data_3PGW
# 
_entry.id   3PGW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3PGW         
NDB   NA0851       
RCSB  RCSB062358   
WWPDB D_1000062358 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3PGW 
_pdbx_database_status.recvd_initial_deposition_date   2010-11-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Weber, G.'      1 
'Trowitzsch, S.' 2 
'Kastner, B.'    3 
'Luehrmann, R.'  4 
'Wahl, M.C.'     5 
# 
_citation.id                        primary 
_citation.title                     'Functional organization of the Sm core in the crystal structure of human U1 snRNP.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            29 
_citation.page_first                4172 
_citation.page_last                 4184 
_citation.year                      2010 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21113136 
_citation.pdbx_database_id_DOI      10.1038/emboj.2010.295 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Weber, G.'      1 
primary 'Trowitzsch, S.' 2 
primary 'Kastner, B.'    3 
primary 'Luhrmann, R.'   4 
primary 'Wahl, M.C.'     5 
# 
_cell.entry_id           3PGW 
_cell.length_a           358.420 
_cell.length_b           88.220 
_cell.length_c           150.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         111.88 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3PGW 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer nat U1-A                                      31319.533 2 ? ? ? ? 
2  polymer nat U1-70K                                    51683.184 2 ? ? ? ? 
3  polymer nat Sm-D3                                     13940.308 2 ? ? ? ? 
4  polymer nat 'Sm B'                                    23686.004 2 ? ? ? ? 
5  polymer nat Sm-D1                                     13310.653 2 ? ? ? ? 
6  polymer nat Sm-D2                                     13551.928 2 ? ? ? ? 
7  polymer nat Sm-F                                      9734.171  2 ? ? ? ? 
8  polymer nat Sm-E                                      10817.601 2 ? ? ? ? 
9  polymer nat 'Sm G'                                    8508.084  2 ? ? ? ? 
10 polymer nat 'U1 snRNA'                                52697.070 2 ? ? ? ? 
11 polymer syn 
;DNA 5'-D(*AP*GP*GP*TP*AP*AP*GP*TP*A)-3'
;
2803.873  2 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'U1 snRNP A, U1 small nuclear ribonucleoprotein A, U1A'                          
2 'U1 snRNP 70 kDa, snRNP70, U1 small nuclear ribonucleoprotein 70 kDa'            
3 'Small nuclear ribonucleoprotein Sm D3, snRNP core protein D3'                   
4 'Small nuclear ribonucleoprotein polypeptides B and B1'                          
5 'Small nuclear ribonucleoprotein Sm D1, Sm-D autoantigen, snRNP core protein D1' 
6 'Small nuclear ribonucleoprotein Sm D2, snRNP core protein D2'                   
7 'snRNP-F, Sm protein F, Small nuclear ribonucleoprotein F, SmF'                  
8 'snRNP-E, Sm protein E, Small nuclear ribonucleoprotein E, SmE'                  
9 'Small nuclear ribonucleoprotein polypeptide G, isoform CRA_a'                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK
PMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQ
PPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
;
;MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK
PMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQ
PPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
;
A,P ? 
2  'polypeptide(L)'        no no 
;MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQ
EVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSA
YKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERE
RRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPS
EAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQD
NGLEGLGNDSRDMYMESEGGDGYLAPENGYLMEAAPE
;
;MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQ
EVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSA
YKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERE
RRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPS
EAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQD
NGLEGLGNDSRDMYMESEGGDGYLAPENGYLMEAAPE
;
S,L ? 
3  'polypeptide(L)'        no no 
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
Z,W ? 
4  'polypeptide(L)'        no no 
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL
;
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL
;
B,Q ? 
5  'polypeptide(L)'        no no 
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
X,U ? 
6  'polypeptide(L)'        no no 
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
Y,V ? 
7  'polypeptide(L)'        no no 
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
F,I ? 
8  'polypeptide(L)'        no no 
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
E,H ? 
9  'polypeptide(L)'        no no MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV G,J ? 
