2  
ATOM 2122  O O    . ASP A 1 49 ? -1.120  13.428  -3.678  1.00 15.00 ? 49 ASP A O    2  
ATOM 2123  C CB   . ASP A 1 49 ? 1.714   12.334  -4.982  1.00 15.00 ? 49 ASP A CB   2  
ATOM 2124  C CG   . ASP A 1 49 ? 2.147   12.895  -6.322  1.00 15.00 ? 49 ASP A CG   2  
ATOM 2125  O OD1  . ASP A 1 49 ? 3.102   13.699  -6.348  1.00 15.00 ? 49 ASP A OD1  2  
ATOM 2126  O OD2  . ASP A 1 49 ? 1.531   12.530  -7.345  1.00 15.00 ? 49 ASP A OD2  2  
ATOM 2127  H H    . ASP A 1 49 ? 3.118   13.169  -3.034  1.00 15.00 ? 49 ASP A H    2  
ATOM 2128  H HA   . ASP A 1 49 ? 1.081   14.339  -4.561  1.00 15.00 ? 49 ASP A HA   2  
ATOM 2129  H HB2  . ASP A 1 49 ? 2.548   11.802  -4.549  1.00 15.00 ? 49 ASP A HB2  2  
ATOM 2130  H HB3  . ASP A 1 49 ? 0.899   11.644  -5.147  1.00 15.00 ? 49 ASP A HB3  2  
ATOM 2131  N N    . GLY A 1 50 ? 0.135   12.181  -2.281  1.00 15.00 ? 50 GLY A N    2  
ATOM 2132  C CA   . GLY A 1 50 ? -1.001  11.716  -1.516  1.00 15.00 ? 50 GLY A CA   2  
ATOM 2133  C C    . GLY A 1 50 ? -1.709  10.570  -2.205  1.00 15.00 ? 50 GLY A C    2  
ATOM 2134  O O    . GLY A 1 50 ? -2.938  10.513  -2.223  1.00 15.00 ? 50 GLY A O    2  
ATOM 2135  H H    . GLY A 1 50 ? 1.039   11.892  -2.034  1.00 15.00 ? 50 GLY A H    2  
ATOM 2136  H HA2  . GLY A 1 50 ? -0.655  11.388  -0.542  1.00 15.00 ? 50 GLY A HA2  2  
ATOM 2137  H HA3  . GLY A 1 50 ? -1.696  12.532  -1.387  1.00 15.00 ? 50 GLY A HA3  2  
ATOM 2138  N N    . ARG A 1 51 ? -0.934  9.660   -2.784  1.00 15.00 ? 51 ARG A N    2  
ATOM 2139  C CA   . ARG A 1 51 ? -1.511  8.518   -3.489  1.00 15.00 ? 51 ARG A CA   2  
ATOM 2140  C C    . ARG A 1 51 ? -1.936  7.437   -2.506  1.00 15.00 ? 51 ARG A C    2  
ATOM 2141  O O    . ARG A 1 51 ? -3.052  6.922   -2.576  1.00 15.00 ? 51 ARG A O    2  
ATOM 2142  C CB   . ARG A 1 51 ? -0.519  7.945   -4.505  1.00 15.00 ? 51 ARG A CB   2  
ATOM 2143  C CG   . ARG A 1 51 ? -0.438  8.744   -5.795  1.00 15.00 ? 51 ARG A CG   2  
ATOM 2144  C CD   . ARG A 1 51 ? -1.496  8.301   -6.795  1.00 15.00 ? 51 ARG A CD   2  
ATOM 2145  N NE   . ARG A 1 51 ? -2.518  9.325   -6.999  1.00 15.00 ? 51 ARG A NE   2  
ATOM 2146  C CZ   . ARG A 1 51 ? -3.328  9.363   -8.054  1.00 15.00 ? 51 ARG A CZ   2  
ATOM 2147  N NH1  . ARG A 1 51 ? -3.240  8.438   -9.001  1.00 15.00 ? 51 ARG A NH1  2  
ATOM 2148  N NH2  . ARG A 1 51 ? -4.230  10.329  -8.162  1.00 15.00 ? 51 ARG A NH2  2  
ATOM 2149  H H    . ARG A 1 51 ? 0.045   9.763   -2.741  1.00 15.00 ? 51 ARG A H    2  
ATOM 2150  H HA   . ARG A 1 51 ? -2.386  8.868   -4.016  1.00 15.00 ? 51 ARG A HA   2  
ATOM 2151  H HB2  . ARG A 1 51 ? 0.466   7.916   -4.062  1.00 15.00 ? 51 ARG A HB2  2  
ATOM 2152  H HB3  . ARG A 1 51 ? -0.822  6.939   -4.751  1.00 15.00 ? 51 ARG A HB3  2  
ATOM 2153  H HG2  . ARG A 1 51 ? -0.586  9.789   -5.570  1.00 15.00 ? 51 ARG A HG2  2  
ATOM 2154  H HG3  . ARG A 1 51 ? 0.538   8.602   -6.233  1.00 15.00 ? 51 ARG A HG3  2  
ATOM 2155  H HD2  . ARG A 1 51 ? -1.015  8.094   -7.739  1.00 15.00 ? 51 ARG A HD2  2  
ATOM 2156  H HD3  . ARG A 1 51 ? -1.968  7.402   -6.427  1.00 15.00 ? 51 ARG A HD3  2  
ATOM 2157  H HE   . ARG A 1 51 ? -2.605  10.021  -6.314  1.00 15.00 ? 51 ARG A HE   2  
ATOM 2158  H HH11 . ARG A 1 51 ? -2.562  7.707   -8.925  1.00 15.00 ? 51 ARG A HH11 2  
ATOM 2159  H HH12 . ARG A 1 51 ? -3.852  8.472   -9.791  1.00 15.00 ? 51 ARG A HH12 2  
ATOM 2160  H HH21 . ARG A 1 51 ? -4.302  11.029  -7.451  1.00 15.00 ? 51 ARG A HH21 2  
ATOM 2161  H HH22 . ARG A 1 51 ? -4.839  10.358  -8.955  1.00 15.00 ? 51 ARG A HH22 2  
ATOM 2162  N N    . ILE A 1 52 ? -1.043  7.104   -1.586  1.00 15.00 ? 52 ILE A N    2  
ATOM 2163  C CA   . ILE A 1 52 ? -1.320  6.096   -0.582  1.00 15.00 ? 52 ILE A CA   2  
ATOM 2164  C C    . ILE A 1 52 ? -2.139  6.698   0.562   1.00 15.00 ? 52 ILE A C    2  
ATOM 2165  O O    . ILE A 1 52 ? -2.204  7.918   0.708   1.00 15.00 ? 52 ILE A O    2  
ATOM 2166  C CB   . ILE A 1 52 ? -0.004  5.502   -0.046  1.00 15.00 ? 52 ILE A CB   2  
ATOM 2167  C CG1  . ILE A 1 52 ? -0.279  4.260   0.795   1.00 15.00 ? 52 ILE A CG1  2  
ATOM 2168  C CG2  . ILE A 1 52 ? 0.768   6.542   0.752   1.00 15.00 ? 52 ILE A CG2  2  
ATOM 2169  C CD1  . ILE A 1 52 ? -1.033  3.186   0.047   1.00 15.00 ? 52 ILE A CD1  2  
ATOM 2170  H H    . ILE A 1 52 ? -0.174  7.552   -1.577  1.00 15.00 ? 52 ILE A H    2  
ATOM 2171  H HA   . ILE A 1 52 ? -1.892  5.303   -1.046  1.00 15.00 ? 52 ILE A HA   2  
ATOM 2172  H HB   . ILE A 1 52 ? 0.603   5.221   -0.894  1.00 15.00 ? 52 ILE A HB   2  
ATOM 2173  H HG12 . ILE A 1 52 ? 0.659   3.839   1.116   1.00 15.00 ? 52 ILE A HG12 2  
ATOM 2174  H HG13 . ILE A 1 52 ? -0.862  4.540   1.658   1.00 15.00 ? 52 ILE A HG13 2  
ATOM 2175  H HG21 . ILE A 1 52 ? 0.128   6.957   1.514   1.00 15.00 ? 52 ILE A HG21 2  
ATOM 2176  H HG22 . ILE A 1 52 ? 1.627   6.079   1.214   1.00 15.00 ? 52 ILE A HG22 2  
ATOM 2177  H HG23 . ILE A 1 52 ? 1.096   7.330   0.090   1.00 15.00 ? 52 ILE A HG23 2  
ATOM 2178  H HD11 . ILE A 1 52 ? -2.085  3.261   0.274   1.00 15.00 ? 52 ILE A HD11 2  
ATOM 2179  H HD12 . ILE A 1 52 ? -0.884  3.315   -1.014  1.00 15.00 ? 52 ILE A HD12 2  
ATOM 2180  H HD13 . ILE A 1 52 ? -0.668  2.215   0.347   1.00 15.00 ? 52 ILE A HD13 2  
ATOM 2181  N N    . HIS A 1 53 ? -2.776  5.845   1.359   1.00 15.00 ? 53 HIS A N    2  
ATOM 2182  C CA   . HIS A 1 53 ? -3.601  6.316   2.468   1.00 15.00 ? 53 HIS A CA   2  
ATOM 2183  C C    . HIS A 1 53 ? -3.579  5.357   3.639   1.00 15.00 ? 53 HIS A C    2  
ATOM 2184  O O    . HIS A 1 53 ? -3.267  4.176   3.499   1.00 15.00 ? 53 HIS A O    2  
ATOM 2185  C CB   . HIS A 1 53 ? -5.040  6.545   2.002   1.00 15.00 ? 53 HIS A CB   2  
ATOM 2186  C CG   . HIS A 1 53 ? -5.186  7.697   1.056   1.00 15.00 ? 53 HIS A CG   2  
ATOM 2187  N ND1  . HIS A 1 53 ? -5.056  7.569   -0.311  1.00 15.00 ? 53 HIS A ND1  2  
ATOM 2188  C CD2  . HIS A 1 53 ? -5.453  9.004   1.287   1.00 15.00 ? 53 HIS A CD2  2  
ATOM 2189  C CE1  . HIS A 1 53 ? -5.235  8.748   -0.880  1.00 15.00 ? 53 HIS A CE1  2  
ATOM 2190  N NE2  . HIS A 1 53 ? -5.478  9.635   0.067   1.00 15.00 ? 53 HIS A NE2  2  
ATOM 2191  H H    . HIS A 1 53 ? -2.700  4.886   1.192   1.00 15.00 ? 53 HIS A H    2  
ATOM 2192  H HA   . HIS A 1 53 ? -3.193  7.252   2.812   1.00 15.00 ? 53 HIS A HA   2  
ATOM 2193  H HB2  . HIS A 1 53 ? -5.394  5.657   1.501   1.00 15.00 ? 53 HIS A HB2  2  
ATOM 2194  H HB3  . HIS A 1 53 ? -5.663  6.739   2.863   1.00 15.00 ? 53 HIS A HB3  2  
ATOM 2195  H HD1  . HIS A 1 53 ? -4.861  6.738   -0.792  1.00 15.00 ? 53 HIS A HD1  2  
ATOM 2196  H HD2  . HIS A 1 53 ? -5.616  9.465   2.251   1.00 15.00 ? 53 HIS A HD2  2  
ATOM 2197  H HE1  . HIS A 1 53 ? -5.192  8.951   -1.940  1.00 15.00 ? 53 HIS A HE1  2  
ATOM 2198  H HE2  . HIS A 1 53 ? -5.551  10.603  -0.071  1.00 15.00 ? 53 HIS A HE2  2  
ATOM 2199  N N    . LYS A 1 54 ? -3.896  5.908   4.802   1.00 15.00 ? 54 LYS A N    2  
ATOM 2200  C CA   . LYS A 1 54 ? -3.905  5.169   6.052   1.00 15.00 ? 54 LYS A CA   2  
ATOM 2201  C C    . LYS A 1 54 ? -4.528  3.776   5.920   1.00 15.00 ? 54 LYS A C    2  
ATOM 2202  O O    . LYS A 1 54 ? -5.613  3.616   5.360   1.00 15.00 ? 54 LYS A O    2  
ATOM 2203  C CB   . LYS A 1 54 ? -4.653  5.969   7.122   1.00 15.00 ? 54 LYS A CB   2  
ATOM 2204  C CG   . LYS A 1 54 ? -3.746  6.555   8.189   1.00 15.00 ? 54 LYS A CG   2  
ATOM 2205  C CD   . LYS A 1 54 ? -4.506  6.830   9.477   1.00 15.00 ? 54 LYS A CD   2  
ATOM 2206  C CE   . LYS A 1 54 ? -4.618  5.580   10.334  1.00 15.00 ? 54 LYS A CE   2  
ATOM 2207  N NZ   . LYS A 1 54 ? -5.976  4.974   10.257  1.00 15.00 ? 54 LYS A NZ   2  
ATOM 2208  H H    . LYS A 1 54 ? -4.114  6.862   4.823   1.00 15.00 ? 54 LYS A H    2  
ATOM 2209  H HA   . LYS A 1 54 ? -2.878  5.066   6.353   1.00 15.00 ? 54 LYS A HA   2  
ATOM 2210  H HB2  . LYS A 1 54 ? -5.179  6.782   6.644   1.00 15.00 ? 54 LYS A HB2  2  
ATOM 2211  H HB3  . LYS A 1 54 ? -5.370  5.323   7.606   1.00 15.00 ? 54 LYS A HB3  2  
ATOM 2212  H HG2  . LYS A 1 54 ? -2.953  5.856   8.394   1.00 15.00 ? 54 LYS A HG2  2  
ATOM 2213  H HG3  . LYS A 1 54 ? -3.327  7.482   7.823   1.00 15.00 ? 54 LYS A HG3  2  
ATOM 2214  H HD2  . LYS A 1 54 ? -3.984  7.592   10.036  1.00 15.00 ? 54 LYS A HD2  2  
ATOM 2215  H HD3  . LYS A 1 54 ? -5.498  7.177   9.230   1.00 15.00 ? 54 LYS A HD3  2  
ATOM 2216  H HE2  . LYS A 1 54 ? -3.891  4.857   9.993   1.00 15.00 ? 54 LYS A HE2  2  
ATOM 2217  H HE3  . LYS A 1 54 ? -4.408  5.843   11.361  1.00 15.00 ? 54 LYS A HE3  2  
ATOM 2218  H HZ1  . LYS A 1 54 ? -6.571  5.329   11.034  1.00 15.00 ? 54 LYS A HZ1  2  
ATOM 2219  H HZ2  . LYS A 1 54 ? -6.426  5.218   9.352   1.00 15.00 ? 54 LYS A HZ2  2  
ATOM 2220  H HZ3  . LYS A 1 54 ? -5.910  3.938   10.331  1.00 15.00 ? 54 LYS A HZ3  2  
ATOM 2221  N N    . GLY A 1 55 ? -3.829  2.777   6.460   1.00 15.00 ? 55 GLY A N    2  
ATOM 2222  C CA   . GLY A 1 55 ? -4.311  1.405   6.422   1.00 15.00 ? 55 GLY A CA   2  
ATOM 2223  C C    . GLY A 1 55 ? -4.731  0.954   5.041   1.00 15.00 ? 55 GLY A C    2  
ATOM 2224  O O    . GLY A 1 55 ? -5.617  0.111   4.903   1.00 15.00 ? 55 GLY A O    2  
ATOM 2225  H H    . GLY A 1 55 ? -2.971  2.976   6.899   1.00 15.00 ? 55 GLY A H    2  
ATOM 2226  H HA2  . GLY A 1 55 ? -3.526  0.750   6.771   1.00 15.00 ? 55 GLY A HA2  2  
ATOM 2227  H HA3  . GLY A 1 55 ? -5.157  1.316   7.088   1.00 15.00 ? 55 GLY A HA3  2  
ATOM 2228  N N    . ASP A 1 56 ? -4.095  1.502   4.014   1.00 15.00 ? 56 ASP A N    2  
ATOM 2229  C CA   . ASP A 1 56 ? -4.424  1.122   2.646   1.00 15.00 ? 56 ASP A CA   2  
ATOM 2230  C C    . ASP A 1 56 ? -4.055  -0.336  2.391   1.00 15.00 ? 56 ASP A C    2  
ATOM 2231  O O    . ASP A 1 56 ? -2.935  -0.761  2.681   1.00 15.00 ? 56 ASP A O    2  
ATOM 2232  C CB   . ASP A 1 56 ? -3.716  2.037   1.647   1.00 15.00 ? 56 ASP A CB   2  
ATOM 2233  C CG   . ASP A 1 56 ? -4.556  3.244   1.280   1.00 15.00 ? 56 ASP A CG   2  
ATOM 2234  O OD1  . ASP A 1 56 ? -5.641  3.417   1.875   1.00 15.00 ? 56 ASP A OD1  2  
ATOM 2235  O OD2  . ASP A 1 56 ? -4.131  4.018   0.398   1.00 15.00 ? 56 ASP A OD2  2  
ATOM 2236  H H    . ASP A 1 56 ? -3.384  2.165   4.178   1.00 15.00 ? 56 ASP A H    2  
ATOM 2237  H HA   . ASP A 1 56 ? -5.493  1.232   2.524   1.00 15.00 ? 56 ASP A HA   2  
ATOM 2238  H HB2  . ASP A 1 56 ? -2.789  2.384   2.077   1.00 15.00 ? 56 ASP A HB2  2  
ATOM 2239  H HB3  . ASP A 1 56 ? -3.504  1.480   0.746   1.00 15.00 ? 56 ASP A HB3  2  
ATOM 2240  N N    . ARG A 1 57 ? -5.005  -1.098  1.851   1.00 15.00 ? 57 ARG A N    2  
ATOM 2241  C CA   . ARG A 1 57 ? -4.784  -2.510  1.557   1.00 15.00 ? 57 ARG A CA   2  
ATOM 2242  C C    . ARG A 1 57 ? -4.032  -2.679  0.242   1.00 15.00 ? 57 ARG A C    2  
ATOM 2243  O O    . ARG A 1 57 ? -4.634  -2.662  -0.831  1.00 15.00 ? 57 ARG A O    2  
ATOM 2244  C CB   . ARG A 1 57 ? -6.120  -3.253  1.483   1.00 15.00 ? 57 ARG A CB   2  
ATOM 2245  C CG   . ARG A 1 57 ? -6.909  -3.227  2.782   1.00 15.00 ? 57 ARG A CG   2  
ATOM 2246  C CD   . ARG A 1 57 ? -8.392  -3.001  2.528   1.00 15.00 ? 57 ARG A CD   2  
ATOM 2247  N NE   . ARG A 1 57 ? -9.181  -3.104  3.754   1.00 15.00 ? 57 ARG A NE   2  
ATOM 2248  C CZ   . ARG A 1 57 ? -9.759  -4.227  4.178   1.00 15.00 ? 57 ARG A CZ   2  
ATOM 2249  N NH1  . ARG A 1 57 ? -9.634  -5.352  3.484   1.00 15.00 ? 57 ARG A NH1  2  
ATOM 2250  N NH2  . ARG A 1 57 ? -10.461 -4.226  5.303   1.00 15.00 ? 57 ARG A NH2  2  
ATOM 2251  H H    . ARG A 1 57 ? -5.877  -0.700  1.647   1.00 15.00 ? 57 ARG A H    2  
ATOM 2252  H HA   . ARG A 1 57 ? -4.191  -2.931  2.355   1.00 15.00 ? 57 ARG A HA   2  
ATOM 2253  H HB2  . ARG A 1 57 ? -6.725  -2.803  0.711   1.00 15.00 ? 57 ARG A HB2  2  
ATOM 2254  H HB3  . ARG A 1 57 ? -5.931  -4.284  1.224   1.00 15.00 ? 57 ARG A HB3  2  
ATOM 2255  H HG2  . ARG A 1 57 ? -6.781  -4.172  3.288   1.00 15.00 ? 57 ARG A HG2  2  
ATOM 2256  H HG3  . ARG A 1 57 ? -6.533  -2.429  3.405   1.00 15.00 ? 57 ARG A HG3  2  
ATOM 2257  H HD2  . ARG A 1 57 ? -8.524  -2.015  2.109   1.00 15.00 ? 57 ARG A HD2  2  
ATOM 2258  H HD3  . ARG A 1 57 ? -8.740  -3.738  1.822   1.00 15.00 ? 57 ARG A HD3  2  
ATOM 2259  H HE   . ARG A 1 57 ? -9.289  -2.291  4.291   1.00 15.00 ? 57 ARG A HE   2  
ATOM 2260  H HH11 . ARG A 1 57 ? -9.105  -5.363  2.637   1.00 15.00 ? 57 ARG A HH11 2  
ATOM 2261  H HH12 . ARG A 1 57 ? -10.072 -6.190  3.810   1.00 15.00 ? 57 ARG A HH12 2  
ATOM 2262  H HH21 . ARG A 1 57 ? -10.557 -3.382  5.831   1.00 15.00 ? 57 ARG A HH21 2  
ATOM 2263  H HH22 . ARG A 1 57 ? -10.895 -5.068  5.622   1.00 15.00 ? 57 ARG A HH22 2  
ATOM 2264  N N    . VAL A 1 58 ? -2.717  -2.846  0.327   1.00 15.00 ? 58 VAL A N    2  
ATOM 2265  C CA   . VAL A 1 58 ? -1.900  -3.020  -0.867  1.00 15.00 ? 58 VAL A CA   2  
ATOM 2266  C C    . VAL A 1 58 ? -1.843  -4.491  -1.274  1.00 15.00 ? 58 VAL A C    2  
ATOM 2267  O O    . VAL A 1 58 ? -1.311  -5.334  -0.545  1.00 15.00 ? 58 VAL A O    2  
ATOM 2268  C CB   . VAL A 1 58 ? -0.471  -2.452  -0.675  1.00 15.00 ? 58 VAL A CB   2  
ATOM 2269  C CG1  . VAL A 1 58 ? -0.511  -1.172  0.147   1.00 15.00 ? 58 VAL A CG1  2  
ATOM 2270  C CG2  . VAL A 1 58 ? 0.455   -3.473  -0.027  1.00 15.00 ? 58 VAL A CG2  2  
ATOM 2271  H H    . VAL A 1 58 ? -2.289  -2.855  1.209   1.00 15.00 ? 58 VAL A H    2  
ATOM 2272  H HA   . VAL A 1 58 ? -2.376  -2.467  -1.664  1.00 15.00 ? 58 VAL A HA   2  
ATOM 2273  H HB   . VAL A 1 58 ? -0.075  -2.207  -1.650  1.00 15.00 ? 58 VAL A HB   2  
ATOM 2274  H HG11 . VAL A 1 58 ? -0.991  -1.366  1.096   1.00 15.00 ? 58 VAL A HG11 2  
ATOM 2275  H HG12 . VAL A 1 58 ? 0.496   -0.823  0.319   1.00 15.00 ? 58 VAL A HG12 2  
ATOM 2276  H HG13 . VAL A 1 58 ? -1.067  -0.417  -0.389  1.00 15.00 ? 58 VAL A HG13 2  
ATOM 2277  H HG21 . VAL A 1 58 ? 1.300   -2.963  0.411   1.00 15.00 ? 58 VAL A HG21 2  
ATOM 2278  H HG22 . VAL A 1 58 ? -0.081  -4.009  0.742   1.00 15.00 ? 58 VAL A HG22 2  
ATOM 2279  H HG23 . VAL A 1 58 ? 0.803   -4.169  -0.775  1.00 15.00 ? 58 VAL A HG23 2  
ATOM 2280  N N    . LEU A 1 59 ? -2.422  -4.794  -2.433  1.00 15.00 ? 59 LEU A N    2  
ATOM 2281  C CA   . LEU A 1 59 ? -2.461  -6.163  -2.936  1.00 15.00 ? 59 LEU A CA   2  
ATOM 2282  C C    . LEU A 1 59 ? -1.508  -6.379  -4.111  1.00 15.00 ? 59 LEU A C    2  
ATOM 2283  O O    . LEU A 1 59 ? -1.212  -7.518  -4.467  1.00 15.00 ? 59 LEU A O    2  
ATOM 2284  C CB   . LEU A 1 59 ? -3.886  -6.528  -3.356  1.00 15.00 ? 59 LEU A CB   2  
ATOM 2285  C CG   . LEU A 1 59 ? -4.935  -6.445  -2.245  1.00 15.00 ? 59 LEU A CG   2  
ATOM 2286  C CD1  . LEU A 1 59 ? -6.224  -7.123  -2.683  1.00 15.00 ? 59 LEU A CD1  2  
ATOM 2287  C CD2  . LEU A 1 59 ? -4.411  -7.074  -0.961  1.00 15.00 ? 59 LEU A CD2  2  
ATOM 2288  H H    . LEU A 1 59 ? -2.844  -4.080  -2.956  1.00 15.00 ? 59 LEU A H    2  
ATOM 2289  H HA   . LEU A 1 59 ? -2.162  -6.815  -2.129  1.00 15.00 ? 59 LEU A HA   2  
ATOM 2290  H HB2  . LEU A 1 59 ? -4.184  -5.864  -4.154  1.00 15.00 ? 59 LEU A HB2  2  
ATOM 2291  H HB3  . LEU A 1 59 ? -3.878  -7.539  -3.736  1.00 15.00 ? 59 LEU A HB3  2  
ATOM 2292  H HG   . LEU A 1 59 ? -5.156  -5.407  -2.044  1.00 15.00 ? 59 LEU A HG   2  
ATOM 2293  H HD11 . LEU A 1 59 ? -6.003  -7.859  -3.442  1.00 15.00 ? 59 LEU A HD11 2  
ATOM 2294  H HD12 . LEU A 1 59 ? -6.683  -7.608  -1.834  1.00 15.00 ? 59 LEU A HD12 2  
ATOM 2295  H HD13 . LEU A 1 59 ? -6.901  -6.383  -3.084  1.00 15.00 ? 59 LEU A HD13 2  
ATOM 2296  H HD21 . LEU A 1 59 ? -5.213  -7.599  -0.463  1.00 15.00 ? 59 LEU A HD21 2  
ATOM 2297  H HD22 . LEU A 1 59 ? -3.619  -7.769  -1.199  1.00 15.00 ? 59 LEU A HD22 2  
ATOM 2298  H HD23 . LEU A 1 59 ? -4.029  -6.300  -0.311  1.00 15.00 ? 59 LEU A HD23 2  
ATOM 2299  N N    . ALA A 1 60 ? -1.046  -5.296  -4.730  1.00 15.00 ? 60 ALA A N    2  
ATOM 2300  C CA   . ALA A 1 60 ? -0.150  -5.418  -5.877  1.00 15.00 ? 60 ALA A CA   2  
ATOM 2301  C C    . ALA A 1 60 ? 0.843   -4.263  -5.968  1.00 15.00 ? 60 ALA A C    2  
ATOM 2302  O O    . ALA A 1 60 ? 0.536   -3.127  -5.609  1.00 15.00 ? 60 ALA A O    2  
ATOM 2303  C CB   . ALA A 1 60 ? -0.964  -5.513  -7.159  1.00 15.00 ? 60 ALA A CB   2  
ATOM 2304  H H    . ALA A 1 60 ? -1.322  -4.407  -4.424  1.00 15.00 ? 60 ALA A H    2  
ATOM 2305  H HA   . ALA A 1 60 ? 0.401   -6.340  -5.772  1.00 15.00 ? 60 ALA A HA   2  
ATOM 2306  H HB1  . ALA A 1 60 ? -1.009  -6.544  -7.480  1.00 15.00 ? 60 ALA A HB1  2  
ATOM 2307  H HB2  . ALA A 1 60 ? -1.964  -5.148  -6.978  1.00 15.00 ? 60 ALA A HB2  2  
ATOM 2308  H HB3  . ALA A 1 60 ? -0.496  -4.916  -7.929  1.00 15.00 ? 60 ALA A HB3  2  
ATOM 2309  N N    . VAL A 1 61 ? 2.030   -4.573  -6.479  1.00 15.00 ? 61 VAL A N    2  
ATOM 2310  C CA   . VAL A 1 61 ? 3.089   -3.587  -6.662  1.00 15.00 ? 61 VAL A CA   2  
ATOM 2311  C C    . VAL A 1 61 ? 3.773   -3.832  -7.995  1.00 15.00 ? 61 VAL A C    2  
ATOM 2312  O O    . VAL A 1 61 ? 4.578   -4.754  -8.128  1.00 15.00 ? 61 VAL A O    2  
ATOM 2313  C CB   . VAL A 1 61 ? 4.138   -3.650  -5.537  1.00 15.00 ? 61 VAL A CB   2  
ATOM 2314  C CG1  . VAL A 1 61 ? 5.109   -2.485  -5.647  1.00 15.00 ? 61 VAL A CG1  2  
ATOM 2315  C CG2  . VAL A 1 61 ? 3.461   -3.665  -4.178  1.00 15.00 ? 61 VAL A CG2  2  
ATOM 2316  H H    . VAL A 1 61 ? 2.196   -5.499  -6.761  1.00 15.00 ? 61 VAL A H    2  
ATOM 2317  H HA   . VAL A 1 61 ? 2.641   -2.604  -6.668  1.00 15.00 ? 61 VAL A HA   2  
ATOM 2318  H HB   . VAL A 1 61 ? 4.700   -4.564  -5.646  1.00 15.00 ? 61 VAL A HB   2  
ATOM 2319  H HG11 . VAL A 1 61 ? 4.680   -1.715  -6.271  1.00 15.00 ? 61 VAL A HG11 2  
ATOM 2320  H HG12 . VAL A 1 61 ? 5.303   -2.085  -4.664  1.00 15.00 ? 61 VAL A HG12 2  
ATOM 2321  H HG13 . VAL A 1 61 ? 6.035   -2.829  -6.084  1.00 15.00 ? 61 VAL A HG13 2  
ATOM 2322  H HG21 . VAL A 1 61 ? 3.971   -2.983  -3.515  1.00 15.00 ? 61 VAL A HG21 2  
ATOM 2323  H HG22 . VAL A 1 61 ? 2.431   -3.360  -4.287  1.00 15.00 ? 61 VAL A HG22 2  
ATOM 2324  H HG23 . VAL A 1 61 ? 3.499   -4.664  -3.769  1.00 15.00 ? 61 VAL A HG23 2  
ATOM 2325  N N    . ASN A 1 62 ? 3.420   -3.032  -8.993  1.00 15.00 ? 62 ASN A N    2  
ATOM 2326  C CA   . ASN A 1 62 ? 3.976   -3.200  -10.326 1.00 15.00 ? 62 ASN A CA   2  
ATOM 2327  C C    . ASN A 1 62 ? 3.525   -4.540  -10.908 1.00 15.00 ? 62 ASN A C    2  
ATOM 2328  O O    . ASN A 1 62 ? 4.089   -5.027  -11.889 1.00 15.00 ? 62 ASN A O    2  
ATOM 2329  C CB   . ASN A 1 62 ? 5.505   -3.118  -10.291 1.00 15.00 ? 62 ASN A CB   2  
ATOM 2330  C CG   . ASN A 1 62 ? 6.012   -1.705  -10.507 1.00 15.00 ? 62 ASN A CG   2  
ATOM 2331  O OD1  . ASN A 1 62 ? 6.850   -1.460  -11.374 1.00 15.00 ? 62 ASN A OD1  2  
ATOM 2332  N ND2  . ASN A 1 62 ? 5.503   -0.766  -9.716  1.00 15.00 ? 62 ASN A ND2  2  
ATOM 2333  H H    . ASN A 1 62 ? 2.752   -2.332  -8.836  1.00 15.00 ? 62 ASN A H    2  
ATOM 2334  H HA   . ASN A 1 62 ? 3.593   -2.404  -10.947 1.00 15.00 ? 62 ASN A HA   2  
ATOM 2335  H HB2  . ASN A 1 62 ? 5.857   -3.464  -9.331  1.00 15.00 ? 62 ASN A HB2  2  
ATOM 2336  H HB3  . ASN A 1 62 ? 5.910   -3.750  -11.068 1.00 15.00 ? 62 ASN A HB3  2  
ATOM 2337  H HD21 . ASN A 1 62 ? 4.839   -1.033  -9.047  1.00 15.00 ? 62 ASN A HD21 2  
ATOM 2338  H HD22 . ASN A 1 62 ? 5.813   0.156   -9.835  1.00 15.00 ? 62 ASN A HD22 2  
ATOM 2339  N N    . GLY A 1 63 ? 2.494   -5.128  -10.293 1.00 15.00 ? 63 GLY A N    2  
ATOM 2340  C CA   . GLY A 1 63 ? 1.966   -6.399  -10.752 1.00 15.00 ? 63 GLY A CA   2  
ATOM 2341  C C    . GLY A 1 63 ? 2.313   -7.563  -9.840  1.00 15.00 ? 63 GLY A C    2  
ATOM 2342  O O    . GLY A 1 63 ? 1.994   -8.710  -10.150 1.00 15.00 ? 63 GLY A O    2  
ATOM 2343  H H    . GLY A 1 63 ? 2.083   -4.688  -9.521  1.00 15.00 ? 63 GLY A H    2  
ATOM 2344  H HA2  . GLY A 1 63 ? 0.890   -6.320  -10.806 1.00 15.00 ? 63 GLY A HA2  2  
ATOM 2345  H HA3  . GLY A 1 63 ? 2.352   -6.601  -11.740 1.00 15.00 ? 63 GLY A HA3  2  
ATOM 2346  N N    . VAL A 1 64 ? 2.958   -7.278  -8.711  1.00 15.00 ? 64 VAL A N    2  
ATOM 2347  C CA   . VAL A 1 64 ? 3.327   -8.328  -7.768  1.00 15.00 ? 64 VAL A CA   2  
ATOM 2348  C C    . VAL A 1 64 ? 2.262   -8.495  -6.683  1.00 15.00 ? 64 VAL A C    2  
ATOM 2349  O O    . VAL A 1 64 ? 2.111   -7.643  -5.808  1.00 15.00 ? 64 VAL A O    2  
ATOM 2350  C CB   . VAL A 1 64 ? 4.705   -8.054  -7.121  1.00 15.00 ? 64 VAL A CB   2  
ATOM 2351  C CG1  . VAL A 1 64 ? 4.617   -6.968  -6.060  1.00 15.00 ? 64 VAL A CG1  2  
ATOM 2352  C CG2  . VAL A 1 64 ? 5.282   -9.334  -6.536  1.00 15.00 ? 64 VAL A CG2  2  
ATOM 2353  H H    . VAL A 1 64 ? 3.185   -6.348  -8.507  1.00 15.00 ? 64 VAL A H    2  
ATOM 2354  H HA   . VAL A 1 64 ? 3.397   -9.253  -8.323  1.00 15.00 ? 64 VAL A HA   2  
ATOM 2355  H HB   . VAL A 1 64 ? 5.374   -7.708  -7.893  1.00 15.00 ? 64 VAL A HB   2  
ATOM 2356  H HG11 . VAL A 1 64 ? 3.966   -6.181  -6.406  1.00 15.00 ? 64 VAL A HG11 2  
ATOM 2357  H HG12 . VAL A 1 64 ? 4.221   -7.388  -5.147  1.00 15.00 ? 64 VAL A HG12 2  
ATOM 2358  H HG13 . VAL A 1 64 ? 5.602   -6.565  -5.874  1.00 15.00 ? 64 VAL A HG13 2  
ATOM 2359  H HG21 . VAL A 1 64 ? 4.945   -9.448  -5.517  1.00 15.00 ? 64 VAL A HG21 2  
ATOM 2360  H HG22 . VAL A 1 64 ? 4.950   -10.179 -7.122  1.00 15.00 ? 64 VAL A HG22 2  
ATOM 2361  H HG23 . VAL A 1 64 ? 6.360   -9.285  -6.555  1.00 15.00 ? 64 VAL A HG23 2  
ATOM 2362  N N    . SER A 1 65 ? 1.522   -9.597  -6.749  1.00 15.00 ? 65 SER A N    2  
ATOM 2363  C CA   . SER A 1 65 ? 0.470   -9.871  -5.775  1.00 15.00 ? 65 SER A CA   2  
ATOM 2364  C C    . SER A 1 65 ? 1.028   -9.876  -4.354  1.00 15.00 ? 65 SER A C    2  
ATOM 2365  O O    . SER A 1 65 ? 2.107   -10.410 -4.102  1.00 15.00 ? 65 SER A O    2  
ATOM 2366  C CB   . SER A 1 65 ? -0.197  -11.213 -6.078  1.00 15.00 ? 65 SER A CB   2  
ATOM 2367  O OG   . SER A 1 65 ? -0.933  -11.156 -7.287  1.00 15.00 ? 65 SER A OG   2  
ATOM 2368  H H    . SER A 1 65 ? 1.685   -10.239 -7.470  1.00 15.00 ? 65 SER A H    2  
ATOM 2369  H HA   . SER A 1 65 ? -0.269  -9.085  -5.854  1.00 15.00 ? 65 SER A HA   2  
ATOM 2370  H HB2  . SER A 1 65 ? 0.560   -11.977 -6.169  1.00 15.00 ? 65 SER A HB2  2  
ATOM 2371  H HB3  . SER A 1 65 ? -0.870  -11.468 -5.272  1.00 15.00 ? 65 SER A HB3  2  
ATOM 2372  H HG   . SER A 1 65 ? -0.630  -11.847 -7.880  1.00 15.00 ? 65 SER A HG   2  
ATOM 2373  N N    . LEU A 1 66 ? 0.283   -9.275  -3.432  1.00 15.00 ? 66 LEU A N    2  
ATOM 2374  C CA   . LEU A 1 66 ? 0.698   -9.205  -2.037  1.00 15.00 ? 66 LEU A CA   2  
ATOM 2375  C C    . LEU A 1 66 ? 0.030   -10.302 -1.209  1.00 15.00 ? 66 LEU A C    2  
ATOM 2376  O O    . LEU A 1 66 ? 0.521   -10.671 -0.143  1.00 15.00 ? 66 LEU A O    2  
ATOM 2377  C CB   . LEU A 1 66 ? 0.362   -7.830  -1.454  1.00 15.00 ? 66 LEU A CB   2  
ATOM 2378  C CG   . LEU A 1 66 ? 1.534   -7.103  -0.791  1.00 15.00 ? 66 LEU A CG   2  
ATOM 2379  C CD1  . LEU A 1 66 ? 1.924   -7.793  0.507   1.00 15.00 ? 66 LEU A CD1  2  
ATOM 2380  C CD2  . LEU A 1 66 ? 2.723   -7.032  -1.739  1.00 15.00 ? 66 LEU A CD2  2  
ATOM 2381  H H    . LEU A 1 66 ? -0.567  -8.867  -3.698  1.00 15.00 ? 66 LEU A H    2  
ATOM 2382  H HA   . LEU A 1 66 ? 1.768   -9.347  -2.004  1.00 15.00 ? 66 LEU A HA   2  
ATOM 2383  H HB2  . LEU A 1 66 ? -0.015  -7.207  -2.252  1.00 15.00 ? 66 LEU A HB2  2  
ATOM 2384  H HB3  . LEU A 1 66 ? -0.418  -7.953  -0.718  1.00 15.00 ? 66 LEU A HB3  2  
ATOM 2385  H HG   . LEU A 1 66 ? 1.234   -6.093  -0.554  1.00 15.00 ? 66 LEU A HG   2  
ATOM 2386  H HD11 . LEU A 1 66 ? 1.618   -8.828  0.471   1.00 15.00 ? 66 LEU A HD11 2  
ATOM 2387  H HD12 . LEU A 1 66 ? 2.995   -7.739  0.636   1.00 15.00 ? 66 LEU A HD12 2  
ATOM 2388  H HD13 . LEU A 1 66 ? 1.436   -7.302  1.336   1.00 15.00 ? 66 LEU A HD13 2  
ATOM 2389  H HD21 . LEU A 1 66 ? 3.491   -7.714  -1.406  1.00 15.00 ? 66 LEU A HD21 2  
ATOM 2390  H HD22 . LEU A 1 66 ? 2.407   -7.306  -2.735  1.00 15.00 ? 66 LEU A HD22 2  
ATOM 2391  H HD23 . LEU A 1 66 ? 3.114   -6.026  -1.750  1.00 15.00 ? 66 LEU A HD23 2  
ATOM 2392  N N    . GLU A 1 67 ? -1.093  -10.817 -1.706  1.00 15.00 ? 67 GLU A N    2  
ATOM 2393  C CA   . GLU A 1 67 ? -1.830  -11.870 -1.010  1.00 15.00 ? 67 GLU A CA   2  
ATOM 2394  C C    . GLU A 1 67 ? -0.893  -12.975 -0.530  1.00 15.00 ? 67 GLU A C    2  
ATOM 2395  O O    . GLU A 1 67 ? -0.403  -13.777 -1.324  1.00 15.00 ? 67 GLU A O    2  
ATOM 2396  C CB   . GLU A 1 67 ? -2.902  -12.460 -1.928  1.00 15.00 ? 67 GLU A CB   2  
ATOM 2397  C CG   . GLU A 1 67 ? -4.011  -11.481 -2.278  1.00 15.00 ? 67 GLU A CG   2  
ATOM 2398  C CD   . GLU A 1 67 ? -3.929  -10.995 -3.712  1.00 15.00 ? 67 GLU A CD   2  
ATOM 2399  O OE1  . GLU A 1 67 ? -3.762  -11.839 -4.617  1.00 15.00 ? 67 GLU A OE1  2  
ATOM 2400  O OE2  . GLU A 1 67 ? -4.032  -9.769  -3.930  1.00 15.00 ? 67 GLU A OE2  2  
ATOM 2401  H H    . GLU A 1 67 ? -1.437  -10.480 -2.559  1.00 15.00 ? 67 GLU A H    2  
ATOM 2402  H HA   . GLU A 1 67 ? -2.311  -11.425 -0.152  1.00 15.00 ? 67 GLU A HA   2  
ATOM 2403  H HB2  . GLU A 1 67 ? -2.435  -12.785 -2.846  1.00 15.00 ? 67 GLU A HB2  2  
ATOM 2404  H HB3  . GLU A 1 67 ? -3.347  -13.315 -1.440  1.00 15.00 ? 67 GLU A HB3  2  
ATOM 2405  H HG2  . GLU A 1 67 ? -4.964  -11.969 -2.134  1.00 15.00 ? 67 GLU A HG2  2  
ATOM 2406  H HG3  . GLU A 1 67 ? -3.942  -10.628 -1.619  1.00 15.00 ? 67 GLU A HG3  2  
ATOM 2407  N N    . GLY A 1 68 ? -0.648  -13.007 0.776   1.00 15.00 ? 68 GLY A N    2  
ATOM 2408  C CA   . GLY A 1 68 ? 0.229   -14.014 1.343   1.00 15.00 ? 68 GLY A CA   2  
ATOM 2409  C C    . GLY A 1 68 ? 1.592   -13.457 1.706   1.00 15.00 ? 68 GLY A C    2  
ATOM 2410  O O    . GLY A 1 68 ? 2.610   -13.881 1.159   1.00 15.00 ? 68 GLY A O    2  
ATOM 2411  H H    . GLY A 1 68 ? -1.067  -12.341 1.360   1.00 15.00 ? 68 GLY A H    2  
ATOM 2412  H HA2  . GLY A 1 68 ? -0.232  -14.418 2.232   1.00 15.00 ? 68 GLY A HA2  2  
ATOM 2413  H HA3  . GLY A 1 68 ? 0.358   -14.810 0.624   1.00 15.00 ? 68 GLY A HA3  2  
ATOM 2414  N N    . ALA A 1 69 ? 1.611   -12.503 2.631   1.00 15.00 ? 69 ALA A N    2  
ATOM 2415  C CA   . ALA A 1 69 ? 2.857   -11.885 3.067   1.00 15.00 ? 69 ALA A CA   2  
ATOM 2416  C C    . ALA A 1 69 ? 2.621   -10.947 4.247   1.00 15.00 ? 69 ALA A C    2  
ATOM 2417  O O    . ALA A 1 69 ? 1.488   -10.552 4.523   1.00 15.00 ? 69 ALA A O    2  
ATOM 2418  C CB   . ALA A 1 69 ? 3.505   -11.134 1.913   1.00 15.00 ? 69 ALA A CB   2  
ATOM 2419  H H    . ALA A 1 69 ? 0.767   -12.207 3.030   1.00 15.00 ? 69 ALA A H    2  
ATOM 2420  H HA   . ALA A 1 69 ? 3.528   -12.673 3.376   1.00 15.00 ? 69 ALA A HA   2  
ATOM 2421  H HB1  . ALA A 1 69 ? 4.326   -11.716 1.521   1.00 15.00 ? 69 ALA A HB1  2  
ATOM 2422  H HB2  . ALA A 1 69 ? 2.775   -10.973 1.134   1.00 15.00 ? 69 ALA A HB2  2  
ATOM 2423  H HB3  . ALA A 1 69 ? 3.874   -10.182 2.263   1.00 15.00 ? 69 ALA A HB3  2  
ATOM 2424  N N    . THR A 1 70 ? 3.698   -10.595 4.941   1.00 15.00 ? 70 THR A N    2  
ATOM 2425  C CA   . THR A 1 70 ? 3.610   -9.704  6.093   1.00 15.00 ? 70 THR A CA   2  
ATOM 2426  C C    . THR A 1 70 ? 3.818   -8.251  5.677   1.00 15.00 ? 70 THR A C    2  
ATOM 2427  O O    . THR A 1 70 ? 3.881   -7.935  4.489   1.00 15.00 ? 70 THR A O    2  
ATOM 2428  C CB   . THR A 1 70 ? 4.646   -10.089 7.155   1.00 15.00 ? 70 THR A CB   2  
ATOM 2429  O OG1  . THR A 1 70 ? 5.895   -9.471  6.890   1.00 15.00 ? 70 THR A OG1  2  
ATOM 2430  C CG2  . THR A 1 70 ? 4.881   -11.582 7.257   1.00 15.00 ? 70 THR A CG2  2  
ATOM 2431  H H    . THR A 1 70 ? 4.573   -10.944 4.673   1.00 15.00 ? 70 THR A H    2  
ATOM 2432  H HA   . THR A 1 70 ? 2.621   -9.806  6.517   1.00 15.00 ? 70 THR A HA   2  
ATOM 2433  H HB   . THR A 1 70 ? 4.299   -9.744  8.118   1.00 15.00 ? 70 THR A HB   2  
ATOM 2434  H HG1  . THR A 1 70 ? 6.353   -9.951  6.198   1.00 15.00 ? 70 THR A HG1  2  
ATOM 2435  H HG21 . THR A 1 70 ? 5.427   -11.800 8.163   1.00 15.00 ? 70 THR A HG21 2  
ATOM 2436  H HG22 . THR A 1 70 ? 3.931   -12.096 7.277   1.00 15.00 ? 70 THR A HG22 2  
ATOM 2437  H HG23 . THR A 1 70 ? 5.452   -11.916 6.403   1.00 15.00 ? 70 THR A HG23 2  
ATOM 2438  N N    . HIS A 1 71 ? 3.923   -7.375  6.668   1.00 15.00 ? 71 HIS A N    2  
ATOM 2439  C CA   . HIS A 1 71 ? 4.125   -5.953  6.424   1.00 15.00 ? 71 HIS A CA   2  
ATOM 2440  C C    . HIS A 1 71 ? 5.446   -5.719  5.699   1.00 15.00 ? 71 HIS A C    2  
ATOM 2441  O O    . HIS A 1 71 ? 5.476   -5.176  4.594   1.00 15.00 ? 71 HIS A O    2  
ATOM 2442  C CB   . HIS A 1 71 ? 4.075   -5.191  7.759   1.00 15.00 ? 71 HIS A CB   2  
ATOM 2443  C CG   . HIS A 1 71 ? 5.144   -4.156  7.945   1.00 15.00 ? 71 HIS A CG   2  
ATOM 2444  N ND1  . HIS A 1 71 ? 5.922   -4.079  9.082   1.00 15.00 ? 71 HIS A ND1  2  
ATOM 2445  C CD2  . HIS A 1 71 ? 5.556   -3.148  7.142   1.00 15.00 ? 71 HIS A CD2  2  
ATOM 2446  C CE1  . HIS A 1 71 ? 6.763   -3.067  8.970   1.00 15.00 ? 71 HIS A CE1  2  
ATOM 2447  N NE2  . HIS A 1 71 ? 6.562   -2.487  7.803   1.00 15.00 ? 71 HIS A NE2  2  
ATOM 2448  H H    . HIS A 1 71 ? 3.863   -7.692  7.591   1.00 15.00 ? 71 HIS A H    2  
ATOM 2449  H HA   . HIS A 1 71 ? 3.320   -5.610  5.794   1.00 15.00 ? 71 HIS A HA   2  
ATOM 2450  H HB2  . HIS A 1 71 ? 3.122   -4.692  7.840   1.00 15.00 ? 71 HIS A HB2  2  
ATOM 2451  H HB3  . HIS A 1 71 ? 4.165   -5.904  8.566   1.00 15.00 ? 71 HIS A HB3  2  
ATOM 2452  H HD1  . HIS A 1 71 ? 5.864   -4.677  9.856   1.00 15.00 ? 71 HIS A HD1  2  
ATOM 2453  H HD2  . HIS A 1 71 ? 5.163   -2.907  6.165   1.00 15.00 ? 71 HIS A HD2  2  
ATOM 2454  H HE1  . HIS A 1 71 ? 7.487   -2.764  9.710   1.00 15.00 ? 71 HIS A HE1  2  
ATOM 2455  H HE2  . HIS A 1 71 ? 7.075   -1.730  7.452   1.00 15.00 ? 71 HIS A HE2  2  
ATOM 2456  N N    . LYS A 1 72 ? 6.532   -6.141  6.330   1.00 15.00 ? 72 LYS A N    2  
ATOM 2457  C CA   . LYS A 1 72 ? 7.863   -5.991  5.752   1.00 15.00 ? 72 LYS A CA   2  
ATOM 2458  C C    . LYS A 1 72 ? 7.910   -6.568  4.343   1.00 15.00 ? 72 LYS A C    2  
ATOM 2459  O O    . LYS A 1 72 ? 8.605   -6.046  3.475   1.00 15.00 ? 72 LYS A O    2  
ATOM 2460  C CB   . LYS A 1 72 ? 8.896   -6.683  6.639   1.00 15.00 ? 72 LYS A CB   2  
ATOM 2461  C CG   . LYS A 1 72 ? 10.333  -6.334  6.290   1.00 15.00 ? 72 LYS A CG   2  
ATOM 2462  C CD   . LYS A 1 72 ? 11.318  -7.068  7.185   1.00 15.00 ? 72 LYS A CD   2  
ATOM 2463  C CE   . LYS A 1 72 ? 11.372  -8.552  6.856   1.00 15.00 ? 72 LYS A CE   2  
ATOM 2464  N NZ   . LYS A 1 72 ? 12.071  -8.810  5.567   1.00 15.00 ? 72 LYS A NZ   2  
ATOM 2465  H H    . LYS A 1 72 ? 6.435   -6.574  7.204   1.00 15.00 ? 72 LYS A H    2  
ATOM 2466  H HA   . LYS A 1 72 ? 8.091   -4.931  5.698   1.00 15.00 ? 72 LYS A HA   2  
ATOM 2467  H HB2  . LYS A 1 72 ? 8.717   -6.400  7.666   1.00 15.00 ? 72 LYS A HB2  2  
ATOM 2468  H HB3  . LYS A 1 72 ? 8.773   -7.752  6.545   1.00 15.00 ? 72 LYS A HB3  2  
ATOM 2469  H HG2  . LYS A 1 72 ? 10.521  -6.610  5.263   1.00 15.00 ? 72 LYS A HG2  2  
ATOM 2470  H HG3  . LYS A 1 72 ? 10.474  -5.270  6.410   1.00 15.00 ? 72 LYS A HG3  2  
ATOM 2471  H HD2  . LYS A 1 72 ? 12.301  -6.644  7.047   1.00 15.00 ? 72 LYS A HD2  2  
ATOM 2472  H HD3  . LYS A 1 72 ? 11.013  -6.948  8.214   1.00 15.00 ? 72 LYS A HD3  2  
ATOM 2473  H HE2  . LYS A 1 72 ? 11.896  -9.064  7.648   1.00 15.00 ? 72 LYS A HE2  2  
ATOM 2474  H HE3  . LYS A 1 72 ? 10.362  -8.929  6.790   1.00 15.00 ? 72 LYS A HE3  2  
ATOM 2475  H HZ1  . LYS A 1 72 ? 11.567  -9.543  5.027   1.00 15.00 ? 72 LYS A HZ1  2  
ATOM 2476  H HZ2  . LYS A 1 72 ? 12.108  -7.940  4.998   1.00 15.00 ? 72 LYS A HZ2  2  
ATOM 2477  H HZ3  . LYS A 1 72 ? 13.043  -9.135  5.746   1.00 15.00 ? 72 LYS A HZ3  2  
ATOM 2478  N N    . GLN A 1 73 ? 7.156   -7.640  4.113   1.00 15.00 ? 73 GLN A N    2  
ATOM 2479  C CA   . GLN A 1 73 ? 7.118   -8.261  2.795   1.00 15.00 ? 73 GLN A CA   2  
ATOM 2480  C C    . GLN A 1 73 ? 6.637   -7.249  1.771   1.00 15.00 ? 73 GLN A C    2  
ATOM 2481  O O    . GLN A 1 73 ? 7.278   -7.032  0.743   1.00 15.00 ? 73 GLN A O    2  
ATOM 2482  C CB   . GLN A 1 73 ? 6.199   -9.480  2.799   1.00 15.00 ? 73 GLN A CB   2  
ATOM 2483  C CG   . GLN A 1 73 ? 6.814   -10.691 3.471   1.00 15.00 ? 73 GLN A CG   2  
ATOM 2484  C CD   . GLN A 1 73 ? 6.463   -11.991 2.774   1.00 15.00 ? 73 GLN A CD   2  
ATOM 2485  O OE1  . GLN A 1 73 ? 5.751   -12.831 3.324   1.00 15.00 ? 73 GLN A OE1  2  
ATOM 2486  N NE2  . GLN A 1 73 ? 6.964   -12.164 1.556   1.00 15.00 ? 73 GLN A NE2  2  
ATOM 2487  H H    . GLN A 1 73 ? 6.612   -8.013  4.839   1.00 15.00 ? 73 GLN A H    2  
ATOM 2488  H HA   . GLN A 1 73 ? 8.122   -8.571  2.541   1.00 15.00 ? 73 GLN A HA   2  
ATOM 2489  H HB2  . GLN A 1 73 ? 5.287   -9.229  3.320   1.00 15.00 ? 73 GLN A HB2  2  
ATOM 2490  H HB3  . GLN A 1 73 ? 5.961   -9.743  1.778   1.00 15.00 ? 73 GLN A HB3  2  
ATOM 2491  H HG2  . GLN A 1 73 ? 7.887   -10.578 3.470   1.00 15.00 ? 73 GLN A HG2  2  
ATOM 2492  H HG3  . GLN A 1 73 ? 6.460   -10.736 4.488   1.00 15.00 ? 73 GLN A HG3  2  
ATOM 2493  H HE21 . GLN A 1 73 ? 7.524   -11.453 1.181   1.00 15.00 ? 73 GLN A HE21 2  
ATOM 2494  H HE22 . GLN A 1 73 ? 6.753   -12.996 1.083   1.00 15.00 ? 73 GLN A HE22 2  
ATOM 2495  N N    . ALA A 1 74 ? 5.517   -6.610  2.077   1.00 15.00 ? 74 ALA A N    2  
ATOM 2496  C CA   . ALA A 1 74 ? 4.965   -5.592  1.197   1.00 15.00 ? 74 ALA A CA   2  
ATOM 2497  C C    . ALA A 1 74 ? 5.902   -4.396  1.147   1.00 15.00 ? 74 ALA A C    2  
ATOM 2498  O O    . ALA A 1 74 ? 6.213   -3.883  0.075   1.00 15.00 ? 74 ALA A O    2  
ATOM 2499  C CB   . ALA A 1 74 ? 3.589   -5.164  1.658   1.00 15.00 ? 74 ALA A CB   2  
ATOM 2500  H H    . ALA A 1 74 ? 5.065   -6.816  2.923   1.00 15.00 ? 74 ALA A H    2  
ATOM 2501  H HA   . ALA A 1 74 ? 4.878   -6.015  0.207   1.00 15.00 ? 74 ALA A HA   2  
ATOM 2502  H HB1  . ALA A 1 74 ? 2.977   -4.950  0.795   1.00 15.00 ? 74 ALA A HB1  2  
ATOM 2503  H HB2  . ALA A 1 74 ? 3.139   -5.957  2.234   1.00 15.00 ? 74 ALA A HB2  2  
ATOM 2504  H HB3  . ALA A 1 74 ? 3.676   -4.277  2.267   1.00 15.00 ? 74 ALA A HB3  2  
ATOM 2505  N N    . VAL A 1 75 ? 6.375   -3.977  2.322   1.00 15.00 ? 75 VAL A N    2  
ATOM 2506  C CA   . VAL A 1 75 ? 7.314   -2.863  2.420   1.00 15.00 ? 75 VAL A CA   2  
ATOM 2507  C C    . VAL A 1 75 ? 8.364   -3.005  1.332   1.00 15.00 ? 75 VAL A C    2  
ATOM 2508  O O    . VAL A 1 75 ? 8.751   -2.034  0.683   1.00 15.00 ? 75 VAL A O    2  
ATOM 2509  C CB   . VAL A 1 75 ? 7.980   -2.838  3.818   1.00 15.00 ? 75 VAL A CB   2  
ATOM 2510  C CG1  . VAL A 1 75 ? 9.470   -3.151  3.749   1.00 15.00 ? 75 VAL A CG1  2  
ATOM 2511  C CG2  . VAL A 1 75 ? 7.750   -1.509  4.505   1.00 15.00 ? 75 VAL A CG2  2  
ATOM 2512  H H    . VAL A 1 75 ? 6.105   -4.445  3.139   1.00 15.00 ? 75 VAL A H    2  
ATOM 2513  H HA   . VAL A 1 75 ? 6.775   -1.938  2.270   1.00 15.00 ? 75 VAL A HA   2  
ATOM 2514  H HB   . VAL A 1 75 ? 7.506   -3.598  4.418   1.00 15.00 ? 75 VAL A HB   2  
ATOM 2515  H HG11 . VAL A 1 75 ? 9.615   -4.119  3.296   1.00 15.00 ? 75 VAL A HG11 2  
ATOM 2516  H HG12 . VAL A 1 75 ? 9.969   -2.398  3.157   1.00 15.00 ? 75 VAL A HG12 2  
ATOM 2517  H HG13 . VAL A 1 75 ? 9.884   -3.156  4.747   1.00 15.00 ? 75 VAL A HG13 2  
ATOM 2518  H HG21 . VAL A 1 75 ? 8.650   -0.915  4.452   1.00 15.00 ? 75 VAL A HG21 2  
ATOM 2519  H HG22 . VAL A 1 75 ? 6.941   -0.987  4.020   1.00 15.00 ? 75 VAL A HG22 2  
ATOM 2520  H HG23 . VAL A 1 75 ? 7.497   -1.690  5.540   1.00 15.00 ? 75 VAL A HG23 2  
ATOM 2521  N N    . GLU A 1 76 ? 8.791   -4.242  1.128   1.00 15.00 ? 76 GLU A N    2  
ATOM 2522  C CA   . GLU A 1 76 ? 9.766   -4.551  0.103   1.00 15.00 ? 76 GLU A CA   2  
ATOM 2523  C C    . GLU A 1 76 ? 9.163   -4.321  -1.280  1.00 15.00 ? 76 GLU A C    2  
ATOM 2524  O O    . GLU A 1 76 ? 9.797   -3.725  -2.145  1.00 15.00 ? 76 GLU A O    2  
ATOM 2525  C CB   . GLU A 1 76 ? 10.243  -5.998  0.242   1.00 15.00 ? 76 GLU A CB   2  
ATOM 2526  C CG   . GLU A 1 76 ? 10.829  -6.316  1.609   1.00 15.00 ? 76 GLU A CG   2  
ATOM 2527  C CD   . GLU A 1 76 ? 10.578  -7.750  2.032   1.00 15.00 ? 76 GLU A CD   2  
ATOM 2528  O OE1  . GLU A 1 76 ? 10.782  -8.659  1.200   1.00 15.00 ? 76 GLU A OE1  2  
ATOM 2529  O OE2  . GLU A 1 76 ? 10.176  -7.964  3.195   1.00 15.00 ? 76 GLU A OE2  2  
ATOM 2530  H H    . GLU A 1 76 ? 8.420   -4.970  1.672   1.00 15.00 ? 76 GLU A H    2  
ATOM 2531  H HA   . GLU A 1 76 ? 10.608  -3.887  0.233   1.00 15.00 ? 76 GLU A HA   2  
ATOM 2532  H HB2  . GLU A 1 76 ? 9.406   -6.659  0.070   1.00 15.00 ? 76 GLU A HB2  2  
ATOM 2533  H HB3  . GLU A 1 76 ? 11.000  -6.188  -0.504  1.00 15.00 ? 76 GLU A HB3  2  
ATOM 2534  H HG2  . GLU A 1 76 ? 11.895  -6.149  1.577   1.00 15.00 ? 76 GLU A HG2  2  
ATOM 2535  H HG3  . GLU A 1 76 ? 10.384  -5.656  2.341   1.00 15.00 ? 76 GLU A HG3  2  
ATOM 2536  N N    . THR A 1 77 ? 7.929   -4.791  -1.483  1.00 15.00 ? 77 THR A N    2  
ATOM 2537  C CA   . THR A 1 77 ? 7.256   -4.617  -2.768  1.00 15.00 ? 77 THR A CA   2  
ATOM 2538  C C    . THR A 1 77 ? 7.004   -3.142  -3.067  1.00 15.00 ? 77 THR A C    2  
ATOM 2539  O O    . THR A 1 77 ? 7.385   -2.644  -4.126  1.00 15.00 ? 77 THR A O    2  
ATOM 2540  C CB   . THR A 1 77 ? 5.939   -5.391  -2.808  1.00 15.00 ? 77 THR A CB   2  
ATOM 2541  O OG1  . THR A 1 77 ? 5.112   -5.041  -1.715  1.00 15.00 ? 77 THR A OG1  2  
ATOM 2542  C CG2  . THR A 1 77 ? 6.126   -6.891  -2.785  1.00 15.00 ? 77 THR A CG2  2  
ATOM 2543  H H    . THR A 1 77 ? 7.457   -5.252  -0.751  1.00 15.00 ? 77 THR A H    2  
ATOM 2544  H HA   . THR A 1 77 ? 7.911   -5.011  -3.531  1.00 15.00 ? 77 THR A HA   2  
ATOM 2545  H HB   . THR A 1 77 ? 5.421   -5.138  -3.721  1.00 15.00 ? 77 THR A HB   2  
ATOM 2546  H HG1  . THR A 1 77 ? 4.374   -4.514  -2.028  1.00 15.00 ? 77 THR A HG1  2  
ATOM 2547  H HG21 . THR A 1 77 ? 6.074   -7.275  -3.794  1.00 15.00 ? 77 THR A HG21 2  
ATOM 2548  H HG22 . THR A 1 77 ? 7.089   -7.128  -2.358  1.00 15.00 ? 77 THR A HG22 2  
ATOM 2549  H HG23 . THR A 1 77 ? 5.347   -7.342  -2.188  1.00 15.00 ? 77 THR A HG23 2  
ATOM 2550  N N    . LEU A 1 78 ? 6.361   -2.443  -2.130  1.00 15.00 ? 78 LEU A N    2  
ATOM 2551  C CA   . LEU A 1 78 ? 6.068   -1.021  -2.311  1.00 15.00 ? 78 LEU A CA   2  
ATOM 2552  C C    . LEU A 1 78 ? 7.344   -0.267  -2.651  1.00 15.00 ? 78 LEU A C    2  
ATOM 2553  O O    . LEU A 1 78 ? 7.392   0.509   -3.605  1.00 15.00 ? 78 LEU A O    2  
ATOM 2554  C CB   . LEU A 1 78 ? 5.446   -0.420  -1.045  1.00 15.00 ? 78 LEU A CB   2  
ATOM 2555  C CG   . LEU A 1 78 ? 4.465   -1.321  -0.291  1.00 15.00 ? 78 LEU A CG   2  
ATOM 2556  C CD1  . LEU A 1 78 ? 3.787   -0.548  0.829   1.00 15.00 ? 78 LEU A CD1  2  
ATOM 2557  C CD2  . LEU A 1 78 ? 3.430   -1.903  -1.243  1.00 15.00 ? 78 LEU A CD2  2  
ATOM 2558  H H    . LEU A 1 78 ? 6.081   -2.890  -1.305  1.00 15.00 ? 78 LEU A H    2  
ATOM 2559  H HA   . LEU A 1 78 ? 5.372   -0.923  -3.130  1.00 15.00 ? 78 LEU A HA   2  
ATOM 2560  H HB2  . LEU A 1 78 ? 6.247   -0.157  -0.370  1.00 15.00 ? 78 LEU A HB2  2  
ATOM 2561  H HB3  . LEU A 1 78 ? 4.925   0.484   -1.323  1.00 15.00 ? 78 LEU A HB3  2  
ATOM 2562  H HG   . LEU A 1 78 ? 5.010   -2.139  0.154   1.00 15.00 ? 78 LEU A HG   2  
ATOM 2563  H HD11 . LEU A 1 78 ? 3.318   0.336   0.423   1.00 15.00 ? 78 LEU A HD11 2  
ATOM 2564  H HD12 . LEU A 1 78 ? 3.038   -1.171  1.295   1.00 15.00 ? 78 LEU A HD12 2  
ATOM 2565  H HD13 . LEU A 1 78 ? 4.524   -0.259  1.564   1.00 15.00 ? 78 LEU A HD13 2  
ATOM 2566  H HD21 . LEU A 1 78 ? 2.443   -1.578  -0.945  1.00 15.00 ? 78 LEU A HD21 2  
ATOM 2567  H HD22 . LEU A 1 78 ? 3.632   -1.564  -2.247  1.00 15.00 ? 78 LEU A HD22 2  
ATOM 2568  H HD23 . LEU A 1 78 ? 3.477   -2.981  -1.210  1.00 15.00 ? 78 LEU A HD23 2  
ATOM 2569  N N    . ARG A 1 79 ? 8.376   -0.516  -1.861  1.00 15.00 ? 79 ARG A N    2  
ATOM 2570  C CA   . ARG A 1 79 ? 9.668   0.116   -2.060  1.00 15.00 ? 79 ARG A CA   2  
ATOM 2571  C C    . ARG A 1 79 ? 10.323  -0.389  -3.344  1.00 15.00 ? 79 ARG A C    2  
ATOM 2572  O O    . ARG A 1 79 ? 10.627  0.390   -4.247  1.00 15.00 ? 79 ARG A O    2  
ATOM 2573  C CB   . ARG A 1 79 ? 10.566  -0.165  -0.854  1.00 15.00 ? 79 ARG A CB   2  
ATOM 2574  C CG   . ARG A 1 79 ? 11.532  0.964   -0.534  1.00 15.00 ? 79 ARG A CG   2  
ATOM 2575  C CD   . ARG A 1 79 ? 12.896  0.434   -0.121  1.00 15.00 ? 79 ARG A CD   2  
ATOM 2576  N NE   . ARG A 1 79 ? 12.965  0.158   1.313   1.00 15.00 ? 79 ARG A NE   2  
ATOM 2577  C CZ   . ARG A 1 79 ? 12.762  -1.043  1.855   1.00 15.00 ? 79 ARG A CZ   2  
ATOM 2578  N NH1  . ARG A 1 79 ? 12.474  -2.089  1.090   1.00 15.00 ? 79 ARG A NH1  2  
ATOM 2579  N NH2  . ARG A 1 79 ? 12.847  -1.197  3.169   1.00 15.00 ? 79 ARG A NH2  2  
ATOM 2580  H H    . ARG A 1 79 ? 8.268   -1.152  -1.123  1.00 15.00 ? 79 ARG A H    2  
ATOM 2581  H HA   . ARG A 1 79 ? 9.511   1.181   -2.144  1.00 15.00 ? 79 ARG A HA   2  
ATOM 2582  H HB2  . ARG A 1 79 ? 9.938   -0.333  0.014   1.00 15.00 ? 79 ARG A HB2  2  
ATOM 2583  H HB3  . ARG A 1 79 ? 11.139  -1.059  -1.049  1.00 15.00 ? 79 ARG A HB3  2  
ATOM 2584  H HG2  . ARG A 1 79 ? 11.649  1.583   -1.411  1.00 15.00 ? 79 ARG A HG2  2  
ATOM 2585  H HG3  . ARG A 1 79 ? 11.125  1.554   0.274   1.00 15.00 ? 79 ARG A HG3  2  
ATOM 2586  H HD2  . ARG A 1 79 ? 13.096  -0.475  -0.666  1.00 15.00 ? 79 ARG A HD2  2  
ATOM 2587  H HD3  . ARG A 1 79 ? 13.643  1.172   -0.371  1.00 15.00 ? 79 ARG A HD3  2  
ATOM 2588  H HE   . ARG A 1 79 ? 13.175  0.909   1.907   1.00 15.00 ? 79 ARG A HE   2  
ATOM 2589  H HH11 . ARG A 1 79 ? 12.408  -1.984  0.099   1.00 15.00 ? 79 ARG A HH11 2  
ATOM 2590  H HH12 . ARG A 1 79 ? 12.324  -2.985  1.507   1.00 15.00 ? 79 ARG A HH12 2  
ATOM 2591  H HH21 . ARG A 1 79 ? 13.063  -0.414  3.751   1.00 15.00 ? 79 ARG A HH21 2  
ATOM 2592  H HH22 . ARG A 1 79 ? 12.694  -2.097  3.577   1.00 15.00 ? 79 ARG A HH22 2  
ATOM 2593  N N    . ASN A 1 80 ? 10.538  -1.700  -3.411  1.00 15.00 ? 80 ASN A N    2  
ATOM 2594  C CA   . ASN A 1 80 ? 11.155  -2.330  -4.577  1.00 15.00 ? 80 ASN A CA   2  
ATOM 2595  C C    . ASN A 1 80 ? 10.270  -2.223  -5.819  1.00 15.00 ? 80 ASN A C    2  
ATOM 2596  O O    . ASN A 1 80 ? 9.836   -3.236  -6.367  1.00 15.00 ? 80 ASN A O    2  
ATOM 2597  C CB   . ASN A 1 80 ? 11.452  -3.803  -4.286  1.00 15.00 ? 80 ASN A CB   2  
ATOM 2598  C CG   . ASN A 1 80 ? 12.341  -3.986  -3.071  1.00 15.00 ? 80 ASN A CG   2  
ATOM 2599  O OD1  . ASN A 1 80 ? 12.267  -3.218  -2.112  1.00 15.00 ? 80 ASN A OD1  2  
ATOM 2600  N ND2  . ASN A 1 80 ? 13.188  -5.008  -3.107  1.00 15.00 ? 80 ASN A ND2  2  
ATOM 2601  H H    . ASN A 1 80 ? 10.272  -2.263  -2.654  1.00 15.00 ? 80 ASN A H    2  
ATOM 2602  H HA   . ASN A 1 80 ? 12.087  -1.821  -4.771  1.00 15.00 ? 80 ASN A HA   2  
ATOM 2603  H HB2  . ASN A 1 80 ? 10.520  -4.324  -4.111  1.00 15.00 ? 80 ASN A HB2  2  
ATOM 2604  H HB3  . ASN A 1 80 ? 11.946  -4.239  -5.141  1.00 15.00 ? 80 ASN A HB3  2  
ATOM 2605  H HD21 . ASN A 1 80 ? 13.192  -5.578  -3.904  1.00 15.00 ? 80 ASN A HD21 2  
ATOM 2606  H HD22 . ASN A 1 80 ? 13.775  -5.150  -2.335  1.00 15.00 ? 80 ASN A HD22 2  
ATOM 2607  N N    . THR A 1 81 ? 10.012  -1.001  -6.270  1.00 15.00 ? 81 THR A N    2  
ATOM 2608  C CA   . THR A 1 81 ? 9.188   -0.793  -7.456  1.00 15.00 ? 81 THR A CA   2  
ATOM 2609  C C    . THR A 1 81 ? 10.064  -0.732  -8.706  1.00 15.00 ? 81 THR A C    2  
ATOM 2610  O O    . THR A 1 81 ? 10.062  -1.653  -9.522  1.00 15.00 ? 81 THR A O    2  
ATOM 2611  C CB   . THR A 1 81 ? 8.358   0.486   -7.320  1.00 15.00 ? 81 THR A CB   2  
ATOM 2612  O OG1  . THR A 1 81 ? 8.788   1.248   -6.206  1.00 15.00 ? 81 THR A OG1  2  
ATOM 2613  C CG2  . THR A 1 81 ? 6.877   0.221   -7.149  1.00 15.00 ? 81 THR A CG2  2  
ATOM 2614  H H    . THR A 1 81 ? 10.388  -0.225  -5.802  1.00 15.00 ? 81 THR A H    2  
ATOM 2615  H HA   . THR A 1 81 ? 8.520   -1.637  -7.544  1.00 15.00 ? 81 THR A HA   2  
ATOM 2616  H HB   . THR A 1 81 ? 8.486   1.084   -8.211  1.00 15.00 ? 81 THR A HB   2  
ATOM 2617  H HG1  . THR A 1 81 ? 8.685   0.730   -5.404  1.00 15.00 ? 81 THR A HG1  2  
ATOM 2618  H HG21 . THR A 1 81 ? 6.341   0.616   -7.999  1.00 15.00 ? 81 THR A HG21 2  
ATOM 2619  H HG22 . THR A 1 81 ? 6.706   -0.844  -7.079  1.00 15.00 ? 81 THR A HG22 2  
ATOM 2620  H HG23 . THR A 1 81 ? 6.526   0.700   -6.247  1.00 15.00 ? 81 THR A HG23 2  
ATOM 2621  N N    . GLY A 1 82 ? 10.821  0.353   -8.842  1.00 15.00 ? 82 GLY A N    2  
ATOM 2622  C CA   . GLY A 1 82 ? 11.699  0.510   -9.980  1.00 15.00 ? 82 GLY A CA   2  
ATOM 2623  C C    . GLY A 1 82 ? 11.411  1.765   -10.776 1.00 15.00 ? 82 GLY A C    2  
ATOM 2624  O O    . GLY A 1 82 ? 11.675  2.878   -10.321 1.00 15.00 ? 82 GLY A O    2  
ATOM 2625  H H    . GLY A 1 82 ? 10.786  1.049   -8.164  1.00 15.00 ? 82 GLY A H    2  
ATOM 2626  H HA2  . GLY A 1 82 ? 12.719  0.547   -9.629  1.00 15.00 ? 82 GLY A HA2  2  
ATOM 2627  H HA3  . GLY A 1 82 ? 11.585  -0.347  -10.628 1.00 15.00 ? 82 GLY A HA3  2  
ATOM 2628  N N    . GLN A 1 83 ? 10.879  1.576   -11.972 1.00 15.00 ? 83 GLN A N    2  
ATOM 2629  C CA   . GLN A 1 83 ? 10.557  2.692   -12.861 1.00 15.00 ? 83 GLN A CA   2  
ATOM 2630  C C    . GLN A 1 83 ? 9.453   3.570   -12.277 1.00 15.00 ? 83 GLN A C    2  
ATOM 2631  O O    . GLN A 1 83 ? 9.717   4.648   -11.750 1.00 15.00 ? 83 GLN A O    2  
ATOM 2632  C CB   . GLN A 1 83 ? 10.149  2.192   -14.255 1.00 15.00 ? 83 GLN A CB   2  
ATOM 2633  C CG   . GLN A 1 83 ? 10.736  0.840   -14.628 1.00 15.00 ? 83 GLN A CG   2  
ATOM 2634  C CD   . GLN A 1 83 ? 9.772   -0.300  -14.364 1.00 15.00 ? 83 GLN A CD   2  
ATOM 2635  O OE1  . GLN A 1 83 ? 8.762   -0.128  -13.681 1.00 15.00 ? 83 GLN A OE1  2  
ATOM 2636  N NE2  . GLN A 1 83 ? 10.079  -1.473  -14.906 1.00 15.00 ? 83 GLN A NE2  2  
ATOM 2637  H H    . GLN A 1 83 ? 10.700  0.662   -12.263 1.00 15.00 ? 83 GLN A H    2  
ATOM 2638  H HA   . GLN A 1 83 ? 11.450  3.292   -12.959 1.00 15.00 ? 83 GLN A HA   2  
ATOM 2639  H HB2  . GLN A 1 83 ? 9.075   2.114   -14.299 1.00 15.00 ? 83 GLN A HB2  2  
ATOM 2640  H HB3  . GLN A 1 83 ? 10.476  2.913   -14.989 1.00 15.00 ? 83 GLN A HB3  2  
ATOM 2641  H HG2  . GLN A 1 83 ? 10.984  0.846   -15.678 1.00 15.00 ? 83 GLN A HG2  2  
ATOM 2642  H HG3  . GLN A 1 83 ? 11.632  0.677   -14.047 1.00 15.00 ? 83 GLN A HG3  2  
ATOM 2643  H HE21 . GLN A 1 83 ? 10.900  -1.537  -15.438 1.00 15.00 ? 83 GLN A HE21 2  
ATOM 2644  H HE22 . GLN A 1 83 ? 9.473   -2.227  -14.752 1.00 15.00 ? 83 GLN A HE22 2  
ATOM 2645  N N    . VAL A 1 84 ? 8.214   3.103   -12.384 1.00 15.00 ? 84 VAL A N    2  
ATOM 2646  C CA   . VAL A 1 84 ? 7.064   3.841   -11.875 1.00 15.00 ? 84 VAL A CA   2  
ATOM 2647  C C    . VAL A 1 84 ? 6.468   3.138   -10.658 1.00 15.00 ? 84 VAL A C    2  
ATOM 2648  O O    . VAL A 1 84 ? 6.672   1.941   -10.456 1.00 15.00 ? 84 VAL A O    2  
ATOM 2649  C CB   . VAL A 1 84 ? 5.983   4.003   -12.969 1.00 15.00 ? 84 VAL A CB   2  
ATOM 2650  C CG1  . VAL A 1 84 ? 4.675   4.521   -12.387 1.00 15.00 ? 84 VAL A CG1  2  
ATOM 2651  C CG2  . VAL A 1 84 ? 6.482   4.934   -14.063 1.00 15.00 ? 84 VAL A CG2  2  
ATOM 2652  H H    . VAL A 1 84 ? 8.067   2.237   -12.815 1.00 15.00 ? 84 VAL A H    2  
ATOM 2653  H HA   . VAL A 1 84 ? 7.401   4.829   -11.584 1.00 15.00 ? 84 VAL A HA   2  
ATOM 2654  H HB   . VAL A 1 84 ? 5.797   3.035   -13.409 1.00 15.00 ? 84 VAL A HB   2  
ATOM 2655  H HG11 . VAL A 1 84 ? 4.848   5.468   -11.899 1.00 15.00 ? 84 VAL A HG11 2  
ATOM 2656  H HG12 . VAL A 1 84 ? 3.955   4.653   -13.182 1.00 15.00 ? 84 VAL A HG12 2  
ATOM 2657  H HG13 . VAL A 1 84 ? 4.292   3.811   -11.670 1.00 15.00 ? 84 VAL A HG13 2  
ATOM 2658  H HG21 . VAL A 1 84 ? 6.639   5.920   -13.650 1.00 15.00 ? 84 VAL A HG21 2  
ATOM 2659  H HG22 . VAL A 1 84 ? 7.414   4.557   -14.459 1.00 15.00 ? 84 VAL A HG22 2  
ATOM 2660  H HG23 . VAL A 1 84 ? 5.749   4.986   -14.854 1.00 15.00 ? 84 VAL A HG23 2  
ATOM 2661  N N    . VAL A 1 85 ? 5.723   3.885   -9.856  1.00 15.00 ? 85 VAL A N    2  
ATOM 2662  C CA   . VAL A 1 85 ? 5.094   3.331   -8.669  1.00 15.00 ? 85 VAL A CA   2  
ATOM 2663  C C    . VAL A 1 85 ? 3.635   2.981   -8.953  1.00 15.00 ? 85 VAL A C    2  
ATOM 2664  O O    . VAL A 1 85 ? 2.723   3.730   -8.604  1.00 15.00 ? 85 VAL A O    2  
ATOM 2665  C CB   . VAL A 1 85 ? 5.186   4.322   -7.486  1.00 15.00 ? 85 VAL A CB   2  
ATOM 2666  C CG1  . VAL A 1 85 ? 4.198   3.977   -6.383  1.00 15.00 ? 85 VAL A CG1  2  
ATOM 2667  C CG2  . VAL A 1 85 ? 6.606   4.367   -6.943  1.00 15.00 ? 85 VAL A CG2  2  
ATOM 2668  H H    . VAL A 1 85 ? 5.588   4.832   -10.069 1.00 15.00 ? 85 VAL A H    2  
ATOM 2669  H HA   . VAL A 1 85 ? 5.625   2.429   -8.399  1.00 15.00 ? 85 VAL A HA   2  
ATOM 2670  H HB   . VAL A 1 85 ? 4.940   5.303   -7.854  1.00 15.00 ? 85 VAL A HB   2  
ATOM 2671  H HG11 . VAL A 1 85 ? 3.862   2.957   -6.505  1.00 15.00 ? 85 VAL A HG11 2  
ATOM 2672  H HG12 . VAL A 1 85 ? 4.679   4.086   -5.422  1.00 15.00 ? 85 VAL A HG12 2  
ATOM 2673  H HG13 . VAL A 1 85 ? 3.351   4.647   -6.440  1.00 15.00 ? 85 VAL A HG13 2  
ATOM 2674  H HG21 . VAL A 1 85 ? 6.581   4.609   -5.890  1.00 15.00 ? 85 VAL A HG21 2  
ATOM 2675  H HG22 . VAL A 1 85 ? 7.075   3.404   -7.080  1.00 15.00 ? 85 VAL A HG22 2  
ATOM 2676  H HG23 . VAL A 1 85 ? 7.171   5.121   -7.472  1.00 15.00 ? 85 VAL A HG23 2  
ATOM 2677  N N    . HIS A 1 86 ? 3.428   1.833   -9.591  1.00 15.00 ? 86 HIS A N    2  
ATOM 2678  C CA   . HIS A 1 86 ? 2.085   1.371   -9.926  1.00 15.00 ? 86 HIS A CA   2  
ATOM 2679  C C    . HIS A 1 86 ? 1.620   0.319   -8.927  1.00 15.00 ? 86 HIS A C    2  
ATOM 2680  O O    . HIS A 1 86 ? 1.756   -0.882  -9.163  1.00 15.00 ? 86 HIS A O    2  
ATOM 2681  C CB   . HIS A 1 86 ? 2.058   0.794   -11.343 1.00 15.00 ? 86 HIS A CB   2  
ATOM 2682  C CG   . HIS A 1 86 ? 0.685   0.724   -11.936 1.00 15.00 ? 86 HIS A CG   2  
ATOM 2683  N ND1  . HIS A 1 86 ? -0.328  1.597   -11.597 1.00 15.00 ? 86 HIS A ND1  2  
ATOM 2684  C CD2  . HIS A 1 86 ? 0.158   -0.122  -12.853 1.00 15.00 ? 86 HIS A CD2  2  
ATOM 2685  C CE1  . HIS A 1 86 ? -1.417  1.291   -12.279 1.00 15.00 ? 86 HIS A CE1  2  
ATOM 2686  N NE2  . HIS A 1 86 ? -1.149  0.252   -13.048 1.00 15.00 ? 86 HIS A NE2  2  
ATOM 2687  H H    . HIS A 1 86 ? 4.199   1.280   -9.843  1.00 15.00 ? 86 HIS A H    2  
ATOM 2688  H HA   . HIS A 1 86 ? 1.419   2.219   -9.877  1.00 15.00 ? 86 HIS A HA   2  
ATOM 2689  H HB2  . HIS A 1 86 ? 2.665   1.412   -11.986 1.00 15.00 ? 86 HIS A HB2  2  
ATOM 2690  H HB3  . HIS A 1 86 ? 2.464   -0.206  -11.324 1.00 15.00 ? 86 HIS A HB3  2  
ATOM 2691  H HD1  . HIS A 1 86 ? -0.258  2.332   -10.952 1.00 15.00 ? 86 HIS A HD1  2  
ATOM 2692  H HD2  . HIS A 1 86 ? 0.671   -0.940  -13.340 1.00 15.00 ? 86 HIS A HD2  2  
ATOM 2693  H HE1  . HIS A 1 86 ? -2.366  1.804   -12.219 1.00 15.00 ? 86 HIS A HE1  2  
ATOM 2694  H HE2  . HIS A 1 86 ? -1.754  -0.123  -13.721 1.00 15.00 ? 86 HIS A HE2  2  
ATOM 2695  N N    . LEU A 1 87 ? 1.083   0.780   -7.804  1.00 15.00 ? 87 LEU A N    2  
ATOM 2696  C CA   . LEU A 1 87 ? 0.610   -0.115  -6.757  1.00 15.00 ? 87 LEU A CA   2  
ATOM 2697  C C    . LEU A 1 87 ? -0.906  -0.265  -6.788  1.00 15.00 ? 87 LEU A C    2  
ATOM 2698  O O    . LEU A 1 87 ? -1.637  0.700   -6.581  1.00 15.00 ? 87 LEU A O    2  
ATOM 2699  C CB   . LEU A 1 87 ? 1.046   0.410   -5.388  1.00 15.00 ? 87 LEU A CB   2  
ATOM 2700  C CG   . LEU A 1 87 ? 1.984   -0.511  -4.616  1.00 15.00 ? 87 LEU A CG   2  
ATOM 2701  C CD1  . LEU A 1 87 ? 3.148   0.275   -4.026  1.00 15.00 ? 87 LEU A CD1  2  
ATOM 2702  C CD2  . LEU A 1 87 ? 1.219   -1.243  -3.525  1.00 15.00 ? 87 LEU A CD2  2  
ATOM 2703  H H    . LEU A 1 87 ? 1.012   1.746   -7.672  1.00 15.00 ? 87 LEU A H    2  
ATOM 2704  H HA   . LEU A 1 87 ? 1.060   -1.083  -6.919  1.00 15.00 ? 87 LEU A HA   2  
ATOM 2705  H HB2  . LEU A 1 87 ? 1.540   1.358   -5.530  1.00 15.00 ? 87 LEU A HB2  2  
ATOM 2706  H HB3  . LEU A 1 87 ? 0.163   0.571   -4.789  1.00 15.00 ? 87 LEU A HB3  2  
ATOM 2707  H HG   . LEU A 1 87 ? 2.388   -1.244  -5.296  1.00 15.00 ? 87 LEU A HG   2  
ATOM 2708  H HD11 . LEU A 1 87 ? 3.067   1.313   -4.314  1.00 15.00 ? 87 LEU A HD11 2  
ATOM 2709  H HD12 . LEU A 1 87 ? 3.126   0.199   -2.949  1.00 15.00 ? 87 LEU A HD12 2  
ATOM 2710  H HD13 . LEU A 1 87 ? 4.079   -0.128  -4.396  1.00 15.00 ? 87 LEU A HD13 2  
ATOM 2711  H HD21 . LEU A 1 87 ? 0.946   -0.543  -2.750  1.00 15.00 ? 87 LEU A HD21 2  
ATOM 2712  H HD22 . LEU A 1 87 ? 0.325   -1.682  -3.944  1.00 15.00 ? 87 LEU A HD22 2  
ATOM 2713  H HD23 . LEU A 1 87 ? 1.840   -2.019  -3.107  1.00 15.00 ? 87 LEU A HD23 2  
ATOM 2714  N N    . LEU A 1 88 ? -1.372  -1.485  -7.028  1.00 15.00 ? 88 LEU A N    2  
ATOM 2715  C CA   . LEU A 1 88 ? -2.802  -1.759  -7.062  1.00 15.00 ? 88 LEU A CA   2  
ATOM 2716  C C    . LEU A 1 88 ? -3.274  -2.209  -5.686  1.00 15.00 ? 88 LEU A C    2  
ATOM 2717  O O    . LEU A 1 88 ? -3.082  -3.361  -5.296  1.00 15.00 ? 88 LEU A O    2  
ATOM 2718  C CB   . LEU A 1 88 ? -3.114  -2.827  -8.112  1.00 15.00 ? 88 LEU A CB   2  
ATOM 2719  C CG   . LEU A 1 88 ? -3.273  -2.302  -9.542  1.00 15.00 ? 88 LEU A CG   2  
ATOM 2720  C CD1  . LEU A 1 88 ? -2.219  -1.247  -9.849  1.00 15.00 ? 88 LEU A CD1  2  
ATOM 2721  C CD2  . LEU A 1 88 ? -3.190  -3.447  -10.540 1.00 15.00 ? 88 LEU A CD2  2  
ATOM 2722  H H    . LEU A 1 88 ? -0.739  -2.219  -7.170  1.00 15.00 ? 88 LEU A H    2  
ATOM 2723  H HA   . LEU A 1 88 ? -3.311  -0.841  -7.327  1.00 15.00 ? 88 LEU A HA   2  
ATOM 2724  H HB2  . LEU A 1 88 ? -2.315  -3.553  -8.103  1.00 15.00 ? 88 LEU A HB2  2  
ATOM 2725  H HB3  . LEU A 1 88 ? -4.031  -3.322  -7.830  1.00 15.00 ? 88 LEU A HB3  2  
ATOM 2726  H HG   . LEU A 1 88 ? -4.245  -1.841  -9.642  1.00 15.00 ? 88 LEU A HG   2  
ATOM 2727  H HD11 . LEU A 1 88 ? -2.122  -0.579  -9.004  1.00 15.00 ? 88 LEU A HD11 2  
ATOM 2728  H HD12 . LEU A 1 88 ? -1.272  -1.729  -10.038 1.00 15.00 ? 88 LEU A HD12 2  
ATOM 2729  H HD13 . LEU A 1 88 ? -2.518  -0.684  -10.720 1.00 15.00 ? 88 LEU A HD13 2  
ATOM 2730  H HD21 . LEU A 1 88 ? -2.156  -3.724  -10.685 1.00 15.00 ? 88 LEU A HD21 2  
ATOM 2731  H HD22 . LEU A 1 88 ? -3.740  -4.296  -10.162 1.00 15.00 ? 88 LEU A HD22 2  
ATOM 2732  H HD23 . LEU A 1 88 ? -3.614  -3.134  -11.483 1.00 15.00 ? 88 LEU A HD23 2  
ATOM 2733  N N    . LEU A 1 89 ? -3.872  -1.284  -4.947  1.00 15.00 ? 89 LEU A N    2  
ATOM 2734  C CA   . LEU A 1 89 ? -4.351  -1.572  -3.601  1.00 15.00 ? 89 LEU A CA   2  
ATOM 2735  C C    . LEU A 1 89 ? -5.863  -1.740  -3.567  1.00 15.00 ? 89 LEU A C    2  
ATOM 2736  O O    . LEU A 1 89 ? -6.508  -1.932  -4.598  1.00 15.00 ? 89 LEU A O    2  
ATOM 2737  C CB   . LEU A 1 89 ? -3.947  -0.451  -2.639  1.00 15.00 ? 89 LEU A CB   2  
ATOM 2738  C CG   . LEU A 1 89 ? -2.862  0.485   -3.151  1.00 15.00 ? 89 LEU A CG   2  
ATOM 2739  C CD1  . LEU A 1 89 ? -2.771  1.721   -2.276  1.00 15.00 ? 89 LEU A CD1  2  
ATOM 2740  C CD2  . LEU A 1 89 ? -1.534  -0.239  -3.196  1.00 15.00 ? 89 LEU A CD2  2  
ATOM 2741  H H    . LEU A 1 89 ? -3.982  -0.381  -5.311  1.00 15.00 ? 89 LEU A H    2  
ATOM 2742  H HA   . LEU A 1 89 ? -3.886  -2.489  -3.277  1.00 15.00 ? 89 LEU A HA   2  
ATOM 2743  H HB2  . LEU A 1 89 ? -4.825  0.138   -2.416  1.00 15.00 ? 89 LEU A HB2  2  
ATOM 2744  H HB3  . LEU A 1 89 ? -3.597  -0.902  -1.722  1.00 15.00 ? 89 LEU A HB3  2  
ATOM 2745  H HG   . LEU A 1 89 ? -3.107  0.800   -4.153  1.00 15.00 ? 89 LEU A HG   2  
ATOM 2746  H HD11 . LEU A 1 89 ? -3.614  1.747   -1.603  1.00 15.00 ? 89 LEU A HD11 2  
ATOM 2747  H HD12 . LEU A 1 89 ? -1.856  1.687   -1.706  1.00 15.00 ? 89 LEU A HD12 2  
ATOM 2748  H HD13 . LEU A 1 89 ? -2.777  2.602   -2.898  1.00 15.00 ? 89 LEU A HD13 2  
ATOM 2749  H HD21 . LEU A 1 89 ? -0.734  0.465   -3.031  1.00 15.00 ? 89 LEU A HD21 2  
ATOM 2750  H HD22 . LEU A 1 89 ? -1.516  -0.994  -2.425  1.00 15.00 ? 89 LEU A HD22 2  
ATOM 2751  H HD23 . LEU A 1 89 ? -1.413  -0.706  -4.161  1.00 15.00 ? 89 LEU A HD23 2  
ATOM 2752  N N    . GLU A 1 90 ? -6.416  -1.649  -2.364  1.00 15.00 ? 90 GLU A N    2  
ATOM 2753  C CA   . GLU A 1 90 ? -7.851  -1.771  -2.161  1.00 15.00 ? 90 GLU A CA   2  
ATOM 2754  C C    . GLU A 1 90 ? -8.324  -0.743  -1.137  1.00 15.00 ? 90 GLU A C    2  
ATOM 2755  O O    . GLU A 1 90 ? -7.585  -0.381  -0.221  1.00 15.00 ? 90 GLU A O    2  
ATOM 2756  C CB   . GLU A 1 90 ? -8.207  -3.196  -1.716  1.00 15.00 ? 90 GLU A CB   2  
ATOM 2757  C CG   . GLU A 1 90 ? -9.372  -3.278  -0.739  1.00 15.00 ? 90 GLU A CG   2  
ATOM 2758  C CD   . GLU A 1 90 ? -9.697  -4.703  -0.337  1.00 15.00 ? 90 GLU A CD   2  
ATOM 2759  O OE1  . GLU A 1 90 ? -8.769  -5.428  0.080   1.00 15.00 ? 90 GLU A OE1  2  
ATOM 2760  O OE2  . GLU A 1 90 ? -10.879 -5.094  -0.439  1.00 15.00 ? 90 GLU A OE2  2  
ATOM 2761  H H    . GLU A 1 90 ? -5.836  -1.485  -1.589  1.00 15.00 ? 90 GLU A H    2  
ATOM 2762  H HA   . GLU A 1 90 ? -8.335  -1.566  -3.104  1.00 15.00 ? 90 GLU A HA   2  
ATOM 2763  H HB2  . GLU A 1 90 ? -8.465  -3.773  -2.592  1.00 15.00 ? 90 GLU A HB2  2  
ATOM 2764  H HB3  . GLU A 1 90 ? -7.341  -3.640  -1.248  1.00 15.00 ? 90 GLU A HB3  2  
ATOM 2765  H HG2  . GLU A 1 90 ? -9.119  -2.719  0.150   1.00 15.00 ? 90 GLU A HG2  2  
ATOM 2766  H HG3  . GLU A 1 90 ? -10.245 -2.841  -1.201  1.00 15.00 ? 90 GLU A HG3  2  
ATOM 2767  N N    . LYS A 1 91 ? -9.553  -0.273  -1.301  1.00 15.00 ? 91 LYS A N    2  
ATOM 2768  C CA   . LYS A 1 91 ? -10.117 0.718   -0.395  1.00 15.00 ? 91 LYS A CA   2  
ATOM 2769  C C    . LYS A 1 91 ? -10.099 0.219   1.046   1.00 15.00 ? 91 LYS A C    2  
ATOM 2770  O O    . LYS A 1 91 ? -10.791 -0.739  1.393   1.00 15.00 ? 91 LYS A O    2  
ATOM 2771  C CB   . LYS A 1 91 ? -11.543 1.062   -0.823  1.00 15.00 ? 91 LYS A CB   2  
ATOM 2772  C CG   . LYS A 1 91 ? -12.073 2.348   -0.209  1.00 15.00 ? 91 LYS A CG   2  
ATOM 2773  C CD   . LYS A 1 91 ? -11.127 3.515   -0.449  1.00 15.00 ? 91 LYS A CD   2  
ATOM 2774  C CE   . LYS A 1 91 ? -10.395 3.911   0.824   1.00 15.00 ? 91 LYS A CE   2  
ATOM 2775  N NZ   . LYS A 1 91 ? -8.963  4.226   0.567   1.00 15.00 ? 91 LYS A NZ   2  
ATOM 2776  H H    . LYS A 1 91 ? -10.095 -0.597  -2.051  1.00 15.00 ? 91 LYS A H    2  
ATOM 2777  H HA   . LYS A 1 91 ? -9.508  1.608   -0.460  1.00 15.00 ? 91 LYS A HA   2  
ATOM 2778  H HB2  . LYS A 1 91 ? -11.564 1.165   -1.900  1.00 15.00 ? 91 LYS A HB2  2  
ATOM 2779  H HB3  . LYS A 1 91 ? -12.198 0.253   -0.535  1.00 15.00 ? 91 LYS A HB3  2  
ATOM 2780  H HG2  . LYS A 1 91 ? -13.031 2.579   -0.650  1.00 15.00 ? 91 LYS A HG2  2  
ATOM 2781  H HG3  . LYS A 1 91 ? -12.190 2.205   0.856   1.00 15.00 ? 91 LYS A HG3  2  
ATOM 2782  H HD2  . LYS A 1 91 ? -10.400 3.230   -1.195  1.00 15.00 ? 91 LYS A HD2  2  
ATOM 2783  H HD3  . LYS A 1 91 ? -11.698 4.361   -0.804  1.00 15.00 ? 91 LYS A HD3  2  
ATOM 2784  H HE2  . LYS A 1 91 ? -10.876 4.782   1.244   1.00 15.00 ? 91 LYS A HE2  2  
ATOM 2785  H HE3  . LYS A 1 91 ? -10.455 3.094   1.528   1.00 15.00 ? 91 LYS A HE3  2  
ATOM 2786  H HZ1  . LYS A 1 91 ? -8.398  3.353   0.574   1.00 15.00 ? 91 LYS A HZ1  2  
ATOM 2787  H HZ2  . LYS A 1 91 ? -8.859  4.686   -0.360  1.00 15.00 ? 91 LYS A HZ2  2  
ATOM 2788  H HZ3  . LYS A 1 91 ? -8.601  4.867   1.301   1.00 15.00 ? 91 LYS A HZ3  2  
ATOM 2789  N N    . GLY A 1 92 ? -9.296  0.874   1.879   1.00 15.00 ? 92 GLY A N    2  
ATOM 2790  C CA   . GLY A 1 92 ? -9.192  0.485   3.274   1.00 15.00 ? 92 GLY A CA   2  
ATOM 2791  C C    . GLY A 1 92 ? -10.435 0.826   4.071   1.00 15.00 ? 92 GLY A C    2  
ATOM 2792  O O    . GLY A 1 92 ? -10.525 1.900   4.664   1.00 15.00 ? 92 GLY A O    2  
ATOM 2793  H H    . GLY A 1 92 ? -8.766  1.626   1.543   1.00 15.00 ? 92 GLY A H    2  
ATOM 2794  H HA2  . GLY A 1 92 ? -9.026  -0.580  3.327   1.00 15.00 ? 92 GLY A HA2  2  
ATOM 2795  H HA3  . GLY A 1 92 ? -8.345  0.991   3.714   1.00 15.00 ? 92 GLY A HA3  2  
ATOM 2796  N N    . GLN A 1 93 ? -11.394 -0.094  4.089   1.00 15.00 ? 93 GLN A N    2  
ATOM 2797  C CA   . GLN A 1 93 ? -12.637 0.111   4.823   1.00 15.00 ? 93 GLN A CA   2  
ATOM 2798  C C    . GLN A 1 93 ? -12.483 -0.321  6.278   1.00 15.00 ? 93 GLN A C    2  
ATOM 2799  O O    . GLN A 1 93 ? -11.852 -1.337  6.570   1.00 15.00 ? 93 GLN A O    2  
ATOM 2800  C CB   . GLN A 1 93 ? -13.778 -0.667  4.165   1.00 15.00 ? 93 GLN A CB   2  
ATOM 2801  C CG   . GLN A 1 93 ? -13.529 -2.165  4.090   1.00 15.00 ? 93 GLN A CG   2  
ATOM 2802  C CD   . GLN A 1 93 ? -14.746 -2.979  4.484   1.00 15.00 ? 93 GLN A CD   2  
ATOM 2803  O OE1  . GLN A 1 93 ? -14.907 -3.353  5.646   1.00 15.00 ? 93 GLN A OE1  2  
ATOM 2804  N NE2  . GLN A 1 93 ? -15.610 -3.260  3.516   1.00 15.00 ? 93 GLN A NE2  2  
ATOM 2805  H H    . GLN A 1 93 ? -11.261 -0.932  3.599   1.00 15.00 ? 93 GLN A H    2  
ATOM 2806  H HA   . GLN A 1 93 ? -12.868 1.165   4.795   1.00 15.00 ? 93 GLN A HA   2  
ATOM 2807  H HB2  . GLN A 1 93 ? -14.683 -0.502  4.730   1.00 15.00 ? 93 GLN A HB2  2  
ATOM 2808  H HB3  . GLN A 1 93 ? -13.918 -0.297  3.160   1.00 15.00 ? 93 GLN A HB3  2  
ATOM 2809  H HG2  . GLN A 1 93 ? -13.256 -2.422  3.077   1.00 15.00 ? 93 GLN A HG2  2  
ATOM 2810  H HG3  . GLN A 1 93 ? -12.715 -2.415  4.755   1.00 15.00 ? 93 GLN A HG3  2  
ATOM 2811  H HE21 . GLN A 1 93 ? -15.416 -2.930  2.613   1.00 15.00 ? 93 GLN A HE21 2  
ATOM 2812  H HE22 . GLN A 1 93 ? -16.405 -3.785  3.743   1.00 15.00 ? 93 GLN A HE22 2  
ATOM 2813  N N    . SER A 1 94 ? -13.063 0.456   7.187   1.00 15.00 ? 94 SER A N    2  
ATOM 2814  C CA   . SER A 1 94 ? -12.988 0.151   8.611   1.00 15.00 ? 94 SER A CA   2  
ATOM 2815  C C    . SER A 1 94 ? -13.612 -1.212  8.910   1.00 15.00 ? 94 SER A C    2  
ATOM 2816  O O    . SER A 1 94 ? -14.681 -1.538  8.394   1.00 15.00 ? 94 SER A O    2  
ATOM 2817  C CB   . SER A 1 94 ? -13.694 1.236   9.426   1.00 15.00 ? 94 SER A CB   2  
ATOM 2818  O OG   . SER A 1 94 ? -14.747 1.827   8.684   1.00 15.00 ? 94 SER A OG   2  
ATOM 2819  H H    . SER A 1 94 ? -13.552 1.253   6.894   1.00 15.00 ? 94 SER A H    2  
ATOM 2820  H HA   . SER A 1 94 ? -11.945 0.127   8.888   1.00 15.00 ? 94 SER A HA   2  
ATOM 2821  H HB2  . SER A 1 94 ? -14.105 0.800   10.324  1.00 15.00 ? 94 SER A HB2  2  
ATOM 2822  H HB3  . SER A 1 94 ? -12.982 2.004   9.691   1.00 15.00 ? 94 SER A HB3  2  
ATOM 2823  H HG   . SER A 1 94 ? -15.246 1.141   8.234   1.00 15.00 ? 94 SER A HG   2  
ATOM 2824  N N    . PRO A 1 95 ? -12.952 -2.030  9.750   1.00 15.00 ? 95 PRO A N    2  
ATOM 2825  C CA   . PRO A 1 95 ? -13.454 -3.361  10.110  1.00 15.00 ? 95 PRO A CA   2  
ATOM 2826  C C    . PRO A 1 95 ? -14.884 -3.316  10.639  1.00 15.00 ? 95 PRO A C    2  
ATOM 2827  O O    . PRO A 1 95 ? -15.133 -2.831  11.743  1.00 15.00 ? 95 PRO A O    2  
ATOM 2828  C CB   . PRO A 1 95 ? -12.494 -3.823  11.209  1.00 15.00 ? 95 PRO A CB   2  
ATOM 2829  C CG   . PRO A 1 95 ? -11.240 -3.057  10.964  1.00 15.00 ? 95 PRO A CG   2  
ATOM 2830  C CD   . PRO A 1 95 ? -11.670 -1.726  10.413  1.00 15.00 ? 95 PRO A CD   2  
ATOM 2831  H HA   . PRO A 1 95 ? -13.403 -4.042  9.273   1.00 15.00 ? 95 PRO A HA   2  
ATOM 2832  H HB2  . PRO A 1 95 ? -12.915 -3.595  12.177  1.00 15.00 ? 95 PRO A HB2  2  
ATOM 2833  H HB3  . PRO A 1 95 ? -12.329 -4.886  11.123  1.00 15.00 ? 95 PRO A HB3  2  
ATOM 2834  H HG2  . PRO A 1 95 ? -10.705 -2.923  11.893  1.00 15.00 ? 95 PRO A HG2  2  
ATOM 2835  H HG3  . PRO A 1 95 ? -10.625 -3.579  10.247  1.00 15.00 ? 95 PRO A HG3  2  
ATOM 2836  H HD2  . PRO A 1 95 ? -11.808 -1.013  11.212  1.00 15.00 ? 95 PRO A HD2  2  
ATOM 2837  H HD3  . PRO A 1 95 ? -10.945 -1.361  9.701   1.00 15.00 ? 95 PRO A HD3  2  
ATOM 2838  N N    . THR A 1 96 ? -15.820 -3.823  9.844   1.00 15.00 ? 96 THR A N    2  
ATOM 2839  C CA   . THR A 1 96 ? -17.225 -3.841  10.233  1.00 15.00 ? 96 THR A CA   2  
ATOM 2840  C C    . THR A 1 96 ? -17.617 -5.203  10.798  1.00 15.00 ? 96 THR A C    2  
ATOM 2841  O O    . THR A 1 96 ? -18.639 -5.275  11.512  1.00 15.00 ? 96 THR A O    2  
ATOM 2842  C CB   . THR A 1 96 ? -18.113 -3.498  9.035   1.00 15.00 ? 96 THR A CB   2  
ATOM 2843  O OG1  . THR A 1 96 ? -18.064 -4.529  8.065   1.00 15.00 ? 96 THR A OG1  2  
ATOM 2844  C CG2  . THR A 1 96 ? -17.723 -2.205  8.352   1.00 15.00 ? 96 THR A CG2  2  
ATOM 2845  O OXT  . THR A 1 96 ? -16.898 -6.186  10.520  1.00 15.00 ? 96 THR A OXT  2  
ATOM 2846  H H    . THR A 1 96 ? -15.560 -4.196  8.975   1.00 15.00 ? 96 THR A H    2  
ATOM 2847  H HA   . THR A 1 96 ? -17.366 -3.093  10.999  1.00 15.00 ? 96 THR A HA   2  
ATOM 2848  H HB   . THR A 1 96 ? -19.134 -3.399  9.374   1.00 15.00 ? 96 THR A HB   2  
ATOM 2849  H HG1  . THR A 1 96 ? -18.509 -5.309  8.403   1.00 15.00 ? 96 THR A HG1  2  
ATOM 2850  H HG21 . THR A 1 96 ? -18.610 -1.716  7.976   1.00 15.00 ? 96 THR A HG21 2  
ATOM 2851  H HG22 . THR A 1 96 ? -17.229 -1.558  9.062   1.00 15.00 ? 96 THR A HG22 2  
ATOM 2852  H HG23 . THR A 1 96 ? -17.054 -2.419  7.532   1.00 15.00 ? 96 THR A HG23 2  
ATOM 2853  N N    . PRO A 1 1  ? -22.865 2.892   -2.768  1.00 15.00 ? 1  PRO A N    3  
ATOM 2854  C CA   . PRO A 1 1  ? -21.849 3.288   -1.756  1.00 15.00 ? 1  PRO A CA   3  
ATOM 2855  C C    . PRO A 1 1  ? -21.469 2.120   -0.847  1.00 15.00 ? 1  PRO A C    3  
ATOM 2856  O O    . PRO A 1 1  ? -22.067 1.924   0.211   1.00 15.00 ? 1  PRO A O    3  
ATOM 2857  C CB   . PRO A 1 1  ? -22.436 4.432   -0.935  1.00 15.00 ? 1  PRO A CB   3  
ATOM 2858  C CG   . PRO A 1 1  ? -23.852 4.526   -1.395  1.00 15.00 ? 1  PRO A CG   3  
ATOM 2859  C CD   . PRO A 1 1  ? -23.885 3.955   -2.792  1.00 15.00 ? 1  PRO A CD   3  
ATOM 2860  H H2   . PRO A 1 1  ? -23.146 1.949   -2.451  1.00 15.00 ? 1  PRO A H2   3  
ATOM 2861  H H3   . PRO A 1 1  ? -22.266 2.720   -3.609  1.00 15.00 ? 1  PRO A H3   3  
ATOM 2862  H HA   . PRO A 1 1  ? -20.966 3.636   -2.271  1.00 15.00 ? 1  PRO A HA   3  
ATOM 2863  H HB2  . PRO A 1 1  ? -22.374 4.196   0.117   1.00 15.00 ? 1  PRO A HB2  3  
ATOM 2864  H HB3  . PRO A 1 1  ? -21.894 5.343   -1.140  1.00 15.00 ? 1  PRO A HB3  3  
ATOM 2865  H HG2  . PRO A 1 1  ? -24.488 3.949   -0.740  1.00 15.00 ? 1  PRO A HG2  3  
ATOM 2866  H HG3  . PRO A 1 1  ? -24.165 5.560   -1.407  1.00 15.00 ? 1  PRO A HG3  3  
ATOM 2867  H HD2  . PRO A 1 1  ? -24.860 3.545   -3.007  1.00 15.00 ? 1  PRO A HD2  3  
ATOM 2868  H HD3  . PRO A 1 1  ? -23.627 4.715   -3.515  1.00 15.00 ? 1  PRO A HD3  3  
ATOM 2869  N N    . LYS A 1 2  ? -20.473 1.347   -1.269  1.00 15.00 ? 2  LYS A N    3  
ATOM 2870  C CA   . LYS A 1 2  ? -20.015 0.200   -0.494  1.00 15.00 ? 2  LYS A CA   3  
ATOM 2871  C C    . LYS A 1 2  ? -18.541 -0.089  -0.768  1.00 15.00 ? 2  LYS A C    3  
ATOM 2872  O O    . LYS A 1 2  ? -18.067 0.074   -1.892  1.00 15.00 ? 2  LYS A O    3  
ATOM 2873  C CB   . LYS A 1 2  ? -20.859 -1.032  -0.823  1.00 15.00 ? 2  LYS A CB   3  
ATOM 2874  C CG   . LYS A 1 2  ? -20.777 -1.454  -2.281  1.00 15.00 ? 2  LYS A CG   3  
ATOM 2875  C CD   . LYS A 1 2  ? -22.121 -1.942  -2.798  1.00 15.00 ? 2  LYS A CD   3  
ATOM 2876  C CE   . LYS A 1 2  ? -22.405 -1.417  -4.196  1.00 15.00 ? 2  LYS A CE   3  
ATOM 2877  N NZ   . LYS A 1 2  ? -22.079 -2.423  -5.245  1.00 15.00 ? 2  LYS A NZ   3  
ATOM 2878  H H    . LYS A 1 2  ? -20.035 1.554   -2.121  1.00 15.00 ? 2  LYS A H    3  
ATOM 2879  H HA   . LYS A 1 2  ? -20.136 0.439   0.552   1.00 15.00 ? 2  LYS A HA   3  
ATOM 2880  H HB2  . LYS A 1 2  ? -20.524 -1.858  -0.212  1.00 15.00 ? 2  LYS A HB2  3  
ATOM 2881  H HB3  . LYS A 1 2  ? -21.892 -0.820  -0.590  1.00 15.00 ? 2  LYS A HB3  3  
ATOM 2882  H HG2  . LYS A 1 2  ? -20.461 -0.608  -2.873  1.00 15.00 ? 2  LYS A HG2  3  
ATOM 2883  H HG3  . LYS A 1 2  ? -20.053 -2.251  -2.375  1.00 15.00 ? 2  LYS A HG3  3  
ATOM 2884  H HD2  . LYS A 1 2  ? -22.115 -3.022  -2.824  1.00 15.00 ? 2  LYS A HD2  3  
ATOM 2885  H HD3  . LYS A 1 2  ? -22.898 -1.601  -2.129  1.00 15.00 ? 2  LYS A HD3  3  
ATOM 2886  H HE2  . LYS A 1 2  ? -23.453 -1.165  -4.266  1.00 15.00 ? 2  LYS A HE2  3  
ATOM 2887  H HE3  . LYS A 1 2  ? -21.811 -0.531  -4.362  1.00 15.00 ? 2  LYS A HE3  3  
ATOM 2888  H HZ1  . LYS A 1 2  ? -21.630 -1.958  -6.060  1.00 15.00 ? 2  LYS A HZ1  3  
ATOM 2889  H HZ2  . LYS A 1 2  ? -21.426 -3.138  -4.865  1.00 15.00 ? 2  LYS A HZ2  3  
ATOM 2890  H HZ3  . LYS A 1 2  ? -22.947 -2.899  -5.566  1.00 15.00 ? 2  LYS A HZ3  3  
ATOM 2891  N N    . PRO A 1 3  ? -17.793 -0.526  0.261   1.00 15.00 ? 3  PRO A N    3  
ATOM 2892  C CA   . PRO A 1 3  ? -16.366 -0.838  0.124   1.00 15.00 ? 3  PRO A CA   3  
ATOM 2893  C C    . PRO A 1 3  ? -16.126 -2.103  -0.693  1.00 15.00 ? 3  PRO A C    3  
ATOM 2894  O O    . PRO A 1 3  ? -17.002 -2.551  -1.431  1.00 15.00 ? 3  PRO A O    3  
ATOM 2895  C CB   . PRO A 1 3  ? -15.905 -1.037  1.567   1.00 15.00 ? 3  PRO A CB   3  
ATOM 2896  C CG   . PRO A 1 3  ? -17.131 -1.456  2.303   1.00 15.00 ? 3  PRO A CG   3  
ATOM 2897  C CD   . PRO A 1 3  ? -18.278 -0.748  1.637   1.00 15.00 ? 3  PRO A CD   3  
ATOM 2898  H HA   . PRO A 1 3  ? -15.824 -0.016  -0.321  1.00 15.00 ? 3  PRO A HA   3  
ATOM 2899  H HB2  . PRO A 1 3  ? -15.143 -1.801  1.601   1.00 15.00 ? 3  PRO A HB2  3  
ATOM 2900  H HB3  . PRO A 1 3  ? -15.511 -0.110  1.953   1.00 15.00 ? 3  PRO A HB3  3  
ATOM 2901  H HG2  . PRO A 1 3  ? -17.256 -2.526  2.228   1.00 15.00 ? 3  PRO A HG2  3  
ATOM 2902  H HG3  . PRO A 1 3  ? -17.057 -1.157  3.338   1.00 15.00 ? 3  PRO A HG3  3  
ATOM 2903  H HD2  . PRO A 1 3  ? -19.159 -1.374  1.638   1.00 15.00 ? 3  PRO A HD2  3  
ATOM 2904  H HD3  . PRO A 1 3  ? -18.480 0.191   2.130   1.00 15.00 ? 3  PRO A HD3  3  
ATOM 2905  N N    . GLY A 1 4  ? -14.931 -2.671  -0.563  1.00 15.00 ? 4  GLY A N    3  
ATOM 2906  C CA   . GLY A 1 4  ? -14.601 -3.874  -1.302  1.00 15.00 ? 4  GLY A CA   3  
ATOM 2907  C C    . GLY A 1 4  ? -13.971 -3.568  -2.645  1.00 15.00 ? 4  GLY A C    3  
ATOM 2908  O O    . GLY A 1 4  ? -13.249 -4.394  -3.204  1.00 15.00 ? 4  GLY A O    3  
ATOM 2909  H H    . GLY A 1 4  ? -14.266 -2.267  0.032   1.00 15.00 ? 4  GLY A H    3  
ATOM 2910  H HA2  . GLY A 1 4  ? -13.911 -4.465  -0.718  1.00 15.00 ? 4  GLY A HA2  3  
ATOM 2911  H HA3  . GLY A 1 4  ? -15.504 -4.446  -1.461  1.00 15.00 ? 4  GLY A HA3  3  
ATOM 2912  N N    . ASP A 1 5  ? -14.243 -2.375  -3.163  1.00 15.00 ? 5  ASP A N    3  
ATOM 2913  C CA   . ASP A 1 5  ? -13.696 -1.957  -4.448  1.00 15.00 ? 5  ASP A CA   3  
ATOM 2914  C C    . ASP A 1 5  ? -12.179 -1.902  -4.397  1.00 15.00 ? 5  ASP A C    3  
ATOM 2915  O O    . ASP A 1 5  ? -11.586 -1.577  -3.368  1.00 15.00 ? 5  ASP A O    3  
ATOM 2916  C CB   . ASP A 1 5  ? -14.259 -0.593  -4.851  1.00 15.00 ? 5  ASP A CB   3  
ATOM 2917  C CG   . ASP A 1 5  ? -15.730 -0.658  -5.211  1.00 15.00 ? 5  ASP A CG   3  
ATOM 2918  O OD1  . ASP A 1 5  ? -16.095 -1.488  -6.070  1.00 15.00 ? 5  ASP A OD1  3  
ATOM 2919  O OD2  . ASP A 1 5  ? -16.518 0.120   -4.634  1.00 15.00 ? 5  ASP A OD2  3  
ATOM 2920  H H    . ASP A 1 5  ? -14.824 -1.760  -2.667  1.00 15.00 ? 5  ASP A H    3  
ATOM 2921  H HA   . ASP A 1 5  ? -13.981 -2.690  -5.190  1.00 15.00 ? 5  ASP A HA   3  
ATOM 2922  H HB2  . ASP A 1 5  ? -14.139 0.096   -4.029  1.00 15.00 ? 5  ASP A HB2  3  
ATOM 2923  H HB3  . ASP A 1 5  ? -13.713 -0.224  -5.707  1.00 15.00 ? 5  ASP A HB3  3  
ATOM 2924  N N    . ILE A 1 6  ? -11.564 -2.237  -5.518  1.00 15.00 ? 6  ILE A N    3  
ATOM 2925  C CA   . ILE A 1 6  ? -10.118 -2.249  -5.629  1.00 15.00 ? 6  ILE A CA   3  
ATOM 2926  C C    . ILE A 1 6  ? -9.617  -1.039  -6.413  1.00 15.00 ? 6  ILE A C    3  
ATOM 2927  O O    . ILE A 1 6  ? -10.233 -0.625  -7.394  1.00 15.00 ? 6  ILE A O    3  
ATOM 2928  C CB   . ILE A 1 6  ? -9.652  -3.544  -6.328  1.00 15.00 ? 6  ILE A CB   3  
ATOM 2929  C CG1  . ILE A 1 6  ? -9.325  -4.619  -5.292  1.00 15.00 ? 6  ILE A CG1  3  
ATOM 2930  C CG2  . ILE A 1 6  ? -8.445  -3.286  -7.228  1.00 15.00 ? 6  ILE A CG2  3  
ATOM 2931  C CD1  . ILE A 1 6  ? -10.466 -4.912  -4.341  1.00 15.00 ? 6  ILE A CD1  3  
ATOM 2932  H H    . ILE A 1 6  ? -12.102 -2.494  -6.296  1.00 15.00 ? 6  ILE A H    3  
ATOM 2933  H HA   . ILE A 1 6  ? -9.700  -2.230  -4.633  1.00 15.00 ? 6  ILE A HA   3  
ATOM 2934  H HB   . ILE A 1 6  ? -10.470 -3.892  -6.945  1.00 15.00 ? 6  ILE A HB   3  
ATOM 2935  H HG12 . ILE A 1 6  ? -9.077  -5.538  -5.802  1.00 15.00 ? 6  ILE A HG12 3  
ATOM 2936  H HG13 . ILE A 1 6  ? -8.476  -4.298  -4.706  1.00 15.00 ? 6  ILE A HG13 3  
ATOM 2937  H HG21 . ILE A 1 6  ? -7.659  -2.817  -6.653  1.00 15.00 ? 6  ILE A HG21 3  
ATOM 2938  H HG22 . ILE A 1 6  ? -8.088  -4.223  -7.629  1.00 15.00 ? 6  ILE A HG22 3  
ATOM 2939  H HG23 . ILE A 1 6  ? -8.732  -2.633  -8.040  1.00 15.00 ? 6  ILE A HG23 3  
ATOM 2940  H HD11 . ILE A 1 6  ? -10.527 -4.128  -3.600  1.00 15.00 ? 6  ILE A HD11 3  
ATOM 2941  H HD12 . ILE A 1 6  ? -11.393 -4.957  -4.894  1.00 15.00 ? 6  ILE A HD12 3  
ATOM 2942  H HD13 . ILE A 1 6  ? -10.293 -5.858  -3.851  1.00 15.00 ? 6  ILE A HD13 3  
ATOM 2943  N N    . PHE A 1 7  ? -8.484  -0.494  -5.988  1.00 15.00 ? 7  PHE A N    3  
ATOM 2944  C CA   . PHE A 1 7  ? -7.892  0.647   -6.670  1.00 15.00 ? 7  PHE A CA   3  
ATOM 2945  C C    . PHE A 1 7  ? -6.373  0.510   -6.725  1.00 15.00 ? 7  PHE A C    3  
ATOM 2946  O O    . PHE A 1 7  ? -5.789  -0.291  -5.997  1.00 15.00 ? 7  PHE A O    3  
ATOM 2947  C CB   . PHE A 1 7  ? -8.299  1.961   -5.990  1.00 15.00 ? 7  PHE A CB   3  
ATOM 2948  C CG   . PHE A 1 7  ? -7.501  2.298   -4.760  1.00 15.00 ? 7  PHE A CG   3  
ATOM 2949  C CD1  . PHE A 1 7  ? -6.204  2.777   -4.867  1.00 15.00 ? 7  PHE A CD1  3  
ATOM 2950  C CD2  . PHE A 1 7  ? -8.052  2.145   -3.498  1.00 15.00 ? 7  PHE A CD2  3  
ATOM 2951  C CE1  . PHE A 1 7  ? -5.473  3.094   -3.740  1.00 15.00 ? 7  PHE A CE1  3  
ATOM 2952  C CE2  . PHE A 1 7  ? -7.325  2.462   -2.367  1.00 15.00 ? 7  PHE A CE2  3  
ATOM 2953  C CZ   . PHE A 1 7  ? -6.034  2.937   -2.488  1.00 15.00 ? 7  PHE A CZ   3  
ATOM 2954  H H    . PHE A 1 7  ? -8.030  -0.878  -5.208  1.00 15.00 ? 7  PHE A H    3  
ATOM 2955  H HA   . PHE A 1 7  ? -8.270  0.645   -7.682  1.00 15.00 ? 7  PHE A HA   3  
ATOM 2956  H HB2  . PHE A 1 7  ? -8.175  2.771   -6.693  1.00 15.00 ? 7  PHE A HB2  3  
ATOM 2957  H HB3  . PHE A 1 7  ? -9.339  1.899   -5.704  1.00 15.00 ? 7  PHE A HB3  3  
ATOM 2958  H HD1  . PHE A 1 7  ? -5.763  2.899   -5.845  1.00 15.00 ? 7  PHE A HD1  3  
ATOM 2959  H HD2  . PHE A 1 7  ? -9.061  1.772   -3.402  1.00 15.00 ? 7  PHE A HD2  3  
ATOM 2960  H HE1  . PHE A 1 7  ? -4.464  3.466   -3.837  1.00 15.00 ? 7  PHE A HE1  3  
ATOM 2961  H HE2  . PHE A 1 7  ? -7.766  2.338   -1.389  1.00 15.00 ? 7  PHE A HE2  3  
ATOM 2962  H HZ   . PHE A 1 7  ? -5.465  3.187   -1.607  1.00 15.00 ? 7  PHE A HZ   3  
ATOM 2963  N N    . GLU A 1 8  ? -5.742  1.285   -7.599  1.00 15.00 ? 8  GLU A N    3  
ATOM 2964  C CA   . GLU A 1 8  ? -4.292  1.237   -7.756  1.00 15.00 ? 8  GLU A CA   3  
ATOM 2965  C C    . GLU A 1 8  ? -3.676  2.629   -7.677  1.00 15.00 ? 8  GLU A C    3  
ATOM 2966  O O    . GLU A 1 8  ? -4.245  3.607   -8.163  1.00 15.00 ? 8  GLU A O    3  
ATOM 2967  C CB   . GLU A 1 8  ? -3.933  0.601   -9.095  1.00 15.00 ? 8  GLU A CB   3  
ATOM 2968  C CG   . GLU A 1 8  ? -4.666  1.220   -10.266 1.00 15.00 ? 8  GLU A CG   3  
ATOM 2969  C CD   . GLU A 1 8  ? -4.557  0.390   -11.531 1.00 15.00 ? 8  GLU A CD   3  
ATOM 2970  O OE1  . GLU A 1 8  ? -4.637  -0.853  -11.434 1.00 15.00 ? 8  GLU A OE1  3  
ATOM 2971  O OE2  . GLU A 1 8  ? -4.393  0.983   -12.618 1.00 15.00 ? 8  GLU A OE2  3  
ATOM 2972  H H    . GLU A 1 8  ? -6.263  1.898   -8.159  1.00 15.00 ? 8  GLU A H    3  
ATOM 2973  H HA   . GLU A 1 8  ? -3.883  0.627   -6.959  1.00 15.00 ? 8  GLU A HA   3  
ATOM 2974  H HB2  . GLU A 1 8  ? -2.873  0.717   -9.261  1.00 15.00 ? 8  GLU A HB2  3  
ATOM 2975  H HB3  . GLU A 1 8  ? -4.174  -0.451  -9.059  1.00 15.00 ? 8  GLU A HB3  3  
ATOM 2976  H HG2  . GLU A 1 8  ? -5.708  1.318   -10.006 1.00 15.00 ? 8  GLU A HG2  3  
ATOM 2977  H HG3  . GLU A 1 8  ? -4.248  2.197   -10.455 1.00 15.00 ? 8  GLU A HG3  3  
ATOM 2978  N N    . VAL A 1 9  ? -2.498  2.694   -7.076  1.00 15.00 ? 9  VAL A N    3  
ATOM 2979  C CA   . VAL A 1 9  ? -1.763  3.945   -6.936  1.00 15.00 ? 9  VAL A CA   3  
ATOM 2980  C C    . VAL A 1 9  ? -0.654  4.011   -7.976  1.00 15.00 ? 9  VAL A C    3  
ATOM 2981  O O    . VAL A 1 9  ? 0.270   3.198   -7.966  1.00 15.00 ? 9  VAL A O    3  
ATOM 2982  C CB   . VAL A 1 9  ? -1.171  4.117   -5.507  1.00 15.00 ? 9  VAL A CB   3  
ATOM 2983  C CG1  . VAL A 1 9  ? -1.292  2.831   -4.704  1.00 15.00 ? 9  VAL A CG1  3  
ATOM 2984  C CG2  . VAL A 1 9  ? 0.283   4.576   -5.553  1.00 15.00 ? 9  VAL A CG2  3  
ATOM 2985  H H    . VAL A 1 9  ? -2.101  1.869   -6.733  1.00 15.00 ? 9  VAL A H    3  
ATOM 2986  H HA   . VAL A 1 9  ? -2.453  4.756   -7.120  1.00 15.00 ? 9  VAL A HA   3  
ATOM 2987  H HB   . VAL A 1 9  ? -1.745  4.878   -4.999  1.00 15.00 ? 9  VAL A HB   3  
ATOM 2988  H HG11 . VAL A 1 9  ? -2.265  2.389   -4.872  1.00 15.00 ? 9  VAL A HG11 3  
ATOM 2989  H HG12 . VAL A 1 9  ? -0.526  2.141   -5.017  1.00 15.00 ? 9  VAL A HG12 3  
ATOM 2990  H HG13 . VAL A 1 9  ? -1.171  3.051   -3.655  1.00 15.00 ? 9  VAL A HG13 3  
ATOM 2991  H HG21 . VAL A 1 9  ? 0.905   3.769   -5.911  1.00 15.00 ? 9  VAL A HG21 3  
ATOM 2992  H HG22 . VAL A 1 9  ? 0.373   5.422   -6.219  1.00 15.00 ? 9  VAL A HG22 3  
ATOM 2993  H HG23 . VAL A 1 9  ? 0.602   4.862   -4.562  1.00 15.00 ? 9  VAL A HG23 3  
ATOM 2994  N N    . GLU A 1 10 ? -0.760  4.969   -8.881  1.00 15.00 ? 10 GLU A N    3  
ATOM 2995  C CA   . GLU A 1 10 ? 0.227   5.123   -9.935  1.00 15.00 ? 10 GLU A CA   3  
ATOM 2996  C C    . GLU A 1 10 ? 1.135   6.322   -9.687  1.00 15.00 ? 10 GLU A C    3  
ATOM 2997  O O    . GLU A 1 10 ? 1.065   7.325   -10.397 1.00 15.00 ? 10 GLU A O    3  
ATOM 2998  C CB   . GLU A 1 10 ? -0.478  5.258   -11.280 1.00 15.00 ? 10 GLU A CB   3  
ATOM 2999  C CG   . GLU A 1 10 ? 0.467   5.474   -12.451 1.00 15.00 ? 10 GLU A CG   3  
ATOM 3000  C CD   . GLU A 1 10 ? -0.068  4.895   -13.746 1.00 15.00 ? 10 GLU A CD   3  
ATOM 3001  O OE1  . GLU A 1 10 ? -0.296  3.668   -13.797 1.00 15.00 ? 10 GLU A OE1  3  
ATOM 3002  O OE2  . GLU A 1 10 ? -0.258  5.668   -14.709 1.00 15.00 ? 10 GLU A OE2  3  
ATOM 3003  H H    . GLU A 1 10 ? -1.525  5.581   -8.847  1.00 15.00 ? 10 GLU A H    3  
ATOM 3004  H HA   . GLU A 1 10 ? 0.833   4.230   -9.950  1.00 15.00 ? 10 GLU A HA   3  
ATOM 3005  H HB2  . GLU A 1 10 ? -1.042  4.356   -11.460 1.00 15.00 ? 10 GLU A HB2  3  
ATOM 3006  H HB3  . GLU A 1 10 ? -1.158  6.095   -11.230 1.00 15.00 ? 10 GLU A HB3  3  
ATOM 3007  H HG2  . GLU A 1 10 ? 0.618   6.535   -12.585 1.00 15.00 ? 10 GLU A HG2  3  
ATOM 3008  H HG3  . GLU A 1 10 ? 1.413   5.003   -12.226 1.00 15.00 ? 10 GLU A HG3  3  
ATOM 3009  N N    . LEU A 1 11 ? 1.998   6.204   -8.686  1.00 15.00 ? 11 LEU A N    3  
ATOM 3010  C CA   . LEU A 1 11 ? 2.932   7.272   -8.359  1.00 15.00 ? 11 LEU A CA   3  
ATOM 3011  C C    . LEU A 1 11 ? 4.210   7.116   -9.173  1.00 15.00 ? 11 LEU A C    3  
ATOM 3012  O O    . LEU A 1 11 ? 4.447   6.066   -9.766  1.00 15.00 ? 11 LEU A O    3  
ATOM 3013  C CB   . LEU A 1 11 ? 3.257   7.262   -6.863  1.00 15.00 ? 11 LEU A CB   3  
ATOM 3014  C CG   . LEU A 1 11 ? 3.314   8.641   -6.203  1.00 15.00 ? 11 LEU A CG   3  
ATOM 3015  C CD1  . LEU A 1 11 ? 1.971   9.345   -6.315  1.00 15.00 ? 11 LEU A CD1  3  
ATOM 3016  C CD2  . LEU A 1 11 ? 3.731   8.514   -4.745  1.00 15.00 ? 11 LEU A CD2  3  
ATOM 3017  H H    . LEU A 1 11 ? 2.011   5.378   -8.161  1.00 15.00 ? 11 LEU A H    3  
ATOM 3018  H HA   . LEU A 1 11 ? 2.467   8.208   -8.612  1.00 15.00 ? 11 LEU A HA   3  
ATOM 3019  H HB2  . LEU A 1 11 ? 2.507   6.673   -6.359  1.00 15.00 ? 11 LEU A HB2  3  
ATOM 3020  H HB3  . LEU A 1 11 ? 4.216   6.785   -6.727  1.00 15.00 ? 11 LEU A HB3  3  
ATOM 3021  H HG   . LEU A 1 11 ? 4.051   9.246   -6.711  1.00 15.00 ? 11 LEU A HG   3  
ATOM 3022  H HD11 . LEU A 1 11 ? 1.414   8.931   -7.141  1.00 15.00 ? 11 LEU A HD11 3  
ATOM 3023  H HD12 . LEU A 1 11 ? 1.414   9.207   -5.400  1.00 15.00 ? 11 LEU A HD12 3  
ATOM 3024  H HD13 . LEU A 1 11 ? 2.131   10.400  -6.482  1.00 15.00 ? 11 LEU A HD13 3  
ATOM 3025  H HD21 . LEU A 1 11 ? 2.883   8.202   -4.154  1.00 15.00 ? 11 LEU A HD21 3  
ATOM 3026  H HD22 . LEU A 1 11 ? 4.520   7.782   -4.659  1.00 15.00 ? 11 LEU A HD22 3  
ATOM 3027  H HD23 . LEU A 1 11 ? 4.087   9.470   -4.389  1.00 15.00 ? 11 LEU A HD23 3  
ATOM 3028  N N    . ALA A 1 12 ? 5.030   8.159   -9.206  1.00 15.00 ? 12 ALA A N    3  
ATOM 3029  C CA   . ALA A 1 12 ? 6.278   8.114   -9.958  1.00 15.00 ? 12 ALA A CA   3  
ATOM 3030  C C    . ALA A 1 12 ? 7.448   7.738   -9.058  1.00 15.00 ? 12 ALA A C    3  
ATOM 3031  O O    . ALA A 1 12 ? 8.047   8.595   -8.408  1.00 15.00 ? 12 ALA A O    3  
ATOM 3032  C CB   . ALA A 1 12 ? 6.541   9.447   -10.638 1.00 15.00 ? 12 ALA A CB   3  
ATOM 3033  H H    . ALA A 1 12 ? 4.791   8.974   -8.717  1.00 15.00 ? 12 ALA A H    3  
ATOM 3034  H HA   . ALA A 1 12 ? 6.175   7.360   -10.728 1.00 15.00 ? 12 ALA A HA   3  
ATOM 3035  H HB1  . ALA A 1 12 ? 7.147   9.286   -11.518 1.00 15.00 ? 12 ALA A HB1  3  
ATOM 3036  H HB2  . ALA A 1 12 ? 5.602   9.896   -10.925 1.00 15.00 ? 12 ALA A HB2  3  
ATOM 3037  H HB3  . ALA A 1 12 ? 7.062   10.103  -9.957  1.00 15.00 ? 12 ALA A HB3  3  
ATOM 3038  N N    . LYS A 1 13 ? 7.766   6.449   -9.026  1.00 15.00 ? 13 LYS A N    3  
ATOM 3039  C CA   . LYS A 1 13 ? 8.864   5.948   -8.209  1.00 15.00 ? 13 LYS A CA   3  
ATOM 3040  C C    . LYS A 1 13 ? 10.161  6.693   -8.515  1.00 15.00 ? 13 LYS A C    3  
ATOM 3041  O O    . LYS A 1 13 ? 11.032  6.825   -7.655  1.00 15.00 ? 13 LYS A O    3  
ATOM 3042  C CB   . LYS A 1 13 ? 9.045   4.447   -8.443  1.00 15.00 ? 13 LYS A CB   3  
ATOM 3043  C CG   . LYS A 1 13 ? 9.539   3.698   -7.219  1.00 15.00 ? 13 LYS A CG   3  
ATOM 3044  C CD   . LYS A 1 13 ? 10.920  4.168   -6.799  1.00 15.00 ? 13 LYS A CD   3  
ATOM 3045  C CE   . LYS A 1 13 ? 10.852  5.048   -5.561  1.00 15.00 ? 13 LYS A CE   3  
ATOM 3046  N NZ   . LYS A 1 13 ? 12.204  5.484   -5.112  1.00 15.00 ? 13 LYS A NZ   3  
ATOM 3047  H H    . LYS A 1 13 ? 7.249   5.818   -9.568  1.00 15.00 ? 13 LYS A H    3  
ATOM 3048  H HA   . LYS A 1 13 ? 8.606   6.112   -7.173  1.00 15.00 ? 13 LYS A HA   3  
ATOM 3049  H HB2  . LYS A 1 13 ? 8.095   4.025   -8.736  1.00 15.00 ? 13 LYS A HB2  3  
ATOM 3050  H HB3  . LYS A 1 13 ? 9.756   4.299   -9.242  1.00 15.00 ? 13 LYS A HB3  3  
ATOM 3051  H HG2  . LYS A 1 13 ? 8.850   3.863   -6.405  1.00 15.00 ? 13 LYS A HG2  3  
ATOM 3052  H HG3  . LYS A 1 13 ? 9.581   2.646   -7.448  1.00 15.00 ? 13 LYS A HG3  3  
ATOM 3053  H HD2  . LYS A 1 13 ? 11.533  3.305   -6.583  1.00 15.00 ? 13 LYS A HD2  3  
ATOM 3054  H HD3  . LYS A 1 13 ? 11.359  4.731   -7.610  1.00 15.00 ? 13 LYS A HD3  3  
ATOM 3055  H HE2  . LYS A 1 13 ? 10.259  5.921   -5.788  1.00 15.00 ? 13 LYS A HE2  3  
ATOM 3056  H HE3  . LYS A 1 13 ? 10.379  4.491   -4.766  1.00 15.00 ? 13 LYS A HE3  3  
ATOM 3057  H HZ1  . LYS A 1 13 ? 12.448  5.021   -4.213  1.00 15.00 ? 13 LYS A HZ1  3  
ATOM 3058  H HZ2  . LYS A 1 13 ? 12.918  5.229   -5.824  1.00 15.00 ? 13 LYS A HZ2  3  
ATOM 3059  H HZ3  . LYS A 1 13 ? 12.220  6.515   -4.973  1.00 15.00 ? 13 LYS A HZ3  3  
ATOM 3060  N N    . ASN A 1 14 ? 10.280  7.185   -9.742  1.00 15.00 ? 14 ASN A N    3  
ATOM 3061  C CA   . ASN A 1 14 ? 11.468  7.921   -10.157 1.00 15.00 ? 14 ASN A CA   3  
ATOM 3062  C C    . ASN A 1 14 ? 11.357  9.388   -9.757  1.00 15.00 ? 14 ASN A C    3  
ATOM 3063  O O    . ASN A 1 14 ? 10.255  9.910   -9.586  1.00 15.00 ? 14 ASN A O    3  
ATOM 3064  C CB   . ASN A 1 14 ? 11.662  7.809   -11.671 1.00 15.00 ? 14 ASN A CB   3  
ATOM 3065  C CG   . ASN A 1 14 ? 12.519  6.621   -12.060 1.00 15.00 ? 14 ASN A CG   3  
ATOM 3066  O OD1  . ASN A 1 14 ? 13.532  6.336   -11.421 1.00 15.00 ? 14 ASN A OD1  3  
ATOM 3067  N ND2  . ASN A 1 14 ? 12.116  5.922   -13.114 1.00 15.00 ? 14 ASN A ND2  3  
ATOM 3068  H H    . ASN A 1 14 ? 9.552   7.052   -10.381 1.00 15.00 ? 14 ASN A H    3  
ATOM 3069  H HA   . ASN A 1 14 ? 12.322  7.486   -9.659  1.00 15.00 ? 14 ASN A HA   3  
ATOM 3070  H HB2  . ASN A 1 14 ? 10.697  7.702   -12.143 1.00 15.00 ? 14 ASN A HB2  3  
ATOM 3071  H HB3  . ASN A 1 14 ? 12.138  8.708   -12.034 1.00 15.00 ? 14 ASN A HB3  3  
ATOM 3072  H HD21 . ASN A 1 14 ? 11.299  6.208   -13.574 1.00 15.00 ? 14 ASN A HD21 3  
ATOM 3073  H HD22 . ASN A 1 14 ? 12.651  5.149   -13.389 1.00 15.00 ? 14 ASN A HD22 3  
ATOM 3074  N N    . ASP A 1 15 ? 12.507  10.043  -9.595  1.00 15.00 ? 15 ASP A N    3  
ATOM 3075  C CA   . ASP A 1 15 ? 12.557  11.453  -9.198  1.00 15.00 ? 15 ASP A CA   3  
ATOM 3076  C C    . ASP A 1 15 ? 12.454  11.593  -7.681  1.00 15.00 ? 15 ASP A C    3  
ATOM 3077  O O    . ASP A 1 15 ? 13.181  12.377  -7.070  1.00 15.00 ? 15 ASP A O    3  
ATOM 3078  C CB   . ASP A 1 15 ? 11.443  12.257  -9.876  1.00 15.00 ? 15 ASP A CB   3  
ATOM 3079  C CG   . ASP A 1 15 ? 11.748  13.742  -9.925  1.00 15.00 ? 15 ASP A CG   3  
ATOM 3080  O OD1  . ASP A 1 15 ? 12.210  14.286  -8.901  1.00 15.00 ? 15 ASP A OD1  3  
ATOM 3081  O OD2  . ASP A 1 15 ? 11.525  14.359  -10.987 1.00 15.00 ? 15 ASP A OD2  3  
ATOM 3082  H H    . ASP A 1 15 ? 13.349  9.562   -9.738  1.00 15.00 ? 15 ASP A H    3  
ATOM 3083  H HA   . ASP A 1 15 ? 13.512  11.846  -9.515  1.00 15.00 ? 15 ASP A HA   3  
ATOM 3084  H HB2  . ASP A 1 15 ? 11.315  11.902  -10.888 1.00 15.00 ? 15 ASP A HB2  3  
ATOM 3085  H HB3  . ASP A 1 15 ? 10.522  12.115  -9.330  1.00 15.00 ? 15 ASP A HB3  3  
ATOM 3086  N N    . ASN A 1 16 ? 11.552  10.825  -7.078  1.00 15.00 ? 16 ASN A N    3  
ATOM 3087  C CA   . ASN A 1 16 ? 11.356  10.855  -5.635  1.00 15.00 ? 16 ASN A CA   3  
ATOM 3088  C C    . ASN A 1 16 ? 10.769  9.532   -5.151  1.00 15.00 ? 16 ASN A C    3  
ATOM 3089  O O    . ASN A 1 16 ? 9.975   8.903   -5.851  1.00 15.00 ? 16 ASN A O    3  
ATOM 3090  C CB   . ASN A 1 16 ? 10.437  12.017  -5.244  1.00 15.00 ? 16 ASN A CB   3  
ATOM 3091  C CG   . ASN A 1 16 ? 11.107  12.987  -4.291  1.00 15.00 ? 16 ASN A CG   3  
ATOM 3092  O OD1  . ASN A 1 16 ? 12.332  13.096  -4.258  1.00 15.00 ? 16 ASN A OD1  3  
ATOM 3093  N ND2  . ASN A 1 16 ? 10.303  13.697  -3.508  1.00 15.00 ? 16 ASN A ND2  3  
ATOM 3094  H H    . ASN A 1 16 ? 11.005  10.219  -7.617  1.00 15.00 ? 16 ASN A H    3  
ATOM 3095  H HA   . ASN A 1 16 ? 12.321  10.998  -5.172  1.00 15.00 ? 16 ASN A HA   3  
ATOM 3096  H HB2  . ASN A 1 16 ? 10.151  12.557  -6.134  1.00 15.00 ? 16 ASN A HB2  3  
ATOM 3097  H HB3  . ASN A 1 16 ? 9.550   11.625  -4.766  1.00 15.00 ? 16 ASN A HB3  3  
ATOM 3098  H HD21 . ASN A 1 16 ? 9.337   13.558  -3.588  1.00 15.00 ? 16 ASN A HD21 3  
ATOM 3099  H HD22 . ASN A 1 16 ? 10.710  14.332  -2.882  1.00 15.00 ? 16 ASN A HD22 3  
ATOM 3100  N N    . SER A 1 17 ? 11.166  9.113   -3.955  1.00 15.00 ? 17 SER A N    3  
ATOM 3101  C CA   . SER A 1 17 ? 10.680  7.860   -3.388  1.00 15.00 ? 17 SER A CA   3  
ATOM 3102  C C    . SER A 1 17 ? 9.363   8.071   -2.656  1.00 15.00 ? 17 SER A C    3  
ATOM 3103  O O    . SER A 1 17 ? 8.704   9.095   -2.827  1.00 15.00 ? 17 SER A O    3  
ATOM 3104  C CB   . SER A 1 17 ? 11.711  7.272   -2.424  1.00 15.00 ? 17 SER A CB   3  
ATOM 3105  O OG   . SER A 1 17 ? 12.885  8.066   -2.379  1.00 15.00 ? 17 SER A OG   3  
ATOM 3106  H H    . SER A 1 17 ? 11.804  9.654   -3.445  1.00 15.00 ? 17 SER A H    3  
ATOM 3107  H HA   . SER A 1 17 ? 10.522  7.166   -4.199  1.00 15.00 ? 17 SER A HA   3  
ATOM 3108  H HB2  . SER A 1 17 ? 11.283  7.227   -1.432  1.00 15.00 ? 17 SER A HB2  3  
ATOM 3109  H HB3  . SER A 1 17 ? 11.975  6.276   -2.746  1.00 15.00 ? 17 SER A HB3  3  
ATOM 3110  H HG   . SER A 1 17 ? 13.451  7.760   -1.666  1.00 15.00 ? 17 SER A HG   3  
ATOM 3111  N N    . LEU A 1 18 ? 8.986   7.097   -1.837  1.00 15.00 ? 18 LEU A N    3  
ATOM 3112  C CA   . LEU A 1 18 ? 7.750   7.185   -1.079  1.00 15.00 ? 18 LEU A CA   3  
ATOM 3113  C C    . LEU A 1 18 ? 8.006   7.772   0.305   1.00 15.00 ? 18 LEU A C    3  
ATOM 3114  O O    . LEU A 1 18 ? 9.099   8.262   0.589   1.00 15.00 ? 18 LEU A O    3  
ATOM 3115  C CB   . LEU A 1 18 ? 7.096   5.805   -0.955  1.00 15.00 ? 18 LEU A CB   3  
ATOM 3116  C CG   . LEU A 1 18 ? 6.869   5.071   -2.280  1.00 15.00 ? 18 LEU A CG   3  
ATOM 3117  C CD1  . LEU A 1 18 ? 6.183   5.982   -3.287  1.00 15.00 ? 18 LEU A CD1  3  
ATOM 3118  C CD2  . LEU A 1 18 ? 8.188   4.556   -2.836  1.00 15.00 ? 18 LEU A CD2  3  
ATOM 3119  H H    . LEU A 1 18 ? 9.553   6.305   -1.738  1.00 15.00 ? 18 LEU A H    3  
ATOM 3120  H HA   . LEU A 1 18 ? 7.086   7.842   -1.617  1.00 15.00 ? 18 LEU A HA   3  
ATOM 3121  H HB2  . LEU A 1 18 ? 7.725   5.188   -0.329  1.00 15.00 ? 18 LEU A HB2  3  
ATOM 3122  H HB3  . LEU A 1 18 ? 6.140   5.924   -0.469  1.00 15.00 ? 18 LEU A HB3  3  
ATOM 3123  H HG   . LEU A 1 18 ? 6.225   4.222   -2.106  1.00 15.00 ? 18 LEU A HG   3  
ATOM 3124  H HD11 . LEU A 1 18 ? 5.561   6.692   -2.763  1.00 15.00 ? 18 LEU A HD11 3  
ATOM 3125  H HD12 . LEU A 1 18 ? 6.930   6.511   -3.860  1.00 15.00 ? 18 LEU A HD12 3  
ATOM 3126  H HD13 . LEU A 1 18 ? 5.572   5.388   -3.951  1.00 15.00 ? 18 LEU A HD13 3  
ATOM 3127  H HD21 . LEU A 1 18 ? 8.685   5.348   -3.376  1.00 15.00 ? 18 LEU A HD21 3  
ATOM 3128  H HD22 . LEU A 1 18 ? 8.817   4.224   -2.024  1.00 15.00 ? 18 LEU A HD22 3  
ATOM 3129  H HD23 . LEU A 1 18 ? 7.998   3.729   -3.505  1.00 15.00 ? 18 LEU A HD23 3  
ATOM 3130  N N    . GLY A 1 19 ? 6.992   7.725   1.159   1.00 15.00 ? 19 GLY A N    3  
ATOM 3131  C CA   . GLY A 1 19 ? 7.127   8.261   2.499   1.00 15.00 ? 19 GLY A CA   3  
ATOM 3132  C C    . GLY A 1 19 ? 5.969   7.878   3.389   1.00 15.00 ? 19 GLY A C    3  
ATOM 3133  O O    . GLY A 1 19 ? 5.443   8.710   4.121   1.00 15.00 ? 19 GLY A O    3  
ATOM 3134  H H    . GLY A 1 19 ? 6.143   7.327   0.877   1.00 15.00 ? 19 GLY A H    3  
ATOM 3135  H HA2  . GLY A 1 19 ? 8.042   7.894   2.939   1.00 15.00 ? 19 GLY A HA2  3  
ATOM 3136  H HA3  . GLY A 1 19 ? 7.175   9.336   2.437   1.00 15.00 ? 19 GLY A HA3  3  
ATOM 3137  N N    . ILE A 1 20 ? 5.564   6.619   3.314   1.00 15.00 ? 20 ILE A N    3  
ATOM 3138  C CA   . ILE A 1 20 ? 4.456   6.122   4.115   1.00 15.00 ? 20 ILE A CA   3  
ATOM 3139  C C    . ILE A 1 20 ? 4.927   5.108   5.154   1.00 15.00 ? 20 ILE A C    3  
ATOM 3140  O O    . ILE A 1 20 ? 5.751   4.242   4.864   1.00 15.00 ? 20 ILE A O    3  
ATOM 3141  C CB   . ILE A 1 20 ? 3.368   5.489   3.217   1.00 15.00 ? 20 ILE A CB   3  
ATOM 3142  C CG1  . ILE A 1 20 ? 2.037   6.189   3.447   1.00 15.00 ? 20 ILE A CG1  3  
ATOM 3143  C CG2  . ILE A 1 20 ? 3.227   4.001   3.484   1.00 15.00 ? 20 ILE A CG2  3  
ATOM 3144  C CD1  . ILE A 1 20 ? 0.847   5.448   2.887   1.00 15.00 ? 20 ILE A CD1  3  
ATOM 3145  H H    . ILE A 1 20 ? 6.022   6.006   2.700   1.00 15.00 ? 20 ILE A H    3  
ATOM 3146  H HA   . ILE A 1 20 ? 4.013   6.961   4.635   1.00 15.00 ? 20 ILE A HA   3  
ATOM 3147  H HB   . ILE A 1 20 ? 3.661   5.621   2.189   1.00 15.00 ? 20 ILE A HB   3  
ATOM 3148  H HG12 . ILE A 1 20 ? 1.885   6.294   4.505   1.00 15.00 ? 20 ILE A HG12 3  
ATOM 3149  H HG13 . ILE A 1 20 ? 2.068   7.166   2.991   1.00 15.00 ? 20 ILE A HG13 3  
ATOM 3150  H HG21 . ILE A 1 20 ? 4.191   3.525   3.400   1.00 15.00 ? 20 ILE A HG21 3  
ATOM 3151  H HG22 . ILE A 1 20 ? 2.837   3.859   4.482   1.00 15.00 ? 20 ILE A HG22 3  
ATOM 3152  H HG23 . ILE A 1 20 ? 2.545   3.571   2.767   1.00 15.00 ? 20 ILE A HG23 3  
ATOM 3153  H HD11 . ILE A 1 20 ? 0.051   6.148   2.683   1.00 15.00 ? 20 ILE A HD11 3  
ATOM 3154  H HD12 . ILE A 1 20 ? 1.134   4.950   1.973   1.00 15.00 ? 20 ILE A HD12 3  
ATOM 3155  H HD13 . ILE A 1 20 ? 0.509   4.715   3.608   1.00 15.00 ? 20 ILE A HD13 3  
ATOM 3156  N N    . SER A 1 21 ? 4.366   5.201   6.353   1.00 15.00 ? 21 SER A N    3  
ATOM 3157  C CA   . SER A 1 21 ? 4.695   4.268   7.420   1.00 15.00 ? 21 SER A CA   3  
ATOM 3158  C C    . SER A 1 21 ? 3.643   3.165   7.442   1.00 15.00 ? 21 SER A C    3  
ATOM 3159  O O    . SER A 1 21 ? 2.503   3.393   7.846   1.00 15.00 ? 21 SER A O    3  
ATOM 3160  C CB   . SER A 1 21 ? 4.756   4.991   8.769   1.00 15.00 ? 21 SER A CB   3  
ATOM 3161  O OG   . SER A 1 21 ? 4.836   4.067   9.841   1.00 15.00 ? 21 SER A OG   3  
ATOM 3162  H H    . SER A 1 21 ? 3.692   5.894   6.513   1.00 15.00 ? 21 SER A H    3  
ATOM 3163  H HA   . SER A 1 21 ? 5.659   3.833   7.201   1.00 15.00 ? 21 SER A HA   3  
ATOM 3164  H HB2  . SER A 1 21 ? 5.629   5.629   8.793   1.00 15.00 ? 21 SER A HB2  3  
ATOM 3165  H HB3  . SER A 1 21 ? 3.871   5.594   8.894   1.00 15.00 ? 21 SER A HB3  3  
ATOM 3166  H HG   . SER A 1 21 ? 5.465   3.376   9.622   1.00 15.00 ? 21 SER A HG   3  
ATOM 3167  N N    . VAL A 1 22 ? 4.014   1.983   6.960   1.00 15.00 ? 22 VAL A N    3  
ATOM 3168  C CA   . VAL A 1 22 ? 3.073   0.870   6.882   1.00 15.00 ? 22 VAL A CA   3  
ATOM 3169  C C    . VAL A 1 22 ? 3.138   -0.043  8.102   1.00 15.00 ? 22 VAL A C    3  
ATOM 3170  O O    . VAL A 1 22 ? 4.157   -0.115  8.790   1.00 15.00 ? 22 VAL A O    3  
ATOM 3171  C CB   . VAL A 1 22 ? 3.312   0.037   5.604   1.00 15.00 ? 22 VAL A CB   3  
ATOM 3172  C CG1  . VAL A 1 22 ? 3.381   0.943   4.385   1.00 15.00 ? 22 VAL A CG1  3  
ATOM 3173  C CG2  . VAL A 1 22 ? 4.585   -0.792  5.721   1.00 15.00 ? 22 VAL A CG2  3  
ATOM 3174  H H    . VAL A 1 22 ? 4.927   1.867   6.617   1.00 15.00 ? 22 VAL A H    3  
ATOM 3175  H HA   . VAL A 1 22 ? 2.080   1.290   6.823   1.00 15.00 ? 22 VAL A HA   3  
ATOM 3176  H HB   . VAL A 1 22 ? 2.478   -0.636  5.477   1.00 15.00 ? 22 VAL A HB   3  
ATOM 3177  H HG11 . VAL A 1 22 ? 3.445   1.973   4.704   1.00 15.00 ? 22 VAL A HG11 3  
ATOM 3178  H HG12 . VAL A 1 22 ? 4.255   0.690   3.800   1.00 15.00 ? 22 VAL A HG12 3  
ATOM 3179  H HG13 . VAL A 1 22 ? 2.494   0.807   3.784   1.00 15.00 ? 22 VAL A HG13 3  
ATOM 3180  H HG21 . VAL A 1 22 ? 5.442   -0.159  5.541   1.00 15.00 ? 22 VAL A HG21 3  
ATOM 3181  H HG22 . VAL A 1 22 ? 4.652   -1.215  6.709   1.00 15.00 ? 22 VAL A HG22 3  
ATOM 3182  H HG23 . VAL A 1 22 ? 4.565   -1.586  4.990   1.00 15.00 ? 22 VAL A HG23 3  
ATOM 3183  N N    . THR A 1 23 ? 2.030   -0.736  8.363   1.00 15.00 ? 23 THR A N    3  
ATOM 3184  C CA   . THR A 1 23 ? 1.940   -1.645  9.500   1.00 15.00 ? 23 THR A CA   3  
ATOM 3185  C C    . THR A 1 23 ? 0.987   -2.811  9.212   1.00 15.00 ? 23 THR A C    3  
ATOM 3186  O O    . THR A 1 23 ? 0.055   -2.689  8.418   1.00 15.00 ? 23 THR A O    3  
ATOM 3187  C CB   . THR A 1 23 ? 1.462   -0.876  10.735  1.00 15.00 ? 23 THR A CB   3  
ATOM 3188  O OG1  . THR A 1 23 ? 1.537   0.521   10.517  1.00 15.00 ? 23 THR A OG1  3  
ATOM 3189  C CG2  . THR A 1 23 ? 2.258   -1.184  11.981  1.00 15.00 ? 23 THR A CG2  3  
ATOM 3190  H H    . THR A 1 23 ? 1.252   -0.628  7.776   1.00 15.00 ? 23 THR A H    3  
ATOM 3191  H HA   . THR A 1 23 ? 2.927   -2.038  9.690   1.00 15.00 ? 23 THR A HA   3  
ATOM 3192  H HB   . THR A 1 23 ? 0.430   -1.131  10.929  1.00 15.00 ? 23 THR A HB   3  
ATOM 3193  H HG1  . THR A 1 23 ? 2.455   0.780   10.411  1.00 15.00 ? 23 THR A HG1  3  
ATOM 3194  H HG21 . THR A 1 23 ? 2.108   -2.217  12.258  1.00 15.00 ? 23 THR A HG21 3  
ATOM 3195  H HG22 . THR A 1 23 ? 3.306   -1.010  11.789  1.00 15.00 ? 23 THR A HG22 3  
ATOM 3196  H HG23 . THR A 1 23 ? 1.928   -0.543  12.784  1.00 15.00 ? 23 THR A HG23 3  
ATOM 3197  N N    . GLY A 1 24 ? 1.216   -3.939  9.873   1.00 15.00 ? 24 GLY A N    3  
ATOM 3198  C CA   . GLY A 1 24 ? 0.349   -5.090  9.689   1.00 15.00 ? 24 GLY A CA   3  
ATOM 3199  C C    . GLY A 1 24 ? 0.446   -5.700  8.305   1.00 15.00 ? 24 GLY A C    3  
ATOM 3200  O O    . GLY A 1 24 ? 0.185   -5.030  7.307   1.00 15.00 ? 24 GLY A O    3  
ATOM 3201  H H    . GLY A 1 24 ? 1.965   -3.985  10.504  1.00 15.00 ? 24 GLY A H    3  
ATOM 3202  H HA2  . GLY A 1 24 ? 0.614   -5.842  10.417  1.00 15.00 ? 24 GLY A HA2  3  
ATOM 3203  H HA3  . GLY A 1 24 ? -0.672  -4.784  9.863   1.00 15.00 ? 24 GLY A HA3  3  
ATOM 3204  N N    . GLY A 1 25 ? 0.805   -6.977  8.248   1.00 15.00 ? 25 GLY A N    3  
ATOM 3205  C CA   . GLY A 1 25 ? 0.914   -7.666  6.975   1.00 15.00 ? 25 GLY A CA   3  
ATOM 3206  C C    . GLY A 1 25 ? 1.007   -9.171  7.137   1.00 15.00 ? 25 GLY A C    3  
ATOM 3207  O O    . GLY A 1 25 ? 0.423   -9.922  6.356   1.00 15.00 ? 25 GLY A O    3  
ATOM 3208  H H    . GLY A 1 25 ? 0.989   -7.458  9.077   1.00 15.00 ? 25 GLY A H    3  
ATOM 3209  H HA2  . GLY A 1 25 ? 0.048   -7.435  6.380   1.00 15.00 ? 25 GLY A HA2  3  
ATOM 3210  H HA3  . GLY A 1 25 ? 1.790   -7.315  6.461   1.00 15.00 ? 25 GLY A HA3  3  
ATOM 3211  N N    . VAL A 1 26 ? 1.746   -9.611  8.156   1.00 15.00 ? 26 VAL A N    3  
ATOM 3212  C CA   . VAL A 1 26 ? 1.924   -11.039 8.437   1.00 15.00 ? 26 VAL A CA   3  
ATOM 3213  C C    . VAL A 1 26 ? 0.625   -11.817 8.244   1.00 15.00 ? 26 VAL A C    3  
ATOM 3214  O O    . VAL A 1 26 ? -0.461  -11.239 8.234   1.00 15.00 ? 26 VAL A O    3  
ATOM 3215  C CB   . VAL A 1 26 ? 2.424   -11.269 9.879   1.00 15.00 ? 26 VAL A CB   3  
ATOM 3216  C CG1  . VAL A 1 26 ? 3.944   -11.278 9.930   1.00 15.00 ? 26 VAL A CG1  3  
ATOM 3217  C CG2  . VAL A 1 26 ? 1.861   -10.210 10.812  1.00 15.00 ? 26 VAL A CG2  3  
ATOM 3218  H H    . VAL A 1 26 ? 2.184   -8.956  8.738   1.00 15.00 ? 26 VAL A H    3  
ATOM 3219  H HA   . VAL A 1 26 ? 2.668   -11.424 7.757   1.00 15.00 ? 26 VAL A HA   3  
ATOM 3220  H HB   . VAL A 1 26 ? 2.071   -12.234 10.211  1.00 15.00 ? 26 VAL A HB   3  
ATOM 3221  H HG11 . VAL A 1 26 ? 4.324   -11.990 9.213   1.00 15.00 ? 26 VAL A HG11 3  
ATOM 3222  H HG12 . VAL A 1 26 ? 4.319   -10.294 9.693   1.00 15.00 ? 26 VAL A HG12 3  
ATOM 3223  H HG13 . VAL A 1 26 ? 4.269   -11.558 10.921  1.00 15.00 ? 26 VAL A HG13 3  
ATOM 3224  H HG21 . VAL A 1 26 ? 2.617   -9.464  11.004  1.00 15.00 ? 26 VAL A HG21 3  
ATOM 3225  H HG22 . VAL A 1 26 ? 1.005   -9.744  10.348  1.00 15.00 ? 26 VAL A HG22 3  
ATOM 3226  H HG23 . VAL A 1 26 ? 1.562   -10.670 11.742  1.00 15.00 ? 26 VAL A HG23 3  
ATOM 3227  N N    . ASN A 1 27 ? 0.745   -13.132 8.093   1.00 15.00 ? 27 ASN A N    3  
ATOM 3228  C CA   . ASN A 1 27 ? -0.420  -13.988 7.902   1.00 15.00 ? 27 ASN A CA   3  
ATOM 3229  C C    . ASN A 1 27 ? -1.023  -14.397 9.244   1.00 15.00 ? 27 ASN A C    3  
ATOM 3230  O O    . ASN A 1 27 ? -1.233  -15.581 9.508   1.00 15.00 ? 27 ASN A O    3  
ATOM 3231  C CB   . ASN A 1 27 ? -0.037  -15.234 7.100   1.00 15.00 ? 27 ASN A CB   3  
ATOM 3232  C CG   . ASN A 1 27 ? 0.785   -14.899 5.871   1.00 15.00 ? 27 ASN A CG   3  
ATOM 3233  O OD1  . ASN A 1 27 ? 0.247   -14.740 4.775   1.00 15.00 ? 27 ASN A OD1  3  
ATOM 3234  N ND2  . ASN A 1 27 ? 2.096   -14.790 6.047   1.00 15.00 ? 27 ASN A ND2  3  
ATOM 3235  H H    . ASN A 1 27 ? 1.638   -13.536 8.112   1.00 15.00 ? 27 ASN A H    3  
ATOM 3236  H HA   . ASN A 1 27 ? -1.155  -13.426 7.347   1.00 15.00 ? 27 ASN A HA   3  
ATOM 3237  H HB2  . ASN A 1 27 ? 0.541   -15.895 7.727   1.00 15.00 ? 27 ASN A HB2  3  
ATOM 3238  H HB3  . ASN A 1 27 ? -0.937  -15.740 6.782   1.00 15.00 ? 27 ASN A HB3  3  
ATOM 3239  H HD21 . ASN A 1 27 ? 2.455   -14.930 6.949   1.00 15.00 ? 27 ASN A HD21 3  
ATOM 3240  H HD22 . ASN A 1 27 ? 2.652   -14.575 5.270   1.00 15.00 ? 27 ASN A HD22 3  
ATOM 3241  N N    . THR A 1 28 ? -1.302  -13.408 10.088  1.00 15.00 ? 28 THR A N    3  
ATOM 3242  C CA   . THR A 1 28 ? -1.883  -13.663 11.401  1.00 15.00 ? 28 THR A CA   3  
ATOM 3243  C C    . THR A 1 28 ? -2.719  -12.475 11.863  1.00 15.00 ? 28 THR A C    3  
ATOM 3244  O O    . THR A 1 28 ? -3.912  -12.610 12.135  1.00 15.00 ? 28 THR A O    3  
ATOM 3245  C CB   . THR A 1 28 ? -0.783  -13.956 12.422  1.00 15.00 ? 28 THR A CB   3  
ATOM 3246  O OG1  . THR A 1 28 ? 0.219   -14.782 11.856  1.00 15.00 ? 28 THR A OG1  3  
ATOM 3247  C CG2  . THR A 1 28 ? -1.293  -14.644 13.671  1.00 15.00 ? 28 THR A CG2  3  
ATOM 3248  H H    . THR A 1 28 ? -1.114  -12.485 9.821   1.00 15.00 ? 28 THR A H    3  
ATOM 3249  H HA   . THR A 1 28 ? -2.524  -14.527 11.317  1.00 15.00 ? 28 THR A HA   3  
ATOM 3250  H HB   . THR A 1 28 ? -0.326  -13.024 12.721  1.00 15.00 ? 28 THR A HB   3  
ATOM 3251  H HG1  . THR A 1 28 ? 1.063   -14.593 12.272  1.00 15.00 ? 28 THR A HG1  3  
ATOM 3252  H HG21 . THR A 1 28 ? -0.699  -14.337 14.519  1.00 15.00 ? 28 THR A HG21 3  
ATOM 3253  H HG22 . THR A 1 28 ? -2.325  -14.370 13.836  1.00 15.00 ? 28 THR A HG22 3  
ATOM 3254  H HG23 . THR A 1 28 ? -1.219  -15.714 13.548  1.00 15.00 ? 28 THR A HG23 3  
ATOM 3255  N N    . SER A 1 29 ? -2.085  -11.310 11.949  1.00 15.00 ? 29 SER A N    3  
ATOM 3256  C CA   . SER A 1 29 ? -2.770  -10.096 12.377  1.00 15.00 ? 29 SER A CA   3  
ATOM 3257  C C    . SER A 1 29 ? -3.778  -9.643  11.327  1.00 15.00 ? 29 SER A C    3  
ATOM 3258  O O    . SER A 1 29 ? -4.947  -9.408  11.634  1.00 15.00 ? 29 SER A O    3  
ATOM 3259  C CB   . SER A 1 29 ? -1.758  -8.980  12.644  1.00 15.00 ? 29 SER A CB   3  
ATOM 3260  O OG   . SER A 1 29 ? -1.239  -9.066  13.960  1.00 15.00 ? 29 SER A OG   3  
ATOM 3261  H H    . SER A 1 29 ? -1.133  -11.265 11.718  1.00 15.00 ? 29 SER A H    3  
ATOM 3262  H HA   . SER A 1 29 ? -3.297  -10.318 13.293  1.00 15.00 ? 29 SER A HA   3  
ATOM 3263  H HB2  . SER A 1 29 ? -0.940  -9.063  11.943  1.00 15.00 ? 29 SER A HB2  3  
ATOM 3264  H HB3  . SER A 1 29 ? -2.241  -8.022  12.522  1.00 15.00 ? 29 SER A HB3  3  
ATOM 3265  H HG   . SER A 1 29 ? -0.894  -8.210  14.225  1.00 15.00 ? 29 SER A HG   3  
ATOM 3266  N N    . VAL A 1 30 ? -3.318  -9.524  10.086  1.00 15.00 ? 30 VAL A N    3  
ATOM 3267  C CA   . VAL A 1 30 ? -4.180  -9.102  8.988   1.00 15.00 ? 30 VAL A CA   3  
ATOM 3268  C C    . VAL A 1 30 ? -4.880  -10.300 8.353   1.00 15.00 ? 30 VAL A C    3  
ATOM 3269  O O    . VAL A 1 30 ? -4.849  -11.405 8.894   1.00 15.00 ? 30 VAL A O    3  
ATOM 3270  C CB   . VAL A 1 30 ? -3.383  -8.340  7.909   1.00 15.00 ? 30 VAL A CB   3  
ATOM 3271  C CG1  . VAL A 1 30 ? -2.640  -7.165  8.527   1.00 15.00 ? 30 VAL A CG1  3  
ATOM 3272  C CG2  . VAL A 1 30 ? -2.416  -9.272  7.190   1.00 15.00 ? 30 VAL A CG2  3  
ATOM 3273  H H    . VAL A 1 30 ? -2.377  -9.728  9.903   1.00 15.00 ? 30 VAL A H    3  
ATOM 3274  H HA   . VAL A 1 30 ? -4.928  -8.434  9.392   1.00 15.00 ? 30 VAL A HA   3  
ATOM 3275  H HB   . VAL A 1 30 ? -4.081  -7.950  7.183   1.00 15.00 ? 30 VAL A HB   3  
ATOM 3276  H HG11 . VAL A 1 30 ? -2.075  -7.506  9.381   1.00 15.00 ? 30 VAL A HG11 3  
ATOM 3277  H HG12 . VAL A 1 30 ? -1.967  -6.740  7.796   1.00 15.00 ? 30 VAL A HG12 3  
ATOM 3278  H HG13 . VAL A 1 30 ? -3.350  -6.414  8.841   1.00 15.00 ? 30 VAL A HG13 3  
ATOM 3279  H HG21 . VAL A 1 30 ? -1.439  -8.815  7.147   1.00 15.00 ? 30 VAL A HG21 3  
ATOM 3280  H HG22 . VAL A 1 30 ? -2.353  -10.207 7.726   1.00 15.00 ? 30 VAL A HG22 3  
ATOM 3281  H HG23 . VAL A 1 30 ? -2.773  -9.455  6.187   1.00 15.00 ? 30 VAL A HG23 3  
ATOM 3282  N N    . ARG A 1 31 ? -5.514  -10.076 7.207   1.00 15.00 ? 31 ARG A N    3  
ATOM 3283  C CA   . ARG A 1 31 ? -6.221  -11.143 6.508   1.00 15.00 ? 31 ARG A CA   3  
ATOM 3284  C C    . ARG A 1 31 ? -5.324  -11.805 5.467   1.00 15.00 ? 31 ARG A C    3  
ATOM 3285  O O    . ARG A 1 31 ? -4.767  -11.138 4.596   1.00 15.00 ? 31 ARG A O    3  
ATOM 3286  C CB   . ARG A 1 31 ? -7.482  -10.600 5.833   1.00 15.00 ? 31 ARG A CB   3  
ATOM 3287  C CG   . ARG A 1 31 ? -8.228  -9.567  6.663   1.00 15.00 ? 31 ARG A CG   3  
ATOM 3288  C CD   . ARG A 1 31 ? -9.093  -10.225 7.726   1.00 15.00 ? 31 ARG A CD   3  
ATOM 3289  N NE   . ARG A 1 31 ? -10.388 -9.564  7.865   1.00 15.00 ? 31 ARG A NE   3  
ATOM 3290  C CZ   . ARG A 1 31 ? -11.346 -9.977  8.692   1.00 15.00 ? 31 ARG A CZ   3  
ATOM 3291  N NH1  . ARG A 1 31 ? -11.156 -11.046 9.455   1.00 15.00 ? 31 ARG A NH1  3  
ATOM 3292  N NH2  . ARG A 1 31 ? -12.495 -9.318  8.757   1.00 15.00 ? 31 ARG A NH2  3  
ATOM 3293  H H    . ARG A 1 31 ? -5.508  -9.175  6.823   1.00 15.00 ? 31 ARG A H    3  
ATOM 3294  H HA   . ARG A 1 31 ? -6.508  -11.883 7.240   1.00 15.00 ? 31 ARG A HA   3  
ATOM 3295  H HB2  . ARG A 1 31 ? -7.204  -10.144 4.895   1.00 15.00 ? 31 ARG A HB2  3  
ATOM 3296  H HB3  . ARG A 1 31 ? -8.153  -11.423 5.636   1.00 15.00 ? 31 ARG A HB3  3  
ATOM 3297  H HG2  . ARG A 1 31 ? -7.512  -8.920  7.147   1.00 15.00 ? 31 ARG A HG2  3  
ATOM 3298  H HG3  . ARG A 1 31 ? -8.859  -8.982  6.010   1.00 15.00 ? 31 ARG A HG3  3  
ATOM 3299  H HD2  . ARG A 1 31 ? -9.254  -11.257 7.452   1.00 15.00 ? 31 ARG A HD2  3  
ATOM 3300  H HD3  . ARG A 1 31 ? -8.574  -10.182 8.672   1.00 15.00 ? 31 ARG A HD3  3  
ATOM 3301  H HE   . ARG A 1 31 ? -10.553 -8.772  7.312   1.00 15.00 ? 31 ARG A HE   3  
ATOM 3302  H HH11 . ARG A 1 31 ? -10.292 -11.546 9.412   1.00 15.00 ? 31 ARG A HH11 3  
ATOM 3303  H HH12 . ARG A 1 31 ? -11.880 -11.351 10.075  1.00 15.00 ? 31 ARG A HH12 3  
ATOM 3304  H HH21 . ARG A 1 31 ? -12.642 -8.512  8.184   1.00 15.00 ? 31 ARG A HH21 3  
ATOM 3305  H HH22 . ARG A 1 31 ? -13.214 -9.629  9.378   1.00 15.00 ? 31 ARG A HH22 3  
ATOM 3306  N N    . HIS A 1 32 ? -5.199  -13.124 5.562   1.00 15.00 ? 32 HIS A N    3  
ATOM 3307  C CA   . HIS A 1 32 ? -4.380  -13.890 4.629   1.00 15.00 ? 32 HIS A CA   3  
ATOM 3308  C C    . HIS A 1 32 ? -2.913  -13.468 4.694   1.00 15.00 ? 32 HIS A C    3  
ATOM 3309  O O    . HIS A 1 32 ? -2.095  -14.131 5.331   1.00 15.00 ? 32 HIS A O    3  
ATOM 3310  C CB   . HIS A 1 32 ? -4.910  -13.725 3.202   1.00 15.00 ? 32 HIS A CB   3  
ATOM 3311  C CG   . HIS A 1 32 ? -6.261  -14.334 2.991   1.00 15.00 ? 32 HIS A CG   3  
ATOM 3312  N ND1  . HIS A 1 32 ? -7.429  -13.745 3.429   1.00 15.00 ? 32 HIS A ND1  3  
ATOM 3313  C CD2  . HIS A 1 32 ? -6.628  -15.486 2.381   1.00 15.00 ? 32 HIS A CD2  3  
ATOM 3314  C CE1  . HIS A 1 32 ? -8.455  -14.509 3.099   1.00 15.00 ? 32 HIS A CE1  3  
ATOM 3315  N NE2  . HIS A 1 32 ? -7.996  -15.571 2.462   1.00 15.00 ? 32 HIS A NE2  3  
ATOM 3316  H H    . HIS A 1 32 ? -5.676  -13.596 6.276   1.00 15.00 ? 32 HIS A H    3  
ATOM 3317  H HA   . HIS A 1 32 ? -4.452  -14.930 4.907   1.00 15.00 ? 32 HIS A HA   3  
ATOM 3318  H HB2  . HIS A 1 32 ? -4.981  -12.673 2.971   1.00 15.00 ? 32 HIS A HB2  3  
ATOM 3319  H HB3  . HIS A 1 32 ? -4.221  -14.193 2.514   1.00 15.00 ? 32 HIS A HB3  3  