10 polyribonucleotide      no no 
;AUACUUACCUGGCAGGGGAGAUACCAUGAUCACGAAGGUGGUUUUCCCAGGGCGAGGCUUAUCCAUUGCACUCCGGAUGU
GCUGACCCCUGCGAUUUCCCCAAAUGUGGGAAACUCGACUGCAUAAUUUGUGGUAGUGGGGGACUGCGUUCGCGCUUUCC
CCUG
;
;AUACUUACCUGGCAGGGGAGAUACCAUGAUCACGAAGGUGGUUUUCCCAGGGCGAGGCUUAUCCAUUGCACUCCGGAUGU
GCUGACCCCUGCGAUUUCCCCAAAUGUGGGAAACUCGACUGCAUAAUUUGUGGUAGUGGGGGACUGCGUUCGCGCUUUCC
CCUG
;
R,N ? 
11 polydeoxyribonucleotide no no '(DA)(DG)(DG)(DT)(DA)(DA)(DG)(DT)(DA)' AGGTAAGTA D,M ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   ALA n 
1  3   VAL n 
1  4   PRO n 
1  5   GLU n 
1  6   THR n 
1  7   ARG n 
1  8   PRO n 
1  9   ASN n 
1  10  HIS n 
1  11  THR n 
1  12  ILE n 
1  13  TYR n 
1  14  ILE n 
1  15  ASN n 
1  16  ASN n 
1  17  LEU n 
1  18  ASN n 
1  19  GLU n 
1  20  LYS n 
1  21  ILE n 
1  22  LYS n 
1  23  LYS n 
1  24  ASP n 
1  25  GLU n 
1  26  LEU n 
1  27  LYS n 
1  28  LYS n 
1  29  SER n 
1  30  LEU n 
1  31  TYR n 
1  32  ALA n 
1  33  ILE n 
1  34  PHE n 
1  35  SER n 
1  36  GLN n 
1  37  PHE n 
1  38  GLY n 
1  39  GLN n 
1  40  ILE n 
1  41  LEU n 
1  42  ASP n 
1  43  ILE n 
1  44  LEU n 
1  45  VAL n 
1  46  SER n 
1  47  ARG n 
1  48  SER n 
1  49  LEU n 
1  50  LYS n 
1  51  MET n 
1  52  ARG n 
1  53  GLY n 
1  54  GLN n 
1  55  ALA n 
1  56  PHE n 
1  57  VAL n 
1  58  ILE n 
1  59  PHE n 
1  60  LYS n 
1  61  GLU n 
1  62  VAL n 
1  63  SER n 
1  64  SER n 
1  65  ALA n 
1  66  THR n 
1  67  ASN n 
1  68  ALA n 
1  69  LEU n 
1  70  ARG n 
1  71  SER n 
1  72  MET n 
1  73  GLN n 
1  74  GLY n 
1  75  PHE n 
1  76  PRO n 
1  77  PHE n 
1  78  TYR n 
1  79  ASP n 
1  80  LYS n 
1  81  PRO n 
1  82  MET n 
1  83  ARG n 
1  84  ILE n 
1  85  GLN n 
1  86  TYR n 
1  87  ALA n 
1  88  LYS n 
1  89  THR n 
1  90  ASP n 
1  91  SER n 
1  92  ASP n 
1  93  ILE n 
1  94  ILE n 
1  95  ALA n 
1  96  LYS n 
1  97  MET n 
1  98  LYS n 
1  99  GLY n 
1  100 THR n 
1  101 PHE n 
1  102 VAL n 
1  103 GLU n 
1  104 ARG n 
1  105 ASP n 
1  106 ARG n 
1  107 LYS n 
1  108 ARG n 
1  109 GLU n 
1  110 LYS n 
1  111 ARG n 
1  112 LYS n 
1  113 PRO n 
1  114 LYS n 
1  115 SER n 
1  116 GLN n 
1  117 GLU n 
1  118 THR n 
1  119 PRO n 
1  120 ALA n 
1  121 THR n 
1  122 LYS n 
1  123 LYS n 
1  124 ALA n 
1  125 VAL n 
1  126 GLN n 
1  127 GLY n 
1  128 GLY n 
1  129 GLY n 
1  130 ALA n 
1  131 THR n 
1  132 PRO n 
1  133 VAL n 
1  134 VAL n 
1  135 GLY n 
1  136 ALA n 
1  137 VAL n 
1  138 GLN n 
1  139 GLY n 
1  140 PRO n 
1  141 VAL n 
1  142 PRO n 
1  143 GLY n 
1  144 MET n 
1  145 PRO n 
1  146 PRO n 
1  147 MET n 
1  148 THR n 
1  149 GLN n 
1  150 ALA n 
1  151 PRO n 
1  152 ARG n 
1  153 ILE n 
1  154 MET n 
1  155 HIS n 
1  156 HIS n 
1  157 MET n 
1  158 PRO n 
1  159 GLY n 
1  160 GLN n 
1  161 PRO n 
1  162 PRO n 
1  163 TYR n 
1  164 MET n 
1  165 PRO n 
1  166 PRO n 
1  167 PRO n 
1  168 GLY n 
1  169 MET n 
1  170 ILE n 
1  171 PRO n 
1  172 PRO n 
1  173 PRO n 
1  174 GLY n 
1  175 LEU n 
1  176 ALA n 
1  177 PRO n 
1  178 GLY n 
1  179 GLN n 
1  180 ILE n 
1  181 PRO n 
1  182 PRO n 
1  183 GLY n 
1  184 ALA n 
1  185 MET n 
1  186 PRO n 
1  187 PRO n 
1  188 GLN n 
1  189 GLN n 
1  190 LEU n 
1  191 MET n 
1  192 PRO n 
1  193 GLY n 
1  194 GLN n 
1  195 MET n 
1  196 PRO n 
1  197 PRO n 
1  198 ALA n 
1  199 GLN n 
1  200 PRO n 
1  201 LEU n 
1  202 SER n 
1  203 GLU n 
1  204 ASN n 
1  205 PRO n 
1  206 PRO n 
1  207 ASN n 
1  208 HIS n 
1  209 ILE n 
1  210 LEU n 
1  211 PHE n 
1  212 LEU n 
1  213 THR n 
1  214 ASN n 
1  215 LEU n 
1  216 PRO n 
1  217 GLU n 
1  218 GLU n 
1  219 THR n 
1  220 ASN n 
1  221 GLU n 
1  222 LEU n 
1  223 MET n 
1  224 LEU n 
1  225 SER n 
1  226 MET n 
1  227 LEU n 
1  228 PHE n 
1  229 ASN n 
1  230 GLN n 
1  231 PHE n 
1  232 PRO n 
1  233 GLY n 
1  234 PHE n 
1  235 LYS n 
1  236 GLU n 
1  237 VAL n 
1  238 ARG n 
1  239 LEU n 
1  240 VAL n 
1  241 PRO n 
1  242 GLY n 
1  243 ARG n 
1  244 HIS n 
1  245 ASP n 
1  246 ILE n 
1  247 ALA n 
1  248 PHE n 
1  249 VAL n 
1  250 GLU n 
1  251 PHE n 
1  252 ASP n 
1  253 ASN n 
1  254 GLU n 
1  255 VAL n 
1  256 GLN n 
1  257 ALA n 
1  258 GLY n 
1  259 ALA n 
1  260 ALA n 
1  261 ARG n 
1  262 ASP n 
1  263 ALA n 
1  264 LEU n 
1  265 GLN n 
1  266 GLY n 
1  267 PHE n 
1  268 LYS n 
1  269 ILE n 
1  270 THR n 
1  271 GLN n 
1  272 ASN n 
1  273 ASN n 
1  274 ALA n 
1  275 MET n 
1  276 LYS n 
1  277 ILE n 
1  278 SER n 
1  279 PHE n 
1  280 ALA n 
1  281 LYS n 
1  282 LYS n 
2  1   MET n 
2  2   THR n 
2  3   GLN n 
2  4   PHE n 
2  5   LEU n 
2  6   PRO n 
2  7   PRO n 
2  8   ASN n 
2  9   LEU n 
2  10  LEU n 
2  11  ALA n 
2  12  LEU n 
2  13  PHE n 
2  14  ALA n 
2  15  PRO n 
2  16  ARG n 
2  17  ASP n 
2  18  PRO n 
2  19  ILE n 
2  20  PRO n 
2  21  TYR n 
2  22  LEU n 
2  23  PRO n 
2  24  PRO n 
2  25  LEU n 
2  26  GLU n 
2  27  LYS n 
2  28  LEU n 
2  29  PRO n 
2  30  HIS n 
2  31  GLU n 
2  32  LYS n 
2  33  HIS n 
2  34  HIS n 
2  35  ASN n 
2  36  GLN n 
2  37  PRO n 
2  38  TYR n 
2  39  CYS n 