ATOM 3320  H HD1  . HIS A 1 32 ? -7.495  -12.895 3.911   1.00 15.00 ? 32 HIS A HD1  3  
ATOM 3321  H HD2  . HIS A 1 32 ? -5.968  -16.205 1.917   1.00 15.00 ? 32 HIS A HD2  3  
ATOM 3322  H HE1  . HIS A 1 32 ? -9.493  -14.300 3.312   1.00 15.00 ? 32 HIS A HE1  3  
ATOM 3323  H HE2  . HIS A 1 32 ? -8.537  -16.338 2.180   1.00 15.00 ? 32 HIS A HE2  3  
ATOM 3324  N N    . GLY A 1 33 ? -2.585  -12.368 4.023   1.00 15.00 ? 33 GLY A N    3  
ATOM 3325  C CA   . GLY A 1 33 ? -1.216  -11.884 4.008   1.00 15.00 ? 33 GLY A CA   3  
ATOM 3326  C C    . GLY A 1 33 ? -1.079  -10.560 3.284   1.00 15.00 ? 33 GLY A C    3  
ATOM 3327  O O    . GLY A 1 33 ? -0.061  -10.300 2.643   1.00 15.00 ? 33 GLY A O    3  
ATOM 3328  H H    . GLY A 1 33 ? -3.277  -11.883 3.526   1.00 15.00 ? 33 GLY A H    3  
ATOM 3329  H HA2  . GLY A 1 33 ? -0.866  -11.762 5.027   1.00 15.00 ? 33 GLY A HA2  3  
ATOM 3330  H HA3  . GLY A 1 33 ? -0.597  -12.616 3.514   1.00 15.00 ? 33 GLY A HA3  3  
ATOM 3331  N N    . GLY A 1 34 ? -2.099  -9.715  3.400   1.00 15.00 ? 34 GLY A N    3  
ATOM 3332  C CA   . GLY A 1 34 ? -2.059  -8.414  2.764   1.00 15.00 ? 34 GLY A CA   3  
ATOM 3333  C C    . GLY A 1 34 ? -1.575  -7.363  3.732   1.00 15.00 ? 34 GLY A C    3  
ATOM 3334  O O    . GLY A 1 34 ? -1.649  -7.564  4.945   1.00 15.00 ? 34 GLY A O    3  
ATOM 3335  H H    . GLY A 1 34 ? -2.879  -9.968  3.937   1.00 15.00 ? 34 GLY A H    3  
ATOM 3336  H HA2  . GLY A 1 34 ? -1.390  -8.454  1.916   1.00 15.00 ? 34 GLY A HA2  3  
ATOM 3337  H HA3  . GLY A 1 34 ? -3.050  -8.152  2.425   1.00 15.00 ? 34 GLY A HA3  3  
ATOM 3338  N N    . ILE A 1 35 ? -1.067  -6.248  3.225   1.00 15.00 ? 35 ILE A N    3  
ATOM 3339  C CA   . ILE A 1 35 ? -0.572  -5.208  4.114   1.00 15.00 ? 35 ILE A CA   3  
ATOM 3340  C C    . ILE A 1 35 ? -1.564  -4.069  4.267   1.00 15.00 ? 35 ILE A C    3  
ATOM 3341  O O    . ILE A 1 35 ? -2.368  -3.797  3.376   1.00 15.00 ? 35 ILE A O    3  
ATOM 3342  C CB   . ILE A 1 35 ? 0.794   -4.655  3.656   1.00 15.00 ? 35 ILE A CB   3  
ATOM 3343  C CG1  . ILE A 1 35 ? 1.704   -4.454  4.875   1.00 15.00 ? 35 ILE A CG1  3  
ATOM 3344  C CG2  . ILE A 1 35 ? 0.639   -3.367  2.848   1.00 15.00 ? 35 ILE A CG2  3  
ATOM 3345  C CD1  . ILE A 1 35 ? 1.583   -3.099  5.539   1.00 15.00 ? 35 ILE A CD1  3  
ATOM 3346  H H    . ILE A 1 35 ? -1.017  -6.128  2.247   1.00 15.00 ? 35 ILE A H    3  
ATOM 3347  H HA   . ILE A 1 35 ? -0.431  -5.660  5.086   1.00 15.00 ? 35 ILE A HA   3  
ATOM 3348  H HB   . ILE A 1 35 ? 1.242   -5.391  3.012   1.00 15.00 ? 35 ILE A HB   3  
ATOM 3349  H HG12 . ILE A 1 35 ? 1.459   -5.199  5.617   1.00 15.00 ? 35 ILE A HG12 3  
ATOM 3350  H HG13 . ILE A 1 35 ? 2.731   -4.583  4.571   1.00 15.00 ? 35 ILE A HG13 3  
ATOM 3351  H HG21 . ILE A 1 35 ? -0.241  -3.437  2.227   1.00 15.00 ? 35 ILE A HG21 3  
ATOM 3352  H HG22 . ILE A 1 35 ? 0.536   -2.528  3.519   1.00 15.00 ? 35 ILE A HG22 3  
ATOM 3353  H HG23 . ILE A 1 35 ? 1.509   -3.225  2.226   1.00 15.00 ? 35 ILE A HG23 3  
ATOM 3354  H HD11 . ILE A 1 35 ? 2.454   -2.508  5.304   1.00 15.00 ? 35 ILE A HD11 3  
ATOM 3355  H HD12 . ILE A 1 35 ? 0.698   -2.597  5.177   1.00 15.00 ? 35 ILE A HD12 3  
ATOM 3356  H HD13 . ILE A 1 35 ? 1.512   -3.227  6.609   1.00 15.00 ? 35 ILE A HD13 3  
ATOM 3357  N N    . TYR A 1 36 ? -1.482  -3.402  5.406   1.00 15.00 ? 36 TYR A N    3  
ATOM 3358  C CA   . TYR A 1 36 ? -2.351  -2.278  5.697   1.00 15.00 ? 36 TYR A CA   3  
ATOM 3359  C C    . TYR A 1 36 ? -1.520  -1.128  6.240   1.00 15.00 ? 36 TYR A C    3  
ATOM 3360  O O    . TYR A 1 36 ? -1.019  -1.190  7.358   1.00 15.00 ? 36 TYR A O    3  
ATOM 3361  C CB   . TYR A 1 36 ? -3.429  -2.683  6.704   1.00 15.00 ? 36 TYR A CB   3  
ATOM 3362  C CG   . TYR A 1 36 ? -4.447  -3.659  6.152   1.00 15.00 ? 36 TYR A CG   3  
ATOM 3363  C CD1  . TYR A 1 36 ? -4.079  -4.947  5.768   1.00 15.00 ? 36 TYR A CD1  3  
ATOM 3364  C CD2  . TYR A 1 36 ? -5.779  -3.292  6.017   1.00 15.00 ? 36 TYR A CD2  3  
ATOM 3365  C CE1  . TYR A 1 36 ? -5.012  -5.834  5.268   1.00 15.00 ? 36 TYR A CE1  3  
ATOM 3366  C CE2  . TYR A 1 36 ? -6.717  -4.175  5.517   1.00 15.00 ? 36 TYR A CE2  3  
ATOM 3367  C CZ   . TYR A 1 36 ? -6.329  -5.445  5.144   1.00 15.00 ? 36 TYR A CZ   3  
ATOM 3368  O OH   . TYR A 1 36 ? -7.259  -6.331  4.647   1.00 15.00 ? 36 TYR A OH   3  
ATOM 3369  H H    . TYR A 1 36 ? -0.806  -3.668  6.069   1.00 15.00 ? 36 TYR A H    3  
ATOM 3370  H HA   . TYR A 1 36 ? -2.815  -1.974  4.774   1.00 15.00 ? 36 TYR A HA   3  
ATOM 3371  H HB2  . TYR A 1 36 ? -2.958  -3.146  7.558   1.00 15.00 ? 36 TYR A HB2  3  
ATOM 3372  H HB3  . TYR A 1 36 ? -3.958  -1.799  7.027   1.00 15.00 ? 36 TYR A HB3  3  
ATOM 3373  H HD1  . TYR A 1 36 ? -3.047  -5.254  5.864   1.00 15.00 ? 36 TYR A HD1  3  
ATOM 3374  H HD2  . TYR A 1 36 ? -6.081  -2.297  6.309   1.00 15.00 ? 36 TYR A HD2  3  
ATOM 3375  H HE1  . TYR A 1 36 ? -4.707  -6.828  4.976   1.00 15.00 ? 36 TYR A HE1  3  
ATOM 3376  H HE2  . TYR A 1 36 ? -7.748  -3.869  5.421   1.00 15.00 ? 36 TYR A HE2  3  
ATOM 3377  H HH   . TYR A 1 36 ? -8.120  -5.906  4.603   1.00 15.00 ? 36 TYR A HH   3  
ATOM 3378  N N    . VAL A 1 37 ? -1.351  -0.085  5.443   1.00 15.00 ? 37 VAL A N    3  
ATOM 3379  C CA   . VAL A 1 37 ? -0.537  1.046   5.872   1.00 15.00 ? 37 VAL A CA   3  
ATOM 3380  C C    . VAL A 1 37 ? -1.025  1.599   7.204   1.00 15.00 ? 37 VAL A C    3  
ATOM 3381  O O    . VAL A 1 37 ? -2.100  1.245   7.684   1.00 15.00 ? 37 VAL A O    3  
ATOM 3382  C CB   . VAL A 1 37 ? -0.465  2.192   4.815   1.00 15.00 ? 37 VAL A CB   3  
ATOM 3383  C CG1  . VAL A 1 37 ? -0.694  1.681   3.408   1.00 15.00 ? 37 VAL A CG1  3  
ATOM 3384  C CG2  . VAL A 1 37 ? -1.431  3.327   5.112   1.00 15.00 ? 37 VAL A CG2  3  
ATOM 3385  H H    . VAL A 1 37 ? -1.760  -0.088  4.554   1.00 15.00 ? 37 VAL A H    3  
ATOM 3386  H HA   . VAL A 1 37 ? 0.467   0.672   6.016   1.00 15.00 ? 37 VAL A HA   3  
ATOM 3387  H HB   . VAL A 1 37 ? 0.525   2.598   4.850   1.00 15.00 ? 37 VAL A HB   3  
ATOM 3388  H HG11 . VAL A 1 37 ? -0.567  0.611   3.381   1.00 15.00 ? 37 VAL A HG11 3  
ATOM 3389  H HG12 . VAL A 1 37 ? -1.695  1.940   3.098   1.00 15.00 ? 37 VAL A HG12 3  
ATOM 3390  H HG13 . VAL A 1 37 ? 0.017   2.142   2.744   1.00 15.00 ? 37 VAL A HG13 3  
ATOM 3391  H HG21 . VAL A 1 37 ? -2.438  2.997   4.931   1.00 15.00 ? 37 VAL A HG21 3  
ATOM 3392  H HG22 . VAL A 1 37 ? -1.328  3.634   6.141   1.00 15.00 ? 37 VAL A HG22 3  
ATOM 3393  H HG23 . VAL A 1 37 ? -1.208  4.163   4.466   1.00 15.00 ? 37 VAL A HG23 3  
ATOM 3394  N N    . LYS A 1 38 ? -0.235  2.482   7.786   1.00 15.00 ? 38 LYS A N    3  
ATOM 3395  C CA   . LYS A 1 38 ? -0.591  3.105   9.048   1.00 15.00 ? 38 LYS A CA   3  
ATOM 3396  C C    . LYS A 1 38 ? -1.133  4.499   8.771   1.00 15.00 ? 38 LYS A C    3  
ATOM 3397  O O    . LYS A 1 38 ? -2.199  4.875   9.255   1.00 15.00 ? 38 LYS A O    3  
ATOM 3398  C CB   . LYS A 1 38 ? 0.620   3.128   9.998   1.00 15.00 ? 38 LYS A CB   3  
ATOM 3399  C CG   . LYS A 1 38 ? 1.195   4.508   10.300  1.00 15.00 ? 38 LYS A CG   3  
ATOM 3400  C CD   . LYS A 1 38 ? 1.665   4.598   11.742  1.00 15.00 ? 38 LYS A CD   3  
ATOM 3401  C CE   . LYS A 1 38 ? 0.737   5.468   12.575  1.00 15.00 ? 38 LYS A CE   3  
ATOM 3402  N NZ   . LYS A 1 38 ? 0.615   4.969   13.973  1.00 15.00 ? 38 LYS A NZ   3  
ATOM 3403  H H    . LYS A 1 38 ? 0.600   2.736   7.344   1.00 15.00 ? 38 LYS A H    3  
ATOM 3404  H HA   . LYS A 1 38 ? -1.376  2.516   9.499   1.00 15.00 ? 38 LYS A HA   3  
ATOM 3405  H HB2  . LYS A 1 38 ? 0.324   2.683   10.936  1.00 15.00 ? 38 LYS A HB2  3  
ATOM 3406  H HB3  . LYS A 1 38 ? 1.405   2.524   9.565   1.00 15.00 ? 38 LYS A HB3  3  
ATOM 3407  H HG2  . LYS A 1 38 ? 2.035   4.690   9.646   1.00 15.00 ? 38 LYS A HG2  3  
ATOM 3408  H HG3  . LYS A 1 38 ? 0.437   5.257   10.134  1.00 15.00 ? 38 LYS A HG3  3  
ATOM 3409  H HD2  . LYS A 1 38 ? 1.684   3.604   12.164  1.00 15.00 ? 38 LYS A HD2  3  
ATOM 3410  H HD3  . LYS A 1 38 ? 2.658   5.021   11.762  1.00 15.00 ? 38 LYS A HD3  3  
ATOM 3411  H HE2  . LYS A 1 38 ? 1.128   6.474   12.594  1.00 15.00 ? 38 LYS A HE2  3  
ATOM 3412  H HE3  . LYS A 1 38 ? -0.241  5.470   12.116  1.00 15.00 ? 38 LYS A HE3  3  
ATOM 3413  H HZ1  . LYS A 1 38 ? -0.358  5.097   14.315  1.00 15.00 ? 38 LYS A HZ1  3  
ATOM 3414  H HZ2  . LYS A 1 38 ? 0.855   3.958   14.014  1.00 15.00 ? 38 LYS A HZ2  3  
ATOM 3415  H HZ3  . LYS A 1 38 ? 1.261   5.493   14.598  1.00 15.00 ? 38 LYS A HZ3  3  
ATOM 3416  N N    . ALA A 1 39 ? -0.391  5.252   7.969   1.00 15.00 ? 39 ALA A N    3  
ATOM 3417  C CA   . ALA A 1 39 ? -0.788  6.597   7.596   1.00 15.00 ? 39 ALA A CA   3  
ATOM 3418  C C    . ALA A 1 39 ? 0.144   7.137   6.523   1.00 15.00 ? 39 ALA A C    3  
ATOM 3419  O O    . ALA A 1 39 ? 1.155   6.512   6.209   1.00 15.00 ? 39 ALA A O    3  
ATOM 3420  C CB   . ALA A 1 39 ? -0.797  7.502   8.816   1.00 15.00 ? 39 ALA A CB   3  
ATOM 3421  H H    . ALA A 1 39 ? 0.446   4.886   7.603   1.00 15.00 ? 39 ALA A H    3  
ATOM 3422  H HA   . ALA A 1 39 ? -1.792  6.552   7.199   1.00 15.00 ? 39 ALA A HA   3  
ATOM 3423  H HB1  . ALA A 1 39 ? -1.552  7.159   9.508   1.00 15.00 ? 39 ALA A HB1  3  
ATOM 3424  H HB2  . ALA A 1 39 ? 0.170   7.472   9.293   1.00 15.00 ? 39 ALA A HB2  3  
ATOM 3425  H HB3  . ALA A 1 39 ? -1.020  8.514   8.512   1.00 15.00 ? 39 ALA A HB3  3  
ATOM 3426  N N    . VAL A 1 40 ? -0.180  8.304   5.982   1.00 15.00 ? 40 VAL A N    3  
ATOM 3427  C CA   . VAL A 1 40 ? 0.658   8.918   4.957   1.00 15.00 ? 40 VAL A CA   3  
ATOM 3428  C C    . VAL A 1 40 ? 1.589   9.930   5.610   1.00 15.00 ? 40 VAL A C    3  
ATOM 3429  O O    . VAL A 1 40 ? 1.170   11.015  6.013   1.00 15.00 ? 40 VAL A O    3  
ATOM 3430  C CB   . VAL A 1 40 ? -0.171  9.611   3.851   1.00 15.00 ? 40 VAL A CB   3  
ATOM 3431  C CG1  . VAL A 1 40 ? -0.291  8.715   2.625   1.00 15.00 ? 40 VAL A CG1  3  
ATOM 3432  C CG2  . VAL A 1 40 ? -1.546  9.994   4.366   1.00 15.00 ? 40 VAL A CG2  3  
ATOM 3433  H H    . VAL A 1 40 ? -0.987  8.766   6.288   1.00 15.00 ? 40 VAL A H    3  
ATOM 3434  H HA   . VAL A 1 40 ? 1.248   8.136   4.504   1.00 15.00 ? 40 VAL A HA   3  
ATOM 3435  H HB   . VAL A 1 40 ? 0.343   10.515  3.557   1.00 15.00 ? 40 VAL A HB   3  
ATOM 3436  H HG11 . VAL A 1 40 ? 0.687   8.360   2.342   1.00 15.00 ? 40 VAL A HG11 3  
ATOM 3437  H HG12 . VAL A 1 40 ? -0.931  7.871   2.850   1.00 15.00 ? 40 VAL A HG12 3  
ATOM 3438  H HG13 . VAL A 1 40 ? -0.718  9.280   1.809   1.00 15.00 ? 40 VAL A HG13 3  
ATOM 3439  H HG21 . VAL A 1 40 ? -2.154  9.106   4.448   1.00 15.00 ? 40 VAL A HG21 3  
ATOM 3440  H HG22 . VAL A 1 40 ? -1.448  10.454  5.337   1.00 15.00 ? 40 VAL A HG22 3  
ATOM 3441  H HG23 . VAL A 1 40 ? -2.009  10.688  3.681   1.00 15.00 ? 40 VAL A HG23 3  
ATOM 3442  N N    . ILE A 1 41 ? 2.847   9.533   5.762   1.00 15.00 ? 41 ILE A N    3  
ATOM 3443  C CA   . ILE A 1 41 ? 3.847   10.358  6.425   1.00 15.00 ? 41 ILE A CA   3  
ATOM 3444  C C    . ILE A 1 41 ? 4.232   11.605  5.626   1.00 15.00 ? 41 ILE A C    3  
ATOM 3445  O O    . ILE A 1 41 ? 4.798   11.508  4.536   1.00 15.00 ? 41 ILE A O    3  
ATOM 3446  C CB   . ILE A 1 41 ? 5.102   9.512   6.770   1.00 15.00 ? 41 ILE A CB   3  
ATOM 3447  C CG1  . ILE A 1 41 ? 4.823   8.604   7.976   1.00 15.00 ? 41 ILE A CG1  3  
ATOM 3448  C CG2  . ILE A 1 41 ? 6.316   10.388  7.041   1.00 15.00 ? 41 ILE A CG2  3  
ATOM 3449  C CD1  . ILE A 1 41 ? 3.398   8.095   8.053   1.00 15.00 ? 41 ILE A CD1  3  
ATOM 3450  H H    . ILE A 1 41 ? 3.100   8.637   5.454   1.00 15.00 ? 41 ILE A H    3  
ATOM 3451  H HA   . ILE A 1 41 ? 3.412   10.682  7.345   1.00 15.00 ? 41 ILE A HA   3  
ATOM 3452  H HB   . ILE A 1 41 ? 5.328   8.892   5.922   1.00 15.00 ? 41 ILE A HB   3  
ATOM 3453  H HG12 . ILE A 1 41 ? 5.474   7.743   7.924   1.00 15.00 ? 41 ILE A HG12 3  
ATOM 3454  H HG13 . ILE A 1 41 ? 5.031   9.151   8.884   1.00 15.00 ? 41 ILE A HG13 3  
ATOM 3455  H HG21 . ILE A 1 41 ? 5.992   11.374  7.338   1.00 15.00 ? 41 ILE A HG21 3  
ATOM 3456  H HG22 . ILE A 1 41 ? 6.905   9.947   7.833   1.00 15.00 ? 41 ILE A HG22 3  
ATOM 3457  H HG23 . ILE A 1 41 ? 6.915   10.458  6.144   1.00 15.00 ? 41 ILE A HG23 3  
ATOM 3458  H HD11 . ILE A 1 41 ? 2.726   8.929   8.194   1.00 15.00 ? 41 ILE A HD11 3  
ATOM 3459  H HD12 . ILE A 1 41 ? 3.147   7.585   7.134   1.00 15.00 ? 41 ILE A HD12 3  
ATOM 3460  H HD13 . ILE A 1 41 ? 3.303   7.412   8.883   1.00 15.00 ? 41 ILE A HD13 3  
ATOM 3461  N N    . PRO A 1 42 ? 3.926   12.802  6.189   1.00 15.00 ? 42 PRO A N    3  
ATOM 3462  C CA   . PRO A 1 42 ? 4.229   14.099  5.563   1.00 15.00 ? 42 PRO A CA   3  
ATOM 3463  C C    . PRO A 1 42 ? 5.725   14.319  5.342   1.00 15.00 ? 42 PRO A C    3  
ATOM 3464  O O    . PRO A 1 42 ? 6.312   15.247  5.898   1.00 15.00 ? 42 PRO A O    3  
ATOM 3465  C CB   . PRO A 1 42 ? 3.696   15.128  6.571   1.00 15.00 ? 42 PRO A CB   3  
ATOM 3466  C CG   . PRO A 1 42 ? 2.728   14.379  7.414   1.00 15.00 ? 42 PRO A CG   3  
ATOM 3467  C CD   . PRO A 1 42 ? 3.257   12.979  7.492   1.00 15.00 ? 42 PRO A CD   3  
ATOM 3468  H HA   . PRO A 1 42 ? 3.708   14.216  4.630   1.00 15.00 ? 42 PRO A HA   3  
ATOM 3469  H HB2  . PRO A 1 42 ? 4.514   15.516  7.160   1.00 15.00 ? 42 PRO A HB2  3  
ATOM 3470  H HB3  . PRO A 1 42 ? 3.213   15.936  6.041   1.00 15.00 ? 42 PRO A HB3  3  
ATOM 3471  H HG2  . PRO A 1 42 ? 2.681   14.818  8.400   1.00 15.00 ? 42 PRO A HG2  3  
ATOM 3472  H HG3  . PRO A 1 42 ? 1.752   14.386  6.951   1.00 15.00 ? 42 PRO A HG3  3  
ATOM 3473  H HD2  . PRO A 1 42 ? 3.961   12.884  8.306   1.00 15.00 ? 42 PRO A HD2  3  
ATOM 3474  H HD3  . PRO A 1 42 ? 2.445   12.276  7.608   1.00 15.00 ? 42 PRO A HD3  3  
ATOM 3475  N N    . GLN A 1 43 ? 6.340   13.466  4.531   1.00 15.00 ? 43 GLN A N    3  
ATOM 3476  C CA   . GLN A 1 43 ? 7.764   13.586  4.251   1.00 15.00 ? 43 GLN A CA   3  
ATOM 3477  C C    . GLN A 1 43 ? 8.108   13.057  2.861   1.00 15.00 ? 43 GLN A C    3  
ATOM 3478  O O    . GLN A 1 43 ? 8.816   13.714  2.097   1.00 15.00 ? 43 GLN A O    3  
ATOM 3479  C CB   . GLN A 1 43 ? 8.574   12.834  5.310   1.00 15.00 ? 43 GLN A CB   3  
ATOM 3480  C CG   . GLN A 1 43 ? 9.223   13.745  6.338   1.00 15.00 ? 43 GLN A CG   3  
ATOM 3481  C CD   . GLN A 1 43 ? 10.245  13.022  7.194   1.00 15.00 ? 43 GLN A CD   3  
ATOM 3482  O OE1  . GLN A 1 43 ? 9.992   11.924  7.689   1.00 15.00 ? 43 GLN A OE1  3  
ATOM 3483  N NE2  . GLN A 1 43 ? 11.408  13.637  7.373   1.00 15.00 ? 43 GLN A NE2  3  
ATOM 3484  H H    . GLN A 1 43 ? 5.827   12.743  4.114   1.00 15.00 ? 43 GLN A H    3  
ATOM 3485  H HA   . GLN A 1 43 ? 8.021   14.633  4.295   1.00 15.00 ? 43 GLN A HA   3  
ATOM 3486  H HB2  . GLN A 1 43 ? 7.918   12.151  5.829   1.00 15.00 ? 43 GLN A HB2  3  
ATOM 3487  H HB3  . GLN A 1 43 ? 9.352   12.268  4.819   1.00 15.00 ? 43 GLN A HB3  3  
ATOM 3488  H HG2  . GLN A 1 43 ? 9.717   14.555  5.823   1.00 15.00 ? 43 GLN A HG2  3  
ATOM 3489  H HG3  . GLN A 1 43 ? 8.454   14.146  6.982   1.00 15.00 ? 43 GLN A HG3  3  
ATOM 3490  H HE21 . GLN A 1 43 ? 11.540  14.510  6.948   1.00 15.00 ? 43 GLN A HE21 3  
ATOM 3491  H HE22 . GLN A 1 43 ? 12.087  13.192  7.922   1.00 15.00 ? 43 GLN A HE22 3  
ATOM 3492  N N    . GLY A 1 44 ? 7.621   11.861  2.542   1.00 15.00 ? 44 GLY A N    3  
ATOM 3493  C CA   . GLY A 1 44 ? 7.913   11.270  1.247   1.00 15.00 ? 44 GLY A CA   3  
ATOM 3494  C C    . GLY A 1 44 ? 6.936   11.666  0.158   1.00 15.00 ? 44 GLY A C    3  
ATOM 3495  O O    . GLY A 1 44 ? 5.873   12.228  0.425   1.00 15.00 ? 44 GLY A O    3  
ATOM 3496  H H    . GLY A 1 44 ? 7.069   11.374  3.193   1.00 15.00 ? 44 GLY A H    3  
ATOM 3497  H HA2  . GLY A 1 44 ? 8.901   11.582  0.945   1.00 15.00 ? 44 GLY A HA2  3  
ATOM 3498  H HA3  . GLY A 1 44 ? 7.910   10.198  1.341   1.00 15.00 ? 44 GLY A HA3  3  
ATOM 3499  N N    . ALA A 1 45 ? 7.312   11.354  -1.076  1.00 15.00 ? 45 ALA A N    3  
ATOM 3500  C CA   . ALA A 1 45 ? 6.498   11.663  -2.251  1.00 15.00 ? 45 ALA A CA   3  
ATOM 3501  C C    . ALA A 1 45 ? 5.112   11.027  -2.183  1.00 15.00 ? 45 ALA A C    3  
ATOM 3502  O O    . ALA A 1 45 ? 4.225   11.380  -2.960  1.00 15.00 ? 45 ALA A O    3  
ATOM 3503  C CB   . ALA A 1 45 ? 7.215   11.209  -3.511  1.00 15.00 ? 45 ALA A CB   3  
ATOM 3504  H H    . ALA A 1 45 ? 8.168   10.897  -1.200  1.00 15.00 ? 45 ALA A H    3  
ATOM 3505  H HA   . ALA A 1 45 ? 6.388   12.736  -2.303  1.00 15.00 ? 45 ALA A HA   3  
ATOM 3506  H HB1  . ALA A 1 45 ? 6.924   11.839  -4.339  1.00 15.00 ? 45 ALA A HB1  3  
ATOM 3507  H HB2  . ALA A 1 45 ? 8.282   11.280  -3.362  1.00 15.00 ? 45 ALA A HB2  3  
ATOM 3508  H HB3  . ALA A 1 45 ? 6.949   10.184  -3.726  1.00 15.00 ? 45 ALA A HB3  3  
ATOM 3509  N N    . ALA A 1 46 ? 4.925   10.090  -1.262  1.00 15.00 ? 46 ALA A N    3  
ATOM 3510  C CA   . ALA A 1 46 ? 3.642   9.417   -1.118  1.00 15.00 ? 46 ALA A CA   3  
ATOM 3511  C C    . ALA A 1 46 ? 2.606   10.353  -0.509  1.00 15.00 ? 46 ALA A C    3  
ATOM 3512  O O    . ALA A 1 46 ? 1.550   10.595  -1.101  1.00 15.00 ? 46 ALA A O    3  
ATOM 3513  C CB   . ALA A 1 46 ? 3.794   8.167   -0.265  1.00 15.00 ? 46 ALA A CB   3  
ATOM 3514  H H    . ALA A 1 46 ? 5.662   9.841   -0.672  1.00 15.00 ? 46 ALA A H    3  
ATOM 3515  H HA   . ALA A 1 46 ? 3.311   9.117   -2.102  1.00 15.00 ? 46 ALA A HA   3  
ATOM 3516  H HB1  . ALA A 1 46 ? 2.984   7.485   -0.478  1.00 15.00 ? 46 ALA A HB1  3  
ATOM 3517  H HB2  . ALA A 1 46 ? 4.736   7.689   -0.491  1.00 15.00 ? 46 ALA A HB2  3  
ATOM 3518  H HB3  . ALA A 1 46 ? 3.770   8.440   0.780   1.00 15.00 ? 46 ALA A HB3  3  
ATOM 3519  N N    . GLU A 1 47 ? 2.920   10.885  0.671   1.00 15.00 ? 47 GLU A N    3  
ATOM 3520  C CA   . GLU A 1 47 ? 2.024   11.811  1.357   1.00 15.00 ? 47 GLU A CA   3  
ATOM 3521  C C    . GLU A 1 47 ? 1.724   13.020  0.472   1.00 15.00 ? 47 GLU A C    3  
ATOM 3522  O O    . GLU A 1 47 ? 0.589   13.492  0.405   1.00 15.00 ? 47 GLU A O    3  
ATOM 3523  C CB   . GLU A 1 47 ? 2.638   12.284  2.683   1.00 15.00 ? 47 GLU A CB   3  
ATOM 3524  C CG   . GLU A 1 47 ? 3.800   13.243  2.484   1.00 15.00 ? 47 GLU A CG   3  
ATOM 3525  C CD   . GLU A 1 47 ? 3.350   14.679  2.295   1.00 15.00 ? 47 GLU A CD   3  
ATOM 3526  O OE1  . GLU A 1 47 ? 2.253   15.027  2.781   1.00 15.00 ? 47 GLU A OE1  3  
ATOM 3527  O OE2  . GLU A 1 47 ? 4.095   15.456  1.661   1.00 15.00 ? 47 GLU A OE2  3  
ATOM 3528  H H    . GLU A 1 47 ? 3.786   10.664  1.081   1.00 15.00 ? 47 GLU A H    3  
ATOM 3529  H HA   . GLU A 1 47 ? 1.096   11.291  1.556   1.00 15.00 ? 47 GLU A HA   3  
ATOM 3530  H HB2  . GLU A 1 47 ? 1.877   12.791  3.254   1.00 15.00 ? 47 GLU A HB2  3  
ATOM 3531  H HB3  . GLU A 1 47 ? 2.990   11.428  3.255   1.00 15.00 ? 47 GLU A HB3  3  
ATOM 3532  H HG2  . GLU A 1 47 ? 4.438   13.195  3.343   1.00 15.00 ? 47 GLU A HG2  3  
ATOM 3533  H HG3  . GLU A 1 47 ? 4.352   12.939  1.612   1.00 15.00 ? 47 GLU A HG3  3  
ATOM 3534  N N    . SER A 1 48 ? 2.765   13.523  -0.196  1.00 15.00 ? 48 SER A N    3  
ATOM 3535  C CA   . SER A 1 48 ? 2.635   14.686  -1.067  1.00 15.00 ? 48 SER A CA   3  
ATOM 3536  C C    . SER A 1 48 ? 1.530   14.469  -2.085  1.00 15.00 ? 48 SER A C    3  
ATOM 3537  O O    . SER A 1 48 ? 0.473   15.095  -2.010  1.00 15.00 ? 48 SER A O    3  
ATOM 3538  C CB   . SER A 1 48 ? 3.958   14.966  -1.782  1.00 15.00 ? 48 SER A CB   3  
ATOM 3539  O OG   . SER A 1 48 ? 4.734   15.912  -1.068  1.00 15.00 ? 48 SER A OG   3  
ATOM 3540  H H    . SER A 1 48 ? 3.644   13.105  -0.091  1.00 15.00 ? 48 SER A H    3  
ATOM 3541  H HA   . SER A 1 48 ? 2.381   15.536  -0.451  1.00 15.00 ? 48 SER A HA   3  
ATOM 3542  H HB2  . SER A 1 48 ? 4.521   14.049  -1.866  1.00 15.00 ? 48 SER A HB2  3  
ATOM 3543  H HB3  . SER A 1 48 ? 3.756   15.355  -2.769  1.00 15.00 ? 48 SER A HB3  3  
ATOM 3544  H HG   . SER A 1 48 ? 5.658   15.817  -1.310  1.00 15.00 ? 48 SER A HG   3  
ATOM 3545  N N    . ASP A 1 49 ? 1.766   13.563  -3.024  1.00 15.00 ? 49 ASP A N    3  
ATOM 3546  C CA   . ASP A 1 49 ? 0.767   13.259  -4.033  1.00 15.00 ? 49 ASP A CA   3  
ATOM 3547  C C    . ASP A 1 49 ? -0.492  12.745  -3.350  1.00 15.00 ? 49 ASP A C    3  
ATOM 3548  O O    . ASP A 1 49 ? -1.610  13.105  -3.718  1.00 15.00 ? 49 ASP A O    3  
ATOM 3549  C CB   . ASP A 1 49 ? 1.298   12.219  -5.022  1.00 15.00 ? 49 ASP A CB   3  
ATOM 3550  C CG   . ASP A 1 49 ? 1.432   12.775  -6.426  1.00 15.00 ? 49 ASP A CG   3  
ATOM 3551  O OD1  . ASP A 1 49 ? 1.985   13.885  -6.575  1.00 15.00 ? 49 ASP A OD1  3  
ATOM 3552  O OD2  . ASP A 1 49 ? 0.983   12.101  -7.376  1.00 15.00 ? 49 ASP A OD2  3  
ATOM 3553  H H    . ASP A 1 49 ? 2.620   13.079  -3.026  1.00 15.00 ? 49 ASP A H    3  
ATOM 3554  H HA   . ASP A 1 49 ? 0.534   14.170  -4.562  1.00 15.00 ? 49 ASP A HA   3  
ATOM 3555  H HB2  . ASP A 1 49 ? 2.271   11.884  -4.694  1.00 15.00 ? 49 ASP A HB2  3  
ATOM 3556  H HB3  . ASP A 1 49 ? 0.622   11.377  -5.050  1.00 15.00 ? 49 ASP A HB3  3  
ATOM 3557  N N    . GLY A 1 50 ? -0.291  11.906  -2.339  1.00 15.00 ? 50 GLY A N    3  
ATOM 3558  C CA   . GLY A 1 50 ? -1.402  11.354  -1.596  1.00 15.00 ? 50 GLY A CA   3  
ATOM 3559  C C    . GLY A 1 50 ? -2.033  10.182  -2.314  1.00 15.00 ? 50 GLY A C    3  
ATOM 3560  O O    . GLY A 1 50 ? -3.255  10.108  -2.440  1.00 15.00 ? 50 GLY A O    3  
ATOM 3561  H H    . GLY A 1 50 ? 0.627   11.666  -2.090  1.00 15.00 ? 50 GLY A H    3  
ATOM 3562  H HA2  . GLY A 1 50 ? -1.046  11.027  -0.625  1.00 15.00 ? 50 GLY A HA2  3  
ATOM 3563  H HA3  . GLY A 1 50 ? -2.148  12.123  -1.456  1.00 15.00 ? 50 GLY A HA3  3  
ATOM 3564  N N    . ARG A 1 51 ? -1.201  9.268   -2.799  1.00 15.00 ? 51 ARG A N    3  
ATOM 3565  C CA   . ARG A 1 51 ? -1.701  8.104   -3.523  1.00 15.00 ? 51 ARG A CA   3  
ATOM 3566  C C    . ARG A 1 51 ? -2.207  7.037   -2.558  1.00 15.00 ? 51 ARG A C    3  
ATOM 3567  O O    . ARG A 1 51 ? -3.277  6.464   -2.760  1.00 15.00 ? 51 ARG A O    3  
ATOM 3568  C CB   . ARG A 1 51 ? -0.615  7.520   -4.432  1.00 15.00 ? 51 ARG A CB   3  
ATOM 3569  C CG   . ARG A 1 51 ? -0.735  7.961   -5.882  1.00 15.00 ? 51 ARG A CG   3  
ATOM 3570  C CD   . ARG A 1 51 ? -1.980  7.387   -6.539  1.00 15.00 ? 51 ARG A CD   3  
ATOM 3571  N NE   . ARG A 1 51 ? -3.131  8.276   -6.405  1.00 15.00 ? 51 ARG A NE   3  
ATOM 3572  C CZ   . ARG A 1 51 ? -4.344  7.991   -6.872  1.00 15.00 ? 51 ARG A CZ   3  
ATOM 3573  N NH1  . ARG A 1 51 ? -4.566  6.845   -7.505  1.00 15.00 ? 51 ARG A NH1  3  
ATOM 3574  N NH2  . ARG A 1 51 ? -5.338  8.853   -6.707  1.00 15.00 ? 51 ARG A NH2  3  
ATOM 3575  H H    . ARG A 1 51 ? -0.232  9.384   -2.675  1.00 15.00 ? 51 ARG A H    3  
ATOM 3576  H HA   . ARG A 1 51 ? -2.528  8.432   -4.135  1.00 15.00 ? 51 ARG A HA   3  
ATOM 3577  H HB2  . ARG A 1 51 ? 0.355   7.824   -4.067  1.00 15.00 ? 51 ARG A HB2  3  
ATOM 3578  H HB3  . ARG A 1 51 ? -0.680  6.444   -4.400  1.00 15.00 ? 51 ARG A HB3  3  
ATOM 3579  H HG2  . ARG A 1 51 ? -0.787  9.039   -5.917  1.00 15.00 ? 51 ARG A HG2  3  
ATOM 3580  H HG3  . ARG A 1 51 ? 0.136   7.622   -6.423  1.00 15.00 ? 51 ARG A HG3  3  
ATOM 3581  H HD2  . ARG A 1 51 ? -1.778  7.233   -7.589  1.00 15.00 ? 51 ARG A HD2  3  
ATOM 3582  H HD3  . ARG A 1 51 ? -2.212  6.440   -6.076  1.00 15.00 ? 51 ARG A HD3  3  
ATOM 3583  H HE   . ARG A 1 51 ? -2.994  9.128   -5.942  1.00 15.00 ? 51 ARG A HE   3  
ATOM 3584  H HH11 . ARG A 1 51 ? -3.821  6.191   -7.632  1.00 15.00 ? 51 ARG A HH11 3  
ATOM 3585  H HH12 . ARG A 1 51 ? -5.480  6.636   -7.854  1.00 15.00 ? 51 ARG A HH12 3  
ATOM 3586  H HH21 . ARG A 1 51 ? -5.176  9.717   -6.231  1.00 15.00 ? 51 ARG A HH21 3  
ATOM 3587  H HH22 . ARG A 1 51 ? -6.250  8.639   -7.059  1.00 15.00 ? 51 ARG A HH22 3  
ATOM 3588  N N    . ILE A 1 52 ? -1.436  6.777   -1.509  1.00 15.00 ? 52 ILE A N    3  
ATOM 3589  C CA   . ILE A 1 52 ? -1.818  5.780   -0.518  1.00 15.00 ? 52 ILE A CA   3  
ATOM 3590  C C    . ILE A 1 52 ? -2.612  6.412   0.623   1.00 15.00 ? 52 ILE A C    3  
ATOM 3591  O O    . ILE A 1 52 ? -2.563  7.624   0.836   1.00 15.00 ? 52 ILE A O    3  
ATOM 3592  C CB   . ILE A 1 52 ? -0.585  5.059   0.064   1.00 15.00 ? 52 ILE A CB   3  
ATOM 3593  C CG1  . ILE A 1 52 ? 0.215   4.383   -1.053  1.00 15.00 ? 52 ILE A CG1  3  
ATOM 3594  C CG2  . ILE A 1 52 ? -1.010  4.034   1.107   1.00 15.00 ? 52 ILE A CG2  3  
ATOM 3595  C CD1  . ILE A 1 52 ? -0.248  2.975   -1.366  1.00 15.00 ? 52 ILE A CD1  3  
ATOM 3596  H H    . ILE A 1 52 ? -0.595  7.267   -1.398  1.00 15.00 ? 52 ILE A H    3  
ATOM 3597  H HA   . ILE A 1 52 ? -2.439  5.044   -1.010  1.00 15.00 ? 52 ILE A HA   3  
ATOM 3598  H HB   . ILE A 1 52 ? 0.038   5.794   0.550   1.00 15.00 ? 52 ILE A HB   3  
ATOM 3599  H HG12 . ILE A 1 52 ? 0.126   4.969   -1.956  1.00 15.00 ? 52 ILE A HG12 3  
ATOM 3600  H HG13 . ILE A 1 52 ? 1.255   4.335   -0.763  1.00 15.00 ? 52 ILE A HG13 3  
ATOM 3601  H HG21 . ILE A 1 52 ? -1.825  3.441   0.717   1.00 15.00 ? 52 ILE A HG21 3  
ATOM 3602  H HG22 . ILE A 1 52 ? -0.176  3.391   1.333   1.00 15.00 ? 52 ILE A HG22 3  
ATOM 3603  H HG23 . ILE A 1 52 ? -1.332  4.542   2.004   1.00 15.00 ? 52 ILE A HG23 3  
ATOM 3604  H HD11 . ILE A 1 52 ? 0.372   2.554   -2.142  1.00 15.00 ? 52 ILE A HD11 3  
ATOM 3605  H HD12 . ILE A 1 52 ? -0.177  2.365   -0.475  1.00 15.00 ? 52 ILE A HD12 3  
ATOM 3606  H HD13 . ILE A 1 52 ? -1.274  3.003   -1.699  1.00 15.00 ? 52 ILE A HD13 3  
ATOM 3607  N N    . HIS A 1 53 ? -3.334  5.574   1.356   1.00 15.00 ? 53 HIS A N    3  
ATOM 3608  C CA   . HIS A 1 53 ? -4.136  6.021   2.484   1.00 15.00 ? 53 HIS A CA   3  
ATOM 3609  C C    . HIS A 1 53 ? -4.047  5.028   3.622   1.00 15.00 ? 53 HIS A C    3  
ATOM 3610  O O    . HIS A 1 53 ? -3.855  3.831   3.412   1.00 15.00 ? 53 HIS A O    3  
ATOM 3611  C CB   . HIS A 1 53 ? -5.593  6.223   2.066   1.00 15.00 ? 53 HIS A CB   3  
ATOM 3612  C CG   . HIS A 1 53 ? -5.772  7.257   0.998   1.00 15.00 ? 53 HIS A CG   3  
ATOM 3613  N ND1  . HIS A 1 53 ? -5.647  6.979   -0.347  1.00 15.00 ? 53 HIS A ND1  3  
ATOM 3614  C CD2  . HIS A 1 53 ? -6.068  8.576   1.081   1.00 15.00 ? 53 HIS A CD2  3  
ATOM 3615  C CE1  . HIS A 1 53 ? -5.858  8.081   -1.044  1.00 15.00 ? 53 HIS A CE1  3  
ATOM 3616  N NE2  . HIS A 1 53 ? -6.116  9.064   -0.201  1.00 15.00 ? 53 HIS A NE2  3  
ATOM 3617  H H    . HIS A 1 53 ? -3.320  4.624   1.135   1.00 15.00 ? 53 HIS A H    3  
ATOM 3618  H HA   . HIS A 1 53 ? -3.732  6.956   2.834   1.00 15.00 ? 53 HIS A HA   3  
ATOM 3619  H HB2  . HIS A 1 53 ? -5.987  5.290   1.693   1.00 15.00 ? 53 HIS A HB2  3  
ATOM 3620  H HB3  . HIS A 1 53 ? -6.168  6.531   2.928   1.00 15.00 ? 53 HIS A HB3  3  
ATOM 3621  H HD1  . HIS A 1 53 ? -5.435  6.103   -0.734  1.00 15.00 ? 53 HIS A HD1  3  
ATOM 3622  H HD2  . HIS A 1 53 ? -6.235  9.139   1.989   1.00 15.00 ? 53 HIS A HD2  3  
ATOM 3623  H HE1  . HIS A 1 53 ? -5.827  8.164   -2.121  1.00 15.00 ? 53 HIS A HE1  3  
ATOM 3624  H HE2  . HIS A 1 53 ? -6.401  9.966   -0.456  1.00 15.00 ? 53 HIS A HE2  3  
ATOM 3625  N N    . LYS A 1 54 ? -4.152  5.554   4.830   1.00 15.00 ? 54 LYS A N    3  
ATOM 3626  C CA   . LYS A 1 54 ? -4.052  4.757   6.037   1.00 15.00 ? 54 LYS A CA   3  
ATOM 3627  C C    . LYS A 1 54 ? -4.679  3.371   5.879   1.00 15.00 ? 54 LYS A C    3  
ATOM 3628  O O    . LYS A 1 54 ? -5.791  3.227   5.370   1.00 15.00 ? 54 LYS A O    3  
ATOM 3629  C CB   . LYS A 1 54 ? -4.661  5.509   7.232   1.00 15.00 ? 54 LYS A CB   3  
ATOM 3630  C CG   . LYS A 1 54 ? -5.916  4.875   7.819   1.00 15.00 ? 54 LYS A CG   3  
ATOM 3631  C CD   . LYS A 1 54 ? -6.273  5.495   9.159   1.00 15.00 ? 54 LYS A CD   3  
ATOM 3632  C CE   . LYS A 1 54 ? -5.168  5.281   10.180  1.00 15.00 ? 54 LYS A CE   3  
ATOM 3633  N NZ   . LYS A 1 54 ? -5.120  3.872   10.659  1.00 15.00 ? 54 LYS A NZ   3  
ATOM 3634  H H    . LYS A 1 54 ? -4.271  6.515   4.911   1.00 15.00 ? 54 LYS A H    3  
ATOM 3635  H HA   . LYS A 1 54 ? -3.003  4.634   6.219   1.00 15.00 ? 54 LYS A HA   3  
ATOM 3636  H HB2  . LYS A 1 54 ? -3.919  5.562   8.012   1.00 15.00 ? 54 LYS A HB2  3  
ATOM 3637  H HB3  . LYS A 1 54 ? -4.905  6.513   6.923   1.00 15.00 ? 54 LYS A HB3  3  
ATOM 3638  H HG2  . LYS A 1 54 ? -6.738  5.022   7.135   1.00 15.00 ? 54 LYS A HG2  3  
ATOM 3639  H HG3  . LYS A 1 54 ? -5.745  3.818   7.959   1.00 15.00 ? 54 LYS A HG3  3  
ATOM 3640  H HD2  . LYS A 1 54 ? -6.426  6.555   9.025   1.00 15.00 ? 54 LYS A HD2  3  
ATOM 3641  H HD3  . LYS A 1 54 ? -7.182  5.041   9.524   1.00 15.00 ? 54 LYS A HD3  3  
ATOM 3642  H HE2  . LYS A 1 54 ? -4.222  5.528   9.723   1.00 15.00 ? 54 LYS A HE2  3  
ATOM 3643  H HE3  . LYS A 1 54 ? -5.342  5.934   11.023  1.00 15.00 ? 54 LYS A HE3  3  
ATOM 3644  H HZ1  . LYS A 1 54 ? -4.777  3.840   11.640  1.00 15.00 ? 54 LYS A HZ1  3  
ATOM 3645  H HZ2  . LYS A 1 54 ? -6.070  3.449   10.621  1.00 15.00 ? 54 LYS A HZ2  3  
ATOM 3646  H HZ3  . LYS A 1 54 ? -4.480  3.312   10.061  1.00 15.00 ? 54 LYS A HZ3  3  
ATOM 3647  N N    . GLY A 1 55 ? -3.947  2.362   6.334   1.00 15.00 ? 55 GLY A N    3  
ATOM 3648  C CA   . GLY A 1 55 ? -4.417  0.989   6.262   1.00 15.00 ? 55 GLY A CA   3  
ATOM 3649  C C    . GLY A 1 55 ? -4.802  0.549   4.863   1.00 15.00 ? 55 GLY A C    3  
ATOM 3650  O O    . GLY A 1 55 ? -5.709  -0.268  4.701   1.00 15.00 ? 55 GLY A O    3  
ATOM 3651  H H    . GLY A 1 55 ? -3.073  2.556   6.735   1.00 15.00 ? 55 GLY A H    3  
ATOM 3652  H HA2  . GLY A 1 55 ? -3.639  0.335   6.623   1.00 15.00 ? 55 GLY A HA2  3  
ATOM 3653  H HA3  . GLY A 1 55 ? -5.279  0.887   6.905   1.00 15.00 ? 55 GLY A HA3  3  
ATOM 3654  N N    . ASP A 1 56 ? -4.117  1.065   3.843   1.00 15.00 ? 56 ASP A N    3  
ATOM 3655  C CA   . ASP A 1 56 ? -4.423  0.673   2.474   1.00 15.00 ? 56 ASP A CA   3  
ATOM 3656  C C    . ASP A 1 56 ? -4.088  -0.798  2.251   1.00 15.00 ? 56 ASP A C    3  
ATOM 3657  O O    . ASP A 1 56 ? -2.974  -1.239  2.540   1.00 15.00 ? 56 ASP A O    3  
ATOM 3658  C CB   . ASP A 1 56 ? -3.671  1.550   1.472   1.00 15.00 ? 56 ASP A CB   3  
ATOM 3659  C CG   . ASP A 1 56 ? -4.604  2.228   0.490   1.00 15.00 ? 56 ASP A CG   3  
ATOM 3660  O OD1  . ASP A 1 56 ? -5.431  1.524   -0.126  1.00 15.00 ? 56 ASP A OD1  3  
ATOM 3661  O OD2  . ASP A 1 56 ? -4.508  3.464   0.339   1.00 15.00 ? 56 ASP A OD2  3  
ATOM 3662  H H    . ASP A 1 56 ? -3.385  1.704   4.013   1.00 15.00 ? 56 ASP A H    3  
ATOM 3663  H HA   . ASP A 1 56 ? -5.485  0.808   2.327   1.00 15.00 ? 56 ASP A HA   3  
ATOM 3664  H HB2  . ASP A 1 56 ? -3.131  2.314   2.006   1.00 15.00 ? 56 ASP A HB2  3  
ATOM 3665  H HB3  . ASP A 1 56 ? -2.974  0.940   0.917   1.00 15.00 ? 56 ASP A HB3  3  
ATOM 3666  N N    . ARG A 1 57 ? -5.053  -1.554  1.736   1.00 15.00 ? 57 ARG A N    3  
ATOM 3667  C CA   . ARG A 1 57 ? -4.852  -2.975  1.473   1.00 15.00 ? 57 ARG A CA   3  
ATOM 3668  C C    . ARG A 1 57 ? -4.109  -3.175  0.159   1.00 15.00 ? 57 ARG A C    3  
ATOM 3669  O O    . ARG A 1 57 ? -4.725  -3.348  -0.893  1.00 15.00 ? 57 ARG A O    3  
ATOM 3670  C CB   . ARG A 1 57 ? -6.198  -3.703  1.429   1.00 15.00 ? 57 ARG A CB   3  
ATOM 3671  C CG   . ARG A 1 57 ? -6.074  -5.216  1.499   1.00 15.00 ? 57 ARG A CG   3  
ATOM 3672  C CD   . ARG A 1 57 ? -7.393  -5.866  1.884   1.00 15.00 ? 57 ARG A CD   3  
ATOM 3673  N NE   . ARG A 1 57 ? -7.226  -7.269  2.254   1.00 15.00 ? 57 ARG A NE   3  
ATOM 3674  C CZ   . ARG A 1 57 ? -7.174  -8.268  1.376   1.00 15.00 ? 57 ARG A CZ   3  
ATOM 3675  N NH1  . ARG A 1 57 ? -7.270  -8.023  0.075   1.00 15.00 ? 57 ARG A NH1  3  
ATOM 3676  N NH2  . ARG A 1 57 ? -7.022  -9.515  1.799   1.00 15.00 ? 57 ARG A NH2  3  
ATOM 3677  H H    . ARG A 1 57 ? -5.919  -1.146  1.525   1.00 15.00 ? 57 ARG A H    3  
ATOM 3678  H HA   . ARG A 1 57 ? -4.257  -3.383  2.276   1.00 15.00 ? 57 ARG A HA   3  
ATOM 3679  H HB2  . ARG A 1 57 ? -6.799  -3.373  2.264   1.00 15.00 ? 57 ARG A HB2  3  
ATOM 3680  H HB3  . ARG A 1 57 ? -6.703  -3.446  0.510   1.00 15.00 ? 57 ARG A HB3  3  
ATOM 3681  H HG2  . ARG A 1 57 ? -5.770  -5.588  0.531   1.00 15.00 ? 57 ARG A HG2  3  
ATOM 3682  H HG3  . ARG A 1 57 ? -5.327  -5.473  2.236   1.00 15.00 ? 57 ARG A HG3  3  
ATOM 3683  H HD2  . ARG A 1 57 ? -7.811  -5.330  2.724   1.00 15.00 ? 57 ARG A HD2  3  
ATOM 3684  H HD3  . ARG A 1 57 ? -8.070  -5.802  1.046   1.00 15.00 ? 57 ARG A HD3  3  
ATOM 3685  H HE   . ARG A 1 57 ? -7.149  -7.479  3.209   1.00 15.00 ? 57 ARG A HE   3  
ATOM 3686  H HH11 . ARG A 1 57 ? -7.383  -7.085  -0.251  1.00 15.00 ? 57 ARG A HH11 3  
ATOM 3687  H HH12 . ARG A 1 57 ? -7.231  -8.778  -0.579  1.00 15.00 ? 57 ARG A HH12 3  
ATOM 3688  H HH21 . ARG A 1 57 ? -6.947  -9.705  2.778   1.00 15.00 ? 57 ARG A HH21 3  
ATOM 3689  H HH22 . ARG A 1 57 ? -6.983  -10.266 1.140   1.00 15.00 ? 57 ARG A HH22 3  
ATOM 3690  N N    . VAL A 1 58 ? -2.782  -3.143  0.223   1.00 15.00 ? 58 VAL A N    3  
ATOM 3691  C CA   . VAL A 1 58 ? -1.963  -3.313  -0.969  1.00 15.00 ? 58 VAL A CA   3  
ATOM 3692  C C    . VAL A 1 58 ? -1.835  -4.789  -1.345  1.00 15.00 ? 58 VAL A C    3  
ATOM 3693  O O    . VAL A 1 58 ? -1.277  -5.596  -0.591  1.00 15.00 ? 58 VAL A O    3  
ATOM 3694  C CB   . VAL A 1 58 ? -0.563  -2.670  -0.801  1.00 15.00 ? 58 VAL A CB   3  
ATOM 3695  C CG1  . VAL A 1 58 ? -0.658  -1.385  0.010   1.00 15.00 ? 58 VAL A CG1  3  
ATOM 3696  C CG2  . VAL A 1 58 ? 0.428   -3.632  -0.157  1.00 15.00 ? 58 VAL A CG2  3  
ATOM 3697  H H    . VAL A 1 58 ? -2.346  -2.996  1.088   1.00 15.00 ? 58 VAL A H    3  
ATOM 3698  H HA   . VAL A 1 58 ? -2.466  -2.805  -1.778  1.00 15.00 ? 58 VAL A HA   3  
ATOM 3699  H HB   . VAL A 1 58 ? -0.194  -2.413  -1.782  1.00 15.00 ? 58 VAL A HB   3  
ATOM 3700  H HG11 . VAL A 1 58 ? -1.419  -0.747  -0.415  1.00 15.00 ? 58 VAL A HG11 3  
ATOM 3701  H HG12 . VAL A 1 58 ? -0.917  -1.622  1.032   1.00 15.00 ? 58 VAL A HG12 3  
ATOM 3702  H HG13 . VAL A 1 58 ? 0.293   -0.875  -0.011  1.00 15.00 ? 58 VAL A HG13 3  
ATOM 3703  H HG21 . VAL A 1 58 ? 1.215   -3.071  0.323   1.00 15.00 ? 58 VAL A HG21 3  
ATOM 3704  H HG22 . VAL A 1 58 ? -0.082  -4.236  0.578   1.00 15.00 ? 58 VAL A HG22 3  
ATOM 3705  H HG23 . VAL A 1 58 ? 0.853   -4.272  -0.916  1.00 15.00 ? 58 VAL A HG23 3  
ATOM 3706  N N    . LEU A 1 59 ? -2.382  -5.132  -2.510  1.00 15.00 ? 59 LEU A N    3  
ATOM 3707  C CA   . LEU A 1 59 ? -2.354  -6.504  -3.002  1.00 15.00 ? 59 LEU A CA   3  
ATOM 3708  C C    . LEU A 1 59 ? -1.380  -6.679  -4.169  1.00 15.00 ? 59 LEU A C    3  
ATOM 3709  O O    . LEU A 1 59 ? -1.078  -7.805  -4.562  1.00 15.00 ? 59 LEU A O    3  
ATOM 3710  C CB   . LEU A 1 59 ? -3.756  -6.940  -3.434  1.00 15.00 ? 59 LEU A CB   3  
ATOM 3711  C CG   . LEU A 1 59 ? -4.812  -6.934  -2.326  1.00 15.00 ? 59 LEU A CG   3  
ATOM 3712  C CD1  . LEU A 1 59 ? -6.051  -7.693  -2.773  1.00 15.00 ? 59 LEU A CD1  3  
ATOM 3713  C CD2  . LEU A 1 59 ? -4.251  -7.534  -1.045  1.00 15.00 ? 59 LEU A CD2  3  
ATOM 3714  H H    . LEU A 1 59 ? -2.823  -4.442  -3.049  1.00 15.00 ? 59 LEU A H    3  
ATOM 3715  H HA   . LEU A 1 59 ? -2.032  -7.136  -2.189  1.00 15.00 ? 59 LEU A HA   3  
ATOM 3716  H HB2  . LEU A 1 59 ? -4.087  -6.279  -4.222  1.00 15.00 ? 59 LEU A HB2  3  
ATOM 3717  H HB3  . LEU A 1 59 ? -3.691  -7.941  -3.832  1.00 15.00 ? 59 LEU A HB3  3  
ATOM 3718  H HG   . LEU A 1 59 ? -5.103  -5.913  -2.120  1.00 15.00 ? 59 LEU A HG   3  
ATOM 3719  H HD11 . LEU A 1 59 ? -6.271  -7.448  -3.802  1.00 15.00 ? 59 LEU A HD11 3  
ATOM 3720  H HD12 . LEU A 1 59 ? -5.873  -8.755  -2.686  1.00 15.00 ? 59 LEU A HD12 3  
ATOM 3721  H HD13 . LEU A 1 59 ? -6.888  -7.416  -2.150  1.00 15.00 ? 59 LEU A HD13 3  
ATOM 3722  H HD21 . LEU A 1 59 ? -5.021  -8.102  -0.545  1.00 15.00 ? 59 LEU A HD21 3  
ATOM 3723  H HD22 . LEU A 1 59 ? -3.423  -8.186  -1.286  1.00 15.00 ? 59 LEU A HD22 3  
ATOM 3724  H HD23 . LEU A 1 59 ? -3.908  -6.741  -0.395  1.00 15.00 ? 59 LEU A HD23 3  
ATOM 3725  N N    . ALA A 1 60 ? -0.907  -5.574  -4.741  1.00 15.00 ? 60 ALA A N    3  
ATOM 3726  C CA   . ALA A 1 60 ? 0.008   -5.650  -5.876  1.00 15.00 ? 60 ALA A CA   3  
ATOM 3727  C C    . ALA A 1 60 ? 0.968   -4.465  -5.929  1.00 15.00 ? 60 ALA A C    3  
ATOM 3728  O O    . ALA A 1 60 ? 0.605   -3.335  -5.602  1.00 15.00 ? 60 ALA A O    3  
ATOM 3729  C CB   . ALA A 1 60 ? -0.782  -5.742  -7.173  1.00 15.00 ? 60 ALA A CB   3  
ATOM 3730  H H    . ALA A 1 60 ? -1.190  -4.697  -4.407  1.00 15.00 ? 60 ALA A H    3  
ATOM 3731  H HA   . ALA A 1 60 ? 0.585   -6.558  -5.780  1.00 15.00 ? 60 ALA A HA   3  
ATOM 3732  H HB1  . ALA A 1 60 ? -0.733  -6.752  -7.553  1.00 15.00 ? 60 ALA A HB1  3  
ATOM 3733  H HB2  . ALA A 1 60 ? -1.813  -5.479  -6.986  1.00 15.00 ? 60 ALA A HB2  3  
ATOM 3734  H HB3  . ALA A 1 60 ? -0.364  -5.063  -7.901  1.00 15.00 ? 60 ALA A HB3  3  
ATOM 3735  N N    . VAL A 1 61 ? 2.193   -4.741  -6.367  1.00 15.00 ? 61 VAL A N    3  
ATOM 3736  C CA   . VAL A 1 61 ? 3.227   -3.720  -6.503  1.00 15.00 ? 61 VAL A CA   3  
ATOM 3737  C C    . VAL A 1 61 ? 4.000   -3.951  -7.790  1.00 15.00 ? 61 VAL A C    3  
ATOM 3738  O O    . VAL A 1 61 ? 4.841   -4.847  -7.865  1.00 15.00 ? 61 VAL A O    3  
ATOM 3739  C CB   . VAL A 1 61 ? 4.215   -3.730  -5.320  1.00 15.00 ? 61 VAL A CB   3  
ATOM 3740  C CG1  . VAL A 1 61 ? 5.218   -2.594  -5.455  1.00 15.00 ? 61 VAL A CG1  3  
ATOM 3741  C CG2  . VAL A 1 61 ? 3.474   -3.642  -3.996  1.00 15.00 ? 61 VAL A CG2  3  
ATOM 3742  H H    . VAL A 1 61 ? 2.404   -5.662  -6.626  1.00 15.00 ? 61 VAL A H    3  
ATOM 3743  H HA   . VAL A 1 61 ? 2.748   -2.753  -6.547  1.00 15.00 ? 61 VAL A HA   3  
ATOM 3744  H HB   . VAL A 1 61 ? 4.760   -4.661  -5.341  1.00 15.00 ? 61 VAL A HB   3  
ATOM 3745  H HG11 . VAL A 1 61 ? 4.830   -1.850  -6.134  1.00 15.00 ? 61 VAL A HG11 3  
ATOM 3746  H HG12 . VAL A 1 61 ? 5.386   -2.146  -4.488  1.00 15.00 ? 61 VAL A HG12 3  
ATOM 3747  H HG13 . VAL A 1 61 ? 6.151   -2.981  -5.839  1.00 15.00 ? 61 VAL A HG13 3  
ATOM 3748  H HG21 . VAL A 1 61 ? 3.781   -2.751  -3.472  1.00 15.00 ? 61 VAL A HG21 3  
ATOM 3749  H HG22 . VAL A 1 61 ? 2.411   -3.604  -4.178  1.00 15.00 ? 61 VAL A HG22 3  
ATOM 3750  H HG23 . VAL A 1 61 ? 3.705   -4.510  -3.396  1.00 15.00 ? 61 VAL A HG23 3  
ATOM 3751  N N    . ASN A 1 62 ? 3.689   -3.166  -8.813  1.00 15.00 ? 62 ASN A N    3  
ATOM 3752  C CA   . ASN A 1 62 ? 4.338   -3.320  -10.105 1.00 15.00 ? 62 ASN A CA   3  
ATOM 3753  C C    . ASN A 1 62 ? 3.977   -4.678  -10.708 1.00 15.00 ? 62 ASN A C    3  
ATOM 3754  O O    . ASN A 1 62 ? 4.622   -5.145  -11.647 1.00 15.00 ? 62 ASN A O    3  
ATOM 3755  C CB   . ASN A 1 62 ? 5.857   -3.182  -9.967  1.00 15.00 ? 62 ASN A CB   3  
ATOM 3756  C CG   . ASN A 1 62 ? 6.327   -1.755  -10.171 1.00 15.00 ? 62 ASN A CG   3  
ATOM 3757  O OD1  . ASN A 1 62 ? 7.247   -1.497  -10.948 1.00 15.00 ? 62 ASN A OD1  3  
ATOM 3758  N ND2  . ASN A 1 62 ? 5.696   -0.817  -9.472  1.00 15.00 ? 62 ASN A ND2  3  
ATOM 3759  H H    . ASN A 1 62 ? 2.993   -2.483  -8.703  1.00 15.00 ? 62 ASN A H    3  
ATOM 3760  H HA   . ASN A 1 62 ? 3.970   -2.541  -10.756 1.00 15.00 ? 62 ASN A HA   3  
ATOM 3761  H HB2  . ASN A 1 62 ? 6.154   -3.500  -8.979  1.00 15.00 ? 62 ASN A HB2  3  
ATOM 3762  H HB3  . ASN A 1 62 ? 6.338   -3.810  -10.703 1.00 15.00 ? 62 ASN A HB3  3  
ATOM 3763  H HD21 . ASN A 1 62 ? 4.972   -1.094  -8.872  1.00 15.00 ? 62 ASN A HD21 3  
ATOM 3764  H HD22 . ASN A 1 62 ? 5.979   0.114   -9.586  1.00 15.00 ? 62 ASN A HD22 3  
ATOM 3765  N N    . GLY A 1 63 ? 2.932   -5.302  -10.159 1.00 15.00 ? 63 GLY A N    3  
ATOM 3766  C CA   . GLY A 1 63 ? 2.484   -6.594  -10.645 1.00 15.00 ? 63 GLY A CA   3  
ATOM 3767  C C    . GLY A 1 63 ? 2.814   -7.741  -9.706  1.00 15.00 ? 63 GLY A C    3  
ATOM 3768  O O    . GLY A 1 63 ? 2.576   -8.902  -10.040 1.00 15.00 ? 63 GLY A O    3  
ATOM 3769  H H    . GLY A 1 63 ? 2.455   -4.877  -9.418  1.00 15.00 ? 63 GLY A H    3  
ATOM 3770  H HA2  . GLY A 1 63 ? 1.412   -6.557  -10.772 1.00 15.00 ? 63 GLY A HA2  3  
ATOM 3771  H HA3  . GLY A 1 63 ? 2.943   -6.784  -11.604 1.00 15.00 ? 63 GLY A HA3  3  
ATOM 3772  N N    . VAL A 1 64 ? 3.350   -7.430  -8.528  1.00 15.00 ? 64 VAL A N    3  
ATOM 3773  C CA   . VAL A 1 64 ? 3.687   -8.467  -7.558  1.00 15.00 ? 64 VAL A CA   3  
ATOM 3774  C C    . VAL A 1 64 ? 2.542   -8.683  -6.569  1.00 15.00 ? 64 VAL A C    3  
ATOM 3775  O O    . VAL A 1 64 ? 2.309   -7.868  -5.678  1.00 15.00 ? 64 VAL A O    3  
ATOM 3776  C CB   . VAL A 1 64 ? 4.992   -8.140  -6.794  1.00 15.00 ? 64 VAL A CB   3  
ATOM 3777  C CG1  . VAL A 1 64 ? 4.770   -7.056  -5.752  1.00 15.00 ? 64 VAL A CG1  3  
ATOM 3778  C CG2  . VAL A 1 64 ? 5.560   -9.396  -6.151  1.00 15.00 ? 64 VAL A CG2  3  
ATOM 3779  H H    . VAL A 1 64 ? 3.513   -6.490  -8.304  1.00 15.00 ? 64 VAL A H    3  
ATOM 3780  H HA   . VAL A 1 64 ? 3.843   -9.385  -8.107  1.00 15.00 ? 64 VAL A HA   3  
ATOM 3781  H HB   . VAL A 1 64 ? 5.715   -7.772  -7.504  1.00 15.00 ? 64 VAL A HB   3  
ATOM 3782  H HG11 . VAL A 1 64 ? 4.100   -6.310  -6.149  1.00 15.00 ? 64 VAL A HG11 3  
ATOM 3783  H HG12 . VAL A 1 64 ? 4.338   -7.493  -4.865  1.00 15.00 ? 64 VAL A HG12 3  
ATOM 3784  H HG13 . VAL A 1 64 ? 5.715   -6.596  -5.503  1.00 15.00 ? 64 VAL A HG13 3  
ATOM 3785  H HG21 . VAL A 1 64 ? 5.309   -9.408  -5.100  1.00 15.00 ? 64 VAL A HG21 3  
ATOM 3786  H HG22 . VAL A 1 64 ? 5.140   -10.268 -6.631  1.00 15.00 ? 64 VAL A HG22 3  
ATOM 3787  H HG23 . VAL A 1 64 ? 6.634   -9.405  -6.264  1.00 15.00 ? 64 VAL A HG23 3  
ATOM 3788  N N    . SER A 1 65 ? 1.824   -9.787  -6.738  1.00 15.00 ? 65 SER A N    3  
ATOM 3789  C CA   . SER A 1 65 ? 0.699   -10.110 -5.865  1.00 15.00 ? 65 SER A CA   3  
ATOM 3790  C C    . SER A 1 65 ? 1.147   -10.204 -4.412  1.00 15.00 ? 65 SER A C    3  
ATOM 3791  O O    . SER A 1 65 ? 2.138   -10.862 -4.096  1.00 15.00 ? 65 SER A O    3  
ATOM 3792  C CB   . SER A 1 65 ? 0.052   -11.427 -6.298  1.00 15.00 ? 65 SER A CB   3  
ATOM 3793  O OG   . SER A 1 65 ? -0.518  -11.315 -7.591  1.00 15.00 ? 65 SER A OG   3  
ATOM 3794  H H    . SER A 1 65 ? 2.053   -10.397 -7.468  1.00 15.00 ? 65 SER A H    3  
ATOM 3795  H HA   . SER A 1 65 ? -0.029  -9.315  -5.952  1.00 15.00 ? 65 SER A HA   3  
ATOM 3796  H HB2  . SER A 1 65 ? 0.801   -12.205 -6.316  1.00 15.00 ? 65 SER A HB2  3  
ATOM 3797  H HB3  . SER A 1 65 ? -0.725  -11.691 -5.597  1.00 15.00 ? 65 SER A HB3  3  
ATOM 3798  H HG   . SER A 1 65 ? 0.164   -11.074 -8.222  1.00 15.00 ? 65 SER A HG   3  
ATOM 3799  N N    . LEU A 1 66 ? 0.407   -9.541  -3.530  1.00 15.00 ? 66 LEU A N    3  
ATOM 3800  C CA   . LEU A 1 66 ? 0.721   -9.546  -2.108  1.00 15.00 ? 66 LEU A CA   3  
ATOM 3801  C C    . LEU A 1 66 ? 0.064   -10.734 -1.409  1.00 15.00 ? 66 LEU A C    3  
ATOM 3802  O O    . LEU A 1 66 ? 0.469   -11.119 -0.312  1.00 15.00 ? 66 LEU A O    3  
ATOM 3803  C CB   . LEU A 1 66 ? 0.267   -8.236  -1.460  1.00 15.00 ? 66 LEU A CB   3  
ATOM 3804  C CG   . LEU A 1 66 ? 1.356   -7.483  -0.694  1.00 15.00 ? 66 LEU A CG   3  
ATOM 3805  C CD1  . LEU A 1 66 ? 1.960   -8.367  0.385   1.00 15.00 ? 66 LEU A CD1  3  
ATOM 3806  C CD2  . LEU A 1 66 ? 2.433   -6.992  -1.649  1.00 15.00 ? 66 LEU A CD2  3  
ATOM 3807  H H    . LEU A 1 66 ? -0.371  -9.035  -3.845  1.00 15.00 ? 66 LEU A H    3  
ATOM 3808  H HA   . LEU A 1 66 ? 1.792   -9.633  -2.008  1.00 15.00 ? 66 LEU A HA   3  
ATOM 3809  H HB2  . LEU A 1 66 ? -0.111  -7.588  -2.237  1.00 15.00 ? 66 LEU A HB2  3  
ATOM 3810  H HB3  . LEU A 1 66 ? -0.538  -8.455  -0.774  1.00 15.00 ? 66 LEU A HB3  3  
ATOM 3811  H HG   . LEU A 1 66 ? 0.917   -6.621  -0.212  1.00 15.00 ? 66 LEU A HG   3  
ATOM 3812  H HD11 . LEU A 1 66 ? 1.832   -9.405  0.114   1.00 15.00 ? 66 LEU A HD11 3  
ATOM 3813  H HD12 . LEU A 1 66 ? 3.013   -8.148  0.483   1.00 15.00 ? 66 LEU A HD12 3  
ATOM 3814  H HD13 . LEU A 1 66 ? 1.464   -8.178  1.326   1.00 15.00 ? 66 LEU A HD13 3  
ATOM 3815  H HD21 . LEU A 1 66 ? 3.400   -7.078  -1.176  1.00 15.00 ? 66 LEU A HD21 3  
ATOM 3816  H HD22 . LEU A 1 66 ? 2.418   -7.590  -2.548  1.00 15.00 ? 66 LEU A HD22 3  
ATOM 3817  H HD23 . LEU A 1 66 ? 2.247   -5.958  -1.901  1.00 15.00 ? 66 LEU A HD23 3  
ATOM 3818  N N    . GLU A 1 67 ? -0.952  -11.313 -2.049  1.00 15.00 ? 67 GLU A N    3  
ATOM 3819  C CA   . GLU A 1 67 ? -1.660  -12.459 -1.486  1.00 15.00 ? 67 GLU A CA   3  
ATOM 3820  C C    . GLU A 1 67 ? -0.677  -13.519 -0.999  1.00 15.00 ? 67 GLU A C    3  
ATOM 3821  O O    . GLU A 1 67 ? -0.209  -14.351 -1.776  1.00 15.00 ? 67 GLU A O    3  
ATOM 3822  C CB   . GLU A 1 67 ? -2.606  -13.062 -2.526  1.00 15.00 ? 67 GLU A CB   3  
ATOM 3823  C CG   . GLU A 1 67 ? -3.817  -12.194 -2.822  1.00 15.00 ? 67 GLU A CG   3  
ATOM 3824  C CD   . GLU A 1 67 ? -4.432  -12.492 -4.176  1.00 15.00 ? 67 GLU A CD   3  
ATOM 3825  O OE1  . GLU A 1 67 ? -4.171  -13.587 -4.718  1.00 15.00 ? 67 GLU A OE1  3  
ATOM 3826  O OE2  . GLU A 1 67 ? -5.173  -11.631 -4.694  1.00 15.00 ? 67 GLU A OE2  3  
ATOM 3827  H H    . GLU A 1 67 ? -1.230  -10.963 -2.920  1.00 15.00 ? 67 GLU A H    3  
ATOM 3828  H HA   . GLU A 1 67 ? -2.240  -12.110 -0.644  1.00 15.00 ? 67 GLU A HA   3  
ATOM 3829  H HB2  . GLU A 1 67 ? -2.062  -13.210 -3.447  1.00 15.00 ? 67 GLU A HB2  3  
ATOM 3830  H HB3  . GLU A 1 67 ? -2.954  -14.020 -2.167  1.00 15.00 ? 67 GLU A HB3  3  
ATOM 3831  H HG2  . GLU A 1 67 ? -4.563  -12.367 -2.060  1.00 15.00 ? 67 GLU A HG2  3  
ATOM 3832  H HG3  . GLU A 1 67 ? -3.515  -11.157 -2.800  1.00 15.00 ? 67 GLU A HG3  3  
ATOM 3833  N N    . GLY A 1 68 ? -0.360  -13.472 0.289   1.00 15.00 ? 68 GLY A N    3  
ATOM 3834  C CA   . GLY A 1 68 ? 0.574   -14.423 0.859   1.00 15.00 ? 68 GLY A CA   3  
ATOM 3835  C C    . GLY A 1 68 ? 1.899   -13.777 1.206   1.00 15.00 ? 68 GLY A C    3  
ATOM 3836  O O    . GLY A 1 68 ? 2.925   -14.077 0.594   1.00 15.00 ? 68 GLY A O    3  
ATOM 3837  H H    . GLY A 1 68 ? -0.759  -12.780 0.857   1.00 15.00 ? 68 GLY A H    3  
ATOM 3838  H HA2  . GLY A 1 68 ? 0.143   -14.844 1.755   1.00 15.00 ? 68 GLY A HA2  3  
ATOM 3839  H HA3  . GLY A 1 68 ? 0.746   -15.215 0.146   1.00 15.00 ? 68 GLY A HA3  3  
ATOM 3840  N N    . ALA A 1 69 ? 1.876   -12.882 2.188   1.00 15.00 ? 69 ALA A N    3  
ATOM 3841  C CA   . ALA A 1 69 ? 3.080   -12.182 2.615   1.00 15.00 ? 69 ALA A CA   3  
ATOM 3842  C C    . ALA A 1 69 ? 2.812   -11.352 3.866   1.00 15.00 ? 69 ALA A C    3  
ATOM 3843  O O    . ALA A 1 69 ? 1.663   -11.068 4.202   1.00 15.00 ? 69 ALA A O    3  
ATOM 3844  C CB   . ALA A 1 69 ? 3.598   -11.300 1.489   1.00 15.00 ? 69 ALA A CB   3  
ATOM 3845  H H    . ALA A 1 69 ? 1.027   -12.681 2.631   1.00 15.00 ? 69 ALA A H    3  
ATOM 3846  H HA   . ALA A 1 69 ? 3.834   -12.922 2.839   1.00 15.00 ? 69 ALA A HA   3  
ATOM 3847  H HB1  . ALA A 1 69 ? 4.545   -11.684 1.139   1.00 15.00 ? 69 ALA A HB1  3  
ATOM 3848  H HB2  . ALA A 1 69 ? 2.888   -11.301 0.676   1.00 15.00 ? 69 ALA A HB2  3  
ATOM 3849  H HB3  . ALA A 1 69 ? 3.729   -10.292 1.851   1.00 15.00 ? 69 ALA A HB3  3  
ATOM 3850  N N    . THR A 1 70 ? 3.880   -10.975 4.559   1.00 15.00 ? 70 THR A N    3  
ATOM 3851  C CA   . THR A 1 70 ? 3.762   -10.186 5.780   1.00 15.00 ? 70 THR A CA   3  
ATOM 3852  C C    . THR A 1 70 ? 3.870   -8.692  5.491   1.00 15.00 ? 70 THR A C    3  
ATOM 3853  O O    . THR A 1 70 ? 3.920   -8.272  4.335   1.00 15.00 ? 70 THR A O    3  
ATOM 3854  C CB   . THR A 1 70 ? 4.842   -10.601 6.779   1.00 15.00 ? 70 THR A CB   3  
ATOM 3855  O OG1  . THR A 1 70 ? 6.091   -10.029 6.434   1.00 15.00 ? 70 THR A OG1  3  
ATOM 3856  C CG2  . THR A 1 70 ? 5.031   -12.100 6.866   1.00 15.00 ? 70 THR A CG2  3  
ATOM 3857  H H    . THR A 1 70 ? 4.771   -11.238 4.245   1.00 15.00 ? 70 THR A H    3  
ATOM 3858  H HA   . THR A 1 70 ? 2.792   -10.385 6.211   1.00 15.00 ? 70 THR A HA   3  
ATOM 3859  H HB   . THR A 1 70 ? 4.565   -10.245 7.761   1.00 15.00 ? 70 THR A HB   3  
ATOM 3860  H HG1  . THR A 1 70 ? 6.748   -10.275 7.089   1.00 15.00 ? 70 THR A HG1  3  
ATOM 3861  H HG21 . THR A 1 70 ? 5.618   -12.340 7.740   1.00 15.00 ? 70 THR A HG21 3  
ATOM 3862  H HG22 . THR A 1 70 ? 4.066   -12.581 6.937   1.00 15.00 ? 70 THR A HG22 3  
ATOM 3863  H HG23 . THR A 1 70 ? 5.543   -12.450 5.981   1.00 15.00 ? 70 THR A HG23 3  
ATOM 3864  N N    . HIS A 1 71 ? 3.905   -7.897  6.556   1.00 15.00 ? 71 HIS A N    3  
ATOM 3865  C CA   . HIS A 1 71 ? 4.006   -6.449  6.436   1.00 15.00 ? 71 HIS A CA   3  
ATOM 3866  C C    . HIS A 1 71 ? 5.312   -6.063  5.756   1.00 15.00 ? 71 HIS A C    3  
ATOM 3867  O O    . HIS A 1 71 ? 5.315   -5.453  4.687   1.00 15.00 ? 71 HIS A O    3  
ATOM 3868  C CB   . HIS A 1 71 ? 3.891   -5.808  7.829   1.00 15.00 ? 71 HIS A CB   3  
ATOM 3869  C CG   . HIS A 1 71 ? 4.770   -4.612  8.048   1.00 15.00 ? 71 HIS A CG   3  
ATOM 3870  N ND1  . HIS A 1 71 ? 5.514   -4.428  9.195   1.00 15.00 ? 71 HIS A ND1  3  
ATOM 3871  C CD2  . HIS A 1 71 ? 5.017   -3.537  7.265   1.00 15.00 ? 71 HIS A CD2  3  
ATOM 3872  C CE1  . HIS A 1 71 ? 6.179   -3.290  9.107   1.00 15.00 ? 71 HIS A CE1  3  
ATOM 3873  N NE2  . HIS A 1 71 ? 5.896   -2.731  7.946   1.00 15.00 ? 71 HIS A NE2  3  
ATOM 3874  H H    . HIS A 1 71 ? 3.861   -8.296  7.448   1.00 15.00 ? 71 HIS A H    3  
ATOM 3875  H HA   . HIS A 1 71 ? 3.185   -6.112  5.824   1.00 15.00 ? 71 HIS A HA   3  
ATOM 3876  H HB2  . HIS A 1 71 ? 2.871   -5.493  7.984   1.00 15.00 ? 71 HIS A HB2  3  
ATOM 3877  H HB3  . HIS A 1 71 ? 4.147   -6.547  8.574   1.00 15.00 ? 71 HIS A HB3  3  
ATOM 3878  H HD1  . HIS A 1 71 ? 5.548   -5.039  9.959   1.00 15.00 ? 71 HIS A HD1  3  
ATOM 3879  H HD2  . HIS A 1 71 ? 4.597   -3.346  6.287   1.00 15.00 ? 71 HIS A HD2  3  
ATOM 3880  H HE1  . HIS A 1 71 ? 6.840   -2.885  9.859   1.00 15.00 ? 71 HIS A HE1  3  
ATOM 3881  H HE2  . HIS A 1 71 ? 6.283   -1.897  7.610   1.00 15.00 ? 71 HIS A HE2  3  
ATOM 3882  N N    . LYS A 1 72 ? 6.418   -6.436  6.381   1.00 15.00 ? 72 LYS A N    3  
ATOM 3883  C CA   . LYS A 1 72 ? 7.739   -6.146  5.838   1.00 15.00 ? 72 LYS A CA   3  
ATOM 3884  C C    . LYS A 1 72 ? 7.840   -6.630  4.398   1.00 15.00 ? 72 LYS A C    3  
ATOM 3885  O O    . LYS A 1 72 ? 8.554   -6.046  3.585   1.00 15.00 ? 72 LYS A O    3  
ATOM 3886  C CB   . LYS A 1 72 ? 8.811   -6.814  6.695   1.00 15.00 ? 72 LYS A CB   3  
ATOM 3887  C CG   . LYS A 1 72 ? 10.220  -6.331  6.394   1.00 15.00 ? 72 LYS A CG   3  
ATOM 3888  C CD   . LYS A 1 72 ? 11.149  -6.549  7.577   1.00 15.00 ? 72 LYS A CD   3  
ATOM 3889  C CE   . LYS A 1 72 ? 11.770  -7.936  7.550   1.00 15.00 ? 72 LYS A CE   3  
ATOM 3890  N NZ   . LYS A 1 72 ? 12.444  -8.218  6.252   1.00 15.00 ? 72 LYS A NZ   3  
ATOM 3891  H H    . LYS A 1 72 ? 6.344   -6.932  7.224   1.00 15.00 ? 72 LYS A H    3  
ATOM 3892  H HA   . LYS A 1 72 ? 7.884   -5.071  5.854   1.00 15.00 ? 72 LYS A HA   3  
ATOM 3893  H HB2  . LYS A 1 72 ? 8.597   -6.618  7.735   1.00 15.00 ? 72 LYS A HB2  3  
ATOM 3894  H HB3  . LYS A 1 72 ? 8.775   -7.881  6.526   1.00 15.00 ? 72 LYS A HB3  3  
ATOM 3895  H HG2  . LYS A 1 72 ? 10.602  -6.875  5.543   1.00 15.00 ? 72 LYS A HG2  3  
ATOM 3896  H HG3  . LYS A 1 72 ? 10.185  -5.276  6.163   1.00 15.00 ? 72 LYS A HG3  3  
ATOM 3897  H HD2  . LYS A 1 72 ? 11.937  -5.812  7.544   1.00 15.00 ? 72 LYS A HD2  3  
ATOM 3898  H HD3  . LYS A 1 72 ? 10.585  -6.435  8.491   1.00 15.00 ? 72 LYS A HD3  3  
ATOM 3899  H HE2  . LYS A 1 72 ? 12.497  -8.007  8.345   1.00 15.00 ? 72 LYS A HE2  3  
ATOM 3900  H HE3  . LYS A 1 72 ? 10.992  -8.668  7.708   1.00 15.00 ? 72 LYS A HE3  3  
ATOM 3901  H HZ1  . LYS A 1 72 ? 11.759  -8.597  5.568   1.00 15.00 ? 72 LYS A HZ1  3  
ATOM 3902  H HZ2  . LYS A 1 72 ? 12.855  -7.344  5.866   1.00 15.00 ? 72 LYS A HZ2  3  
ATOM 3903  H HZ3  . LYS A 1 72 ? 13.203  -8.916  6.388   1.00 15.00 ? 72 LYS A HZ3  3  
ATOM 3904  N N    . GLN A 1 73 ? 7.111   -7.696  4.088   1.00 15.00 ? 73 GLN A N    3  
ATOM 3905  C CA   . GLN A 1 73 ? 7.113   -8.251  2.742   1.00 15.00 ? 73 GLN A CA   3  
ATOM 3906  C C    . GLN A 1 73 ? 6.641   -7.203  1.744   1.00 15.00 ? 73 GLN A C    3  
ATOM 3907  O O    . GLN A 1 73 ? 7.313   -6.934  0.749   1.00 15.00 ? 73 GLN A O    3  
ATOM 3908  C CB   . GLN A 1 73 ? 6.217   -9.486  2.671   1.00 15.00 ? 73 GLN A CB   3  
ATOM 3909  C CG   . GLN A 1 73 ? 6.736   -10.556 1.725   1.00 15.00 ? 73 GLN A CG   3  
ATOM 3910  C CD   . GLN A 1 73 ? 6.708   -11.942 2.339   1.00 15.00 ? 73 GLN A CD   3  
ATOM 3911  O OE1  . GLN A 1 73 ? 5.939   -12.208 3.263   1.00 15.00 ? 73 GLN A OE1  3  
ATOM 3912  N NE2  . GLN A 1 73 ? 7.549   -12.833 1.828   1.00 15.00 ? 73 GLN A NE2  3  
ATOM 3913  H H    . GLN A 1 73 ? 6.556   -8.114  4.778   1.00 15.00 ? 73 GLN A H    3  
ATOM 3914  H HA   . GLN A 1 73 ? 8.127   -8.534  2.500   1.00 15.00 ? 73 GLN A HA   3  
ATOM 3915  H HB2  . GLN A 1 73 ? 6.137   -9.916  3.658   1.00 15.00 ? 73 GLN A HB2  3  
ATOM 3916  H HB3  . GLN A 1 73 ? 5.236   -9.185  2.337   1.00 15.00 ? 73 GLN A HB3  3  
ATOM 3917  H HG2  . GLN A 1 73 ? 6.123   -10.560 0.836   1.00 15.00 ? 73 GLN A HG2  3  
ATOM 3918  H HG3  . GLN A 1 73 ? 7.755   -10.317 1.457   1.00 15.00 ? 73 GLN A HG3  3  
ATOM 3919  H HE21 . GLN A 1 73 ? 8.132   -12.550 1.093   1.00 15.00 ? 73 GLN A HE21 3  
ATOM 3920  H HE22 . GLN A 1 73 ? 7.552   -13.737 2.207   1.00 15.00 ? 73 GLN A HE22 3  
ATOM 3921  N N    . ALA A 1 74 ? 5.493   -6.594  2.028   1.00 15.00 ? 74 ALA A N    3  
ATOM 3922  C CA   . ALA A 1 74 ? 4.961   -5.558  1.159   1.00 15.00 ? 74 ALA A CA   3  
ATOM 3923  C C    . ALA A 1 74 ? 5.867   -4.341  1.199   1.00 15.00 ? 74 ALA A C    3  
ATOM 3924  O O    . ALA A 1 74 ? 6.217   -3.782  0.162   1.00 15.00 ? 74 ALA A O    3  
ATOM 3925  C CB   . ALA A 1 74 ? 3.551   -5.181  1.565   1.00 15.00 ? 74 ALA A CB   3  
ATOM 3926  H H    . ALA A 1 74 ? 5.008   -6.834  2.845   1.00 15.00 ? 74 ALA A H    3  
ATOM 3927  H HA   . ALA A 1 74 ? 4.934   -5.946  0.152   1.00 15.00 ? 74 ALA A HA   3  
ATOM 3928  H HB1  . ALA A 1 74 ? 3.039   -4.758  0.714   1.00 15.00 ? 74 ALA A HB1  3  
ATOM 3929  H HB2  . ALA A 1 74 ? 3.027   -6.061  1.903   1.00 15.00 ? 74 ALA A HB2  3  
ATOM 3930  H HB3  . ALA A 1 74 ? 3.590   -4.454  2.361   1.00 15.00 ? 74 ALA A HB3  3  
ATOM 3931  N N    . VAL A 1 75 ? 6.273   -3.957  2.410   1.00 15.00 ? 75 VAL A N    3  
ATOM 3932  C CA   . VAL A 1 75 ? 7.178   -2.828  2.597   1.00 15.00 ? 75 VAL A CA   3  
ATOM 3933  C C    . VAL A 1 75 ? 8.275   -2.897  1.550   1.00 15.00 ? 75 VAL A C    3  
ATOM 3934  O O    . VAL A 1 75 ? 8.629   -1.898  0.924   1.00 15.00 ? 75 VAL A O    3  
ATOM 3935  C CB   . VAL A 1 75 ? 7.787   -2.853  4.022   1.00 15.00 ? 75 VAL A CB   3  
ATOM 3936  C CG1  . VAL A 1 75 ? 9.304   -3.001  3.995   1.00 15.00 ? 75 VAL A CG1  3  
ATOM 3937  C CG2  . VAL A 1 75 ? 7.385   -1.618  4.804   1.00 15.00 ? 75 VAL A CG2  3  
ATOM 3938  H H    . VAL A 1 75 ? 5.976   -4.464  3.195   1.00 15.00 ? 75 VAL A H    3  
ATOM 3939  H HA   . VAL A 1 75 ? 6.624   -1.910  2.466   1.00 15.00 ? 75 VAL A HA   3  
ATOM 3940  H HB   . VAL A 1 75 ? 7.379   -3.709  4.535   1.00 15.00 ? 75 VAL A HB   3  
ATOM 3941  H HG11 . VAL A 1 75 ? 9.736   -2.189  3.429   1.00 15.00 ? 75 VAL A HG11 3  
ATOM 3942  H HG12 . VAL A 1 75 ? 9.685   -2.978  5.006   1.00 15.00 ? 75 VAL A HG12 3  
ATOM 3943  H HG13 . VAL A 1 75 ? 9.567   -3.941  3.534   1.00 15.00 ? 75 VAL A HG13 3  
ATOM 3944  H HG21 . VAL A 1 75 ? 8.234   -0.957  4.896   1.00 15.00 ? 75 VAL A HG21 3  
ATOM 3945  H HG22 . VAL A 1 75 ? 6.585   -1.109  4.288   1.00 15.00 ? 75 VAL A HG22 3  
ATOM 3946  H HG23 . VAL A 1 75 ? 7.052   -1.918  5.787   1.00 15.00 ? 75 VAL A HG23 3  
ATOM 3947  N N    . GLU A 1 76 ? 8.779   -4.104  1.349   1.00 15.00 ? 76 GLU A N    3  
ATOM 3948  C CA   . GLU A 1 76 ? 9.806   -4.344  0.358   1.00 15.00 ? 76 GLU A CA   3  
ATOM 3949  C C    . GLU A 1 76 ? 9.239   -4.135  -1.042  1.00 15.00 ? 76 GLU A C    3  
ATOM 3950  O O    . GLU A 1 76 ? 9.872   -3.509  -1.884  1.00 15.00 ? 76 GLU A O    3  
ATOM 3951  C CB   . GLU A 1 76 ? 10.365  -5.760  0.503   1.00 15.00 ? 76 GLU A CB   3  
ATOM 3952  C CG   . GLU A 1 76 ? 11.014  -6.021  1.854   1.00 15.00 ? 76 GLU A CG   3  
ATOM 3953  C CD   . GLU A 1 76 ? 11.153  -7.500  2.157   1.00 15.00 ? 76 GLU A CD   3  
ATOM 3954  O OE1  . GLU A 1 76 ? 12.139  -8.111  1.693   1.00 15.00 ? 76 GLU A OE1  3  
ATOM 3955  O OE2  . GLU A 1 76 ? 10.277  -8.047  2.860   1.00 15.00 ? 76 GLU A OE2  3  
ATOM 3956  H H    . GLU A 1 76 ? 8.430   -4.860  1.870   1.00 15.00 ? 76 GLU A H    3  
ATOM 3957  H HA   . GLU A 1 76 ? 10.600  -3.631  0.524   1.00 15.00 ? 76 GLU A HA   3  
ATOM 3958  H HB2  . GLU A 1 76 ? 9.560   -6.468  0.370   1.00 15.00 ? 76 GLU A HB2  3  
ATOM 3959  H HB3  . GLU A 1 76 ? 11.106  -5.922  -0.266  1.00 15.00 ? 76 GLU A HB3  3  
ATOM 3960  H HG2  . GLU A 1 76 ? 11.997  -5.575  1.858   1.00 15.00 ? 76 GLU A HG2  3  
ATOM 3961  H HG3  . GLU A 1 76 ? 10.409  -5.564  2.625   1.00 15.00 ? 76 GLU A HG3  3  
ATOM 3962  N N    . THR A 1 77 ? 8.034   -4.658  -1.287  1.00 15.00 ? 77 THR A N    3  
ATOM 3963  C CA   . THR A 1 77 ? 7.396   -4.511  -2.593  1.00 15.00 ? 77 THR A CA   3  
ATOM 3964  C C    . THR A 1 77 ? 7.090   -3.047  -2.902  1.00 15.00 ? 77 THR A C    3  
ATOM 3965  O O    . THR A 1 77 ? 7.496   -2.530  -3.943  1.00 15.00 ? 77 THR A O    3  
ATOM 3966  C CB   . THR A 1 77 ? 6.116   -5.339  -2.676  1.00 15.00 ? 77 THR A CB   3  
ATOM 3967  O OG1  . THR A 1 77 ? 5.155   -4.882  -1.742  1.00 15.00 ? 77 THR A OG1  3  
ATOM 3968  C CG2  . THR A 1 77 ? 6.339   -6.815  -2.429  1.00 15.00 ? 77 THR A CG2  3  
ATOM 3969  H H    . THR A 1 77 ? 7.559   -5.143  -0.572  1.00 15.00 ? 77 THR A H    3  
ATOM 3970  H HA   . THR A 1 77 ? 8.091   -4.876  -3.334  1.00 15.00 ? 77 THR A HA   3  
ATOM 3971  H HB   . THR A 1 77 ? 5.703   -5.231  -3.668  1.00 15.00 ? 77 THR A HB   3  
ATOM 3972  H HG1  . THR A 1 77 ? 4.377   -5.444  -1.780  1.00 15.00 ? 77 THR A HG1  3  
ATOM 3973  H HG21 . THR A 1 77 ? 6.268   -7.351  -3.365  1.00 15.00 ? 77 THR A HG21 3  
ATOM 3974  H HG22 . THR A 1 77 ? 7.319   -6.965  -2.001  1.00 15.00 ? 77 THR A HG22 3  
ATOM 3975  H HG23 . THR A 1 77 ? 5.588   -7.184  -1.746  1.00 15.00 ? 77 THR A HG23 3  
ATOM 3976  N N    . LEU A 1 78 ? 6.374   -2.379  -1.996  1.00 15.00 ? 78 LEU A N    3  
ATOM 3977  C CA   . LEU A 1 78 ? 6.026   -0.972  -2.193  1.00 15.00 ? 78 LEU A CA   3  
ATOM 3978  C C    . LEU A 1 78 ? 7.280   -0.163  -2.479  1.00 15.00 ? 78 LEU A C    3  
ATOM 3979  O O    . LEU A 1 78 ? 7.337   0.611   -3.434  1.00 15.00 ? 78 LEU A O    3  
ATOM 3980  C CB   . LEU A 1 78 ? 5.324   -0.396  -0.956  1.00 15.00 ? 78 LEU A CB   3  
ATOM 3981  C CG   . LEU A 1 78 ? 4.348   -1.336  -0.245  1.00 15.00 ? 78 LEU A CG   3  
ATOM 3982  C CD1  . LEU A 1 78 ? 3.603   -0.594  0.854   1.00 15.00 ? 78 LEU A CD1  3  
ATOM 3983  C CD2  . LEU A 1 78 ? 3.370   -1.943  -1.237  1.00 15.00 ? 78 LEU A CD2  3  
ATOM 3984  H H    . LEU A 1 78 ? 6.077   -2.839  -1.184  1.00 15.00 ? 78 LEU A H    3  
ATOM 3985  H HA   . LEU A 1 78 ? 5.362   -0.905  -3.041  1.00 15.00 ? 78 LEU A HA   3  
ATOM 3986  H HB2  . LEU A 1 78 ? 6.083   -0.101  -0.247  1.00 15.00 ? 78 LEU A HB2  3  
ATOM 3987  H HB3  . LEU A 1 78 ? 4.780   0.486   -1.259  1.00 15.00 ? 78 LEU A HB3  3  
ATOM 3988  H HG   . LEU A 1 78 ? 4.903   -2.137  0.216   1.00 15.00 ? 78 LEU A HG   3  
ATOM 3989  H HD11 . LEU A 1 78 ? 4.169   0.277   1.149   1.00 15.00 ? 78 LEU A HD11 3  
ATOM 3990  H HD12 . LEU A 1 78 ? 2.635   -0.286  0.487   1.00 15.00 ? 78 LEU A HD12 3  
ATOM 3991  H HD13 . LEU A 1 78 ? 3.474   -1.245  1.705   1.00 15.00 ? 78 LEU A HD13 3  
ATOM 3992  H HD21 . LEU A 1 78 ? 2.382   -1.964  -0.803  1.00 15.00 ? 78 LEU A HD21 3  
ATOM 3993  H HD22 . LEU A 1 78 ? 3.355   -1.348  -2.138  1.00 15.00 ? 78 LEU A HD22 3  
ATOM 3994  H HD23 . LEU A 1 78 ? 3.679   -2.950  -1.476  1.00 15.00 ? 78 LEU A HD23 3  
ATOM 3995  N N    . ARG A 1 79 ? 8.286   -0.363  -1.642  1.00 15.00 ? 79 ARG A N    3  
ATOM 3996  C CA   . ARG A 1 79 ? 9.556   0.326   -1.786  1.00 15.00 ? 79 ARG A CA   3  
ATOM 3997  C C    . ARG A 1 79 ? 10.293  -0.155  -3.036  1.00 15.00 ? 79 ARG A C    3  
ATOM 3998  O O    . ARG A 1 79 ? 10.590  0.632   -3.934  1.00 15.00 ? 79 ARG A O    3  
ATOM 3999  C CB   . ARG A 1 79 ? 10.408  0.094   -0.538  1.00 15.00 ? 79 ARG A CB   3  
ATOM 4000  C CG   . ARG A 1 79 ? 11.259  1.292   -0.148  1.00 15.00 ? 79 ARG A CG   3  
ATOM 4001  C CD   . ARG A 1 79 ? 11.767  1.174   1.280   1.00 15.00 ? 79 ARG A CD   3  
ATOM 4002  N NE   . ARG A 1 79 ? 13.141  0.682   1.333   1.00 15.00 ? 79 ARG A NE   3  
ATOM 4003  C CZ   . ARG A 1 79 ? 13.898  0.716   2.428   1.00 15.00 ? 79 ARG A CZ   3  
ATOM 4004  N NH1  . ARG A 1 79 ? 13.418  1.218   3.559   1.00 15.00 ? 79 ARG A NH1  3  
ATOM 4005  N NH2  . ARG A 1 79 ? 15.138  0.246   2.391   1.00 15.00 ? 79 ARG A NH2  3  
ATOM 4006  H H    . ARG A 1 79 ? 8.173   -1.000  -0.906  1.00 15.00 ? 79 ARG A H    3  
ATOM 4007  H HA   . ARG A 1 79 ? 9.354   1.382   -1.885  1.00 15.00 ? 79 ARG A HA   3  
ATOM 4008  H HB2  . ARG A 1 79 ? 9.750   -0.141  0.292   1.00 15.00 ? 79 ARG A HB2  3  
ATOM 4009  H HB3  . ARG A 1 79 ? 11.063  -0.746  -0.714  1.00 15.00 ? 79 ARG A HB3  3  
ATOM 4010  H HG2  . ARG A 1 79 ? 12.105  1.353   -0.816  1.00 15.00 ? 79 ARG A HG2  3  
ATOM 4011  H HG3  . ARG A 1 79 ? 10.663  2.188   -0.237  1.00 15.00 ? 79 ARG A HG3  3  
ATOM 4012  H HD2  . ARG A 1 79 ? 11.726  2.148   1.744   1.00 15.00 ? 79 ARG A HD2  3  
ATOM 4013  H HD3  . ARG A 1 79 ? 11.128  0.492   1.820   1.00 15.00 ? 79 ARG A HD3  3  
ATOM 4014  H HE   . ARG A 1 79 ? 13.520  0.306   0.511   1.00 15.00 ? 79 ARG A HE   3  
ATOM 4015  H HH11 . ARG A 1 79 ? 12.484  1.573   3.593   1.00 15.00 ? 79 ARG A HH11 3  
ATOM 4016  H HH12 . ARG A 1 79 ? 13.991  1.240   4.378   1.00 15.00 ? 79 ARG A HH12 3  
ATOM 4017  H HH21 . ARG A 1 79 ? 15.504  -0.133  1.541   1.00 15.00 ? 79 ARG A HH21 3  
ATOM 4018  H HH22 . ARG A 1 79 ? 15.706  0.272   3.213   1.00 15.00 ? 79 ARG A HH22 3  
ATOM 4019  N N    . ASN A 1 80 ? 10.586  -1.452  -3.078  1.00 15.00 ? 80 ASN A N    3  
ATOM 4020  C CA   . ASN A 1 80 ? 11.291  -2.056  -4.208  1.00 15.00 ? 80 ASN A CA   3  
ATOM 4021  C C    . ASN A 1 80 ? 10.460  -2.016  -5.491  1.00 15.00 ? 80 ASN A C    3  
ATOM 4022  O O    . ASN A 1 80 ? 10.129  -3.060  -6.054  1.00 15.00 ? 80 ASN A O    3  
ATOM 4023  C CB   . ASN A 1 80 ? 11.662  -3.506  -3.887  1.00 15.00 ? 80 ASN A CB   3  
ATOM 4024  C CG   . ASN A 1 80 ? 12.487  -3.625  -2.619  1.00 15.00 ? 80 ASN A CG   3  
ATOM 4025  O OD1  . ASN A 1 80 ? 13.030  -2.638  -2.123  1.00 15.00 ? 80 ASN A OD1  3  
ATOM 4026  N ND2  . ASN A 1 80 ? 12.584  -4.839  -2.089  1.00 15.00 ? 80 ASN A ND2  3  
ATOM 4027  H H    . ASN A 1 80 ? 10.322  -2.021  -2.325  1.00 15.00 ? 80 ASN A H    3  
ATOM 4028  H HA   . ASN A 1 80 ? 12.198  -1.494  -4.367  1.00 15.00 ? 80 ASN A HA   3  
ATOM 4029  H HB2  . ASN A 1 80 ? 10.757  -4.085  -3.764  1.00 15.00 ? 80 ASN A HB2  3  
ATOM 4030  H HB3  . ASN A 1 80 ? 12.235  -3.913  -4.707  1.00 15.00 ? 80 ASN A HB3  3  
ATOM 4031  H HD21 . ASN A 1 80 ? 12.126  -5.579  -2.539  1.00 15.00 ? 80 ASN A HD21 3  
ATOM 4032  H HD22 . ASN A 1 80 ? 13.112  -4.944  -1.270  1.00 15.00 ? 80 ASN A HD22 3  
ATOM 4033  N N    . THR A 1 81 ? 10.139  -0.818  -5.965  1.00 15.00 ? 81 THR A N    3  
ATOM 4034  C CA   . THR A 1 81 ? 9.366   -0.679  -7.195  1.00 15.00 ? 81 THR A CA   3  
ATOM 4035  C C    . THR A 1 81 ? 10.304  -0.510  -8.387  1.00 15.00 ? 81 THR A C    3  
ATOM 4036  O O    . THR A 1 81 ? 10.419  -1.399  -9.230  1.00 15.00 ? 81 THR A O    3  
ATOM 4037  C CB   . THR A 1 81 ? 8.403   0.508   -7.101  1.00 15.00 ? 81 THR A CB   3  
ATOM 4038  O OG1  . THR A 1 81 ? 8.672   1.285   -5.947  1.00 15.00 ? 81 THR A OG1  3  
ATOM 4039  C CG2  . THR A 1 81 ? 6.948   0.093   -7.047  1.00 15.00 ? 81 THR A CG2  3  
ATOM 4040  H H    . THR A 1 81 ? 10.437  -0.015  -5.489  1.00 15.00 ? 81 THR A H    3  
ATOM 4041  H HA   . THR A 1 81 ? 8.795   -1.586  -7.330  1.00 15.00 ? 81 THR A HA   3  
ATOM 4042  H HB   . THR A 1 81 ? 8.534   1.135   -7.971  1.00 15.00 ? 81 THR A HB   3  
ATOM 4043  H HG1  . THR A 1 81 ? 8.500   0.761   -5.161  1.00 15.00 ? 81 THR A HG1  3  
ATOM 4044  H HG21 . THR A 1 81 ? 6.382   0.677   -7.757  1.00 15.00 ? 81 THR A HG21 3  
ATOM 4045  H HG22 . THR A 1 81 ? 6.862   -0.956  -7.294  1.00 15.00 ? 81 THR A HG22 3  
ATOM 4046  H HG23 . THR A 1 81 ? 6.562   0.261   -6.053  1.00 15.00 ? 81 THR A HG23 3  
ATOM 4047  N N    . GLY A 1 82 ? 10.984  0.631   -8.441  1.00 15.00 ? 82 GLY A N    3  
ATOM 4048  C CA   . GLY A 1 82 ? 11.914  0.892   -9.516  1.00 15.00 ? 82 GLY A CA   3  
ATOM 4049  C C    . GLY A 1 82 ? 11.579  2.148   -10.292 1.00 15.00 ? 82 GLY A C    3  
ATOM 4050  O O    . GLY A 1 82 ? 11.731  3.262   -9.793  1.00 15.00 ? 82 GLY A O    3  
ATOM 4051  H H    . GLY A 1 82 ? 10.860  1.297   -7.744  1.00 15.00 ? 82 GLY A H    3  
ATOM 4052  H HA2  . GLY A 1 82 ? 12.905  0.994   -9.101  1.00 15.00 ? 82 GLY A HA2  3  
ATOM 4053  H HA3  . GLY A 1 82 ? 11.906  0.051   -10.195 1.00 15.00 ? 82 GLY A HA3  3  
ATOM 4054  N N    . GLN A 1 83 ? 11.135  1.956   -11.522 1.00 15.00 ? 83 GLN A N    3  
ATOM 4055  C CA   . GLN A 1 83 ? 10.783  3.068   -12.403 1.00 15.00 ? 83 GLN A CA   3  
ATOM 4056  C C    . GLN A 1 83 ? 9.579   3.847   -11.876 1.00 15.00 ? 83 GLN A C    3  
ATOM 4057  O O    . GLN A 1 83 ? 9.727   4.938   -11.325 1.00 15.00 ? 83 GLN A O    3  
ATOM 4058  C CB   . GLN A 1 83 ? 10.502  2.575   -13.831 1.00 15.00 ? 83 GLN A CB   3  
ATOM 4059  C CG   . GLN A 1 83 ? 11.206  1.275   -14.192 1.00 15.00 ? 83 GLN A CG   3  
ATOM 4060  C CD   . GLN A 1 83 ? 10.313  0.064   -14.006 1.00 15.00 ? 83 GLN A CD   3  
ATOM 4061  O OE1  . GLN A 1 83 ? 9.156   0.188   -13.604 1.00 15.00 ? 83 GLN A OE1  3  
ATOM 4062  N NE2  . GLN A 1 83 ? 10.849  -1.116  -14.297 1.00 15.00 ? 83 GLN A NE2  3  
ATOM 4063  H H    . GLN A 1 83 ? 11.046  1.039   -11.846 1.00 15.00 ? 83 GLN A H    3  
ATOM 4064  H HA   . GLN A 1 83 ? 11.631  3.735   -12.432 1.00 15.00 ? 83 GLN A HA   3  
ATOM 4065  H HB2  . GLN A 1 83 ? 9.441   2.425   -13.948 1.00 15.00 ? 83 GLN A HB2  3  
ATOM 4066  H HB3  . GLN A 1 83 ? 10.825  3.335   -14.528 1.00 15.00 ? 83 GLN A HB3  3  
ATOM 4067  H HG2  . GLN A 1 83 ? 11.513  1.321   -15.226 1.00 15.00 ? 83 GLN A HG2  3  
ATOM 4068  H HG3  . GLN A 1 83 ? 12.076  1.164   -13.562 1.00 15.00 ? 83 GLN A HG3  3  
ATOM 4069  H HE21 . GLN A 1 83 ? 11.777  -1.139  -14.611 1.00 15.00 ? 83 GLN A HE21 3  
ATOM 4070  H HE22 . GLN A 1 83 ? 10.294  -1.916  -14.185 1.00 15.00 ? 83 GLN A HE22 3  
ATOM 4071  N N    . VAL A 1 84 ? 8.389   3.285   -12.064 1.00 15.00 ? 84 VAL A N    3  
ATOM 4072  C CA   . VAL A 1 84 ? 7.156   3.925   -11.623 1.00 15.00 ? 84 VAL A CA   3  
ATOM 4073  C C    . VAL A 1 84 ? 6.532   3.176   -10.449 1.00 15.00 ? 84 VAL A C    3  
ATOM 4074  O O    . VAL A 1 84 ? 6.787   1.988   -10.245 1.00 15.00 ? 84 VAL A O    3  
ATOM 4075  C CB   . VAL A 1 84 ? 6.137   4.020   -12.782 1.00 15.00 ? 84 VAL A CB   3  
ATOM 4076  C CG1  . VAL A 1 84 ? 4.771   4.475   -12.285 1.00 15.00 ? 84 VAL A CG1  3  
ATOM 4077  C CG2  . VAL A 1 84 ? 6.652   4.965   -13.857 1.00 15.00 ? 84 VAL A CG2  3  
ATOM 4078  H H    . VAL A 1 84 ? 8.337   2.418   -12.513 1.00 15.00 ? 84 VAL A H    3  
ATOM 4079  H HA   . VAL A 1 84 ? 7.399   4.931   -11.306 1.00 15.00 ? 84 VAL A HA   3  
ATOM 4080  H HB   . VAL A 1 84 ? 6.028   3.039   -13.220 1.00 15.00 ? 84 VAL A HB   3  
ATOM 4081  H HG11 . VAL A 1 84 ? 4.865   5.440   -11.811 1.00 15.00 ? 84 VAL A HG11 3  
ATOM 4082  H HG12 . VAL A 1 84 ? 4.091   4.549   -13.120 1.00 15.00 ? 84 VAL A HG12 3  
ATOM 4083  H HG13 . VAL A 1 84 ? 4.390   3.759   -11.573 1.00 15.00 ? 84 VAL A HG13 3  
ATOM 4084  H HG21 . VAL A 1 84 ? 6.728   5.963   -13.450 1.00 15.00 ? 84 VAL A HG21 3  
ATOM 4085  H HG22 . VAL A 1 84 ? 7.625   4.636   -14.189 1.00 15.00 ? 84 VAL A HG22 3  
ATOM 4086  H HG23 . VAL A 1 84 ? 5.967   4.967   -14.692 1.00 15.00 ? 84 VAL A HG23 3  
ATOM 4087  N N    . VAL A 1 85 ? 5.706   3.876   -9.686  1.00 15.00 ? 85 VAL A N    3  
ATOM 4088  C CA   . VAL A 1 85 ? 5.040   3.283   -8.538  1.00 15.00 ? 85 VAL A CA   3  
ATOM 4089  C C    . VAL A 1 85 ? 3.619   2.858   -8.905  1.00 15.00 ? 85 VAL A C    3  
ATOM 4090  O O    . VAL A 1 85 ? 2.651   3.566   -8.628  1.00 15.00 ? 85 VAL A O    3  
ATOM 4091  C CB   . VAL A 1 85 ? 5.019   4.273   -7.349  1.00 15.00 ? 85 VAL A CB   3  
ATOM 4092  C CG1  . VAL A 1 85 ? 3.944   3.915   -6.334  1.00 15.00 ? 85 VAL A CG1  3  
ATOM 4093  C CG2  . VAL A 1 85 ? 6.387   4.329   -6.684  1.00 15.00 ? 85 VAL A CG2  3  
ATOM 4094  H H    . VAL A 1 85 ? 5.535   4.817   -9.902  1.00 15.00 ? 85 VAL A H    3  
ATOM 4095  H HA   . VAL A 1 85 ? 5.602   2.409   -8.243  1.00 15.00 ? 85 VAL A HA   3  
ATOM 4096  H HB   . VAL A 1 85 ? 4.798   5.255   -7.735  1.00 15.00 ? 85 VAL A HB   3  
ATOM 4097  H HG11 . VAL A 1 85 ? 3.673   2.875   -6.447  1.00 15.00 ? 85 VAL A HG11 3  
ATOM 4098  H HG12 . VAL A 1 85 ? 4.321   4.084   -5.336  1.00 15.00 ? 85 VAL A HG12 3  
ATOM 4099  H HG13 . VAL A 1 85 ? 3.074   4.537   -6.501  1.00 15.00 ? 85 VAL A HG13 3  
ATOM 4100  H HG21 . VAL A 1 85 ? 6.274   4.218   -5.615  1.00 15.00 ? 85 VAL A HG21 3  
ATOM 4101  H HG22 . VAL A 1 85 ? 7.007   3.531   -7.066  1.00 15.00 ? 85 VAL A HG22 3  
ATOM 4102  H HG23 . VAL A 1 85 ? 6.852   5.280   -6.899  1.00 15.00 ? 85 VAL A HG23 3  
ATOM 4103  N N    . HIS A 1 86 ? 3.508   1.691   -9.534  1.00 15.00 ? 86 HIS A N    3  
ATOM 4104  C CA   . HIS A 1 86 ? 2.212   1.159   -9.943  1.00 15.00 ? 86 HIS A CA   3  
ATOM 4105  C C    . HIS A 1 86 ? 1.733   0.101   -8.955  1.00 15.00 ? 86 HIS A C    3  
ATOM 4106  O O    . HIS A 1 86 ? 1.970   -1.092  -9.142  1.00 15.00 ? 86 HIS A O    3  
ATOM 4107  C CB   . HIS A 1 86 ? 2.300   0.560   -11.347 1.00 15.00 ? 86 HIS A CB   3  
ATOM 4108  C CG   . HIS A 1 86 ? 0.968   0.382   -12.008 1.00 15.00 ? 86 HIS A CG   3  
ATOM 4109  N ND1  . HIS A 1 86 ? -0.159  1.084   -11.634 1.00 15.00 ? 86 HIS A ND1  3  
ATOM 4110  C CD2  . HIS A 1 86 ? 0.585   -0.425  -13.026 1.00 15.00 ? 86 HIS A CD2  3  
ATOM 4111  C CE1  . HIS A 1 86 ? -1.176  0.716   -12.393 1.00 15.00 ? 86 HIS A CE1  3  
ATOM 4112  N NE2  . HIS A 1 86 ? -0.751  -0.198  -13.245 1.00 15.00 ? 86 HIS A NE2  3  
ATOM 4113  H H    . HIS A 1 86 ? 4.321   1.174   -9.727  1.00 15.00 ? 86 HIS A H    3  
ATOM 4114  H HA   . HIS A 1 86 ? 1.505   1.975   -9.950  1.00 15.00 ? 86 HIS A HA   3  
ATOM 4115  H HB2  . HIS A 1 86 ? 2.895   1.209   -11.971 1.00 15.00 ? 86 HIS A HB2  3  
ATOM 4116  H HB3  . HIS A 1 86 ? 2.775   -0.408  -11.288 1.00 15.00 ? 86 HIS A HB3  3  
ATOM 4117  H HD1  . HIS A 1 86 ? -0.206  1.752   -10.919 1.00 15.00 ? 86 HIS A HD1  3  
ATOM 4118  H HD2  . HIS A 1 86 ? 1.215   -1.119  -13.565 1.00 15.00 ? 86 HIS A HD2  3  
ATOM 4119  H HE1  . HIS A 1 86 ? -2.184  1.099   -12.327 1.00 15.00 ? 86 HIS A HE1  3  
ATOM 4120  H HE2  . HIS A 1 86 ? -1.320  -0.703  -13.862 1.00 15.00 ? 86 HIS A HE2  3  
ATOM 4121  N N    . LEU A 1 87 ? 1.070   0.550   -7.895  1.00 15.00 ? 87 LEU A N    3  
ATOM 4122  C CA   . LEU A 1 87 ? 0.570   -0.350  -6.865  1.00 15.00 ? 87 LEU A CA   3  
ATOM 4123  C C    . LEU A 1 87 ? -0.935  -0.563  -6.981  1.00 15.00 ? 87 LEU A C    3  
ATOM 4124  O O    . LEU A 1 87 ? -1.707  0.391   -6.977  1.00 15.00 ? 87 LEU A O    3  
ATOM 4125  C CB   . LEU A 1 87 ? 0.900   0.210   -5.481  1.00 15.00 ? 87 LEU A CB   3  
ATOM 4126  C CG   . LEU A 1 87 ? 1.864   -0.637  -4.657  1.00 15.00 ? 87 LEU A CG   3  
ATOM 4127  C CD1  . LEU A 1 87 ? 2.968   0.226   -4.062  1.00 15.00 ? 87 LEU A CD1  3  
ATOM 4128  C CD2  . LEU A 1 87 ? 1.109   -1.376  -3.562  1.00 15.00 ? 87 LEU A CD2  3  
ATOM 4129  H H    . LEU A 1 87 ? 0.924   1.513   -7.798  1.00 15.00 ? 87 LEU A H    3  
ATOM 4130  H HA   . LEU A 1 87 ? 1.067   -1.301  -6.985  1.00 15.00 ? 87 LEU A HA   3  
ATOM 4131  H HB2  . LEU A 1 87 ? 1.329   1.191   -5.605  1.00 15.00 ? 87 LEU A HB2  3  
ATOM 4132  H HB3  . LEU A 1 87 ? -0.021  0.307   -4.925  1.00 15.00 ? 87 LEU A HB3  3  
ATOM 4133  H HG   . LEU A 1 87 ? 2.323   -1.367  -5.303  1.00 15.00 ? 87 LEU A HG   3  
ATOM 4134  H HD11 . LEU A 1 87 ? 2.975   1.190   -4.548  1.00 15.00 ? 87 LEU A HD11 3  
ATOM 4135  H HD12 . LEU A 1 87 ? 2.792   0.357   -3.004  1.00 15.00 ? 87 LEU A HD12 3  
ATOM 4136  H HD13 . LEU A 1 87 ? 3.921   -0.258  -4.210  1.00 15.00 ? 87 LEU A HD13 3  
ATOM 4137  H HD21 . LEU A 1 87 ? 0.788   -0.671  -2.811  1.00 15.00 ? 87 LEU A HD21 3  
ATOM 4138  H HD22 . LEU A 1 87 ? 0.243   -1.866  -3.987  1.00 15.00 ? 87 LEU A HD22 3  
ATOM 4139  H HD23 . LEU A 1 87 ? 1.756   -2.113  -3.112  1.00 15.00 ? 87 LEU A HD23 3  
ATOM 4140  N N    . LEU A 1 88 ? -1.347  -1.823  -7.054  1.00 15.00 ? 88 LEU A N    3  
ATOM 4141  C CA   . LEU A 1 88 ? -2.763  -2.160  -7.136  1.00 15.00 ? 88 LEU A CA   3  
ATOM 4142  C C    . LEU A 1 88 ? -3.251  -2.617  -5.770  1.00 15.00 ? 88 LEU A C    3  
ATOM 4143  O O    . LEU A 1 88 ? -2.989  -3.745  -5.351  1.00 15.00 ? 88 LEU A O    3  
ATOM 4144  C CB   . LEU A 1 88 ? -2.995  -3.251  -8.183  1.00 15.00 ? 88 LEU A CB   3  
ATOM 4145  C CG   . LEU A 1 88 ? -3.181  -2.747  -9.616  1.00 15.00 ? 88 LEU A CG   3  
ATOM 4146  C CD1  . LEU A 1 88 ? -2.182  -1.643  -9.932  1.00 15.00 ? 88 LEU A CD1  3  
ATOM 4147  C CD2  . LEU A 1 88 ? -3.040  -3.893  -10.606 1.00 15.00 ? 88 LEU A CD2  3  
ATOM 4148  H H    . LEU A 1 88 ? -0.685  -2.544  -7.032  1.00 15.00 ? 88 LEU A H    3  
ATOM 4149  H HA   . LEU A 1 88 ? -3.305  -1.267  -7.424  1.00 15.00 ? 88 LEU A HA   3  
ATOM 4150  H HB2  . LEU A 1 88 ? -2.147  -3.919  -8.166  1.00 15.00 ? 88 LEU A HB2  3  
ATOM 4151  H HB3  . LEU A 1 88 ? -3.877  -3.808  -7.903  1.00 15.00 ? 88 LEU A HB3  3  
ATOM 4152  H HG   . LEU A 1 88 ? -4.175  -2.335  -9.720  1.00 15.00 ? 88 LEU A HG   3  
ATOM 4153  H HD11 . LEU A 1 88 ? -2.118  -0.965  -9.092  1.00 15.00 ? 88 LEU A HD11 3  
ATOM 4154  H HD12 . LEU A 1 88 ? -1.211  -2.078  -10.118 1.00 15.00 ? 88 LEU A HD12 3  
ATOM 4155  H HD13 . LEU A 1 88 ? -2.508  -1.101  -10.807 1.00 15.00 ? 88 LEU A HD13 3  
ATOM 4156  H HD21 . LEU A 1 88 ? -2.043  -4.302  -10.544 1.00 15.00 ? 88 LEU A HD21 3  
ATOM 4157  H HD22 . LEU A 1 88 ? -3.760  -4.663  -10.370 1.00 15.00 ? 88 LEU A HD22 3  
ATOM 4158  H HD23 . LEU A 1 88 ? -3.219  -3.529  -11.607 1.00 15.00 ? 88 LEU A HD23 3  
ATOM 4159  N N    . LEU A 1 89 ? -3.935  -1.726  -5.066  1.00 15.00 ? 89 LEU A N    3  
ATOM 4160  C CA   . LEU A 1 89 ? -4.428  -2.029  -3.730  1.00 15.00 ? 89 LEU A CA   3  
ATOM 4161  C C    . LEU A 1 89 ? -5.930  -2.267  -3.715  1.00 15.00 ? 89 LEU A C    3  
ATOM 4162  O O    . LEU A 1 89 ? -6.563  -2.447  -4.755  1.00 15.00 ? 89 LEU A O    3  
ATOM 4163  C CB   . LEU A 1 89 ? -4.097  -0.891  -2.760  1.00 15.00 ? 89 LEU A CB   3  
ATOM 4164  C CG   . LEU A 1 89 ? -3.078  0.124   -3.260  1.00 15.00 ? 89 LEU A CG   3  
ATOM 4165  C CD1  . LEU A 1 89 ? -3.111  1.364   -2.390  1.00 15.00 ? 89 LEU A CD1  3  
ATOM 4166  C CD2  . LEU A 1 89 ? -1.692  -0.487  -3.267  1.00 15.00 ? 89 LEU A CD2  3  
ATOM 4167  H H    . LEU A 1 89 ? -4.097  -0.838  -5.447  1.00 15.00 ? 89 LEU A H    3  
ATOM 4168  H HA   . LEU A 1 89 ? -3.926  -2.920  -3.394  1.00 15.00 ? 89 LEU A HA   3  
ATOM 4169  H HB2  . LEU A 1 89 ? -5.011  -0.364  -2.533  1.00 15.00 ? 89 LEU A HB2  3  
ATOM 4170  H HB3  . LEU A 1 89 ? -3.718  -1.325  -1.847  1.00 15.00 ? 89 LEU A HB3  3  
ATOM 4171  H HG   . LEU A 1 89 ? -3.326  0.412   -4.269  1.00 15.00 ? 89 LEU A HG   3  
ATOM 4172  H HD11 . LEU A 1 89 ? -4.049  1.402   -1.857  1.00 15.00 ? 89 LEU A HD11 3  
ATOM 4173  H HD12 . LEU A 1 89 ? -2.297  1.324   -1.683  1.00 15.00 ? 89 LEU A HD12 3  
ATOM 4174  H HD13 . LEU A 1 89 ? -3.014  2.240   -3.010  1.00 15.00 ? 89 LEU A HD13 3  
ATOM 4175  H HD21 . LEU A 1 89 ? -0.965  0.267   -3.009  1.00 15.00 ? 89 LEU A HD21 3  
ATOM 4176  H HD22 . LEU A 1 89 ? -1.654  -1.288  -2.545  1.00 15.00 ? 89 LEU A HD22 3  
ATOM 4177  H HD23 . LEU A 1 89 ? -1.477  -0.877  -4.250  1.00 15.00 ? 89 LEU A HD23 3  
ATOM 4178  N N    . GLU A 1 90 ? -6.487  -2.242  -2.511  1.00 15.00 ? 90 GLU A N    3  
ATOM 4179  C CA   . GLU A 1 90 ? -7.915  -2.428  -2.308  1.00 15.00 ? 90 GLU A CA   3  
ATOM 4180  C C    . GLU A 1 90 ? -8.408  -1.470  -1.227  1.00 15.00 ? 90 GLU A C    3  
ATOM 4181  O O    . GLU A 1 90 ? -7.760  -1.301  -0.194  1.00 15.00 ? 90 GLU A O    3  
ATOM 4182  C CB   . GLU A 1 90 ? -8.218  -3.887  -1.935  1.00 15.00 ? 90 GLU A CB   3  
ATOM 4183  C CG   . GLU A 1 90 ? -9.233  -4.054  -0.810  1.00 15.00 ? 90 GLU A CG   3  
ATOM 4184  C CD   . GLU A 1 90 ? -9.785  -5.464  -0.729  1.00 15.00 ? 90 GLU A CD   3  
ATOM 4185  O OE1  . GLU A 1 90 ? -9.139  -6.386  -1.270  1.00 15.00 ? 90 GLU A OE1  3  
ATOM 4186  O OE2  . GLU A 1 90 ? -10.863 -5.645  -0.126  1.00 15.00 ? 90 GLU A OE2  3  
ATOM 4187  H H    . GLU A 1 90 ? -5.914  -2.078  -1.731  1.00 15.00 ? 90 GLU A H    3  
ATOM 4188  H HA   . GLU A 1 90 ? -8.413  -2.189  -3.235  1.00 15.00 ? 90 GLU A HA   3  
ATOM 4189  H HB2  . GLU A 1 90 ? -8.603  -4.389  -2.808  1.00 15.00 ? 90 GLU A HB2  3  
ATOM 4190  H HB3  . GLU A 1 90 ? -7.298  -4.365  -1.633  1.00 15.00 ? 90 GLU A HB3  3  
ATOM 4191  H HG2  . GLU A 1 90 ? -8.753  -3.818  0.128   1.00 15.00 ? 90 GLU A HG2  3  
ATOM 4192  H HG3  . GLU A 1 90 ? -10.052 -3.370  -0.977  1.00 15.00 ? 90 GLU A HG3  3  
ATOM 4193  N N    . LYS A 1 91 ? -9.551  -0.840  -1.473  1.00 15.00 ? 91 LYS A N    3  
ATOM 4194  C CA   . LYS A 1 91 ? -10.120 0.108   -0.521  1.00 15.00 ? 91 LYS A CA   3  
ATOM 4195  C C    . LYS A 1 91 ? -10.111 -0.457  0.896   1.00 15.00 ? 91 LYS A C    3  
ATOM 4196  O O    . LYS A 1 91 ? -10.932 -1.306  1.244   1.00 15.00 ? 91 LYS A O    3  
ATOM 4197  C CB   . LYS A 1 91 ? -11.544 0.477   -0.930  1.00 15.00 ? 91 LYS A CB   3  
ATOM 4198  C CG   . LYS A 1 91 ? -12.095 1.678   -0.179  1.00 15.00 ? 91 LYS A CG   3  
ATOM 4199  C CD   . LYS A 1 91 ? -11.477 2.976   -0.673  1.00 15.00 ? 91 LYS A CD   3  
ATOM 4200  C CE   . LYS A 1 91 ? -11.750 3.197   -2.152  1.00 15.00 ? 91 LYS A CE   3  
ATOM 4201  N NZ   . LYS A 1 91 ? -11.646 4.634   -2.528  1.00 15.00 ? 91 LYS A NZ   3  
ATOM 4202  H H    . LYS A 1 91 ? -10.020 -1.011  -2.316  1.00 15.00 ? 91 LYS A H    3  
ATOM 4203  H HA   . LYS A 1 91 ? -9.510  0.999   -0.541  1.00 15.00 ? 91 LYS A HA   3  
ATOM 4204  H HB2  . LYS A 1 91 ? -11.554 0.701   -1.988  1.00 15.00 ? 91 LYS A HB2  3  
ATOM 4205  H HB3  . LYS A 1 91 ? -12.191 -0.367  -0.743  1.00 15.00 ? 91 LYS A HB3  3  
ATOM 4206  H HG2  . LYS A 1 91 ? -13.162 1.721   -0.323  1.00 15.00 ? 91 LYS A HG2  3  
ATOM 4207  H HG3  . LYS A 1 91 ? -11.876 1.563   0.872   1.00 15.00 ? 91 LYS A HG3  3  
ATOM 4208  H HD2  . LYS A 1 91 ? -11.897 3.799   -0.114  1.00 15.00 ? 91 LYS A HD2  3  
ATOM 4209  H HD3  . LYS A 1 91 ? -10.409 2.939   -0.515  1.00 15.00 ? 91 LYS A HD3  3  
ATOM 4210  H HE2  . LYS A 1 91 ? -11.031 2.631   -2.726  1.00 15.00 ? 91 LYS A HE2  3  
ATOM 4211  H HE3  . LYS A 1 91 ? -12.746 2.845   -2.378  1.00 15.00 ? 91 LYS A HE3  3  
ATOM 4212  H HZ1  . LYS A 1 91 ? -12.139 4.805   -3.428  1.00 15.00 ? 91 LYS A HZ1  3  
ATOM 4213  H HZ2  . LYS A 1 91 ? -12.078 5.228   -1.791  1.00 15.00 ? 91 LYS A HZ2  3  
ATOM 4214  H HZ3  . LYS A 1 91 ? -10.647 4.904   -2.634  1.00 15.00 ? 91 LYS A HZ3  3  
ATOM 4215  N N    . GLY A 1 92 ? -9.173  0.020   1.708   1.00 15.00 ? 92 GLY A N    3  
ATOM 4216  C CA   . GLY A 1 92 ? -9.067  -0.446  3.077   1.00 15.00 ? 92 GLY A CA   3  
ATOM 4217  C C    . GLY A 1 92 ? -10.286 -0.095  3.907   1.00 15.00 ? 92 GLY A C    3  
ATOM 4218  O O    . GLY A 1 92 ? -10.961 0.900   3.642   1.00 15.00 ? 92 GLY A O    3  
ATOM 4219  H H    . GLY A 1 92 ? -8.546  0.695   1.372   1.00 15.00 ? 92 GLY A H    3  
ATOM 4220  H HA2  . GLY A 1 92 ? -8.946  -1.519  3.072   1.00 15.00 ? 92 GLY A HA2  3  
ATOM 4221  H HA3  . GLY A 1 92 ? -8.195  0.002   3.532   1.00 15.00 ? 92 GLY A HA3  3  
ATOM 4222  N N    . GLN A 1 93 ? -10.568 -0.914  4.915   1.00 15.00 ? 93 GLN A N    3  
ATOM 4223  C CA   . GLN A 1 93 ? -11.714 -0.687  5.788   1.00 15.00 ? 93 GLN A CA   3  
ATOM 4224  C C    . GLN A 1 93 ? -11.349 0.259   6.928   1.00 15.00 ? 93 GLN A C    3  
ATOM 4225  O O    . GLN A 1 93 ? -10.756 -0.155  7.924   1.00 15.00 ? 93 GLN A O    3  
ATOM 4226  C CB   . GLN A 1 93 ? -12.223 -2.014  6.353   1.00 15.00 ? 93 GLN A CB   3  
ATOM 4227  C CG   . GLN A 1 93 ? -12.912 -2.891  5.321   1.00 15.00 ? 93 GLN A CG   3  
ATOM 4228  C CD   . GLN A 1 93 ? -11.936 -3.751  4.543   1.00 15.00 ? 93 GLN A CD   3  
ATOM 4229  O OE1  . GLN A 1 93 ? -11.900 -3.712  3.313   1.00 15.00 ? 93 GLN A OE1  3  
ATOM 4230  N NE2  . GLN A 1 93 ? -11.138 -4.536  5.258   1.00 15.00 ? 93 GLN A NE2  3  
ATOM 4231  H H    . GLN A 1 93 ? -9.992  -1.690  5.076   1.00 15.00 ? 93 GLN A H    3  
ATOM 4232  H HA   . GLN A 1 93 ? -12.496 -0.234  5.197   1.00 15.00 ? 93 GLN A HA   3  
ATOM 4233  H HB2  . GLN A 1 93 ? -11.386 -2.563  6.760   1.00 15.00 ? 93 GLN A HB2  3  
ATOM 4234  H HB3  . GLN A 1 93 ? -12.926 -1.808  7.147   1.00 15.00 ? 93 GLN A HB3  3  
ATOM 4235  H HG2  . GLN A 1 93 ? -13.613 -3.538  5.828   1.00 15.00 ? 93 GLN A HG2  3  
ATOM 4236  H HG3  . GLN A 1 93 ? -13.445 -2.257  4.627   1.00 15.00 ? 93 GLN A HG3  3  
ATOM 4237  H HE21 . GLN A 1 93 ? -11.223 -4.516  6.234   1.00 15.00 ? 93 GLN A HE21 3  
ATOM 4238  H HE22 . GLN A 1 93 ? -10.497 -5.103  4.780   1.00 15.00 ? 93 GLN A HE22 3  
ATOM 4239  N N    . SER A 1 94 ? -11.707 1.529   6.774   1.00 15.00 ? 94 SER A N    3  
ATOM 4240  C CA   . SER A 1 94 ? -11.416 2.534   7.791   1.00 15.00 ? 94 SER A CA   3  
ATOM 4241  C C    . SER A 1 94 ? -12.550 2.622   8.809   1.00 15.00 ? 94 SER A C    3  
ATOM 4242  O O    . SER A 1 94 ? -13.660 2.155   8.557   1.00 15.00 ? 94 SER A O    3  
ATOM 4243  C CB   . SER A 1 94 ? -11.193 3.899   7.139   1.00 15.00 ? 94 SER A CB   3  
ATOM 4244  O OG   . SER A 1 94 ? -11.926 4.014   5.931   1.00 15.00 ? 94 SER A OG   3  
ATOM 4245  H H    . SER A 1 94 ? -12.177 1.798   5.957   1.00 15.00 ? 94 SER A H    3  
ATOM 4246  H HA   . SER A 1 94 ? -10.513 2.237   8.301   1.00 15.00 ? 94 SER A HA   3  
ATOM 4247  H HB2  . SER A 1 94 ? -11.516 4.676   7.815   1.00 15.00 ? 94 SER A HB2  3  
ATOM 4248  H HB3  . SER A 1 94 ? -10.142 4.025   6.921   1.00 15.00 ? 94 SER A HB3  3  
ATOM 4249  H HG   . SER A 1 94 ? -12.825 3.707   6.071   1.00 15.00 ? 94 SER A HG   3  
ATOM 4250  N N    . PRO A 1 95 ? -12.283 3.228   9.979   1.00 15.00 ? 95 PRO A N    3  
ATOM 4251  C CA   . PRO A 1 95 ? -13.287 3.377   11.037  1.00 15.00 ? 95 PRO A CA   3  
ATOM 4252  C C    . PRO A 1 95 ? -14.585 3.990   10.523  1.00 15.00 ? 95 PRO A C    3  
ATOM 4253  O O    . PRO A 1 95 ? -15.657 3.755   11.079  1.00 15.00 ? 95 PRO A O    3  
ATOM 4254  C CB   . PRO A 1 95 ? -12.611 4.318   12.038  1.00 15.00 ? 95 PRO A CB   3  
ATOM 4255  C CG   . PRO A 1 95 ? -11.152 4.112   11.824  1.00 15.00 ? 95 PRO A CG   3  
ATOM 4256  C CD   . PRO A 1 95 ? -10.985 3.815   10.360  1.00 15.00 ? 95 PRO A CD   3  
ATOM 4257  H HA   . PRO A 1 95 ? -13.501 2.433   11.515  1.00 15.00 ? 95 PRO A HA   3  
ATOM 4258  H HB2  . PRO A 1 95 ? -12.902 5.337   11.831  1.00 15.00 ? 95 PRO A HB2  3  
ATOM 4259  H HB3  . PRO A 1 95 ? -12.904 4.050   13.042  1.00 15.00 ? 95 PRO A HB3  3  
ATOM 4260  H HG2  . PRO A 1 95 ? -10.612 5.009   12.089  1.00 15.00 ? 95 PRO A HG2  3  
ATOM 4261  H HG3  . PRO A 1 95 ? -10.808 3.277   12.417  1.00 15.00 ? 95 PRO A HG3  3  
ATOM 4262  H HD2  . PRO A 1 95 ? -10.797 4.725   9.809   1.00 15.00 ? 95 PRO A HD2  3  
ATOM 4263  H HD3  . PRO A 1 95 ? -10.183 3.107   10.207  1.00 15.00 ? 95 PRO A HD3  3  
ATOM 4264  N N    . THR A 1 96 ? -14.480 4.776   9.456   1.00 15.00 ? 96 THR A N    3  
ATOM 4265  C CA   . THR A 1 96 ? -15.646 5.423   8.866   1.00 15.00 ? 96 THR A CA   3  
ATOM 4266  C C    . THR A 1 96 ? -16.302 4.518   7.827   1.00 15.00 ? 96 THR A C    3  
ATOM 4267  O O    . THR A 1 96 ? -17.469 4.779   7.469   1.00 15.00 ? 96 THR A O    3  
ATOM 4268  C CB   . THR A 1 96 ? -15.247 6.751   8.222   1.00 15.00 ? 96 THR A CB   3  
ATOM 4269  O OG1  . THR A 1 96 ? -14.522 6.531   7.026   1.00 15.00 ? 96 THR A OG1  3  
ATOM 4270  C CG2  . THR A 1 96 ? -14.395 7.620   9.122   1.00 15.00 ? 96 THR A CG2  3  
ATOM 4271  O OXT  . THR A 1 96 ? -15.642 3.556   7.381   1.00 15.00 ? 96 THR A OXT  3  
ATOM 4272  H H    . THR A 1 96 ? -13.598 4.925   9.056   1.00 15.00 ? 96 THR A H    3  
ATOM 4273  H HA   . THR A 1 96 ? -16.355 5.615   9.657   1.00 15.00 ? 96 THR A HA   3  
ATOM 4274  H HB   . THR A 1 96 ? -16.143 7.305   7.979   1.00 15.00 ? 96 THR A HB   3  
ATOM 4275  H HG1  . THR A 1 96 ? -15.122 6.560   6.277   1.00 15.00 ? 96 THR A HG1  3  
ATOM 4276  H HG21 . THR A 1 96 ? -14.420 8.640   8.766   1.00 15.00 ? 96 THR A HG21 3  
ATOM 4277  H HG22 . THR A 1 96 ? -14.780 7.581   10.130  1.00 15.00 ? 96 THR A HG22 3  
ATOM 4278  H HG23 . THR A 1 96 ? -13.377 7.260   9.111   1.00 15.00 ? 96 THR A HG23 3  
ATOM 4279  N N    . PRO A 1 1  ? -20.855 1.494   4.419   1.00 15.00 ? 1  PRO A N    4  
ATOM 4280  C CA   . PRO A 1 1  ? -19.567 2.167   4.740   1.00 15.00 ? 1  PRO A CA   4  
ATOM 4281  C C    . PRO A 1 1  ? -18.366 1.292   4.387   1.00 15.00 ? 1  PRO A C    4  
ATOM 4282  O O    . PRO A 1 1  ? -17.394 1.219   5.140   1.00 15.00 ? 1  PRO A O    4  
ATOM 4283  C CB   . PRO A 1 1  ? -19.577 2.489   6.233   1.00 15.00 ? 1  PRO A CB   4  
ATOM 4284  C CG   . PRO A 1 1  ? -20.819 1.840   6.744   1.00 15.00 ? 1  PRO A CG   4  
ATOM 4285  C CD   . PRO A 1 1  ? -21.753 1.719   5.563   1.00 15.00 ? 1  PRO A CD   4  
ATOM 4286  H H2   . PRO A 1 1  ? -20.558 0.526   4.209   1.00 15.00 ? 1  PRO A H2   4  
ATOM 4287  H H3   . PRO A 1 1  ? -21.079 1.909   3.485   1.00 15.00 ? 1  PRO A H3   4  
ATOM 4288  H HA   . PRO A 1 1  ? -19.510 3.088   4.179   1.00 15.00 ? 1  PRO A HA   4  
ATOM 4289  H HB2  . PRO A 1 1  ? -18.693 2.079   6.701   1.00 15.00 ? 1  PRO A HB2  4  
ATOM 4290  H HB3  . PRO A 1 1  ? -19.604 3.559   6.375   1.00 15.00 ? 1  PRO A HB3  4  
ATOM 4291  H HG2  . PRO A 1 1  ? -20.586 0.862   7.137   1.00 15.00 ? 1  PRO A HG2  4  
ATOM 4292  H HG3  . PRO A 1 1  ? -21.265 2.456   7.511   1.00 15.00 ? 1  PRO A HG3  4  
ATOM 4293  H HD2  . PRO A 1 1  ? -22.420 0.880   5.697   1.00 15.00 ? 1  PRO A HD2  4  
ATOM 4294  H HD3  . PRO A 1 1  ? -22.315 2.632   5.433   1.00 15.00 ? 1  PRO A HD3  4  
ATOM 4295  N N    . LYS A 1 2  ? -18.441 0.629   3.237   1.00 15.00 ? 2  LYS A N    4  
ATOM 4296  C CA   . LYS A 1 2  ? -17.361 -0.240  2.785   1.00 15.00 ? 2  LYS A CA   4  
ATOM 4297  C C    . LYS A 1 2  ? -17.378 -0.386  1.265   1.00 15.00 ? 2  LYS A C    4  
ATOM 4298  O O    . LYS A 1 2  ? -18.012 -1.293  0.726   1.00 15.00 ? 2  LYS A O    4  
ATOM 4299  C CB   . LYS A 1 2  ? -17.478 -1.617  3.444   1.00 15.00 ? 2  LYS A CB   4  
ATOM 4300  C CG   . LYS A 1 2  ? -17.557 -1.559  4.961   1.00 15.00 ? 2  LYS A CG   4  
ATOM 4301  C CD   . LYS A 1 2  ? -17.568 -2.951  5.574   1.00 15.00 ? 2  LYS A CD   4  
ATOM 4302  C CE   . LYS A 1 2  ? -18.935 -3.299  6.143   1.00 15.00 ? 2  LYS A CE   4  
ATOM 4303  N NZ   . LYS A 1 2  ? -19.724 -4.150  5.211   1.00 15.00 ? 2  LYS A NZ   4  
ATOM 4304  H H    . LYS A 1 2  ? -19.241 0.727   2.680   1.00 15.00 ? 2  LYS A H    4  
ATOM 4305  H HA   . LYS A 1 2  ? -16.426 0.211   3.081   1.00 15.00 ? 2  LYS A HA   4  
ATOM 4306  H HB2  . LYS A 1 2  ? -18.369 -2.105  3.076   1.00 15.00 ? 2  LYS A HB2  4  
ATOM 4307  H HB3  . LYS A 1 2  ? -16.616 -2.208  3.172   1.00 15.00 ? 2  LYS A HB3  4  
ATOM 4308  H HG2  . LYS A 1 2  ? -16.700 -1.019  5.336   1.00 15.00 ? 2  LYS A HG2  4  
ATOM 4309  H HG3  . LYS A 1 2  ? -18.462 -1.042  5.244   1.00 15.00 ? 2  LYS A HG3  4  
ATOM 4310  H HD2  . LYS A 1 2  ? -17.312 -3.672  4.813   1.00 15.00 ? 2  LYS A HD2  4  
ATOM 4311  H HD3  . LYS A 1 2  ? -16.838 -2.988  6.369   1.00 15.00 ? 2  LYS A HD3  4  
ATOM 4312  H HE2  . LYS A 1 2  ? -18.799 -3.830  7.073   1.00 15.00 ? 2  LYS A HE2  4  
ATOM 4313  H HE3  . LYS A 1 2  ? -19.477 -2.383  6.328   1.00 15.00 ? 2  LYS A HE3  4  
ATOM 4314  H HZ1  . LYS A 1 2  ? -20.395 -3.565  4.673   1.00 15.00 ? 2  LYS A HZ1  4  
ATOM 4315  H HZ2  . LYS A 1 2  ? -19.089 -4.633  4.543   1.00 15.00 ? 2  LYS A HZ2  4  
ATOM 4316  H HZ3  . LYS A 1 2  ? -20.257 -4.866  5.745   1.00 15.00 ? 2  LYS A HZ3  4  
ATOM 4317  N N    . PRO A 1 3  ? -16.676 0.512   0.551   1.00 15.00 ? 3  PRO A N    4  
ATOM 4318  C CA   . PRO A 1 3  ? -16.611 0.481   -0.914  1.00 15.00 ? 3  PRO A CA   4  
ATOM 4319  C C    . PRO A 1 3  ? -16.271 -0.905  -1.453  1.00 15.00 ? 3  PRO A C    4  
ATOM 4320  O O    . PRO A 1 3  ? -17.060 -1.509  -2.178  1.00 15.00 ? 3  PRO A O    4  
ATOM 4321  C CB   . PRO A 1 3  ? -15.492 1.472   -1.237  1.00 15.00 ? 3  PRO A CB   4  
ATOM 4322  C CG   . PRO A 1 3  ? -15.501 2.429   -0.096  1.00 15.00 ? 3  PRO A CG   4  
ATOM 4323  C CD   . PRO A 1 3  ? -15.891 1.626   1.115   1.00 15.00 ? 3  PRO A CD   4  
ATOM 4324  H HA   . PRO A 1 3  ? -17.535 0.820   -1.357  1.00 15.00 ? 3  PRO A HA   4  
ATOM 4325  H HB2  . PRO A 1 3  ? -14.551 0.947   -1.308  1.00 15.00 ? 3  PRO A HB2  4  
ATOM 4326  H HB3  . PRO A 1 3  ? -15.706 1.970   -2.171  1.00 15.00 ? 3  PRO A HB3  4  
ATOM 4327  H HG2  . PRO A 1 3  ? -14.516 2.853   0.036   1.00 15.00 ? 3  PRO A HG2  4  
ATOM 4328  H HG3  . PRO A 1 3  ? -16.225 3.210   -0.276  1.00 15.00 ? 3  PRO A HG3  4  
ATOM 4329  H HD2  . PRO A 1 3  ? -15.012 1.258   1.622   1.00 15.00 ? 3  PRO A HD2  4  
ATOM 4330  H HD3  . PRO A 1 3  ? -16.494 2.221   1.785   1.00 15.00 ? 3  PRO A HD3  4  
ATOM 4331  N N    . GLY A 1 4  ? -15.090 -1.405  -1.100  1.00 15.00 ? 4  GLY A N    4  
ATOM 4332  C CA   . GLY A 1 4  ? -14.677 -2.716  -1.564  1.00 15.00 ? 4  GLY A CA   4  
ATOM 4333  C C    . GLY A 1 4  ? -13.964 -2.665  -2.902  1.00 15.00 ? 4  GLY A C    4  
ATOM 4334  O O    . GLY A 1 4  ? -13.232 -3.589  -3.256  1.00 15.00 ? 4  GLY A O    4  
ATOM 4335  H H    . GLY A 1 4  ? -14.495 -0.880  -0.525  1.00 15.00 ? 4  GLY A H    4  
ATOM 4336  H HA2  . GLY A 1 4  ? -14.013 -3.152  -0.832  1.00 15.00 ? 4  GLY A HA2  4  
ATOM 4337  H HA3  . GLY A 1 4  ? -15.551 -3.343  -1.659  1.00 15.00 ? 4  GLY A HA3  4  
ATOM 4338  N N    . ASP A 1 5  ? -14.178 -1.585  -3.647  1.00 15.00 ? 5  ASP A N    4  
ATOM 4339  C CA   . ASP A 1 5  ? -13.549 -1.422  -4.951  1.00 15.00 ? 5  ASP A CA   4  
ATOM 4340  C C    . ASP A 1 5  ? -12.036 -1.386  -4.823  1.00 15.00 ? 5  ASP A C    4  
ATOM 4341  O O    . ASP A 1 5  ? -11.491 -1.049  -3.772  1.00 15.00 ? 5  ASP A O    4  
ATOM 4342  C CB   . ASP A 1 5  ? -14.049 -0.146  -5.629  1.00 15.00 ? 5  ASP A CB   4  
ATOM 4343  C CG   . ASP A 1 5  ? -15.275 -0.389  -6.487  1.00 15.00 ? 5  ASP A CG   4  
ATOM 4344  O OD1  . ASP A 1 5  ? -16.054 -1.310  -6.162  1.00 15.00 ? 5  ASP A OD1  4  
ATOM 4345  O OD2  . ASP A 1 5  ? -15.457 0.341   -7.484  1.00 15.00 ? 5  ASP A OD2  4  
ATOM 4346  H H    . ASP A 1 5  ? -14.773 -0.883  -3.313  1.00 15.00 ? 5  ASP A H    4  
ATOM 4347  H HA   . ASP A 1 5  ? -13.815 -2.273  -5.563  1.00 15.00 ? 5  ASP A HA   4  
ATOM 4348  H HB2  . ASP A 1 5  ? -14.301 0.581   -4.872  1.00 15.00 ? 5  ASP A HB2  4  
ATOM 4349  H HB3  . ASP A 1 5  ? -13.265 0.252   -6.257  1.00 15.00 ? 5  ASP A HB3  4  
ATOM 4350  N N    . ILE A 1 6  ? -11.371 -1.753  -5.905  1.00 15.00 ? 6  ILE A N    4  
ATOM 4351  C CA   . ILE A 1 6  ? -9.922  -1.790  -5.945  1.00 15.00 ? 6  ILE A CA   4  
ATOM 4352  C C    . ILE A 1 6  ? -9.362  -0.586  -6.699  1.00 15.00 ? 6  ILE A C    4  
ATOM 4353  O O    . ILE A 1 6  ? -9.944  -0.136  -7.686  1.00 15.00 ? 6  ILE A O    4  
ATOM 4354  C CB   . ILE A 1 6  ? -9.450  -3.093  -6.626  1.00 15.00 ? 6  ILE A CB   4  
ATOM 4355  C CG1  . ILE A 1 6  ? -9.129  -4.156  -5.575  1.00 15.00 ? 6  ILE A CG1  4  
ATOM 4356  C CG2  . ILE A 1 6  ? -8.240  -2.847  -7.524  1.00 15.00 ? 6  ILE A CG2  4  
ATOM 4357  C CD1  . ILE A 1 6  ? -10.286 -4.456  -4.647  1.00 15.00 ? 6  ILE A CD1  4  
ATOM 4358  H H    . ILE A 1 6  ? -11.874 -2.019  -6.702  1.00 15.00 ? 6  ILE A H    4  
ATOM 4359  H HA   . ILE A 1 6  ? -9.552  -1.782  -4.929  1.00 15.00 ? 6  ILE A HA   4  
ATOM 4360  H HB   . ILE A 1 6  ? -10.264 -3.449  -7.243  1.00 15.00 ? 6  ILE A HB   4  
ATOM 4361  H HG12 . ILE A 1 6  ? -8.859  -5.075  -6.074  1.00 15.00 ? 6  ILE A HG12 4  
ATOM 4362  H HG13 . ILE A 1 6  ? -8.298  -3.819  -4.975  1.00 15.00 ? 6  ILE A HG13 4  
ATOM 4363  H HG21 . ILE A 1 6  ? -7.453  -2.380  -6.948  1.00 15.00 ? 6  ILE A HG21 4  
ATOM 4364  H HG22 . ILE A 1 6  ? -7.886  -3.788  -7.919  1.00 15.00 ? 6  ILE A HG22 4  
ATOM 4365  H HG23 . ILE A 1 6  ? -8.521  -2.196  -8.339  1.00 15.00 ? 6  ILE A HG23 4  
ATOM 4366  H HD11 . ILE A 1 6  ? -10.295 -3.738  -3.839  1.00 15.00 ? 6  ILE A HD11 4  
ATOM 4367  H HD12 . ILE A 1 6  ? -11.214 -4.391  -5.196  1.00 15.00 ? 6  ILE A HD12 4  
ATOM 4368  H HD13 . ILE A 1 6  ? -10.176 -5.451  -4.243  1.00 15.00 ? 6  ILE A HD13 4  
ATOM 4369  N N    . PHE A 1 7  ? -8.221  -0.085  -6.243  1.00 15.00 ? 7  PHE A N    4  
ATOM 4370  C CA   . PHE A 1 7  ? -7.579  1.047   -6.897  1.00 15.00 ? 7  PHE A CA   4  
ATOM 4371  C C    . PHE A 1 7  ? -6.065  0.861   -6.926  1.00 15.00 ? 7  PHE A C    4  
ATOM 4372  O O    . PHE A 1 7  ? -5.521  0.027   -6.206  1.00 15.00 ? 7  PHE A O    4  
ATOM 4373  C CB   . PHE A 1 7  ? -7.954  2.364   -6.205  1.00 15.00 ? 7  PHE A CB   4  
ATOM 4374  C CG   . PHE A 1 7  ? -7.154  2.673   -4.967  1.00 15.00 ? 7  PHE A CG   4  
ATOM 4375  C CD1  . PHE A 1 7  ? -5.833  3.084   -5.062  1.00 15.00 ? 7  PHE A CD1  4  
ATOM 4376  C CD2  . PHE A 1 7  ? -7.728  2.563   -3.711  1.00 15.00 ? 7  PHE A CD2  4  
ATOM 4377  C CE1  . PHE A 1 7  ? -5.101  3.379   -3.928  1.00 15.00 ? 7  PHE A CE1  4  
ATOM 4378  C CE2  . PHE A 1 7  ? -7.000  2.855   -2.574  1.00 15.00 ? 7  PHE A CE2  4  
ATOM 4379  C CZ   . PHE A 1 7  ? -5.685  3.264   -2.683  1.00 15.00 ? 7  PHE A CZ   4  
ATOM 4380  H H    . PHE A 1 7  ? -7.796  -0.494  -5.461  1.00 15.00 ? 7  PHE A H    4  
ATOM 4381  H HA   . PHE A 1 7  ? -7.938  1.072   -7.915  1.00 15.00 ? 7  PHE A HA   4  
ATOM 4382  H HB2  . PHE A 1 7  ? -7.808  3.178   -6.899  1.00 15.00 ? 7  PHE A HB2  4  
ATOM 4383  H HB3  . PHE A 1 7  ? -8.997  2.326   -5.923  1.00 15.00 ? 7  PHE A HB3  4  
ATOM 4384  H HD1  . PHE A 1 7  ? -5.373  3.172   -6.034  1.00 15.00 ? 7  PHE A HD1  4  
ATOM 4385  H HD2  . PHE A 1 7  ? -8.756  2.243   -3.625  1.00 15.00 ? 7  PHE A HD2  4  
ATOM 4386  H HE1  . PHE A 1 7  ? -4.073  3.698   -4.016  1.00 15.00 ? 7  PHE A HE1  4  
ATOM 4387  H HE2  . PHE A 1 7  ? -7.459  2.764   -1.600  1.00 15.00 ? 7  PHE A HE2  4  
ATOM 4388  H HZ   . PHE A 1 7  ? -5.116  3.495   -1.798  1.00 15.00 ? 7  PHE A HZ   4  
ATOM 4389  N N    . GLU A 1 8  ? -5.394  1.635   -7.771  1.00 15.00 ? 8  GLU A N    4  
ATOM 4390  C CA   . GLU A 1 8  ? -3.944  1.546   -7.902  1.00 15.00 ? 8  GLU A CA   4  
ATOM 4391  C C    . GLU A 1 8  ? -3.289  2.916   -7.779  1.00 15.00 ? 8  GLU A C    4  
ATOM 4392  O O    . GLU A 1 8  ? -3.813  3.920   -8.261  1.00 15.00 ? 8  GLU A O    4  
ATOM 4393  C CB   . GLU A 1 8  ? -3.580  0.931   -9.249  1.00 15.00 ? 8  GLU A CB   4  
ATOM 4394  C CG   . GLU A 1 8  ? -4.246  1.621   -10.424 1.00 15.00 ? 8  GLU A CG   4  
ATOM 4395  C CD   . GLU A 1 8  ? -4.211  0.787   -11.689 1.00 15.00 ? 8  GLU A CD   4  
ATOM 4396  O OE1  . GLU A 1 8  ? -4.325  -0.453  -11.587 1.00 15.00 ? 8  GLU A OE1  4  
ATOM 4397  O OE2  . GLU A 1 8  ? -4.071  1.374   -12.783 1.00 15.00 ? 8  GLU A OE2  4  
ATOM 4398  H H    . GLU A 1 8  ? -5.886  2.276   -8.325  1.00 15.00 ? 8  GLU A H    4  
ATOM 4399  H HA   . GLU A 1 8  ? -3.568  0.906   -7.112  1.00 15.00 ? 8  GLU A HA   4  
ATOM 4400  H HB2  . GLU A 1 8  ? -2.511  0.996   -9.383  1.00 15.00 ? 8  GLU A HB2  4  
ATOM 4401  H HB3  . GLU A 1 8  ? -3.875  -0.108  -9.253  1.00 15.00 ? 8  GLU A HB3  4  
ATOM 4402  H HG2  . GLU A 1 8  ? -5.275  1.818   -10.169 1.00 15.00 ? 8  GLU A HG2  4  
ATOM 4403  H HG3  . GLU A 1 8  ? -3.735  2.554   -10.609 1.00 15.00 ? 8  GLU A HG3  4  
ATOM 4404  N N    . VAL A 1 9  ? -2.128  2.931   -7.145  1.00 15.00 ? 9  VAL A N    4  
ATOM 4405  C CA   . VAL A 1 9  ? -1.356  4.153   -6.959  1.00 15.00 ? 9  VAL A CA   4  
ATOM 4406  C C    . VAL A 1 9  ? -0.220  4.197   -7.970  1.00 15.00 ? 9  VAL A C    4  
ATOM 4407  O O    . VAL A 1 9  ? 0.679   3.357   -7.944  1.00 15.00 ? 9  VAL A O    4  
ATOM 4408  C CB   . VAL A 1 9  ? -0.803  4.275   -5.513  1.00 15.00 ? 9  VAL A CB   4  
ATOM 4409  C CG1  . VAL A 1 9  ? -0.798  2.923   -4.812  1.00 15.00 ? 9  VAL A CG1  4  
ATOM 4410  C CG2  . VAL A 1 9  ? 0.593   4.891   -5.498  1.00 15.00 ? 9  VAL A CG2  4  
ATOM 4411  H H    . VAL A 1 9  ? -1.767  2.086   -6.809  1.00 15.00 ? 9  VAL A H    4  
ATOM 4412  H HA   . VAL A 1 9  ? -2.014  4.991   -7.147  1.00 15.00 ? 9  VAL A HA   4  
ATOM 4413  H HB   . VAL A 1 9  ? -1.462  4.929   -4.961  1.00 15.00 ? 9  VAL A HB   4  
ATOM 4414  H HG11 . VAL A 1 9  ? -1.750  2.430   -4.967  1.00 15.00 ? 9  VAL A HG11 4  
ATOM 4415  H HG12 . VAL A 1 9  ? -0.008  2.313   -5.219  1.00 15.00 ? 9  VAL A HG12 4  
ATOM 4416  H HG13 . VAL A 1 9  ? -0.633  3.066   -3.755  1.00 15.00 ? 9  VAL A HG13 4  
ATOM 4417  H HG21 . VAL A 1 9  ? 1.292   4.213   -5.966  1.00 15.00 ? 9  VAL A HG21 4  
ATOM 4418  H HG22 . VAL A 1 9  ? 0.581   5.825   -6.041  1.00 15.00 ? 9  VAL A HG22 4  
ATOM 4419  H HG23 . VAL A 1 9  ? 0.896   5.073   -4.478  1.00 15.00 ? 9  VAL A HG23 4  
ATOM 4420  N N    . GLU A 1 10 ? -0.281  5.162   -8.874  1.00 15.00 ? 10 GLU A N    4  
ATOM 4421  C CA   . GLU A 1 10 ? 0.730   5.291   -9.911  1.00 15.00 ? 10 GLU A CA   4  
ATOM 4422  C C    . GLU A 1 10 ? 1.676   6.460   -9.658  1.00 15.00 ? 10 GLU A C    4  
ATOM 4423  O O    . GLU A 1 10 ? 1.631   7.471   -10.360 1.00 15.00 ? 10 GLU A O    4  
ATOM 4424  C CB   . GLU A 1 10 ? 0.052   5.447   -11.266 1.00 15.00 ? 10 GLU A CB   4  
ATOM 4425  C CG   . GLU A 1 10 ? 1.024   5.580   -12.428 1.00 15.00 ? 10 GLU A CG   4  
ATOM 4426  C CD   . GLU A 1 10 ? 0.617   6.664   -13.407 1.00 15.00 ? 10 GLU A CD   4  
ATOM 4427  O OE1  . GLU A 1 10 ? 0.445   7.822   -12.973 1.00 15.00 ? 10 GLU A OE1  4  
ATOM 4428  O OE2  . GLU A 1 10 ? 0.469   6.353   -14.608 1.00 15.00 ? 10 GLU A OE2  4  
ATOM 4429  H H    . GLU A 1 10 ? -1.033  5.790   -8.856  1.00 15.00 ? 10 GLU A H    4  
ATOM 4430  H HA   . GLU A 1 10 ? 1.307   4.379   -9.920  1.00 15.00 ? 10 GLU A HA   4  
ATOM 4431  H HB2  . GLU A 1 10 ? -0.567  4.579   -11.439 1.00 15.00 ? 10 GLU A HB2  4  
ATOM 4432  H HB3  . GLU A 1 10 ? -0.573  6.326   -11.241 1.00 15.00 ? 10 GLU A HB3  4  
ATOM 4433  H HG2  . GLU A 1 10 ? 2.001   5.819   -12.037 1.00 15.00 ? 10 GLU A HG2  4  
ATOM 4434  H HG3  . GLU A 1 10 ? 1.067   4.638   -12.954 1.00 15.00 ? 10 GLU A HG3  4  
ATOM 4435  N N    . LEU A 1 11 ? 2.551   6.305   -8.672  1.00 15.00 ? 11 LEU A N    4  
ATOM 4436  C CA   . LEU A 1 11 ? 3.528   7.339   -8.354  1.00 15.00 ? 11 LEU A CA   4  
ATOM 4437  C C    . LEU A 1 11 ? 4.784   7.128   -9.192  1.00 15.00 ? 11 LEU A C    4  
ATOM 4438  O O    . LEU A 1 11 ? 4.952   6.075   -9.801  1.00 15.00 ? 11 LEU A O    4  
ATOM 4439  C CB   . LEU A 1 11 ? 3.876   7.315   -6.863  1.00 15.00 ? 11 LEU A CB   4  
ATOM 4440  C CG   . LEU A 1 11 ? 4.096   8.688   -6.215  1.00 15.00 ? 11 LEU A CG   4  
ATOM 4441  C CD1  . LEU A 1 11 ? 2.947   9.636   -6.536  1.00 15.00 ? 11 LEU A CD1  4  
ATOM 4442  C CD2  . LEU A 1 11 ? 4.264   8.541   -4.709  1.00 15.00 ? 11 LEU A CD2  4  
ATOM 4443  H H    . LEU A 1 11 ? 2.550   5.471   -8.160  1.00 15.00 ? 11 LEU A H    4  
ATOM 4444  H HA   . LEU A 1 11 ? 3.097   8.291   -8.604  1.00 15.00 ? 11 LEU A HA   4  
ATOM 4445  H HB2  . LEU A 1 11 ? 3.078   6.814   -6.339  1.00 15.00 ? 11 LEU A HB2  4  
ATOM 4446  H HB3  . LEU A 1 11 ? 4.779   6.738   -6.737  1.00 15.00 ? 11 LEU A HB3  4  
ATOM 4447  H HG   . LEU A 1 11 ? 5.003   9.121   -6.610  1.00 15.00 ? 11 LEU A HG   4  
ATOM 4448  H HD11 . LEU A 1 11 ? 2.244   9.146   -7.190  1.00 15.00 ? 11 LEU A HD11 4  
ATOM 4449  H HD12 . LEU A 1 11 ? 2.448   9.922   -5.621  1.00 15.00 ? 11 LEU A HD12 4  
ATOM 4450  H HD13 . LEU A 1 11 ? 3.335   10.519  -7.022  1.00 15.00 ? 11 LEU A HD13 4  
ATOM 4451  H HD21 . LEU A 1 11 ? 3.375   8.093   -4.289  1.00 15.00 ? 11 LEU A HD21 4  
ATOM 4452  H HD22 . LEU A 1 11 ? 5.116   7.912   -4.501  1.00 15.00 ? 11 LEU A HD22 4  
ATOM 4453  H HD23 . LEU A 1 11 ? 4.418   9.515   -4.267  1.00 15.00 ? 11 LEU A HD23 4  
ATOM 4454  N N    . ALA A 1 12 ? 5.661   8.122   -9.231  1.00 15.00 ? 12 ALA A N    4  
ATOM 4455  C CA   . ALA A 1 12 ? 6.889   8.010   -10.011 1.00 15.00 ? 12 ALA A CA   4  
ATOM 4456  C C    . ALA A 1 12 ? 8.058   7.562   -9.142  1.00 15.00 ? 12 ALA A C    4  
ATOM 4457  O O    . ALA A 1 12 ? 8.729   8.380   -8.512  1.00 15.00 ? 12 ALA A O    4  
ATOM 4458  C CB   . ALA A 1 12 ? 7.212   9.327   -10.695 1.00 15.00 ? 12 ALA A CB   4  
ATOM 4459  H H    . ALA A 1 12 ? 5.481   8.945   -8.730  1.00 15.00 ? 12 ALA A H    4  
ATOM 4460  H HA   . ALA A 1 12 ? 6.725   7.267   -10.780 1.00 15.00 ? 12 ALA A HA   4  
ATOM 4461  H HB1  . ALA A 1 12 ? 7.928   9.152   -11.485 1.00 15.00 ? 12 ALA A HB1  4  
ATOM 4462  H HB2  . ALA A 1 12 ? 6.309   9.746   -11.113 1.00 15.00 ? 12 ALA A HB2  4  
ATOM 4463  H HB3  . ALA A 1 12 ? 7.629   10.014  -9.975  1.00 15.00 ? 12 ALA A HB3  4  
ATOM 4464  N N    . LYS A 1 13 ? 8.296   6.256   -9.119  1.00 15.00 ? 13 LYS A N    4  
ATOM 4465  C CA   . LYS A 1 13 ? 9.383   5.685   -8.335  1.00 15.00 ? 13 LYS A CA   4  
ATOM 4466  C C    . LYS A 1 13 ? 10.730  6.273   -8.754  1.00 15.00 ? 13 LYS A C    4  
ATOM 4467  O O    . LYS A 1 13 ? 11.671  6.324   -7.963  1.00 15.00 ? 13 LYS A O    4  
ATOM 4468  C CB   . LYS A 1 13 ? 9.398   4.163   -8.498  1.00 15.00 ? 13 LYS A CB   4  
ATOM 4469  C CG   . LYS A 1 13 ? 9.887   3.423   -7.266  1.00 15.00 ? 13 LYS A CG   4  
ATOM 4470  C CD   . LYS A 1 13 ? 11.303  3.828   -6.901  1.00 15.00 ? 13 LYS A CD   4  
ATOM 4471  C CE   . LYS A 1 13 ? 11.316  4.809   -5.740  1.00 15.00 ? 13 LYS A CE   4  
ATOM 4472  N NZ   . LYS A 1 13 ? 12.588  5.580   -5.676  1.00 15.00 ? 13 LYS A NZ   4  
ATOM 4473  H H    . LYS A 1 13 ? 7.725   5.660   -9.646  1.00 15.00 ? 13 LYS A H    4  
ATOM 4474  H HA   . LYS A 1 13 ? 9.205   5.925   -7.298  1.00 15.00 ? 13 LYS A HA   4  
ATOM 4475  H HB2  . LYS A 1 13 ? 8.396   3.827   -8.718  1.00 15.00 ? 13 LYS A HB2  4  
ATOM 4476  H HB3  . LYS A 1 13 ? 10.043  3.906   -9.326  1.00 15.00 ? 13 LYS A HB3  4  
ATOM 4477  H HG2  . LYS A 1 13 ? 9.233   3.650   -6.437  1.00 15.00 ? 13 LYS A HG2  4  
ATOM 4478  H HG3  . LYS A 1 13 ? 9.866   2.365   -7.464  1.00 15.00 ? 13 LYS A HG3  4  
ATOM 4479  H HD2  . LYS A 1 13 ? 11.859  2.946   -6.621  1.00 15.00 ? 13 LYS A HD2  4  
ATOM 4480  H HD3  . LYS A 1 13 ? 11.765  4.291   -7.762  1.00 15.00 ? 13 LYS A HD3  4  
ATOM 4481  H HE2  . LYS A 1 13 ? 10.493  5.498   -5.858  1.00 15.00 ? 13 LYS A HE2  4  
ATOM 4482  H HE3  . LYS A 1 13 ? 11.192  4.258   -4.819  1.00 15.00 ? 13 LYS A HE3  4  
ATOM 4483  H HZ1  . LYS A 1 13 ? 13.264  5.104   -5.044  1.00 15.00 ? 13 LYS A HZ1  4  
ATOM 4484  H HZ2  . LYS A 1 13 ? 13.010  5.654   -6.624  1.00 15.00 ? 13 LYS A HZ2  4  
ATOM 4485  H HZ3  . LYS A 1 13 ? 12.408  6.538   -5.315  1.00 15.00 ? 13 LYS A HZ3  4  
ATOM 4486  N N    . ASN A 1 14 ? 10.814  6.720   -10.000 1.00 15.00 ? 14 ASN A N    4  
ATOM 4487  C CA   . ASN A 1 14 ? 12.047  7.299   -10.523 1.00 15.00 ? 14 ASN A CA   4  
ATOM 4488  C C    . ASN A 1 14 ? 12.153  8.775   -10.156 1.00 15.00 ? 14 ASN A C    4  
ATOM 4489  O O    . ASN A 1 14 ? 13.244  9.282   -9.896  1.00 15.00 ? 14 ASN A O    4  
ATOM 4490  C CB   . ASN A 1 14 ? 12.102  7.146   -12.044 1.00 15.00 ? 14 ASN A CB   4  
ATOM 4491  C CG   . ASN A 1 14 ? 12.419  5.729   -12.478 1.00 15.00 ? 14 ASN A CG   4  
ATOM 4492  O OD1  . ASN A 1 14 ? 12.953  4.934   -11.705 1.00 15.00 ? 14 ASN A OD1  4  
ATOM 4493  N ND2  . ASN A 1 14 ? 12.090  5.407   -13.724 1.00 15.00 ? 14 ASN A ND2  4  
ATOM 4494  H H    . ASN A 1 14 ? 10.034  6.651   -10.583 1.00 15.00 ? 14 ASN A H    4  
ATOM 4495  H HA   . ASN A 1 14 ? 12.879  6.768   -10.085 1.00 15.00 ? 14 ASN A HA   4  
ATOM 4496  H HB2  . ASN A 1 14 ? 11.145  7.423   -12.461 1.00 15.00 ? 14 ASN A HB2  4  
ATOM 4497  H HB3  . ASN A 1 14 ? 12.864  7.803   -12.438 1.00 15.00 ? 14 ASN A HB3  4  
ATOM 4498  H HD21 . ASN A 1 14 ? 11.666  6.093   -14.282 1.00 15.00 ? 14 ASN A HD21 4  
ATOM 4499  H HD22 . ASN A 1 14 ? 12.285  4.499   -14.035 1.00 15.00 ? 14 ASN A HD22 4  
ATOM 4500  N N    . ASP A 1 15 ? 11.014  9.458   -10.125 1.00 15.00 ? 15 ASP A N    4  
ATOM 4501  C CA   . ASP A 1 15 ? 10.988  10.873  -9.777  1.00 15.00 ? 15 ASP A CA   4  
ATOM 4502  C C    . ASP A 1 15 ? 11.286  11.059  -8.294  1.00 15.00 ? 15 ASP A C    4  
ATOM 4503  O O    . ASP A 1 15 ? 12.041  11.950  -7.906  1.00 15.00 ? 15 ASP A O    4  
ATOM 4504  C CB   . ASP A 1 15 ? 9.627   11.481  -10.119 1.00 15.00 ? 15 ASP A CB   4  
ATOM 4505  C CG   . ASP A 1 15 ? 9.718   12.961  -10.434 1.00 15.00 ? 15 ASP A CG   4  
ATOM 4506  O OD1  . ASP A 1 15 ? 10.723  13.376  -11.049 1.00 15.00 ? 15 ASP A OD1  4  
ATOM 4507  O OD2  . ASP A 1 15 ? 8.784   13.705  -10.066 1.00 15.00 ? 15 ASP A OD2  4  
ATOM 4508  H H    . ASP A 1 15 ? 10.174  9.000   -10.335 1.00 15.00 ? 15 ASP A H    4  
ATOM 4509  H HA   . ASP A 1 15 ? 11.753  11.372  -10.353 1.00 15.00 ? 15 ASP A HA   4  
ATOM 4510  H HB2  . ASP A 1 15 ? 9.218   10.973  -10.979 1.00 15.00 ? 15 ASP A HB2  4  
ATOM 4511  H HB3  . ASP A 1 15 ? 8.960   11.350  -9.278  1.00 15.00 ? 15 ASP A HB3  4  
ATOM 4512  N N    . ASN A 1 16 ? 10.687  10.205  -7.471  1.00 15.00 ? 16 ASN A N    4  
ATOM 4513  C CA   . ASN A 1 16 ? 10.883  10.261  -6.028  1.00 15.00 ? 16 ASN A CA   4  
ATOM 4514  C C    . ASN A 1 16 ? 10.384  8.978   -5.367  1.00 15.00 ? 16 ASN A C    4  
ATOM 4515  O O    . ASN A 1 16 ? 9.628   8.215   -5.967  1.00 15.00 ? 16 ASN A O    4  
ATOM 4516  C CB   . ASN A 1 16 ? 10.154  11.473  -5.440  1.00 15.00 ? 16 ASN A CB   4  
ATOM 4517  C CG   . ASN A 1 16 ? 11.032  12.275  -4.499  1.00 15.00 ? 16 ASN A CG   4  
ATOM 4518  O OD1  . ASN A 1 16 ? 11.650  13.262  -4.898  1.00 15.00 ? 16 ASN A OD1  4  
ATOM 4519  N ND2  . ASN A 1 16 ? 11.091  11.853  -3.241  1.00 15.00 ? 16 ASN A ND2  4  
ATOM 4520  H H    . ASN A 1 16 ? 10.099  9.515   -7.845  1.00 15.00 ? 16 ASN A H    4  
ATOM 4521  H HA   . ASN A 1 16 ? 11.941  10.361  -5.840  1.00 15.00 ? 16 ASN A HA   4  
ATOM 4522  H HB2  . ASN A 1 16 ? 9.839   12.120  -6.245  1.00 15.00 ? 16 ASN A HB2  4  
ATOM 4523  H HB3  . ASN A 1 16 ? 9.285   11.136  -4.895  1.00 15.00 ? 16 ASN A HB3  4  
ATOM 4524  H HD21 . ASN A 1 16 ? 10.571  11.059  -2.995  1.00 15.00 ? 16 ASN A HD21 4  
ATOM 4525  H HD22 . ASN A 1 16 ? 11.651  12.352  -2.611  1.00 15.00 ? 16 ASN A HD22 4  
ATOM 4526  N N    . SER A 1 17 ? 10.806  8.750   -4.128  1.00 15.00 ? 17 SER A N    4  
ATOM 4527  C CA   . SER A 1 17 ? 10.393  7.562   -3.388  1.00 15.00 ? 17 SER A CA   4  
ATOM 4528  C C    . SER A 1 17 ? 9.064   7.813   -2.688  1.00 15.00 ? 17 SER A C    4  
ATOM 4529  O O    . SER A 1 17 ? 8.351   8.754   -3.024  1.00 15.00 ? 17 SER A O    4  
ATOM 4530  C CB   . SER A 1 17 ? 11.455  7.180   -2.357  1.00 15.00 ? 17 SER A CB   4  
ATOM 4531  O OG   . SER A 1 17 ? 11.959  5.878   -2.600  1.00 15.00 ? 17 SER A OG   4  
ATOM 4532  H H    . SER A 1 17 ? 11.404  9.397   -3.699  1.00 15.00 ? 17 SER A H    4  
ATOM 4533  H HA   . SER A 1 17 ? 10.273  6.753   -4.093  1.00 15.00 ? 17 SER A HA   4  
ATOM 4534  H HB2  . SER A 1 17 ? 12.272  7.884   -2.407  1.00 15.00 ? 17 SER A HB2  4  
ATOM 4535  H HB3  . SER A 1 17 ? 11.016  7.206   -1.369  1.00 15.00 ? 17 SER A HB3  4  
ATOM 4536  H HG   . SER A 1 17 ? 12.552  5.899   -3.354  1.00 15.00 ? 17 SER A HG   4  
ATOM 4537  N N    . LEU A 1 18 ? 8.735   6.978   -1.709  1.00 15.00 ? 18 LEU A N    4  
ATOM 4538  C CA   . LEU A 1 18 ? 7.491   7.143   -0.974  1.00 15.00 ? 18 LEU A CA   4  
ATOM 4539  C C    . LEU A 1 18 ? 7.744   7.807   0.374   1.00 15.00 ? 18 LEU A C    4  
ATOM 4540  O O    . LEU A 1 18 ? 8.834   8.316   0.634   1.00 15.00 ? 18 LEU A O    4  
ATOM 4541  C CB   . LEU A 1 18 ? 6.788   5.796   -0.772  1.00 15.00 ? 18 LEU A CB   4  
ATOM 4542  C CG   . LEU A 1 18 ? 6.861   4.840   -1.964  1.00 15.00 ? 18 LEU A CG   4  
ATOM 4543  C CD1  . LEU A 1 18 ? 6.267   3.488   -1.601  1.00 15.00 ? 18 LEU A CD1  4  
ATOM 4544  C CD2  . LEU A 1 18 ? 6.144   5.435   -3.166  1.00 15.00 ? 18 LEU A CD2  4  
ATOM 4545  H H    . LEU A 1 18 ? 9.341   6.244   -1.473  1.00 15.00 ? 18 LEU A H    4  
ATOM 4546  H HA   . LEU A 1 18 ? 6.857   7.788   -1.561  1.00 15.00 ? 18 LEU A HA   4  
ATOM 4547  H HB2  . LEU A 1 18 ? 7.232   5.307   0.084   1.00 15.00 ? 18 LEU A HB2  4  
ATOM 4548  H HB3  . LEU A 1 18 ? 5.745   5.984   -0.553  1.00 15.00 ? 18 LEU A HB3  4  
ATOM 4549  H HG   . LEU A 1 18 ? 7.897   4.688   -2.232  1.00 15.00 ? 18 LEU A HG   4  
ATOM 4550  H HD11 . LEU A 1 18 ? 5.565   3.609   -0.789  1.00 15.00 ? 18 LEU A HD11 4  
ATOM 4551  H HD12 . LEU A 1 18 ? 5.757   3.077   -2.460  1.00 15.00 ? 18 LEU A HD12 4  
ATOM 4552  H HD13 . LEU A 1 18 ? 7.057   2.818   -1.297  1.00 15.00 ? 18 LEU A HD13 4  
ATOM 4553  H HD21 . LEU A 1 18 ? 5.946   4.656   -3.888  1.00 15.00 ? 18 LEU A HD21 4  
ATOM 4554  H HD22 . LEU A 1 18 ? 5.211   5.875   -2.847  1.00 15.00 ? 18 LEU A HD22 4  
ATOM 4555  H HD23 . LEU A 1 18 ? 6.765   6.194   -3.617  1.00 15.00 ? 18 LEU A HD23 4  
ATOM 4556  N N    . GLY A 1 19 ? 6.727   7.798   1.225   1.00 15.00 ? 19 GLY A N    4  
ATOM 4557  C CA   . GLY A 1 19 ? 6.846   8.401   2.536   1.00 15.00 ? 19 GLY A CA   4  
ATOM 4558  C C    . GLY A 1 19 ? 5.735   7.964   3.457   1.00 15.00 ? 19 GLY A C    4  
ATOM 4559  O O    . GLY A 1 19 ? 5.183   8.769   4.201   1.00 15.00 ? 19 GLY A O    4  
ATOM 4560  H H    . GLY A 1 19 ? 5.884   7.378   0.958   1.00 15.00 ? 19 GLY A H    4  
ATOM 4561  H HA2  . GLY A 1 19 ? 7.794   8.123   2.972   1.00 15.00 ? 19 GLY A HA2  4  
ATOM 4562  H HA3  . GLY A 1 19 ? 6.807   9.473   2.431   1.00 15.00 ? 19 GLY A HA3  4  
ATOM 4563  N N    . ILE A 1 20 ? 5.396   6.687   3.387   1.00 15.00 ? 20 ILE A N    4  
ATOM 4564  C CA   . ILE A 1 20 ? 4.335   6.131   4.207   1.00 15.00 ? 20 ILE A CA   4  
ATOM 4565  C C    . ILE A 1 20 ? 4.873   5.143   5.233   1.00 15.00 ? 20 ILE A C    4  
ATOM 4566  O O    . ILE A 1 20 ? 5.720   4.305   4.923   1.00 15.00 ? 20 ILE A O    4  
ATOM 4567  C CB   . ILE A 1 20 ? 3.269   5.440   3.328   1.00 15.00 ? 20 ILE A CB   4  
ATOM 4568  C CG1  . ILE A 1 20 ? 1.907   6.077   3.575   1.00 15.00 ? 20 ILE A CG1  4  
ATOM 4569  C CG2  . ILE A 1 20 ? 3.215   3.949   3.608   1.00 15.00 ? 20 ILE A CG2  4  
ATOM 4570  C CD1  . ILE A 1 20 ? 0.738   5.146   3.352   1.00 15.00 ? 20 ILE A CD1  4  
ATOM 4571  H H    . ILE A 1 20 ? 5.869   6.102   2.759   1.00 15.00 ? 20 ILE A H    4  
ATOM 4572  H HA   . ILE A 1 20 ? 3.853   6.943   4.738   1.00 15.00 ? 20 ILE A HA   4  
ATOM 4573  H HB   . ILE A 1 20 ? 3.541   5.579   2.295   1.00 15.00 ? 20 ILE A HB   4  
ATOM 4574  H HG12 . ILE A 1 20 ? 1.868   6.407   4.595   1.00 15.00 ? 20 ILE A HG12 4  
ATOM 4575  H HG13 . ILE A 1 20 ? 1.789   6.924   2.919   1.00 15.00 ? 20 ILE A HG13 4  
ATOM 4576  H HG21 . ILE A 1 20 ? 4.199   3.523   3.491   1.00 15.00 ? 20 ILE A HG21 4  
ATOM 4577  H HG22 . ILE A 1 20 ? 2.869   3.794   4.620   1.00 15.00 ? 20 ILE A HG22 4  
ATOM 4578  H HG23 . ILE A 1 20 ? 2.531   3.479   2.918   1.00 15.00 ? 20 ILE A HG23 4  
ATOM 4579  H HD11 . ILE A 1 20 ? -0.101  5.706   2.970   1.00 15.00 ? 20 ILE A HD11 4  
ATOM 4580  H HD12 . ILE A 1 20 ? 1.020   4.385   2.643   1.00 15.00 ? 20 ILE A HD12 4  
ATOM 4581  H HD13 . ILE A 1 20 ? 0.467   4.684   4.288   1.00 15.00 ? 20 ILE A HD13 4  
ATOM 4582  N N    . SER A 1 21 ? 4.336   5.215   6.440   1.00 15.00 ? 21 SER A N    4  
ATOM 4583  C CA   . SER A 1 21 ? 4.714   4.295   7.496   1.00 15.00 ? 21 SER A CA   4  
ATOM 4584  C C    . SER A 1 21 ? 3.713   3.148   7.491   1.00 15.00 ? 21 SER A C    4  
ATOM 4585  O O    . SER A 1 21 ? 2.588   3.297   7.964   1.00 15.00 ? 21 SER A O    4  
ATOM 4586  C CB   . SER A 1 21 ? 4.729   5.005   8.853   1.00 15.00 ? 21 SER A CB   4  
ATOM 4587  O OG   . SER A 1 21 ? 4.868   4.077   9.915   1.00 15.00 ? 21 SER A OG   4  
ATOM 4588  H H    . SER A 1 21 ? 3.637   5.879   6.613   1.00 15.00 ? 21 SER A H    4  
ATOM 4589  H HA   . SER A 1 21 ? 5.699   3.910   7.275   1.00 15.00 ? 21 SER A HA   4  
ATOM 4590  H HB2  . SER A 1 21 ? 5.559   5.699   8.885   1.00 15.00 ? 21 SER A HB2  4  
ATOM 4591  H HB3  . SER A 1 21 ? 3.805   5.548   8.983   1.00 15.00 ? 21 SER A HB3  4  
ATOM 4592  H HG   . SER A 1 21 ? 5.796   3.863   10.034  1.00 15.00 ? 21 SER A HG   4  
ATOM 4593  N N    . VAL A 1 22 ? 4.102   2.024   6.901   1.00 15.00 ? 22 VAL A N    4  
ATOM 4594  C CA   . VAL A 1 22 ? 3.199   0.883   6.783   1.00 15.00 ? 22 VAL A CA   4  
ATOM 4595  C C    . VAL A 1 22 ? 3.363   -0.110  7.927   1.00 15.00 ? 22 VAL A C    4  
ATOM 4596  O O    . VAL A 1 22 ? 4.436   -0.229  8.518   1.00 15.00 ? 22 VAL A O    4  
ATOM 4597  C CB   . VAL A 1 22 ? 3.391   0.147   5.433   1.00 15.00 ? 22 VAL A CB   4  
ATOM 4598  C CG1  . VAL A 1 22 ? 3.674   1.130   4.306   1.00 15.00 ? 22 VAL A CG1  4  
ATOM 4599  C CG2  . VAL A 1 22 ? 4.505   -0.885  5.522   1.00 15.00 ? 22 VAL A CG2  4  
ATOM 4600  H H    . VAL A 1 22 ? 4.997   1.974   6.500   1.00 15.00 ? 22 VAL A H    4  
ATOM 4601  H HA   . VAL A 1 22 ? 2.189   1.266   6.807   1.00 15.00 ? 22 VAL A HA   4  
ATOM 4602  H HB   . VAL A 1 22 ? 2.473   -0.372  5.200   1.00 15.00 ? 22 VAL A HB   4  
ATOM 4603  H HG11 . VAL A 1 22 ? 4.288   1.938   4.674   1.00 15.00 ? 22 VAL A HG11 4  
ATOM 4604  H HG12 . VAL A 1 22 ? 4.196   0.617   3.510   1.00 15.00 ? 22 VAL A HG12 4  
ATOM 4605  H HG13 . VAL A 1 22 ? 2.742   1.529   3.930   1.00 15.00 ? 22 VAL A HG13 4  
ATOM 4606  H HG21 . VAL A 1 22 ? 5.023   -0.938  4.577   1.00 15.00 ? 22 VAL A HG21 4  
ATOM 4607  H HG22 . VAL A 1 22 ? 5.200   -0.601  6.299   1.00 15.00 ? 22 VAL A HG22 4  
ATOM 4608  H HG23 . VAL A 1 22 ? 4.081   -1.849  5.753   1.00 15.00 ? 22 VAL A HG23 4  
ATOM 4609  N N    . THR A 1 23 ? 2.281   -0.826  8.222   1.00 15.00 ? 23 THR A N    4  
ATOM 4610  C CA   . THR A 1 23 ? 2.280   -1.822  9.282   1.00 15.00 ? 23 THR A CA   4  
ATOM 4611  C C    . THR A 1 23 ? 1.307   -2.957  8.957   1.00 15.00 ? 23 THR A C    4  
ATOM 4612  O O    . THR A 1 23 ? 0.731   -3.000  7.867   1.00 15.00 ? 23 THR A O    4  
ATOM 4613  C CB   . THR A 1 23 ? 1.921   -1.172  10.619  1.00 15.00 ? 23 THR A CB   4  
ATOM 4614  O OG1  . THR A 1 23 ? 2.112   -2.082  11.688  1.00 15.00 ? 23 THR A OG1  4  
ATOM 4615  C CG2  . THR A 1 23 ? 0.495   -0.684  10.681  1.00 15.00 ? 23 THR A CG2  4  
ATOM 4616  H H    . THR A 1 23 ? 1.461   -0.682  7.705   1.00 15.00 ? 23 THR A H    4  
ATOM 4617  H HA   . THR A 1 23 ? 3.274   -2.229  9.349   1.00 15.00 ? 23 THR A HA   4  
ATOM 4618  H HB   . THR A 1 23 ? 2.567   -0.319  10.777  1.00 15.00 ? 23 THR A HB   4  
ATOM 4619  H HG1  . THR A 1 23 ? 1.861   -1.662  12.515  1.00 15.00 ? 23 THR A HG1  4  
ATOM 4620  H HG21 . THR A 1 23 ? 0.325   -0.194  11.627  1.00 15.00 ? 23 THR A HG21 4  
ATOM 4621  H HG22 . THR A 1 23 ? 0.320   0.013   9.876   1.00 15.00 ? 23 THR A HG22 4  
ATOM 4622  H HG23 . THR A 1 23 ? -0.176  -1.524  10.584  1.00 15.00 ? 23 THR A HG23 4  
ATOM 4623  N N    . GLY A 1 24 ? 1.132   -3.878  9.902   1.00 15.00 ? 24 GLY A N    4  
ATOM 4624  C CA   . GLY A 1 24 ? 0.233   -5.000  9.688   1.00 15.00 ? 24 GLY A CA   4  
ATOM 4625  C C    . GLY A 1 24 ? 0.828   -6.040  8.761   1.00 15.00 ? 24 GLY A C    4  
ATOM 4626  O O    . GLY A 1 24 ? 1.844   -6.654  9.083   1.00 15.00 ? 24 GLY A O    4  
ATOM 4627  H H    . GLY A 1 24 ? 1.619   -3.796  10.749  1.00 15.00 ? 24 GLY A H    4  
ATOM 4628  H HA2  . GLY A 1 24 ? 0.013   -5.461  10.639  1.00 15.00 ? 24 GLY A HA2  4  
ATOM 4629  H HA3  . GLY A 1 24 ? -0.686  -4.632  9.254   1.00 15.00 ? 24 GLY A HA3  4  
ATOM 4630  N N    . GLY A 1 25 ? 0.204   -6.223  7.601   1.00 15.00 ? 25 GLY A N    4  
ATOM 4631  C CA   . GLY A 1 25 ? 0.700   -7.180  6.627   1.00 15.00 ? 25 GLY A CA   4  
ATOM 4632  C C    . GLY A 1 25 ? 0.658   -8.619  7.105   1.00 15.00 ? 25 GLY A C    4  
ATOM 4633  O O    . GLY A 1 25 ? -0.065  -9.441  6.543   1.00 15.00 ? 25 GLY A O    4  
ATOM 4634  H H    . GLY A 1 25 ? -0.593  -5.692  7.397   1.00 15.00 ? 25 GLY A H    4  
ATOM 4635  H HA2  . GLY A 1 25 ? 0.110   -7.101  5.732   1.00 15.00 ? 25 GLY A HA2  4  
ATOM 4636  H HA3  . GLY A 1 25 ? 1.718   -6.926  6.386   1.00 15.00 ? 25 GLY A HA3  4  
ATOM 4637  N N    . VAL A 1 26 ? 1.452   -8.923  8.133   1.00 15.00 ? 26 VAL A N    4  
ATOM 4638  C CA   . VAL A 1 26 ? 1.536   -10.276 8.696   1.00 15.00 ? 26 VAL A CA   4  
ATOM 4639  C C    . VAL A 1 26 ? 0.223   -11.044 8.561   1.00 15.00 ? 26 VAL A C    4  
ATOM 4640  O O    . VAL A 1 26 ? -0.861  -10.466 8.648   1.00 15.00 ? 26 VAL A O    4  
ATOM 4641  C CB   . VAL A 1 26 ? 1.943   -10.243 10.183  1.00 15.00 ? 26 VAL A CB   4  
ATOM 4642  C CG1  . VAL A 1 26 ? 3.444   -10.439 10.331  1.00 15.00 ? 26 VAL A CG1  4  
ATOM 4643  C CG2  . VAL A 1 26 ? 1.504   -8.939  10.831  1.00 15.00 ? 26 VAL A CG2  4  
ATOM 4644  H H    . VAL A 1 26 ? 2.010   -8.217  8.520   1.00 15.00 ? 26 VAL A H    4  
ATOM 4645  H HA   . VAL A 1 26 ? 2.303   -10.808 8.153   1.00 15.00 ? 26 VAL A HA   4  
ATOM 4646  H HB   . VAL A 1 26 ? 1.446   -11.057 10.691  1.00 15.00 ? 26 VAL A HB   4  
ATOM 4647  H HG11 . VAL A 1 26 ? 3.764   -11.255 9.702   1.00 15.00 ? 26 VAL A HG11 4  
ATOM 4648  H HG12 . VAL A 1 26 ? 3.956   -9.534  10.036  1.00 15.00 ? 26 VAL A HG12 4  
ATOM 4649  H HG13 . VAL A 1 26 ? 3.678   -10.665 11.361  1.00 15.00 ? 26 VAL A HG13 4  
ATOM 4650  H HG21 . VAL A 1 26 ? 2.314   -8.226  10.787  1.00 15.00 ? 26 VAL A HG21 4  
ATOM 4651  H HG22 . VAL A 1 26 ? 0.650   -8.545  10.301  1.00 15.00 ? 26 VAL A HG22 4  
ATOM 4652  H HG23 . VAL A 1 26 ? 1.238   -9.119  11.862  1.00 15.00 ? 26 VAL A HG23 4  
ATOM 4653  N N    . ASN A 1 27 ? 0.333   -12.352 8.345   1.00 15.00 ? 27 ASN A N    4  
ATOM 4654  C CA   . ASN A 1 27 ? -0.839  -13.207 8.194   1.00 15.00 ? 27 ASN A CA   4  
ATOM 4655  C C    . ASN A 1 27 ? -1.443  -13.554 9.553   1.00 15.00 ? 27 ASN A C    4  
ATOM 4656  O O    . ASN A 1 27 ? -1.596  -14.726 9.896   1.00 15.00 ? 27 ASN A O    4  
ATOM 4657  C CB   . ASN A 1 27 ? -0.465  -14.491 7.448   1.00 15.00 ? 27 ASN A CB   4  
ATOM 4658  C CG   . ASN A 1 27 ? 0.420   -14.228 6.244   1.00 15.00 ? 27 ASN A CG   4  
ATOM 4659  O OD1  . ASN A 1 27 ? -0.066  -14.069 5.124   1.00 15.00 ? 27 ASN A OD1  4  
ATOM 4660  N ND2  . ASN A 1 27 ? 1.728   -14.182 6.470   1.00 15.00 ? 27 ASN A ND2  4  
ATOM 4661  H H    . ASN A 1 27 ? 1.226   -12.751 8.285   1.00 15.00 ? 27 ASN A H    4  
ATOM 4662  H HA   . ASN A 1 27 ? -1.571  -12.665 7.614   1.00 15.00 ? 27 ASN A HA   4  
ATOM 4663  H HB2  . ASN A 1 27 ? 0.064   -15.150 8.121   1.00 15.00 ? 27 ASN A HB2  4  
ATOM 4664  H HB3  . ASN A 1 27 ? -1.367  -14.979 7.109   1.00 15.00 ? 27 ASN A HB3  4  
ATOM 4665  H HD21 . ASN A 1 27 ? 2.044   -14.319 7.387   1.00 15.00 ? 27 ASN A HD21 4  
ATOM 4666  H HD22 . ASN A 1 27 ? 2.323   -14.013 5.710   1.00 15.00 ? 27 ASN A HD22 4  
ATOM 4667  N N    . THR A 1 28 ? -1.785  -12.526 10.324  1.00 15.00 ? 28 THR A N    4  
ATOM 4668  C CA   . THR A 1 28 ? -2.373  -12.722 11.644  1.00 15.00 ? 28 THR A CA   4  
ATOM 4669  C C    . THR A 1 28 ? -3.275  -11.549 12.010  1.00 15.00 ? 28 THR A C    4  
ATOM 4670  O O    . THR A 1 28 ? -4.488  -11.705 12.150  1.00 15.00 ? 28 THR A O    4  
ATOM 4671  C CB   . THR A 1 28 ? -1.274  -12.886 12.696  1.00 15.00 ? 28 THR A CB   4  
ATOM 4672  O OG1  . THR A 1 28 ? -0.058  -13.290 12.092  1.00 15.00 ? 28 THR A OG1  4  
ATOM 4673  C CG2  . THR A 1 28 ? -1.616  -13.902 13.764  1.00 15.00 ? 28 THR A CG2  4  
ATOM 4674  H H    . THR A 1 28 ? -1.641  -11.615 9.997   1.00 15.00 ? 28 THR A H    4  
ATOM 4675  H HA   . THR A 1 28 ? -2.967  -13.623 11.612  1.00 15.00 ? 28 THR A HA   4  
ATOM 4676  H HB   . THR A 1 28 ? -1.112  -11.935 13.183  1.00 15.00 ? 28 THR A HB   4  
ATOM 4677  H HG1  . THR A 1 28 ? -0.186  -14.130 11.646  1.00 15.00 ? 28 THR A HG1  4  
ATOM 4678  H HG21 . THR A 1 28 ? -2.203  -13.428 14.537  1.00 15.00 ? 28 THR A HG21 4  
ATOM 4679  H HG22 . THR A 1 28 ? -2.183  -14.709 13.325  1.00 15.00 ? 28 THR A HG22 4  
ATOM 4680  H HG23 . THR A 1 28 ? -0.705  -14.293 14.193  1.00 15.00 ? 28 THR A HG23 4  
ATOM 4681  N N    . SER A 1 29 ? -2.674  -10.373 12.158  1.00 15.00 ? 29 SER A N    4  
ATOM 4682  C CA   . SER A 1 29 ? -3.424  -9.171  12.501  1.00 15.00 ? 29 SER A CA   4  
ATOM 4683  C C    . SER A 1 29 ? -4.358  -8.779  11.361  1.00 15.00 ? 29 SER A C    4  
ATOM 4684  O O    . SER A 1 29 ? -5.541  -8.516  11.576  1.00 15.00 ? 29 SER A O    4  
ATOM 4685  C CB   . SER A 1 29 ? -2.467  -8.019  12.813  1.00 15.00 ? 29 SER A CB   4  
ATOM 4686  O OG   . SER A 1 29 ? -2.930  -7.254  13.912  1.00 15.00 ? 29 SER A OG   4  
ATOM 4687  H H    . SER A 1 29 ? -1.705  -10.311 12.028  1.00 15.00 ? 29 SER A H    4  
ATOM 4688  H HA   . SER A 1 29 ? -4.014  -9.387  13.378  1.00 15.00 ? 29 SER A HA   4  
ATOM 4689  H HB2  . SER A 1 29 ? -1.493  -8.417  13.053  1.00 15.00 ? 29 SER A HB2  4  
ATOM 4690  H HB3  . SER A 1 29 ? -2.389  -7.375  11.949  1.00 15.00 ? 29 SER A HB3  4  
ATOM 4691  H HG   . SER A 1 29 ? -3.438  -6.505  13.590  1.00 15.00 ? 29 SER A HG   4  
ATOM 4692  N N    . VAL A 1 30 ? -3.817  -8.750  10.148  1.00 15.00 ? 30 VAL A N    4  
ATOM 4693  C CA   . VAL A 1 30 ? -4.598  -8.398  8.970   1.00 15.00 ? 30 VAL A CA   4  
ATOM 4694  C C    . VAL A 1 30 ? -5.267  -9.634  8.375   1.00 15.00 ? 30 VAL A C    4  
ATOM 4695  O O    . VAL A 1 30 ? -5.249  -10.708 8.975   1.00 15.00 ? 30 VAL A O    4  
ATOM 4696  C CB   . VAL A 1 30 ? -3.719  -7.727  7.896   1.00 15.00 ? 30 VAL A CB   4  
ATOM 4697  C CG1  . VAL A 1 30 ? -3.115  -6.438  8.431   1.00 15.00 ? 30 VAL A CG1  4  
ATOM 4698  C CG2  . VAL A 1 30 ? -2.630  -8.679  7.423   1.00 15.00 ? 30 VAL A CG2  4  
ATOM 4699  H H    . VAL A 1 30 ? -2.869  -8.975  10.043  1.00 15.00 ? 30 VAL A H    4  
ATOM 4700  H HA   . VAL A 1 30 ? -5.362  -7.696  9.272   1.00 15.00 ? 30 VAL A HA   4  
ATOM 4701  H HB   . VAL A 1 30 ? -4.343  -7.479  7.050   1.00 15.00 ? 30 VAL A HB   4  
ATOM 4702  H HG11 . VAL A 1 30 ? -3.905  -5.773  8.744   1.00 15.00 ? 30 VAL A HG11 4  
ATOM 4703  H HG12 . VAL A 1 30 ? -2.478  -6.662  9.274   1.00 15.00 ? 30 VAL A HG12 4  
ATOM 4704  H HG13 . VAL A 1 30 ? -2.532  -5.965  7.655   1.00 15.00 ? 30 VAL A HG13 4  
ATOM 4705  H HG21 . VAL A 1 30 ? -1.685  -8.387  7.856   1.00 15.00 ? 30 VAL A HG21 4  
ATOM 4706  H HG22 . VAL A 1 30 ? -2.871  -9.685  7.732   1.00 15.00 ? 30 VAL A HG22 4  
ATOM 4707  H HG23 . VAL A 1 30 ? -2.560  -8.639  6.347   1.00 15.00 ? 30 VAL A HG23 4  
ATOM 4708  N N    . ARG A 1 31 ? -5.859  -9.478  7.195   1.00 15.00 ? 31 ARG A N    4  
ATOM 4709  C CA   . ARG A 1 31 ? -6.533  -10.587 6.530   1.00 15.00 ? 31 ARG A CA   4  
ATOM 4710  C C    . ARG A 1 31 ? -5.588  -11.315 5.579   1.00 15.00 ? 31 ARG A C    4  
ATOM 4711  O O    . ARG A 1 31 ? -4.962  -10.700 4.716   1.00 15.00 ? 31 ARG A O    4  
ATOM 4712  C CB   . ARG A 1 31 ? -7.756  -10.085 5.762   1.00 15.00 ? 31 ARG A CB   4  
ATOM 4713  C CG   . ARG A 1 31 ? -8.555  -9.028  6.509   1.00 15.00 ? 31 ARG A CG   4  
ATOM 4714  C CD   . ARG A 1 31 ? -9.641  -8.424  5.632   1.00 15.00 ? 31 ARG A CD   4  
ATOM 4715  N NE   . ARG A 1 31 ? -10.974 -8.618  6.199   1.00 15.00 ? 31 ARG A NE   4  
ATOM 4716  C CZ   . ARG A 1 31 ? -11.375 -8.085  7.351   1.00 15.00 ? 31 ARG A CZ   4  
ATOM 4717  N NH1  . ARG A 1 31 ? -10.550 -7.325  8.061   1.00 15.00 ? 31 ARG A NH1  4  
ATOM 4718  N NH2  . ARG A 1 31 ? -12.605 -8.311  7.793   1.00 15.00 ? 31 ARG A NH2  4  
ATOM 4719  H H    . ARG A 1 31 ? -5.845  -8.599  6.763   1.00 15.00 ? 31 ARG A H    4  
ATOM 4720  H HA   . ARG A 1 31 ? -6.859  -11.279 7.292   1.00 15.00 ? 31 ARG A HA   4  
ATOM 4721  H HB2  . ARG A 1 31 ? -7.428  -9.662  4.824   1.00 15.00 ? 31 ARG A HB2  4  
ATOM 4722  H HB3  . ARG A 1 31 ? -8.409  -10.922 5.560   1.00 15.00 ? 31 ARG A HB3  4  
ATOM 4723  H HG2  . ARG A 1 31 ? -9.016  -9.483  7.372   1.00 15.00 ? 31 ARG A HG2  4  
ATOM 4724  H HG3  . ARG A 1 31 ? -7.884  -8.243  6.828   1.00 15.00 ? 31 ARG A HG3  4  
ATOM 4725  H HD2  . ARG A 1 31 ? -9.456  -7.365  5.530   1.00 15.00 ? 31 ARG A HD2  4  
ATOM 4726  H HD3  . ARG A 1 31 ? -9.603  -8.890  4.659   1.00 15.00 ? 31 ARG A HD3  4  
ATOM 4727  H HE   . ARG A 1 31 ? -11.603 -9.176  5.695   1.00 15.00 ? 31 ARG A HE   4  
ATOM 4728  H HH11 . ARG A 1 31 ? -9.622  -7.151  7.733   1.00 15.00 ? 31 ARG A HH11 4  
ATOM 4729  H HH12 . ARG A 1 31 ? -10.858 -6.927  8.925   1.00 15.00 ? 31 ARG A HH12 4  
ATOM 4730  H HH21 . ARG A 1 31 ? -13.230 -8.883  7.262   1.00 15.00 ? 31 ARG A HH21 4  
ATOM 4731  H HH22 . ARG A 1 31 ? -12.906 -7.910  8.659   1.00 15.00 ? 31 ARG A HH22 4  
ATOM 4732  N N    . HIS A 1 32 ? -5.497  -12.630 5.744   1.00 15.00 ? 32 HIS A N    4  
ATOM 4733  C CA   . HIS A 1 32 ? -4.638  -13.457 4.903   1.00 15.00 ? 32 HIS A CA   4  
ATOM 4734  C C    . HIS A 1 32 ? -3.178  -13.003 4.976   1.00 15.00 ? 32 HIS A C    4  
ATOM 4735  O O    . HIS A 1 32 ? -2.391  -13.548 5.749   1.00 15.00 ? 32 HIS A O    4  
ATOM 4736  C CB   . HIS A 1 32 ? -5.133  -13.432 3.453   1.00 15.00 ? 32 HIS A CB   4  
ATOM 4737  C CG   . HIS A 1 32 ? -6.551  -13.884 3.297   1.00 15.00 ? 32 HIS A CG   4  
ATOM 4738  N ND1  . HIS A 1 32 ? -7.515  -13.129 2.663   1.00 15.00 ? 32 HIS A ND1  4  
ATOM 4739  C CD2  . HIS A 1 32 ? -7.169  -15.021 3.697   1.00 15.00 ? 32 HIS A CD2  4  
ATOM 4740  C CE1  . HIS A 1 32 ? -8.664  -13.780 2.680   1.00 15.00 ? 32 HIS A CE1  4  
ATOM 4741  N NE2  . HIS A 1 32 ? -8.481  -14.931 3.301   1.00 15.00 ? 32 HIS A NE2  4  
ATOM 4742  H H    . HIS A 1 32 ? -6.028  -13.057 6.447   1.00 15.00 ? 32 HIS A H    4  
ATOM 4743  H HA   . HIS A 1 32 ? -4.700  -14.470 5.272   1.00 15.00 ? 32 HIS A HA   4  
ATOM 4744  H HB2  . HIS A 1 32 ? -5.065  -12.425 3.073   1.00 15.00 ? 32 HIS A HB2  4  
ATOM 4745  H HB3  . HIS A 1 32 ? -4.508  -14.081 2.856   1.00 15.00 ? 32 HIS A HB3  4  
ATOM 4746  H HD1  . HIS A 1 32 ? -7.378  -12.246 2.260   1.00 15.00 ? 32 HIS A HD1  4  
ATOM 4747  H HD2  . HIS A 1 32 ? -6.715  -15.845 4.228   1.00 15.00 ? 32 HIS A HD2  4  
ATOM 4748  H HE1  . HIS A 1 32 ? -9.595  -13.431 2.258   1.00 15.00 ? 32 HIS A HE1  4  
ATOM 4749  H HE2  . HIS A 1 32 ? -9.154  -15.637 3.392   1.00 15.00 ? 32 HIS A HE2  4  
ATOM 4750  N N    . GLY A 1 33 ? -2.821  -12.011 4.164   1.00 15.00 ? 33 GLY A N    4  
ATOM 4751  C CA   . GLY A 1 33 ? -1.457  -11.510 4.150   1.00 15.00 ? 33 GLY A CA   4  
ATOM 4752  C C    . GLY A 1 33 ? -1.332  -10.206 3.389   1.00 15.00 ? 33 GLY A C    4  
ATOM 4753  O O    . GLY A 1 33 ? -0.261  -9.877  2.879   1.00 15.00 ? 33 GLY A O    4  
ATOM 4754  H H    . GLY A 1 33 ? -3.488  -11.618 3.566   1.00 15.00 ? 33 GLY A H    4  
ATOM 4755  H HA2  . GLY A 1 33 ? -1.121  -11.352 5.169   1.00 15.00 ? 33 GLY A HA2  4  
ATOM 4756  H HA3  . GLY A 1 33 ? -0.822  -12.248 3.686   1.00 15.00 ? 33 GLY A HA3  4  
ATOM 4757  N N    . GLY A 1 34 ? -2.424  -9.450  3.325   1.00 15.00 ? 34 GLY A N    4  
ATOM 4758  C CA   . GLY A 1 34 ? -2.398  -8.175  2.639   1.00 15.00 ? 34 GLY A CA   4  
ATOM 4759  C C    . GLY A 1 34 ? -1.872  -7.089  3.547   1.00 15.00 ? 34 GLY A C    4  
ATOM 4760  O O    . GLY A 1 34 ? -2.050  -7.164  4.763   1.00 15.00 ? 34 GLY A O    4  
ATOM 4761  H H    . GLY A 1 34 ? -3.247  -9.751  3.762   1.00 15.00 ? 34 GLY A H    4  
ATOM 4762  H HA2  . GLY A 1 34 ? -1.760  -8.252  1.769   1.00 15.00 ? 34 GLY A HA2  4  
ATOM 4763  H HA3  . GLY A 1 34 ? -3.398  -7.919  2.325   1.00 15.00 ? 34 GLY A HA3  4  
ATOM 4764  N N    . ILE A 1 35 ? -1.212  -6.087  2.985   1.00 15.00 ? 35 ILE A N    4  
ATOM 4765  C CA   . ILE A 1 35 ? -0.666  -5.021  3.810   1.00 15.00 ? 35 ILE A CA   4  
ATOM 4766  C C    . ILE A 1 35 ? -1.675  -3.907  4.032   1.00 15.00 ? 35 ILE A C    4  
ATOM 4767  O O    . ILE A 1 35 ? -2.569  -3.680  3.218   1.00 15.00 ? 35 ILE A O    4  
ATOM 4768  C CB   . ILE A 1 35 ? 0.645   -4.445  3.224   1.00 15.00 ? 35 ILE A CB   4  
ATOM 4769  C CG1  . ILE A 1 35 ? 1.768   -4.549  4.267   1.00 15.00 ? 35 ILE A CG1  4  
ATOM 4770  C CG2  . ILE A 1 35 ? 0.462   -3.005  2.747   1.00 15.00 ? 35 ILE A CG2  4  
ATOM 4771  C CD1  . ILE A 1 35 ? 2.625   -3.307  4.399   1.00 15.00 ? 35 ILE A CD1  4  
ATOM 4772  H H    . ILE A 1 35 ? -1.082  -6.069  2.009   1.00 15.00 ? 35 ILE A H    4  
ATOM 4773  H HA   . ILE A 1 35 ? -0.432  -5.455  4.772   1.00 15.00 ? 35 ILE A HA   4  
ATOM 4774  H HB   . ILE A 1 35 ? 0.910   -5.040  2.371   1.00 15.00 ? 35 ILE A HB   4  
ATOM 4775  H HG12 . ILE A 1 35 ? 1.332   -4.747  5.234   1.00 15.00 ? 35 ILE A HG12 4  
ATOM 4776  H HG13 . ILE A 1 35 ? 2.417   -5.371  4.001   1.00 15.00 ? 35 ILE A HG13 4  
ATOM 4777  H HG21 . ILE A 1 35 ? -0.391  -2.949  2.089   1.00 15.00 ? 35 ILE A HG21 4  
ATOM 4778  H HG22 . ILE A 1 35 ? 0.302   -2.361  3.599   1.00 15.00 ? 35 ILE A HG22 4  
ATOM 4779  H HG23 . ILE A 1 35 ? 1.348   -2.688  2.217   1.00 15.00 ? 35 ILE A HG23 4  
ATOM 4780  H HD11 . ILE A 1 35 ? 3.541   -3.555  4.913   1.00 15.00 ? 35 ILE A HD11 4  
ATOM 4781  H HD12 . ILE A 1 35 ? 2.856   -2.922  3.417   1.00 15.00 ? 35 ILE A HD12 4  
ATOM 4782  H HD13 . ILE A 1 35 ? 2.087   -2.558  4.963   1.00 15.00 ? 35 ILE A HD13 4  
ATOM 4783  N N    . TYR A 1 36 ? -1.507  -3.214  5.145   1.00 15.00 ? 36 TYR A N    4  
ATOM 4784  C CA   . TYR A 1 36 ? -2.378  -2.107  5.508   1.00 15.00 ? 36 TYR A CA   4  
ATOM 4785  C C    . TYR A 1 36 ? -1.553  -0.979  6.102   1.00 15.00 ? 36 TYR A C    4  
ATOM 4786  O O    . TYR A 1 36 ? -1.047  -1.090  7.219   1.00 15.00 ? 36 TYR A O    4  
ATOM 4787  C CB   . TYR A 1 36 ? -3.438  -2.563  6.511   1.00 15.00 ? 36 TYR A CB   4  
ATOM 4788  C CG   . TYR A 1 36 ? -4.415  -3.571  5.950   1.00 15.00 ? 36 TYR A CG   4  
ATOM 4789  C CD1  . TYR A 1 36 ? -4.024  -4.880  5.695   1.00 15.00 ? 36 TYR A CD1  4  
ATOM 4790  C CD2  . TYR A 1 36 ? -5.728  -3.213  5.677   1.00 15.00 ? 36 TYR A CD2  4  
ATOM 4791  C CE1  . TYR A 1 36 ? -4.915  -5.803  5.185   1.00 15.00 ? 36 TYR A CE1  4  
ATOM 4792  C CE2  . TYR A 1 36 ? -6.626  -4.130  5.166   1.00 15.00 ? 36 TYR A CE2  4  
ATOM 4793  C CZ   . TYR A 1 36 ? -6.215  -5.424  4.922   1.00 15.00 ? 36 TYR A CZ   4  
ATOM 4794  O OH   . TYR A 1 36 ? -7.106  -6.341  4.414   1.00 15.00 ? 36 TYR A OH   4  
ATOM 4795  H H    . TYR A 1 36 ? -0.763  -3.452  5.739   1.00 15.00 ? 36 TYR A H    4  
ATOM 4796  H HA   . TYR A 1 36 ? -2.863  -1.753  4.610   1.00 15.00 ? 36 TYR A HA   4  
ATOM 4797  H HB2  . TYR A 1 36 ? -2.949  -3.016  7.360   1.00 15.00 ? 36 TYR A HB2  4  
ATOM 4798  H HB3  . TYR A 1 36 ? -4.002  -1.704  6.843   1.00 15.00 ? 36 TYR A HB3  4  
ATOM 4799  H HD1  . TYR A 1 36 ? -3.006  -5.174  5.901   1.00 15.00 ? 36 TYR A HD1  4  
ATOM 4800  H HD2  . TYR A 1 36 ? -6.047  -2.199  5.869   1.00 15.00 ? 36 TYR A HD2  4  
ATOM 4801  H HE1  . TYR A 1 36 ? -4.592  -6.814  4.994   1.00 15.00 ? 36 TYR A HE1  4  
ATOM 4802  H HE2  . TYR A 1 36 ? -7.643  -3.832  4.960   1.00 15.00 ? 36 TYR A HE2  4  
ATOM 4803  H HH   . TYR A 1 36 ? -7.970  -6.199  4.806   1.00 15.00 ? 36 TYR A HH   4  
ATOM 4804  N N    . VAL A 1 37 ? -1.403  0.100   5.347   1.00 15.00 ? 37 VAL A N    4  
ATOM 4805  C CA   . VAL A 1 37 ? -0.613  1.235   5.813   1.00 15.00 ? 37 VAL A CA   4  
ATOM 4806  C C    . VAL A 1 37 ? -1.125  1.753   7.151   1.00 15.00 ? 37 VAL A C    4  
ATOM 4807  O O    . VAL A 1 37 ? -2.311  1.660   7.454   1.00 15.00 ? 37 VAL A O    4  
ATOM 4808  C CB   . VAL A 1 37 ? -0.574  2.404   4.784   1.00 15.00 ? 37 VAL A CB   4  
ATOM 4809  C CG1  . VAL A 1 37 ? -0.743  1.906   3.363   1.00 15.00 ? 37 VAL A CG1  4  
ATOM 4810  C CG2  . VAL A 1 37 ? -1.610  3.475   5.076   1.00 15.00 ? 37 VAL A CG2  4  
ATOM 4811  H H    . VAL A 1 37 ? -1.822  0.126   4.459   1.00 15.00 ? 37 VAL A H    4  
ATOM 4812  H HA   . VAL A 1 37 ? 0.400   0.884   5.952   1.00 15.00 ? 37 VAL A HA   4  
ATOM 4813  H HB   . VAL A 1 37 ? 0.386   2.861   4.854   1.00 15.00 ? 37 VAL A HB   4  
ATOM 4814  H HG11 . VAL A 1 37 ? -0.470  0.864   3.308   1.00 15.00 ? 37 VAL A HG11 4  
ATOM 4815  H HG12 . VAL A 1 37 ? -1.773  2.028   3.070   1.00 15.00 ? 37 VAL A HG12 4  
ATOM 4816  H HG13 . VAL A 1 37 ? -0.111  2.482   2.704   1.00 15.00 ? 37 VAL A HG13 4  
ATOM 4817  H HG21 . VAL A 1 37 ? -2.587  3.085   4.873   1.00 15.00 ? 37 VAL A HG21 4  
ATOM 4818  H HG22 . VAL A 1 37 ? -1.546  3.776   6.110   1.00 15.00 ? 37 VAL A HG22 4  
ATOM 4819  H HG23 . VAL A 1 37 ? -1.429  4.331   4.443   1.00 15.00 ? 37 VAL A HG23 4  
ATOM 4820  N N    . LYS A 1 38 ? -0.228  2.326   7.937   1.00 15.00 ? 38 LYS A N    4  
ATOM 4821  C CA   . LYS A 1 38 ? -0.608  2.889   9.219   1.00 15.00 ? 38 LYS A CA   4  
ATOM 4822  C C    . LYS A 1 38 ? -1.137  4.297   8.990   1.00 15.00 ? 38 LYS A C    4  
ATOM 4823  O O    . LYS A 1 38 ? -2.182  4.673   9.520   1.00 15.00 ? 38 LYS A O    4  
ATOM 4824  C CB   . LYS A 1 38 ? 0.578   2.897   10.189  1.00 15.00 ? 38 LYS A CB   4  
ATOM 4825  C CG   . LYS A 1 38 ? 0.283   3.595   11.507  1.00 15.00 ? 38 LYS A CG   4  
ATOM 4826  C CD   . LYS A 1 38 ? -0.548  2.717   12.428  1.00 15.00 ? 38 LYS A CD   4  
ATOM 4827  C CE   . LYS A 1 38 ? -2.037  2.929   12.210  1.00 15.00 ? 38 LYS A CE   4  
ATOM 4828  N NZ   . LYS A 1 38 ? -2.680  1.750   11.566  1.00 15.00 ? 38 LYS A NZ   4  
ATOM 4829  H H    . LYS A 1 38 ? 0.699   2.393   7.638   1.00 15.00 ? 38 LYS A H    4  
ATOM 4830  H HA   . LYS A 1 38 ? -1.401  2.279   9.628   1.00 15.00 ? 38 LYS A HA   4  
ATOM 4831  H HB2  . LYS A 1 38 ? 0.857   1.876   10.403  1.00 15.00 ? 38 LYS A HB2  4  
ATOM 4832  H HB3  . LYS A 1 38 ? 1.411   3.396   9.721   1.00 15.00 ? 38 LYS A HB3  4  
ATOM 4833  H HG2  . LYS A 1 38 ? 1.217   3.830   11.995  1.00 15.00 ? 38 LYS A HG2  4  
ATOM 4834  H HG3  . LYS A 1 38 ? -0.260  4.507   11.307  1.00 15.00 ? 38 LYS A HG3  4  
ATOM 4835  H HD2  . LYS A 1 38 ? -0.310  1.681   12.233  1.00 15.00 ? 38 LYS A HD2  4  
ATOM 4836  H HD3  . LYS A 1 38 ? -0.305  2.957   13.453  1.00 15.00 ? 38 LYS A HD3  4  
ATOM 4837  H HE2  . LYS A 1 38 ? -2.507  3.105   13.166  1.00 15.00 ? 38 LYS A HE2  4  
ATOM 4838  H HE3  . LYS A 1 38 ? -2.176  3.794   11.577  1.00 15.00 ? 38 LYS A HE3  4  
ATOM 4839  H HZ1  . LYS A 1 38 ? -3.312  2.060   10.801  1.00 15.00 ? 38 LYS A HZ1  4  
ATOM 4840  H HZ2  . LYS A 1 38 ? -1.955  1.120   11.167  1.00 15.00 ? 38 LYS A HZ2  4  
ATOM 4841  H HZ3  . LYS A 1 38 ? -3.236  1.219   12.267  1.00 15.00 ? 38 LYS A HZ3  4  
ATOM 4842  N N    . ALA A 1 39 ? -0.416  5.063   8.170   1.00 15.00 ? 39 ALA A N    4  
ATOM 4843  C CA   . ALA A 1 39 ? -0.820  6.418   7.831   1.00 15.00 ? 39 ALA A CA   4  
ATOM 4844  C C    . ALA A 1 39 ? 0.079   6.980   6.739   1.00 15.00 ? 39 ALA A C    4  
ATOM 4845  O O    . ALA A 1 39 ? 1.085   6.369   6.388   1.00 15.00 ? 39 ALA A O    4  
ATOM 4846  C CB   . ALA A 1 39 ? -0.805  7.305   9.061   1.00 15.00 ? 39 ALA A CB   4  
ATOM 4847  H H    . ALA A 1 39 ? 0.402   4.696   7.760   1.00 15.00 ? 39 ALA A H    4  
ATOM 4848  H HA   . ALA A 1 39 ? -1.833  6.377   7.457   1.00 15.00 ? 39 ALA A HA   4  
ATOM 4849  H HB1  . ALA A 1 39 ? -1.808  7.381   9.455   1.00 15.00 ? 39 ALA A HB1  4  
ATOM 4850  H HB2  . ALA A 1 39 ? -0.156  6.875   9.808   1.00 15.00 ? 39 ALA A HB2  4  
ATOM 4851  H HB3  . ALA A 1 39 ? -0.447  8.287   8.792   1.00 15.00 ? 39 ALA A HB3  4  
ATOM 4852  N N    . VAL A 1 40 ? -0.271  8.152   6.222   1.00 15.00 ? 40 VAL A N    4  
ATOM 4853  C CA   . VAL A 1 40 ? 0.532   8.794   5.182   1.00 15.00 ? 40 VAL A CA   4  
ATOM 4854  C C    . VAL A 1 40 ? 1.460   9.816   5.825   1.00 15.00 ? 40 VAL A C    4  
ATOM 4855  O O    . VAL A 1 40 ? 1.011   10.834  6.351   1.00 15.00 ? 40 VAL A O    4  
ATOM 4856  C CB   . VAL A 1 40 ? -0.335  9.488   4.102   1.00 15.00 ? 40 VAL A CB   4  
ATOM 4857  C CG1  . VAL A 1 40 ? -0.248  8.736   2.782   1.00 15.00 ? 40 VAL A CG1  4  
ATOM 4858  C CG2  . VAL A 1 40 ? -1.784  9.608   4.551   1.00 15.00 ? 40 VAL A CG2  4  
ATOM 4859  H H    . VAL A 1 40 ? -1.074  8.602   6.558   1.00 15.00 ? 40 VAL A H    4  
ATOM 4860  H HA   . VAL A 1 40 ? 1.128   8.026   4.706   1.00 15.00 ? 40 VAL A HA   4  
ATOM 4861  H HB   . VAL A 1 40 ? 0.052   10.484  3.945   1.00 15.00 ? 40 VAL A HB   4  
ATOM 4862  H HG11 . VAL A 1 40 ? 0.789   8.583   2.522   1.00 15.00 ? 40 VAL A HG11 4  
ATOM 4863  H HG12 . VAL A 1 40 ? -0.741  7.778   2.877   1.00 15.00 ? 40 VAL A HG12 4  
ATOM 4864  H HG13 . VAL A 1 40 ? -0.731  9.313   2.007   1.00 15.00 ? 40 VAL A HG13 4  
ATOM 4865  H HG21 . VAL A 1 40 ? -2.390  9.949   3.726   1.00 15.00 ? 40 VAL A HG21 4  
ATOM 4866  H HG22 . VAL A 1 40 ? -2.136  8.642   4.882   1.00 15.00 ? 40 VAL A HG22 4  
ATOM 4867  H HG23 . VAL A 1 40 ? -1.851  10.314  5.365   1.00 15.00 ? 40 VAL A HG23 4  
ATOM 4868  N N    . ILE A 1 41 ? 2.751   9.507   5.828   1.00 15.00 ? 41 ILE A N    4  
ATOM 4869  C CA   . ILE A 1 41 ? 3.739   10.367  6.465   1.00 15.00 ? 41 ILE A CA   4  
ATOM 4870  C C    . ILE A 1 41 ? 4.112   11.592  5.628   1.00 15.00 ? 41 ILE A C    4  
ATOM 4871  O O    . ILE A 1 41 ? 4.691   11.470  4.546   1.00 15.00 ? 41 ILE A O    4  
ATOM 4872  C CB   . ILE A 1 41 ? 5.004   9.555   6.854   1.00 15.00 ? 41 ILE A CB   4  
ATOM 4873  C CG1  . ILE A 1 41 ? 4.718   8.642   8.056   1.00 15.00 ? 41 ILE A CG1  4  
ATOM 4874  C CG2  . ILE A 1 41 ? 6.180   10.470  7.164   1.00 15.00 ? 41 ILE A CG2  4  
ATOM 4875  C CD1  . ILE A 1 41 ? 3.299   8.113   8.117   1.00 15.00 ? 41 ILE A CD1  4  
ATOM 4876  H H    . ILE A 1 41 ? 3.041   8.660   5.429   1.00 15.00 ? 41 ILE A H    4  
ATOM 4877  H HA   . ILE A 1 41 ? 3.292   10.720  7.366   1.00 15.00 ? 41 ILE A HA   4  
ATOM 4878  H HB   . ILE A 1 41 ? 5.279   8.941   6.016   1.00 15.00 ? 41 ILE A HB   4  
ATOM 4879  H HG12 . ILE A 1 41 ? 5.381   7.790   8.014   1.00 15.00 ? 41 ILE A HG12 4  
ATOM 4880  H HG13 . ILE A 1 41 ? 4.906   9.192   8.967   1.00 15.00 ? 41 ILE A HG13 4  
ATOM 4881  H HG21 . ILE A 1 41 ? 5.814   11.452  7.425   1.00 15.00 ? 41 ILE A HG21 4  
ATOM 4882  H HG22 . ILE A 1 41 ? 6.742   10.061  7.991   1.00 15.00 ? 41 ILE A HG22 4  
ATOM 4883  H HG23 . ILE A 1 41 ? 6.818   10.540  6.295   1.00 15.00 ? 41 ILE A HG23 4  
ATOM 4884  H HD11 . ILE A 1 41 ? 2.617   8.932   8.286   1.00 15.00 ? 41 ILE A HD11 4  
ATOM 4885  H HD12 . ILE A 1 41 ? 3.056   7.628   7.182   1.00 15.00 ? 41 ILE A HD12 4  
ATOM 4886  H HD13 . ILE A 1 41 ? 3.214   7.401   8.924   1.00 15.00 ? 41 ILE A HD13 4  
ATOM 4887  N N    . PRO A 1 42 ? 3.780   12.800  6.150   1.00 15.00 ? 42 PRO A N    4  
ATOM 4888  C CA   . PRO A 1 42 ? 4.069   14.081  5.487   1.00 15.00 ? 42 PRO A CA   4  
ATOM 4889  C C    . PRO A 1 42 ? 5.565   14.328  5.294   1.00 15.00 ? 42 PRO A C    4  
ATOM 4890  O O    . PRO A 1 42 ? 6.111   15.303  5.810   1.00 15.00 ? 42 PRO A O    4  
ATOM 4891  C CB   . PRO A 1 42 ? 3.487   15.132  6.444   1.00 15.00 ? 42 PRO A CB   4  
ATOM 4892  C CG   . PRO A 1 42 ? 2.529   14.388  7.305   1.00 15.00 ? 42 PRO A CG   4  
ATOM 4893  C CD   . PRO A 1 42 ? 3.095   13.007  7.440   1.00 15.00 ? 42 PRO A CD   4  
ATOM 4894  H HA   . PRO A 1 42 ? 3.567   14.153  4.539   1.00 15.00 ? 42 PRO A HA   4  
ATOM 4895  H HB2  . PRO A 1 42 ? 4.283   15.570  7.028   1.00 15.00 ? 42 PRO A HB2  4  
ATOM 4896  H HB3  . PRO A 1 42 ? 2.988   15.902  5.875   1.00 15.00 ? 42 PRO A HB3  4  
ATOM 4897  H HG2  . PRO A 1 42 ? 2.459   14.862  8.273   1.00 15.00 ? 42 PRO A HG2  4  
ATOM 4898  H HG3  . PRO A 1 42 ? 1.559   14.352  6.831   1.00 15.00 ? 42 PRO A HG3  4  
ATOM 4899  H HD2  . PRO A 1 42 ? 3.793   12.963  8.262   1.00 15.00 ? 42 PRO A HD2  4  
ATOM 4900  H HD3  . PRO A 1 42 ? 2.301   12.288  7.575   1.00 15.00 ? 42 PRO A HD3  4  
ATOM 4901  N N    . GLN A 1 43 ? 6.227   13.447  4.552   1.00 15.00 ? 43 GLN A N    4  
ATOM 4902  C CA   . GLN A 1 43 ? 7.652   13.585  4.304   1.00 15.00 ? 43 GLN A CA   4  
ATOM 4903  C C    . GLN A 1 43 ? 8.030   13.054  2.922   1.00 15.00 ? 43 GLN A C    4  
ATOM 4904  O O    . GLN A 1 43 ? 8.746   13.716  2.170   1.00 15.00 ? 43 GLN A O    4  
ATOM 4905  C CB   . GLN A 1 43 ? 8.445   12.846  5.385   1.00 15.00 ? 43 GLN A CB   4  
ATOM 4906  C CG   . GLN A 1 43 ? 9.937   12.775  5.108   1.00 15.00 ? 43 GLN A CG   4  
ATOM 4907  C CD   . GLN A 1 43 ? 10.756  12.591  6.371   1.00 15.00 ? 43 GLN A CD   4  
ATOM 4908  O OE1  . GLN A 1 43 ? 11.561  11.665  6.472   1.00 15.00 ? 43 GLN A OE1  4  
ATOM 4909  N NE2  . GLN A 1 43 ? 10.555  13.474  7.342   1.00 15.00 ? 43 GLN A NE2  4  
ATOM 4910  H H    . GLN A 1 43 ? 5.748   12.686  4.165   1.00 15.00 ? 43 GLN A H    4  
ATOM 4911  H HA   . GLN A 1 43 ? 7.895   14.636  4.350   1.00 15.00 ? 43 GLN A HA   4  
ATOM 4912  H HB2  . GLN A 1 43 ? 8.299   13.349  6.329   1.00 15.00 ? 43 GLN A HB2  4  
ATOM 4913  H HB3  . GLN A 1 43 ? 8.067   11.837  5.463   1.00 15.00 ? 43 GLN A HB3  4  
ATOM 4914  H HG2  . GLN A 1 43 ? 10.126  11.942  4.449   1.00 15.00 ? 43 GLN A HG2  4  
ATOM 4915  H HG3  . GLN A 1 43 ? 10.243  13.692  4.627   1.00 15.00 ? 43 GLN A HG3  4  
ATOM 4916  H HE21 . GLN A 1 43 ? 9.899   14.186  7.191   1.00 15.00 ? 43 GLN A HE21 4  
ATOM 4917  H HE22 . GLN A 1 43 ? 11.072  13.379  8.169   1.00 15.00 ? 43 GLN A HE22 4  
ATOM 4918  N N    . GLY A 1 44 ? 7.561   11.853  2.596   1.00 15.00 ? 44 GLY A N    4  
ATOM 4919  C CA   . GLY A 1 44 ? 7.885   11.261  1.307   1.00 15.00 ? 44 GLY A CA   4  
ATOM 4920  C C    . GLY A 1 44 ? 6.923   11.644  0.198   1.00 15.00 ? 44 GLY A C    4  
ATOM 4921  O O    . GLY A 1 44 ? 5.862   12.217  0.443   1.00 15.00 ? 44 GLY A O    4  
ATOM 4922  H H    . GLY A 1 44 ? 7.000   11.362  3.237   1.00 15.00 ? 44 GLY A H    4  
ATOM 4923  H HA2  . GLY A 1 44 ? 8.875   11.585  1.023   1.00 15.00 ? 44 GLY A HA2  4  
ATOM 4924  H HA3  . GLY A 1 44 ? 7.894   10.190  1.404   1.00 15.00 ? 44 GLY A HA3  4  
ATOM 4925  N N    . ALA A 1 45 ? 7.310   11.313  -1.028  1.00 15.00 ? 45 ALA A N    4  
ATOM 4926  C CA   . ALA A 1 45 ? 6.511   11.612  -2.216  1.00 15.00 ? 45 ALA A CA   4  
ATOM 4927  C C    . ALA A 1 45 ? 5.113   11.002  -2.156  1.00 15.00 ? 45 ALA A C    4  
ATOM 4928  O O    . ALA A 1 45 ? 4.244   11.361  -2.950  1.00 15.00 ? 45 ALA A O    4  
ATOM 4929  C CB   . ALA A 1 45 ? 7.231   11.122  -3.459  1.00 15.00 ? 45 ALA A CB   4  
ATOM 4930  H H    . ALA A 1 45 ? 8.166   10.852  -1.139  1.00 15.00 ? 45 ALA A H    4  
ATOM 4931  H HA   . ALA A 1 45 ? 6.419   12.685  -2.291  1.00 15.00 ? 45 ALA A HA   4  
ATOM 4932  H HB1  . ALA A 1 45 ? 7.075   11.822  -4.267  1.00 15.00 ? 45 ALA A HB1  4  
ATOM 4933  H HB2  . ALA A 1 45 ? 8.287   11.038  -3.252  1.00 15.00 ? 45 ALA A HB2  4  
ATOM 4934  H HB3  . ALA A 1 45 ? 6.841   10.154  -3.740  1.00 15.00 ? 45 ALA A HB3  4  
ATOM 4935  N N    . ALA A 1 46 ? 4.893   10.079  -1.228  1.00 15.00 ? 46 ALA A N    4  
ATOM 4936  C CA   . ALA A 1 46 ? 3.591   9.437   -1.104  1.00 15.00 ? 46 ALA A CA   4  
ATOM 4937  C C    . ALA A 1 46 ? 2.566   10.405  -0.531  1.00 15.00 ? 46 ALA A C    4  
ATOM 4938  O O    . ALA A 1 46 ? 1.528   10.662  -1.149  1.00 15.00 ? 46 ALA A O    4  
ATOM 4939  C CB   . ALA A 1 46 ? 3.694   8.198   -0.229  1.00 15.00 ? 46 ALA A CB   4  
ATOM 4940  H H    . ALA A 1 46 ? 5.616   9.818   -0.622  1.00 15.00 ? 46 ALA A H    4  
ATOM 4941  H HA   . ALA A 1 46 ? 3.273   9.130   -2.089  1.00 15.00 ? 46 ALA A HA   4  
ATOM 4942  H HB1  . ALA A 1 46 ? 2.830   7.572   -0.390  1.00 15.00 ? 46 ALA A HB1  4  
ATOM 4943  H HB2  . ALA A 1 46 ? 4.588   7.651   -0.485  1.00 15.00 ? 46 ALA A HB2  4  
ATOM 4944  H HB3  . ALA A 1 46 ? 3.737   8.494   0.810   1.00 15.00 ? 46 ALA A HB3  4  
ATOM 4945  N N    . GLU A 1 47 ? 2.871   10.949  0.646   1.00 15.00 ? 47 GLU A N    4  
ATOM 4946  C CA   . GLU A 1 47 ? 1.986   11.909  1.296   1.00 15.00 ? 47 GLU A CA   4  
ATOM 4947  C C    . GLU A 1 47 ? 1.738   13.107  0.380   1.00 15.00 ? 47 GLU A C    4  
ATOM 4948  O O    . GLU A 1 47 ? 0.613   13.593  0.262   1.00 15.00 ? 47 GLU A O    4  
ATOM 4949  C CB   . GLU A 1 47 ? 2.590   12.390  2.625   1.00 15.00 ? 47 GLU A CB   4  
ATOM 4950  C CG   . GLU A 1 47 ? 3.823   13.252  2.423   1.00 15.00 ? 47 GLU A CG   4  
ATOM 4951  C CD   . GLU A 1 47 ? 3.487   14.715  2.204   1.00 15.00 ? 47 GLU A CD   4  
ATOM 4952  O OE1  . GLU A 1 47 ? 2.376   15.133  2.593   1.00 15.00 ? 47 GLU A OE1  4  
ATOM 4953  O OE2  . GLU A 1 47 ? 4.335   15.442  1.646   1.00 15.00 ? 47 GLU A OE2  4  
ATOM 4954  H H    . GLU A 1 47 ? 3.724   10.715  1.075   1.00 15.00 ? 47 GLU A H    4  
ATOM 4955  H HA   . GLU A 1 47 ? 1.041   11.417  1.486   1.00 15.00 ? 47 GLU A HA   4  
ATOM 4956  H HB2  . GLU A 1 47 ? 1.852   12.976  3.147   1.00 15.00 ? 47 GLU A HB2  4  
ATOM 4957  H HB3  . GLU A 1 47 ? 2.863   11.536  3.247   1.00 15.00 ? 47 GLU A HB3  4  
ATOM 4958  H HG2  . GLU A 1 47 ? 4.448   13.170  3.289   1.00 15.00 ? 47 GLU A HG2  4  
ATOM 4959  H HG3  . GLU A 1 47 ? 4.358   12.890  1.564   1.00 15.00 ? 47 GLU A HG3  4  
ATOM 4960  N N    . SER A 1 48 ? 2.810   13.582  -0.260  1.00 15.00 ? 48 SER A N    4  
ATOM 4961  C CA   . SER A 1 48 ? 2.730   14.729  -1.160  1.00 15.00 ? 48 SER A CA   4  
ATOM 4962  C C    . SER A 1 48 ? 1.665   14.503  -2.219  1.00 15.00 ? 48 SER A C    4  
ATOM 4963  O O    . SER A 1 48 ? 0.604   15.128  -2.189  1.00 15.00 ? 48 SER A O    4  
ATOM 4964  C CB   . SER A 1 48 ? 4.086   14.982  -1.823  1.00 15.00 ? 48 SER A CB   4  
ATOM 4965  O OG   . SER A 1 48 ? 4.695   16.154  -1.308  1.00 15.00 ? 48 SER A OG   4  
ATOM 4966  H H    . SER A 1 48 ? 3.678   13.152  -0.117  1.00 15.00 ? 48 SER A H    4  
ATOM 4967  H HA   . SER A 1 48 ? 2.459   15.594  -0.572  1.00 15.00 ? 48 SER A HA   4  
ATOM 4968  H HB2  . SER A 1 48 ? 4.738   14.142  -1.636  1.00 15.00 ? 48 SER A HB2  4  
ATOM 4969  H HB3  . SER A 1 48 ? 3.949   15.101  -2.888  1.00 15.00 ? 48 SER A HB3  4  
ATOM 4970  H HG   . SER A 1 48 ? 4.203   16.925  -1.598  1.00 15.00 ? 48 SER A HG   4  
ATOM 4971  N N    . ASP A 1 49 ? 1.939   13.592  -3.144  1.00 15.00 ? 49 ASP A N    4  
ATOM 4972  C CA   . ASP A 1 49 ? 0.982   13.277  -4.191  1.00 15.00 ? 49 ASP A CA   4  
ATOM 4973  C C    . ASP A 1 49 ? -0.318  12.813  -3.552  1.00 15.00 ? 49 ASP A C    4  
ATOM 4974  O O    . ASP A 1 49 ? -1.410  13.184  -3.984  1.00 15.00 ? 49 ASP A O    4  
ATOM 4975  C CB   . ASP A 1 49 ? 1.534   12.190  -5.115  1.00 15.00 ? 49 ASP A CB   4  
ATOM 4976  C CG   . ASP A 1 49 ? 2.219   12.765  -6.340  1.00 15.00 ? 49 ASP A CG   4  
ATOM 4977  O OD1  . ASP A 1 49 ? 3.153   13.577  -6.171  1.00 15.00 ? 49 ASP A OD1  4  
ATOM 4978  O OD2  . ASP A 1 49 ? 1.822   12.404  -7.467  1.00 15.00 ? 49 ASP A OD2  4  
ATOM 4979  H H    . ASP A 1 49 ? 2.793   13.112  -3.111  1.00 15.00 ? 49 ASP A H    4  
ATOM 4980  H HA   . ASP A 1 49 ? 0.798   14.173  -4.762  1.00 15.00 ? 49 ASP A HA   4  
ATOM 4981  H HB2  . ASP A 1 49 ? 2.252   11.594  -4.572  1.00 15.00 ? 49 ASP A HB2  4  
ATOM 4982  H HB3  . ASP A 1 49 ? 0.722   11.558  -5.443  1.00 15.00 ? 49 ASP A HB3  4  
ATOM 4983  N N    . GLY A 1 50 ? -0.181  12.005  -2.506  1.00 15.00 ? 50 GLY A N    4  
ATOM 4984  C CA   . GLY A 1 50 ? -1.337  11.504  -1.796  1.00 15.00 ? 50 GLY A CA   4  
ATOM 4985  C C    . GLY A 1 50 ? -1.963  10.324  -2.505  1.00 15.00 ? 50 GLY A C    4  
ATOM 4986  O O    . GLY A 1 50 ? -3.187  10.219  -2.587  1.00 15.00 ? 50 GLY A O    4  
ATOM 4987  H H    . GLY A 1 50 ? 0.719   11.757  -2.207  1.00 15.00 ? 50 GLY A H    4  
ATOM 4988  H HA2  . GLY A 1 50 ? -1.029  11.201  -0.800  1.00 15.00 ? 50 GLY A HA2  4  
ATOM 4989  H HA3  . GLY A 1 50 ? -2.069  12.294  -1.713  1.00 15.00 ? 50 GLY A HA3  4  
ATOM 4990  N N    . ARG A 1 51 ? -1.125  9.437   -3.029  1.00 15.00 ? 51 ARG A N    4  
ATOM 4991  C CA   . ARG A 1 51 ? -1.619  8.266   -3.746  1.00 15.00 ? 51 ARG A CA   4  
ATOM 4992  C C    . ARG A 1 51 ? -2.057  7.185   -2.770  1.00 15.00 ? 51 ARG A C    4  
ATOM 4993  O O    . ARG A 1 51 ? -3.166  6.658   -2.865  1.00 15.00 ? 51 ARG A O    4  
ATOM 4994  C CB   . ARG A 1 51 ? -0.549  7.715   -4.692  1.00 15.00 ? 51 ARG A CB   4  
ATOM 4995  C CG   . ARG A 1 51 ? -0.214  8.648   -5.843  1.00 15.00 ? 51 ARG A CG   4  
ATOM 4996  C CD   . ARG A 1 51 ? -1.139  8.425   -7.029  1.00 15.00 ? 51 ARG A CD   4  
ATOM 4997  N NE   . ARG A 1 51 ? -2.487  8.927   -6.775  1.00 15.00 ? 51 ARG A NE   4  
ATOM 4998  C CZ   . ARG A 1 51 ? -3.558  8.560   -7.474  1.00 15.00 ? 51 ARG A CZ   4  
ATOM 4999  N NH1  . ARG A 1 51 ? -3.444  7.687   -8.468  1.00 15.00 ? 51 ARG A NH1  4  
ATOM 5000  N NH2  . ARG A 1 51 ? -4.748  9.066   -7.179  1.00 15.00 ? 51 ARG A NH2  4  
ATOM 5001  H H    . ARG A 1 51 ? -0.155  9.577   -2.935  1.00 15.00 ? 51 ARG A H    4  
ATOM 5002  H HA   . ARG A 1 51 ? -2.476  8.574   -4.328  1.00 15.00 ? 51 ARG A HA   4  
ATOM 5003  H HB2  . ARG A 1 51 ? 0.355   7.530   -4.133  1.00 15.00 ? 51 ARG A HB2  4  
ATOM 5004  H HB3  . ARG A 1 51 ? -0.902  6.783   -5.107  1.00 15.00 ? 51 ARG A HB3  4  
ATOM 5005  H HG2  . ARG A 1 51 ? -0.314  9.669   -5.508  1.00 15.00 ? 51 ARG A HG2  4  
ATOM 5006  H HG3  . ARG A 1 51 ? 0.803   8.465   -6.153  1.00 15.00 ? 51 ARG A HG3  4  
ATOM 5007  H HD2  . ARG A 1 51 ? -0.731  8.936   -7.888  1.00 15.00 ? 51 ARG A HD2  4  
ATOM 5008  H HD3  . ARG A 1 51 ? -1.192  7.365   -7.233  1.00 15.00 ? 51 ARG A HD3  4  
ATOM 5009  H HE   . ARG A 1 51 ? -2.599  9.573   -6.047  1.00 15.00 ? 51 ARG A HE   4  
ATOM 5010  H HH11 . ARG A 1 51 ? -2.550  7.301   -8.695  1.00 15.00 ? 51 ARG A HH11 4  
ATOM 5011  H HH12 . ARG A 1 51 ? -4.252  7.415   -8.989  1.00 15.00 ? 51 ARG A HH12 4  
ATOM 5012  H HH21 . ARG A 1 51 ? -4.840  9.723   -6.431  1.00 15.00 ? 51 ARG A HH21 4  
ATOM 5013  H HH22 . ARG A 1 51 ? -5.553  8.790   -7.704  1.00 15.00 ? 51 ARG A HH22 4  
ATOM 5014  N N    . ILE A 1 52 ? -1.184  6.867   -1.826  1.00 15.00 ? 52 ILE A N    4  
ATOM 5015  C CA   . ILE A 1 52 ? -1.475  5.862   -0.826  1.00 15.00 ? 52 ILE A CA   4  
ATOM 5016  C C    . ILE A 1 52 ? -2.330  6.457   0.294   1.00 15.00 ? 52 ILE A C    4  
ATOM 5017  O O    . ILE A 1 52 ? -2.384  7.676   0.457   1.00 15.00 ? 52 ILE A O    4  
ATOM 5018  C CB   . ILE A 1 52 ? -0.170  5.285   -0.251  1.00 15.00 ? 52 ILE A CB   4  
ATOM 5019  C CG1  . ILE A 1 52 ? -0.462  4.048   0.589   1.00 15.00 ? 52 ILE A CG1  4  
ATOM 5020  C CG2  . ILE A 1 52 ? 0.574   6.338   0.558   1.00 15.00 ? 52 ILE A CG2  4  
ATOM 5021  C CD1  . ILE A 1 52 ? -1.185  2.966   -0.176  1.00 15.00 ? 52 ILE A CD1  4  
ATOM 5022  H H    . ILE A 1 52 ? -0.320  7.324   -1.798  1.00 15.00 ? 52 ILE A H    4  
ATOM 5023  H HA   . ILE A 1 52 ? -2.024  5.062   -1.302  1.00 15.00 ? 52 ILE A HA   4  
ATOM 5024  H HB   . ILE A 1 52 ? 0.461   5.001   -1.081  1.00 15.00 ? 52 ILE A HB   4  
ATOM 5025  H HG12 . ILE A 1 52 ? 0.468   3.634   0.941   1.00 15.00 ? 52 ILE A HG12 4  
ATOM 5026  H HG13 . ILE A 1 52 ? -1.075  4.328   1.430   1.00 15.00 ? 52 ILE A HG13 4  
ATOM 5027  H HG21 . ILE A 1 52 ? -0.096  6.777   1.280   1.00 15.00 ? 52 ILE A HG21 4  
ATOM 5028  H HG22 . ILE A 1 52 ? 1.407   5.879   1.069   1.00 15.00 ? 52 ILE A HG22 4  
ATOM 5029  H HG23 . ILE A 1 52 ? 0.940   7.107   -0.105  1.00 15.00 ? 52 ILE A HG23 4  
ATOM 5030  H HD11 . ILE A 1 52 ? -2.248  3.144   -0.134  1.00 15.00 ? 52 ILE A HD11 4  
ATOM 5031  H HD12 . ILE A 1 52 ? -0.858  2.979   -1.206  1.00 15.00 ? 52 ILE A HD12 4  
ATOM 5032  H HD13 . ILE A 1 52 ? -0.962  2.004   0.262   1.00 15.00 ? 52 ILE A HD13 4  
ATOM 5033  N N    . HIS A 1 53 ? -3.009  5.602   1.053   1.00 15.00 ? 53 HIS A N    4  
ATOM 5034  C CA   . HIS A 1 53 ? -3.867  6.070   2.137   1.00 15.00 ? 53 HIS A CA   4  
ATOM 5035  C C    . HIS A 1 53 ? -3.863  5.121   3.316   1.00 15.00 ? 53 HIS A C    4  
ATOM 5036  O O    . HIS A 1 53 ? -3.509  3.951   3.199   1.00 15.00 ? 53 HIS A O    4  
ATOM 5037  C CB   . HIS A 1 53 ? -5.297  6.279   1.636   1.00 15.00 ? 53 HIS A CB   4  
ATOM 5038  C CG   . HIS A 1 53 ? -5.408  7.311   0.557   1.00 15.00 ? 53 HIS A CG   4  
ATOM 5039  N ND1  . HIS A 1 53 ? -5.150  7.042   -0.771  1.00 15.00 ? 53 HIS A ND1  4  
ATOM 5040  C CD2  . HIS A 1 53 ? -5.752  8.619   0.615   1.00 15.00 ? 53 HIS A CD2  4  
ATOM 5041  C CE1  . HIS A 1 53 ? -5.330  8.141   -1.483  1.00 15.00 ? 53 HIS A CE1  4  
ATOM 5042  N NE2  . HIS A 1 53 ? -5.696  9.111   -0.666  1.00 15.00 ? 53 HIS A NE2  4  
ATOM 5043  H H    . HIS A 1 53 ? -2.939  4.643   0.876   1.00 15.00 ? 53 HIS A H    4  
ATOM 5044  H HA   . HIS A 1 53 ? -3.478  7.013   2.484   1.00 15.00 ? 53 HIS A HA   4  
ATOM 5045  H HB2  . HIS A 1 53 ? -5.673  5.346   1.244   1.00 15.00 ? 53 HIS A HB2  4  
ATOM 5046  H HB3  . HIS A 1 53 ? -5.917  6.593   2.463   1.00 15.00 ? 53 HIS A HB3  4  
ATOM 5047  H HD1  . HIS A 1 53 ? -4.875  6.176   -1.137  1.00 15.00 ? 53 HIS A HD1  4  
ATOM 5048  H HD2  . HIS A 1 53 ? -6.021  9.173   1.503   1.00 15.00 ? 53 HIS A HD2  4  
ATOM 5049  H HE1  . HIS A 1 53 ? -5.200  8.229   -2.551  1.00 15.00 ? 53 HIS A HE1  4  
ATOM 5050  H HE2  . HIS A 1 53 ? -5.968  10.011  -0.943  1.00 15.00 ? 53 HIS A HE2  4  
ATOM 5051  N N    . LYS A 1 54 ? -4.243  5.666   4.461   1.00 15.00 ? 54 LYS A N    4  
ATOM 5052  C CA   . LYS A 1 54 ? -4.279  4.927   5.710   1.00 15.00 ? 54 LYS A CA   4  
ATOM 5053  C C    . LYS A 1 54 ? -4.850  3.517   5.544   1.00 15.00 ? 54 LYS A C    4  
ATOM 5054  O O    . LYS A 1 54 ? -5.895  3.324   4.924   1.00 15.00 ? 54 LYS A O    4  
ATOM 5055  C CB   . LYS A 1 54 ? -5.100  5.699   6.746   1.00 15.00 ? 54 LYS A CB   4  
ATOM 5056  C CG   . LYS A 1 54 ? -4.275  6.234   7.903   1.00 15.00 ? 54 LYS A CG   4  
ATOM 5057  C CD   . LYS A 1 54 ? -5.109  6.371   9.166   1.00 15.00 ? 54 LYS A CD   4  
ATOM 5058  C CE   . LYS A 1 54 ? -5.270  5.035   9.875   1.00 15.00 ? 54 LYS A CE   4  
ATOM 5059  N NZ   . LYS A 1 54 ? -6.510  4.327   9.452   1.00 15.00 ? 54 LYS A NZ   4  
ATOM 5060  H H    . LYS A 1 54 ? -4.491  6.611   4.469   1.00 15.00 ? 54 LYS A H    4  
ATOM 5061  H HA   . LYS A 1 54 ? -3.261  4.857   6.053   1.00 15.00 ? 54 LYS A HA   4  
ATOM 5062  H HB2  . LYS A 1 54 ? -5.578  6.535   6.258   1.00 15.00 ? 54 LYS A HB2  4  
ATOM 5063  H HB3  . LYS A 1 54 ? -5.861  5.046   7.148   1.00 15.00 ? 54 LYS A HB3  4  
ATOM 5064  H HG2  . LYS A 1 54 ? -3.461  5.554   8.093   1.00 15.00 ? 54 LYS A HG2  4  
ATOM 5065  H HG3  . LYS A 1 54 ? -3.882  7.204   7.634   1.00 15.00 ? 54 LYS A HG3  4  
ATOM 5066  H HD2  . LYS A 1 54 ? -4.622  7.065   9.835   1.00 15.00 ? 54 LYS A HD2  4  
ATOM 5067  H HD3  . LYS A 1 54 ? -6.086  6.748   8.902   1.00 15.00 ? 54 LYS A HD3  4  
ATOM 5068  H HE2  . LYS A 1 54 ? -4.416  4.415   9.645   1.00 15.00 ? 54 LYS A HE2  4  
ATOM 5069  H HE3  . LYS A 1 54 ? -5.311  5.210   10.940  1.00 15.00 ? 54 LYS A HE3  4  
ATOM 5070  H HZ1  . LYS A 1 54 ? -6.949  3.857   10.269  1.00 15.00 ? 54 LYS A HZ1  4  
ATOM 5071  H HZ2  . LYS A 1 54 ? -7.189  5.004   9.049   1.00 15.00 ? 54 LYS A HZ2  4  
ATOM 5072  H HZ3  . LYS A 1 54 ? -6.284  3.609   8.734   1.00 15.00 ? 54 LYS A HZ3  4  
ATOM 5073  N N    . GLY A 1 55 ? -4.153  2.538   6.121   1.00 15.00 ? 55 GLY A N    4  
ATOM 5074  C CA   . GLY A 1 55 ? -4.593  1.154   6.053   1.00 15.00 ? 55 GLY A CA   4  
ATOM 5075  C C    . GLY A 1 55 ? -4.931  0.698   4.649   1.00 15.00 ? 55 GLY A C    4  
ATOM 5076  O O    . GLY A 1 55 ? -5.836  -0.116  4.462   1.00 15.00 ? 55 GLY A O    4  
ATOM 5077  H H    . GLY A 1 55 ? -3.328  2.761   6.609   1.00 15.00 ? 55 GLY A H    4  
ATOM 5078  H HA2  . GLY A 1 55 ? -3.810  0.520   6.439   1.00 15.00 ? 55 GLY A HA2  4  
ATOM 5079  H HA3  . GLY A 1 55 ? -5.469  1.039   6.675   1.00 15.00 ? 55 GLY A HA3  4  
ATOM 5080  N N    . ASP A 1 56 ? -4.208  1.207   3.658   1.00 15.00 ? 56 ASP A N    4  
ATOM 5081  C CA   . ASP A 1 56 ? -4.461  0.812   2.278   1.00 15.00 ? 56 ASP A CA   4  
ATOM 5082  C C    . ASP A 1 56 ? -4.129  -0.661  2.072   1.00 15.00 ? 56 ASP A C    4  
ATOM 5083  O O    . ASP A 1 56 ? -3.065  -1.127  2.487   1.00 15.00 ? 56 ASP A O    4  
ATOM 5084  C CB   . ASP A 1 56 ? -3.661  1.674   1.299   1.00 15.00 ? 56 ASP A CB   4  
ATOM 5085  C CG   . ASP A 1 56 ? -4.555  2.408   0.321   1.00 15.00 ? 56 ASP A CG   4  
ATOM 5086  O OD1  . ASP A 1 56 ? -5.264  1.733   -0.456  1.00 15.00 ? 56 ASP A OD1  4  
ATOM 5087  O OD2  . ASP A 1 56 ? -4.549  3.656   0.333   1.00 15.00 ? 56 ASP A OD2  4  
ATOM 5088  H H    . ASP A 1 56 ? -3.485  1.846   3.858   1.00 15.00 ? 56 ASP A H    4  
ATOM 5089  H HA   . ASP A 1 56 ? -5.516  0.954   2.087   1.00 15.00 ? 56 ASP A HA   4  
ATOM 5090  H HB2  . ASP A 1 56 ? -3.092  2.403   1.850   1.00 15.00 ? 56 ASP A HB2  4  
ATOM 5091  H HB3  . ASP A 1 56 ? -2.986  1.044   0.738   1.00 15.00 ? 56 ASP A HB3  4  
ATOM 5092  N N    . ARG A 1 57 ? -5.039  -1.386  1.429   1.00 15.00 ? 57 ARG A N    4  
ATOM 5093  C CA   . ARG A 1 57 ? -4.837  -2.804  1.163   1.00 15.00 ? 57 ARG A CA   4  
ATOM 5094  C C    . ARG A 1 57 ? -4.048  -2.998  -0.126  1.00 15.00 ? 57 ARG A C    4  
ATOM 5095  O O    . ARG A 1 57 ? -4.621  -3.057  -1.214  1.00 15.00 ? 57 ARG A O    4  
ATOM 5096  C CB   . ARG A 1 57 ? -6.182  -3.529  1.069   1.00 15.00 ? 57 ARG A CB   4  
ATOM 5097  C CG   . ARG A 1 57 ? -6.229  -4.820  1.870   1.00 15.00 ? 57 ARG A CG   4  
ATOM 5098  C CD   . ARG A 1 57 ? -5.898  -6.026  1.007   1.00 15.00 ? 57 ARG A CD   4  
ATOM 5099  N NE   . ARG A 1 57 ? -6.146  -7.285  1.706   1.00 15.00 ? 57 ARG A NE   4  
ATOM 5100  C CZ   . ARG A 1 57 ? -7.347  -7.848  1.816   1.00 15.00 ? 57 ARG A CZ   4  
ATOM 5101  N NH1  . ARG A 1 57 ? -8.412  -7.268  1.277   1.00 15.00 ? 57 ARG A NH1  4  
ATOM 5102  N NH2  . ARG A 1 57 ? -7.483  -8.995  2.468   1.00 15.00 ? 57 ARG A NH2  4  
ATOM 5103  H H    . ARG A 1 57 ? -5.865  -0.955  1.122   1.00 15.00 ? 57 ARG A H    4  
ATOM 5104  H HA   . ARG A 1 57 ? -4.272  -3.218  1.983   1.00 15.00 ? 57 ARG A HA   4  
ATOM 5105  H HB2  . ARG A 1 57 ? -6.958  -2.874  1.436   1.00 15.00 ? 57 ARG A HB2  4  
ATOM 5106  H HB3  . ARG A 1 57 ? -6.381  -3.766  0.034   1.00 15.00 ? 57 ARG A HB3  4  
ATOM 5107  H HG2  . ARG A 1 57 ? -5.510  -4.758  2.673   1.00 15.00 ? 57 ARG A HG2  4  
ATOM 5108  H HG3  . ARG A 1 57 ? -7.221  -4.942  2.281   1.00 15.00 ? 57 ARG A HG3  4  
ATOM 5109  H HD2  . ARG A 1 57 ? -6.508  -5.994  0.117   1.00 15.00 ? 57 ARG A HD2  4  
ATOM 5110  H HD3  . ARG A 1 57 ? -4.856  -5.978  0.730   1.00 15.00 ? 57 ARG A HD3  4  
ATOM 5111  H HE   . ARG A 1 57 ? -5.377  -7.734  2.115   1.00 15.00 ? 57 ARG A HE   4  
ATOM 5112  H HH11 . ARG A 1 57 ? -8.316  -6.403  0.785   1.00 15.00 ? 57 ARG A HH11 4  
ATOM 5113  H HH12 . ARG A 1 57 ? -9.311  -7.697  1.363   1.00 15.00 ? 57 ARG A HH12 4  
ATOM 5114  H HH21 . ARG A 1 57 ? -6.684  -9.437  2.876   1.00 15.00 ? 57 ARG A HH21 4  
ATOM 5115  H HH22 . ARG A 1 57 ? -8.386  -9.419  2.550   1.00 15.00 ? 57 ARG A HH22 4  
ATOM 5116  N N    . VAL A 1 58 ? -2.728  -3.088  0.000   1.00 15.00 ? 58 VAL A N    4  
ATOM 5117  C CA   . VAL A 1 58 ? -1.864  -3.265  -1.159  1.00 15.00 ? 58 VAL A CA   4  
ATOM 5118  C C    . VAL A 1 58 ? -1.782  -4.736  -1.566  1.00 15.00 ? 58 VAL A C    4  
ATOM 5119  O O    . VAL A 1 58 ? -1.278  -5.577  -0.814  1.00 15.00 ? 58 VAL A O    4  
ATOM 5120  C CB   . VAL A 1 58 ? -0.449  -2.693  -0.902  1.00 15.00 ? 58 VAL A CB   4  
ATOM 5121  C CG1  . VAL A 1 58 ? -0.538  -1.378  -0.140  1.00 15.00 ? 58 VAL A CG1  4  
ATOM 5122  C CG2  . VAL A 1 58 ? 0.426   -3.686  -0.147  1.00 15.00 ? 58 VAL A CG2  4  
ATOM 5123  H H    . VAL A 1 58 ? -2.327  -3.029  0.892   1.00 15.00 ? 58 VAL A H    4  
ATOM 5124  H HA   . VAL A 1 58 ? -2.304  -2.713  -1.976  1.00 15.00 ? 58 VAL A HA   4  
ATOM 5125  H HB   . VAL A 1 58 ? 0.012   -2.493  -1.857  1.00 15.00 ? 58 VAL A HB   4  
ATOM 5126  H HG11 . VAL A 1 58 ? -1.128  -0.673  -0.707  1.00 15.00 ? 58 VAL A HG11 4  
ATOM 5127  H HG12 . VAL A 1 58 ? -1.006  -1.548  0.821   1.00 15.00 ? 58 VAL A HG12 4  
ATOM 5128  H HG13 . VAL A 1 58 ? 0.454   -0.980  0.009   1.00 15.00 ? 58 VAL A HG13 4  
ATOM 5129  H HG21 . VAL A 1 58 ? 1.236   -3.159  0.333   1.00 15.00 ? 58 VAL A HG21 4  
ATOM 5130  H HG22 . VAL A 1 58 ? -0.166  -4.194  0.600   1.00 15.00 ? 58 VAL A HG22 4  
ATOM 5131  H HG23 . VAL A 1 58 ? 0.829   -4.410  -0.839  1.00 15.00 ? 58 VAL A HG23 4  
ATOM 5132  N N    . LEU A 1 59 ? -2.305  -5.038  -2.754  1.00 15.00 ? 59 LEU A N    4  
ATOM 5133  C CA   . LEU A 1 59 ? -2.313  -6.407  -3.267  1.00 15.00 ? 59 LEU A CA   4  
ATOM 5134  C C    . LEU A 1 59 ? -1.307  -6.613  -4.401  1.00 15.00 ? 59 LEU A C    4  
ATOM 5135  O O    . LEU A 1 59 ? -0.991  -7.748  -4.752  1.00 15.00 ? 59 LEU A O    4  
ATOM 5136  C CB   . LEU A 1 59 ? -3.713  -6.781  -3.755  1.00 15.00 ? 59 LEU A CB   4  
ATOM 5137  C CG   . LEU A 1 59 ? -4.758  -6.957  -2.653  1.00 15.00 ? 59 LEU A CG   4  
ATOM 5138  C CD1  . LEU A 1 59 ? -4.252  -7.918  -1.588  1.00 15.00 ? 59 LEU A CD1  4  
ATOM 5139  C CD2  . LEU A 1 59 ? -5.111  -5.612  -2.037  1.00 15.00 ? 59 LEU A CD2  4  
ATOM 5140  H H    . LEU A 1 59 ? -2.705  -4.321  -3.295  1.00 15.00 ? 59 LEU A H    4  
ATOM 5141  H HA   . LEU A 1 59 ? -2.048  -7.062  -2.451  1.00 15.00 ? 59 LEU A HA   4  
ATOM 5142  H HB2  . LEU A 1 59 ? -4.056  -6.008  -4.428  1.00 15.00 ? 59 LEU A HB2  4  
ATOM 5143  H HB3  . LEU A 1 59 ? -3.643  -7.708  -4.304  1.00 15.00 ? 59 LEU A HB3  4  
ATOM 5144  H HG   . LEU A 1 59 ? -5.656  -7.377  -3.081  1.00 15.00 ? 59 LEU A HG   4  
ATOM 5145  H HD11 . LEU A 1 59 ? -3.446  -8.513  -1.994  1.00 15.00 ? 59 LEU A HD11 4  
ATOM 5146  H HD12 . LEU A 1 59 ? -3.893  -7.357  -0.738  1.00 15.00 ? 59 LEU A HD12 4  
ATOM 5147  H HD13 . LEU A 1 59 ? -5.057  -8.567  -1.277  1.00 15.00 ? 59 LEU A HD13 4  
ATOM 5148  H HD21 . LEU A 1 59 ? -4.526  -5.460  -1.142  1.00 15.00 ? 59 LEU A HD21 4  
ATOM 5149  H HD22 . LEU A 1 59 ? -4.896  -4.825  -2.745  1.00 15.00 ? 59 LEU A HD22 4  
ATOM 5150  H HD23 . LEU A 1 59 ? -6.162  -5.595  -1.788  1.00 15.00 ? 59 LEU A HD23 4  
ATOM 5151  N N    . ALA A 1 60 ? -0.825  -5.524  -4.992  1.00 15.00 ? 60 ALA A N    4  
ATOM 5152  C CA   . ALA A 1 60 ? 0.120   -5.624  -6.102  1.00 15.00 ? 60 ALA A CA   4  
ATOM 5153  C C    . ALA A 1 60 ? 1.107   -4.461  -6.126  1.00 15.00 ? 60 ALA A C    4  
ATOM 5154  O O    . ALA A 1 60 ? 0.769   -3.333  -5.770  1.00 15.00 ? 60 ALA A O    4  
ATOM 5155  C CB   . ALA A 1 60 ? -0.637  -5.695  -7.420  1.00 15.00 ? 60 ALA A CB   4  
ATOM 5156  H H    . ALA A 1 60 ? -1.121  -4.642  -4.692  1.00 15.00 ? 60 ALA A H    4  
ATOM 5157  H HA   . ALA A 1 60 ? 0.671   -6.545  -5.992  1.00 15.00 ? 60 ALA A HA   4  
ATOM 5158  H HB1  . ALA A 1 60 ? -0.730  -6.726  -7.726  1.00 15.00 ? 60 ALA A HB1  4  
ATOM 5159  H HB2  . ALA A 1 60 ? -1.621  -5.268  -7.292  1.00 15.00 ? 60 ALA A HB2  4  
ATOM 5160  H HB3  . ALA A 1 60 ? -0.099  -5.141  -8.175  1.00 15.00 ? 60 ALA A HB3  4  
ATOM 5161  N N    . VAL A 1 61 ? 2.325   -4.751  -6.573  1.00 15.00 ? 61 VAL A N    4  
ATOM 5162  C CA   . VAL A 1 61 ? 3.378   -3.747  -6.682  1.00 15.00 ? 61 VAL A CA   4  
ATOM 5163  C C    . VAL A 1 61 ? 4.138   -3.959  -7.981  1.00 15.00 ? 61 VAL A C    4  
ATOM 5164  O O    . VAL A 1 61 ? 4.951   -4.876  -8.092  1.00 15.00 ? 61 VAL A O    4  
ATOM 5165  C CB   . VAL A 1 61 ? 4.371   -3.810  -5.502  1.00 15.00 ? 61 VAL A CB   4  
ATOM 5166  C CG1  . VAL A 1 61 ? 5.430   -2.728  -5.637  1.00 15.00 ? 61 VAL A CG1  4  
ATOM 5167  C CG2  . VAL A 1 61 ? 3.642   -3.688  -4.173  1.00 15.00 ? 61 VAL A CG2  4  
ATOM 5168  H H    . VAL A 1 61 ? 2.519   -5.670  -6.857  1.00 15.00 ? 61 VAL A H    4  
ATOM 5169  H HA   . VAL A 1 61 ? 2.917   -2.771  -6.697  1.00 15.00 ? 61 VAL A HA   4  
ATOM 5170  H HB   . VAL A 1 61 ? 4.867   -4.767  -5.527  1.00 15.00 ? 61 VAL A HB   4  
ATOM 5171  H HG11 . VAL A 1 61 ? 5.028   -1.900  -6.203  1.00 15.00 ? 61 VAL A HG11 4  
ATOM 5172  H HG12 . VAL A 1 61 ? 5.722   -2.386  -4.657  1.00 15.00 ? 61 VAL A HG12 4  
ATOM 5173  H HG13 . VAL A 1 61 ? 6.291   -3.129  -6.150  1.00 15.00 ? 61 VAL A HG13 4  
ATOM 5174  H HG21 . VAL A 1 61 ? 3.830   -2.713  -3.748  1.00 15.00 ? 61 VAL A HG21 4  
ATOM 5175  H HG22 . VAL A 1 61 ? 2.582   -3.813  -4.328  1.00 15.00 ? 61 VAL A HG22 4  
ATOM 5176  H HG23 . VAL A 1 61 ? 3.999   -4.449  -3.495  1.00 15.00 ? 61 VAL A HG23 4  
ATOM 5177  N N    . ASN A 1 62 ? 3.840   -3.130  -8.974  1.00 15.00 ? 62 ASN A N    4  
ATOM 5178  C CA   . ASN A 1 62 ? 4.470   -3.258  -10.279 1.00 15.00 ? 62 ASN A CA   4  
ATOM 5179  C C    . ASN A 1 62 ? 4.057   -4.581  -10.925 1.00 15.00 ? 62 ASN A C    4  
ATOM 5180  O O    . ASN A 1 62 ? 4.678   -5.040  -11.883 1.00 15.00 ? 62 ASN A O    4  
ATOM 5181  C CB   . ASN A 1 62 ? 5.993   -3.175  -10.157 1.00 15.00 ? 62 ASN A CB   4  
ATOM 5182  C CG   . ASN A 1 62 ? 6.503   -1.751  -10.268 1.00 15.00 ? 62 ASN A CG   4  
ATOM 5183  O OD1  . ASN A 1 62 ? 7.474   -1.480  -10.975 1.00 15.00 ? 62 ASN A OD1  4  
ATOM 5184  N ND2  . ASN A 1 62 ? 5.848   -0.831  -9.568  1.00 15.00 ? 62 ASN A ND2  4  
ATOM 5185  H H    . ASN A 1 62 ? 3.163   -2.435  -8.835  1.00 15.00 ? 62 ASN A H    4  
ATOM 5186  H HA   . ASN A 1 62 ? 4.119   -2.445  -10.898 1.00 15.00 ? 62 ASN A HA   4  
ATOM 5187  H HB2  . ASN A 1 62 ? 6.295   -3.571  -9.200  1.00 15.00 ? 62 ASN A HB2  4  
ATOM 5188  H HB3  . ASN A 1 62 ? 6.444   -3.762  -10.944 1.00 15.00 ? 62 ASN A HB3  4  
ATOM 5189  H HD21 . ASN A 1 62 ? 5.083   -1.118  -9.026  1.00 15.00 ? 62 ASN A HD21 4  
ATOM 5190  H HD22 . ASN A 1 62 ? 6.155   0.098   -9.622  1.00 15.00 ? 62 ASN A HD22 4  
ATOM 5191  N N    . GLY A 1 63 ? 2.994   -5.185  -10.386 1.00 15.00 ? 63 GLY A N    4  
ATOM 5192  C CA   . GLY A 1 63 ? 2.496   -6.443  -10.908 1.00 15.00 ? 63 GLY A CA   4  
ATOM 5193  C C    . GLY A 1 63 ? 2.821   -7.631  -10.020 1.00 15.00 ? 63 GLY A C    4  
ATOM 5194  O O    . GLY A 1 63 ? 2.538   -8.773  -10.381 1.00 15.00 ? 63 GLY A O    4  
ATOM 5195  H H    . GLY A 1 63 ? 2.538   -4.766  -9.628  1.00 15.00 ? 63 GLY A H    4  
ATOM 5196  H HA2  . GLY A 1 63 ? 1.422   -6.373  -10.999 1.00 15.00 ? 63 GLY A HA2  4  
ATOM 5197  H HA3  . GLY A 1 63 ? 2.921   -6.610  -11.887 1.00 15.00 ? 63 GLY A HA3  4  
ATOM 5198  N N    . VAL A 1 64 ? 3.408   -7.371  -8.855  1.00 15.00 ? 64 VAL A N    4  
ATOM 5199  C CA   . VAL A 1 64 ? 3.753   -8.442  -7.927  1.00 15.00 ? 64 VAL A CA   4  
ATOM 5200  C C    . VAL A 1 64 ? 2.640   -8.657  -6.901  1.00 15.00 ? 64 VAL A C    4  
ATOM 5201  O O    . VAL A 1 64 ? 2.434   -7.834  -6.010  1.00 15.00 ? 64 VAL A O    4  
ATOM 5202  C CB   . VAL A 1 64 ? 5.090   -8.163  -7.203  1.00 15.00 ? 64 VAL A CB   4  
ATOM 5203  C CG1  . VAL A 1 64 ? 4.928   -7.111  -6.118  1.00 15.00 ? 64 VAL A CG1  4  
ATOM 5204  C CG2  . VAL A 1 64 ? 5.661   -9.449  -6.624  1.00 15.00 ? 64 VAL A CG2  4  
ATOM 5205  H H    . VAL A 1 64 ? 3.607   -6.443  -8.611  1.00 15.00 ? 64 VAL A H    4  
ATOM 5206  H HA   . VAL A 1 64 ? 3.867   -9.349  -8.504  1.00 15.00 ? 64 VAL A HA   4  
ATOM 5207  H HB   . VAL A 1 64 ? 5.791   -7.782  -7.929  1.00 15.00 ? 64 VAL A HB   4  
ATOM 5208  H HG11 . VAL A 1 64 ? 4.255   -6.342  -6.464  1.00 15.00 ? 64 VAL A HG11 4  
ATOM 5209  H HG12 . VAL A 1 64 ? 4.523   -7.570  -5.229  1.00 15.00 ? 64 VAL A HG12 4  
ATOM 5210  H HG13 . VAL A 1 64 ? 5.889   -6.674  -5.893  1.00 15.00 ? 64 VAL A HG13 4  
ATOM 5211  H HG21 . VAL A 1 64 ? 5.457   -9.488  -5.564  1.00 15.00 ? 64 VAL A HG21 4  
ATOM 5212  H HG22 . VAL A 1 64 ? 5.203   -10.297 -7.111  1.00 15.00 ? 64 VAL A HG22 4  
ATOM 5213  H HG23 . VAL A 1 64 ? 6.728   -9.474  -6.787  1.00 15.00 ? 64 VAL A HG23 4  
ATOM 5214  N N    . SER A 1 65 ? 1.922   -9.766  -7.034  1.00 15.00 ? 65 SER A N    4  
ATOM 5215  C CA   . SER A 1 65 ? 0.832   -10.079 -6.117  1.00 15.00 ? 65 SER A CA   4  
ATOM 5216  C C    . SER A 1 65 ? 1.335   -10.142 -4.682  1.00 15.00 ? 65 SER A C    4  
ATOM 5217  O O    . SER A 1 65 ? 2.272   -10.876 -4.366  1.00 15.00 ? 65 SER A O    4  
ATOM 5218  C CB   . SER A 1 65 ? 0.171   -11.404 -6.502  1.00 15.00 ? 65 SER A CB   4  
ATOM 5219  O OG   . SER A 1 65 ? -0.651  -11.251 -7.646  1.00 15.00 ? 65 SER A OG   4  
ATOM 5220  H H    . SER A 1 65 ? 2.128   -10.386 -7.764  1.00 15.00 ? 65 SER A H    4  
ATOM 5221  H HA   . SER A 1 65 ? 0.099   -9.285  -6.185  1.00 15.00 ? 65 SER A HA   4  
ATOM 5222  H HB2  . SER A 1 65 ? 0.935   -12.135 -6.719  1.00 15.00 ? 65 SER A HB2  4  
ATOM 5223  H HB3  . SER A 1 65 ? -0.437  -11.752 -5.680  1.00 15.00 ? 65 SER A HB3  4  
ATOM 5224  H HG   . SER A 1 65 ? -0.991  -12.107 -7.913  1.00 15.00 ? 65 SER A HG   4  
ATOM 5225  N N    . LEU A 1 66 ? 0.706   -9.355  -3.824  1.00 15.00 ? 66 LEU A N    4  
ATOM 5226  C CA   . LEU A 1 66 ? 1.073   -9.291  -2.420  1.00 15.00 ? 66 LEU A CA   4  
ATOM 5227  C C    . LEU A 1 66 ? 0.337   -10.351 -1.605  1.00 15.00 ? 66 LEU A C    4  
ATOM 5228  O O    . LEU A 1 66 ? 0.772   -10.718 -0.514  1.00 15.00 ? 66 LEU A O    4  
ATOM 5229  C CB   . LEU A 1 66 ? 0.763   -7.899  -1.880  1.00 15.00 ? 66 LEU A CB   4  
ATOM 5230  C CG   . LEU A 1 66 ? 1.905   -6.890  -2.020  1.00 15.00 ? 66 LEU A CG   4  
ATOM 5231  C CD1  . LEU A 1 66 ? 1.462   -5.688  -2.839  1.00 15.00 ? 66 LEU A CD1  4  
ATOM 5232  C CD2  . LEU A 1 66 ? 2.400   -6.454  -0.651  1.00 15.00 ? 66 LEU A CD2  4  
ATOM 5233  H H    . LEU A 1 66 ? -0.028  -8.792  -4.148  1.00 15.00 ? 66 LEU A H    4  
ATOM 5234  H HA   . LEU A 1 66 ? 2.136   -9.467  -2.344  1.00 15.00 ? 66 LEU A HA   4  
ATOM 5235  H HB2  . LEU A 1 66 ? -0.097  -7.519  -2.415  1.00 15.00 ? 66 LEU A HB2  4  
ATOM 5236  H HB3  . LEU A 1 66 ? 0.510   -7.986  -0.835  1.00 15.00 ? 66 LEU A HB3  4  
ATOM 5237  H HG   . LEU A 1 66 ? 2.728   -7.360  -2.539  1.00 15.00 ? 66 LEU A HG   4  
ATOM 5238  H HD11 . LEU A 1 66 ? 0.435   -5.449  -2.601  1.00 15.00 ? 66 LEU A HD11 4  
ATOM 5239  H HD12 . LEU A 1 66 ? 2.091   -4.842  -2.606  1.00 15.00 ? 66 LEU A HD12 4  
ATOM 5240  H HD13 . LEU A 1 66 ? 1.543   -5.918  -3.890  1.00 15.00 ? 66 LEU A HD13 4  
ATOM 5241  H HD21 . LEU A 1 66 ? 2.965   -5.539  -0.748  1.00 15.00 ? 66 LEU A HD21 4  
ATOM 5242  H HD22 . LEU A 1 66 ? 1.556   -6.288  0.002   1.00 15.00 ? 66 LEU A HD22 4  
ATOM 5243  H HD23 . LEU A 1 66 ? 3.032   -7.225  -0.235  1.00 15.00 ? 66 LEU A HD23 4  
ATOM 5244  N N    . GLU A 1 67 ? -0.780  -10.841 -2.140  1.00 15.00 ? 67 GLU A N    4  
ATOM 5245  C CA   . GLU A 1 67 ? -1.573  -11.861 -1.459  1.00 15.00 ? 67 GLU A CA   4  
ATOM 5246  C C    . GLU A 1 67 ? -0.683  -12.984 -0.932  1.00 15.00 ? 67 GLU A C    4  
ATOM 5247  O O    . GLU A 1 67 ? -0.225  -13.836 -1.693  1.00 15.00 ? 67 GLU A O    4  
ATOM 5248  C CB   . GLU A 1 67 ? -2.627  -12.435 -2.408  1.00 15.00 ? 67 GLU A CB   4  
ATOM 5249  C CG   . GLU A 1 67 ? -3.843  -11.539 -2.582  1.00 15.00 ? 67 GLU A CG   4  
ATOM 5250  C CD   . GLU A 1 67 ? -5.135  -12.324 -2.691  1.00 15.00 ? 67 GLU A CD   4  
ATOM 5251  O OE1  . GLU A 1 67 ? -5.694  -12.697 -1.638  1.00 15.00 ? 67 GLU A OE1  4  
ATOM 5252  O OE2  . GLU A 1 67 ? -5.588  -12.567 -3.829  1.00 15.00 ? 67 GLU A OE2  4  
ATOM 5253  H H    . GLU A 1 67 ? -1.078  -10.509 -3.013  1.00 15.00 ? 67 GLU A H    4  
ATOM 5254  H HA   . GLU A 1 67 ? -2.071  -11.391 -0.624  1.00 15.00 ? 67 GLU A HA   4  
ATOM 5255  H HB2  . GLU A 1 67 ? -2.177  -12.587 -3.378  1.00 15.00 ? 67 GLU A HB2  4  
ATOM 5256  H HB3  . GLU A 1 67 ? -2.961  -13.387 -2.023  1.00 15.00 ? 67 GLU A HB3  4  
ATOM 5257  H HG2  . GLU A 1 67 ? -3.912  -10.879 -1.730  1.00 15.00 ? 67 GLU A HG2  4  
ATOM 5258  H HG3  . GLU A 1 67 ? -3.717  -10.954 -3.481  1.00 15.00 ? 67 GLU A HG3  4  
ATOM 5259  N N    . GLY A 1 68 ? -0.441  -12.975 0.375   1.00 15.00 ? 68 GLY A N    4  
ATOM 5260  C CA   . GLY A 1 68 ? 0.394   -13.994 0.982   1.00 15.00 ? 68 GLY A CA   4  
ATOM 5261  C C    . GLY A 1 68 ? 1.739   -13.454 1.428   1.00 15.00 ? 68 GLY A C    4  
ATOM 5262  O O    . GLY A 1 68 ? 2.782   -13.872 0.925   1.00 15.00 ? 68 GLY A O    4  
ATOM 5263  H H    . GLY A 1 68 ? -0.832  -12.269 0.932   1.00 15.00 ? 68 GLY A H    4  
ATOM 5264  H HA2  . GLY A 1 68 ? -0.120  -14.401 1.840   1.00 15.00 ? 68 GLY A HA2  4  
ATOM 5265  H HA3  . GLY A 1 68 ? 0.556   -14.785 0.265   1.00 15.00 ? 68 GLY A HA3  4  
ATOM 5266  N N    . ALA A 1 69 ? 1.715   -12.522 2.376   1.00 15.00 ? 69 ALA A N    4  
ATOM 5267  C CA   . ALA A 1 69 ? 2.940   -11.924 2.893   1.00 15.00 ? 69 ALA A CA   4  
ATOM 5268  C C    . ALA A 1 69 ? 2.646   -11.017 4.084   1.00 15.00 ? 69 ALA A C    4  
ATOM 5269  O O    . ALA A 1 69 ? 1.499   -10.642 4.323   1.00 15.00 ? 69 ALA A O    4  
ATOM 5270  C CB   . ALA A 1 69 ? 3.651   -11.145 1.797   1.00 15.00 ? 69 ALA A CB   4  
ATOM 5271  H H    . ALA A 1 69 ? 0.853   -12.231 2.738   1.00 15.00 ? 69 ALA A H    4  
ATOM 5272  H HA   . ALA A 1 69 ? 3.592   -12.723 3.215   1.00 15.00 ? 69 ALA A HA   4  
ATOM 5273  H HB1  . ALA A 1 69 ? 4.714   -11.330 1.855   1.00 15.00 ? 69 ALA A HB1  4  
ATOM 5274  H HB2  . ALA A 1 69 ? 3.283   -11.463 0.833   1.00 15.00 ? 69 ALA A HB2  4  
ATOM 5275  H HB3  . ALA A 1 69 ? 3.462   -10.089 1.924   1.00 15.00 ? 69 ALA A HB3  4  
ATOM 5276  N N    . THR A 1 70 ? 3.687   -10.670 4.830   1.00 15.00 ? 70 THR A N    4  
ATOM 5277  C CA   . THR A 1 70 ? 3.537   -9.810  5.998   1.00 15.00 ? 70 THR A CA   4  
ATOM 5278  C C    . THR A 1 70 ? 3.764   -8.345  5.635   1.00 15.00 ? 70 THR A C    4  
ATOM 5279  O O    . THR A 1 70 ? 3.908   -7.996  4.464   1.00 15.00 ? 70 THR A O    4  
ATOM 5280  C CB   . THR A 1 70 ? 4.514   -10.229 7.098   1.00 15.00 ? 70 THR A CB   4  
ATOM 5281  O OG1  . THR A 1 70 ? 5.810   -9.720  6.839   1.00 15.00 ? 70 THR A OG1  4  
ATOM 5282  C CG2  . THR A 1 70 ? 4.634   -11.730 7.255   1.00 15.00 ? 70 THR A CG2  4  
ATOM 5283  H H    . THR A 1 70 ? 4.577   -11.003 4.592   1.00 15.00 ? 70 THR A H    4  
ATOM 5284  H HA   . THR A 1 70 ? 2.527   -9.924  6.365   1.00 15.00 ? 70 THR A HA   4  
ATOM 5285  H HB   . THR A 1 70 ? 4.173   -9.825  8.040   1.00 15.00 ? 70 THR A HB   4  
ATOM 5286  H HG1  . THR A 1 70 ? 6.120   -9.229  7.604   1.00 15.00 ? 70 THR A HG1  4  
ATOM 5287  H HG21 . THR A 1 70 ? 4.945   -11.963 8.263   1.00 15.00 ? 70 THR A HG21 4  
ATOM 5288  H HG22 . THR A 1 70 ? 3.677   -12.190 7.058   1.00 15.00 ? 70 THR A HG22 4  
ATOM 5289  H HG23 . THR A 1 70 ? 5.366   -12.108 6.557   1.00 15.00 ? 70 THR A HG23 4  
ATOM 5290  N N    . HIS A 1 71 ? 3.795   -7.496  6.656   1.00 15.00 ? 71 HIS A N    4  
ATOM 5291  C CA   . HIS A 1 71 ? 4.003   -6.066  6.472   1.00 15.00 ? 71 HIS A CA   4  
ATOM 5292  C C    . HIS A 1 71 ? 5.368   -5.809  5.853   1.00 15.00 ? 71 HIS A C    4  
ATOM 5293  O O    . HIS A 1 71 ? 5.473   -5.269  4.752   1.00 15.00 ? 71 HIS A O    4  
ATOM 5294  C CB   . HIS A 1 71 ? 3.849   -5.356  7.829   1.00 15.00 ? 71 HIS A CB   4  
ATOM 5295  C CG   . HIS A 1 71 ? 4.698   -4.135  8.045   1.00 15.00 ? 71 HIS A CG   4  
ATOM 5296  N ND1  . HIS A 1 71 ? 4.955   -3.630  9.303   1.00 15.00 ? 71 HIS A ND1  4  
ATOM 5297  C CD2  . HIS A 1 71 ? 5.312   -3.295  7.176   1.00 15.00 ? 71 HIS A CD2  4  
ATOM 5298  C CE1  . HIS A 1 71 ? 5.680   -2.533  9.198   1.00 15.00 ? 71 HIS A CE1  4  
ATOM 5299  N NE2  . HIS A 1 71 ? 5.914   -2.309  7.919   1.00 15.00 ? 71 HIS A NE2  4  
ATOM 5300  H H    . HIS A 1 71 ? 3.673   -7.841  7.562   1.00 15.00 ? 71 HIS A H    4  
ATOM 5301  H HA   . HIS A 1 71 ? 3.242   -5.705  5.798   1.00 15.00 ? 71 HIS A HA   4  
ATOM 5302  H HB2  . HIS A 1 71 ? 2.823   -5.047  7.936   1.00 15.00 ? 71 HIS A HB2  4  
ATOM 5303  H HB3  . HIS A 1 71 ? 4.082   -6.061  8.614   1.00 15.00 ? 71 HIS A HB3  4  
ATOM 5304  H HD1  . HIS A 1 71 ? 4.649   -4.020  10.148  1.00 15.00 ? 71 HIS A HD1  4  
ATOM 5305  H HD2  . HIS A 1 71 ? 5.319   -3.380  6.099   1.00 15.00 ? 71 HIS A HD2  4  
ATOM 5306  H HE1  . HIS A 1 71 ? 5.996   -1.907  10.019  1.00 15.00 ? 71 HIS A HE1  4  
ATOM 5307  H HE2  . HIS A 1 71 ? 6.504   -1.611  7.567   1.00 15.00 ? 71 HIS A HE2  4  
ATOM 5308  N N    . LYS A 1 72 ? 6.407   -6.212  6.564   1.00 15.00 ? 72 LYS A N    4  
ATOM 5309  C CA   . LYS A 1 72 ? 7.772   -6.041  6.084   1.00 15.00 ? 72 LYS A CA   4  
ATOM 5310  C C    . LYS A 1 72 ? 7.919   -6.627  4.686   1.00 15.00 ? 72 LYS A C    4  
ATOM 5311  O O    . LYS A 1 72 ? 8.640   -6.087  3.847   1.00 15.00 ? 72 LYS A O    4  
ATOM 5312  C CB   . LYS A 1 72 ? 8.750   -6.711  7.047   1.00 15.00 ? 72 LYS A CB   4  
ATOM 5313  C CG   . LYS A 1 72 ? 10.202  -6.328  6.811   1.00 15.00 ? 72 LYS A CG   4  
ATOM 5314  C CD   . LYS A 1 72 ? 11.138  -7.095  7.731   1.00 15.00 ? 72 LYS A CD   4  
ATOM 5315  C CE   . LYS A 1 72 ? 11.446  -8.480  7.183   1.00 15.00 ? 72 LYS A CE   4  
ATOM 5316  N NZ   . LYS A 1 72 ? 12.353  -8.424  6.004   1.00 15.00 ? 72 LYS A NZ   4  
ATOM 5317  H H    . LYS A 1 72 ? 6.252   -6.649  7.428   1.00 15.00 ? 72 LYS A H    4  
ATOM 5318  H HA   . LYS A 1 72 ? 7.982   -4.976  6.038   1.00 15.00 ? 72 LYS A HA   4  
ATOM 5319  H HB2  . LYS A 1 72 ? 8.483   -6.436  8.057   1.00 15.00 ? 72 LYS A HB2  4  
ATOM 5320  H HB3  . LYS A 1 72 ? 8.660   -7.782  6.942   1.00 15.00 ? 72 LYS A HB3  4  
ATOM 5321  H HG2  . LYS A 1 72 ? 10.460  -6.548  5.786   1.00 15.00 ? 72 LYS A HG2  4  
ATOM 5322  H HG3  . LYS A 1 72 ? 10.319  -5.269  6.995   1.00 15.00 ? 72 LYS A HG3  4  
ATOM 5323  H HD2  . LYS A 1 72 ? 12.062  -6.545  7.829   1.00 15.00 ? 72 LYS A HD2  4  
ATOM 5324  H HD3  . LYS A 1 72 ? 10.672  -7.196  8.700   1.00 15.00 ? 72 LYS A HD3  4  
ATOM 5325  H HE2  . LYS A 1 72 ? 11.917  -9.064  7.960   1.00 15.00 ? 72 LYS A HE2  4  
ATOM 5326  H HE3  . LYS A 1 72 ? 10.518  -8.952  6.892   1.00 15.00 ? 72 LYS A HE3  4  
ATOM 5327  H HZ1  . LYS A 1 72 ? 12.111  -9.179  5.330   1.00 15.00 ? 72 LYS A HZ1  4  
ATOM 5328  H HZ2  . LYS A 1 72 ? 12.260  -7.505  5.525   1.00 15.00 ? 72 LYS A HZ2  4  
ATOM 5329  H HZ3  . LYS A 1 72 ? 13.340  -8.547  6.306   1.00 15.00 ? 72 LYS A HZ3  4  
ATOM 5330  N N    . GLN A 1 73 ? 7.215   -7.728  4.435   1.00 15.00 ? 73 GLN A N    4  
ATOM 5331  C CA   . GLN A 1 73 ? 7.257   -8.372  3.129   1.00 15.00 ? 73 GLN A CA   4  
ATOM 5332  C C    . GLN A 1 73 ? 6.779   -7.395  2.068   1.00 15.00 ? 73 GLN A C    4  
ATOM 5333  O O    . GLN A 1 73 ? 7.433   -7.202  1.043   1.00 15.00 ? 73 GLN A O    4  
ATOM 5334  C CB   . GLN A 1 73 ? 6.387   -9.629  3.121   1.00 15.00 ? 73 GLN A CB   4  
ATOM 5335  C CG   . GLN A 1 73 ? 6.944   -10.752 3.977   1.00 15.00 ? 73 GLN A CG   4  
ATOM 5336  C CD   . GLN A 1 73 ? 6.663   -12.124 3.396   1.00 15.00 ? 73 GLN A CD   4  
ATOM 5337  O OE1  . GLN A 1 73 ? 5.944   -12.927 3.989   1.00 15.00 ? 73 GLN A OE1  4  
ATOM 5338  N NE2  . GLN A 1 73 ? 7.232   -12.399 2.228   1.00 15.00 ? 73 GLN A NE2  4  
ATOM 5339  H H    . GLN A 1 73 ? 6.648   -8.106  5.139   1.00 15.00 ? 73 GLN A H    4  
ATOM 5340  H HA   . GLN A 1 73 ? 8.281   -8.645  2.922   1.00 15.00 ? 73 GLN A HA   4  
ATOM 5341  H HB2  . GLN A 1 73 ? 5.404   -9.376  3.491   1.00 15.00 ? 73 GLN A HB2  4  
ATOM 5342  H HB3  . GLN A 1 73 ? 6.300   -9.987  2.106   1.00 15.00 ? 73 GLN A HB3  4  
ATOM 5343  H HG2  . GLN A 1 73 ? 8.013   -10.626 4.063   1.00 15.00 ? 73 GLN A HG2  4  
ATOM 5344  H HG3  . GLN A 1 73 ? 6.496   -10.694 4.958   1.00 15.00 ? 73 GLN A HG3  4  
ATOM 5345  H HE21 . GLN A 1 73 ? 7.793   -11.711 1.813   1.00 15.00 ? 73 GLN A HE21 4  
ATOM 5346  H HE22 . GLN A 1 73 ? 7.067   -13.278 1.828   1.00 15.00 ? 73 GLN A HE22 4  
ATOM 5347  N N    . ALA A 1 74 ? 5.646   -6.756  2.339   1.00 15.00 ? 74 ALA A N    4  
ATOM 5348  C CA   . ALA A 1 74 ? 5.100   -5.769  1.422   1.00 15.00 ? 74 ALA A CA   4  
ATOM 5349  C C    . ALA A 1 74 ? 6.023   -4.567  1.366   1.00 15.00 ? 74 ALA A C    4  
ATOM 5350  O O    . ALA A 1 74 ? 6.391   -4.104  0.288   1.00 15.00 ? 74 ALA A O    4  
ATOM 5351  C CB   . ALA A 1 74 ? 3.714   -5.342  1.849   1.00 15.00 ? 74 ALA A CB   4  
ATOM 5352  H H    . ALA A 1 74 ? 5.184   -6.937  3.184   1.00 15.00 ? 74 ALA A H    4  
ATOM 5353  H HA   . ALA A 1 74 ? 5.035   -6.216  0.443   1.00 15.00 ? 74 ALA A HA   4  
ATOM 5354  H HB1  . ALA A 1 74 ? 3.280   -4.730  1.075   1.00 15.00 ? 74 ALA A HB1  4  
ATOM 5355  H HB2  . ALA A 1 74 ? 3.101   -6.214  2.009   1.00 15.00 ? 74 ALA A HB2  4  
ATOM 5356  H HB3  . ALA A 1 74 ? 3.782   -4.772  2.763   1.00 15.00 ? 74 ALA A HB3  4  
ATOM 5357  N N    . VAL A 1 75 ? 6.420   -4.088  2.546   1.00 15.00 ? 75 VAL A N    4  
ATOM 5358  C CA   . VAL A 1 75 ? 7.339   -2.960  2.653   1.00 15.00 ? 75 VAL A CA   4  
ATOM 5359  C C    . VAL A 1 75 ? 8.434   -3.120  1.614   1.00 15.00 ? 75 VAL A C    4  
ATOM 5360  O O    . VAL A 1 75 ? 8.842   -2.164  0.958   1.00 15.00 ? 75 VAL A O    4  
ATOM 5361  C CB   . VAL A 1 75 ? 7.948   -2.895  4.076   1.00 15.00 ? 75 VAL A CB   4  
ATOM 5362  C CG1  . VAL A 1 75 ? 9.451   -3.149  4.069   1.00 15.00 ? 75 VAL A CG1  4  
ATOM 5363  C CG2  . VAL A 1 75 ? 7.636   -1.572  4.746   1.00 15.00 ? 75 VAL A CG2  4  
ATOM 5364  H H    . VAL A 1 75 ? 6.105   -4.523  3.366   1.00 15.00 ? 75 VAL A H    4  
ATOM 5365  H HA   . VAL A 1 75 ? 6.797   -2.046  2.458   1.00 15.00 ? 75 VAL A HA   4  
ATOM 5366  H HB   . VAL A 1 75 ? 7.483   -3.671  4.663   1.00 15.00 ? 75 VAL A HB   4  
ATOM 5367  H HG11 . VAL A 1 75 ? 9.648   -4.129  3.662   1.00 15.00 ? 75 VAL A HG11 4  
ATOM 5368  H HG12 . VAL A 1 75 ? 9.939   -2.402  3.461   1.00 15.00 ? 75 VAL A HG12 4  
ATOM 5369  H HG13 . VAL A 1 75 ? 9.830   -3.096  5.079   1.00 15.00 ? 75 VAL A HG13 4  
ATOM 5370  H HG21 . VAL A 1 75 ? 8.534   -0.976  4.805   1.00 15.00 ? 75 VAL A HG21 4  
ATOM 5371  H HG22 . VAL A 1 75 ? 6.888   -1.045  4.175   1.00 15.00 ? 75 VAL A HG22 4  
ATOM 5372  H HG23 . VAL A 1 75 ? 7.265   -1.764  5.743   1.00 15.00 ? 75 VAL A HG23 4  
ATOM 5373  N N    . GLU A 1 76 ? 8.877   -4.359  1.462   1.00 15.00 ? 76 GLU A N    4  
ATOM 5374  C CA   . GLU A 1 76 ? 9.899   -4.689  0.489   1.00 15.00 ? 76 GLU A CA   4  
ATOM 5375  C C    . GLU A 1 76 ? 9.367   -4.502  -0.930  1.00 15.00 ? 76 GLU A C    4  
ATOM 5376  O O    . GLU A 1 76 ? 10.030  -3.897  -1.767  1.00 15.00 ? 76 GLU A O    4  
ATOM 5377  C CB   . GLU A 1 76 ? 10.376  -6.130  0.683   1.00 15.00 ? 76 GLU A CB   4  
ATOM 5378  C CG   . GLU A 1 76 ? 10.865  -6.425  2.092   1.00 15.00 ? 76 GLU A CG   4  
ATOM 5379  C CD   . GLU A 1 76 ? 12.374  -6.538  2.173   1.00 15.00 ? 76 GLU A CD   4  
ATOM 5380  O OE1  . GLU A 1 76 ? 12.902  -7.638  1.905   1.00 15.00 ? 76 GLU A OE1  4  
ATOM 5381  O OE2  . GLU A 1 76 ? 13.029  -5.528  2.505   1.00 15.00 ? 76 GLU A OE2  4  
ATOM 5382  H H    . GLU A 1 76 ? 8.488   -5.075  2.011   1.00 15.00 ? 76 GLU A H    4  
ATOM 5383  H HA   . GLU A 1 76 ? 10.732  -4.019  0.640   1.00 15.00 ? 76 GLU A HA   4  
ATOM 5384  H HB2  . GLU A 1 76 ? 9.558   -6.801  0.462   1.00 15.00 ? 76 GLU A HB2  4  
ATOM 5385  H HB3  . GLU A 1 76 ? 11.185  -6.325  -0.004  1.00 15.00 ? 76 GLU A HB3  4  
ATOM 5386  H HG2  . GLU A 1 76 ? 10.544  -5.628  2.745   1.00 15.00 ? 76 GLU A HG2  4  
ATOM 5387  H HG3  . GLU A 1 76 ? 10.430  -7.357  2.423   1.00 15.00 ? 76 GLU A HG3  4  
ATOM 5388  N N    . THR A 1 77 ? 8.165   -5.021  -1.199  1.00 15.00 ? 77 THR A N    4  
ATOM 5389  C CA   . THR A 1 77 ? 7.573   -4.894  -2.529  1.00 15.00 ? 77 THR A CA   4  
ATOM 5390  C C    . THR A 1 77 ? 7.295   -3.437  -2.879  1.00 15.00 ? 77 THR A C    4  
ATOM 5391  O O    . THR A 1 77 ? 7.724   -2.952  -3.926  1.00 15.00 ? 77 THR A O    4  
ATOM 5392  C CB   . THR A 1 77 ? 6.285   -5.707  -2.639  1.00 15.00 ? 77 THR A CB   4  
ATOM 5393  O OG1  . THR A 1 77 ? 5.452   -5.489  -1.517  1.00 15.00 ? 77 THR A OG1  4  
ATOM 5394  C CG2  . THR A 1 77 ? 6.526   -7.197  -2.758  1.00 15.00 ? 77 THR A CG2  4  
ATOM 5395  H H    . THR A 1 77 ? 7.665   -5.491  -0.490  1.00 15.00 ? 77 THR A H    4  
ATOM 5396  H HA   . THR A 1 77 ? 8.287   -5.284  -3.239  1.00 15.00 ? 77 THR A HA   4  
ATOM 5397  H HB   . THR A 1 77 ? 5.754   -5.389  -3.523  1.00 15.00 ? 77 THR A HB   4  
ATOM 5398  H HG1  . THR A 1 77 ? 4.670   -6.041  -1.587  1.00 15.00 ? 77 THR A HG1  4  
ATOM 5399  H HG21 . THR A 1 77 ? 6.428   -7.495  -3.792  1.00 15.00 ? 77 THR A HG21 4  
ATOM 5400  H HG22 . THR A 1 77 ? 7.520   -7.430  -2.408  1.00 15.00 ? 77 THR A HG22 4  
ATOM 5401  H HG23 . THR A 1 77 ? 5.800   -7.727  -2.160  1.00 15.00 ? 77 THR A HG23 4  
ATOM 5402  N N    . LEU A 1 78 ? 6.577   -2.739  -2.001  1.00 15.00 ? 78 LEU A N    4  
ATOM 5403  C CA   . LEU A 1 78 ? 6.250   -1.335  -2.236  1.00 15.00 ? 78 LEU A CA   4  
ATOM 5404  C C    . LEU A 1 78 ? 7.518   -0.545  -2.521  1.00 15.00 ? 78 LEU A C    4  
ATOM 5405  O O    . LEU A 1 78 ? 7.587   0.225   -3.478  1.00 15.00 ? 78 LEU A O    4  
ATOM 5406  C CB   . LEU A 1 78 ? 5.525   -0.729  -1.028  1.00 15.00 ? 78 LEU A CB   4  
ATOM 5407  C CG   . LEU A 1 78 ? 4.556   -1.663  -0.296  1.00 15.00 ? 78 LEU A CG   4  
ATOM 5408  C CD1  . LEU A 1 78 ? 3.701   -0.879  0.686   1.00 15.00 ? 78 LEU A CD1  4  
ATOM 5409  C CD2  . LEU A 1 78 ? 3.678   -2.413  -1.287  1.00 15.00 ? 78 LEU A CD2  4  
ATOM 5410  H H    . LEU A 1 78 ? 6.261   -3.176  -1.183  1.00 15.00 ? 78 LEU A H    4  
ATOM 5411  H HA   . LEU A 1 78 ? 5.604   -1.282  -3.099  1.00 15.00 ? 78 LEU A HA   4  
ATOM 5412  H HB2  . LEU A 1 78 ? 6.270   -0.397  -0.320  1.00 15.00 ? 78 LEU A HB2  4  
ATOM 5413  H HB3  . LEU A 1 78 ? 4.968   0.132   -1.367  1.00 15.00 ? 78 LEU A HB3  4  
ATOM 5414  H HG   . LEU A 1 78 ? 5.123   -2.389  0.266   1.00 15.00 ? 78 LEU A HG   4  
ATOM 5415  H HD11 . LEU A 1 78 ? 3.628   0.148   0.360   1.00 15.00 ? 78 LEU A HD11 4  
ATOM 5416  H HD12 . LEU A 1 78 ? 2.712   -1.313  0.729   1.00 15.00 ? 78 LEU A HD12 4  
ATOM 5417  H HD13 . LEU A 1 78 ? 4.153   -0.915  1.666   1.00 15.00 ? 78 LEU A HD13 4  
ATOM 5418  H HD21 . LEU A 1 78 ? 2.912   -2.954  -0.751  1.00 15.00 ? 78 LEU A HD21 4  
ATOM 5419  H HD22 . LEU A 1 78 ? 3.216   -1.710  -1.962  1.00 15.00 ? 78 LEU A HD22 4  
ATOM 5420  H HD23 . LEU A 1 78 ? 4.283   -3.109  -1.849  1.00 15.00 ? 78 LEU A HD23 4  
ATOM 5421  N N    . ARG A 1 79 ? 8.524   -0.757  -1.685  1.00 15.00 ? 79 ARG A N    4  
ATOM 5422  C CA   . ARG A 1 79 ? 9.803   -0.085  -1.839  1.00 15.00 ? 79 ARG A CA   4  
ATOM 5423  C C    . ARG A 1 79 ? 10.528  -0.585  -3.089  1.00 15.00 ? 79 ARG A C    4  
ATOM 5424  O O    . ARG A 1 79 ? 10.864  0.198   -3.977  1.00 15.00 ? 79 ARG A O    4  
ATOM 5425  C CB   . ARG A 1 79 ? 10.662  -0.314  -0.594  1.00 15.00 ? 79 ARG A CB   4  
ATOM 5426  C CG   . ARG A 1 79 ? 11.533  0.877   -0.226  1.00 15.00 ? 79 ARG A CG   4  
ATOM 5427  C CD   . ARG A 1 79 ? 12.717  1.016   -1.169  1.00 15.00 ? 79 ARG A CD   4  
ATOM 5428  N NE   . ARG A 1 79 ? 13.218  2.387   -1.221  1.00 15.00 ? 79 ARG A NE   4  
ATOM 5429  C CZ   . ARG A 1 79 ? 13.979  2.861   -2.204  1.00 15.00 ? 79 ARG A CZ   4  
ATOM 5430  N NH1  . ARG A 1 79 ? 14.330  2.079   -3.217  1.00 15.00 ? 79 ARG A NH1  4  
ATOM 5431  N NH2  . ARG A 1 79 ? 14.391  4.121   -2.174  1.00 15.00 ? 79 ARG A NH2  4  
ATOM 5432  H H    . ARG A 1 79 ? 8.406   -1.392  -0.948  1.00 15.00 ? 79 ARG A H    4  
ATOM 5433  H HA   . ARG A 1 79 ? 9.613   0.972   -1.947  1.00 15.00 ? 79 ARG A HA   4  
ATOM 5434  H HB2  . ARG A 1 79 ? 10.008  -0.526  0.244   1.00 15.00 ? 79 ARG A HB2  4  
ATOM 5435  H HB3  . ARG A 1 79 ? 11.303  -1.166  -0.762  1.00 15.00 ? 79 ARG A HB3  4  
ATOM 5436  H HG2  . ARG A 1 79 ? 10.938  1.776   -0.279  1.00 15.00 ? 79 ARG A HG2  4  
ATOM 5437  H HG3  . ARG A 1 79 ? 11.900  0.744   0.781   1.00 15.00 ? 79 ARG A HG3  4  
ATOM 5438  H HD2  . ARG A 1 79 ? 13.510  0.366   -0.829  1.00 15.00 ? 79 ARG A HD2  4  
ATOM 5439  H HD3  . ARG A 1 79 ? 12.409  0.718   -2.160  1.00 15.00 ? 79 ARG A HD3  4  
ATOM 5440  H HE   . ARG A 1 79 ? 12.974  2.986   -0.484  1.00 15.00 ? 79 ARG A HE   4  
ATOM 5441  H HH11 . ARG A 1 79 ? 14.023  1.128   -3.245  1.00 15.00 ? 79 ARG A HH11 4  
ATOM 5442  H HH12 . ARG A 1 79 ? 14.901  2.442   -3.953  1.00 15.00 ? 79 ARG A HH12 4  
ATOM 5443  H HH21 . ARG A 1 79 ? 14.130  4.714   -1.412  1.00 15.00 ? 79 ARG A HH21 4  
ATOM 5444  H HH22 . ARG A 1 79 ? 14.963  4.478   -2.912  1.00 15.00 ? 79 ARG A HH22 4  
ATOM 5445  N N    . ASN A 1 80 ? 10.769  -1.893  -3.144  1.00 15.00 ? 80 ASN A N    4  
ATOM 5446  C CA   . ASN A 1 80 ? 11.457  -2.510  -4.278  1.00 15.00 ? 80 ASN A CA   4  
ATOM 5447  C C    . ASN A 1 80 ? 10.635  -2.418  -5.565  1.00 15.00 ? 80 ASN A C    4  
ATOM 5448  O O    . ASN A 1 80 ? 10.253  -3.440  -6.136  1.00 15.00 ? 80 ASN A O    4  
ATOM 5449  C CB   . ASN A 1 80 ? 11.772  -3.978  -3.979  1.00 15.00 ? 80 ASN A CB   4  
ATOM 5450  C CG   . ASN A 1 80 ? 12.900  -4.138  -2.978  1.00 15.00 ? 80 ASN A CG   4  
ATOM 5451  O OD1  . ASN A 1 80 ? 14.040  -4.417  -3.350  1.00 15.00 ? 80 ASN A OD1  4  
ATOM 5452  N ND2  . ASN A 1 80 ? 12.589  -3.963  -1.699  1.00 15.00 ? 80 ASN A ND2  4  
ATOM 5453  H H    . ASN A 1 80 ? 10.478  -2.461  -2.400  1.00 15.00 ? 80 ASN A H    4  
ATOM 5454  H HA   . ASN A 1 80 ? 12.386  -1.980  -4.425  1.00 15.00 ? 80 ASN A HA   4  
ATOM 5455  H HB2  . ASN A 1 80 ? 10.889  -4.457  -3.583  1.00 15.00 ? 80 ASN A HB2  4  
ATOM 5456  H HB3  . ASN A 1 80 ? 12.059  -4.469  -4.897  1.00 15.00 ? 80 ASN A HB3  4  
ATOM 5457  H HD21 . ASN A 1 80 ? 11.662  -3.742  -1.474  1.00 15.00 ? 80 ASN A HD21 4  
ATOM 5458  H HD22 . ASN A 1 80 ? 13.301  -4.061  -1.032  1.00 15.00 ? 80 ASN A HD22 4  
ATOM 5459  N N    . THR A 1 81 ? 10.379  -1.201  -6.032  1.00 15.00 ? 81 THR A N    4  
ATOM 5460  C CA   . THR A 1 81 ? 9.619   -1.012  -7.264  1.00 15.00 ? 81 THR A CA   4  
ATOM 5461  C C    . THR A 1 81 ? 10.569  -0.879  -8.451  1.00 15.00 ? 81 THR A C    4  
ATOM 5462  O O    . THR A 1 81 ? 10.685  -1.792  -9.270  1.00 15.00 ? 81 THR A O    4  
ATOM 5463  C CB   . THR A 1 81 ? 8.716   0.219   -7.163  1.00 15.00 ? 81 THR A CB   4  
ATOM 5464  O OG1  . THR A 1 81 ? 9.006   0.962   -5.992  1.00 15.00 ? 81 THR A OG1  4  
ATOM 5465  C CG2  . THR A 1 81 ? 7.241   -0.122  -7.136  1.00 15.00 ? 81 THR A CG2  4  
ATOM 5466  H H    . THR A 1 81 ? 10.715  -0.418  -5.548  1.00 15.00 ? 81 THR A H    4  
ATOM 5467  H HA   . THR A 1 81 ? 9.004   -1.888  -7.409  1.00 15.00 ? 81 THR A HA   4  
ATOM 5468  H HB   . THR A 1 81 ? 8.891   0.853   -8.020  1.00 15.00 ? 81 THR A HB   4  
ATOM 5469  H HG1  . THR A 1 81 ? 8.881   0.404   -5.220  1.00 15.00 ? 81 THR A HG1  4  
ATOM 5470  H HG21 . THR A 1 81 ? 6.703   0.556   -7.781  1.00 15.00 ? 81 THR A HG21 4  
ATOM 5471  H HG22 . THR A 1 81 ? 7.100   -1.136  -7.482  1.00 15.00 ? 81 THR A HG22 4  
ATOM 5472  H HG23 . THR A 1 81 ? 6.868   -0.031  -6.127  1.00 15.00 ? 81 THR A HG23 4  
ATOM 5473  N N    . GLY A 1 82 ? 11.258  0.256   -8.531  1.00 15.00 ? 82 GLY A N    4  
ATOM 5474  C CA   . GLY A 1 82 ? 12.199  0.477   -9.609  1.00 15.00 ? 82 GLY A CA   4  
ATOM 5475  C C    . GLY A 1 82 ? 11.885  1.711   -10.429 1.00 15.00 ? 82 GLY A C    4  
ATOM 5476  O O    . GLY A 1 82 ? 12.127  2.837   -9.995  1.00 15.00 ? 82 GLY A O    4  
ATOM 5477  H H    . GLY A 1 82 ? 11.132  0.943   -7.850  1.00 15.00 ? 82 GLY A H    4  
ATOM 5478  H HA2  . GLY A 1 82 ? 13.188  0.583   -9.189  1.00 15.00 ? 82 GLY A HA2  4  
ATOM 5479  H HA3  . GLY A 1 82 ? 12.190  -0.385  -10.261 1.00 15.00 ? 82 GLY A HA3  4  
ATOM 5480  N N    . GLN A 1 83 ? 11.359  1.491   -11.624 1.00 15.00 ? 83 GLN A N    4  
ATOM 5481  C CA   . GLN A 1 83 ? 11.021  2.584   -12.534 1.00 15.00 ? 83 GLN A CA   4  
ATOM 5482  C C    . GLN A 1 83 ? 9.907   3.469   -11.973 1.00 15.00 ? 83 GLN A C    4  
ATOM 5483  O O    . GLN A 1 83 ? 10.173  4.523   -11.396 1.00 15.00 ? 83 GLN A O    4  
ATOM 5484  C CB   . GLN A 1 83 ? 10.620  2.044   -13.915 1.00 15.00 ? 83 GLN A CB   4  
ATOM 5485  C CG   . GLN A 1 83 ? 9.924   0.690   -13.882 1.00 15.00 ? 83 GLN A CG   4  
ATOM 5486  C CD   . GLN A 1 83 ? 8.798   0.591   -14.892 1.00 15.00 ? 83 GLN A CD   4  
ATOM 5487  O OE1  . GLN A 1 83 ? 7.790   1.290   -14.786 1.00 15.00 ? 83 GLN A OE1  4  
ATOM 5488  N NE2  . GLN A 1 83 ? 8.963   -0.282  -15.879 1.00 15.00 ? 83 GLN A NE2  4  
ATOM 5489  H H    . GLN A 1 83 ? 11.205  0.568   -11.904 1.00 15.00 ? 83 GLN A H    4  
ATOM 5490  H HA   . GLN A 1 83 ? 11.907  3.190   -12.649 1.00 15.00 ? 83 GLN A HA   4  
ATOM 5491  H HB2  . GLN A 1 83 ? 9.953   2.752   -14.383 1.00 15.00 ? 83 GLN A HB2  4  
ATOM 5492  H HB3  . GLN A 1 83 ? 11.510  1.951   -14.521 1.00 15.00 ? 83 GLN A HB3  4  
ATOM 5493  H HG2  . GLN A 1 83 ? 10.650  -0.079  -14.099 1.00 15.00 ? 83 GLN A HG2  4  
ATOM 5494  H HG3  . GLN A 1 83 ? 9.517   0.532   -12.894 1.00 15.00 ? 83 GLN A HG3  4  
ATOM 5495  H HE21 . GLN A 1 83 ? 9.791   -0.806  -15.900 1.00 15.00 ? 83 GLN A HE21 4  
ATOM 5496  H HE22 . GLN A 1 83 ? 8.250   -0.367  -16.546 1.00 15.00 ? 83 GLN A HE22 4  
ATOM 5497  N N    . VAL A 1 84 ? 8.662   3.041   -12.158 1.00 15.00 ? 84 VAL A N    4  
ATOM 5498  C CA   . VAL A 1 84 ? 7.509   3.794   -11.683 1.00 15.00 ? 84 VAL A CA   4  
ATOM 5499  C C    . VAL A 1 84 ? 6.838   3.080   -10.511 1.00 15.00 ? 84 VAL A C    4  
ATOM 5500  O O    . VAL A 1 84 ? 7.019   1.878   -10.315 1.00 15.00 ? 84 VAL A O    4  
ATOM 5501  C CB   . VAL A 1 84 ? 6.486   4.007   -12.823 1.00 15.00 ? 84 VAL A CB   4  
ATOM 5502  C CG1  . VAL A 1 84 ? 5.191   4.617   -12.304 1.00 15.00 ? 84 VAL A CG1  4  
ATOM 5503  C CG2  . VAL A 1 84 ? 7.087   4.884   -13.909 1.00 15.00 ? 84 VAL A CG2  4  
ATOM 5504  H H    . VAL A 1 84 ? 8.515   2.198   -12.631 1.00 15.00 ? 84 VAL A H    4  
ATOM 5505  H HA   . VAL A 1 84 ? 7.855   4.766   -11.354 1.00 15.00 ? 84 VAL A HA   4  
ATOM 5506  H HB   . VAL A 1 84 ? 6.255   3.045   -13.257 1.00 15.00 ? 84 VAL A HB   4  
ATOM 5507  H HG11 . VAL A 1 84 ? 5.405   5.566   -11.836 1.00 15.00 ? 84 VAL A HG11 4  
ATOM 5508  H HG12 . VAL A 1 84 ? 4.511   4.769   -13.129 1.00 15.00 ? 84 VAL A HG12 4  
ATOM 5509  H HG13 . VAL A 1 84 ? 4.740   3.952   -11.584 1.00 15.00 ? 84 VAL A HG13 4  
ATOM 5510  H HG21 . VAL A 1 84 ? 7.238   5.882   -13.522 1.00 15.00 ? 84 VAL A HG21 4  
ATOM 5511  H HG22 . VAL A 1 84 ? 8.035   4.472   -14.222 1.00 15.00 ? 84 VAL A HG22 4  
ATOM 5512  H HG23 . VAL A 1 84 ? 6.415   4.924   -14.754 1.00 15.00 ? 84 VAL A HG23 4  
ATOM 5513  N N    . VAL A 1 85 ? 6.062   3.826   -9.736  1.00 15.00 ? 85 VAL A N    4  
ATOM 5514  C CA   . VAL A 1 85 ? 5.369   3.265   -8.588  1.00 15.00 ? 85 VAL A CA   4  
ATOM 5515  C C    . VAL A 1 85 ? 3.924   2.926   -8.946  1.00 15.00 ? 85 VAL A C    4  
ATOM 5516  O O    . VAL A 1 85 ? 3.002   3.685   -8.650  1.00 15.00 ? 85 VAL A O    4  
ATOM 5517  C CB   . VAL A 1 85 ? 5.408   4.248   -7.394  1.00 15.00 ? 85 VAL A CB   4  
ATOM 5518  C CG1  . VAL A 1 85 ? 4.346   3.919   -6.355  1.00 15.00 ? 85 VAL A CG1  4  
ATOM 5519  C CG2  . VAL A 1 85 ? 6.793   4.258   -6.763  1.00 15.00 ? 85 VAL A CG2  4  
ATOM 5520  H H    . VAL A 1 85 ? 5.951   4.779   -9.940  1.00 15.00 ? 85 VAL A H    4  
ATOM 5521  H HA   . VAL A 1 85 ? 5.881   2.358   -8.299  1.00 15.00 ? 85 VAL A HA   4  
ATOM 5522  H HB   . VAL A 1 85 ? 5.207   5.236   -7.770  1.00 15.00 ? 85 VAL A HB   4  
ATOM 5523  H HG11 . VAL A 1 85 ? 4.015   2.900   -6.486  1.00 15.00 ? 85 VAL A HG11 4  
ATOM 5524  H HG12 . VAL A 1 85 ? 4.762   4.040   -5.365  1.00 15.00 ? 85 VAL A HG12 4  
ATOM 5525  H HG13 . VAL A 1 85 ? 3.507   4.592   -6.479  1.00 15.00 ? 85 VAL A HG13 4  
ATOM 5526  H HG21 . VAL A 1 85 ? 6.700   4.247   -5.687  1.00 15.00 ? 85 VAL A HG21 4  
ATOM 5527  H HG22 . VAL A 1 85 ? 7.343   3.386   -7.086  1.00 15.00 ? 85 VAL A HG22 4  
ATOM 5528  H HG23 . VAL A 1 85 ? 7.321   5.149   -7.069  1.00 15.00 ? 85 VAL A HG23 4  
ATOM 5529  N N    . HIS A 1 86 ? 3.742   1.775   -9.587  1.00 15.00 ? 86 HIS A N    4  
ATOM 5530  C CA   . HIS A 1 86 ? 2.415   1.320   -9.989  1.00 15.00 ? 86 HIS A CA   4  
ATOM 5531  C C    . HIS A 1 86 ? 1.914   0.235   -9.041  1.00 15.00 ? 86 HIS A C    4  
ATOM 5532  O O    . HIS A 1 86 ? 2.080   -0.957  -9.299  1.00 15.00 ? 86 HIS A O    4  
ATOM 5533  C CB   . HIS A 1 86 ? 2.444   0.790   -11.424 1.00 15.00 ? 86 HIS A CB   4  
ATOM 5534  C CG   . HIS A 1 86 ? 1.233   1.160   -12.223 1.00 15.00 ? 86 HIS A CG   4  
ATOM 5535  N ND1  . HIS A 1 86 ? -0.009  1.362   -11.658 1.00 15.00 ? 86 HIS A ND1  4  
ATOM 5536  C CD2  . HIS A 1 86 ? 1.078   1.368   -13.552 1.00 15.00 ? 86 HIS A CD2  4  
ATOM 5537  C CE1  . HIS A 1 86 ? -0.875  1.676   -12.605 1.00 15.00 ? 86 HIS A CE1  4  
ATOM 5538  N NE2  . HIS A 1 86 ? -0.241  1.688   -13.763 1.00 15.00 ? 86 HIS A NE2  4  
ATOM 5539  H H    . HIS A 1 86 ? 4.522   1.215   -9.794  1.00 15.00 ? 86 HIS A H    4  
ATOM 5540  H HA   . HIS A 1 86 ? 1.744   2.165   -9.939  1.00 15.00 ? 86 HIS A HA   4  
ATOM 5541  H HB2  . HIS A 1 86 ? 3.310   1.189   -11.930 1.00 15.00 ? 86 HIS A HB2  4  
ATOM 5542  H HB3  . HIS A 1 86 ? 2.512   -0.288  -11.401 1.00 15.00 ? 86 HIS A HB3  4  
ATOM 5543  H HD1  . HIS A 1 86 ? -0.224  1.284   -10.705 1.00 15.00 ? 86 HIS A HD1  4  
ATOM 5544  H HD2  . HIS A 1 86 ? 1.849   1.296   -14.307 1.00 15.00 ? 86 HIS A HD2  4  
ATOM 5545  H HE1  . HIS A 1 86 ? -1.923  1.890   -12.457 1.00 15.00 ? 86 HIS A HE1  4  
ATOM 5546  H HE2  . HIS A 1 86 ? -0.663  1.815   -14.638 1.00 15.00 ? 86 HIS A HE2  4  
ATOM 5547  N N    . LEU A 1 87 ? 1.315   0.661   -7.935  1.00 15.00 ? 87 LEU A N    4  
ATOM 5548  C CA   . LEU A 1 87 ? 0.803   -0.264  -6.933  1.00 15.00 ? 87 LEU A CA   4  
ATOM 5549  C C    . LEU A 1 87 ? -0.712  -0.416  -7.026  1.00 15.00 ? 87 LEU A C    4  
ATOM 5550  O O    . LEU A 1 87 ? -1.451  0.550   -6.860  1.00 15.00 ? 87 LEU A O    4  
ATOM 5551  C CB   . LEU A 1 87 ? 1.186   0.229   -5.537  1.00 15.00 ? 87 LEU A CB   4  
ATOM 5552  C CG   . LEU A 1 87 ? 2.092   -0.709  -4.749  1.00 15.00 ? 87 LEU A CG   4  
ATOM 5553  C CD1  . LEU A 1 87 ? 3.224   0.065   -4.091  1.00 15.00 ? 87 LEU A CD1  4  
ATOM 5554  C CD2  . LEU A 1 87 ? 1.286   -1.469  -3.709  1.00 15.00 ? 87 LEU A CD2  4  
ATOM 5555  H H    . LEU A 1 87 ? 1.225   1.623   -7.783  1.00 15.00 ? 87 LEU A H    4  
ATOM 5556  H HA   . LEU A 1 87 ? 1.262   -1.226  -7.102  1.00 15.00 ? 87 LEU A HA   4  
ATOM 5557  H HB2  . LEU A 1 87 ? 1.687   1.178   -5.638  1.00 15.00 ? 87 LEU A HB2  4  
ATOM 5558  H HB3  . LEU A 1 87 ? 0.282   0.380   -4.969  1.00 15.00 ? 87 LEU A HB3  4  
ATOM 5559  H HG   . LEU A 1 87 ? 2.527   -1.423  -5.429  1.00 15.00 ? 87 LEU A HG   4  
ATOM 5560  H HD11 . LEU A 1 87 ? 2.813   0.852   -3.476  1.00 15.00 ? 87 LEU A HD11 4  
ATOM 5561  H HD12 . LEU A 1 87 ? 3.808   -0.603  -3.477  1.00 15.00 ? 87 LEU A HD12 4  
ATOM 5562  H HD13 . LEU A 1 87 ? 3.856   0.497   -4.853  1.00 15.00 ? 87 LEU A HD13 4  
ATOM 5563  H HD21 . LEU A 1 87 ? 0.991   -0.792  -2.922  1.00 15.00 ? 87 LEU A HD21 4  
ATOM 5564  H HD22 . LEU A 1 87 ? 0.403   -1.887  -4.171  1.00 15.00 ? 87 LEU A HD22 4  
ATOM 5565  H HD23 . LEU A 1 87 ? 1.886   -2.263  -3.294  1.00 15.00 ? 87 LEU A HD23 4  
ATOM 5566  N N    . LEU A 1 88 ? -1.169  -1.640  -7.270  1.00 15.00 ? 88 LEU A N    4  
ATOM 5567  C CA   . LEU A 1 88 ? -2.598  -1.920  -7.359  1.00 15.00 ? 88 LEU A CA   4  
ATOM 5568  C C    . LEU A 1 88 ? -3.115  -2.394  -6.008  1.00 15.00 ? 88 LEU A C    4  
ATOM 5569  O O    . LEU A 1 88 ? -2.919  -3.548  -5.625  1.00 15.00 ? 88 LEU A O    4  
ATOM 5570  C CB   . LEU A 1 88 ? -2.869  -2.972  -8.437  1.00 15.00 ? 88 LEU A CB   4  
ATOM 5571  C CG   . LEU A 1 88 ? -2.974  -2.427  -9.865  1.00 15.00 ? 88 LEU A CG   4  
ATOM 5572  C CD1  . LEU A 1 88 ? -1.912  -1.365  -10.117 1.00 15.00 ? 88 LEU A CD1  4  
ATOM 5573  C CD2  . LEU A 1 88 ? -2.848  -3.558  -10.875 1.00 15.00 ? 88 LEU A CD2  4  
ATOM 5574  H H    . LEU A 1 88 ? -0.530  -2.376  -7.377  1.00 15.00 ? 88 LEU A H    4  
ATOM 5575  H HA   . LEU A 1 88 ? -3.103  -1.000  -7.626  1.00 15.00 ? 88 LEU A HA   4  
ATOM 5576  H HB2  . LEU A 1 88 ? -2.070  -3.697  -8.408  1.00 15.00 ? 88 LEU A HB2  4  
ATOM 5577  H HB3  . LEU A 1 88 ? -3.795  -3.472  -8.198  1.00 15.00 ? 88 LEU A HB3  4  
ATOM 5578  H HG   . LEU A 1 88 ? -3.943  -1.967  -9.996  1.00 15.00 ? 88 LEU A HG   4  
ATOM 5579  H HD11 . LEU A 1 88 ? -1.841  -0.715  -9.255  1.00 15.00 ? 88 LEU A HD11 4  
ATOM 5580  H HD12 . LEU A 1 88 ? -0.959  -1.842  -10.288 1.00 15.00 ? 88 LEU A HD12 4  
ATOM 5581  H HD13 . LEU A 1 88 ? -2.185  -0.782  -10.983 1.00 15.00 ? 88 LEU A HD13 4  
ATOM 5582  H HD21 . LEU A 1 88 ? -2.906  -3.155  -11.875 1.00 15.00 ? 88 LEU A HD21 4  
ATOM 5583  H HD22 . LEU A 1 88 ? -1.898  -4.055  -10.743 1.00 15.00 ? 88 LEU A HD22 4  
ATOM 5584  H HD23 . LEU A 1 88 ? -3.649  -4.266  -10.725 1.00 15.00 ? 88 LEU A HD23 4  
ATOM 5585  N N    . LEU A 1 89 ? -3.751  -1.487  -5.278  1.00 15.00 ? 89 LEU A N    4  
ATOM 5586  C CA   . LEU A 1 89 ? -4.269  -1.798  -3.952  1.00 15.00 ? 89 LEU A CA   4  
ATOM 5587  C C    . LEU A 1 89 ? -5.785  -1.945  -3.947  1.00 15.00 ? 89 LEU A C    4  
ATOM 5588  O O    . LEU A 1 89 ? -6.421  -2.088  -4.991  1.00 15.00 ? 89 LEU A O    4  
ATOM 5589  C CB   . LEU A 1 89 ? -3.872  -0.706  -2.956  1.00 15.00 ? 89 LEU A CB   4  
ATOM 5590  C CG   . LEU A 1 89 ? -2.793  0.250   -3.440  1.00 15.00 ? 89 LEU A CG   4  
ATOM 5591  C CD1  . LEU A 1 89 ? -2.713  1.459   -2.533  1.00 15.00 ? 89 LEU A CD1  4  
ATOM 5592  C CD2  . LEU A 1 89 ? -1.461  -0.461  -3.500  1.00 15.00 ? 89 LEU A CD2  4  
ATOM 5593  H H    . LEU A 1 89 ? -3.859  -0.581  -5.633  1.00 15.00 ? 89 LEU A H    4  
ATOM 5594  H HA   . LEU A 1 89 ? -3.823  -2.726  -3.639  1.00 15.00 ? 89 LEU A HA   4  
ATOM 5595  H HB2  . LEU A 1 89 ? -4.753  -0.128  -2.716  1.00 15.00 ? 89 LEU A HB2  4  
ATOM 5596  H HB3  . LEU A 1 89 ? -3.519  -1.183  -2.054  1.00 15.00 ? 89 LEU A HB3  4  
ATOM 5597  H HG   . LEU A 1 89 ? -3.038  0.588   -4.433  1.00 15.00 ? 89 LEU A HG   4  
ATOM 5598  H HD11 . LEU A 1 89 ? -3.636  1.557   -1.982  1.00 15.00 ? 89 LEU A HD11 4  
ATOM 5599  H HD12 . LEU A 1 89 ? -1.893  1.331   -1.844  1.00 15.00 ? 89 LEU A HD12 4  
ATOM 5600  H HD13 . LEU A 1 89 ? -2.552  2.345   -3.128  1.00 15.00 ? 89 LEU A HD13 4  
ATOM 5601  H HD21 . LEU A 1 89 ? -0.673  0.229   -3.244  1.00 15.00 ? 89 LEU A HD21 4  
ATOM 5602  H HD22 . LEU A 1 89 ? -1.464  -1.282  -2.799  1.00 15.00 ? 89 LEU A HD22 4  
ATOM 5603  H HD23 . LEU A 1 89 ? -1.302  -0.840  -4.498  1.00 15.00 ? 89 LEU A HD23 4  
ATOM 5604  N N    . GLU A 1 90 ? -6.347  -1.886  -2.745  1.00 15.00 ? 90 GLU A N    4  
ATOM 5605  C CA   . GLU A 1 90 ? -7.785  -1.986  -2.547  1.00 15.00 ? 90 GLU A CA   4  
ATOM 5606  C C    . GLU A 1 90 ? -8.216  -1.021  -1.447  1.00 15.00 ? 90 GLU A C    4  
ATOM 5607  O O    . GLU A 1 90 ? -7.521  -0.863  -0.443  1.00 15.00 ? 90 GLU A O    4  
ATOM 5608  C CB   . GLU A 1 90 ? -8.177  -3.428  -2.196  1.00 15.00 ? 90 GLU A CB   4  
ATOM 5609  C CG   . GLU A 1 90 ? -9.348  -3.544  -1.231  1.00 15.00 ? 90 GLU A CG   4  
ATOM 5610  C CD   . GLU A 1 90 ? -9.887  -4.958  -1.137  1.00 15.00 ? 90 GLU A CD   4  
ATOM 5611  O OE1  . GLU A 1 90 ? -9.085  -5.884  -0.894  1.00 15.00 ? 90 GLU A OE1  4  
ATOM 5612  O OE2  . GLU A 1 90 ? -11.111 -5.139  -1.306  1.00 15.00 ? 90 GLU A OE2  4  
ATOM 5613  H H    . GLU A 1 90 ? -5.769  -1.756  -1.963  1.00 15.00 ? 90 GLU A H    4  
ATOM 5614  H HA   . GLU A 1 90 ? -8.267  -1.701  -3.470  1.00 15.00 ? 90 GLU A HA   4  
ATOM 5615  H HB2  . GLU A 1 90 ? -8.443  -3.941  -3.106  1.00 15.00 ? 90 GLU A HB2  4  
ATOM 5616  H HB3  . GLU A 1 90 ? -7.324  -3.921  -1.753  1.00 15.00 ? 90 GLU A HB3  4  
ATOM 5617  H HG2  . GLU A 1 90 ? -9.021  -3.234  -0.249  1.00 15.00 ? 90 GLU A HG2  4  
ATOM 5618  H HG3  . GLU A 1 90 ? -10.141 -2.893  -1.567  1.00 15.00 ? 90 GLU A HG3  4  
ATOM 5619  N N    . LYS A 1 91 ? -9.358  -0.371  -1.639  1.00 15.00 ? 91 LYS A N    4  
ATOM 5620  C CA   . LYS A 1 91 ? -9.859  0.580   -0.657  1.00 15.00 ? 91 LYS A CA   4  
ATOM 5621  C C    . LYS A 1 91 ? -9.998  -0.072  0.714   1.00 15.00 ? 91 LYS A C    4  
ATOM 5622  O O    . LYS A 1 91 ? -10.995 -0.733  1.004   1.00 15.00 ? 91 LYS A O    4  
ATOM 5623  C CB   . LYS A 1 91 ? -11.198 1.155   -1.109  1.00 15.00 ? 91 LYS A CB   4  
ATOM 5624  C CG   . LYS A 1 91 ? -11.520 2.495   -0.469  1.00 15.00 ? 91 LYS A CG   4  
ATOM 5625  C CD   . LYS A 1 91 ? -11.044 3.654   -1.331  1.00 15.00 ? 91 LYS A CD   4  
ATOM 5626  C CE   . LYS A 1 91 ? -10.498 4.790   -0.482  1.00 15.00 ? 91 LYS A CE   4  
ATOM 5627  N NZ   . LYS A 1 91 ? -9.203  4.431   0.160   1.00 15.00 ? 91 LYS A NZ   4  
ATOM 5628  H H    . LYS A 1 91 ? -9.872  -0.531  -2.458  1.00 15.00 ? 91 LYS A H    4  
ATOM 5629  H HA   . LYS A 1 91 ? -9.142  1.384   -0.584  1.00 15.00 ? 91 LYS A HA   4  
ATOM 5630  H HB2  . LYS A 1 91 ? -11.176 1.285   -2.182  1.00 15.00 ? 91 LYS A HB2  4  
ATOM 5631  H HB3  . LYS A 1 91 ? -11.983 0.459   -0.854  1.00 15.00 ? 91 LYS A HB3  4  
ATOM 5632  H HG2  . LYS A 1 91 ? -12.587 2.572   -0.336  1.00 15.00 ? 91 LYS A HG2  4  
ATOM 5633  H HG3  . LYS A 1 91 ? -11.031 2.549   0.492   1.00 15.00 ? 91 LYS A HG3  4  
ATOM 5634  H HD2  . LYS A 1 91 ? -10.263 3.303   -1.990  1.00 15.00 ? 91 LYS A HD2  4  
ATOM 5635  H HD3  . LYS A 1 91 ? -11.875 4.020   -1.916  1.00 15.00 ? 91 LYS A HD3  4  
ATOM 5636  H HE2  . LYS A 1 91 ? -10.349 5.654   -1.112  1.00 15.00 ? 91 LYS A HE2  4  
ATOM 5637  H HE3  . LYS A 1 91 ? -11.218 5.026   0.287   1.00 15.00 ? 91 LYS A HE3  4  
ATOM 5638  H HZ1  . LYS A 1 91 ? -9.363  4.124   1.141   1.00 15.00 ? 91 LYS A HZ1  4  
ATOM 5639  H HZ2  . LYS A 1 91 ? -8.747  3.657   -0.363  1.00 15.00 ? 91 LYS A HZ2  4  
ATOM 5640  H HZ3  . LYS A 1 91 ? -8.567  5.254   0.166   1.00 15.00 ? 91 LYS A HZ3  4  
ATOM 5641  N N    . GLY A 1 92 ? -8.982  0.117   1.548   1.00 15.00 ? 92 GLY A N    4  
ATOM 5642  C CA   . GLY A 1 92 ? -8.987  -0.457  2.883   1.00 15.00 ? 92 GLY A CA   4  
ATOM 5643  C C    . GLY A 1 92 ? -9.952  0.236   3.828   1.00 15.00 ? 92 GLY A C    4  
ATOM 5644  O O    . GLY A 1 92 ? -9.552  0.703   4.895   1.00 15.00 ? 92 GLY A O    4  
ATOM 5645  H H    . GLY A 1 92 ? -8.217  0.652   1.253   1.00 15.00 ? 92 GLY A H    4  
ATOM 5646  H HA2  . GLY A 1 92 ? -9.260  -1.499  2.811   1.00 15.00 ? 92 GLY A HA2  4  
ATOM 5647  H HA3  . GLY A 1 92 ? -7.989  -0.387  3.292   1.00 15.00 ? 92 GLY A HA3  4  
ATOM 5648  N N    . GLN A 1 93 ? -11.223 0.301   3.445   1.00 15.00 ? 93 GLN A N    4  
ATOM 5649  C CA   . GLN A 1 93 ? -12.236 0.939   4.277   1.00 15.00 ? 93 GLN A CA   4  
ATOM 5650  C C    . GLN A 1 93 ? -12.814 -0.049  5.286   1.00 15.00 ? 93 GLN A C    4  
ATOM 5651  O O    . GLN A 1 93 ? -13.220 -1.153  4.924   1.00 15.00 ? 93 GLN A O    4  
ATOM 5652  C CB   . GLN A 1 93 ? -13.354 1.516   3.407   1.00 15.00 ? 93 GLN A CB   4  
ATOM 5653  C CG   . GLN A 1 93 ? -13.447 3.033   3.464   1.00 15.00 ? 93 GLN A CG   4  
ATOM 5654  C CD   . GLN A 1 93 ? -13.767 3.546   4.854   1.00 15.00 ? 93 GLN A CD   4  
ATOM 5655  O OE1  . GLN A 1 93 ? -13.056 3.253   5.816   1.00 15.00 ? 93 GLN A OE1  4  
ATOM 5656  N NE2  . GLN A 1 93 ? -14.841 4.318   4.968   1.00 15.00 ? 93 GLN A NE2  4  
ATOM 5657  H H    . GLN A 1 93 ? -11.487 -0.092  2.589   1.00 15.00 ? 93 GLN A H    4  
ATOM 5658  H HA   . GLN A 1 93 ? -11.760 1.745   4.815   1.00 15.00 ? 93 GLN A HA   4  
ATOM 5659  H HB2  . GLN A 1 93 ? -13.181 1.226   2.381   1.00 15.00 ? 93 GLN A HB2  4  
ATOM 5660  H HB3  . GLN A 1 93 ? -14.299 1.107   3.732   1.00 15.00 ? 93 GLN A HB3  4  
ATOM 5661  H HG2  . GLN A 1 93 ? -12.501 3.450   3.152   1.00 15.00 ? 93 GLN A HG2  4  
ATOM 5662  H HG3  . GLN A 1 93 ? -14.224 3.358   2.788   1.00 15.00 ? 93 GLN A HG3  4  
ATOM 5663  H HE21 . GLN A 1 93 ? -15.360 4.511   4.160   1.00 15.00 ? 93 GLN A HE21 4  
ATOM 5664  H HE22 . GLN A 1 93 ? -15.072 4.663   5.856   1.00 15.00 ? 93 GLN A HE22 4  
ATOM 5665  N N    . SER A 1 94 ? -12.850 0.355   6.551   1.00 15.00 ? 94 SER A N    4  
ATOM 5666  C CA   . SER A 1 94 ? -13.381 -0.496  7.610   1.00 15.00 ? 94 SER A CA   4  
ATOM 5667  C C    . SER A 1 94 ? -14.890 -0.311  7.748   1.00 15.00 ? 94 SER A C    4  
ATOM 5668  O O    . SER A 1 94 ? -15.454 0.658   7.240   1.00 15.00 ? 94 SER A O    4  
ATOM 5669  C CB   . SER A 1 94 ? -12.693 -0.183  8.940   1.00 15.00 ? 94 SER A CB   4  
ATOM 5670  O OG   . SER A 1 94 ? -11.339 0.184   8.740   1.00 15.00 ? 94 SER A OG   4  
ATOM 5671  H H    . SER A 1 94 ? -12.513 1.247   6.779   1.00 15.00 ? 94 SER A H    4  
ATOM 5672  H HA   . SER A 1 94 ? -13.179 -1.522  7.342   1.00 15.00 ? 94 SER A HA   4  
ATOM 5673  H HB2  . SER A 1 94 ? -13.206 0.634   9.425   1.00 15.00 ? 94 SER A HB2  4  
ATOM 5674  H HB3  . SER A 1 94 ? -12.726 -1.057  9.574   1.00 15.00 ? 94 SER A HB3  4  
ATOM 5675  H HG   . SER A 1 94 ? -11.285 1.125   8.558   1.00 15.00 ? 94 SER A HG   4  
ATOM 5676  N N    . PRO A 1 95 ? -15.567 -1.242  8.443   1.00 15.00 ? 95 PRO A N    4  
ATOM 5677  C CA   . PRO A 1 95 ? -17.018 -1.175  8.646   1.00 15.00 ? 95 PRO A CA   4  
ATOM 5678  C C    . PRO A 1 95 ? -17.469 0.191   9.154   1.00 15.00 ? 95 PRO A C    4  
ATOM 5679  O O    . PRO A 1 95 ? -18.612 0.596   8.941   1.00 15.00 ? 95 PRO A O    4  
ATOM 5680  C CB   . PRO A 1 95 ? -17.277 -2.252  9.701   1.00 15.00 ? 95 PRO A CB   4  
ATOM 5681  C CG   . PRO A 1 95 ? -16.170 -3.231  9.519   1.00 15.00 ? 95 PRO A CG   4  
ATOM 5682  C CD   . PRO A 1 95 ? -14.973 -2.430  9.084   1.00 15.00 ? 95 PRO A CD   4  
ATOM 5683  H HA   . PRO A 1 95 ? -17.556 -1.417  7.741   1.00 15.00 ? 95 PRO A HA   4  
ATOM 5684  H HB2  . PRO A 1 95 ? -17.256 -1.807  10.685  1.00 15.00 ? 95 PRO A HB2  4  
ATOM 5685  H HB3  . PRO A 1 95 ? -18.240 -2.708  9.525   1.00 15.00 ? 95 PRO A HB3  4  
ATOM 5686  H HG2  . PRO A 1 95 ? -15.966 -3.733  10.453  1.00 15.00 ? 95 PRO A HG2  4  
ATOM 5687  H HG3  . PRO A 1 95 ? -16.437 -3.949  8.757   1.00 15.00 ? 95 PRO A HG3  4  
ATOM 5688  H HD2  . PRO A 1 95 ? -14.377 -2.149  9.939   1.00 15.00 ? 95 PRO A HD2  4  
ATOM 5689  H HD3  . PRO A 1 95 ? -14.380 -2.992  8.378   1.00 15.00 ? 95 PRO A HD3  4  
ATOM 5690  N N    . THR A 1 96 ? -16.564 0.896   9.826   1.00 15.00 ? 96 THR A N    4  
ATOM 5691  C CA   . THR A 1 96 ? -16.869 2.217   10.363  1.00 15.00 ? 96 THR A CA   4  
ATOM 5692  C C    . THR A 1 96 ? -16.543 3.306   9.346   1.00 15.00 ? 96 THR A C    4  
ATOM 5693  O O    . THR A 1 96 ? -17.317 4.281   9.256   1.00 15.00 ? 96 THR A O    4  
ATOM 5694  C CB   . THR A 1 96 ? -16.088 2.458   11.658  1.00 15.00 ? 96 THR A CB   4  
ATOM 5695  O OG1  . THR A 1 96 ? -15.052 1.503   11.805  1.00 15.00 ? 96 THR A OG1  4  
ATOM 5696  C CG2  . THR A 1 96 ? -16.952 2.392   12.898  1.00 15.00 ? 96 THR A CG2  4  
ATOM 5697  O OXT  . THR A 1 96 ? -15.515 3.174   8.649   1.00 15.00 ? 96 THR A OXT  4  
ATOM 5698  H H    . THR A 1 96 ? -15.670 0.519   9.963   1.00 15.00 ? 96 THR A H    4  
ATOM 5699  H HA   . THR A 1 96 ? -17.926 2.250   10.581  1.00 15.00 ? 96 THR A HA   4  
ATOM 5700  H HB   . THR A 1 96 ? -15.640 3.441   11.620  1.00 15.00 ? 96 THR A HB   4  
ATOM 5701  H HG1  . THR A 1 96 ? -15.435 0.633   11.941  1.00 15.00 ? 96 THR A HG1  4  
ATOM 5702  H HG21 . THR A 1 96 ? -17.652 3.214   12.893  1.00 15.00 ? 96 THR A HG21 4  
ATOM 5703  H HG22 . THR A 1 96 ? -17.494 1.458   12.910  1.00 15.00 ? 96 THR A HG22 4  
ATOM 5704  H HG23 . THR A 1 96 ? -16.327 2.456   13.777  1.00 15.00 ? 96 THR A HG23 4  
ATOM 5705  N N    . PRO A 1 1  ? -16.637 4.778   -8.336  1.00 15.00 ? 1  PRO A N    5  
ATOM 5706  C CA   . PRO A 1 1  ? -16.466 3.465   -7.657  1.00 15.00 ? 1  PRO A CA   5  
ATOM 5707  C C    . PRO A 1 1  ? -17.385 3.333   -6.443  1.00 15.00 ? 1  PRO A C    5  
ATOM 5708  O O    . PRO A 1 1  ? -18.300 4.134   -6.255  1.00 15.00 ? 1  PRO A O    5  
ATOM 5709  C CB   . PRO A 1 1  ? -15.005 3.353   -7.232  1.00 15.00 ? 1  PRO A CB   5  
ATOM 5710  C CG   . PRO A 1 1  ? -14.352 4.554   -7.830  1.00 15.00 ? 1  PRO A CG   5  
ATOM 5711  C CD   . PRO A 1 1  ? -15.443 5.580   -8.023  1.00 15.00 ? 1  PRO A CD   5  
ATOM 5712  H H2   . PRO A 1 1  ? -17.553 5.099   -7.981  1.00 15.00 ? 1  PRO A H2   5  
ATOM 5713  H H3   . PRO A 1 1  ? -16.826 4.479   -9.321  1.00 15.00 ? 1  PRO A H3   5  
ATOM 5714  H HA   . PRO A 1 1  ? -16.694 2.679   -8.361  1.00 15.00 ? 1  PRO A HA   5  