2  40  GLY n 
2  41  ILE n 
2  42  ALA n 
2  43  PRO n 
2  44  TYR n 
2  45  ILE n 
2  46  ARG n 
2  47  GLU n 
2  48  PHE n 
2  49  GLU n 
2  50  ASP n 
2  51  PRO n 
2  52  ARG n 
2  53  ASP n 
2  54  ALA n 
2  55  PRO n 
2  56  PRO n 
2  57  PRO n 
2  58  THR n 
2  59  ARG n 
2  60  ALA n 
2  61  GLU n 
2  62  THR n 
2  63  ARG n 
2  64  GLU n 
2  65  GLU n 
2  66  ARG n 
2  67  MET n 
2  68  GLU n 
2  69  ARG n 
2  70  LYS n 
2  71  ARG n 
2  72  ARG n 
2  73  GLU n 
2  74  LYS n 
2  75  ILE n 
2  76  GLU n 
2  77  ARG n 
2  78  ARG n 
2  79  GLN n 
2  80  GLN n 
2  81  GLU n 
2  82  VAL n 
2  83  GLU n 
2  84  THR n 
2  85  GLU n 
2  86  LEU n 
2  87  LYS n 
2  88  MET n 
2  89  TRP n 
2  90  ASP n 
2  91  PRO n 
2  92  HIS n 
2  93  ASN n 
2  94  ASP n 
2  95  PRO n 
2  96  ASN n 
2  97  ALA n 
2  98  GLN n 
2  99  GLY n 
2  100 ASP n 
2  101 ALA n 
2  102 PHE n 
2  103 LYS n 
2  104 THR n 
2  105 LEU n 
2  106 PHE n 
2  107 VAL n 
2  108 ALA n 
2  109 ARG n 
2  110 VAL n 
2  111 ASN n 
2  112 TYR n 
2  113 ASP n 
2  114 THR n 
2  115 THR n 
2  116 GLU n 
2  117 SER n 
2  118 LYS n 
2  119 LEU n 
2  120 ARG n 
2  121 ARG n 
2  122 GLU n 
2  123 PHE n 
2  124 GLU n 
2  125 VAL n 
2  126 TYR n 
2  127 GLY n 
2  128 PRO n 
2  129 ILE n 
2  130 LYS n 
2  131 ARG n 
2  132 ILE n 
2  133 HIS n 
2  134 MET n 
2  135 VAL n 
2  136 TYR n 
2  137 SER n 
2  138 LYS n 
2  139 ARG n 
2  140 SER n 
2  141 GLY n 
2  142 LYS n 
2  143 PRO n 
2  144 ARG n 
2  145 GLY n 
2  146 TYR n 
2  147 ALA n 
2  148 PHE n 
2  149 ILE n 
2  150 GLU n 
2  151 TYR n 
2  152 GLU n 
2  153 HIS n 
2  154 GLU n 
2  155 ARG n 
2  156 ASP n 
2  157 MET n 
2  158 HIS n 
2  159 SER n 
2  160 ALA n 
2  161 TYR n 
2  162 LYS n 
2  163 HIS n 
2  164 ALA n 
2  165 ASP n 
2  166 GLY n 
2  167 LYS n 
2  168 LYS n 
2  169 ILE n 
2  170 ASP n 
2  171 GLY n 
2  172 ARG n 
2  173 ARG n 
2  174 VAL n 
2  175 LEU n 
2  176 VAL n 
2  177 ASP n 
2  178 VAL n 
2  179 GLU n 
2  180 ARG n 
2  181 GLY n 
2  182 ARG n 
2  183 THR n 
2  184 VAL n 
2  185 LYS n 
2  186 GLY n 
2  187 TRP n 
2  188 ARG n 
2  189 PRO n 
2  190 ARG n 
2  191 ARG n 
2  192 LEU n 
2  193 GLY n 
2  194 GLY n 
2  195 GLY n 
2  196 LEU n 
2  197 GLY n 
2  198 GLY n 
2  199 THR n 
2  200 ARG n 
2  201 ARG n 
2  202 GLY n 
2  203 GLY n 
2  204 ALA n 
2  205 ASP n 
2  206 VAL n 
2  207 ASN n 
2  208 ILE n 
2  209 ARG n 
2  210 HIS n 
2  211 SER n 
2  212 GLY n 
2  213 ARG n 
2  214 ASP n 
2  215 ASP n 
2  216 THR n 
2  217 SER n 
2  218 ARG n 
2  219 TYR n 
2  220 ASP n 
2  221 GLU n 
2  222 ARG n 
2  223 PRO n 
2  224 GLY n 
2  225 PRO n 
2  226 SER n 
2  227 PRO n 
2  228 LEU n 
2  229 PRO n 
2  230 HIS n 
2  231 ARG n 
2  232 ASP n 
2  233 ARG n 
2  234 ASP n 
2  235 ARG n 
2  236 ASP n 
2  237 ARG n 
2  238 GLU n 
2  239 ARG n 
2  240 GLU n 
2  241 ARG n 
2  242 ARG n 
2  243 GLU n 
2  244 ARG n 
2  245 SER n 
2  246 ARG n 
2  247 GLU n 
2  248 ARG n 
2  249 ASP n 
2  250 LYS n 
2  251 GLU n 
2  252 ARG n 
2  253 GLU n 
2  254 ARG n 
2  255 ARG n 
2  256 ARG n 
2  257 SER n 
2  258 ARG n 
2  259 SER n 
2  260 ARG n 
2  261 ASP n 
2  262 ARG n 
2  263 ARG n 
2  264 ARG n 
2  265 ARG n 
2  266 SER n 
2  267 ARG n 
2  268 SER n 
2  269 ARG n 
2  270 ASP n 
2  271 LYS n 
2  272 GLU n 
2  273 GLU n 
2  274 ARG n 
2  275 ARG n 
2  276 ARG n 
2  277 SER n 
2  278 ARG n 
2  279 GLU n 
2  280 ARG n 
2  281 SER n 
2  282 LYS n 
2  283 ASP n 
2  284 LYS n 
2  285 ASP n 
2  286 ARG n 
2  287 ASP n 
2  288 ARG n 
2  289 LYS n 
2  290 ARG n 
2  291 ARG n 
2  292 SER n 
2  293 SER n 
2  294 ARG n 
2  295 SER n 
2  296 ARG n 
2  297 GLU n 
2  298 ARG n 
2  299 ALA n 
2  300 ARG n 
2  301 ARG n 
2  302 GLU n 
2  303 ARG n 
2  304 GLU n 
2  305 ARG n 
2  306 LYS n 
2  307 GLU n 
2  308 GLU n 
2  309 LEU n 
2  310 ARG n 
2  311 GLY n 
2  312 GLY n 
2  313 GLY n 
2  314 GLY n 
2  315 ASP n 
2  316 MET n 
2  317 ALA n 
2  318 GLU n 
2  319 PRO n 
2  320 SER n 
2  321 GLU n 
2  322 ALA n 
2  323 GLY n 
2  324 ASP n 
2  325 ALA n 
2  326 PRO n 
2  327 PRO n 
2  328 ASP n 
2  329 ASP n 
2  330 GLY n 
2  331 PRO n 
2  332 PRO n 
2  333 GLY n 
2  334 GLU n 
2  335 LEU n 
2  336 GLY n 
2  337 PRO n 
2  338 ASP n 
2  339 GLY n 
2  340 PRO n 
2  341 ASP n 
2  342 GLY n 
2  343 PRO n 
2  344 GLU n 
2  345 GLU n 
2  346 LYS n 
2  347 GLY n 
2  348 ARG n 
2  349 ASP n 
2  350 ARG n 
2  351 ASP n 
2  352 ARG n 
2  353 GLU n 
2  354 ARG n 
2  355 ARG n 
2  356 ARG n 
2  357 SER n 
2  358 HIS n 
2  359 ARG n 
2  360 SER n 
2  361 GLU n 
2  362 ARG n 
2  363 GLU n 
2  364 ARG n 
2  365 ARG n 
2  366 ARG n 
2  367 ASP n 
2  368 ARG n 
2  369 ASP n 
2  370 ARG n 
2  371 ASP n 
2  372 ARG n 
2  373 ASP n 
2  374 ARG n 
2  375 ASP n 
2  376 ARG n 
2  377 GLU n 
2  378 HIS n 
2  379 LYS n 
2  380 ARG n 
2  381 GLY n 
2  382 GLU n 
2  383 ARG n 
2  384 GLY n 
2  385 SER n 
2  386 GLU n 
2  387 ARG n 
2  388 GLY n 
2  389 ARG n 
2  390 ASP n 
2  391 GLU n 
2  392 ALA n 
2  393 ARG n 
2  394 GLY n 
2  395 GLY n 
2  396 GLY n 