ATOM 5715  H HB2  . PRO A 1 1  ? -14.937 3.358   -6.154  1.00 15.00 ? 1  PRO A HB2  5  
ATOM 5716  H HB3  . PRO A 1 1  ? -14.581 2.440   -7.622  1.00 15.00 ? 1  PRO A HB3  5  
ATOM 5717  H HG2  . PRO A 1 1  ? -13.597 4.934   -7.157  1.00 15.00 ? 1  PRO A HG2  5  
ATOM 5718  H HG3  . PRO A 1 1  ? -13.910 4.296   -8.781  1.00 15.00 ? 1  PRO A HG3  5  
ATOM 5719  H HD2  . PRO A 1 1  ? -15.590 6.148   -7.116  1.00 15.00 ? 1  PRO A HD2  5  
ATOM 5720  H HD3  . PRO A 1 1  ? -15.199 6.238   -8.844  1.00 15.00 ? 1  PRO A HD3  5  
ATOM 5721  N N    . LYS A 1 2  ? -17.133 2.316   -5.625  1.00 15.00 ? 2  LYS A N    5  
ATOM 5722  C CA   . LYS A 1 2  ? -17.937 2.078   -4.431  1.00 15.00 ? 2  LYS A CA   5  
ATOM 5723  C C    . LYS A 1 2  ? -17.112 1.387   -3.347  1.00 15.00 ? 2  LYS A C    5  
ATOM 5724  O O    . LYS A 1 2  ? -16.073 0.792   -3.631  1.00 15.00 ? 2  LYS A O    5  
ATOM 5725  C CB   . LYS A 1 2  ? -19.160 1.226   -4.777  1.00 15.00 ? 2  LYS A CB   5  
ATOM 5726  C CG   . LYS A 1 2  ? -20.377 2.042   -5.181  1.00 15.00 ? 2  LYS A CG   5  
ATOM 5727  C CD   . LYS A 1 2  ? -21.425 1.178   -5.863  1.00 15.00 ? 2  LYS A CD   5  
ATOM 5728  C CE   . LYS A 1 2  ? -21.289 1.228   -7.376  1.00 15.00 ? 2  LYS A CE   5  
ATOM 5729  N NZ   . LYS A 1 2  ? -22.179 0.240   -8.048  1.00 15.00 ? 2  LYS A NZ   5  
ATOM 5730  H H    . LYS A 1 2  ? -16.390 1.710   -5.829  1.00 15.00 ? 2  LYS A H    5  
ATOM 5731  H HA   . LYS A 1 2  ? -18.269 3.035   -4.059  1.00 15.00 ? 2  LYS A HA   5  
ATOM 5732  H HB2  . LYS A 1 2  ? -18.906 0.569   -5.596  1.00 15.00 ? 2  LYS A HB2  5  
ATOM 5733  H HB3  . LYS A 1 2  ? -19.423 0.629   -3.916  1.00 15.00 ? 2  LYS A HB3  5  
ATOM 5734  H HG2  . LYS A 1 2  ? -20.810 2.485   -4.297  1.00 15.00 ? 2  LYS A HG2  5  
ATOM 5735  H HG3  . LYS A 1 2  ? -20.066 2.821   -5.861  1.00 15.00 ? 2  LYS A HG3  5  
ATOM 5736  H HD2  . LYS A 1 2  ? -21.305 0.157   -5.534  1.00 15.00 ? 2  LYS A HD2  5  
ATOM 5737  H HD3  . LYS A 1 2  ? -22.407 1.535   -5.587  1.00 15.00 ? 2  LYS A HD3  5  
ATOM 5738  H HE2  . LYS A 1 2  ? -21.546 2.220   -7.716  1.00 15.00 ? 2  LYS A HE2  5  
ATOM 5739  H HE3  . LYS A 1 2  ? -20.263 1.013   -7.639  1.00 15.00 ? 2  LYS A HE3  5  
ATOM 5740  H HZ1  . LYS A 1 2  ? -21.633 -0.598  -8.331  1.00 15.00 ? 2  LYS A HZ1  5  
ATOM 5741  H HZ2  . LYS A 1 2  ? -22.937 -0.055  -7.401  1.00 15.00 ? 2  LYS A HZ2  5  
ATOM 5742  H HZ3  . LYS A 1 2  ? -22.607 0.664   -8.896  1.00 15.00 ? 2  LYS A HZ3  5  
ATOM 5743  N N    . PRO A 1 3  ? -17.568 1.457   -2.085  1.00 15.00 ? 3  PRO A N    5  
ATOM 5744  C CA   . PRO A 1 3  ? -16.868 0.833   -0.957  1.00 15.00 ? 3  PRO A CA   5  
ATOM 5745  C C    . PRO A 1 3  ? -16.575 -0.637  -1.197  1.00 15.00 ? 3  PRO A C    5  
ATOM 5746  O O    . PRO A 1 3  ? -17.325 -1.322  -1.892  1.00 15.00 ? 3  PRO A O    5  
ATOM 5747  C CB   . PRO A 1 3  ? -17.850 0.964   0.190   1.00 15.00 ? 3  PRO A CB   5  
ATOM 5748  C CG   . PRO A 1 3  ? -18.695 2.140   -0.157  1.00 15.00 ? 3  PRO A CG   5  
ATOM 5749  C CD   . PRO A 1 3  ? -18.799 2.146   -1.658  1.00 15.00 ? 3  PRO A CD   5  
ATOM 5750  H HA   . PRO A 1 3  ? -15.952 1.353   -0.717  1.00 15.00 ? 3  PRO A HA   5  
ATOM 5751  H HB2  . PRO A 1 3  ? -18.432 0.058   0.253   1.00 15.00 ? 3  PRO A HB2  5  
ATOM 5752  H HB3  . PRO A 1 3  ? -17.309 1.118   1.108   1.00 15.00 ? 3  PRO A HB3  5  
ATOM 5753  H HG2  . PRO A 1 3  ? -19.675 2.033   0.286   1.00 15.00 ? 3  PRO A HG2  5  
ATOM 5754  H HG3  . PRO A 1 3  ? -18.223 3.048   0.189   1.00 15.00 ? 3  PRO A HG3  5  
ATOM 5755  H HD2  . PRO A 1 3  ? -19.676 1.604   -1.978  1.00 15.00 ? 3  PRO A HD2  5  
ATOM 5756  H HD3  . PRO A 1 3  ? -18.822 3.159   -2.031  1.00 15.00 ? 3  PRO A HD3  5  
ATOM 5757  N N    . GLY A 1 4  ? -15.477 -1.119  -0.628  1.00 15.00 ? 4  GLY A N    5  
ATOM 5758  C CA   . GLY A 1 4  ? -15.113 -2.507  -0.811  1.00 15.00 ? 4  GLY A CA   5  
ATOM 5759  C C    . GLY A 1 4  ? -14.389 -2.709  -2.121  1.00 15.00 ? 4  GLY A C    5  
ATOM 5760  O O    . GLY A 1 4  ? -13.609 -3.648  -2.278  1.00 15.00 ? 4  GLY A O    5  
ATOM 5761  H H    . GLY A 1 4  ? -14.908 -0.527  -0.091  1.00 15.00 ? 4  GLY A H    5  
ATOM 5762  H HA2  . GLY A 1 4  ? -14.470 -2.814  0.002   1.00 15.00 ? 4  GLY A HA2  5  
ATOM 5763  H HA3  . GLY A 1 4  ? -16.007 -3.112  -0.806  1.00 15.00 ? 4  GLY A HA3  5  
ATOM 5764  N N    . ASP A 1 5  ? -14.654 -1.810  -3.064  1.00 15.00 ? 5  ASP A N    5  
ATOM 5765  C CA   . ASP A 1 5  ? -14.027 -1.871  -4.379  1.00 15.00 ? 5  ASP A CA   5  
ATOM 5766  C C    . ASP A 1 5  ? -12.520 -1.727  -4.262  1.00 15.00 ? 5  ASP A C    5  
ATOM 5767  O O    . ASP A 1 5  ? -11.996 -1.316  -3.227  1.00 15.00 ? 5  ASP A O    5  
ATOM 5768  C CB   . ASP A 1 5  ? -14.590 -0.781  -5.292  1.00 15.00 ? 5  ASP A CB   5  
ATOM 5769  C CG   . ASP A 1 5  ? -14.272 -1.028  -6.753  1.00 15.00 ? 5  ASP A CG   5  
ATOM 5770  O OD1  . ASP A 1 5  ? -13.118 -0.778  -7.160  1.00 15.00 ? 5  ASP A OD1  5  
ATOM 5771  O OD2  . ASP A 1 5  ? -15.177 -1.473  -7.491  1.00 15.00 ? 5  ASP A OD2  5  
ATOM 5772  H H    . ASP A 1 5  ? -15.288 -1.081  -2.865  1.00 15.00 ? 5  ASP A H    5  
ATOM 5773  H HA   . ASP A 1 5  ? -14.240 -2.839  -4.811  1.00 15.00 ? 5  ASP A HA   5  
ATOM 5774  H HB2  . ASP A 1 5  ? -15.663 -0.744  -5.178  1.00 15.00 ? 5  ASP A HB2  5  
ATOM 5775  H HB3  . ASP A 1 5  ? -14.169 0.172   -5.006  1.00 15.00 ? 5  ASP A HB3  5  
ATOM 5776  N N    . ILE A 1 6  ? -11.833 -2.087  -5.331  1.00 15.00 ? 6  ILE A N    5  
ATOM 5777  C CA   . ILE A 1 6  ? -10.385 -2.026  -5.371  1.00 15.00 ? 6  ILE A CA   5  
ATOM 5778  C C    . ILE A 1 6  ? -9.904  -0.802  -6.147  1.00 15.00 ? 6  ILE A C    5  
ATOM 5779  O O    . ILE A 1 6  ? -10.541 -0.373  -7.109  1.00 15.00 ? 6  ILE A O    5  
ATOM 5780  C CB   . ILE A 1 6  ? -9.824  -3.310  -6.020  1.00 15.00 ? 6  ILE A CB   5  
ATOM 5781  C CG1  . ILE A 1 6  ? -9.298  -4.263  -4.946  1.00 15.00 ? 6  ILE A CG1  5  
ATOM 5782  C CG2  . ILE A 1 6  ? -8.728  -2.992  -7.034  1.00 15.00 ? 6  ILE A CG2  5  
ATOM 5783  C CD1  . ILE A 1 6  ? -10.391 -4.884  -4.103  1.00 15.00 ? 6  ILE A CD1  5  
ATOM 5784  H H    . ILE A 1 6  ? -12.316 -2.418  -6.117  1.00 15.00 ? 6  ILE A H    5  
ATOM 5785  H HA   . ILE A 1 6  ? -10.021 -1.971  -4.355  1.00 15.00 ? 6  ILE A HA   5  
ATOM 5786  H HB   . ILE A 1 6  ? -10.641 -3.792  -6.542  1.00 15.00 ? 6  ILE A HB   5  
ATOM 5787  H HG12 . ILE A 1 6  ? -8.751  -5.063  -5.421  1.00 15.00 ? 6  ILE A HG12 5  
ATOM 5788  H HG13 . ILE A 1 6  ? -8.636  -3.721  -4.288  1.00 15.00 ? 6  ILE A HG13 5  
ATOM 5789  H HG21 . ILE A 1 6  ? -7.953  -2.409  -6.556  1.00 15.00 ? 6  ILE A HG21 5  
ATOM 5790  H HG22 . ILE A 1 6  ? -8.307  -3.912  -7.411  1.00 15.00 ? 6  ILE A HG22 5  
ATOM 5791  H HG23 . ILE A 1 6  ? -9.148  -2.425  -7.853  1.00 15.00 ? 6  ILE A HG23 5  
ATOM 5792  H HD11 . ILE A 1 6  ? -10.646 -4.214  -3.295  1.00 15.00 ? 6  ILE A HD11 5  
ATOM 5793  H HD12 . ILE A 1 6  ? -11.263 -5.059  -4.716  1.00 15.00 ? 6  ILE A HD12 5  
ATOM 5794  H HD13 . ILE A 1 6  ? -10.042 -5.822  -3.697  1.00 15.00 ? 6  ILE A HD13 5  
ATOM 5795  N N    . PHE A 1 7  ? -8.765  -0.261  -5.733  1.00 15.00 ? 7  PHE A N    5  
ATOM 5796  C CA   . PHE A 1 7  ? -8.185  0.895   -6.401  1.00 15.00 ? 7  PHE A CA   5  
ATOM 5797  C C    . PHE A 1 7  ? -6.668  0.749   -6.488  1.00 15.00 ? 7  PHE A C    5  
ATOM 5798  O O    . PHE A 1 7  ? -6.080  -0.085  -5.804  1.00 15.00 ? 7  PHE A O    5  
ATOM 5799  C CB   . PHE A 1 7  ? -8.568  2.193   -5.676  1.00 15.00 ? 7  PHE A CB   5  
ATOM 5800  C CG   . PHE A 1 7  ? -7.692  2.529   -4.499  1.00 15.00 ? 7  PHE A CG   5  
ATOM 5801  C CD1  . PHE A 1 7  ? -6.418  3.044   -4.690  1.00 15.00 ? 7  PHE A CD1  5  
ATOM 5802  C CD2  . PHE A 1 7  ? -8.145  2.336   -3.205  1.00 15.00 ? 7  PHE A CD2  5  
ATOM 5803  C CE1  . PHE A 1 7  ? -5.614  3.358   -3.612  1.00 15.00 ? 7  PHE A CE1  5  
ATOM 5804  C CE2  . PHE A 1 7  ? -7.344  2.648   -2.123  1.00 15.00 ? 7  PHE A CE2  5  
ATOM 5805  C CZ   . PHE A 1 7  ? -6.077  3.160   -2.327  1.00 15.00 ? 7  PHE A CZ   5  
ATOM 5806  H H    . PHE A 1 7  ? -8.298  -0.656  -4.967  1.00 15.00 ? 7  PHE A H    5  
ATOM 5807  H HA   . PHE A 1 7  ? -8.584  0.921   -7.404  1.00 15.00 ? 7  PHE A HA   5  
ATOM 5808  H HB2  . PHE A 1 7  ? -8.509  3.014   -6.374  1.00 15.00 ? 7  PHE A HB2  5  
ATOM 5809  H HB3  . PHE A 1 7  ? -9.584  2.107   -5.319  1.00 15.00 ? 7  PHE A HB3  5  
ATOM 5810  H HD1  . PHE A 1 7  ? -6.053  3.198   -5.694  1.00 15.00 ? 7  PHE A HD1  5  
ATOM 5811  H HD2  . PHE A 1 7  ? -9.134  1.936   -3.044  1.00 15.00 ? 7  PHE A HD2  5  
ATOM 5812  H HE1  . PHE A 1 7  ? -4.624  3.758   -3.775  1.00 15.00 ? 7  PHE A HE1  5  
ATOM 5813  H HE2  . PHE A 1 7  ? -7.709  2.492   -1.118  1.00 15.00 ? 7  PHE A HE2  5  
ATOM 5814  H HZ   . PHE A 1 7  ? -5.448  3.405   -1.485  1.00 15.00 ? 7  PHE A HZ   5  
ATOM 5815  N N    . GLU A 1 8  ? -6.042  1.552   -7.340  1.00 15.00 ? 8  GLU A N    5  
ATOM 5816  C CA   . GLU A 1 8  ? -4.595  1.493   -7.519  1.00 15.00 ? 8  GLU A CA   5  
ATOM 5817  C C    . GLU A 1 8  ? -3.958  2.874   -7.419  1.00 15.00 ? 8  GLU A C    5  
ATOM 5818  O O    . GLU A 1 8  ? -4.521  3.871   -7.870  1.00 15.00 ? 8  GLU A O    5  
ATOM 5819  C CB   . GLU A 1 8  ? -4.264  0.881   -8.877  1.00 15.00 ? 8  GLU A CB   5  
ATOM 5820  C CG   . GLU A 1 8  ? -5.004  1.536   -10.025 1.00 15.00 ? 8  GLU A CG   5  
ATOM 5821  C CD   . GLU A 1 8  ? -4.951  0.717   -11.299 1.00 15.00 ? 8  GLU A CD   5  
ATOM 5822  O OE1  . GLU A 1 8  ? -5.054  -0.525  -11.211 1.00 15.00 ? 8  GLU A OE1  5  
ATOM 5823  O OE2  . GLU A 1 8  ? -4.807  1.316   -12.385 1.00 15.00 ? 8  GLU A OE2  5  
ATOM 5824  H H    . GLU A 1 8  ? -6.564  2.193   -7.868  1.00 15.00 ? 8  GLU A H    5  
ATOM 5825  H HA   . GLU A 1 8  ? -4.183  0.860   -6.742  1.00 15.00 ? 8  GLU A HA   5  
ATOM 5826  H HB2  . GLU A 1 8  ? -3.204  0.985   -9.055  1.00 15.00 ? 8  GLU A HB2  5  
ATOM 5827  H HB3  . GLU A 1 8  ? -4.520  -0.168  -8.861  1.00 15.00 ? 8  GLU A HB3  5  
ATOM 5828  H HG2  . GLU A 1 8  ? -6.036  1.665   -9.740  1.00 15.00 ? 8  GLU A HG2  5  
ATOM 5829  H HG3  . GLU A 1 8  ? -4.559  2.501   -10.214 1.00 15.00 ? 8  GLU A HG3  5  
ATOM 5830  N N    . VAL A 1 9  ? -2.767  2.908   -6.841  1.00 15.00 ? 9  VAL A N    5  
ATOM 5831  C CA   . VAL A 1 9  ? -2.009  4.143   -6.686  1.00 15.00 ? 9  VAL A CA   5  
ATOM 5832  C C    . VAL A 1 9  ? -0.921  4.217   -7.747  1.00 15.00 ? 9  VAL A C    5  
ATOM 5833  O O    . VAL A 1 9  ? -0.022  3.376   -7.788  1.00 15.00 ? 9  VAL A O    5  
ATOM 5834  C CB   . VAL A 1 9  ? -1.383  4.272   -5.268  1.00 15.00 ? 9  VAL A CB   5  
ATOM 5835  C CG1  . VAL A 1 9  ? -1.501  2.968   -4.494  1.00 15.00 ? 9  VAL A CG1  5  
ATOM 5836  C CG2  . VAL A 1 9  ? 0.076   4.712   -5.338  1.00 15.00 ? 9  VAL A CG2  5  
ATOM 5837  H H    . VAL A 1 9  ? -2.375  2.068   -6.527  1.00 15.00 ? 9  VAL A H    5  
ATOM 5838  H HA   . VAL A 1 9  ? -2.690  4.969   -6.836  1.00 15.00 ? 9  VAL A HA   5  
ATOM 5839  H HB   . VAL A 1 9  ? -1.934  5.028   -4.728  1.00 15.00 ? 9  VAL A HB   5  
ATOM 5840  H HG11 . VAL A 1 9  ? -2.476  2.534   -4.661  1.00 15.00 ? 9  VAL A HG11 5  
ATOM 5841  H HG12 . VAL A 1 9  ? -0.739  2.283   -4.831  1.00 15.00 ? 9  VAL A HG12 5  
ATOM 5842  H HG13 . VAL A 1 9  ? -1.368  3.164   -3.442  1.00 15.00 ? 9  VAL A HG13 5  
ATOM 5843  H HG21 . VAL A 1 9  ? 0.676   3.909   -5.741  1.00 15.00 ? 9  VAL A HG21 5  
ATOM 5844  H HG22 . VAL A 1 9  ? 0.161   5.579   -5.976  1.00 15.00 ? 9  VAL A HG22 5  
ATOM 5845  H HG23 . VAL A 1 9  ? 0.426   4.959   -4.346  1.00 15.00 ? 9  VAL A HG23 5  
ATOM 5846  N N    . GLU A 1 10 ? -1.013  5.213   -8.611  1.00 15.00 ? 10 GLU A N    5  
ATOM 5847  C CA   . GLU A 1 10 ? -0.041  5.377   -9.676  1.00 15.00 ? 10 GLU A CA   5  
ATOM 5848  C C    . GLU A 1 10 ? 0.911   6.536   -9.402  1.00 15.00 ? 10 GLU A C    5  
ATOM 5849  O O    . GLU A 1 10 ? 0.856   7.570   -10.069 1.00 15.00 ? 10 GLU A O    5  
ATOM 5850  C CB   . GLU A 1 10 ? -0.764  5.580   -11.001 1.00 15.00 ? 10 GLU A CB   5  
ATOM 5851  C CG   . GLU A 1 10 ? 0.164   5.840   -12.177 1.00 15.00 ? 10 GLU A CG   5  
ATOM 5852  C CD   . GLU A 1 10 ? -0.376  5.283   -13.480 1.00 15.00 ? 10 GLU A CD   5  
ATOM 5853  O OE1  . GLU A 1 10 ? -1.177  4.326   -13.430 1.00 15.00 ? 10 GLU A OE1  5  
ATOM 5854  O OE2  . GLU A 1 10 ? 0.003   5.803   -14.551 1.00 15.00 ? 10 GLU A OE2  5  
ATOM 5855  H H    . GLU A 1 10 ? -1.756  5.847   -8.537  1.00 15.00 ? 10 GLU A H    5  
ATOM 5856  H HA   . GLU A 1 10 ? 0.536   4.466   -9.735  1.00 15.00 ? 10 GLU A HA   5  
ATOM 5857  H HB2  . GLU A 1 10 ? -1.340  4.691   -11.212 1.00 15.00 ? 10 GLU A HB2  5  
ATOM 5858  H HB3  . GLU A 1 10 ? -1.435  6.419   -10.903 1.00 15.00 ? 10 GLU A HB3  5  
ATOM 5859  H HG2  . GLU A 1 10 ? 0.296   6.906   -12.287 1.00 15.00 ? 10 GLU A HG2  5  
ATOM 5860  H HG3  . GLU A 1 10 ? 1.120   5.379   -11.974 1.00 15.00 ? 10 GLU A HG3  5  
ATOM 5861  N N    . LEU A 1 11 ? 1.795   6.349   -8.429  1.00 15.00 ? 11 LEU A N    5  
ATOM 5862  C CA   . LEU A 1 11 ? 2.772   7.372   -8.083  1.00 15.00 ? 11 LEU A CA   5  
ATOM 5863  C C    . LEU A 1 11 ? 4.020   7.208   -8.943  1.00 15.00 ? 11 LEU A C    5  
ATOM 5864  O O    . LEU A 1 11 ? 4.210   6.170   -9.573  1.00 15.00 ? 11 LEU A O    5  
ATOM 5865  C CB   . LEU A 1 11 ? 3.143   7.285   -6.601  1.00 15.00 ? 11 LEU A CB   5  
ATOM 5866  C CG   . LEU A 1 11 ? 3.329   8.630   -5.893  1.00 15.00 ? 11 LEU A CG   5  
ATOM 5867  C CD1  . LEU A 1 11 ? 2.045   9.445   -5.937  1.00 15.00 ? 11 LEU A CD1  5  
ATOM 5868  C CD2  . LEU A 1 11 ? 3.775   8.416   -4.454  1.00 15.00 ? 11 LEU A CD2  5  
ATOM 5869  H H    . LEU A 1 11 ? 1.794   5.502   -7.940  1.00 15.00 ? 11 LEU A H    5  
ATOM 5870  H HA   . LEU A 1 11 ? 2.333   8.333   -8.282  1.00 15.00 ? 11 LEU A HA   5  
ATOM 5871  H HB2  . LEU A 1 11 ? 2.368   6.736   -6.092  1.00 15.00 ? 11 LEU A HB2  5  
ATOM 5872  H HB3  . LEU A 1 11 ? 4.066   6.731   -6.514  1.00 15.00 ? 11 LEU A HB3  5  
ATOM 5873  H HG   . LEU A 1 11 ? 4.098   9.193   -6.402  1.00 15.00 ? 11 LEU A HG   5  
ATOM 5874  H HD11 . LEU A 1 11 ? 1.415   9.082   -6.734  1.00 15.00 ? 11 LEU A HD11 5  
ATOM 5875  H HD12 . LEU A 1 11 ? 1.525   9.348   -4.995  1.00 15.00 ? 11 LEU A HD12 5  
ATOM 5876  H HD13 . LEU A 1 11 ? 2.284   10.484  -6.111  1.00 15.00 ? 11 LEU A HD13 5  
ATOM 5877  H HD21 . LEU A 1 11 ? 2.909   8.269   -3.826  1.00 15.00 ? 11 LEU A HD21 5  
ATOM 5878  H HD22 . LEU A 1 11 ? 4.410   7.544   -4.400  1.00 15.00 ? 11 LEU A HD22 5  
ATOM 5879  H HD23 . LEU A 1 11 ? 4.323   9.282   -4.114  1.00 15.00 ? 11 LEU A HD23 5  
ATOM 5880  N N    . ALA A 1 12 ? 4.864   8.230   -8.974  1.00 15.00 ? 12 ALA A N    5  
ATOM 5881  C CA   . ALA A 1 12 ? 6.084   8.177   -9.771  1.00 15.00 ? 12 ALA A CA   5  
ATOM 5882  C C    . ALA A 1 12 ? 7.279   7.750   -8.928  1.00 15.00 ? 12 ALA A C    5  
ATOM 5883  O O    . ALA A 1 12 ? 7.929   8.575   -8.286  1.00 15.00 ? 12 ALA A O    5  
ATOM 5884  C CB   . ALA A 1 12 ? 6.352   9.521   -10.426 1.00 15.00 ? 12 ALA A CB   5  
ATOM 5885  H H    . ALA A 1 12 ? 4.661   9.037   -8.455  1.00 15.00 ? 12 ALA A H    5  
ATOM 5886  H HA   . ALA A 1 12 ? 5.936   7.447   -10.556 1.00 15.00 ? 12 ALA A HA   5  
ATOM 5887  H HB1  . ALA A 1 12 ? 6.897   9.368   -11.347 1.00 15.00 ? 12 ALA A HB1  5  
ATOM 5888  H HB2  . ALA A 1 12 ? 5.414   10.011  -10.640 1.00 15.00 ? 12 ALA A HB2  5  
ATOM 5889  H HB3  . ALA A 1 12 ? 6.938   10.137  -9.760  1.00 15.00 ? 12 ALA A HB3  5  
ATOM 5890  N N    . LYS A 1 13 ? 7.562   6.453   -8.938  1.00 15.00 ? 13 LYS A N    5  
ATOM 5891  C CA   . LYS A 1 13 ? 8.679   5.903   -8.180  1.00 15.00 ? 13 LYS A CA   5  
ATOM 5892  C C    . LYS A 1 13 ? 9.992   6.569   -8.585  1.00 15.00 ? 13 LYS A C    5  
ATOM 5893  O O    . LYS A 1 13 ? 10.899  6.725   -7.768  1.00 15.00 ? 13 LYS A O    5  
ATOM 5894  C CB   . LYS A 1 13 ? 8.766   4.391   -8.400  1.00 15.00 ? 13 LYS A CB   5  
ATOM 5895  C CG   . LYS A 1 13 ? 9.258   3.626   -7.184  1.00 15.00 ? 13 LYS A CG   5  
ATOM 5896  C CD   . LYS A 1 13 ? 10.662  4.048   -6.787  1.00 15.00 ? 13 LYS A CD   5  
ATOM 5897  C CE   . LYS A 1 13 ? 10.649  4.921   -5.543  1.00 15.00 ? 13 LYS A CE   5  
ATOM 5898  N NZ   . LYS A 1 13 ? 12.003  5.044   -4.935  1.00 15.00 ? 13 LYS A NZ   5  
ATOM 5899  H H    . LYS A 1 13 ? 7.006   5.848   -9.471  1.00 15.00 ? 13 LYS A H    5  
ATOM 5900  H HA   . LYS A 1 13 ? 8.498   6.097   -7.133  1.00 15.00 ? 13 LYS A HA   5  
ATOM 5901  H HB2  . LYS A 1 13 ? 7.784   4.021   -8.656  1.00 15.00 ? 13 LYS A HB2  5  
ATOM 5902  H HB3  . LYS A 1 13 ? 9.439   4.194   -9.220  1.00 15.00 ? 13 LYS A HB3  5  
ATOM 5903  H HG2  . LYS A 1 13 ? 8.589   3.813   -6.357  1.00 15.00 ? 13 LYS A HG2  5  
ATOM 5904  H HG3  . LYS A 1 13 ? 9.262   2.574   -7.415  1.00 15.00 ? 13 LYS A HG3  5  
ATOM 5905  H HD2  . LYS A 1 13 ? 11.249  3.164   -6.587  1.00 15.00 ? 13 LYS A HD2  5  
ATOM 5906  H HD3  . LYS A 1 13 ? 11.106  4.600   -7.602  1.00 15.00 ? 13 LYS A HD3  5  
ATOM 5907  H HE2  . LYS A 1 13 ? 10.294  5.905   -5.813  1.00 15.00 ? 13 LYS A HE2  5  
ATOM 5908  H HE3  . LYS A 1 13 ? 9.976   4.484   -4.820  1.00 15.00 ? 13 LYS A HE3  5  
ATOM 5909  H HZ1  . LYS A 1 13 ? 12.063  4.457   -4.078  1.00 15.00 ? 13 LYS A HZ1  5  
ATOM 5910  H HZ2  . LYS A 1 13 ? 12.729  4.730   -5.610  1.00 15.00 ? 13 LYS A HZ2  5  
ATOM 5911  H HZ3  . LYS A 1 13 ? 12.191  6.034   -4.677  1.00 15.00 ? 13 LYS A HZ3  5  
ATOM 5912  N N    . ASN A 1 14 ? 10.084  6.962   -9.850  1.00 15.00 ? 14 ASN A N    5  
ATOM 5913  C CA   . ASN A 1 14 ? 11.286  7.611   -10.362 1.00 15.00 ? 14 ASN A CA   5  
ATOM 5914  C C    . ASN A 1 14 ? 11.254  9.108   -10.078 1.00 15.00 ? 14 ASN A C    5  
ATOM 5915  O O    . ASN A 1 14 ? 10.207  9.747   -10.181 1.00 15.00 ? 14 ASN A O    5  
ATOM 5916  C CB   . ASN A 1 14 ? 11.420  7.366   -11.866 1.00 15.00 ? 14 ASN A CB   5  
ATOM 5917  C CG   . ASN A 1 14 ? 12.803  7.706   -12.387 1.00 15.00 ? 14 ASN A CG   5  
ATOM 5918  O OD1  . ASN A 1 14 ? 13.801  7.130   -11.952 1.00 15.00 ? 14 ASN A OD1  5  
ATOM 5919  N ND2  . ASN A 1 14 ? 12.869  8.644   -13.324 1.00 15.00 ? 14 ASN A ND2  5  
ATOM 5920  H H    . ASN A 1 14 ? 9.328   6.812   -10.452 1.00 15.00 ? 14 ASN A H    5  
ATOM 5921  H HA   . ASN A 1 14 ? 12.137  7.178   -9.858  1.00 15.00 ? 14 ASN A HA   5  
ATOM 5922  H HB2  . ASN A 1 14 ? 11.223  6.325   -12.075 1.00 15.00 ? 14 ASN A HB2  5  
ATOM 5923  H HB3  . ASN A 1 14 ? 10.698  7.976   -12.389 1.00 15.00 ? 14 ASN A HB3  5  
ATOM 5924  H HD21 . ASN A 1 14 ? 12.033  9.059   -13.623 1.00 15.00 ? 14 ASN A HD21 5  
ATOM 5925  H HD22 . ASN A 1 14 ? 13.750  8.883   -13.679 1.00 15.00 ? 14 ASN A HD22 5  
ATOM 5926  N N    . ASP A 1 15 ? 12.412  9.659   -9.713  1.00 15.00 ? 15 ASP A N    5  
ATOM 5927  C CA   . ASP A 1 15 ? 12.538  11.081  -9.402  1.00 15.00 ? 15 ASP A CA   5  
ATOM 5928  C C    . ASP A 1 15 ? 12.067  11.388  -7.978  1.00 15.00 ? 15 ASP A C    5  
ATOM 5929  O O    . ASP A 1 15 ? 12.314  12.476  -7.459  1.00 15.00 ? 15 ASP A O    5  
ATOM 5930  C CB   . ASP A 1 15 ? 11.758  11.931  -10.407 1.00 15.00 ? 15 ASP A CB   5  
ATOM 5931  C CG   . ASP A 1 15 ? 11.892  11.423  -11.830 1.00 15.00 ? 15 ASP A CG   5  
ATOM 5932  O OD1  . ASP A 1 15 ? 13.006  11.001  -12.207 1.00 15.00 ? 15 ASP A OD1  5  
ATOM 5933  O OD2  . ASP A 1 15 ? 10.884  11.447  -12.567 1.00 15.00 ? 15 ASP A OD2  5  
ATOM 5934  H H    . ASP A 1 15 ? 13.205  9.093   -9.648  1.00 15.00 ? 15 ASP A H    5  
ATOM 5935  H HA   . ASP A 1 15 ? 13.585  11.336  -9.475  1.00 15.00 ? 15 ASP A HA   5  
ATOM 5936  H HB2  . ASP A 1 15 ? 10.712  11.926  -10.139 1.00 15.00 ? 15 ASP A HB2  5  
ATOM 5937  H HB3  . ASP A 1 15 ? 12.129  12.941  -10.369 1.00 15.00 ? 15 ASP A HB3  5  
ATOM 5938  N N    . ASN A 1 16 ? 11.395  10.426  -7.348  1.00 15.00 ? 16 ASN A N    5  
ATOM 5939  C CA   . ASN A 1 16 ? 10.901  10.602  -5.987  1.00 15.00 ? 16 ASN A CA   5  
ATOM 5940  C C    . ASN A 1 16 ? 10.494  9.261   -5.384  1.00 15.00 ? 16 ASN A C    5  
ATOM 5941  O O    . ASN A 1 16 ? 9.843   8.448   -6.039  1.00 15.00 ? 16 ASN A O    5  
ATOM 5942  C CB   . ASN A 1 16 ? 9.711   11.565  -5.968  1.00 15.00 ? 16 ASN A CB   5  
ATOM 5943  C CG   . ASN A 1 16 ? 10.140  13.010  -5.807  1.00 15.00 ? 16 ASN A CG   5  
ATOM 5944  O OD1  . ASN A 1 16 ? 10.472  13.452  -4.707  1.00 15.00 ? 16 ASN A OD1  5  
ATOM 5945  N ND2  . ASN A 1 16 ? 10.136  13.755  -6.906  1.00 15.00 ? 16 ASN A ND2  5  
ATOM 5946  H H    . ASN A 1 16 ? 11.230  9.578   -7.804  1.00 15.00 ? 16 ASN A H    5  
ATOM 5947  H HA   . ASN A 1 16 ? 11.702  11.020  -5.396  1.00 15.00 ? 16 ASN A HA   5  
ATOM 5948  H HB2  . ASN A 1 16 ? 9.166   11.473  -6.895  1.00 15.00 ? 16 ASN A HB2  5  
ATOM 5949  H HB3  . ASN A 1 16 ? 9.060   11.308  -5.145  1.00 15.00 ? 16 ASN A HB3  5  
ATOM 5950  H HD21 . ASN A 1 16 ? 9.860   13.336  -7.748  1.00 15.00 ? 16 ASN A HD21 5  
ATOM 5951  H HD22 . ASN A 1 16 ? 10.409  14.693  -6.830  1.00 15.00 ? 16 ASN A HD22 5  
ATOM 5952  N N    . SER A 1 17 ? 10.879  9.039   -4.133  1.00 15.00 ? 17 SER A N    5  
ATOM 5953  C CA   . SER A 1 17 ? 10.549  7.797   -3.443  1.00 15.00 ? 17 SER A CA   5  
ATOM 5954  C C    . SER A 1 17 ? 9.172   7.896   -2.797  1.00 15.00 ? 17 SER A C    5  
ATOM 5955  O O    . SER A 1 17 ? 8.359   8.733   -3.182  1.00 15.00 ? 17 SER A O    5  
ATOM 5956  C CB   . SER A 1 17 ? 11.598  7.484   -2.375  1.00 15.00 ? 17 SER A CB   5  
ATOM 5957  O OG   . SER A 1 17 ? 12.710  8.358   -2.475  1.00 15.00 ? 17 SER A OG   5  
ATOM 5958  H H    . SER A 1 17 ? 11.394  9.726   -3.661  1.00 15.00 ? 17 SER A H    5  
ATOM 5959  H HA   . SER A 1 17 ? 10.538  7.001   -4.172  1.00 15.00 ? 17 SER A HA   5  
ATOM 5960  H HB2  . SER A 1 17 ? 11.153  7.597   -1.397  1.00 15.00 ? 17 SER A HB2  5  
ATOM 5961  H HB3  . SER A 1 17 ? 11.941  6.467   -2.498  1.00 15.00 ? 17 SER A HB3  5  
ATOM 5962  H HG   . SER A 1 17 ? 12.646  9.036   -1.798  1.00 15.00 ? 17 SER A HG   5  
ATOM 5963  N N    . LEU A 1 18 ? 8.916   7.044   -1.809  1.00 15.00 ? 18 LEU A N    5  
ATOM 5964  C CA   . LEU A 1 18 ? 7.638   7.059   -1.118  1.00 15.00 ? 18 LEU A CA   5  
ATOM 5965  C C    . LEU A 1 18 ? 7.705   7.950   0.118   1.00 15.00 ? 18 LEU A C    5  
ATOM 5966  O O    . LEU A 1 18 ? 8.662   8.700   0.308   1.00 15.00 ? 18 LEU A O    5  
ATOM 5967  C CB   . LEU A 1 18 ? 7.213   5.638   -0.725  1.00 15.00 ? 18 LEU A CB   5  
ATOM 5968  C CG   . LEU A 1 18 ? 7.191   4.624   -1.871  1.00 15.00 ? 18 LEU A CG   5  
ATOM 5969  C CD1  . LEU A 1 18 ? 6.395   5.166   -3.049  1.00 15.00 ? 18 LEU A CD1  5  
ATOM 5970  C CD2  . LEU A 1 18 ? 8.607   4.271   -2.299  1.00 15.00 ? 18 LEU A CD2  5  
ATOM 5971  H H    . LEU A 1 18 ? 9.601   6.400   -1.537  1.00 15.00 ? 18 LEU A H    5  
ATOM 5972  H HA   . LEU A 1 18 ? 6.907   7.468   -1.797  1.00 15.00 ? 18 LEU A HA   5  
ATOM 5973  H HB2  . LEU A 1 18 ? 7.894   5.279   0.033   1.00 15.00 ? 18 LEU A HB2  5  
ATOM 5974  H HB3  . LEU A 1 18 ? 6.220   5.685   -0.298  1.00 15.00 ? 18 LEU A HB3  5  
ATOM 5975  H HG   . LEU A 1 18 ? 6.708   3.719   -1.531  1.00 15.00 ? 18 LEU A HG   5  
ATOM 5976  H HD11 . LEU A 1 18 ? 5.671   5.885   -2.694  1.00 15.00 ? 18 LEU A HD11 5  
ATOM 5977  H HD12 . LEU A 1 18 ? 7.066   5.644   -3.747  1.00 15.00 ? 18 LEU A HD12 5  
ATOM 5978  H HD13 . LEU A 1 18 ? 5.883   4.352   -3.541  1.00 15.00 ? 18 LEU A HD13 5  
ATOM 5979  H HD21 . LEU A 1 18 ? 8.914   4.924   -3.102  1.00 15.00 ? 18 LEU A HD21 5  
ATOM 5980  H HD22 . LEU A 1 18 ? 9.277   4.392   -1.461  1.00 15.00 ? 18 LEU A HD22 5  
ATOM 5981  H HD23 . LEU A 1 18 ? 8.636   3.246   -2.638  1.00 15.00 ? 18 LEU A HD23 5  
ATOM 5982  N N    . GLY A 1 19 ? 6.676   7.861   0.947   1.00 15.00 ? 19 GLY A N    5  
ATOM 5983  C CA   . GLY A 1 19 ? 6.610   8.658   2.156   1.00 15.00 ? 19 GLY A CA   5  
ATOM 5984  C C    . GLY A 1 19 ? 5.546   8.146   3.093   1.00 15.00 ? 19 GLY A C    5  
ATOM 5985  O O    . GLY A 1 19 ? 4.919   8.914   3.810   1.00 15.00 ? 19 GLY A O    5  
ATOM 5986  H H    . GLY A 1 19 ? 5.945   7.247   0.734   1.00 15.00 ? 19 GLY A H    5  
ATOM 5987  H HA2  . GLY A 1 19 ? 7.566   8.635   2.663   1.00 15.00 ? 19 GLY A HA2  5  
ATOM 5988  H HA3  . GLY A 1 19 ? 6.377   9.679   1.887   1.00 15.00 ? 19 GLY A HA3  5  
ATOM 5989  N N    . ILE A 1 20 ? 5.321   6.841   3.062   1.00 15.00 ? 20 ILE A N    5  
ATOM 5990  C CA   . ILE A 1 20 ? 4.315   6.223   3.907   1.00 15.00 ? 20 ILE A CA   5  
ATOM 5991  C C    . ILE A 1 20 ? 4.927   5.286   4.947   1.00 15.00 ? 20 ILE A C    5  
ATOM 5992  O O    . ILE A 1 20 ? 5.841   4.519   4.645   1.00 15.00 ? 20 ILE A O    5  
ATOM 5993  C CB   . ILE A 1 20 ? 3.283   5.449   3.061   1.00 15.00 ? 20 ILE A CB   5  
ATOM 5994  C CG1  . ILE A 1 20 ? 1.874   5.932   3.381   1.00 15.00 ? 20 ILE A CG1  5  
ATOM 5995  C CG2  . ILE A 1 20 ? 3.391   3.951   3.300   1.00 15.00 ? 20 ILE A CG2  5  
ATOM 5996  C CD1  . ILE A 1 20 ? 0.792   4.997   2.903   1.00 15.00 ? 20 ILE A CD1  5  
ATOM 5997  H H    . ILE A 1 20 ? 5.841   6.280   2.449   1.00 15.00 ? 20 ILE A H    5  
ATOM 5998  H HA   . ILE A 1 20 ? 3.792   7.013   4.426   1.00 15.00 ? 20 ILE A HA   5  
ATOM 5999  H HB   . ILE A 1 20 ? 3.492   5.640   2.023   1.00 15.00 ? 20 ILE A HB   5  
ATOM 6000  H HG12 . ILE A 1 20 ? 1.773   6.030   4.448   1.00 15.00 ? 20 ILE A HG12 5  
ATOM 6001  H HG13 . ILE A 1 20 ? 1.717   6.891   2.916   1.00 15.00 ? 20 ILE A HG13 5  
ATOM 6002  H HG21 . ILE A 1 20 ? 4.416   3.637   3.170   1.00 15.00 ? 20 ILE A HG21 5  
ATOM 6003  H HG22 . ILE A 1 20 ? 3.068   3.732   4.307   1.00 15.00 ? 20 ILE A HG22 5  
ATOM 6004  H HG23 . ILE A 1 20 ? 2.760   3.429   2.597   1.00 15.00 ? 20 ILE A HG23 5  
ATOM 6005  H HD11 . ILE A 1 20 ? -0.077  5.569   2.619   1.00 15.00 ? 20 ILE A HD11 5  
ATOM 6006  H HD12 . ILE A 1 20 ? 1.154   4.438   2.052   1.00 15.00 ? 20 ILE A HD12 5  
ATOM 6007  H HD13 . ILE A 1 20 ? 0.532   4.314   3.701   1.00 15.00 ? 20 ILE A HD13 5  
ATOM 6008  N N    . SER A 1 21 ? 4.371   5.309   6.150   1.00 15.00 ? 21 SER A N    5  
ATOM 6009  C CA   . SER A 1 21 ? 4.812   4.415   7.211   1.00 15.00 ? 21 SER A CA   5  
ATOM 6010  C C    . SER A 1 21 ? 3.878   3.206   7.227   1.00 15.00 ? 21 SER A C    5  
ATOM 6011  O O    . SER A 1 21 ? 2.717   3.320   7.618   1.00 15.00 ? 21 SER A O    5  
ATOM 6012  C CB   . SER A 1 21 ? 4.806   5.132   8.565   1.00 15.00 ? 21 SER A CB   5  
ATOM 6013  O OG   . SER A 1 21 ? 4.623   4.216   9.631   1.00 15.00 ? 21 SER A OG   5  
ATOM 6014  H H    . SER A 1 21 ? 3.615   5.909   6.314   1.00 15.00 ? 21 SER A H    5  
ATOM 6015  H HA   . SER A 1 21 ? 5.815   4.085   6.979   1.00 15.00 ? 21 SER A HA   5  
ATOM 6016  H HB2  . SER A 1 21 ? 5.749   5.642   8.704   1.00 15.00 ? 21 SER A HB2  5  
ATOM 6017  H HB3  . SER A 1 21 ? 4.004   5.855   8.585   1.00 15.00 ? 21 SER A HB3  5  
ATOM 6018  H HG   . SER A 1 21 ? 5.321   3.557   9.610   1.00 15.00 ? 21 SER A HG   5  
ATOM 6019  N N    . VAL A 1 22 ? 4.366   2.063   6.751   1.00 15.00 ? 22 VAL A N    5  
ATOM 6020  C CA   . VAL A 1 22 ? 3.533   0.862   6.667   1.00 15.00 ? 22 VAL A CA   5  
ATOM 6021  C C    . VAL A 1 22 ? 3.662   -0.037  7.890   1.00 15.00 ? 22 VAL A C    5  
ATOM 6022  O O    . VAL A 1 22 ? 4.713   -0.098  8.525   1.00 15.00 ? 22 VAL A O    5  
ATOM 6023  C CB   . VAL A 1 22 ? 3.889   0.028   5.424   1.00 15.00 ? 22 VAL A CB   5  
ATOM 6024  C CG1  . VAL A 1 22 ? 3.514   0.763   4.149   1.00 15.00 ? 22 VAL A CG1  5  
ATOM 6025  C CG2  . VAL A 1 22 ? 5.368   -0.318  5.430   1.00 15.00 ? 22 VAL A CG2  5  
ATOM 6026  H H    . VAL A 1 22 ? 5.291   2.034   6.413   1.00 15.00 ? 22 VAL A H    5  
ATOM 6027  H HA   . VAL A 1 22 ? 2.504   1.180   6.574   1.00 15.00 ? 22 VAL A HA   5  
ATOM 6028  H HB   . VAL A 1 22 ? 3.326   -0.893  5.460   1.00 15.00 ? 22 VAL A HB   5  
ATOM 6029  H HG11 . VAL A 1 22 ? 3.269   1.789   4.382   1.00 15.00 ? 22 VAL A HG11 5  
ATOM 6030  H HG12 . VAL A 1 22 ? 4.349   0.738   3.463   1.00 15.00 ? 22 VAL A HG12 5  
ATOM 6031  H HG13 . VAL A 1 22 ? 2.661   0.282   3.695   1.00 15.00 ? 22 VAL A HG13 5  
ATOM 6032  H HG21 . VAL A 1 22 ? 5.863   0.210   4.629   1.00 15.00 ? 22 VAL A HG21 5  
ATOM 6033  H HG22 . VAL A 1 22 ? 5.802   -0.028  6.375   1.00 15.00 ? 22 VAL A HG22 5  
ATOM 6034  H HG23 . VAL A 1 22 ? 5.489   -1.382  5.288   1.00 15.00 ? 22 VAL A HG23 5  
ATOM 6035  N N    . THR A 1 23 ? 2.572   -0.741  8.199   1.00 15.00 ? 23 THR A N    5  
ATOM 6036  C CA   . THR A 1 23 ? 2.539   -1.659  9.331   1.00 15.00 ? 23 THR A CA   5  
ATOM 6037  C C    . THR A 1 23 ? 1.563   -2.815  9.070   1.00 15.00 ? 23 THR A C    5  
ATOM 6038  O O    . THR A 1 23 ? 0.927   -2.881  8.013   1.00 15.00 ? 23 THR A O    5  
ATOM 6039  C CB   . THR A 1 23 ? 2.155   -0.909  10.605  1.00 15.00 ? 23 THR A CB   5  
ATOM 6040  O OG1  . THR A 1 23 ? 2.176   -1.773  11.730  1.00 15.00 ? 23 THR A OG1  5  
ATOM 6041  C CG2  . THR A 1 23 ? 0.788   -0.275  10.526  1.00 15.00 ? 23 THR A CG2  5  
ATOM 6042  H H    . THR A 1 23 ? 1.772   -0.646  7.642   1.00 15.00 ? 23 THR A H    5  
ATOM 6043  H HA   . THR A 1 23 ? 3.529   -2.067  9.448   1.00 15.00 ? 23 THR A HA   5  
ATOM 6044  H HB   . THR A 1 23 ? 2.874   -0.117  10.771  1.00 15.00 ? 23 THR A HB   5  
ATOM 6045  H HG1  . THR A 1 23 ? 1.298   -2.132  11.881  1.00 15.00 ? 23 THR A HG1  5  
ATOM 6046  H HG21 . THR A 1 23 ? 0.663   0.410   11.350  1.00 15.00 ? 23 THR A HG21 5  
ATOM 6047  H HG22 . THR A 1 23 ? 0.698   0.261   9.594   1.00 15.00 ? 23 THR A HG22 5  
ATOM 6048  H HG23 . THR A 1 23 ? 0.033   -1.044  10.576  1.00 15.00 ? 23 THR A HG23 5  
ATOM 6049  N N    . GLY A 1 24 ? 1.448   -3.722  10.042  1.00 15.00 ? 24 GLY A N    5  
ATOM 6050  C CA   . GLY A 1 24 ? 0.547   -4.859  9.904   1.00 15.00 ? 24 GLY A CA   5  
ATOM 6051  C C    . GLY A 1 24 ? 1.078   -5.908  8.947   1.00 15.00 ? 24 GLY A C    5  
ATOM 6052  O O    . GLY A 1 24 ? 2.112   -6.522  9.206   1.00 15.00 ? 24 GLY A O    5  
ATOM 6053  H H    . GLY A 1 24 ? 1.976   -3.617  10.861  1.00 15.00 ? 24 GLY A H    5  
ATOM 6054  H HA2  . GLY A 1 24 ? 0.407   -5.313  10.874  1.00 15.00 ? 24 GLY A HA2  5  
ATOM 6055  H HA3  . GLY A 1 24 ? -0.407  -4.507  9.542   1.00 15.00 ? 24 GLY A HA3  5  
ATOM 6056  N N    . GLY A 1 25 ? 0.376   -6.099  7.833   1.00 15.00 ? 25 GLY A N    5  
ATOM 6057  C CA   . GLY A 1 25 ? 0.802   -7.066  6.833   1.00 15.00 ? 25 GLY A CA   5  
ATOM 6058  C C    . GLY A 1 25 ? 0.800   -8.501  7.326   1.00 15.00 ? 25 GLY A C    5  
ATOM 6059  O O    . GLY A 1 25 ? 0.042   -9.330  6.823   1.00 15.00 ? 25 GLY A O    5  
ATOM 6060  H H    . GLY A 1 25 ? -0.434  -5.569  7.681   1.00 15.00 ? 25 GLY A H    5  
ATOM 6061  H HA2  . GLY A 1 25 ? 0.145   -6.997  5.985   1.00 15.00 ? 25 GLY A HA2  5  
ATOM 6062  H HA3  . GLY A 1 25 ? 1.798   -6.811  6.514   1.00 15.00 ? 25 GLY A HA3  5  
ATOM 6063  N N    . VAL A 1 26 ? 1.667   -8.795  8.295   1.00 15.00 ? 26 VAL A N    5  
ATOM 6064  C CA   . VAL A 1 26 ? 1.795   -10.144 8.862   1.00 15.00 ? 26 VAL A CA   5  
ATOM 6065  C C    . VAL A 1 26 ? 0.488   -10.931 8.788   1.00 15.00 ? 26 VAL A C    5  
ATOM 6066  O O    . VAL A 1 26 ? -0.595  -10.379 8.978   1.00 15.00 ? 26 VAL A O    5  
ATOM 6067  C CB   . VAL A 1 26 ? 2.266   -10.099 10.331  1.00 15.00 ? 26 VAL A CB   5  
ATOM 6068  C CG1  . VAL A 1 26 ? 3.763   -10.356 10.423  1.00 15.00 ? 26 VAL A CG1  5  
ATOM 6069  C CG2  . VAL A 1 26 ? 1.909   -8.766  10.968  1.00 15.00 ? 26 VAL A CG2  5  
ATOM 6070  H H    . VAL A 1 26 ? 2.249   -8.085  8.637   1.00 15.00 ? 26 VAL A H    5  
ATOM 6071  H HA   . VAL A 1 26 ? 2.544   -10.669 8.288   1.00 15.00 ? 26 VAL A HA   5  
ATOM 6072  H HB   . VAL A 1 26 ? 1.757   -10.881 10.877  1.00 15.00 ? 26 VAL A HB   5  
ATOM 6073  H HG11 . VAL A 1 26 ? 3.996   -11.299 9.951   1.00 15.00 ? 26 VAL A HG11 5  
ATOM 6074  H HG12 . VAL A 1 26 ? 4.296   -9.561  9.922   1.00 15.00 ? 26 VAL A HG12 5  
ATOM 6075  H HG13 . VAL A 1 26 ? 4.059   -10.390 11.461  1.00 15.00 ? 26 VAL A HG13 5  
ATOM 6076  H HG21 . VAL A 1 26 ? 2.731   -8.077  10.842  1.00 15.00 ? 26 VAL A HG21 5  
ATOM 6077  H HG22 . VAL A 1 26 ? 1.029   -8.365  10.488  1.00 15.00 ? 26 VAL A HG22 5  
ATOM 6078  H HG23 . VAL A 1 26 ? 1.715   -8.908  12.021  1.00 15.00 ? 26 VAL A HG23 5  
ATOM 6079  N N    . ASN A 1 27 ? 0.603   -12.225 8.507   1.00 15.00 ? 27 ASN A N    5  
ATOM 6080  C CA   . ASN A 1 27 ? -0.562  -13.095 8.401   1.00 15.00 ? 27 ASN A CA   5  
ATOM 6081  C C    . ASN A 1 27 ? -1.122  -13.430 9.781   1.00 15.00 ? 27 ASN A C    5  
ATOM 6082  O O    . ASN A 1 27 ? -1.150  -14.593 10.186  1.00 15.00 ? 27 ASN A O    5  
ATOM 6083  C CB   . ASN A 1 27 ? -0.190  -14.383 7.663   1.00 15.00 ? 27 ASN A CB   5  
ATOM 6084  C CG   . ASN A 1 27 ? 0.968   -15.109 8.318   1.00 15.00 ? 27 ASN A CG   5  
ATOM 6085  O OD1  . ASN A 1 27 ? 0.780   -15.881 9.259   1.00 15.00 ? 27 ASN A OD1  5  
ATOM 6086  N ND2  . ASN A 1 27 ? 2.176   -14.864 7.824   1.00 15.00 ? 27 ASN A ND2  5  
ATOM 6087  H H    . ASN A 1 27 ? 1.496   -12.604 8.364   1.00 15.00 ? 27 ASN A H    5  
ATOM 6088  H HA   . ASN A 1 27 ? -1.317  -12.571 7.833   1.00 15.00 ? 27 ASN A HA   5  
ATOM 6089  H HB2  . ASN A 1 27 ? -1.044  -15.043 7.651   1.00 15.00 ? 27 ASN A HB2  5  
ATOM 6090  H HB3  . ASN A 1 27 ? 0.088   -14.141 6.648   1.00 15.00 ? 27 ASN A HB3  5  
ATOM 6091  H HD21 . ASN A 1 27 ? 2.251   -14.237 7.075   1.00 15.00 ? 27 ASN A HD21 5  
ATOM 6092  H HD22 . ASN A 1 27 ? 2.943   -15.320 8.229   1.00 15.00 ? 27 ASN A HD22 5  
ATOM 6093  N N    . THR A 1 28 ? -1.568  -12.405 10.499  1.00 15.00 ? 28 THR A N    5  
ATOM 6094  C CA   . THR A 1 28 ? -2.126  -12.593 11.833  1.00 15.00 ? 28 THR A CA   5  
ATOM 6095  C C    . THR A 1 28 ? -3.149  -11.508 12.156  1.00 15.00 ? 28 THR A C    5  
ATOM 6096  O O    . THR A 1 28 ? -4.336  -11.789 12.319  1.00 15.00 ? 28 THR A O    5  
ATOM 6097  C CB   . THR A 1 28 ? -1.011  -12.586 12.879  1.00 15.00 ? 28 THR A CB   5  
ATOM 6098  O OG1  . THR A 1 28 ? 0.066   -13.410 12.470  1.00 15.00 ? 28 THR A OG1  5  
ATOM 6099  C CG2  . THR A 1 28 ? -1.465  -13.065 14.241  1.00 15.00 ? 28 THR A CG2  5  
ATOM 6100  H H    . THR A 1 28 ? -1.520  -11.501 10.124  1.00 15.00 ? 28 THR A H    5  
ATOM 6101  H HA   . THR A 1 28 ? -2.619  -13.553 11.853  1.00 15.00 ? 28 THR A HA   5  
ATOM 6102  H HB   . THR A 1 28 ? -0.642  -11.576 12.990  1.00 15.00 ? 28 THR A HB   5  
ATOM 6103  H HG1  . THR A 1 28 ? 0.748   -13.406 13.145  1.00 15.00 ? 28 THR A HG1  5  
ATOM 6104  H HG21 . THR A 1 28 ? -1.449  -12.239 14.937  1.00 15.00 ? 28 THR A HG21 5  
ATOM 6105  H HG22 . THR A 1 28 ? -2.469  -13.456 14.169  1.00 15.00 ? 28 THR A HG22 5  
ATOM 6106  H HG23 . THR A 1 28 ? -0.800  -13.841 14.589  1.00 15.00 ? 28 THR A HG23 5  
ATOM 6107  N N    . SER A 1 29 ? -2.678  -10.269 12.249  1.00 15.00 ? 29 SER A N    5  
ATOM 6108  C CA   . SER A 1 29 ? -3.550  -9.141  12.554  1.00 15.00 ? 29 SER A CA   5  
ATOM 6109  C C    . SER A 1 29 ? -4.489  -8.843  11.390  1.00 15.00 ? 29 SER A C    5  
ATOM 6110  O O    . SER A 1 29 ? -5.696  -8.693  11.576  1.00 15.00 ? 29 SER A O    5  
ATOM 6111  C CB   . SER A 1 29 ? -2.717  -7.900  12.882  1.00 15.00 ? 29 SER A CB   5  
ATOM 6112  O OG   . SER A 1 29 ? -3.253  -7.204  13.994  1.00 15.00 ? 29 SER A OG   5  
ATOM 6113  H H    . SER A 1 29 ? -1.722  -10.109 12.109  1.00 15.00 ? 29 SER A H    5  
ATOM 6114  H HA   . SER A 1 29 ? -4.141  -9.404  13.419  1.00 15.00 ? 29 SER A HA   5  
ATOM 6115  H HB2  . SER A 1 29 ? -1.706  -8.200  13.115  1.00 15.00 ? 29 SER A HB2  5  
ATOM 6116  H HB3  . SER A 1 29 ? -2.708  -7.239  12.028  1.00 15.00 ? 29 SER A HB3  5  
ATOM 6117  H HG   . SER A 1 29 ? -2.582  -6.625  14.364  1.00 15.00 ? 29 SER A HG   5  
ATOM 6118  N N    . VAL A 1 30 ? -3.926  -8.755  10.189  1.00 15.00 ? 30 VAL A N    5  
ATOM 6119  C CA   . VAL A 1 30 ? -4.712  -8.472  8.995   1.00 15.00 ? 30 VAL A CA   5  
ATOM 6120  C C    . VAL A 1 30 ? -5.555  -9.678  8.589   1.00 15.00 ? 30 VAL A C    5  
ATOM 6121  O O    . VAL A 1 30 ? -5.597  -10.684 9.296   1.00 15.00 ? 30 VAL A O    5  
ATOM 6122  C CB   . VAL A 1 30 ? -3.810  -8.064  7.814   1.00 15.00 ? 30 VAL A CB   5  
ATOM 6123  C CG1  . VAL A 1 30 ? -3.042  -6.794  8.143   1.00 15.00 ? 30 VAL A CG1  5  
ATOM 6124  C CG2  . VAL A 1 30 ? -2.856  -9.193  7.454   1.00 15.00 ? 30 VAL A CG2  5  
ATOM 6125  H H    . VAL A 1 30 ? -2.957  -8.882  10.105  1.00 15.00 ? 30 VAL A H    5  
ATOM 6126  H HA   . VAL A 1 30 ? -5.370  -7.645  9.219   1.00 15.00 ? 30 VAL A HA   5  
ATOM 6127  H HB   . VAL A 1 30 ? -4.438  -7.866  6.959   1.00 15.00 ? 30 VAL A HB   5  
ATOM 6128  H HG11 . VAL A 1 30 ? -2.510  -6.926  9.074   1.00 15.00 ? 30 VAL A HG11 5  
ATOM 6129  H HG12 . VAL A 1 30 ? -2.336  -6.585  7.353   1.00 15.00 ? 30 VAL A HG12 5  
ATOM 6130  H HG13 . VAL A 1 30 ? -3.732  -5.969  8.237   1.00 15.00 ? 30 VAL A HG13 5  
ATOM 6131  H HG21 . VAL A 1 30 ? -1.877  -8.977  7.854   1.00 15.00 ? 30 VAL A HG21 5  
ATOM 6132  H HG22 . VAL A 1 30 ? -3.219  -10.120 7.873   1.00 15.00 ? 30 VAL A HG22 5  
ATOM 6133  H HG23 . VAL A 1 30 ? -2.794  -9.283  6.379   1.00 15.00 ? 30 VAL A HG23 5  
ATOM 6134  N N    . ARG A 1 31 ? -6.226  -9.567  7.446   1.00 15.00 ? 31 ARG A N    5  
ATOM 6135  C CA   . ARG A 1 31 ? -7.071  -10.646 6.943   1.00 15.00 ? 31 ARG A CA   5  
ATOM 6136  C C    . ARG A 1 31 ? -6.307  -11.966 6.885   1.00 15.00 ? 31 ARG A C    5  
ATOM 6137  O O    . ARG A 1 31 ? -6.519  -12.853 7.712   1.00 15.00 ? 31 ARG A O    5  
ATOM 6138  C CB   . ARG A 1 31 ? -7.609  -10.292 5.554   1.00 15.00 ? 31 ARG A CB   5  
ATOM 6139  C CG   . ARG A 1 31 ? -9.075  -9.891  5.553   1.00 15.00 ? 31 ARG A CG   5  
ATOM 6140  C CD   . ARG A 1 31 ? -9.985  -11.104 5.446   1.00 15.00 ? 31 ARG A CD   5  
ATOM 6141  N NE   . ARG A 1 31 ? -10.534 -11.491 6.743   1.00 15.00 ? 31 ARG A NE   5  
ATOM 6142  C CZ   . ARG A 1 31 ? -11.511 -12.382 6.897   1.00 15.00 ? 31 ARG A CZ   5  
ATOM 6143  N NH1  . ARG A 1 31 ? -12.047 -12.977 5.839   1.00 15.00 ? 31 ARG A NH1  5  
ATOM 6144  N NH2  . ARG A 1 31 ? -11.953 -12.677 8.112   1.00 15.00 ? 31 ARG A NH2  5  
ATOM 6145  H H    . ARG A 1 31 ? -6.153  -8.739  6.928   1.00 15.00 ? 31 ARG A H    5  
ATOM 6146  H HA   . ARG A 1 31 ? -7.904  -10.757 7.621   1.00 15.00 ? 31 ARG A HA   5  
ATOM 6147  H HB2  . ARG A 1 31 ? -7.033  -9.470  5.156   1.00 15.00 ? 31 ARG A HB2  5  
ATOM 6148  H HB3  . ARG A 1 31 ? -7.493  -11.148 4.905   1.00 15.00 ? 31 ARG A HB3  5  
ATOM 6149  H HG2  . ARG A 1 31 ? -9.296  -9.367  6.471   1.00 15.00 ? 31 ARG A HG2  5  
ATOM 6150  H HG3  . ARG A 1 31 ? -9.258  -9.239  4.711   1.00 15.00 ? 31 ARG A HG3  5  
ATOM 6151  H HD2  . ARG A 1 31 ? -10.799 -10.869 4.777   1.00 15.00 ? 31 ARG A HD2  5  
ATOM 6152  H HD3  . ARG A 1 31 ? -9.416  -11.930 5.045   1.00 15.00 ? 31 ARG A HD3  5  
ATOM 6153  H HE   . ARG A 1 31 ? -10.156 -11.066 7.540   1.00 15.00 ? 31 ARG A HE   5  
ATOM 6154  H HH11 . ARG A 1 31 ? -11.719 -12.758 4.921   1.00 15.00 ? 31 ARG A HH11 5  
ATOM 6155  H HH12 . ARG A 1 31 ? -12.781 -13.646 5.961   1.00 15.00 ? 31 ARG A HH12 5  
ATOM 6156  H HH21 . ARG A 1 31 ? -11.552 -12.231 8.912   1.00 15.00 ? 31 ARG A HH21 5  
ATOM 6157  H HH22 . ARG A 1 31 ? -12.687 -13.346 8.227   1.00 15.00 ? 31 ARG A HH22 5  
ATOM 6158  N N    . HIS A 1 32 ? -5.420  -12.092 5.902   1.00 15.00 ? 32 HIS A N    5  
ATOM 6159  C CA   . HIS A 1 32 ? -4.630  -13.307 5.739   1.00 15.00 ? 32 HIS A CA   5  
ATOM 6160  C C    . HIS A 1 32 ? -3.154  -12.981 5.530   1.00 15.00 ? 32 HIS A C    5  
ATOM 6161  O O    . HIS A 1 32 ? -2.282  -13.598 6.138   1.00 15.00 ? 32 HIS A O    5  
ATOM 6162  C CB   . HIS A 1 32 ? -5.154  -14.128 4.558   1.00 15.00 ? 32 HIS A CB   5  
ATOM 6163  C CG   . HIS A 1 32 ? -5.511  -13.299 3.363   1.00 15.00 ? 32 HIS A CG   5  
ATOM 6164  N ND1  . HIS A 1 32 ? -6.768  -12.766 3.165   1.00 15.00 ? 32 HIS A ND1  5  
ATOM 6165  C CD2  . HIS A 1 32 ? -4.768  -12.911 2.299   1.00 15.00 ? 32 HIS A CD2  5  
ATOM 6166  C CE1  . HIS A 1 32 ? -6.782  -12.087 2.031   1.00 15.00 ? 32 HIS A CE1  5  
ATOM 6167  N NE2  . HIS A 1 32 ? -5.582  -12.159 1.488   1.00 15.00 ? 32 HIS A NE2  5  
ATOM 6168  H H    . HIS A 1 32 ? -5.297  -11.352 5.271   1.00 15.00 ? 32 HIS A H    5  
ATOM 6169  H HA   . HIS A 1 32 ? -4.731  -13.890 6.642   1.00 15.00 ? 32 HIS A HA   5  
ATOM 6170  H HB2  . HIS A 1 32 ? -4.396  -14.835 4.256   1.00 15.00 ? 32 HIS A HB2  5  
ATOM 6171  H HB3  . HIS A 1 32 ? -6.038  -14.666 4.867   1.00 15.00 ? 32 HIS A HB3  5  
ATOM 6172  H HD1  . HIS A 1 32 ? -7.535  -12.870 3.766   1.00 15.00 ? 32 HIS A HD1  5  
ATOM 6173  H HD2  . HIS A 1 32 ? -3.729  -13.149 2.122   1.00 15.00 ? 32 HIS A HD2  5  
ATOM 6174  H HE1  . HIS A 1 32 ? -7.632  -11.562 1.620   1.00 15.00 ? 32 HIS A HE1  5  
ATOM 6175  H HE2  . HIS A 1 32 ? -5.332  -11.789 0.616   1.00 15.00 ? 32 HIS A HE2  5  
ATOM 6176  N N    . GLY A 1 33 ? -2.882  -12.012 4.662   1.00 15.00 ? 33 GLY A N    5  
ATOM 6177  C CA   . GLY A 1 33 ? -1.509  -11.625 4.385   1.00 15.00 ? 33 GLY A CA   5  
ATOM 6178  C C    . GLY A 1 33 ? -1.412  -10.334 3.595   1.00 15.00 ? 33 GLY A C    5  
ATOM 6179  O O    . GLY A 1 33 ? -0.411  -10.082 2.925   1.00 15.00 ? 33 GLY A O    5  
ATOM 6180  H H    . GLY A 1 33 ? -3.619  -11.559 4.202   1.00 15.00 ? 33 GLY A H    5  
ATOM 6181  H HA2  . GLY A 1 33 ? -0.979  -11.497 5.322   1.00 15.00 ? 33 GLY A HA2  5  
ATOM 6182  H HA3  . GLY A 1 33 ? -1.034  -12.415 3.824   1.00 15.00 ? 33 GLY A HA3  5  
ATOM 6183  N N    . GLY A 1 34 ? -2.445  -9.503  3.687   1.00 15.00 ? 34 GLY A N    5  
ATOM 6184  C CA   . GLY A 1 34 ? -2.437  -8.234  2.987   1.00 15.00 ? 34 GLY A CA   5  
ATOM 6185  C C    . GLY A 1 34 ? -1.845  -7.145  3.854   1.00 15.00 ? 34 GLY A C    5  
ATOM 6186  O O    . GLY A 1 34 ? -1.887  -7.244  5.081   1.00 15.00 ? 34 GLY A O    5  
ATOM 6187  H H    . GLY A 1 34 ? -3.211  -9.746  4.247   1.00 15.00 ? 34 GLY A H    5  
ATOM 6188  H HA2  . GLY A 1 34 ? -1.850  -8.329  2.085   1.00 15.00 ? 34 GLY A HA2  5  
ATOM 6189  H HA3  . GLY A 1 34 ? -3.449  -7.965  2.726   1.00 15.00 ? 34 GLY A HA3  5  
ATOM 6190  N N    . ILE A 1 35 ? -1.282  -6.111  3.241   1.00 15.00 ? 35 ILE A N    5  
ATOM 6191  C CA   . ILE A 1 35 ? -0.682  -5.038  4.022   1.00 15.00 ? 35 ILE A CA   5  
ATOM 6192  C C    . ILE A 1 35 ? -1.667  -3.917  4.293   1.00 15.00 ? 35 ILE A C    5  
ATOM 6193  O O    . ILE A 1 35 ? -2.608  -3.690  3.533   1.00 15.00 ? 35 ILE A O    5  
ATOM 6194  C CB   . ILE A 1 35 ? 0.587   -4.458  3.352   1.00 15.00 ? 35 ILE A CB   5  
ATOM 6195  C CG1  . ILE A 1 35 ? 1.736   -4.400  4.372   1.00 15.00 ? 35 ILE A CG1  5  
ATOM 6196  C CG2  . ILE A 1 35 ? 0.316   -3.082  2.745   1.00 15.00 ? 35 ILE A CG2  5  
ATOM 6197  C CD1  . ILE A 1 35 ? 2.117   -3.001  4.819   1.00 15.00 ? 35 ILE A CD1  5  
ATOM 6198  H H    . ILE A 1 35 ? -1.262  -6.072  2.258   1.00 15.00 ? 35 ILE A H    5  
ATOM 6199  H HA   . ILE A 1 35 ? -0.389  -5.461  4.971   1.00 15.00 ? 35 ILE A HA   5  
ATOM 6200  H HB   . ILE A 1 35 ? 0.867   -5.120  2.553   1.00 15.00 ? 35 ILE A HB   5  
ATOM 6201  H HG12 . ILE A 1 35 ? 1.450   -4.953  5.253   1.00 15.00 ? 35 ILE A HG12 5  
ATOM 6202  H HG13 . ILE A 1 35 ? 2.612   -4.858  3.938   1.00 15.00 ? 35 ILE A HG13 5  
ATOM 6203  H HG21 . ILE A 1 35 ? -0.569  -3.127  2.129   1.00 15.00 ? 35 ILE A HG21 5  
ATOM 6204  H HG22 . ILE A 1 35 ? 0.164   -2.363  3.536   1.00 15.00 ? 35 ILE A HG22 5  
ATOM 6205  H HG23 . ILE A 1 35 ? 1.161   -2.782  2.144   1.00 15.00 ? 35 ILE A HG23 5  
ATOM 6206  H HD11 . ILE A 1 35 ? 2.706   -2.525  4.049   1.00 15.00 ? 35 ILE A HD11 5  
ATOM 6207  H HD12 . ILE A 1 35 ? 1.221   -2.424  4.995   1.00 15.00 ? 35 ILE A HD12 5  
ATOM 6208  H HD13 . ILE A 1 35 ? 2.694   -3.059  5.730   1.00 15.00 ? 35 ILE A HD13 5  
ATOM 6209  N N    . TYR A 1 36 ? -1.417  -3.209  5.379   1.00 15.00 ? 36 TYR A N    5  
ATOM 6210  C CA   . TYR A 1 36 ? -2.245  -2.086  5.771   1.00 15.00 ? 36 TYR A CA   5  
ATOM 6211  C C    . TYR A 1 36 ? -1.358  -0.969  6.280   1.00 15.00 ? 36 TYR A C    5  
ATOM 6212  O O    . TYR A 1 36 ? -0.732  -1.096  7.332   1.00 15.00 ? 36 TYR A O    5  
ATOM 6213  C CB   . TYR A 1 36 ? -3.246  -2.498  6.848   1.00 15.00 ? 36 TYR A CB   5  
ATOM 6214  C CG   . TYR A 1 36 ? -4.282  -3.481  6.360   1.00 15.00 ? 36 TYR A CG   5  
ATOM 6215  C CD1  . TYR A 1 36 ? -3.934  -4.789  6.055   1.00 15.00 ? 36 TYR A CD1  5  
ATOM 6216  C CD2  . TYR A 1 36 ? -5.606  -3.099  6.201   1.00 15.00 ? 36 TYR A CD2  5  
ATOM 6217  C CE1  . TYR A 1 36 ? -4.877  -5.691  5.607   1.00 15.00 ? 36 TYR A CE1  5  
ATOM 6218  C CE2  . TYR A 1 36 ? -6.557  -3.994  5.753   1.00 15.00 ? 36 TYR A CE2  5  
ATOM 6219  C CZ   . TYR A 1 36 ? -6.187  -5.290  5.458   1.00 15.00 ? 36 TYR A CZ   5  
ATOM 6220  O OH   . TYR A 1 36 ? -7.131  -6.187  5.012   1.00 15.00 ? 36 TYR A OH   5  
ATOM 6221  H H    . TYR A 1 36 ? -0.635  -3.440  5.927   1.00 15.00 ? 36 TYR A H    5  
ATOM 6222  H HA   . TYR A 1 36 ? -2.775  -1.745  4.896   1.00 15.00 ? 36 TYR A HA   5  
ATOM 6223  H HB2  . TYR A 1 36 ? -2.715  -2.957  7.668   1.00 15.00 ? 36 TYR A HB2  5  
ATOM 6224  H HB3  . TYR A 1 36 ? -3.762  -1.620  7.206   1.00 15.00 ? 36 TYR A HB3  5  
ATOM 6225  H HD1  . TYR A 1 36 ? -2.906  -5.100  6.174   1.00 15.00 ? 36 TYR A HD1  5  
ATOM 6226  H HD2  . TYR A 1 36 ? -5.892  -2.083  6.433   1.00 15.00 ? 36 TYR A HD2  5  
ATOM 6227  H HE1  . TYR A 1 36 ? -4.585  -6.704  5.375   1.00 15.00 ? 36 TYR A HE1  5  
ATOM 6228  H HE2  . TYR A 1 36 ? -7.581  -3.677  5.634   1.00 15.00 ? 36 TYR A HE2  5  
ATOM 6229  H HH   . TYR A 1 36 ? -7.386  -6.768  5.733   1.00 15.00 ? 36 TYR A HH   5  
ATOM 6230  N N    . VAL A 1 37 ? -1.282  0.118   5.526   1.00 15.00 ? 37 VAL A N    5  
ATOM 6231  C CA   . VAL A 1 37 ? -0.431  1.228   5.928   1.00 15.00 ? 37 VAL A CA   5  
ATOM 6232  C C    . VAL A 1 37 ? -0.802  1.722   7.315   1.00 15.00 ? 37 VAL A C    5  
ATOM 6233  O O    . VAL A 1 37 ? -1.929  1.555   7.775   1.00 15.00 ? 37 VAL A O    5  
ATOM 6234  C CB   . VAL A 1 37 ? -0.430  2.417   4.920   1.00 15.00 ? 37 VAL A CB   5  
ATOM 6235  C CG1  . VAL A 1 37 ? -0.741  1.962   3.509   1.00 15.00 ? 37 VAL A CG1  5  
ATOM 6236  C CG2  . VAL A 1 37 ? -1.377  3.540   5.321   1.00 15.00 ? 37 VAL A CG2  5  
ATOM 6237  H H    . VAL A 1 37 ? -1.791  0.163   4.688   1.00 15.00 ? 37 VAL A H    5  
ATOM 6238  H HA   . VAL A 1 37 ? 0.579   0.843   5.975   1.00 15.00 ? 37 VAL A HA   5  
ATOM 6239  H HB   . VAL A 1 37 ? 0.561   2.824   4.911   1.00 15.00 ? 37 VAL A HB   5  
ATOM 6240  H HG11 . VAL A 1 37 ? -0.670  0.889   3.446   1.00 15.00 ? 37 VAL A HG11 5  
ATOM 6241  H HG12 . VAL A 1 37 ? -1.739  2.280   3.249   1.00 15.00 ? 37 VAL A HG12 5  
ATOM 6242  H HG13 . VAL A 1 37 ? -0.033  2.408   2.830   1.00 15.00 ? 37 VAL A HG13 5  
ATOM 6243  H HG21 . VAL A 1 37 ? -2.386  3.263   5.072   1.00 15.00 ? 37 VAL A HG21 5  
ATOM 6244  H HG22 . VAL A 1 37 ? -1.299  3.726   6.380   1.00 15.00 ? 37 VAL A HG22 5  
ATOM 6245  H HG23 . VAL A 1 37 ? -1.113  4.438   4.782   1.00 15.00 ? 37 VAL A HG23 5  
ATOM 6246  N N    . LYS A 1 38 ? 0.154   2.353   7.962   1.00 15.00 ? 38 LYS A N    5  
ATOM 6247  C CA   . LYS A 1 38 ? -0.060  2.906   9.283   1.00 15.00 ? 38 LYS A CA   5  
ATOM 6248  C C    . LYS A 1 38 ? -0.543  4.334   9.128   1.00 15.00 ? 38 LYS A C    5  
ATOM 6249  O O    . LYS A 1 38 ? -1.525  4.745   9.745   1.00 15.00 ? 38 LYS A O    5  
ATOM 6250  C CB   . LYS A 1 38 ? 1.228   2.854   10.108  1.00 15.00 ? 38 LYS A CB   5  
ATOM 6251  C CG   . LYS A 1 38 ? 0.996   2.947   11.607  1.00 15.00 ? 38 LYS A CG   5  
ATOM 6252  C CD   . LYS A 1 38 ? 1.626   4.200   12.191  1.00 15.00 ? 38 LYS A CD   5  
ATOM 6253  C CE   . LYS A 1 38 ? 0.663   5.374   12.151  1.00 15.00 ? 38 LYS A CE   5  
ATOM 6254  N NZ   . LYS A 1 38 ? -0.007  5.588   13.464  1.00 15.00 ? 38 LYS A NZ   5  
ATOM 6255  H H    . LYS A 1 38 ? 1.018   2.470   7.526   1.00 15.00 ? 38 LYS A H    5  
ATOM 6256  H HA   . LYS A 1 38 ? -0.826  2.324   9.775   1.00 15.00 ? 38 LYS A HA   5  
ATOM 6257  H HB2  . LYS A 1 38 ? 1.733   1.923   9.903   1.00 15.00 ? 38 LYS A HB2  5  
ATOM 6258  H HB3  . LYS A 1 38 ? 1.868   3.670   9.811   1.00 15.00 ? 38 LYS A HB3  5  
ATOM 6259  H HG2  . LYS A 1 38 ? -0.066  2.968   11.797  1.00 15.00 ? 38 LYS A HG2  5  
ATOM 6260  H HG3  . LYS A 1 38 ? 1.432   2.081   12.084  1.00 15.00 ? 38 LYS A HG3  5  
ATOM 6261  H HD2  . LYS A 1 38 ? 1.902   4.008   13.217  1.00 15.00 ? 38 LYS A HD2  5  
ATOM 6262  H HD3  . LYS A 1 38 ? 2.506   4.448   11.618  1.00 15.00 ? 38 LYS A HD3  5  
ATOM 6263  H HE2  . LYS A 1 38 ? 1.212   6.265   11.887  1.00 15.00 ? 38 LYS A HE2  5  
ATOM 6264  H HE3  . LYS A 1 38 ? -0.088  5.178   11.401  1.00 15.00 ? 38 LYS A HE3  5  
ATOM 6265  H HZ1  . LYS A 1 38 ? -0.927  5.104   13.479  1.00 15.00 ? 38 LYS A HZ1  5  
ATOM 6266  H HZ2  . LYS A 1 38 ? 0.584   5.211   14.232  1.00 15.00 ? 38 LYS A HZ2  5  
ATOM 6267  H HZ3  . LYS A 1 38 ? -0.160  6.604   13.626  1.00 15.00 ? 38 LYS A HZ3  5  
ATOM 6268  N N    . ALA A 1 39 ? 0.149   5.072   8.269   1.00 15.00 ? 39 ALA A N    5  
ATOM 6269  C CA   . ALA A 1 39 ? -0.205  6.450   7.978   1.00 15.00 ? 39 ALA A CA   5  
ATOM 6270  C C    . ALA A 1 39 ? 0.645   6.991   6.836   1.00 15.00 ? 39 ALA A C    5  
ATOM 6271  O O    . ALA A 1 39 ? 1.649   6.386   6.464   1.00 15.00 ? 39 ALA A O    5  
ATOM 6272  C CB   . ALA A 1 39 ? -0.076  7.307   9.219   1.00 15.00 ? 39 ALA A CB   5  
ATOM 6273  H H    . ALA A 1 39 ? 0.910   4.666   7.796   1.00 15.00 ? 39 ALA A H    5  
ATOM 6274  H HA   . ALA A 1 39 ? -1.240  6.463   7.669   1.00 15.00 ? 39 ALA A HA   5  
ATOM 6275  H HB1  . ALA A 1 39 ? -1.016  7.296   9.751   1.00 15.00 ? 39 ALA A HB1  5  
ATOM 6276  H HB2  . ALA A 1 39 ? 0.703   6.910   9.851   1.00 15.00 ? 39 ALA A HB2  5  
ATOM 6277  H HB3  . ALA A 1 39 ? 0.166   8.319   8.935   1.00 15.00 ? 39 ALA A HB3  5  
ATOM 6278  N N    . VAL A 1 40 ? 0.247   8.133   6.290   1.00 15.00 ? 40 VAL A N    5  
ATOM 6279  C CA   . VAL A 1 40 ? 0.987   8.750   5.191   1.00 15.00 ? 40 VAL A CA   5  
ATOM 6280  C C    . VAL A 1 40 ? 1.928   9.835   5.721   1.00 15.00 ? 40 VAL A C    5  
ATOM 6281  O O    . VAL A 1 40 ? 1.490   10.792  6.360   1.00 15.00 ? 40 VAL A O    5  
ATOM 6282  C CB   . VAL A 1 40 ? 0.042   9.356   4.128   1.00 15.00 ? 40 VAL A CB   5  
ATOM 6283  C CG1  . VAL A 1 40 ? -0.166  8.387   2.974   1.00 15.00 ? 40 VAL A CG1  5  
ATOM 6284  C CG2  . VAL A 1 40 ? -1.291  9.739   4.744   1.00 15.00 ? 40 VAL A CG2  5  
ATOM 6285  H H    . VAL A 1 40 ? -0.556  8.573   6.637   1.00 15.00 ? 40 VAL A H    5  
ATOM 6286  H HA   . VAL A 1 40 ? 1.574   7.975   4.718   1.00 15.00 ? 40 VAL A HA   5  
ATOM 6287  H HB   . VAL A 1 40 ? 0.503   10.248  3.735   1.00 15.00 ? 40 VAL A HB   5  
ATOM 6288  H HG11 . VAL A 1 40 ? -0.246  7.381   3.358   1.00 15.00 ? 40 VAL A HG11 5  
ATOM 6289  H HG12 . VAL A 1 40 ? -1.074  8.644   2.447   1.00 15.00 ? 40 VAL A HG12 5  
ATOM 6290  H HG13 . VAL A 1 40 ? 0.672   8.449   2.296   1.00 15.00 ? 40 VAL A HG13 5  
ATOM 6291  H HG21 . VAL A 1 40 ? -1.799  8.844   5.075   1.00 15.00 ? 40 VAL A HG21 5  
ATOM 6292  H HG22 . VAL A 1 40 ? -1.122  10.389  5.588   1.00 15.00 ? 40 VAL A HG22 5  
ATOM 6293  H HG23 . VAL A 1 40 ? -1.896  10.247  4.010   1.00 15.00 ? 40 VAL A HG23 5  
ATOM 6294  N N    . ILE A 1 41 ? 3.226   9.657   5.478   1.00 15.00 ? 41 ILE A N    5  
ATOM 6295  C CA   . ILE A 1 41 ? 4.246   10.596  5.955   1.00 15.00 ? 41 ILE A CA   5  
ATOM 6296  C C    . ILE A 1 41 ? 4.339   11.856  5.106   1.00 15.00 ? 41 ILE A C    5  
ATOM 6297  O O    . ILE A 1 41 ? 4.818   11.814  3.973   1.00 15.00 ? 41 ILE A O    5  
ATOM 6298  C CB   . ILE A 1 41 ? 5.640   9.925   6.023   1.00 15.00 ? 41 ILE A CB   5  
ATOM 6299  C CG1  . ILE A 1 41 ? 5.531   8.457   6.458   1.00 15.00 ? 41 ILE A CG1  5  
ATOM 6300  C CG2  . ILE A 1 41 ? 6.564   10.681  6.956   1.00 15.00 ? 41 ILE A CG2  5  
ATOM 6301  C CD1  . ILE A 1 41 ? 4.466   8.199   7.503   1.00 15.00 ? 41 ILE A CD1  5  
ATOM 6302  H H    . ILE A 1 41 ? 3.510   8.861   4.983   1.00 15.00 ? 41 ILE A H    5  
ATOM 6303  H HA   . ILE A 1 41 ? 3.968   10.889  6.943   1.00 15.00 ? 41 ILE A HA   5  
ATOM 6304  H HB   . ILE A 1 41 ? 6.077   9.964   5.038   1.00 15.00 ? 41 ILE A HB   5  
ATOM 6305  H HG12 . ILE A 1 41 ? 5.301   7.848   5.599   1.00 15.00 ? 41 ILE A HG12 5  
ATOM 6306  H HG13 . ILE A 1 41 ? 6.480   8.142   6.869   1.00 15.00 ? 41 ILE A HG13 5  
ATOM 6307  H HG21 . ILE A 1 41 ? 6.164   11.666  7.142   1.00 15.00 ? 41 ILE A HG21 5  
ATOM 6308  H HG22 . ILE A 1 41 ? 6.652   10.142  7.889   1.00 15.00 ? 41 ILE A HG22 5  
ATOM 6309  H HG23 . ILE A 1 41 ? 7.538   10.767  6.495   1.00 15.00 ? 41 ILE A HG23 5  
ATOM 6310  H HD11 . ILE A 1 41 ? 4.881   7.600   8.298   1.00 15.00 ? 41 ILE A HD11 5  
ATOM 6311  H HD12 . ILE A 1 41 ? 4.119   9.139   7.905   1.00 15.00 ? 41 ILE A HD12 5  
ATOM 6312  H HD13 . ILE A 1 41 ? 3.638   7.675   7.047   1.00 15.00 ? 41 ILE A HD13 5  
ATOM 6313  N N    . PRO A 1 42 ? 3.894   13.008  5.657   1.00 15.00 ? 42 PRO A N    5  
ATOM 6314  C CA   . PRO A 1 42 ? 3.936   14.294  4.954   1.00 15.00 ? 42 PRO A CA   5  
ATOM 6315  C C    . PRO A 1 42 ? 5.361   14.774  4.713   1.00 15.00 ? 42 PRO A C    5  
ATOM 6316  O O    . PRO A 1 42 ? 5.784   15.806  5.234   1.00 15.00 ? 42 PRO A O    5  
ATOM 6317  C CB   . PRO A 1 42 ? 3.198   15.250  5.895   1.00 15.00 ? 42 PRO A CB   5  
ATOM 6318  C CG   . PRO A 1 42 ? 3.324   14.630  7.242   1.00 15.00 ? 42 PRO A CG   5  
ATOM 6319  C CD   . PRO A 1 42 ? 3.325   13.145  7.013   1.00 15.00 ? 42 PRO A CD   5  
ATOM 6320  H HA   . PRO A 1 42 ? 3.417   14.241  4.011   1.00 15.00 ? 42 PRO A HA   5  
ATOM 6321  H HB2  . PRO A 1 42 ? 3.665   16.223  5.862   1.00 15.00 ? 42 PRO A HB2  5  
ATOM 6322  H HB3  . PRO A 1 42 ? 2.164   15.330  5.593   1.00 15.00 ? 42 PRO A HB3  5  
ATOM 6323  H HG2  . PRO A 1 42 ? 4.250   14.939  7.704   1.00 15.00 ? 42 PRO A HG2  5  
ATOM 6324  H HG3  . PRO A 1 42 ? 2.483   14.913  7.857   1.00 15.00 ? 42 PRO A HG3  5  
ATOM 6325  H HD2  . PRO A 1 42 ? 3.948   12.652  7.745   1.00 15.00 ? 42 PRO A HD2  5  
ATOM 6326  H HD3  . PRO A 1 42 ? 2.318   12.756  7.049   1.00 15.00 ? 42 PRO A HD3  5  
ATOM 6327  N N    . GLN A 1 43 ? 6.088   14.012  3.911   1.00 15.00 ? 43 GLN A N    5  
ATOM 6328  C CA   . GLN A 1 43 ? 7.466   14.332  3.572   1.00 15.00 ? 43 GLN A CA   5  
ATOM 6329  C C    . GLN A 1 43 ? 7.853   13.609  2.292   1.00 15.00 ? 43 GLN A C    5  
ATOM 6330  O O    . GLN A 1 43 ? 8.437   14.197  1.381   1.00 15.00 ? 43 GLN A O    5  
ATOM 6331  C CB   . GLN A 1 43 ? 8.406   13.929  4.710   1.00 15.00 ? 43 GLN A CB   5  
ATOM 6332  C CG   . GLN A 1 43 ? 8.614   15.024  5.744   1.00 15.00 ? 43 GLN A CG   5  
ATOM 6333  C CD   . GLN A 1 43 ? 9.693   14.676  6.751   1.00 15.00 ? 43 GLN A CD   5  
ATOM 6334  O OE1  . GLN A 1 43 ? 10.673  15.405  6.904   1.00 15.00 ? 43 GLN A OE1  5  
ATOM 6335  N NE2  . GLN A 1 43 ? 9.518   13.557  7.443   1.00 15.00 ? 43 GLN A NE2  5  
ATOM 6336  H H    . GLN A 1 43 ? 5.682   13.207  3.528   1.00 15.00 ? 43 GLN A H    5  
ATOM 6337  H HA   . GLN A 1 43 ? 7.534   15.397  3.411   1.00 15.00 ? 43 GLN A HA   5  
ATOM 6338  H HB2  . GLN A 1 43 ? 7.997   13.064  5.211   1.00 15.00 ? 43 GLN A HB2  5  
ATOM 6339  H HB3  . GLN A 1 43 ? 9.368   13.671  4.292   1.00 15.00 ? 43 GLN A HB3  5  
ATOM 6340  H HG2  . GLN A 1 43 ? 8.897   15.933  5.235   1.00 15.00 ? 43 GLN A HG2  5  
ATOM 6341  H HG3  . GLN A 1 43 ? 7.686   15.182  6.273   1.00 15.00 ? 43 GLN A HG3  5  
ATOM 6342  H HE21 . GLN A 1 43 ? 8.713   13.026  7.269   1.00 15.00 ? 43 GLN A HE21 5  
ATOM 6343  H HE22 . GLN A 1 43 ? 10.201  13.308  8.101   1.00 15.00 ? 43 GLN A HE22 5  
ATOM 6344  N N    . GLY A 1 44 ? 7.507   12.328  2.229   1.00 15.00 ? 44 GLY A N    5  
ATOM 6345  C CA   . GLY A 1 44 ? 7.805   11.537  1.056   1.00 15.00 ? 44 GLY A CA   5  
ATOM 6346  C C    . GLY A 1 44 ? 6.715   11.635  0.006   1.00 15.00 ? 44 GLY A C    5  
ATOM 6347  O O    . GLY A 1 44 ? 5.541   11.857  0.329   1.00 15.00 ? 44 GLY A O    5  
ATOM 6348  H H    . GLY A 1 44 ? 7.034   11.920  2.984   1.00 15.00 ? 44 GLY A H    5  
ATOM 6349  H HA2  . GLY A 1 44 ? 8.733   11.887  0.629   1.00 15.00 ? 44 GLY A HA2  5  
ATOM 6350  H HA3  . GLY A 1 44 ? 7.923   10.506  1.347   1.00 15.00 ? 44 GLY A HA3  5  
ATOM 6351  N N    . ALA A 1 45 ? 7.118   11.467  -1.252  1.00 15.00 ? 45 ALA A N    5  
ATOM 6352  C CA   . ALA A 1 45 ? 6.210   11.539  -2.401  1.00 15.00 ? 45 ALA A CA   5  
ATOM 6353  C C    . ALA A 1 45 ? 4.860   10.867  -2.150  1.00 15.00 ? 45 ALA A C    5  
ATOM 6354  O O    . ALA A 1 45 ? 3.897   11.124  -2.872  1.00 15.00 ? 45 ALA A O    5  
ATOM 6355  C CB   . ALA A 1 45 ? 6.873   10.927  -3.625  1.00 15.00 ? 45 ALA A CB   5  
ATOM 6356  H H    . ALA A 1 45 ? 8.066   11.292  -1.416  1.00 15.00 ? 45 ALA A H    5  
ATOM 6357  H HA   . ALA A 1 45 ? 6.039   12.583  -2.614  1.00 15.00 ? 45 ALA A HA   5  
ATOM 6358  H HB1  . ALA A 1 45 ? 6.600   11.494  -4.503  1.00 15.00 ? 45 ALA A HB1  5  
ATOM 6359  H HB2  . ALA A 1 45 ? 7.946   10.948  -3.503  1.00 15.00 ? 45 ALA A HB2  5  
ATOM 6360  H HB3  . ALA A 1 45 ? 6.543   9.905   -3.740  1.00 15.00 ? 45 ALA A HB3  5  
ATOM 6361  N N    . ALA A 1 46 ? 4.783   10.006  -1.142  1.00 15.00 ? 46 ALA A N    5  
ATOM 6362  C CA   . ALA A 1 46 ? 3.539   9.318   -0.842  1.00 15.00 ? 46 ALA A CA   5  
ATOM 6363  C C    . ALA A 1 46 ? 2.511   10.271  -0.238  1.00 15.00 ? 46 ALA A C    5  
ATOM 6364  O O    . ALA A 1 46 ? 1.531   10.629  -0.895  1.00 15.00 ? 46 ALA A O    5  
ATOM 6365  C CB   . ALA A 1 46 ? 3.792   8.150   0.096   1.00 15.00 ? 46 ALA A CB   5  
ATOM 6366  H H    . ALA A 1 46 ? 5.575   9.822   -0.600  1.00 15.00 ? 46 ALA A H    5  
ATOM 6367  H HA   . ALA A 1 46 ? 3.149   8.923   -1.769  1.00 15.00 ? 46 ALA A HA   5  
ATOM 6368  H HB1  . ALA A 1 46 ? 4.315   7.369   -0.435  1.00 15.00 ? 46 ALA A HB1  5  
ATOM 6369  H HB2  . ALA A 1 46 ? 4.391   8.482   0.931   1.00 15.00 ? 46 ALA A HB2  5  
ATOM 6370  H HB3  . ALA A 1 46 ? 2.849   7.768   0.459   1.00 15.00 ? 46 ALA A HB3  5  
ATOM 6371  N N    . GLU A 1 47 ? 2.733   10.688  1.010   1.00 15.00 ? 47 GLU A N    5  
ATOM 6372  C CA   . GLU A 1 47 ? 1.808   11.610  1.670   1.00 15.00 ? 47 GLU A CA   5  
ATOM 6373  C C    . GLU A 1 47 ? 1.676   12.896  0.863   1.00 15.00 ? 47 GLU A C    5  
ATOM 6374  O O    . GLU A 1 47 ? 0.590   13.468  0.760   1.00 15.00 ? 47 GLU A O    5  
ATOM 6375  C CB   . GLU A 1 47 ? 2.227   11.896  3.123   1.00 15.00 ? 47 GLU A CB   5  
ATOM 6376  C CG   . GLU A 1 47 ? 1.163   12.624  3.942   1.00 15.00 ? 47 GLU A CG   5  
ATOM 6377  C CD   . GLU A 1 47 ? 0.848   14.017  3.424   1.00 15.00 ? 47 GLU A CD   5  
ATOM 6378  O OE1  . GLU A 1 47 ? 1.752   14.663  2.855   1.00 15.00 ? 47 GLU A OE1  5  
ATOM 6379  O OE2  . GLU A 1 47 ? -0.308  14.460  3.588   1.00 15.00 ? 47 GLU A OE2  5  
ATOM 6380  H H    . GLU A 1 47 ? 3.540   10.386  1.483   1.00 15.00 ? 47 GLU A H    5  
ATOM 6381  H HA   . GLU A 1 47 ? 0.840   11.127  1.682   1.00 15.00 ? 47 GLU A HA   5  
ATOM 6382  H HB2  . GLU A 1 47 ? 2.431   10.955  3.609   1.00 15.00 ? 47 GLU A HB2  5  
ATOM 6383  H HB3  . GLU A 1 47 ? 3.125   12.489  3.135   1.00 15.00 ? 47 GLU A HB3  5  
ATOM 6384  H HG2  . GLU A 1 47 ? 0.254   12.043  3.923   1.00 15.00 ? 47 GLU A HG2  5  
ATOM 6385  H HG3  . GLU A 1 47 ? 1.511   12.707  4.961   1.00 15.00 ? 47 GLU A HG3  5  
ATOM 6386  N N    . SER A 1 48 ? 2.790   13.343  0.287   1.00 15.00 ? 48 SER A N    5  
ATOM 6387  C CA   . SER A 1 48 ? 2.800   14.559  -0.519  1.00 15.00 ? 48 SER A CA   5  
ATOM 6388  C C    . SER A 1 48 ? 1.744   14.481  -1.614  1.00 15.00 ? 48 SER A C    5  
ATOM 6389  O O    . SER A 1 48 ? 0.763   15.224  -1.599  1.00 15.00 ? 48 SER A O    5  
ATOM 6390  C CB   . SER A 1 48 ? 4.182   14.775  -1.139  1.00 15.00 ? 48 SER A CB   5  
ATOM 6391  O OG   . SER A 1 48 ? 5.198   14.718  -0.153  1.00 15.00 ? 48 SER A OG   5  
ATOM 6392  H H    . SER A 1 48 ? 3.622   12.840  0.403   1.00 15.00 ? 48 SER A H    5  
ATOM 6393  H HA   . SER A 1 48 ? 2.571   15.391  0.130   1.00 15.00 ? 48 SER A HA   5  
ATOM 6394  H HB2  . SER A 1 48 ? 4.368   14.006  -1.874  1.00 15.00 ? 48 SER A HB2  5  
ATOM 6395  H HB3  . SER A 1 48 ? 4.213   15.743  -1.615  1.00 15.00 ? 48 SER A HB3  5  
ATOM 6396  H HG   . SER A 1 48 ? 4.929   15.229  0.614   1.00 15.00 ? 48 SER A HG   5  
ATOM 6397  N N    . ASP A 1 49 ? 1.944   13.564  -2.555  1.00 15.00 ? 49 ASP A N    5  
ATOM 6398  C CA   . ASP A 1 49 ? 0.997   13.378  -3.646  1.00 15.00 ? 49 ASP A CA   5  
ATOM 6399  C C    . ASP A 1 49 ? -0.348  12.923  -3.094  1.00 15.00 ? 49 ASP A C    5  
ATOM 6400  O O    . ASP A 1 49 ? -1.404  13.330  -3.580  1.00 15.00 ? 49 ASP A O    5  
ATOM 6401  C CB   . ASP A 1 49 ? 1.528   12.351  -4.647  1.00 15.00 ? 49 ASP A CB   5  
ATOM 6402  C CG   . ASP A 1 49 ? 1.182   12.709  -6.079  1.00 15.00 ? 49 ASP A CG   5  
ATOM 6403  O OD1  . ASP A 1 49 ? 0.032   13.130  -6.324  1.00 15.00 ? 49 ASP A OD1  5  
ATOM 6404  O OD2  . ASP A 1 49 ? 2.060   12.567  -6.956  1.00 15.00 ? 49 ASP A OD2  5  
ATOM 6405  H H    . ASP A 1 49 ? 2.738   12.993  -2.508  1.00 15.00 ? 49 ASP A H    5  
ATOM 6406  H HA   . ASP A 1 49 ? 0.870   14.326  -4.145  1.00 15.00 ? 49 ASP A HA   5  
ATOM 6407  H HB2  . ASP A 1 49 ? 2.603   12.294  -4.560  1.00 15.00 ? 49 ASP A HB2  5  
ATOM 6408  H HB3  . ASP A 1 49 ? 1.101   11.384  -4.423  1.00 15.00 ? 49 ASP A HB3  5  
ATOM 6409  N N    . GLY A 1 50 ? -0.296  12.079  -2.068  1.00 15.00 ? 50 GLY A N    5  
ATOM 6410  C CA   . GLY A 1 50 ? -1.509  11.581  -1.451  1.00 15.00 ? 50 GLY A CA   5  
ATOM 6411  C C    . GLY A 1 50 ? -2.115  10.423  -2.215  1.00 15.00 ? 50 GLY A C    5  
ATOM 6412  O O    . GLY A 1 50 ? -3.329  10.372  -2.414  1.00 15.00 ? 50 GLY A O    5  
ATOM 6413  H H    . GLY A 1 50 ? 0.577   11.797  -1.724  1.00 15.00 ? 50 GLY A H    5  
ATOM 6414  H HA2  . GLY A 1 50 ? -1.279  11.254  -0.447  1.00 15.00 ? 50 GLY A HA2  5  
ATOM 6415  H HA3  . GLY A 1 50 ? -2.231  12.382  -1.400  1.00 15.00 ? 50 GLY A HA3  5  
ATOM 6416  N N    . ARG A 1 51 ? -1.273  9.489   -2.644  1.00 15.00 ? 51 ARG A N    5  
ATOM 6417  C CA   . ARG A 1 51 ? -1.750  8.330   -3.389  1.00 15.00 ? 51 ARG A CA   5  
ATOM 6418  C C    . ARG A 1 51 ? -2.324  7.280   -2.444  1.00 15.00 ? 51 ARG A C    5  
ATOM 6419  O O    . ARG A 1 51 ? -3.449  6.814   -2.629  1.00 15.00 ? 51 ARG A O    5  
ATOM 6420  C CB   . ARG A 1 51 ? -0.623  7.721   -4.230  1.00 15.00 ? 51 ARG A CB   5  
ATOM 6421  C CG   . ARG A 1 51 ? -0.635  8.165   -5.684  1.00 15.00 ? 51 ARG A CG   5  
ATOM 6422  C CD   . ARG A 1 51 ? -1.992  7.938   -6.332  1.00 15.00 ? 51 ARG A CD   5  
ATOM 6423  N NE   . ARG A 1 51 ? -2.595  9.192   -6.781  1.00 15.00 ? 51 ARG A NE   5  
ATOM 6424  C CZ   . ARG A 1 51 ? -3.907  9.410   -6.838  1.00 15.00 ? 51 ARG A CZ   5  
ATOM 6425  N NH1  . ARG A 1 51 ? -4.765  8.460   -6.488  1.00 15.00 ? 51 ARG A NH1  5  
ATOM 6426  N NH2  . ARG A 1 51 ? -4.364  10.585  -7.250  1.00 15.00 ? 51 ARG A NH2  5  
ATOM 6427  H H    . ARG A 1 51 ? -0.314  9.581   -2.454  1.00 15.00 ? 51 ARG A H    5  
ATOM 6428  H HA   . ARG A 1 51 ? -2.535  8.667   -4.048  1.00 15.00 ? 51 ARG A HA   5  
ATOM 6429  H HB2  . ARG A 1 51 ? 0.328   7.998   -3.801  1.00 15.00 ? 51 ARG A HB2  5  
ATOM 6430  H HB3  . ARG A 1 51 ? -0.717  6.647   -4.204  1.00 15.00 ? 51 ARG A HB3  5  
ATOM 6431  H HG2  . ARG A 1 51 ? -0.401  9.218   -5.729  1.00 15.00 ? 51 ARG A HG2  5  
ATOM 6432  H HG3  . ARG A 1 51 ? 0.112   7.605   -6.227  1.00 15.00 ? 51 ARG A HG3  5  
ATOM 6433  H HD2  . ARG A 1 51 ? -1.865  7.285   -7.183  1.00 15.00 ? 51 ARG A HD2  5  
ATOM 6434  H HD3  . ARG A 1 51 ? -2.646  7.469   -5.613  1.00 15.00 ? 51 ARG A HD3  5  
ATOM 6435  H HE   . ARG A 1 51 ? -1.988  9.912   -7.051  1.00 15.00 ? 51 ARG A HE   5  
ATOM 6436  H HH11 . ARG A 1 51 ? -4.430  7.570   -6.179  1.00 15.00 ? 51 ARG A HH11 5  
ATOM 6437  H HH12 . ARG A 1 51 ? -5.748  8.634   -6.533  1.00 15.00 ? 51 ARG A HH12 5  
ATOM 6438  H HH21 . ARG A 1 51 ? -3.723  11.305  -7.516  1.00 15.00 ? 51 ARG A HH21 5  
ATOM 6439  H HH22 . ARG A 1 51 ? -5.349  10.752  -7.293  1.00 15.00 ? 51 ARG A HH22 5  
ATOM 6440  N N    . ILE A 1 52 ? -1.549  6.914   -1.429  1.00 15.00 ? 52 ILE A N    5  
ATOM 6441  C CA   . ILE A 1 52 ? -1.987  5.923   -0.454  1.00 15.00 ? 52 ILE A CA   5  
ATOM 6442  C C    . ILE A 1 52 ? -2.685  6.586   0.729   1.00 15.00 ? 52 ILE A C    5  
ATOM 6443  O O    . ILE A 1 52 ? -2.557  7.791   0.946   1.00 15.00 ? 52 ILE A O    5  
ATOM 6444  C CB   . ILE A 1 52 ? -0.805  5.086   0.078   1.00 15.00 ? 52 ILE A CB   5  
ATOM 6445  C CG1  . ILE A 1 52 ? -0.007  4.481   -1.083  1.00 15.00 ? 52 ILE A CG1  5  
ATOM 6446  C CG2  . ILE A 1 52 ? -1.310  3.993   1.013   1.00 15.00 ? 52 ILE A CG2  5  
ATOM 6447  C CD1  . ILE A 1 52 ? -0.245  2.998   -1.276  1.00 15.00 ? 52 ILE A CD1  5  
ATOM 6448  H H    . ILE A 1 52 ? -0.663  7.323   -1.331  1.00 15.00 ? 52 ILE A H    5  
ATOM 6449  H HA   . ILE A 1 52 ? -2.681  5.255   -0.945  1.00 15.00 ? 52 ILE A HA   5  
ATOM 6450  H HB   . ILE A 1 52 ? -0.160  5.739   0.647   1.00 15.00 ? 52 ILE A HB   5  
ATOM 6451  H HG12 . ILE A 1 52 ? -0.282  4.982   -1.999  1.00 15.00 ? 52 ILE A HG12 5  
ATOM 6452  H HG13 . ILE A 1 52 ? 1.047   4.628   -0.901  1.00 15.00 ? 52 ILE A HG13 5  
ATOM 6453  H HG21 . ILE A 1 52 ? -2.175  3.517   0.573   1.00 15.00 ? 52 ILE A HG21 5  
ATOM 6454  H HG22 . ILE A 1 52 ? -0.534  3.259   1.158   1.00 15.00 ? 52 ILE A HG22 5  
ATOM 6455  H HG23 . ILE A 1 52 ? -1.583  4.426   1.963   1.00 15.00 ? 52 ILE A HG23 5  
ATOM 6456  H HD11 . ILE A 1 52 ? 0.366   2.636   -2.089  1.00 15.00 ? 52 ILE A HD11 5  
ATOM 6457  H HD12 . ILE A 1 52 ? 0.011   2.470   -0.367  1.00 15.00 ? 52 ILE A HD12 5  
ATOM 6458  H HD13 . ILE A 1 52 ? -1.285  2.833   -1.504  1.00 15.00 ? 52 ILE A HD13 5  
ATOM 6459  N N    . HIS A 1 53 ? -3.416  5.784   1.495   1.00 15.00 ? 53 HIS A N    5  
ATOM 6460  C CA   . HIS A 1 53 ? -4.128  6.274   2.663   1.00 15.00 ? 53 HIS A CA   5  
ATOM 6461  C C    . HIS A 1 53 ? -4.017  5.287   3.803   1.00 15.00 ? 53 HIS A C    5  
ATOM 6462  O O    . HIS A 1 53 ? -3.817  4.090   3.597   1.00 15.00 ? 53 HIS A O    5  
ATOM 6463  C CB   . HIS A 1 53 ? -5.597  6.540   2.329   1.00 15.00 ? 53 HIS A CB   5  
ATOM 6464  C CG   . HIS A 1 53 ? -5.789  7.446   1.153   1.00 15.00 ? 53 HIS A CG   5  
ATOM 6465  N ND1  . HIS A 1 53 ? -5.710  7.012   -0.153  1.00 15.00 ? 53 HIS A ND1  5  
ATOM 6466  C CD2  . HIS A 1 53 ? -6.059  8.772   1.091   1.00 15.00 ? 53 HIS A CD2  5  
ATOM 6467  C CE1  . HIS A 1 53 ? -5.922  8.031   -0.967  1.00 15.00 ? 53 HIS A CE1  5  
ATOM 6468  N NE2  . HIS A 1 53 ? -6.137  9.110   -0.237  1.00 15.00 ? 53 HIS A NE2  5  
ATOM 6469  H H    . HIS A 1 53 ? -3.474  4.835   1.271   1.00 15.00 ? 53 HIS A H    5  
ATOM 6470  H HA   . HIS A 1 53 ? -3.663  7.193   2.982   1.00 15.00 ? 53 HIS A HA   5  
ATOM 6471  H HB2  . HIS A 1 53 ? -6.084  5.602   2.107   1.00 15.00 ? 53 HIS A HB2  5  
ATOM 6472  H HB3  . HIS A 1 53 ? -6.076  6.995   3.183   1.00 15.00 ? 53 HIS A HB3  5  
ATOM 6473  H HD1  . HIS A 1 53 ? -5.526  6.094   -0.441  1.00 15.00 ? 53 HIS A HD1  5  
ATOM 6474  H HD2  . HIS A 1 53 ? -6.189  9.440   1.932   1.00 15.00 ? 53 HIS A HD2  5  
ATOM 6475  H HE1  . HIS A 1 53 ? -5.922  7.989   -2.047  1.00 15.00 ? 53 HIS A HE1  5  
ATOM 6476  H HE2  . HIS A 1 53 ? -6.224  10.021  -0.588  1.00 15.00 ? 53 HIS A HE2  5  
ATOM 6477  N N    . LYS A 1 54 ? -4.118  5.820   5.008   1.00 15.00 ? 54 LYS A N    5  
ATOM 6478  C CA   . LYS A 1 54 ? -4.004  5.038   6.225   1.00 15.00 ? 54 LYS A CA   5  
ATOM 6479  C C    . LYS A 1 54 ? -4.601  3.634   6.074   1.00 15.00 ? 54 LYS A C    5  
ATOM 6480  O O    . LYS A 1 54 ? -5.712  3.469   5.571   1.00 15.00 ? 54 LYS A O    5  
ATOM 6481  C CB   . LYS A 1 54 ? -4.685  5.780   7.377   1.00 15.00 ? 54 LYS A CB   5  
ATOM 6482  C CG   . LYS A 1 54 ? -3.732  6.188   8.484   1.00 15.00 ? 54 LYS A CG   5  
ATOM 6483  C CD   . LYS A 1 54 ? -4.333  5.944   9.859   1.00 15.00 ? 54 LYS A CD   5  
ATOM 6484  C CE   . LYS A 1 54 ? -4.478  4.460   10.148  1.00 15.00 ? 54 LYS A CE   5  
ATOM 6485  N NZ   . LYS A 1 54 ? -4.581  4.186   11.608  1.00 15.00 ? 54 LYS A NZ   5  
ATOM 6486  H H    . LYS A 1 54 ? -4.251  6.784   5.082   1.00 15.00 ? 54 LYS A H    5  
ATOM 6487  H HA   . LYS A 1 54 ? -2.952  4.955   6.439   1.00 15.00 ? 54 LYS A HA   5  
ATOM 6488  H HB2  . LYS A 1 54 ? -5.149  6.674   6.986   1.00 15.00 ? 54 LYS A HB2  5  
ATOM 6489  H HB3  . LYS A 1 54 ? -5.448  5.145   7.801   1.00 15.00 ? 54 LYS A HB3  5  
ATOM 6490  H HG2  . LYS A 1 54 ? -2.826  5.612   8.392   1.00 15.00 ? 54 LYS A HG2  5  
ATOM 6491  H HG3  . LYS A 1 54 ? -3.504  7.239   8.381   1.00 15.00 ? 54 LYS A HG3  5  
ATOM 6492  H HD2  . LYS A 1 54 ? -3.691  6.385   10.606  1.00 15.00 ? 54 LYS A HD2  5  
ATOM 6493  H HD3  . LYS A 1 54 ? -5.308  6.407   9.902   1.00 15.00 ? 54 LYS A HD3  5  
ATOM 6494  H HE2  . LYS A 1 54 ? -5.370  4.096   9.660   1.00 15.00 ? 54 LYS A HE2  5  
ATOM 6495  H HE3  . LYS A 1 54 ? -3.616  3.943   9.753   1.00 15.00 ? 54 LYS A HE3  5  
ATOM 6496  H HZ1  . LYS A 1 54 ? -3.637  4.010   12.007  1.00 15.00 ? 54 LYS A HZ1  5  
ATOM 6497  H HZ2  . LYS A 1 54 ? -5.003  5.002   12.096  1.00 15.00 ? 54 LYS A HZ2  5  
ATOM 6498  H HZ3  . LYS A 1 54 ? -5.176  3.350   11.775  1.00 15.00 ? 54 LYS A HZ3  5  
ATOM 6499  N N    . GLY A 1 55 ? -3.849  2.631   6.523   1.00 15.00 ? 55 GLY A N    5  
ATOM 6500  C CA   . GLY A 1 55 ? -4.303  1.250   6.446   1.00 15.00 ? 55 GLY A CA   5  
ATOM 6501  C C    . GLY A 1 55 ? -4.760  0.826   5.061   1.00 15.00 ? 55 GLY A C    5  
ATOM 6502  O O    . GLY A 1 55 ? -5.693  0.033   4.937   1.00 15.00 ? 55 GLY A O    5  
ATOM 6503  H H    . GLY A 1 55 ? -2.974  2.831   6.922   1.00 15.00 ? 55 GLY A H    5  
ATOM 6504  H HA2  . GLY A 1 55 ? -3.496  0.601   6.749   1.00 15.00 ? 55 GLY A HA2  5  
ATOM 6505  H HA3  . GLY A 1 55 ? -5.125  1.119   7.135   1.00 15.00 ? 55 GLY A HA3  5  
ATOM 6506  N N    . ASP A 1 56 ? -4.108  1.329   4.013   1.00 15.00 ? 56 ASP A N    5  
ATOM 6507  C CA   . ASP A 1 56 ? -4.483  0.951   2.655   1.00 15.00 ? 56 ASP A CA   5  
ATOM 6508  C C    . ASP A 1 56 ? -4.194  -0.528  2.411   1.00 15.00 ? 56 ASP A C    5  
ATOM 6509  O O    . ASP A 1 56 ? -3.094  -1.006  2.699   1.00 15.00 ? 56 ASP A O    5  
ATOM 6510  C CB   . ASP A 1 56 ? -3.748  1.813   1.628   1.00 15.00 ? 56 ASP A CB   5  
ATOM 6511  C CG   . ASP A 1 56 ? -4.700  2.501   0.672   1.00 15.00 ? 56 ASP A CG   5  
ATOM 6512  O OD1  . ASP A 1 56 ? -5.584  1.816   0.116   1.00 15.00 ? 56 ASP A OD1  5  
ATOM 6513  O OD2  . ASP A 1 56 ? -4.564  3.728   0.481   1.00 15.00 ? 56 ASP A OD2  5  
ATOM 6514  H H    . ASP A 1 56 ? -3.355  1.948   4.152   1.00 15.00 ? 56 ASP A H    5  
ATOM 6515  H HA   . ASP A 1 56 ? -5.547  1.114   2.551   1.00 15.00 ? 56 ASP A HA   5  
ATOM 6516  H HB2  . ASP A 1 56 ? -3.180  2.570   2.142   1.00 15.00 ? 56 ASP A HB2  5  
ATOM 6517  H HB3  . ASP A 1 56 ? -3.078  1.190   1.054   1.00 15.00 ? 56 ASP A HB3  5  
ATOM 6518  N N    . ARG A 1 57 ? -5.182  -1.246  1.880   1.00 15.00 ? 57 ARG A N    5  
ATOM 6519  C CA   . ARG A 1 57 ? -5.029  -2.670  1.593   1.00 15.00 ? 57 ARG A CA   5  
ATOM 6520  C C    . ARG A 1 57 ? -4.308  -2.875  0.264   1.00 15.00 ? 57 ARG A C    5  
ATOM 6521  O O    . ARG A 1 57 ? -4.941  -2.924  -0.790  1.00 15.00 ? 57 ARG A O    5  
ATOM 6522  C CB   . ARG A 1 57 ? -6.399  -3.353  1.541   1.00 15.00 ? 57 ARG A CB   5  
ATOM 6523  C CG   . ARG A 1 57 ? -7.116  -3.397  2.879   1.00 15.00 ? 57 ARG A CG   5  
ATOM 6524  C CD   . ARG A 1 57 ? -8.617  -3.220  2.711   1.00 15.00 ? 57 ARG A CD   5  
ATOM 6525  N NE   . ARG A 1 57 ? -9.323  -3.268  3.990   1.00 15.00 ? 57 ARG A NE   5  
ATOM 6526  C CZ   . ARG A 1 57 ? -9.708  -4.396  4.584   1.00 15.00 ? 57 ARG A CZ   5  
ATOM 6527  N NH1  . ARG A 1 57 ? -9.450  -5.572  4.025   1.00 15.00 ? 57 ARG A NH1  5  
ATOM 6528  N NH2  . ARG A 1 57 ? -10.350 -4.348  5.743   1.00 15.00 ? 57 ARG A NH2  5  
ATOM 6529  H H    . ARG A 1 57 ? -6.034  -0.808  1.674   1.00 15.00 ? 57 ARG A H    5  
ATOM 6530  H HA   . ARG A 1 57 ? -4.443  -3.111  2.384   1.00 15.00 ? 57 ARG A HA   5  
ATOM 6531  H HB2  . ARG A 1 57 ? -7.025  -2.822  0.841   1.00 15.00 ? 57 ARG A HB2  5  
ATOM 6532  H HB3  . ARG A 1 57 ? -6.268  -4.367  1.195   1.00 15.00 ? 57 ARG A HB3  5  
ATOM 6533  H HG2  . ARG A 1 57 ? -6.928  -4.352  3.343   1.00 15.00 ? 57 ARG A HG2  5  
ATOM 6534  H HG3  . ARG A 1 57 ? -6.736  -2.605  3.509   1.00 15.00 ? 57 ARG A HG3  5  
ATOM 6535  H HD2  . ARG A 1 57 ? -8.803  -2.265  2.244   1.00 15.00 ? 57 ARG A HD2  5  
ATOM 6536  H HD3  . ARG A 1 57 ? -8.990  -4.008  2.074   1.00 15.00 ? 57 ARG A HD3  5  
ATOM 6537  H HE   . ARG A 1 57 ? -9.524  -2.415  4.428   1.00 15.00 ? 57 ARG A HE   5  
ATOM 6538  H HH11 . ARG A 1 57 ? -8.964  -5.616  3.152   1.00 15.00 ? 57 ARG A HH11 5  
ATOM 6539  H HH12 . ARG A 1 57 ? -9.742  -6.414  4.477   1.00 15.00 ? 57 ARG A HH12 5  
ATOM 6540  H HH21 . ARG A 1 57 ? -10.546 -3.466  6.171   1.00 15.00 ? 57 ARG A HH21 5  
ATOM 6541  H HH22 . ARG A 1 57 ? -10.640 -5.195  6.190   1.00 15.00 ? 57 ARG A HH22 5  
ATOM 6542  N N    . VAL A 1 58 ? -2.985  -2.989  0.315   1.00 15.00 ? 58 VAL A N    5  
ATOM 6543  C CA   . VAL A 1 58 ? -2.196  -3.180  -0.897  1.00 15.00 ? 58 VAL A CA   5  
ATOM 6544  C C    . VAL A 1 58 ? -2.107  -4.658  -1.277  1.00 15.00 ? 58 VAL A C    5  
ATOM 6545  O O    . VAL A 1 58 ? -1.561  -5.478  -0.532  1.00 15.00 ? 58 VAL A O    5  
ATOM 6546  C CB   . VAL A 1 58 ? -0.779  -2.568  -0.763  1.00 15.00 ? 58 VAL A CB   5  
ATOM 6547  C CG1  . VAL A 1 58 ? -0.820  -1.297  0.074   1.00 15.00 ? 58 VAL A CG1  5  
ATOM 6548  C CG2  . VAL A 1 58 ? 0.213   -3.563  -0.175  1.00 15.00 ? 58 VAL A CG2  5  
ATOM 6549  H H    . VAL A 1 58 ? -2.530  -2.938  1.182   1.00 15.00 ? 58 VAL A H    5  
ATOM 6550  H HA   . VAL A 1 58 ? -2.706  -2.661  -1.695  1.00 15.00 ? 58 VAL A HA   5  
ATOM 6551  H HB   . VAL A 1 58 ? -0.440  -2.299  -1.751  1.00 15.00 ? 58 VAL A HB   5  
ATOM 6552  H HG11 . VAL A 1 58 ? -1.515  -0.598  -0.366  1.00 15.00 ? 58 VAL A HG11 5  
ATOM 6553  H HG12 . VAL A 1 58 ? -1.138  -1.538  1.078   1.00 15.00 ? 58 VAL A HG12 5  
ATOM 6554  H HG13 . VAL A 1 58 ? 0.165   -0.855  0.105   1.00 15.00 ? 58 VAL A HG13 5  
ATOM 6555  H HG21 . VAL A 1 58 ? 1.054   -3.029  0.241   1.00 15.00 ? 58 VAL A HG21 5  
ATOM 6556  H HG22 . VAL A 1 58 ? -0.270  -4.137  0.601   1.00 15.00 ? 58 VAL A HG22 5  
ATOM 6557  H HG23 . VAL A 1 58 ? 0.558   -4.228  -0.952  1.00 15.00 ? 58 VAL A HG23 5  
ATOM 6558  N N    . LEU A 1 59 ? -2.668  -4.988  -2.439  1.00 15.00 ? 59 LEU A N    5  
ATOM 6559  C CA   . LEU A 1 59 ? -2.670  -6.362  -2.931  1.00 15.00 ? 59 LEU A CA   5  
ATOM 6560  C C    . LEU A 1 59 ? -1.703  -6.560  -4.102  1.00 15.00 ? 59 LEU A C    5  
ATOM 6561  O O    . LEU A 1 59 ? -1.457  -7.691  -4.520  1.00 15.00 ? 59 LEU A O    5  
ATOM 6562  C CB   . LEU A 1 59 ? -4.083  -6.769  -3.354  1.00 15.00 ? 59 LEU A CB   5  
ATOM 6563  C CG   . LEU A 1 59 ? -5.014  -7.166  -2.207  1.00 15.00 ? 59 LEU A CG   5  
ATOM 6564  C CD1  . LEU A 1 59 ? -4.542  -8.460  -1.562  1.00 15.00 ? 59 LEU A CD1  5  
ATOM 6565  C CD2  . LEU A 1 59 ? -5.092  -6.051  -1.176  1.00 15.00 ? 59 LEU A CD2  5  
ATOM 6566  H H    . LEU A 1 59 ? -3.097  -4.287  -2.977  1.00 15.00 ? 59 LEU A H    5  
ATOM 6567  H HA   . LEU A 1 59 ? -2.358  -7.000  -2.118  1.00 15.00 ? 59 LEU A HA   5  
ATOM 6568  H HB2  . LEU A 1 59 ? -4.530  -5.940  -3.883  1.00 15.00 ? 59 LEU A HB2  5  
ATOM 6569  H HB3  . LEU A 1 59 ? -4.006  -7.607  -4.031  1.00 15.00 ? 59 LEU A HB3  5  
ATOM 6570  H HG   . LEU A 1 59 ? -6.007  -7.331  -2.599  1.00 15.00 ? 59 LEU A HG   5  
ATOM 6571  H HD11 . LEU A 1 59 ? -4.113  -9.103  -2.316  1.00 15.00 ? 59 LEU A HD11 5  
ATOM 6572  H HD12 . LEU A 1 59 ? -3.798  -8.238  -0.812  1.00 15.00 ? 59 LEU A HD12 5  
ATOM 6573  H HD13 . LEU A 1 59 ? -5.381  -8.959  -1.100  1.00 15.00 ? 59 LEU A HD13 5  
ATOM 6574  H HD21 . LEU A 1 59 ? -4.349  -6.217  -0.409  1.00 15.00 ? 59 LEU A HD21 5  
ATOM 6575  H HD22 . LEU A 1 59 ? -4.907  -5.102  -1.657  1.00 15.00 ? 59 LEU A HD22 5  
ATOM 6576  H HD23 . LEU A 1 59 ? -6.075  -6.043  -0.729  1.00 15.00 ? 59 LEU A HD23 5  
ATOM 6577  N N    . ALA A 1 60 ? -1.174  -5.466  -4.649  1.00 15.00 ? 60 ALA A N    5  
ATOM 6578  C CA   . ALA A 1 60 ? -0.259  -5.559  -5.786  1.00 15.00 ? 60 ALA A CA   5  
ATOM 6579  C C    . ALA A 1 60 ? 0.727   -4.392  -5.834  1.00 15.00 ? 60 ALA A C    5  
ATOM 6580  O O    . ALA A 1 60 ? 0.388   -3.259  -5.495  1.00 15.00 ? 60 ALA A O    5  
ATOM 6581  C CB   . ALA A 1 60 ? -1.053  -5.627  -7.083  1.00 15.00 ? 60 ALA A CB   5  
ATOM 6582  H H    . ALA A 1 60 ? -1.412  -4.586  -4.295  1.00 15.00 ? 60 ALA A H    5  
ATOM 6583  H HA   . ALA A 1 60 ? 0.297   -6.479  -5.696  1.00 15.00 ? 60 ALA A HA   5  
ATOM 6584  H HB1  . ALA A 1 60 ? -1.115  -6.654  -7.412  1.00 15.00 ? 60 ALA A HB1  5  
ATOM 6585  H HB2  . ALA A 1 60 ? -2.048  -5.242  -6.916  1.00 15.00 ? 60 ALA A HB2  5  
ATOM 6586  H HB3  . ALA A 1 60 ? -0.560  -5.035  -7.840  1.00 15.00 ? 60 ALA A HB3  5  
ATOM 6587  N N    . VAL A 1 61 ? 1.945   -4.687  -6.283  1.00 15.00 ? 61 VAL A N    5  
ATOM 6588  C CA   . VAL A 1 61 ? 2.998   -3.684  -6.413  1.00 15.00 ? 61 VAL A CA   5  
ATOM 6589  C C    . VAL A 1 61 ? 3.755   -3.917  -7.710  1.00 15.00 ? 61 VAL A C    5  
ATOM 6590  O O    . VAL A 1 61 ? 4.581   -4.826  -7.802  1.00 15.00 ? 61 VAL A O    5  
ATOM 6591  C CB   . VAL A 1 61 ? 3.995   -3.725  -5.237  1.00 15.00 ? 61 VAL A CB   5  
ATOM 6592  C CG1  . VAL A 1 61 ? 5.048   -2.639  -5.392  1.00 15.00 ? 61 VAL A CG1  5  
ATOM 6593  C CG2  . VAL A 1 61 ? 3.269   -3.584  -3.909  1.00 15.00 ? 61 VAL A CG2  5  
ATOM 6594  H H    . VAL A 1 61 ? 2.139   -5.611  -6.552  1.00 15.00 ? 61 VAL A H    5  
ATOM 6595  H HA   . VAL A 1 61 ? 2.538   -2.707  -6.445  1.00 15.00 ? 61 VAL A HA   5  
ATOM 6596  H HB   . VAL A 1 61 ? 4.496   -4.680  -5.248  1.00 15.00 ? 61 VAL A HB   5  
ATOM 6597  H HG11 . VAL A 1 61 ? 4.619   -1.792  -5.907  1.00 15.00 ? 61 VAL A HG11 5  
ATOM 6598  H HG12 . VAL A 1 61 ? 5.392   -2.331  -4.418  1.00 15.00 ? 61 VAL A HG12 5  
ATOM 6599  H HG13 . VAL A 1 61 ? 5.880   -3.023  -5.963  1.00 15.00 ? 61 VAL A HG13 5  
ATOM 6600  H HG21 . VAL A 1 61 ? 3.263   -2.546  -3.613  1.00 15.00 ? 61 VAL A HG21 5  
ATOM 6601  H HG22 . VAL A 1 61 ? 2.254   -3.934  -4.013  1.00 15.00 ? 61 VAL A HG22 5  
ATOM 6602  H HG23 . VAL A 1 61 ? 3.777   -4.170  -3.158  1.00 15.00 ? 61 VAL A HG23 5  
ATOM 6603  N N    . ASN A 1 62 ? 3.445   -3.117  -8.723  1.00 15.00 ? 62 ASN A N    5  
ATOM 6604  C CA   . ASN A 1 62 ? 4.076   -3.268  -10.025 1.00 15.00 ? 62 ASN A CA   5  
ATOM 6605  C C    . ASN A 1 62 ? 3.686   -4.612  -10.640 1.00 15.00 ? 62 ASN A C    5  
ATOM 6606  O O    . ASN A 1 62 ? 4.312   -5.080  -11.591 1.00 15.00 ? 62 ASN A O    5  
ATOM 6607  C CB   . ASN A 1 62 ? 5.598   -3.155  -9.906  1.00 15.00 ? 62 ASN A CB   5  
ATOM 6608  C CG   . ASN A 1 62 ? 6.082   -1.725  -10.051 1.00 15.00 ? 62 ASN A CG   5  
ATOM 6609  O OD1  . ASN A 1 62 ? 7.100   -1.463  -10.691 1.00 15.00 ? 62 ASN A OD1  5  
ATOM 6610  N ND2  . ASN A 1 62 ? 5.350   -0.789  -9.454  1.00 15.00 ? 62 ASN A ND2  5  
ATOM 6611  H H    . ASN A 1 62 ? 2.761   -2.425  -8.599  1.00 15.00 ? 62 ASN A H    5  
ATOM 6612  H HA   . ASN A 1 62 ? 3.712   -2.476  -10.663 1.00 15.00 ? 62 ASN A HA   5  
ATOM 6613  H HB2  . ASN A 1 62 ? 5.907   -3.523  -8.940  1.00 15.00 ? 62 ASN A HB2  5  
ATOM 6614  H HB3  . ASN A 1 62 ? 6.060   -3.752  -10.679 1.00 15.00 ? 62 ASN A HB3  5  
ATOM 6615  H HD21 . ASN A 1 62 ? 4.552   -1.070  -8.960  1.00 15.00 ? 62 ASN A HD21 5  
ATOM 6616  H HD22 . ASN A 1 62 ? 5.639   0.145   -9.532  1.00 15.00 ? 62 ASN A HD22 5  
ATOM 6617  N N    . GLY A 1 63 ? 2.634   -5.224  -10.088 1.00 15.00 ? 63 GLY A N    5  
ATOM 6618  C CA   . GLY A 1 63 ? 2.157   -6.501  -10.585 1.00 15.00 ? 63 GLY A CA   5  
ATOM 6619  C C    . GLY A 1 63 ? 2.476   -7.664  -9.662  1.00 15.00 ? 63 GLY A C    5  
ATOM 6620  O O    . GLY A 1 63 ? 2.198   -8.815  -9.996  1.00 15.00 ? 63 GLY A O    5  
ATOM 6621  H H    . GLY A 1 63 ? 2.172   -4.797  -9.338  1.00 15.00 ? 63 GLY A H    5  
ATOM 6622  H HA2  . GLY A 1 63 ? 1.085   -6.443  -10.698 1.00 15.00 ? 63 GLY A HA2  5  
ATOM 6623  H HA3  . GLY A 1 63 ? 2.602   -6.688  -11.551 1.00 15.00 ? 63 GLY A HA3  5  
ATOM 6624  N N    . VAL A 1 64 ? 3.048   -7.373  -8.496  1.00 15.00 ? 64 VAL A N    5  
ATOM 6625  C CA   . VAL A 1 64 ? 3.383   -8.421  -7.538  1.00 15.00 ? 64 VAL A CA   5  
ATOM 6626  C C    . VAL A 1 64 ? 2.256   -8.611  -6.523  1.00 15.00 ? 64 VAL A C    5  
ATOM 6627  O O    . VAL A 1 64 ? 2.042   -7.771  -5.649  1.00 15.00 ? 64 VAL A O    5  
ATOM 6628  C CB   . VAL A 1 64 ? 4.712   -8.123  -6.806  1.00 15.00 ? 64 VAL A CB   5  
ATOM 6629  C CG1  . VAL A 1 64 ? 4.534   -7.053  -5.741  1.00 15.00 ? 64 VAL A CG1  5  
ATOM 6630  C CG2  . VAL A 1 64 ? 5.283   -9.396  -6.201  1.00 15.00 ? 64 VAL A CG2  5  
ATOM 6631  H H    . VAL A 1 64 ? 3.243   -6.439  -8.274  1.00 15.00 ? 64 VAL A H    5  
ATOM 6632  H HA   . VAL A 1 64 ? 3.504   -9.342  -8.092  1.00 15.00 ? 64 VAL A HA   5  
ATOM 6633  H HB   . VAL A 1 64 ? 5.417   -7.751  -7.532  1.00 15.00 ? 64 VAL A HB   5  
ATOM 6634  H HG11 . VAL A 1 64 ? 3.865   -6.291  -6.108  1.00 15.00 ? 64 VAL A HG11 5  
ATOM 6635  H HG12 . VAL A 1 64 ? 4.119   -7.499  -4.850  1.00 15.00 ? 64 VAL A HG12 5  
ATOM 6636  H HG13 . VAL A 1 64 ? 5.492   -6.611  -5.511  1.00 15.00 ? 64 VAL A HG13 5  
ATOM 6637  H HG21 . VAL A 1 64 ? 5.068   -9.420  -5.143  1.00 15.00 ? 64 VAL A HG21 5  
ATOM 6638  H HG22 . VAL A 1 64 ? 4.835   -10.255 -6.679  1.00 15.00 ? 64 VAL A HG22 5  
ATOM 6639  H HG23 . VAL A 1 64 ? 6.353   -9.418  -6.351  1.00 15.00 ? 64 VAL A HG23 5  
ATOM 6640  N N    . SER A 1 65 ? 1.531   -9.716  -6.649  1.00 15.00 ? 65 SER A N    5  
ATOM 6641  C CA   . SER A 1 65 ? 0.423   -10.008 -5.746  1.00 15.00 ? 65 SER A CA   5  
ATOM 6642  C C    . SER A 1 65 ? 0.888   -10.026 -4.294  1.00 15.00 ? 65 SER A C    5  
ATOM 6643  O O    . SER A 1 65 ? 1.881   -10.671 -3.956  1.00 15.00 ? 65 SER A O    5  
ATOM 6644  C CB   . SER A 1 65 ? -0.217  -11.350 -6.106  1.00 15.00 ? 65 SER A CB   5  
ATOM 6645  O OG   . SER A 1 65 ? -1.230  -11.187 -7.083  1.00 15.00 ? 65 SER A OG   5  
ATOM 6646  H H    . SER A 1 65 ? 1.742   -10.348 -7.368  1.00 15.00 ? 65 SER A H    5  
ATOM 6647  H HA   . SER A 1 65 ? -0.314  -9.225  -5.865  1.00 15.00 ? 65 SER A HA   5  
ATOM 6648  H HB2  . SER A 1 65 ? 0.539   -12.014 -6.497  1.00 15.00 ? 65 SER A HB2  5  
ATOM 6649  H HB3  . SER A 1 65 ? -0.655  -11.786 -5.220  1.00 15.00 ? 65 SER A HB3  5  
ATOM 6650  H HG   . SER A 1 65 ? -2.005  -10.790 -6.678  1.00 15.00 ? 65 SER A HG   5  
ATOM 6651  N N    . LEU A 1 66 ? 0.162   -9.312  -3.440  1.00 15.00 ? 66 LEU A N    5  
ATOM 6652  C CA   . LEU A 1 66 ? 0.493   -9.241  -2.022  1.00 15.00 ? 66 LEU A CA   5  
ATOM 6653  C C    . LEU A 1 66 ? -0.222  -10.339 -1.239  1.00 15.00 ? 66 LEU A C    5  
ATOM 6654  O O    . LEU A 1 66 ? 0.207   -10.714 -0.147  1.00 15.00 ? 66 LEU A O    5  
ATOM 6655  C CB   . LEU A 1 66 ? 0.119   -7.868  -1.459  1.00 15.00 ? 66 LEU A CB   5  
ATOM 6656  C CG   . LEU A 1 66 ? 1.171   -7.234  -0.546  1.00 15.00 ? 66 LEU A CG   5  
ATOM 6657  C CD1  . LEU A 1 66 ? 1.481   -8.150  0.627   1.00 15.00 ? 66 LEU A CD1  5  
ATOM 6658  C CD2  . LEU A 1 66 ? 2.436   -6.922  -1.331  1.00 15.00 ? 66 LEU A CD2  5  
ATOM 6659  H H    . LEU A 1 66 ? -0.617  -8.820  -3.772  1.00 15.00 ? 66 LEU A H    5  
ATOM 6660  H HA   . LEU A 1 66 ? 1.559   -9.382  -1.924  1.00 15.00 ? 66 LEU A HA   5  
ATOM 6661  H HB2  . LEU A 1 66 ? -0.058  -7.199  -2.288  1.00 15.00 ? 66 LEU A HB2  5  
ATOM 6662  H HB3  . LEU A 1 66 ? -0.798  -7.968  -0.897  1.00 15.00 ? 66 LEU A HB3  5  
ATOM 6663  H HG   . LEU A 1 66 ? 0.783   -6.306  -0.151  1.00 15.00 ? 66 LEU A HG   5  
ATOM 6664  H HD11 . LEU A 1 66 ? 1.733   -9.133  0.260   1.00 15.00 ? 66 LEU A HD11 5  
ATOM 6665  H HD12 . LEU A 1 66 ? 2.315   -7.750  1.185   1.00 15.00 ? 66 LEU A HD12 5  
ATOM 6666  H HD13 . LEU A 1 66 ? 0.617   -8.216  1.271   1.00 15.00 ? 66 LEU A HD13 5  
ATOM 6667  H HD21 . LEU A 1 66 ? 3.297   -7.048  -0.690  1.00 15.00 ? 66 LEU A HD21 5  
ATOM 6668  H HD22 . LEU A 1 66 ? 2.513   -7.594  -2.172  1.00 15.00 ? 66 LEU A HD22 5  
ATOM 6669  H HD23 . LEU A 1 66 ? 2.398   -5.903  -1.686  1.00 15.00 ? 66 LEU A HD23 5  
ATOM 6670  N N    . GLU A 1 67 ? -1.314  -10.853 -1.803  1.00 15.00 ? 67 GLU A N    5  
ATOM 6671  C CA   . GLU A 1 67 ? -2.089  -11.909 -1.157  1.00 15.00 ? 67 GLU A CA   5  
ATOM 6672  C C    . GLU A 1 67 ? -1.177  -13.015 -0.631  1.00 15.00 ? 67 GLU A C    5  
ATOM 6673  O O    . GLU A 1 67 ? -0.778  -13.912 -1.374  1.00 15.00 ? 67 GLU A O    5  
ATOM 6674  C CB   . GLU A 1 67 ? -3.106  -12.494 -2.140  1.00 15.00 ? 67 GLU A CB   5  
ATOM 6675  C CG   . GLU A 1 67 ? -4.487  -12.697 -1.538  1.00 15.00 ? 67 GLU A CG   5  
ATOM 6676  C CD   . GLU A 1 67 ? -5.376  -13.570 -2.401  1.00 15.00 ? 67 GLU A CD   5  
ATOM 6677  O OE1  . GLU A 1 67 ? -5.148  -13.620 -3.628  1.00 15.00 ? 67 GLU A OE1  5  
ATOM 6678  O OE2  . GLU A 1 67 ? -6.301  -14.204 -1.851  1.00 15.00 ? 67 GLU A OE2  5  
ATOM 6679  H H    . GLU A 1 67 ? -1.607  -10.513 -2.674  1.00 15.00 ? 67 GLU A H    5  
ATOM 6680  H HA   . GLU A 1 67 ? -2.618  -11.470 -0.325  1.00 15.00 ? 67 GLU A HA   5  
ATOM 6681  H HB2  . GLU A 1 67 ? -3.200  -11.826 -2.983  1.00 15.00 ? 67 GLU A HB2  5  
ATOM 6682  H HB3  . GLU A 1 67 ? -2.745  -13.450 -2.489  1.00 15.00 ? 67 GLU A HB3  5  
ATOM 6683  H HG2  . GLU A 1 67 ? -4.379  -13.166 -0.571  1.00 15.00 ? 67 GLU A HG2  5  
ATOM 6684  H HG3  . GLU A 1 67 ? -4.959  -11.733 -1.419  1.00 15.00 ? 67 GLU A HG3  5  
ATOM 6685  N N    . GLY A 1 68 ? -0.848  -12.940 0.654   1.00 15.00 ? 68 GLY A N    5  
ATOM 6686  C CA   . GLY A 1 68 ? 0.017   -13.936 1.259   1.00 15.00 ? 68 GLY A CA   5  
ATOM 6687  C C    . GLY A 1 68 ? 1.393   -13.388 1.581   1.00 15.00 ? 68 GLY A C    5  
ATOM 6688  O O    . GLY A 1 68 ? 2.388   -13.801 0.986   1.00 15.00 ? 68 GLY A O    5  
ATOM 6689  H H    . GLY A 1 68 ? -1.194  -12.201 1.197   1.00 15.00 ? 68 GLY A H    5  
ATOM 6690  H HA2  . GLY A 1 68 ? -0.441  -14.289 2.171   1.00 15.00 ? 68 GLY A HA2  5  
ATOM 6691  H HA3  . GLY A 1 68 ? 0.123   -14.767 0.577   1.00 15.00 ? 68 GLY A HA3  5  
ATOM 6692  N N    . ALA A 1 69 ? 1.449   -12.453 2.524   1.00 15.00 ? 69 ALA A N    5  
ATOM 6693  C CA   . ALA A 1 69 ? 2.711   -11.844 2.925   1.00 15.00 ? 69 ALA A CA   5  
ATOM 6694  C C    . ALA A 1 69 ? 2.520   -10.932 4.134   1.00 15.00 ? 69 ALA A C    5  
ATOM 6695  O O    . ALA A 1 69 ? 1.400   -10.538 4.456   1.00 15.00 ? 69 ALA A O    5  
ATOM 6696  C CB   . ALA A 1 69 ? 3.311   -11.068 1.761   1.00 15.00 ? 69 ALA A CB   5  
ATOM 6697  H H    . ALA A 1 69 ? 0.622   -12.164 2.960   1.00 15.00 ? 69 ALA A H    5  
ATOM 6698  H HA   . ALA A 1 69 ? 3.395   -12.637 3.189   1.00 15.00 ? 69 ALA A HA   5  
ATOM 6699  H HB1  . ALA A 1 69 ? 4.192   -11.580 1.404   1.00 15.00 ? 69 ALA A HB1  5  
ATOM 6700  H HB2  . ALA A 1 69 ? 2.587   -11.001 0.962   1.00 15.00 ? 69 ALA A HB2  5  
ATOM 6701  H HB3  . ALA A 1 69 ? 3.579   -10.075 2.088   1.00 15.00 ? 69 ALA A HB3  5  
ATOM 6702  N N    . THR A 1 70 ? 3.619   -10.605 4.804   1.00 15.00 ? 70 THR A N    5  
ATOM 6703  C CA   . THR A 1 70 ? 3.570   -9.743  5.980   1.00 15.00 ? 70 THR A CA   5  
ATOM 6704  C C    . THR A 1 70 ? 3.795   -8.281  5.600   1.00 15.00 ? 70 THR A C    5  
ATOM 6705  O O    . THR A 1 70 ? 3.880   -7.938  4.421   1.00 15.00 ? 70 THR A O    5  
ATOM 6706  C CB   . THR A 1 70 ? 4.622   -10.181 7.001   1.00 15.00 ? 70 THR A CB   5  
ATOM 6707  O OG1  . THR A 1 70 ? 5.916   -9.776  6.592   1.00 15.00 ? 70 THR A OG1  5  
ATOM 6708  C CG2  . THR A 1 70 ? 4.659   -11.678 7.223   1.00 15.00 ? 70 THR A CG2  5  
ATOM 6709  H H    . THR A 1 70 ? 4.484   -10.952 4.501   1.00 15.00 ? 70 THR A H    5  
ATOM 6710  H HA   . THR A 1 70 ? 2.588   -9.841  6.424   1.00 15.00 ? 70 THR A HA   5  
ATOM 6711  H HB   . THR A 1 70 ? 4.404   -9.711  7.949   1.00 15.00 ? 70 THR A HB   5  
ATOM 6712  H HG1  . THR A 1 70 ? 6.506   -9.776  7.349   1.00 15.00 ? 70 THR A HG1  5  
ATOM 6713  H HG21 . THR A 1 70 ? 4.049   -11.931 8.077   1.00 15.00 ? 70 THR A HG21 5  
ATOM 6714  H HG22 . THR A 1 70 ? 4.278   -12.183 6.348   1.00 15.00 ? 70 THR A HG22 5  
ATOM 6715  H HG23 . THR A 1 70 ? 5.677   -11.990 7.404   1.00 15.00 ? 70 THR A HG23 5  
ATOM 6716  N N    . HIS A 1 71 ? 3.891   -7.427  6.614   1.00 15.00 ? 71 HIS A N    5  
ATOM 6717  C CA   . HIS A 1 71 ? 4.107   -6.000  6.410   1.00 15.00 ? 71 HIS A CA   5  
ATOM 6718  C C    . HIS A 1 71 ? 5.460   -5.759  5.752   1.00 15.00 ? 71 HIS A C    5  
ATOM 6719  O O    . HIS A 1 71 ? 5.539   -5.209  4.654   1.00 15.00 ? 71 HIS A O    5  
ATOM 6720  C CB   . HIS A 1 71 ? 3.986   -5.276  7.761   1.00 15.00 ? 71 HIS A CB   5  
ATOM 6721  C CG   . HIS A 1 71 ? 4.817   -4.040  7.930   1.00 15.00 ? 71 HIS A CG   5  
ATOM 6722  N ND1  . HIS A 1 71 ? 5.185   -3.563  9.170   1.00 15.00 ? 71 HIS A ND1  5  
ATOM 6723  C CD2  . HIS A 1 71 ? 5.317   -3.163  7.030   1.00 15.00 ? 71 HIS A CD2  5  
ATOM 6724  C CE1  . HIS A 1 71 ? 5.868   -2.445  9.026   1.00 15.00 ? 71 HIS A CE1  5  
ATOM 6725  N NE2  . HIS A 1 71 ? 5.968   -2.181  7.736   1.00 15.00 ? 71 HIS A NE2  5  
ATOM 6726  H H    . HIS A 1 71 ? 3.814   -7.767  7.528   1.00 15.00 ? 71 HIS A H    5  
ATOM 6727  H HA   . HIS A 1 71 ? 3.333   -5.641  5.749   1.00 15.00 ? 71 HIS A HA   5  
ATOM 6728  H HB2  . HIS A 1 71 ? 2.960   -4.984  7.899   1.00 15.00 ? 71 HIS A HB2  5  
ATOM 6729  H HB3  . HIS A 1 71 ? 4.259   -5.966  8.548   1.00 15.00 ? 71 HIS A HB3  5  
ATOM 6730  H HD1  . HIS A 1 71 ? 4.975   -3.984  10.029  1.00 15.00 ? 71 HIS A HD1  5  
ATOM 6731  H HD2  . HIS A 1 71 ? 5.212   -3.218  5.958   1.00 15.00 ? 71 HIS A HD2  5  
ATOM 6732  H HE1  . HIS A 1 71 ? 6.241   -1.828  9.829   1.00 15.00 ? 71 HIS A HE1  5  
ATOM 6733  H HE2  . HIS A 1 71 ? 6.561   -1.504  7.349   1.00 15.00 ? 71 HIS A HE2  5  
ATOM 6734  N N    . LYS A 1 72 ? 6.520   -6.192  6.420   1.00 15.00 ? 72 LYS A N    5  
ATOM 6735  C CA   . LYS A 1 72 ? 7.870   -6.045  5.888   1.00 15.00 ? 72 LYS A CA   5  
ATOM 6736  C C    . LYS A 1 72 ? 7.946   -6.617  4.480   1.00 15.00 ? 72 LYS A C    5  
ATOM 6737  O O    . LYS A 1 72 ? 8.674   -6.109  3.631   1.00 15.00 ? 72 LYS A O    5  
ATOM 6738  C CB   . LYS A 1 72 ? 8.873   -6.751  6.797   1.00 15.00 ? 72 LYS A CB   5  
ATOM 6739  C CG   . LYS A 1 72 ? 10.320  -6.411  6.484   1.00 15.00 ? 72 LYS A CG   5  
ATOM 6740  C CD   . LYS A 1 72 ? 11.268  -7.491  6.980   1.00 15.00 ? 72 LYS A CD   5  
ATOM 6741  C CE   . LYS A 1 72 ? 11.302  -7.550  8.498   1.00 15.00 ? 72 LYS A CE   5  
ATOM 6742  N NZ   . LYS A 1 72 ? 12.403  -8.422  8.995   1.00 15.00 ? 72 LYS A NZ   5  
ATOM 6743  H H    . LYS A 1 72 ? 6.390   -6.640  7.283   1.00 15.00 ? 72 LYS A H    5  
ATOM 6744  H HA   . LYS A 1 72 ? 8.106   -4.986  5.842   1.00 15.00 ? 72 LYS A HA   5  
ATOM 6745  H HB2  . LYS A 1 72 ? 8.670   -6.474  7.821   1.00 15.00 ? 72 LYS A HB2  5  
ATOM 6746  H HB3  . LYS A 1 72 ? 8.747   -7.819  6.692   1.00 15.00 ? 72 LYS A HB3  5  
ATOM 6747  H HG2  . LYS A 1 72 ? 10.429  -6.313  5.414   1.00 15.00 ? 72 LYS A HG2  5  
ATOM 6748  H HG3  . LYS A 1 72 ? 10.570  -5.475  6.961   1.00 15.00 ? 72 LYS A HG3  5  
ATOM 6749  H HD2  . LYS A 1 72 ? 10.940  -8.447  6.600   1.00 15.00 ? 72 LYS A HD2  5  
ATOM 6750  H HD3  . LYS A 1 72 ? 12.262  -7.278  6.614   1.00 15.00 ? 72 LYS A HD3  5  
ATOM 6751  H HE2  . LYS A 1 72 ? 11.446  -6.551  8.882   1.00 15.00 ? 72 LYS A HE2  5  
ATOM 6752  H HE3  . LYS A 1 72 ? 10.359  -7.939  8.852   1.00 15.00 ? 72 LYS A HE3  5  
ATOM 6753  H HZ1  . LYS A 1 72 ? 12.401  -8.442  10.035  1.00 15.00 ? 72 LYS A HZ1  5  
ATOM 6754  H HZ2  . LYS A 1 72 ? 12.280  -9.391  8.639   1.00 15.00 ? 72 LYS A HZ2  5  
ATOM 6755  H HZ3  . LYS A 1 72 ? 13.322  -8.059  8.669   1.00 15.00 ? 72 LYS A HZ3  5  
ATOM 6756  N N    . GLN A 1 73 ? 7.175   -7.669  4.234   1.00 15.00 ? 73 GLN A N    5  
ATOM 6757  C CA   . GLN A 1 73 ? 7.149   -8.294  2.920   1.00 15.00 ? 73 GLN A CA   5  
ATOM 6758  C C    . GLN A 1 73 ? 6.710   -7.274  1.879   1.00 15.00 ? 73 GLN A C    5  
ATOM 6759  O O    . GLN A 1 73 ? 7.383   -7.074  0.868   1.00 15.00 ? 73 GLN A O    5  
ATOM 6760  C CB   . GLN A 1 73 ? 6.204   -9.495  2.914   1.00 15.00 ? 73 GLN A CB   5  
ATOM 6761  C CG   . GLN A 1 73 ? 6.668   -10.627 2.012   1.00 15.00 ? 73 GLN A CG   5  
ATOM 6762  C CD   . GLN A 1 73 ? 6.789   -11.948 2.747   1.00 15.00 ? 73 GLN A CD   5  
ATOM 6763  O OE1  . GLN A 1 73 ? 5.788   -12.594 3.054   1.00 15.00 ? 73 GLN A OE1  5  
ATOM 6764  N NE2  . GLN A 1 73 ? 8.021   -12.355 3.032   1.00 15.00 ? 73 GLN A NE2  5  
ATOM 6765  H H    . GLN A 1 73 ? 6.607   -8.024  4.947   1.00 15.00 ? 73 GLN A H    5  
ATOM 6766  H HA   . GLN A 1 73 ? 8.150   -8.626  2.687   1.00 15.00 ? 73 GLN A HA   5  
ATOM 6767  H HB2  . GLN A 1 73 ? 6.119   -9.876  3.921   1.00 15.00 ? 73 GLN A HB2  5  
ATOM 6768  H HB3  . GLN A 1 73 ? 5.231   -9.170  2.578   1.00 15.00 ? 73 GLN A HB3  5  
ATOM 6769  H HG2  . GLN A 1 73 ? 5.957   -10.743 1.208   1.00 15.00 ? 73 GLN A HG2  5  
ATOM 6770  H HG3  . GLN A 1 73 ? 7.634   -10.369 1.602   1.00 15.00 ? 73 GLN A HG3  5  
ATOM 6771  H HE21 . GLN A 1 73 ? 8.771   -11.788 2.756   1.00 15.00 ? 73 GLN A HE21 5  
ATOM 6772  H HE22 . GLN A 1 73 ? 8.129   -13.205 3.507   1.00 15.00 ? 73 GLN A HE22 5  
ATOM 6773  N N    . ALA A 1 74 ? 5.590   -6.609  2.149   1.00 15.00 ? 74 ALA A N    5  
ATOM 6774  C CA   . ALA A 1 74 ? 5.086   -5.585  1.249   1.00 15.00 ? 74 ALA A CA   5  
ATOM 6775  C C    . ALA A 1 74 ? 6.038   -4.403  1.234   1.00 15.00 ? 74 ALA A C    5  
ATOM 6776  O O    . ALA A 1 74 ? 6.372   -3.876  0.174   1.00 15.00 ? 74 ALA A O    5  
ATOM 6777  C CB   . ALA A 1 74 ? 3.698   -5.139  1.659   1.00 15.00 ? 74 ALA A CB   5  
ATOM 6778  H H    . ALA A 1 74 ? 5.109   -6.796  2.982   1.00 15.00 ? 74 ALA A H    5  
ATOM 6779  H HA   . ALA A 1 74 ? 5.029   -6.008  0.257   1.00 15.00 ? 74 ALA A HA   5  
ATOM 6780  H HB1  . ALA A 1 74 ? 3.181   -4.751  0.795   1.00 15.00 ? 74 ALA A HB1  5  
ATOM 6781  H HB2  . ALA A 1 74 ? 3.153   -5.979  2.061   1.00 15.00 ? 74 ALA A HB2  5  
ATOM 6782  H HB3  . ALA A 1 74 ? 3.778   -4.366  2.408   1.00 15.00 ? 74 ALA A HB3  5  
ATOM 6783  N N    . VAL A 1 75 ? 6.497   -4.009  2.424   1.00 15.00 ? 75 VAL A N    5  
ATOM 6784  C CA   . VAL A 1 75 ? 7.446   -2.908  2.557   1.00 15.00 ? 75 VAL A CA   5  
ATOM 6785  C C    . VAL A 1 75 ? 8.507   -3.040  1.478   1.00 15.00 ? 75 VAL A C    5  
ATOM 6786  O O    . VAL A 1 75 ? 8.891   -2.066  0.833   1.00 15.00 ? 75 VAL A O    5  
ATOM 6787  C CB   . VAL A 1 75 ? 8.096   -2.916  3.964   1.00 15.00 ? 75 VAL A CB   5  
ATOM 6788  C CG1  . VAL A 1 75 ? 9.575   -3.284  3.916   1.00 15.00 ? 75 VAL A CG1  5  
ATOM 6789  C CG2  . VAL A 1 75 ? 7.909   -1.583  4.659   1.00 15.00 ? 75 VAL A CG2  5  
ATOM 6790  H H    . VAL A 1 75 ? 6.207   -4.487  3.228   1.00 15.00 ? 75 VAL A H    5  
ATOM 6791  H HA   . VAL A 1 75 ? 6.917   -1.976  2.418   1.00 15.00 ? 75 VAL A HA   5  
ATOM 6792  H HB   . VAL A 1 75 ? 7.586   -3.661  4.553   1.00 15.00 ? 75 VAL A HB   5  
ATOM 6793  H HG11 . VAL A 1 75 ? 9.694   -4.238  3.429   1.00 15.00 ? 75 VAL A HG11 5  
ATOM 6794  H HG12 . VAL A 1 75 ? 10.116  -2.529  3.366   1.00 15.00 ? 75 VAL A HG12 5  
ATOM 6795  H HG13 . VAL A 1 75 ? 9.964   -3.343  4.922   1.00 15.00 ? 75 VAL A HG13 5  
ATOM 6796  H HG21 . VAL A 1 75 ? 8.872   -1.125  4.828   1.00 15.00 ? 75 VAL A HG21 5  
ATOM 6797  H HG22 . VAL A 1 75 ? 7.304   -0.936  4.044   1.00 15.00 ? 75 VAL A HG22 5  
ATOM 6798  H HG23 . VAL A 1 75 ? 7.417   -1.747  5.606   1.00 15.00 ? 75 VAL A HG23 5  
ATOM 6799  N N    . GLU A 1 76 ? 8.942   -4.274  1.275   1.00 15.00 ? 76 GLU A N    5  
ATOM 6800  C CA   . GLU A 1 76 ? 9.927   -4.578  0.256   1.00 15.00 ? 76 GLU A CA   5  
ATOM 6801  C C    . GLU A 1 76 ? 9.333   -4.351  -1.131  1.00 15.00 ? 76 GLU A C    5  
ATOM 6802  O O    . GLU A 1 76 ? 9.968   -3.750  -1.992  1.00 15.00 ? 76 GLU A O    5  
ATOM 6803  C CB   . GLU A 1 76 ? 10.410  -6.023  0.396   1.00 15.00 ? 76 GLU A CB   5  
ATOM 6804  C CG   . GLU A 1 76 ? 10.962  -6.351  1.774   1.00 15.00 ? 76 GLU A CG   5  
ATOM 6805  C CD   . GLU A 1 76 ? 10.797  -7.814  2.135   1.00 15.00 ? 76 GLU A CD   5  
ATOM 6806  O OE1  . GLU A 1 76 ? 10.936  -8.667  1.233   1.00 15.00 ? 76 GLU A OE1  5  
ATOM 6807  O OE2  . GLU A 1 76 ? 10.529  -8.108  3.319   1.00 15.00 ? 76 GLU A OE2  5  
ATOM 6808  H H    . GLU A 1 76 ? 8.571   -5.006  1.816   1.00 15.00 ? 76 GLU A H    5  
ATOM 6809  H HA   . GLU A 1 76 ? 10.765  -3.910  0.392   1.00 15.00 ? 76 GLU A HA   5  
ATOM 6810  H HB2  . GLU A 1 76 ? 9.582   -6.687  0.196   1.00 15.00 ? 76 GLU A HB2  5  
ATOM 6811  H HB3  . GLU A 1 76 ? 11.188  -6.202  -0.332  1.00 15.00 ? 76 GLU A HB3  5  
ATOM 6812  H HG2  . GLU A 1 76 ? 12.014  -6.108  1.794   1.00 15.00 ? 76 GLU A HG2  5  
ATOM 6813  H HG3  . GLU A 1 76 ? 10.442  -5.753  2.510   1.00 15.00 ? 76 GLU A HG3  5  
ATOM 6814  N N    . THR A 1 77 ? 8.104   -4.832  -1.342  1.00 15.00 ? 77 THR A N    5  
ATOM 6815  C CA   . THR A 1 77 ? 7.435   -4.670  -2.631  1.00 15.00 ? 77 THR A CA   5  
ATOM 6816  C C    . THR A 1 77 ? 7.172   -3.199  -2.942  1.00 15.00 ? 77 THR A C    5  
ATOM 6817  O O    . THR A 1 77 ? 7.569   -2.700  -3.995  1.00 15.00 ? 77 THR A O    5  
ATOM 6818  C CB   . THR A 1 77 ? 6.123   -5.451  -2.671  1.00 15.00 ? 77 THR A CB   5  
ATOM 6819  O OG1  . THR A 1 77 ? 5.230   -4.991  -1.674  1.00 15.00 ? 77 THR A OG1  5  
ATOM 6820  C CG2  . THR A 1 77 ? 6.306   -6.941  -2.477  1.00 15.00 ? 77 THR A CG2  5  
ATOM 6821  H H    . THR A 1 77 ? 7.634   -5.299  -0.613  1.00 15.00 ? 77 THR A H    5  
ATOM 6822  H HA   . THR A 1 77 ? 8.095   -5.065  -3.390  1.00 15.00 ? 77 THR A HA   5  
ATOM 6823  H HB   . THR A 1 77 ? 5.662   -5.299  -3.635  1.00 15.00 ? 77 THR A HB   5  
ATOM 6824  H HG1  . THR A 1 77 ? 4.390   -5.448  -1.760  1.00 15.00 ? 77 THR A HG1  5  
ATOM 6825  H HG21 . THR A 1 77 ? 6.180   -7.444  -3.426  1.00 15.00 ? 77 THR A HG21 5  
ATOM 6826  H HG22 . THR A 1 77 ? 7.297   -7.136  -2.095  1.00 15.00 ? 77 THR A HG22 5  
ATOM 6827  H HG23 . THR A 1 77 ? 5.571   -7.306  -1.776  1.00 15.00 ? 77 THR A HG23 5  
ATOM 6828  N N    . LEU A 1 78 ? 6.498   -2.505  -2.023  1.00 15.00 ? 78 LEU A N    5  
ATOM 6829  C CA   . LEU A 1 78 ? 6.187   -1.089  -2.219  1.00 15.00 ? 78 LEU A CA   5  
ATOM 6830  C C    . LEU A 1 78 ? 7.456   -0.313  -2.534  1.00 15.00 ? 78 LEU A C    5  
ATOM 6831  O O    . LEU A 1 78 ? 7.506   0.466   -3.485  1.00 15.00 ? 78 LEU A O    5  
ATOM 6832  C CB   . LEU A 1 78 ? 5.521   -0.495  -0.972  1.00 15.00 ? 78 LEU A CB   5  
ATOM 6833  C CG   . LEU A 1 78 ? 4.547   -1.417  -0.234  1.00 15.00 ? 78 LEU A CG   5  
ATOM 6834  C CD1  . LEU A 1 78 ? 3.740   -0.631  0.787   1.00 15.00 ? 78 LEU A CD1  5  
ATOM 6835  C CD2  . LEU A 1 78 ? 3.622   -2.120  -1.216  1.00 15.00 ? 78 LEU A CD2  5  
ATOM 6836  H H    . LEU A 1 78 ? 6.204   -2.953  -1.203  1.00 15.00 ? 78 LEU A H    5  
ATOM 6837  H HA   . LEU A 1 78 ? 5.510   -1.007  -3.055  1.00 15.00 ? 78 LEU A HA   5  
ATOM 6838  H HB2  . LEU A 1 78 ? 6.299   -0.205  -0.281  1.00 15.00 ? 78 LEU A HB2  5  
ATOM 6839  H HB3  . LEU A 1 78 ? 4.982   0.393   -1.269  1.00 15.00 ? 78 LEU A HB3  5  
ATOM 6840  H HG   . LEU A 1 78 ? 5.109   -2.170  0.297   1.00 15.00 ? 78 LEU A HG   5  
ATOM 6841  H HD11 . LEU A 1 78 ? 3.368   0.275   0.332   1.00 15.00 ? 78 LEU A HD11 5  
ATOM 6842  H HD12 . LEU A 1 78 ? 2.908   -1.231  1.127   1.00 15.00 ? 78 LEU A HD12 5  
ATOM 6843  H HD13 . LEU A 1 78 ? 4.369   -0.380  1.627   1.00 15.00 ? 78 LEU A HD13 5  
ATOM 6844  H HD21 . LEU A 1 78 ? 2.740   -2.464  -0.697  1.00 15.00 ? 78 LEU A HD21 5  
ATOM 6845  H HD22 . LEU A 1 78 ? 3.335   -1.430  -1.996  1.00 15.00 ? 78 LEU A HD22 5  
ATOM 6846  H HD23 . LEU A 1 78 ? 4.135   -2.964  -1.652  1.00 15.00 ? 78 LEU A HD23 5  
ATOM 6847  N N    . ARG A 1 79 ? 8.483   -0.546  -1.730  1.00 15.00 ? 79 ARG A N    5  
ATOM 6848  C CA   . ARG A 1 79 ? 9.765   0.112   -1.912  1.00 15.00 ? 79 ARG A CA   5  
ATOM 6849  C C    . ARG A 1 79 ? 10.445  -0.381  -3.189  1.00 15.00 ? 79 ARG A C    5  
ATOM 6850  O O    . ARG A 1 79 ? 10.747  0.405   -4.087  1.00 15.00 ? 79 ARG A O    5  
ATOM 6851  C CB   . ARG A 1 79 ? 10.656  -0.152  -0.698  1.00 15.00 ? 79 ARG A CB   5  
ATOM 6852  C CG   . ARG A 1 79 ? 11.584  1.003   -0.360  1.00 15.00 ? 79 ARG A CG   5  
ATOM 6853  C CD   . ARG A 1 79 ? 11.005  1.883   0.737   1.00 15.00 ? 79 ARG A CD   5  
ATOM 6854  N NE   . ARG A 1 79 ? 11.906  1.997   1.882   1.00 15.00 ? 79 ARG A NE   5  
ATOM 6855  C CZ   . ARG A 1 79 ? 11.982  1.095   2.858   1.00 15.00 ? 79 ARG A CZ   5  
ATOM 6856  N NH1  . ARG A 1 79 ? 11.221  0.008   2.829   1.00 15.00 ? 79 ARG A NH1  5  
ATOM 6857  N NH2  . ARG A 1 79 ? 12.823  1.281   3.866   1.00 15.00 ? 79 ARG A NH2  5  
ATOM 6858  H H    . ARG A 1 79 ? 8.376   -1.186  -0.995  1.00 15.00 ? 79 ARG A H    5  
ATOM 6859  H HA   . ARG A 1 79 ? 9.587   1.173   -1.997  1.00 15.00 ? 79 ARG A HA   5  
ATOM 6860  H HB2  . ARG A 1 79 ? 10.025  -0.343  0.161   1.00 15.00 ? 79 ARG A HB2  5  
ATOM 6861  H HB3  . ARG A 1 79 ? 11.259  -1.027  -0.891  1.00 15.00 ? 79 ARG A HB3  5  
ATOM 6862  H HG2  . ARG A 1 79 ? 12.531  0.606   -0.026  1.00 15.00 ? 79 ARG A HG2  5  
ATOM 6863  H HG3  . ARG A 1 79 ? 11.736  1.601   -1.247  1.00 15.00 ? 79 ARG A HG3  5  
ATOM 6864  H HD2  . ARG A 1 79 ? 10.828  2.869   0.333   1.00 15.00 ? 79 ARG A HD2  5  
ATOM 6865  H HD3  . ARG A 1 79 ? 10.069  1.458   1.067   1.00 15.00 ? 79 ARG A HD3  5  
ATOM 6866  H HE   . ARG A 1 79 ? 12.482  2.788   1.927   1.00 15.00 ? 79 ARG A HE   5  
ATOM 6867  H HH11 . ARG A 1 79 ? 10.586  -0.139  2.072   1.00 15.00 ? 79 ARG A HH11 5  
ATOM 6868  H HH12 . ARG A 1 79 ? 11.284  -0.665  3.567   1.00 15.00 ? 79 ARG A HH12 5  
ATOM 6869  H HH21 . ARG A 1 79 ? 13.400  2.097   3.892   1.00 15.00 ? 79 ARG A HH21 5  
ATOM 6870  H HH22 . ARG A 1 79 ? 12.881  0.604   4.601   1.00 15.00 ? 79 ARG A HH22 5  
ATOM 6871  N N    . ASN A 1 80 ? 10.685  -1.688  -3.253  1.00 15.00 ? 80 ASN A N    5  
ATOM 6872  C CA   . ASN A 1 80 ? 11.333  -2.308  -4.409  1.00 15.00 ? 80 ASN A CA   5  
ATOM 6873  C C    . ASN A 1 80 ? 10.474  -2.227  -5.673  1.00 15.00 ? 80 ASN A C    5  
ATOM 6874  O O    . ASN A 1 80 ? 10.138  -3.253  -6.266  1.00 15.00 ? 80 ASN A O    5  
ATOM 6875  C CB   . ASN A 1 80 ? 11.658  -3.773  -4.108  1.00 15.00 ? 80 ASN A CB   5  
ATOM 6876  C CG   . ASN A 1 80 ? 12.544  -3.930  -2.887  1.00 15.00 ? 80 ASN A CG   5  
ATOM 6877  O OD1  . ASN A 1 80 ? 13.408  -3.094  -2.621  1.00 15.00 ? 80 ASN A OD1  5  
ATOM 6878  N ND2  . ASN A 1 80 ? 12.335  -5.006  -2.138  1.00 15.00 ? 80 ASN A ND2  5  
ATOM 6879  H H    . ASN A 1 80 ? 10.421  -2.255  -2.499  1.00 15.00 ? 80 ASN A H    5  
ATOM 6880  H HA   . ASN A 1 80 ? 12.258  -1.780  -4.587  1.00 15.00 ? 80 ASN A HA   5  
ATOM 6881  H HB2  . ASN A 1 80 ? 10.737  -4.311  -3.935  1.00 15.00 ? 80 ASN A HB2  5  
ATOM 6882  H HB3  . ASN A 1 80 ? 12.166  -4.204  -4.957  1.00 15.00 ? 80 ASN A HB3  5  
ATOM 6883  H HD21 . ASN A 1 80 ? 11.631  -5.630  -2.411  1.00 15.00 ? 80 ASN A HD21 5  
ATOM 6884  H HD22 . ASN A 1 80 ? 12.894  -5.133  -1.343  1.00 15.00 ? 80 ASN A HD22 5  
ATOM 6885  N N    . THR A 1 81 ? 10.137  -1.015  -6.101  1.00 15.00 ? 81 THR A N    5  
ATOM 6886  C CA   . THR A 1 81 ? 9.341   -0.838  -7.311  1.00 15.00 ? 81 THR A CA   5  
ATOM 6887  C C    . THR A 1 81 ? 10.259  -0.575  -8.503  1.00 15.00 ? 81 THR A C    5  
ATOM 6888  O O    . THR A 1 81 ? 10.442  -1.440  -9.359  1.00 15.00 ? 81 THR A O    5  
ATOM 6889  C CB   . THR A 1 81 ? 8.334   0.303   -7.143  1.00 15.00 ? 81 THR A CB   5  
ATOM 6890  O OG1  . THR A 1 81 ? 8.543   0.988   -5.920  1.00 15.00 ? 81 THR A OG1  5  
ATOM 6891  C CG2  . THR A 1 81 ? 6.893   -0.164  -7.165  1.00 15.00 ? 81 THR A CG2  5  
ATOM 6892  H H    . THR A 1 81 ? 10.444  -0.228  -5.607  1.00 15.00 ? 81 THR A H    5  
ATOM 6893  H HA   . THR A 1 81 ? 8.804   -1.758  -7.488  1.00 15.00 ? 81 THR A HA   5  
ATOM 6894  H HB   . THR A 1 81 ? 8.462   1.006   -7.953  1.00 15.00 ? 81 THR A HB   5  
ATOM 6895  H HG1  . THR A 1 81 ? 9.421   1.374   -5.915  1.00 15.00 ? 81 THR A HG1  5  
ATOM 6896  H HG21 . THR A 1 81 ? 6.291   0.549   -7.710  1.00 15.00 ? 81 THR A HG21 5  
ATOM 6897  H HG22 . THR A 1 81 ? 6.833   -1.128  -7.648  1.00 15.00 ? 81 THR A HG22 5  
ATOM 6898  H HG23 . THR A 1 81 ? 6.524   -0.246  -6.153  1.00 15.00 ? 81 THR A HG23 5  
ATOM 6899  N N    . GLY A 1 82 ? 10.851  0.617   -8.542  1.00 15.00 ? 82 GLY A N    5  
ATOM 6900  C CA   . GLY A 1 82 ? 11.758  0.958   -9.619  1.00 15.00 ? 82 GLY A CA   5  
ATOM 6901  C C    . GLY A 1 82 ? 11.341  2.194   -10.390 1.00 15.00 ? 82 GLY A C    5  
ATOM 6902  O O    . GLY A 1 82 ? 11.504  3.319   -9.919  1.00 15.00 ? 82 GLY A O    5  
ATOM 6903  H H    . GLY A 1 82 ? 10.680  1.262   -7.831  1.00 15.00 ? 82 GLY A H    5  
ATOM 6904  H HA2  . GLY A 1 82 ? 12.740  1.127   -9.202  1.00 15.00 ? 82 GLY A HA2  5  
ATOM 6905  H HA3  . GLY A 1 82 ? 11.813  0.124   -10.303 1.00 15.00 ? 82 GLY A HA3  5  
ATOM 6906  N N    . GLN A 1 83 ? 10.822  1.975   -11.589 1.00 15.00 ? 83 GLN A N    5  
ATOM 6907  C CA   . GLN A 1 83 ? 10.396  3.068   -12.463 1.00 15.00 ? 83 GLN A CA   5  
ATOM 6908  C C    . GLN A 1 83 ? 9.228   3.857   -11.869 1.00 15.00 ? 83 GLN A C    5  
ATOM 6909  O O    . GLN A 1 83 ? 9.425   4.912   -11.268 1.00 15.00 ? 83 GLN A O    5  
ATOM 6910  C CB   . GLN A 1 83 ? 10.019  2.538   -13.854 1.00 15.00 ? 83 GLN A CB   5  
ATOM 6911  C CG   . GLN A 1 83 ? 9.405   1.145   -13.849 1.00 15.00 ? 83 GLN A CG   5  
ATOM 6912  C CD   . GLN A 1 83 ? 8.249   1.013   -14.822 1.00 15.00 ? 83 GLN A CD   5  