2  397 GLY n 
2  398 GLY n 
2  399 GLN n 
2  400 ASP n 
2  401 ASN n 
2  402 GLY n 
2  403 LEU n 
2  404 GLU n 
2  405 GLY n 
2  406 LEU n 
2  407 GLY n 
2  408 ASN n 
2  409 ASP n 
2  410 SER n 
2  411 ARG n 
2  412 ASP n 
2  413 MET n 
2  414 TYR n 
2  415 MET n 
2  416 GLU n 
2  417 SER n 
2  418 GLU n 
2  419 GLY n 
2  420 GLY n 
2  421 ASP n 
2  422 GLY n 
2  423 TYR n 
2  424 LEU n 
2  425 ALA n 
2  426 PRO n 
2  427 GLU n 
2  428 ASN n 
2  429 GLY n 
2  430 TYR n 
2  431 LEU n 
2  432 MET n 
2  433 GLU n 
2  434 ALA n 
2  435 ALA n 
2  436 PRO n 
2  437 GLU n 
3  1   MET n 
3  2   SER n 
3  3   ILE n 
3  4   GLY n 
3  5   VAL n 
3  6   PRO n 
3  7   ILE n 
3  8   LYS n 
3  9   VAL n 
3  10  LEU n 
3  11  HIS n 
3  12  GLU n 
3  13  ALA n 
3  14  GLU n 
3  15  GLY n 
3  16  HIS n 
3  17  ILE n 
3  18  VAL n 
3  19  THR n 
3  20  CYS n 
3  21  GLU n 
3  22  THR n 
3  23  ASN n 
3  24  THR n 
3  25  GLY n 
3  26  GLU n 
3  27  VAL n 
3  28  TYR n 
3  29  ARG n 
3  30  GLY n 
3  31  LYS n 
3  32  LEU n 
3  33  ILE n 
3  34  GLU n 
3  35  ALA n 
3  36  GLU n 
3  37  ASP n 
3  38  ASN n 
3  39  MET n 
3  40  ASN n 
3  41  CYS n 
3  42  GLN n 
3  43  MET n 
3  44  SER n 
3  45  ASN n 
3  46  ILE n 
3  47  THR n 
3  48  VAL n 
3  49  THR n 
3  50  TYR n 
3  51  ARG n 
3  52  ASP n 
3  53  GLY n 
3  54  ARG n 
3  55  VAL n 
3  56  ALA n 
3  57  GLN n 
3  58  LEU n 
3  59  GLU n 
3  60  GLN n 
3  61  VAL n 
3  62  TYR n 
3  63  ILE n 
3  64  ARG n 
3  65  GLY n 
3  66  SER n 
3  67  LYS n 
3  68  ILE n 
3  69  ARG n 
3  70  PHE n 
3  71  LEU n 
3  72  ILE n 
3  73  LEU n 
3  74  PRO n 
3  75  ASP n 
3  76  MET n 
3  77  LEU n 
3  78  LYS n 
3  79  ASN n 
3  80  ALA n 
3  81  PRO n 
3  82  MET n 
3  83  LEU n 
3  84  LYS n 
3  85  SER n 
3  86  MET n 
3  87  LYS n 
3  88  ASN n 
3  89  LYS n 
3  90  ASN n 
3  91  GLN n 
3  92  GLY n 
3  93  SER n 
3  94  GLY n 
3  95  ALA n 
3  96  GLY n 
3  97  ARG n 
3  98  GLY n 
3  99  LYS n 
3  100 ALA n 
3  101 ALA n 
3  102 ILE n 
3  103 LEU n 
3  104 LYS n 
3  105 ALA n 
3  106 GLN n 
3  107 VAL n 
3  108 ALA n 
3  109 ALA n 
3  110 ARG n 
3  111 GLY n 
3  112 ARG n 
3  113 GLY n 
3  114 ARG n 
3  115 GLY n 
3  116 MET n 
3  117 GLY n 
3  118 ARG n 
3  119 GLY n 
3  120 ASN n 
3  121 ILE n 
3  122 PHE n 
3  123 GLN n 
3  124 LYS n 
3  125 ARG n 
3  126 ARG n 
4  1   MET n 
4  2   THR n 
4  3   VAL n 
4  4   GLY n 
4  5   LYS n 
4  6   SER n 
4  7   SER n 
4  8   LYS n 
4  9   MET n 
4  10  LEU n 
4  11  GLN n 
4  12  HIS n 