ATOM 6913  O OE1  . GLN A 1 83 ? 7.085   0.998   -14.422 1.00 15.00 ? 83 GLN A OE1  5  
ATOM 6914  N NE2  . GLN A 1 83 ? 8.566   0.918   -16.108 1.00 15.00 ? 83 GLN A NE2  5  
ATOM 6915  H H    . GLN A 1 83 ? 10.738  1.052   -11.899 1.00 15.00 ? 83 GLN A H    5  
ATOM 6916  H HA   . GLN A 1 83 ? 11.235  3.738   -12.570 1.00 15.00 ? 83 GLN A HA   5  
ATOM 6917  H HB2  . GLN A 1 83 ? 9.307   3.216   -14.301 1.00 15.00 ? 83 GLN A HB2  5  
ATOM 6918  H HB3  . GLN A 1 83 ? 10.908  2.512   -14.467 1.00 15.00 ? 83 GLN A HB3  5  
ATOM 6919  H HG2  . GLN A 1 83 ? 10.166  0.429   -14.121 1.00 15.00 ? 83 GLN A HG2  5  
ATOM 6920  H HG3  . GLN A 1 83 ? 9.045   0.927   -12.854 1.00 15.00 ? 83 GLN A HG3  5  
ATOM 6921  H HE21 . GLN A 1 83 ? 9.514   0.936   -16.354 1.00 15.00 ? 83 GLN A HE21 5  
ATOM 6922  H HE22 . GLN A 1 83 ? 7.838   0.832   -16.759 1.00 15.00 ? 83 GLN A HE22 5  
ATOM 6923  N N    . VAL A 1 84 ? 8.013   3.351   -12.058 1.00 15.00 ? 84 VAL A N    5  
ATOM 6924  C CA   . VAL A 1 84 ? 6.817   4.016   -11.557 1.00 15.00 ? 84 VAL A CA   5  
ATOM 6925  C C    . VAL A 1 84 ? 6.198   3.238   -10.399 1.00 15.00 ? 84 VAL A C    5  
ATOM 6926  O O    . VAL A 1 84 ? 6.434   2.040   -10.240 1.00 15.00 ? 84 VAL A O    5  
ATOM 6927  C CB   . VAL A 1 84 ? 5.774   4.195   -12.683 1.00 15.00 ? 84 VAL A CB   5  
ATOM 6928  C CG1  . VAL A 1 84 ? 4.450   4.713   -12.138 1.00 15.00 ? 84 VAL A CG1  5  
ATOM 6929  C CG2  . VAL A 1 84 ? 6.312   5.134   -13.750 1.00 15.00 ? 84 VAL A CG2  5  
ATOM 6930  H H    . VAL A 1 84 ? 7.917   2.514   -12.552 1.00 15.00 ? 84 VAL A H    5  
ATOM 6931  H HA   . VAL A 1 84 ? 7.105   4.999   -11.205 1.00 15.00 ? 84 VAL A HA   5  
ATOM 6932  H HB   . VAL A 1 84 ? 5.598   3.232   -13.139 1.00 15.00 ? 84 VAL A HB   5  
ATOM 6933  H HG11 . VAL A 1 84 ? 4.614   5.651   -11.631 1.00 15.00 ? 84 VAL A HG11 5  
ATOM 6934  H HG12 . VAL A 1 84 ? 3.759   4.860   -12.954 1.00 15.00 ? 84 VAL A HG12 5  
ATOM 6935  H HG13 . VAL A 1 84 ? 4.040   3.995   -11.444 1.00 15.00 ? 84 VAL A HG13 5  
ATOM 6936  H HG21 . VAL A 1 84 ? 6.425   6.125   -13.332 1.00 15.00 ? 84 VAL A HG21 5  
ATOM 6937  H HG22 . VAL A 1 84 ? 7.271   4.777   -14.095 1.00 15.00 ? 84 VAL A HG22 5  
ATOM 6938  H HG23 . VAL A 1 84 ? 5.621   5.170   -14.579 1.00 15.00 ? 84 VAL A HG23 5  
ATOM 6939  N N    . VAL A 1 85 ? 5.400   3.927   -9.597  1.00 15.00 ? 85 VAL A N    5  
ATOM 6940  C CA   . VAL A 1 85 ? 4.745   3.309   -8.458  1.00 15.00 ? 85 VAL A CA   5  
ATOM 6941  C C    . VAL A 1 85 ? 3.310   2.920   -8.812  1.00 15.00 ? 85 VAL A C    5  
ATOM 6942  O O    . VAL A 1 85 ? 2.360   3.634   -8.493  1.00 15.00 ? 85 VAL A O    5  
ATOM 6943  C CB   . VAL A 1 85 ? 4.763   4.263   -7.241  1.00 15.00 ? 85 VAL A CB   5  
ATOM 6944  C CG1  . VAL A 1 85 ? 3.703   3.892   -6.214  1.00 15.00 ? 85 VAL A CG1  5  
ATOM 6945  C CG2  . VAL A 1 85 ? 6.145   4.281   -6.605  1.00 15.00 ? 85 VAL A CG2  5  
ATOM 6946  H H    . VAL A 1 85 ? 5.246   4.879   -9.776  1.00 15.00 ? 85 VAL A H    5  
ATOM 6947  H HA   . VAL A 1 85 ? 5.297   2.416   -8.200  1.00 15.00 ? 85 VAL A HA   5  
ATOM 6948  H HB   . VAL A 1 85 ? 4.548   5.258   -7.594  1.00 15.00 ? 85 VAL A HB   5  
ATOM 6949  H HG11 . VAL A 1 85 ? 3.390   2.871   -6.370  1.00 15.00 ? 85 VAL A HG11 5  
ATOM 6950  H HG12 . VAL A 1 85 ? 4.113   3.996   -5.220  1.00 15.00 ? 85 VAL A HG12 5  
ATOM 6951  H HG13 . VAL A 1 85 ? 2.853   4.554   -6.324  1.00 15.00 ? 85 VAL A HG13 5  
ATOM 6952  H HG21 . VAL A 1 85 ? 6.047   4.264   -5.529  1.00 15.00 ? 85 VAL A HG21 5  
ATOM 6953  H HG22 . VAL A 1 85 ? 6.702   3.414   -6.929  1.00 15.00 ? 85 VAL A HG22 5  
ATOM 6954  H HG23 . VAL A 1 85 ? 6.667   5.177   -6.904  1.00 15.00 ? 85 VAL A HG23 5  
ATOM 6955  N N    . HIS A 1 86 ? 3.168   1.775   -9.475  1.00 15.00 ? 86 HIS A N    5  
ATOM 6956  C CA   . HIS A 1 86 ? 1.855   1.277   -9.874  1.00 15.00 ? 86 HIS A CA   5  
ATOM 6957  C C    . HIS A 1 86 ? 1.367   0.221   -8.889  1.00 15.00 ? 86 HIS A C    5  
ATOM 6958  O O    . HIS A 1 86 ? 1.569   -0.976  -9.094  1.00 15.00 ? 86 HIS A O    5  
ATOM 6959  C CB   . HIS A 1 86 ? 1.913   0.689   -11.284 1.00 15.00 ? 86 HIS A CB   5  
ATOM 6960  C CG   . HIS A 1 86 ? 0.564   0.485   -11.903 1.00 15.00 ? 86 HIS A CG   5  
ATOM 6961  N ND1  . HIS A 1 86 ? -0.539  1.242   -11.569 1.00 15.00 ? 86 HIS A ND1  5  
ATOM 6962  C CD2  . HIS A 1 86 ? 0.143   -0.398  -12.839 1.00 15.00 ? 86 HIS A CD2  5  
ATOM 6963  C CE1  . HIS A 1 86 ? -1.580  0.833   -12.273 1.00 15.00 ? 86 HIS A CE1  5  
ATOM 6964  N NE2  . HIS A 1 86 ? -1.193  -0.160  -13.051 1.00 15.00 ? 86 HIS A NE2  5  
ATOM 6965  H H    . HIS A 1 86 ? 3.967   1.251   -9.700  1.00 15.00 ? 86 HIS A H    5  
ATOM 6966  H HA   . HIS A 1 86 ? 1.166   2.109   -9.865  1.00 15.00 ? 86 HIS A HA   5  
ATOM 6967  H HB2  . HIS A 1 86 ? 2.473   1.356   -11.922 1.00 15.00 ? 86 HIS A HB2  5  
ATOM 6968  H HB3  . HIS A 1 86 ? 2.411   -0.268  -11.247 1.00 15.00 ? 86 HIS A HB3  5  
ATOM 6969  H HD1  . HIS A 1 86 ? -0.557  1.971   -10.914 1.00 15.00 ? 86 HIS A HD1  5  
ATOM 6970  H HD2  . HIS A 1 86 ? 0.746   -1.149  -13.329 1.00 15.00 ? 86 HIS A HD2  5  
ATOM 6971  H HE1  . HIS A 1 86 ? -2.578  1.243   -12.220 1.00 15.00 ? 86 HIS A HE1  5  
ATOM 6972  H HE2  . HIS A 1 86 ? -1.748  -0.594  -13.732 1.00 15.00 ? 86 HIS A HE2  5  
ATOM 6973  N N    . LEU A 1 87 ? 0.739   0.675   -7.812  1.00 15.00 ? 87 LEU A N    5  
ATOM 6974  C CA   . LEU A 1 87 ? 0.237   -0.225  -6.781  1.00 15.00 ? 87 LEU A CA   5  
ATOM 6975  C C    . LEU A 1 87 ? -1.277  -0.397  -6.863  1.00 15.00 ? 87 LEU A C    5  
ATOM 6976  O O    . LEU A 1 87 ? -2.022  0.577   -6.841  1.00 15.00 ? 87 LEU A O    5  
ATOM 6977  C CB   . LEU A 1 87 ? 0.619   0.308   -5.400  1.00 15.00 ? 87 LEU A CB   5  
ATOM 6978  C CG   . LEU A 1 87 ? 1.563   -0.586  -4.606  1.00 15.00 ? 87 LEU A CG   5  
ATOM 6979  C CD1  . LEU A 1 87 ? 2.668   0.236   -3.961  1.00 15.00 ? 87 LEU A CD1  5  
ATOM 6980  C CD2  . LEU A 1 87 ? 0.787   -1.361  -3.555  1.00 15.00 ? 87 LEU A CD2  5  
ATOM 6981  H H    . LEU A 1 87 ? 0.620   1.641   -7.702  1.00 15.00 ? 87 LEU A H    5  
ATOM 6982  H HA   . LEU A 1 87 ? 0.705   -1.186  -6.925  1.00 15.00 ? 87 LEU A HA   5  
ATOM 6983  H HB2  . LEU A 1 87 ? 1.087   1.271   -5.524  1.00 15.00 ? 87 LEU A HB2  5  
ATOM 6984  H HB3  . LEU A 1 87 ? -0.284  0.439   -4.824  1.00 15.00 ? 87 LEU A HB3  5  
ATOM 6985  H HG   . LEU A 1 87 ? 2.021   -1.293  -5.278  1.00 15.00 ? 87 LEU A HG   5  
ATOM 6986  H HD11 . LEU A 1 87 ? 2.804   1.154   -4.514  1.00 15.00 ? 87 LEU A HD11 5  
ATOM 6987  H HD12 . LEU A 1 87 ? 2.397   0.467   -2.941  1.00 15.00 ? 87 LEU A HD12 5  
ATOM 6988  H HD13 . LEU A 1 87 ? 3.589   -0.328  -3.969  1.00 15.00 ? 87 LEU A HD13 5  
ATOM 6989  H HD21 . LEU A 1 87 ? 0.549   -0.705  -2.732  1.00 15.00 ? 87 LEU A HD21 5  
ATOM 6990  H HD22 . LEU A 1 87 ? -0.127  -1.739  -3.989  1.00 15.00 ? 87 LEU A HD22 5  
ATOM 6991  H HD23 . LEU A 1 87 ? 1.385   -2.185  -3.198  1.00 15.00 ? 87 LEU A HD23 5  
ATOM 6992  N N    . LEU A 1 88 ? -1.724  -1.647  -6.931  1.00 15.00 ? 88 LEU A N    5  
ATOM 6993  C CA   . LEU A 1 88 ? -3.151  -1.948  -6.985  1.00 15.00 ? 88 LEU A CA   5  
ATOM 6994  C C    . LEU A 1 88 ? -3.630  -2.417  -5.618  1.00 15.00 ? 88 LEU A C    5  
ATOM 6995  O O    . LEU A 1 88 ? -3.420  -3.569  -5.236  1.00 15.00 ? 88 LEU A O    5  
ATOM 6996  C CB   . LEU A 1 88 ? -3.432  -3.016  -8.045  1.00 15.00 ? 88 LEU A CB   5  
ATOM 6997  C CG   . LEU A 1 88 ? -3.625  -2.485  -9.468  1.00 15.00 ? 88 LEU A CG   5  
ATOM 6998  C CD1  . LEU A 1 88 ? -2.595  -1.410  -9.784  1.00 15.00 ? 88 LEU A CD1  5  
ATOM 6999  C CD2  . LEU A 1 88 ? -3.537  -3.621  -10.476 1.00 15.00 ? 88 LEU A CD2  5  
ATOM 7000  H H    . LEU A 1 88 ? -1.080  -2.385  -6.926  1.00 15.00 ? 88 LEU A H    5  
ATOM 7001  H HA   . LEU A 1 88 ? -3.675  -1.037  -7.248  1.00 15.00 ? 88 LEU A HA   5  
ATOM 7002  H HB2  . LEU A 1 88 ? -2.605  -3.711  -8.051  1.00 15.00 ? 88 LEU A HB2  5  
ATOM 7003  H HB3  . LEU A 1 88 ? -4.326  -3.550  -7.760  1.00 15.00 ? 88 LEU A HB3  5  
ATOM 7004  H HG   . LEU A 1 88 ? -4.606  -2.041  -9.549  1.00 15.00 ? 88 LEU A HG   5  
ATOM 7005  H HD11 . LEU A 1 88 ? -2.507  -0.738  -8.942  1.00 15.00 ? 88 LEU A HD11 5  
ATOM 7006  H HD12 . LEU A 1 88 ? -1.639  -1.872  -9.978  1.00 15.00 ? 88 LEU A HD12 5  
ATOM 7007  H HD13 . LEU A 1 88 ? -2.910  -0.855  -10.655 1.00 15.00 ? 88 LEU A HD13 5  
ATOM 7008  H HD21 . LEU A 1 88 ? -3.207  -3.233  -11.428 1.00 15.00 ? 88 LEU A HD21 5  
ATOM 7009  H HD22 . LEU A 1 88 ? -2.833  -4.360  -10.125 1.00 15.00 ? 88 LEU A HD22 5  
ATOM 7010  H HD23 . LEU A 1 88 ? -4.510  -4.076  -10.590 1.00 15.00 ? 88 LEU A HD23 5  
ATOM 7011  N N    . LEU A 1 89 ? -4.250  -1.510  -4.873  1.00 15.00 ? 89 LEU A N    5  
ATOM 7012  C CA   . LEU A 1 89 ? -4.731  -1.823  -3.533  1.00 15.00 ? 89 LEU A CA   5  
ATOM 7013  C C    . LEU A 1 89 ? -6.245  -1.976  -3.484  1.00 15.00 ? 89 LEU A C    5  
ATOM 7014  O O    . LEU A 1 89 ? -6.911  -2.137  -4.506  1.00 15.00 ? 89 LEU A O    5  
ATOM 7015  C CB   . LEU A 1 89 ? -4.315  -0.734  -2.541  1.00 15.00 ? 89 LEU A CB   5  
ATOM 7016  C CG   . LEU A 1 89 ? -3.338  0.299   -3.070  1.00 15.00 ? 89 LEU A CG   5  
ATOM 7017  C CD1  . LEU A 1 89 ? -3.345  1.514   -2.171  1.00 15.00 ? 89 LEU A CD1  5  
ATOM 7018  C CD2  . LEU A 1 89 ? -1.950  -0.295  -3.157  1.00 15.00 ? 89 LEU A CD2  5  
ATOM 7019  H H    . LEU A 1 89 ? -4.373  -0.606  -5.227  1.00 15.00 ? 89 LEU A H    5  
ATOM 7020  H HA   . LEU A 1 89 ? -4.274  -2.749  -3.233  1.00 15.00 ? 89 LEU A HA   5  
ATOM 7021  H HB2  . LEU A 1 89 ? -5.204  -0.213  -2.217  1.00 15.00 ? 89 LEU A HB2  5  
ATOM 7022  H HB3  . LEU A 1 89 ? -3.869  -1.210  -1.683  1.00 15.00 ? 89 LEU A HB3  5  
ATOM 7023  H HG   . LEU A 1 89 ? -3.638  0.605   -4.059  1.00 15.00 ? 89 LEU A HG   5  
ATOM 7024  H HD11 . LEU A 1 89 ? -4.300  1.585   -1.677  1.00 15.00 ? 89 LEU A HD11 5  
ATOM 7025  H HD12 . LEU A 1 89 ? -2.565  1.414   -1.434  1.00 15.00 ? 89 LEU A HD12 5  
ATOM 7026  H HD13 . LEU A 1 89 ? -3.177  2.400   -2.761  1.00 15.00 ? 89 LEU A HD13 5  
ATOM 7027  H HD21 . LEU A 1 89 ? -1.218  0.465   -2.930  1.00 15.00 ? 89 LEU A HD21 5  
ATOM 7028  H HD22 . LEU A 1 89 ? -1.866  -1.103  -2.447  1.00 15.00 ? 89 LEU A HD22 5  
ATOM 7029  H HD23 . LEU A 1 89 ? -1.784  -0.673  -4.154  1.00 15.00 ? 89 LEU A HD23 5  
ATOM 7030  N N    . GLU A 1 90 ? -6.771  -1.898  -2.265  1.00 15.00 ? 90 GLU A N    5  
ATOM 7031  C CA   . GLU A 1 90 ? -8.200  -1.996  -2.019  1.00 15.00 ? 90 GLU A CA   5  
ATOM 7032  C C    . GLU A 1 90 ? -8.612  -0.949  -0.986  1.00 15.00 ? 90 GLU A C    5  
ATOM 7033  O O    . GLU A 1 90 ? -7.904  -0.724  -0.005  1.00 15.00 ? 90 GLU A O    5  
ATOM 7034  C CB   . GLU A 1 90 ? -8.563  -3.408  -1.540  1.00 15.00 ? 90 GLU A CB   5  
ATOM 7035  C CG   . GLU A 1 90 ? -9.661  -3.452  -0.485  1.00 15.00 ? 90 GLU A CG   5  
ATOM 7036  C CD   . GLU A 1 90 ? -9.989  -4.864  -0.042  1.00 15.00 ? 90 GLU A CD   5  
ATOM 7037  O OE1  . GLU A 1 90 ? -9.049  -5.672  0.113   1.00 15.00 ? 90 GLU A OE1  5  
ATOM 7038  O OE2  . GLU A 1 90 ? -11.187 -5.163  0.149   1.00 15.00 ? 90 GLU A OE2  5  
ATOM 7039  H H    . GLU A 1 90 ? -6.168  -1.753  -1.504  1.00 15.00 ? 90 GLU A H    5  
ATOM 7040  H HA   . GLU A 1 90 ? -8.713  -1.792  -2.946  1.00 15.00 ? 90 GLU A HA   5  
ATOM 7041  H HB2  . GLU A 1 90 ? -8.894  -3.984  -2.390  1.00 15.00 ? 90 GLU A HB2  5  
ATOM 7042  H HB3  . GLU A 1 90 ? -7.679  -3.872  -1.127  1.00 15.00 ? 90 GLU A HB3  5  
ATOM 7043  H HG2  . GLU A 1 90 ? -9.335  -2.888  0.377   1.00 15.00 ? 90 GLU A HG2  5  
ATOM 7044  H HG3  . GLU A 1 90 ? -10.553 -3.001  -0.894  1.00 15.00 ? 90 GLU A HG3  5  
ATOM 7045  N N    . LYS A 1 91 ? -9.751  -0.306  -1.213  1.00 15.00 ? 91 LYS A N    5  
ATOM 7046  C CA   . LYS A 1 91 ? -10.241 0.722   -0.301  1.00 15.00 ? 91 LYS A CA   5  
ATOM 7047  C C    . LYS A 1 91 ? -10.223 0.230   1.145   1.00 15.00 ? 91 LYS A C    5  
ATOM 7048  O O    . LYS A 1 91 ? -11.035 -0.607  1.539   1.00 15.00 ? 91 LYS A O    5  
ATOM 7049  C CB   . LYS A 1 91 ? -11.654 1.145   -0.701  1.00 15.00 ? 91 LYS A CB   5  
ATOM 7050  C CG   . LYS A 1 91 ? -12.116 2.431   -0.037  1.00 15.00 ? 91 LYS A CG   5  
ATOM 7051  C CD   . LYS A 1 91 ? -11.372 3.640   -0.582  1.00 15.00 ? 91 LYS A CD   5  
ATOM 7052  C CE   . LYS A 1 91 ? -11.847 4.007   -1.979  1.00 15.00 ? 91 LYS A CE   5  
ATOM 7053  N NZ   . LYS A 1 91 ? -12.263 5.435   -2.068  1.00 15.00 ? 91 LYS A NZ   5  
ATOM 7054  H H    . LYS A 1 91 ? -10.273 -0.523  -2.014  1.00 15.00 ? 91 LYS A H    5  
ATOM 7055  H HA   . LYS A 1 91 ? -9.584  1.575   -0.383  1.00 15.00 ? 91 LYS A HA   5  
ATOM 7056  H HB2  . LYS A 1 91 ? -11.680 1.286   -1.773  1.00 15.00 ? 91 LYS A HB2  5  
ATOM 7057  H HB3  . LYS A 1 91 ? -12.343 0.357   -0.433  1.00 15.00 ? 91 LYS A HB3  5  
ATOM 7058  H HG2  . LYS A 1 91 ? -13.173 2.560   -0.219  1.00 15.00 ? 91 LYS A HG2  5  
ATOM 7059  H HG3  . LYS A 1 91 ? -11.939 2.360   1.026   1.00 15.00 ? 91 LYS A HG3  5  
ATOM 7060  H HD2  . LYS A 1 91 ? -11.539 4.480   0.076   1.00 15.00 ? 91 LYS A HD2  5  
ATOM 7061  H HD3  . LYS A 1 91 ? -10.316 3.413   -0.618  1.00 15.00 ? 91 LYS A HD3  5  
ATOM 7062  H HE2  . LYS A 1 91 ? -11.041 3.833   -2.676  1.00 15.00 ? 91 LYS A HE2  5  
ATOM 7063  H HE3  . LYS A 1 91 ? -12.687 3.380   -2.237  1.00 15.00 ? 91 LYS A HE3  5  
ATOM 7064  H HZ1  . LYS A 1 91 ? -13.300 5.505   -2.080  1.00 15.00 ? 91 LYS A HZ1  5  
ATOM 7065  H HZ2  . LYS A 1 91 ? -11.899 5.965   -1.250  1.00 15.00 ? 91 LYS A HZ2  5  
ATOM 7066  H HZ3  . LYS A 1 91 ? -11.888 5.863   -2.938  1.00 15.00 ? 91 LYS A HZ3  5  
ATOM 7067  N N    . GLY A 1 92 ? -9.283  0.755   1.926   1.00 15.00 ? 92 GLY A N    5  
ATOM 7068  C CA   . GLY A 1 92 ? -9.163  0.360   3.318   1.00 15.00 ? 92 GLY A CA   5  
ATOM 7069  C C    . GLY A 1 92 ? -10.395 0.694   4.135   1.00 15.00 ? 92 GLY A C    5  
ATOM 7070  O O    . GLY A 1 92 ? -10.579 1.837   4.555   1.00 15.00 ? 92 GLY A O    5  
ATOM 7071  H H    . GLY A 1 92 ? -8.661  1.414   1.552   1.00 15.00 ? 92 GLY A H    5  
ATOM 7072  H HA2  . GLY A 1 92 ? -8.994  -0.706  3.364   1.00 15.00 ? 92 GLY A HA2  5  
ATOM 7073  H HA3  . GLY A 1 92 ? -8.311  0.865   3.750   1.00 15.00 ? 92 GLY A HA3  5  
ATOM 7074  N N    . GLN A 1 93 ? -11.238 -0.307  4.364   1.00 15.00 ? 93 GLN A N    5  
ATOM 7075  C CA   . GLN A 1 93 ? -12.457 -0.119  5.142   1.00 15.00 ? 93 GLN A CA   5  
ATOM 7076  C C    . GLN A 1 93 ? -12.177 -0.287  6.633   1.00 15.00 ? 93 GLN A C    5  
ATOM 7077  O O    . GLN A 1 93 ? -11.023 -0.286  7.061   1.00 15.00 ? 93 GLN A O    5  
ATOM 7078  C CB   . GLN A 1 93 ? -13.531 -1.112  4.691   1.00 15.00 ? 93 GLN A CB   5  
ATOM 7079  C CG   . GLN A 1 93 ? -14.796 -0.447  4.173   1.00 15.00 ? 93 GLN A CG   5  
ATOM 7080  C CD   . GLN A 1 93 ? -15.217 -0.971  2.814   1.00 15.00 ? 93 GLN A CD   5  
ATOM 7081  O OE1  . GLN A 1 93 ? -14.971 -0.338  1.788   1.00 15.00 ? 93 GLN A OE1  5  
ATOM 7082  N NE2  . GLN A 1 93 ? -15.857 -2.135  2.801   1.00 15.00 ? 93 GLN A NE2  5  
ATOM 7083  H H    . GLN A 1 93 ? -11.033 -1.196  4.006   1.00 15.00 ? 93 GLN A H    5  
ATOM 7084  H HA   . GLN A 1 93 ? -12.811 0.886   4.965   1.00 15.00 ? 93 GLN A HA   5  
ATOM 7085  H HB2  . GLN A 1 93 ? -13.125 -1.728  3.901   1.00 15.00 ? 93 GLN A HB2  5  
ATOM 7086  H HB3  . GLN A 1 93 ? -13.798 -1.744  5.526   1.00 15.00 ? 93 GLN A HB3  5  
ATOM 7087  H HG2  . GLN A 1 93 ? -15.596 -0.628  4.875   1.00 15.00 ? 93 GLN A HG2  5  
ATOM 7088  H HG3  . GLN A 1 93 ? -14.621 0.616   4.095   1.00 15.00 ? 93 GLN A HG3  5  
ATOM 7089  H HE21 . GLN A 1 93 ? -16.019 -2.584  3.657   1.00 15.00 ? 93 GLN A HE21 5  
ATOM 7090  H HE22 . GLN A 1 93 ? -16.141 -2.497  1.936   1.00 15.00 ? 93 GLN A HE22 5  
ATOM 7091  N N    . SER A 1 94 ? -13.239 -0.435  7.420   1.00 15.00 ? 94 SER A N    5  
ATOM 7092  C CA   . SER A 1 94 ? -13.101 -0.607  8.862   1.00 15.00 ? 94 SER A CA   5  
ATOM 7093  C C    . SER A 1 94 ? -12.303 -1.869  9.182   1.00 15.00 ? 94 SER A C    5  
ATOM 7094  O O    . SER A 1 94 ? -12.355 -2.850  8.441   1.00 15.00 ? 94 SER A O    5  
ATOM 7095  C CB   . SER A 1 94 ? -14.478 -0.679  9.524   1.00 15.00 ? 94 SER A CB   5  
ATOM 7096  O OG   . SER A 1 94 ? -14.985 0.617   9.791   1.00 15.00 ? 94 SER A OG   5  
ATOM 7097  H H    . SER A 1 94 ? -14.135 -0.430  7.022   1.00 15.00 ? 94 SER A H    5  
ATOM 7098  H HA   . SER A 1 94 ? -12.569 0.249   9.248   1.00 15.00 ? 94 SER A HA   5  
ATOM 7099  H HB2  . SER A 1 94 ? -15.165 -1.192  8.868   1.00 15.00 ? 94 SER A HB2  5  
ATOM 7100  H HB3  . SER A 1 94 ? -14.399 -1.220  10.456  1.00 15.00 ? 94 SER A HB3  5  
ATOM 7101  H HG   . SER A 1 94 ? -15.330 0.648   10.686  1.00 15.00 ? 94 SER A HG   5  
ATOM 7102  N N    . PRO A 1 95 ? -11.551 -1.860  10.296  1.00 15.00 ? 95 PRO A N    5  
ATOM 7103  C CA   . PRO A 1 95 ? -10.741 -3.009  10.710  1.00 15.00 ? 95 PRO A CA   5  
ATOM 7104  C C    . PRO A 1 95 ? -11.541 -4.307  10.727  1.00 15.00 ? 95 PRO A C    5  
ATOM 7105  O O    . PRO A 1 95 ? -12.698 -4.329  11.147  1.00 15.00 ? 95 PRO A O    5  
ATOM 7106  C CB   . PRO A 1 95 ? -10.294 -2.636  12.125  1.00 15.00 ? 95 PRO A CB   5  
ATOM 7107  C CG   . PRO A 1 95 ? -10.308 -1.147  12.145  1.00 15.00 ? 95 PRO A CG   5  
ATOM 7108  C CD   . PRO A 1 95 ? -11.433 -0.730  11.237  1.00 15.00 ? 95 PRO A CD   5  
ATOM 7109  H HA   . PRO A 1 95 ? -9.874  -3.130  10.076  1.00 15.00 ? 95 PRO A HA   5  
ATOM 7110  H HB2  . PRO A 1 95 ? -10.987 -3.049  12.844  1.00 15.00 ? 95 PRO A HB2  5  
ATOM 7111  H HB3  . PRO A 1 95 ? -9.303  -3.023  12.307  1.00 15.00 ? 95 PRO A HB3  5  
ATOM 7112  H HG2  . PRO A 1 95 ? -10.487 -0.795  13.150  1.00 15.00 ? 95 PRO A HG2  5  
ATOM 7113  H HG3  . PRO A 1 95 ? -9.367  -0.766  11.775  1.00 15.00 ? 95 PRO A HG3  5  
ATOM 7114  H HD2  . PRO A 1 95 ? -12.345 -0.601  11.801  1.00 15.00 ? 95 PRO A HD2  5  
ATOM 7115  H HD3  . PRO A 1 95 ? -11.179 0.181   10.715  1.00 15.00 ? 95 PRO A HD3  5  
ATOM 7116  N N    . THR A 1 96 ? -10.917 -5.387  10.267  1.00 15.00 ? 96 THR A N    5  
ATOM 7117  C CA   . THR A 1 96 ? -11.572 -6.690  10.228  1.00 15.00 ? 96 THR A CA   5  
ATOM 7118  C C    . THR A 1 96 ? -11.278 -7.484  11.497  1.00 15.00 ? 96 THR A C    5  
ATOM 7119  O O    . THR A 1 96 ? -10.624 -6.928  12.404  1.00 15.00 ? 96 THR A O    5  
ATOM 7120  C CB   . THR A 1 96 ? -11.113 -7.479  9.001   1.00 15.00 ? 96 THR A CB   5  
ATOM 7121  O OG1  . THR A 1 96 ? -11.716 -8.760  8.975   1.00 15.00 ? 96 THR A OG1  5  
ATOM 7122  C CG2  . THR A 1 96 ? -9.613  -7.676  8.943   1.00 15.00 ? 96 THR A CG2  5  
ATOM 7123  O OXT  . THR A 1 96 ? -11.706 -8.655  11.573  1.00 15.00 ? 96 THR A OXT  5  
ATOM 7124  H H    . THR A 1 96 ? -9.995  -5.306  9.945   1.00 15.00 ? 96 THR A H    5  
ATOM 7125  H HA   . THR A 1 96 ? -12.636 -6.523  10.160  1.00 15.00 ? 96 THR A HA   5  
ATOM 7126  H HB   . THR A 1 96 ? -11.411 -6.945  8.110   1.00 15.00 ? 96 THR A HB   5  
ATOM 7127  H HG1  . THR A 1 96 ? -12.535 -8.719  8.475   1.00 15.00 ? 96 THR A HG1  5  
ATOM 7128  H HG21 . THR A 1 96 ? -9.186  -6.981  8.236   1.00 15.00 ? 96 THR A HG21 5  
ATOM 7129  H HG22 . THR A 1 96 ? -9.189  -7.501  9.921   1.00 15.00 ? 96 THR A HG22 5  
ATOM 7130  H HG23 . THR A 1 96 ? -9.395  -8.687  8.632   1.00 15.00 ? 96 THR A HG23 5  
ATOM 7131  N N    . PRO A 1 1  ? -20.795 5.158   1.785   1.00 15.00 ? 1  PRO A N    6  
ATOM 7132  C CA   . PRO A 1 1  ? -19.575 4.755   2.538   1.00 15.00 ? 1  PRO A CA   6  
ATOM 7133  C C    . PRO A 1 1  ? -19.297 3.258   2.410   1.00 15.00 ? 1  PRO A C    6  
ATOM 7134  O O    . PRO A 1 1  ? -19.126 2.558   3.409   1.00 15.00 ? 1  PRO A O    6  
ATOM 7135  C CB   . PRO A 1 1  ? -19.791 5.135   4.000   1.00 15.00 ? 1  PRO A CB   6  
ATOM 7136  C CG   . PRO A 1 1  ? -21.049 5.937   3.990   1.00 15.00 ? 1  PRO A CG   6  
ATOM 7137  C CD   . PRO A 1 1  ? -21.830 5.484   2.781   1.00 15.00 ? 1  PRO A CD   6  
ATOM 7138  H H2   . PRO A 1 1  ? -20.952 4.352   1.158   1.00 15.00 ? 1  PRO A H2   6  
ATOM 7139  H H3   . PRO A 1 1  ? -20.415 5.907   1.159   1.00 15.00 ? 1  PRO A H3   6  
ATOM 7140  H HA   . PRO A 1 1  ? -18.732 5.306   2.149   1.00 15.00 ? 1  PRO A HA   6  
ATOM 7141  H HB2  . PRO A 1 1  ? -19.895 4.241   4.599   1.00 15.00 ? 1  PRO A HB2  6  
ATOM 7142  H HB3  . PRO A 1 1  ? -18.955 5.719   4.353   1.00 15.00 ? 1  PRO A HB3  6  
ATOM 7143  H HG2  . PRO A 1 1  ? -21.612 5.746   4.892   1.00 15.00 ? 1  PRO A HG2  6  
ATOM 7144  H HG3  . PRO A 1 1  ? -20.813 6.987   3.911   1.00 15.00 ? 1  PRO A HG3  6  
ATOM 7145  H HD2  . PRO A 1 1  ? -22.419 4.611   3.020   1.00 15.00 ? 1  PRO A HD2  6  
ATOM 7146  H HD3  . PRO A 1 1  ? -22.465 6.281   2.424   1.00 15.00 ? 1  PRO A HD3  6  
ATOM 7147  N N    . LYS A 1 2  ? -19.255 2.773   1.173   1.00 15.00 ? 2  LYS A N    6  
ATOM 7148  C CA   . LYS A 1 2  ? -19.001 1.365   0.911   1.00 15.00 ? 2  LYS A CA   6  
ATOM 7149  C C    . LYS A 1 2  ? -18.220 1.194   -0.391  1.00 15.00 ? 2  LYS A C    6  
ATOM 7150  O O    . LYS A 1 2  ? -18.804 0.958   -1.449  1.00 15.00 ? 2  LYS A O    6  
ATOM 7151  C CB   . LYS A 1 2  ? -20.326 0.601   0.838   1.00 15.00 ? 2  LYS A CB   6  
ATOM 7152  C CG   . LYS A 1 2  ? -20.173 -0.846  0.402   1.00 15.00 ? 2  LYS A CG   6  
ATOM 7153  C CD   . LYS A 1 2  ? -21.502 -1.440  -0.041  1.00 15.00 ? 2  LYS A CD   6  
ATOM 7154  C CE   . LYS A 1 2  ? -21.371 -2.167  -1.370  1.00 15.00 ? 2  LYS A CE   6  
ATOM 7155  N NZ   . LYS A 1 2  ? -22.569 -1.968  -2.233  1.00 15.00 ? 2  LYS A NZ   6  
ATOM 7156  H H    . LYS A 1 2  ? -19.401 3.375   0.417   1.00 15.00 ? 2  LYS A H    6  
ATOM 7157  H HA   . LYS A 1 2  ? -18.412 0.975   1.727   1.00 15.00 ? 2  LYS A HA   6  
ATOM 7158  H HB2  . LYS A 1 2  ? -20.788 0.612   1.814   1.00 15.00 ? 2  LYS A HB2  6  
ATOM 7159  H HB3  . LYS A 1 2  ? -20.977 1.099   0.136   1.00 15.00 ? 2  LYS A HB3  6  
ATOM 7160  H HG2  . LYS A 1 2  ? -19.479 -0.888  -0.422  1.00 15.00 ? 2  LYS A HG2  6  
ATOM 7161  H HG3  . LYS A 1 2  ? -19.788 -1.421  1.230   1.00 15.00 ? 2  LYS A HG3  6  
ATOM 7162  H HD2  . LYS A 1 2  ? -21.840 -2.139  0.708   1.00 15.00 ? 2  LYS A HD2  6  
ATOM 7163  H HD3  . LYS A 1 2  ? -22.224 -0.643  -0.146  1.00 15.00 ? 2  LYS A HD3  6  
ATOM 7164  H HE2  . LYS A 1 2  ? -20.501 -1.792  -1.887  1.00 15.00 ? 2  LYS A HE2  6  
ATOM 7165  H HE3  . LYS A 1 2  ? -21.248 -3.222  -1.178  1.00 15.00 ? 2  LYS A HE3  6  
ATOM 7166  H HZ1  . LYS A 1 2  ? -22.579 -2.672  -2.998  1.00 15.00 ? 2  LYS A HZ1  6  
ATOM 7167  H HZ2  . LYS A 1 2  ? -23.437 -2.072  -1.670  1.00 15.00 ? 2  LYS A HZ2  6  
ATOM 7168  H HZ3  . LYS A 1 2  ? -22.553 -1.016  -2.653  1.00 15.00 ? 2  LYS A HZ3  6  
ATOM 7169  N N    . PRO A 1 3  ? -16.882 1.312   -0.332  1.00 15.00 ? 3  PRO A N    6  
ATOM 7170  C CA   . PRO A 1 3  ? -16.028 1.170   -1.514  1.00 15.00 ? 3  PRO A CA   6  
ATOM 7171  C C    . PRO A 1 3  ? -16.004 -0.267  -2.043  1.00 15.00 ? 3  PRO A C    6  
ATOM 7172  O O    . PRO A 1 3  ? -16.830 -0.636  -2.878  1.00 15.00 ? 3  PRO A O    6  
ATOM 7173  C CB   . PRO A 1 3  ? -14.647 1.605   -1.013  1.00 15.00 ? 3  PRO A CB   6  
ATOM 7174  C CG   . PRO A 1 3  ? -14.680 1.366   0.458   1.00 15.00 ? 3  PRO A CG   6  
ATOM 7175  C CD   . PRO A 1 3  ? -16.103 1.596   0.888   1.00 15.00 ? 3  PRO A CD   6  
ATOM 7176  H HA   . PRO A 1 3  ? -16.348 1.831   -2.307  1.00 15.00 ? 3  PRO A HA   6  
ATOM 7177  H HB2  . PRO A 1 3  ? -13.883 1.013   -1.494  1.00 15.00 ? 3  PRO A HB2  6  
ATOM 7178  H HB3  . PRO A 1 3  ? -14.493 2.650   -1.238  1.00 15.00 ? 3  PRO A HB3  6  
ATOM 7179  H HG2  . PRO A 1 3  ? -14.384 0.350   0.673   1.00 15.00 ? 3  PRO A HG2  6  
ATOM 7180  H HG3  . PRO A 1 3  ? -14.022 2.061   0.957   1.00 15.00 ? 3  PRO A HG3  6  
ATOM 7181  H HD2  . PRO A 1 3  ? -16.371 0.916   1.683   1.00 15.00 ? 3  PRO A HD2  6  
ATOM 7182  H HD3  . PRO A 1 3  ? -16.241 2.620   1.202   1.00 15.00 ? 3  PRO A HD3  6  
ATOM 7183  N N    . GLY A 1 4  ? -15.063 -1.078  -1.559  1.00 15.00 ? 4  GLY A N    6  
ATOM 7184  C CA   . GLY A 1 4  ? -14.975 -2.457  -2.005  1.00 15.00 ? 4  GLY A CA   6  
ATOM 7185  C C    . GLY A 1 4  ? -14.150 -2.619  -3.269  1.00 15.00 ? 4  GLY A C    6  
ATOM 7186  O O    . GLY A 1 4  ? -13.333 -3.534  -3.371  1.00 15.00 ? 4  GLY A O    6  
ATOM 7187  H H    . GLY A 1 4  ? -14.430 -0.742  -0.893  1.00 15.00 ? 4  GLY A H    6  
ATOM 7188  H HA2  . GLY A 1 4  ? -14.526 -3.048  -1.220  1.00 15.00 ? 4  GLY A HA2  6  
ATOM 7189  H HA3  . GLY A 1 4  ? -15.972 -2.827  -2.191  1.00 15.00 ? 4  GLY A HA3  6  
ATOM 7190  N N    . ASP A 1 5  ? -14.367 -1.734  -4.237  1.00 15.00 ? 5  ASP A N    6  
ATOM 7191  C CA   . ASP A 1 5  ? -13.643 -1.788  -5.502  1.00 15.00 ? 5  ASP A CA   6  
ATOM 7192  C C    . ASP A 1 5  ? -12.149 -1.603  -5.297  1.00 15.00 ? 5  ASP A C    6  
ATOM 7193  O O    . ASP A 1 5  ? -11.707 -0.783  -4.493  1.00 15.00 ? 5  ASP A O    6  
ATOM 7194  C CB   . ASP A 1 5  ? -14.173 -0.722  -6.464  1.00 15.00 ? 5  ASP A CB   6  
ATOM 7195  C CG   . ASP A 1 5  ? -15.655 -0.882  -6.744  1.00 15.00 ? 5  ASP A CG   6  
ATOM 7196  O OD1  . ASP A 1 5  ? -16.098 -2.031  -6.952  1.00 15.00 ? 5  ASP A OD1  6  
ATOM 7197  O OD2  . ASP A 1 5  ? -16.371 0.141   -6.754  1.00 15.00 ? 5  ASP A OD2  6  
ATOM 7198  H H    . ASP A 1 5  ? -15.034 -1.031  -4.101  1.00 15.00 ? 5  ASP A H    6  
ATOM 7199  H HA   . ASP A 1 5  ? -13.803 -2.764  -5.940  1.00 15.00 ? 5  ASP A HA   6  
ATOM 7200  H HB2  . ASP A 1 5  ? -14.011 0.255   -6.033  1.00 15.00 ? 5  ASP A HB2  6  
ATOM 7201  H HB3  . ASP A 1 5  ? -13.638 -0.793  -7.399  1.00 15.00 ? 5  ASP A HB3  6  
ATOM 7202  N N    . ILE A 1 6  ? -11.385 -2.384  -6.043  1.00 15.00 ? 6  ILE A N    6  
ATOM 7203  C CA   . ILE A 1 6  ? -9.935  -2.347  -5.984  1.00 15.00 ? 6  ILE A CA   6  
ATOM 7204  C C    . ILE A 1 6  ? -9.394  -1.136  -6.743  1.00 15.00 ? 6  ILE A C    6  
ATOM 7205  O O    . ILE A 1 6  ? -10.010 -0.669  -7.701  1.00 15.00 ? 6  ILE A O    6  
ATOM 7206  C CB   . ILE A 1 6  ? -9.360  -3.647  -6.587  1.00 15.00 ? 6  ILE A CB   6  
ATOM 7207  C CG1  . ILE A 1 6  ? -9.012  -4.640  -5.479  1.00 15.00 ? 6  ILE A CG1  6  
ATOM 7208  C CG2  . ILE A 1 6  ? -8.139  -3.371  -7.459  1.00 15.00 ? 6  ILE A CG2  6  
ATOM 7209  C CD1  . ILE A 1 6  ? -10.178 -4.966  -4.571  1.00 15.00 ? 6  ILE A CD1  6  
ATOM 7210  H H    . ILE A 1 6  ? -11.815 -3.011  -6.661  1.00 15.00 ? 6  ILE A H    6  
ATOM 7211  H HA   . ILE A 1 6  ? -9.635  -2.287  -4.946  1.00 15.00 ? 6  ILE A HA   6  
ATOM 7212  H HB   . ILE A 1 6  ? -10.130 -4.081  -7.212  1.00 15.00 ? 6  ILE A HB   6  
ATOM 7213  H HG12 . ILE A 1 6  ? -8.671  -5.562  -5.924  1.00 15.00 ? 6  ILE A HG12 6  
ATOM 7214  H HG13 . ILE A 1 6  ? -8.221  -4.226  -4.872  1.00 15.00 ? 6  ILE A HG13 6  
ATOM 7215  H HG21 . ILE A 1 6  ? -7.411  -2.807  -6.892  1.00 15.00 ? 6  ILE A HG21 6  
ATOM 7216  H HG22 . ILE A 1 6  ? -7.702  -4.306  -7.775  1.00 15.00 ? 6  ILE A HG22 6  
ATOM 7217  H HG23 . ILE A 1 6  ? -8.437  -2.801  -8.327  1.00 15.00 ? 6  ILE A HG23 6  
ATOM 7218  H HD11 . ILE A 1 6  ? -10.480 -4.076  -4.039  1.00 15.00 ? 6  ILE A HD11 6  
ATOM 7219  H HD12 . ILE A 1 6  ? -11.004 -5.330  -5.163  1.00 15.00 ? 6  ILE A HD12 6  
ATOM 7220  H HD13 . ILE A 1 6  ? -9.881  -5.726  -3.863  1.00 15.00 ? 6  ILE A HD13 6  
ATOM 7221  N N    . PHE A 1 7  ? -8.234  -0.643  -6.324  1.00 15.00 ? 7  PHE A N    6  
ATOM 7222  C CA   . PHE A 1 7  ? -7.615  0.499   -6.984  1.00 15.00 ? 7  PHE A CA   6  
ATOM 7223  C C    . PHE A 1 7  ? -6.096  0.363   -6.984  1.00 15.00 ? 7  PHE A C    6  
ATOM 7224  O O    . PHE A 1 7  ? -5.538  -0.458  -6.260  1.00 15.00 ? 7  PHE A O    6  
ATOM 7225  C CB   . PHE A 1 7  ? -8.046  1.814   -6.320  1.00 15.00 ? 7  PHE A CB   6  
ATOM 7226  C CG   . PHE A 1 7  ? -7.288  2.162   -5.067  1.00 15.00 ? 7  PHE A CG   6  
ATOM 7227  C CD1  . PHE A 1 7  ? -5.980  2.618   -5.132  1.00 15.00 ? 7  PHE A CD1  6  
ATOM 7228  C CD2  . PHE A 1 7  ? -7.890  2.046   -3.825  1.00 15.00 ? 7  PHE A CD2  6  
ATOM 7229  C CE1  . PHE A 1 7  ? -5.289  2.951   -3.984  1.00 15.00 ? 7  PHE A CE1  6  
ATOM 7230  C CE2  . PHE A 1 7  ? -7.203  2.375   -2.673  1.00 15.00 ? 7  PHE A CE2  6  
ATOM 7231  C CZ   . PHE A 1 7  ? -5.901  2.829   -2.754  1.00 15.00 ? 7  PHE A CZ   6  
ATOM 7232  H H    . PHE A 1 7  ? -7.780  -1.062  -5.562  1.00 15.00 ? 7  PHE A H    6  
ATOM 7233  H HA   . PHE A 1 7  ? -7.955  0.500   -8.009  1.00 15.00 ? 7  PHE A HA   6  
ATOM 7234  H HB2  . PHE A 1 7  ? -7.905  2.622   -7.021  1.00 15.00 ? 7  PHE A HB2  6  
ATOM 7235  H HB3  . PHE A 1 7  ? -9.094  1.749   -6.065  1.00 15.00 ? 7  PHE A HB3  6  
ATOM 7236  H HD1  . PHE A 1 7  ? -5.498  2.712   -6.094  1.00 15.00 ? 7  PHE A HD1  6  
ATOM 7237  H HD2  . PHE A 1 7  ? -8.908  1.691   -3.761  1.00 15.00 ? 7  PHE A HD2  6  
ATOM 7238  H HE1  . PHE A 1 7  ? -4.271  3.305   -4.050  1.00 15.00 ? 7  PHE A HE1  6  
ATOM 7239  H HE2  . PHE A 1 7  ? -7.683  2.279   -1.710  1.00 15.00 ? 7  PHE A HE2  6  
ATOM 7240  H HZ   . PHE A 1 7  ? -5.363  3.091   -1.857  1.00 15.00 ? 7  PHE A HZ   6  
ATOM 7241  N N    . GLU A 1 8  ? -5.434  1.167   -7.809  1.00 15.00 ? 8  GLU A N    6  
ATOM 7242  C CA   . GLU A 1 8  ? -3.980  1.128   -7.912  1.00 15.00 ? 8  GLU A CA   6  
ATOM 7243  C C    . GLU A 1 8  ? -3.376  2.522   -7.794  1.00 15.00 ? 8  GLU A C    6  
ATOM 7244  O O    . GLU A 1 8  ? -3.934  3.503   -8.286  1.00 15.00 ? 8  GLU A O    6  
ATOM 7245  C CB   . GLU A 1 8  ? -3.570  0.507   -9.243  1.00 15.00 ? 8  GLU A CB   6  
ATOM 7246  C CG   . GLU A 1 8  ? -4.250  1.146   -10.437 1.00 15.00 ? 8  GLU A CG   6  
ATOM 7247  C CD   . GLU A 1 8  ? -4.223  0.263   -11.669 1.00 15.00 ? 8  GLU A CD   6  
ATOM 7248  O OE1  . GLU A 1 8  ? -4.287  -0.975  -11.514 1.00 15.00 ? 8  GLU A OE1  6  
ATOM 7249  O OE2  . GLU A 1 8  ? -4.139  0.809   -12.789 1.00 15.00 ? 8  GLU A OE2  6  
ATOM 7250  H H    . GLU A 1 8  ? -5.936  1.796   -8.368  1.00 15.00 ? 8  GLU A H    6  
ATOM 7251  H HA   . GLU A 1 8  ? -3.598  0.511   -7.107  1.00 15.00 ? 8  GLU A HA   6  
ATOM 7252  H HB2  . GLU A 1 8  ? -2.503  0.616   -9.364  1.00 15.00 ? 8  GLU A HB2  6  
ATOM 7253  H HB3  . GLU A 1 8  ? -3.820  -0.543  -9.231  1.00 15.00 ? 8  GLU A HB3  6  
ATOM 7254  H HG2  . GLU A 1 8  ? -5.277  1.348   -10.179 1.00 15.00 ? 8  GLU A HG2  6  
ATOM 7255  H HG3  . GLU A 1 8  ? -3.746  2.073   -10.663 1.00 15.00 ? 8  GLU A HG3  6  
ATOM 7256  N N    . VAL A 1 9  ? -2.218  2.588   -7.154  1.00 15.00 ? 9  VAL A N    6  
ATOM 7257  C CA   . VAL A 1 9  ? -1.495  3.841   -6.974  1.00 15.00 ? 9  VAL A CA   6  
ATOM 7258  C C    . VAL A 1 9  ? -0.357  3.921   -7.982  1.00 15.00 ? 9  VAL A C    6  
ATOM 7259  O O    . VAL A 1 9  ? 0.565   3.106   -7.955  1.00 15.00 ? 9  VAL A O    6  
ATOM 7260  C CB   . VAL A 1 9  ? -0.950  3.996   -5.526  1.00 15.00 ? 9  VAL A CB   6  
ATOM 7261  C CG1  . VAL A 1 9  ? -0.981  2.667   -4.783  1.00 15.00 ? 9  VAL A CG1  6  
ATOM 7262  C CG2  . VAL A 1 9  ? 0.460   4.577   -5.518  1.00 15.00 ? 9  VAL A CG2  6  
ATOM 7263  H H    . VAL A 1 9  ? -1.827  1.760   -6.809  1.00 15.00 ? 9  VAL A H    6  
ATOM 7264  H HA   . VAL A 1 9  ? -2.184  4.651   -7.171  1.00 15.00 ? 9  VAL A HA   6  
ATOM 7265  H HB   . VAL A 1 9  ? -1.597  4.684   -5.000  1.00 15.00 ? 9  VAL A HB   6  
ATOM 7266  H HG11 . VAL A 1 9  ? -1.931  2.178   -4.954  1.00 15.00 ? 9  VAL A HG11 6  
ATOM 7267  H HG12 . VAL A 1 9  ? -0.183  2.037   -5.143  1.00 15.00 ? 9  VAL A HG12 6  
ATOM 7268  H HG13 . VAL A 1 9  ? -0.852  2.843   -3.725  1.00 15.00 ? 9  VAL A HG13 6  
ATOM 7269  H HG21 . VAL A 1 9  ? 1.149   3.858   -5.936  1.00 15.00 ? 9  VAL A HG21 6  
ATOM 7270  H HG22 . VAL A 1 9  ? 0.481   5.481   -6.108  1.00 15.00 ? 9  VAL A HG22 6  
ATOM 7271  H HG23 . VAL A 1 9  ? 0.750   4.804   -4.502  1.00 15.00 ? 9  VAL A HG23 6  
ATOM 7272  N N    . GLU A 1 10 ? -0.441  4.884   -8.887  1.00 15.00 ? 10 GLU A N    6  
ATOM 7273  C CA   . GLU A 1 10 ? 0.570   5.041   -9.919  1.00 15.00 ? 10 GLU A CA   6  
ATOM 7274  C C    . GLU A 1 10 ? 1.485   6.235   -9.664  1.00 15.00 ? 10 GLU A C    6  
ATOM 7275  O O    . GLU A 1 10 ? 1.421   7.240   -10.372 1.00 15.00 ? 10 GLU A O    6  
ATOM 7276  C CB   . GLU A 1 10 ? -0.105  5.177   -11.278 1.00 15.00 ? 10 GLU A CB   6  
ATOM 7277  C CG   . GLU A 1 10 ? 0.869   5.312   -12.437 1.00 15.00 ? 10 GLU A CG   6  
ATOM 7278  C CD   . GLU A 1 10 ? 0.311   6.143   -13.575 1.00 15.00 ? 10 GLU A CD   6  
ATOM 7279  O OE1  . GLU A 1 10 ? -0.693  5.717   -14.185 1.00 15.00 ? 10 GLU A OE1  6  
ATOM 7280  O OE2  . GLU A 1 10 ? 0.877   7.220   -13.858 1.00 15.00 ? 10 GLU A OE2  6  
ATOM 7281  H H    . GLU A 1 10 ? -1.211  5.491   -8.872  1.00 15.00 ? 10 GLU A H    6  
ATOM 7282  H HA   . GLU A 1 10 ? 1.172   4.145   -9.924  1.00 15.00 ? 10 GLU A HA   6  
ATOM 7283  H HB2  . GLU A 1 10 ? -0.714  4.302   -11.445 1.00 15.00 ? 10 GLU A HB2  6  
ATOM 7284  H HB3  . GLU A 1 10 ? -0.739  6.050   -11.262 1.00 15.00 ? 10 GLU A HB3  6  
ATOM 7285  H HG2  . GLU A 1 10 ? 1.773   5.781   -12.080 1.00 15.00 ? 10 GLU A HG2  6  
ATOM 7286  H HG3  . GLU A 1 10 ? 1.101   4.325   -12.812 1.00 15.00 ? 10 GLU A HG3  6  
ATOM 7287  N N    . LEU A 1 11 ? 2.355   6.107   -8.671  1.00 15.00 ? 11 LEU A N    6  
ATOM 7288  C CA   . LEU A 1 11 ? 3.304   7.167   -8.353  1.00 15.00 ? 11 LEU A CA   6  
ATOM 7289  C C    . LEU A 1 11 ? 4.569   6.982   -9.184  1.00 15.00 ? 11 LEU A C    6  
ATOM 7290  O O    . LEU A 1 11 ? 4.770   5.926   -9.780  1.00 15.00 ? 11 LEU A O    6  
ATOM 7291  C CB   . LEU A 1 11 ? 3.647   7.160   -6.860  1.00 15.00 ? 11 LEU A CB   6  
ATOM 7292  C CG   . LEU A 1 11 ? 3.793   8.542   -6.215  1.00 15.00 ? 11 LEU A CG   6  
ATOM 7293  C CD1  . LEU A 1 11 ? 2.480   9.310   -6.273  1.00 15.00 ? 11 LEU A CD1  6  
ATOM 7294  C CD2  . LEU A 1 11 ? 4.267   8.409   -4.775  1.00 15.00 ? 11 LEU A CD2  6  
ATOM 7295  H H    . LEU A 1 11 ? 2.372   5.276   -8.154  1.00 15.00 ? 11 LEU A H    6  
ATOM 7296  H HA   . LEU A 1 11 ? 2.850   8.108   -8.610  1.00 15.00 ? 11 LEU A HA   6  
ATOM 7297  H HB2  . LEU A 1 11 ? 2.872   6.620   -6.340  1.00 15.00 ? 11 LEU A HB2  6  
ATOM 7298  H HB3  . LEU A 1 11 ? 4.578   6.630   -6.729  1.00 15.00 ? 11 LEU A HB3  6  
ATOM 7299  H HG   . LEU A 1 11 ? 4.534   9.109   -6.759  1.00 15.00 ? 11 LEU A HG   6  
ATOM 7300  H HD11 . LEU A 1 11 ? 1.963   9.073   -7.191  1.00 15.00 ? 11 LEU A HD11 6  
ATOM 7301  H HD12 . LEU A 1 11 ? 1.863   9.033   -5.431  1.00 15.00 ? 11 LEU A HD12 6  
ATOM 7302  H HD13 . LEU A 1 11 ? 2.681   10.371  -6.238  1.00 15.00 ? 11 LEU A HD13 6  
ATOM 7303  H HD21 . LEU A 1 11 ? 4.124   9.348   -4.260  1.00 15.00 ? 11 LEU A HD21 6  
ATOM 7304  H HD22 . LEU A 1 11 ? 3.698   7.637   -4.278  1.00 15.00 ? 11 LEU A HD22 6  
ATOM 7305  H HD23 . LEU A 1 11 ? 5.314   8.148   -4.763  1.00 15.00 ? 11 LEU A HD23 6  
ATOM 7306  N N    . ALA A 1 12 ? 5.418   8.000   -9.231  1.00 15.00 ? 12 ALA A N    6  
ATOM 7307  C CA   . ALA A 1 12 ? 6.653   7.913   -10.005 1.00 15.00 ? 12 ALA A CA   6  
ATOM 7308  C C    . ALA A 1 12 ? 7.829   7.513   -9.123  1.00 15.00 ? 12 ALA A C    6  
ATOM 7309  O O    . ALA A 1 12 ? 8.491   8.363   -8.529  1.00 15.00 ? 12 ALA A O    6  
ATOM 7310  C CB   . ALA A 1 12 ? 6.941   9.231   -10.704 1.00 15.00 ? 12 ALA A CB   6  
ATOM 7311  H H    . ALA A 1 12 ? 5.211   8.823   -8.741  1.00 15.00 ? 12 ALA A H    6  
ATOM 7312  H HA   . ALA A 1 12 ? 6.515   7.155   -10.765 1.00 15.00 ? 12 ALA A HA   6  
ATOM 7313  H HB1  . ALA A 1 12 ? 7.640   9.062   -11.511 1.00 15.00 ? 12 ALA A HB1  6  
ATOM 7314  H HB2  . ALA A 1 12 ? 6.022   9.636   -11.102 1.00 15.00 ? 12 ALA A HB2  6  
ATOM 7315  H HB3  . ALA A 1 12 ? 7.367   9.928   -9.998  1.00 15.00 ? 12 ALA A HB3  6  
ATOM 7316  N N    . LYS A 1 13 ? 8.082   6.211   -9.048  1.00 15.00 ? 13 LYS A N    6  
ATOM 7317  C CA   . LYS A 1 13 ? 9.179   5.685   -8.243  1.00 15.00 ? 13 LYS A CA   6  
ATOM 7318  C C    . LYS A 1 13 ? 10.503  6.349   -8.620  1.00 15.00 ? 13 LYS A C    6  
ATOM 7319  O O    . LYS A 1 13 ? 11.409  6.466   -7.797  1.00 15.00 ? 13 LYS A O    6  
ATOM 7320  C CB   . LYS A 1 13 ? 9.277   4.169   -8.422  1.00 15.00 ? 13 LYS A CB   6  
ATOM 7321  C CG   . LYS A 1 13 ? 9.771   3.440   -7.186  1.00 15.00 ? 13 LYS A CG   6  
ATOM 7322  C CD   . LYS A 1 13 ? 11.164  3.897   -6.794  1.00 15.00 ? 13 LYS A CD   6  
ATOM 7323  C CE   . LYS A 1 13 ? 11.120  4.870   -5.627  1.00 15.00 ? 13 LYS A CE   6  
ATOM 7324  N NZ   . LYS A 1 13 ? 12.373  5.667   -5.520  1.00 15.00 ? 13 LYS A NZ   6  
ATOM 7325  H H    . LYS A 1 13 ? 7.518   5.586   -9.548  1.00 15.00 ? 13 LYS A H    6  
ATOM 7326  H HA   . LYS A 1 13 ? 8.964   5.903   -7.208  1.00 15.00 ? 13 LYS A HA   6  
ATOM 7327  H HB2  . LYS A 1 13 ? 8.299   3.785   -8.671  1.00 15.00 ? 13 LYS A HB2  6  
ATOM 7328  H HB3  . LYS A 1 13 ? 9.955   3.954   -9.235  1.00 15.00 ? 13 LYS A HB3  6  
ATOM 7329  H HG2  . LYS A 1 13 ? 9.094   3.637   -6.368  1.00 15.00 ? 13 LYS A HG2  6  
ATOM 7330  H HG3  . LYS A 1 13 ? 9.793   2.381   -7.390  1.00 15.00 ? 13 LYS A HG3  6  
ATOM 7331  H HD2  . LYS A 1 13 ? 11.749  3.035   -6.510  1.00 15.00 ? 13 LYS A HD2  6  
ATOM 7332  H HD3  . LYS A 1 13 ? 11.623  4.383   -7.644  1.00 15.00 ? 13 LYS A HD3  6  
ATOM 7333  H HE2  . LYS A 1 13 ? 10.287  5.542   -5.767  1.00 15.00 ? 13 LYS A HE2  6  
ATOM 7334  H HE3  . LYS A 1 13 ? 10.980  4.310   -4.714  1.00 15.00 ? 13 LYS A HE3  6  
ATOM 7335  H HZ1  . LYS A 1 13 ? 13.141  5.076   -5.142  1.00 15.00 ? 13 LYS A HZ1  6  
ATOM 7336  H HZ2  . LYS A 1 13 ? 12.652  6.022   -6.456  1.00 15.00 ? 13 LYS A HZ2  6  
ATOM 7337  H HZ3  . LYS A 1 13 ? 12.228  6.477   -4.883  1.00 15.00 ? 13 LYS A HZ3  6  
ATOM 7338  N N    . ASN A 1 14 ? 10.602  6.790   -9.868  1.00 15.00 ? 14 ASN A N    6  
ATOM 7339  C CA   . ASN A 1 14 ? 11.812  7.445   -10.354 1.00 15.00 ? 14 ASN A CA   6  
ATOM 7340  C C    . ASN A 1 14 ? 11.799  8.928   -10.003 1.00 15.00 ? 14 ASN A C    6  
ATOM 7341  O O    . ASN A 1 14 ? 12.787  9.467   -9.504  1.00 15.00 ? 14 ASN A O    6  
ATOM 7342  C CB   . ASN A 1 14 ? 11.933  7.282   -11.870 1.00 15.00 ? 14 ASN A CB   6  
ATOM 7343  C CG   . ASN A 1 14 ? 12.375  5.891   -12.277 1.00 15.00 ? 14 ASN A CG   6  
ATOM 7344  O OD1  . ASN A 1 14 ? 12.937  5.144   -11.476 1.00 15.00 ? 14 ASN A OD1  6  
ATOM 7345  N ND2  . ASN A 1 14 ? 12.121  5.537   -13.532 1.00 15.00 ? 14 ASN A ND2  6  
ATOM 7346  H H    . ASN A 1 14 ? 9.846   6.672   -10.475 1.00 15.00 ? 14 ASN A H    6  
ATOM 7347  H HA   . ASN A 1 14 ? 12.661  6.978   -9.878  1.00 15.00 ? 14 ASN A HA   6  
ATOM 7348  H HB2  . ASN A 1 14 ? 10.973  7.479   -12.323 1.00 15.00 ? 14 ASN A HB2  6  
ATOM 7349  H HB3  . ASN A 1 14 ? 12.655  7.993   -12.245 1.00 15.00 ? 14 ASN A HB3  6  
ATOM 7350  H HD21 . ASN A 1 14 ? 11.668  6.185   -14.112 1.00 15.00 ? 14 ASN A HD21 6  
ATOM 7351  H HD22 . ASN A 1 14 ? 12.398  4.646   -13.828 1.00 15.00 ? 14 ASN A HD22 6  
ATOM 7352  N N    . ASP A 1 15 ? 10.673  9.583   -10.264 1.00 15.00 ? 15 ASP A N    6  
ATOM 7353  C CA   . ASP A 1 15 ? 10.535  11.004  -9.972  1.00 15.00 ? 15 ASP A CA   6  
ATOM 7354  C C    . ASP A 1 15 ? 10.640  11.257  -8.472  1.00 15.00 ? 15 ASP A C    6  
ATOM 7355  O O    . ASP A 1 15 ? 11.219  12.254  -8.040  1.00 15.00 ? 15 ASP A O    6  
ATOM 7356  C CB   . ASP A 1 15 ? 9.198   11.528  -10.500 1.00 15.00 ? 15 ASP A CB   6  
ATOM 7357  C CG   . ASP A 1 15 ? 9.338   12.864  -11.204 1.00 15.00 ? 15 ASP A CG   6  
ATOM 7358  O OD1  . ASP A 1 15 ? 10.043  13.746  -10.670 1.00 15.00 ? 15 ASP A OD1  6  
ATOM 7359  O OD2  . ASP A 1 15 ? 8.743   13.028  -12.290 1.00 15.00 ? 15 ASP A OD2  6  
ATOM 7360  H H    . ASP A 1 15 ? 9.919   9.100   -10.660 1.00 15.00 ? 15 ASP A H    6  
ATOM 7361  H HA   . ASP A 1 15 ? 11.338  11.525  -10.470 1.00 15.00 ? 15 ASP A HA   6  
ATOM 7362  H HB2  . ASP A 1 15 ? 8.790   10.815  -11.201 1.00 15.00 ? 15 ASP A HB2  6  
ATOM 7363  H HB3  . ASP A 1 15 ? 8.512   11.647  -9.674  1.00 15.00 ? 15 ASP A HB3  6  
ATOM 7364  N N    . ASN A 1 16 ? 10.077  10.348  -7.681  1.00 15.00 ? 16 ASN A N    6  
ATOM 7365  C CA   . ASN A 1 16 ? 10.110  10.475  -6.229  1.00 15.00 ? 16 ASN A CA   6  
ATOM 7366  C C    . ASN A 1 16 ? 9.726   9.162   -5.553  1.00 15.00 ? 16 ASN A C    6  
ATOM 7367  O O    . ASN A 1 16 ? 9.035   8.328   -6.138  1.00 15.00 ? 16 ASN A O    6  
ATOM 7368  C CB   . ASN A 1 16 ? 9.166   11.589  -5.775  1.00 15.00 ? 16 ASN A CB   6  
ATOM 7369  C CG   . ASN A 1 16 ? 7.753   11.393  -6.289  1.00 15.00 ? 16 ASN A CG   6  
ATOM 7370  O OD1  . ASN A 1 16 ? 7.244   10.273  -6.327  1.00 15.00 ? 16 ASN A OD1  6  
ATOM 7371  N ND2  . ASN A 1 16 ? 7.112   12.485  -6.687  1.00 15.00 ? 16 ASN A ND2  6  
ATOM 7372  H H    . ASN A 1 16 ? 9.631   9.574   -8.084  1.00 15.00 ? 16 ASN A H    6  
ATOM 7373  H HA   . ASN A 1 16 ? 11.119  10.732  -5.942  1.00 15.00 ? 16 ASN A HA   6  
ATOM 7374  H HB2  . ASN A 1 16 ? 9.137   11.611  -4.696  1.00 15.00 ? 16 ASN A HB2  6  
ATOM 7375  H HB3  . ASN A 1 16 ? 9.535   12.536  -6.141  1.00 15.00 ? 16 ASN A HB3  6  
ATOM 7376  H HD21 . ASN A 1 16 ? 7.580   13.344  -6.628  1.00 15.00 ? 16 ASN A HD21 6  
ATOM 7377  H HD22 . ASN A 1 16 ? 6.197   12.388  -7.024  1.00 15.00 ? 16 ASN A HD22 6  
ATOM 7378  N N    . SER A 1 17 ? 10.171  8.990   -4.313  1.00 15.00 ? 17 SER A N    6  
ATOM 7379  C CA   . SER A 1 17 ? 9.868   7.785   -3.549  1.00 15.00 ? 17 SER A CA   6  
ATOM 7380  C C    . SER A 1 17 ? 8.524   7.934   -2.837  1.00 15.00 ? 17 SER A C    6  
ATOM 7381  O O    . SER A 1 17 ? 7.633   8.623   -3.330  1.00 15.00 ? 17 SER A O    6  
ATOM 7382  C CB   . SER A 1 17 ? 10.982  7.512   -2.536  1.00 15.00 ? 17 SER A CB   6  
ATOM 7383  O OG   . SER A 1 17 ? 12.203  8.103   -2.947  1.00 15.00 ? 17 SER A OG   6  
ATOM 7384  H H    . SER A 1 17 ? 10.712  9.694   -3.898  1.00 15.00 ? 17 SER A H    6  
ATOM 7385  H HA   . SER A 1 17 ? 9.808   6.957   -4.241  1.00 15.00 ? 17 SER A HA   6  
ATOM 7386  H HB2  . SER A 1 17 ? 10.701  7.925   -1.578  1.00 15.00 ? 17 SER A HB2  6  
ATOM 7387  H HB3  . SER A 1 17 ? 11.125  6.446   -2.439  1.00 15.00 ? 17 SER A HB3  6  
ATOM 7388  H HG   . SER A 1 17 ? 12.544  8.658   -2.242  1.00 15.00 ? 17 SER A HG   6  
ATOM 7389  N N    . LEU A 1 18 ? 8.375   7.297   -1.677  1.00 15.00 ? 18 LEU A N    6  
ATOM 7390  C CA   . LEU A 1 18 ? 7.132   7.387   -0.921  1.00 15.00 ? 18 LEU A CA   6  
ATOM 7391  C C    . LEU A 1 18 ? 7.380   7.995   0.457   1.00 15.00 ? 18 LEU A C    6  
ATOM 7392  O O    . LEU A 1 18 ? 8.476   8.475   0.748   1.00 15.00 ? 18 LEU A O    6  
ATOM 7393  C CB   . LEU A 1 18 ? 6.482   6.005   -0.779  1.00 15.00 ? 18 LEU A CB   6  
ATOM 7394  C CG   . LEU A 1 18 ? 6.169   5.298   -2.099  1.00 15.00 ? 18 LEU A CG   6  
ATOM 7395  C CD1  . LEU A 1 18 ? 5.363   6.207   -3.014  1.00 15.00 ? 18 LEU A CD1  6  
ATOM 7396  C CD2  . LEU A 1 18 ? 7.454   4.854   -2.782  1.00 15.00 ? 18 LEU A CD2  6  
ATOM 7397  H H    . LEU A 1 18 ? 9.114   6.761   -1.322  1.00 15.00 ? 18 LEU A H    6  
ATOM 7398  H HA   . LEU A 1 18 ? 6.465   8.035   -1.469  1.00 15.00 ? 18 LEU A HA   6  
ATOM 7399  H HB2  . LEU A 1 18 ? 7.146   5.375   -0.205  1.00 15.00 ? 18 LEU A HB2  6  
ATOM 7400  H HB3  . LEU A 1 18 ? 5.556   6.116   -0.229  1.00 15.00 ? 18 LEU A HB3  6  
ATOM 7401  H HG   . LEU A 1 18 ? 5.576   4.419   -1.896  1.00 15.00 ? 18 LEU A HG   6  
ATOM 7402  H HD11 . LEU A 1 18 ? 5.893   7.138   -3.154  1.00 15.00 ? 18 LEU A HD11 6  
ATOM 7403  H HD12 . LEU A 1 18 ? 5.225   5.725   -3.970  1.00 15.00 ? 18 LEU A HD12 6  
ATOM 7404  H HD13 . LEU A 1 18 ? 4.400   6.405   -2.567  1.00 15.00 ? 18 LEU A HD13 6  
ATOM 7405  H HD21 . LEU A 1 18 ? 7.729   5.576   -3.537  1.00 15.00 ? 18 LEU A HD21 6  
ATOM 7406  H HD22 . LEU A 1 18 ? 8.244   4.780   -2.050  1.00 15.00 ? 18 LEU A HD22 6  
ATOM 7407  H HD23 . LEU A 1 18 ? 7.301   3.890   -3.245  1.00 15.00 ? 18 LEU A HD23 6  
ATOM 7408  N N    . GLY A 1 19 ? 6.353   7.973   1.297   1.00 15.00 ? 19 GLY A N    6  
ATOM 7409  C CA   . GLY A 1 19 ? 6.467   8.526   2.632   1.00 15.00 ? 19 GLY A CA   6  
ATOM 7410  C C    . GLY A 1 19 ? 5.353   8.055   3.532   1.00 15.00 ? 19 GLY A C    6  
ATOM 7411  O O    . GLY A 1 19 ? 4.754   8.846   4.255   1.00 15.00 ? 19 GLY A O    6  
ATOM 7412  H H    . GLY A 1 19 ? 5.506   7.579   1.007   1.00 15.00 ? 19 GLY A H    6  
ATOM 7413  H HA2  . GLY A 1 19 ? 7.414   8.232   3.061   1.00 15.00 ? 19 GLY A HA2  6  
ATOM 7414  H HA3  . GLY A 1 19 ? 6.429   9.601   2.567   1.00 15.00 ? 19 GLY A HA3  6  
ATOM 7415  N N    . ILE A 1 20 ? 5.062   6.767   3.468   1.00 15.00 ? 20 ILE A N    6  
ATOM 7416  C CA   . ILE A 1 20 ? 4.002   6.182   4.270   1.00 15.00 ? 20 ILE A CA   6  
ATOM 7417  C C    . ILE A 1 20 ? 4.548   5.220   5.318   1.00 15.00 ? 20 ILE A C    6  
ATOM 7418  O O    . ILE A 1 20 ? 5.387   4.369   5.022   1.00 15.00 ? 20 ILE A O    6  
ATOM 7419  C CB   . ILE A 1 20 ? 2.980   5.452   3.372   1.00 15.00 ? 20 ILE A CB   6  
ATOM 7420  C CG1  . ILE A 1 20 ? 1.581   5.990   3.642   1.00 15.00 ? 20 ILE A CG1  6  
ATOM 7421  C CG2  . ILE A 1 20 ? 3.022   3.951   3.600   1.00 15.00 ? 20 ILE A CG2  6  
ATOM 7422  C CD1  . ILE A 1 20 ? 0.474   5.010   3.341   1.00 15.00 ? 20 ILE A CD1  6  
ATOM 7423  H H    . ILE A 1 20 ? 5.569   6.193   2.856   1.00 15.00 ? 20 ILE A H    6  
ATOM 7424  H HA   . ILE A 1 20 ? 3.483   6.981   4.782   1.00 15.00 ? 20 ILE A HA   6  
ATOM 7425  H HB   . ILE A 1 20 ? 3.237   5.644   2.344   1.00 15.00 ? 20 ILE A HB   6  
ATOM 7426  H HG12 . ILE A 1 20 ? 1.512   6.245   4.682   1.00 15.00 ? 20 ILE A HG12 6  
ATOM 7427  H HG13 . ILE A 1 20 ? 1.419   6.873   3.045   1.00 15.00 ? 20 ILE A HG13 6  
ATOM 7428  H HG21 . ILE A 1 20 ? 4.032   3.594   3.470   1.00 15.00 ? 20 ILE A HG21 6  
ATOM 7429  H HG22 . ILE A 1 20 ? 2.687   3.739   4.604   1.00 15.00 ? 20 ILE A HG22 6  
ATOM 7430  H HG23 . ILE A 1 20 ? 2.371   3.462   2.893   1.00 15.00 ? 20 ILE A HG23 6  
ATOM 7431  H HD11 . ILE A 1 20 ? -0.383  5.540   2.956   1.00 15.00 ? 20 ILE A HD11 6  
ATOM 7432  H HD12 . ILE A 1 20 ? 0.820   4.297   2.611   1.00 15.00 ? 20 ILE A HD12 6  
ATOM 7433  H HD13 . ILE A 1 20 ? 0.201   4.495   4.247   1.00 15.00 ? 20 ILE A HD13 6  
ATOM 7434  N N    . SER A 1 21 ? 4.028   5.330   6.531   1.00 15.00 ? 21 SER A N    6  
ATOM 7435  C CA   . SER A 1 21 ? 4.418   4.438   7.607   1.00 15.00 ? 21 SER A CA   6  
ATOM 7436  C C    . SER A 1 21 ? 3.482   3.237   7.574   1.00 15.00 ? 21 SER A C    6  
ATOM 7437  O O    . SER A 1 21 ? 2.311   3.345   7.934   1.00 15.00 ? 21 SER A O    6  
ATOM 7438  C CB   . SER A 1 21 ? 4.349   5.156   8.958   1.00 15.00 ? 21 SER A CB   6  
ATOM 7439  O OG   . SER A 1 21 ? 4.567   4.253   10.029  1.00 15.00 ? 21 SER A OG   6  
ATOM 7440  H H    . SER A 1 21 ? 3.337   6.003   6.695   1.00 15.00 ? 21 SER A H    6  
ATOM 7441  H HA   . SER A 1 21 ? 5.430   4.106   7.422   1.00 15.00 ? 21 SER A HA   6  
ATOM 7442  H HB2  . SER A 1 21 ? 5.107   5.927   8.993   1.00 15.00 ? 21 SER A HB2  6  
ATOM 7443  H HB3  . SER A 1 21 ? 3.376   5.607   9.075   1.00 15.00 ? 21 SER A HB3  6  
ATOM 7444  H HG   . SER A 1 21 ? 5.300   3.672   9.813   1.00 15.00 ? 21 SER A HG   6  
ATOM 7445  N N    . VAL A 1 22 ? 3.985   2.111   7.080   1.00 15.00 ? 22 VAL A N    6  
ATOM 7446  C CA   . VAL A 1 22 ? 3.163   0.916   6.935   1.00 15.00 ? 22 VAL A CA   6  
ATOM 7447  C C    . VAL A 1 22 ? 3.255   -0.016  8.133   1.00 15.00 ? 22 VAL A C    6  
ATOM 7448  O O    . VAL A 1 22 ? 4.263   -0.057  8.839   1.00 15.00 ? 22 VAL A O    6  
ATOM 7449  C CB   . VAL A 1 22 ? 3.545   0.141   5.659   1.00 15.00 ? 22 VAL A CB   6  
ATOM 7450  C CG1  . VAL A 1 22 ? 3.495   1.056   4.447   1.00 15.00 ? 22 VAL A CG1  6  
ATOM 7451  C CG2  . VAL A 1 22 ? 4.929   -0.478  5.792   1.00 15.00 ? 22 VAL A CG2  6  
ATOM 7452  H H    . VAL A 1 22 ? 4.913   2.097   6.765   1.00 15.00 ? 22 VAL A H    6  
ATOM 7453  H HA   . VAL A 1 22 ? 2.137   1.237   6.834   1.00 15.00 ? 22 VAL A HA   6  
ATOM 7454  H HB   . VAL A 1 22 ? 2.829   -0.654  5.513   1.00 15.00 ? 22 VAL A HB   6  
ATOM 7455  H HG11 . VAL A 1 22 ? 3.912   2.019   4.707   1.00 15.00 ? 22 VAL A HG11 6  
ATOM 7456  H HG12 . VAL A 1 22 ? 4.073   0.618   3.645   1.00 15.00 ? 22 VAL A HG12 6  
ATOM 7457  H HG13 . VAL A 1 22 ? 2.470   1.182   4.129   1.00 15.00 ? 22 VAL A HG13 6  
ATOM 7458  H HG21 . VAL A 1 22 ? 5.674   0.237   5.477   1.00 15.00 ? 22 VAL A HG21 6  
ATOM 7459  H HG22 . VAL A 1 22 ? 5.107   -0.751  6.820   1.00 15.00 ? 22 VAL A HG22 6  
ATOM 7460  H HG23 . VAL A 1 22 ? 4.990   -1.358  5.170   1.00 15.00 ? 22 VAL A HG23 6  
ATOM 7461  N N    . THR A 1 23 ? 2.176   -0.760  8.349   1.00 15.00 ? 23 THR A N    6  
ATOM 7462  C CA   . THR A 1 23 ? 2.092   -1.699  9.454   1.00 15.00 ? 23 THR A CA   6  
ATOM 7463  C C    . THR A 1 23 ? 1.196   -2.884  9.089   1.00 15.00 ? 23 THR A C    6  
ATOM 7464  O O    . THR A 1 23 ? 0.691   -2.971  7.967   1.00 15.00 ? 23 THR A O    6  
ATOM 7465  C CB   . THR A 1 23 ? 1.561   -0.981  10.695  1.00 15.00 ? 23 THR A CB   6  
ATOM 7466  O OG1  . THR A 1 23 ? 1.645   0.420   10.529  1.00 15.00 ? 23 THR A OG1  6  
ATOM 7467  C CG2  . THR A 1 23 ? 2.310   -1.335  11.958  1.00 15.00 ? 23 THR A CG2  6  
ATOM 7468  H H    . THR A 1 23 ? 1.409   -0.669  7.746   1.00 15.00 ? 23 THR A H    6  
ATOM 7469  H HA   . THR A 1 23 ? 3.089   -2.064  9.657   1.00 15.00 ? 23 THR A HA   6  
ATOM 7470  H HB   . THR A 1 23 ? 0.523   -1.238  10.838  1.00 15.00 ? 23 THR A HB   6  
ATOM 7471  H HG1  . THR A 1 23 ? 1.170   0.673   9.736   1.00 15.00 ? 23 THR A HG1  6  
ATOM 7472  H HG21 . THR A 1 23 ? 1.607   -1.611  12.729  1.00 15.00 ? 23 THR A HG21 6  
ATOM 7473  H HG22 . THR A 1 23 ? 2.974   -2.163  11.761  1.00 15.00 ? 23 THR A HG22 6  
ATOM 7474  H HG23 . THR A 1 23 ? 2.885   -0.480  12.282  1.00 15.00 ? 23 THR A HG23 6  
ATOM 7475  N N    . GLY A 1 24 ? 1.001   -3.794  10.040  1.00 15.00 ? 24 GLY A N    6  
ATOM 7476  C CA   . GLY A 1 24 ? 0.166   -4.957  9.793   1.00 15.00 ? 24 GLY A CA   6  
ATOM 7477  C C    . GLY A 1 24 ? 0.840   -5.970  8.888   1.00 15.00 ? 24 GLY A C    6  
ATOM 7478  O O    . GLY A 1 24 ? 1.915   -6.475  9.207   1.00 15.00 ? 24 GLY A O    6  
ATOM 7479  H H    . GLY A 1 24 ? 1.427   -3.675  10.915  1.00 15.00 ? 24 GLY A H    6  
ATOM 7480  H HA2  . GLY A 1 24 ? -0.065  -5.430  10.736  1.00 15.00 ? 24 GLY A HA2  6  
ATOM 7481  H HA3  . GLY A 1 24 ? -0.753  -4.633  9.328   1.00 15.00 ? 24 GLY A HA3  6  
ATOM 7482  N N    . GLY A 1 25 ? 0.211   -6.257  7.752   1.00 15.00 ? 25 GLY A N    6  
ATOM 7483  C CA   . GLY A 1 25 ? 0.775   -7.203  6.804   1.00 15.00 ? 25 GLY A CA   6  
ATOM 7484  C C    . GLY A 1 25 ? 0.818   -8.628  7.322   1.00 15.00 ? 25 GLY A C    6  
ATOM 7485  O O    . GLY A 1 25 ? 0.148   -9.507  6.781   1.00 15.00 ? 25 GLY A O    6  
ATOM 7486  H H    . GLY A 1 25 ? -0.640  -5.815  7.550   1.00 15.00 ? 25 GLY A H    6  
ATOM 7487  H HA2  . GLY A 1 25 ? 0.189   -7.183  5.903   1.00 15.00 ? 25 GLY A HA2  6  
ATOM 7488  H HA3  . GLY A 1 25 ? 1.777   -6.891  6.566   1.00 15.00 ? 25 GLY A HA3  6  
ATOM 7489  N N    . VAL A 1 26 ? 1.624   -8.854  8.361   1.00 15.00 ? 26 VAL A N    6  
ATOM 7490  C CA   . VAL A 1 26 ? 1.788   -10.182 8.968   1.00 15.00 ? 26 VAL A CA   6  
ATOM 7491  C C    . VAL A 1 26 ? 0.569   -11.078 8.759   1.00 15.00 ? 26 VAL A C    6  
ATOM 7492  O O    . VAL A 1 26 ? -0.569  -10.657 8.962   1.00 15.00 ? 26 VAL A O    6  
ATOM 7493  C CB   . VAL A 1 26 ? 2.076   -10.076 10.480  1.00 15.00 ? 26 VAL A CB   6  
ATOM 7494  C CG1  . VAL A 1 26 ? 3.570   -10.164 10.748  1.00 15.00 ? 26 VAL A CG1  6  
ATOM 7495  C CG2  . VAL A 1 26 ? 1.503   -8.786  11.044  1.00 15.00 ? 26 VAL A CG2  6  
ATOM 7496  H H    . VAL A 1 26 ? 2.135   -8.104  8.730   1.00 15.00 ? 26 VAL A H    6  
ATOM 7497  H HA   . VAL A 1 26 ? 2.641   -10.651 8.501   1.00 15.00 ? 26 VAL A HA   6  
ATOM 7498  H HB   . VAL A 1 26 ? 1.595   -10.906 10.978  1.00 15.00 ? 26 VAL A HB   6  
ATOM 7499  H HG11 . VAL A 1 26 ? 3.947   -11.108 10.382  1.00 15.00 ? 26 VAL A HG11 6  
ATOM 7500  H HG12 . VAL A 1 26 ? 4.075   -9.355  10.240  1.00 15.00 ? 26 VAL A HG12 6  
ATOM 7501  H HG13 . VAL A 1 26 ? 3.751   -10.091 11.810  1.00 15.00 ? 26 VAL A HG13 6  
ATOM 7502  H HG21 . VAL A 1 26 ? 2.264   -8.021  11.032  1.00 15.00 ? 26 VAL A HG21 6  
ATOM 7503  H HG22 . VAL A 1 26 ? 0.667   -8.471  10.437  1.00 15.00 ? 26 VAL A HG22 6  
ATOM 7504  H HG23 . VAL A 1 26 ? 1.171   -8.951  12.058  1.00 15.00 ? 26 VAL A HG23 6  
ATOM 7505  N N    . ASN A 1 27 ? 0.825   -12.316 8.347   1.00 15.00 ? 27 ASN A N    6  
ATOM 7506  C CA   . ASN A 1 27 ? -0.239  -13.281 8.102   1.00 15.00 ? 27 ASN A CA   6  
ATOM 7507  C C    . ASN A 1 27 ? -0.800  -13.822 9.414   1.00 15.00 ? 27 ASN A C    6  
ATOM 7508  O O    . ASN A 1 27 ? -0.703  -15.017 9.698   1.00 15.00 ? 27 ASN A O    6  
ATOM 7509  C CB   . ASN A 1 27 ? 0.285   -14.435 7.244   1.00 15.00 ? 27 ASN A CB   6  
ATOM 7510  C CG   . ASN A 1 27 ? 1.563   -15.034 7.799   1.00 15.00 ? 27 ASN A CG   6  
ATOM 7511  O OD1  . ASN A 1 27 ? 2.661   -14.560 7.509   1.00 15.00 ? 27 ASN A OD1  6  
ATOM 7512  N ND2  . ASN A 1 27 ? 1.425   -16.082 8.602   1.00 15.00 ? 27 ASN A ND2  6  
ATOM 7513  H H    . ASN A 1 27 ? 1.755   -12.586 8.202   1.00 15.00 ? 27 ASN A H    6  
ATOM 7514  H HA   . ASN A 1 27 ? -1.029  -12.776 7.566   1.00 15.00 ? 27 ASN A HA   6  
ATOM 7515  H HB2  . ASN A 1 27 ? -0.464  -15.212 7.199   1.00 15.00 ? 27 ASN A HB2  6  
ATOM 7516  H HB3  . ASN A 1 27 ? 0.482   -14.072 6.246   1.00 15.00 ? 27 ASN A HB3  6  
ATOM 7517  H HD21 . ASN A 1 27 ? 0.519   -16.407 8.789   1.00 15.00 ? 27 ASN A HD21 6  
ATOM 7518  H HD22 . ASN A 1 27 ? 2.235   -16.489 8.975   1.00 15.00 ? 27 ASN A HD22 6  
ATOM 7519  N N    . THR A 1 28 ? -1.388  -12.937 10.212  1.00 15.00 ? 28 THR A N    6  
ATOM 7520  C CA   . THR A 1 28 ? -1.964  -13.330 11.493  1.00 15.00 ? 28 THR A CA   6  
ATOM 7521  C C    . THR A 1 28 ? -3.119  -12.411 11.878  1.00 15.00 ? 28 THR A C    6  
ATOM 7522  O O    . THR A 1 28 ? -4.188  -12.874 12.276  1.00 15.00 ? 28 THR A O    6  
ATOM 7523  C CB   . THR A 1 28 ? -0.893  -13.307 12.585  1.00 15.00 ? 28 THR A CB   6  
ATOM 7524  O OG1  . THR A 1 28 ? 0.362   -13.707 12.065  1.00 15.00 ? 28 THR A OG1  6  
ATOM 7525  C CG2  . THR A 1 28 ? -1.214  -14.212 13.756  1.00 15.00 ? 28 THR A CG2  6  
ATOM 7526  H H    . THR A 1 28 ? -1.436  -11.999 9.933   1.00 15.00 ? 28 THR A H    6  
ATOM 7527  H HA   . THR A 1 28 ? -2.340  -14.337 11.392  1.00 15.00 ? 28 THR A HA   6  
ATOM 7528  H HB   . THR A 1 28 ? -0.799  -12.299 12.962  1.00 15.00 ? 28 THR A HB   6  
ATOM 7529  H HG1  . THR A 1 28 ? 0.301   -14.608 11.737  1.00 15.00 ? 28 THR A HG1  6  
ATOM 7530  H HG21 . THR A 1 28 ? -1.027  -13.684 14.680  1.00 15.00 ? 28 THR A HG21 6  
ATOM 7531  H HG22 . THR A 1 28 ? -2.253  -14.503 13.712  1.00 15.00 ? 28 THR A HG22 6  
ATOM 7532  H HG23 . THR A 1 28 ? -0.591  -15.092 13.712  1.00 15.00 ? 28 THR A HG23 6  
ATOM 7533  N N    . SER A 1 29 ? -2.896  -11.106 11.758  1.00 15.00 ? 29 SER A N    6  
ATOM 7534  C CA   . SER A 1 29 ? -3.918  -10.122 12.095  1.00 15.00 ? 29 SER A CA   6  
ATOM 7535  C C    . SER A 1 29 ? -4.778  -9.789  10.880  1.00 15.00 ? 29 SER A C    6  
ATOM 7536  O O    . SER A 1 29 ? -5.997  -9.662  10.986  1.00 15.00 ? 29 SER A O    6  
ATOM 7537  C CB   . SER A 1 29 ? -3.268  -8.848  12.639  1.00 15.00 ? 29 SER A CB   6  
ATOM 7538  O OG   . SER A 1 29 ? -4.237  -7.981  13.203  1.00 15.00 ? 29 SER A OG   6  
ATOM 7539  H H    . SER A 1 29 ? -2.023  -10.798 11.437  1.00 15.00 ? 29 SER A H    6  
ATOM 7540  H HA   . SER A 1 29 ? -4.548  -10.548 12.861  1.00 15.00 ? 29 SER A HA   6  
ATOM 7541  H HB2  . SER A 1 29 ? -2.551  -9.110  13.402  1.00 15.00 ? 29 SER A HB2  6  
ATOM 7542  H HB3  . SER A 1 29 ? -2.766  -8.332  11.834  1.00 15.00 ? 29 SER A HB3  6  
ATOM 7543  H HG   . SER A 1 29 ? -3.953  -7.709  14.078  1.00 15.00 ? 29 SER A HG   6  
ATOM 7544  N N    . VAL A 1 30 ? -4.133  -9.646  9.727   1.00 15.00 ? 30 VAL A N    6  
ATOM 7545  C CA   . VAL A 1 30 ? -4.839  -9.325  8.492   1.00 15.00 ? 30 VAL A CA   6  
ATOM 7546  C C    . VAL A 1 30 ? -5.646  -10.520 7.992   1.00 15.00 ? 30 VAL A C    6  
ATOM 7547  O O    . VAL A 1 30 ? -5.701  -11.561 8.646   1.00 15.00 ? 30 VAL A O    6  
ATOM 7548  C CB   . VAL A 1 30 ? -3.862  -8.877  7.389   1.00 15.00 ? 30 VAL A CB   6  
ATOM 7549  C CG1  . VAL A 1 30 ? -3.107  -7.630  7.820   1.00 15.00 ? 30 VAL A CG1  6  
ATOM 7550  C CG2  . VAL A 1 30 ? -2.896  -9.999  7.039   1.00 15.00 ? 30 VAL A CG2  6  
ATOM 7551  H H    . VAL A 1 30 ? -3.160  -9.758  9.706   1.00 15.00 ? 30 VAL A H    6  
ATOM 7552  H HA   . VAL A 1 30 ? -5.516  -8.509  8.698   1.00 15.00 ? 30 VAL A HA   6  
ATOM 7553  H HB   . VAL A 1 30 ? -4.435  -8.636  6.505   1.00 15.00 ? 30 VAL A HB   6  
ATOM 7554  H HG11 . VAL A 1 30 ? -3.811  -6.857  8.088   1.00 15.00 ? 30 VAL A HG11 6  
ATOM 7555  H HG12 . VAL A 1 30 ? -2.485  -7.862  8.672   1.00 15.00 ? 30 VAL A HG12 6  
ATOM 7556  H HG13 . VAL A 1 30 ? -2.487  -7.285  7.006   1.00 15.00 ? 30 VAL A HG13 6  
ATOM 7557  H HG21 . VAL A 1 30 ? -2.058  -9.595  6.491   1.00 15.00 ? 30 VAL A HG21 6  
ATOM 7558  H HG22 . VAL A 1 30 ? -2.542  -10.466 7.946   1.00 15.00 ? 30 VAL A HG22 6  
ATOM 7559  H HG23 . VAL A 1 30 ? -3.403  -10.734 6.431   1.00 15.00 ? 30 VAL A HG23 6  
ATOM 7560  N N    . ARG A 1 31 ? -6.270  -10.362 6.829   1.00 15.00 ? 31 ARG A N    6  
ATOM 7561  C CA   . ARG A 1 31 ? -7.074  -11.427 6.241   1.00 15.00 ? 31 ARG A CA   6  
ATOM 7562  C C    . ARG A 1 31 ? -6.247  -12.695 6.052   1.00 15.00 ? 31 ARG A C    6  
ATOM 7563  O O    . ARG A 1 31 ? -6.650  -13.779 6.474   1.00 15.00 ? 31 ARG A O    6  
ATOM 7564  C CB   . ARG A 1 31 ? -7.654  -10.973 4.899   1.00 15.00 ? 31 ARG A CB   6  
ATOM 7565  C CG   . ARG A 1 31 ? -9.153  -10.725 4.938   1.00 15.00 ? 31 ARG A CG   6  
ATOM 7566  C CD   . ARG A 1 31 ? -9.935  -12.026 4.868   1.00 15.00 ? 31 ARG A CD   6  
ATOM 7567  N NE   . ARG A 1 31 ? -9.714  -12.862 6.046   1.00 15.00 ? 31 ARG A NE   6  
ATOM 7568  C CZ   . ARG A 1 31 ? -10.313 -12.664 7.217   1.00 15.00 ? 31 ARG A CZ   6  
ATOM 7569  N NH1  . ARG A 1 31 ? -11.172 -11.664 7.370   1.00 15.00 ? 31 ARG A NH1  6  
ATOM 7570  N NH2  . ARG A 1 31 ? -10.055 -13.470 8.239   1.00 15.00 ? 31 ARG A NH2  6  
ATOM 7571  H H    . ARG A 1 31 ? -6.188  -9.508  6.355   1.00 15.00 ? 31 ARG A H    6  
ATOM 7572  H HA   . ARG A 1 31 ? -7.886  -11.640 6.920   1.00 15.00 ? 31 ARG A HA   6  
ATOM 7573  H HB2  . ARG A 1 31 ? -7.167  -10.056 4.601   1.00 15.00 ? 31 ARG A HB2  6  
ATOM 7574  H HB3  . ARG A 1 31 ? -7.457  -11.733 4.157   1.00 15.00 ? 31 ARG A HB3  6  
ATOM 7575  H HG2  . ARG A 1 31 ? -9.401  -10.217 5.859   1.00 15.00 ? 31 ARG A HG2  6  
ATOM 7576  H HG3  . ARG A 1 31 ? -9.428  -10.104 4.098   1.00 15.00 ? 31 ARG A HG3  6  
ATOM 7577  H HD2  . ARG A 1 31 ? -10.988 -11.796 4.796   1.00 15.00 ? 31 ARG A HD2  6  
ATOM 7578  H HD3  . ARG A 1 31 ? -9.625  -12.571 3.989   1.00 15.00 ? 31 ARG A HD3  6  
ATOM 7579  H HE   . ARG A 1 31 ? -9.084  -13.608 5.960   1.00 15.00 ? 31 ARG A HE   6  
ATOM 7580  H HH11 . ARG A 1 31 ? -11.372 -11.054 6.604   1.00 15.00 ? 31 ARG A HH11 6  
ATOM 7581  H HH12 . ARG A 1 31 ? -11.620 -11.521 8.253   1.00 15.00 ? 31 ARG A HH12 6  
ATOM 7582  H HH21 . ARG A 1 31 ? -9.409  -14.225 8.128   1.00 15.00 ? 31 ARG A HH21 6  
ATOM 7583  H HH22 . ARG A 1 31 ? -10.505 -13.321 9.119   1.00 15.00 ? 31 ARG A HH22 6  
ATOM 7584  N N    . HIS A 1 32 ? -5.089  -12.553 5.414   1.00 15.00 ? 32 HIS A N    6  
ATOM 7585  C CA   . HIS A 1 32 ? -4.209  -13.690 5.170   1.00 15.00 ? 32 HIS A CA   6  
ATOM 7586  C C    . HIS A 1 32 ? -2.750  -13.248 5.102   1.00 15.00 ? 32 HIS A C    6  
ATOM 7587  O O    . HIS A 1 32 ? -1.892  -13.804 5.785   1.00 15.00 ? 32 HIS A O    6  
ATOM 7588  C CB   . HIS A 1 32 ? -4.600  -14.394 3.870   1.00 15.00 ? 32 HIS A CB   6  
ATOM 7589  C CG   . HIS A 1 32 ? -6.064  -14.693 3.768   1.00 15.00 ? 32 HIS A CG   6  
ATOM 7590  N ND1  . HIS A 1 32 ? -6.908  -14.033 2.900   1.00 15.00 ? 32 HIS A ND1  6  
ATOM 7591  C CD2  . HIS A 1 32 ? -6.834  -15.589 4.430   1.00 15.00 ? 32 HIS A CD2  6  
ATOM 7592  C CE1  . HIS A 1 32 ? -8.134  -14.508 3.034   1.00 15.00 ? 32 HIS A CE1  6  
ATOM 7593  N NE2  . HIS A 1 32 ? -8.115  -15.453 3.955   1.00 15.00 ? 32 HIS A NE2  6  
ATOM 7594  H H    . HIS A 1 32 ? -4.822  -11.664 5.100   1.00 15.00 ? 32 HIS A H    6  
ATOM 7595  H HA   . HIS A 1 32 ? -4.325  -14.380 5.991   1.00 15.00 ? 32 HIS A HA   6  
ATOM 7596  H HB2  . HIS A 1 32 ? -4.331  -13.767 3.033   1.00 15.00 ? 32 HIS A HB2  6  
ATOM 7597  H HB3  . HIS A 1 32 ? -4.063  -15.329 3.800   1.00 15.00 ? 32 HIS A HB3  6  
ATOM 7598  H HD1  . HIS A 1 32 ? -6.648  -13.321 2.278   1.00 15.00 ? 32 HIS A HD1  6  
ATOM 7599  H HD2  . HIS A 1 32 ? -6.501  -16.281 5.191   1.00 15.00 ? 32 HIS A HD2  6  
ATOM 7600  H HE1  . HIS A 1 32 ? -9.002  -14.180 2.482   1.00 15.00 ? 32 HIS A HE1  6  
ATOM 7601  H HE2  . HIS A 1 32 ? -8.903  -15.920 4.302   1.00 15.00 ? 32 HIS A HE2  6  
ATOM 7602  N N    . GLY A 1 33 ? -2.477  -12.249 4.269   1.00 15.00 ? 33 GLY A N    6  
ATOM 7603  C CA   . GLY A 1 33 ? -1.120  -11.753 4.122   1.00 15.00 ? 33 GLY A CA   6  
ATOM 7604  C C    . GLY A 1 33 ? -1.060  -10.444 3.358   1.00 15.00 ? 33 GLY A C    6  
ATOM 7605  O O    . GLY A 1 33 ? -0.050  -10.131 2.729   1.00 15.00 ? 33 GLY A O    6  
ATOM 7606  H H    . GLY A 1 33 ? -3.202  -11.849 3.746   1.00 15.00 ? 33 GLY A H    6  
ATOM 7607  H HA2  . GLY A 1 33 ? -0.686  -11.602 5.105   1.00 15.00 ? 33 GLY A HA2  6  
ATOM 7608  H HA3  . GLY A 1 33 ? -0.537  -12.492 3.595   1.00 15.00 ? 33 GLY A HA3  6  
ATOM 7609  N N    . GLY A 1 34 ? -2.138  -9.670  3.426   1.00 15.00 ? 34 GLY A N    6  
ATOM 7610  C CA   . GLY A 1 34 ? -2.173  -8.390  2.746   1.00 15.00 ? 34 GLY A CA   6  
ATOM 7611  C C    . GLY A 1 34 ? -1.690  -7.281  3.652   1.00 15.00 ? 34 GLY A C    6  
ATOM 7612  O O    . GLY A 1 34 ? -1.856  -7.362  4.869   1.00 15.00 ? 34 GLY A O    6  
ATOM 7613  H H    . GLY A 1 34 ? -2.910  -9.963  3.953   1.00 15.00 ? 34 GLY A H    6  
ATOM 7614  H HA2  . GLY A 1 34 ? -1.540  -8.436  1.872   1.00 15.00 ? 34 GLY A HA2  6  
ATOM 7615  H HA3  . GLY A 1 34 ? -3.187  -8.179  2.441   1.00 15.00 ? 34 GLY A HA3  6  
ATOM 7616  N N    . ILE A 1 35 ? -1.080  -6.250  3.082   1.00 15.00 ? 35 ILE A N    6  
ATOM 7617  C CA   . ILE A 1 35 ? -0.576  -5.154  3.897   1.00 15.00 ? 35 ILE A CA   6  
ATOM 7618  C C    . ILE A 1 35 ? -1.636  -4.087  4.123   1.00 15.00 ? 35 ILE A C    6  
ATOM 7619  O O    . ILE A 1 35 ? -2.558  -3.921  3.326   1.00 15.00 ? 35 ILE A O    6  
ATOM 7620  C CB   . ILE A 1 35 ? 0.694   -4.512  3.289   1.00 15.00 ? 35 ILE A CB   6  
ATOM 7621  C CG1  . ILE A 1 35 ? 1.834   -4.530  4.322   1.00 15.00 ? 35 ILE A CG1  6  
ATOM 7622  C CG2  . ILE A 1 35 ? 0.417   -3.094  2.792   1.00 15.00 ? 35 ILE A CG2  6  
ATOM 7623  C CD1  . ILE A 1 35 ? 2.568   -3.212  4.477   1.00 15.00 ? 35 ILE A CD1  6  
ATOM 7624  H H    . ILE A 1 35 ? -0.960  -6.229  2.105   1.00 15.00 ? 35 ILE A H    6  
ATOM 7625  H HA   . ILE A 1 35 ? -0.308  -5.570  4.858   1.00 15.00 ? 35 ILE A HA   6  
ATOM 7626  H HB   . ILE A 1 35 ? 0.987   -5.104  2.441   1.00 15.00 ? 35 ILE A HB   6  
ATOM 7627  H HG12 . ILE A 1 35 ? 1.429   -4.791  5.287   1.00 15.00 ? 35 ILE A HG12 6  
ATOM 7628  H HG13 . ILE A 1 35 ? 2.557   -5.278  4.031   1.00 15.00 ? 35 ILE A HG13 6  
ATOM 7629  H HG21 . ILE A 1 35 ? -0.433  -3.105  2.127   1.00 15.00 ? 35 ILE A HG21 6  
ATOM 7630  H HG22 . ILE A 1 35 ? 0.205   -2.453  3.635   1.00 15.00 ? 35 ILE A HG22 6  
ATOM 7631  H HG23 . ILE A 1 35 ? 1.283   -2.721  2.266   1.00 15.00 ? 35 ILE A HG23 6  
ATOM 7632  H HD11 . ILE A 1 35 ? 3.507   -3.382  4.983   1.00 15.00 ? 35 ILE A HD11 6  
ATOM 7633  H HD12 . ILE A 1 35 ? 2.756   -2.786  3.503   1.00 15.00 ? 35 ILE A HD12 6  
ATOM 7634  H HD13 . ILE A 1 35 ? 1.964   -2.531  5.059   1.00 15.00 ? 35 ILE A HD13 6  
ATOM 7635  N N    . TYR A 1 36 ? -1.475  -3.362  5.217   1.00 15.00 ? 36 TYR A N    6  
ATOM 7636  C CA   . TYR A 1 36 ? -2.390  -2.289  5.575   1.00 15.00 ? 36 TYR A CA   6  
ATOM 7637  C C    . TYR A 1 36 ? -1.611  -1.125  6.161   1.00 15.00 ? 36 TYR A C    6  
ATOM 7638  O O    . TYR A 1 36 ? -1.117  -1.201  7.286   1.00 15.00 ? 36 TYR A O    6  
ATOM 7639  C CB   . TYR A 1 36 ? -3.428  -2.780  6.582   1.00 15.00 ? 36 TYR A CB   6  
ATOM 7640  C CG   . TYR A 1 36 ? -4.353  -3.837  6.028   1.00 15.00 ? 36 TYR A CG   6  
ATOM 7641  C CD1  . TYR A 1 36 ? -3.921  -5.146  5.864   1.00 15.00 ? 36 TYR A CD1  6  
ATOM 7642  C CD2  . TYR A 1 36 ? -5.656  -3.524  5.668   1.00 15.00 ? 36 TYR A CD2  6  
ATOM 7643  C CE1  . TYR A 1 36 ? -4.762  -6.115  5.357   1.00 15.00 ? 36 TYR A CE1  6  
ATOM 7644  C CE2  . TYR A 1 36 ? -6.505  -4.487  5.160   1.00 15.00 ? 36 TYR A CE2  6  
ATOM 7645  C CZ   . TYR A 1 36 ? -6.054  -5.782  5.006   1.00 15.00 ? 36 TYR A CZ   6  
ATOM 7646  O OH   . TYR A 1 36 ? -6.896  -6.745  4.501   1.00 15.00 ? 36 TYR A OH   6  
ATOM 7647  H H    . TYR A 1 36 ? -0.707  -3.549  5.798   1.00 15.00 ? 36 TYR A H    6  
ATOM 7648  H HA   . TYR A 1 36 ? -2.889  -1.961  4.674   1.00 15.00 ? 36 TYR A HA   6  
ATOM 7649  H HB2  . TYR A 1 36 ? -2.921  -3.200  7.437   1.00 15.00 ? 36 TYR A HB2  6  
ATOM 7650  H HB3  . TYR A 1 36 ? -4.033  -1.944  6.903   1.00 15.00 ? 36 TYR A HB3  6  
ATOM 7651  H HD1  . TYR A 1 36 ? -2.909  -5.405  6.139   1.00 15.00 ? 36 TYR A HD1  6  
ATOM 7652  H HD2  . TYR A 1 36 ? -6.005  -2.509  5.789   1.00 15.00 ? 36 TYR A HD2  6  
ATOM 7653  H HE1  . TYR A 1 36 ? -4.406  -7.126  5.236   1.00 15.00 ? 36 TYR A HE1  6  
ATOM 7654  H HE2  . TYR A 1 36 ? -7.514  -4.222  4.885   1.00 15.00 ? 36 TYR A HE2  6  
ATOM 7655  H HH   . TYR A 1 36 ? -7.628  -6.880  5.106   1.00 15.00 ? 36 TYR A HH   6  
ATOM 7656  N N    . VAL A 1 37 ? -1.488  -0.054  5.392   1.00 15.00 ? 37 VAL A N    6  
ATOM 7657  C CA   . VAL A 1 37 ? -0.744  1.114   5.851   1.00 15.00 ? 37 VAL A CA   6  
ATOM 7658  C C    . VAL A 1 37 ? -1.294  1.637   7.172   1.00 15.00 ? 37 VAL A C    6  
ATOM 7659  O O    . VAL A 1 37 ? -2.492  1.562   7.433   1.00 15.00 ? 37 VAL A O    6  
ATOM 7660  C CB   . VAL A 1 37 ? -0.727  2.265   4.805   1.00 15.00 ? 37 VAL A CB   6  
ATOM 7661  C CG1  . VAL A 1 37 ? -0.852  1.740   3.390   1.00 15.00 ? 37 VAL A CG1  6  
ATOM 7662  C CG2  . VAL A 1 37 ? -1.806  3.303   5.060   1.00 15.00 ? 37 VAL A CG2  6  
ATOM 7663  H H    . VAL A 1 37 ? -1.895  -0.055  4.498   1.00 15.00 ? 37 VAL A H    6  
ATOM 7664  H HA   . VAL A 1 37 ? 0.277   0.799   6.012   1.00 15.00 ? 37 VAL A HA   6  
ATOM 7665  H HB   . VAL A 1 37 ? 0.214   2.757   4.885   1.00 15.00 ? 37 VAL A HB   6  
ATOM 7666  H HG11 . VAL A 1 37 ? -0.527  0.711   3.353   1.00 15.00 ? 37 VAL A HG11 6  
ATOM 7667  H HG12 . VAL A 1 37 ? -1.882  1.806   3.082   1.00 15.00 ? 37 VAL A HG12 6  
ATOM 7668  H HG13 . VAL A 1 37 ? -0.240  2.337   2.730   1.00 15.00 ? 37 VAL A HG13 6  
ATOM 7669  H HG21 . VAL A 1 37 ? -2.765  2.873   4.852   1.00 15.00 ? 37 VAL A HG21 6  
ATOM 7670  H HG22 . VAL A 1 37 ? -1.768  3.627   6.089   1.00 15.00 ? 37 VAL A HG22 6  
ATOM 7671  H HG23 . VAL A 1 37 ? -1.648  4.152   4.412   1.00 15.00 ? 37 VAL A HG23 6  
ATOM 7672  N N    . LYS A 1 38 ? -0.416  2.195   7.991   1.00 15.00 ? 38 LYS A N    6  
ATOM 7673  C CA   . LYS A 1 38 ? -0.833  2.762   9.261   1.00 15.00 ? 38 LYS A CA   6  
ATOM 7674  C C    . LYS A 1 38 ? -1.411  4.146   9.005   1.00 15.00 ? 38 LYS A C    6  
ATOM 7675  O O    . LYS A 1 38 ? -2.484  4.486   9.501   1.00 15.00 ? 38 LYS A O    6  
ATOM 7676  C CB   . LYS A 1 38 ? 0.344   2.808   10.246  1.00 15.00 ? 38 LYS A CB   6  
ATOM 7677  C CG   . LYS A 1 38 ? 0.526   4.129   10.985  1.00 15.00 ? 38 LYS A CG   6  
ATOM 7678  C CD   . LYS A 1 38 ? 1.121   3.912   12.369  1.00 15.00 ? 38 LYS A CD   6  
ATOM 7679  C CE   . LYS A 1 38 ? 2.280   2.928   12.331  1.00 15.00 ? 38 LYS A CE   6  
ATOM 7680  N NZ   . LYS A 1 38 ? 2.997   2.858   13.634  1.00 15.00 ? 38 LYS A NZ   6  
ATOM 7681  H H    . LYS A 1 38 ? 0.524   2.246   7.725   1.00 15.00 ? 38 LYS A H    6  
ATOM 7682  H HA   . LYS A 1 38 ? -1.607  2.129   9.668   1.00 15.00 ? 38 LYS A HA   6  
ATOM 7683  H HB2  . LYS A 1 38 ? 0.194   2.040   10.983  1.00 15.00 ? 38 LYS A HB2  6  
ATOM 7684  H HB3  . LYS A 1 38 ? 1.254   2.592   9.708   1.00 15.00 ? 38 LYS A HB3  6  
ATOM 7685  H HG2  . LYS A 1 38 ? 1.187   4.764   10.415  1.00 15.00 ? 38 LYS A HG2  6  
ATOM 7686  H HG3  . LYS A 1 38 ? -0.435  4.610   11.092  1.00 15.00 ? 38 LYS A HG3  6  
ATOM 7687  H HD2  . LYS A 1 38 ? 1.477   4.856   12.751  1.00 15.00 ? 38 LYS A HD2  6  
ATOM 7688  H HD3  . LYS A 1 38 ? 0.353   3.522   13.021  1.00 15.00 ? 38 LYS A HD3  6  
ATOM 7689  H HE2  . LYS A 1 38 ? 1.891   1.949   12.090  1.00 15.00 ? 38 LYS A HE2  6  
ATOM 7690  H HE3  . LYS A 1 38 ? 2.972   3.237   11.562  1.00 15.00 ? 38 LYS A HE3  6  
ATOM 7691  H HZ1  . LYS A 1 38 ? 3.915   3.343   13.563  1.00 15.00 ? 38 LYS A HZ1  6  
ATOM 7692  H HZ2  . LYS A 1 38 ? 2.433   3.316   14.379  1.00 15.00 ? 38 LYS A HZ2  6  
ATOM 7693  H HZ3  . LYS A 1 38 ? 3.161   1.866   13.900  1.00 15.00 ? 38 LYS A HZ3  6  
ATOM 7694  N N    . ALA A 1 39 ? -0.694  4.929   8.203   1.00 15.00 ? 39 ALA A N    6  
ATOM 7695  C CA   . ALA A 1 39 ? -1.135  6.269   7.843   1.00 15.00 ? 39 ALA A CA   6  
ATOM 7696  C C    . ALA A 1 39 ? -0.230  6.858   6.771   1.00 15.00 ? 39 ALA A C    6  
ATOM 7697  O O    . ALA A 1 39 ? 0.802   6.277   6.444   1.00 15.00 ? 39 ALA A O    6  
ATOM 7698  C CB   . ALA A 1 39 ? -1.181  7.163   9.069   1.00 15.00 ? 39 ALA A CB   6  
ATOM 7699  H H    . ALA A 1 39 ? 0.152   4.588   7.828   1.00 15.00 ? 39 ALA A H    6  
ATOM 7700  H HA   . ALA A 1 39 ? -2.137  6.191   7.446   1.00 15.00 ? 39 ALA A HA   6  
ATOM 7701  H HB1  . ALA A 1 39 ? -2.209  7.295   9.373   1.00 15.00 ? 39 ALA A HB1  6  
ATOM 7702  H HB2  . ALA A 1 39 ? -0.623  6.704   9.870   1.00 15.00 ? 39 ALA A HB2  6  
ATOM 7703  H HB3  . ALA A 1 39 ? -0.750  8.124   8.831   1.00 15.00 ? 39 ALA A HB3  6  
ATOM 7704  N N    . VAL A 1 40 ? -0.607  8.017   6.240   1.00 15.00 ? 40 VAL A N    6  
ATOM 7705  C CA   . VAL A 1 40 ? 0.196   8.682   5.213   1.00 15.00 ? 40 VAL A CA   6  
ATOM 7706  C C    . VAL A 1 40 ? 1.079   9.739   5.862   1.00 15.00 ? 40 VAL A C    6  
ATOM 7707  O O    . VAL A 1 40 ? 0.587   10.733  6.395   1.00 15.00 ? 40 VAL A O    6  
ATOM 7708  C CB   . VAL A 1 40 ? -0.671  9.342   4.113   1.00 15.00 ? 40 VAL A CB   6  
ATOM 7709  C CG1  . VAL A 1 40 ? -0.597  8.542   2.822   1.00 15.00 ? 40 VAL A CG1  6  
ATOM 7710  C CG2  . VAL A 1 40 ? -2.115  9.488   4.567   1.00 15.00 ? 40 VAL A CG2  6  
ATOM 7711  H H    . VAL A 1 40 ? -1.432  8.440   6.555   1.00 15.00 ? 40 VAL A H    6  
ATOM 7712  H HA   . VAL A 1 40 ? 0.824   7.932   4.751   1.00 15.00 ? 40 VAL A HA   6  
ATOM 7713  H HB   . VAL A 1 40 ? -0.278  10.329  3.918   1.00 15.00 ? 40 VAL A HB   6  
ATOM 7714  H HG11 . VAL A 1 40 ? -0.471  7.495   3.052   1.00 15.00 ? 40 VAL A HG11 6  
ATOM 7715  H HG12 . VAL A 1 40 ? -1.511  8.678   2.261   1.00 15.00 ? 40 VAL A HG12 6  
ATOM 7716  H HG13 . VAL A 1 40 ? 0.241   8.886   2.234   1.00 15.00 ? 40 VAL A HG13 6  
ATOM 7717  H HG21 . VAL A 1 40 ? -2.714  9.858   3.749   1.00 15.00 ? 40 VAL A HG21 6  
ATOM 7718  H HG22 . VAL A 1 40 ? -2.488  8.525   4.882   1.00 15.00 ? 40 VAL A HG22 6  
ATOM 7719  H HG23 . VAL A 1 40 ? -2.163  10.181  5.393   1.00 15.00 ? 40 VAL A HG23 6  
ATOM 7720  N N    . ILE A 1 41 ? 2.384   9.490   5.858   1.00 15.00 ? 41 ILE A N    6  
ATOM 7721  C CA   . ILE A 1 41 ? 3.332   10.393  6.495   1.00 15.00 ? 41 ILE A CA   6  
ATOM 7722  C C    . ILE A 1 41 ? 3.643   11.632  5.656   1.00 15.00 ? 41 ILE A C    6  
ATOM 7723  O O    . ILE A 1 41 ? 4.198   11.533  4.560   1.00 15.00 ? 41 ILE A O    6  
ATOM 7724  C CB   . ILE A 1 41 ? 4.634   9.641   6.884   1.00 15.00 ? 41 ILE A CB   6  
ATOM 7725  C CG1  . ILE A 1 41 ? 4.388   8.700   8.074   1.00 15.00 ? 41 ILE A CG1  6  
ATOM 7726  C CG2  . ILE A 1 41 ? 5.760   10.611  7.211   1.00 15.00 ? 41 ILE A CG2  6  
ATOM 7727  C CD1  . ILE A 1 41 ? 2.970   8.174   8.174   1.00 15.00 ? 41 ILE A CD1  6  
ATOM 7728  H H    . ILE A 1 41 ? 2.711   8.662   5.450   1.00 15.00 ? 41 ILE A H    6  
ATOM 7729  H HA   . ILE A 1 41 ? 2.868   10.726  7.393   1.00 15.00 ? 41 ILE A HA   6  
ATOM 7730  H HB   . ILE A 1 41 ? 4.946   9.052   6.041   1.00 15.00 ? 41 ILE A HB   6  
ATOM 7731  H HG12 . ILE A 1 41 ? 5.045   7.848   7.987   1.00 15.00 ? 41 ILE A HG12 6  
ATOM 7732  H HG13 . ILE A 1 41 ? 4.612   9.227   8.990   1.00 15.00 ? 41 ILE A HG13 6  
ATOM 7733  H HG21 . ILE A 1 41 ? 5.345   11.578  7.454   1.00 15.00 ? 41 ILE A HG21 6  
ATOM 7734  H HG22 . ILE A 1 41 ? 6.321   10.235  8.054   1.00 15.00 ? 41 ILE A HG22 6  
ATOM 7735  H HG23 . ILE A 1 41 ? 6.413   10.702  6.355   1.00 15.00 ? 41 ILE A HG23 6  
ATOM 7736  H HD11 . ILE A 1 41 ? 2.293   8.998   8.347   1.00 15.00 ? 41 ILE A HD11 6  
ATOM 7737  H HD12 . ILE A 1 41 ? 2.704   7.678   7.252   1.00 15.00 ? 41 ILE A HD12 6  
ATOM 7738  H HD13 . ILE A 1 41 ? 2.902   7.475   8.993   1.00 15.00 ? 41 ILE A HD13 6  
ATOM 7739  N N    . PRO A 1 42 ? 3.290   12.826  6.192   1.00 15.00 ? 42 PRO A N    6  
ATOM 7740  C CA   . PRO A 1 42 ? 3.521   14.114  5.523   1.00 15.00 ? 42 PRO A CA   6  
ATOM 7741  C C    . PRO A 1 42 ? 5.004   14.438  5.360   1.00 15.00 ? 42 PRO A C    6  
ATOM 7742  O O    . PRO A 1 42 ? 5.486   15.452  5.865   1.00 15.00 ? 42 PRO A O    6  
ATOM 7743  C CB   . PRO A 1 42 ? 2.856   15.133  6.455   1.00 15.00 ? 42 PRO A CB   6  
ATOM 7744  C CG   . PRO A 1 42 ? 2.825   14.471  7.785   1.00 15.00 ? 42 PRO A CG   6  
ATOM 7745  C CD   . PRO A 1 42 ? 2.640   13.009  7.506   1.00 15.00 ? 42 PRO A CD   6  
ATOM 7746  H HA   . PRO A 1 42 ? 3.039   14.148  4.563   1.00 15.00 ? 42 PRO A HA   6  
ATOM 7747  H HB2  . PRO A 1 42 ? 3.442   16.040  6.478   1.00 15.00 ? 42 PRO A HB2  6  
ATOM 7748  H HB3  . PRO A 1 42 ? 1.860   15.352  6.101   1.00 15.00 ? 42 PRO A HB3  6  
ATOM 7749  H HG2  . PRO A 1 42 ? 3.758   14.640  8.303   1.00 15.00 ? 42 PRO A HG2  6  
ATOM 7750  H HG3  . PRO A 1 42 ? 1.998   14.850  8.366   1.00 15.00 ? 42 PRO A HG3  6  
ATOM 7751  H HD2  . PRO A 1 42 ? 3.131   12.417  8.265   1.00 15.00 ? 42 PRO A HD2  6  
ATOM 7752  H HD3  . PRO A 1 42 ? 1.590   12.764  7.454   1.00 15.00 ? 42 PRO A HD3  6  
ATOM 7753  N N    . GLN A 1 43 ? 5.726   13.574  4.654   1.00 15.00 ? 43 GLN A N    6  
ATOM 7754  C CA   . GLN A 1 43 ? 7.148   13.779  4.433   1.00 15.00 ? 43 GLN A CA   6  
ATOM 7755  C C    . GLN A 1 43 ? 7.583   13.232  3.074   1.00 15.00 ? 43 GLN A C    6  
ATOM 7756  O O    . GLN A 1 43 ? 8.311   13.895  2.336   1.00 15.00 ? 43 GLN A O    6  
ATOM 7757  C CB   . GLN A 1 43 ? 7.952   13.109  5.550   1.00 15.00 ? 43 GLN A CB   6  
ATOM 7758  C CG   . GLN A 1 43 ? 9.451   13.106  5.307   1.00 15.00 ? 43 GLN A CG   6  
ATOM 7759  C CD   . GLN A 1 43 ? 10.233  13.690  6.468   1.00 15.00 ? 43 GLN A CD   6  
ATOM 7760  O OE1  . GLN A 1 43 ? 10.377  14.907  6.586   1.00 15.00 ? 43 GLN A OE1  6  
ATOM 7761  N NE2  . GLN A 1 43 ? 10.744  12.821  7.333   1.00 15.00 ? 43 GLN A NE2  6  
ATOM 7762  H H    . GLN A 1 43 ? 5.294   12.781  4.276   1.00 15.00 ? 43 GLN A H    6  
ATOM 7763  H HA   . GLN A 1 43 ? 7.337   14.841  4.457   1.00 15.00 ? 43 GLN A HA   6  
ATOM 7764  H HB2  . GLN A 1 43 ? 7.760   13.629  6.477   1.00 15.00 ? 43 GLN A HB2  6  
ATOM 7765  H HB3  . GLN A 1 43 ? 7.624   12.085  5.649   1.00 15.00 ? 43 GLN A HB3  6  
ATOM 7766  H HG2  . GLN A 1 43 ? 9.774   12.088  5.150   1.00 15.00 ? 43 GLN A HG2  6  
ATOM 7767  H HG3  . GLN A 1 43 ? 9.658   13.689  4.422   1.00 15.00 ? 43 GLN A HG3  6  
ATOM 7768  H HE21 . GLN A 1 43 ? 10.591  11.866  7.177   1.00 15.00 ? 43 GLN A HE21 6  
ATOM 7769  H HE22 . GLN A 1 43 ? 11.254  13.171  8.094   1.00 15.00 ? 43 GLN A HE22 6  
ATOM 7770  N N    . GLY A 1 44 ? 7.147   12.016  2.754   1.00 15.00 ? 44 GLY A N    6  
ATOM 7771  C CA   . GLY A 1 44 ? 7.525   11.410  1.487   1.00 15.00 ? 44 GLY A CA   6  
ATOM 7772  C C    . GLY A 1 44 ? 6.594   11.759  0.342   1.00 15.00 ? 44 GLY A C    6  
ATOM 7773  O O    . GLY A 1 44 ? 5.510   12.303  0.543   1.00 15.00 ? 44 GLY A O    6  
ATOM 7774  H H    . GLY A 1 44 ? 6.574   11.526  3.384   1.00 15.00 ? 44 GLY A H    6  
ATOM 7775  H HA2  . GLY A 1 44 ? 8.518   11.748  1.232   1.00 15.00 ? 44 GLY A HA2  6  
ATOM 7776  H HA3  . GLY A 1 44 ? 7.550   10.341  1.602   1.00 15.00 ? 44 GLY A HA3  6  
ATOM 7777  N N    . ALA A 1 45 ? 7.037   11.435  -0.867  1.00 15.00 ? 45 ALA A N    6  
ATOM 7778  C CA   . ALA A 1 45 ? 6.277   11.707  -2.085  1.00 15.00 ? 45 ALA A CA   6  
ATOM 7779  C C    . ALA A 1 45 ? 4.893   11.060  -2.078  1.00 15.00 ? 45 ALA A C    6  
ATOM 7780  O O    . ALA A 1 45 ? 4.044   11.402  -2.901  1.00 15.00 ? 45 ALA A O    6  
ATOM 7781  C CB   . ALA A 1 45 ? 7.064   11.237  -3.298  1.00 15.00 ? 45 ALA A CB   6  
ATOM 7782  H H    . ALA A 1 45 ? 7.911   11.000  -0.943  1.00 15.00 ? 45 ALA A H    6  
ATOM 7783  H HA   . ALA A 1 45 ? 6.157   12.777  -2.165  1.00 15.00 ? 45 ALA A HA   6  
ATOM 7784  H HB1  . ALA A 1 45 ? 7.241   12.073  -3.959  1.00 15.00 ? 45 ALA A HB1  6  
ATOM 7785  H HB2  . ALA A 1 45 ? 8.009   10.826  -2.974  1.00 15.00 ? 45 ALA A HB2  6  
ATOM 7786  H HB3  . ALA A 1 45 ? 6.502   10.477  -3.819  1.00 15.00 ? 45 ALA A HB3  6  
ATOM 7787  N N    . ALA A 1 46 ? 4.663   10.127  -1.162  1.00 15.00 ? 46 ALA A N    6  
ATOM 7788  C CA   . ALA A 1 46 ? 3.374   9.453   -1.087  1.00 15.00 ? 46 ALA A CA   6  
ATOM 7789  C C    . ALA A 1 46 ? 2.304   10.386  -0.542  1.00 15.00 ? 46 ALA A C    6  
ATOM 7790  O O    . ALA A 1 46 ? 1.274   10.609  -1.187  1.00 15.00 ? 46 ALA A O    6  
ATOM 7791  C CB   . ALA A 1 46 ? 3.476   8.211   -0.219  1.00 15.00 ? 46 ALA A CB   6  
ATOM 7792  H H    . ALA A 1 46 ? 5.371   9.883   -0.532  1.00 15.00 ? 46 ALA A H    6  
ATOM 7793  H HA   . ALA A 1 46 ? 3.098   9.145   -2.085  1.00 15.00 ? 46 ALA A HA   6  
ATOM 7794  H HB1  . ALA A 1 46 ? 2.568   7.635   -0.308  1.00 15.00 ? 46 ALA A HB1  6  
ATOM 7795  H HB2  . ALA A 1 46 ? 4.315   7.614   -0.544  1.00 15.00 ? 46 ALA A HB2  6  
ATOM 7796  H HB3  . ALA A 1 46 ? 3.618   8.505   0.811   1.00 15.00 ? 46 ALA A HB3  6  
ATOM 7797  N N    . GLU A 1 47 ? 2.560   10.936  0.644   1.00 15.00 ? 47 GLU A N    6  
ATOM 7798  C CA   . GLU A 1 47 ? 1.629   11.863  1.276   1.00 15.00 ? 47 GLU A CA   6  
ATOM 7799  C C    . GLU A 1 47 ? 1.361   13.053  0.355   1.00 15.00 ? 47 GLU A C    6  
ATOM 7800  O O    . GLU A 1 47 ? 0.222   13.499  0.211   1.00 15.00 ? 47 GLU A O    6  
ATOM 7801  C CB   . GLU A 1 47 ? 2.185   12.361  2.620   1.00 15.00 ? 47 GLU A CB   6  
ATOM 7802  C CG   . GLU A 1 47 ? 3.386   13.273  2.449   1.00 15.00 ? 47 GLU A CG   6  
ATOM 7803  C CD   . GLU A 1 47 ? 2.994   14.721  2.222   1.00 15.00 ? 47 GLU A CD   6  
ATOM 7804  O OE1  . GLU A 1 47 ? 1.853   15.088  2.573   1.00 15.00 ? 47 GLU A OE1  6  
ATOM 7805  O OE2  . GLU A 1 47 ? 3.828   15.487  1.695   1.00 15.00 ? 47 GLU A OE2  6  
ATOM 7806  H H    . GLU A 1 47 ? 3.408   10.726  1.096   1.00 15.00 ? 47 GLU A H    6  
ATOM 7807  H HA   . GLU A 1 47 ? 0.697   11.338  1.443   1.00 15.00 ? 47 GLU A HA   6  
ATOM 7808  H HB2  . GLU A 1 47 ? 1.414   12.913  3.129   1.00 15.00 ? 47 GLU A HB2  6  
ATOM 7809  H HB3  . GLU A 1 47 ? 2.479   11.514  3.244   1.00 15.00 ? 47 GLU A HB3  6  
ATOM 7810  H HG2  . GLU A 1 47 ? 3.993   13.217  3.329   1.00 15.00 ? 47 GLU A HG2  6  
ATOM 7811  H HG3  . GLU A 1 47 ? 3.956   12.936  1.602   1.00 15.00 ? 47 GLU A HG3  6  
ATOM 7812  N N    . SER A 1 48 ? 2.429   13.566  -0.260  1.00 15.00 ? 48 SER A N    6  
ATOM 7813  C CA   . SER A 1 48 ? 2.328   14.709  -1.163  1.00 15.00 ? 48 SER A CA   6  
ATOM 7814  C C    . SER A 1 48 ? 1.296   14.442  -2.245  1.00 15.00 ? 48 SER A C    6  
ATOM 7815  O O    . SER A 1 48 ? 0.218   15.036  -2.248  1.00 15.00 ? 48 SER A O    6  
ATOM 7816  C CB   . SER A 1 48 ? 3.687   15.009  -1.798  1.00 15.00 ? 48 SER A CB   6  
ATOM 7817  O OG   . SER A 1 48 ? 4.480   15.818  -0.948  1.00 15.00 ? 48 SER A OG   6  
ATOM 7818  H H    . SER A 1 48 ? 3.308   13.166  -0.099  1.00 15.00 ? 48 SER A H    6  
ATOM 7819  H HA   . SER A 1 48 ? 2.013   15.564  -0.583  1.00 15.00 ? 48 SER A HA   6  
ATOM 7820  H HB2  . SER A 1 48 ? 4.209   14.082  -1.982  1.00 15.00 ? 48 SER A HB2  6  
ATOM 7821  H HB3  . SER A 1 48 ? 3.537   15.529  -2.733  1.00 15.00 ? 48 SER A HB3  6  
ATOM 7822  H HG   . SER A 1 48 ? 3.991   16.609  -0.709  1.00 15.00 ? 48 SER A HG   6  
ATOM 7823  N N    . ASP A 1 49 ? 1.619   13.527  -3.151  1.00 15.00 ? 49 ASP A N    6  
ATOM 7824  C CA   . ASP A 1 49 ? 0.698   13.171  -4.217  1.00 15.00 ? 49 ASP A CA   6  
ATOM 7825  C C    . ASP A 1 49 ? -0.604  12.679  -3.605  1.00 15.00 ? 49 ASP A C    6  
ATOM 7826  O O    . ASP A 1 49 ? -1.695  13.019  -4.063  1.00 15.00 ? 49 ASP A O    6  
ATOM 7827  C CB   . ASP A 1 49 ? 1.304   12.088  -5.112  1.00 15.00 ? 49 ASP A CB   6  
ATOM 7828  C CG   . ASP A 1 49 ? 1.043   12.341  -6.584  1.00 15.00 ? 49 ASP A CG   6  
ATOM 7829  O OD1  . ASP A 1 49 ? 1.116   13.514  -7.007  1.00 15.00 ? 49 ASP A OD1  6  
ATOM 7830  O OD2  . ASP A 1 49 ? 0.765   11.366  -7.314  1.00 15.00 ? 49 ASP A OD2  6  
ATOM 7831  H H    . ASP A 1 49 ? 2.485   13.071  -3.090  1.00 15.00 ? 49 ASP A H    6  
ATOM 7832  H HA   . ASP A 1 49 ? 0.503   14.054  -4.806  1.00 15.00 ? 49 ASP A HA   6  
ATOM 7833  H HB2  . ASP A 1 49 ? 2.372   12.056  -4.956  1.00 15.00 ? 49 ASP A HB2  6  
ATOM 7834  H HB3  . ASP A 1 49 ? 0.878   11.131  -4.848  1.00 15.00 ? 49 ASP A HB3  6  
ATOM 7835  N N    . GLY A 1 50 ? -0.470  11.880  -2.552  1.00 15.00 ? 50 GLY A N    6  
ATOM 7836  C CA   . GLY A 1 50 ? -1.628  11.352  -1.865  1.00 15.00 ? 50 GLY A CA   6  
ATOM 7837  C C    . GLY A 1 50 ? -2.205  10.153  -2.582  1.00 15.00 ? 50 GLY A C    6  
ATOM 7838  O O    . GLY A 1 50 ? -3.424  10.010  -2.684  1.00 15.00 ? 50 GLY A O    6  
ATOM 7839  H H    . GLY A 1 50 ? 0.429   11.656  -2.232  1.00 15.00 ? 50 GLY A H    6  
ATOM 7840  H HA2  . GLY A 1 50 ? -1.335  11.061  -0.861  1.00 15.00 ? 50 GLY A HA2  6  
ATOM 7841  H HA3  . GLY A 1 50 ? -2.382  12.122  -1.803  1.00 15.00 ? 50 GLY A HA3  6  
ATOM 7842  N N    . ARG A 1 51 ? -1.331  9.292   -3.092  1.00 15.00 ? 51 ARG A N    6  
ATOM 7843  C CA   . ARG A 1 51 ? -1.779  8.106   -3.817  1.00 15.00 ? 51 ARG A CA   6  
ATOM 7844  C C    . ARG A 1 51 ? -2.200  7.012   -2.846  1.00 15.00 ? 51 ARG A C    6  
ATOM 7845  O O    . ARG A 1 51 ? -3.287  6.446   -2.964  1.00 15.00 ? 51 ARG A O    6  
ATOM 7846  C CB   . ARG A 1 51 ? -0.680  7.587   -4.749  1.00 15.00 ? 51 ARG A CB   6  
ATOM 7847  C CG   . ARG A 1 51 ? -0.638  8.295   -6.093  1.00 15.00 ? 51 ARG A CG   6  
ATOM 7848  C CD   . ARG A 1 51 ? -1.695  7.755   -7.044  1.00 15.00 ? 51 ARG A CD   6  
ATOM 7849  N NE   . ARG A 1 51 ? -2.715  8.756   -7.351  1.00 15.00 ? 51 ARG A NE   6  
ATOM 7850  C CZ   . ARG A 1 51 ? -3.490  8.717   -8.433  1.00 15.00 ? 51 ARG A CZ   6  
ATOM 7851  N NH1  . ARG A 1 51 ? -3.369  7.729   -9.310  1.00 15.00 ? 51 ARG A NH1  6  
ATOM 7852  N NH2  . ARG A 1 51 ? -4.390  9.669   -8.637  1.00 15.00 ? 51 ARG A NH2  6  
ATOM 7853  H H    . ARG A 1 51 ? -0.367  9.463   -2.984  1.00 15.00 ? 51 ARG A H    6  
ATOM 7854  H HA   . ARG A 1 51 ? -2.636  8.389   -4.410  1.00 15.00 ? 51 ARG A HA   6  
ATOM 7855  H HB2  . ARG A 1 51 ? 0.279   7.713   -4.270  1.00 15.00 ? 51 ARG A HB2  6  
ATOM 7856  H HB3  . ARG A 1 51 ? -0.848  6.536   -4.927  1.00 15.00 ? 51 ARG A HB3  6  
ATOM 7857  H HG2  . ARG A 1 51 ? -0.812  9.349   -5.940  1.00 15.00 ? 51 ARG A HG2  6  
ATOM 7858  H HG3  . ARG A 1 51 ? 0.336   8.149   -6.534  1.00 15.00 ? 51 ARG A HG3  6  
ATOM 7859  H HD2  . ARG A 1 51 ? -1.213  7.452   -7.961  1.00 15.00 ? 51 ARG A HD2  6  
ATOM 7860  H HD3  . ARG A 1 51 ? -2.170  6.899   -6.587  1.00 15.00 ? 51 ARG A HD3  6  
ATOM 7861  H HE   . ARG A 1 51 ? -2.827  9.496   -6.719  1.00 15.00 ? 51 ARG A HE   6  
ATOM 7862  H HH11 . ARG A 1 51 ? -2.694  7.007   -9.162  1.00 15.00 ? 51 ARG A HH11 6  
ATOM 7863  H HH12 . ARG A 1 51 ? -3.954  7.706   -10.121 1.00 15.00 ? 51 ARG A HH12 6  
ATOM 7864  H HH21 . ARG A 1 51 ? -4.486  10.416  -7.979  1.00 15.00 ? 51 ARG A HH21 6  
ATOM 7865  H HH22 . ARG A 1 51 ? -4.972  9.641   -9.450  1.00 15.00 ? 51 ARG A HH22 6  
ATOM 7866  N N    . ILE A 1 52 ? -1.337  6.725   -1.882  1.00 15.00 ? 52 ILE A N    6  
ATOM 7867  C CA   . ILE A 1 52 ? -1.617  5.711   -0.886  1.00 15.00 ? 52 ILE A CA   6  
ATOM 7868  C C    . ILE A 1 52 ? -2.516  6.279   0.214   1.00 15.00 ? 52 ILE A C    6  
ATOM 7869  O O    . ILE A 1 52 ? -2.632  7.496   0.358   1.00 15.00 ? 52 ILE A O    6  
ATOM 7870  C CB   . ILE A 1 52 ? -0.305  5.177   -0.284  1.00 15.00 ? 52 ILE A CB   6  
ATOM 7871  C CG1  . ILE A 1 52 ? -0.569  3.916   0.528   1.00 15.00 ? 52 ILE A CG1  6  
ATOM 7872  C CG2  . ILE A 1 52 ? 0.374   6.245   0.562   1.00 15.00 ? 52 ILE A CG2  6  
ATOM 7873  C CD1  . ILE A 1 52 ? -1.259  2.830   -0.261  1.00 15.00 ? 52 ILE A CD1  6  
ATOM 7874  H H    . ILE A 1 52 ? -0.491  7.211   -1.836  1.00 15.00 ? 52 ILE A H    6  
ATOM 7875  H HA   . ILE A 1 52 ? -2.128  4.894   -1.373  1.00 15.00 ? 52 ILE A HA   6  
ATOM 7876  H HB   . ILE A 1 52 ? 0.359   4.933   -1.100  1.00 15.00 ? 52 ILE A HB   6  
ATOM 7877  H HG12 . ILE A 1 52 ? 0.370   3.519   0.878   1.00 15.00 ? 52 ILE A HG12 6  
ATOM 7878  H HG13 . ILE A 1 52 ? -1.193  4.163   1.372   1.00 15.00 ? 52 ILE A HG13 6  
ATOM 7879  H HG21 . ILE A 1 52 ? -0.325  6.628   1.288   1.00 15.00 ? 52 ILE A HG21 6  
ATOM 7880  H HG22 . ILE A 1 52 ? 1.225   5.816   1.071   1.00 15.00 ? 52 ILE A HG22 6  
ATOM 7881  H HG23 . ILE A 1 52 ? 0.706   7.050   -0.076  1.00 15.00 ? 52 ILE A HG23 6  
ATOM 7882  H HD11 . ILE A 1 52 ? -2.319  3.031   -0.300  1.00 15.00 ? 52 ILE A HD11 6  
ATOM 7883  H HD12 . ILE A 1 52 ? -0.860  2.809   -1.264  1.00 15.00 ? 52 ILE A HD12 6  
ATOM 7884  H HD13 . ILE A 1 52 ? -1.090  1.875   0.214   1.00 15.00 ? 52 ILE A HD13 6  
ATOM 7885  N N    . HIS A 1 53 ? -3.162  5.402   0.977   1.00 15.00 ? 53 HIS A N    6  
ATOM 7886  C CA   . HIS A 1 53 ? -4.058  5.843   2.043   1.00 15.00 ? 53 HIS A CA   6  
ATOM 7887  C C    . HIS A 1 53 ? -4.042  4.901   3.229   1.00 15.00 ? 53 HIS A C    6  
ATOM 7888  O O    . HIS A 1 53 ? -3.649  3.743   3.126   1.00 15.00 ? 53 HIS A O    6  
ATOM 7889  C CB   . HIS A 1 53 ? -5.485  5.994   1.513   1.00 15.00 ? 53 HIS A CB   6  
ATOM 7890  C CG   . HIS A 1 53 ? -5.641  7.103   0.519   1.00 15.00 ? 53 HIS A CG   6  
ATOM 7891  N ND1  . HIS A 1 53 ? -5.499  6.921   -0.840  1.00 15.00 ? 53 HIS A ND1  6  
ATOM 7892  C CD2  . HIS A 1 53 ? -5.930  8.415   0.693   1.00 15.00 ? 53 HIS A CD2  6  
ATOM 7893  C CE1  . HIS A 1 53 ? -5.693  8.073   -1.459  1.00 15.00 ? 53 HIS A CE1  6  
ATOM 7894  N NE2  . HIS A 1 53 ? -5.956  8.994   -0.551  1.00 15.00 ? 53 HIS A NE2  6  
ATOM 7895  H H    . HIS A 1 53 ? -3.044  4.446   0.816   1.00 15.00 ? 53 HIS A H    6  
ATOM 7896  H HA   . HIS A 1 53 ? -3.713  6.802   2.391   1.00 15.00 ? 53 HIS A HA   6  
ATOM 7897  H HB2  . HIS A 1 53 ? -5.782  5.074   1.032   1.00 15.00 ? 53 HIS A HB2  6  
ATOM 7898  H HB3  . HIS A 1 53 ? -6.149  6.193   2.341   1.00 15.00 ? 53 HIS A HB3  6  
ATOM 7899  H HD1  . HIS A 1 53 ? -5.288  6.075   -1.286  1.00 15.00 ? 53 HIS A HD1  6  
ATOM 7900  H HD2  . HIS A 1 53 ? -6.106  8.913   1.637   1.00 15.00 ? 53 HIS A HD2  6  
ATOM 7901  H HE1  . HIS A 1 53 ? -5.645  8.233   -2.526  1.00 15.00 ? 53 HIS A HE1  6  
ATOM 7902  H HE2  . HIS A 1 53 ? -6.072  9.950   -0.733  1.00 15.00 ? 53 HIS A HE2  6  
ATOM 7903  N N    . LYS A 1 54 ? -4.460  5.442   4.362   1.00 15.00 ? 54 LYS A N    6  
ATOM 7904  C CA   . LYS A 1 54 ? -4.495  4.713   5.616   1.00 15.00 ? 54 LYS A CA   6  
ATOM 7905  C C    . LYS A 1 54 ? -5.038  3.291   5.456   1.00 15.00 ? 54 LYS A C    6  
ATOM 7906  O O    . LYS A 1 54 ? -6.062  3.072   4.809   1.00 15.00 ? 54 LYS A O    6  
ATOM 7907  C CB   . LYS A 1 54 ? -5.343  5.477   6.636   1.00 15.00 ? 54 LYS A CB   6  
ATOM 7908  C CG   . LYS A 1 54 ? -4.691  5.593   8.002   1.00 15.00 ? 54 LYS A CG   6  
ATOM 7909  C CD   . LYS A 1 54 ? -5.497  4.872   9.071   1.00 15.00 ? 54 LYS A CD   6  
ATOM 7910  C CE   . LYS A 1 54 ? -5.441  3.363   8.887   1.00 15.00 ? 54 LYS A CE   6  
ATOM 7911  N NZ   . LYS A 1 54 ? -6.688  2.832   8.271   1.00 15.00 ? 54 LYS A NZ   6  
ATOM 7912  H H    . LYS A 1 54 ? -4.739  6.377   4.357   1.00 15.00 ? 54 LYS A H    6  
ATOM 7913  H HA   . LYS A 1 54 ? -3.482  4.667   5.973   1.00 15.00 ? 54 LYS A HA   6  
ATOM 7914  H HB2  . LYS A 1 54 ? -5.523  6.474   6.261   1.00 15.00 ? 54 LYS A HB2  6  
ATOM 7915  H HB3  . LYS A 1 54 ? -6.290  4.971   6.753   1.00 15.00 ? 54 LYS A HB3  6  
ATOM 7916  H HG2  . LYS A 1 54 ? -3.706  5.159   7.953   1.00 15.00 ? 54 LYS A HG2  6  
ATOM 7917  H HG3  . LYS A 1 54 ? -4.614  6.638   8.265   1.00 15.00 ? 54 LYS A HG3  6  
ATOM 7918  H HD2  . LYS A 1 54 ? -5.094  5.121   10.041  1.00 15.00 ? 54 LYS A HD2  6  
ATOM 7919  H HD3  . LYS A 1 54 ? -6.526  5.195   9.011   1.00 15.00 ? 54 LYS A HD3  6  
ATOM 7920  H HE2  . LYS A 1 54 ? -4.604  3.121   8.250   1.00 15.00 ? 54 LYS A HE2  6  
ATOM 7921  H HE3  . LYS A 1 54 ? -5.302  2.901   9.854   1.00 15.00 ? 54 LYS A HE3  6  
ATOM 7922  H HZ1  . LYS A 1 54 ? -6.708  1.795   8.341   1.00 15.00 ? 54 LYS A HZ1  6  
ATOM 7923  H HZ2  . LYS A 1 54 ? -7.521  3.217   8.761   1.00 15.00 ? 54 LYS A HZ2  6  
ATOM 7924  H HZ3  . LYS A 1 54 ? -6.734  3.101   7.267   1.00 15.00 ? 54 LYS A HZ3  6  
ATOM 7925  N N    . GLY A 1 55 ? -4.342  2.331   6.066   1.00 15.00 ? 55 GLY A N    6  
ATOM 7926  C CA   . GLY A 1 55 ? -4.757  0.938   6.004   1.00 15.00 ? 55 GLY A CA   6  
ATOM 7927  C C    . GLY A 1 55 ? -5.046  0.460   4.597   1.00 15.00 ? 55 GLY A C    6  
ATOM 7928  O O    . GLY A 1 55 ? -5.927  -0.375  4.393   1.00 15.00 ? 55 GLY A O    6  
ATOM 7929  H H    . GLY A 1 55 ? -3.533  2.573   6.572   1.00 15.00 ? 55 GLY A H    6  
ATOM 7930  H HA2  . GLY A 1 55 ? -3.975  0.322   6.421   1.00 15.00 ? 55 GLY A HA2  6  
ATOM 7931  H HA3  . GLY A 1 55 ? -5.649  0.816   6.601   1.00 15.00 ? 55 GLY A HA3  6  
ATOM 7932  N N    . ASP A 1 56 ? -4.305  0.974   3.621   1.00 15.00 ? 56 ASP A N    6  
ATOM 7933  C CA   . ASP A 1 56 ? -4.509  0.562   2.238   1.00 15.00 ? 56 ASP A CA   6  
ATOM 7934  C C    . ASP A 1 56 ? -4.139  -0.904  2.055   1.00 15.00 ? 56 ASP A C    6  
ATOM 7935  O O    . ASP A 1 56 ? -3.072  -1.341  2.492   1.00 15.00 ? 56 ASP A O    6  
ATOM 7936  C CB   . ASP A 1 56 ? -3.697  1.433   1.277   1.00 15.00 ? 56 ASP A CB   6  
ATOM 7937  C CG   . ASP A 1 56 ? -4.573  2.122   0.252   1.00 15.00 ? 56 ASP A CG   6  
ATOM 7938  O OD1  . ASP A 1 56 ? -5.352  1.422   -0.428  1.00 15.00 ? 56 ASP A OD1  6  
ATOM 7939  O OD2  . ASP A 1 56 ? -4.483  3.362   0.132   1.00 15.00 ? 56 ASP A OD2  6  
ATOM 7940  H H    . ASP A 1 56 ? -3.604  1.631   3.836   1.00 15.00 ? 56 ASP A H    6  
ATOM 7941  H HA   . ASP A 1 56 ? -5.560  0.681   2.014   1.00 15.00 ? 56 ASP A HA   6  
ATOM 7942  H HB2  . ASP A 1 56 ? -3.173  2.188   1.837   1.00 15.00 ? 56 ASP A HB2  6  
ATOM 7943  H HB3  . ASP A 1 56 ? -2.981  0.815   0.755   1.00 15.00 ? 56 ASP A HB3  6  
ATOM 7944  N N    . ARG A 1 57 ? -5.024  -1.656  1.405   1.00 15.00 ? 57 ARG A N    6  
ATOM 7945  C CA   . ARG A 1 57 ? -4.788  -3.073  1.154   1.00 15.00 ? 57 ARG A CA   6  
ATOM 7946  C C    . ARG A 1 57 ? -3.968  -3.258  -0.117  1.00 15.00 ? 57 ARG A C    6  
ATOM 7947  O O    . ARG A 1 57 ? -4.518  -3.355  -1.214  1.00 15.00 ? 57 ARG A O    6  
ATOM 7948  C CB   . ARG A 1 57 ? -6.118  -3.822  1.035   1.00 15.00 ? 57 ARG A CB   6  
ATOM 7949  C CG   . ARG A 1 57 ? -6.264  -4.953  2.037   1.00 15.00 ? 57 ARG A CG   6  
ATOM 7950  C CD   . ARG A 1 57 ? -5.926  -6.299  1.415   1.00 15.00 ? 57 ARG A CD   6  
ATOM 7951  N NE   . ARG A 1 57 ? -7.094  -6.931  0.807   1.00 15.00 ? 57 ARG A NE   6  
ATOM 7952  C CZ   . ARG A 1 57 ? -7.175  -8.231  0.533   1.00 15.00 ? 57 ARG A CZ   6  
ATOM 7953  N NH1  . ARG A 1 57 ? -6.159  -9.039  0.810   1.00 15.00 ? 57 ARG A NH1  6  
ATOM 7954  N NH2  . ARG A 1 57 ? -8.274  -8.725  -0.020  1.00 15.00 ? 57 ARG A NH2  6  
ATOM 7955  H H    . ARG A 1 57 ? -5.853  -1.247  1.081   1.00 15.00 ? 57 ARG A H    6  
ATOM 7956  H HA   . ARG A 1 57 ? -4.233  -3.470  1.990   1.00 15.00 ? 57 ARG A HA   6  
ATOM 7957  H HB2  . ARG A 1 57 ? -6.927  -3.124  1.191   1.00 15.00 ? 57 ARG A HB2  6  
ATOM 7958  H HB3  . ARG A 1 57 ? -6.199  -4.237  0.041   1.00 15.00 ? 57 ARG A HB3  6  
ATOM 7959  H HG2  . ARG A 1 57 ? -5.595  -4.773  2.863   1.00 15.00 ? 57 ARG A HG2  6  
ATOM 7960  H HG3  . ARG A 1 57 ? -7.283  -4.976  2.394   1.00 15.00 ? 57 ARG A HG3  6  
ATOM 7961  H HD2  . ARG A 1 57 ? -5.172  -6.151  0.656   1.00 15.00 ? 57 ARG A HD2  6  
ATOM 7962  H HD3  . ARG A 1 57 ? -5.537  -6.949  2.186   1.00 15.00 ? 57 ARG A HD3  6  
ATOM 7963  H HE   . ARG A 1 57 ? -7.858  -6.357  0.591   1.00 15.00 ? 57 ARG A HE   6  
ATOM 7964  H HH11 . ARG A 1 57 ? -5.327  -8.673  1.227   1.00 15.00 ? 57 ARG A HH11 6  
ATOM 7965  H HH12 . ARG A 1 57 ? -6.225  -10.015 0.602   1.00 15.00 ? 57 ARG A HH12 6  
ATOM 7966  H HH21 . ARG A 1 57 ? -9.043  -8.121  -0.230  1.00 15.00 ? 57 ARG A HH21 6  
ATOM 7967  H HH22 . ARG A 1 57 ? -8.335  -9.702  -0.226  1.00 15.00 ? 57 ARG A HH22 6  
ATOM 7968  N N    . VAL A 1 58 ? -2.649  -3.294  0.034   1.00 15.00 ? 58 VAL A N    6  
ATOM 7969  C CA   . VAL A 1 58 ? -1.758  -3.456  -1.107  1.00 15.00 ? 58 VAL A CA   6  
ATOM 7970  C C    . VAL A 1 58 ? -1.602  -4.930  -1.482  1.00 15.00 ? 58 VAL A C    6  
ATOM 7971  O O    . VAL A 1 58 ? -1.053  -5.728  -0.716  1.00 15.00 ? 58 VAL A O    6  
ATOM 7972  C CB   . VAL A 1 58 ? -0.374  -2.812  -0.840  1.00 15.00 ? 58 VAL A CB   6  
ATOM 7973  C CG1  . VAL A 1 58 ? -0.533  -1.510  -0.066  1.00 15.00 ? 58 VAL A CG1  6  
ATOM 7974  C CG2  . VAL A 1 58 ? 0.553   -3.764  -0.096  1.00 15.00 ? 58 VAL A CG2  6  
ATOM 7975  H H    . VAL A 1 58 ? -2.266  -3.204  0.932   1.00 15.00 ? 58 VAL A H    6  
ATOM 7976  H HA   . VAL A 1 58 ? -2.210  -2.941  -1.943  1.00 15.00 ? 58 VAL A HA   6  
ATOM 7977  H HB   . VAL A 1 58 ? 0.076   -2.578  -1.793  1.00 15.00 ? 58 VAL A HB   6  
ATOM 7978  H HG11 . VAL A 1 58 ? -1.142  -0.824  -0.636  1.00 15.00 ? 58 VAL A HG11 6  
ATOM 7979  H HG12 . VAL A 1 58 ? -1.008  -1.709  0.885   1.00 15.00 ? 58 VAL A HG12 6  
ATOM 7980  H HG13 . VAL A 1 58 ? 0.440   -1.071  0.103   1.00 15.00 ? 58 VAL A HG13 6  
ATOM 7981  H HG21 . VAL A 1 58 ? 1.342   -3.200  0.378   1.00 15.00 ? 58 VAL A HG21 6  
ATOM 7982  H HG22 . VAL A 1 58 ? -0.009  -4.300  0.655   1.00 15.00 ? 58 VAL A HG22 6  
ATOM 7983  H HG23 . VAL A 1 58 ? 0.982   -4.466  -0.794  1.00 15.00 ? 58 VAL A HG23 6  
ATOM 7984  N N    . LEU A 1 59 ? -2.117  -5.286  -2.658  1.00 15.00 ? 59 LEU A N    6  
ATOM 7985  C CA   . LEU A 1 59 ? -2.059  -6.666  -3.138  1.00 15.00 ? 59 LEU A CA   6  
ATOM 7986  C C    . LEU A 1 59 ? -1.054  -6.851  -4.279  1.00 15.00 ? 59 LEU A C    6  
ATOM 7987  O O    . LEU A 1 59 ? -0.686  -7.980  -4.603  1.00 15.00 ? 59 LEU A O    6  
ATOM 7988  C CB   . LEU A 1 59 ? -3.444  -7.122  -3.598  1.00 15.00 ? 59 LEU A CB   6  
ATOM 7989  C CG   . LEU A 1 59 ? -4.462  -7.336  -2.477  1.00 15.00 ? 59 LEU A CG   6  
ATOM 7990  C CD1  . LEU A 1 59 ? -3.941  -8.350  -1.471  1.00 15.00 ? 59 LEU A CD1  6  
ATOM 7991  C CD2  . LEU A 1 59 ? -4.783  -6.017  -1.792  1.00 15.00 ? 59 LEU A CD2  6  
ATOM 7992  H H    . LEU A 1 59 ? -2.558  -4.604  -3.212  1.00 15.00 ? 59 LEU A H    6  
ATOM 7993  H HA   . LEU A 1 59 ? -1.752  -7.285  -2.309  1.00 15.00 ? 59 LEU A HA   6  
ATOM 7994  H HB2  . LEU A 1 59 ? -3.837  -6.379  -4.277  1.00 15.00 ? 59 LEU A HB2  6  
ATOM 7995  H HB3  . LEU A 1 59 ? -3.332  -8.053  -4.134  1.00 15.00 ? 59 LEU A HB3  6  
ATOM 7996  H HG   . LEU A 1 59 ? -5.376  -7.726  -2.900  1.00 15.00 ? 59 LEU A HG   6  
ATOM 7997  H HD11 . LEU A 1 59 ? -3.164  -8.946  -1.928  1.00 15.00 ? 59 LEU A HD11 6  
ATOM 7998  H HD12 . LEU A 1 59 ? -3.539  -7.832  -0.613  1.00 15.00 ? 59 LEU A HD12 6  
ATOM 7999  H HD13 . LEU A 1 59 ? -4.750  -8.993  -1.156  1.00 15.00 ? 59 LEU A HD13 6  
ATOM 8000  H HD21 . LEU A 1 59 ? -4.052  -5.825  -1.020  1.00 15.00 ? 59 LEU A HD21 6  
ATOM 8001  H HD22 . LEU A 1 59 ? -4.758  -5.218  -2.518  1.00 15.00 ? 59 LEU A HD22 6  
ATOM 8002  H HD23 . LEU A 1 59 ? -5.767  -6.071  -1.350  1.00 15.00 ? 59 LEU A HD23 6  
ATOM 8003  N N    . ALA A 1 60 ? -0.633  -5.755  -4.908  1.00 15.00 ? 60 ALA A N    6  
ATOM 8004  C CA   . ALA A 1 60 ? 0.300   -5.843  -6.030  1.00 15.00 ? 60 ALA A CA   6  
ATOM 8005  C C    . ALA A 1 60 ? 1.239   -4.642  -6.105  1.00 15.00 ? 60 ALA A C    6  
ATOM 8006  O O    . ALA A 1 60 ? 0.884   -3.529  -5.721  1.00 15.00 ? 60 ALA A O    6  
ATOM 8007  C CB   . ALA A 1 60 ? -0.475  -5.978  -7.333  1.00 15.00 ? 60 ALA A CB   6  
ATOM 8008  H H    . ALA A 1 60 ? -0.971  -4.880  -4.630  1.00 15.00 ? 60 ALA A H    6  
ATOM 8009  H HA   . ALA A 1 60 ? 0.891   -6.738  -5.908  1.00 15.00 ? 60 ALA A HA   6  
ATOM 8010  H HB1  . ALA A 1 60 ? -0.435  -7.003  -7.671  1.00 15.00 ? 60 ALA A HB1  6  
ATOM 8011  H HB2  . ALA A 1 60 ? -1.504  -5.693  -7.171  1.00 15.00 ? 60 ALA A HB2  6  
ATOM 8012  H HB3  . ALA A 1 60 ? -0.037  -5.335  -8.082  1.00 15.00 ? 60 ALA A HB3  6  
ATOM 8013  N N    . VAL A 1 61 ? 2.436   -4.888  -6.630  1.00 15.00 ? 61 VAL A N    6  
ATOM 8014  C CA   . VAL A 1 61 ? 3.450   -3.852  -6.799  1.00 15.00 ? 61 VAL A CA   6  
ATOM 8015  C C    . VAL A 1 61 ? 4.137   -4.037  -8.140  1.00 15.00 ? 61 VAL A C    6  
ATOM 8016  O O    . VAL A 1 61 ? 4.976   -4.924  -8.299  1.00 15.00 ? 61 VAL A O    6  
ATOM 8017  C CB   . VAL A 1 61 ? 4.514   -3.889  -5.687  1.00 15.00 ? 61 VAL A CB   6  
ATOM 8018  C CG1  . VAL A 1 61 ? 5.284   -2.580  -5.645  1.00 15.00 ? 61 VAL A CG1  6  
ATOM 8019  C CG2  . VAL A 1 61 ? 3.879   -4.185  -4.340  1.00 15.00 ? 61 VAL A CG2  6  
ATOM 8020  H H    . VAL A 1 61 ? 2.640   -5.799  -6.930  1.00 15.00 ? 61 VAL A H    6  
ATOM 8021  H HA   . VAL A 1 61 ? 2.961   -2.888  -6.781  1.00 15.00 ? 61 VAL A HA   6  
ATOM 8022  H HB   . VAL A 1 61 ? 5.213   -4.681  -5.913  1.00 15.00 ? 61 VAL A HB   6  
ATOM 8023  H HG11 . VAL A 1 61 ? 4.601   -1.767  -5.450  1.00 15.00 ? 61 VAL A HG11 6  
ATOM 8024  H HG12 . VAL A 1 61 ? 6.024   -2.624  -4.862  1.00 15.00 ? 61 VAL A HG12 6  
ATOM 8025  H HG13 . VAL A 1 61 ? 5.774   -2.420  -6.594  1.00 15.00 ? 61 VAL A HG13 6  
ATOM 8026  H HG21 . VAL A 1 61 ? 4.479   -3.746  -3.557  1.00 15.00 ? 61 VAL A HG21 6  
ATOM 8027  H HG22 . VAL A 1 61 ? 2.885   -3.764  -4.311  1.00 15.00 ? 61 VAL A HG22 6  
ATOM 8028  H HG23 . VAL A 1 61 ? 3.823   -5.253  -4.194  1.00 15.00 ? 61 VAL A HG23 6  
ATOM 8029  N N    . ASN A 1 62 ? 3.751   -3.225  -9.116  1.00 15.00 ? 62 ASN A N    6  
ATOM 8030  C CA   . ASN A 1 62 ? 4.310   -3.336  -10.456 1.00 15.00 ? 62 ASN A CA   6  
ATOM 8031  C C    . ASN A 1 62 ? 3.912   -4.678  -11.069 1.00 15.00 ? 62 ASN A C    6  
ATOM 8032  O O    . ASN A 1 62 ? 4.489   -5.116  -12.065 1.00 15.00 ? 62 ASN A O    6  
ATOM 8033  C CB   . ASN A 1 62 ? 5.835   -3.195  -10.423 1.00 15.00 ? 62 ASN A CB   6  
ATOM 8034  C CG   . ASN A 1 62 ? 6.282   -1.747  -10.463 1.00 15.00 ? 62 ASN A CG   6  
ATOM 8035  O OD1  . ASN A 1 62 ? 7.014   -1.336  -11.363 1.00 15.00 ? 62 ASN A OD1  6  
ATOM 8036  N ND2  . ASN A 1 62 ? 5.843   -0.965  -9.483  1.00 15.00 ? 62 ASN A ND2  6  
ATOM 8037  H H    . ASN A 1 62 ? 3.057   -2.556  -8.939  1.00 15.00 ? 62 ASN A H    6  
ATOM 8038  H HA   . ASN A 1 62 ? 3.893   -2.541  -11.056 1.00 15.00 ? 62 ASN A HA   6  
ATOM 8039  H HB2  . ASN A 1 62 ? 6.215   -3.644  -9.519  1.00 15.00 ? 62 ASN A HB2  6  
ATOM 8040  H HB3  . ASN A 1 62 ? 6.255   -3.706  -11.278 1.00 15.00 ? 62 ASN A HB3  6  
ATOM 8041  H HD21 . ASN A 1 62 ? 5.263   -1.360  -8.799  1.00 15.00 ? 62 ASN A HD21 6  
ATOM 8042  H HD22 . ASN A 1 62 ? 6.118   -0.024  -9.484  1.00 15.00 ? 62 ASN A HD22 6  
ATOM 8043  N N    . GLY A 1 63 ? 2.914   -5.323  -10.459 1.00 15.00 ? 63 GLY A N    6  
ATOM 8044  C CA   . GLY A 1 63 ? 2.438   -6.604  -10.941 1.00 15.00 ? 63 GLY A CA   6  
ATOM 8045  C C    . GLY A 1 63 ? 2.870   -7.767  -10.068 1.00 15.00 ? 63 GLY A C    6  
ATOM 8046  O O    . GLY A 1 63 ? 2.634   -8.925  -10.414 1.00 15.00 ? 63 GLY A O    6  
ATOM 8047  H H    . GLY A 1 63 ? 2.493   -4.920  -9.674  1.00 15.00 ? 63 GLY A H    6  
ATOM 8048  H HA2  . GLY A 1 63 ? 1.358   -6.579  -10.962 1.00 15.00 ? 63 GLY A HA2  6  
ATOM 8049  H HA3  . GLY A 1 63 ? 2.806   -6.761  -11.944 1.00 15.00 ? 63 GLY A HA3  6  
ATOM 8050  N N    . VAL A 1 64 ? 3.491   -7.469  -8.929  1.00 15.00 ? 64 VAL A N    6  
ATOM 8051  C CA   . VAL A 1 64 ? 3.931   -8.515  -8.015  1.00 15.00 ? 64 VAL A CA   6  
ATOM 8052  C C    . VAL A 1 64 ? 2.871   -8.781  -6.947  1.00 15.00 ? 64 VAL A C    6  
ATOM 8053  O O    . VAL A 1 64 ? 2.687   -7.990  -6.023  1.00 15.00 ? 64 VAL A O    6  
ATOM 8054  C CB   . VAL A 1 64 ? 5.281   -8.166  -7.344  1.00 15.00 ? 64 VAL A CB   6  
ATOM 8055  C CG1  . VAL A 1 64 ? 5.114   -7.095  -6.278  1.00 15.00 ? 64 VAL A CG1  6  
ATOM 8056  C CG2  . VAL A 1 64 ? 5.919   -9.415  -6.756  1.00 15.00 ? 64 VAL A CG2  6  
ATOM 8057  H H    . VAL A 1 64 ? 3.646   -6.531  -8.695  1.00 15.00 ? 64 VAL A H    6  
ATOM 8058  H HA   . VAL A 1 64 ? 4.068   -9.418  -8.594  1.00 15.00 ? 64 VAL A HA   6  
ATOM 8059  H HB   . VAL A 1 64 ? 5.942   -7.777  -8.101  1.00 15.00 ? 64 VAL A HB   6  
ATOM 8060  H HG11 . VAL A 1 64 ? 4.420   -6.347  -6.627  1.00 15.00 ? 64 VAL A HG11 6  
ATOM 8061  H HG12 . VAL A 1 64 ? 4.734   -7.545  -5.373  1.00 15.00 ? 64 VAL A HG12 6  
ATOM 8062  H HG13 . VAL A 1 64 ? 6.069   -6.634  -6.077  1.00 15.00 ? 64 VAL A HG13 6  
ATOM 8063  H HG21 . VAL A 1 64 ? 5.311   -9.781  -5.941  1.00 15.00 ? 64 VAL A HG21 6  
ATOM 8064  H HG22 . VAL A 1 64 ? 5.993   -10.175 -7.519  1.00 15.00 ? 64 VAL A HG22 6  
ATOM 8065  H HG23 . VAL A 1 64 ? 6.907   -9.176  -6.389  1.00 15.00 ? 64 VAL A HG23 6  
ATOM 8066  N N    . SER A 1 65 ? 2.168   -9.897  -7.087  1.00 15.00 ? 65 SER A N    6  
ATOM 8067  C CA   . SER A 1 65 ? 1.122   -10.261 -6.139  1.00 15.00 ? 65 SER A CA   6  
ATOM 8068  C C    . SER A 1 65 ? 1.691   -10.393 -4.733  1.00 15.00 ? 65 SER A C    6  
ATOM 8069  O O    . SER A 1 65 ? 2.532   -11.251 -4.468  1.00 15.00 ? 65 SER A O    6  
ATOM 8070  C CB   . SER A 1 65 ? 0.454   -11.571 -6.559  1.00 15.00 ? 65 SER A CB   6  
ATOM 8071  O OG   . SER A 1 65 ? -0.710  -11.326 -7.329  1.00 15.00 ? 65 SER A OG   6  
ATOM 8072  H H    . SER A 1 65 ? 2.354   -10.485 -7.846  1.00 15.00 ? 65 SER A H    6  
ATOM 8073  H HA   . SER A 1 65 ? 0.383   -9.472  -6.140  1.00 15.00 ? 65 SER A HA   6  
ATOM 8074  H HB2  . SER A 1 65 ? 1.145   -12.153 -7.151  1.00 15.00 ? 65 SER A HB2  6  
ATOM 8075  H HB3  . SER A 1 65 ? 0.177   -12.130 -5.677  1.00 15.00 ? 65 SER A HB3  6  
ATOM 8076  H HG   . SER A 1 65 ? -1.383  -10.924 -6.774  1.00 15.00 ? 65 SER A HG   6  
ATOM 8077  N N    . LEU A 1 66 ? 1.226   -9.531  -3.838  1.00 15.00 ? 66 LEU A N    6  
ATOM 8078  C CA   . LEU A 1 66 ? 1.686   -9.542  -2.457  1.00 15.00 ? 66 LEU A CA   6  
ATOM 8079  C C    . LEU A 1 66 ? 0.860   -10.503 -1.605  1.00 15.00 ? 66 LEU A C    6  
ATOM 8080  O O    . LEU A 1 66 ? 1.233   -10.817 -0.474  1.00 15.00 ? 66 LEU A O    6  
ATOM 8081  C CB   . LEU A 1 66 ? 1.623   -8.130  -1.875  1.00 15.00 ? 66 LEU A CB   6  
ATOM 8082  C CG   . LEU A 1 66 ? 2.980   -7.453  -1.683  1.00 15.00 ? 66 LEU A CG   6  
ATOM 8083  C CD1  . LEU A 1 66 ? 2.813   -5.947  -1.570  1.00 15.00 ? 66 LEU A CD1  6  
ATOM 8084  C CD2  . LEU A 1 66 ? 3.682   -8.009  -0.453  1.00 15.00 ? 66 LEU A CD2  6  
ATOM 8085  H H    . LEU A 1 66 ? 0.558   -8.870  -4.113  1.00 15.00 ? 66 LEU A H    6  
ATOM 8086  H HA   . LEU A 1 66 ? 2.714   -9.874  -2.456  1.00 15.00 ? 66 LEU A HA   6  
ATOM 8087  H HB2  . LEU A 1 66 ? 1.028   -7.519  -2.539  1.00 15.00 ? 66 LEU A HB2  6  
ATOM 8088  H HB3  . LEU A 1 66 ? 1.130   -8.177  -0.916  1.00 15.00 ? 66 LEU A HB3  6  
ATOM 8089  H HG   . LEU A 1 66 ? 3.601   -7.656  -2.543  1.00 15.00 ? 66 LEU A HG   6  
ATOM 8090  H HD11 . LEU A 1 66 ? 2.045   -5.618  -2.255  1.00 15.00 ? 66 LEU A HD11 6  
ATOM 8091  H HD12 . LEU A 1 66 ? 2.528   -5.690  -0.561  1.00 15.00 ? 66 LEU A HD12 6  
ATOM 8092  H HD13 . LEU A 1 66 ? 3.746   -5.462  -1.815  1.00 15.00 ? 66 LEU A HD13 6  
ATOM 8093  H HD21 . LEU A 1 66 ? 3.309   -7.511  0.430   1.00 15.00 ? 66 LEU A HD21 6  
ATOM 8094  H HD22 . LEU A 1 66 ? 3.490   -9.069  -0.377  1.00 15.00 ? 66 LEU A HD22 6  
ATOM 8095  H HD23 . LEU A 1 66 ? 4.745   -7.841  -0.539  1.00 15.00 ? 66 LEU A HD23 6  
ATOM 8096  N N    . GLU A 1 67 ? -0.263  -10.971 -2.151  1.00 15.00 ? 67 GLU A N    6  
ATOM 8097  C CA   . GLU A 1 67 ? -1.134  -11.899 -1.436  1.00 15.00 ? 67 GLU A CA   6  
ATOM 8098  C C    . GLU A 1 67 ? -0.324  -13.021 -0.792  1.00 15.00 ? 67 GLU A C    6  
ATOM 8099  O O    . GLU A 1 67 ? 0.108   -13.956 -1.468  1.00 15.00 ? 67 GLU A O    6  
ATOM 8100  C CB   . GLU A 1 67 ? -2.176  -12.488 -2.388  1.00 15.00 ? 67 GLU A CB   6  
ATOM 8101  C CG   . GLU A 1 67 ? -1.585  -13.010 -3.688  1.00 15.00 ? 67 GLU A CG   6  
ATOM 8102  C CD   . GLU A 1 67 ? -2.295  -14.250 -4.195  1.00 15.00 ? 67 GLU A CD   6  
ATOM 8103  O OE1  . GLU A 1 67 ? -3.511  -14.166 -4.471  1.00 15.00 ? 67 GLU A OE1  6  
ATOM 8104  O OE2  . GLU A 1 67 ? -1.636  -15.304 -4.318  1.00 15.00 ? 67 GLU A OE2  6  
ATOM 8105  H H    . GLU A 1 67 ? -0.510  -10.688 -3.056  1.00 15.00 ? 67 GLU A H    6  
ATOM 8106  H HA   . GLU A 1 67 ? -1.641  -11.346 -0.659  1.00 15.00 ? 67 GLU A HA   6  
ATOM 8107  H HB2  . GLU A 1 67 ? -2.679  -13.305 -1.892  1.00 15.00 ? 67 GLU A HB2  6  
ATOM 8108  H HB3  . GLU A 1 67 ? -2.900  -11.724 -2.629  1.00 15.00 ? 67 GLU A HB3  6  
ATOM 8109  H HG2  . GLU A 1 67 ? -1.660  -12.238 -4.439  1.00 15.00 ? 67 GLU A HG2  6  