4  13  ILE n 
4  14  ASP n 
4  15  TYR n 
4  16  ARG n 
4  17  MET n 
4  18  ARG n 
4  19  CYS n 
4  20  ILE n 
4  21  LEU n 
4  22  GLN n 
4  23  ASP n 
4  24  GLY n 
4  25  ARG n 
4  26  ILE n 
4  27  PHE n 
4  28  ILE n 
4  29  GLY n 
4  30  THR n 
4  31  PHE n 
4  32  LYS n 
4  33  ALA n 
4  34  PHE n 
4  35  ASP n 
4  36  LYS n 
4  37  HIS n 
4  38  MET n 
4  39  ASN n 
4  40  LEU n 
4  41  ILE n 
4  42  LEU n 
4  43  CYS n 
4  44  ASP n 
4  45  CYS n 
4  46  ASP n 
4  47  GLU n 
4  48  PHE n 
4  49  ARG n 
4  50  LYS n 
4  51  ILE n 
4  52  LYS n 
4  53  PRO n 
4  54  LYS n 
4  55  ASN n 
4  56  SER n 
4  57  LYS n 
4  58  GLN n 
4  59  ALA n 
4  60  GLU n 
4  61  ARG n 
4  62  GLU n 
4  63  GLU n 
4  64  LYS n 
4  65  ARG n 
4  66  VAL n 
4  67  LEU n 
4  68  GLY n 
4  69  LEU n 
4  70  VAL n 
4  71  LEU n 
4  72  LEU n 
4  73  ARG n 
4  74  GLY n 
4  75  GLU n 
4  76  ASN n 
4  77  LEU n 
4  78  VAL n 
4  79  SER n 
4  80  MET n 
4  81  THR n 
4  82  VAL n 
4  83  GLU n 
4  84  GLY n 
4  85  PRO n 
4  86  PRO n 
4  87  PRO n 
4  88  LYS n 
4  89  ASP n 
4  90  THR n 
4  91  GLY n 
4  92  ILE n 
4  93  ALA n 
4  94  ARG n 
4  95  VAL n 
4  96  PRO n 
4  97  LEU n 
4  98  ALA n 
4  99  GLY n 
4  100 ALA n 
4  101 ALA n 
4  102 GLY n 
4  103 GLY n 
4  104 PRO n 
4  105 GLY n 
4  106 ILE n 
4  107 GLY n 
4  108 ARG n 
4  109 ALA n 
4  110 ALA n 
4  111 GLY n 
4  112 ARG n 
4  113 GLY n 
4  114 ILE n 
4  115 PRO n 
4  116 ALA n 
4  117 GLY n 
4  118 VAL n 
4  119 PRO n 
4  120 MET n 
4  121 PRO n 
4  122 GLN n 
4  123 ALA n 
4  124 PRO n 
4  125 ALA n 
4  126 GLY n 
4  127 LEU n 
4  128 ALA n 
4  129 GLY n 
4  130 PRO n 
4  131 VAL n 
4  132 ARG n 
4  133 GLY n 
4  134 VAL n 
4  135 GLY n 
4  136 GLY n 
4  137 PRO n 
4  138 SER n 
4  139 GLN n 
4  140 GLN n 
4  141 VAL n 
4  142 MET n 
4  143 THR n 
4  144 PRO n 
4  145 GLN n 
4  146 GLY n 
4  147 ARG n 
4  148 GLY n 
4  149 THR n 
4  150 VAL n 
4  151 ALA n 
4  152 ALA n 
4  153 ALA n 
4  154 ALA n 
4  155 ALA n 
4  156 ALA n 
4  157 ALA n 
4  158 THR n 
4  159 ALA n 
4  160 SER n 
4  161 ILE n 
4  162 ALA n 
4  163 GLY n 
4  164 ALA n 
4  165 PRO n 
4  166 THR n 
4  167 GLN n 
4  168 TYR n 
4  169 PRO n 
4  170 PRO n 
4  171 GLY n 
4  172 ARG n 
4  173 GLY n 
4  174 GLY n 
4  175 PRO n 
4  176 PRO n 
4  177 PRO n 
4  178 PRO n 
4  179 MET n 
4  180 GLY n 
4  181 ARG n 
4  182 GLY n 
4  183 ALA n 
4  184 PRO n 
4  185 PRO n 
4  186 PRO n 
4  187 GLY n 
4  188 MET n 
4  189 MET n 
4  190 GLY n 