ATOM 8110  H HG3  . GLU A 1 67 ? -0.545  -13.251 -3.523  1.00 15.00 ? 67 GLU A HG3  6  
ATOM 8111  N N    . GLY A 1 68 ? -0.117  -12.916 0.515   1.00 15.00 ? 68 GLY A N    6  
ATOM 8112  C CA   . GLY A 1 68 ? 0.647   -13.921 1.229   1.00 15.00 ? 68 GLY A CA   6  
ATOM 8113  C C    . GLY A 1 68 ? 2.004   -13.407 1.667   1.00 15.00 ? 68 GLY A C    6  
ATOM 8114  O O    . GLY A 1 68 ? 3.039   -13.897 1.215   1.00 15.00 ? 68 GLY A O    6  
ATOM 8115  H H    . GLY A 1 68 ? -0.481  -12.146 0.999   1.00 15.00 ? 68 GLY A H    6  
ATOM 8116  H HA2  . GLY A 1 68 ? 0.091   -14.228 2.103   1.00 15.00 ? 68 GLY A HA2  6  
ATOM 8117  H HA3  . GLY A 1 68 ? 0.789   -14.776 0.586   1.00 15.00 ? 68 GLY A HA3  6  
ATOM 8118  N N    . ALA A 1 69 ? 1.997   -12.413 2.550   1.00 15.00 ? 69 ALA A N    6  
ATOM 8119  C CA   . ALA A 1 69 ? 3.231   -11.825 3.053   1.00 15.00 ? 69 ALA A CA   6  
ATOM 8120  C C    . ALA A 1 69 ? 2.942   -10.833 4.174   1.00 15.00 ? 69 ALA A C    6  
ATOM 8121  O O    . ALA A 1 69 ? 1.897   -10.185 4.190   1.00 15.00 ? 69 ALA A O    6  
ATOM 8122  C CB   . ALA A 1 69 ? 3.989   -11.143 1.923   1.00 15.00 ? 69 ALA A CB   6  
ATOM 8123  H H    . ALA A 1 69 ? 1.140   -12.066 2.870   1.00 15.00 ? 69 ALA A H    6  
ATOM 8124  H HA   . ALA A 1 69 ? 3.848   -12.623 3.440   1.00 15.00 ? 69 ALA A HA   6  
ATOM 8125  H HB1  . ALA A 1 69 ? 5.041   -11.369 2.008   1.00 15.00 ? 69 ALA A HB1  6  
ATOM 8126  H HB2  . ALA A 1 69 ? 3.619   -11.502 0.974   1.00 15.00 ? 69 ALA A HB2  6  
ATOM 8127  H HB3  . ALA A 1 69 ? 3.843   -10.075 1.985   1.00 15.00 ? 69 ALA A HB3  6  
ATOM 8128  N N    . THR A 1 70 ? 3.873   -10.724 5.115   1.00 15.00 ? 70 THR A N    6  
ATOM 8129  C CA   . THR A 1 70 ? 3.715   -9.816  6.246   1.00 15.00 ? 70 THR A CA   6  
ATOM 8130  C C    . THR A 1 70 ? 3.884   -8.362  5.813   1.00 15.00 ? 70 THR A C    6  
ATOM 8131  O O    . THR A 1 70 ? 4.007   -8.064  4.625   1.00 15.00 ? 70 THR A O    6  
ATOM 8132  C CB   . THR A 1 70 ? 4.731   -10.153 7.338   1.00 15.00 ? 70 THR A CB   6  
ATOM 8133  O OG1  . THR A 1 70 ? 6.019   -9.676  6.990   1.00 15.00 ? 70 THR A OG1  6  
ATOM 8134  C CG2  . THR A 1 70 ? 4.848   -11.637 7.609   1.00 15.00 ? 70 THR A CG2  6  
ATOM 8135  H H    . THR A 1 70 ? 4.683   -11.271 5.051   1.00 15.00 ? 70 THR A H    6  
ATOM 8136  H HA   . THR A 1 70 ? 2.717   -9.948  6.641   1.00 15.00 ? 70 THR A HA   6  
ATOM 8137  H HB   . THR A 1 70 ? 4.428   -9.672  8.257   1.00 15.00 ? 70 THR A HB   6  
ATOM 8138  H HG1  . THR A 1 70 ? 6.574   -9.653  7.773   1.00 15.00 ? 70 THR A HG1  6  
ATOM 8139  H HG21 . THR A 1 70 ? 4.530   -11.845 8.620   1.00 15.00 ? 70 THR A HG21 6  
ATOM 8140  H HG22 . THR A 1 70 ? 4.222   -12.180 6.916   1.00 15.00 ? 70 THR A HG22 6  
ATOM 8141  H HG23 . THR A 1 70 ? 5.875   -11.946 7.485   1.00 15.00 ? 70 THR A HG23 6  
ATOM 8142  N N    . HIS A 1 71 ? 3.887   -7.462  6.791   1.00 15.00 ? 71 HIS A N    6  
ATOM 8143  C CA   . HIS A 1 71 ? 4.036   -6.036  6.531   1.00 15.00 ? 71 HIS A CA   6  
ATOM 8144  C C    . HIS A 1 71 ? 5.381   -5.749  5.876   1.00 15.00 ? 71 HIS A C    6  
ATOM 8145  O O    . HIS A 1 71 ? 5.445   -5.219  4.766   1.00 15.00 ? 71 HIS A O    6  
ATOM 8146  C CB   . HIS A 1 71 ? 3.880   -5.253  7.847   1.00 15.00 ? 71 HIS A CB   6  
ATOM 8147  C CG   . HIS A 1 71 ? 4.888   -4.161  8.063   1.00 15.00 ? 71 HIS A CG   6  
ATOM 8148  N ND1  . HIS A 1 71 ? 5.586   -4.008  9.242   1.00 15.00 ? 71 HIS A ND1  6  
ATOM 8149  C CD2  . HIS A 1 71 ? 5.306   -3.164  7.249   1.00 15.00 ? 71 HIS A CD2  6  
ATOM 8150  C CE1  . HIS A 1 71 ? 6.389   -2.964  9.145   1.00 15.00 ? 71 HIS A CE1  6  
ATOM 8151  N NE2  . HIS A 1 71 ? 6.238   -2.435  7.946   1.00 15.00 ? 71 HIS A NE2  6  
ATOM 8152  H H    . HIS A 1 71 ? 3.783   -7.766  7.714   1.00 15.00 ? 71 HIS A H    6  
ATOM 8153  H HA   . HIS A 1 71 ? 3.251   -5.742  5.854   1.00 15.00 ? 71 HIS A HA   6  
ATOM 8154  H HB2  . HIS A 1 71 ? 2.902   -4.800  7.869   1.00 15.00 ? 71 HIS A HB2  6  
ATOM 8155  H HB3  . HIS A 1 71 ? 3.964   -5.945  8.673   1.00 15.00 ? 71 HIS A HB3  6  
ATOM 8156  H HD1  . HIS A 1 71 ? 5.505   -4.580  10.034  1.00 15.00 ? 71 HIS A HD1  6  
ATOM 8157  H HD2  . HIS A 1 71 ? 4.969   -2.977  6.240   1.00 15.00 ? 71 HIS A HD2  6  
ATOM 8158  H HE1  . HIS A 1 71 ? 7.053   -2.603  9.916   1.00 15.00 ? 71 HIS A HE1  6  
ATOM 8159  H HE2  . HIS A 1 71 ? 6.691   -1.629  7.622   1.00 15.00 ? 71 HIS A HE2  6  
ATOM 8160  N N    . LYS A 1 72 ? 6.450   -6.106  6.572   1.00 15.00 ? 72 LYS A N    6  
ATOM 8161  C CA   . LYS A 1 72 ? 7.799   -5.895  6.067   1.00 15.00 ? 72 LYS A CA   6  
ATOM 8162  C C    . LYS A 1 72 ? 7.948   -6.481  4.667   1.00 15.00 ? 72 LYS A C    6  
ATOM 8163  O O    . LYS A 1 72 ? 8.644   -5.922  3.821   1.00 15.00 ? 72 LYS A O    6  
ATOM 8164  C CB   . LYS A 1 72 ? 8.813   -6.531  7.015   1.00 15.00 ? 72 LYS A CB   6  
ATOM 8165  C CG   . LYS A 1 72 ? 10.250  -6.116  6.742   1.00 15.00 ? 72 LYS A CG   6  
ATOM 8166  C CD   . LYS A 1 72 ? 11.225  -6.865  7.636   1.00 15.00 ? 72 LYS A CD   6  
ATOM 8167  C CE   . LYS A 1 72 ? 11.269  -8.345  7.296   1.00 15.00 ? 72 LYS A CE   6  
ATOM 8168  N NZ   . LYS A 1 72 ? 12.604  -8.941  7.579   1.00 15.00 ? 72 LYS A NZ   6  
ATOM 8169  H H    . LYS A 1 72 ? 6.327   -6.528  7.449   1.00 15.00 ? 72 LYS A H    6  
ATOM 8170  H HA   . LYS A 1 72 ? 7.977   -4.825  6.018   1.00 15.00 ? 72 LYS A HA   6  
ATOM 8171  H HB2  . LYS A 1 72 ? 8.564   -6.250  8.028   1.00 15.00 ? 72 LYS A HB2  6  
ATOM 8172  H HB3  . LYS A 1 72 ? 8.746   -7.605  6.925   1.00 15.00 ? 72 LYS A HB3  6  
ATOM 8173  H HG2  . LYS A 1 72 ? 10.486  -6.330  5.711   1.00 15.00 ? 72 LYS A HG2  6  
ATOM 8174  H HG3  . LYS A 1 72 ? 10.349  -5.056  6.924   1.00 15.00 ? 72 LYS A HG3  6  
ATOM 8175  H HD2  . LYS A 1 72 ? 12.212  -6.447  7.505   1.00 15.00 ? 72 LYS A HD2  6  
ATOM 8176  H HD3  . LYS A 1 72 ? 10.916  -6.749  8.665   1.00 15.00 ? 72 LYS A HD3  6  
ATOM 8177  H HE2  . LYS A 1 72 ? 10.524  -8.859  7.885   1.00 15.00 ? 72 LYS A HE2  6  
ATOM 8178  H HE3  . LYS A 1 72 ? 11.044  -8.467  6.247   1.00 15.00 ? 72 LYS A HE3  6  
ATOM 8179  H HZ1  . LYS A 1 72 ? 12.674  -9.884  7.145   1.00 15.00 ? 72 LYS A HZ1  6  
ATOM 8180  H HZ2  . LYS A 1 72 ? 13.355  -8.335  7.190   1.00 15.00 ? 72 LYS A HZ2  6  
ATOM 8181  H HZ3  . LYS A 1 72 ? 12.745  -9.033  8.605   1.00 15.00 ? 72 LYS A HZ3  6  
ATOM 8182  N N    . GLN A 1 73 ? 7.277   -7.604  4.423   1.00 15.00 ? 73 GLN A N    6  
ATOM 8183  C CA   . GLN A 1 73 ? 7.328   -8.249  3.116   1.00 15.00 ? 73 GLN A CA   6  
ATOM 8184  C C    . GLN A 1 73 ? 6.820   -7.290  2.053   1.00 15.00 ? 73 GLN A C    6  
ATOM 8185  O O    . GLN A 1 73 ? 7.448   -7.113  1.010   1.00 15.00 ? 73 GLN A O    6  
ATOM 8186  C CB   . GLN A 1 73 ? 6.497   -9.533  3.118   1.00 15.00 ? 73 GLN A CB   6  
ATOM 8187  C CG   . GLN A 1 73 ? 7.059   -10.612 4.029   1.00 15.00 ? 73 GLN A CG   6  
ATOM 8188  C CD   . GLN A 1 73 ? 6.983   -11.996 3.414   1.00 15.00 ? 73 GLN A CD   6  
ATOM 8189  O OE1  . GLN A 1 73 ? 6.054   -12.757 3.682   1.00 15.00 ? 73 GLN A OE1  6  
ATOM 8190  N NE2  . GLN A 1 73 ? 7.965   -12.331 2.585   1.00 15.00 ? 73 GLN A NE2  6  
ATOM 8191  H H    . GLN A 1 73 ? 6.728   -8.000  5.132   1.00 15.00 ? 73 GLN A H    6  
ATOM 8192  H HA   . GLN A 1 73 ? 8.358   -8.492  2.900   1.00 15.00 ? 73 GLN A HA   6  
ATOM 8193  H HB2  . GLN A 1 73 ? 5.495   -9.300  3.446   1.00 15.00 ? 73 GLN A HB2  6  
ATOM 8194  H HB3  . GLN A 1 73 ? 6.457   -9.925  2.113   1.00 15.00 ? 73 GLN A HB3  6  
ATOM 8195  H HG2  . GLN A 1 73 ? 8.094   -10.385 4.237   1.00 15.00 ? 73 GLN A HG2  6  
ATOM 8196  H HG3  . GLN A 1 73 ? 6.499   -10.612 4.952   1.00 15.00 ? 73 GLN A HG3  6  
ATOM 8197  H HE21 . GLN A 1 73 ? 8.674   -11.675 2.418   1.00 15.00 ? 73 GLN A HE21 6  
ATOM 8198  H HE22 . GLN A 1 73 ? 7.941   -13.220 2.173   1.00 15.00 ? 73 GLN A HE22 6  
ATOM 8199  N N    . ALA A 1 74 ? 5.695   -6.645  2.340   1.00 15.00 ? 74 ALA A N    6  
ATOM 8200  C CA   . ALA A 1 74 ? 5.134   -5.674  1.418   1.00 15.00 ? 74 ALA A CA   6  
ATOM 8201  C C    . ALA A 1 74 ? 6.057   -4.474  1.324   1.00 15.00 ? 74 ALA A C    6  
ATOM 8202  O O    . ALA A 1 74 ? 6.439   -4.050  0.235   1.00 15.00 ? 74 ALA A O    6  
ATOM 8203  C CB   . ALA A 1 74 ? 3.761   -5.233  1.863   1.00 15.00 ? 74 ALA A CB   6  
ATOM 8204  H H    . ALA A 1 74 ? 5.252   -6.809  3.199   1.00 15.00 ? 74 ALA A H    6  
ATOM 8205  H HA   . ALA A 1 74 ? 5.045   -6.139  0.452   1.00 15.00 ? 74 ALA A HA   6  
ATOM 8206  H HB1  . ALA A 1 74 ? 3.285   -4.701  1.055   1.00 15.00 ? 74 ALA A HB1  6  
ATOM 8207  H HB2  . ALA A 1 74 ? 3.173   -6.097  2.127   1.00 15.00 ? 74 ALA A HB2  6  
ATOM 8208  H HB3  . ALA A 1 74 ? 3.856   -4.582  2.717   1.00 15.00 ? 74 ALA A HB3  6  
ATOM 8209  N N    . VAL A 1 75 ? 6.430   -3.951  2.492   1.00 15.00 ? 75 VAL A N    6  
ATOM 8210  C CA   . VAL A 1 75 ? 7.339   -2.814  2.584   1.00 15.00 ? 75 VAL A CA   6  
ATOM 8211  C C    . VAL A 1 75 ? 8.456   -2.970  1.565   1.00 15.00 ? 75 VAL A C    6  
ATOM 8212  O O    . VAL A 1 75 ? 8.824   -2.025  0.867   1.00 15.00 ? 75 VAL A O    6  
ATOM 8213  C CB   . VAL A 1 75 ? 7.929   -2.719  4.014   1.00 15.00 ? 75 VAL A CB   6  
ATOM 8214  C CG1  . VAL A 1 75 ? 9.447   -2.854  4.020   1.00 15.00 ? 75 VAL A CG1  6  
ATOM 8215  C CG2  . VAL A 1 75 ? 7.507   -1.433  4.693   1.00 15.00 ? 75 VAL A CG2  6  
ATOM 8216  H H    . VAL A 1 75 ? 6.097   -4.357  3.319   1.00 15.00 ? 75 VAL A H    6  
ATOM 8217  H HA   . VAL A 1 75 ? 6.787   -1.910  2.372   1.00 15.00 ? 75 VAL A HA   6  
ATOM 8218  H HB   . VAL A 1 75 ? 7.521   -3.536  4.589   1.00 15.00 ? 75 VAL A HB   6  
ATOM 8219  H HG11 . VAL A 1 75 ? 9.879   -2.093  3.387   1.00 15.00 ? 75 VAL A HG11 6  
ATOM 8220  H HG12 . VAL A 1 75 ? 9.815   -2.734  5.029   1.00 15.00 ? 75 VAL A HG12 6  
ATOM 8221  H HG13 . VAL A 1 75 ? 9.724   -3.830  3.651   1.00 15.00 ? 75 VAL A HG13 6  
ATOM 8222  H HG21 . VAL A 1 75 ? 8.338   -0.745  4.712   1.00 15.00 ? 75 VAL A HG21 6  
ATOM 8223  H HG22 . VAL A 1 75 ? 6.683   -0.993  4.153   1.00 15.00 ? 75 VAL A HG22 6  
ATOM 8224  H HG23 . VAL A 1 75 ? 7.200   -1.656  5.706   1.00 15.00 ? 75 VAL A HG23 6  
ATOM 8225  N N    . GLU A 1 76 ? 8.973   -4.186  1.483   1.00 15.00 ? 76 GLU A N    6  
ATOM 8226  C CA   . GLU A 1 76 ? 10.032  -4.504  0.549   1.00 15.00 ? 76 GLU A CA   6  
ATOM 8227  C C    . GLU A 1 76 ? 9.525   -4.424  -0.887  1.00 15.00 ? 76 GLU A C    6  
ATOM 8228  O O    . GLU A 1 76 ? 10.199  -3.874  -1.754  1.00 15.00 ? 76 GLU A O    6  
ATOM 8229  C CB   . GLU A 1 76 ? 10.591  -5.900  0.834   1.00 15.00 ? 76 GLU A CB   6  
ATOM 8230  C CG   . GLU A 1 76 ? 11.250  -6.024  2.198   1.00 15.00 ? 76 GLU A CG   6  
ATOM 8231  C CD   . GLU A 1 76 ? 11.525  -7.465  2.583   1.00 15.00 ? 76 GLU A CD   6  
ATOM 8232  O OE1  . GLU A 1 76 ? 10.563  -8.260  2.634   1.00 15.00 ? 76 GLU A OE1  6  
ATOM 8233  O OE2  . GLU A 1 76 ? 12.703  -7.799  2.832   1.00 15.00 ? 76 GLU A OE2  6  
ATOM 8234  H H    . GLU A 1 76 ? 8.621   -4.894  2.063   1.00 15.00 ? 76 GLU A H    6  
ATOM 8235  H HA   . GLU A 1 76 ? 10.820  -3.777  0.681   1.00 15.00 ? 76 GLU A HA   6  
ATOM 8236  H HB2  . GLU A 1 76 ? 9.783   -6.615  0.781   1.00 15.00 ? 76 GLU A HB2  6  
ATOM 8237  H HB3  . GLU A 1 76 ? 11.325  -6.142  0.079   1.00 15.00 ? 76 GLU A HB3  6  
ATOM 8238  H HG2  . GLU A 1 76 ? 12.187  -5.488  2.181   1.00 15.00 ? 76 GLU A HG2  6  
ATOM 8239  H HG3  . GLU A 1 76 ? 10.599  -5.586  2.941   1.00 15.00 ? 76 GLU A HG3  6  
ATOM 8240  N N    . THR A 1 77 ? 8.332   -4.970  -1.141  1.00 15.00 ? 77 THR A N    6  
ATOM 8241  C CA   . THR A 1 77 ? 7.767   -4.939  -2.487  1.00 15.00 ? 77 THR A CA   6  
ATOM 8242  C C    . THR A 1 77 ? 7.475   -3.509  -2.932  1.00 15.00 ? 77 THR A C    6  
ATOM 8243  O O    . THR A 1 77 ? 7.960   -3.065  -3.972  1.00 15.00 ? 77 THR A O    6  
ATOM 8244  C CB   . THR A 1 77 ? 6.503   -5.790  -2.574  1.00 15.00 ? 77 THR A CB   6  
ATOM 8245  O OG1  . THR A 1 77 ? 5.877   -5.888  -1.313  1.00 15.00 ? 77 THR A OG1  6  
ATOM 8246  C CG2  . THR A 1 77 ? 6.764   -7.197  -3.069  1.00 15.00 ? 77 THR A CG2  6  
ATOM 8247  H H    . THR A 1 77 ? 7.818   -5.391  -0.408  1.00 15.00 ? 77 THR A H    6  
ATOM 8248  H HA   . THR A 1 77 ? 8.508   -5.355  -3.154  1.00 15.00 ? 77 THR A HA   6  
ATOM 8249  H HB   . THR A 1 77 ? 5.816   -5.321  -3.262  1.00 15.00 ? 77 THR A HB   6  
ATOM 8250  H HG1  . THR A 1 77 ? 6.315   -6.563  -0.789  1.00 15.00 ? 77 THR A HG1  6  
ATOM 8251  H HG21 . THR A 1 77 ? 5.827   -7.665  -3.334  1.00 15.00 ? 77 THR A HG21 6  
ATOM 8252  H HG22 . THR A 1 77 ? 7.407   -7.162  -3.936  1.00 15.00 ? 77 THR A HG22 6  
ATOM 8253  H HG23 . THR A 1 77 ? 7.244   -7.770  -2.286  1.00 15.00 ? 77 THR A HG23 6  
ATOM 8254  N N    . LEU A 1 78 ? 6.681   -2.788  -2.138  1.00 15.00 ? 78 LEU A N    6  
ATOM 8255  C CA   . LEU A 1 78 ? 6.332   -1.406  -2.464  1.00 15.00 ? 78 LEU A CA   6  
ATOM 8256  C C    . LEU A 1 78 ? 7.593   -0.591  -2.707  1.00 15.00 ? 78 LEU A C    6  
ATOM 8257  O O    . LEU A 1 78 ? 7.690   0.156   -3.681  1.00 15.00 ? 78 LEU A O    6  
ATOM 8258  C CB   . LEU A 1 78 ? 5.515   -0.761  -1.338  1.00 15.00 ? 78 LEU A CB   6  
ATOM 8259  C CG   . LEU A 1 78 ? 4.545   -1.689  -0.604  1.00 15.00 ? 78 LEU A CG   6  
ATOM 8260  C CD1  . LEU A 1 78 ? 3.638   -0.887  0.318   1.00 15.00 ? 78 LEU A CD1  6  
ATOM 8261  C CD2  . LEU A 1 78 ? 3.720   -2.498  -1.594  1.00 15.00 ? 78 LEU A CD2  6  
ATOM 8262  H H    . LEU A 1 78 ? 6.325   -3.194  -1.321  1.00 15.00 ? 78 LEU A H    6  
ATOM 8263  H HA   . LEU A 1 78 ? 5.743   -1.416  -3.368  1.00 15.00 ? 78 LEU A HA   6  
ATOM 8264  H HB2  . LEU A 1 78 ? 6.205   -0.354  -0.613  1.00 15.00 ? 78 LEU A HB2  6  
ATOM 8265  H HB3  . LEU A 1 78 ? 4.946   0.054   -1.760  1.00 15.00 ? 78 LEU A HB3  6  
ATOM 8266  H HG   . LEU A 1 78 ? 5.110   -2.378  0.005   1.00 15.00 ? 78 LEU A HG   6  
ATOM 8267  H HD11 . LEU A 1 78 ? 3.572   0.130   -0.038  1.00 15.00 ? 78 LEU A HD11 6  
ATOM 8268  H HD12 . LEU A 1 78 ? 2.653   -1.330  0.329   1.00 15.00 ? 78 LEU A HD12 6  
ATOM 8269  H HD13 . LEU A 1 78 ? 4.046   -0.893  1.318   1.00 15.00 ? 78 LEU A HD13 6  
ATOM 8270  H HD21 . LEU A 1 78 ? 2.680   -2.473  -1.304  1.00 15.00 ? 78 LEU A HD21 6  
ATOM 8271  H HD22 . LEU A 1 78 ? 3.827   -2.076  -2.582  1.00 15.00 ? 78 LEU A HD22 6  
ATOM 8272  H HD23 . LEU A 1 78 ? 4.067   -3.521  -1.600  1.00 15.00 ? 78 LEU A HD23 6  
ATOM 8273  N N    . ARG A 1 79 ? 8.560   -0.752  -1.815  1.00 15.00 ? 79 ARG A N    6  
ATOM 8274  C CA   . ARG A 1 79 ? 9.826   -0.048  -1.926  1.00 15.00 ? 79 ARG A CA   6  
ATOM 8275  C C    . ARG A 1 79 ? 10.614  -0.559  -3.129  1.00 15.00 ? 79 ARG A C    6  
ATOM 8276  O O    . ARG A 1 79 ? 11.009  0.215   -4.000  1.00 15.00 ? 79 ARG A O    6  
ATOM 8277  C CB   . ARG A 1 79 ? 10.635  -0.231  -0.640  1.00 15.00 ? 79 ARG A CB   6  
ATOM 8278  C CG   . ARG A 1 79 ? 11.651  0.875   -0.395  1.00 15.00 ? 79 ARG A CG   6  
ATOM 8279  C CD   . ARG A 1 79 ? 13.078  0.348   -0.432  1.00 15.00 ? 79 ARG A CD   6  
ATOM 8280  N NE   . ARG A 1 79 ? 13.789  0.606   0.818   1.00 15.00 ? 79 ARG A NE   6  
ATOM 8281  C CZ   . ARG A 1 79 ? 13.637  -0.124  1.920   1.00 15.00 ? 79 ARG A CZ   6  
ATOM 8282  N NH1  . ARG A 1 79 ? 12.805  -1.157  1.930   1.00 15.00 ? 79 ARG A NH1  6  
ATOM 8283  N NH2  . ARG A 1 79 ? 14.321  0.179   3.015   1.00 15.00 ? 79 ARG A NH2  6  
ATOM 8284  H H    . ARG A 1 79 ? 8.421   -1.369  -1.067  1.00 15.00 ? 79 ARG A H    6  
ATOM 8285  H HA   . ARG A 1 79 ? 9.614   1.002   -2.065  1.00 15.00 ? 79 ARG A HA   6  
ATOM 8286  H HB2  . ARG A 1 79 ? 9.952   -0.257  0.199   1.00 15.00 ? 79 ARG A HB2  6  
ATOM 8287  H HB3  . ARG A 1 79 ? 11.161  -1.173  -0.692  1.00 15.00 ? 79 ARG A HB3  6  
ATOM 8288  H HG2  . ARG A 1 79 ? 11.538  1.629   -1.159  1.00 15.00 ? 79 ARG A HG2  6  
ATOM 8289  H HG3  . ARG A 1 79 ? 11.464  1.312   0.575   1.00 15.00 ? 79 ARG A HG3  6  
ATOM 8290  H HD2  . ARG A 1 79 ? 13.053  -0.717  -0.606  1.00 15.00 ? 79 ARG A HD2  6  
ATOM 8291  H HD3  . ARG A 1 79 ? 13.606  0.832   -1.241  1.00 15.00 ? 79 ARG A HD3  6  
ATOM 8292  H HE   . ARG A 1 79 ? 14.411  1.363   0.837   1.00 15.00 ? 79 ARG A HE   6  
ATOM 8293  H HH11 . ARG A 1 79 ? 12.287  -1.392  1.107   1.00 15.00 ? 79 ARG A HH11 6  
ATOM 8294  H HH12 . ARG A 1 79 ? 12.695  -1.703  2.761   1.00 15.00 ? 79 ARG A HH12 6  
ATOM 8295  H HH21 . ARG A 1 79 ? 14.951  0.956   3.013   1.00 15.00 ? 79 ARG A HH21 6  
ATOM 8296  H HH22 . ARG A 1 79 ? 14.207  -0.369  3.844   1.00 15.00 ? 79 ARG A HH22 6  
ATOM 8297  N N    . ASN A 1 80 ? 10.835  -1.871  -3.165  1.00 15.00 ? 80 ASN A N    6  
ATOM 8298  C CA   . ASN A 1 80 ? 11.571  -2.511  -4.255  1.00 15.00 ? 80 ASN A CA   6  
ATOM 8299  C C    . ASN A 1 80 ? 10.818  -2.423  -5.585  1.00 15.00 ? 80 ASN A C    6  
ATOM 8300  O O    . ASN A 1 80 ? 10.530  -3.445  -6.208  1.00 15.00 ? 80 ASN A O    6  
ATOM 8301  C CB   . ASN A 1 80 ? 11.841  -3.979  -3.917  1.00 15.00 ? 80 ASN A CB   6  
ATOM 8302  C CG   . ASN A 1 80 ? 12.729  -4.139  -2.698  1.00 15.00 ? 80 ASN A CG   6  
ATOM 8303  O OD1  . ASN A 1 80 ? 12.915  -3.199  -1.924  1.00 15.00 ? 80 ASN A OD1  6  
ATOM 8304  N ND2  . ASN A 1 80 ? 13.282  -5.333  -2.520  1.00 15.00 ? 80 ASN A ND2  6  
ATOM 8305  H H    . ASN A 1 80 ? 10.490  -2.429  -2.436  1.00 15.00 ? 80 ASN A H    6  
ATOM 8306  H HA   . ASN A 1 80 ? 12.515  -2.000  -4.358  1.00 15.00 ? 80 ASN A HA   6  
ATOM 8307  H HB2  . ASN A 1 80 ? 10.901  -4.477  -3.724  1.00 15.00 ? 80 ASN A HB2  6  
ATOM 8308  H HB3  . ASN A 1 80 ? 12.327  -4.451  -4.758  1.00 15.00 ? 80 ASN A HB3  6  
ATOM 8309  H HD21 . ASN A 1 80 ? 13.089  -6.034  -3.177  1.00 15.00 ? 80 ASN A HD21 6  
ATOM 8310  H HD22 . ASN A 1 80 ? 13.860  -5.464  -1.740  1.00 15.00 ? 80 ASN A HD22 6  
ATOM 8311  N N    . THR A 1 81 ? 10.510  -1.208  -6.026  1.00 15.00 ? 81 THR A N    6  
ATOM 8312  C CA   . THR A 1 81 ? 9.806   -1.021  -7.290  1.00 15.00 ? 81 THR A CA   6  
ATOM 8313  C C    . THR A 1 81 ? 10.802  -0.746  -8.412  1.00 15.00 ? 81 THR A C    6  
ATOM 8314  O O    . THR A 1 81 ? 11.025  -1.595  -9.276  1.00 15.00 ? 81 THR A O    6  
ATOM 8315  C CB   . THR A 1 81 ? 8.789   0.119   -7.178  1.00 15.00 ? 81 THR A CB   6  
ATOM 8316  O OG1  . THR A 1 81 ? 9.008   0.874   -6.000  1.00 15.00 ? 81 THR A OG1  6  
ATOM 8317  C CG2  . THR A 1 81 ? 7.353   -0.364  -7.153  1.00 15.00 ? 81 THR A CG2  6  
ATOM 8318  H H    . THR A 1 81 ? 10.769  -0.424  -5.501  1.00 15.00 ? 81 THR A H    6  
ATOM 8319  H HA   . THR A 1 81 ? 9.281   -1.938  -7.512  1.00 15.00 ? 81 THR A HA   6  
ATOM 8320  H HB   . THR A 1 81 ? 8.902   0.775   -8.029  1.00 15.00 ? 81 THR A HB   6  
ATOM 8321  H HG1  . THR A 1 81 ? 8.462   1.663   -6.019  1.00 15.00 ? 81 THR A HG1  6  
ATOM 8322  H HG21 . THR A 1 81 ? 6.719   0.365   -7.636  1.00 15.00 ? 81 THR A HG21 6  
ATOM 8323  H HG22 . THR A 1 81 ? 7.280   -1.307  -7.675  1.00 15.00 ? 81 THR A HG22 6  
ATOM 8324  H HG23 . THR A 1 81 ? 7.034   -0.496  -6.129  1.00 15.00 ? 81 THR A HG23 6  
ATOM 8325  N N    . GLY A 1 82 ? 11.414  0.434   -8.385  1.00 15.00 ? 82 GLY A N    6  
ATOM 8326  C CA   . GLY A 1 82 ? 12.395  0.782   -9.394  1.00 15.00 ? 82 GLY A CA   6  
ATOM 8327  C C    . GLY A 1 82 ? 11.971  1.943   -10.271 1.00 15.00 ? 82 GLY A C    6  
ATOM 8328  O O    . GLY A 1 82 ? 12.137  3.106   -9.902  1.00 15.00 ? 82 GLY A O    6  
ATOM 8329  H H    . GLY A 1 82 ? 11.209  1.066   -7.667  1.00 15.00 ? 82 GLY A H    6  
ATOM 8330  H HA2  . GLY A 1 82 ? 13.320  1.042   -8.902  1.00 15.00 ? 82 GLY A HA2  6  
ATOM 8331  H HA3  . GLY A 1 82 ? 12.567  -0.081  -10.021 1.00 15.00 ? 82 GLY A HA3  6  
ATOM 8332  N N    . GLN A 1 83 ? 11.446  1.623   -11.447 1.00 15.00 ? 83 GLN A N    6  
ATOM 8333  C CA   . GLN A 1 83 ? 11.017  2.641   -12.404 1.00 15.00 ? 83 GLN A CA   6  
ATOM 8334  C C    . GLN A 1 83 ? 9.855   3.479   -11.869 1.00 15.00 ? 83 GLN A C    6  
ATOM 8335  O O    . GLN A 1 83 ? 10.064  4.550   -11.301 1.00 15.00 ? 83 GLN A O    6  
ATOM 8336  C CB   . GLN A 1 83 ? 10.636  2.000   -13.747 1.00 15.00 ? 83 GLN A CB   6  
ATOM 8337  C CG   . GLN A 1 83 ? 10.023  0.612   -13.626 1.00 15.00 ? 83 GLN A CG   6  
ATOM 8338  C CD   . GLN A 1 83 ? 8.905   0.379   -14.625 1.00 15.00 ? 83 GLN A CD   6  
ATOM 8339  O OE1  . GLN A 1 83 ? 8.153   1.295   -14.957 1.00 15.00 ? 83 GLN A OE1  6  
ATOM 8340  N NE2  . GLN A 1 83 ? 8.791   -0.852  -15.109 1.00 15.00 ? 83 GLN A NE2  6  
ATOM 8341  H H    . GLN A 1 83 ? 11.359  0.677   -11.682 1.00 15.00 ? 83 GLN A H    6  
ATOM 8342  H HA   . GLN A 1 83 ? 11.858  3.298   -12.567 1.00 15.00 ? 83 GLN A HA   6  
ATOM 8343  H HB2  . GLN A 1 83 ? 9.922   2.639   -14.246 1.00 15.00 ? 83 GLN A HB2  6  
ATOM 8344  H HB3  . GLN A 1 83 ? 11.523  1.924   -14.359 1.00 15.00 ? 83 GLN A HB3  6  
ATOM 8345  H HG2  . GLN A 1 83 ? 10.794  -0.125  -13.795 1.00 15.00 ? 83 GLN A HG2  6  
ATOM 8346  H HG3  . GLN A 1 83 ? 9.625   0.493   -12.629 1.00 15.00 ? 83 GLN A HG3  6  
ATOM 8347  H HE21 . GLN A 1 83 ? 9.425   -1.533  -14.799 1.00 15.00 ? 83 GLN A HE21 6  
ATOM 8348  H HE22 . GLN A 1 83 ? 8.077   -1.031  -15.756 1.00 15.00 ? 83 GLN A HE22 6  
ATOM 8349  N N    . VAL A 1 84 ? 8.631   2.996   -12.066 1.00 15.00 ? 84 VAL A N    6  
ATOM 8350  C CA   . VAL A 1 84 ? 7.441   3.707   -11.615 1.00 15.00 ? 84 VAL A CA   6  
ATOM 8351  C C    . VAL A 1 84 ? 6.781   2.981   -10.445 1.00 15.00 ? 84 VAL A C    6  
ATOM 8352  O O    . VAL A 1 84 ? 7.003   1.789   -10.234 1.00 15.00 ? 84 VAL A O    6  
ATOM 8353  C CB   . VAL A 1 84 ? 6.427   3.868   -12.771 1.00 15.00 ? 84 VAL A CB   6  
ATOM 8354  C CG1  . VAL A 1 84 ? 5.105   4.439   -12.276 1.00 15.00 ? 84 VAL A CG1  6  
ATOM 8355  C CG2  . VAL A 1 84 ? 7.010   4.752   -13.861 1.00 15.00 ? 84 VAL A CG2  6  
ATOM 8356  H H    . VAL A 1 84 ? 8.525   2.144   -12.532 1.00 15.00 ? 84 VAL A H    6  
ATOM 8357  H HA   . VAL A 1 84 ? 7.744   4.694   -11.291 1.00 15.00 ? 84 VAL A HA   6  
ATOM 8358  H HB   . VAL A 1 84 ? 6.236   2.893   -13.194 1.00 15.00 ? 84 VAL A HB   6  
ATOM 8359  H HG11 . VAL A 1 84 ? 5.281   5.393   -11.804 1.00 15.00 ? 84 VAL A HG11 6  
ATOM 8360  H HG12 . VAL A 1 84 ? 4.435   4.570   -13.112 1.00 15.00 ? 84 VAL A HG12 6  
ATOM 8361  H HG13 . VAL A 1 84 ? 4.662   3.759   -11.563 1.00 15.00 ? 84 VAL A HG13 6  
ATOM 8362  H HG21 . VAL A 1 84 ? 7.118   5.760   -13.485 1.00 15.00 ? 84 VAL A HG21 6  
ATOM 8363  H HG22 . VAL A 1 84 ? 7.978   4.372   -14.153 1.00 15.00 ? 84 VAL A HG22 6  
ATOM 8364  H HG23 . VAL A 1 84 ? 6.350   4.754   -14.715 1.00 15.00 ? 84 VAL A HG23 6  
ATOM 8365  N N    . VAL A 1 85 ? 5.966   3.707   -9.690  1.00 15.00 ? 85 VAL A N    6  
ATOM 8366  C CA   . VAL A 1 85 ? 5.274   3.136   -8.547  1.00 15.00 ? 85 VAL A CA   6  
ATOM 8367  C C    . VAL A 1 85 ? 3.846   2.749   -8.926  1.00 15.00 ? 85 VAL A C    6  
ATOM 8368  O O    . VAL A 1 85 ? 2.892   3.469   -8.632  1.00 15.00 ? 85 VAL A O    6  
ATOM 8369  C CB   . VAL A 1 85 ? 5.265   4.130   -7.361  1.00 15.00 ? 85 VAL A CB   6  
ATOM 8370  C CG1  . VAL A 1 85 ? 4.192   3.783   -6.339  1.00 15.00 ? 85 VAL A CG1  6  
ATOM 8371  C CG2  . VAL A 1 85 ? 6.637   4.182   -6.702  1.00 15.00 ? 85 VAL A CG2  6  
ATOM 8372  H H    . VAL A 1 85 ? 5.825   4.653   -9.908  1.00 15.00 ? 85 VAL A H    6  
ATOM 8373  H HA   . VAL A 1 85 ? 5.810   2.248   -8.243  1.00 15.00 ? 85 VAL A HA   6  
ATOM 8374  H HB   . VAL A 1 85 ? 5.046   5.110   -7.749  1.00 15.00 ? 85 VAL A HB   6  
ATOM 8375  H HG11 . VAL A 1 85 ? 3.901   2.749   -6.458  1.00 15.00 ? 85 VAL A HG11 6  
ATOM 8376  H HG12 . VAL A 1 85 ? 4.581   3.936   -5.343  1.00 15.00 ? 85 VAL A HG12 6  
ATOM 8377  H HG13 . VAL A 1 85 ? 3.333   4.422   -6.493  1.00 15.00 ? 85 VAL A HG13 6  
ATOM 8378  H HG21 . VAL A 1 85 ? 6.525   4.129   -5.629  1.00 15.00 ? 85 VAL A HG21 6  
ATOM 8379  H HG22 . VAL A 1 85 ? 7.232   3.349   -7.044  1.00 15.00 ? 85 VAL A HG22 6  
ATOM 8380  H HG23 . VAL A 1 85 ? 7.128   5.107   -6.967  1.00 15.00 ? 85 VAL A HG23 6  
ATOM 8381  N N    . HIS A 1 86 ? 3.714   1.601   -9.585  1.00 15.00 ? 86 HIS A N    6  
ATOM 8382  C CA   . HIS A 1 86 ? 2.410   1.103   -10.009 1.00 15.00 ? 86 HIS A CA   6  
ATOM 8383  C C    . HIS A 1 86 ? 1.922   0.012   -9.063  1.00 15.00 ? 86 HIS A C    6  
ATOM 8384  O O    . HIS A 1 86 ? 2.112   -1.177  -9.317  1.00 15.00 ? 86 HIS A O    6  
ATOM 8385  C CB   . HIS A 1 86 ? 2.487   0.562   -11.438 1.00 15.00 ? 86 HIS A CB   6  
ATOM 8386  C CG   . HIS A 1 86 ? 1.291   0.901   -12.271 1.00 15.00 ? 86 HIS A CG   6  
ATOM 8387  N ND1  . HIS A 1 86 ? -0.003  0.631   -11.876 1.00 15.00 ? 86 HIS A ND1  6  
ATOM 8388  C CD2  . HIS A 1 86 ? 1.195   1.492   -13.486 1.00 15.00 ? 86 HIS A CD2  6  
ATOM 8389  C CE1  . HIS A 1 86 ? -0.841  1.041   -12.811 1.00 15.00 ? 86 HIS A CE1  6  
ATOM 8390  N NE2  . HIS A 1 86 ? -0.140  1.567   -13.798 1.00 15.00 ? 86 HIS A NE2  6  
ATOM 8391  H H    . HIS A 1 86 ? 4.516   1.075   -9.790  1.00 15.00 ? 86 HIS A H    6  
ATOM 8392  H HA   . HIS A 1 86 ? 1.714   1.928   -9.981  1.00 15.00 ? 86 HIS A HA   6  
ATOM 8393  H HB2  . HIS A 1 86 ? 3.358   0.973   -11.925 1.00 15.00 ? 86 HIS A HB2  6  
ATOM 8394  H HB3  . HIS A 1 86 ? 2.575   -0.514  -11.403 1.00 15.00 ? 86 HIS A HB3  6  
ATOM 8395  H HD1  . HIS A 1 86 ? -0.267  0.203   -11.035 1.00 15.00 ? 86 HIS A HD1  6  
ATOM 8396  H HD2  . HIS A 1 86 ? 2.017   1.841   -14.095 1.00 15.00 ? 86 HIS A HD2  6  
ATOM 8397  H HE1  . HIS A 1 86 ? -1.917  0.960   -12.774 1.00 15.00 ? 86 HIS A HE1  6  
ATOM 8398  H HE2  . HIS A 1 86 ? -0.507  1.864   -14.656 1.00 15.00 ? 86 HIS A HE2  6  
ATOM 8399  N N    . LEU A 1 87 ? 1.305   0.428   -7.963  1.00 15.00 ? 87 LEU A N    6  
ATOM 8400  C CA   . LEU A 1 87 ? 0.801   -0.506  -6.965  1.00 15.00 ? 87 LEU A CA   6  
ATOM 8401  C C    . LEU A 1 87 ? -0.704  -0.709  -7.098  1.00 15.00 ? 87 LEU A C    6  
ATOM 8402  O O    . LEU A 1 87 ? -1.466  0.252   -7.123  1.00 15.00 ? 87 LEU A O    6  
ATOM 8403  C CB   . LEU A 1 87 ? 1.126   0.011   -5.562  1.00 15.00 ? 87 LEU A CB   6  
ATOM 8404  C CG   . LEU A 1 87 ? 2.063   -0.875  -4.748  1.00 15.00 ? 87 LEU A CG   6  
ATOM 8405  C CD1  . LEU A 1 87 ? 3.149   -0.038  -4.087  1.00 15.00 ? 87 LEU A CD1  6  
ATOM 8406  C CD2  . LEU A 1 87 ? 1.278   -1.653  -3.704  1.00 15.00 ? 87 LEU A CD2  6  
ATOM 8407  H H    . LEU A 1 87 ? 1.195   1.389   -7.813  1.00 15.00 ? 87 LEU A H    6  
ATOM 8408  H HA   . LEU A 1 87 ? 1.297   -1.453  -7.113  1.00 15.00 ? 87 LEU A HA   6  
ATOM 8409  H HB2  . LEU A 1 87 ? 1.578   0.985   -5.657  1.00 15.00 ? 87 LEU A HB2  6  
ATOM 8410  H HB3  . LEU A 1 87 ? 0.202   0.116   -5.016  1.00 15.00 ? 87 LEU A HB3  6  
ATOM 8411  H HG   . LEU A 1 87 ? 2.540   -1.580  -5.409  1.00 15.00 ? 87 LEU A HG   6  
ATOM 8412  H HD11 . LEU A 1 87 ? 3.400   0.795   -4.727  1.00 15.00 ? 87 LEU A HD11 6  
ATOM 8413  H HD12 . LEU A 1 87 ? 2.791   0.332   -3.138  1.00 15.00 ? 87 LEU A HD12 6  
ATOM 8414  H HD13 . LEU A 1 87 ? 4.026   -0.647  -3.929  1.00 15.00 ? 87 LEU A HD13 6  
ATOM 8415  H HD21 . LEU A 1 87 ? 0.975   -0.984  -2.913  1.00 15.00 ? 87 LEU A HD21 6  
ATOM 8416  H HD22 . LEU A 1 87 ? 0.400   -2.087  -4.161  1.00 15.00 ? 87 LEU A HD22 6  
ATOM 8417  H HD23 . LEU A 1 87 ? 1.897   -2.437  -3.296  1.00 15.00 ? 87 LEU A HD23 6  
ATOM 8418  N N    . LEU A 1 88 ? -1.126  -1.967  -7.163  1.00 15.00 ? 88 LEU A N    6  
ATOM 8419  C CA   . LEU A 1 88 ? -2.544  -2.294  -7.269  1.00 15.00 ? 88 LEU A CA   6  
ATOM 8420  C C    . LEU A 1 88 ? -3.071  -2.745  -5.912  1.00 15.00 ? 88 LEU A C    6  
ATOM 8421  O O    . LEU A 1 88 ? -2.863  -3.886  -5.501  1.00 15.00 ? 88 LEU A O    6  
ATOM 8422  C CB   . LEU A 1 88 ? -2.763  -3.388  -8.316  1.00 15.00 ? 88 LEU A CB   6  
ATOM 8423  C CG   . LEU A 1 88 ? -2.892  -2.890  -9.759  1.00 15.00 ? 88 LEU A CG   6  
ATOM 8424  C CD1  . LEU A 1 88 ? -1.867  -1.804  -10.047 1.00 15.00 ? 88 LEU A CD1  6  
ATOM 8425  C CD2  . LEU A 1 88 ? -2.735  -4.046  -10.736 1.00 15.00 ? 88 LEU A CD2  6  
ATOM 8426  H H    . LEU A 1 88 ? -0.470  -2.694  -7.123  1.00 15.00 ? 88 LEU A H    6  
ATOM 8427  H HA   . LEU A 1 88 ? -3.073  -1.398  -7.573  1.00 15.00 ? 88 LEU A HA   6  
ATOM 8428  H HB2  . LEU A 1 88 ? -1.931  -4.073  -8.266  1.00 15.00 ? 88 LEU A HB2  6  
ATOM 8429  H HB3  . LEU A 1 88 ? -3.665  -3.924  -8.062  1.00 15.00 ? 88 LEU A HB3  6  
ATOM 8430  H HG   . LEU A 1 88 ? -3.876  -2.465  -9.898  1.00 15.00 ? 88 LEU A HG   6  
ATOM 8431  H HD11 . LEU A 1 88 ? -1.832  -1.113  -9.216  1.00 15.00 ? 88 LEU A HD11 6  
ATOM 8432  H HD12 . LEU A 1 88 ? -0.894  -2.253  -10.183 1.00 15.00 ? 88 LEU A HD12 6  
ATOM 8433  H HD13 . LEU A 1 88 ? -2.147  -1.272  -10.944 1.00 15.00 ? 88 LEU A HD13 6  
ATOM 8434  H HD21 . LEU A 1 88 ? -1.720  -4.412  -10.701 1.00 15.00 ? 88 LEU A HD21 6  
ATOM 8435  H HD22 . LEU A 1 88 ? -3.414  -4.841  -10.465 1.00 15.00 ? 88 LEU A HD22 6  
ATOM 8436  H HD23 . LEU A 1 88 ? -2.961  -3.705  -11.735 1.00 15.00 ? 88 LEU A HD23 6  
ATOM 8437  N N    . LEU A 1 89 ? -3.730  -1.832  -5.211  1.00 15.00 ? 89 LEU A N    6  
ATOM 8438  C CA   . LEU A 1 89 ? -4.262  -2.123  -3.885  1.00 15.00 ? 89 LEU A CA   6  
ATOM 8439  C C    . LEU A 1 89 ? -5.776  -2.294  -3.902  1.00 15.00 ? 89 LEU A C    6  
ATOM 8440  O O    . LEU A 1 89 ? -6.384  -2.519  -4.948  1.00 15.00 ? 89 LEU A O    6  
ATOM 8441  C CB   . LEU A 1 89 ? -3.895  -1.005  -2.906  1.00 15.00 ? 89 LEU A CB   6  
ATOM 8442  C CG   . LEU A 1 89 ? -2.845  -0.027  -3.406  1.00 15.00 ? 89 LEU A CG   6  
ATOM 8443  C CD1  . LEU A 1 89 ? -2.819  1.213   -2.536  1.00 15.00 ? 89 LEU A CD1  6  
ATOM 8444  C CD2  . LEU A 1 89 ? -1.490  -0.694  -3.426  1.00 15.00 ? 89 LEU A CD2  6  
ATOM 8445  H H    . LEU A 1 89 ? -3.849  -0.936  -5.588  1.00 15.00 ? 89 LEU A H    6  
ATOM 8446  H HA   . LEU A 1 89 ? -3.806  -3.038  -3.547  1.00 15.00 ? 89 LEU A HA   6  
ATOM 8447  H HB2  . LEU A 1 89 ? -4.791  -0.448  -2.673  1.00 15.00 ? 89 LEU A HB2  6  
ATOM 8448  H HB3  . LEU A 1 89 ? -3.528  -1.458  -1.998  1.00 15.00 ? 89 LEU A HB3  6  
ATOM 8449  H HG   . LEU A 1 89 ? -3.088  0.271   -4.413  1.00 15.00 ? 89 LEU A HG   6  
ATOM 8450  H HD11 . LEU A 1 89 ? -3.684  1.217   -1.890  1.00 15.00 ? 89 LEU A HD11 6  
ATOM 8451  H HD12 . LEU A 1 89 ? -1.922  1.206   -1.937  1.00 15.00 ? 89 LEU A HD12 6  
ATOM 8452  H HD13 . LEU A 1 89 ? -2.831  2.092   -3.161  1.00 15.00 ? 89 LEU A HD13 6  
ATOM 8453  H HD21 . LEU A 1 89 ? -0.720  0.050   -3.299  1.00 15.00 ? 89 LEU A HD21 6  
ATOM 8454  H HD22 . LEU A 1 89 ? -1.437  -1.411  -2.622  1.00 15.00 ? 89 LEU A HD22 6  
ATOM 8455  H HD23 . LEU A 1 89 ? -1.354  -1.199  -4.370  1.00 15.00 ? 89 LEU A HD23 6  
ATOM 8456  N N    . GLU A 1 90 ? -6.370  -2.164  -2.721  1.00 15.00 ? 90 GLU A N    6  
ATOM 8457  C CA   . GLU A 1 90 ? -7.813  -2.278  -2.556  1.00 15.00 ? 90 GLU A CA   6  
ATOM 8458  C C    . GLU A 1 90 ? -8.301  -1.258  -1.529  1.00 15.00 ? 90 GLU A C    6  
ATOM 8459  O O    . GLU A 1 90 ? -7.720  -1.122  -0.453  1.00 15.00 ? 90 GLU A O    6  
ATOM 8460  C CB   . GLU A 1 90 ? -8.188  -3.703  -2.127  1.00 15.00 ? 90 GLU A CB   6  
ATOM 8461  C CG   . GLU A 1 90 ? -9.393  -3.784  -1.199  1.00 15.00 ? 90 GLU A CG   6  
ATOM 8462  C CD   . GLU A 1 90 ? -9.759  -5.211  -0.840  1.00 15.00 ? 90 GLU A CD   6  
ATOM 8463  O OE1  . GLU A 1 90 ? -9.544  -6.108  -1.682  1.00 15.00 ? 90 GLU A OE1  6  
ATOM 8464  O OE2  . GLU A 1 90 ? -10.260 -5.431  0.282   1.00 15.00 ? 90 GLU A OE2  6  
ATOM 8465  H H    . GLU A 1 90 ? -5.816  -1.973  -1.934  1.00 15.00 ? 90 GLU A H    6  
ATOM 8466  H HA   . GLU A 1 90 ? -8.274  -2.062  -3.508  1.00 15.00 ? 90 GLU A HA   6  
ATOM 8467  H HB2  . GLU A 1 90 ? -8.410  -4.280  -3.011  1.00 15.00 ? 90 GLU A HB2  6  
ATOM 8468  H HB3  . GLU A 1 90 ? -7.343  -4.148  -1.622  1.00 15.00 ? 90 GLU A HB3  6  
ATOM 8469  H HG2  . GLU A 1 90 ? -9.166  -3.248  -0.289  1.00 15.00 ? 90 GLU A HG2  6  
ATOM 8470  H HG3  . GLU A 1 90 ? -10.239 -3.322  -1.687  1.00 15.00 ? 90 GLU A HG3  6  
ATOM 8471  N N    . LYS A 1 91 ? -9.366  -0.540  -1.870  1.00 15.00 ? 91 LYS A N    6  
ATOM 8472  C CA   . LYS A 1 91 ? -9.924  0.471   -0.976  1.00 15.00 ? 91 LYS A CA   6  
ATOM 8473  C C    . LYS A 1 91 ? -10.122 -0.087  0.431   1.00 15.00 ? 91 LYS A C    6  
ATOM 8474  O O    . LYS A 1 91 ? -11.139 -0.716  0.724   1.00 15.00 ? 91 LYS A O    6  
ATOM 8475  C CB   . LYS A 1 91 ? -11.254 0.989   -1.528  1.00 15.00 ? 91 LYS A CB   6  
ATOM 8476  C CG   . LYS A 1 91 ? -11.329 2.505   -1.611  1.00 15.00 ? 91 LYS A CG   6  
ATOM 8477  C CD   . LYS A 1 91 ? -11.003 3.156   -0.276  1.00 15.00 ? 91 LYS A CD   6  
ATOM 8478  C CE   . LYS A 1 91 ? -10.808 4.656   -0.420  1.00 15.00 ? 91 LYS A CE   6  
ATOM 8479  N NZ   . LYS A 1 91 ? -12.064 5.344   -0.828  1.00 15.00 ? 91 LYS A NZ   6  
ATOM 8480  H H    . LYS A 1 91 ? -9.785  -0.690  -2.743  1.00 15.00 ? 91 LYS A H    6  
ATOM 8481  H HA   . LYS A 1 91 ? -9.223  1.291   -0.928  1.00 15.00 ? 91 LYS A HA   6  
ATOM 8482  H HB2  . LYS A 1 91 ? -11.399 0.588   -2.520  1.00 15.00 ? 91 LYS A HB2  6  
ATOM 8483  H HB3  . LYS A 1 91 ? -12.055 0.645   -0.890  1.00 15.00 ? 91 LYS A HB3  6  
ATOM 8484  H HG2  . LYS A 1 91 ? -10.621 2.851   -2.350  1.00 15.00 ? 91 LYS A HG2  6  
ATOM 8485  H HG3  . LYS A 1 91 ? -12.328 2.791   -1.907  1.00 15.00 ? 91 LYS A HG3  6  
ATOM 8486  H HD2  . LYS A 1 91 ? -11.817 2.973   0.410   1.00 15.00 ? 91 LYS A HD2  6  
ATOM 8487  H HD3  . LYS A 1 91 ? -10.096 2.720   0.115   1.00 15.00 ? 91 LYS A HD3  6  
ATOM 8488  H HE2  . LYS A 1 91 ? -10.481 5.057   0.528   1.00 15.00 ? 91 LYS A HE2  6  
ATOM 8489  H HE3  . LYS A 1 91 ? -10.049 4.837   -1.167  1.00 15.00 ? 91 LYS A HE3  6  
ATOM 8490  H HZ1  . LYS A 1 91 ? -11.869 6.339   -1.058  1.00 15.00 ? 91 LYS A HZ1  6  
ATOM 8491  H HZ2  . LYS A 1 91 ? -12.470 4.879   -1.666  1.00 15.00 ? 91 LYS A HZ2  6  
ATOM 8492  H HZ3  . LYS A 1 91 ? -12.759 5.308   -0.055  1.00 15.00 ? 91 LYS A HZ3  6  
ATOM 8493  N N    . GLY A 1 92 ? -9.141  0.148   1.297   1.00 15.00 ? 92 GLY A N    6  
ATOM 8494  C CA   . GLY A 1 92 ? -9.222  -0.336  2.662   1.00 15.00 ? 92 GLY A CA   6  
ATOM 8495  C C    . GLY A 1 92 ? -10.297 0.366   3.467   1.00 15.00 ? 92 GLY A C    6  
ATOM 8496  O O    . GLY A 1 92 ? -10.376 1.594   3.473   1.00 15.00 ? 92 GLY A O    6  
ATOM 8497  H H    . GLY A 1 92 ? -8.354  0.655   1.005   1.00 15.00 ? 92 GLY A H    6  
ATOM 8498  H HA2  . GLY A 1 92 ? -9.435  -1.395  2.644   1.00 15.00 ? 92 GLY A HA2  6  
ATOM 8499  H HA3  . GLY A 1 92 ? -8.267  -0.181  3.144   1.00 15.00 ? 92 GLY A HA3  6  
ATOM 8500  N N    . GLN A 1 93 ? -11.127 -0.416  4.150   1.00 15.00 ? 93 GLN A N    6  
ATOM 8501  C CA   . GLN A 1 93 ? -12.203 0.136   4.964   1.00 15.00 ? 93 GLN A CA   6  
ATOM 8502  C C    . GLN A 1 93 ? -11.705 0.476   6.365   1.00 15.00 ? 93 GLN A C    6  
ATOM 8503  O O    . GLN A 1 93 ? -11.059 -0.342  7.021   1.00 15.00 ? 93 GLN A O    6  
ATOM 8504  C CB   . GLN A 1 93 ? -13.366 -0.855  5.050   1.00 15.00 ? 93 GLN A CB   6  
ATOM 8505  C CG   . GLN A 1 93 ? -12.938 -2.263  5.431   1.00 15.00 ? 93 GLN A CG   6  
ATOM 8506  C CD   . GLN A 1 93 ? -14.098 -3.114  5.910   1.00 15.00 ? 93 GLN A CD   6  
ATOM 8507  O OE1  . GLN A 1 93 ? -15.225 -2.971  5.437   1.00 15.00 ? 93 GLN A OE1  6  
ATOM 8508  N NE2  . GLN A 1 93 ? -13.826 -4.008  6.855   1.00 15.00 ? 93 GLN A NE2  6  
ATOM 8509  H H    . GLN A 1 93 ? -11.012 -1.389  4.105   1.00 15.00 ? 93 GLN A H    6  
ATOM 8510  H HA   . GLN A 1 93 ? -12.548 1.041   4.488   1.00 15.00 ? 93 GLN A HA   6  
ATOM 8511  H HB2  . GLN A 1 93 ? -14.070 -0.504  5.789   1.00 15.00 ? 93 GLN A HB2  6  
ATOM 8512  H HB3  . GLN A 1 93 ? -13.858 -0.900  4.089   1.00 15.00 ? 93 GLN A HB3  6  
ATOM 8513  H HG2  . GLN A 1 93 ? -12.497 -2.738  4.567   1.00 15.00 ? 93 GLN A HG2  6  
ATOM 8514  H HG3  . GLN A 1 93 ? -12.205 -2.202  6.221   1.00 15.00 ? 93 GLN A HG3  6  
ATOM 8515  H HE21 . GLN A 1 93 ? -12.905 -4.066  7.185   1.00 15.00 ? 93 GLN A HE21 6  
ATOM 8516  H HE22 . GLN A 1 93 ? -14.557 -4.571  7.183   1.00 15.00 ? 93 GLN A HE22 6  
ATOM 8517  N N    . SER A 1 94 ? -12.008 1.689   6.818   1.00 15.00 ? 94 SER A N    6  
ATOM 8518  C CA   . SER A 1 94 ? -11.589 2.137   8.141   1.00 15.00 ? 94 SER A CA   6  
ATOM 8519  C C    . SER A 1 94 ? -12.344 1.385   9.236   1.00 15.00 ? 94 SER A C    6  
ATOM 8520  O O    . SER A 1 94 ? -13.361 0.745   8.972   1.00 15.00 ? 94 SER A O    6  
ATOM 8521  C CB   . SER A 1 94 ? -11.819 3.642   8.289   1.00 15.00 ? 94 SER A CB   6  
ATOM 8522  O OG   . SER A 1 94 ? -13.168 3.922   8.622   1.00 15.00 ? 94 SER A OG   6  
ATOM 8523  H H    . SER A 1 94 ? -12.524 2.297   6.249   1.00 15.00 ? 94 SER A H    6  
ATOM 8524  H HA   . SER A 1 94 ? -10.534 1.932   8.242   1.00 15.00 ? 94 SER A HA   6  
ATOM 8525  H HB2  . SER A 1 94 ? -11.181 4.027   9.070   1.00 15.00 ? 94 SER A HB2  6  
ATOM 8526  H HB3  . SER A 1 94 ? -11.582 4.133   7.356   1.00 15.00 ? 94 SER A HB3  6  
ATOM 8527  H HG   . SER A 1 94 ? -13.705 3.901   7.827   1.00 15.00 ? 94 SER A HG   6  
ATOM 8528  N N    . PRO A 1 95 ? -11.852 1.455   10.485  1.00 15.00 ? 95 PRO A N    6  
ATOM 8529  C CA   . PRO A 1 95 ? -12.484 0.778   11.622  1.00 15.00 ? 95 PRO A CA   6  
ATOM 8530  C C    . PRO A 1 95 ? -13.971 1.099   11.732  1.00 15.00 ? 95 PRO A C    6  
ATOM 8531  O O    . PRO A 1 95 ? -14.808 0.199   11.779  1.00 15.00 ? 95 PRO A O    6  
ATOM 8532  C CB   . PRO A 1 95 ? -11.726 1.330   12.831  1.00 15.00 ? 95 PRO A CB   6  
ATOM 8533  C CG   . PRO A 1 95 ? -10.396 1.730   12.294  1.00 15.00 ? 95 PRO A CG   6  
ATOM 8534  C CD   . PRO A 1 95 ? -10.642 2.199   10.886  1.00 15.00 ? 95 PRO A CD   6  
ATOM 8535  H HA   . PRO A 1 95 ? -12.352 -0.292  11.568  1.00 15.00 ? 95 PRO A HA   6  
ATOM 8536  H HB2  . PRO A 1 95 ? -12.260 2.177   13.238  1.00 15.00 ? 95 PRO A HB2  6  
ATOM 8537  H HB3  . PRO A 1 95 ? -11.633 0.561   13.583  1.00 15.00 ? 95 PRO A HB3  6  
ATOM 8538  H HG2  . PRO A 1 95 ? -9.985  2.531   12.890  1.00 15.00 ? 95 PRO A HG2  6  
ATOM 8539  H HG3  . PRO A 1 95 ? -9.729  0.881   12.294  1.00 15.00 ? 95 PRO A HG3  6  
ATOM 8540  H HD2  . PRO A 1 95 ? -10.821 3.264   10.869  1.00 15.00 ? 95 PRO A HD2  6  
ATOM 8541  H HD3  . PRO A 1 95 ? -9.806  1.945   10.252  1.00 15.00 ? 95 PRO A HD3  6  
ATOM 8542  N N    . THR A 1 96 ? -14.291 2.388   11.774  1.00 15.00 ? 96 THR A N    6  
ATOM 8543  C CA   . THR A 1 96 ? -15.677 2.828   11.879  1.00 15.00 ? 96 THR A CA   6  
ATOM 8544  C C    . THR A 1 96 ? -16.276 3.077   10.498  1.00 15.00 ? 96 THR A C    6  
ATOM 8545  O O    . THR A 1 96 ? -17.276 2.411   10.159  1.00 15.00 ? 96 THR A O    6  
ATOM 8546  C CB   . THR A 1 96 ? -15.768 4.099   12.724  1.00 15.00 ? 96 THR A CB   6  
ATOM 8547  O OG1  . THR A 1 96 ? -15.117 3.921   13.969  1.00 15.00 ? 96 THR A OG1  6  
ATOM 8548  C CG2  . THR A 1 96 ? -17.191 4.529   13.007  1.00 15.00 ? 96 THR A CG2  6  
ATOM 8549  O OXT  . THR A 1 96 ? -15.738 3.936   9.768   1.00 15.00 ? 96 THR A OXT  6  
ATOM 8550  H H    . THR A 1 96 ? -13.579 3.060   11.733  1.00 15.00 ? 96 THR A H    6  
ATOM 8551  H HA   . THR A 1 96 ? -16.238 2.043   12.365  1.00 15.00 ? 96 THR A HA   6  
ATOM 8552  H HB   . THR A 1 96 ? -15.278 4.905   12.197  1.00 15.00 ? 96 THR A HB   6  
ATOM 8553  H HG1  . THR A 1 96 ? -14.250 3.536   13.825  1.00 15.00 ? 96 THR A HG1  6  
ATOM 8554  H HG21 . THR A 1 96 ? -17.596 5.029   12.139  1.00 15.00 ? 96 THR A HG21 6  
ATOM 8555  H HG22 . THR A 1 96 ? -17.791 3.660   13.234  1.00 15.00 ? 96 THR A HG22 6  
ATOM 8556  H HG23 . THR A 1 96 ? -17.203 5.205   13.850  1.00 15.00 ? 96 THR A HG23 6  
ATOM 8557  N N    . PRO A 1 1  ? -17.612 3.425   -6.803  1.00 15.00 ? 1  PRO A N    7  
ATOM 8558  C CA   . PRO A 1 1  ? -17.117 2.099   -6.344  1.00 15.00 ? 1  PRO A CA   7  
ATOM 8559  C C    . PRO A 1 1  ? -16.017 2.238   -5.293  1.00 15.00 ? 1  PRO A C    7  
ATOM 8560  O O    . PRO A 1 1  ? -14.980 2.853   -5.542  1.00 15.00 ? 1  PRO A O    7  
ATOM 8561  C CB   . PRO A 1 1  ? -16.592 1.355   -7.568  1.00 15.00 ? 1  PRO A CB   7  
ATOM 8562  C CG   . PRO A 1 1  ? -16.976 2.222   -8.720  1.00 15.00 ? 1  PRO A CG   7  
ATOM 8563  C CD   . PRO A 1 1  ? -17.109 3.622   -8.173  1.00 15.00 ? 1  PRO A CD   7  
ATOM 8564  H H2   . PRO A 1 1  ? -17.279 4.061   -6.059  1.00 15.00 ? 1  PRO A H2   7  
ATOM 8565  H H3   . PRO A 1 1  ? -18.641 3.335   -6.629  1.00 15.00 ? 1  PRO A H3   7  
ATOM 8566  H HA   . PRO A 1 1  ? -17.944 1.549   -5.921  1.00 15.00 ? 1  PRO A HA   7  
ATOM 8567  H HB2  . PRO A 1 1  ? -15.519 1.244   -7.495  1.00 15.00 ? 1  PRO A HB2  7  
ATOM 8568  H HB3  . PRO A 1 1  ? -17.058 0.384   -7.633  1.00 15.00 ? 1  PRO A HB3  7  
ATOM 8569  H HG2  . PRO A 1 1  ? -16.206 2.188   -9.477  1.00 15.00 ? 1  PRO A HG2  7  
ATOM 8570  H HG3  . PRO A 1 1  ? -17.919 1.890   -9.129  1.00 15.00 ? 1  PRO A HG3  7  
ATOM 8571  H HD2  . PRO A 1 1  ? -16.147 4.114   -8.160  1.00 15.00 ? 1  PRO A HD2  7  
ATOM 8572  H HD3  . PRO A 1 1  ? -17.815 4.190   -8.760  1.00 15.00 ? 1  PRO A HD3  7  
ATOM 8573  N N    . LYS A 1 2  ? -16.252 1.660   -4.119  1.00 15.00 ? 2  LYS A N    7  
ATOM 8574  C CA   . LYS A 1 2  ? -15.283 1.717   -3.030  1.00 15.00 ? 2  LYS A CA   7  
ATOM 8575  C C    . LYS A 1 2  ? -15.468 0.543   -2.068  1.00 15.00 ? 2  LYS A C    7  
ATOM 8576  O O    . LYS A 1 2  ? -14.579 -0.298  -1.934  1.00 15.00 ? 2  LYS A O    7  
ATOM 8577  C CB   . LYS A 1 2  ? -15.406 3.043   -2.279  1.00 15.00 ? 2  LYS A CB   7  
ATOM 8578  C CG   . LYS A 1 2  ? -14.361 4.069   -2.684  1.00 15.00 ? 2  LYS A CG   7  
ATOM 8579  C CD   . LYS A 1 2  ? -14.108 5.068   -1.568  1.00 15.00 ? 2  LYS A CD   7  
ATOM 8580  C CE   . LYS A 1 2  ? -12.934 5.979   -1.889  1.00 15.00 ? 2  LYS A CE   7  
ATOM 8581  N NZ   . LYS A 1 2  ? -13.381 7.355   -2.245  1.00 15.00 ? 2  LYS A NZ   7  
ATOM 8582  H H    . LYS A 1 2  ? -17.095 1.184   -3.982  1.00 15.00 ? 2  LYS A H    7  
ATOM 8583  H HA   . LYS A 1 2  ? -14.297 1.653   -3.466  1.00 15.00 ? 2  LYS A HA   7  
ATOM 8584  H HB2  . LYS A 1 2  ? -16.382 3.463   -2.470  1.00 15.00 ? 2  LYS A HB2  7  
ATOM 8585  H HB3  . LYS A 1 2  ? -15.304 2.856   -1.220  1.00 15.00 ? 2  LYS A HB3  7  
ATOM 8586  H HG2  . LYS A 1 2  ? -13.438 3.558   -2.913  1.00 15.00 ? 2  LYS A HG2  7  
ATOM 8587  H HG3  . LYS A 1 2  ? -14.709 4.598   -3.558  1.00 15.00 ? 2  LYS A HG3  7  
ATOM 8588  H HD2  . LYS A 1 2  ? -14.993 5.671   -1.432  1.00 15.00 ? 2  LYS A HD2  7  
ATOM 8589  H HD3  . LYS A 1 2  ? -13.894 4.527   -0.658  1.00 15.00 ? 2  LYS A HD3  7  
ATOM 8590  H HE2  . LYS A 1 2  ? -12.289 6.033   -1.025  1.00 15.00 ? 2  LYS A HE2  7  
ATOM 8591  H HE3  . LYS A 1 2  ? -12.386 5.562   -2.721  1.00 15.00 ? 2  LYS A HE3  7  
ATOM 8592  H HZ1  . LYS A 1 2  ? -12.679 7.809   -2.864  1.00 15.00 ? 2  LYS A HZ1  7  
ATOM 8593  H HZ2  . LYS A 1 2  ? -14.293 7.317   -2.743  1.00 15.00 ? 2  LYS A HZ2  7  
ATOM 8594  H HZ3  . LYS A 1 2  ? -13.492 7.928   -1.384  1.00 15.00 ? 2  LYS A HZ3  7  
ATOM 8595  N N    . PRO A 1 3  ? -16.628 0.463   -1.383  1.00 15.00 ? 3  PRO A N    7  
ATOM 8596  C CA   . PRO A 1 3  ? -16.915 -0.621  -0.437  1.00 15.00 ? 3  PRO A CA   7  
ATOM 8597  C C    . PRO A 1 3  ? -16.492 -1.987  -0.962  1.00 15.00 ? 3  PRO A C    7  
ATOM 8598  O O    . PRO A 1 3  ? -17.256 -2.659  -1.655  1.00 15.00 ? 3  PRO A O    7  
ATOM 8599  C CB   . PRO A 1 3  ? -18.431 -0.561  -0.308  1.00 15.00 ? 3  PRO A CB   7  
ATOM 8600  C CG   . PRO A 1 3  ? -18.766 0.876   -0.502  1.00 15.00 ? 3  PRO A CG   7  
ATOM 8601  C CD   . PRO A 1 3  ? -17.752 1.419   -1.476  1.00 15.00 ? 3  PRO A CD   7  
ATOM 8602  H HA   . PRO A 1 3  ? -16.460 -0.444  0.526   1.00 15.00 ? 3  PRO A HA   7  
ATOM 8603  H HB2  . PRO A 1 3  ? -18.879 -1.180  -1.072  1.00 15.00 ? 3  PRO A HB2  7  
ATOM 8604  H HB3  . PRO A 1 3  ? -18.728 -0.910  0.669   1.00 15.00 ? 3  PRO A HB3  7  
ATOM 8605  H HG2  . PRO A 1 3  ? -19.763 0.969   -0.908  1.00 15.00 ? 3  PRO A HG2  7  
ATOM 8606  H HG3  . PRO A 1 3  ? -18.695 1.399   0.441   1.00 15.00 ? 3  PRO A HG3  7  
ATOM 8607  H HD2  . PRO A 1 3  ? -18.164 1.436   -2.474  1.00 15.00 ? 3  PRO A HD2  7  
ATOM 8608  H HD3  . PRO A 1 3  ? -17.443 2.409   -1.178  1.00 15.00 ? 3  PRO A HD3  7  
ATOM 8609  N N    . GLY A 1 4  ? -15.270 -2.392  -0.638  1.00 15.00 ? 4  GLY A N    7  
ATOM 8610  C CA   . GLY A 1 4  ? -14.774 -3.674  -1.098  1.00 15.00 ? 4  GLY A CA   7  
ATOM 8611  C C    . GLY A 1 4  ? -14.104 -3.576  -2.454  1.00 15.00 ? 4  GLY A C    7  
ATOM 8612  O O    . GLY A 1 4  ? -13.293 -4.429  -2.816  1.00 15.00 ? 4  GLY A O    7  
ATOM 8613  H H    . GLY A 1 4  ? -14.699 -1.815  -0.089  1.00 15.00 ? 4  GLY A H    7  
ATOM 8614  H HA2  . GLY A 1 4  ? -14.060 -4.052  -0.380  1.00 15.00 ? 4  GLY A HA2  7  
ATOM 8615  H HA3  . GLY A 1 4  ? -15.601 -4.365  -1.166  1.00 15.00 ? 4  GLY A HA3  7  
ATOM 8616  N N    . ASP A 1 5  ? -14.438 -2.529  -3.205  1.00 15.00 ? 5  ASP A N    7  
ATOM 8617  C CA   . ASP A 1 5  ? -13.857 -2.322  -4.525  1.00 15.00 ? 5  ASP A CA   7  
ATOM 8618  C C    . ASP A 1 5  ? -12.352 -2.141  -4.426  1.00 15.00 ? 5  ASP A C    7  
ATOM 8619  O O    . ASP A 1 5  ? -11.831 -1.676  -3.412  1.00 15.00 ? 5  ASP A O    7  
ATOM 8620  C CB   . ASP A 1 5  ? -14.488 -1.103  -5.202  1.00 15.00 ? 5  ASP A CB   7  
ATOM 8621  C CG   . ASP A 1 5  ? -15.990 -1.241  -5.357  1.00 15.00 ? 5  ASP A CG   7  
ATOM 8622  O OD1  . ASP A 1 5  ? -16.706 -1.119  -4.341  1.00 15.00 ? 5  ASP A OD1  7  
ATOM 8623  O OD2  . ASP A 1 5  ? -16.450 -1.470  -6.496  1.00 15.00 ? 5  ASP A OD2  7  
ATOM 8624  H H    . ASP A 1 5  ? -15.089 -1.880  -2.862  1.00 15.00 ? 5  ASP A H    7  
ATOM 8625  H HA   . ASP A 1 5  ? -14.055 -3.201  -5.123  1.00 15.00 ? 5  ASP A HA   7  
ATOM 8626  H HB2  . ASP A 1 5  ? -14.286 -0.225  -4.607  1.00 15.00 ? 5  ASP A HB2  7  
ATOM 8627  H HB3  . ASP A 1 5  ? -14.052 -0.978  -6.182  1.00 15.00 ? 5  ASP A HB3  7  
ATOM 8628  N N    . ILE A 1 6  ? -11.661 -2.531  -5.485  1.00 15.00 ? 6  ILE A N    7  
ATOM 8629  C CA   . ILE A 1 6  ? -10.214 -2.438  -5.534  1.00 15.00 ? 6  ILE A CA   7  
ATOM 8630  C C    . ILE A 1 6  ? -9.763  -1.190  -6.288  1.00 15.00 ? 6  ILE A C    7  
ATOM 8631  O O    . ILE A 1 6  ? -10.394 -0.776  -7.261  1.00 15.00 ? 6  ILE A O    7  
ATOM 8632  C CB   . ILE A 1 6  ? -9.624  -3.697  -6.208  1.00 15.00 ? 6  ILE A CB   7  
ATOM 8633  C CG1  . ILE A 1 6  ? -9.049  -4.644  -5.155  1.00 15.00 ? 6  ILE A CG1  7  
ATOM 8634  C CG2  . ILE A 1 6  ? -8.556  -3.332  -7.236  1.00 15.00 ? 6  ILE A CG2  7  
ATOM 8635  C CD1  . ILE A 1 6  ? -10.107 -5.312  -4.303  1.00 15.00 ? 6  ILE A CD1  7  
ATOM 8636  H H    . ILE A 1 6  ? -12.140 -2.904  -6.254  1.00 15.00 ? 6  ILE A H    7  
ATOM 8637  H HA   . ILE A 1 6  ? -9.845  -2.392  -4.520  1.00 15.00 ? 6  ILE A HA   7  
ATOM 8638  H HB   . ILE A 1 6  ? -10.432 -4.199  -6.724  1.00 15.00 ? 6  ILE A HB   7  
ATOM 8639  H HG12 . ILE A 1 6  ? -8.483  -5.420  -5.648  1.00 15.00 ? 6  ILE A HG12 7  
ATOM 8640  H HG13 . ILE A 1 6  ? -8.395  -4.089  -4.499  1.00 15.00 ? 6  ILE A HG13 7  
ATOM 8641  H HG21 . ILE A 1 6  ? -7.836  -2.664  -6.785  1.00 15.00 ? 6  ILE A HG21 7  
ATOM 8642  H HG22 . ILE A 1 6  ? -8.056  -4.229  -7.570  1.00 15.00 ? 6  ILE A HG22 7  
ATOM 8643  H HG23 . ILE A 1 6  ? -9.020  -2.842  -8.079  1.00 15.00 ? 6  ILE A HG23 7  
ATOM 8644  H HD11 . ILE A 1 6  ? -10.383 -4.655  -3.492  1.00 15.00 ? 6  ILE A HD11 7  
ATOM 8645  H HD12 . ILE A 1 6  ? -10.976 -5.522  -4.908  1.00 15.00 ? 6  ILE A HD12 7  
ATOM 8646  H HD13 . ILE A 1 6  ? -9.716  -6.235  -3.902  1.00 15.00 ? 6  ILE A HD13 7  
ATOM 8647  N N    . PHE A 1 7  ? -8.655  -0.609  -5.843  1.00 15.00 ? 7  PHE A N    7  
ATOM 8648  C CA   . PHE A 1 7  ? -8.104  0.574   -6.487  1.00 15.00 ? 7  PHE A CA   7  
ATOM 8649  C C    . PHE A 1 7  ? -6.580  0.493   -6.535  1.00 15.00 ? 7  PHE A C    7  
ATOM 8650  O O    . PHE A 1 7  ? -5.961  -0.181  -5.714  1.00 15.00 ? 7  PHE A O    7  
ATOM 8651  C CB   . PHE A 1 7  ? -8.565  1.850   -5.767  1.00 15.00 ? 7  PHE A CB   7  
ATOM 8652  C CG   . PHE A 1 7  ? -7.724  2.236   -4.580  1.00 15.00 ? 7  PHE A CG   7  
ATOM 8653  C CD1  . PHE A 1 7  ? -6.482  2.825   -4.755  1.00 15.00 ? 7  PHE A CD1  7  
ATOM 8654  C CD2  . PHE A 1 7  ? -8.181  2.016   -3.290  1.00 15.00 ? 7  PHE A CD2  7  
ATOM 8655  C CE1  . PHE A 1 7  ? -5.711  3.186   -3.668  1.00 15.00 ? 7  PHE A CE1  7  
ATOM 8656  C CE2  . PHE A 1 7  ? -7.414  2.377   -2.199  1.00 15.00 ? 7  PHE A CE2  7  
ATOM 8657  C CZ   . PHE A 1 7  ? -6.178  2.963   -2.388  1.00 15.00 ? 7  PHE A CZ   7  
ATOM 8658  H H    . PHE A 1 7  ? -8.189  -0.995  -5.071  1.00 15.00 ? 7  PHE A H    7  
ATOM 8659  H HA   . PHE A 1 7  ? -8.476  0.590   -7.501  1.00 15.00 ? 7  PHE A HA   7  
ATOM 8660  H HB2  . PHE A 1 7  ? -8.543  2.673   -6.465  1.00 15.00 ? 7  PHE A HB2  7  
ATOM 8661  H HB3  . PHE A 1 7  ? -9.579  1.708   -5.422  1.00 15.00 ? 7  PHE A HB3  7  
ATOM 8662  H HD1  . PHE A 1 7  ? -6.114  3.000   -5.755  1.00 15.00 ? 7  PHE A HD1  7  
ATOM 8663  H HD2  . PHE A 1 7  ? -9.147  1.557   -3.141  1.00 15.00 ? 7  PHE A HD2  7  
ATOM 8664  H HE1  . PHE A 1 7  ? -4.745  3.644   -3.819  1.00 15.00 ? 7  PHE A HE1  7  
ATOM 8665  H HE2  . PHE A 1 7  ? -7.782  2.201   -1.199  1.00 15.00 ? 7  PHE A HE2  7  
ATOM 8666  H HZ   . PHE A 1 7  ? -5.578  3.246   -1.538  1.00 15.00 ? 7  PHE A HZ   7  
ATOM 8667  N N    . GLU A 1 8  ? -5.984  1.169   -7.509  1.00 15.00 ? 8  GLU A N    7  
ATOM 8668  C CA   . GLU A 1 8  ? -4.534  1.157   -7.672  1.00 15.00 ? 8  GLU A CA   7  
ATOM 8669  C C    . GLU A 1 8  ? -3.946  2.559   -7.596  1.00 15.00 ? 8  GLU A C    7  
ATOM 8670  O O    . GLU A 1 8  ? -4.533  3.527   -8.079  1.00 15.00 ? 8  GLU A O    7  
ATOM 8671  C CB   . GLU A 1 8  ? -4.168  0.524   -9.009  1.00 15.00 ? 8  GLU A CB   7  
ATOM 8672  C CG   . GLU A 1 8  ? -4.903  1.132   -10.184 1.00 15.00 ? 8  GLU A CG   7  
ATOM 8673  C CD   . GLU A 1 8  ? -5.971  0.215   -10.746 1.00 15.00 ? 8  GLU A CD   7  
ATOM 8674  O OE1  . GLU A 1 8  ? -5.659  -0.964  -11.016 1.00 15.00 ? 8  GLU A OE1  7  
ATOM 8675  O OE2  . GLU A 1 8  ? -7.120  0.675   -10.918 1.00 15.00 ? 8  GLU A OE2  7  
ATOM 8676  H H    . GLU A 1 8  ? -6.532  1.680   -8.141  1.00 15.00 ? 8  GLU A H    7  
ATOM 8677  H HA   . GLU A 1 8  ? -4.106  0.558   -6.878  1.00 15.00 ? 8  GLU A HA   7  
ATOM 8678  H HB2  . GLU A 1 8  ? -3.109  0.648   -9.174  1.00 15.00 ? 8  GLU A HB2  7  
ATOM 8679  H HB3  . GLU A 1 8  ? -4.400  -0.530  -8.973  1.00 15.00 ? 8  GLU A HB3  7  
ATOM 8680  H HG2  . GLU A 1 8  ? -5.370  2.048   -9.859  1.00 15.00 ? 8  GLU A HG2  7  
ATOM 8681  H HG3  . GLU A 1 8  ? -4.187  1.348   -10.961 1.00 15.00 ? 8  GLU A HG3  7  
ATOM 8682  N N    . VAL A 1 9  ? -2.767  2.641   -7.000  1.00 15.00 ? 9  VAL A N    7  
ATOM 8683  C CA   . VAL A 1 9  ? -2.047  3.900   -6.858  1.00 15.00 ? 9  VAL A CA   7  
ATOM 8684  C C    . VAL A 1 9  ? -0.946  3.980   -7.905  1.00 15.00 ? 9  VAL A C    7  
ATOM 8685  O O    . VAL A 1 9  ? -0.023  3.168   -7.907  1.00 15.00 ? 9  VAL A O    7  
ATOM 8686  C CB   . VAL A 1 9  ? -1.446  4.066   -5.434  1.00 15.00 ? 9  VAL A CB   7  
ATOM 8687  C CG1  . VAL A 1 9  ? -1.421  2.736   -4.694  1.00 15.00 ? 9  VAL A CG1  7  
ATOM 8688  C CG2  . VAL A 1 9  ? -0.046  4.668   -5.485  1.00 15.00 ? 9  VAL A CG2  7  
ATOM 8689  H H    . VAL A 1 9  ? -2.357  1.820   -6.661  1.00 15.00 ? 9  VAL A H    7  
ATOM 8690  H HA   . VAL A 1 9  ? -2.747  4.706   -7.032  1.00 15.00 ? 9  VAL A HA   7  
ATOM 8691  H HB   . VAL A 1 9  ? -2.081  4.742   -4.879  1.00 15.00 ? 9  VAL A HB   7  
ATOM 8692  H HG11 . VAL A 1 9  ? -2.383  2.249   -4.792  1.00 15.00 ? 9  VAL A HG11 7  
ATOM 8693  H HG12 . VAL A 1 9  ? -0.656  2.106   -5.120  1.00 15.00 ? 9  VAL A HG12 7  
ATOM 8694  H HG13 . VAL A 1 9  ? -1.207  2.907   -3.650  1.00 15.00 ? 9  VAL A HG13 7  
ATOM 8695  H HG21 . VAL A 1 9  ? 0.653   3.924   -5.836  1.00 15.00 ? 9  VAL A HG21 7  
ATOM 8696  H HG22 . VAL A 1 9  ? -0.042  5.513   -6.157  1.00 15.00 ? 9  VAL A HG22 7  
ATOM 8697  H HG23 . VAL A 1 9  ? 0.242   4.993   -4.496  1.00 15.00 ? 9  VAL A HG23 7  
ATOM 8698  N N    . GLU A 1 10 ? -1.063  4.944   -8.805  1.00 15.00 ? 10 GLU A N    7  
ATOM 8699  C CA   . GLU A 1 10 ? -0.086  5.106   -9.869  1.00 15.00 ? 10 GLU A CA   7  
ATOM 8700  C C    . GLU A 1 10 ? 0.824   6.308   -9.636  1.00 15.00 ? 10 GLU A C    7  
ATOM 8701  O O    . GLU A 1 10 ? 0.717   7.322   -10.326 1.00 15.00 ? 10 GLU A O    7  
ATOM 8702  C CB   . GLU A 1 10 ? -0.806  5.236   -11.205 1.00 15.00 ? 10 GLU A CB   7  
ATOM 8703  C CG   . GLU A 1 10 ? 0.125   5.458   -12.387 1.00 15.00 ? 10 GLU A CG   7  
ATOM 8704  C CD   . GLU A 1 10 ? 0.166   4.269   -13.328 1.00 15.00 ? 10 GLU A CD   7  
ATOM 8705  O OE1  . GLU A 1 10 ? -0.881  3.954   -13.932 1.00 15.00 ? 10 GLU A OE1  7  
ATOM 8706  O OE2  . GLU A 1 10 ? 1.244   3.653   -13.460 1.00 15.00 ? 10 GLU A OE2  7  
ATOM 8707  H H    . GLU A 1 10 ? -1.831  5.551   -8.762  1.00 15.00 ? 10 GLU A H    7  
ATOM 8708  H HA   . GLU A 1 10 ? 0.522   4.215   -9.892  1.00 15.00 ? 10 GLU A HA   7  
ATOM 8709  H HB2  . GLU A 1 10 ? -1.367  4.331   -11.378 1.00 15.00 ? 10 GLU A HB2  7  
ATOM 8710  H HB3  . GLU A 1 10 ? -1.490  6.069   -11.148 1.00 15.00 ? 10 GLU A HB3  7  
ATOM 8711  H HG2  . GLU A 1 10 ? -0.214  6.321   -12.939 1.00 15.00 ? 10 GLU A HG2  7  
ATOM 8712  H HG3  . GLU A 1 10 ? 1.122   5.638   -12.015 1.00 15.00 ? 10 GLU A HG3  7  
ATOM 8713  N N    . LEU A 1 11 ? 1.731   6.182   -8.675  1.00 15.00 ? 11 LEU A N    7  
ATOM 8714  C CA   . LEU A 1 11 ? 2.673   7.253   -8.372  1.00 15.00 ? 11 LEU A CA   7  
ATOM 8715  C C    . LEU A 1 11 ? 3.919   7.113   -9.240  1.00 15.00 ? 11 LEU A C    7  
ATOM 8716  O O    . LEU A 1 11 ? 4.173   6.050   -9.801  1.00 15.00 ? 11 LEU A O    7  
ATOM 8717  C CB   . LEU A 1 11 ? 3.060   7.234   -6.892  1.00 15.00 ? 11 LEU A CB   7  
ATOM 8718  C CG   . LEU A 1 11 ? 3.294   8.610   -6.260  1.00 15.00 ? 11 LEU A CG   7  
ATOM 8719  C CD1  . LEU A 1 11 ? 2.014   9.432   -6.267  1.00 15.00 ? 11 LEU A CD1  7  
ATOM 8720  C CD2  . LEU A 1 11 ? 3.823   8.459   -4.840  1.00 15.00 ? 11 LEU A CD2  7  
ATOM 8721  H H    . LEU A 1 11 ? 1.775   5.347   -8.167  1.00 15.00 ? 11 LEU A H    7  
ATOM 8722  H HA   . LEU A 1 11 ? 2.193   8.188   -8.600  1.00 15.00 ? 11 LEU A HA   7  
ATOM 8723  H HB2  . LEU A 1 11 ? 2.275   6.740   -6.346  1.00 15.00 ? 11 LEU A HB2  7  
ATOM 8724  H HB3  . LEU A 1 11 ? 3.966   6.658   -6.785  1.00 15.00 ? 11 LEU A HB3  7  
ATOM 8725  H HG   . LEU A 1 11 ? 4.035   9.142   -6.838  1.00 15.00 ? 11 LEU A HG   7  
ATOM 8726  H HD11 . LEU A 1 11 ? 1.433   9.189   -7.143  1.00 15.00 ? 11 LEU A HD11 7  
ATOM 8727  H HD12 . LEU A 1 11 ? 1.439   9.211   -5.380  1.00 15.00 ? 11 LEU A HD12 7  
ATOM 8728  H HD13 . LEU A 1 11 ? 2.262   10.483  -6.281  1.00 15.00 ? 11 LEU A HD13 7  
ATOM 8729  H HD21 . LEU A 1 11 ? 3.009   8.201   -4.178  1.00 15.00 ? 11 LEU A HD21 7  
ATOM 8730  H HD22 . LEU A 1 11 ? 4.568   7.678   -4.815  1.00 15.00 ? 11 LEU A HD22 7  
ATOM 8731  H HD23 . LEU A 1 11 ? 4.266   9.390   -4.520  1.00 15.00 ? 11 LEU A HD23 7  
ATOM 8732  N N    . ALA A 1 12 ? 4.687   8.185   -9.360  1.00 15.00 ? 12 ALA A N    7  
ATOM 8733  C CA   . ALA A 1 12 ? 5.899   8.158   -10.173 1.00 15.00 ? 12 ALA A CA   7  
ATOM 8734  C C    . ALA A 1 12 ? 7.142   7.908   -9.324  1.00 15.00 ? 12 ALA A C    7  
ATOM 8735  O O    . ALA A 1 12 ? 7.722   8.842   -8.770  1.00 15.00 ? 12 ALA A O    7  
ATOM 8736  C CB   . ALA A 1 12 ? 6.043   9.451   -10.957 1.00 15.00 ? 12 ALA A CB   7  
ATOM 8737  H H    . ALA A 1 12 ? 4.434   9.010   -8.896  1.00 15.00 ? 12 ALA A H    7  
ATOM 8738  H HA   . ALA A 1 12 ? 5.798   7.347   -10.881 1.00 15.00 ? 12 ALA A HA   7  
ATOM 8739  H HB1  . ALA A 1 12 ? 6.491   9.240   -11.917 1.00 15.00 ? 12 ALA A HB1  7  
ATOM 8740  H HB2  . ALA A 1 12 ? 5.069   9.894   -11.103 1.00 15.00 ? 12 ALA A HB2  7  
ATOM 8741  H HB3  . ALA A 1 12 ? 6.672   10.137  -10.409 1.00 15.00 ? 12 ALA A HB3  7  
ATOM 8742  N N    . LYS A 1 13 ? 7.551   6.645   -9.228  1.00 15.00 ? 13 LYS A N    7  
ATOM 8743  C CA   . LYS A 1 13 ? 8.735   6.268   -8.451  1.00 15.00 ? 13 LYS A CA   7  
ATOM 8744  C C    . LYS A 1 13 ? 10.033  6.829   -9.040  1.00 15.00 ? 13 LYS A C    7  
ATOM 8745  O O    . LYS A 1 13 ? 11.085  6.197   -8.943  1.00 15.00 ? 13 LYS A O    7  
ATOM 8746  C CB   . LYS A 1 13 ? 8.850   4.750   -8.366  1.00 15.00 ? 13 LYS A CB   7  
ATOM 8747  C CG   . LYS A 1 13 ? 9.908   4.262   -7.382  1.00 15.00 ? 13 LYS A CG   7  
ATOM 8748  C CD   . LYS A 1 13 ? 10.011  5.166   -6.160  1.00 15.00 ? 13 LYS A CD   7  
ATOM 8749  C CE   . LYS A 1 13 ? 8.760   5.082   -5.299  1.00 15.00 ? 13 LYS A CE   7  
ATOM 8750  N NZ   . LYS A 1 13 ? 8.040   6.384   -5.231  1.00 15.00 ? 13 LYS A NZ   7  
ATOM 8751  H H    . LYS A 1 13 ? 7.049   5.947   -9.696  1.00 15.00 ? 13 LYS A H    7  
ATOM 8752  H HA   . LYS A 1 13 ? 8.608   6.663   -7.456  1.00 15.00 ? 13 LYS A HA   7  
ATOM 8753  H HB2  . LYS A 1 13 ? 7.898   4.341   -8.072  1.00 15.00 ? 13 LYS A HB2  7  
ATOM 8754  H HB3  . LYS A 1 13 ? 9.105   4.378   -9.345  1.00 15.00 ? 13 LYS A HB3  7  
ATOM 8755  H HG2  . LYS A 1 13 ? 9.649   3.267   -7.056  1.00 15.00 ? 13 LYS A HG2  7  
ATOM 8756  H HG3  . LYS A 1 13 ? 10.866  4.240   -7.881  1.00 15.00 ? 13 LYS A HG3  7  
ATOM 8757  H HD2  . LYS A 1 13 ? 10.862  4.861   -5.570  1.00 15.00 ? 13 LYS A HD2  7  
ATOM 8758  H HD3  . LYS A 1 13 ? 10.145  6.188   -6.490  1.00 15.00 ? 13 LYS A HD3  7  
ATOM 8759  H HE2  . LYS A 1 13 ? 8.098   4.338   -5.717  1.00 15.00 ? 13 LYS A HE2  7  
ATOM 8760  H HE3  . LYS A 1 13 ? 9.046   4.786   -4.300  1.00 15.00 ? 13 LYS A HE3  7  
ATOM 8761  H HZ1  . LYS A 1 13 ? 7.658   6.532   -4.276  1.00 15.00 ? 13 LYS A HZ1  7  
ATOM 8762  H HZ2  . LYS A 1 13 ? 8.689   7.164   -5.458  1.00 15.00 ? 13 LYS A HZ2  7  
ATOM 8763  H HZ3  . LYS A 1 13 ? 7.253   6.394   -5.911  1.00 15.00 ? 13 LYS A HZ3  7  
ATOM 8764  N N    . ASN A 1 14 ? 9.961   7.998   -9.652  1.00 15.00 ? 14 ASN A N    7  
ATOM 8765  C CA   . ASN A 1 14 ? 11.135  8.618   -10.256 1.00 15.00 ? 14 ASN A CA   7  
ATOM 8766  C C    . ASN A 1 14 ? 11.592  9.833   -9.457  1.00 15.00 ? 14 ASN A C    7  
ATOM 8767  O O    . ASN A 1 14 ? 12.656  9.816   -8.837  1.00 15.00 ? 14 ASN A O    7  
ATOM 8768  C CB   . ASN A 1 14 ? 10.835  9.027   -11.700 1.00 15.00 ? 14 ASN A CB   7  
ATOM 8769  C CG   . ASN A 1 14 ? 11.966  8.675   -12.647 1.00 15.00 ? 14 ASN A CG   7  
ATOM 8770  O OD1  . ASN A 1 14 ? 12.712  9.547   -13.092 1.00 15.00 ? 14 ASN A OD1  7  
ATOM 8771  N ND2  . ASN A 1 14 ? 12.098  7.391   -12.960 1.00 15.00 ? 14 ASN A ND2  7  
ATOM 8772  H H    . ASN A 1 14 ? 9.105   8.450   -9.704  1.00 15.00 ? 14 ASN A H    7  
ATOM 8773  H HA   . ASN A 1 14 ? 11.930  7.887   -10.259 1.00 15.00 ? 14 ASN A HA   7  
ATOM 8774  H HB2  . ASN A 1 14 ? 9.942   8.520   -12.033 1.00 15.00 ? 14 ASN A HB2  7  
ATOM 8775  H HB3  . ASN A 1 14 ? 10.675  10.094  -11.740 1.00 15.00 ? 14 ASN A HB3  7  
ATOM 8776  H HD21 . ASN A 1 14 ? 11.467  6.752   -12.567 1.00 15.00 ? 14 ASN A HD21 7  
ATOM 8777  H HD22 . ASN A 1 14 ? 12.820  7.135   -13.570 1.00 15.00 ? 14 ASN A HD22 7  
ATOM 8778  N N    . ASP A 1 15 ? 10.784  10.890  -9.478  1.00 15.00 ? 15 ASP A N    7  
ATOM 8779  C CA   . ASP A 1 15 ? 11.107  12.119  -8.757  1.00 15.00 ? 15 ASP A CA   7  
ATOM 8780  C C    . ASP A 1 15 ? 11.566  11.817  -7.333  1.00 15.00 ? 15 ASP A C    7  
ATOM 8781  O O    . ASP A 1 15 ? 12.526  12.409  -6.841  1.00 15.00 ? 15 ASP A O    7  
ATOM 8782  C CB   . ASP A 1 15 ? 9.894   13.050  -8.727  1.00 15.00 ? 15 ASP A CB   7  
ATOM 8783  C CG   . ASP A 1 15 ? 8.641   12.354  -8.233  1.00 15.00 ? 15 ASP A CG   7  
ATOM 8784  O OD1  . ASP A 1 15 ? 8.138   11.461  -8.947  1.00 15.00 ? 15 ASP A OD1  7  
ATOM 8785  O OD2  . ASP A 1 15 ? 8.164   12.701  -7.132  1.00 15.00 ? 15 ASP A OD2  7  
ATOM 8786  H H    . ASP A 1 15 ? 9.952   10.844  -9.993  1.00 15.00 ? 15 ASP A H    7  
ATOM 8787  H HA   . ASP A 1 15 ? 11.912  12.609  -9.284  1.00 15.00 ? 15 ASP A HA   7  
ATOM 8788  H HB2  . ASP A 1 15 ? 10.103  13.882  -8.071  1.00 15.00 ? 15 ASP A HB2  7  
ATOM 8789  H HB3  . ASP A 1 15 ? 9.708   13.421  -9.725  1.00 15.00 ? 15 ASP A HB3  7  
ATOM 8790  N N    . ASN A 1 16 ? 10.873  10.892  -6.677  1.00 15.00 ? 16 ASN A N    7  
ATOM 8791  C CA   . ASN A 1 16 ? 11.209  10.510  -5.311  1.00 15.00 ? 16 ASN A CA   7  
ATOM 8792  C C    . ASN A 1 16 ? 10.514  9.209   -4.924  1.00 15.00 ? 16 ASN A C    7  
ATOM 8793  O O    . ASN A 1 16 ? 9.695   8.684   -5.678  1.00 15.00 ? 16 ASN A O    7  
ATOM 8794  C CB   . ASN A 1 16 ? 10.815  11.625  -4.338  1.00 15.00 ? 16 ASN A CB   7  
ATOM 8795  C CG   . ASN A 1 16 ? 11.961  12.036  -3.435  1.00 15.00 ? 16 ASN A CG   7  
ATOM 8796  O OD1  . ASN A 1 16 ? 12.352  11.296  -2.533  1.00 15.00 ? 16 ASN A OD1  7  
ATOM 8797  N ND2  . ASN A 1 16 ? 12.505  13.223  -3.674  1.00 15.00 ? 16 ASN A ND2  7  
ATOM 8798  H H    . ASN A 1 16 ? 10.118  10.454  -7.123  1.00 15.00 ? 16 ASN A H    7  
ATOM 8799  H HA   . ASN A 1 16 ? 12.278  10.363  -5.261  1.00 15.00 ? 16 ASN A HA   7  
ATOM 8800  H HB2  . ASN A 1 16 ? 10.498  12.490  -4.902  1.00 15.00 ? 16 ASN A HB2  7  
ATOM 8801  H HB3  . ASN A 1 16 ? 9.997   11.284  -3.720  1.00 15.00 ? 16 ASN A HB3  7  
ATOM 8802  H HD21 . ASN A 1 16 ? 12.141  13.760  -4.409  1.00 15.00 ? 16 ASN A HD21 7  
ATOM 8803  H HD22 . ASN A 1 16 ? 13.248  13.515  -3.106  1.00 15.00 ? 16 ASN A HD22 7  
ATOM 8804  N N    . SER A 1 17 ? 10.840  8.698   -3.742  1.00 15.00 ? 17 SER A N    7  
ATOM 8805  C CA   . SER A 1 17 ? 10.239  7.462   -3.254  1.00 15.00 ? 17 SER A CA   7  
ATOM 8806  C C    . SER A 1 17 ? 8.924   7.756   -2.547  1.00 15.00 ? 17 SER A C    7  
ATOM 8807  O O    . SER A 1 17 ? 8.379   8.853   -2.665  1.00 15.00 ? 17 SER A O    7  
ATOM 8808  C CB   . SER A 1 17 ? 11.182  6.744   -2.290  1.00 15.00 ? 17 SER A CB   7  
ATOM 8809  O OG   . SER A 1 17 ? 12.394  7.461   -2.126  1.00 15.00 ? 17 SER A OG   7  
ATOM 8810  H H    . SER A 1 17 ? 11.496  9.164   -3.182  1.00 15.00 ? 17 SER A H    7  
ATOM 8811  H HA   . SER A 1 17 ? 10.048  6.825   -4.103  1.00 15.00 ? 17 SER A HA   7  
ATOM 8812  H HB2  . SER A 1 17 ? 10.699  6.652   -1.327  1.00 15.00 ? 17 SER A HB2  7  
ATOM 8813  H HB3  . SER A 1 17 ? 11.406  5.761   -2.675  1.00 15.00 ? 17 SER A HB3  7  
ATOM 8814  H HG   . SER A 1 17 ? 12.957  7.317   -2.890  1.00 15.00 ? 17 SER A HG   7  
ATOM 8815  N N    . LEU A 1 18 ? 8.423   6.777   -1.803  1.00 15.00 ? 18 LEU A N    7  
ATOM 8816  C CA   . LEU A 1 18 ? 7.179   6.954   -1.075  1.00 15.00 ? 18 LEU A CA   7  
ATOM 8817  C C    . LEU A 1 18 ? 7.440   7.637   0.263   1.00 15.00 ? 18 LEU A C    7  
ATOM 8818  O O    . LEU A 1 18 ? 8.543   8.120   0.518   1.00 15.00 ? 18 LEU A O    7  
ATOM 8819  C CB   . LEU A 1 18 ? 6.476   5.606   -0.863  1.00 15.00 ? 18 LEU A CB   7  
ATOM 8820  C CG   . LEU A 1 18 ? 5.859   4.996   -2.123  1.00 15.00 ? 18 LEU A CG   7  
ATOM 8821  C CD1  . LEU A 1 18 ? 6.821   4.009   -2.765  1.00 15.00 ? 18 LEU A CD1  7  
ATOM 8822  C CD2  . LEU A 1 18 ? 4.538   4.317   -1.795  1.00 15.00 ? 18 LEU A CD2  7  
ATOM 8823  H H    . LEU A 1 18 ? 8.904   5.926   -1.738  1.00 15.00 ? 18 LEU A H    7  
ATOM 8824  H HA   . LEU A 1 18 ? 6.549   7.591   -1.670  1.00 15.00 ? 18 LEU A HA   7  
ATOM 8825  H HB2  . LEU A 1 18 ? 7.196   4.907   -0.463  1.00 15.00 ? 18 LEU A HB2  7  
ATOM 8826  H HB3  . LEU A 1 18 ? 5.688   5.741   -0.135  1.00 15.00 ? 18 LEU A HB3  7  
ATOM 8827  H HG   . LEU A 1 18 ? 5.663   5.782   -2.837  1.00 15.00 ? 18 LEU A HG   7  
ATOM 8828  H HD11 . LEU A 1 18 ? 7.809   4.443   -2.805  1.00 15.00 ? 18 LEU A HD11 7  
ATOM 8829  H HD12 . LEU A 1 18 ? 6.850   3.101   -2.180  1.00 15.00 ? 18 LEU A HD12 7  
ATOM 8830  H HD13 . LEU A 1 18 ? 6.487   3.781   -3.767  1.00 15.00 ? 18 LEU A HD13 7  
ATOM 8831  H HD21 . LEU A 1 18 ? 4.426   3.433   -2.405  1.00 15.00 ? 18 LEU A HD21 7  
ATOM 8832  H HD22 . LEU A 1 18 ? 4.525   4.038   -0.751  1.00 15.00 ? 18 LEU A HD22 7  
ATOM 8833  H HD23 . LEU A 1 18 ? 3.724   4.998   -1.995  1.00 15.00 ? 18 LEU A HD23 7  
ATOM 8834  N N    . GLY A 1 19 ? 6.421   7.677   1.111   1.00 15.00 ? 19 GLY A N    7  
ATOM 8835  C CA   . GLY A 1 19 ? 6.557   8.307   2.408   1.00 15.00 ? 19 GLY A CA   7  
ATOM 8836  C C    . GLY A 1 19 ? 5.489   7.847   3.366   1.00 15.00 ? 19 GLY A C    7  
ATOM 8837  O O    . GLY A 1 19 ? 4.952   8.636   4.139   1.00 15.00 ? 19 GLY A O    7  
ATOM 8838  H H    . GLY A 1 19 ? 5.566   7.279   0.852   1.00 15.00 ? 19 GLY A H    7  
ATOM 8839  H HA2  . GLY A 1 19 ? 7.527   8.070   2.820   1.00 15.00 ? 19 GLY A HA2  7  
ATOM 8840  H HA3  . GLY A 1 19 ? 6.476   9.376   2.286   1.00 15.00 ? 19 GLY A HA3  7  
ATOM 8841  N N    . ILE A 1 20 ? 5.170   6.565   3.296   1.00 15.00 ? 20 ILE A N    7  
ATOM 8842  C CA   . ILE A 1 20 ? 4.152   5.981   4.149   1.00 15.00 ? 20 ILE A CA   7  
ATOM 8843  C C    . ILE A 1 20 ? 4.746   4.988   5.141   1.00 15.00 ? 20 ILE A C    7  
ATOM 8844  O O    . ILE A 1 20 ? 5.589   4.165   4.786   1.00 15.00 ? 20 ILE A O    7  
ATOM 8845  C CB   . ILE A 1 20 ? 3.065   5.285   3.300   1.00 15.00 ? 20 ILE A CB   7  
ATOM 8846  C CG1  . ILE A 1 20 ? 1.699   5.867   3.633   1.00 15.00 ? 20 ILE A CG1  7  
ATOM 8847  C CG2  . ILE A 1 20 ? 3.069   3.783   3.527   1.00 15.00 ? 20 ILE A CG2  7  
ATOM 8848  C CD1  . ILE A 1 20 ? 0.549   4.926   3.373   1.00 15.00 ? 20 ILE A CD1  7  
ATOM 8849  H H    . ILE A 1 20 ? 5.629   5.995   2.645   1.00 15.00 ? 20 ILE A H    7  
ATOM 8850  H HA   . ILE A 1 20 ? 3.679   6.779   4.706   1.00 15.00 ? 20 ILE A HA   7  
ATOM 8851  H HB   . ILE A 1 20 ? 3.281   5.469   2.260   1.00 15.00 ? 20 ILE A HB   7  
ATOM 8852  H HG12 . ILE A 1 20 ? 1.682   6.117   4.676   1.00 15.00 ? 20 ILE A HG12 7  
ATOM 8853  H HG13 . ILE A 1 20 ? 1.540   6.759   3.048   1.00 15.00 ? 20 ILE A HG13 7  
ATOM 8854  H HG21 . ILE A 1 20 ? 4.062   3.395   3.364   1.00 15.00 ? 20 ILE A HG21 7  
ATOM 8855  H HG22 . ILE A 1 20 ? 2.762   3.581   4.543   1.00 15.00 ? 20 ILE A HG22 7  
ATOM 8856  H HG23 . ILE A 1 20 ? 2.379   3.316   2.842   1.00 15.00 ? 20 ILE A HG23 7  
ATOM 8857  H HD11 . ILE A 1 20 ? -0.318  5.490   3.068   1.00 15.00 ? 20 ILE A HD11 7  
ATOM 8858  H HD12 . ILE A 1 20 ? 0.827   4.234   2.594   1.00 15.00 ? 20 ILE A HD12 7  
ATOM 8859  H HD13 . ILE A 1 20 ? 0.326   4.381   4.275   1.00 15.00 ? 20 ILE A HD13 7  
ATOM 8860  N N    . SER A 1 21 ? 4.262   5.042   6.372   1.00 15.00 ? 21 SER A N    7  
ATOM 8861  C CA   . SER A 1 21 ? 4.699   4.116   7.402   1.00 15.00 ? 21 SER A CA   7  
ATOM 8862  C C    . SER A 1 21 ? 3.697   2.971   7.454   1.00 15.00 ? 21 SER A C    7  
ATOM 8863  O O    . SER A 1 21 ? 2.599   3.121   7.988   1.00 15.00 ? 21 SER A O    7  
ATOM 8864  C CB   . SER A 1 21 ? 4.797   4.821   8.759   1.00 15.00 ? 21 SER A CB   7  
ATOM 8865  O OG   . SER A 1 21 ? 5.049   3.893   9.800   1.00 15.00 ? 21 SER A OG   7  
ATOM 8866  H H    . SER A 1 21 ? 3.564   5.695   6.582   1.00 15.00 ? 21 SER A H    7  
ATOM 8867  H HA   . SER A 1 21 ? 5.668   3.729   7.122   1.00 15.00 ? 21 SER A HA   7  
ATOM 8868  H HB2  . SER A 1 21 ? 5.604   5.540   8.731   1.00 15.00 ? 21 SER A HB2  7  
ATOM 8869  H HB3  . SER A 1 21 ? 3.870   5.333   8.965   1.00 15.00 ? 21 SER A HB3  7  
ATOM 8870  H HG   . SER A 1 21 ? 5.625   4.295   10.455  1.00 15.00 ? 21 SER A HG   7  
ATOM 8871  N N    . VAL A 1 22 ? 4.055   1.845   6.847   1.00 15.00 ? 22 VAL A N    7  
ATOM 8872  C CA   . VAL A 1 22 ? 3.149   0.703   6.780   1.00 15.00 ? 22 VAL A CA   7  
ATOM 8873  C C    . VAL A 1 22 ? 3.376   -0.283  7.920   1.00 15.00 ? 22 VAL A C    7  
ATOM 8874  O O    . VAL A 1 22 ? 4.467   -0.366  8.482   1.00 15.00 ? 22 VAL A O    7  
ATOM 8875  C CB   . VAL A 1 22 ? 3.276   -0.043  5.425   1.00 15.00 ? 22 VAL A CB   7  
ATOM 8876  C CG1  . VAL A 1 22 ? 3.589   0.923   4.288   1.00 15.00 ? 22 VAL A CG1  7  
ATOM 8877  C CG2  . VAL A 1 22 ? 4.334   -1.135  5.495   1.00 15.00 ? 22 VAL A CG2  7  
ATOM 8878  H H    . VAL A 1 22 ? 4.927   1.795   6.401   1.00 15.00 ? 22 VAL A H    7  
ATOM 8879  H HA   . VAL A 1 22 ? 2.141   1.084   6.853   1.00 15.00 ? 22 VAL A HA   7  
ATOM 8880  H HB   . VAL A 1 22 ? 2.326   -0.511  5.210   1.00 15.00 ? 22 VAL A HB   7  
ATOM 8881  H HG11 . VAL A 1 22 ? 3.958   1.854   4.690   1.00 15.00 ? 22 VAL A HG11 7  
ATOM 8882  H HG12 . VAL A 1 22 ? 4.343   0.485   3.646   1.00 15.00 ? 22 VAL A HG12 7  
ATOM 8883  H HG13 . VAL A 1 22 ? 2.693   1.111   3.715   1.00 15.00 ? 22 VAL A HG13 7  
ATOM 8884  H HG21 . VAL A 1 22 ? 4.624   -1.420  4.494   1.00 15.00 ? 22 VAL A HG21 7  
ATOM 8885  H HG22 . VAL A 1 22 ? 5.196   -0.767  6.030   1.00 15.00 ? 22 VAL A HG22 7  
ATOM 8886  H HG23 . VAL A 1 22 ? 3.928   -1.992  6.010   1.00 15.00 ? 22 VAL A HG23 7  
ATOM 8887  N N    . THR A 1 23 ? 2.325   -1.031  8.246   1.00 15.00 ? 23 THR A N    7  
ATOM 8888  C CA   . THR A 1 23 ? 2.382   -2.025  9.308   1.00 15.00 ? 23 THR A CA   7  
ATOM 8889  C C    . THR A 1 23 ? 1.433   -3.186  9.007   1.00 15.00 ? 23 THR A C    7  
ATOM 8890  O O    . THR A 1 23 ? 0.807   -3.228  7.946   1.00 15.00 ? 23 THR A O    7  
ATOM 8891  C CB   . THR A 1 23 ? 2.037   -1.383  10.652  1.00 15.00 ? 23 THR A CB   7  
ATOM 8892  O OG1  . THR A 1 23 ? 2.296   -2.277  11.719  1.00 15.00 ? 23 THR A OG1  7  
ATOM 8893  C CG2  . THR A 1 23 ? 0.594   -0.951  10.755  1.00 15.00 ? 23 THR A CG2  7  
ATOM 8894  H H    . THR A 1 23 ? 1.487   -0.912  7.751   1.00 15.00 ? 23 THR A H    7  
ATOM 8895  H HA   . THR A 1 23 ? 3.390   -2.404  9.349   1.00 15.00 ? 23 THR A HA   7  
ATOM 8896  H HB   . THR A 1 23 ? 2.653   -0.503  10.787  1.00 15.00 ? 23 THR A HB   7  
ATOM 8897  H HG1  . THR A 1 23 ? 2.064   -1.859  12.551  1.00 15.00 ? 23 THR A HG1  7  
ATOM 8898  H HG21 . THR A 1 23 ? 0.401   -0.172  10.033  1.00 15.00 ? 23 THR A HG21 7  
ATOM 8899  H HG22 . THR A 1 23 ? -0.048  -1.795  10.556  1.00 15.00 ? 23 THR A HG22 7  
ATOM 8900  H HG23 . THR A 1 23 ? 0.401   -0.577  11.749  1.00 15.00 ? 23 THR A HG23 7  
ATOM 8901  N N    . GLY A 1 24 ? 1.331   -4.129  9.941   1.00 15.00 ? 24 GLY A N    7  
ATOM 8902  C CA   . GLY A 1 24 ? 0.455   -5.273  9.744   1.00 15.00 ? 24 GLY A CA   7  
ATOM 8903  C C    . GLY A 1 24 ? 1.054   -6.299  8.805   1.00 15.00 ? 24 GLY A C    7  
ATOM 8904  O O    . GLY A 1 24 ? 2.053   -6.938  9.133   1.00 15.00 ? 24 GLY A O    7  
ATOM 8905  H H    . GLY A 1 24 ? 1.852   -4.048  10.766  1.00 15.00 ? 24 GLY A H    7  
ATOM 8906  H HA2  . GLY A 1 24 ? 0.267   -5.740  10.698  1.00 15.00 ? 24 GLY A HA2  7  
ATOM 8907  H HA3  . GLY A 1 24 ? -0.480  -4.927  9.330   1.00 15.00 ? 24 GLY A HA3  7  
ATOM 8908  N N    . GLY A 1 25 ? 0.449   -6.444  7.629   1.00 15.00 ? 25 GLY A N    7  
ATOM 8909  C CA   . GLY A 1 25 ? 0.947   -7.385  6.642   1.00 15.00 ? 25 GLY A CA   7  
ATOM 8910  C C    . GLY A 1 25 ? 0.906   -8.831  7.099   1.00 15.00 ? 25 GLY A C    7  
ATOM 8911  O O    . GLY A 1 25 ? 0.177   -9.644  6.531   1.00 15.00 ? 25 GLY A O    7  
ATOM 8912  H H    . GLY A 1 25 ? -0.337  -5.896  7.425   1.00 15.00 ? 25 GLY A H    7  
ATOM 8913  H HA2  . GLY A 1 25 ? 0.359   -7.292  5.747   1.00 15.00 ? 25 GLY A HA2  7  
ATOM 8914  H HA3  . GLY A 1 25 ? 1.965   -7.126  6.407   1.00 15.00 ? 25 GLY A HA3  7  
ATOM 8915  N N    . VAL A 1 26 ? 1.707   -9.150  8.115   1.00 15.00 ? 26 VAL A N    7  
ATOM 8916  C CA   . VAL A 1 26 ? 1.797   -10.510 8.659   1.00 15.00 ? 26 VAL A CA   7  
ATOM 8917  C C    . VAL A 1 26 ? 0.487   -11.282 8.520   1.00 15.00 ? 26 VAL A C    7  
ATOM 8918  O O    . VAL A 1 26 ? -0.599  -10.711 8.622   1.00 15.00 ? 26 VAL A O    7  
ATOM 8919  C CB   . VAL A 1 26 ? 2.212   -10.497 10.145  1.00 15.00 ? 26 VAL A CB   7  
ATOM 8920  C CG1  . VAL A 1 26 ? 3.713   -10.694 10.284  1.00 15.00 ? 26 VAL A CG1  7  
ATOM 8921  C CG2  . VAL A 1 26 ? 1.776   -9.202  10.813  1.00 15.00 ? 26 VAL A CG2  7  
ATOM 8922  H H    . VAL A 1 26 ? 2.269   -8.449  8.508   1.00 15.00 ? 26 VAL A H    7  
ATOM 8923  H HA   . VAL A 1 26 ? 2.563   -11.033 8.106   1.00 15.00 ? 26 VAL A HA   7  
ATOM 8924  H HB   . VAL A 1 26 ? 1.718   -11.318 10.644  1.00 15.00 ? 26 VAL A HB   7  
ATOM 8925  H HG11 . VAL A 1 26 ? 4.017   -11.558 9.711   1.00 15.00 ? 26 VAL A HG11 7  
ATOM 8926  H HG12 . VAL A 1 26 ? 4.227   -9.819  9.915   1.00 15.00 ? 26 VAL A HG12 7  
ATOM 8927  H HG13 . VAL A 1 26 ? 3.962   -10.846 11.324  1.00 15.00 ? 26 VAL A HG13 7  
ATOM 8928  H HG21 . VAL A 1 26 ? 2.598   -8.503  10.810  1.00 15.00 ? 26 VAL A HG21 7  
ATOM 8929  H HG22 . VAL A 1 26 ? 0.944   -8.781  10.268  1.00 15.00 ? 26 VAL A HG22 7  
ATOM 8930  H HG23 . VAL A 1 26 ? 1.476   -9.404  11.831  1.00 15.00 ? 26 VAL A HG23 7  
ATOM 8931  N N    . ASN A 1 27 ? 0.604   -12.585 8.284   1.00 15.00 ? 27 ASN A N    7  
ATOM 8932  C CA   . ASN A 1 27 ? -0.562  -13.446 8.127   1.00 15.00 ? 27 ASN A CA   7  
ATOM 8933  C C    . ASN A 1 27 ? -1.145  -13.830 9.486   1.00 15.00 ? 27 ASN A C    7  
ATOM 8934  O O    . ASN A 1 27 ? -1.284  -15.012 9.802   1.00 15.00 ? 27 ASN A O    7  
ATOM 8935  C CB   . ASN A 1 27 ? -0.186  -14.707 7.347   1.00 15.00 ? 27 ASN A CB   7  
ATOM 8936  C CG   . ASN A 1 27 ? 0.541   -14.391 6.054   1.00 15.00 ? 27 ASN A CG   7  
ATOM 8937  O OD1  . ASN A 1 27 ? 1.452   -13.564 6.027   1.00 15.00 ? 27 ASN A OD1  7  
ATOM 8938  N ND2  . ASN A 1 27 ? 0.138   -15.049 4.973   1.00 15.00 ? 27 ASN A ND2  7  
ATOM 8939  H H    . ASN A 1 27 ? 1.499   -12.978 8.214   1.00 15.00 ? 27 ASN A H    7  
ATOM 8940  H HA   . ASN A 1 27 ? -1.306  -12.897 7.570   1.00 15.00 ? 27 ASN A HA   7  
ATOM 8941  H HB2  . ASN A 1 27 ? 0.457   -15.323 7.957   1.00 15.00 ? 27 ASN A HB2  7  
ATOM 8942  H HB3  . ASN A 1 27 ? -1.084  -15.257 7.109   1.00 15.00 ? 27 ASN A HB3  7  
ATOM 8943  H HD21 . ASN A 1 27 ? -0.595  -15.693 5.069   1.00 15.00 ? 27 ASN A HD21 7  
ATOM 8944  H HD22 . ASN A 1 27 ? 0.591   -14.865 4.124   1.00 15.00 ? 27 ASN A HD22 7  
ATOM 8945  N N    . THR A 1 28 ? -1.485  -12.824 10.284  1.00 15.00 ? 28 THR A N    7  
ATOM 8946  C CA   . THR A 1 28 ? -2.053  -13.054 11.606  1.00 15.00 ? 28 THR A CA   7  
ATOM 8947  C C    . THR A 1 28 ? -2.972  -11.904 12.002  1.00 15.00 ? 28 THR A C    7  
ATOM 8948  O O    . THR A 1 28 ? -4.182  -12.083 12.141  1.00 15.00 ? 28 THR A O    7  
ATOM 8949  C CB   . THR A 1 28 ? -0.940  -13.214 12.643  1.00 15.00 ? 28 THR A CB   7  
ATOM 8950  O OG1  . THR A 1 28 ? 0.210   -13.797 12.058  1.00 15.00 ? 28 THR A OG1  7  
ATOM 8951  C CG2  . THR A 1 28 ? -1.341  -14.075 13.822  1.00 15.00 ? 28 THR A CG2  7  
ATOM 8952  H H    . THR A 1 28 ? -1.352  -11.904 9.976   1.00 15.00 ? 28 THR A H    7  
ATOM 8953  H HA   . THR A 1 28 ? -2.631  -13.964 11.566  1.00 15.00 ? 28 THR A HA   7  
ATOM 8954  H HB   . THR A 1 28 ? -0.672  -12.239 13.022  1.00 15.00 ? 28 THR A HB   7  
ATOM 8955  H HG1  . THR A 1 28 ? 0.013   -14.698 11.791  1.00 15.00 ? 28 THR A HG1  7  
ATOM 8956  H HG21 . THR A 1 28 ? -2.084  -13.556 14.411  1.00 15.00 ? 28 THR A HG21 7  
ATOM 8957  H HG22 . THR A 1 28 ? -1.752  -15.007 13.465  1.00 15.00 ? 28 THR A HG22 7  
ATOM 8958  H HG23 . THR A 1 28 ? -0.473  -14.275 14.433  1.00 15.00 ? 28 THR A HG23 7  
ATOM 8959  N N    . SER A 1 29 ? -2.391  -10.721 12.172  1.00 15.00 ? 29 SER A N    7  
ATOM 8960  C CA   . SER A 1 29 ? -3.161  -9.540  12.542  1.00 15.00 ? 29 SER A CA   7  
ATOM 8961  C C    . SER A 1 29 ? -4.112  -9.156  11.415  1.00 15.00 ? 29 SER A C    7  
ATOM 8962  O O    . SER A 1 29 ? -5.296  -8.905  11.642  1.00 15.00 ? 29 SER A O    7  
ATOM 8963  C CB   . SER A 1 29 ? -2.226  -8.372  12.864  1.00 15.00 ? 29 SER A CB   7  
ATOM 8964  O OG   . SER A 1 29 ? -2.614  -7.723  14.063  1.00 15.00 ? 29 SER A OG   7  
ATOM 8965  H H    . SER A 1 29 ? -1.423  -10.639 12.040  1.00 15.00 ? 29 SER A H    7  
ATOM 8966  H HA   . SER A 1 29 ? -3.740  -9.782  13.421  1.00 15.00 ? 29 SER A HA   7  
ATOM 8967  H HB2  . SER A 1 29 ? -1.219  -8.742  12.981  1.00 15.00 ? 29 SER A HB2  7  
ATOM 8968  H HB3  . SER A 1 29 ? -2.255  -7.656  12.055  1.00 15.00 ? 29 SER A HB3  7  
ATOM 8969  H HG   . SER A 1 29 ? -1.862  -7.673  14.658  1.00 15.00 ? 29 SER A HG   7  
ATOM 8970  N N    . VAL A 1 30 ? -3.585  -9.124  10.196  1.00 15.00 ? 30 VAL A N    7  
ATOM 8971  C CA   . VAL A 1 30 ? -4.381  -8.784  9.024   1.00 15.00 ? 30 VAL A CA   7  
ATOM 8972  C C    . VAL A 1 30 ? -5.040  -10.032 8.443   1.00 15.00 ? 30 VAL A C    7  
ATOM 8973  O O    . VAL A 1 30 ? -5.014  -11.098 9.058   1.00 15.00 ? 30 VAL A O    7  
ATOM 8974  C CB   . VAL A 1 30 ? -3.519  -8.108  7.938   1.00 15.00 ? 30 VAL A CB   7  
ATOM 8975  C CG1  . VAL A 1 30 ? -2.907  -6.820  8.469   1.00 15.00 ? 30 VAL A CG1  7  
ATOM 8976  C CG2  . VAL A 1 30 ? -2.436  -9.057  7.443   1.00 15.00 ? 30 VAL A CG2  7  
ATOM 8977  H H    . VAL A 1 30 ? -2.636  -9.343  10.080  1.00 15.00 ? 30 VAL A H    7  
ATOM 8978  H HA   . VAL A 1 30 ? -5.150  -8.091  9.331   1.00 15.00 ? 30 VAL A HA   7  
ATOM 8979  H HB   . VAL A 1 30 ? -4.157  -7.857  7.104   1.00 15.00 ? 30 VAL A HB   7  
ATOM 8980  H HG11 . VAL A 1 30 ? -2.313  -7.038  9.344   1.00 15.00 ? 30 VAL A HG11 7  
ATOM 8981  H HG12 . VAL A 1 30 ? -2.280  -6.380  7.708   1.00 15.00 ? 30 VAL A HG12 7  
ATOM 8982  H HG13 . VAL A 1 30 ? -3.694  -6.129  8.731   1.00 15.00 ? 30 VAL A HG13 7  
ATOM 8983  H HG21 . VAL A 1 30 ? -1.473  -8.718  7.794   1.00 15.00 ? 30 VAL A HG21 7  
ATOM 8984  H HG22 . VAL A 1 30 ? -2.627  -10.050 7.821   1.00 15.00 ? 30 VAL A HG22 7  
ATOM 8985  H HG23 . VAL A 1 30 ? -2.441  -9.075  6.364   1.00 15.00 ? 30 VAL A HG23 7  
ATOM 8986  N N    . ARG A 1 31 ? -5.631  -9.898  7.261   1.00 15.00 ? 31 ARG A N    7  
ATOM 8987  C CA   . ARG A 1 31 ? -6.293  -11.023 6.612   1.00 15.00 ? 31 ARG A CA   7  
ATOM 8988  C C    . ARG A 1 31 ? -5.366  -11.704 5.611   1.00 15.00 ? 31 ARG A C    7  
ATOM 8989  O O    . ARG A 1 31 ? -4.784  -11.053 4.743   1.00 15.00 ? 31 ARG A O    7  
ATOM 8990  C CB   . ARG A 1 31 ? -7.568  -10.560 5.906   1.00 15.00 ? 31 ARG A CB   7  
ATOM 8991  C CG   . ARG A 1 31 ? -8.414  -9.604  6.732   1.00 15.00 ? 31 ARG A CG   7  
ATOM 8992  C CD   . ARG A 1 31 ? -9.554  -10.329 7.428   1.00 15.00 ? 31 ARG A CD   7  
ATOM 8993  N NE   . ARG A 1 31 ? -9.073  -11.417 8.277   1.00 15.00 ? 31 ARG A NE   7  
ATOM 8994  C CZ   . ARG A 1 31 ? -9.834  -12.429 8.686   1.00 15.00 ? 31 ARG A CZ   7  
ATOM 8995  N NH1  . ARG A 1 31 ? -11.110 -12.496 8.329   1.00 15.00 ? 31 ARG A NH1  7  
ATOM 8996  N NH2  . ARG A 1 31 ? -9.317  -13.378 9.455   1.00 15.00 ? 31 ARG A NH2  7  
ATOM 8997  H H    . ARG A 1 31 ? -5.623  -9.025  6.816   1.00 15.00 ? 31 ARG A H    7  
ATOM 8998  H HA   . ARG A 1 31 ? -6.558  -11.736 7.379   1.00 15.00 ? 31 ARG A HA   7  
ATOM 8999  H HB2  . ARG A 1 31 ? -7.294  -10.064 4.988   1.00 15.00 ? 31 ARG A HB2  7  
ATOM 9000  H HB3  . ARG A 1 31 ? -8.169  -11.426 5.671   1.00 15.00 ? 31 ARG A HB3  7  
ATOM 9001  H HG2  . ARG A 1 31 ? -7.789  -9.137  7.479   1.00 15.00 ? 31 ARG A HG2  7  
ATOM 9002  H HG3  . ARG A 1 31 ? -8.825  -8.847  6.080   1.00 15.00 ? 31 ARG A HG3  7  
ATOM 9003  H HD2  . ARG A 1 31 ? -10.095 -9.622  8.039   1.00 15.00 ? 31 ARG A HD2  7  
ATOM 9004  H HD3  . ARG A 1 31 ? -10.215 -10.736 6.678   1.00 15.00 ? 31 ARG A HD3  7  
ATOM 9005  H HE   . ARG A 1 31 ? -8.134  -11.392 8.557   1.00 15.00 ? 31 ARG A HE   7  
ATOM 9006  H HH11 . ARG A 1 31 ? -11.506 -11.784 7.750   1.00 15.00 ? 31 ARG A HH11 7  
ATOM 9007  H HH12 . ARG A 1 31 ? -11.677 -13.259 8.639   1.00 15.00 ? 31 ARG A HH12 7  
ATOM 9008  H HH21 . ARG A 1 31 ? -8.356  -13.333 9.727   1.00 15.00 ? 31 ARG A HH21 7  
ATOM 9009  H HH22 . ARG A 1 31 ? -9.888  -14.139 9.763   1.00 15.00 ? 31 ARG A HH22 7  
ATOM 9010  N N    . HIS A 1 32 ? -5.241  -13.020 5.737   1.00 15.00 ? 32 HIS A N    7  
ATOM 9011  C CA   . HIS A 1 32 ? -4.394  -13.806 4.845   1.00 15.00 ? 32 HIS A CA   7  
ATOM 9012  C C    . HIS A 1 32 ? -2.938  -13.343 4.904   1.00 15.00 ? 32 HIS A C    7  
ATOM 9013  O O    . HIS A 1 32 ? -2.122  -13.925 5.617   1.00 15.00 ? 32 HIS A O    7  
ATOM 9014  C CB   . HIS A 1 32 ? -4.918  -13.721 3.409   1.00 15.00 ? 32 HIS A CB   7  
ATOM 9015  C CG   . HIS A 1 32 ? -6.273  -14.330 3.229   1.00 15.00 ? 32 HIS A CG   7  
ATOM 9016  N ND1  . HIS A 1 32 ? -7.396  -13.873 3.884   1.00 15.00 ? 32 HIS A ND1  7  
ATOM 9017  C CD2  . HIS A 1 32 ? -6.684  -15.366 2.460   1.00 15.00 ? 32 HIS A CD2  7  
ATOM 9018  C CE1  . HIS A 1 32 ? -8.439  -14.601 3.528   1.00 15.00 ? 32 HIS A CE1  7  
ATOM 9019  N NE2  . HIS A 1 32 ? -8.033  -15.513 2.664   1.00 15.00 ? 32 HIS A NE2  7  
ATOM 9020  H H    . HIS A 1 32 ? -5.738  -13.477 6.446   1.00 15.00 ? 32 HIS A H    7  
ATOM 9021  H HA   . HIS A 1 32 ? -4.442  -14.834 5.171   1.00 15.00 ? 32 HIS A HA   7  
ATOM 9022  H HB2  . HIS A 1 32 ? -4.981  -12.684 3.116   1.00 15.00 ? 32 HIS A HB2  7  
ATOM 9023  H HB3  . HIS A 1 32 ? -4.231  -14.234 2.751   1.00 15.00 ? 32 HIS A HB3  7  
ATOM 9024  H HD1  . HIS A 1 32 ? -7.425  -13.126 4.518   1.00 15.00 ? 32 HIS A HD1  7  
ATOM 9025  H HD2  . HIS A 1 32 ? -6.064  -15.965 1.807   1.00 15.00 ? 32 HIS A HD2  7  
ATOM 9026  H HE1  . HIS A 1 32 ? -9.451  -14.472 3.881   1.00 15.00 ? 32 HIS A HE1  7  
ATOM 9027  H HE2  . HIS A 1 32 ? -8.620  -16.122 2.168   1.00 15.00 ? 32 HIS A HE2  7  
ATOM 9028  N N    . GLY A 1 33 ? -2.618  -12.299 4.144   1.00 15.00 ? 33 GLY A N    7  
ATOM 9029  C CA   . GLY A 1 33 ? -1.261  -11.781 4.115   1.00 15.00 ? 33 GLY A CA   7  
ATOM 9030  C C    . GLY A 1 33 ? -1.172  -10.463 3.375   1.00 15.00 ? 33 GLY A C    7  
ATOM 9031  O O    . GLY A 1 33 ? -0.142  -10.144 2.781   1.00 15.00 ? 33 GLY A O    7  
ATOM 9032  H H    . GLY A 1 33 ? -3.309  -11.879 3.591   1.00 15.00 ? 33 GLY A H    7  
ATOM 9033  H HA2  . GLY A 1 33 ? -0.907  -11.636 5.130   1.00 15.00 ? 33 GLY A HA2  7  
ATOM 9034  H HA3  . GLY A 1 33 ? -0.626  -12.501 3.625   1.00 15.00 ? 33 GLY A HA3  7  
ATOM 9035  N N    . GLY A 1 34 ? -2.250  -9.687  3.426   1.00 15.00 ? 34 GLY A N    7  
ATOM 9036  C CA   . GLY A 1 34 ? -2.263  -8.396  2.772   1.00 15.00 ? 34 GLY A CA   7  
ATOM 9037  C C    . GLY A 1 34 ? -1.777  -7.318  3.711   1.00 15.00 ? 34 GLY A C    7  
ATOM 9038  O O    . GLY A 1 34 ? -1.910  -7.455  4.927   1.00 15.00 ? 34 GLY A O    7  
ATOM 9039  H H    . GLY A 1 34 ? -3.037  -9.987  3.927   1.00 15.00 ? 34 GLY A H    7  
ATOM 9040  H HA2  . GLY A 1 34 ? -1.620  -8.431  1.904   1.00 15.00 ? 34 GLY A HA2  7  
ATOM 9041  H HA3  . GLY A 1 34 ? -3.271  -8.165  2.460   1.00 15.00 ? 34 GLY A HA3  7  
ATOM 9042  N N    . ILE A 1 35 ? -1.196  -6.254  3.174   1.00 15.00 ? 35 ILE A N    7  
ATOM 9043  C CA   . ILE A 1 35 ? -0.689  -5.193  4.029   1.00 15.00 ? 35 ILE A CA   7  
ATOM 9044  C C    . ILE A 1 35 ? -1.702  -4.075  4.217   1.00 15.00 ? 35 ILE A C    7  
ATOM 9045  O O    . ILE A 1 35 ? -2.549  -3.824  3.362   1.00 15.00 ? 35 ILE A O    7  
ATOM 9046  C CB   . ILE A 1 35 ? 0.650   -4.620  3.508   1.00 15.00 ? 35 ILE A CB   7  
ATOM 9047  C CG1  . ILE A 1 35 ? 1.730   -4.785  4.586   1.00 15.00 ? 35 ILE A CG1  7  
ATOM 9048  C CG2  . ILE A 1 35 ? 0.510   -3.161  3.080   1.00 15.00 ? 35 ILE A CG2  7  
ATOM 9049  C CD1  . ILE A 1 35 ? 2.822   -3.737  4.550   1.00 15.00 ? 35 ILE A CD1  7  
ATOM 9050  H H    . ILE A 1 35 ? -1.097  -6.188  2.197   1.00 15.00 ? 35 ILE A H    7  
ATOM 9051  H HA   . ILE A 1 35 ? -0.499  -5.634  4.998   1.00 15.00 ? 35 ILE A HA   7  
ATOM 9052  H HB   . ILE A 1 35 ? 0.935   -5.189  2.644   1.00 15.00 ? 35 ILE A HB   7  
ATOM 9053  H HG12 . ILE A 1 35 ? 1.265   -4.738  5.559   1.00 15.00 ? 35 ILE A HG12 7  
ATOM 9054  H HG13 . ILE A 1 35 ? 2.197   -5.753  4.467   1.00 15.00 ? 35 ILE A HG13 7  
ATOM 9055  H HG21 . ILE A 1 35 ? -0.331  -3.060  2.410   1.00 15.00 ? 35 ILE A HG21 7  
ATOM 9056  H HG22 . ILE A 1 35 ? 0.350   -2.544  3.952   1.00 15.00 ? 35 ILE A HG22 7  
ATOM 9057  H HG23 . ILE A 1 35 ? 1.412   -2.846  2.576   1.00 15.00 ? 35 ILE A HG23 7  
ATOM 9058  H HD11 . ILE A 1 35 ? 3.352   -3.801  3.611   1.00 15.00 ? 35 ILE A HD11 7  
ATOM 9059  H HD12 . ILE A 1 35 ? 2.381   -2.756  4.650   1.00 15.00 ? 35 ILE A HD12 7  
ATOM 9060  H HD13 . ILE A 1 35 ? 3.509   -3.908  5.365   1.00 15.00 ? 35 ILE A HD13 7  
ATOM 9061  N N    . TYR A 1 36 ? -1.583  -3.408  5.352   1.00 15.00 ? 36 TYR A N    7  
ATOM 9062  C CA   . TYR A 1 36 ? -2.456  -2.298  5.703   1.00 15.00 ? 36 TYR A CA   7  
ATOM 9063  C C    . TYR A 1 36 ? -1.626  -1.171  6.295   1.00 15.00 ? 36 TYR A C    7  
ATOM 9064  O O    . TYR A 1 36 ? -1.115  -1.283  7.409   1.00 15.00 ? 36 TYR A O    7  
ATOM 9065  C CB   . TYR A 1 36 ? -3.525  -2.753  6.697   1.00 15.00 ? 36 TYR A CB   7  
ATOM 9066  C CG   . TYR A 1 36 ? -4.531  -3.713  6.103   1.00 15.00 ? 36 TYR A CG   7  
ATOM 9067  C CD1  . TYR A 1 36 ? -4.153  -4.992  5.709   1.00 15.00 ? 36 TYR A CD1  7  
ATOM 9068  C CD2  . TYR A 1 36 ? -5.858  -3.339  5.933   1.00 15.00 ? 36 TYR A CD2  7  
ATOM 9069  C CE1  . TYR A 1 36 ? -5.070  -5.869  5.163   1.00 15.00 ? 36 TYR A CE1  7  
ATOM 9070  C CE2  . TYR A 1 36 ? -6.780  -4.212  5.388   1.00 15.00 ? 36 TYR A CE2  7  
ATOM 9071  C CZ   . TYR A 1 36 ? -6.382  -5.475  5.005   1.00 15.00 ? 36 TYR A CZ   7  
ATOM 9072  O OH   . TYR A 1 36 ? -7.297  -6.347  4.462   1.00 15.00 ? 36 TYR A OH   7  
ATOM 9073  H H    . TYR A 1 36 ? -0.872  -3.668  5.974   1.00 15.00 ? 36 TYR A H    7  
ATOM 9074  H HA   . TYR A 1 36 ? -2.934  -1.945  4.800   1.00 15.00 ? 36 TYR A HA   7  
ATOM 9075  H HB2  . TYR A 1 36 ? -3.046  -3.248  7.529   1.00 15.00 ? 36 TYR A HB2  7  
ATOM 9076  H HB3  . TYR A 1 36 ? -4.062  -1.889  7.059   1.00 15.00 ? 36 TYR A HB3  7  
ATOM 9077  H HD1  . TYR A 1 36 ? -3.125  -5.300  5.834   1.00 15.00 ? 36 TYR A HD1  7  
ATOM 9078  H HD2  . TYR A 1 36 ? -6.167  -2.349  6.232   1.00 15.00 ? 36 TYR A HD2  7  
ATOM 9079  H HE1  . TYR A 1 36 ? -4.756  -6.857  4.863   1.00 15.00 ? 36 TYR A HE1  7  
ATOM 9080  H HE2  . TYR A 1 36 ? -7.808  -3.903  5.265   1.00 15.00 ? 36 TYR A HE2  7  
ATOM 9081  H HH   . TYR A 1 36 ? -7.913  -5.862  3.908   1.00 15.00 ? 36 TYR A HH   7  
ATOM 9082  N N    . VAL A 1 37 ? -1.471  -0.096  5.535   1.00 15.00 ? 37 VAL A N    7  
ATOM 9083  C CA   . VAL A 1 37 ? -0.670  1.036   5.986   1.00 15.00 ? 37 VAL A CA   7  
ATOM 9084  C C    . VAL A 1 37 ? -1.152  1.562   7.331   1.00 15.00 ? 37 VAL A C    7  
ATOM 9085  O O    . VAL A 1 37 ? -2.330  1.466   7.665   1.00 15.00 ? 37 VAL A O    7  
ATOM 9086  C CB   . VAL A 1 37 ? -0.640  2.203   4.955   1.00 15.00 ? 37 VAL A CB   7  
ATOM 9087  C CG1  . VAL A 1 37 ? -0.836  1.709   3.535   1.00 15.00 ? 37 VAL A CG1  7  
ATOM 9088  C CG2  . VAL A 1 37 ? -1.665  3.281   5.265   1.00 15.00 ? 37 VAL A CG2  7  
ATOM 9089  H H    . VAL A 1 37 ? -1.889  -0.073  4.648   1.00 15.00 ? 37 VAL A H    7  
ATOM 9090  H HA   . VAL A 1 37 ? 0.344   0.681   6.108   1.00 15.00 ? 37 VAL A HA   7  
ATOM 9091  H HB   . VAL A 1 37 ? 0.324   2.655   5.009   1.00 15.00 ? 37 VAL A HB   7  
ATOM 9092  H HG11 . VAL A 1 37 ? -0.598  0.658   3.479   1.00 15.00 ? 37 VAL A HG11 7  
ATOM 9093  H HG12 . VAL A 1 37 ? -1.864  1.864   3.247   1.00 15.00 ? 37 VAL A HG12 7  
ATOM 9094  H HG13 . VAL A 1 37 ? -0.190  2.263   2.871   1.00 15.00 ? 37 VAL A HG13 7  
ATOM 9095  H HG21 . VAL A 1 37 ? -2.647  2.898   5.072   1.00 15.00 ? 37 VAL A HG21 7  
ATOM 9096  H HG22 . VAL A 1 37 ? -1.585  3.577   6.300   1.00 15.00 ? 37 VAL A HG22 7  
ATOM 9097  H HG23 . VAL A 1 37 ? -1.488  4.138   4.633   1.00 15.00 ? 37 VAL A HG23 7  
ATOM 9098  N N    . LYS A 1 38 ? -0.237  2.149   8.086   1.00 15.00 ? 38 LYS A N    7  
ATOM 9099  C CA   . LYS A 1 38 ? -0.582  2.727   9.371   1.00 15.00 ? 38 LYS A CA   7  
ATOM 9100  C C    . LYS A 1 38 ? -1.106  4.137   9.140   1.00 15.00 ? 38 LYS A C    7  
ATOM 9101  O O    . LYS A 1 38 ? -2.145  4.521   9.676   1.00 15.00 ? 38 LYS A O    7  
ATOM 9102  C CB   . LYS A 1 38 ? 0.629   2.737   10.310  1.00 15.00 ? 38 LYS A CB   7  
ATOM 9103  C CG   . LYS A 1 38 ? 0.380   3.459   11.625  1.00 15.00 ? 38 LYS A CG   7  
ATOM 9104  C CD   . LYS A 1 38 ? -0.200  2.522   12.672  1.00 15.00 ? 38 LYS A CD   7  
ATOM 9105  C CE   . LYS A 1 38 ? -1.702  2.707   12.815  1.00 15.00 ? 38 LYS A CE   7  
ATOM 9106  N NZ   . LYS A 1 38 ? -2.394  1.425   13.121  1.00 15.00 ? 38 LYS A NZ   7  
ATOM 9107  H H    . LYS A 1 38 ? 0.681   2.218   7.759   1.00 15.00 ? 38 LYS A H    7  
ATOM 9108  H HA   . LYS A 1 38 ? -1.369  2.127   9.806   1.00 15.00 ? 38 LYS A HA   7  
ATOM 9109  H HB2  . LYS A 1 38 ? 0.903   1.717   10.533  1.00 15.00 ? 38 LYS A HB2  7  
ATOM 9110  H HB3  . LYS A 1 38 ? 1.455   3.219   9.811   1.00 15.00 ? 38 LYS A HB3  7  
ATOM 9111  H HG2  . LYS A 1 38 ? 1.316   3.854   11.990  1.00 15.00 ? 38 LYS A HG2  7  
ATOM 9112  H HG3  . LYS A 1 38 ? -0.314  4.269   11.456  1.00 15.00 ? 38 LYS A HG3  7  
ATOM 9113  H HD2  . LYS A 1 38 ? 0.000   1.502   12.379  1.00 15.00 ? 38 LYS A HD2  7  
ATOM 9114  H HD3  . LYS A 1 38 ? 0.271   2.725   13.623  1.00 15.00 ? 38 LYS A HD3  7  
ATOM 9115  H HE2  . LYS A 1 38 ? -1.892  3.408   13.614  1.00 15.00 ? 38 LYS A HE2  7  
ATOM 9116  H HE3  . LYS A 1 38 ? -2.092  3.105   11.889  1.00 15.00 ? 38 LYS A HE3  7  
ATOM 9117  H HZ1  . LYS A 1 38 ? -3.299  1.376   12.611  1.00 15.00 ? 38 LYS A HZ1  7  
ATOM 9118  H HZ2  . LYS A 1 38 ? -1.802  0.621   12.831  1.00 15.00 ? 38 LYS A HZ2  7  
ATOM 9119  H HZ3  . LYS A 1 38 ? -2.579  1.354   14.143  1.00 15.00 ? 38 LYS A HZ3  7  
ATOM 9120  N N    . ALA A 1 39 ? -0.386  4.894   8.312   1.00 15.00 ? 39 ALA A N    7  
ATOM 9121  C CA   . ALA A 1 39 ? -0.782  6.251   7.970   1.00 15.00 ? 39 ALA A CA   7  
ATOM 9122  C C    . ALA A 1 39 ? 0.113   6.805   6.870   1.00 15.00 ? 39 ALA A C    7  
ATOM 9123  O O    . ALA A 1 39 ? 1.104   6.179   6.504   1.00 15.00 ? 39 ALA A O    7  
ATOM 9124  C CB   . ALA A 1 39 ? -0.753  7.141   9.198   1.00 15.00 ? 39 ALA A CB   7  
ATOM 9125  H H    . ALA A 1 39 ? 0.426   4.520   7.899   1.00 15.00 ? 39 ALA A H    7  
ATOM 9126  H HA   . ALA A 1 39 ? -1.798  6.216   7.605   1.00 15.00 ? 39 ALA A HA   7  
ATOM 9127  H HB1  . ALA A 1 39 ? -1.743  7.187   9.626   1.00 15.00 ? 39 ALA A HB1  7  
ATOM 9128  H HB2  . ALA A 1 39 ? -0.065  6.732   9.922   1.00 15.00 ? 39 ALA A HB2  7  
ATOM 9129  H HB3  . ALA A 1 39 ? -0.435  8.133   8.916   1.00 15.00 ? 39 ALA A HB3  7  
ATOM 9130  N N    . VAL A 1 40 ? -0.225  7.986   6.362   1.00 15.00 ? 40 VAL A N    7  
ATOM 9131  C CA   . VAL A 1 40 ? 0.573   8.621   5.313   1.00 15.00 ? 40 VAL A CA   7  
ATOM 9132  C C    . VAL A 1 40 ? 1.528   9.630   5.940   1.00 15.00 ? 40 VAL A C    7  
ATOM 9133  O O    . VAL A 1 40 ? 1.101   10.639  6.501   1.00 15.00 ? 40 VAL A O    7  
ATOM 9134  C CB   . VAL A 1 40 ? -0.303  9.329   4.250   1.00 15.00 ? 40 VAL A CB   7  
ATOM 9135  C CG1  . VAL A 1 40 ? -0.279  8.560   2.936   1.00 15.00 ? 40 VAL A CG1  7  
ATOM 9136  C CG2  . VAL A 1 40 ? -1.732  9.499   4.740   1.00 15.00 ? 40 VAL A CG2  7  
ATOM 9137  H H    . VAL A 1 40 ? -1.017  8.445   6.709   1.00 15.00 ? 40 VAL A H    7  
ATOM 9138  H HA   . VAL A 1 40 ? 1.150   7.848   4.824   1.00 15.00 ? 40 VAL A HA   7  
ATOM 9139  H HB   . VAL A 1 40 ? 0.111   10.311  4.069   1.00 15.00 ? 40 VAL A HB   7  
ATOM 9140  H HG11 . VAL A 1 40 ? 0.738   8.481   2.584   1.00 15.00 ? 40 VAL A HG11 7  
ATOM 9141  H HG12 . VAL A 1 40 ? -0.688  7.570   3.088   1.00 15.00 ? 40 VAL A HG12 7  
ATOM 9142  H HG13 . VAL A 1 40 ? -0.873  9.085   2.202   1.00 15.00 ? 40 VAL A HG13 7  
ATOM 9143  H HG21 . VAL A 1 40 ? -2.344  9.889   3.941   1.00 15.00 ? 40 VAL A HG21 7  
ATOM 9144  H HG22 . VAL A 1 40 ? -2.118  8.541   5.056   1.00 15.00 ? 40 VAL A HG22 7  
ATOM 9145  H HG23 . VAL A 1 40 ? -1.747  10.185  5.574   1.00 15.00 ? 40 VAL A HG23 7  
ATOM 9146  N N    . ILE A 1 41 ? 2.821   9.323   5.889   1.00 15.00 ? 41 ILE A N    7  
ATOM 9147  C CA   . ILE A 1 41 ? 3.832   10.175  6.503   1.00 15.00 ? 41 ILE A CA   7  
ATOM 9148  C C    . ILE A 1 41 ? 4.172   11.411  5.670   1.00 15.00 ? 41 ILE A C    7  
ATOM 9149  O O    . ILE A 1 41 ? 4.683   11.302  4.553   1.00 15.00 ? 41 ILE A O    7  
ATOM 9150  C CB   . ILE A 1 41 ? 5.117   9.366   6.832   1.00 15.00 ? 41 ILE A CB   7  
ATOM 9151  C CG1  . ILE A 1 41 ? 4.871   8.391   7.996   1.00 15.00 ? 41 ILE A CG1  7  
ATOM 9152  C CG2  . ILE A 1 41 ? 6.280   10.289  7.166   1.00 15.00 ? 41 ILE A CG2  7  
ATOM 9153  C CD1  . ILE A 1 41 ? 3.437   7.916   8.127   1.00 15.00 ? 41 ILE A CD1  7  
ATOM 9154  H H    . ILE A 1 41 ? 3.096   8.486   5.462   1.00 15.00 ? 41 ILE A H    7  
ATOM 9155  H HA   . ILE A 1 41 ? 3.418   10.514  7.424   1.00 15.00 ? 41 ILE A HA   7  
ATOM 9156  H HB   . ILE A 1 41 ? 5.390   8.799   5.960   1.00 15.00 ? 41 ILE A HB   7  
ATOM 9157  H HG12 . ILE A 1 41 ? 5.490   7.517   7.856   1.00 15.00 ? 41 ILE A HG12 7  
ATOM 9158  H HG13 . ILE A 1 41 ? 5.146   8.874   8.922   1.00 15.00 ? 41 ILE A HG13 7  
ATOM 9159  H HG21 . ILE A 1 41 ? 5.901   11.262  7.441   1.00 15.00 ? 41 ILE A HG21 7  
ATOM 9160  H HG22 . ILE A 1 41 ? 6.841   9.874   7.990   1.00 15.00 ? 41 ILE A HG22 7  
ATOM 9161  H HG23 . ILE A 1 41 ? 6.923   10.382  6.303   1.00 15.00 ? 41 ILE A HG23 7  
ATOM 9162  H HD11 . ILE A 1 41 ? 2.795   8.762   8.324   1.00 15.00 ? 41 ILE A HD11 7  
ATOM 9163  H HD12 . ILE A 1 41 ? 3.130   7.439   7.207   1.00 15.00 ? 41 ILE A HD12 7  
ATOM 9164  H HD13 . ILE A 1 41 ? 3.364   7.211   8.941   1.00 15.00 ? 41 ILE A HD13 7  
ATOM 9165  N N    . PRO A 1 42 ? 3.893   12.614  6.232   1.00 15.00 ? 42 PRO A N    7  
ATOM 9166  C CA   . PRO A 1 42 ? 4.162   13.903  5.575   1.00 15.00 ? 42 PRO A CA   7  
ATOM 9167  C C    . PRO A 1 42 ? 5.649   14.141  5.313   1.00 15.00 ? 42 PRO A C    7  
ATOM 9168  O O    . PRO A 1 42 ? 6.224   15.111  5.805   1.00 15.00 ? 42 PRO A O    7  
ATOM 9169  C CB   . PRO A 1 42 ? 3.636   14.945  6.574   1.00 15.00 ? 42 PRO A CB   7  
ATOM 9170  C CG   . PRO A 1 42 ? 2.726   14.194  7.480   1.00 15.00 ? 42 PRO A CG   7  
ATOM 9171  C CD   . PRO A 1 42 ? 3.292   12.809  7.565   1.00 15.00 ? 42 PRO A CD   7  
ATOM 9172  H HA   . PRO A 1 42 ? 3.616   13.993  4.653   1.00 15.00 ? 42 PRO A HA   7  
ATOM 9173  H HB2  . PRO A 1 42 ? 4.464   15.375  7.117   1.00 15.00 ? 42 PRO A HB2  7  
ATOM 9174  H HB3  . PRO A 1 42 ? 3.107   15.721  6.041   1.00 15.00 ? 42 PRO A HB3  7  
ATOM 9175  H HG2  . PRO A 1 42 ? 2.715   14.656  8.456   1.00 15.00 ? 42 PRO A HG2  7  
ATOM 9176  H HG3  . PRO A 1 42 ? 1.731   14.167  7.063   1.00 15.00 ? 42 PRO A HG3  7  
ATOM 9177  H HD2  . PRO A 1 42 ? 4.042   12.754  8.340   1.00 15.00 ? 42 PRO A HD2  7  
ATOM 9178  H HD3  . PRO A 1 42 ? 2.506   12.092  7.743   1.00 15.00 ? 42 PRO A HD3  7  
ATOM 9179  N N    . GLN A 1 43 ? 6.270   13.257  4.539   1.00 15.00 ? 43 GLN A N    7  
ATOM 9180  C CA   . GLN A 1 43 ? 7.685   13.390  4.228   1.00 15.00 ? 43 GLN A CA   7  
ATOM 9181  C C    . GLN A 1 43 ? 8.001   12.858  2.831   1.00 15.00 ? 43 GLN A C    7  
ATOM 9182  O O    . GLN A 1 43 ? 8.709   13.506  2.059   1.00 15.00 ? 43 GLN A O    7  
ATOM 9183  C CB   . GLN A 1 43 ? 8.521   12.647  5.274   1.00 15.00 ? 43 GLN A CB   7  
ATOM 9184  C CG   . GLN A 1 43 ? 9.996   12.557  4.927   1.00 15.00 ? 43 GLN A CG   7  
ATOM 9185  C CD   . GLN A 1 43 ? 10.893  12.702  6.141   1.00 15.00 ? 43 GLN A CD   7  
ATOM 9186  O OE1  . GLN A 1 43 ? 11.261  11.715  6.778   1.00 15.00 ? 43 GLN A OE1  7  
ATOM 9187  N NE2  . GLN A 1 43 ? 11.248  13.939  6.469   1.00 15.00 ? 43 GLN A NE2  7  
ATOM 9188  H H    . GLN A 1 43 ? 5.770   12.500  4.173   1.00 15.00 ? 43 GLN A H    7  
ATOM 9189  H HA   . GLN A 1 43 ? 7.933   14.439  4.265   1.00 15.00 ? 43 GLN A HA   7  
ATOM 9190  H HB2  . GLN A 1 43 ? 8.427   13.159  6.221   1.00 15.00 ? 43 GLN A HB2  7  
ATOM 9191  H HB3  . GLN A 1 43 ? 8.135   11.644  5.379   1.00 15.00 ? 43 GLN A HB3  7  
ATOM 9192  H HG2  . GLN A 1 43 ? 10.186  11.596  4.472   1.00 15.00 ? 43 GLN A HG2  7  
ATOM 9193  H HG3  . GLN A 1 43 ? 10.235  13.341  4.224   1.00 15.00 ? 43 GLN A HG3  7  
ATOM 9194  H HE21 . GLN A 1 43 ? 10.918  14.678  5.916   1.00 15.00 ? 43 GLN A HE21 7  
ATOM 9195  H HE22 . GLN A 1 43 ? 11.827  14.063  7.250   1.00 15.00 ? 43 GLN A HE22 7  
ATOM 9196  N N    . GLY A 1 44 ? 7.492   11.671  2.516   1.00 15.00 ? 44 GLY A N    7  
ATOM 9197  C CA   . GLY A 1 44 ? 7.759   11.078  1.214   1.00 15.00 ? 44 GLY A CA   7  
ATOM 9198  C C    . GLY A 1 44 ? 6.772   11.490  0.137   1.00 15.00 ? 44 GLY A C    7  
ATOM 9199  O O    . GLY A 1 44 ? 5.724   12.069  0.419   1.00 15.00 ? 44 GLY A O    7  
ATOM 9200  H H    . GLY A 1 44 ? 6.942   11.190  3.173   1.00 15.00 ? 44 GLY A H    7  
ATOM 9201  H HA2  . GLY A 1 44 ? 8.748   11.378  0.901   1.00 15.00 ? 44 GLY A HA2  7  
ATOM 9202  H HA3  . GLY A 1 44 ? 7.744   10.007  1.308   1.00 15.00 ? 44 GLY A HA3  7  
ATOM 9203  N N    . ALA A 1 45 ? 7.125   11.177  -1.105  1.00 15.00 ? 45 ALA A N    7  
ATOM 9204  C CA   . ALA A 1 45 ? 6.300   11.504  -2.268  1.00 15.00 ? 45 ALA A CA   7  
ATOM 9205  C C    . ALA A 1 45 ? 4.893   10.917  -2.177  1.00 15.00 ? 45 ALA A C    7  
ATOM 9206  O O    . ALA A 1 45 ? 4.005   11.307  -2.935  1.00 15.00 ? 45 ALA A O    7  
ATOM 9207  C CB   . ALA A 1 45 ? 6.981   11.020  -3.538  1.00 15.00 ? 45 ALA A CB   7  
ATOM 9208  H H    . ALA A 1 45 ? 7.974   10.709  -1.245  1.00 15.00 ? 45 ALA A H    7  
ATOM 9209  H HA   . ALA A 1 45 ? 6.224   12.580  -2.325  1.00 15.00 ? 45 ALA A HA   7  
ATOM 9210  H HB1  . ALA A 1 45 ? 6.614   11.585  -4.382  1.00 15.00 ? 45 ALA A HB1  7  
ATOM 9211  H HB2  . ALA A 1 45 ? 8.048   11.156  -3.449  1.00 15.00 ? 45 ALA A HB2  7  
ATOM 9212  H HB3  . ALA A 1 45 ? 6.763   9.972   -3.685  1.00 15.00 ? 45 ALA A HB3  7  
ATOM 9213  N N    . ALA A 1 46 ? 4.688   9.978   -1.261  1.00 15.00 ? 46 ALA A N    7  
ATOM 9214  C CA   . ALA A 1 46 ? 3.382   9.351   -1.103  1.00 15.00 ? 46 ALA A CA   7  
ATOM 9215  C C    . ALA A 1 46 ? 2.389   10.315  -0.469  1.00 15.00 ? 46 ALA A C    7  
ATOM 9216  O O    . ALA A 1 46 ? 1.331   10.596  -1.041  1.00 15.00 ? 46 ALA A O    7  
ATOM 9217  C CB   . ALA A 1 46 ? 3.499   8.090   -0.263  1.00 15.00 ? 46 ALA A CB   7  
ATOM 9218  H H    . ALA A 1 46 ? 5.426   9.695   -0.687  1.00 15.00 ? 46 ALA A H    7  
ATOM 9219  H HA   . ALA A 1 46 ? 3.023   9.071   -2.083  1.00 15.00 ? 46 ALA A HA   7  
ATOM 9220  H HB1  . ALA A 1 46 ? 2.579   7.529   -0.326  1.00 15.00 ? 46 ALA A HB1  7  
ATOM 9221  H HB2  . ALA A 1 46 ? 4.315   7.487   -0.633  1.00 15.00 ? 46 ALA A HB2  7  
ATOM 9222  H HB3  . ALA A 1 46 ? 3.687   8.361   0.766   1.00 15.00 ? 46 ALA A HB3  7  
ATOM 9223  N N    . GLU A 1 47 ? 2.742   10.824  0.710   1.00 15.00 ? 47 GLU A N    7  
ATOM 9224  C CA   . GLU A 1 47 ? 1.890   11.772  1.421   1.00 15.00 ? 47 GLU A CA   7  
ATOM 9225  C C    . GLU A 1 47 ? 1.615   12.995  0.548   1.00 15.00 ? 47 GLU A C    7  
ATOM 9226  O O    . GLU A 1 47 ? 0.491   13.495  0.493   1.00 15.00 ? 47 GLU A O    7  
ATOM 9227  C CB   . GLU A 1 47 ? 2.549   12.215  2.737   1.00 15.00 ? 47 GLU A CB   7  
ATOM 9228  C CG   . GLU A 1 47 ? 3.773   13.084  2.512   1.00 15.00 ? 47 GLU A CG   7  
ATOM 9229  C CD   . GLU A 1 47 ? 3.427   14.550  2.327   1.00 15.00 ? 47 GLU A CD   7  
ATOM 9230  O OE1  . GLU A 1 47 ? 2.341   14.966  2.783   1.00 15.00 ? 47 GLU A OE1  7  
ATOM 9231  O OE2  . GLU A 1 47 ? 4.242   15.282  1.728   1.00 15.00 ? 47 GLU A OE2  7  
ATOM 9232  H H    . GLU A 1 47 ? 3.606   10.569  1.103   1.00 15.00 ? 47 GLU A H    7  
ATOM 9233  H HA   . GLU A 1 47 ? 0.950   11.281  1.635   1.00 15.00 ? 47 GLU A HA   7  
ATOM 9234  H HB2  . GLU A 1 47 ? 1.833   12.784  3.306   1.00 15.00 ? 47 GLU A HB2  7  
ATOM 9235  H HB3  . GLU A 1 47 ? 2.846   11.343  3.322   1.00 15.00 ? 47 GLU A HB3  7  
ATOM 9236  H HG2  . GLU A 1 47 ? 4.423   12.991  3.357   1.00 15.00 ? 47 GLU A HG2  7  
ATOM 9237  H HG3  . GLU A 1 47 ? 4.283   12.739  1.631   1.00 15.00 ? 47 GLU A HG3  7  
ATOM 9238  N N    . SER A 1 48 ? 2.663   13.477  -0.126  1.00 15.00 ? 48 SER A N    7  
ATOM 9239  C CA   . SER A 1 48 ? 2.554   14.648  -0.990  1.00 15.00 ? 48 SER A CA   7  
ATOM 9240  C C    . SER A 1 48 ? 1.439   14.460  -2.004  1.00 15.00 ? 48 SER A C    7  
ATOM 9241  O O    . SER A 1 48 ? 0.387   15.091  -1.908  1.00 15.00 ? 48 SER A O    7  
ATOM 9242  C CB   . SER A 1 48 ? 3.880   14.906  -1.709  1.00 15.00 ? 48 SER A CB   7  
ATOM 9243  O OG   . SER A 1 48 ? 4.201   16.286  -1.708  1.00 15.00 ? 48 SER A OG   7  
ATOM 9244  H H    . SER A 1 48 ? 3.532   13.036  -0.033  1.00 15.00 ? 48 SER A H    7  
ATOM 9245  H HA   . SER A 1 48 ? 2.319   15.499  -0.368  1.00 15.00 ? 48 SER A HA   7  
ATOM 9246  H HB2  . SER A 1 48 ? 4.669   14.366  -1.209  1.00 15.00 ? 48 SER A HB2  7  
ATOM 9247  H HB3  . SER A 1 48 ? 3.804   14.567  -2.733  1.00 15.00 ? 48 SER A HB3  7  
ATOM 9248  H HG   . SER A 1 48 ? 4.435   16.560  -0.818  1.00 15.00 ? 48 SER A HG   7  
ATOM 9249  N N    . ASP A 1 49 ? 1.663   13.571  -2.964  1.00 15.00 ? 49 ASP A N    7  
ATOM 9250  C CA   . ASP A 1 49 ? 0.655   13.292  -3.973  1.00 15.00 ? 49 ASP A CA   7  
ATOM 9251  C C    . ASP A 1 49 ? -0.617  12.814  -3.289  1.00 15.00 ? 49 ASP A C    7  
ATOM 9252  O O    . ASP A 1 49 ? -1.726  13.204  -3.657  1.00 15.00 ? 49 ASP A O    7  
ATOM 9253  C CB   . ASP A 1 49 ? 1.157   12.234  -4.958  1.00 15.00 ? 49 ASP A CB   7  
ATOM 9254  C CG   . ASP A 1 49 ? 1.269   12.769  -6.372  1.00 15.00 ? 49 ASP A CG   7  
ATOM 9255  O OD1  . ASP A 1 49 ? 1.858   13.856  -6.550  1.00 15.00 ? 49 ASP A OD1  7  
ATOM 9256  O OD2  . ASP A 1 49 ? 0.769   12.101  -7.301  1.00 15.00 ? 49 ASP A OD2  7  
ATOM 9257  H H    . ASP A 1 49 ? 2.514   13.082  -2.982  1.00 15.00 ? 49 ASP A H    7  
ATOM 9258  H HA   . ASP A 1 49 ? 0.448   14.207  -4.506  1.00 15.00 ? 49 ASP A HA   7  
ATOM 9259  H HB2  . ASP A 1 49 ? 2.132   11.892  -4.644  1.00 15.00 ? 49 ASP A HB2  7  
ATOM 9260  H HB3  . ASP A 1 49 ? 0.472   11.398  -4.962  1.00 15.00 ? 49 ASP A HB3  7  
ATOM 9261  N N    . GLY A 1 50 ? -0.437  11.971  -2.277  1.00 15.00 ? 50 GLY A N    7  
ATOM 9262  C CA   . GLY A 1 50 ? -1.561  11.449  -1.533  1.00 15.00 ? 50 GLY A CA   7  
ATOM 9263  C C    . GLY A 1 50 ? -2.221  10.294  -2.253  1.00 15.00 ? 50 GLY A C    7  
ATOM 9264  O O    . GLY A 1 50 ? -3.448  10.200  -2.296  1.00 15.00 ? 50 GLY A O    7  
ATOM 9265  H H    . GLY A 1 50 ? 0.474   11.707  -2.030  1.00 15.00 ? 50 GLY A H    7  
ATOM 9266  H HA2  . GLY A 1 50 ? -1.211  11.112  -0.562  1.00 15.00 ? 50 GLY A HA2  7  
ATOM 9267  H HA3  . GLY A 1 50 ? -2.287  12.236  -1.392  1.00 15.00 ? 50 GLY A HA3  7  
ATOM 9268  N N    . ARG A 1 51 ? -1.408  9.417   -2.832  1.00 15.00 ? 51 ARG A N    7  
ATOM 9269  C CA   . ARG A 1 51 ? -1.936  8.271   -3.566  1.00 15.00 ? 51 ARG A CA   7  
ATOM 9270  C C    . ARG A 1 51 ? -2.351  7.164   -2.607  1.00 15.00 ? 51 ARG A C    7  
ATOM 9271  O O    . ARG A 1 51 ? -3.466  6.647   -2.683  1.00 15.00 ? 51 ARG A O    7  
ATOM 9272  C CB   . ARG A 1 51 ? -0.905  7.741   -4.565  1.00 15.00 ? 51 ARG A CB   7  
ATOM 9273  C CG   . ARG A 1 51 ? -1.036  8.347   -5.953  1.00 15.00 ? 51 ARG A CG   7  
ATOM 9274  C CD   . ARG A 1 51 ? -2.188  7.724   -6.727  1.00 15.00 ? 51 ARG A CD   7  
ATOM 9275  N NE   . ARG A 1 51 ? -3.338  8.620   -6.813  1.00 15.00 ? 51 ARG A NE   7  
ATOM 9276  C CZ   . ARG A 1 51 ? -4.568  8.217   -7.122  1.00 15.00 ? 51 ARG A CZ   7  
ATOM 9277  N NH1  . ARG A 1 51 ? -4.810  6.937   -7.374  1.00 15.00 ? 51 ARG A NH1  7  
ATOM 9278  N NH2  . ARG A 1 51 ? -5.560  9.096   -7.180  1.00 15.00 ? 51 ARG A NH2  7  
ATOM 9279  H H    . ARG A 1 51 ? -0.435  9.548   -2.768  1.00 15.00 ? 51 ARG A H    7  
ATOM 9280  H HA   . ARG A 1 51 ? -2.809  8.602   -4.108  1.00 15.00 ? 51 ARG A HA   7  
ATOM 9281  H HB2  . ARG A 1 51 ? 0.088   7.953   -4.196  1.00 15.00 ? 51 ARG A HB2  7  
ATOM 9282  H HB3  . ARG A 1 51 ? -1.026  6.673   -4.651  1.00 15.00 ? 51 ARG A HB3  7  
ATOM 9283  H HG2  . ARG A 1 51 ? -1.212  9.408   -5.858  1.00 15.00 ? 51 ARG A HG2  7  
ATOM 9284  H HG3  . ARG A 1 51 ? -0.118  8.179   -6.496  1.00 15.00 ? 51 ARG A HG3  7  
ATOM 9285  H HD2  . ARG A 1 51 ? -1.850  7.492   -7.726  1.00 15.00 ? 51 ARG A HD2  7  
ATOM 9286  H HD3  . ARG A 1 51 ? -2.489  6.814   -6.229  1.00 15.00 ? 51 ARG A HD3  7  
ATOM 9287  H HE   . ARG A 1 51 ? -3.187  9.571   -6.631  1.00 15.00 ? 51 ARG A HE   7  
ATOM 9288  H HH11 . ARG A 1 51 ? -4.067  6.269   -7.331  1.00 15.00 ? 51 ARG A HH11 7  
ATOM 9289  H HH12 . ARG A 1 51 ? -5.736  6.639   -7.606  1.00 15.00 ? 51 ARG A HH12 7  
ATOM 9290  H HH21 . ARG A 1 51 ? -5.383  10.062  -6.990  1.00 15.00 ? 51 ARG A HH21 7  
ATOM 9291  H HH22 . ARG A 1 51 ? -6.484  8.793   -7.413  1.00 15.00 ? 51 ARG A HH22 7  
ATOM 9292  N N    . ILE A 1 52 ? -1.452  6.813   -1.699  1.00 15.00 ? 52 ILE A N    7  
ATOM 9293  C CA   . ILE A 1 52 ? -1.723  5.782   -0.719  1.00 15.00 ? 52 ILE A CA   7  
ATOM 9294  C C    . ILE A 1 52 ? -2.540  6.354   0.440   1.00 15.00 ? 52 ILE A C    7  
ATOM 9295  O O    . ILE A 1 52 ? -2.625  7.572   0.600   1.00 15.00 ? 52 ILE A O    7  
ATOM 9296  C CB   . ILE A 1 52 ? -0.405  5.180   -0.199  1.00 15.00 ? 52 ILE A CB   7  
ATOM 9297  C CG1  . ILE A 1 52 ? -0.680  3.915   0.606   1.00 15.00 ? 52 ILE A CG1  7  
ATOM 9298  C CG2  . ILE A 1 52 ? 0.366   6.201   0.626   1.00 15.00 ? 52 ILE A CG2  7  
ATOM 9299  C CD1  . ILE A 1 52 ? -1.486  2.887   -0.152  1.00 15.00 ? 52 ILE A CD1  7  
ATOM 9300  H H    . ILE A 1 52 ? -0.585  7.262   -1.682  1.00 15.00 ? 52 ILE A H    7  
ATOM 9301  H HA   . ILE A 1 52 ? -2.291  4.999   -1.201  1.00 15.00 ? 52 ILE A HA   7  
ATOM 9302  H HB   . ILE A 1 52 ? 0.202   4.923   -1.054  1.00 15.00 ? 52 ILE A HB   7  
ATOM 9303  H HG12 . ILE A 1 52 ? 0.259   3.460   0.878   1.00 15.00 ? 52 ILE A HG12 7  
ATOM 9304  H HG13 . ILE A 1 52 ? -1.226  4.176   1.498   1.00 15.00 ? 52 ILE A HG13 7  
ATOM 9305  H HG21 . ILE A 1 52 ? -0.278  6.606   1.392   1.00 15.00 ? 52 ILE A HG21 7  
ATOM 9306  H HG22 . ILE A 1 52 ? 1.219   5.725   1.085   1.00 15.00 ? 52 ILE A HG22 7  
ATOM 9307  H HG23 . ILE A 1 52 ? 0.704   7.000   -0.018  1.00 15.00 ? 52 ILE A HG23 7  
ATOM 9308  H HD11 . ILE A 1 52 ? -2.487  3.260   -0.308  1.00 15.00 ? 52 ILE A HD11 7  
ATOM 9309  H HD12 . ILE A 1 52 ? -1.018  2.701   -1.107  1.00 15.00 ? 52 ILE A HD12 7  
ATOM 9310  H HD13 . ILE A 1 52 ? -1.526  1.970   0.416   1.00 15.00 ? 52 ILE A HD13 7  
ATOM 9311  N N    . HIS A 1 53 ? -3.154  5.484   1.237   1.00 15.00 ? 53 HIS A N    7  
ATOM 9312  C CA   . HIS A 1 53 ? -3.973  5.937   2.358   1.00 15.00 ? 53 HIS A CA   7  
ATOM 9313  C C    . HIS A 1 53 ? -3.925  4.977   3.528   1.00 15.00 ? 53 HIS A C    7  
ATOM 9314  O O    . HIS A 1 53 ? -3.547  3.817   3.395   1.00 15.00 ? 53 HIS A O    7  
ATOM 9315  C CB   . HIS A 1 53 ? -5.421  6.146   1.912   1.00 15.00 ? 53 HIS A CB   7  
ATOM 9316  C CG   . HIS A 1 53 ? -5.579  7.202   0.863   1.00 15.00 ? 53 HIS A CG   7  
ATOM 9317  N ND1  . HIS A 1 53 ? -5.789  6.914   -0.470  1.00 15.00 ? 53 HIS A ND1  7  
ATOM 9318  C CD2  . HIS A 1 53 ? -5.560  8.554   0.954   1.00 15.00 ? 53 HIS A CD2  7  
ATOM 9319  C CE1  . HIS A 1 53 ? -5.890  8.041   -1.152  1.00 15.00 ? 53 HIS A CE1  7  
ATOM 9320  N NE2  . HIS A 1 53 ? -5.756  9.050   -0.311  1.00 15.00 ? 53 HIS A NE2  7  
ATOM 9321  H H    . HIS A 1 53 ? -3.065  4.527   1.063   1.00 15.00 ? 53 HIS A H    7  
ATOM 9322  H HA   . HIS A 1 53 ? -3.575  6.878   2.700   1.00 15.00 ? 53 HIS A HA   7  
ATOM 9323  H HB2  . HIS A 1 53 ? -5.804  5.220   1.511   1.00 15.00 ? 53 HIS A HB2  7  
ATOM 9324  H HB3  . HIS A 1 53 ? -6.014  6.435   2.768   1.00 15.00 ? 53 HIS A HB3  7  
ATOM 9325  H HD1  . HIS A 1 53 ? -5.853  6.017   -0.858  1.00 15.00 ? 53 HIS A HD1  7  
ATOM 9326  H HD2  . HIS A 1 53 ? -5.417  9.133   1.856   1.00 15.00 ? 53 HIS A HD2  7  
ATOM 9327  H HE1  . HIS A 1 53 ? -6.057  8.123   -2.215  1.00 15.00 ? 53 HIS A HE1  7  
ATOM 9328  H HE2  . HIS A 1 53 ? -5.890  9.994   -0.537  1.00 15.00 ? 53 HIS A HE2  7  
ATOM 9329  N N    . LYS A 1 54 ? -4.302  5.505   4.682   1.00 15.00 ? 54 LYS A N    7  
ATOM 9330  C CA   . LYS A 1 54 ? -4.304  4.761   5.926   1.00 15.00 ? 54 LYS A CA   7  
ATOM 9331  C C    . LYS A 1 54 ? -4.881  3.351   5.767   1.00 15.00 ? 54 LYS A C    7  
ATOM 9332  O O    . LYS A 1 54 ? -5.932  3.162   5.154   1.00 15.00 ? 54 LYS A O    7  
ATOM 9333  C CB   . LYS A 1 54 ? -5.099  5.529   6.985   1.00 15.00 ? 54 LYS A CB   7  
ATOM 9334  C CG   . LYS A 1 54 ? -4.231  6.210   8.027   1.00 15.00 ? 54 LYS A CG   7  
ATOM 9335  C CD   . LYS A 1 54 ? -5.046  6.644   9.234   1.00 15.00 ? 54 LYS A CD   7  
ATOM 9336  C CE   . LYS A 1 54 ? -4.988  5.610   10.347  1.00 15.00 ? 54 LYS A CE   7  
ATOM 9337  N NZ   . LYS A 1 54 ? -5.750  6.046   11.549  1.00 15.00 ? 54 LYS A NZ   7  
ATOM 9338  H H    . LYS A 1 54 ? -4.572  6.443   4.698   1.00 15.00 ? 54 LYS A H    7  
ATOM 9339  H HA   . LYS A 1 54 ? -3.279  4.691   6.245   1.00 15.00 ? 54 LYS A HA   7  
ATOM 9340  H HB2  . LYS A 1 54 ? -5.691  6.286   6.492   1.00 15.00 ? 54 LYS A HB2  7  
ATOM 9341  H HB3  . LYS A 1 54 ? -5.761  4.842   7.493   1.00 15.00 ? 54 LYS A HB3  7  
ATOM 9342  H HG2  . LYS A 1 54 ? -3.468  5.521   8.350   1.00 15.00 ? 54 LYS A HG2  7  
ATOM 9343  H HG3  . LYS A 1 54 ? -3.768  7.080   7.584   1.00 15.00 ? 54 LYS A HG3  7  
ATOM 9344  H HD2  . LYS A 1 54 ? -4.653  7.579   9.605   1.00 15.00 ? 54 LYS A HD2  7  
ATOM 9345  H HD3  . LYS A 1 54 ? -6.075  6.778   8.932   1.00 15.00 ? 54 LYS A HD3  7  
ATOM 9346  H HE2  . LYS A 1 54 ? -5.407  4.684   9.983   1.00 15.00 ? 54 LYS A HE2  7  
ATOM 9347  H HE3  . LYS A 1 54 ? -3.955  5.454   10.622  1.00 15.00 ? 54 LYS A HE3  7  
ATOM 9348  H HZ1  . LYS A 1 54 ? -5.444  5.504   12.382  1.00 15.00 ? 54 LYS A HZ1  7  
ATOM 9349  H HZ2  . LYS A 1 54 ? -5.586  7.057   11.729  1.00 15.00 ? 54 LYS A HZ2  7  
ATOM 9350  H HZ3  . LYS A 1 54 ? -6.768  5.891   11.403  1.00 15.00 ? 54 LYS A HZ3  7  
ATOM 9351  N N    . GLY A 1 55 ? -4.185  2.369   6.339   1.00 15.00 ? 55 GLY A N    7  
ATOM 9352  C CA   . GLY A 1 55 ? -4.631  0.986   6.275   1.00 15.00 ? 55 GLY A CA   7  
ATOM 9353  C C    . GLY A 1 55 ? -4.984  0.527   4.875   1.00 15.00 ? 55 GLY A C    7  
ATOM 9354  O O    . GLY A 1 55 ? -5.878  -0.302  4.702   1.00 15.00 ? 55 GLY A O    7  
ATOM 9355  H H    . GLY A 1 55 ? -3.356  2.588   6.822   1.00 15.00 ? 55 GLY A H    7  
ATOM 9356  H HA2  . GLY A 1 55 ? -3.846  0.349   6.654   1.00 15.00 ? 55 GLY A HA2  7  
ATOM 9357  H HA3  . GLY A 1 55 ? -5.501  0.874   6.906   1.00 15.00 ? 55 GLY A HA3  7  
ATOM 9358  N N    . ASP A 1 56 ? -4.285  1.047   3.872   1.00 15.00 ? 56 ASP A N    7  
ATOM 9359  C CA   . ASP A 1 56 ? -4.554  0.647   2.495   1.00 15.00 ? 56 ASP A CA   7  
ATOM 9360  C C    . ASP A 1 56 ? -4.200  -0.820  2.284   1.00 15.00 ? 56 ASP A C    7  
ATOM 9361  O O    . ASP A 1 56 ? -3.105  -1.258  2.642   1.00 15.00 ? 56 ASP A O    7  
ATOM 9362  C CB   . ASP A 1 56 ? -3.780  1.521   1.505   1.00 15.00 ? 56 ASP A CB   7  
ATOM 9363  C CG   . ASP A 1 56 ? -4.697  2.245   0.540   1.00 15.00 ? 56 ASP A CG   7  
ATOM 9364  O OD1  . ASP A 1 56 ? -5.529  1.572   -0.103  1.00 15.00 ? 56 ASP A OD1  7  
ATOM 9365  O OD2  . ASP A 1 56 ? -4.583  3.484   0.429   1.00 15.00 ? 56 ASP A OD2  7  
ATOM 9366  H H    . ASP A 1 56 ? -3.569  1.696   4.061   1.00 15.00 ? 56 ASP A H    7  
ATOM 9367  H HA   . ASP A 1 56 ? -5.613  0.774   2.319   1.00 15.00 ? 56 ASP A HA   7  
ATOM 9368  H HB2  . ASP A 1 56 ? -3.211  2.256   2.048   1.00 15.00 ? 56 ASP A HB2  7  
ATOM 9369  H HB3  . ASP A 1 56 ? -3.106  0.900   0.934   1.00 15.00 ? 56 ASP A HB3  7  
ATOM 9370  N N    . ARG A 1 57 ? -5.123  -1.575  1.696   1.00 15.00 ? 57 ARG A N    7  
ATOM 9371  C CA   . ARG A 1 57 ? -4.891  -2.988  1.433   1.00 15.00 ? 57 ARG A CA   7  
ATOM 9372  C C    . ARG A 1 57 ? -4.100  -3.163  0.142   1.00 15.00 ? 57 ARG A C    7  
ATOM 9373  O O    . ARG A 1 57 ? -4.677  -3.309  -0.936  1.00 15.00 ? 57 ARG A O    7  
ATOM 9374  C CB   . ARG A 1 57 ? -6.216  -3.747  1.341   1.00 15.00 ? 57 ARG A CB   7  
ATOM 9375  C CG   . ARG A 1 57 ? -6.057  -5.253  1.468   1.00 15.00 ? 57 ARG A CG   7  
ATOM 9376  C CD   . ARG A 1 57 ? -7.398  -5.966  1.425   1.00 15.00 ? 57 ARG A CD   7  
ATOM 9377  N NE   . ARG A 1 57 ? -7.334  -7.284  2.053   1.00 15.00 ? 57 ARG A NE   7  
ATOM 9378  C CZ   . ARG A 1 57 ? -8.179  -8.277  1.784   1.00 15.00 ? 57 ARG A CZ   7  
ATOM 9379  N NH1  . ARG A 1 57 ? -9.154  -8.108  0.900   1.00 15.00 ? 57 ARG A NH1  7  
ATOM 9380  N NH2  . ARG A 1 57 ? -8.049  -9.443  2.402   1.00 15.00 ? 57 ARG A NH2  7  
ATOM 9381  H H    . ARG A 1 57 ? -5.975  -1.171  1.427   1.00 15.00 ? 57 ARG A H    7  
ATOM 9382  H HA   . ARG A 1 57 ? -4.313  -3.387  2.251   1.00 15.00 ? 57 ARG A HA   7  
ATOM 9383  H HB2  . ARG A 1 57 ? -6.869  -3.407  2.132   1.00 15.00 ? 57 ARG A HB2  7  
ATOM 9384  H HB3  . ARG A 1 57 ? -6.676  -3.533  0.389   1.00 15.00 ? 57 ARG A HB3  7  
ATOM 9385  H HG2  . ARG A 1 57 ? -5.446  -5.610  0.652   1.00 15.00 ? 57 ARG A HG2  7  
ATOM 9386  H HG3  . ARG A 1 57 ? -5.571  -5.475  2.406   1.00 15.00 ? 57 ARG A HG3  7  
ATOM 9387  H HD2  . ARG A 1 57 ? -8.128  -5.364  1.947   1.00 15.00 ? 57 ARG A HD2  7  
ATOM 9388  H HD3  . ARG A 1 57 ? -7.697  -6.081  0.394   1.00 15.00 ? 57 ARG A HD3  7  
ATOM 9389  H HE   . ARG A 1 57 ? -6.623  -7.438  2.710   1.00 15.00 ? 57 ARG A HE   7  
ATOM 9390  H HH11 . ARG A 1 57 ? -9.258  -7.232  0.431   1.00 15.00 ? 57 ARG A HH11 7  
ATOM 9391  H HH12 . ARG A 1 57 ? -9.784  -8.858  0.703   1.00 15.00 ? 57 ARG A HH12 7  
ATOM 9392  H HH21 . ARG A 1 57 ? -7.315  -9.576  3.069   1.00 15.00 ? 57 ARG A HH21 7  
ATOM 9393  H HH22 . ARG A 1 57 ? -8.683  -10.189 2.201   1.00 15.00 ? 57 ARG A HH22 7  
ATOM 9394  N N    . VAL A 1 58 ? -2.775  -3.135  0.255   1.00 15.00 ? 58 VAL A N    7  
ATOM 9395  C CA   . VAL A 1 58 ? -1.911  -3.278  -0.909  1.00 15.00 ? 58 VAL A CA   7  
ATOM 9396  C C    . VAL A 1 58 ? -1.784  -4.744  -1.322  1.00 15.00 ? 58 VAL A C    7  
ATOM 9397  O O    . VAL A 1 58 ? -1.223  -5.566  -0.593  1.00 15.00 ? 58 VAL A O    7  
ATOM 9398  C CB   . VAL A 1 58 ? -0.513  -2.663  -0.658  1.00 15.00 ? 58 VAL A CB   7  
ATOM 9399  C CG1  . VAL A 1 58 ? -0.641  -1.343  0.089   1.00 15.00 ? 58 VAL A CG1  7  
ATOM 9400  C CG2  . VAL A 1 58 ? 0.392   -3.621  0.106   1.00 15.00 ? 58 VAL A CG2  7  
ATOM 9401  H H    . VAL A 1 58 ? -2.372  -3.007  1.139   1.00 15.00 ? 58 VAL A H    7  
ATOM 9402  H HA   . VAL A 1 58 ? -2.373  -2.737  -1.721  1.00 15.00 ? 58 VAL A HA   7  
ATOM 9403  H HB   . VAL A 1 58 ? -0.059  -2.459  -1.616  1.00 15.00 ? 58 VAL A HB   7  
ATOM 9404  H HG11 . VAL A 1 58 ? -1.291  -0.679  -0.462  1.00 15.00 ? 58 VAL A HG11 7  
ATOM 9405  H HG12 . VAL A 1 58 ? -1.057  -1.523  1.070   1.00 15.00 ? 58 VAL A HG12 7  
ATOM 9406  H HG13 . VAL A 1 58 ? 0.335   -0.891  0.190   1.00 15.00 ? 58 VAL A HG13 7  
ATOM 9407  H HG21 . VAL A 1 58 ? 1.149   -3.059  0.633   1.00 15.00 ? 58 VAL A HG21 7  
ATOM 9408  H HG22 . VAL A 1 58 ? -0.197  -4.185  0.815   1.00 15.00 ? 58 VAL A HG22 7  
ATOM 9409  H HG23 . VAL A 1 58 ? 0.865   -4.299  -0.588  1.00 15.00 ? 58 VAL A HG23 7  
ATOM 9410  N N    . LEU A 1 59 ? -2.339  -5.064  -2.489  1.00 15.00 ? 59 LEU A N    7  
ATOM 9411  C CA   . LEU A 1 59 ? -2.314  -6.430  -3.002  1.00 15.00 ? 59 LEU A CA   7  
ATOM 9412  C C    . LEU A 1 59 ? -1.345  -6.601  -4.175  1.00 15.00 ? 59 LEU A C    7  
ATOM 9413  O O    . LEU A 1 59 ? -1.068  -7.727  -4.587  1.00 15.00 ? 59 LEU A O    7  
ATOM 9414  C CB   . LEU A 1 59 ? -3.719  -6.855  -3.430  1.00 15.00 ? 59 LEU A CB   7  
ATOM 9415  C CG   . LEU A 1 59 ? -4.778  -6.803  -2.326  1.00 15.00 ? 59 LEU A CG   7  
ATOM 9416  C CD1  . LEU A 1 59 ? -6.080  -7.422  -2.809  1.00 15.00 ? 59 LEU A CD1  7  
ATOM 9417  C CD2  . LEU A 1 59 ? -4.280  -7.512  -1.074  1.00 15.00 ? 59 LEU A CD2  7  
ATOM 9418  H H    . LEU A 1 59 ? -2.787  -4.365  -3.012  1.00 15.00 ? 59 LEU A H    7  
ATOM 9419  H HA   . LEU A 1 59 ? -1.992  -7.072  -2.197  1.00 15.00 ? 59 LEU A HA   7  
ATOM 9420  H HB2  . LEU A 1 59 ? -4.037  -6.210  -4.236  1.00 15.00 ? 59 LEU A HB2  7  
ATOM 9421  H HB3  . LEU A 1 59 ? -3.668  -7.868  -3.801  1.00 15.00 ? 59 LEU A HB3  7  
ATOM 9422  H HG   . LEU A 1 59 ? -4.973  -5.771  -2.072  1.00 15.00 ? 59 LEU A HG   7  
ATOM 9423  H HD11 . LEU A 1 59 ? -5.889  -8.415  -3.187  1.00 15.00 ? 59 LEU A HD11 7  
ATOM 9424  H HD12 . LEU A 1 59 ? -6.779  -7.478  -1.988  1.00 15.00 ? 59 LEU A HD12 7  
ATOM 9425  H HD13 . LEU A 1 59 ? -6.498  -6.812  -3.597  1.00 15.00 ? 59 LEU A HD13 7  
ATOM 9426  H HD21 . LEU A 1 59 ? -5.080  -8.098  -0.649  1.00 15.00 ? 59 LEU A HD21 7  
ATOM 9427  H HD22 . LEU A 1 59 ? -3.456  -8.161  -1.332  1.00 15.00 ? 59 LEU A HD22 7  
ATOM 9428  H HD23 . LEU A 1 59 ? -3.948  -6.778  -0.353  1.00 15.00 ? 59 LEU A HD23 7  
ATOM 9429  N N    . ALA A 1 60 ? -0.849  -5.498  -4.732  1.00 15.00 ? 60 ALA A N    7  
ATOM 9430  C CA   . ALA A 1 60 ? 0.061   -5.585  -5.873  1.00 15.00 ? 60 ALA A CA   7  
ATOM 9431  C C    . ALA A 1 60 ? 1.035   -4.410  -5.941  1.00 15.00 ? 60 ALA A C    7  
ATOM 9432  O O    . ALA A 1 60 ? 0.699   -3.280  -5.591  1.00 15.00 ? 60 ALA A O    7  
ATOM 9433  C CB   . ALA A 1 60 ? -0.738  -5.679  -7.164  1.00 15.00 ? 60 ALA A CB   7  
ATOM 9434  H H    . ALA A 1 60 ? -1.110  -4.619  -4.386  1.00 15.00 ? 60 ALA A H    7  
ATOM 9435  H HA   . ALA A 1 60 ? 0.630   -6.498  -5.777  1.00 15.00 ? 60 ALA A HA   7  
ATOM 9436  H HB1  . ALA A 1 60 ? -0.682  -6.687  -7.548  1.00 15.00 ? 60 ALA A HB1  7  
ATOM 9437  H HB2  . ALA A 1 60 ? -1.770  -5.427  -6.967  1.00 15.00 ? 60 ALA A HB2  7  
ATOM 9438  H HB3  . ALA A 1 60 ? -0.332  -4.993  -7.892  1.00 15.00 ? 60 ALA A HB3  7  
ATOM 9439  N N    . VAL A 1 61 ? 2.241   -4.701  -6.423  1.00 15.00 ? 61 VAL A N    7  
ATOM 9440  C CA   . VAL A 1 61 ? 3.290   -3.699  -6.583  1.00 15.00 ? 61 VAL A CA   7  
ATOM 9441  C C    . VAL A 1 61 ? 4.024   -3.939  -7.892  1.00 15.00 ? 61 VAL A C    7  
ATOM 9442  O O    . VAL A 1 61 ? 4.951   -4.746  -7.957  1.00 15.00 ? 61 VAL A O    7  
ATOM 9443  C CB   . VAL A 1 61 ? 4.304   -3.735  -5.424  1.00 15.00 ? 61 VAL A CB   7  
ATOM 9444  C CG1  . VAL A 1 61 ? 5.310   -2.602  -5.560  1.00 15.00 ? 61 VAL A CG1  7  
ATOM 9445  C CG2  . VAL A 1 61 ? 3.586   -3.668  -4.085  1.00 15.00 ? 61 VAL A CG2  7  
ATOM 9446  H H    . VAL A 1 61 ? 2.427   -5.623  -6.699  1.00 15.00 ? 61 VAL A H    7  
ATOM 9447  H HA   . VAL A 1 61 ? 2.831   -2.721  -6.611  1.00 15.00 ? 61 VAL A HA   7  
ATOM 9448  H HB   . VAL A 1 61 ? 4.842   -4.668  -5.472  1.00 15.00 ? 61 VAL A HB   7  
ATOM 9449  H HG11 . VAL A 1 61 ? 4.969   -1.904  -6.310  1.00 15.00 ? 61 VAL A HG11 7  
ATOM 9450  H HG12 . VAL A 1 61 ? 5.409   -2.093  -4.613  1.00 15.00 ? 61 VAL A HG12 7  
ATOM 9451  H HG13 . VAL A 1 61 ? 6.268   -3.006  -5.853  1.00 15.00 ? 61 VAL A HG13 7  
ATOM 9452  H HG21 . VAL A 1 61 ? 4.062   -2.929  -3.458  1.00 15.00 ? 61 VAL A HG21 7  
ATOM 9453  H HG22 . VAL A 1 61 ? 2.554   -3.394  -4.244  1.00 15.00 ? 61 VAL A HG22 7  
ATOM 9454  H HG23 . VAL A 1 61 ? 3.632   -4.633  -3.604  1.00 15.00 ? 61 VAL A HG23 7  
ATOM 9455  N N    . ASN A 1 62 ? 3.581   -3.259  -8.943  1.00 15.00 ? 62 ASN A N    7  
ATOM 9456  C CA   . ASN A 1 62 ? 4.173   -3.425  -10.263 1.00 15.00 ? 62 ASN A CA   7  
ATOM 9457  C C    . ASN A 1 62 ? 3.824   -4.803  -10.822 1.00 15.00 ? 62 ASN A C    7  
ATOM 9458  O O    . ASN A 1 62 ? 4.456   -5.284  -11.762 1.00 15.00 ? 62 ASN A O    7  
ATOM 9459  C CB   . ASN A 1 62 ? 5.692   -3.241  -10.204 1.00 15.00 ? 62 ASN A CB   7  
ATOM 9460  C CG   . ASN A 1 62 ? 6.093   -1.990  -9.446  1.00 15.00 ? 62 ASN A CG   7  
ATOM 9461  O OD1  . ASN A 1 62 ? 7.089   -1.982  -8.722  1.00 15.00 ? 62 ASN A OD1  7  
ATOM 9462  N ND2  . ASN A 1 62 ? 5.317   -0.922  -9.608  1.00 15.00 ? 62 ASN A ND2  7  
ATOM 9463  H H    . ASN A 1 62 ? 2.822   -2.648  -8.832  1.00 15.00 ? 62 ASN A H    7  
ATOM 9464  H HA   . ASN A 1 62 ? 3.751   -2.671  -10.911 1.00 15.00 ? 62 ASN A HA   7  
ATOM 9465  H HB2  . ASN A 1 62 ? 6.134   -4.095  -9.712  1.00 15.00 ? 62 ASN A HB2  7  
ATOM 9466  H HB3  . ASN A 1 62 ? 6.079   -3.170  -11.210 1.00 15.00 ? 62 ASN A HB3  7  
ATOM 9467  H HD21 . ASN A 1 62 ? 4.540   -0.999  -10.200 1.00 15.00 ? 62 ASN A HD21 7  
ATOM 9468  H HD22 . ASN A 1 62 ? 5.552   -0.101  -9.127  1.00 15.00 ? 62 ASN A HD22 7  
ATOM 9469  N N    . GLY A 1 63 ? 2.800   -5.426  -10.236 1.00 15.00 ? 63 GLY A N    7  
ATOM 9470  C CA   . GLY A 1 63 ? 2.362   -6.734  -10.681 1.00 15.00 ? 63 GLY A CA   7  
ATOM 9471  C C    . GLY A 1 63 ? 2.723   -7.852  -9.720  1.00 15.00 ? 63 GLY A C    7  
ATOM 9472  O O    . GLY A 1 63 ? 2.474   -9.023  -10.010 1.00 15.00 ? 63 GLY A O    7  
ATOM 9473  H H    . GLY A 1 63 ? 2.332   -4.986  -9.497  1.00 15.00 ? 63 GLY A H    7  
ATOM 9474  H HA2  . GLY A 1 63 ? 1.288   -6.715  -10.790 1.00 15.00 ? 63 GLY A HA2  7  
ATOM 9475  H HA3  . GLY A 1 63 ? 2.807   -6.943  -11.643 1.00 15.00 ? 63 GLY A HA3  7  
ATOM 9476  N N    . VAL A 1 64 ? 3.293   -7.505  -8.570  1.00 15.00 ? 64 VAL A N    7  
ATOM 9477  C CA   . VAL A 1 64 ? 3.658   -8.510  -7.579  1.00 15.00 ? 64 VAL A CA   7  
ATOM 9478  C C    . VAL A 1 64 ? 2.537   -8.690  -6.556  1.00 15.00 ? 64 VAL A C    7  
ATOM 9479  O O    . VAL A 1 64 ? 2.346   -7.861  -5.667  1.00 15.00 ? 64 VAL A O    7  
ATOM 9480  C CB   . VAL A 1 64 ? 4.986   -8.162  -6.865  1.00 15.00 ? 64 VAL A CB   7  
ATOM 9481  C CG1  . VAL A 1 64 ? 4.793   -7.062  -5.834  1.00 15.00 ? 64 VAL A CG1  7  
ATOM 9482  C CG2  . VAL A 1 64 ? 5.584   -9.404  -6.221  1.00 15.00 ? 64 VAL A CG2  7  
ATOM 9483  H H    . VAL A 1 64 ? 3.461   -6.559  -8.380  1.00 15.00 ? 64 VAL A H    7  
ATOM 9484  H HA   . VAL A 1 64 ? 3.796   -9.446  -8.103  1.00 15.00 ? 64 VAL A HA   7  
ATOM 9485  H HB   . VAL A 1 64 ? 5.682   -7.801  -7.606  1.00 15.00 ? 64 VAL A HB   7  
ATOM 9486  H HG11 . VAL A 1 64 ? 4.103   -6.328  -6.219  1.00 15.00 ? 64 VAL A HG11 7  
ATOM 9487  H HG12 . VAL A 1 64 ? 4.396   -7.488  -4.925  1.00 15.00 ? 64 VAL A HG12 7  
ATOM 9488  H HG13 . VAL A 1 64 ? 5.742   -6.591  -5.627  1.00 15.00 ? 64 VAL A HG13 7  
ATOM 9489  H HG21 . VAL A 1 64 ? 6.069   -9.132  -5.295  1.00 15.00 ? 64 VAL A HG21 7  
ATOM 9490  H HG22 . VAL A 1 64 ? 4.800   -10.119 -6.020  1.00 15.00 ? 64 VAL A HG22 7  
ATOM 9491  H HG23 . VAL A 1 64 ? 6.308   -9.843  -6.891  1.00 15.00 ? 64 VAL A HG23 7  
ATOM 9492  N N    . SER A 1 65 ? 1.786   -9.774  -6.701  1.00 15.00 ? 65 SER A N    7  
ATOM 9493  C CA   . SER A 1 65 ? 0.673   -10.062 -5.802  1.00 15.00 ? 65 SER A CA   7  
ATOM 9494  C C    . SER A 1 65 ? 1.140   -10.124 -4.352  1.00 15.00 ? 65 SER A C    7  
ATOM 9495  O O    . SER A 1 65 ? 2.147   -10.759 -4.038  1.00 15.00 ? 65 SER A O    7  
ATOM 9496  C CB   . SER A 1 65 ? 0.004   -11.381 -6.192  1.00 15.00 ? 65 SER A CB   7  
ATOM 9497  O OG   . SER A 1 65 ? -0.780  -11.229 -7.363  1.00 15.00 ? 65 SER A OG   7  
ATOM 9498  H H    . SER A 1 65 ? 1.980   -10.393 -7.434  1.00 15.00 ? 65 SER A H    7  
ATOM 9499  H HA   . SER A 1 65 ? -0.046  -9.261  -5.902  1.00 15.00 ? 65 SER A HA   7  
ATOM 9500  H HB2  . SER A 1 65 ? 0.763   -12.126 -6.377  1.00 15.00 ? 65 SER A HB2  7  
ATOM 9501  H HB3  . SER A 1 65 ? -0.635  -11.710 -5.386  1.00 15.00 ? 65 SER A HB3  7  
ATOM 9502  H HG   . SER A 1 65 ? -0.372  -11.709 -8.087  1.00 15.00 ? 65 SER A HG   7  
ATOM 9503  N N    . LEU A 1 66 ? 0.397   -9.462  -3.471  1.00 15.00 ? 66 LEU A N    7  
ATOM 9504  C CA   . LEU A 1 66 ? 0.728   -9.441  -2.052  1.00 15.00 ? 66 LEU A CA   7  
ATOM 9505  C C    . LEU A 1 66 ? 0.093   -10.625 -1.326  1.00 15.00 ? 66 LEU A C    7  
ATOM 9506  O O    . LEU A 1 66 ? 0.520   -10.994 -0.232  1.00 15.00 ? 66 LEU A O    7  
ATOM 9507  C CB   . LEU A 1 66 ? 0.267   -8.126  -1.416  1.00 15.00 ? 66 LEU A CB   7  
ATOM 9508  C CG   . LEU A 1 66 ? 1.320   -7.417  -0.565  1.00 15.00 ? 66 LEU A CG   7  
ATOM 9509  C CD1  . LEU A 1 66 ? 1.816   -8.334  0.543   1.00 15.00 ? 66 LEU A CD1  7  
ATOM 9510  C CD2  . LEU A 1 66 ? 2.479   -6.953  -1.433  1.00 15.00 ? 66 LEU A CD2  7  
ATOM 9511  H H    . LEU A 1 66 ? -0.395  -8.977  -3.783  1.00 15.00 ? 66 LEU A H    7  
ATOM 9512  H HA   . LEU A 1 66 ? 1.801   -9.515  -1.962  1.00 15.00 ? 66 LEU A HA   7  
ATOM 9513  H HB2  . LEU A 1 66 ? -0.038  -7.456  -2.208  1.00 15.00 ? 66 LEU A HB2  7  
ATOM 9514  H HB3  . LEU A 1 66 ? -0.590  -8.331  -0.792  1.00 15.00 ? 66 LEU A HB3  7  
ATOM 9515  H HG   . LEU A 1 66 ? 0.876   -6.547  -0.104  1.00 15.00 ? 66 LEU A HG   7  
ATOM 9516  H HD11 . LEU A 1 66 ? 1.955   -9.330  0.150   1.00 15.00 ? 66 LEU A HD11 7  
ATOM 9517  H HD12 . LEU A 1 66 ? 2.755   -7.963  0.925   1.00 15.00 ? 66 LEU A HD12 7  
ATOM 9518  H HD13 . LEU A 1 66 ? 1.088   -8.361  1.341   1.00 15.00 ? 66 LEU A HD13 7  
ATOM 9519  H HD21 . LEU A 1 66 ? 3.406   -7.074  -0.892  1.00 15.00 ? 66 LEU A HD21 7  
ATOM 9520  H HD22 . LEU A 1 66 ? 2.511   -7.543  -2.337  1.00 15.00 ? 66 LEU A HD22 7  
ATOM 9521  H HD23 . LEU A 1 66 ? 2.345   -5.912  -1.687  1.00 15.00 ? 66 LEU A HD23 7  
ATOM 9522  N N    . GLU A 1 67 ? -0.929  -11.219 -1.941  1.00 15.00 ? 67 GLU A N    7  
ATOM 9523  C CA   . GLU A 1 67 ? -1.619  -12.363 -1.351  1.00 15.00 ? 67 GLU A CA   7  
ATOM 9524  C C    . GLU A 1 67 ? -0.620  -13.402 -0.850  1.00 15.00 ? 67 GLU A C    7  
ATOM 9525  O O    . GLU A 1 67 ? -0.141  -14.239 -1.615  1.00 15.00 ? 67 GLU A O    7  
ATOM 9526  C CB   . GLU A 1 67 ? -2.564  -12.998 -2.373  1.00 15.00 ? 67 GLU A CB   7  
ATOM 9527  C CG   . GLU A 1 67 ? -3.950  -12.376 -2.388  1.00 15.00 ? 67 GLU A CG   7  
ATOM 9528  C CD   . GLU A 1 67 ? -4.155  -11.436 -3.560  1.00 15.00 ? 67 GLU A CD   7  
ATOM 9529  O OE1  . GLU A 1 67 ? -3.532  -10.353 -3.568  1.00 15.00 ? 67 GLU A OE1  7  
ATOM 9530  O OE2  . GLU A 1 67 ? -4.937  -11.783 -4.470  1.00 15.00 ? 67 GLU A OE2  7  
ATOM 9531  H H    . GLU A 1 67 ? -1.226  -10.882 -2.811  1.00 15.00 ? 67 GLU A H    7  
ATOM 9532  H HA   . GLU A 1 67 ? -2.198  -12.005 -0.513  1.00 15.00 ? 67 GLU A HA   7  
ATOM 9533  H HB2  . GLU A 1 67 ? -2.134  -12.891 -3.358  1.00 15.00 ? 67 GLU A HB2  7  
ATOM 9534  H HB3  . GLU A 1 67 ? -2.666  -14.049 -2.147  1.00 15.00 ? 67 GLU A HB3  7  
ATOM 9535  H HG2  . GLU A 1 67 ? -4.684  -13.165 -2.448  1.00 15.00 ? 67 GLU A HG2  7  
ATOM 9536  H HG3  . GLU A 1 67 ? -4.092  -11.822 -1.472  1.00 15.00 ? 67 GLU A HG3  7  
ATOM 9537  N N    . GLY A 1 68 ? -0.307  -13.337 0.439   1.00 15.00 ? 68 GLY A N    7  
ATOM 9538  C CA   . GLY A 1 68 ? 0.637   -14.270 1.021   1.00 15.00 ? 68 GLY A CA   7  
ATOM 9539  C C    . GLY A 1 68 ? 1.957   -13.610 1.369   1.00 15.00 ? 68 GLY A C    7  
ATOM 9540  O O    . GLY A 1 68 ? 2.993   -13.932 0.788   1.00 15.00 ? 68 GLY A O    7  
ATOM 9541  H H    . GLY A 1 68 ? -0.717  -12.645 0.999   1.00 15.00 ? 68 GLY A H    7  
ATOM 9542  H HA2  . GLY A 1 68 ? 0.207   -14.689 1.919   1.00 15.00 ? 68 GLY A HA2  7  
ATOM 9543  H HA3  . GLY A 1 68 ? 0.821   -15.067 0.316   1.00 15.00 ? 68 GLY A HA3  7  
ATOM 9544  N N    . ALA A 1 69 ? 1.918   -12.683 2.320   1.00 15.00 ? 69 ALA A N    7  
ATOM 9545  C CA   . ALA A 1 69 ? 3.116   -11.972 2.746   1.00 15.00 ? 69 ALA A CA   7  
ATOM 9546  C C    . ALA A 1 69 ? 2.826   -11.100 3.963   1.00 15.00 ? 69 ALA A C    7  
ATOM 9547  O O    . ALA A 1 69 ? 1.682   -10.725 4.214   1.00 15.00 ? 69 ALA A O    7  
ATOM 9548  C CB   . ALA A 1 69 ? 3.662   -11.128 1.605   1.00 15.00 ? 69 ALA A CB   7  
ATOM 9549  H H    . ALA A 1 69 ? 1.061   -12.469 2.743   1.00 15.00 ? 69 ALA A H    7  
ATOM 9550  H HA   . ALA A 1 69 ? 3.863   -12.706 3.011   1.00 15.00 ? 69 ALA A HA   7  
ATOM 9551  H HB1  . ALA A 1 69 ? 4.456   -11.665 1.107   1.00 15.00 ? 69 ALA A HB1  7  
ATOM 9552  H HB2  . ALA A 1 69 ? 2.871   -10.921 0.899   1.00 15.00 ? 69 ALA A HB2  7  
ATOM 9553  H HB3  . ALA A 1 69 ? 4.047   -10.197 1.996   1.00 15.00 ? 69 ALA A HB3  7  
ATOM 9554  N N    . THR A 1 70 ? 3.868   -10.788 4.721   1.00 15.00 ? 70 THR A N    7  
ATOM 9555  C CA   . THR A 1 70 ? 3.724   -9.969  5.917   1.00 15.00 ? 70 THR A CA   7  
ATOM 9556  C C    . THR A 1 70 ? 3.958   -8.491  5.610   1.00 15.00 ? 70 THR A C    7  
ATOM 9557  O O    . THR A 1 70 ? 4.075   -8.093  4.451   1.00 15.00 ? 70 THR A O    7  
ATOM 9558  C CB   . THR A 1 70 ? 4.706   -10.432 6.994   1.00 15.00 ? 70 THR A CB   7  
ATOM 9559  O OG1  . THR A 1 70 ? 6.016   -9.973  6.706   1.00 15.00 ? 70 THR A OG1  7  
ATOM 9560  C CG2  . THR A 1 70 ? 4.769   -11.937 7.142   1.00 15.00 ? 70 THR A CG2  7  
ATOM 9561  H H    . THR A 1 70 ? 4.755   -11.123 4.475   1.00 15.00 ? 70 THR A H    7  
ATOM 9562  H HA   . THR A 1 70 ? 2.716   -10.095 6.286   1.00 15.00 ? 70 THR A HA   7  
ATOM 9563  H HB   . THR A 1 70 ? 4.403   -10.018 7.945   1.00 15.00 ? 70 THR A HB   7  
ATOM 9564  H HG1  . THR A 1 70 ? 6.072   -9.032  6.885   1.00 15.00 ? 70 THR A HG1  7  
ATOM 9565  H HG21 . THR A 1 70 ? 5.069   -12.187 8.148   1.00 15.00 ? 70 THR A HG21 7  
ATOM 9566  H HG22 . THR A 1 70 ? 3.796   -12.359 6.940   1.00 15.00 ? 70 THR A HG22 7  
ATOM 9567  H HG23 . THR A 1 70 ? 5.488   -12.337 6.442   1.00 15.00 ? 70 THR A HG23 7  
ATOM 9568  N N    . HIS A 1 71 ? 4.030   -7.689  6.667   1.00 15.00 ? 71 HIS A N    7  
ATOM 9569  C CA   . HIS A 1 71 ? 4.255   -6.254  6.545   1.00 15.00 ? 71 HIS A CA   7  
ATOM 9570  C C    . HIS A 1 71 ? 5.575   -5.989  5.841   1.00 15.00 ? 71 HIS A C    7  
ATOM 9571  O O    . HIS A 1 71 ? 5.616   -5.381  4.772   1.00 15.00 ? 71 HIS A O    7  
ATOM 9572  C CB   . HIS A 1 71 ? 4.236   -5.622  7.948   1.00 15.00 ? 71 HIS A CB   7  
ATOM 9573  C CG   . HIS A 1 71 ? 4.953   -4.310  8.089   1.00 15.00 ? 71 HIS A CG   7  
ATOM 9574  N ND1  . HIS A 1 71 ? 5.208   -3.738  9.318   1.00 15.00 ? 71 HIS A ND1  7  
ATOM 9575  C CD2  . HIS A 1 71 ? 5.444   -3.445  7.168   1.00 15.00 ? 71 HIS A CD2  7  
ATOM 9576  C CE1  . HIS A 1 71 ? 5.816   -2.581  9.149   1.00 15.00 ? 71 HIS A CE1  7  
ATOM 9577  N NE2  . HIS A 1 71 ? 5.975   -2.379  7.854   1.00 15.00 ? 71 HIS A NE2  7  
ATOM 9578  H H    . HIS A 1 71 ? 3.931   -8.076  7.558   1.00 15.00 ? 71 HIS A H    7  
ATOM 9579  H HA   . HIS A 1 71 ? 3.453   -5.837  5.958   1.00 15.00 ? 71 HIS A HA   7  
ATOM 9580  H HB2  . HIS A 1 71 ? 3.213   -5.452  8.233   1.00 15.00 ? 71 HIS A HB2  7  
ATOM 9581  H HB3  . HIS A 1 71 ? 4.681   -6.317  8.646   1.00 15.00 ? 71 HIS A HB3  7  
ATOM 9582  H HD1  . HIS A 1 71 ? 4.974   -4.126  10.188  1.00 15.00 ? 71 HIS A HD1  7  
ATOM 9583  H HD2  . HIS A 1 71 ? 5.416   -3.566  6.095   1.00 15.00 ? 71 HIS A HD2  7  
ATOM 9584  H HE1  . HIS A 1 71 ? 6.107   -1.900  9.936   1.00 15.00 ? 71 HIS A HE1  7  
ATOM 9585  H HE2  . HIS A 1 71 ? 6.315   -1.555  7.450   1.00 15.00 ? 71 HIS A HE2  7  
ATOM 9586  N N    . LYS A 1 72 ? 6.650   -6.458  6.451   1.00 15.00 ? 72 LYS A N    7  
ATOM 9587  C CA   . LYS A 1 72 ? 7.984   -6.289  5.895   1.00 15.00 ? 72 LYS A CA   7  
ATOM 9588  C C    . LYS A 1 72 ? 8.037   -6.785  4.453   1.00 15.00 ? 72 LYS A C    7  
ATOM 9589  O O    . LYS A 1 72 ? 8.725   -6.207  3.613   1.00 15.00 ? 72 LYS A O    7  
ATOM 9590  C CB   . LYS A 1 72 ? 8.997   -7.045  6.751   1.00 15.00 ? 72 LYS A CB   7  
ATOM 9591  C CG   . LYS A 1 72 ? 10.443  -6.682  6.454   1.00 15.00 ? 72 LYS A CG   7  
ATOM 9592  C CD   . LYS A 1 72 ? 11.390  -7.278  7.482   1.00 15.00 ? 72 LYS A CD   7  
ATOM 9593  C CE   . LYS A 1 72 ? 11.481  -8.789  7.347   1.00 15.00 ? 72 LYS A CE   7  
ATOM 9594  N NZ   . LYS A 1 72 ? 12.537  -9.198  6.381   1.00 15.00 ? 72 LYS A NZ   7  
ATOM 9595  H H    . LYS A 1 72 ? 6.541   -6.942  7.297   1.00 15.00 ? 72 LYS A H    7  
ATOM 9596  H HA   . LYS A 1 72 ? 8.220   -5.230  5.907   1.00 15.00 ? 72 LYS A HA   7  
ATOM 9597  H HB2  . LYS A 1 72 ? 8.799   -6.831  7.791   1.00 15.00 ? 72 LYS A HB2  7  
ATOM 9598  H HB3  . LYS A 1 72 ? 8.870   -8.105  6.582   1.00 15.00 ? 72 LYS A HB3  7  
ATOM 9599  H HG2  . LYS A 1 72 ? 10.705  -7.059  5.477   1.00 15.00 ? 72 LYS A HG2  7  
ATOM 9600  H HG3  . LYS A 1 72 ? 10.543  -5.606  6.465   1.00 15.00 ? 72 LYS A HG3  7  
ATOM 9601  H HD2  . LYS A 1 72 ? 12.373  -6.855  7.340   1.00 15.00 ? 72 LYS A HD2  7  
ATOM 9602  H HD3  . LYS A 1 72 ? 11.031  -7.034  8.472   1.00 15.00 ? 72 LYS A HD3  7  
ATOM 9603  H HE2  . LYS A 1 72 ? 11.708  -9.212  8.315   1.00 15.00 ? 72 LYS A HE2  7  
ATOM 9604  H HE3  . LYS A 1 72 ? 10.527  -9.165  7.006   1.00 15.00 ? 72 LYS A HE3  7  
ATOM 9605  H HZ1  . LYS A 1 72 ? 12.112  -9.421  5.459   1.00 15.00 ? 72 LYS A HZ1  7  
ATOM 9606  H HZ2  . LYS A 1 72 ? 13.226  -8.428  6.257   1.00 15.00 ? 72 LYS A HZ2  7  
ATOM 9607  H HZ3  . LYS A 1 72 ? 13.036  -10.040 6.732   1.00 15.00 ? 72 LYS A HZ3  7  
ATOM 9608  N N    . GLN A 1 73 ? 7.298   -7.855  4.170   1.00 15.00 ? 73 GLN A N    7  
ATOM 9609  C CA   . GLN A 1 73 ? 7.261   -8.415  2.826   1.00 15.00 ? 73 GLN A CA   7  
ATOM 9610  C C    . GLN A 1 73 ? 6.754   -7.371  1.843   1.00 15.00 ? 73 GLN A C    7  
ATOM 9611  O O    . GLN A 1 73 ? 7.417   -7.061  0.853   1.00 15.00 ? 73 GLN A O    7  
ATOM 9612  C CB   . GLN A 1 73 ? 6.368   -9.655  2.785   1.00 15.00 ? 73 GLN A CB   7  
ATOM 9613  C CG   . GLN A 1 73 ? 6.974   -10.855 3.490   1.00 15.00 ? 73 GLN A CG   7  
ATOM 9614  C CD   . GLN A 1 73 ? 6.484   -12.174 2.924   1.00 15.00 ? 73 GLN A CD   7  
ATOM 9615  O OE1  . GLN A 1 73 ? 5.982   -13.028 3.655   1.00 15.00 ? 73 GLN A OE1  7  
ATOM 9616  N NE2  . GLN A 1 73 ? 6.629   -12.346 1.615   1.00 15.00 ? 73 GLN A NE2  7  
ATOM 9617  H H    . GLN A 1 73 ? 6.764   -8.271  4.879   1.00 15.00 ? 73 GLN A H    7  
ATOM 9618  H HA   . GLN A 1 73 ? 8.268   -8.694  2.552   1.00 15.00 ? 73 GLN A HA   7  
ATOM 9619  H HB2  . GLN A 1 73 ? 5.426   -9.422  3.259   1.00 15.00 ? 73 GLN A HB2  7  
ATOM 9620  H HB3  . GLN A 1 73 ? 6.188   -9.922  1.754   1.00 15.00 ? 73 GLN A HB3  7  
ATOM 9621  H HG2  . GLN A 1 73 ? 8.047   -10.812 3.386   1.00 15.00 ? 73 GLN A HG2  7  
ATOM 9622  H HG3  . GLN A 1 73 ? 6.712   -10.809 4.537   1.00 15.00 ? 73 GLN A HG3  7  
ATOM 9623  H HE21 . GLN A 1 73 ? 7.039   -11.623 1.096   1.00 15.00 ? 73 GLN A HE21 7  
ATOM 9624  H HE22 . GLN A 1 73 ? 6.321   -13.190 1.223   1.00 15.00 ? 73 GLN A HE22 7  
ATOM 9625  N N    . ALA A 1 74 ? 5.584   -6.814  2.134   1.00 15.00 ? 74 ALA A N    7  
ATOM 9626  C CA   . ALA A 1 74 ? 5.009   -5.783  1.284   1.00 15.00 ? 74 ALA A CA   7  
ATOM 9627  C C    . ALA A 1 74 ? 5.888   -4.545  1.314   1.00 15.00 ? 74 ALA A C    7  
ATOM 9628  O O    . ALA A 1 74 ? 6.180   -3.953  0.277   1.00 15.00 ? 74 ALA A O    7  
ATOM 9629  C CB   . ALA A 1 74 ? 3.601   -5.442  1.724   1.00 15.00 ? 74 ALA A CB   7  
ATOM 9630  H H    . ALA A 1 74 ? 5.110   -7.091  2.947   1.00 15.00 ? 74 ALA A H    7  
ATOM 9631  H HA   . ALA A 1 74 ? 4.969   -6.165  0.274   1.00 15.00 ? 74 ALA A HA   7  
ATOM 9632  H HB1  . ALA A 1 74 ? 2.895   -5.991  1.122   1.00 15.00 ? 74 ALA A HB1  7  
ATOM 9633  H HB2  . ALA A 1 74 ? 3.474   -5.706  2.763   1.00 15.00 ? 74 ALA A HB2  7  
ATOM 9634  H HB3  . ALA A 1 74 ? 3.437   -4.383  1.597   1.00 15.00 ? 74 ALA A HB3  7  
ATOM 9635  N N    . VAL A 1 75 ? 6.335   -4.176  2.515   1.00 15.00 ? 75 VAL A N    7  
ATOM 9636  C CA   . VAL A 1 75 ? 7.218   -3.028  2.686   1.00 15.00 ? 75 VAL A CA   7  
ATOM 9637  C C    . VAL A 1 75 ? 8.282   -3.057  1.602   1.00 15.00 ? 75 VAL A C    7  
ATOM 9638  O O    . VAL A 1 75 ? 8.603   -2.039  0.990   1.00 15.00 ? 75 VAL A O    7  
ATOM 9639  C CB   . VAL A 1 75 ? 7.873   -3.053  4.090   1.00 15.00 ? 75 VAL A CB   7  
ATOM 9640  C CG1  . VAL A 1 75 ? 9.382   -3.252  4.016   1.00 15.00 ? 75 VAL A CG1  7  
ATOM 9641  C CG2  . VAL A 1 75 ? 7.542   -1.797  4.870   1.00 15.00 ? 75 VAL A CG2  7  
ATOM 9642  H H    . VAL A 1 75 ? 6.083   -4.706  3.300   1.00 15.00 ? 75 VAL A H    7  
ATOM 9643  H HA   . VAL A 1 75 ? 6.635   -2.123  2.586   1.00 15.00 ? 75 VAL A HA   7  
ATOM 9644  H HB   . VAL A 1 75 ? 7.454   -3.888  4.630   1.00 15.00 ? 75 VAL A HB   7  
ATOM 9645  H HG11 . VAL A 1 75 ? 9.825   -2.444  3.452   1.00 15.00 ? 75 VAL A HG11 7  
ATOM 9646  H HG12 . VAL A 1 75 ? 9.793   -3.260  5.015   1.00 15.00 ? 75 VAL A HG12 7  
ATOM 9647  H HG13 . VAL A 1 75 ? 9.600   -4.191  3.531   1.00 15.00 ? 75 VAL A HG13 7  
ATOM 9648  H HG21 . VAL A 1 75 ? 8.327   -1.069  4.731   1.00 15.00 ? 75 VAL A HG21 7  
ATOM 9649  H HG22 . VAL A 1 75 ? 6.605   -1.390  4.520   1.00 15.00 ? 75 VAL A HG22 7  
ATOM 9650  H HG23 . VAL A 1 75 ? 7.460   -2.046  5.918   1.00 15.00 ? 75 VAL A HG23 7  
ATOM 9651  N N    . GLU A 1 76 ? 8.798   -4.254  1.358   1.00 15.00 ? 76 GLU A N    7  
ATOM 9652  C CA   . GLU A 1 76 ? 9.802   -4.458  0.331   1.00 15.00 ? 76 GLU A CA   7  
ATOM 9653  C C    . GLU A 1 76 ? 9.200   -4.227  -1.052  1.00 15.00 ? 76 GLU A C    7  
ATOM 9654  O O    . GLU A 1 76 ? 9.817   -3.592  -1.902  1.00 15.00 ? 76 GLU A O    7  
ATOM 9655  C CB   . GLU A 1 76 ? 10.380  -5.871  0.422   1.00 15.00 ? 76 GLU A CB   7  
ATOM 9656  C CG   . GLU A 1 76 ? 10.884  -6.236  1.809   1.00 15.00 ? 76 GLU A CG   7  
ATOM 9657  C CD   . GLU A 1 76 ? 12.322  -6.719  1.800   1.00 15.00 ? 76 GLU A CD   7  
ATOM 9658  O OE1  . GLU A 1 76 ? 13.203  -5.953  1.355   1.00 15.00 ? 76 GLU A OE1  7  
ATOM 9659  O OE2  . GLU A 1 76 ? 12.567  -7.862  2.237   1.00 15.00 ? 76 GLU A OE2  7  
ATOM 9660  H H    . GLU A 1 76 ? 8.478   -5.025  1.875   1.00 15.00 ? 76 GLU A H    7  
ATOM 9661  H HA   . GLU A 1 76 ? 10.593  -3.741  0.492   1.00 15.00 ? 76 GLU A HA   7  
ATOM 9662  H HB2  . GLU A 1 76 ? 9.614   -6.580  0.143   1.00 15.00 ? 76 GLU A HB2  7  
ATOM 9663  H HB3  . GLU A 1 76 ? 11.204  -5.955  -0.272  1.00 15.00 ? 76 GLU A HB3  7  
ATOM 9664  H HG2  . GLU A 1 76 ? 10.818  -5.365  2.443   1.00 15.00 ? 76 GLU A HG2  7  
ATOM 9665  H HG3  . GLU A 1 76 ? 10.259  -7.020  2.210   1.00 15.00 ? 76 GLU A HG3  7  
ATOM 9666  N N    . THR A 1 77 ? 7.991   -4.747  -1.277  1.00 15.00 ? 77 THR A N    7  
ATOM 9667  C CA   . THR A 1 77 ? 7.326   -4.584  -2.568  1.00 15.00 ? 77 THR A CA   7  
ATOM 9668  C C    . THR A 1 77 ? 7.019   -3.119  -2.858  1.00 15.00 ? 77 THR A C    7  
ATOM 9669  O O    . THR A 1 77 ? 7.444   -2.580  -3.879  1.00 15.00 ? 77 THR A O    7  
ATOM 9670  C CB   . THR A 1 77 ? 6.041   -5.407  -2.631  1.00 15.00 ? 77 THR A CB   7  
ATOM 9671  O OG1  . THR A 1 77 ? 5.141   -5.021  -1.609  1.00 15.00 ? 77 THR A OG1  7  
ATOM 9672  C CG2  . THR A 1 77 ? 6.276   -6.895  -2.504  1.00 15.00 ? 77 THR A CG2  7  
ATOM 9673  H H    . THR A 1 77 ? 7.533   -5.244  -0.559  1.00 15.00 ? 77 THR A H    7  
ATOM 9674  H HA   . THR A 1 77 ? 8.004   -4.946  -3.328  1.00 15.00 ? 77 THR A HA   7  
ATOM 9675  H HB   . THR A 1 77 ? 5.567   -5.230  -3.585  1.00 15.00 ? 77 THR A HB   7  
ATOM 9676  H HG1  . THR A 1 77 ? 4.250   -5.282  -1.851  1.00 15.00 ? 77 THR A HG1  7  
ATOM 9677  H HG21 . THR A 1 77 ? 6.234   -7.351  -3.483  1.00 15.00 ? 77 THR A HG21 7  
ATOM 9678  H HG22 . THR A 1 77 ? 7.248   -7.070  -2.067  1.00 15.00 ? 77 THR A HG22 7  
ATOM 9679  H HG23 . THR A 1 77 ? 5.514   -7.328  -1.873  1.00 15.00 ? 77 THR A HG23 7  
ATOM 9680  N N    . LEU A 1 78 ? 6.278   -2.475  -1.957  1.00 15.00 ? 78 LEU A N    7  
ATOM 9681  C CA   . LEU A 1 78 ? 5.920   -1.070  -2.135  1.00 15.00 ? 78 LEU A CA   7  
ATOM 9682  C C    . LEU A 1 78 ? 7.169   -0.237  -2.379  1.00 15.00 ? 78 LEU A C    7  
ATOM 9683  O O    . LEU A 1 78 ? 7.217   0.585   -3.295  1.00 15.00 ? 78 LEU A O    7  
ATOM 9684  C CB   . LEU A 1 78 ? 5.177   -0.531  -0.906  1.00 15.00 ? 78 LEU A CB   7  
ATOM 9685  C CG   . LEU A 1 78 ? 4.233   -1.518  -0.214  1.00 15.00 ? 78 LEU A CG   7  
ATOM 9686  C CD1  . LEU A 1 78 ? 3.403   -0.807  0.844   1.00 15.00 ? 78 LEU A CD1  7  
ATOM 9687  C CD2  . LEU A 1 78 ? 3.331   -2.201  -1.230  1.00 15.00 ? 78 LEU A CD2  7  
ATOM 9688  H H    . LEU A 1 78 ? 5.966   -2.955  -1.162  1.00 15.00 ? 78 LEU A H    7  
ATOM 9689  H HA   . LEU A 1 78 ? 5.276   -0.996  -2.998  1.00 15.00 ? 78 LEU A HA   7  
ATOM 9690  H HB2  . LEU A 1 78 ? 5.913   -0.206  -0.185  1.00 15.00 ? 78 LEU A HB2  7  
ATOM 9691  H HB3  . LEU A 1 78 ? 4.599   0.328   -1.213  1.00 15.00 ? 78 LEU A HB3  7  
ATOM 9692  H HG   . LEU A 1 78 ? 4.819   -2.278  0.280   1.00 15.00 ? 78 LEU A HG   7  
ATOM 9693  H HD11 . LEU A 1 78 ? 3.330   0.243   0.598   1.00 15.00 ? 78 LEU A HD11 7  
ATOM 9694  H HD12 . LEU A 1 78 ? 2.414   -1.239  0.876   1.00 15.00 ? 78 LEU A HD12 7  
ATOM 9695  H HD13 . LEU A 1 78 ? 3.877   -0.918  1.808   1.00 15.00 ? 78 LEU A HD13 7  
ATOM 9696  H HD21 . LEU A 1 78 ? 2.352   -2.350  -0.799  1.00 15.00 ? 78 LEU A HD21 7  
ATOM 9697  H HD22 . LEU A 1 78 ? 3.245   -1.580  -2.110  1.00 15.00 ? 78 LEU A HD22 7  
ATOM 9698  H HD23 . LEU A 1 78 ? 3.754   -3.156  -1.504  1.00 15.00 ? 78 LEU A HD23 7  
ATOM 9699  N N    . ARG A 1 79 ? 8.181   -0.466  -1.555  1.00 15.00 ? 79 ARG A N    7  
ATOM 9700  C CA   . ARG A 1 79 ? 9.442   0.246   -1.674  1.00 15.00 ? 79 ARG A CA   7  
ATOM 9701  C C    . ARG A 1 79 ? 10.177  -0.166  -2.949  1.00 15.00 ? 79 ARG A C    7  
ATOM 9702  O O    . ARG A 1 79 ? 10.484  0.671   -3.797  1.00 15.00 ? 79 ARG A O    7  
ATOM 9703  C CB   . ARG A 1 79 ? 10.310  -0.031  -0.445  1.00 15.00 ? 79 ARG A CB   7  
ATOM 9704  C CG   . ARG A 1 79 ? 11.234  1.120   -0.079  1.00 15.00 ? 79 ARG A CG   7  
ATOM 9705  C CD   . ARG A 1 79 ? 12.614  0.624   0.327   1.00 15.00 ? 79 ARG A CD   7  
ATOM 9706  N NE   . ARG A 1 79 ? 12.990  1.085   1.661   1.00 15.00 ? 79 ARG A NE   7  
ATOM 9707  C CZ   . ARG A 1 79 ? 14.242  1.107   2.112   1.00 15.00 ? 79 ARG A CZ   7  
ATOM 9708  N NH1  . ARG A 1 79 ? 15.240  0.696   1.339   1.00 15.00 ? 79 ARG A NH1  7  
ATOM 9709  N NH2  . ARG A 1 79 ? 14.497  1.542   3.338   1.00 15.00 ? 79 ARG A NH2  7  
ATOM 9710  H H    . ARG A 1 79 ? 8.079   -1.140  -0.851  1.00 15.00 ? 79 ARG A H    7  
ATOM 9711  H HA   . ARG A 1 79 ? 9.225   1.302   -1.722  1.00 15.00 ? 79 ARG A HA   7  
ATOM 9712  H HB2  . ARG A 1 79 ? 9.662   -0.229  0.400   1.00 15.00 ? 79 ARG A HB2  7  
ATOM 9713  H HB3  . ARG A 1 79 ? 10.915  -0.905  -0.635  1.00 15.00 ? 79 ARG A HB3  7  
ATOM 9714  H HG2  . ARG A 1 79 ? 11.335  1.773   -0.933  1.00 15.00 ? 79 ARG A HG2  7  
ATOM 9715  H HG3  . ARG A 1 79 ? 10.801  1.668   0.745   1.00 15.00 ? 79 ARG A HG3  7  
ATOM 9716  H HD2  . ARG A 1 79 ? 12.613  -0.455  0.317   1.00 15.00 ? 79 ARG A HD2  7  
ATOM 9717  H HD3  . ARG A 1 79 ? 13.338  0.990   -0.387  1.00 15.00 ? 79 ARG A HD3  7  
ATOM 9718  H HE   . ARG A 1 79 ? 12.272  1.393   2.253   1.00 15.00 ? 79 ARG A HE   7  
ATOM 9719  H HH11 . ARG A 1 79 ? 15.054  0.368   0.413   1.00 15.00 ? 79 ARG A HH11 7  
ATOM 9720  H HH12 . ARG A 1 79 ? 16.178  0.716   1.683   1.00 15.00 ? 79 ARG A HH12 7  
ATOM 9721  H HH21 . ARG A 1 79 ? 13.749  1.853   3.924   1.00 15.00 ? 79 ARG A HH21 7  
ATOM 9722  H HH22 . ARG A 1 79 ? 15.437  1.559   3.677   1.00 15.00 ? 79 ARG A HH22 7  
ATOM 9723  N N    . ASN A 1 80 ? 10.456  -1.461  -3.070  1.00 15.00 ? 80 ASN A N    7  
ATOM 9724  C CA   . ASN A 1 80 ? 11.154  -2.001  -4.235  1.00 15.00 ? 80 ASN A CA   7  
ATOM 9725  C C    . ASN A 1 80 ? 10.323  -1.869  -5.511  1.00 15.00 ? 80 ASN A C    7  
ATOM 9726  O O    . ASN A 1 80 ? 9.963   -2.871  -6.130  1.00 15.00 ? 80 ASN A O    7  
ATOM 9727  C CB   . ASN A 1 80 ? 11.509  -3.472  -4.006  1.00 15.00 ? 80 ASN A CB   7  
ATOM 9728  C CG   . ASN A 1 80 ? 12.385  -3.673  -2.785  1.00 15.00 ? 80 ASN A CG   7  
ATOM 9729  O OD1  . ASN A 1 80 ? 13.067  -2.750  -2.338  1.00 15.00 ? 80 ASN A OD1  7  
ATOM 9730  N ND2  . ASN A 1 80 ? 12.373  -4.883  -2.240  1.00 15.00 ? 80 ASN A ND2  7  
ATOM 9731  H H    . ASN A 1 80 ? 10.184  -2.074  -2.355  1.00 15.00 ? 80 ASN A H    7  
ATOM 9732  H HA   . ASN A 1 80 ? 12.068  -1.440  -4.359  1.00 15.00 ? 80 ASN A HA   7  
ATOM 9733  H HB2  . ASN A 1 80 ? 10.598  -4.039  -3.872  1.00 15.00 ? 80 ASN A HB2  7  
ATOM 9734  H HB3  . ASN A 1 80 ? 12.036  -3.847  -4.871  1.00 15.00 ? 80 ASN A HB3  7  
ATOM 9735  H HD21 . ASN A 1 80 ? 11.806  -5.570  -2.650  1.00 15.00 ? 80 ASN A HD21 7  
ATOM 9736  H HD22 . ASN A 1 80 ? 12.930  -5.040  -1.449  1.00 15.00 ? 80 ASN A HD22 7  
ATOM 9737  N N    . THR A 1 81 ? 10.031  -0.638  -5.914  1.00 15.00 ? 81 THR A N    7  
ATOM 9738  C CA   . THR A 1 81 ? 9.257   -0.405  -7.129  1.00 15.00 ? 81 THR A CA   7  
ATOM 9739  C C    . THR A 1 81 ? 10.194  -0.212  -8.318  1.00 15.00 ? 81 THR A C    7  
ATOM 9740  O O    . THR A 1 81 ? 10.399  -1.130  -9.112  1.00 15.00 ? 81 THR A O    7  
ATOM 9741  C CB   . THR A 1 81 ? 8.342   0.811   -6.963  1.00 15.00 ? 81 THR A CB   7  
ATOM 9742  O OG1  . THR A 1 81 ? 8.665   1.527   -5.784  1.00 15.00 ? 81 THR A OG1  7  
ATOM 9743  C CG2  . THR A 1 81 ? 6.873   0.447   -6.891  1.00 15.00 ? 81 THR A CG2  7  
ATOM 9744  H H    . THR A 1 81 ? 10.350  0.128   -5.392  1.00 15.00 ? 81 THR A H    7  
ATOM 9745  H HA   . THR A 1 81 ? 8.650   -1.280  -7.305  1.00 15.00 ? 81 THR A HA   7  
ATOM 9746  H HB   . THR A 1 81 ? 8.478   1.471   -7.808  1.00 15.00 ? 81 THR A HB   7  
ATOM 9747  H HG1  . THR A 1 81 ? 8.120   2.315   -5.728  1.00 15.00 ? 81 THR A HG1  7  
ATOM 9748  H HG21 . THR A 1 81 ? 6.464   0.780   -5.949  1.00 15.00 ? 81 THR A HG21 7  
ATOM 9749  H HG22 . THR A 1 81 ? 6.345   0.925   -7.701  1.00 15.00 ? 81 THR A HG22 7  
ATOM 9750  H HG23 . THR A 1 81 ? 6.761   -0.625  -6.973  1.00 15.00 ? 81 THR A HG23 7  
ATOM 9751  N N    . GLY A 1 82 ? 10.771  0.981   -8.428  1.00 15.00 ? 82 GLY A N    7  
ATOM 9752  C CA   . GLY A 1 82 ? 11.690  1.263   -9.510  1.00 15.00 ? 82 GLY A CA   7  
ATOM 9753  C C    . GLY A 1 82 ? 11.262  2.443   -10.356 1.00 15.00 ? 82 GLY A C    7  
ATOM 9754  O O    . GLY A 1 82 ? 11.351  3.594   -9.928  1.00 15.00 ? 82 GLY A O    7  
ATOM 9755  H H    . GLY A 1 82 ? 10.578  1.671   -7.768  1.00 15.00 ? 82 GLY A H    7  
ATOM 9756  H HA2  . GLY A 1 82 ? 12.664  1.471   -9.092  1.00 15.00 ? 82 GLY A HA2  7  
ATOM 9757  H HA3  . GLY A 1 82 ? 11.762  0.390   -10.141 1.00 15.00 ? 82 GLY A HA3  7  
ATOM 9758  N N    . GLN A 1 83 ? 10.812  2.152   -11.565 1.00 15.00 ? 83 GLN A N    7  
ATOM 9759  C CA   . GLN A 1 83 ? 10.378  3.193   -12.496 1.00 15.00 ? 83 GLN A CA   7  
ATOM 9760  C C    . GLN A 1 83 ? 9.140   3.924   -11.978 1.00 15.00 ? 83 GLN A C    7  
ATOM 9761  O O    . GLN A 1 83 ? 9.242   5.023   -11.433 1.00 15.00 ? 83 GLN A O    7  
ATOM 9762  C CB   . GLN A 1 83 ? 10.111  2.614   -13.895 1.00 15.00 ? 83 GLN A CB   7  
ATOM 9763  C CG   . GLN A 1 83 ? 10.877  1.335   -14.197 1.00 15.00 ? 83 GLN A CG   7  
ATOM 9764  C CD   . GLN A 1 83 ? 10.050  0.091   -13.941 1.00 15.00 ? 83 GLN A CD   7  
ATOM 9765  O OE1  . GLN A 1 83 ? 8.936   0.169   -13.422 1.00 15.00 ? 83 GLN A OE1  7  
ATOM 9766  N NE2  . GLN A 1 83 ? 10.592  -1.066  -14.306 1.00 15.00 ? 83 GLN A NE2  7  
ATOM 9767  H H    . GLN A 1 83 ? 10.773  1.215   -11.838 1.00 15.00 ? 83 GLN A H    7  
ATOM 9768  H HA   . GLN A 1 83 ? 11.183  3.909   -12.571 1.00 15.00 ? 83 GLN A HA   7  
ATOM 9769  H HB2  . GLN A 1 83 ? 9.059   2.405   -13.996 1.00 15.00 ? 83 GLN A HB2  7  
ATOM 9770  H HB3  . GLN A 1 83 ? 10.390  3.353   -14.632 1.00 15.00 ? 83 GLN A HB3  7  
ATOM 9771  H HG2  . GLN A 1 83 ? 11.175  1.344   -15.235 1.00 15.00 ? 83 GLN A HG2  7  
ATOM 9772  H HG3  . GLN A 1 83 ? 11.756  1.301   -13.570 1.00 15.00 ? 83 GLN A HG3  7  
ATOM 9773  H HE21 . GLN A 1 83 ? 11.483  -1.052  -14.713 1.00 15.00 ? 83 GLN A HE21 7  
ATOM 9774  H HE22 . GLN A 1 83 ? 10.078  -1.886  -14.152 1.00 15.00 ? 83 GLN A HE22 7  
ATOM 9775  N N    . VAL A 1 84 ? 7.971   3.314   -12.160 1.00 15.00 ? 84 VAL A N    7  
ATOM 9776  C CA   . VAL A 1 84 ? 6.717   3.911   -11.718 1.00 15.00 ? 84 VAL A CA   7  
ATOM 9777  C C    . VAL A 1 84 ? 6.127   3.144   -10.537 1.00 15.00 ? 84 VAL A C    7  
ATOM 9778  O O    . VAL A 1 84 ? 6.449   1.977   -10.313 1.00 15.00 ? 84 VAL A O    7  
ATOM 9779  C CB   . VAL A 1 84 ? 5.692   3.961   -12.873 1.00 15.00 ? 84 VAL A CB   7  
ATOM 9780  C CG1  . VAL A 1 84 ? 4.321   4.404   -12.379 1.00 15.00 ? 84 VAL A CG1  7  
ATOM 9781  C CG2  . VAL A 1 84 ? 6.186   4.886   -13.973 1.00 15.00 ? 84 VAL A CG2  7  
ATOM 9782  H H    . VAL A 1 84 ? 7.950   2.441   -12.602 1.00 15.00 ? 84 VAL A H    7  
ATOM 9783  H HA   . VAL A 1 84 ? 6.924   4.927   -11.406 1.00 15.00 ? 84 VAL A HA   7  
ATOM 9784  H HB   . VAL A 1 84 ? 5.596   2.968   -13.285 1.00 15.00 ? 84 VAL A HB   7  
ATOM 9785  H HG11 . VAL A 1 84 ? 4.411   5.353   -11.872 1.00 15.00 ? 84 VAL A HG11 7  
ATOM 9786  H HG12 . VAL A 1 84 ? 3.652   4.507   -13.220 1.00 15.00 ? 84 VAL A HG12 7  
ATOM 9787  H HG13 . VAL A 1 84 ? 3.929   3.667   -11.694 1.00 15.00 ? 84 VAL A HG13 7  
ATOM 9788  H HG21 . VAL A 1 84 ? 6.274   5.891   -13.585 1.00 15.00 ? 84 VAL A HG21 7  
ATOM 9789  H HG22 . VAL A 1 84 ? 7.151   4.549   -14.322 1.00 15.00 ? 84 VAL A HG22 7  
ATOM 9790  H HG23 . VAL A 1 84 ? 5.483   4.878   -14.793 1.00 15.00 ? 84 VAL A HG23 7  
ATOM 9791  N N    . VAL A 1 85 ? 5.250   3.805   -9.794  1.00 15.00 ? 85 VAL A N    7  
ATOM 9792  C CA   . VAL A 1 85 ? 4.605   3.190   -8.646  1.00 15.00 ? 85 VAL A CA   7  
ATOM 9793  C C    . VAL A 1 85 ? 3.220   2.677   -9.031  1.00 15.00 ? 85 VAL A C    7  
ATOM 9794  O O    . VAL A 1 85 ? 2.209   3.329   -8.777  1.00 15.00 ? 85 VAL A O    7  
ATOM 9795  C CB   . VAL A 1 85 ? 4.496   4.193   -7.470  1.00 15.00 ? 85 VAL A CB   7  
ATOM 9796  C CG1  . VAL A 1 85 ? 3.415   3.789   -6.476  1.00 15.00 ? 85 VAL A CG1  7  
ATOM 9797  C CG2  . VAL A 1 85 ? 5.837   4.334   -6.768  1.00 15.00 ? 85 VAL A CG2  7  
ATOM 9798  H H    . VAL A 1 85 ? 5.025   4.730   -10.027 1.00 15.00 ? 85 VAL A H    7  
ATOM 9799  H HA   . VAL A 1 85 ? 5.213   2.356   -8.328  1.00 15.00 ? 85 VAL A HA   7  
ATOM 9800  H HB   . VAL A 1 85 ? 4.232   5.155   -7.877  1.00 15.00 ? 85 VAL A HB   7  
ATOM 9801  H HG11 . VAL A 1 85 ? 3.177   2.743   -6.606  1.00 15.00 ? 85 VAL A HG11 7  
ATOM 9802  H HG12 . VAL A 1 85 ? 3.770   3.956   -5.470  1.00 15.00 ? 85 VAL A HG12 7  
ATOM 9803  H HG13 . VAL A 1 85 ? 2.530   4.386   -6.649  1.00 15.00 ? 85 VAL A HG13 7  
ATOM 9804  H HG21 . VAL A 1 85 ? 5.676   4.467   -5.708  1.00 15.00 ? 85 VAL A HG21 7  
ATOM 9805  H HG22 . VAL A 1 85 ? 6.426   3.445   -6.934  1.00 15.00 ? 85 VAL A HG22 7  
ATOM 9806  H HG23 . VAL A 1 85 ? 6.360   5.192   -7.162  1.00 15.00 ? 85 VAL A HG23 7  
ATOM 9807  N N    . HIS A 1 86 ? 3.189   1.501   -9.650  1.00 15.00 ? 86 HIS A N    7  
ATOM 9808  C CA   . HIS A 1 86 ? 1.932   0.891   -10.071 1.00 15.00 ? 86 HIS A CA   7  
ATOM 9809  C C    . HIS A 1 86 ? 1.462   -0.125  -9.037  1.00 15.00 ? 86 HIS A C    7  
ATOM 9810  O O    . HIS A 1 86 ? 1.668   -1.328  -9.192  1.00 15.00 ? 86 HIS A O    7  
ATOM 9811  C CB   . HIS A 1 86 ? 2.097   0.213   -11.431 1.00 15.00 ? 86 HIS A CB   7  
ATOM 9812  C CG   . HIS A 1 86 ? 0.798   -0.078  -12.117 1.00 15.00 ? 86 HIS A CG   7  
ATOM 9813  N ND1  . HIS A 1 86 ? -0.271  0.793   -12.105 1.00 15.00 ? 86 HIS A ND1  7  
ATOM 9814  C CD2  . HIS A 1 86 ? 0.398   -1.152  -12.839 1.00 15.00 ? 86 HIS A CD2  7  
ATOM 9815  C CE1  . HIS A 1 86 ? -1.272  0.268   -12.789 1.00 15.00 ? 86 HIS A CE1  7  
ATOM 9816  N NE2  . HIS A 1 86 ? -0.892  -0.911  -13.244 1.00 15.00 ? 86 HIS A NE2  7  
ATOM 9817  H H    . HIS A 1 86 ? 4.033   1.033   -9.826  1.00 15.00 ? 86 HIS A H    7  
ATOM 9818  H HA   . HIS A 1 86 ? 1.192   1.673   -10.153 1.00 15.00 ? 86 HIS A HA   7  
ATOM 9819  H HB2  . HIS A 1 86 ? 2.677   0.854   -12.077 1.00 15.00 ? 86 HIS A HB2  7  
ATOM 9820  H HB3  . HIS A 1 86 ? 2.620   -0.723  -11.297 1.00 15.00 ? 86 HIS A HB3  7  
ATOM 9821  H HD1  . HIS A 1 86 ? -0.293  1.667   -11.661 1.00 15.00 ? 86 HIS A HD1  7  
ATOM 9822  H HD2  . HIS A 1 86 ? 0.985   -2.033  -13.055 1.00 15.00 ? 86 HIS A HD2  7  
ATOM 9823  H HE1  . HIS A 1 86 ? -2.237  0.726   -12.949 1.00 15.00 ? 86 HIS A HE1  7  
ATOM 9824  H HE2  . HIS A 1 86 ? -1.471  -1.551  -13.708 1.00 15.00 ? 86 HIS A HE2  7  
ATOM 9825  N N    . LEU A 1 87 ? 0.846   0.374   -7.973  1.00 15.00 ? 87 LEU A N    7  
ATOM 9826  C CA   . LEU A 1 87 ? 0.361   -0.478  -6.897  1.00 15.00 ? 87 LEU A CA   7  
ATOM 9827  C C    . LEU A 1 87 ? -1.152  -0.661  -6.957  1.00 15.00 ? 87 LEU A C    7  
ATOM 9828  O O    . LEU A 1 87 ? -1.907  0.304   -6.870  1.00 15.00 ? 87 LEU A O    7  
ATOM 9829  C CB   . LEU A 1 87 ? 0.752   0.122   -5.546  1.00 15.00 ? 87 LEU A CB   7  
ATOM 9830  C CG   . LEU A 1 87 ? 1.703   -0.731  -4.715  1.00 15.00 ? 87 LEU A CG   7  
ATOM 9831  C CD1  . LEU A 1 87 ? 2.840   0.115   -4.161  1.00 15.00 ? 87 LEU A CD1  7  
ATOM 9832  C CD2  . LEU A 1 87 ? 0.948   -1.419  -3.589  1.00 15.00 ? 87 LEU A CD2  7  
ATOM 9833  H H    . LEU A 1 87 ? 0.726   1.342   -7.903  1.00 15.00 ? 87 LEU A H    7  
ATOM 9834  H HA   . LEU A 1 87 ? 0.833   -1.443  -6.999  1.00 15.00 ? 87 LEU A HA   7  
ATOM 9835  H HB2  . LEU A 1 87 ? 1.220   1.078   -5.722  1.00 15.00 ? 87 LEU A HB2  7  
ATOM 9836  H HB3  . LEU A 1 87 ? -0.146  0.282   -4.971  1.00 15.00 ? 87 LEU A HB3  7  
ATOM 9837  H HG   . LEU A 1 87 ? 2.130   -1.490  -5.349  1.00 15.00 ? 87 LEU A HG   7  
ATOM 9838  H HD11 . LEU A 1 87 ? 2.987   0.979   -4.793  1.00 15.00 ? 87 LEU A HD11 7  
ATOM 9839  H HD12 . LEU A 1 87 ? 2.593   0.439   -3.161  1.00 15.00 ? 87 LEU A HD12 7  
ATOM 9840  H HD13 . LEU A 1 87 ? 3.746   -0.471  -4.137  1.00 15.00 ? 87 LEU A HD13 7  
ATOM 9841  H HD21 . LEU A 1 87 ? 0.634   -0.681  -2.866  1.00 15.00 ? 87 LEU A HD21 7  
ATOM 9842  H HD22 . LEU A 1 87 ? 0.078   -1.921  -3.990  1.00 15.00 ? 87 LEU A HD22 7  
ATOM 9843  H HD23 . LEU A 1 87 ? 1.591   -2.141  -3.110  1.00 15.00 ? 87 LEU A HD23 7  
ATOM 9844  N N    . LEU A 1 88 ? -1.589  -1.910  -7.078  1.00 15.00 ? 88 LEU A N    7  
ATOM 9845  C CA   . LEU A 1 88 ? -3.013  -2.221  -7.117  1.00 15.00 ? 88 LEU A CA   7  
ATOM 9846  C C    . LEU A 1 88 ? -3.471  -2.678  -5.739  1.00 15.00 ? 88 LEU A C    7  
ATOM 9847  O O    . LEU A 1 88 ? -3.213  -3.810  -5.330  1.00 15.00 ? 88 LEU A O    7  
ATOM 9848  C CB   . LEU A 1 88 ? -3.295  -3.304  -8.162  1.00 15.00 ? 88 LEU A CB   7  
ATOM 9849  C CG   . LEU A 1 88 ? -3.456  -2.796  -9.597  1.00 15.00 ? 88 LEU A CG   7  
ATOM 9850  C CD1  . LEU A 1 88 ? -2.435  -1.708  -9.902  1.00 15.00 ? 88 LEU A CD1  7  
ATOM 9851  C CD2  . LEU A 1 88 ? -3.323  -3.946  -10.585 1.00 15.00 ? 88 LEU A CD2  7  
ATOM 9852  H H    . LEU A 1 88 ? -0.938  -2.642  -7.123  1.00 15.00 ? 88 LEU A H    7  
ATOM 9853  H HA   . LEU A 1 88 ? -3.546  -1.317  -7.387  1.00 15.00 ? 88 LEU A HA   7  
ATOM 9854  H HB2  . LEU A 1 88 ? -2.480  -4.012  -8.142  1.00 15.00 ? 88 LEU A HB2  7  
ATOM 9855  H HB3  . LEU A 1 88 ? -4.203  -3.817  -7.881  1.00 15.00 ? 88 LEU A HB3  7  
ATOM 9856  H HG   . LEU A 1 88 ? -4.442  -2.369  -9.712  1.00 15.00 ? 88 LEU A HG   7  
ATOM 9857  H HD11 . LEU A 1 88 ? -2.373  -1.029  -9.063  1.00 15.00 ? 88 LEU A HD11 7  
ATOM 9858  H HD12 . LEU A 1 88 ? -1.469  -2.159  -10.073 1.00 15.00 ? 88 LEU A HD12 7  
ATOM 9859  H HD13 . LEU A 1 88 ? -2.741  -1.164  -10.783 1.00 15.00 ? 88 LEU A HD13 7  
ATOM 9860  H HD21 . LEU A 1 88 ? -2.297  -4.019  -10.915 1.00 15.00 ? 88 LEU A HD21 7  
ATOM 9861  H HD22 . LEU A 1 88 ? -3.614  -4.868  -10.105 1.00 15.00 ? 88 LEU A HD22 7  
ATOM 9862  H HD23 . LEU A 1 88 ? -3.963  -3.765  -11.436 1.00 15.00 ? 88 LEU A HD23 7  
ATOM 9863  N N    . LEU A 1 89 ? -4.123  -1.778  -5.017  1.00 15.00 ? 89 LEU A N    7  
ATOM 9864  C CA   . LEU A 1 89 ? -4.586  -2.072  -3.666  1.00 15.00 ? 89 LEU A CA   7  
ATOM 9865  C C    . LEU A 1 89 ? -6.092  -2.288  -3.612  1.00 15.00 ? 89 LEU A C    7  
ATOM 9866  O O    . LEU A 1 89 ? -6.746  -2.514  -4.630  1.00 15.00 ? 89 LEU A O    7  
ATOM 9867  C CB   . LEU A 1 89 ? -4.212  -0.928  -2.719  1.00 15.00 ? 89 LEU A CB   7  
ATOM 9868  C CG   . LEU A 1 89 ? -3.246  0.098   -3.293  1.00 15.00 ? 89 LEU A CG   7  
ATOM 9869  C CD1  . LEU A 1 89 ? -3.130  1.292   -2.368  1.00 15.00 ? 89 LEU A CD1  7  
ATOM 9870  C CD2  . LEU A 1 89 ? -1.892  -0.538  -3.518  1.00 15.00 ? 89 LEU A CD2  7  
ATOM 9871  H H    . LEU A 1 89 ? -4.278  -0.887  -5.392  1.00 15.00 ? 89 LEU A H    7  
ATOM 9872  H HA   . LEU A 1 89 ? -4.087  -2.968  -3.336  1.00 15.00 ? 89 LEU A HA   7  
ATOM 9873  H HB2  . LEU A 1 89 ? -5.118  -0.415  -2.430  1.00 15.00 ? 89 LEU A HB2  7  
ATOM 9874  H HB3  . LEU A 1 89 ? -3.764  -1.355  -1.834  1.00 15.00 ? 89 LEU A HB3  7  
ATOM 9875  H HG   . LEU A 1 89 ? -3.617  0.444   -4.244  1.00 15.00 ? 89 LEU A HG   7  
ATOM 9876  H HD11 . LEU A 1 89 ? -3.946  1.280   -1.662  1.00 15.00 ? 89 LEU A HD11 7  
ATOM 9877  H HD12 . LEU A 1 89 ? -2.192  1.240   -1.837  1.00 15.00 ? 89 LEU A HD12 7  
ATOM 9878  H HD13 . LEU A 1 89 ? -3.169  2.200   -2.950  1.00 15.00 ? 89 LEU A HD13 7  
ATOM 9879  H HD21 . LEU A 1 89 ? -1.116  0.150   -3.218  1.00 15.00 ? 89 LEU A HD21 7  
ATOM 9880  H HD22 . LEU A 1 89 ? -1.822  -1.441  -2.932  1.00 15.00 ? 89 LEU A HD22 7  
ATOM 9881  H HD23 . LEU A 1 89 ? -1.778  -0.778  -4.564  1.00 15.00 ? 89 LEU A HD23 7  
ATOM 9882  N N    . GLU A 1 90 ? -6.623  -2.194  -2.400  1.00 15.00 ? 90 GLU A N    7  
ATOM 9883  C CA   . GLU A 1 90 ? -8.049  -2.352  -2.157  1.00 15.00 ? 90 GLU A CA   7  
ATOM 9884  C C    . GLU A 1 90 ? -8.508  -1.343  -1.107  1.00 15.00 ? 90 GLU A C    7  
ATOM 9885  O O    . GLU A 1 90 ? -7.808  -1.097  -0.125  1.00 15.00 ? 90 GLU A O    7  
ATOM 9886  C CB   . GLU A 1 90 ? -8.357  -3.787  -1.708  1.00 15.00 ? 90 GLU A CB   7  
ATOM 9887  C CG   . GLU A 1 90 ? -9.480  -3.897  -0.685  1.00 15.00 ? 90 GLU A CG   7  
ATOM 9888  C CD   . GLU A 1 90 ? -10.172 -5.246  -0.719  1.00 15.00 ? 90 GLU A CD   7  
ATOM 9889  O OE1  . GLU A 1 90 ? -9.618  -6.182  -1.335  1.00 15.00 ? 90 GLU A OE1  7  
ATOM 9890  O OE2  . GLU A 1 90 ? -11.266 -5.367  -0.131  1.00 15.00 ? 90 GLU A OE2  7  
ATOM 9891  H H    . GLU A 1 90 ? -6.031  -1.999  -1.642  1.00 15.00 ? 90 GLU A H    7  
ATOM 9892  H HA   . GLU A 1 90 ? -8.567  -2.152  -3.083  1.00 15.00 ? 90 GLU A HA   7  
ATOM 9893  H HB2  . GLU A 1 90 ? -8.637  -4.366  -2.574  1.00 15.00 ? 90 GLU A HB2  7  
ATOM 9894  H HB3  . GLU A 1 90 ? -7.464  -4.215  -1.277  1.00 15.00 ? 90 GLU A HB3  7  
ATOM 9895  H HG2  . GLU A 1 90 ? -9.066  -3.746  0.302   1.00 15.00 ? 90 GLU A HG2  7  
ATOM 9896  H HG3  . GLU A 1 90 ? -10.211 -3.129  -0.888  1.00 15.00 ? 90 GLU A HG3  7  
ATOM 9897  N N    . LYS A 1 91 ? -9.680  -0.757  -1.321  1.00 15.00 ? 91 LYS A N    7  
ATOM 9898  C CA   . LYS A 1 91 ? -10.219 0.229   -0.392  1.00 15.00 ? 91 LYS A CA   7  
ATOM 9899  C C    . LYS A 1 91 ? -10.228 -0.310  1.036   1.00 15.00 ? 91 LYS A C    7  
ATOM 9900  O O    . LYS A 1 91 ? -11.054 -1.152  1.389   1.00 15.00 ? 91 LYS A O    7  
ATOM 9901  C CB   . LYS A 1 91 ? -11.631 0.634   -0.810  1.00 15.00 ? 91 LYS A CB   7  
ATOM 9902  C CG   . LYS A 1 91 ? -12.098 1.934   -0.178  1.00 15.00 ? 91 LYS A CG   7  
ATOM 9903  C CD   . LYS A 1 91 ? -11.338 3.129   -0.734  1.00 15.00 ? 91 LYS A CD   7  
ATOM 9904  C CE   . LYS A 1 91 ? -10.800 4.015   0.379   1.00 15.00 ? 91 LYS A CE   7  
ATOM 9905  N NZ   . LYS A 1 91 ? -9.383  3.698   0.705   1.00 15.00 ? 91 LYS A NZ   7  
ATOM 9906  H H    . LYS A 1 91 ? -10.193 -0.989  -2.123  1.00 15.00 ? 91 LYS A H    7  
ATOM 9907  H HA   . LYS A 1 91 ? -9.580  1.099   -0.429  1.00 15.00 ? 91 LYS A HA   7  
ATOM 9908  H HB2  . LYS A 1 91 ? -11.655 0.749   -1.884  1.00 15.00 ? 91 LYS A HB2  7  
ATOM 9909  H HB3  . LYS A 1 91 ? -12.318 -0.149  -0.523  1.00 15.00 ? 91 LYS A HB3  7  
ATOM 9910  H HG2  . LYS A 1 91 ? -13.149 2.064   -0.380  1.00 15.00 ? 91 LYS A HG2  7  
ATOM 9911  H HG3  . LYS A 1 91 ? -11.938 1.882   0.890   1.00 15.00 ? 91 LYS A HG3  7  
ATOM 9912  H HD2  . LYS A 1 91 ? -10.510 2.773   -1.328  1.00 15.00 ? 91 LYS A HD2  7  
ATOM 9913  H HD3  . LYS A 1 91 ? -12.005 3.710   -1.354  1.00 15.00 ? 91 LYS A HD3  7  
ATOM 9914  H HE2  . LYS A 1 91 ? -10.866 5.046   0.064   1.00 15.00 ? 91 LYS A HE2  7  
ATOM 9915  H HE3  . LYS A 1 91 ? -11.406 3.870   1.261   1.00 15.00 ? 91 LYS A HE3  7  
ATOM 9916  H HZ1  . LYS A 1 91 ? -9.118  4.134   1.612   1.00 15.00 ? 91 LYS A HZ1  7  
ATOM 9917  H HZ2  . LYS A 1 91 ? -9.254  2.669   0.778   1.00 15.00 ? 91 LYS A HZ2  7  
ATOM 9918  H HZ3  . LYS A 1 91 ? -8.754  4.062   -0.039  1.00 15.00 ? 91 LYS A HZ3  7  
ATOM 9919  N N    . GLY A 1 92 ? -9.301  0.183   1.852   1.00 15.00 ? 92 GLY A N    7  
ATOM 9920  C CA   . GLY A 1 92 ? -9.214  -0.259  3.232   1.00 15.00 ? 92 GLY A CA   7  
ATOM 9921  C C    . GLY A 1 92 ? -10.384 0.218   4.070   1.00 15.00 ? 92 GLY A C    7  
ATOM 9922  O O    . GLY A 1 92 ? -10.716 1.404   4.067   1.00 15.00 ? 92 GLY A O    7  
ATOM 9923  H H    . GLY A 1 92 ? -8.669  0.851   1.513   1.00 15.00 ? 92 GLY A H    7  
ATOM 9924  H HA2  . GLY A 1 92 ? -9.188  -1.338  3.252   1.00 15.00 ? 92 GLY A HA2  7  
ATOM 9925  H HA3  . GLY A 1 92 ? -8.299  0.120   3.662   1.00 15.00 ? 92 GLY A HA3  7  
ATOM 9926  N N    . GLN A 1 93 ? -11.009 -0.707  4.790   1.00 15.00 ? 93 GLN A N    7  
ATOM 9927  C CA   . GLN A 1 93 ? -12.148 -0.376  5.639   1.00 15.00 ? 93 GLN A CA   7  
ATOM 9928  C C    . GLN A 1 93 ? -11.682 0.086   7.016   1.00 15.00 ? 93 GLN A C    7  
ATOM 9929  O O    . GLN A 1 93 ? -11.561 -0.715  7.942   1.00 15.00 ? 93 GLN A O    7  
ATOM 9930  C CB   . GLN A 1 93 ? -13.075 -1.585  5.779   1.00 15.00 ? 93 GLN A CB   7  
ATOM 9931  C CG   . GLN A 1 93 ? -13.761 -1.978  4.481   1.00 15.00 ? 93 GLN A CG   7  
ATOM 9932  C CD   . GLN A 1 93 ? -15.139 -2.569  4.706   1.00 15.00 ? 93 GLN A CD   7  
ATOM 9933  O OE1  . GLN A 1 93 ? -16.110 -2.171  4.063   1.00 15.00 ? 93 GLN A OE1  7  
ATOM 9934  N NE2  . GLN A 1 93 ? -15.230 -3.524  5.624   1.00 15.00 ? 93 GLN A NE2  7  
ATOM 9935  H H    . GLN A 1 93 ? -10.696 -1.635  4.751   1.00 15.00 ? 93 GLN A H    7  
ATOM 9936  H HA   . GLN A 1 93 ? -12.690 0.430   5.166   1.00 15.00 ? 93 GLN A HA   7  
ATOM 9937  H HB2  . GLN A 1 93 ? -12.497 -2.429  6.126   1.00 15.00 ? 93 GLN A HB2  7  
ATOM 9938  H HB3  . GLN A 1 93 ? -13.837 -1.357  6.509   1.00 15.00 ? 93 GLN A HB3  7  
ATOM 9939  H HG2  . GLN A 1 93 ? -13.860 -1.100  3.860   1.00 15.00 ? 93 GLN A HG2  7  
ATOM 9940  H HG3  . GLN A 1 93 ? -13.150 -2.710  3.973   1.00 15.00 ? 93 GLN A HG3  7  
ATOM 9941  H HE21 . GLN A 1 93 ? -14.415 -3.790  6.098   1.00 15.00 ? 93 GLN A HE21 7  
ATOM 9942  H HE22 . GLN A 1 93 ? -16.110 -3.924  5.790   1.00 15.00 ? 93 GLN A HE22 7  
ATOM 9943  N N    . SER A 1 94 ? -11.422 1.384   7.141   1.00 15.00 ? 94 SER A N    7  
ATOM 9944  C CA   . SER A 1 94 ? -10.968 1.954   8.405   1.00 15.00 ? 94 SER A CA   7  
ATOM 9945  C C    . SER A 1 94 ? -12.069 1.886   9.461   1.00 15.00 ? 94 SER A C    7  
ATOM 9946  O O    . SER A 1 94 ? -13.254 1.974   9.141   1.00 15.00 ? 94 SER A O    7  
ATOM 9947  C CB   . SER A 1 94 ? -10.528 3.405   8.204   1.00 15.00 ? 94 SER A CB   7  
ATOM 9948  O OG   . SER A 1 94 ? -9.655  3.821   9.240   1.00 15.00 ? 94 SER A OG   7  
ATOM 9949  H H    . SER A 1 94 ? -11.537 1.971   6.366   1.00 15.00 ? 94 SER A H    7  
ATOM 9950  H HA   . SER A 1 94 ? -10.123 1.375   8.745   1.00 15.00 ? 94 SER A HA   7  
ATOM 9951  H HB2  . SER A 1 94 ? -10.013 3.496   7.259   1.00 15.00 ? 94 SER A HB2  7  
ATOM 9952  H HB3  . SER A 1 94 ? -11.397 4.046   8.203   1.00 15.00 ? 94 SER A HB3  7  
ATOM 9953  H HG   . SER A 1 94 ? -8.820  4.107   8.860   1.00 15.00 ? 94 SER A HG   7  
ATOM 9954  N N    . PRO A 1 95 ? -11.688 1.728   10.740  1.00 15.00 ? 95 PRO A N    7  
ATOM 9955  C CA   . PRO A 1 95 ? -12.648 1.650   11.846  1.00 15.00 ? 95 PRO A CA   7  
ATOM 9956  C C    . PRO A 1 95 ? -13.629 2.816   11.844  1.00 15.00 ? 95 PRO A C    7  
ATOM 9957  O O    . PRO A 1 95 ? -14.806 2.652   12.168  1.00 15.00 ? 95 PRO A O    7  
ATOM 9958  C CB   . PRO A 1 95 ? -11.761 1.699   13.092  1.00 15.00 ? 95 PRO A CB   7  
ATOM 9959  C CG   . PRO A 1 95 ? -10.441 1.180   12.639  1.00 15.00 ? 95 PRO A CG   7  
ATOM 9960  C CD   . PRO A 1 95 ? -10.294 1.616   11.208  1.00 15.00 ? 95 PRO A CD   7  
ATOM 9961  H HA   . PRO A 1 95 ? -13.197 0.719   11.828  1.00 15.00 ? 95 PRO A HA   7  
ATOM 9962  H HB2  . PRO A 1 95 ? -11.687 2.718   13.444  1.00 15.00 ? 95 PRO A HB2  7  
ATOM 9963  H HB3  . PRO A 1 95 ? -12.185 1.076   13.865  1.00 15.00 ? 95 PRO A HB3  7  
ATOM 9964  H HG2  . PRO A 1 95 ? -9.652  1.604   13.243  1.00 15.00 ? 95 PRO A HG2  7  
ATOM 9965  H HG3  . PRO A 1 95 ? -10.427 0.102   12.706  1.00 15.00 ? 95 PRO A HG3  7  
ATOM 9966  H HD2  . PRO A 1 95 ? -9.791  2.570   11.154  1.00 15.00 ? 95 PRO A HD2  7  
ATOM 9967  H HD3  . PRO A 1 95 ? -9.756  0.872   10.640  1.00 15.00 ? 95 PRO A HD3  7  
ATOM 9968  N N    . THR A 1 96 ? -13.138 3.995   11.478  1.00 15.00 ? 96 THR A N    7  
ATOM 9969  C CA   . THR A 1 96 ? -13.972 5.191   11.434  1.00 15.00 ? 96 THR A CA   7  
ATOM 9970  C C    . THR A 1 96 ? -14.597 5.367   10.054  1.00 15.00 ? 96 THR A C    7  
ATOM 9971  O O    . THR A 1 96 ? -15.831 5.550   9.984   1.00 15.00 ? 96 THR A O    7  
ATOM 9972  C CB   . THR A 1 96 ? -13.146 6.427   11.793  1.00 15.00 ? 96 THR A CB   7  
ATOM 9973  O OG1  . THR A 1 96 ? -12.052 6.575   10.906  1.00 15.00 ? 96 THR A OG1  7  
ATOM 9974  C CG2  . THR A 1 96 ? -12.593 6.389   13.202  1.00 15.00 ? 96 THR A CG2  7  
ATOM 9975  O OXT  . THR A 1 96 ? -13.849 5.322   9.056   1.00 15.00 ? 96 THR A OXT  7  
ATOM 9976  H H    . THR A 1 96 ? -12.192 4.063   11.231  1.00 15.00 ? 96 THR A H    7  
ATOM 9977  H HA   . THR A 1 96 ? -14.760 5.072   12.161  1.00 15.00 ? 96 THR A HA   7  
ATOM 9978  H HB   . THR A 1 96 ? -13.773 7.303   11.708  1.00 15.00 ? 96 THR A HB   7  
ATOM 9979  H HG1  . THR A 1 96 ? -12.356 6.468   10.002  1.00 15.00 ? 96 THR A HG1  7  
ATOM 9980  H HG21 . THR A 1 96 ? -12.196 7.360   13.459  1.00 15.00 ? 96 THR A HG21 7  
ATOM 9981  H HG22 . THR A 1 96 ? -13.383 6.129   13.891  1.00 15.00 ? 96 THR A HG22 7  
ATOM 9982  H HG23 . THR A 1 96 ? -11.807 5.651   13.260  1.00 15.00 ? 96 THR A HG23 7  
ATOM 9983  N N    . PRO A 1 1  ? -22.529 2.183   3.808   1.00 15.00 ? 1  PRO A N    8  
ATOM 9984  C CA   . PRO A 1 1  ? -21.534 2.588   2.779   1.00 15.00 ? 1  PRO A CA   8  
ATOM 9985  C C    . PRO A 1 1  ? -20.242 1.781   2.892   1.00 15.00 ? 1  PRO A C    8  
ATOM 9986  O O    . PRO A 1 1  ? -19.479 1.940   3.845   1.00 15.00 ? 1  PRO A O    8  
ATOM 9987  C CB   . PRO A 1 1  ? -21.253 4.076   2.970   1.00 15.00 ? 1  PRO A CB   8  
ATOM 9988  C CG   . PRO A 1 1  ? -21.985 4.433   4.220   1.00 15.00 ? 1  PRO A CG   8  
ATOM 9989  C CD   . PRO A 1 1  ? -23.097 3.422   4.365   1.00 15.00 ? 1  PRO A CD   8  
ATOM 9990  H H2   . PRO A 1 1  ? -21.975 1.572   4.432   1.00 15.00 ? 1  PRO A H2   8  
ATOM 9991  H H3   . PRO A 1 1  ? -23.135 1.525   3.265   1.00 15.00 ? 1  PRO A H3   8  
ATOM 9992  H HA   . PRO A 1 1  ? -21.965 2.430   1.802   1.00 15.00 ? 1  PRO A HA   8  
ATOM 9993  H HB2  . PRO A 1 1  ? -20.189 4.236   3.072   1.00 15.00 ? 1  PRO A HB2  8  
ATOM 9994  H HB3  . PRO A 1 1  ? -21.628 4.629   2.122   1.00 15.00 ? 1  PRO A HB3  8  
ATOM 9995  H HG2  . PRO A 1 1  ? -21.315 4.377   5.065   1.00 15.00 ? 1  PRO A HG2  8  
ATOM 9996  H HG3  . PRO A 1 1  ? -22.395 5.429   4.132   1.00 15.00 ? 1  PRO A HG3  8  
ATOM 9997  H HD2  . PRO A 1 1  ? -23.352 3.292   5.407   1.00 15.00 ? 1  PRO A HD2  8  
ATOM 9998  H HD3  . PRO A 1 1  ? -23.963 3.732   3.800   1.00 15.00 ? 1  PRO A HD3  8  
ATOM 9999  N N    . LYS A 1 2  ? -20.005 0.915   1.911   1.00 15.00 ? 2  LYS A N    8  
ATOM 10000 C CA   . LYS A 1 2  ? -18.811 0.083   1.896   1.00 15.00 ? 2  LYS A CA   8  
ATOM 10001 C C    . LYS A 1 2  ? -18.323 -0.124  0.461   1.00 15.00 ? 2  LYS A C    8  
ATOM 10002 O O    . LYS A 1 2  ? -19.038 -0.686  -0.368  1.00 15.00 ? 2  LYS A O    8  
ATOM 10003 C CB   . LYS A 1 2  ? -19.108 -1.267  2.551   1.00 15.00 ? 2  LYS A CB   8  
ATOM 10004 C CG   . LYS A 1 2  ? -17.956 -2.253  2.465   1.00 15.00 ? 2  LYS A CG   8  
ATOM 10005 C CD   . LYS A 1 2  ? -17.254 -2.412  3.804   1.00 15.00 ? 2  LYS A CD   8  
ATOM 10006 C CE   . LYS A 1 2  ? -17.830 -3.572  4.601   1.00 15.00 ? 2  LYS A CE   8  
ATOM 10007 N NZ   . LYS A 1 2  ? -17.392 -3.541  6.024   1.00 15.00 ? 2  LYS A NZ   8  
ATOM 10008 H H    . LYS A 1 2  ? -20.649 0.832   1.181   1.00 15.00 ? 2  LYS A H    8  
ATOM 10009 H HA   . LYS A 1 2  ? -18.045 0.590   2.462   1.00 15.00 ? 2  LYS A HA   8  
ATOM 10010 H HB2  . LYS A 1 2  ? -19.337 -1.104  3.594   1.00 15.00 ? 2  LYS A HB2  8  
ATOM 10011 H HB3  . LYS A 1 2  ? -19.967 -1.707  2.068   1.00 15.00 ? 2  LYS A HB3  8  
ATOM 10012 H HG2  . LYS A 1 2  ? -18.341 -3.212  2.154   1.00 15.00 ? 2  LYS A HG2  8  
ATOM 10013 H HG3  . LYS A 1 2  ? -17.245 -1.895  1.736   1.00 15.00 ? 2  LYS A HG3  8  
ATOM 10014 H HD2  . LYS A 1 2  ? -16.204 -2.594  3.630   1.00 15.00 ? 2  LYS A HD2  8  
ATOM 10015 H HD3  . LYS A 1 2  ? -17.374 -1.502  4.373   1.00 15.00 ? 2  LYS A HD3  8  
ATOM 10016 H HE2  . LYS A 1 2  ? -18.907 -3.518  4.564   1.00 15.00 ? 2  LYS A HE2  8  
ATOM 10017 H HE3  . LYS A 1 2  ? -17.501 -4.498  4.152   1.00 15.00 ? 2  LYS A HE3  8  
ATOM 10018 H HZ1  . LYS A 1 2  ? -17.190 -4.505  6.357   1.00 15.00 ? 2  LYS A HZ1  8  
ATOM 10019 H HZ2  . LYS A 1 2  ? -16.531 -2.965  6.121   1.00 15.00 ? 2  LYS A HZ2  8  
ATOM 10020 H HZ3  . LYS A 1 2  ? -18.139 -3.129  6.619   1.00 15.00 ? 2  LYS A HZ3  8  
ATOM 10021 N N    . PRO A 1 3  ? -17.096 0.332   0.145   1.00 15.00 ? 3  PRO A N    8  
ATOM 10022 C CA   . PRO A 1 3  ? -16.528 0.193   -1.200  1.00 15.00 ? 3  PRO A CA   8  
ATOM 10023 C C    . PRO A 1 3  ? -16.322 -1.270  -1.600  1.00 15.00 ? 3  PRO A C    8  
ATOM 10024 O O    . PRO A 1 3  ? -17.188 -1.870  -2.237  1.00 15.00 ? 3  PRO A O    8  
ATOM 10025 C CB   . PRO A 1 3  ? -15.188 0.934   -1.109  1.00 15.00 ? 3  PRO A CB   8  
ATOM 10026 C CG   . PRO A 1 3  ? -14.858 0.959   0.344   1.00 15.00 ? 3  PRO A CG   8  
ATOM 10027 C CD   . PRO A 1 3  ? -16.173 1.019   1.066   1.00 15.00 ? 3  PRO A CD   8  
ATOM 10028 H HA   . PRO A 1 3  ? -17.155 0.674   -1.937  1.00 15.00 ? 3  PRO A HA   8  
ATOM 10029 H HB2  . PRO A 1 3  ? -14.440 0.400   -1.675  1.00 15.00 ? 3  PRO A HB2  8  
ATOM 10030 H HB3  . PRO A 1 3  ? -15.300 1.933   -1.503  1.00 15.00 ? 3  PRO A HB3  8  
ATOM 10031 H HG2  . PRO A 1 3  ? -14.322 0.061   0.615   1.00 15.00 ? 3  PRO A HG2  8  
ATOM 10032 H HG3  . PRO A 1 3  ? -14.265 1.833   0.571   1.00 15.00 ? 3  PRO A HG3  8  
ATOM 10033 H HD2  . PRO A 1 3  ? -16.110 0.499   2.010   1.00 15.00 ? 3  PRO A HD2  8  
ATOM 10034 H HD3  . PRO A 1 3  ? -16.474 2.045   1.218   1.00 15.00 ? 3  PRO A HD3  8  
ATOM 10035 N N    . GLY A 1 4  ? -15.177 -1.841  -1.230  1.00 15.00 ? 4  GLY A N    8  
ATOM 10036 C CA   . GLY A 1 4  ? -14.897 -3.225  -1.570  1.00 15.00 ? 4  GLY A CA   8  
ATOM 10037 C C    . GLY A 1 4  ? -14.124 -3.359  -2.868  1.00 15.00 ? 4  GLY A C    8  
ATOM 10038 O O    . GLY A 1 4  ? -13.347 -4.298  -3.042  1.00 15.00 ? 4  GLY A O    8  
ATOM 10039 H H    . GLY A 1 4  ? -14.518 -1.322  -0.725  1.00 15.00 ? 4  GLY A H    8  
ATOM 10040 H HA2  . GLY A 1 4  ? -14.320 -3.670  -0.772  1.00 15.00 ? 4  GLY A HA2  8  
ATOM 10041 H HA3  . GLY A 1 4  ? -15.832 -3.757  -1.663  1.00 15.00 ? 4  GLY A HA3  8  
ATOM 10042 N N    . ASP A 1 5  ? -14.337 -2.417  -3.782  1.00 15.00 ? 5  ASP A N    8  
ATOM 10043 C CA   . ASP A 1 5  ? -13.656 -2.431  -5.072  1.00 15.00 ? 5  ASP A CA   8  
ATOM 10044 C C    . ASP A 1 5  ? -12.153 -2.309  -4.900  1.00 15.00 ? 5  ASP A C    8  
ATOM 10045 O O    . ASP A 1 5  ? -11.656 -1.954  -3.831  1.00 15.00 ? 5  ASP A O    8  
ATOM 10046 C CB   . ASP A 1 5  ? -14.175 -1.299  -5.960  1.00 15.00 ? 5  ASP A CB   8  
ATOM 10047 C CG   . ASP A 1 5  ? -14.323 -1.724  -7.408  1.00 15.00 ? 5  ASP A CG   8  
ATOM 10048 O OD1  . ASP A 1 5  ? -15.397 -2.252  -7.764  1.00 15.00 ? 5  ASP A OD1  8  
ATOM 10049 O OD2  . ASP A 1 5  ? -13.365 -1.529  -8.185  1.00 15.00 ? 5  ASP A OD2  8  
ATOM 10050 H H    . ASP A 1 5  ? -14.968 -1.695  -3.584  1.00 15.00 ? 5  ASP A H    8  
ATOM 10051 H HA   . ASP A 1 5  ? -13.862 -3.377  -5.554  1.00 15.00 ? 5  ASP A HA   8  
ATOM 10052 H HB2  . ASP A 1 5  ? -15.140 -0.978  -5.598  1.00 15.00 ? 5  ASP A HB2  8  
ATOM 10053 H HB3  . ASP A 1 5  ? -13.484 -0.470  -5.916  1.00 15.00 ? 5  ASP A HB3  8  
ATOM 10054 N N    . ILE A 1 6  ? -11.440 -2.624  -5.967  1.00 15.00 ? 6  ILE A N    8  
ATOM 10055 C CA   . ILE A 1 6  ? -9.991  -2.578  -5.972  1.00 15.00 ? 6  ILE A CA   8  
ATOM 10056 C C    . ILE A 1 6  ? -9.486  -1.351  -6.728  1.00 15.00 ? 6  ILE A C    8  
ATOM 10057 O O    . ILE A 1 6  ? -10.090 -0.927  -7.713  1.00 15.00 ? 6  ILE A O    8  
ATOM 10058 C CB   . ILE A 1 6  ? -9.428  -3.858  -6.625  1.00 15.00 ? 6  ILE A CB   8  
ATOM 10059 C CG1  . ILE A 1 6  ? -9.035  -4.874  -5.554  1.00 15.00 ? 6  ILE A CG1  8  
ATOM 10060 C CG2  . ILE A 1 6  ? -8.236  -3.545  -7.525  1.00 15.00 ? 6  ILE A CG2  8  
ATOM 10061 C CD1  . ILE A 1 6  ? -10.171 -5.242  -4.624  1.00 15.00 ? 6  ILE A CD1  8  
ATOM 10062 H H    . ILE A 1 6  ? -11.907 -2.908  -6.781  1.00 15.00 ? 6  ILE A H    8  
ATOM 10063 H HA   . ILE A 1 6  ? -9.646  -2.536  -4.948  1.00 15.00 ? 6  ILE A HA   8  
ATOM 10064 H HB   . ILE A 1 6  ? -10.215 -4.281  -7.235  1.00 15.00 ? 6  ILE A HB   8  
ATOM 10065 H HG12 . ILE A 1 6  ? -8.695  -5.779  -6.034  1.00 15.00 ? 6  ILE A HG12 8  
ATOM 10066 H HG13 . ILE A 1 6  ? -8.234  -4.466  -4.958  1.00 15.00 ? 6  ILE A HG13 8  
ATOM 10067 H HG21 . ILE A 1 6  ? -7.501  -2.980  -6.967  1.00 15.00 ? 6  ILE A HG21 8  
ATOM 10068 H HG22 . ILE A 1 6  ? -7.794  -4.466  -7.873  1.00 15.00 ? 6  ILE A HG22 8  
ATOM 10069 H HG23 . ILE A 1 6  ? -8.567  -2.961  -8.373  1.00 15.00 ? 6  ILE A HG23 8  
ATOM 10070 H HD11 . ILE A 1 6  ? -10.259 -4.493  -3.850  1.00 15.00 ? 6  ILE A HD11 8  
ATOM 10071 H HD12 . ILE A 1 6  ? -11.094 -5.291  -5.183  1.00 15.00 ? 6  ILE A HD12 8  
ATOM 10072 H HD13 . ILE A 1 6  ? -9.971  -6.203  -4.174  1.00 15.00 ? 6  ILE A HD13 8  
ATOM 10073 N N    . PHE A 1 7  ? -8.368  -0.801  -6.275  1.00 15.00 ? 7  PHE A N    8  
ATOM 10074 C CA   . PHE A 1 7  ? -7.777  0.359   -6.927  1.00 15.00 ? 7  PHE A CA   8  
ATOM 10075 C C    . PHE A 1 7  ? -6.256  0.244   -6.949  1.00 15.00 ? 7  PHE A C    8  
ATOM 10076 O O    . PHE A 1 7  ? -5.679  -0.583  -6.246  1.00 15.00 ? 7  PHE A O    8  
ATOM 10077 C CB   . PHE A 1 7  ? -8.216  1.655   -6.234  1.00 15.00 ? 7  PHE A CB   8  
ATOM 10078 C CG   . PHE A 1 7  ? -7.442  1.982   -4.987  1.00 15.00 ? 7  PHE A CG   8  
ATOM 10079 C CD1  . PHE A 1 7  ? -6.167  2.518   -5.069  1.00 15.00 ? 7  PHE A CD1  8  
ATOM 10080 C CD2  . PHE A 1 7  ? -7.992  1.757   -3.735  1.00 15.00 ? 7  PHE A CD2  8  
ATOM 10081 C CE1  . PHE A 1 7  ? -5.455  2.825   -3.926  1.00 15.00 ? 7  PHE A CE1  8  
ATOM 10082 C CE2  . PHE A 1 7  ? -7.283  2.061   -2.589  1.00 15.00 ? 7  PHE A CE2  8  
ATOM 10083 C CZ   . PHE A 1 7  ? -6.013  2.596   -2.685  1.00 15.00 ? 7  PHE A CZ   8  
ATOM 10084 H H    . PHE A 1 7  ? -7.923  -1.191  -5.493  1.00 15.00 ? 7  PHE A H    8  
ATOM 10085 H HA   . PHE A 1 7  ? -8.133  0.369   -7.946  1.00 15.00 ? 7  PHE A HA   8  
ATOM 10086 H HB2  . PHE A 1 7  ? -8.095  2.478   -6.921  1.00 15.00 ? 7  PHE A HB2  8  
ATOM 10087 H HB3  . PHE A 1 7  ? -9.259  1.571   -5.964  1.00 15.00 ? 7  PHE A HB3  8  
ATOM 10088 H HD1  . PHE A 1 7  ? -5.728  2.697   -6.039  1.00 15.00 ? 7  PHE A HD1  8  
ATOM 10089 H HD2  . PHE A 1 7  ? -8.984  1.339   -3.659  1.00 15.00 ? 7  PHE A HD2  8  
ATOM 10090 H HE1  . PHE A 1 7  ? -4.462  3.243   -4.004  1.00 15.00 ? 7  PHE A HE1  8  
ATOM 10091 H HE2  . PHE A 1 7  ? -7.722  1.881   -1.618  1.00 15.00 ? 7  PHE A HE2  8  
ATOM 10092 H HZ   . PHE A 1 7  ? -5.459  2.836   -1.792  1.00 15.00 ? 7  PHE A HZ   8  
ATOM 10093 N N    . GLU A 1 8  ? -5.613  1.068   -7.769  1.00 15.00 ? 8  GLU A N    8  
ATOM 10094 C CA   . GLU A 1 8  ? -4.160  1.044   -7.889  1.00 15.00 ? 8  GLU A CA   8  
ATOM 10095 C C    . GLU A 1 8  ? -3.564  2.441   -7.755  1.00 15.00 ? 8  GLU A C    8  
ATOM 10096 O O    . GLU A 1 8  ? -4.138  3.427   -8.217  1.00 15.00 ? 8  GLU A O    8  
ATOM 10097 C CB   . GLU A 1 8  ? -3.758  0.450   -9.235  1.00 15.00 ? 8  GLU A CB   8  
ATOM 10098 C CG   . GLU A 1 8  ? -4.475  1.085   -10.408 1.00 15.00 ? 8  GLU A CG   8  
ATOM 10099 C CD   . GLU A 1 8  ? -4.385  0.251   -11.671 1.00 15.00 ? 8  GLU A CD   8  
ATOM 10100 O OE1  . GLU A 1 8  ? -4.428  -0.992  -11.566 1.00 15.00 ? 8  GLU A OE1  8  
ATOM 10101 O OE2  . GLU A 1 8  ? -4.272  0.842   -12.766 1.00 15.00 ? 8  GLU A OE2  8  
ATOM 10102 H H    . GLU A 1 8  ? -6.128  1.700   -8.313  1.00 15.00 ? 8  GLU A H    8  
ATOM 10103 H HA   . GLU A 1 8  ? -3.764  0.418   -7.099  1.00 15.00 ? 8  GLU A HA   8  
ATOM 10104 H HB2  . GLU A 1 8  ? -2.696  0.587   -9.373  1.00 15.00 ? 8  GLU A HB2  8  
ATOM 10105 H HB3  . GLU A 1 8  ? -3.981  -0.607  -9.232  1.00 15.00 ? 8  GLU A HB3  8  
ATOM 10106 H HG2  . GLU A 1 8  ? -5.514  1.209   -10.149 1.00 15.00 ? 8  GLU A HG2  8  
ATOM 10107 H HG3  . GLU A 1 8  ? -4.033  2.051   -10.597 1.00 15.00 ? 8  GLU A HG3  8  
ATOM 10108 N N    . VAL A 1 9  ? -2.396  2.501   -7.134  1.00 15.00 ? 9  VAL A N    8  
ATOM 10109 C CA   . VAL A 1 9  ? -1.678  3.755   -6.941  1.00 15.00 ? 9  VAL A CA   8  
ATOM 10110 C C    . VAL A 1 9  ? -0.559  3.864   -7.967  1.00 15.00 ? 9  VAL A C    8  
ATOM 10111 O O    . VAL A 1 9  ? 0.383   3.074   -7.958  1.00 15.00 ? 9  VAL A O    8  
ATOM 10112 C CB   . VAL A 1 9  ? -1.110  3.885   -5.497  1.00 15.00 ? 9  VAL A CB   8  
ATOM 10113 C CG1  . VAL A 1 9  ? -1.333  2.604   -4.706  1.00 15.00 ? 9  VAL A CG1  8  
ATOM 10114 C CG2  . VAL A 1 9  ? 0.372   4.248   -5.499  1.00 15.00 ? 9  VAL A CG2  8  
ATOM 10115 H H    . VAL A 1 9  ? -1.993  1.670   -6.811  1.00 15.00 ? 9  VAL A H    8  
ATOM 10116 H HA   . VAL A 1 9  ? -2.376  4.564   -7.110  1.00 15.00 ? 9  VAL A HA   8  
ATOM 10117 H HB   . VAL A 1 9  ? -1.647  4.679   -4.998  1.00 15.00 ? 9  VAL A HB   8  
ATOM 10118 H HG11 . VAL A 1 9  ? -2.323  2.221   -4.909  1.00 15.00 ? 9  VAL A HG11 8  
ATOM 10119 H HG12 . VAL A 1 9  ? -0.597  1.871   -5.000  1.00 15.00 ? 9  VAL A HG12 8  
ATOM 10120 H HG13 . VAL A 1 9  ? -1.234  2.812   -3.651  1.00 15.00 ? 9  VAL A HG13 8  
ATOM 10121 H HG21 . VAL A 1 9  ? 0.951   3.395   -5.820  1.00 15.00 ? 9  VAL A HG21 8  
ATOM 10122 H HG22 . VAL A 1 9  ? 0.542   5.073   -6.173  1.00 15.00 ? 9  VAL A HG22 8  
ATOM 10123 H HG23 . VAL A 1 9  ? 0.673   4.532   -4.501  1.00 15.00 ? 9  VAL A HG23 8  
ATOM 10124 N N    . GLU A 1 10 ? -0.681  4.831   -8.863  1.00 15.00 ? 10 GLU A N    8  
ATOM 10125 C CA   . GLU A 1 10 ? 0.311   5.022   -9.907  1.00 15.00 ? 10 GLU A CA   8  
ATOM 10126 C C    . GLU A 1 10 ? 1.189   6.240   -9.642  1.00 15.00 ? 10 GLU A C    8  
ATOM 10127 O O    . GLU A 1 10 ? 1.094   7.252   -10.337 1.00 15.00 ? 10 GLU A O    8  
ATOM 10128 C CB   . GLU A 1 10 ? -0.386  5.153   -11.255 1.00 15.00 ? 10 GLU A CB   8  
ATOM 10129 C CG   . GLU A 1 10 ? 0.568   5.316   -12.427 1.00 15.00 ? 10 GLU A CG   8  
ATOM 10130 C CD   . GLU A 1 10 ? -0.115  5.872   -13.661 1.00 15.00 ? 10 GLU A CD   8  
ATOM 10131 O OE1  . GLU A 1 10 ? -0.201  7.111   -13.784 1.00 15.00 ? 10 GLU A OE1  8  
ATOM 10132 O OE2  . GLU A 1 10 ? -0.564  5.067   -14.504 1.00 15.00 ? 10 GLU A OE2  8  
ATOM 10133 H H    . GLU A 1 10 ? -1.463  5.420   -8.830  1.00 15.00 ? 10 GLU A H    8  
ATOM 10134 H HA   . GLU A 1 10 ? 0.939   4.144   -9.927  1.00 15.00 ? 10 GLU A HA   8  
ATOM 10135 H HB2  . GLU A 1 10 ? -0.977  4.264   -11.418 1.00 15.00 ? 10 GLU A HB2  8  
ATOM 10136 H HB3  . GLU A 1 10 ? -1.040  6.010   -11.224 1.00 15.00 ? 10 GLU A HB3  8  
ATOM 10137 H HG2  . GLU A 1 10 ? 1.361   5.989   -12.139 1.00 15.00 ? 10 GLU A HG2  8  
ATOM 10138 H HG3  . GLU A 1 10 ? 0.988   4.350   -12.669 1.00 15.00 ? 10 GLU A HG3  8  
ATOM 10139 N N    . LEU A 1 11 ? 2.056   6.128   -8.644  1.00 15.00 ? 11 LEU A N    8  
ATOM 10140 C CA   . LEU A 1 11 ? 2.969   7.211   -8.301  1.00 15.00 ? 11 LEU A CA   8  
ATOM 10141 C C    . LEU A 1 11 ? 4.251   7.087   -9.116  1.00 15.00 ? 11 LEU A C    8  
ATOM 10142 O O    . LEU A 1 11 ? 4.514   6.044   -9.708  1.00 15.00 ? 11 LEU A O    8  
ATOM 10143 C CB   . LEU A 1 11 ? 3.296   7.189   -6.806  1.00 15.00 ? 11 LEU A CB   8  
ATOM 10144 C CG   . LEU A 1 11 ? 3.464   8.565   -6.154  1.00 15.00 ? 11 LEU A CG   8  
ATOM 10145 C CD1  . LEU A 1 11 ? 2.231   9.429   -6.381  1.00 15.00 ? 11 LEU A CD1  8  
ATOM 10146 C CD2  . LEU A 1 11 ? 3.746   8.416   -4.666  1.00 15.00 ? 11 LEU A CD2  8  
ATOM 10147 H H    . LEU A 1 11 ? 2.090   5.293   -8.136  1.00 15.00 ? 11 LEU A H    8  
ATOM 10148 H HA   . LEU A 1 11 ? 2.486   8.140   -8.544  1.00 15.00 ? 11 LEU A HA   8  
ATOM 10149 H HB2  . LEU A 1 11 ? 2.505   6.663   -6.296  1.00 15.00 ? 11 LEU A HB2  8  
ATOM 10150 H HB3  . LEU A 1 11 ? 4.214   6.639   -6.668  1.00 15.00 ? 11 LEU A HB3  8  
ATOM 10151 H HG   . LEU A 1 11 ? 4.308   9.067   -6.604  1.00 15.00 ? 11 LEU A HG   8  
ATOM 10152 H HD11 . LEU A 1 11 ? 1.543   8.912   -7.031  1.00 15.00 ? 11 LEU A HD11 8  
ATOM 10153 H HD12 . LEU A 1 11 ? 1.751   9.631   -5.435  1.00 15.00 ? 11 LEU A HD12 8  
ATOM 10154 H HD13 . LEU A 1 11 ? 2.526   10.362  -6.840  1.00 15.00 ? 11 LEU A HD13 8  
ATOM 10155 H HD21 . LEU A 1 11 ? 3.333   9.261   -4.135  1.00 15.00 ? 11 LEU A HD21 8  
ATOM 10156 H HD22 . LEU A 1 11 ? 3.291   7.506   -4.303  1.00 15.00 ? 11 LEU A HD22 8  
ATOM 10157 H HD23 . LEU A 1 11 ? 4.812   8.374   -4.504  1.00 15.00 ? 11 LEU A HD23 8  
ATOM 10158 N N    . ALA A 1 12 ? 5.045   8.149   -9.148  1.00 15.00 ? 12 ALA A N    8  
ATOM 10159 C CA   . ALA A 1 12 ? 6.294   8.133   -9.901  1.00 15.00 ? 12 ALA A CA   8  
ATOM 10160 C C    . ALA A 1 12 ? 7.470   7.774   -9.002  1.00 15.00 ? 12 ALA A C    8  
ATOM 10161 O O    . ALA A 1 12 ? 8.068   8.641   -8.364  1.00 15.00 ? 12 ALA A O    8  
ATOM 10162 C CB   . ALA A 1 12 ? 6.530   9.475   -10.573 1.00 15.00 ? 12 ALA A CB   8  
ATOM 10163 H H    . ALA A 1 12 ? 4.787   8.958   -8.659  1.00 15.00 ? 12 ALA A H    8  
ATOM 10164 H HA   . ALA A 1 12 ? 6.205   7.382   -10.675 1.00 15.00 ? 12 ALA A HA   8  
ATOM 10165 H HB1  . ALA A 1 12 ? 7.091   9.323   -11.484 1.00 15.00 ? 12 ALA A HB1  8  
ATOM 10166 H HB2  . ALA A 1 12 ? 5.581   9.933   -10.806 1.00 15.00 ? 12 ALA A HB2  8  
ATOM 10167 H HB3  . ALA A 1 12 ? 7.088   10.117  -9.909  1.00 15.00 ? 12 ALA A HB3  8  
ATOM 10168 N N    . LYS A 1 13 ? 7.797   6.487   -8.960  1.00 15.00 ? 13 LYS A N    8  
ATOM 10169 C CA   . LYS A 1 13 ? 8.902   6.000   -8.144  1.00 15.00 ? 13 LYS A CA   8  
ATOM 10170 C C    . LYS A 1 13 ? 10.193  6.747   -8.468  1.00 15.00 ? 13 LYS A C    8  
ATOM 10171 O O    . LYS A 1 13 ? 11.052  6.930   -7.606  1.00 15.00 ? 13 LYS A O    8  
ATOM 10172 C CB   . LYS A 1 13 ? 9.090   4.497   -8.366  1.00 15.00 ? 13 LYS A CB   8  
ATOM 10173 C CG   . LYS A 1 13 ? 9.569   3.752   -7.132  1.00 15.00 ? 13 LYS A CG   8  
ATOM 10174 C CD   . LYS A 1 13 ? 10.937  4.233   -6.679  1.00 15.00 ? 13 LYS A CD   8  
ATOM 10175 C CE   . LYS A 1 13 ? 10.843  5.047   -5.398  1.00 15.00 ? 13 LYS A CE   8  
ATOM 10176 N NZ   . LYS A 1 13 ? 12.095  4.969   -4.594  1.00 15.00 ? 13 LYS A NZ   8  
ATOM 10177 H H    . LYS A 1 13 ? 7.281   5.848   -9.493  1.00 15.00 ? 13 LYS A H    8  
ATOM 10178 H HA   . LYS A 1 13 ? 8.650   6.172   -7.108  1.00 15.00 ? 13 LYS A HA   8  
ATOM 10179 H HB2  . LYS A 1 13 ? 8.144   4.072   -8.669  1.00 15.00 ? 13 LYS A HB2  8  
ATOM 10180 H HB3  . LYS A 1 13 ? 9.810   4.344   -9.157  1.00 15.00 ? 13 LYS A HB3  8  
ATOM 10181 H HG2  . LYS A 1 13 ? 8.861   3.907   -6.332  1.00 15.00 ? 13 LYS A HG2  8  
ATOM 10182 H HG3  . LYS A 1 13 ? 9.628   2.703   -7.363  1.00 15.00 ? 13 LYS A HG3  8  
ATOM 10183 H HD2  . LYS A 1 13 ? 11.567  3.374   -6.502  1.00 15.00 ? 13 LYS A HD2  8  
ATOM 10184 H HD3  . LYS A 1 13 ? 11.369  4.844   -7.457  1.00 15.00 ? 13 LYS A HD3  8  
ATOM 10185 H HE2  . LYS A 1 13 ? 10.654  6.078   -5.654  1.00 15.00 ? 13 LYS A HE2  8  
ATOM 10186 H HE3  . LYS A 1 13 ? 10.022  4.668   -4.807  1.00 15.00 ? 13 LYS A HE3  8  
ATOM 10187 H HZ1  . LYS A 1 13 ? 11.874  4.704   -3.613  1.00 15.00 ? 13 LYS A HZ1  8  
ATOM 10188 H HZ2  . LYS A 1 13 ? 12.737  4.258   -4.998  1.00 15.00 ? 13 LYS A HZ2  8  
ATOM 10189 H HZ3  . LYS A 1 13 ? 12.576  5.891   -4.592  1.00 15.00 ? 13 LYS A HZ3  8  
ATOM 10190 N N    . ASN A 1 14 ? 10.322  7.181   -9.715  1.00 15.00 ? 14 ASN A N    8  
ATOM 10191 C CA   . ASN A 1 14 ? 11.508  7.908   -10.148 1.00 15.00 ? 14 ASN A CA   8  
ATOM 10192 C C    . ASN A 1 14 ? 11.382  9.392   -9.824  1.00 15.00 ? 14 ASN A C    8  
ATOM 10193 O O    . ASN A 1 14 ? 10.320  9.988   -10.009 1.00 15.00 ? 14 ASN A O    8  
ATOM 10194 C CB   . ASN A 1 14 ? 11.728  7.717   -11.649 1.00 15.00 ? 14 ASN A CB   8  
ATOM 10195 C CG   . ASN A 1 14 ? 13.119  8.133   -12.088 1.00 15.00 ? 14 ASN A CG   8  
ATOM 10196 O OD1  . ASN A 1 14 ? 14.119  7.608   -11.600 1.00 15.00 ? 14 ASN A OD1  8  
ATOM 10197 N ND2  . ASN A 1 14 ? 13.188  9.083   -13.014 1.00 15.00 ? 14 ASN A ND2  8  
ATOM 10198 H H    . ASN A 1 14 ? 9.605   7.008   -10.358 1.00 15.00 ? 14 ASN A H    8  
ATOM 10199 H HA   . ASN A 1 14 ? 12.357  7.506   -9.614  1.00 15.00 ? 14 ASN A HA   8  
ATOM 10200 H HB2  . ASN A 1 14 ? 11.589  6.676   -11.898 1.00 15.00 ? 14 ASN A HB2  8  
ATOM 10201 H HB3  . ASN A 1 14 ? 11.006  8.312   -12.190 1.00 15.00 ? 14 ASN A HB3  8  
ATOM 10202 H HD21 . ASN A 1 14 ? 12.349  9.456   -13.357 1.00 15.00 ? 14 ASN A HD21 8  
ATOM 10203 H HD22 . ASN A 1 14 ? 14.074  9.371   -13.316 1.00 15.00 ? 14 ASN A HD22 8  
ATOM 10204 N N    . ASP A 1 15 ? 12.476  9.976   -9.331  1.00 15.00 ? 15 ASP A N    8  
ATOM 10205 C CA   . ASP A 1 15 ? 12.519  11.395  -8.964  1.00 15.00 ? 15 ASP A CA   8  
ATOM 10206 C C    . ASP A 1 15 ? 12.103  11.605  -7.508  1.00 15.00 ? 15 ASP A C    8  
ATOM 10207 O O    . ASP A 1 15 ? 12.481  12.598  -6.887  1.00 15.00 ? 15 ASP A O    8  
ATOM 10208 C CB   . ASP A 1 15 ? 11.630  12.235  -9.888  1.00 15.00 ? 15 ASP A CB   8  
ATOM 10209 C CG   . ASP A 1 15 ? 12.081  13.680  -9.967  1.00 15.00 ? 15 ASP A CG   8  
ATOM 10210 O OD1  . ASP A 1 15 ? 11.824  14.437  -9.007  1.00 15.00 ? 15 ASP A OD1  8  
ATOM 10211 O OD2  . ASP A 1 15 ? 12.691  14.056  -10.990 1.00 15.00 ? 15 ASP A OD2  8  
ATOM 10212 H H    . ASP A 1 15 ? 13.283  9.434   -9.207  1.00 15.00 ? 15 ASP A H    8  
ATOM 10213 H HA   . ASP A 1 15 ? 13.541  11.726  -9.076  1.00 15.00 ? 15 ASP A HA   8  
ATOM 10214 H HB2  . ASP A 1 15 ? 11.655  11.815  -10.882 1.00 15.00 ? 15 ASP A HB2  8  
ATOM 10215 H HB3  . ASP A 1 15 ? 10.615  12.213  -9.518  1.00 15.00 ? 15 ASP A HB3  8  
ATOM 10216 N N    . ASN A 1 16 ? 11.326  10.670  -6.966  1.00 15.00 ? 16 ASN A N    8  
ATOM 10217 C CA   . ASN A 1 16 ? 10.871  10.768  -5.583  1.00 15.00 ? 16 ASN A CA   8  
ATOM 10218 C C    . ASN A 1 16 ? 10.311  9.435   -5.093  1.00 15.00 ? 16 ASN A C    8  
ATOM 10219 O O    . ASN A 1 16 ? 9.552   8.771   -5.799  1.00 15.00 ? 16 ASN A O    8  
ATOM 10220 C CB   . ASN A 1 16 ? 9.806   11.860  -5.451  1.00 15.00 ? 16 ASN A CB   8  
ATOM 10221 C CG   . ASN A 1 16 ? 8.747   11.769  -6.532  1.00 15.00 ? 16 ASN A CG   8  
ATOM 10222 O OD1  . ASN A 1 16 ? 8.761   12.534  -7.497  1.00 15.00 ? 16 ASN A OD1  8  
ATOM 10223 N ND2  . ASN A 1 16 ? 7.820   10.832  -6.375  1.00 15.00 ? 16 ASN A ND2  8  
ATOM 10224 H H    . ASN A 1 16 ? 11.055  9.900   -7.504  1.00 15.00 ? 16 ASN A H    8  
ATOM 10225 H HA   . ASN A 1 16 ? 11.721  11.032  -4.973  1.00 15.00 ? 16 ASN A HA   8  
ATOM 10226 H HB2  . ASN A 1 16 ? 9.320   11.767  -4.490  1.00 15.00 ? 16 ASN A HB2  8  
ATOM 10227 H HB3  . ASN A 1 16 ? 10.281  12.827  -5.517  1.00 15.00 ? 16 ASN A HB3  8  
ATOM 10228 H HD21 . ASN A 1 16 ? 7.871   10.259  -5.582  1.00 15.00 ? 16 ASN A HD21 8  
ATOM 10229 H HD22 . ASN A 1 16 ? 7.123   10.751  -7.060  1.00 15.00 ? 16 ASN A HD22 8  
ATOM 10230 N N    . SER A 1 17 ? 10.683  9.056   -3.875  1.00 15.00 ? 17 SER A N    8  
ATOM 10231 C CA   . SER A 1 17 ? 10.213  7.809   -3.282  1.00 15.00 ? 17 SER A CA   8  
ATOM 10232 C C    . SER A 1 17 ? 8.870   8.027   -2.592  1.00 15.00 ? 17 SER A C    8  
ATOM 10233 O O    . SER A 1 17 ? 8.142   8.956   -2.929  1.00 15.00 ? 17 SER A O    8  
ATOM 10234 C CB   . SER A 1 17 ? 11.237  7.278   -2.277  1.00 15.00 ? 17 SER A CB   8  
ATOM 10235 O OG   . SER A 1 17 ? 12.487  7.928   -2.428  1.00 15.00 ? 17 SER A OG   8  
ATOM 10236 H H    . SER A 1 17 ? 11.285  9.632   -3.358  1.00 15.00 ? 17 SER A H    8  
ATOM 10237 H HA   . SER A 1 17 ? 10.087  7.088   -4.075  1.00 15.00 ? 17 SER A HA   8  
ATOM 10238 H HB2  . SER A 1 17 ? 10.873  7.451   -1.274  1.00 15.00 ? 17 SER A HB2  8  
ATOM 10239 H HB3  . SER A 1 17 ? 11.373  6.218   -2.432  1.00 15.00 ? 17 SER A HB3  8  
ATOM 10240 H HG   . SER A 1 17 ? 13.168  7.275   -2.609  1.00 15.00 ? 17 SER A HG   8  
ATOM 10241 N N    . LEU A 1 18 ? 8.544   7.178   -1.623  1.00 15.00 ? 18 LEU A N    8  
ATOM 10242 C CA   . LEU A 1 18 ? 7.286   7.312   -0.901  1.00 15.00 ? 18 LEU A CA   8  
ATOM 10243 C C    . LEU A 1 18 ? 7.521   7.888   0.492   1.00 15.00 ? 18 LEU A C    8  
ATOM 10244 O O    . LEU A 1 18 ? 8.629   8.312   0.822   1.00 15.00 ? 18 LEU A O    8  
ATOM 10245 C CB   . LEU A 1 18 ? 6.569   5.959   -0.803  1.00 15.00 ? 18 LEU A CB   8  
ATOM 10246 C CG   . LEU A 1 18 ? 6.175   5.339   -2.144  1.00 15.00 ? 18 LEU A CG   8  
ATOM 10247 C CD1  . LEU A 1 18 ? 7.277   4.424   -2.656  1.00 15.00 ? 18 LEU A CD1  8  
ATOM 10248 C CD2  . LEU A 1 18 ? 4.865   4.575   -2.013  1.00 15.00 ? 18 LEU A CD2  8  
ATOM 10249 H H    . LEU A 1 18 ? 9.159   6.453   -1.386  1.00 15.00 ? 18 LEU A H    8  
ATOM 10250 H HA   . LEU A 1 18 ? 6.668   7.999   -1.458  1.00 15.00 ? 18 LEU A HA   8  
ATOM 10251 H HB2  . LEU A 1 18 ? 7.218   5.268   -0.286  1.00 15.00 ? 18 LEU A HB2  8  
ATOM 10252 H HB3  . LEU A 1 18 ? 5.670   6.090   -0.215  1.00 15.00 ? 18 LEU A HB3  8  
ATOM 10253 H HG   . LEU A 1 18 ? 6.032   6.126   -2.869  1.00 15.00 ? 18 LEU A HG   8  
ATOM 10254 H HD11 . LEU A 1 18 ? 7.658   3.828   -1.839  1.00 15.00 ? 18 LEU A HD11 8  
ATOM 10255 H HD12 . LEU A 1 18 ? 6.879   3.774   -3.421  1.00 15.00 ? 18 LEU A HD12 8  
ATOM 10256 H HD13 . LEU A 1 18 ? 8.076   5.021   -3.070  1.00 15.00 ? 18 LEU A HD13 8  
ATOM 10257 H HD21 . LEU A 1 18 ? 4.692   4.001   -2.910  1.00 15.00 ? 18 LEU A HD21 8  
ATOM 10258 H HD22 . LEU A 1 18 ? 4.920   3.910   -1.164  1.00 15.00 ? 18 LEU A HD22 8  
ATOM 10259 H HD23 . LEU A 1 18 ? 4.054   5.274   -1.870  1.00 15.00 ? 18 LEU A HD23 8  
ATOM 10260 N N    . GLY A 1 19 ? 6.470   7.904   1.301   1.00 15.00 ? 19 GLY A N    8  
ATOM 10261 C CA   . GLY A 1 19 ? 6.568   8.432   2.647   1.00 15.00 ? 19 GLY A CA   8  
ATOM 10262 C C    . GLY A 1 19 ? 5.439   7.952   3.524   1.00 15.00 ? 19 GLY A C    8  
ATOM 10263 O O    . GLY A 1 19 ? 4.828   8.735   4.244   1.00 15.00 ? 19 GLY A O    8  
ATOM 10264 H H    . GLY A 1 19 ? 5.614   7.555   0.980   1.00 15.00 ? 19 GLY A H    8  
ATOM 10265 H HA2  . GLY A 1 19 ? 7.508   8.127   3.083   1.00 15.00 ? 19 GLY A HA2  8  
ATOM 10266 H HA3  . GLY A 1 19 ? 6.536   9.509   2.600   1.00 15.00 ? 19 GLY A HA3  8  
ATOM 10267 N N    . ILE A 1 20 ? 5.151   6.662   3.445   1.00 15.00 ? 20 ILE A N    8  
ATOM 10268 C CA   . ILE A 1 20 ? 4.080   6.069   4.228   1.00 15.00 ? 20 ILE A CA   8  
ATOM 10269 C C    . ILE A 1 20 ? 4.616   5.101   5.278   1.00 15.00 ? 20 ILE A C    8  
ATOM 10270 O O    . ILE A 1 20 ? 5.518   4.308   5.007   1.00 15.00 ? 20 ILE A O    8  
ATOM 10271 C CB   . ILE A 1 20 ? 3.072   5.339   3.311   1.00 15.00 ? 20 ILE A CB   8  
ATOM 10272 C CG1  . ILE A 1 20 ? 1.660   5.842   3.589   1.00 15.00 ? 20 ILE A CG1  8  
ATOM 10273 C CG2  . ILE A 1 20 ? 3.144   3.836   3.510   1.00 15.00 ? 20 ILE A CG2  8  
ATOM 10274 C CD1  . ILE A 1 20 ? 0.575   4.832   3.300   1.00 15.00 ? 20 ILE A CD1  8  
ATOM 10275 H H    . ILE A 1 20 ? 5.669   6.094   2.838   1.00 15.00 ? 20 ILE A H    8  
ATOM 10276 H HA   . ILE A 1 20 ? 3.552   6.864   4.736   1.00 15.00 ? 20 ILE A HA   8  
ATOM 10277 H HB   . ILE A 1 20 ? 3.328   5.556   2.286   1.00 15.00 ? 20 ILE A HB   8  
ATOM 10278 H HG12 . ILE A 1 20 ? 1.592   6.103   4.627   1.00 15.00 ? 20 ILE A HG12 8  
ATOM 10279 H HG13 . ILE A 1 20 ? 1.471   6.717   2.987   1.00 15.00 ? 20 ILE A HG13 8  
ATOM 10280 H HG21 . ILE A 1 20 ? 4.169   3.510   3.431   1.00 15.00 ? 20 ILE A HG21 8  
ATOM 10281 H HG22 . ILE A 1 20 ? 2.761   3.595   4.491   1.00 15.00 ? 20 ILE A HG22 8  
ATOM 10282 H HG23 . ILE A 1 20 ? 2.546   3.346   2.758   1.00 15.00 ? 20 ILE A HG23 8  
ATOM 10283 H HD11 . ILE A 1 20 ? -0.314  5.342   2.967   1.00 15.00 ? 20 ILE A HD11 8  
ATOM 10284 H HD12 . ILE A 1 20 ? 0.915   4.154   2.534   1.00 15.00 ? 20 ILE A HD12 8  
ATOM 10285 H HD13 . ILE A 1 20 ? 0.356   4.277   4.199   1.00 15.00 ? 20 ILE A HD13 8  
ATOM 10286 N N    . SER A 1 21 ? 4.021   5.143   6.462   1.00 15.00 ? 21 SER A N    8  
ATOM 10287 C CA   . SER A 1 21 ? 4.399   4.240   7.537   1.00 15.00 ? 21 SER A CA   8  
ATOM 10288 C C    . SER A 1 21 ? 3.456   3.043   7.503   1.00 15.00 ? 21 SER A C    8  
ATOM 10289 O O    . SER A 1 21 ? 2.288   3.154   7.874   1.00 15.00 ? 21 SER A O    8  
ATOM 10290 C CB   . SER A 1 21 ? 4.331   4.954   8.891   1.00 15.00 ? 21 SER A CB   8  
ATOM 10291 O OG   . SER A 1 21 ? 4.667   4.075   9.950   1.00 15.00 ? 21 SER A OG   8  
ATOM 10292 H H    . SER A 1 21 ? 3.286   5.773   6.605   1.00 15.00 ? 21 SER A H    8  
ATOM 10293 H HA   . SER A 1 21 ? 5.410   3.902   7.356   1.00 15.00 ? 21 SER A HA   8  
ATOM 10294 H HB2  . SER A 1 21 ? 5.025   5.784   8.894   1.00 15.00 ? 21 SER A HB2  8  
ATOM 10295 H HB3  . SER A 1 21 ? 3.330   5.325   9.050   1.00 15.00 ? 21 SER A HB3  8  
ATOM 10296 H HG   . SER A 1 21 ? 5.430   3.548   9.700   1.00 15.00 ? 21 SER A HG   8  
ATOM 10297 N N    . VAL A 1 22 ? 3.949   1.915   7.002   1.00 15.00 ? 22 VAL A N    8  
ATOM 10298 C CA   . VAL A 1 22 ? 3.118   0.724   6.861   1.00 15.00 ? 22 VAL A CA   8  
ATOM 10299 C C    . VAL A 1 22 ? 3.217   -0.219  8.053   1.00 15.00 ? 22 VAL A C    8  
ATOM 10300 O O    . VAL A 1 22 ? 4.222   -0.254  8.763   1.00 15.00 ? 22 VAL A O    8  
ATOM 10301 C CB   . VAL A 1 22 ? 3.479   -0.049  5.575   1.00 15.00 ? 22 VAL A CB   8  
ATOM 10302 C CG1  . VAL A 1 22 ? 3.460   0.881   4.374   1.00 15.00 ? 22 VAL A CG1  8  
ATOM 10303 C CG2  . VAL A 1 22 ? 4.840   -0.719  5.700   1.00 15.00 ? 22 VAL A CG2  8  
ATOM 10304 H H    . VAL A 1 22 ? 4.877   1.895   6.681   1.00 15.00 ? 22 VAL A H    8  
ATOM 10305 H HA   . VAL A 1 22 ? 2.094   1.052   6.771   1.00 15.00 ? 22 VAL A HA   8  
ATOM 10306 H HB   . VAL A 1 22 ? 2.735   -0.818  5.419   1.00 15.00 ? 22 VAL A HB   8  
ATOM 10307 H HG11 . VAL A 1 22 ? 3.809   1.858   4.672   1.00 15.00 ? 22 VAL A HG11 8  
ATOM 10308 H HG12 . VAL A 1 22 ? 4.109   0.484   3.605   1.00 15.00 ? 22 VAL A HG12 8  
ATOM 10309 H HG13 . VAL A 1 22 ? 2.453   0.959   3.991   1.00 15.00 ? 22 VAL A HG13 8  
ATOM 10310 H HG21 . VAL A 1 22 ? 5.609   -0.030  5.384   1.00 15.00 ? 22 VAL A HG21 8  
ATOM 10311 H HG22 . VAL A 1 22 ? 5.012   -1.003  6.726   1.00 15.00 ? 22 VAL A HG22 8  
ATOM 10312 H HG23 . VAL A 1 22 ? 4.867   -1.599  5.074   1.00 15.00 ? 22 VAL A HG23 8  
ATOM 10313 N N    . THR A 1 23 ? 2.150   -0.988  8.251   1.00 15.00 ? 23 THR A N    8  
ATOM 10314 C CA   . THR A 1 23 ? 2.076   -1.952  9.338   1.00 15.00 ? 23 THR A CA   8  
ATOM 10315 C C    . THR A 1 23 ? 1.206   -3.144  8.935   1.00 15.00 ? 23 THR A C    8  
ATOM 10316 O O    . THR A 1 23 ? 0.683   -3.194  7.818   1.00 15.00 ? 23 THR A O    8  
ATOM 10317 C CB   . THR A 1 23 ? 1.510   -1.286  10.595  1.00 15.00 ? 23 THR A CB   8  
ATOM 10318 O OG1  . THR A 1 23 ? 1.478   0.122   10.446  1.00 15.00 ? 23 THR A OG1  8  
ATOM 10319 C CG2  . THR A 1 23 ? 2.303   -1.594  11.844  1.00 15.00 ? 23 THR A CG2  8  
ATOM 10320 H H    . THR A 1 23 ? 1.389   -0.907  7.639   1.00 15.00 ? 23 THR A H    8  
ATOM 10321 H HA   . THR A 1 23 ? 3.078   -2.302  9.542   1.00 15.00 ? 23 THR A HA   8  
ATOM 10322 H HB   . THR A 1 23 ? 0.498   -1.632  10.750  1.00 15.00 ? 23 THR A HB   8  
ATOM 10323 H HG1  . THR A 1 23 ? 2.374   0.456   10.363  1.00 15.00 ? 23 THR A HG1  8  
ATOM 10324 H HG21 . THR A 1 23 ? 2.078   -2.597  12.175  1.00 15.00 ? 23 THR A HG21 8  
ATOM 10325 H HG22 . THR A 1 23 ? 3.358   -1.513  11.629  1.00 15.00 ? 23 THR A HG22 8  
ATOM 10326 H HG23 . THR A 1 23 ? 2.038   -0.891  12.619  1.00 15.00 ? 23 THR A HG23 8  
ATOM 10327 N N    . GLY A 1 24 ? 1.050   -4.099  9.846   1.00 15.00 ? 24 GLY A N    8  
ATOM 10328 C CA   . GLY A 1 24 ? 0.239   -5.269  9.558   1.00 15.00 ? 24 GLY A CA   8  
ATOM 10329 C C    . GLY A 1 24 ? 0.950   -6.263  8.665   1.00 15.00 ? 24 GLY A C    8  
ATOM 10330 O O    . GLY A 1 24 ? 2.030   -6.747  9.001   1.00 15.00 ? 24 GLY A O    8  
ATOM 10331 H H    . GLY A 1 24 ? 1.485   -4.009  10.720  1.00 15.00 ? 24 GLY A H    8  
ATOM 10332 H HA2  . GLY A 1 24 ? -0.019  -5.755  10.487  1.00 15.00 ? 24 GLY A HA2  8  
ATOM 10333 H HA3  . GLY A 1 24 ? -0.668  -4.948  9.066   1.00 15.00 ? 24 GLY A HA3  8  
ATOM 10334 N N    . GLY A 1 25 ? 0.345   -6.561  7.520   1.00 15.00 ? 25 GLY A N    8  
ATOM 10335 C CA   . GLY A 1 25 ? 0.944   -7.493  6.583   1.00 15.00 ? 25 GLY A CA   8  
ATOM 10336 C C    . GLY A 1 25 ? 0.979   -8.920  7.093   1.00 15.00 ? 25 GLY A C    8  
ATOM 10337 O O    . GLY A 1 25 ? 0.323   -9.798  6.534   1.00 15.00 ? 25 GLY A O    8  
ATOM 10338 H H    . GLY A 1 25 ? -0.512  -6.138  7.305   1.00 15.00 ? 25 GLY A H    8  
ATOM 10339 H HA2  . GLY A 1 25 ? 0.387   -7.470  5.665   1.00 15.00 ? 25 GLY A HA2  8  
ATOM 10340 H HA3  . GLY A 1 25 ? 1.951   -7.174  6.379   1.00 15.00 ? 25 GLY A HA3  8  
ATOM 10341 N N    . VAL A 1 26 ? 1.765   -9.150  8.147   1.00 15.00 ? 26 VAL A N    8  
ATOM 10342 C CA   . VAL A 1 26 ? 1.919   -10.481 8.746   1.00 15.00 ? 26 VAL A CA   8  
ATOM 10343 C C    . VAL A 1 26 ? 0.680   -11.352 8.554   1.00 15.00 ? 26 VAL A C    8  
ATOM 10344 O O    . VAL A 1 26 ? -0.450  -10.881 8.679   1.00 15.00 ? 26 VAL A O    8  
ATOM 10345 C CB   . VAL A 1 26 ? 2.226   -10.385 10.251  1.00 15.00 ? 26 VAL A CB   8  
ATOM 10346 C CG1  . VAL A 1 26 ? 3.706   -10.122 10.481  1.00 15.00 ? 26 VAL A CG1  8  
ATOM 10347 C CG2  . VAL A 1 26 ? 1.378   -9.302  10.896  1.00 15.00 ? 26 VAL A CG2  8  
ATOM 10348 H H    . VAL A 1 26 ? 2.267   -8.401  8.530   1.00 15.00 ? 26 VAL A H    8  
ATOM 10349 H HA   . VAL A 1 26 ? 2.757   -10.963 8.265   1.00 15.00 ? 26 VAL A HA   8  
ATOM 10350 H HB   . VAL A 1 26 ? 1.975   -11.330 10.710  1.00 15.00 ? 26 VAL A HB   8  
ATOM 10351 H HG11 . VAL A 1 26 ? 4.290   -10.830 9.912   1.00 15.00 ? 26 VAL A HG11 8  
ATOM 10352 H HG12 . VAL A 1 26 ? 3.947   -9.119  10.163  1.00 15.00 ? 26 VAL A HG12 8  
ATOM 10353 H HG13 . VAL A 1 26 ? 3.932   -10.232 11.531  1.00 15.00 ? 26 VAL A HG13 8  
ATOM 10354 H HG21 . VAL A 1 26 ? 1.804   -9.031  11.850  1.00 15.00 ? 26 VAL A HG21 8  
ATOM 10355 H HG22 . VAL A 1 26 ? 1.355   -8.436  10.253  1.00 15.00 ? 26 VAL A HG22 8  
ATOM 10356 H HG23 . VAL A 1 26 ? 0.374   -9.670  11.041  1.00 15.00 ? 26 VAL A HG23 8  
ATOM 10357 N N    . ASN A 1 27 ? 0.906   -12.625 8.246   1.00 15.00 ? 27 ASN A N    8  
ATOM 10358 C CA   . ASN A 1 27 ? -0.185  -13.568 8.031   1.00 15.00 ? 27 ASN A CA   8  
ATOM 10359 C C    . ASN A 1 27 ? -0.806  -14.000 9.358   1.00 15.00 ? 27 ASN A C    8  
ATOM 10360 O O    . ASN A 1 27 ? -0.810  -15.184 9.696   1.00 15.00 ? 27 ASN A O    8  
ATOM 10361 C CB   . ASN A 1 27 ? 0.322   -14.794 7.269   1.00 15.00 ? 27 ASN A CB   8  
ATOM 10362 C CG   . ASN A 1 27 ? 1.123   -14.419 6.037   1.00 15.00 ? 27 ASN A CG   8  
ATOM 10363 O OD1  . ASN A 1 27 ? 0.578   -14.305 4.940   1.00 15.00 ? 27 ASN A OD1  8  
ATOM 10364 N ND2  . ASN A 1 27 ? 2.425   -14.226 6.214   1.00 15.00 ? 27 ASN A ND2  8  
ATOM 10365 H H    . ASN A 1 27 ? 1.831   -12.937 8.159   1.00 15.00 ? 27 ASN A H    8  
ATOM 10366 H HA   . ASN A 1 27 ? -0.938  -13.072 7.437   1.00 15.00 ? 27 ASN A HA   8  
ATOM 10367 H HB2  . ASN A 1 27 ? 0.954   -15.379 7.921   1.00 15.00 ? 27 ASN A HB2  8  
ATOM 10368 H HB3  . ASN A 1 27 ? -0.521  -15.393 6.961   1.00 15.00 ? 27 ASN A HB3  8  
ATOM 10369 H HD21 . ASN A 1 27 ? 2.790   -14.335 7.117   1.00 15.00 ? 27 ASN A HD21 8  
ATOM 10370 H HD22 . ASN A 1 27 ? 2.966   -13.983 5.435   1.00 15.00 ? 27 ASN A HD22 8  
ATOM 10371 N N    . THR A 1 28 ? -1.330  -13.034 10.106  1.00 15.00 ? 28 THR A N    8  
ATOM 10372 C CA   . THR A 1 28 ? -1.952  -13.320 11.394  1.00 15.00 ? 28 THR A CA   8  
ATOM 10373 C C    . THR A 1 28 ? -3.031  -12.292 11.719  1.00 15.00 ? 28 THR A C    8  
ATOM 10374 O O    . THR A 1 28 ? -4.183  -12.645 11.972  1.00 15.00 ? 28 THR A O    8  
ATOM 10375 C CB   . THR A 1 28 ? -0.896  -13.337 12.501  1.00 15.00 ? 28 THR A CB   8  
ATOM 10376 O OG1  . THR A 1 28 ? 0.394   -13.560 11.960  1.00 15.00 ? 28 THR A OG1  8  
ATOM 10377 C CG2  . THR A 1 28 ? -1.145  -14.401 13.549  1.00 15.00 ? 28 THR A CG2  8  
ATOM 10378 H H    . THR A 1 28 ? -1.299  -12.109 9.786   1.00 15.00 ? 28 THR A H    8  
ATOM 10379 H HA   . THR A 1 28 ? -2.409  -14.296 11.330  1.00 15.00 ? 28 THR A HA   8  
ATOM 10380 H HB   . THR A 1 28 ? -0.895  -12.378 12.998  1.00 15.00 ? 28 THR A HB   8  
ATOM 10381 H HG1  . THR A 1 28 ? 1.039   -13.587 12.671  1.00 15.00 ? 28 THR A HG1  8  
ATOM 10382 H HG21 . THR A 1 28 ? -1.926  -14.071 14.218  1.00 15.00 ? 28 THR A HG21 8  
ATOM 10383 H HG22 . THR A 1 28 ? -1.448  -15.318 13.066  1.00 15.00 ? 28 THR A HG22 8  
ATOM 10384 H HG23 . THR A 1 28 ? -0.238  -14.572 14.110  1.00 15.00 ? 28 THR A HG23 8  
ATOM 10385 N N    . SER A 1 29 ? -2.649  -11.020 11.713  1.00 15.00 ? 29 SER A N    8  
ATOM 10386 C CA   . SER A 1 29 ? -3.582  -9.939  12.009  1.00 15.00 ? 29 SER A CA   8  
ATOM 10387 C C    . SER A 1 29 ? -4.470  -9.638  10.806  1.00 15.00 ? 29 SER A C    8  
ATOM 10388 O O    . SER A 1 29 ? -5.685  -9.496  10.939  1.00 15.00 ? 29 SER A O    8  
ATOM 10389 C CB   . SER A 1 29 ? -2.820  -8.679  12.423  1.00 15.00 ? 29 SER A CB   8  
ATOM 10390 O OG   . SER A 1 29 ? -2.647  -8.625  13.828  1.00 15.00 ? 29 SER A OG   8  
ATOM 10391 H H    . SER A 1 29 ? -1.716  -10.802 11.505  1.00 15.00 ? 29 SER A H    8  
ATOM 10392 H HA   . SER A 1 29 ? -4.206  -10.257 12.831  1.00 15.00 ? 29 SER A HA   8  
ATOM 10393 H HB2  . SER A 1 29 ? -1.848  -8.678  11.953  1.00 15.00 ? 29 SER A HB2  8  
ATOM 10394 H HB3  . SER A 1 29 ? -3.373  -7.806  12.107  1.00 15.00 ? 29 SER A HB3  8  
ATOM 10395 H HG   . SER A 1 29 ? -2.068  -9.339  14.107  1.00 15.00 ? 29 SER A HG   8  
ATOM 10396 N N    . VAL A 1 30 ? -3.855  -9.540  9.631   1.00 15.00 ? 30 VAL A N    8  
ATOM 10397 C CA   . VAL A 1 30 ? -4.591  -9.255  8.406   1.00 15.00 ? 30 VAL A CA   8  
ATOM 10398 C C    . VAL A 1 30 ? -5.433  -10.453 7.977   1.00 15.00 ? 30 VAL A C    8  
ATOM 10399 O O    . VAL A 1 30 ? -5.526  -11.448 8.696   1.00 15.00 ? 30 VAL A O    8  
ATOM 10400 C CB   . VAL A 1 30 ? -3.639  -8.864  7.257   1.00 15.00 ? 30 VAL A CB   8  
ATOM 10401 C CG1  . VAL A 1 30 ? -2.789  -7.667  7.653   1.00 15.00 ? 30 VAL A CG1  8  
ATOM 10402 C CG2  . VAL A 1 30 ? -2.761  -10.042 6.861   1.00 15.00 ? 30 VAL A CG2  8  
ATOM 10403 H H    . VAL A 1 30 ? -2.884  -9.663  9.588   1.00 15.00 ? 30 VAL A H    8  
ATOM 10404 H HA   . VAL A 1 30 ? -5.248  -8.419  8.600   1.00 15.00 ? 30 VAL A HA   8  
ATOM 10405 H HB   . VAL A 1 30 ? -4.236  -8.583  6.401   1.00 15.00 ? 30 VAL A HB   8  
ATOM 10406 H HG11 . VAL A 1 30 ? -2.507  -7.754  8.692   1.00 15.00 ? 30 VAL A HG11 8  
ATOM 10407 H HG12 . VAL A 1 30 ? -1.900  -7.638  7.040   1.00 15.00 ? 30 VAL A HG12 8  
ATOM 10408 H HG13 . VAL A 1 30 ? -3.355  -6.759  7.509   1.00 15.00 ? 30 VAL A HG13 8  
ATOM 10409 H HG21 . VAL A 1 30 ? -1.893  -9.680  6.329   1.00 15.00 ? 30 VAL A HG21 8  
ATOM 10410 H HG22 . VAL A 1 30 ? -2.446  -10.570 7.748   1.00 15.00 ? 30 VAL A HG22 8  
ATOM 10411 H HG23 . VAL A 1 30 ? -3.320  -10.710 6.223   1.00 15.00 ? 30 VAL A HG23 8  
ATOM 10412 N N    . ARG A 1 31 ? -6.046  -10.351 6.802   1.00 15.00 ? 31 ARG A N    8  
ATOM 10413 C CA   . ARG A 1 31 ? -6.881  -11.426 6.278   1.00 15.00 ? 31 ARG A CA   8  
ATOM 10414 C C    . ARG A 1 31 ? -6.094  -12.728 6.168   1.00 15.00 ? 31 ARG A C    8  
ATOM 10415 O O    . ARG A 1 31 ? -6.503  -13.758 6.705   1.00 15.00 ? 31 ARG A O    8  
ATOM 10416 C CB   . ARG A 1 31 ? -7.446  -11.040 4.909   1.00 15.00 ? 31 ARG A CB   8  
ATOM 10417 C CG   . ARG A 1 31 ? -8.729  -10.229 4.988   1.00 15.00 ? 31 ARG A CG   8  
ATOM 10418 C CD   . ARG A 1 31 ? -9.593  -10.432 3.753   1.00 15.00 ? 31 ARG A CD   8  
ATOM 10419 N NE   . ARG A 1 31 ? -10.520 -11.550 3.911   1.00 15.00 ? 31 ARG A NE   8  
ATOM 10420 C CZ   . ARG A 1 31 ? -11.529 -11.558 4.779   1.00 15.00 ? 31 ARG A CZ   8  
ATOM 10421 N NH1  . ARG A 1 31 ? -11.743 -10.513 5.568   1.00 15.00 ? 31 ARG A NH1  8  
ATOM 10422 N NH2  . ARG A 1 31 ? -12.326 -12.615 4.859   1.00 15.00 ? 31 ARG A NH2  8  
ATOM 10423 H H    . ARG A 1 31 ? -5.935  -9.533  6.274   1.00 15.00 ? 31 ARG A H    8  
ATOM 10424 H HA   . ARG A 1 31 ? -7.701  -11.572 6.966   1.00 15.00 ? 31 ARG A HA   8  
ATOM 10425 H HB2  . ARG A 1 31 ? -6.708  -10.454 4.381   1.00 15.00 ? 31 ARG A HB2  8  
ATOM 10426 H HB3  . ARG A 1 31 ? -7.647  -11.940 4.349   1.00 15.00 ? 31 ARG A HB3  8  
ATOM 10427 H HG2  . ARG A 1 31 ? -9.287  -10.539 5.859   1.00 15.00 ? 31 ARG A HG2  8  
ATOM 10428 H HG3  . ARG A 1 31 ? -8.478  -9.182  5.072   1.00 15.00 ? 31 ARG A HG3  8  
ATOM 10429 H HD2  . ARG A 1 31 ? -10.159 -9.530  3.573   1.00 15.00 ? 31 ARG A HD2  8  
ATOM 10430 H HD3  . ARG A 1 31 ? -8.950  -10.627 2.908   1.00 15.00 ? 31 ARG A HD3  8  
ATOM 10431 H HE   . ARG A 1 31 ? -10.385 -12.335 3.340   1.00 15.00 ? 31 ARG A HE   8  
ATOM 10432 H HH11 . ARG A 1 31 ? -11.146 -9.713  5.512   1.00 15.00 ? 31 ARG A HH11 8  
ATOM 10433 H HH12 . ARG A 1 31 ? -12.503 -10.525 6.218   1.00 15.00 ? 31 ARG A HH12 8  
ATOM 10434 H HH21 . ARG A 1 31 ? -12.169 -13.406 4.267   1.00 15.00 ? 31 ARG A HH21 8  
ATOM 10435 H HH22 . ARG A 1 31 ? -13.083 -12.622 5.512   1.00 15.00 ? 31 ARG A HH22 8  
ATOM 10436 N N    . HIS A 1 32 ? -4.965  -12.678 5.468   1.00 15.00 ? 32 HIS A N    8  
ATOM 10437 C CA   . HIS A 1 32 ? -4.126  -13.858 5.289   1.00 15.00 ? 32 HIS A CA   8  
ATOM 10438 C C    . HIS A 1 32 ? -2.662  -13.470 5.100   1.00 15.00 ? 32 HIS A C    8  
ATOM 10439 O O    . HIS A 1 32 ? -1.770  -14.075 5.690   1.00 15.00 ? 32 HIS A O    8  
ATOM 10440 C CB   . HIS A 1 32 ? -4.608  -14.675 4.089   1.00 15.00 ? 32 HIS A CB   8  
ATOM 10441 C CG   . HIS A 1 32 ? -4.497  -13.946 2.786   1.00 15.00 ? 32 HIS A CG   8  
ATOM 10442 N ND1  . HIS A 1 32 ? -5.333  -12.908 2.431   1.00 15.00 ? 32 HIS A ND1  8  
ATOM 10443 C CD2  . HIS A 1 32 ? -3.641  -14.108 1.749   1.00 15.00 ? 32 HIS A CD2  8  
ATOM 10444 C CE1  . HIS A 1 32 ? -4.997  -12.465 1.233   1.00 15.00 ? 32 HIS A CE1  8  
ATOM 10445 N NE2  . HIS A 1 32 ? -3.973  -13.175 0.797   1.00 15.00 ? 32 HIS A NE2  8  
ATOM 10446 H H    . HIS A 1 32 ? -4.691  -11.830 5.062   1.00 15.00 ? 32 HIS A H    8  
ATOM 10447 H HA   . HIS A 1 32 ? -4.212  -14.462 6.180   1.00 15.00 ? 32 HIS A HA   8  
ATOM 10448 H HB2  . HIS A 1 32 ? -4.018  -15.576 4.015   1.00 15.00 ? 32 HIS A HB2  8  
ATOM 10449 H HB3  . HIS A 1 32 ? -5.645  -14.940 4.235   1.00 15.00 ? 32 HIS A HB3  8  
ATOM 10450 H HD1  . HIS A 1 32 ? -6.065  -12.551 2.976   1.00 15.00 ? 32 HIS A HD1  8  
ATOM 10451 H HD2  . HIS A 1 32 ? -2.845  -14.836 1.683   1.00 15.00 ? 32 HIS A HD2  8  
ATOM 10452 H HE1  . HIS A 1 32 ? -5.478  -11.658 0.700   1.00 15.00 ? 32 HIS A HE1  8  
ATOM 10453 H HE2  . HIS A 1 32 ? -3.463  -12.988 -0.018  1.00 15.00 ? 32 HIS A HE2  8  
ATOM 10454 N N    . GLY A 1 33 ? -2.423  -12.460 4.269   1.00 15.00 ? 33 GLY A N    8  
ATOM 10455 C CA   . GLY A 1 33 ? -1.064  -12.011 4.014   1.00 15.00 ? 33 GLY A CA   8  
ATOM 10456 C C    . GLY A 1 33 ? -1.016  -10.703 3.246   1.00 15.00 ? 33 GLY A C    8  
ATOM 10457 O O    . GLY A 1 33 ? -0.015  -10.392 2.601   1.00 15.00 ? 33 GLY A O    8  
ATOM 10458 H H    . GLY A 1 33 ? -3.174  -12.020 3.822   1.00 15.00 ? 33 GLY A H    8  
ATOM 10459 H HA2  . GLY A 1 33 ? -0.550  -11.875 4.960   1.00 15.00 ? 33 GLY A HA2  8  
ATOM 10460 H HA3  . GLY A 1 33 ? -0.549  -12.769 3.445   1.00 15.00 ? 33 GLY A HA3  8  
ATOM 10461 N N    . GLY A 1 34 ? -2.090  -9.922  3.333   1.00 15.00 ? 34 GLY A N    8  
ATOM 10462 C CA   . GLY A 1 34 ? -2.130  -8.641  2.658   1.00 15.00 ? 34 GLY A CA   8  
ATOM 10463 C C    . GLY A 1 34 ? -1.689  -7.540  3.591   1.00 15.00 ? 34 GLY A C    8  
ATOM 10464 O O    . GLY A 1 34 ? -1.807  -7.685  4.808   1.00 15.00 ? 34 GLY A O    8  
ATOM 10465 H H    . GLY A 1 34 ? -2.852  -10.207 3.878   1.00 15.00 ? 34 GLY A H    8  
ATOM 10466 H HA2  . GLY A 1 34 ? -1.472  -8.670  1.801   1.00 15.00 ? 34 GLY A HA2  8  
ATOM 10467 H HA3  . GLY A 1 34 ? -3.138  -8.443  2.328   1.00 15.00 ? 34 GLY A HA3  8  
ATOM 10468 N N    . ILE A 1 35 ? -1.166  -6.446  3.053   1.00 15.00 ? 35 ILE A N    8  
ATOM 10469 C CA   . ILE A 1 35 ? -0.709  -5.368  3.917   1.00 15.00 ? 35 ILE A CA   8  
ATOM 10470 C C    . ILE A 1 35 ? -1.750  -4.274  4.076   1.00 15.00 ? 35 ILE A C    8  
ATOM 10471 O O    . ILE A 1 35 ? -2.589  -4.051  3.204   1.00 15.00 ? 35 ILE A O    8  
ATOM 10472 C CB   . ILE A 1 35 ? 0.630   -4.758  3.441   1.00 15.00 ? 35 ILE A CB   8  
ATOM 10473 C CG1  . ILE A 1 35 ? 1.610   -4.720  4.618   1.00 15.00 ? 35 ILE A CG1  8  
ATOM 10474 C CG2  . ILE A 1 35 ? 0.434   -3.366  2.844   1.00 15.00 ? 35 ILE A CG2  8  
ATOM 10475 C CD1  . ILE A 1 35 ? 2.775   -3.769  4.439   1.00 15.00 ? 35 ILE A CD1  8  
ATOM 10476 H H    . ILE A 1 35 ? -1.075  -6.369  2.074   1.00 15.00 ? 35 ILE A H    8  
ATOM 10477 H HA   . ILE A 1 35 ? -0.537  -5.802  4.893   1.00 15.00 ? 35 ILE A HA   8  
ATOM 10478 H HB   . ILE A 1 35 ? 1.032   -5.395  2.674   1.00 15.00 ? 35 ILE A HB   8  
ATOM 10479 H HG12 . ILE A 1 35 ? 1.078   -4.422  5.508   1.00 15.00 ? 35 ILE A HG12 8  
ATOM 10480 H HG13 . ILE A 1 35 ? 2.011   -5.711  4.763   1.00 15.00 ? 35 ILE A HG13 8  
ATOM 10481 H HG21 . ILE A 1 35 ? -0.425  -3.371  2.189   1.00 15.00 ? 35 ILE A HG21 8  
ATOM 10482 H HG22 . ILE A 1 35 ? 0.275   -2.653  3.639   1.00 15.00 ? 35 ILE A HG22 8  
ATOM 10483 H HG23 . ILE A 1 35 ? 1.314   -3.089  2.283   1.00 15.00 ? 35 ILE A HG23 8  
ATOM 10484 H HD11 . ILE A 1 35 ? 3.423   -4.135  3.658   1.00 15.00 ? 35 ILE A HD11 8  
ATOM 10485 H HD12 . ILE A 1 35 ? 2.404   -2.791  4.171   1.00 15.00 ? 35 ILE A HD12 8  
ATOM 10486 H HD13 . ILE A 1 35 ? 3.326   -3.703  5.364   1.00 15.00 ? 35 ILE A HD13 8  
ATOM 10487 N N    . TYR A 1 36 ? -1.664  -3.592  5.204   1.00 15.00 ? 36 TYR A N    8  
ATOM 10488 C CA   . TYR A 1 36 ? -2.565  -2.499  5.523   1.00 15.00 ? 36 TYR A CA   8  
ATOM 10489 C C    . TYR A 1 36 ? -1.765  -1.339  6.089   1.00 15.00 ? 36 TYR A C    8  
ATOM 10490 O O    . TYR A 1 36 ? -1.271  -1.402  7.215   1.00 15.00 ? 36 TYR A O    8  
ATOM 10491 C CB   . TYR A 1 36 ? -3.624  -2.957  6.525   1.00 15.00 ? 36 TYR A CB   8  
ATOM 10492 C CG   . TYR A 1 36 ? -4.593  -3.967  5.955   1.00 15.00 ? 36 TYR A CG   8  
ATOM 10493 C CD1  . TYR A 1 36 ? -4.196  -5.274  5.694   1.00 15.00 ? 36 TYR A CD1  8  
ATOM 10494 C CD2  . TYR A 1 36 ? -5.907  -3.613  5.677   1.00 15.00 ? 36 TYR A CD2  8  
ATOM 10495 C CE1  . TYR A 1 36 ? -5.081  -6.197  5.173   1.00 15.00 ? 36 TYR A CE1  8  
ATOM 10496 C CE2  . TYR A 1 36 ? -6.797  -4.531  5.156   1.00 15.00 ? 36 TYR A CE2  8  
ATOM 10497 C CZ   . TYR A 1 36 ? -6.380  -5.822  4.905   1.00 15.00 ? 36 TYR A CZ   8  
ATOM 10498 O OH   . TYR A 1 36 ? -7.265  -6.739  4.386   1.00 15.00 ? 36 TYR A OH   8  
ATOM 10499 H H    . TYR A 1 36 ? -0.957  -3.826  5.843   1.00 15.00 ? 36 TYR A H    8  
ATOM 10500 H HA   . TYR A 1 36 ? -3.047  -2.182  4.610   1.00 15.00 ? 36 TYR A HA   8  
ATOM 10501 H HB2  . TYR A 1 36 ? -3.135  -3.408  7.376   1.00 15.00 ? 36 TYR A HB2  8  
ATOM 10502 H HB3  . TYR A 1 36 ? -4.192  -2.099  6.855   1.00 15.00 ? 36 TYR A HB3  8  
ATOM 10503 H HD1  . TYR A 1 36 ? -3.177  -5.569  5.904   1.00 15.00 ? 36 TYR A HD1  8  
ATOM 10504 H HD2  . TYR A 1 36 ? -6.231  -2.602  5.872   1.00 15.00 ? 36 TYR A HD2  8  
ATOM 10505 H HE1  . TYR A 1 36 ? -4.752  -7.206  4.976   1.00 15.00 ? 36 TYR A HE1  8  
ATOM 10506 H HE2  . TYR A 1 36 ? -7.814  -4.236  4.945   1.00 15.00 ? 36 TYR A HE2  8  
ATOM 10507 H HH   . TYR A 1 36 ? -6.848  -7.213  3.663   1.00 15.00 ? 36 TYR A HH   8  
ATOM 10508 N N    . VAL A 1 37 ? -1.613  -0.290  5.293   1.00 15.00 ? 37 VAL A N    8  
ATOM 10509 C CA   . VAL A 1 37 ? -0.838  0.869   5.717   1.00 15.00 ? 37 VAL A CA   8  
ATOM 10510 C C    . VAL A 1 37 ? -1.352  1.427   7.038   1.00 15.00 ? 37 VAL A C    8  
ATOM 10511 O O    . VAL A 1 37 ? -2.541  1.356   7.338   1.00 15.00 ? 37 VAL A O    8  
ATOM 10512 C CB   . VAL A 1 37 ? -0.802  2.000   4.643   1.00 15.00 ? 37 VAL A CB   8  
ATOM 10513 C CG1  . VAL A 1 37 ? -1.028  1.460   3.243   1.00 15.00 ? 37 VAL A CG1  8  
ATOM 10514 C CG2  . VAL A 1 37 ? -1.794  3.115   4.929   1.00 15.00 ? 37 VAL A CG2  8  
ATOM 10515 H H    . VAL A 1 37 ? -2.013  -0.308  4.400   1.00 15.00 ? 37 VAL A H    8  
ATOM 10516 H HA   . VAL A 1 37 ? 0.178   0.532   5.870   1.00 15.00 ? 37 VAL A HA   8  
ATOM 10517 H HB   . VAL A 1 37 ? 0.172   2.430   4.667   1.00 15.00 ? 37 VAL A HB   8  
ATOM 10518 H HG11 . VAL A 1 37 ? -0.327  0.665   3.044   1.00 15.00 ? 37 VAL A HG11 8  
ATOM 10519 H HG12 . VAL A 1 37 ? -2.034  1.084   3.164   1.00 15.00 ? 37 VAL A HG12 8  
ATOM 10520 H HG13 . VAL A 1 37 ? -0.886  2.256   2.528   1.00 15.00 ? 37 VAL A HG13 8  
ATOM 10521 H HG21 . VAL A 1 37 ? -2.784  2.770   4.712   1.00 15.00 ? 37 VAL A HG21 8  
ATOM 10522 H HG22 . VAL A 1 37 ? -1.729  3.409   5.965   1.00 15.00 ? 37 VAL A HG22 8  
ATOM 10523 H HG23 . VAL A 1 37 ? -1.567  3.964   4.301   1.00 15.00 ? 37 VAL A HG23 8  
ATOM 10524 N N    . LYS A 1 38 ? -0.447  2.002   7.813   1.00 15.00 ? 38 LYS A N    8  
ATOM 10525 C CA   . LYS A 1 38 ? -0.812  2.597   9.085   1.00 15.00 ? 38 LYS A CA   8  
ATOM 10526 C C    . LYS A 1 38 ? -1.404  3.976   8.825   1.00 15.00 ? 38 LYS A C    8  
ATOM 10527 O O    . LYS A 1 38 ? -2.491  4.297   9.303   1.00 15.00 ? 38 LYS A O    8  
ATOM 10528 C CB   . LYS A 1 38 ? 0.410   2.657   10.020  1.00 15.00 ? 38 LYS A CB   8  
ATOM 10529 C CG   . LYS A 1 38 ? 0.892   4.059   10.382  1.00 15.00 ? 38 LYS A CG   8  
ATOM 10530 C CD   . LYS A 1 38 ? 1.391   4.114   11.816  1.00 15.00 ? 38 LYS A CD   8  
ATOM 10531 C CE   . LYS A 1 38 ? 0.450   4.913   12.703  1.00 15.00 ? 38 LYS A CE   8  
ATOM 10532 N NZ   . LYS A 1 38 ? 0.465   4.425   14.110  1.00 15.00 ? 38 LYS A NZ   8  
ATOM 10533 H H    . LYS A 1 38 ? 0.482   2.041   7.515   1.00 15.00 ? 38 LYS A H    8  
ATOM 10534 H HA   . LYS A 1 38 ? -1.570  1.974   9.537   1.00 15.00 ? 38 LYS A HA   8  
ATOM 10535 H HB2  . LYS A 1 38 ? 0.161   2.147   10.938  1.00 15.00 ? 38 LYS A HB2  8  
ATOM 10536 H HB3  . LYS A 1 38 ? 1.228   2.133   9.547   1.00 15.00 ? 38 LYS A HB3  8  
ATOM 10537 H HG2  . LYS A 1 38 ? 1.699   4.334   9.720   1.00 15.00 ? 38 LYS A HG2  8  
ATOM 10538 H HG3  . LYS A 1 38 ? 0.078   4.758   10.269  1.00 15.00 ? 38 LYS A HG3  8  
ATOM 10539 H HD2  . LYS A 1 38 ? 1.461   3.107   12.199  1.00 15.00 ? 38 LYS A HD2  8  
ATOM 10540 H HD3  . LYS A 1 38 ? 2.367   4.576   11.831  1.00 15.00 ? 38 LYS A HD3  8  
ATOM 10541 H HE2  . LYS A 1 38 ? 0.753   5.949   12.687  1.00 15.00 ? 38 LYS A HE2  8  
ATOM 10542 H HE3  . LYS A 1 38 ? -0.553  4.825   12.311  1.00 15.00 ? 38 LYS A HE3  8  
ATOM 10543 H HZ1  . LYS A 1 38 ? -0.452  4.615   14.564  1.00 15.00 ? 38 LYS A HZ1  8  
ATOM 10544 H HZ2  . LYS A 1 38 ? 0.645   3.401   14.132  1.00 15.00 ? 38 LYS A HZ2  8  
ATOM 10545 H HZ3  . LYS A 1 38 ? 1.212   4.909   14.648  1.00 15.00 ? 38 LYS A HZ3  8  
ATOM 10546 N N    . ALA A 1 39 ? -0.683  4.776   8.043   1.00 15.00 ? 39 ALA A N    8  
ATOM 10547 C CA   . ALA A 1 39 ? -1.133  6.110   7.684   1.00 15.00 ? 39 ALA A CA   8  
ATOM 10548 C C    . ALA A 1 39 ? -0.206  6.710   6.639   1.00 15.00 ? 39 ALA A C    8  
ATOM 10549 O O    . ALA A 1 39 ? 0.837   6.137   6.337   1.00 15.00 ? 39 ALA A O    8  
ATOM 10550 C CB   . ALA A 1 39 ? -1.214  6.999   8.913   1.00 15.00 ? 39 ALA A CB   8  
ATOM 10551 H H    . ALA A 1 39 ? 0.173   4.451   7.679   1.00 15.00 ? 39 ALA A H    8  
ATOM 10552 H HA   . ALA A 1 39 ? -2.124  6.025   7.262   1.00 15.00 ? 39 ALA A HA   8  
ATOM 10553 H HB1  . ALA A 1 39 ? -2.241  7.062   9.240   1.00 15.00 ? 39 ALA A HB1  8  
ATOM 10554 H HB2  . ALA A 1 39 ? -0.610  6.577   9.702   1.00 15.00 ? 39 ALA A HB2  8  
ATOM 10555 H HB3  . ALA A 1 39 ? -0.851  7.986   8.668   1.00 15.00 ? 39 ALA A HB3  8  
ATOM 10556 N N    . VAL A 1 40 ? -0.569  7.873   6.112   1.00 15.00 ? 40 VAL A N    8  
ATOM 10557 C CA   . VAL A 1 40 ? 0.265   8.547   5.119   1.00 15.00 ? 40 VAL A CA   8  
ATOM 10558 C C    . VAL A 1 40 ? 1.124   9.591   5.820   1.00 15.00 ? 40 VAL A C    8  
ATOM 10559 O O    . VAL A 1 40 ? 0.611   10.558  6.381   1.00 15.00 ? 40 VAL A O    8  
ATOM 10560 C CB   . VAL A 1 40 ? -0.566  9.225   4.001   1.00 15.00 ? 40 VAL A CB   8  
ATOM 10561 C CG1  . VAL A 1 40 ? -0.426  8.463   2.691   1.00 15.00 ? 40 VAL A CG1  8  
ATOM 10562 C CG2  . VAL A 1 40 ? -2.030  9.339   4.396   1.00 15.00 ? 40 VAL A CG2  8  
ATOM 10563 H H    . VAL A 1 40 ? -1.401  8.295   6.411   1.00 15.00 ? 40 VAL A H    8  
ATOM 10564 H HA   . VAL A 1 40 ? 0.909   7.803   4.668   1.00 15.00 ? 40 VAL A HA   8  
ATOM 10565 H HB   . VAL A 1 40 ? -0.180  10.223  3.850   1.00 15.00 ? 40 VAL A HB   8  
ATOM 10566 H HG11 . VAL A 1 40 ? 0.618   8.400   2.422   1.00 15.00 ? 40 VAL A HG11 8  
ATOM 10567 H HG12 . VAL A 1 40 ? -0.831  7.466   2.804   1.00 15.00 ? 40 VAL A HG12 8  
ATOM 10568 H HG13 . VAL A 1 40 ? -0.965  8.984   1.913   1.00 15.00 ? 40 VAL A HG13 8  
ATOM 10569 H HG21 . VAL A 1 40 ? -2.604  9.698   3.555   1.00 15.00 ? 40 VAL A HG21 8  
ATOM 10570 H HG22 . VAL A 1 40 ? -2.396  8.368   4.695   1.00 15.00 ? 40 VAL A HG22 8  
ATOM 10571 H HG23 . VAL A 1 40 ? -2.127  10.029  5.221   1.00 15.00 ? 40 VAL A HG23 8  
ATOM 10572 N N    . ILE A 1 41 ? 2.431   9.355   5.835   1.00 15.00 ? 41 ILE A N    8  
ATOM 10573 C CA   . ILE A 1 41 ? 3.357   10.240  6.528   1.00 15.00 ? 41 ILE A CA   8  
ATOM 10574 C C    . ILE A 1 41 ? 3.664   11.521  5.750   1.00 15.00 ? 41 ILE A C    8  
ATOM 10575 O O    . ILE A 1 41 ? 4.221   11.479  4.652   1.00 15.00 ? 41 ILE A O    8  
ATOM 10576 C CB   . ILE A 1 41 ? 4.663   9.487   6.898   1.00 15.00 ? 41 ILE A CB   8  
ATOM 10577 C CG1  . ILE A 1 41 ? 4.423   8.521   8.069   1.00 15.00 ? 41 ILE A CG1  8  
ATOM 10578 C CG2  . ILE A 1 41 ? 5.788   10.451  7.242   1.00 15.00 ? 41 ILE A CG2  8  
ATOM 10579 C CD1  . ILE A 1 41 ? 3.013   7.970   8.148   1.00 15.00 ? 41 ILE A CD1  8  
ATOM 10580 H H    . ILE A 1 41 ? 2.775   8.544   5.407   1.00 15.00 ? 41 ILE A H    8  
ATOM 10581 H HA   . ILE A 1 41 ? 2.876   10.525  7.436   1.00 15.00 ? 41 ILE A HA   8  
ATOM 10582 H HB   . ILE A 1 41 ? 4.973   8.915   6.043   1.00 15.00 ? 41 ILE A HB   8  
ATOM 10583 H HG12 . ILE A 1 41 ? 5.095   7.681   7.973   1.00 15.00 ? 41 ILE A HG12 8  
ATOM 10584 H HG13 . ILE A 1 41 ? 4.630   9.034   8.997   1.00 15.00 ? 41 ILE A HG13 8  
ATOM 10585 H HG21 . ILE A 1 41 ? 5.372   11.404  7.532   1.00 15.00 ? 41 ILE A HG21 8  
ATOM 10586 H HG22 . ILE A 1 41 ? 6.367   10.047  8.060   1.00 15.00 ? 41 ILE A HG22 8  
ATOM 10587 H HG23 . ILE A 1 41 ? 6.425   10.580  6.379   1.00 15.00 ? 41 ILE A HG23 8  
ATOM 10588 H HD11 . ILE A 1 41 ? 2.324   8.774   8.358   1.00 15.00 ? 41 ILE A HD11 8  
ATOM 10589 H HD12 . ILE A 1 41 ? 2.753   7.510   7.206   1.00 15.00 ? 41 ILE A HD12 8  
ATOM 10590 H HD13 . ILE A 1 41 ? 2.957   7.234   8.935   1.00 15.00 ? 41 ILE A HD13 8  
ATOM 10591 N N    . PRO A 1 42 ? 3.305   12.686  6.345   1.00 15.00 ? 42 PRO A N    8  
ATOM 10592 C CA   . PRO A 1 42 ? 3.531   14.007  5.742   1.00 15.00 ? 42 PRO A CA   8  
ATOM 10593 C C    . PRO A 1 42 ? 5.012   14.340  5.589   1.00 15.00 ? 42 PRO A C    8  
ATOM 10594 O O    . PRO A 1 42 ? 5.503   15.308  6.171   1.00 15.00 ? 42 PRO A O    8  
ATOM 10595 C CB   . PRO A 1 42 ? 2.869   14.977  6.727   1.00 15.00 ? 42 PRO A CB   8  
ATOM 10596 C CG   . PRO A 1 42 ? 2.839   14.245  8.021   1.00 15.00 ? 42 PRO A CG   8  
ATOM 10597 C CD   . PRO A 1 42 ? 2.653   12.800  7.666   1.00 15.00 ? 42 PRO A CD   8  
ATOM 10598 H HA   . PRO A 1 42 ? 3.045   14.090  4.786   1.00 15.00 ? 42 PRO A HA   8  
ATOM 10599 H HB2  . PRO A 1 42 ? 3.456   15.881  6.798   1.00 15.00 ? 42 PRO A HB2  8  
ATOM 10600 H HB3  . PRO A 1 42 ? 1.872   15.215  6.387   1.00 15.00 ? 42 PRO A HB3  8  
ATOM 10601 H HG2  . PRO A 1 42 ? 3.773   14.387  8.545   1.00 15.00 ? 42 PRO A HG2  8  
ATOM 10602 H HG3  . PRO A 1 42 ? 2.012   14.593  8.622   1.00 15.00 ? 42 PRO A HG3  8  
ATOM 10603 H HD2  . PRO A 1 42 ? 3.142   12.169  8.393   1.00 15.00 ? 42 PRO A HD2  8  
ATOM 10604 H HD3  . PRO A 1 42 ? 1.603   12.559  7.599   1.00 15.00 ? 42 PRO A HD3  8  
ATOM 10605 N N    . GLN A 1 43 ? 5.723   13.537  4.805   1.00 15.00 ? 43 GLN A N    8  
ATOM 10606 C CA   . GLN A 1 43 ? 7.146   13.760  4.586   1.00 15.00 ? 43 GLN A CA   8  
ATOM 10607 C C    . GLN A 1 43 ? 7.590   13.240  3.221   1.00 15.00 ? 43 GLN A C    8  
ATOM 10608 O O    . GLN A 1 43 ? 8.313   13.923  2.495   1.00 15.00 ? 43 GLN A O    8  
ATOM 10609 C CB   . GLN A 1 43 ? 7.963   13.087  5.691   1.00 15.00 ? 43 GLN A CB   8  
ATOM 10610 C CG   . GLN A 1 43 ? 8.361   14.032  6.813   1.00 15.00 ? 43 GLN A CG   8  
ATOM 10611 C CD   . GLN A 1 43 ? 9.698   14.702  6.563   1.00 15.00 ? 43 GLN A CD   8  
ATOM 10612 O OE1  . GLN A 1 43 ? 10.291  14.551  5.496   1.00 15.00 ? 43 GLN A OE1  8  
ATOM 10613 N NE2  . GLN A 1 43 ? 10.179  15.447  7.551   1.00 15.00 ? 43 GLN A NE2  8  
ATOM 10614 H H    . GLN A 1 43 ? 5.281   12.780  4.367   1.00 15.00 ? 43 GLN A H    8  
ATOM 10615 H HA   . GLN A 1 43 ? 7.321   14.824  4.623   1.00 15.00 ? 43 GLN A HA   8  
ATOM 10616 H HB2  . GLN A 1 43 ? 7.379   12.285  6.116   1.00 15.00 ? 43 GLN A HB2  8  
ATOM 10617 H HB3  . GLN A 1 43 ? 8.863   12.676  5.259   1.00 15.00 ? 43 GLN A HB3  8  
ATOM 10618 H HG2  . GLN A 1 43 ? 7.605   14.797  6.908   1.00 15.00 ? 43 GLN A HG2  8  
ATOM 10619 H HG3  . GLN A 1 43 ? 8.422   13.471  7.734   1.00 15.00 ? 43 GLN A HG3  8  
ATOM 10620 H HE21 . GLN A 1 43 ? 9.652   15.522  8.374   1.00 15.00 ? 43 GLN A HE21 8  
ATOM 10621 H HE22 . GLN A 1 43 ? 11.042  15.892  7.417   1.00 15.00 ? 43 GLN A HE22 8  
ATOM 10622 N N    . GLY A 1 44 ? 7.170   12.025  2.880   1.00 15.00 ? 44 GLY A N    8  
ATOM 10623 C CA   . GLY A 1 44 ? 7.559   11.445  1.604   1.00 15.00 ? 44 GLY A CA   8  
ATOM 10624 C C    . GLY A 1 44 ? 6.626   11.805  0.463   1.00 15.00 ? 44 GLY A C    8  
ATOM 10625 O O    . GLY A 1 44 ? 5.525   12.313  0.676   1.00 15.00 ? 44 GLY A O    8  
ATOM 10626 H H    . GLY A 1 44 ? 6.601   11.517  3.499   1.00 15.00 ? 44 GLY A H    8  
ATOM 10627 H HA2  . GLY A 1 44 ? 8.549   11.796  1.358   1.00 15.00 ? 44 GLY A HA2  8  
ATOM 10628 H HA3  . GLY A 1 44 ? 7.593   10.374  1.701   1.00 15.00 ? 44 GLY A HA3  8  
ATOM 10629 N N    . ALA A 1 45 ? 7.084   11.530  -0.753  1.00 15.00 ? 45 ALA A N    8  
ATOM 10630 C CA   . ALA A 1 45 ? 6.321   11.818  -1.967  1.00 15.00 ? 45 ALA A CA   8  
ATOM 10631 C C    . ALA A 1 45 ? 4.949   11.148  -1.971  1.00 15.00 ? 45 ALA A C    8  
ATOM 10632 O O    . ALA A 1 45 ? 4.094   11.485  -2.791  1.00 15.00 ? 45 ALA A O    8  
ATOM 10633 C CB   . ALA A 1 45 ? 7.110   11.386  -3.191  1.00 15.00 ? 45 ALA A CB   8  
ATOM 10634 H H    . ALA A 1 45 ? 7.969   11.119  -0.838  1.00 15.00 ? 45 ALA A H    8  
ATOM 10635 H HA   . ALA A 1 45 ? 6.185   12.888  -2.024  1.00 15.00 ? 45 ALA A HA   8  
ATOM 10636 H HB1  . ALA A 1 45 ? 7.040   12.147  -3.953  1.00 15.00 ? 45 ALA A HB1  8  
ATOM 10637 H HB2  . ALA A 1 45 ? 8.145   11.242  -2.919  1.00 15.00 ? 45 ALA A HB2  8  
ATOM 10638 H HB3  . ALA A 1 45 ? 6.705   10.458  -3.569  1.00 15.00 ? 45 ALA A HB3  8  
ATOM 10639 N N    . ALA A 1 46 ? 4.735   10.199  -1.068  1.00 15.00 ? 46 ALA A N    8  
ATOM 10640 C CA   . ALA A 1 46 ? 3.459   9.499   -1.002  1.00 15.00 ? 46 ALA A CA   8  
ATOM 10641 C C    . ALA A 1 46 ? 2.374   10.407  -0.448  1.00 15.00 ? 46 ALA A C    8  
ATOM 10642 O O    . ALA A 1 46 ? 1.354   10.639  -1.099  1.00 15.00 ? 46 ALA A O    8  
ATOM 10643 C CB   . ALA A 1 46 ? 3.582   8.250   -0.145  1.00 15.00 ? 46 ALA A CB   8  
ATOM 10644 H H    . ALA A 1 46 ? 5.445   9.959   -0.441  1.00 15.00 ? 46 ALA A H    8  
ATOM 10645 H HA   . ALA A 1 46 ? 3.190   9.197   -2.004  1.00 15.00 ? 46 ALA A HA   8  
ATOM 10646 H HB1  . ALA A 1 46 ? 2.647   7.710   -0.160  1.00 15.00 ? 46 ALA A HB1  8  
ATOM 10647 H HB2  . ALA A 1 46 ? 4.368   7.620   -0.536  1.00 15.00 ? 46 ALA A HB2  8  
ATOM 10648 H HB3  . ALA A 1 46 ? 3.818   8.533   0.871   1.00 15.00 ? 46 ALA A HB3  8  
ATOM 10649 N N    . GLU A 1 47 ? 2.602   10.928  0.752   1.00 15.00 ? 47 GLU A N    8  
ATOM 10650 C CA   . GLU A 1 47 ? 1.644   11.825  1.386   1.00 15.00 ? 47 GLU A CA   8  
ATOM 10651 C C    . GLU A 1 47 ? 1.370   13.032  0.489   1.00 15.00 ? 47 GLU A C    8  
ATOM 10652 O O    . GLU A 1 47 ? 0.226   13.460  0.336   1.00 15.00 ? 47 GLU A O    8  
ATOM 10653 C CB   . GLU A 1 47 ? 2.171   12.298  2.750   1.00 15.00 ? 47 GLU A CB   8  
ATOM 10654 C CG   . GLU A 1 47 ? 3.337   13.263  2.622   1.00 15.00 ? 47 GLU A CG   8  
ATOM 10655 C CD   . GLU A 1 47 ? 2.890   14.700  2.440   1.00 15.00 ? 47 GLU A CD   8  
ATOM 10656 O OE1  . GLU A 1 47 ? 1.729   15.009  2.784   1.00 15.00 ? 47 GLU A OE1  8  
ATOM 10657 O OE2  . GLU A 1 47 ? 3.700   15.517  1.954   1.00 15.00 ? 47 GLU A OE2  8  
ATOM 10658 H H    . GLU A 1 47 ? 3.442   10.716  1.216   1.00 15.00 ? 47 GLU A H    8  
ATOM 10659 H HA   . GLU A 1 47 ? 0.718   11.281  1.525   1.00 15.00 ? 47 GLU A HA   8  
ATOM 10660 H HB2  . GLU A 1 47 ? 1.375   12.800  3.272   1.00 15.00 ? 47 GLU A HB2  8  
ATOM 10661 H HB3  . GLU A 1 47 ? 2.493   11.443  3.343   1.00 15.00 ? 47 GLU A HB3  8  
ATOM 10662 H HG2  . GLU A 1 47 ? 3.936   13.201  3.508   1.00 15.00 ? 47 GLU A HG2  8  
ATOM 10663 H HG3  . GLU A 1 47 ? 3.930   12.977  1.771   1.00 15.00 ? 47 GLU A HG3  8  
ATOM 10664 N N    . SER A 1 48 ? 2.437   13.579  -0.097  1.00 15.00 ? 48 SER A N    8  
ATOM 10665 C CA   . SER A 1 48 ? 2.325   14.740  -0.975  1.00 15.00 ? 48 SER A CA   8  
ATOM 10666 C C    . SER A 1 48 ? 1.316   14.479  -2.082  1.00 15.00 ? 48 SER A C    8  
ATOM 10667 O O    . SER A 1 48 ? 0.216   15.032  -2.074  1.00 15.00 ? 48 SER A O    8  
ATOM 10668 C CB   . SER A 1 48 ? 3.688   15.087  -1.577  1.00 15.00 ? 48 SER A CB   8  
ATOM 10669 O OG   . SER A 1 48 ? 3.630   16.303  -2.304  1.00 15.00 ? 48 SER A OG   8  
ATOM 10670 H H    . SER A 1 48 ? 3.321   13.192  0.067   1.00 15.00 ? 48 SER A H    8  
ATOM 10671 H HA   . SER A 1 48 ? 1.981   15.573  -0.380  1.00 15.00 ? 48 SER A HA   8  
ATOM 10672 H HB2  . SER A 1 48 ? 4.413   15.192  -0.784  1.00 15.00 ? 48 SER A HB2  8  
ATOM 10673 H HB3  . SER A 1 48 ? 3.997   14.297  -2.244  1.00 15.00 ? 48 SER A HB3  8  
ATOM 10674 H HG   . SER A 1 48 ? 4.269   16.279  -3.020  1.00 15.00 ? 48 SER A HG   8  
ATOM 10675 N N    . ASP A 1 49 ? 1.684   13.618  -3.024  1.00 15.00 ? 49 ASP A N    8  
ATOM 10676 C CA   . ASP A 1 49 ? 0.789   13.275  -4.118  1.00 15.00 ? 49 ASP A CA   8  
ATOM 10677 C C    . ASP A 1 49 ? -0.498  12.693  -3.554  1.00 15.00 ? 49 ASP A C    8  
ATOM 10678 O O    . ASP A 1 49 ? -1.595  12.992  -4.027  1.00 15.00 ? 49 ASP A O    8  
ATOM 10679 C CB   . ASP A 1 49 ? 1.454   12.268  -5.059  1.00 15.00 ? 49 ASP A CB   8  
ATOM 10680 C CG   . ASP A 1 49 ? 2.115   12.938  -6.248  1.00 15.00 ? 49 ASP A CG   8  
ATOM 10681 O OD1  . ASP A 1 49 ? 3.094   13.685  -6.041  1.00 15.00 ? 49 ASP A OD1  8  
ATOM 10682 O OD2  . ASP A 1 49 ? 1.652   12.717  -7.387  1.00 15.00 ? 49 ASP A OD2  8  
ATOM 10683 H H    . ASP A 1 49 ? 2.566   13.193  -2.972  1.00 15.00 ? 49 ASP A H    8  
ATOM 10684 H HA   . ASP A 1 49 ? 0.561   14.177  -4.663  1.00 15.00 ? 49 ASP A HA   8  
ATOM 10685 H HB2  . ASP A 1 49 ? 2.208   11.719  -4.515  1.00 15.00 ? 49 ASP A HB2  8  
ATOM 10686 H HB3  . ASP A 1 49 ? 0.707   11.580  -5.426  1.00 15.00 ? 49 ASP A HB3  8  
ATOM 10687 N N    . GLY A 1 50 ? -0.346  11.861  -2.529  1.00 15.00 ? 50 GLY A N    8  
ATOM 10688 C CA   . GLY A 1 50 ? -1.489  11.244  -1.893  1.00 15.00 ? 50 GLY A CA   8  
ATOM 10689 C C    . GLY A 1 50 ? -1.979  10.040  -2.670  1.00 15.00 ? 50 GLY A C    8  
ATOM 10690 O O    . GLY A 1 50 ? -3.180  9.880   -2.890  1.00 15.00 ? 50 GLY A O    8  
ATOM 10691 H H    . GLY A 1 50 ? 0.556   11.670  -2.198  1.00 15.00 ? 50 GLY A H    8  
ATOM 10692 H HA2  . GLY A 1 50 ? -1.204  10.934  -0.891  1.00 15.00 ? 50 GLY A HA2  8  
ATOM 10693 H HA3  . GLY A 1 50 ? -2.287  11.968  -1.824  1.00 15.00 ? 50 GLY A HA3  8  
ATOM 10694 N N    . ARG A 1 51 ? -1.046  9.197   -3.097  1.00 15.00 ? 51 ARG A N    8  
ATOM 10695 C CA   . ARG A 1 51 ? -1.387  8.007   -3.869  1.00 15.00 ? 51 ARG A CA   8  
ATOM 10696 C C    . ARG A 1 51 ? -1.886  6.901   -2.950  1.00 15.00 ? 51 ARG A C    8  
ATOM 10697 O O    . ARG A 1 51 ? -2.979  6.366   -3.140  1.00 15.00 ? 51 ARG A O    8  
ATOM 10698 C CB   . ARG A 1 51 ? -0.166  7.525   -4.658  1.00 15.00 ? 51 ARG A CB   8  
ATOM 10699 C CG   . ARG A 1 51 ? -0.438  7.306   -6.138  1.00 15.00 ? 51 ARG A CG   8  
ATOM 10700 C CD   . ARG A 1 51 ? -0.873  8.589   -6.825  1.00 15.00 ? 51 ARG A CD   8  
ATOM 10701 N NE   . ARG A 1 51 ? -2.326  8.741   -6.837  1.00 15.00 ? 51 ARG A NE   8  
ATOM 10702 C CZ   . ARG A 1 51 ? -2.950  9.859   -7.199  1.00 15.00 ? 51 ARG A CZ   8  
ATOM 10703 N NH1  . ARG A 1 51 ? -2.253  10.921  -7.582  1.00 15.00 ? 51 ARG A NH1  8  
ATOM 10704 N NH2  . ARG A 1 51 ? -4.275  9.915   -7.181  1.00 15.00 ? 51 ARG A NH2  8  
ATOM 10705 H H    . ARG A 1 51 ? -0.103  9.385   -2.897  1.00 15.00 ? 51 ARG A H    8  
ATOM 10706 H HA   . ARG A 1 51 ? -2.173  8.271   -4.560  1.00 15.00 ? 51 ARG A HA   8  
ATOM 10707 H HB2  . ARG A 1 51 ? 0.620   8.259   -4.564  1.00 15.00 ? 51 ARG A HB2  8  
ATOM 10708 H HB3  . ARG A 1 51 ? 0.176   6.591   -4.236  1.00 15.00 ? 51 ARG A HB3  8  
ATOM 10709 H HG2  . ARG A 1 51 ? 0.466   6.951   -6.609  1.00 15.00 ? 51 ARG A HG2  8  
ATOM 10710 H HG3  . ARG A 1 51 ? -1.217  6.566   -6.246  1.00 15.00 ? 51 ARG A HG3  8  
ATOM 10711 H HD2  . ARG A 1 51 ? -0.437  9.428   -6.303  1.00 15.00 ? 51 ARG A HD2  8  
ATOM 10712 H HD3  . ARG A 1 51 ? -0.513  8.573   -7.844  1.00 15.00 ? 51 ARG A HD3  8  
ATOM 10713 H HE   . ARG A 1 51 ? -2.864  7.970   -6.560  1.00 15.00 ? 51 ARG A HE   8  
ATOM 10714 H HH11 . ARG A 1 51 ? -1.254  10.885  -7.600  1.00 15.00 ? 51 ARG A HH11 8  
ATOM 10715 H HH12 . ARG A 1 51 ? -2.727  11.759  -7.853  1.00 15.00 ? 51 ARG A HH12 8  
ATOM 10716 H HH21 . ARG A 1 51 ? -4.805  9.117   -6.895  1.00 15.00 ? 51 ARG A HH21 8  
ATOM 10717 H HH22 . ARG A 1 51 ? -4.744  10.755  -7.453  1.00 15.00 ? 51 ARG A HH22 8  
ATOM 10718 N N    . ILE A 1 52 ? -1.082  6.570   -1.950  1.00 15.00 ? 52 ILE A N    8  
ATOM 10719 C CA   . ILE A 1 52 ? -1.434  5.541   -0.993  1.00 15.00 ? 52 ILE A CA   8  
ATOM 10720 C C    . ILE A 1 52 ? -2.375  6.105   0.073   1.00 15.00 ? 52 ILE A C    8  
ATOM 10721 O O    . ILE A 1 52 ? -2.514  7.322   0.202   1.00 15.00 ? 52 ILE A O    8  
ATOM 10722 C CB   . ILE A 1 52 ? -0.162  4.969   -0.340  1.00 15.00 ? 52 ILE A CB   8  
ATOM 10723 C CG1  . ILE A 1 52 ? -0.486  3.719   0.472   1.00 15.00 ? 52 ILE A CG1  8  
ATOM 10724 C CG2  . ILE A 1 52 ? 0.514   6.025   0.523   1.00 15.00 ? 52 ILE A CG2  8  
ATOM 10725 C CD1  . ILE A 1 52 ? -1.187  2.646   -0.327  1.00 15.00 ? 52 ILE A CD1  8  
ATOM 10726 H H    . ILE A 1 52 ? -0.229  7.034   -1.848  1.00 15.00 ? 52 ILE A H    8  
ATOM 10727 H HA   . ILE A 1 52 ? -1.937  4.747   -1.525  1.00 15.00 ? 52 ILE A HA   8  
ATOM 10728 H HB   . ILE A 1 52 ? 0.525   4.703   -1.130  1.00 15.00 ? 52 ILE A HB   8  
ATOM 10729 H HG12 . ILE A 1 52 ? 0.432   3.298   0.848   1.00 15.00 ? 52 ILE A HG12 8  
ATOM 10730 H HG13 . ILE A 1 52 ? -1.121  3.990   1.300   1.00 15.00 ? 52 ILE A HG13 8  
ATOM 10731 H HG21 . ILE A 1 52 ? -0.195  6.416   1.236   1.00 15.00 ? 52 ILE A HG21 8  
ATOM 10732 H HG22 . ILE A 1 52 ? 1.348   5.583   1.047   1.00 15.00 ? 52 ILE A HG22 8  
ATOM 10733 H HG23 . ILE A 1 52 ? 0.870   6.828   -0.105  1.00 15.00 ? 52 ILE A HG23 8  
ATOM 10734 H HD11 . ILE A 1 52 ? -1.504  1.853   0.333   1.00 15.00 ? 52 ILE A HD11 8  
ATOM 10735 H HD12 . ILE A 1 52 ? -2.048  3.070   -0.820  1.00 15.00 ? 52 ILE A HD12 8  
ATOM 10736 H HD13 . ILE A 1 52 ? -0.509  2.250   -1.068  1.00 15.00 ? 52 ILE A HD13 8  
ATOM 10737 N N    . HIS A 1 53 ? -3.034  5.225   0.822   1.00 15.00 ? 53 HIS A N    8  
ATOM 10738 C CA   . HIS A 1 53 ? -3.972  5.659   1.854   1.00 15.00 ? 53 HIS A CA   8  
ATOM 10739 C C    . HIS A 1 53 ? -3.982  4.724   3.046   1.00 15.00 ? 53 HIS A C    8  
ATOM 10740 O O    . HIS A 1 53 ? -3.594  3.561   2.957   1.00 15.00 ? 53 HIS A O    8  
ATOM 10741 C CB   . HIS A 1 53 ? -5.382  5.785   1.275   1.00 15.00 ? 53 HIS A CB   8  
ATOM 10742 C CG   . HIS A 1 53 ? -5.517  6.878   0.260   1.00 15.00 ? 53 HIS A CG   8  
ATOM 10743 N ND1  . HIS A 1 53 ? -5.408  6.662   -1.097  1.00 15.00 ? 53 HIS A ND1  8  
ATOM 10744 C CD2  . HIS A 1 53 ? -5.754  8.203   0.411   1.00 15.00 ? 53 HIS A CD2  8  
ATOM 10745 C CE1  . HIS A 1 53 ? -5.572  7.807   -1.738  1.00 15.00 ? 53 HIS A CE1  8  
ATOM 10746 N NE2  . HIS A 1 53 ? -5.784  8.756   -0.846  1.00 15.00 ? 53 HIS A NE2  8  
ATOM 10747 H H    . HIS A 1 53 ? -2.896  4.270   0.670   1.00 15.00 ? 53 HIS A H    8  
ATOM 10748 H HA   . HIS A 1 53 ? -3.653  6.625   2.207   1.00 15.00 ? 53 HIS A HA   8  
ATOM 10749 H HB2  . HIS A 1 53 ? -5.653  4.855   0.799   1.00 15.00 ? 53 HIS A HB2  8  
ATOM 10750 H HB3  . HIS A 1 53 ? -6.076  5.988   2.078   1.00 15.00 ? 53 HIS A HB3  8  
ATOM 10751 H HD1  . HIS A 1 53 ? -5.236  5.799   -1.528  1.00 15.00 ? 53 HIS A HD1  8  
ATOM 10752 H HD2  . HIS A 1 53 ? -5.895  8.727   1.346   1.00 15.00 ? 53 HIS A HD2  8  
ATOM 10753 H HE1  . HIS A 1 53 ? -5.539  7.942   -2.809  1.00 15.00 ? 53 HIS A HE1  8  
ATOM 10754 H HE2  . HIS A 1 53 ? -5.848  9.714   -1.045  1.00 15.00 ? 53 HIS A HE2  8  
ATOM 10755 N N    . LYS A 1 54 ? -4.415  5.279   4.169   1.00 15.00 ? 54 LYS A N    8  
ATOM 10756 C CA   . LYS A 1 54 ? -4.477  4.569   5.433   1.00 15.00 ? 54 LYS A CA   8  
ATOM 10757 C C    . LYS A 1 54 ? -5.050  3.155   5.297   1.00 15.00 ? 54 LYS A C    8  
ATOM 10758 O O    . LYS A 1 54 ? -6.081  2.947   4.657   1.00 15.00 ? 54 LYS A O    8  
ATOM 10759 C CB   . LYS A 1 54 ? -5.313  5.369   6.435   1.00 15.00 ? 54 LYS A CB   8  
ATOM 10760 C CG   . LYS A 1 54 ? -4.559  5.738   7.699   1.00 15.00 ? 54 LYS A CG   8  
ATOM 10761 C CD   . LYS A 1 54 ? -5.447  5.635   8.929   1.00 15.00 ? 54 LYS A CD   8  
ATOM 10762 C CE   . LYS A 1 54 ? -5.558  4.200   9.420   1.00 15.00 ? 54 LYS A CE   8  
ATOM 10763 N NZ   . LYS A 1 54 ? -6.920  3.640   9.200   1.00 15.00 ? 54 LYS A NZ   8  
ATOM 10764 H H    . LYS A 1 54 ? -4.687  6.218   4.149   1.00 15.00 ? 54 LYS A H    8  
ATOM 10765 H HA   . LYS A 1 54 ? -3.468  4.506   5.799   1.00 15.00 ? 54 LYS A HA   8  
ATOM 10766 H HB2  . LYS A 1 54 ? -5.645  6.281   5.961   1.00 15.00 ? 54 LYS A HB2  8  
ATOM 10767 H HB3  . LYS A 1 54 ? -6.178  4.786   6.715   1.00 15.00 ? 54 LYS A HB3  8  
ATOM 10768 H HG2  . LYS A 1 54 ? -3.725  5.066   7.813   1.00 15.00 ? 54 LYS A HG2  8  
ATOM 10769 H HG3  . LYS A 1 54 ? -4.199  6.752   7.609   1.00 15.00 ? 54 LYS A HG3  8  
ATOM 10770 H HD2  . LYS A 1 54 ? -5.026  6.243   9.717   1.00 15.00 ? 54 LYS A HD2  8  
ATOM 10771 H HD3  . LYS A 1 54 ? -6.433  5.999   8.680   1.00 15.00 ? 54 LYS A HD3  8  
ATOM 10772 H HE2  . LYS A 1 54 ? -4.839  3.594   8.889   1.00 15.00 ? 54 LYS A HE2  8  
ATOM 10773 H HE3  . LYS A 1 54 ? -5.335  4.177   10.477  1.00 15.00 ? 54 LYS A HE3  8  
ATOM 10774 H HZ1  . LYS A 1 54 ? -7.174  3.000   9.979   1.00 15.00 ? 54 LYS A HZ1  8  
ATOM 10775 H HZ2  . LYS A 1 54 ? -7.620  4.409   9.155   1.00 15.00 ? 54 LYS A HZ2  8  
ATOM 10776 H HZ3  . LYS A 1 54 ? -6.947  3.108   8.307   1.00 15.00 ? 54 LYS A HZ3  8  
ATOM 10777 N N    . GLY A 1 55 ? -4.372  2.190   5.924   1.00 15.00 ? 55 GLY A N    8  
ATOM 10778 C CA   . GLY A 1 55 ? -4.818  0.807   5.889   1.00 15.00 ? 55 GLY A CA   8  
ATOM 10779 C C    . GLY A 1 55 ? -5.121  0.312   4.492   1.00 15.00 ? 55 GLY A C    8  
ATOM 10780 O O    . GLY A 1 55 ? -5.989  -0.541  4.306   1.00 15.00 ? 55 GLY A O    8  
ATOM 10781 H H    . GLY A 1 55 ? -3.557  2.424   6.424   1.00 15.00 ? 55 GLY A H    8  
ATOM 10782 H HA2  . GLY A 1 55 ? -4.047  0.181   6.314   1.00 15.00 ? 55 GLY A HA2  8  
ATOM 10783 H HA3  . GLY A 1 55 ? -5.710  0.715   6.491   1.00 15.00 ? 55 GLY A HA3  8  
ATOM 10784 N N    . ASP A 1 56 ? -4.406  0.837   3.506   1.00 15.00 ? 56 ASP A N    8  
ATOM 10785 C CA   . ASP A 1 56 ? -4.617  0.422   2.127   1.00 15.00 ? 56 ASP A CA   8  
ATOM 10786 C C    . ASP A 1 56 ? -4.225  -1.040  1.937   1.00 15.00 ? 56 ASP A C    8  
ATOM 10787 O O    . ASP A 1 56 ? -3.127  -1.451  2.317   1.00 15.00 ? 56 ASP A O    8  
ATOM 10788 C CB   . ASP A 1 56 ? -3.825  1.312   1.167   1.00 15.00 ? 56 ASP A CB   8  
ATOM 10789 C CG   . ASP A 1 56 ? -4.688  2.377   0.521   1.00 15.00 ? 56 ASP A CG   8  
ATOM 10790 O OD1  . ASP A 1 56 ? -5.919  2.358   0.733   1.00 15.00 ? 56 ASP A OD1  8  
ATOM 10791 O OD2  . ASP A 1 56 ? -4.133  3.231   -0.199  1.00 15.00 ? 56 ASP A OD2  8  
ATOM 10792 H H    . ASP A 1 56 ? -3.717  1.510   3.711   1.00 15.00 ? 56 ASP A H    8  
ATOM 10793 H HA   . ASP A 1 56 ? -5.670  0.525   1.913   1.00 15.00 ? 56 ASP A HA   8  
ATOM 10794 H HB2  . ASP A 1 56 ? -3.031  1.801   1.710   1.00 15.00 ? 56 ASP A HB2  8  
ATOM 10795 H HB3  . ASP A 1 56 ? -3.397  0.699   0.387   1.00 15.00 ? 56 ASP A HB3  8  
ATOM 10796 N N    . ARG A 1 57 ? -5.126  -1.818  1.343   1.00 15.00 ? 57 ARG A N    8  
ATOM 10797 C CA   . ARG A 1 57 ? -4.871  -3.232  1.096   1.00 15.00 ? 57 ARG A CA   8  
ATOM 10798 C C    . ARG A 1 57 ? -4.018  -3.405  -0.154  1.00 15.00 ? 57 ARG A C    8  
ATOM 10799 O O    . ARG A 1 57 ? -4.543  -3.556  -1.257  1.00 15.00 ? 57 ARG A O    8  
ATOM 10800 C CB   . ARG A 1 57 ? -6.189  -3.992  0.929   1.00 15.00 ? 57 ARG A CB   8  
ATOM 10801 C CG   . ARG A 1 57 ? -7.228  -3.659  1.987   1.00 15.00 ? 57 ARG A CG   8  
ATOM 10802 C CD   . ARG A 1 57 ? -8.227  -4.793  2.157   1.00 15.00 ? 57 ARG A CD   8  
ATOM 10803 N NE   . ARG A 1 57 ? -9.257  -4.475  3.143   1.00 15.00 ? 57 ARG A NE   8  
ATOM 10804 C CZ   . ARG A 1 57 ? -10.166 -5.348  3.571   1.00 15.00 ? 57 ARG A CZ   8  
ATOM 10805 N NH1  . ARG A 1 57 ? -10.174 -6.590  3.105   1.00 15.00 ? 57 ARG A NH1  8  
ATOM 10806 N NH2  . ARG A 1 57 ? -11.069 -4.978  4.469   1.00 15.00 ? 57 ARG A NH2  8  
ATOM 10807 H H    . ARG A 1 57 ? -5.981  -1.431  1.062   1.00 15.00 ? 57 ARG A H    8  
ATOM 10808 H HA   . ARG A 1 57 ? -4.337  -3.630  1.944   1.00 15.00 ? 57 ARG A HA   8  
ATOM 10809 H HB2  . ARG A 1 57 ? -6.605  -3.756  -0.038  1.00 15.00 ? 57 ARG A HB2  8  
ATOM 10810 H HB3  . ARG A 1 57 ? -5.987  -5.052  0.975   1.00 15.00 ? 57 ARG A HB3  8  
ATOM 10811 H HG2  . ARG A 1 57 ? -6.728  -3.487  2.928   1.00 15.00 ? 57 ARG A HG2  8  
ATOM 10812 H HG3  . ARG A 1 57 ? -7.757  -2.765  1.689   1.00 15.00 ? 57 ARG A HG3  8  
ATOM 10813 H HD2  . ARG A 1 57 ? -8.702  -4.982  1.205   1.00 15.00 ? 57 ARG A HD2  8  
ATOM 10814 H HD3  . ARG A 1 57 ? -7.697  -5.678  2.475   1.00 15.00 ? 57 ARG A HD3  8  
ATOM 10815 H HE   . ARG A 1 57 ? -9.272  -3.565  3.505   1.00 15.00 ? 57 ARG A HE   8  
ATOM 10816 H HH11 . ARG A 1 57 ? -9.496  -6.876  2.428   1.00 15.00 ? 57 ARG A HH11 8  
ATOM 10817 H HH12 . ARG A 1 57 ? -10.860 -7.241  3.430   1.00 15.00 ? 57 ARG A HH12 8  
ATOM 10818 H HH21 . ARG A 1 57 ? -11.066 -4.043  4.825   1.00 15.00 ? 57 ARG A HH21 8  
ATOM 10819 H HH22 . ARG A 1 57 ? -11.752 -5.633  4.791   1.00 15.00 ? 57 ARG A HH22 8  
ATOM 10820 N N    . VAL A 1 58 ? -2.700  -3.376  0.019   1.00 15.00 ? 58 VAL A N    8  
ATOM 10821 C CA   . VAL A 1 58 ? -1.789  -3.523  -1.107  1.00 15.00 ? 58 VAL A CA   8  
ATOM 10822 C C    . VAL A 1 58 ? -1.643  -4.990  -1.507  1.00 15.00 ? 58 VAL A C    8  
ATOM 10823 O O    . VAL A 1 58 ? -1.104  -5.807  -0.754  1.00 15.00 ? 58 VAL A O    8  
ATOM 10824 C CB   . VAL A 1 58 ? -0.402  -2.896  -0.813  1.00 15.00 ? 58 VAL A CB   8  
ATOM 10825 C CG1  . VAL A 1 58 ? -0.554  -1.620  0.003   1.00 15.00 ? 58 VAL A CG1  8  
ATOM 10826 C CG2  . VAL A 1 58 ? 0.519   -3.877  -0.100  1.00 15.00 ? 58 VAL A CG2  8  
ATOM 10827 H H    . VAL A 1 58 ? -2.336  -3.247  0.920   1.00 15.00 ? 58 VAL A H    8  
ATOM 10828 H HA   . VAL A 1 58 ? -2.225  -2.991  -1.939  1.00 15.00 ? 58 VAL A HA   8  
ATOM 10829 H HB   . VAL A 1 58 ? 0.051   -2.631  -1.757  1.00 15.00 ? 58 VAL A HB   8  
ATOM 10830 H HG11 . VAL A 1 58 ? -1.251  -0.958  -0.489  1.00 15.00 ? 58 VAL A HG11 8  
ATOM 10831 H HG12 . VAL A 1 58 ? -0.923  -1.865  0.988   1.00 15.00 ? 58 VAL A HG12 8  
ATOM 10832 H HG13 . VAL A 1 58 ? 0.406   -1.132  0.090   1.00 15.00 ? 58 VAL A HG13 8  
ATOM 10833 H HG21 . VAL A 1 58 ? 1.319   -3.335  0.381   1.00 15.00 ? 58 VAL A HG21 8  
ATOM 10834 H HG22 . VAL A 1 58 ? -0.043  -4.426  0.641   1.00 15.00 ? 58 VAL A HG22 8  
ATOM 10835 H HG23 . VAL A 1 58 ? 0.936   -4.567  -0.819  1.00 15.00 ? 58 VAL A HG23 8  
ATOM 10836 N N    . LEU A 1 59 ? -2.158  -5.314  -2.692  1.00 15.00 ? 59 LEU A N    8  
ATOM 10837 C CA   . LEU A 1 59 ? -2.113  -6.680  -3.204  1.00 15.00 ? 59 LEU A CA   8  
ATOM 10838 C C    . LEU A 1 59 ? -1.110  -6.843  -4.348  1.00 15.00 ? 59 LEU A C    8  
ATOM 10839 O O    . LEU A 1 59 ? -0.768  -7.965  -4.715  1.00 15.00 ? 59 LEU A O    8  
ATOM 10840 C CB   . LEU A 1 59 ? -3.504  -7.110  -3.675  1.00 15.00 ? 59 LEU A CB   8  
ATOM 10841 C CG   . LEU A 1 59 ? -4.587  -7.101  -2.595  1.00 15.00 ? 59 LEU A CG   8  
ATOM 10842 C CD1  . LEU A 1 59 ? -5.850  -7.778  -3.104  1.00 15.00 ? 59 LEU A CD1  8  
ATOM 10843 C CD2  . LEU A 1 59 ? -4.087  -7.783  -1.330  1.00 15.00 ? 59 LEU A CD2  8  
ATOM 10844 H H    . LEU A 1 59 ? -2.590  -4.617  -3.230  1.00 15.00 ? 59 LEU A H    8  
ATOM 10845 H HA   . LEU A 1 59 ? -1.812  -7.322  -2.391  1.00 15.00 ? 59 LEU A HA   8  
ATOM 10846 H HB2  . LEU A 1 59 ? -3.812  -6.447  -4.471  1.00 15.00 ? 59 LEU A HB2  8  
ATOM 10847 H HB3  . LEU A 1 59 ? -3.432  -8.111  -4.072  1.00 15.00 ? 59 LEU A HB3  8  
ATOM 10848 H HG   . LEU A 1 59 ? -4.833  -6.078  -2.349  1.00 15.00 ? 59 LEU A HG   8  
ATOM 10849 H HD11 . LEU A 1 59 ? -5.594  -8.729  -3.547  1.00 15.00 ? 59 LEU A HD11 8  
ATOM 10850 H HD12 . LEU A 1 59 ? -6.531  -7.936  -2.280  1.00 15.00 ? 59 LEU A HD12 8  
ATOM 10851 H HD13 . LEU A 1 59 ? -6.321  -7.150  -3.845  1.00 15.00 ? 59 LEU A HD13 8  
ATOM 10852 H HD21 . LEU A 1 59 ? -4.880  -8.379  -0.903  1.00 15.00 ? 59 LEU A HD21 8  
ATOM 10853 H HD22 . LEU A 1 59 ? -3.248  -8.420  -1.573  1.00 15.00 ? 59 LEU A HD22 8  
ATOM 10854 H HD23 . LEU A 1 59 ? -3.775  -7.034  -0.616  1.00 15.00 ? 59 LEU A HD23 8  
ATOM 10855 N N    . ALA A 1 60 ? -0.660  -5.734  -4.932  1.00 15.00 ? 60 ALA A N    8  
ATOM 10856 C CA   . ALA A 1 60 ? 0.278   -5.807  -6.051  1.00 15.00 ? 60 ALA A CA   8  
ATOM 10857 C C    . ALA A 1 60 ? 1.220   -4.606  -6.112  1.00 15.00 ? 60 ALA A C    8  
ATOM 10858 O O    . ALA A 1 60 ? 0.854   -3.488  -5.753  1.00 15.00 ? 60 ALA A O    8  
ATOM 10859 C CB   . ALA A 1 60 ? -0.490  -5.938  -7.358  1.00 15.00 ? 60 ALA A CB   8  
ATOM 10860 H H    . ALA A 1 60 ? -0.975  -4.861  -4.623  1.00 15.00 ? 60 ALA A H    8  
ATOM 10861 H HA   . ALA A 1 60 ? 0.869   -6.702  -5.931  1.00 15.00 ? 60 ALA A HA   8  
ATOM 10862 H HB1  . ALA A 1 60 ? -0.459  -6.965  -7.691  1.00 15.00 ? 60 ALA A HB1  8  
ATOM 10863 H HB2  . ALA A 1 60 ? -1.516  -5.641  -7.203  1.00 15.00 ? 60 ALA A HB2  8  
ATOM 10864 H HB3  . ALA A 1 60 ? -0.040  -5.303  -8.107  1.00 15.00 ? 60 ALA A HB3  8  
ATOM 10865 N N    . VAL A 1 61 ? 2.432   -4.859  -6.600  1.00 15.00 ? 61 VAL A N    8  
ATOM 10866 C CA   . VAL A 1 61 ? 3.453   -3.827  -6.757  1.00 15.00 ? 61 VAL A CA   8  
ATOM 10867 C C    . VAL A 1 61 ? 4.175   -4.039  -8.078  1.00 15.00 ? 61 VAL A C    8  
ATOM 10868 O O    . VAL A 1 61 ? 5.038   -4.909  -8.190  1.00 15.00 ? 61 VAL A O    8  
ATOM 10869 C CB   . VAL A 1 61 ? 4.480   -3.850  -5.609  1.00 15.00 ? 61 VAL A CB   8  
ATOM 10870 C CG1  . VAL A 1 61 ? 5.370   -2.617  -5.661  1.00 15.00 ? 61 VAL A CG1  8  
ATOM 10871 C CG2  . VAL A 1 61 ? 3.777   -3.958  -4.266  1.00 15.00 ? 61 VAL A CG2  8  
ATOM 10872 H H    . VAL A 1 61 ? 2.642   -5.774  -6.884  1.00 15.00 ? 61 VAL A H    8  
ATOM 10873 H HA   . VAL A 1 61 ? 2.966   -2.862  -6.770  1.00 15.00 ? 61 VAL A HA   8  
ATOM 10874 H HB   . VAL A 1 61 ? 5.107   -4.719  -5.733  1.00 15.00 ? 61 VAL A HB   8  
ATOM 10875 H HG11 . VAL A 1 61 ? 5.090   -2.005  -6.506  1.00 15.00 ? 61 VAL A HG11 8  
ATOM 10876 H HG12 . VAL A 1 61 ? 5.252   -2.049  -4.751  1.00 15.00 ? 61 VAL A HG12 8  
ATOM 10877 H HG13 . VAL A 1 61 ? 6.400   -2.922  -5.765  1.00 15.00 ? 61 VAL A HG13 8  
ATOM 10878 H HG21 . VAL A 1 61 ? 4.249   -3.294  -3.558  1.00 15.00 ? 61 VAL A HG21 8  
ATOM 10879 H HG22 . VAL A 1 61 ? 2.739   -3.684  -4.380  1.00 15.00 ? 61 VAL A HG22 8  
ATOM 10880 H HG23 . VAL A 1 61 ? 3.843   -4.974  -3.905  1.00 15.00 ? 61 VAL A HG23 8  
ATOM 10881 N N    . ASN A 1 62 ? 3.791   -3.268  -9.088  1.00 15.00 ? 62 ASN A N    8  
ATOM 10882 C CA   . ASN A 1 62 ? 4.379   -3.411  -10.411 1.00 15.00 ? 62 ASN A CA   8  
ATOM 10883 C C    . ASN A 1 62 ? 4.021   -4.778  -10.994 1.00 15.00 ? 62 ASN A C    8  
ATOM 10884 O O    . ASN A 1 62 ? 4.636   -5.237  -11.957 1.00 15.00 ? 62 ASN A O    8  
ATOM 10885 C CB   . ASN A 1 62 ? 5.900   -3.242  -10.353 1.00 15.00 ? 62 ASN A CB   8  
ATOM 10886 C CG   . ASN A 1 62 ? 6.324   -1.993  -9.601  1.00 15.00 ? 62 ASN A CG   8  
ATOM 10887 O OD1  . ASN A 1 62 ? 7.382   -1.968  -8.973  1.00 15.00 ? 62 ASN A OD1  8  
ATOM 10888 N ND2  . ASN A 1 62 ? 5.505   -0.946  -9.664  1.00 15.00 ? 62 ASN A ND2  8  
ATOM 10889 H H    . ASN A 1 62 ? 3.079   -2.609  -8.948  1.00 15.00 ? 62 ASN A H    8  
ATOM 10890 H HA   . ASN A 1 62 ? 3.961   -2.642  -11.044 1.00 15.00 ? 62 ASN A HA   8  
ATOM 10891 H HB2  . ASN A 1 62 ? 6.332   -4.099  -9.859  1.00 15.00 ? 62 ASN A HB2  8  
ATOM 10892 H HB3  . ASN A 1 62 ? 6.286   -3.181  -11.360 1.00 15.00 ? 62 ASN A HB3  8  
ATOM 10893 H HD21 . ASN A 1 62 ? 4.681   -1.031  -10.187 1.00 15.00 ? 62 ASN A HD21 8  
ATOM 10894 H HD22 . ASN A 1 62 ? 5.758   -0.132  -9.183  1.00 15.00 ? 62 ASN A HD22 8  
ATOM 10895 N N    . GLY A 1 63 ? 3.011   -5.420  -10.400 1.00 15.00 ? 63 GLY A N    8  
ATOM 10896 C CA   . GLY A 1 63 ? 2.570   -6.722  -10.864 1.00 15.00 ? 63 GLY A CA   8  
ATOM 10897 C C    . GLY A 1 63 ? 2.957   -7.860  -9.935  1.00 15.00 ? 63 GLY A C    8  
ATOM 10898 O O    . GLY A 1 63 ? 2.715   -9.025  -10.248 1.00 15.00 ? 63 GLY A O    8  
ATOM 10899 H H    . GLY A 1 63 ? 2.556   -5.000  -9.642  1.00 15.00 ? 63 GLY A H    8  
ATOM 10900 H HA2  . GLY A 1 63 ? 1.493   -6.706  -10.949 1.00 15.00 ? 63 GLY A HA2  8  
ATOM 10901 H HA3  . GLY A 1 63 ? 2.994   -6.907  -11.840 1.00 15.00 ? 63 GLY A HA3  8  
ATOM 10902 N N    . VAL A 1 64 ? 3.549   -7.534  -8.788  1.00 15.00 ? 64 VAL A N    8  
ATOM 10903 C CA   . VAL A 1 64 ? 3.947   -8.558  -7.828  1.00 15.00 ? 64 VAL A CA   8  
ATOM 10904 C C    . VAL A 1 64 ? 2.854   -8.778  -6.781  1.00 15.00 ? 64 VAL A C    8  
ATOM 10905 O O    . VAL A 1 64 ? 2.634   -7.939  -5.909  1.00 15.00 ? 64 VAL A O    8  
ATOM 10906 C CB   . VAL A 1 64 ? 5.283   -8.206  -7.134  1.00 15.00 ? 64 VAL A CB   8  
ATOM 10907 C CG1  . VAL A 1 64 ? 5.097   -7.127  -6.079  1.00 15.00 ? 64 VAL A CG1  8  
ATOM 10908 C CG2  . VAL A 1 64 ? 5.909   -9.452  -6.525  1.00 15.00 ? 64 VAL A CG2  8  
ATOM 10909 H H    . VAL A 1 64 ? 3.714   -6.591  -8.581  1.00 15.00 ? 64 VAL A H    8  
ATOM 10910 H HA   . VAL A 1 64 ? 4.087   -9.480  -8.375  1.00 15.00 ? 64 VAL A HA   8  
ATOM 10911 H HB   . VAL A 1 64 ? 5.960   -7.824  -7.882  1.00 15.00 ? 64 VAL A HB   8  
ATOM 10912 H HG11 . VAL A 1 64 ? 4.399   -6.389  -6.441  1.00 15.00 ? 64 VAL A HG11 8  
ATOM 10913 H HG12 . VAL A 1 64 ? 4.713   -7.572  -5.173  1.00 15.00 ? 64 VAL A HG12 8  
ATOM 10914 H HG13 . VAL A 1 64 ? 6.047   -6.655  -5.874  1.00 15.00 ? 64 VAL A HG13 8  
ATOM 10915 H HG21 . VAL A 1 64 ? 5.695   -9.481  -5.466  1.00 15.00 ? 64 VAL A HG21 8  
ATOM 10916 H HG22 . VAL A 1 64 ? 5.498   -10.330 -7.000  1.00 15.00 ? 64 VAL A HG22 8  
ATOM 10917 H HG23 . VAL A 1 64 ? 6.978   -9.428  -6.676  1.00 15.00 ? 64 VAL A HG23 8  
ATOM 10918 N N    . SER A 1 65 ? 2.167   -9.911  -6.879  1.00 15.00 ? 65 SER A N    8  
ATOM 10919 C CA   . SER A 1 65 ? 1.092   -10.237 -5.947  1.00 15.00 ? 65 SER A CA   8  
ATOM 10920 C C    . SER A 1 65 ? 1.589   -10.219 -4.505  1.00 15.00 ? 65 SER A C    8  
ATOM 10921 O O    . SER A 1 65 ? 2.658   -10.746 -4.198  1.00 15.00 ? 65 SER A O    8  
ATOM 10922 C CB   . SER A 1 65 ? 0.502   -11.609 -6.277  1.00 15.00 ? 65 SER A CB   8  
ATOM 10923 O OG   . SER A 1 65 ? 0.560   -11.868 -7.669  1.00 15.00 ? 65 SER A OG   8  
ATOM 10924 H H    . SER A 1 65 ? 2.383   -10.540 -7.598  1.00 15.00 ? 65 SER A H    8  
ATOM 10925 H HA   . SER A 1 65 ? 0.319   -9.488  -6.055  1.00 15.00 ? 65 SER A HA   8  
ATOM 10926 H HB2  . SER A 1 65 ? 1.061   -12.373 -5.758  1.00 15.00 ? 65 SER A HB2  8  
ATOM 10927 H HB3  . SER A 1 65 ? -0.531  -11.640 -5.960  1.00 15.00 ? 65 SER A HB3  8  
ATOM 10928 H HG   . SER A 1 65 ? 0.533   -12.816 -7.820  1.00 15.00 ? 65 SER A HG   8  
ATOM 10929 N N    . LEU A 1 66 ? 0.801   -9.610  -3.625  1.00 15.00 ? 66 LEU A N    8  
ATOM 10930 C CA   . LEU A 1 66 ? 1.151   -9.520  -2.213  1.00 15.00 ? 66 LEU A CA   8  
ATOM 10931 C C    . LEU A 1 66 ? 0.460   -10.619 -1.409  1.00 15.00 ? 66 LEU A C    8  
ATOM 10932 O O    . LEU A 1 66 ? 0.901   -10.968 -0.315  1.00 15.00 ? 66 LEU A O    8  
ATOM 10933 C CB   . LEU A 1 66 ? 0.767   -8.146  -1.659  1.00 15.00 ? 66 LEU A CB   8  
ATOM 10934 C CG   . LEU A 1 66 ? 1.823   -7.490  -0.768  1.00 15.00 ? 66 LEU A CG   8  
ATOM 10935 C CD1  . LEU A 1 66 ? 2.246   -8.436  0.345   1.00 15.00 ? 66 LEU A CD1  8  
ATOM 10936 C CD2  . LEU A 1 66 ? 3.027   -7.065  -1.596  1.00 15.00 ? 66 LEU A CD2  8  
ATOM 10937 H H    . LEU A 1 66 ? -0.039  -9.212  -3.934  1.00 15.00 ? 66 LEU A H    8  
ATOM 10938 H HA   . LEU A 1 66 ? 2.220   -9.647  -2.128  1.00 15.00 ? 66 LEU A HA   8  
ATOM 10939 H HB2  . LEU A 1 66 ? 0.570   -7.488  -2.493  1.00 15.00 ? 66 LEU A HB2  8  
ATOM 10940 H HB3  . LEU A 1 66 ? -0.140  -8.252  -1.084  1.00 15.00 ? 66 LEU A HB3  8  
ATOM 10941 H HG   . LEU A 1 66 ? 1.401   -6.606  -0.312  1.00 15.00 ? 66 LEU A HG   8  
ATOM 10942 H HD11 . LEU A 1 66 ? 2.478   -9.404  -0.075  1.00 15.00 ? 66 LEU A HD11 8  
ATOM 10943 H HD12 . LEU A 1 66 ? 3.120   -8.040  0.841   1.00 15.00 ? 66 LEU A HD12 8  
ATOM 10944 H HD13 . LEU A 1 66 ? 1.442   -8.536  1.058   1.00 15.00 ? 66 LEU A HD13 8  
ATOM 10945 H HD21 . LEU A 1 66 ? 3.768   -7.851  -1.583  1.00 15.00 ? 66 LEU A HD21 8  
ATOM 10946 H HD22 . LEU A 1 66 ? 2.717   -6.880  -2.613  1.00 15.00 ? 66 LEU A HD22 8  
ATOM 10947 H HD23 . LEU A 1 66 ? 3.451   -6.164  -1.179  1.00 15.00 ? 66 LEU A HD23 8  
ATOM 10948 N N    . GLU A 1 67 ? -0.626  -11.162 -1.959  1.00 15.00 ? 67 GLU A N    8  
ATOM 10949 C CA   . GLU A 1 67 ? -1.375  -12.223 -1.291  1.00 15.00 ? 67 GLU A CA   8  
ATOM 10950 C C    . GLU A 1 67 ? -0.436  -13.301 -0.759  1.00 15.00 ? 67 GLU A C    8  
ATOM 10951 O O    . GLU A 1 67 ? 0.006   -14.177 -1.503  1.00 15.00 ? 67 GLU A O    8  
ATOM 10952 C CB   . GLU A 1 67 ? -2.390  -12.842 -2.254  1.00 15.00 ? 67 GLU A CB   8  
ATOM 10953 C CG   . GLU A 1 67 ? -3.707  -12.085 -2.321  1.00 15.00 ? 67 GLU A CG   8  
ATOM 10954 C CD   . GLU A 1 67 ? -3.875  -11.319 -3.619  1.00 15.00 ? 67 GLU A CD   8  
ATOM 10955 O OE1  . GLU A 1 67 ? -2.853  -10.866 -4.177  1.00 15.00 ? 67 GLU A OE1  8  
ATOM 10956 O OE2  . GLU A 1 67 ? -5.027  -11.173 -4.077  1.00 15.00 ? 67 GLU A OE2  8  
ATOM 10957 H H    . GLU A 1 67 ? -0.930  -10.843 -2.834  1.00 15.00 ? 67 GLU A H    8  
ATOM 10958 H HA   . GLU A 1 67 ? -1.905  -11.781 -0.460  1.00 15.00 ? 67 GLU A HA   8  
ATOM 10959 H HB2  . GLU A 1 67 ? -1.962  -12.864 -3.245  1.00 15.00 ? 67 GLU A HB2  8  
ATOM 10960 H HB3  . GLU A 1 67 ? -2.597  -13.854 -1.939  1.00 15.00 ? 67 GLU A HB3  8  
ATOM 10961 H HG2  . GLU A 1 67 ? -4.519  -12.791 -2.230  1.00 15.00 ? 67 GLU A HG2  8  
ATOM 10962 H HG3  . GLU A 1 67 ? -3.746  -11.385 -1.499  1.00 15.00 ? 67 GLU A HG3  8  
ATOM 10963 N N    . GLY A 1 68 ? -0.131  -13.223 0.531   1.00 15.00 ? 68 GLY A N    8  
ATOM 10964 C CA   . GLY A 1 68 ? 0.761   -14.189 1.143   1.00 15.00 ? 68 GLY A CA   8  
ATOM 10965 C C    . GLY A 1 68 ? 2.107   -13.584 1.490   1.00 15.00 ? 68 GLY A C    8  
ATOM 10966 O O    . GLY A 1 68 ? 3.137   -13.991 0.952   1.00 15.00 ? 68 GLY A O    8  
ATOM 10967 H H    . GLY A 1 68 ? -0.509  -12.499 1.072   1.00 15.00 ? 68 GLY A H    8  
ATOM 10968 H HA2  . GLY A 1 68 ? 0.303   -14.566 2.046   1.00 15.00 ? 68 GLY A HA2  8  
ATOM 10969 H HA3  . GLY A 1 68 ? 0.913   -15.010 0.458   1.00 15.00 ? 68 GLY A HA3  8  
ATOM 10970 N N    . ALA A 1 69 ? 2.095   -12.606 2.389   1.00 15.00 ? 69 ALA A N    8  
ATOM 10971 C CA   . ALA A 1 69 ? 3.318   -11.935 2.810   1.00 15.00 ? 69 ALA A CA   8  
ATOM 10972 C C    . ALA A 1 69 ? 3.043   -10.980 3.967   1.00 15.00 ? 69 ALA A C    8  
ATOM 10973 O O    . ALA A 1 69 ? 1.996   -10.336 4.018   1.00 15.00 ? 69 ALA A O    8  
ATOM 10974 C CB   . ALA A 1 69 ? 3.939   -11.188 1.639   1.00 15.00 ? 69 ALA A CB   8  
ATOM 10975 H H    . ALA A 1 69 ? 1.241   -12.327 2.778   1.00 15.00 ? 69 ALA A H    8  
ATOM 10976 H HA   . ALA A 1 69 ? 4.018   -12.690 3.138   1.00 15.00 ? 69 ALA A HA   8  
ATOM 10977 H HB1  . ALA A 1 69 ? 4.987   -11.442 1.565   1.00 15.00 ? 69 ALA A HB1  8  
ATOM 10978 H HB2  . ALA A 1 69 ? 3.436   -11.468 0.725   1.00 15.00 ? 69 ALA A HB2  8  
ATOM 10979 H HB3  . ALA A 1 69 ? 3.837   -10.124 1.794   1.00 15.00 ? 69 ALA A HB3  8  
ATOM 10980 N N    . THR A 1 70 ? 3.988   -10.896 4.897   1.00 15.00 ? 70 THR A N    8  
ATOM 10981 C CA   . THR A 1 70 ? 3.844   -10.024 6.057   1.00 15.00 ? 70 THR A CA   8  
ATOM 10982 C C    . THR A 1 70 ? 4.005   -8.556  5.668   1.00 15.00 ? 70 THR A C    8  
ATOM 10983 O O    . THR A 1 70 ? 4.101   -8.220  4.488   1.00 15.00 ? 70 THR A O    8  
ATOM 10984 C CB   . THR A 1 70 ? 4.874   -10.392 7.126   1.00 15.00 ? 70 THR A CB   8  
ATOM 10985 O OG1  . THR A 1 70 ? 6.157   -9.907  6.774   1.00 15.00 ? 70 THR A OG1  8  
ATOM 10986 C CG2  . THR A 1 70 ? 4.993   -11.883 7.355   1.00 15.00 ? 70 THR A CG2  8  
ATOM 10987 H H    . THR A 1 70 ? 4.799   -11.438 4.804   1.00 15.00 ? 70 THR A H    8  
ATOM 10988 H HA   . THR A 1 70 ? 2.852   -10.172 6.461   1.00 15.00 ? 70 THR A HA   8  
ATOM 10989 H HB   . THR A 1 70 ? 4.584   -9.936  8.062   1.00 15.00 ? 70 THR A HB   8  
ATOM 10990 H HG1  . THR A 1 70 ? 6.782   -10.119 7.470   1.00 15.00 ? 70 THR A HG1  8  
ATOM 10991 H HG21 . THR A 1 70 ? 5.039   -12.083 8.415   1.00 15.00 ? 70 THR A HG21 8  
ATOM 10992 H HG22 . THR A 1 70 ? 4.134   -12.382 6.932   1.00 15.00 ? 70 THR A HG22 8  
ATOM 10993 H HG23 . THR A 1 70 ? 5.892   -12.249 6.880   1.00 15.00 ? 70 THR A HG23 8  
ATOM 10994 N N    . HIS A 1 71 ? 4.032   -7.689  6.674   1.00 15.00 ? 71 HIS A N    8  
ATOM 10995 C CA   . HIS A 1 71 ? 4.180   -6.255  6.457   1.00 15.00 ? 71 HIS A CA   8  
ATOM 10996 C C    . HIS A 1 71 ? 5.511   -5.952  5.784   1.00 15.00 ? 71 HIS A C    8  
ATOM 10997 O O    . HIS A 1 71 ? 5.555   -5.398  4.686   1.00 15.00 ? 71 HIS A O    8  
ATOM 10998 C CB   . HIS A 1 71 ? 4.044   -5.514  7.799   1.00 15.00 ? 71 HIS A CB   8  
ATOM 10999 C CG   . HIS A 1 71 ? 5.003   -4.380  8.008   1.00 15.00 ? 71 HIS A CG   8  
ATOM 11000 N ND1  . HIS A 1 71 ? 5.678   -4.181  9.194   1.00 15.00 ? 71 HIS A ND1  8  
ATOM 11001 C CD2  . HIS A 1 71 ? 5.386   -3.374  7.188   1.00 15.00 ? 71 HIS A CD2  8  
ATOM 11002 C CE1  . HIS A 1 71 ? 6.431   -3.102  9.095   1.00 15.00 ? 71 HIS A CE1  8  
ATOM 11003 N NE2  . HIS A 1 71 ? 6.274   -2.594  7.887   1.00 15.00 ? 71 HIS A NE2  8  
ATOM 11004 H H    . HIS A 1 71 ? 3.947   -8.022  7.588   1.00 15.00 ? 71 HIS A H    8  
ATOM 11005 H HA   . HIS A 1 71 ? 3.386   -5.939  5.803   1.00 15.00 ? 71 HIS A HA   8  
ATOM 11006 H HB2  . HIS A 1 71 ? 3.046   -5.111  7.872   1.00 15.00 ? 71 HIS A HB2  8  
ATOM 11007 H HB3  . HIS A 1 71 ? 4.192   -6.223  8.601   1.00 15.00 ? 71 HIS A HB3  8  
ATOM 11008 H HD1  . HIS A 1 71 ? 5.612   -4.747  9.991   1.00 15.00 ? 71 HIS A HD1  8  
ATOM 11009 H HD2  . HIS A 1 71 ? 5.054   -3.214  6.173   1.00 15.00 ? 71 HIS A HD2  8  
ATOM 11010 H HE1  . HIS A 1 71 ? 7.063   -2.700  9.871   1.00 15.00 ? 71 HIS A HE1  8  
ATOM 11011 H HE2  . HIS A 1 71 ? 6.623   -1.727  7.592   1.00 15.00 ? 71 HIS A HE2  8  
ATOM 11012 N N    . LYS A 1 72 ? 6.592   -6.330  6.447   1.00 15.00 ? 72 LYS A N    8  
ATOM 11013 C CA   . LYS A 1 72 ? 7.931   -6.114  5.914   1.00 15.00 ? 72 LYS A CA   8  
ATOM 11014 C C    . LYS A 1 72 ? 8.044   -6.676  4.502   1.00 15.00 ? 72 LYS A C    8  
ATOM 11015 O O    . LYS A 1 72 ? 8.750   -6.125  3.660   1.00 15.00 ? 72 LYS A O    8  
ATOM 11016 C CB   . LYS A 1 72 ? 8.964   -6.770  6.827   1.00 15.00 ? 72 LYS A CB   8  
ATOM 11017 C CG   . LYS A 1 72 ? 10.395  -6.353  6.531   1.00 15.00 ? 72 LYS A CG   8  
ATOM 11018 C CD   . LYS A 1 72 ? 11.395  -7.240  7.256   1.00 15.00 ? 72 LYS A CD   8  
ATOM 11019 C CE   . LYS A 1 72 ? 11.335  -7.031  8.760   1.00 15.00 ? 72 LYS A CE   8  
ATOM 11020 N NZ   . LYS A 1 72 ? 11.722  -8.259  9.508   1.00 15.00 ? 72 LYS A NZ   8  
ATOM 11021 H H    . LYS A 1 72 ? 6.487   -6.778  7.313   1.00 15.00 ? 72 LYS A H    8  
ATOM 11022 H HA   . LYS A 1 72 ? 8.111   -5.044  5.878   1.00 15.00 ? 72 LYS A HA   8  
ATOM 11023 H HB2  . LYS A 1 72 ? 8.738   -6.508  7.850   1.00 15.00 ? 72 LYS A HB2  8  
ATOM 11024 H HB3  . LYS A 1 72 ? 8.892   -7.842  6.717   1.00 15.00 ? 72 LYS A HB3  8  
ATOM 11025 H HG2  . LYS A 1 72 ? 10.568  -6.428  5.467   1.00 15.00 ? 72 LYS A HG2  8  
ATOM 11026 H HG3  . LYS A 1 72 ? 10.535  -5.331  6.849   1.00 15.00 ? 72 LYS A HG3  8  
ATOM 11027 H HD2  . LYS A 1 72 ? 11.171  -8.273  7.037   1.00 15.00 ? 72 LYS A HD2  8  
ATOM 11028 H HD3  . LYS A 1 72 ? 12.390  -7.003  6.908   1.00 15.00 ? 72 LYS A HD3  8  
ATOM 11029 H HE2  . LYS A 1 72 ? 12.009  -6.231  9.027   1.00 15.00 ? 72 LYS A HE2  8  
ATOM 11030 H HE3  . LYS A 1 72 ? 10.326  -6.757  9.033   1.00 15.00 ? 72 LYS A HE3  8  
ATOM 11031 H HZ1  . LYS A 1 72 ? 10.899  -8.884  9.621   1.00 15.00 ? 72 LYS A HZ1  8  
ATOM 11032 H HZ2  . LYS A 1 72 ? 12.465  -8.772  8.992   1.00 15.00 ? 72 LYS A HZ2  8  
ATOM 11033 H HZ3  . LYS A 1 72 ? 12.082  -8.005  10.450  1.00 15.00 ? 72 LYS A HZ3  8  
ATOM 11034 N N    . GLN A 1 73 ? 7.335   -7.770  4.243   1.00 15.00 ? 73 GLN A N    8  
ATOM 11035 C CA   . GLN A 1 73 ? 7.355   -8.390  2.924   1.00 15.00 ? 73 GLN A CA   8  
ATOM 11036 C C    . GLN A 1 73 ? 6.866   -7.396  1.880   1.00 15.00 ? 73 GLN A C    8  
ATOM 11037 O O    . GLN A 1 73 ? 7.548   -7.138  0.888   1.00 15.00 ? 73 GLN A O    8  
ATOM 11038 C CB   . GLN A 1 73 ? 6.489   -9.650  2.906   1.00 15.00 ? 73 GLN A CB   8  
ATOM 11039 C CG   . GLN A 1 73 ? 7.048   -10.780 3.755   1.00 15.00 ? 73 GLN A CG   8  
ATOM 11040 C CD   . GLN A 1 73 ? 6.743   -12.149 3.180   1.00 15.00 ? 73 GLN A CD   8  
ATOM 11041 O OE1  . GLN A 1 73 ? 6.119   -12.985 3.833   1.00 15.00 ? 73 GLN A OE1  8  
ATOM 11042 N NE2  . GLN A 1 73 ? 7.184   -12.386 1.949   1.00 15.00 ? 73 GLN A NE2  8  
ATOM 11043 H H    . GLN A 1 73 ? 6.782   -8.163  4.950   1.00 15.00 ? 73 GLN A H    8  
ATOM 11044 H HA   . GLN A 1 73 ? 8.377   -8.658  2.699   1.00 15.00 ? 73 GLN A HA   8  
ATOM 11045 H HB2  . GLN A 1 73 ? 5.505   -9.404  3.275   1.00 15.00 ? 73 GLN A HB2  8  
ATOM 11046 H HB3  . GLN A 1 73 ? 6.406   -10.001 1.888   1.00 15.00 ? 73 GLN A HB3  8  
ATOM 11047 H HG2  . GLN A 1 73 ? 8.120   -10.667 3.822   1.00 15.00 ? 73 GLN A HG2  8  
ATOM 11048 H HG3  . GLN A 1 73 ? 6.619   -10.717 4.744   1.00 15.00 ? 73 GLN A HG3  8  
ATOM 11049 H HE21 . GLN A 1 73 ? 7.674   -11.674 1.488   1.00 15.00 ? 73 GLN A HE21 8  
ATOM 11050 H HE22 . GLN A 1 73 ? 7.000   -13.263 1.553   1.00 15.00 ? 73 GLN A HE22 8  
ATOM 11051 N N    . ALA A 1 74 ? 5.694   -6.818  2.123   1.00 15.00 ? 74 ALA A N    8  
ATOM 11052 C CA   . ALA A 1 74 ? 5.138   -5.827  1.214   1.00 15.00 ? 74 ALA A CA   8  
ATOM 11053 C C    . ALA A 1 74 ? 6.001   -4.577  1.229   1.00 15.00 ? 74 ALA A C    8  
ATOM 11054 O O    . ALA A 1 74 ? 6.327   -4.022  0.182   1.00 15.00 ? 74 ALA A O    8  
ATOM 11055 C CB   . ALA A 1 74 ? 3.710   -5.488  1.588   1.00 15.00 ? 74 ALA A CB   8  
ATOM 11056 H H    . ALA A 1 74 ? 5.205   -7.047  2.941   1.00 15.00 ? 74 ALA A H    8  
ATOM 11057 H HA   . ALA A 1 74 ? 5.140   -6.246  0.218   1.00 15.00 ? 74 ALA A HA   8  
ATOM 11058 H HB1  . ALA A 1 74 ? 3.048   -5.821  0.804   1.00 15.00 ? 74 ALA A HB1  8  
ATOM 11059 H HB2  . ALA A 1 74 ? 3.454   -5.981  2.513   1.00 15.00 ? 74 ALA A HB2  8  
ATOM 11060 H HB3  . ALA A 1 74 ? 3.617   -4.419  1.709   1.00 15.00 ? 74 ALA A HB3  8  
ATOM 11061 N N    . VAL A 1 75 ? 6.392   -4.155  2.432   1.00 15.00 ? 75 VAL A N    8  
ATOM 11062 C CA   . VAL A 1 75 ? 7.252   -2.988  2.596   1.00 15.00 ? 75 VAL A CA   8  
ATOM 11063 C C    . VAL A 1 75 ? 8.356   -3.037  1.555   1.00 15.00 ? 75 VAL A C    8  
ATOM 11064 O O    . VAL A 1 75 ? 8.706   -2.030  0.941   1.00 15.00 ? 75 VAL A O    8  
ATOM 11065 C CB   . VAL A 1 75 ? 7.855   -2.954  4.022   1.00 15.00 ? 75 VAL A CB   8  
ATOM 11066 C CG1  . VAL A 1 75 ? 9.365   -3.160  4.011   1.00 15.00 ? 75 VAL A CG1  8  
ATOM 11067 C CG2  . VAL A 1 75 ? 7.501   -1.662  4.731   1.00 15.00 ? 75 VAL A CG2  8  
ATOM 11068 H H    . VAL A 1 75 ? 6.113   -4.656  3.227   1.00 15.00 ? 75 VAL A H    8  
ATOM 11069 H HA   . VAL A 1 75 ? 6.661   -2.096  2.442   1.00 15.00 ? 75 VAL A HA   8  
ATOM 11070 H HB   . VAL A 1 75 ? 7.413   -3.762  4.582   1.00 15.00 ? 75 VAL A HB   8  
ATOM 11071 H HG11 . VAL A 1 75 ? 9.597   -4.106  3.547   1.00 15.00 ? 75 VAL A HG11 8  
ATOM 11072 H HG12 . VAL A 1 75 ? 9.833   -2.362  3.454   1.00 15.00 ? 75 VAL A HG12 8  
ATOM 11073 H HG13 . VAL A 1 75 ? 9.737   -3.156  5.025   1.00 15.00 ? 75 VAL A HG13 8  
ATOM 11074 H HG21 . VAL A 1 75 ? 8.376   -1.032  4.792   1.00 15.00 ? 75 VAL A HG21 8  
ATOM 11075 H HG22 . VAL A 1 75 ? 6.723   -1.151  4.185   1.00 15.00 ? 75 VAL A HG22 8  
ATOM 11076 H HG23 . VAL A 1 75 ? 7.154   -1.894  5.727   1.00 15.00 ? 75 VAL A HG23 8  
ATOM 11077 N N    . GLU A 1 76 ? 8.873   -4.239  1.350   1.00 15.00 ? 76 GLU A N    8  
ATOM 11078 C CA   . GLU A 1 76 ? 9.913   -4.464  0.368   1.00 15.00 ? 76 GLU A CA   8  
ATOM 11079 C C    . GLU A 1 76 ? 9.368   -4.251  -1.041  1.00 15.00 ? 76 GLU A C    8  
ATOM 11080 O O    . GLU A 1 76 ? 10.009  -3.607  -1.864  1.00 15.00 ? 76 GLU A O    8  
ATOM 11081 C CB   . GLU A 1 76 ? 10.478  -5.879  0.508   1.00 15.00 ? 76 GLU A CB   8  
ATOM 11082 C CG   . GLU A 1 76 ? 11.102  -6.152  1.868   1.00 15.00 ? 76 GLU A CG   8  
ATOM 11083 C CD   . GLU A 1 76 ? 11.059  -7.620  2.246   1.00 15.00 ? 76 GLU A CD   8  
ATOM 11084 O OE1  . GLU A 1 76 ? 10.310  -8.378  1.595   1.00 15.00 ? 76 GLU A OE1  8  
ATOM 11085 O OE2  . GLU A 1 76 ? 11.773  -8.010  3.193   1.00 15.00 ? 76 GLU A OE2  8  
ATOM 11086 H H    . GLU A 1 76 ? 8.528   -5.000  1.864   1.00 15.00 ? 76 GLU A H    8  
ATOM 11087 H HA   . GLU A 1 76 ? 10.702  -3.750  0.550   1.00 15.00 ? 76 GLU A HA   8  
ATOM 11088 H HB2  . GLU A 1 76 ? 9.680   -6.590  0.353   1.00 15.00 ? 76 GLU A HB2  8  
ATOM 11089 H HB3  . GLU A 1 76 ? 11.235  -6.029  -0.247  1.00 15.00 ? 76 GLU A HB3  8  
ATOM 11090 H HG2  . GLU A 1 76 ? 12.133  -5.832  1.848   1.00 15.00 ? 76 GLU A HG2  8  
ATOM 11091 H HG3  . GLU A 1 76 ? 10.566  -5.586  2.617   1.00 15.00 ? 76 GLU A HG3  8  
ATOM 11092 N N    . THR A 1 77 ? 8.178   -4.791  -1.316  1.00 15.00 ? 77 THR A N    8  
ATOM 11093 C CA   . THR A 1 77 ? 7.570   -4.640  -2.637  1.00 15.00 ? 77 THR A CA   8  
ATOM 11094 C C    . THR A 1 77 ? 7.251   -3.178  -2.940  1.00 15.00 ? 77 THR A C    8  
ATOM 11095 O O    . THR A 1 77 ? 7.680   -2.643  -3.961  1.00 15.00 ? 77 THR A O    8  
ATOM 11096 C CB   . THR A 1 77 ? 6.306   -5.487  -2.762  1.00 15.00 ? 77 THR A CB   8  
ATOM 11097 O OG1  . THR A 1 77 ? 5.398   -5.203  -1.714  1.00 15.00 ? 77 THR A OG1  8  
ATOM 11098 C CG2  . THR A 1 77 ? 6.578   -6.975  -2.749  1.00 15.00 ? 77 THR A CG2  8  
ATOM 11099 H H    . THR A 1 77 ? 7.696   -5.292  -0.618  1.00 15.00 ? 77 THR A H    8  
ATOM 11100 H HA   . THR A 1 77 ? 8.290   -4.987  -3.363  1.00 15.00 ? 77 THR A HA   8  
ATOM 11101 H HB   . THR A 1 77 ? 5.827   -5.249  -3.700  1.00 15.00 ? 77 THR A HB   8  
ATOM 11102 H HG1  . THR A 1 77 ? 4.596   -4.825  -2.080  1.00 15.00 ? 77 THR A HG1  8  
ATOM 11103 H HG21 . THR A 1 77 ? 6.535   -7.356  -3.759  1.00 15.00 ? 77 THR A HG21 8  
ATOM 11104 H HG22 . THR A 1 77 ? 7.559   -7.158  -2.337  1.00 15.00 ? 77 THR A HG22 8  
ATOM 11105 H HG23 . THR A 1 77 ? 5.834   -7.472  -2.145  1.00 15.00 ? 77 THR A HG23 8  
ATOM 11106 N N    . LEU A 1 78 ? 6.498   -2.533  -2.049  1.00 15.00 ? 78 LEU A N    8  
ATOM 11107 C CA   . LEU A 1 78 ? 6.133   -1.130  -2.240  1.00 15.00 ? 78 LEU A CA   8  
ATOM 11108 C C    . LEU A 1 78 ? 7.381   -0.295  -2.472  1.00 15.00 ? 78 LEU A C    8  
ATOM 11109 O O    . LEU A 1 78 ? 7.448   0.507   -3.404  1.00 15.00 ? 78 LEU A O    8  
ATOM 11110 C CB   . LEU A 1 78 ? 5.375   -0.587  -1.023  1.00 15.00 ? 78 LEU A CB   8  
ATOM 11111 C CG   . LEU A 1 78 ? 4.403   -1.564  -0.359  1.00 15.00 ? 78 LEU A CG   8  
ATOM 11112 C CD1  . LEU A 1 78 ? 3.586   -0.855  0.711   1.00 15.00 ? 78 LEU A CD1  8  
ATOM 11113 C CD2  . LEU A 1 78 ? 3.490   -2.201  -1.397  1.00 15.00 ? 78 LEU A CD2  8  
ATOM 11114 H H    . LEU A 1 78 ? 6.184   -3.008  -1.252  1.00 15.00 ? 78 LEU A H    8  
ATOM 11115 H HA   . LEU A 1 78 ? 5.499   -1.064  -3.111  1.00 15.00 ? 78 LEU A HA   8  
ATOM 11116 H HB2  . LEU A 1 78 ? 6.100   -0.279  -0.285  1.00 15.00 ? 78 LEU A HB2  8  
ATOM 11117 H HB3  . LEU A 1 78 ? 4.816   0.283   -1.335  1.00 15.00 ? 78 LEU A HB3  8  
ATOM 11118 H HG   . LEU A 1 78 ? 4.967   -2.349  0.121   1.00 15.00 ? 78 LEU A HG   8  
ATOM 11119 H HD11 . LEU A 1 78 ? 4.132   0.005   1.069   1.00 15.00 ? 78 LEU A HD11 8  
ATOM 11120 H HD12 . LEU A 1 78 ? 2.644   -0.534  0.291   1.00 15.00 ? 78 LEU A HD12 8  
ATOM 11121 H HD13 . LEU A 1 78 ? 3.402   -1.533  1.531   1.00 15.00 ? 78 LEU A HD13 8  
ATOM 11122 H HD21 . LEU A 1 78 ? 2.461   -1.969  -1.165  1.00 15.00 ? 78 LEU A HD21 8  
ATOM 11123 H HD22 . LEU A 1 78 ? 3.732   -1.816  -2.377  1.00 15.00 ? 78 LEU A HD22 8  
ATOM 11124 H HD23 . LEU A 1 78 ? 3.627   -3.272  -1.387  1.00 15.00 ? 78 LEU A HD23 8  
ATOM 11125 N N    . ARG A 1 79 ? 8.371   -0.503  -1.618  1.00 15.00 ? 79 ARG A N    8  
ATOM 11126 C CA   . ARG A 1 79 ? 9.633   0.208   -1.716  1.00 15.00 ? 79 ARG A CA   8  
ATOM 11127 C C    . ARG A 1 79 ? 10.396  -0.231  -2.965  1.00 15.00 ? 79 ARG A C    8  
ATOM 11128 O O    . ARG A 1 79 ? 10.701  0.583   -3.837  1.00 15.00 ? 79 ARG A O    8  
ATOM 11129 C CB   . ARG A 1 79 ? 10.466  -0.052  -0.460  1.00 15.00 ? 79 ARG A CB   8  
ATOM 11130 C CG   . ARG A 1 79 ? 11.379  1.103   -0.080  1.00 15.00 ? 79 ARG A CG   8  
ATOM 11131 C CD   . ARG A 1 79 ? 12.161  0.801   1.189   1.00 15.00 ? 79 ARG A CD   8  
ATOM 11132 N NE   . ARG A 1 79 ? 12.167  1.934   2.111   1.00 15.00 ? 79 ARG A NE   8  
ATOM 11133 C CZ   . ARG A 1 79 ? 12.976  2.984   1.990   1.00 15.00 ? 79 ARG A CZ   8  
ATOM 11134 N NH1  . ARG A 1 79 ? 13.841  3.051   0.986   1.00 15.00 ? 79 ARG A NH1  8  
ATOM 11135 N NH2  . ARG A 1 79 ? 12.919  3.969   2.875   1.00 15.00 ? 79 ARG A NH2  8  
ATOM 11136 H H    . ARG A 1 79 ? 8.252   -1.164  -0.904  1.00 15.00 ? 79 ARG A H    8  
ATOM 11137 H HA   . ARG A 1 79 ? 9.419   1.263   -1.788  1.00 15.00 ? 79 ARG A HA   8  
ATOM 11138 H HB2  . ARG A 1 79 ? 9.794   -0.241  0.368   1.00 15.00 ? 79 ARG A HB2  8  
ATOM 11139 H HB3  . ARG A 1 79 ? 11.076  -0.928  -0.622  1.00 15.00 ? 79 ARG A HB3  8  
ATOM 11140 H HG2  . ARG A 1 79 ? 12.075  1.279   -0.886  1.00 15.00 ? 79 ARG A HG2  8  
ATOM 11141 H HG3  . ARG A 1 79 ? 10.778  1.986   0.079   1.00 15.00 ? 79 ARG A HG3  8  
ATOM 11142 H HD2  . ARG A 1 79 ? 11.711  -0.048  1.681   1.00 15.00 ? 79 ARG A HD2  8  
ATOM 11143 H HD3  . ARG A 1 79 ? 13.179  0.562   0.920   1.00 15.00 ? 79 ARG A HD3  8  
ATOM 11144 H HE   . ARG A 1 79 ? 11.537  1.910   2.861   1.00 15.00 ? 79 ARG A HE   8  
ATOM 11145 H HH11 . ARG A 1 79 ? 13.888  2.311   0.315   1.00 15.00 ? 79 ARG A HH11 8  
ATOM 11146 H HH12 . ARG A 1 79 ? 14.446  3.842   0.900   1.00 15.00 ? 79 ARG A HH12 8  
ATOM 11147 H HH21 . ARG A 1 79 ? 12.268  3.924   3.633   1.00 15.00 ? 79 ARG A HH21 8  
ATOM 11148 H HH22 . ARG A 1 79 ? 13.527  4.758   2.784   1.00 15.00 ? 79 ARG A HH22 8  
ATOM 11149 N N    . ASN A 1 80 ? 10.697  -1.524  -3.038  1.00 15.00 ? 80 ASN A N    8  
ATOM 11150 C CA   . ASN A 1 80 ? 11.420  -2.096  -4.173  1.00 15.00 ? 80 ASN A CA   8  
ATOM 11151 C C    . ASN A 1 80 ? 10.604  -2.026  -5.464  1.00 15.00 ? 80 ASN A C    8  
ATOM 11152 O O    . ASN A 1 80 ? 10.286  -3.056  -6.059  1.00 15.00 ? 80 ASN A O    8  
ATOM 11153 C CB   . ASN A 1 80 ? 11.793  -3.551  -3.881  1.00 15.00 ? 80 ASN A CB   8  
ATOM 11154 C CG   . ASN A 1 80 ? 12.619  -3.694  -2.617  1.00 15.00 ? 80 ASN A CG   8  
ATOM 11155 O OD1  . ASN A 1 80 ? 12.905  -2.710  -1.935  1.00 15.00 ? 80 ASN A OD1  8  
ATOM 11156 N ND2  . ASN A 1 80 ? 13.007  -4.923  -2.298  1.00 15.00 ? 80 ASN A ND2  8  
ATOM 11157 H H    . ASN A 1 80 ? 10.421  -2.116  -2.307  1.00 15.00 ? 80 ASN A H    8  
ATOM 11158 H HA   . ASN A 1 80 ? 12.327  -1.526  -4.305  1.00 15.00 ? 80 ASN A HA   8  
ATOM 11159 H HB2  . ASN A 1 80 ? 10.888  -4.133  -3.768  1.00 15.00 ? 80 ASN A HB2  8  
ATOM 11160 H HB3  . ASN A 1 80 ? 12.365  -3.942  -4.710  1.00 15.00 ? 80 ASN A HB3  8  
ATOM 11161 H HD21 . ASN A 1 80 ? 12.743  -5.659  -2.888  1.00 15.00 ? 80 ASN A HD21 8  
ATOM 11162 H HD22 . ASN A 1 80 ? 13.543  -5.043  -1.486  1.00 15.00 ? 80 ASN A HD22 8  
ATOM 11163 N N    . THR A 1 81 ? 10.280  -0.817  -5.906  1.00 15.00 ? 81 THR A N    8  
ATOM 11164 C CA   . THR A 1 81 ? 9.517   -0.643  -7.138  1.00 15.00 ? 81 THR A CA   8  
ATOM 11165 C C    . THR A 1 81 ? 10.466  -0.447  -8.318  1.00 15.00 ? 81 THR A C    8  
ATOM 11166 O O    . THR A 1 81 ? 10.622  -1.334  -9.156  1.00 15.00 ? 81 THR A O    8  
ATOM 11167 C CB   . THR A 1 81 ? 8.561   0.546   -7.018  1.00 15.00 ? 81 THR A CB   8  
ATOM 11168 O OG1  . THR A 1 81 ? 8.849   1.307   -5.859  1.00 15.00 ? 81 THR A OG1  8  
ATOM 11169 C CG2  . THR A 1 81 ? 7.103   0.143   -6.949  1.00 15.00 ? 81 THR A CG2  8  
ATOM 11170 H H    . THR A 1 81 ? 10.567  -0.027  -5.403  1.00 15.00 ? 81 THR A H    8  
ATOM 11171 H HA   . THR A 1 81 ? 8.943   -1.544  -7.301  1.00 15.00 ? 81 THR A HA   8  
ATOM 11172 H HB   . THR A 1 81 ? 8.685   1.182   -7.883  1.00 15.00 ? 81 THR A HB   8  
ATOM 11173 H HG1  . THR A 1 81 ? 8.268   2.071   -5.826  1.00 15.00 ? 81 THR A HG1  8  
ATOM 11174 H HG21 . THR A 1 81 ? 6.552   0.665   -7.716  1.00 15.00 ? 81 THR A HG21 8  
ATOM 11175 H HG22 . THR A 1 81 ? 7.014   -0.923  -7.103  1.00 15.00 ? 81 THR A HG22 8  
ATOM 11176 H HG23 . THR A 1 81 ? 6.704   0.401   -5.980  1.00 15.00 ? 81 THR A HG23 8  
ATOM 11177 N N    . GLY A 1 82 ? 11.110  0.716   -8.366  1.00 15.00 ? 82 GLY A N    8  
ATOM 11178 C CA   . GLY A 1 82 ? 12.047  1.004   -9.430  1.00 15.00 ? 82 GLY A CA   8  
ATOM 11179 C C    . GLY A 1 82 ? 11.684  2.245   -10.218 1.00 15.00 ? 82 GLY A C    8  
ATOM 11180 O O    . GLY A 1 82 ? 11.824  3.368   -9.734  1.00 15.00 ? 82 GLY A O    8  
ATOM 11181 H H    . GLY A 1 82 ? 10.954  1.380   -7.671  1.00 15.00 ? 82 GLY A H    8  
ATOM 11182 H HA2  . GLY A 1 82 ? 13.028  1.141   -9.001  1.00 15.00 ? 82 GLY A HA2  8  
ATOM 11183 H HA3  . GLY A 1 82 ? 12.078  0.160   -10.104 1.00 15.00 ? 82 GLY A HA3  8  
ATOM 11184 N N    . GLN A 1 83 ? 11.229  2.032   -11.442 1.00 15.00 ? 83 GLN A N    8  
ATOM 11185 C CA   . GLN A 1 83 ? 10.850  3.132   -12.330 1.00 15.00 ? 83 GLN A CA   8  
ATOM 11186 C C    . GLN A 1 83 ? 9.645   3.901   -11.791 1.00 15.00 ? 83 GLN A C    8  
ATOM 11187 O O    . GLN A 1 83 ? 9.789   4.978   -11.214 1.00 15.00 ? 83 GLN A O    8  
ATOM 11188 C CB   . GLN A 1 83 ? 10.550  2.641   -13.762 1.00 15.00 ? 83 GLN A CB   8  
ATOM 11189 C CG   . GLN A 1 83 ? 10.637  1.134   -13.962 1.00 15.00 ? 83 GLN A CG   8  
ATOM 11190 C CD   . GLN A 1 83 ? 9.470   0.392   -13.340 1.00 15.00 ? 83 GLN A CD   8  
ATOM 11191 O OE1  . GLN A 1 83 ? 8.309   0.720   -13.584 1.00 15.00 ? 83 GLN A OE1  8  
ATOM 11192 N NE2  . GLN A 1 83 ? 9.774   -0.616  -12.530 1.00 15.00 ? 83 GLN A NE2  8  
ATOM 11193 H H    . GLN A 1 83 ? 11.152  1.112   -11.752 1.00 15.00 ? 83 GLN A H    8  
ATOM 11194 H HA   . GLN A 1 83 ? 11.689  3.811   -12.372 1.00 15.00 ? 83 GLN A HA   8  
ATOM 11195 H HB2  . GLN A 1 83 ? 9.553   2.954   -14.032 1.00 15.00 ? 83 GLN A HB2  8  
ATOM 11196 H HB3  . GLN A 1 83 ? 11.252  3.109   -14.437 1.00 15.00 ? 83 GLN A HB3  8  
ATOM 11197 H HG2  . GLN A 1 83 ? 10.648  0.927   -15.022 1.00 15.00 ? 83 GLN A HG2  8  
ATOM 11198 H HG3  . GLN A 1 83 ? 11.554  0.775   -13.519 1.00 15.00 ? 83 GLN A HG3  8  
ATOM 11199 H HE21 . GLN A 1 83 ? 10.720  -0.821  -12.381 1.00 15.00 ? 83 GLN A HE21 8  
ATOM 11200 H HE22 . GLN A 1 83 ? 9.039   -1.113  -12.114 1.00 15.00 ? 83 GLN A HE22 8  
ATOM 11201 N N    . VAL A 1 84 ? 8.458   3.343   -12.001 1.00 15.00 ? 84 VAL A N    8  
ATOM 11202 C CA   . VAL A 1 84 ? 7.219   3.968   -11.557 1.00 15.00 ? 84 VAL A CA   8  
ATOM 11203 C C    . VAL A 1 84 ? 6.591   3.186   -10.408 1.00 15.00 ? 84 VAL A C    8  
ATOM 11204 O O    . VAL A 1 84 ? 6.857   1.997   -10.226 1.00 15.00 ? 84 VAL A O    8  
ATOM 11205 C CB   . VAL A 1 84 ? 6.211   4.082   -12.722 1.00 15.00 ? 84 VAL A CB   8  
ATOM 11206 C CG1  . VAL A 1 84 ? 4.853   4.567   -12.234 1.00 15.00 ? 84 VAL A CG1  8  
ATOM 11207 C CG2  . VAL A 1 84 ? 6.752   5.013   -13.796 1.00 15.00 ? 84 VAL A CG2  8  
ATOM 11208 H H    . VAL A 1 84 ? 8.414   2.488   -12.472 1.00 15.00 ? 84 VAL A H    8  
ATOM 11209 H HA   . VAL A 1 84 ? 7.454   4.967   -11.215 1.00 15.00 ? 84 VAL A HA   8  
ATOM 11210 H HB   . VAL A 1 84 ? 6.083   3.103   -13.159 1.00 15.00 ? 84 VAL A HB   8  
ATOM 11211 H HG11 . VAL A 1 84 ? 4.964   5.529   -11.759 1.00 15.00 ? 84 VAL A HG11 8  
ATOM 11212 H HG12 . VAL A 1 84 ? 4.180   4.656   -13.074 1.00 15.00 ? 84 VAL A HG12 8  
ATOM 11213 H HG13 . VAL A 1 84 ? 4.450   3.859   -11.525 1.00 15.00 ? 84 VAL A HG13 8  
ATOM 11214 H HG21 . VAL A 1 84 ? 6.822   6.016   -13.399 1.00 15.00 ? 84 VAL A HG21 8  
ATOM 11215 H HG22 . VAL A 1 84 ? 7.732   4.678   -14.102 1.00 15.00 ? 84 VAL A HG22 8  
ATOM 11216 H HG23 . VAL A 1 84 ? 6.087   5.007   -14.646 1.00 15.00 ? 84 VAL A HG23 8  
ATOM 11217 N N    . VAL A 1 85 ? 5.746   3.858   -9.640  1.00 15.00 ? 85 VAL A N    8  
ATOM 11218 C CA   . VAL A 1 85 ? 5.077   3.229   -8.517  1.00 15.00 ? 85 VAL A CA   8  
ATOM 11219 C C    . VAL A 1 85 ? 3.668   2.791   -8.912  1.00 15.00 ? 85 VAL A C    8  
ATOM 11220 O O    . VAL A 1 85 ? 2.689   3.488   -8.649  1.00 15.00 ? 85 VAL A O    8  
ATOM 11221 C CB   . VAL A 1 85 ? 5.024   4.194   -7.309  1.00 15.00 ? 85 VAL A CB   8  
ATOM 11222 C CG1  . VAL A 1 85 ? 3.933   3.804   -6.323  1.00 15.00 ? 85 VAL A CG1  8  
ATOM 11223 C CG2  . VAL A 1 85 ? 6.379   4.250   -6.619  1.00 15.00 ? 85 VAL A CG2  8  
ATOM 11224 H H    . VAL A 1 85 ? 5.565   4.802   -9.836  1.00 15.00 ? 85 VAL A H    8  
ATOM 11225 H HA   . VAL A 1 85 ? 5.649   2.358   -8.232  1.00 15.00 ? 85 VAL A HA   8  
ATOM 11226 H HB   . VAL A 1 85 ? 4.799   5.180   -7.681  1.00 15.00 ? 85 VAL A HB   8  
ATOM 11227 H HG11 . VAL A 1 85 ? 3.674   2.764   -6.465  1.00 15.00 ? 85 VAL A HG11 8  
ATOM 11228 H HG12 . VAL A 1 85 ? 4.291   3.952   -5.314  1.00 15.00 ? 85 VAL A HG12 8  
ATOM 11229 H HG13 . VAL A 1 85 ? 3.062   4.423   -6.492  1.00 15.00 ? 85 VAL A HG13 8  
ATOM 11230 H HG21 . VAL A 1 85 ? 6.237   4.269   -5.548  1.00 15.00 ? 85 VAL A HG21 8  
ATOM 11231 H HG22 . VAL A 1 85 ? 6.957   3.379   -6.890  1.00 15.00 ? 85 VAL A HG22 8  
ATOM 11232 H HG23 . VAL A 1 85 ? 6.903   5.142   -6.928  1.00 15.00 ? 85 VAL A HG23 8  
ATOM 11233 N N    . HIS A 1 86 ? 3.581   1.626   -9.548  1.00 15.00 ? 86 HIS A N    8  
ATOM 11234 C CA   . HIS A 1 86 ? 2.297   1.082   -9.981  1.00 15.00 ? 86 HIS A CA   8  
ATOM 11235 C C    . HIS A 1 86 ? 1.834   -0.010  -9.025  1.00 15.00 ? 86 HIS A C    8  
ATOM 11236 O O    . HIS A 1 86 ? 2.080   -1.195  -9.251  1.00 15.00 ? 86 HIS A O    8  
ATOM 11237 C CB   . HIS A 1 86 ? 2.405   0.525   -11.401 1.00 15.00 ? 86 HIS A CB   8  
ATOM 11238 C CG   . HIS A 1 86 ? 1.095   0.471   -12.125 1.00 15.00 ? 86 HIS A CG   8  
ATOM 11239 N ND1  . HIS A 1 86 ? -0.084  0.936   -11.583 1.00 15.00 ? 86 HIS A ND1  8  
ATOM 11240 C CD2  . HIS A 1 86 ? 0.782   0.003   -13.357 1.00 15.00 ? 86 HIS A CD2  8  
ATOM 11241 C CE1  . HIS A 1 86 ? -1.066  0.756   -12.449 1.00 15.00 ? 86 HIS A CE1  8  
ATOM 11242 N NE2  . HIS A 1 86 ? -0.566  0.193   -13.533 1.00 15.00 ? 86 HIS A NE2  8  
ATOM 11243 H H    . HIS A 1 86 ? 4.401   1.117   -9.730  1.00 15.00 ? 86 HIS A H    8  
ATOM 11244 H HA   . HIS A 1 86 ? 1.575   1.885   -9.969  1.00 15.00 ? 86 HIS A HA   8  
ATOM 11245 H HB2  . HIS A 1 86 ? 3.075   1.147   -11.975 1.00 15.00 ? 86 HIS A HB2  8  
ATOM 11246 H HB3  . HIS A 1 86 ? 2.803   -0.479  -11.357 1.00 15.00 ? 86 HIS A HB3  8  
ATOM 11247 H HD1  . HIS A 1 86 ? -0.188  1.338   -10.695 1.00 15.00 ? 86 HIS A HD1  8  
ATOM 11248 H HD2  . HIS A 1 86 ? 1.467   -0.437  -14.068 1.00 15.00 ? 86 HIS A HD2  8  
ATOM 11249 H HE1  . HIS A 1 86 ? -2.100  1.026   -12.297 1.00 15.00 ? 86 HIS A HE1  8  
ATOM 11250 H HE2  . HIS A 1 86 ? -1.091  -0.131  -14.295 1.00 15.00 ? 86 HIS A HE2  8  
ATOM 11251 N N    . LEU A 1 87 ? 1.177   0.402   -7.948  1.00 15.00 ? 87 LEU A N    8  
ATOM 11252 C CA   . LEU A 1 87 ? 0.693   -0.531  -6.941  1.00 15.00 ? 87 LEU A CA   8  
ATOM 11253 C C    . LEU A 1 87 ? -0.812  -0.753  -7.051  1.00 15.00 ? 87 LEU A C    8  
ATOM 11254 O O    . LEU A 1 87 ? -1.594  0.189   -6.960  1.00 15.00 ? 87 LEU A O    8  
ATOM 11255 C CB   . LEU A 1 87 ? 1.035   -0.004  -5.548  1.00 15.00 ? 87 LEU A CB   8  
ATOM 11256 C CG   . LEU A 1 87 ? 1.983   -0.887  -4.744  1.00 15.00 ? 87 LEU A CG   8  
ATOM 11257 C CD1  . LEU A 1 87 ? 3.090   -0.056  -4.110  1.00 15.00 ? 87 LEU A CD1  8  
ATOM 11258 C CD2  . LEU A 1 87 ? 1.213   -1.656  -3.681  1.00 15.00 ? 87 LEU A CD2  8  
ATOM 11259 H H    . LEU A 1 87 ? 1.026   1.359   -7.820  1.00 15.00 ? 87 LEU A H    8  
ATOM 11260 H HA   . LEU A 1 87 ? 1.197   -1.473  -7.092  1.00 15.00 ? 87 LEU A HA   8  
ATOM 11261 H HB2  . LEU A 1 87 ? 1.486   0.970   -5.655  1.00 15.00 ? 87 LEU A HB2  8  
ATOM 11262 H HB3  . LEU A 1 87 ? 0.120   0.103   -4.990  1.00 15.00 ? 87 LEU A HB3  8  
ATOM 11263 H HG   . LEU A 1 87 ? 2.441   -1.599  -5.411  1.00 15.00 ? 87 LEU A HG   8  
ATOM 11264 H HD11 . LEU A 1 87 ? 3.074   0.942   -4.522  1.00 15.00 ? 87 LEU A HD11 8  
ATOM 11265 H HD12 . LEU A 1 87 ? 2.938   -0.006  -3.042  1.00 15.00 ? 87 LEU A HD12 8  
ATOM 11266 H HD13 . LEU A 1 87 ? 4.046   -0.514  -4.316  1.00 15.00 ? 87 LEU A HD13 8  
ATOM 11267 H HD21 . LEU A 1 87 ? 0.885   -0.972  -2.913  1.00 15.00 ? 87 LEU A HD21 8  
ATOM 11268 H HD22 . LEU A 1 87 ? 0.352   -2.130  -4.130  1.00 15.00 ? 87 LEU A HD22 8  
ATOM 11269 H HD23 . LEU A 1 87 ? 1.852   -2.407  -3.244  1.00 15.00 ? 87 LEU A HD23 8  
ATOM 11270 N N    . LEU A 1 88 ? -1.213  -2.008  -7.221  1.00 15.00 ? 88 LEU A N    8  
ATOM 11271 C CA   . LEU A 1 88 ? -2.628  -2.351  -7.314  1.00 15.00 ? 88 LEU A CA   8  
ATOM 11272 C C    . LEU A 1 88 ? -3.127  -2.831  -5.958  1.00 15.00 ? 88 LEU A C    8  
ATOM 11273 O O    . LEU A 1 88 ? -2.870  -3.965  -5.555  1.00 15.00 ? 88 LEU A O    8  
ATOM 11274 C CB   . LEU A 1 88 ? -2.849  -3.426  -8.379  1.00 15.00 ? 88 LEU A CB   8  
ATOM 11275 C CG   . LEU A 1 88 ? -2.993  -2.902  -9.810  1.00 15.00 ? 88 LEU A CG   8  
ATOM 11276 C CD1  . LEU A 1 88 ? -1.987  -1.791  -10.081 1.00 15.00 ? 88 LEU A CD1  8  
ATOM 11277 C CD2  . LEU A 1 88 ? -2.820  -4.035  -10.810 1.00 15.00 ? 88 LEU A CD2  8  
ATOM 11278 H H    . LEU A 1 88 ? -0.544  -2.722  -7.269  1.00 15.00 ? 88 LEU A H    8  
ATOM 11279 H HA   . LEU A 1 88 ? -3.172  -1.456  -7.592  1.00 15.00 ? 88 LEU A HA   8  
ATOM 11280 H HB2  . LEU A 1 88 ? -2.012  -4.107  -8.350  1.00 15.00 ? 88 LEU A HB2  8  
ATOM 11281 H HB3  . LEU A 1 88 ? -3.745  -3.973  -8.128  1.00 15.00 ? 88 LEU A HB3  8  
ATOM 11282 H HG   . LEU A 1 88 ? -3.984  -2.491  -9.937  1.00 15.00 ? 88 LEU A HG   8  
ATOM 11283 H HD11 . LEU A 1 88 ? -1.952  -1.122  -9.231  1.00 15.00 ? 88 LEU A HD11 8  
ATOM 11284 H HD12 . LEU A 1 88 ? -1.010  -2.221  -10.242 1.00 15.00 ? 88 LEU A HD12 8  
ATOM 11285 H HD13 . LEU A 1 88 ? -2.287  -1.240  -10.960 1.00 15.00 ? 88 LEU A HD13 8  
ATOM 11286 H HD21 . LEU A 1 88 ? -2.321  -3.663  -11.693 1.00 15.00 ? 88 LEU A HD21 8  
ATOM 11287 H HD22 . LEU A 1 88 ? -2.227  -4.820  -10.365 1.00 15.00 ? 88 LEU A HD22 8  
ATOM 11288 H HD23 . LEU A 1 88 ? -3.789  -4.425  -11.083 1.00 15.00 ? 88 LEU A HD23 8  
ATOM 11289 N N    . LEU A 1 89 ? -3.816  -1.948  -5.249  1.00 15.00 ? 89 LEU A N    8  
ATOM 11290 C CA   . LEU A 1 89 ? -4.324  -2.264  -3.920  1.00 15.00 ? 89 LEU A CA   8  
ATOM 11291 C C    . LEU A 1 89 ? -5.830  -2.491  -3.925  1.00 15.00 ? 89 LEU A C    8  
ATOM 11292 O O    . LEU A 1 89 ? -6.442  -2.720  -4.969  1.00 15.00 ? 89 LEU A O    8  
ATOM 11293 C CB   . LEU A 1 89 ? -3.988  -1.134  -2.943  1.00 15.00 ? 89 LEU A CB   8  
ATOM 11294 C CG   . LEU A 1 89 ? -2.972  -0.120  -3.451  1.00 15.00 ? 89 LEU A CG   8  
ATOM 11295 C CD1  . LEU A 1 89 ? -2.910  1.081   -2.527  1.00 15.00 ? 89 LEU A CD1  8  
ATOM 11296 C CD2  . LEU A 1 89 ? -1.612  -0.771  -3.581  1.00 15.00 ? 89 LEU A CD2  8  
ATOM 11297 H H    . LEU A 1 89 ? -3.971  -1.056  -5.620  1.00 15.00 ? 89 LEU A H    8  
ATOM 11298 H HA   . LEU A 1 89 ? -3.833  -3.163  -3.588  1.00 15.00 ? 89 LEU A HA   8  
ATOM 11299 H HB2  . LEU A 1 89 ? -4.902  -0.607  -2.704  1.00 15.00 ? 89 LEU A HB2  8  
ATOM 11300 H HB3  . LEU A 1 89 ? -3.601  -1.574  -2.037  1.00 15.00 ? 89 LEU A HB3  8  
ATOM 11301 H HG   . LEU A 1 89 ? -3.273  0.224   -4.427  1.00 15.00 ? 89 LEU A HG   8  
ATOM 11302 H HD11 . LEU A 1 89 ? -3.491  0.882   -1.639  1.00 15.00 ? 89 LEU A HD11 8  
ATOM 11303 H HD12 . LEU A 1 89 ? -1.884  1.267   -2.251  1.00 15.00 ? 89 LEU A HD12 8  
ATOM 11304 H HD13 . LEU A 1 89 ? -3.311  1.944   -3.035  1.00 15.00 ? 89 LEU A HD13 8  
ATOM 11305 H HD21 . LEU A 1 89 ? -0.848  -0.076  -3.267  1.00 15.00 ? 89 LEU A HD21 8  
ATOM 11306 H HD22 . LEU A 1 89 ? -1.578  -1.649  -2.958  1.00 15.00 ? 89 LEU A HD22 8  
ATOM 11307 H HD23 . LEU A 1 89 ? -1.446  -1.052  -4.609  1.00 15.00 ? 89 LEU A HD23 8  
ATOM 11308 N N    . GLU A 1 90 ? -6.413  -2.407  -2.735  1.00 15.00 ? 90 GLU A N    8  
ATOM 11309 C CA   . GLU A 1 90 ? -7.847  -2.578  -2.552  1.00 15.00 ? 90 GLU A CA   8  
ATOM 11310 C C    . GLU A 1 90 ? -8.347  -1.623  -1.472  1.00 15.00 ? 90 GLU A C    8  
ATOM 11311 O O    . GLU A 1 90 ? -7.739  -1.505  -0.408  1.00 15.00 ? 90 GLU A O    8  
ATOM 11312 C CB   . GLU A 1 90 ? -8.167  -4.034  -2.185  1.00 15.00 ? 90 GLU A CB   8  
ATOM 11313 C CG   . GLU A 1 90 ? -9.349  -4.199  -1.239  1.00 15.00 ? 90 GLU A CG   8  
ATOM 11314 C CD   . GLU A 1 90 ? -9.696  -5.654  -0.988  1.00 15.00 ? 90 GLU A CD   8  
ATOM 11315 O OE1  . GLU A 1 90 ? -8.765  -6.455  -0.760  1.00 15.00 ? 90 GLU A OE1  8  
ATOM 11316 O OE2  . GLU A 1 90 ? -10.898 -5.992  -1.019  1.00 15.00 ? 90 GLU A OE2  8  
ATOM 11317 H H    . GLU A 1 90 ? -5.854  -2.210  -1.952  1.00 15.00 ? 90 GLU A H    8  
ATOM 11318 H HA   . GLU A 1 90 ? -8.332  -2.334  -3.486  1.00 15.00 ? 90 GLU A HA   8  
ATOM 11319 H HB2  . GLU A 1 90 ? -8.387  -4.575  -3.091  1.00 15.00 ? 90 GLU A HB2  8  
ATOM 11320 H HB3  . GLU A 1 90 ? -7.298  -4.474  -1.719  1.00 15.00 ? 90 GLU A HB3  8  
ATOM 11321 H HG2  . GLU A 1 90 ? -9.106  -3.735  -0.295  1.00 15.00 ? 90 GLU A HG2  8  
ATOM 11322 H HG3  . GLU A 1 90 ? -10.210 -3.708  -1.670  1.00 15.00 ? 90 GLU A HG3  8  
ATOM 11323 N N    . LYS A 1 91 ? -9.451  -0.938  -1.752  1.00 15.00 ? 91 LYS A N    8  
ATOM 11324 C CA   . LYS A 1 91 ? -10.022 0.011   -0.802  1.00 15.00 ? 91 LYS A CA   8  
ATOM 11325 C C    . LYS A 1 91 ? -10.101 -0.591  0.599   1.00 15.00 ? 91 LYS A C    8  
ATOM 11326 O O    . LYS A 1 91 ? -10.940 -1.448  0.874   1.00 15.00 ? 91 LYS A O    8  
ATOM 11327 C CB   . LYS A 1 91 ? -11.411 0.452   -1.263  1.00 15.00 ? 91 LYS A CB   8  
ATOM 11328 C CG   . LYS A 1 91 ? -11.883 1.745   -0.618  1.00 15.00 ? 91 LYS A CG   8  
ATOM 11329 C CD   . LYS A 1 91 ? -11.065 2.937   -1.088  1.00 15.00 ? 91 LYS A CD   8  
ATOM 11330 C CE   . LYS A 1 91 ? -11.409 3.319   -2.518  1.00 15.00 ? 91 LYS A CE   8  
ATOM 11331 N NZ   . LYS A 1 91 ? -12.555 4.268   -2.579  1.00 15.00 ? 91 LYS A NZ   8  
ATOM 11332 H H    . LYS A 1 91 ? -9.890  -1.071  -2.618  1.00 15.00 ? 91 LYS A H    8  
ATOM 11333 H HA   . LYS A 1 91 ? -9.374  0.874   -0.771  1.00 15.00 ? 91 LYS A HA   8  
ATOM 11334 H HB2  . LYS A 1 91 ? -11.392 0.594   -2.335  1.00 15.00 ? 91 LYS A HB2  8  
ATOM 11335 H HB3  . LYS A 1 91 ? -12.121 -0.325  -1.024  1.00 15.00 ? 91 LYS A HB3  8  
ATOM 11336 H HG2  . LYS A 1 91 ? -12.917 1.908   -0.877  1.00 15.00 ? 91 LYS A HG2  8  
ATOM 11337 H HG3  . LYS A 1 91 ? -11.789 1.655   0.454   1.00 15.00 ? 91 LYS A HG3  8  
ATOM 11338 H HD2  . LYS A 1 91 ? -11.270 3.779   -0.443  1.00 15.00 ? 91 LYS A HD2  8  
ATOM 11339 H HD3  . LYS A 1 91 ? -10.016 2.687   -1.034  1.00 15.00 ? 91 LYS A HD3  8  
ATOM 11340 H HE2  . LYS A 1 91 ? -10.546 3.783   -2.971  1.00 15.00 ? 91 LYS A HE2  8  
ATOM 11341 H HE3  . LYS A 1 91 ? -11.665 2.424   -3.065  1.00 15.00 ? 91 LYS A HE3  8  
ATOM 11342 H HZ1  . LYS A 1 91 ? -13.454 3.747   -2.531  1.00 15.00 ? 91 LYS A HZ1  8  
ATOM 11343 H HZ2  . LYS A 1 91 ? -12.511 4.935   -1.783  1.00 15.00 ? 91 LYS A HZ2  8  
ATOM 11344 H HZ3  . LYS A 1 91 ? -12.527 4.807   -3.469  1.00 15.00 ? 91 LYS A HZ3  8  
ATOM 11345 N N    . GLY A 1 92 ? -9.212  -0.136  1.477   1.00 15.00 ? 92 GLY A N    8  
ATOM 11346 C CA   . GLY A 1 92 ? -9.185  -0.639  2.838   1.00 15.00 ? 92 GLY A CA   8  
ATOM 11347 C C    . GLY A 1 92 ? -10.375 -0.179  3.657   1.00 15.00 ? 92 GLY A C    8  
ATOM 11348 O O    . GLY A 1 92 ? -11.385 0.259   3.106   1.00 15.00 ? 92 GLY A O    8  
ATOM 11349 H H    . GLY A 1 92 ? -8.566  0.545   1.197   1.00 15.00 ? 92 GLY A H    8  
ATOM 11350 H HA2  . GLY A 1 92 ? -9.178  -1.718  2.811   1.00 15.00 ? 92 GLY A HA2  8  
ATOM 11351 H HA3  . GLY A 1 92 ? -8.279  -0.297  3.317   1.00 15.00 ? 92 GLY A HA3  8  
ATOM 11352 N N    . GLN A 1 93 ? -10.256 -0.281  4.977   1.00 15.00 ? 93 GLN A N    8  
ATOM 11353 C CA   . GLN A 1 93 ? -11.329 0.126   5.877   1.00 15.00 ? 93 GLN A CA   8  
ATOM 11354 C C    . GLN A 1 93 ? -11.391 1.645   5.998   1.00 15.00 ? 93 GLN A C    8  
ATOM 11355 O O    . GLN A 1 93 ? -10.382 2.333   5.838   1.00 15.00 ? 93 GLN A O    8  
ATOM 11356 C CB   . GLN A 1 93 ? -11.128 -0.501  7.259   1.00 15.00 ? 93 GLN A CB   8  
ATOM 11357 C CG   . GLN A 1 93 ? -12.015 -1.710  7.514   1.00 15.00 ? 93 GLN A CG   8  
ATOM 11358 C CD   . GLN A 1 93 ? -12.592 -1.724  8.916   1.00 15.00 ? 93 GLN A CD   8  
ATOM 11359 O OE1  . GLN A 1 93 ? -12.117 -1.014  9.803   1.00 15.00 ? 93 GLN A OE1  8  
ATOM 11360 N NE2  . GLN A 1 93 ? -13.623 -2.536  9.123   1.00 15.00 ? 93 GLN A NE2  8  
ATOM 11361 H H    . GLN A 1 93 ? -9.426  -0.639  5.355   1.00 15.00 ? 93 GLN A H    8  
ATOM 11362 H HA   . GLN A 1 93 ? -12.261 -0.228  5.463   1.00 15.00 ? 93 GLN A HA   8  
ATOM 11363 H HB2  . GLN A 1 93 ? -10.098 -0.811  7.355   1.00 15.00 ? 93 GLN A HB2  8  
ATOM 11364 H HB3  . GLN A 1 93 ? -11.343 0.241   8.015   1.00 15.00 ? 93 GLN A HB3  8  
ATOM 11365 H HG2  . GLN A 1 93 ? -12.830 -1.698  6.806   1.00 15.00 ? 93 GLN A HG2  8  
ATOM 11366 H HG3  . GLN A 1 93 ? -11.429 -2.606  7.372   1.00 15.00 ? 93 GLN A HG3  8  
ATOM 11367 H HE21 . GLN A 1 93 ? -13.948 -3.072  8.371   1.00 15.00 ? 93 GLN A HE21 8  
ATOM 11368 H HE22 . GLN A 1 93 ? -14.016 -2.565  10.021  1.00 15.00 ? 93 GLN A HE22 8  
ATOM 11369 N N    . SER A 1 94 ? -12.582 2.163   6.283   1.00 15.00 ? 94 SER A N    8  
ATOM 11370 C CA   . SER A 1 94 ? -12.776 3.600   6.426   1.00 15.00 ? 94 SER A CA   8  
ATOM 11371 C C    . SER A 1 94 ? -12.563 4.035   7.876   1.00 15.00 ? 94 SER A C    8  
ATOM 11372 O O    . SER A 1 94 ? -13.244 3.553   8.781   1.00 15.00 ? 94 SER A O    8  
ATOM 11373 C CB   . SER A 1 94 ? -14.181 3.993   5.966   1.00 15.00 ? 94 SER A CB   8  
ATOM 11374 O OG   . SER A 1 94 ? -14.175 4.417   4.614   1.00 15.00 ? 94 SER A OG   8  
ATOM 11375 H H    . SER A 1 94 ? -13.348 1.563   6.399   1.00 15.00 ? 94 SER A H    8  
ATOM 11376 H HA   . SER A 1 94 ? -12.051 4.095   5.799   1.00 15.00 ? 94 SER A HA   8  
ATOM 11377 H HB2  . SER A 1 94 ? -14.839 3.142   6.060   1.00 15.00 ? 94 SER A HB2  8  
ATOM 11378 H HB3  . SER A 1 94 ? -14.547 4.801   6.582   1.00 15.00 ? 94 SER A HB3  8  
ATOM 11379 H HG   . SER A 1 94 ? -13.808 3.722   4.062   1.00 15.00 ? 94 SER A HG   8  
ATOM 11380 N N    . PRO A 1 95 ? -11.612 4.956   8.120   1.00 15.00 ? 95 PRO A N    8  
ATOM 11381 C CA   . PRO A 1 95 ? -11.320 5.448   9.470   1.00 15.00 ? 95 PRO A CA   8  
ATOM 11382 C C    . PRO A 1 95 ? -12.574 5.922   10.196  1.00 15.00 ? 95 PRO A C    8  
ATOM 11383 O O    . PRO A 1 95 ? -12.806 5.569   11.352  1.00 15.00 ? 95 PRO A O    8  
ATOM 11384 C CB   . PRO A 1 95 ? -10.368 6.620   9.225   1.00 15.00 ? 95 PRO A CB   8  
ATOM 11385 C CG   . PRO A 1 95 ? -9.716  6.311   7.923   1.00 15.00 ? 95 PRO A CG   8  
ATOM 11386 C CD   . PRO A 1 95 ? -10.749 5.589   7.103   1.00 15.00 ? 95 PRO A CD   8  
ATOM 11387 H HA   . PRO A 1 95 ? -10.824 4.695   10.066  1.00 15.00 ? 95 PRO A HA   8  
ATOM 11388 H HB2  . PRO A 1 95 ? -10.931 7.541   9.178   1.00 15.00 ? 95 PRO A HB2  8  
ATOM 11389 H HB3  . PRO A 1 95 ? -9.645  6.674   10.025  1.00 15.00 ? 95 PRO A HB3  8  
ATOM 11390 H HG2  . PRO A 1 95 ? -9.423  7.228   7.433   1.00 15.00 ? 95 PRO A HG2  8  
ATOM 11391 H HG3  . PRO A 1 95 ? -8.856  5.678   8.083   1.00 15.00 ? 95 PRO A HG3  8  
ATOM 11392 H HD2  . PRO A 1 95 ? -11.311 6.288   6.502   1.00 15.00 ? 95 PRO A HD2  8  
ATOM 11393 H HD3  . PRO A 1 95 ? -10.281 4.843   6.478   1.00 15.00 ? 95 PRO A HD3  8  
ATOM 11394 N N    . THR A 1 96 ? -13.381 6.724   9.510   1.00 15.00 ? 96 THR A N    8  
ATOM 11395 C CA   . THR A 1 96 ? -14.613 7.247   10.089  1.00 15.00 ? 96 THR A CA   8  
ATOM 11396 C C    . THR A 1 96 ? -15.809 6.388   9.690   1.00 15.00 ? 96 THR A C    8  
ATOM 11397 O O    . THR A 1 96 ? -15.589 5.275   9.167   1.00 15.00 ? 96 THR A O    8  
ATOM 11398 C CB   . THR A 1 96 ? -14.838 8.693   9.644   1.00 15.00 ? 96 THR A CB   8  
ATOM 11399 O OG1  . THR A 1 96 ? -14.481 8.860   8.283   1.00 15.00 ? 96 THR A OG1  8  
ATOM 11400 C CG2  . THR A 1 96 ? -14.047 9.698   10.452  1.00 15.00 ? 96 THR A CG2  8  
ATOM 11401 O OXT  . THR A 1 96 ? -16.955 6.834   9.905   1.00 15.00 ? 96 THR A OXT  8  
ATOM 11402 H H    . THR A 1 96 ? -13.143 6.970   8.591   1.00 15.00 ? 96 THR A H    8  
ATOM 11403 H HA   . THR A 1 96 ? -14.510 7.223   11.164  1.00 15.00 ? 96 THR A HA   8  
ATOM 11404 H HB   . THR A 1 96 ? -15.886 8.933   9.751   1.00 15.00 ? 96 THR A HB   8  
ATOM 11405 H HG1  . THR A 1 96 ? -15.273 8.856   7.741   1.00 15.00 ? 96 THR A HG1  8  
ATOM 11406 H HG21 . THR A 1 96 ? -14.715 10.239  11.106  1.00 15.00 ? 96 THR A HG21 8  
ATOM 11407 H HG22 . THR A 1 96 ? -13.305 9.182   11.043  1.00 15.00 ? 96 THR A HG22 8  
ATOM 11408 H HG23 . THR A 1 96 ? -13.557 10.392  9.785   1.00 15.00 ? 96 THR A HG23 8  
ATOM 11409 N N    . PRO A 1 1  ? -21.358 5.093   3.301   1.00 15.00 ? 1  PRO A N    9  
ATOM 11410 C CA   . PRO A 1 1  ? -20.733 4.864   1.971   1.00 15.00 ? 1  PRO A CA   9  
ATOM 11411 C C    . PRO A 1 1  ? -19.471 4.010   2.079   1.00 15.00 ? 1  PRO A C    9  
ATOM 11412 O O    . PRO A 1 1  ? -18.536 4.355   2.803   1.00 15.00 ? 1  PRO A O    9  
ATOM 11413 C CB   . PRO A 1 1  ? -20.402 6.229   1.376   1.00 15.00 ? 1  PRO A CB   9  
ATOM 11414 C CG   . PRO A 1 1  ? -21.008 7.204   2.330   1.00 15.00 ? 1  PRO A CG   9  
ATOM 11415 C CD   . PRO A 1 1  ? -21.101 6.497   3.660   1.00 15.00 ? 1  PRO A CD   9  
ATOM 11416 H H2   . PRO A 1 1  ? -20.933 4.350   3.882   1.00 15.00 ? 1  PRO A H2   9  
ATOM 11417 H H3   . PRO A 1 1  ? -22.337 4.765   3.131   1.00 15.00 ? 1  PRO A H3   9  
ATOM 11418 H HA   . PRO A 1 1  ? -21.447 4.362   1.335   1.00 15.00 ? 1  PRO A HA   9  
ATOM 11419 H HB2  . PRO A 1 1  ? -19.330 6.350   1.313   1.00 15.00 ? 1  PRO A HB2  9  
ATOM 11420 H HB3  . PRO A 1 1  ? -20.840 6.315   0.394   1.00 15.00 ? 1  PRO A HB3  9  
ATOM 11421 H HG2  . PRO A 1 1  ? -20.376 8.076   2.413   1.00 15.00 ? 1  PRO A HG2  9  
ATOM 11422 H HG3  . PRO A 1 1  ? -21.992 7.487   1.987   1.00 15.00 ? 1  PRO A HG3  9  
ATOM 11423 H HD2  . PRO A 1 1  ? -20.171 6.590   4.201   1.00 15.00 ? 1  PRO A HD2  9  
ATOM 11424 H HD3  . PRO A 1 1  ? -21.918 6.897   4.242   1.00 15.00 ? 1  PRO A HD3  9  
ATOM 11425 N N    . LYS A 1 2  ? -19.452 2.897   1.354   1.00 15.00 ? 2  LYS A N    9  
ATOM 11426 C CA   . LYS A 1 2  ? -18.307 1.995   1.368   1.00 15.00 ? 2  LYS A CA   9  
ATOM 11427 C C    . LYS A 1 2  ? -18.099 1.359   -0.005  1.00 15.00 ? 2  LYS A C    9  
ATOM 11428 O O    . LYS A 1 2  ? -18.874 0.496   -0.419  1.00 15.00 ? 2  LYS A O    9  
ATOM 11429 C CB   . LYS A 1 2  ? -18.507 0.903   2.421   1.00 15.00 ? 2  LYS A CB   9  
ATOM 11430 C CG   . LYS A 1 2  ? -19.871 0.236   2.353   1.00 15.00 ? 2  LYS A CG   9  
ATOM 11431 C CD   . LYS A 1 2  ? -19.798 -1.225  2.766   1.00 15.00 ? 2  LYS A CD   9  
ATOM 11432 C CE   . LYS A 1 2  ? -19.674 -1.370  4.274   1.00 15.00 ? 2  LYS A CE   9  
ATOM 11433 N NZ   . LYS A 1 2  ? -20.511 -2.486  4.794   1.00 15.00 ? 2  LYS A NZ   9  
ATOM 11434 H H    . LYS A 1 2  ? -20.227 2.676   0.797   1.00 15.00 ? 2  LYS A H    9  
ATOM 11435 H HA   . LYS A 1 2  ? -17.433 2.573   1.625   1.00 15.00 ? 2  LYS A HA   9  
ATOM 11436 H HB2  . LYS A 1 2  ? -17.751 0.144   2.285   1.00 15.00 ? 2  LYS A HB2  9  
ATOM 11437 H HB3  . LYS A 1 2  ? -18.393 1.340   3.402   1.00 15.00 ? 2  LYS A HB3  9  
ATOM 11438 H HG2  . LYS A 1 2  ? -20.548 0.753   3.016   1.00 15.00 ? 2  LYS A HG2  9  
ATOM 11439 H HG3  . LYS A 1 2  ? -20.240 0.297   1.339   1.00 15.00 ? 2  LYS A HG3  9  
ATOM 11440 H HD2  . LYS A 1 2  ? -20.695 -1.727  2.439   1.00 15.00 ? 2  LYS A HD2  9  
ATOM 11441 H HD3  . LYS A 1 2  ? -18.937 -1.679  2.297   1.00 15.00 ? 2  LYS A HD3  9  
ATOM 11442 H HE2  . LYS A 1 2  ? -18.641 -1.562  4.521   1.00 15.00 ? 2  LYS A HE2  9  
ATOM 11443 H HE3  . LYS A 1 2  ? -19.989 -0.448  4.739   1.00 15.00 ? 2  LYS A HE3  9  
ATOM 11444 H HZ1  . LYS A 1 2  ? -20.655 -2.377  5.818   1.00 15.00 ? 2  LYS A HZ1  9  
ATOM 11445 H HZ2  . LYS A 1 2  ? -21.438 -2.488  4.322   1.00 15.00 ? 2  LYS A HZ2  9  
ATOM 11446 H HZ3  . LYS A 1 2  ? -20.043 -3.397  4.616   1.00 15.00 ? 2  LYS A HZ3  9  
ATOM 11447 N N    . PRO A 1 3  ? -17.049 1.775   -0.738  1.00 15.00 ? 3  PRO A N    9  
ATOM 11448 C CA   . PRO A 1 3  ? -16.757 1.235   -2.070  1.00 15.00 ? 3  PRO A CA   9  
ATOM 11449 C C    . PRO A 1 3  ? -16.468 -0.264  -2.042  1.00 15.00 ? 3  PRO A C    9  
ATOM 11450 O O    . PRO A 1 3  ? -17.294 -1.069  -2.470  1.00 15.00 ? 3  PRO A O    9  
ATOM 11451 C CB   . PRO A 1 3  ? -15.517 2.015   -2.522  1.00 15.00 ? 3  PRO A CB   9  
ATOM 11452 C CG   . PRO A 1 3  ? -14.923 2.566   -1.271  1.00 15.00 ? 3  PRO A CG   9  
ATOM 11453 C CD   . PRO A 1 3  ? -16.071 2.800   -0.333  1.00 15.00 ? 3  PRO A CD   9  
ATOM 11454 H HA   . PRO A 1 3  ? -17.570 1.425   -2.754  1.00 15.00 ? 3  PRO A HA   9  
ATOM 11455 H HB2  . PRO A 1 3  ? -14.832 1.347   -3.022  1.00 15.00 ? 3  PRO A HB2  9  
ATOM 11456 H HB3  . PRO A 1 3  ? -15.813 2.805   -3.196  1.00 15.00 ? 3  PRO A HB3  9  
ATOM 11457 H HG2  . PRO A 1 3  ? -14.235 1.851   -0.848  1.00 15.00 ? 3  PRO A HG2  9  
ATOM 11458 H HG3  . PRO A 1 3  ? -14.416 3.495   -1.483  1.00 15.00 ? 3  PRO A HG3  9  
ATOM 11459 H HD2  . PRO A 1 3  ? -15.757 2.655   0.690   1.00 15.00 ? 3  PRO A HD2  9  
ATOM 11460 H HD3  . PRO A 1 3  ? -16.474 3.793   -0.469  1.00 15.00 ? 3  PRO A HD3  9  
ATOM 11461 N N    . GLY A 1 4  ? -15.291 -0.635  -1.547  1.00 15.00 ? 4  GLY A N    9  
ATOM 11462 C CA   . GLY A 1 4  ? -14.926 -2.039  -1.487  1.00 15.00 ? 4  GLY A CA   9  
ATOM 11463 C C    . GLY A 1 4  ? -14.140 -2.474  -2.707  1.00 15.00 ? 4  GLY A C    9  
ATOM 11464 O O    . GLY A 1 4  ? -13.323 -3.391  -2.635  1.00 15.00 ? 4  GLY A O    9  
ATOM 11465 H H    . GLY A 1 4  ? -14.663 0.045   -1.227  1.00 15.00 ? 4  GLY A H    9  
ATOM 11466 H HA2  . GLY A 1 4  ? -14.326 -2.208  -0.605  1.00 15.00 ? 4  GLY A HA2  9  
ATOM 11467 H HA3  . GLY A 1 4  ? -15.825 -2.632  -1.420  1.00 15.00 ? 4  GLY A HA3  9  
ATOM 11468 N N    . ASP A 1 5  ? -14.388 -1.808  -3.829  1.00 15.00 ? 5  ASP A N    9  
ATOM 11469 C CA   . ASP A 1 5  ? -13.699 -2.122  -5.073  1.00 15.00 ? 5  ASP A CA   9  
ATOM 11470 C C    . ASP A 1 5  ? -12.206 -1.898  -4.935  1.00 15.00 ? 5  ASP A C    9  
ATOM 11471 O O    . ASP A 1 5  ? -11.744 -1.128  -4.092  1.00 15.00 ? 5  ASP A O    9  
ATOM 11472 C CB   . ASP A 1 5  ? -14.254 -1.274  -6.219  1.00 15.00 ? 5  ASP A CB   9  
ATOM 11473 C CG   . ASP A 1 5  ? -15.291 -2.017  -7.039  1.00 15.00 ? 5  ASP A CG   9  
ATOM 11474 O OD1  . ASP A 1 5  ? -14.916 -2.989  -7.729  1.00 15.00 ? 5  ASP A OD1  9  
ATOM 11475 O OD2  . ASP A 1 5  ? -16.476 -1.628  -6.991  1.00 15.00 ? 5  ASP A OD2  9  
ATOM 11476 H H    . ASP A 1 5  ? -15.050 -1.086  -3.820  1.00 15.00 ? 5  ASP A H    9  
ATOM 11477 H HA   . ASP A 1 5  ? -13.861 -3.167  -5.300  1.00 15.00 ? 5  ASP A HA   9  
ATOM 11478 H HB2  . ASP A 1 5  ? -14.713 -0.386  -5.813  1.00 15.00 ? 5  ASP A HB2  9  
ATOM 11479 H HB3  . ASP A 1 5  ? -13.443 -0.988  -6.873  1.00 15.00 ? 5  ASP A HB3  9  
ATOM 11480 N N    . ILE A 1 6  ? -11.466 -2.594  -5.774  1.00 15.00 ? 6  ILE A N    9  
ATOM 11481 C CA   . ILE A 1 6  ? -10.021 -2.516  -5.783  1.00 15.00 ? 6  ILE A CA   9  
ATOM 11482 C C    . ILE A 1 6  ? -9.545  -1.254  -6.497  1.00 15.00 ? 6  ILE A C    9  
ATOM 11483 O O    . ILE A 1 6  ? -10.162 -0.805  -7.462  1.00 15.00 ? 6  ILE A O    9  
ATOM 11484 C CB   . ILE A 1 6  ? -9.445  -3.762  -6.485  1.00 15.00 ? 6  ILE A CB   9  
ATOM 11485 C CG1  . ILE A 1 6  ? -8.924  -4.763  -5.455  1.00 15.00 ? 6  ILE A CG1  9  
ATOM 11486 C CG2  . ILE A 1 6  ? -8.342  -3.388  -7.472  1.00 15.00 ? 6  ILE A CG2  9  
ATOM 11487 C CD1  . ILE A 1 6  ? -10.022 -5.430  -4.655  1.00 15.00 ? 6  ILE A CD1  9  
ATOM 11488 H H    . ILE A 1 6  ? -11.910 -3.191  -6.412  1.00 15.00 ? 6  ILE A H    9  
ATOM 11489 H HA   . ILE A 1 6  ? -9.671  -2.506  -4.760  1.00 15.00 ? 6  ILE A HA   9  
ATOM 11490 H HB   . ILE A 1 6  ? -10.256 -4.220  -7.037  1.00 15.00 ? 6  ILE A HB   9  
ATOM 11491 H HG12 . ILE A 1 6  ? -8.369  -5.537  -5.964  1.00 15.00 ? 6  ILE A HG12 9  
ATOM 11492 H HG13 . ILE A 1 6  ? -8.270  -4.252  -4.766  1.00 15.00 ? 6  ILE A HG13 9  
ATOM 11493 H HG21 . ILE A 1 6  ? -7.583  -2.810  -6.963  1.00 15.00 ? 6  ILE A HG21 9  
ATOM 11494 H HG22 . ILE A 1 6  ? -7.900  -4.286  -7.877  1.00 15.00 ? 6  ILE A HG22 9  
ATOM 11495 H HG23 . ILE A 1 6  ? -8.762  -2.799  -8.275  1.00 15.00 ? 6  ILE A HG23 9  
ATOM 11496 H HD11 . ILE A 1 6  ? -10.301 -4.793  -3.828  1.00 15.00 ? 6  ILE A HD11 9  
ATOM 11497 H HD12 . ILE A 1 6  ? -10.880 -5.595  -5.289  1.00 15.00 ? 6  ILE A HD12 9  
ATOM 11498 H HD13 . ILE A 1 6  ? -9.667  -6.377  -4.276  1.00 15.00 ? 6  ILE A HD13 9  
ATOM 11499 N N    . PHE A 1 7  ? -8.433  -0.700  -6.030  1.00 15.00 ? 7  PHE A N    9  
ATOM 11500 C CA   . PHE A 1 7  ? -7.867  0.492   -6.644  1.00 15.00 ? 7  PHE A CA   9  
ATOM 11501 C C    . PHE A 1 7  ? -6.347  0.389   -6.694  1.00 15.00 ? 7  PHE A C    9  
ATOM 11502 O O    . PHE A 1 7  ? -5.753  -0.450  -6.020  1.00 15.00 ? 7  PHE A O    9  
ATOM 11503 C CB   . PHE A 1 7  ? -8.307  1.756   -5.894  1.00 15.00 ? 7  PHE A CB   9  
ATOM 11504 C CG   . PHE A 1 7  ? -7.545  2.022   -4.625  1.00 15.00 ? 7  PHE A CG   9  
ATOM 11505 C CD1  . PHE A 1 7  ? -6.241  2.489   -4.667  1.00 15.00 ? 7  PHE A CD1  9  
ATOM 11506 C CD2  . PHE A 1 7  ? -8.138  1.813   -3.391  1.00 15.00 ? 7  PHE A CD2  9  
ATOM 11507 C CE1  . PHE A 1 7  ? -5.543  2.740   -3.504  1.00 15.00 ? 7  PHE A CE1  9  
ATOM 11508 C CE2  . PHE A 1 7  ? -7.444  2.064   -2.223  1.00 15.00 ? 7  PHE A CE2  9  
ATOM 11509 C CZ   . PHE A 1 7  ? -6.145  2.528   -2.280  1.00 15.00 ? 7  PHE A CZ   9  
ATOM 11510 H H    . PHE A 1 7  ? -7.977  -1.110  -5.266  1.00 15.00 ? 7  PHE A H    9  
ATOM 11511 H HA   . PHE A 1 7  ? -8.239  0.538   -7.657  1.00 15.00 ? 7  PHE A HA   9  
ATOM 11512 H HB2  . PHE A 1 7  ? -8.176  2.611   -6.541  1.00 15.00 ? 7  PHE A HB2  9  
ATOM 11513 H HB3  . PHE A 1 7  ? -9.354  1.665   -5.640  1.00 15.00 ? 7  PHE A HB3  9  
ATOM 11514 H HD1  . PHE A 1 7  ? -5.768  2.655   -5.624  1.00 15.00 ? 7  PHE A HD1  9  
ATOM 11515 H HD2  . PHE A 1 7  ? -9.154  1.448   -3.345  1.00 15.00 ? 7  PHE A HD2  9  
ATOM 11516 H HE1  . PHE A 1 7  ? -4.527  3.103   -3.550  1.00 15.00 ? 7  PHE A HE1  9  
ATOM 11517 H HE2  . PHE A 1 7  ? -7.916  1.897   -1.267  1.00 15.00 ? 7  PHE A HE2  9  
ATOM 11518 H HZ   . PHE A 1 7  ? -5.602  2.725   -1.371  1.00 15.00 ? 7  PHE A HZ   9  
ATOM 11519 N N    . GLU A 1 8  ? -5.724  1.231   -7.510  1.00 15.00 ? 8  GLU A N    9  
ATOM 11520 C CA   . GLU A 1 8  ? -4.273  1.211   -7.661  1.00 15.00 ? 8  GLU A CA   9  
ATOM 11521 C C    . GLU A 1 8  ? -3.668  2.602   -7.512  1.00 15.00 ? 8  GLU A C    9  
ATOM 11522 O O    . GLU A 1 8  ? -4.236  3.598   -7.961  1.00 15.00 ? 8  GLU A O    9  
ATOM 11523 C CB   . GLU A 1 8  ? -3.908  0.647   -9.029  1.00 15.00 ? 8  GLU A CB   9  
ATOM 11524 C CG   . GLU A 1 8  ? -4.605  1.351   -10.176 1.00 15.00 ? 8  GLU A CG   9  
ATOM 11525 C CD   . GLU A 1 8  ? -4.772  0.465   -11.395 1.00 15.00 ? 8  GLU A CD   9  
ATOM 11526 O OE1  . GLU A 1 8  ? -5.194  -0.699  -11.229 1.00 15.00 ? 8  GLU A OE1  9  
ATOM 11527 O OE2  . GLU A 1 8  ? -4.482  0.935   -12.515 1.00 15.00 ? 8  GLU A OE2  9  
ATOM 11528 H H    . GLU A 1 8  ? -6.252  1.868   -8.034  1.00 15.00 ? 8  GLU A H    9  
ATOM 11529 H HA   . GLU A 1 8  ? -3.859  0.564   -6.897  1.00 15.00 ? 8  GLU A HA   9  
ATOM 11530 H HB2  . GLU A 1 8  ? -2.842  0.744   -9.172  1.00 15.00 ? 8  GLU A HB2  9  
ATOM 11531 H HB3  . GLU A 1 8  ? -4.176  -0.398  -9.059  1.00 15.00 ? 8  GLU A HB3  9  
ATOM 11532 H HG2  . GLU A 1 8  ? -5.581  1.667   -9.844  1.00 15.00 ? 8  GLU A HG2  9  
ATOM 11533 H HG3  . GLU A 1 8  ? -4.022  2.216   -10.454 1.00 15.00 ? 8  GLU A HG3  9  
ATOM 11534 N N    . VAL A 1 9  ? -2.496  2.645   -6.896  1.00 15.00 ? 9  VAL A N    9  
ATOM 11535 C CA   . VAL A 1 9  ? -1.765  3.890   -6.693  1.00 15.00 ? 9  VAL A CA   9  
ATOM 11536 C C    . VAL A 1 9  ? -0.644  4.000   -7.718  1.00 15.00 ? 9  VAL A C    9  
ATOM 11537 O O    . VAL A 1 9  ? 0.280   3.188   -7.729  1.00 15.00 ? 9  VAL A O    9  
ATOM 11538 C CB   . VAL A 1 9  ? -1.192  4.000   -5.252  1.00 15.00 ? 9  VAL A CB   9  
ATOM 11539 C CG1  . VAL A 1 9  ? -1.181  2.642   -4.563  1.00 15.00 ? 9  VAL A CG1  9  
ATOM 11540 C CG2  . VAL A 1 9  ? 0.208   4.606   -5.252  1.00 15.00 ? 9  VAL A CG2  9  
ATOM 11541 H H    . VAL A 1 9  ? -2.098  1.806   -6.589  1.00 15.00 ? 9  VAL A H    9  
ATOM 11542 H HA   . VAL A 1 9  ? -2.455  4.708   -6.851  1.00 15.00 ? 9  VAL A HA   9  
ATOM 11543 H HB   . VAL A 1 9  ? -1.839  4.655   -4.685  1.00 15.00 ? 9  VAL A HB   9  
ATOM 11544 H HG11 . VAL A 1 9  ? -2.131  2.148   -4.721  1.00 15.00 ? 9  VAL A HG11 9  
ATOM 11545 H HG12 . VAL A 1 9  ? -0.389  2.036   -4.976  1.00 15.00 ? 9  VAL A HG12 9  
ATOM 11546 H HG13 . VAL A 1 9  ? -1.016  2.776   -3.504  1.00 15.00 ? 9  VAL A HG13 9  
ATOM 11547 H HG21 . VAL A 1 9  ? 0.907   3.902   -5.680  1.00 15.00 ? 9  VAL A HG21 9  
ATOM 11548 H HG22 . VAL A 1 9  ? 0.208   5.513   -5.839  1.00 15.00 ? 9  VAL A HG22 9  
ATOM 11549 H HG23 . VAL A 1 9  ? 0.503   4.834   -4.238  1.00 15.00 ? 9  VAL A HG23 9  
ATOM 11550 N N    . GLU A 1 10 ? -0.743  4.992   -8.590  1.00 15.00 ? 10 GLU A N    9  
ATOM 11551 C CA   . GLU A 1 10 ? 0.252   5.184   -9.631  1.00 15.00 ? 10 GLU A CA   9  
ATOM 11552 C C    . GLU A 1 10 ? 1.166   6.369   -9.340  1.00 15.00 ? 10 GLU A C    9  
ATOM 11553 O O    . GLU A 1 10 ? 1.083   7.407   -9.999  1.00 15.00 ? 10 GLU A O    9  
ATOM 11554 C CB   . GLU A 1 10 ? -0.443  5.371   -10.974 1.00 15.00 ? 10 GLU A CB   9  
ATOM 11555 C CG   . GLU A 1 10 ? 0.512   5.611   -12.133 1.00 15.00 ? 10 GLU A CG   9  
ATOM 11556 C CD   . GLU A 1 10 ? 0.218   6.901   -12.874 1.00 15.00 ? 10 GLU A CD   9  
ATOM 11557 O OE1  . GLU A 1 10 ? -0.245  7.864   -12.227 1.00 15.00 ? 10 GLU A OE1  9  
ATOM 11558 O OE2  . GLU A 1 10 ? 0.453   6.949   -14.100 1.00 15.00 ? 10 GLU A OE2  9  
ATOM 11559 H H    . GLU A 1 10 ? -1.512  5.597   -8.544  1.00 15.00 ? 10 GLU A H    9  
ATOM 11560 H HA   . GLU A 1 10 ? 0.854   4.289   -9.677  1.00 15.00 ? 10 GLU A HA   9  
ATOM 11561 H HB2  . GLU A 1 10 ? -1.019  4.483   -11.186 1.00 15.00 ? 10 GLU A HB2  9  
ATOM 11562 H HB3  . GLU A 1 10 ? -1.112  6.214   -10.902 1.00 15.00 ? 10 GLU A HB3  9  
ATOM 11563 H HG2  . GLU A 1 10 ? 1.520   5.656   -11.748 1.00 15.00 ? 10 GLU A HG2  9  
ATOM 11564 H HG3  . GLU A 1 10 ? 0.430   4.788   -12.827 1.00 15.00 ? 10 GLU A HG3  9  
ATOM 11565 N N    . LEU A 1 11 ? 2.054   6.200   -8.369  1.00 15.00 ? 11 LEU A N    9  
ATOM 11566 C CA   . LEU A 1 11 ? 3.003   7.247   -8.013  1.00 15.00 ? 11 LEU A CA   9  
ATOM 11567 C C    . LEU A 1 11 ? 4.256   7.114   -8.872  1.00 15.00 ? 11 LEU A C    9  
ATOM 11568 O O    . LEU A 1 11 ? 4.461   6.088   -9.515  1.00 15.00 ? 11 LEU A O    9  
ATOM 11569 C CB   . LEU A 1 11 ? 3.371   7.163   -6.529  1.00 15.00 ? 11 LEU A CB   9  
ATOM 11570 C CG   . LEU A 1 11 ? 3.548   8.511   -5.819  1.00 15.00 ? 11 LEU A CG   9  
ATOM 11571 C CD1  . LEU A 1 11 ? 2.253   9.310   -5.836  1.00 15.00 ? 11 LEU A CD1  9  
ATOM 11572 C CD2  . LEU A 1 11 ? 4.024   8.300   -4.389  1.00 15.00 ? 11 LEU A CD2  9  
ATOM 11573 H H    . LEU A 1 11 ? 2.081   5.346   -7.891  1.00 15.00 ? 11 LEU A H    9  
ATOM 11574 H HA   . LEU A 1 11 ? 2.540   8.196   -8.213  1.00 15.00 ? 11 LEU A HA   9  
ATOM 11575 H HB2  . LEU A 1 11 ? 2.598   6.610   -6.023  1.00 15.00 ? 11 LEU A HB2  9  
ATOM 11576 H HB3  . LEU A 1 11 ? 4.296   6.615   -6.440  1.00 15.00 ? 11 LEU A HB3  9  
ATOM 11577 H HG   . LEU A 1 11 ? 4.300   9.086   -6.340  1.00 15.00 ? 11 LEU A HG   9  
ATOM 11578 H HD11 . LEU A 1 11 ? 1.770   9.196   -6.794  1.00 15.00 ? 11 LEU A HD11 9  
ATOM 11579 H HD12 . LEU A 1 11 ? 1.597   8.949   -5.058  1.00 15.00 ? 11 LEU A HD12 9  
ATOM 11580 H HD13 . LEU A 1 11 ? 2.472   10.354  -5.665  1.00 15.00 ? 11 LEU A HD13 9  
ATOM 11581 H HD21 . LEU A 1 11 ? 4.127   9.257   -3.899  1.00 15.00 ? 11 LEU A HD21 9  
ATOM 11582 H HD22 . LEU A 1 11 ? 3.304   7.698   -3.854  1.00 15.00 ? 11 LEU A HD22 9  
ATOM 11583 H HD23 . LEU A 1 11 ? 4.980   7.796   -4.397  1.00 15.00 ? 11 LEU A HD23 9  
ATOM 11584 N N    . ALA A 1 12 ? 5.089   8.146   -8.888  1.00 15.00 ? 12 ALA A N    9  
ATOM 11585 C CA   . ALA A 1 12 ? 6.311   8.112   -9.683  1.00 15.00 ? 12 ALA A CA   9  
ATOM 11586 C C    . ALA A 1 12 ? 7.508   7.692   -8.841  1.00 15.00 ? 12 ALA A C    9  
ATOM 11587 O O    . ALA A 1 12 ? 8.163   8.523   -8.211  1.00 15.00 ? 12 ALA A O    9  
ATOM 11588 C CB   . ALA A 1 12 ? 6.568   9.462   -10.331 1.00 15.00 ? 12 ALA A CB   9  
ATOM 11589 H H    . ALA A 1 12 ? 4.878   8.944   -8.359  1.00 15.00 ? 12 ALA A H    9  
ATOM 11590 H HA   . ALA A 1 12 ? 6.172   7.386   -10.472 1.00 15.00 ? 12 ALA A HA   9  
ATOM 11591 H HB1  . ALA A 1 12 ? 7.193   9.326   -11.202 1.00 15.00 ? 12 ALA A HB1  9  
ATOM 11592 H HB2  . ALA A 1 12 ? 5.629   9.904   -10.626 1.00 15.00 ? 12 ALA A HB2  9  
ATOM 11593 H HB3  . ALA A 1 12 ? 7.068   10.110  -9.627  1.00 15.00 ? 12 ALA A HB3  9  
ATOM 11594 N N    . LYS A 1 13 ? 7.788   6.394   -8.838  1.00 15.00 ? 13 LYS A N    9  
ATOM 11595 C CA   . LYS A 1 13 ? 8.907   5.851   -8.080  1.00 15.00 ? 13 LYS A CA   9  
ATOM 11596 C C    . LYS A 1 13 ? 10.221  6.515   -8.489  1.00 15.00 ? 13 LYS A C    9  
ATOM 11597 O O    . LYS A 1 13 ? 11.164  6.591   -7.704  1.00 15.00 ? 13 LYS A O    9  
ATOM 11598 C CB   . LYS A 1 13 ? 8.992   4.337   -8.290  1.00 15.00 ? 13 LYS A CB   9  
ATOM 11599 C CG   . LYS A 1 13 ? 9.518   3.585   -7.082  1.00 15.00 ? 13 LYS A CG   9  
ATOM 11600 C CD   . LYS A 1 13 ? 10.902  4.066   -6.692  1.00 15.00 ? 13 LYS A CD   9  
ATOM 11601 C CE   . LYS A 1 13 ? 10.843  5.030   -5.519  1.00 15.00 ? 13 LYS A CE   9  
ATOM 11602 N NZ   . LYS A 1 13 ? 12.198  5.489   -5.108  1.00 15.00 ? 13 LYS A NZ   9  
ATOM 11603 H H    . LYS A 1 13 ? 7.228   5.786   -9.362  1.00 15.00 ? 13 LYS A H    9  
ATOM 11604 H HA   . LYS A 1 13 ? 8.726   6.050   -7.035  1.00 15.00 ? 13 LYS A HA   9  
ATOM 11605 H HB2  . LYS A 1 13 ? 8.005   3.962   -8.518  1.00 15.00 ? 13 LYS A HB2  9  
ATOM 11606 H HB3  . LYS A 1 13 ? 9.645   4.135   -9.126  1.00 15.00 ? 13 LYS A HB3  9  
ATOM 11607 H HG2  . LYS A 1 13 ? 8.846   3.739   -6.251  1.00 15.00 ? 13 LYS A HG2  9  
ATOM 11608 H HG3  . LYS A 1 13 ? 9.567   2.536   -7.319  1.00 15.00 ? 13 LYS A HG3  9  
ATOM 11609 H HD2  . LYS A 1 13 ? 11.505  3.214   -6.416  1.00 15.00 ? 13 LYS A HD2  9  
ATOM 11610 H HD3  . LYS A 1 13 ? 11.347  4.566   -7.541  1.00 15.00 ? 13 LYS A HD3  9  
ATOM 11611 H HE2  . LYS A 1 13 ? 10.252  5.888   -5.804  1.00 15.00 ? 13 LYS A HE2  9  
ATOM 11612 H HE3  . LYS A 1 13 ? 10.371  4.532   -4.685  1.00 15.00 ? 13 LYS A HE3  9  
ATOM 11613 H HZ1  . LYS A 1 13 ? 12.733  4.699   -4.695  1.00 15.00 ? 13 LYS A HZ1  9  
ATOM 11614 H HZ2  . LYS A 1 13 ? 12.718  5.851   -5.933  1.00 15.00 ? 13 LYS A HZ2  9  
ATOM 11615 H HZ3  . LYS A 1 13 ? 12.120  6.249   -4.402  1.00 15.00 ? 13 LYS A HZ3  9  
ATOM 11616 N N    . ASN A 1 14 ? 10.274  7.000   -9.723  1.00 15.00 ? 14 ASN A N    9  
ATOM 11617 C CA   . ASN A 1 14 ? 11.472  7.655   -10.236 1.00 15.00 ? 14 ASN A CA   9  
ATOM 11618 C C    . ASN A 1 14 ? 11.504  9.122   -9.825  1.00 15.00 ? 14 ASN A C    9  
ATOM 11619 O O    . ASN A 1 14 ? 12.512  9.611   -9.317  1.00 15.00 ? 14 ASN A O    9  
ATOM 11620 C CB   . ASN A 1 14 ? 11.524  7.549   -11.761 1.00 15.00 ? 14 ASN A CB   9  
ATOM 11621 C CG   . ASN A 1 14 ? 11.920  6.167   -12.238 1.00 15.00 ? 14 ASN A CG   9  
ATOM 11622 O OD1  . ASN A 1 14 ? 12.507  5.383   -11.492 1.00 15.00 ? 14 ASN A OD1  9  
ATOM 11623 N ND2  . ASN A 1 14 ? 11.600  5.862   -13.490 1.00 15.00 ? 14 ASN A ND2  9  
ATOM 11624 H H    . ASN A 1 14 ? 9.493   6.910   -10.302 1.00 15.00 ? 14 ASN A H    9  
ATOM 11625 H HA   . ASN A 1 14 ? 12.332  7.155   -9.817  1.00 15.00 ? 14 ASN A HA   9  
ATOM 11626 H HB2  . ASN A 1 14 ? 10.550  7.781   -12.164 1.00 15.00 ? 14 ASN A HB2  9  
ATOM 11627 H HB3  . ASN A 1 14 ? 12.244  8.261   -12.139 1.00 15.00 ? 14 ASN A HB3  9  
ATOM 11628 H HD21 . ASN A 1 14 ? 11.132  6.538   -14.025 1.00 15.00 ? 14 ASN A HD21 9  
ATOM 11629 H HD22 . ASN A 1 14 ? 11.846  4.977   -13.830 1.00 15.00 ? 14 ASN A HD22 9  
ATOM 11630 N N    . ASP A 1 15 ? 10.394  9.820   -10.039 1.00 15.00 ? 15 ASP A N    9  
ATOM 11631 C CA   . ASP A 1 15 ? 10.304  11.229  -9.679  1.00 15.00 ? 15 ASP A CA   9  
ATOM 11632 C C    . ASP A 1 15 ? 10.567  11.412  -8.188  1.00 15.00 ? 15 ASP A C    9  
ATOM 11633 O O    . ASP A 1 15 ? 11.217  12.371  -7.772  1.00 15.00 ? 15 ASP A O    9  
ATOM 11634 C CB   . ASP A 1 15 ? 8.925   11.786  -10.041 1.00 15.00 ? 15 ASP A CB   9  
ATOM 11635 C CG   . ASP A 1 15 ? 9.006   13.161  -10.674 1.00 15.00 ? 15 ASP A CG   9  
ATOM 11636 O OD1  . ASP A 1 15 ? 9.869   13.359  -11.555 1.00 15.00 ? 15 ASP A OD1  9  
ATOM 11637 O OD2  . ASP A 1 15 ? 8.208   14.041  -10.288 1.00 15.00 ? 15 ASP A OD2  9  
ATOM 11638 H H    . ASP A 1 15 ? 9.618   9.377   -10.442 1.00 15.00 ? 15 ASP A H    9  
ATOM 11639 H HA   . ASP A 1 15 ? 11.059  11.764  -10.235 1.00 15.00 ? 15 ASP A HA   9  
ATOM 11640 H HB2  . ASP A 1 15 ? 8.445   11.117  -10.739 1.00 15.00 ? 15 ASP A HB2  9  
ATOM 11641 H HB3  . ASP A 1 15 ? 8.325   11.856  -9.145  1.00 15.00 ? 15 ASP A HB3  9  
ATOM 11642 N N    . ASN A 1 16 ? 10.058  10.478  -7.391  1.00 15.00 ? 16 ASN A N    9  
ATOM 11643 C CA   . ASN A 1 16 ? 10.235  10.520  -5.945  1.00 15.00 ? 16 ASN A CA   9  
ATOM 11644 C C    . ASN A 1 16 ? 9.873   9.177   -5.319  1.00 15.00 ? 16 ASN A C    9  
ATOM 11645 O O    . ASN A 1 16 ? 9.200   8.355   -5.940  1.00 15.00 ? 16 ASN A O    9  
ATOM 11646 C CB   . ASN A 1 16 ? 9.374   11.629  -5.338  1.00 15.00 ? 16 ASN A CB   9  
ATOM 11647 C CG   . ASN A 1 16 ? 10.064  12.978  -5.365  1.00 15.00 ? 16 ASN A CG   9  
ATOM 11648 O OD1  . ASN A 1 16 ? 9.649   13.888  -6.084  1.00 15.00 ? 16 ASN A OD1  9  
ATOM 11649 N ND2  . ASN A 1 16 ? 11.126  13.115  -4.579  1.00 15.00 ? 16 ASN A ND2  9  
ATOM 11650 H H    . ASN A 1 16 ? 9.553   9.738   -7.787  1.00 15.00 ? 16 ASN A H    9  
ATOM 11651 H HA   . ASN A 1 16 ? 11.275  10.731  -5.743  1.00 15.00 ? 16 ASN A HA   9  
ATOM 11652 H HB2  . ASN A 1 16 ? 8.452   11.707  -5.895  1.00 15.00 ? 16 ASN A HB2  9  
ATOM 11653 H HB3  . ASN A 1 16 ? 9.148   11.380  -4.311  1.00 15.00 ? 16 ASN A HB3  9  
ATOM 11654 H HD21 . ASN A 1 16 ? 11.399  12.349  -4.033  1.00 15.00 ? 16 ASN A HD21 9  
ATOM 11655 H HD22 . ASN A 1 16 ? 11.592  13.978  -4.576  1.00 15.00 ? 16 ASN A HD22 9  
ATOM 11656 N N    . SER A 1 17 ? 10.316  8.961   -4.084  1.00 15.00 ? 17 SER A N    9  
ATOM 11657 C CA   . SER A 1 17 ? 10.027  7.717   -3.379  1.00 15.00 ? 17 SER A CA   9  
ATOM 11658 C C    . SER A 1 17 ? 8.680   7.810   -2.674  1.00 15.00 ? 17 SER A C    9  
ATOM 11659 O O    . SER A 1 17 ? 7.861   8.666   -3.001  1.00 15.00 ? 17 SER A O    9  
ATOM 11660 C CB   . SER A 1 17 ? 11.123  7.411   -2.357  1.00 15.00 ? 17 SER A CB   9  
ATOM 11661 O OG   . SER A 1 17 ? 12.205  8.319   -2.476  1.00 15.00 ? 17 SER A OG   9  
ATOM 11662 H H    . SER A 1 17 ? 10.844  9.654   -3.636  1.00 15.00 ? 17 SER A H    9  
ATOM 11663 H HA   . SER A 1 17 ? 9.988   6.920   -4.107  1.00 15.00 ? 17 SER A HA   9  
ATOM 11664 H HB2  . SER A 1 17 ? 10.710  7.488   -1.361  1.00 15.00 ? 17 SER A HB2  9  
ATOM 11665 H HB3  . SER A 1 17 ? 11.489  6.408   -2.517  1.00 15.00 ? 17 SER A HB3  9  
ATOM 11666 H HG   . SER A 1 17 ? 12.371  8.731   -1.625  1.00 15.00 ? 17 SER A HG   9  
ATOM 11667 N N    . LEU A 1 18 ? 8.454   6.934   -1.701  1.00 15.00 ? 18 LEU A N    9  
ATOM 11668 C CA   . LEU A 1 18 ? 7.204   6.946   -0.961  1.00 15.00 ? 18 LEU A CA   9  
ATOM 11669 C C    . LEU A 1 18 ? 7.342   7.763   0.317   1.00 15.00 ? 18 LEU A C    9  
ATOM 11670 O O    . LEU A 1 18 ? 8.356   8.425   0.538   1.00 15.00 ? 18 LEU A O    9  
ATOM 11671 C CB   . LEU A 1 18 ? 6.745   5.520   -0.631  1.00 15.00 ? 18 LEU A CB   9  
ATOM 11672 C CG   . LEU A 1 18 ? 6.627   4.582   -1.834  1.00 15.00 ? 18 LEU A CG   9  
ATOM 11673 C CD1  . LEU A 1 18 ? 5.773   5.214   -2.922  1.00 15.00 ? 18 LEU A CD1  9  
ATOM 11674 C CD2  . LEU A 1 18 ? 8.006   4.230   -2.374  1.00 15.00 ? 18 LEU A CD2  9  
ATOM 11675 H H    . LEU A 1 18 ? 9.142   6.274   -1.475  1.00 15.00 ? 18 LEU A H    9  
ATOM 11676 H HA   . LEU A 1 18 ? 6.465   7.416   -1.590  1.00 15.00 ? 18 LEU A HA   9  
ATOM 11677 H HB2  . LEU A 1 18 ? 7.447   5.091   0.068   1.00 15.00 ? 18 LEU A HB2  9  
ATOM 11678 H HB3  . LEU A 1 18 ? 5.775   5.575   -0.152  1.00 15.00 ? 18 LEU A HB3  9  
ATOM 11679 H HG   . LEU A 1 18 ? 6.146   3.667   -1.522  1.00 15.00 ? 18 LEU A HG   9  
ATOM 11680 H HD11 . LEU A 1 18 ? 4.868   5.611   -2.485  1.00 15.00 ? 18 LEU A HD11 9  
ATOM 11681 H HD12 . LEU A 1 18 ? 6.325   6.013   -3.395  1.00 15.00 ? 18 LEU A HD12 9  
ATOM 11682 H HD13 . LEU A 1 18 ? 5.519   4.467   -3.660  1.00 15.00 ? 18 LEU A HD13 9  
ATOM 11683 H HD21 . LEU A 1 18 ? 8.343   5.013   -3.038  1.00 15.00 ? 18 LEU A HD21 9  
ATOM 11684 H HD22 . LEU A 1 18 ? 8.699   4.132   -1.552  1.00 15.00 ? 18 LEU A HD22 9  
ATOM 11685 H HD23 . LEU A 1 18 ? 7.953   3.297   -2.915  1.00 15.00 ? 18 LEU A HD23 9  
ATOM 11686 N N    . GLY A 1 19 ? 6.313   7.713   1.150   1.00 15.00 ? 19 GLY A N    9  
ATOM 11687 C CA   . GLY A 1 19 ? 6.317   8.451   2.397   1.00 15.00 ? 19 GLY A CA   9  
ATOM 11688 C C    . GLY A 1 19 ? 5.270   7.937   3.353   1.00 15.00 ? 19 GLY A C    9  
ATOM 11689 O O    . GLY A 1 19 ? 4.673   8.701   4.106   1.00 15.00 ? 19 GLY A O    9  
ATOM 11690 H H    . GLY A 1 19 ? 5.535   7.168   0.913   1.00 15.00 ? 19 GLY A H    9  
ATOM 11691 H HA2  . GLY A 1 19 ? 7.290   8.367   2.860   1.00 15.00 ? 19 GLY A HA2  9  
ATOM 11692 H HA3  . GLY A 1 19 ? 6.114   9.490   2.187   1.00 15.00 ? 19 GLY A HA3  9  
ATOM 11693 N N    . ILE A 1 20 ? 5.034   6.636   3.300   1.00 15.00 ? 20 ILE A N    9  
ATOM 11694 C CA   . ILE A 1 20 ? 4.042   6.000   4.149   1.00 15.00 ? 20 ILE A CA   9  
ATOM 11695 C C    . ILE A 1 20 ? 4.678   5.065   5.169   1.00 15.00 ? 20 ILE A C    9  
ATOM 11696 O O    . ILE A 1 20 ? 5.590   4.302   4.851   1.00 15.00 ? 20 ILE A O    9  
ATOM 11697 C CB   . ILE A 1 20 ? 3.023   5.212   3.298   1.00 15.00 ? 20 ILE A CB   9  
ATOM 11698 C CG1  . ILE A 1 20 ? 1.610   5.706   3.587   1.00 15.00 ? 20 ILE A CG1  9  
ATOM 11699 C CG2  . ILE A 1 20 ? 3.126   3.719   3.567   1.00 15.00 ? 20 ILE A CG2  9  
ATOM 11700 C CD1  . ILE A 1 20 ? 0.536   4.693   3.281   1.00 15.00 ? 20 ILE A CD1  9  
ATOM 11701 H H    . ILE A 1 20 ? 5.535   6.087   2.661   1.00 15.00 ? 20 ILE A H    9  
ATOM 11702 H HA   . ILE A 1 20 ? 3.503   6.773   4.682   1.00 15.00 ? 20 ILE A HA   9  
ATOM 11