4  191 PRO n 
4  192 PRO n 
4  193 PRO n 
4  194 GLY n 
4  195 MET n 
4  196 ARG n 
4  197 PRO n 
4  198 PRO n 
4  199 MET n 
4  200 GLY n 
4  201 PRO n 
4  202 PRO n 
4  203 MET n 
4  204 GLY n 
4  205 ILE n 
4  206 PRO n 
4  207 PRO n 
4  208 GLY n 
4  209 ARG n 
4  210 GLY n 
4  211 THR n 
4  212 PRO n 
4  213 MET n 
4  214 GLY n 
4  215 MET n 
4  216 PRO n 
4  217 PRO n 
4  218 PRO n 
4  219 GLY n 
4  220 MET n 
4  221 ARG n 
4  222 PRO n 
4  223 PRO n 
4  224 PRO n 
4  225 PRO n 
4  226 GLY n 
4  227 MET n 
4  228 ARG n 
4  229 GLY n 
4  230 LEU n 
4  231 LEU n 
5  1   MET n 
5  2   LYS n 
5  3   LEU n 
5  4   VAL n 
5  5   ARG n 
5  6   PHE n 
5  7   LEU n 
5  8   MET n 
5  9   LYS n 
5  10  LEU n 
5  11  SER n 
5  12  HIS n 
5  13  GLU n 
5  14  THR n 
5  15  VAL n 
5  16  THR n 
5  17  ILE n 
5  18  GLU n 
5  19  LEU n 
5  20  LYS n 
5  21  ASN n 
5  22  GLY n 
5  23  THR n 
5  24  GLN n 
5  25  VAL n 
5  26  HIS n 
5  27  GLY n 
5  28  THR n 
5  29  ILE n 
5  30  THR n 
5  31  GLY n 
5  32  VAL n 
5  33  ASP n 
5  34  VAL n 
5  35  SER n 
5  36  MET n 
5  37  ASN n 
5  38  THR n 
5  39  HIS n 
5  40  LEU n 
5  41  LYS n 
5  42  ALA n 
5  43  VAL n 
5  44  LYS n 
5  45  MET n 
5  46  THR n 
5  47  LEU n 
5  48  LYS n 
5  49  ASN n 
5  50  ARG n 
5  51  GLU n 
5  52  PRO n 
5  53  VAL n 
5  54  GLN n 
5  55  LEU n 
5  56  GLU n 
5  57  THR n 
5  58  LEU n 
5  59  SER n 
5  60  ILE n 
5  61  ARG n 
5  62  GLY n 
5  63  ASN n 
5  64  ASN n 
5  65  ILE n 
5  66  ARG n 
5  67  TYR n 
5  68  PHE n 
5  69  ILE n 
5  70  LEU n 
5  71  PRO n 
5  72  ASP n 
5  73  SER n 
5  74  LEU n 
5  75  PRO n 
5  76  LEU n 
5  77  ASP n 
5  78  THR n 
5  79  LEU n 
5  80  LEU n 
5  81  VAL n 
5  82  ASP n 
5  83  VAL n 
5  84  GLU n 
5  85  PRO n 
5  86  LYS n 
5  87  VAL n 
5  88  LYS n 
5  89  SER n 
5  90  LYS n 
5  91  LYS n 
5  92  ARG n 
5  93  GLU n 
5  94  ALA n 
5  95  VAL n 
5  96  ALA n 
5  97  GLY n 
5  98  ARG n 
5  99  GLY n 
5  100 ARG n 
5  101 GLY n 
5  102 ARG n 
5  103 GLY n 
5  104 ARG n 
5  105 GLY n 
5  106 ARG n 
5  107 GLY n 
5  108 ARG n 
5  109 GLY n 
5  110 ARG n 
5  111 GLY n 
5  112 ARG n 
5  113 GLY n 
5  114 ARG n 
5  115 GLY n 
5  116 GLY n 
5  117 PRO n 
5  118 ARG n 
5  119 ARG n 
6  1   MET n 
6  2   SER n 
6  3   LEU n 
6  4   LEU n 
6  5   ASN n 
6  6   LYS n 
6  7   PRO n 
6  8   LYS n 
6  9   SER n 
6  10  GLU n 
6  11  MET n 
6  12  THR n 
6  13  PRO n 
6  14  GLU n 
6  15  GLU n 
6  16  LEU n 
6  17  GLN n 
6  18  LYS n 
6  19  ARG n 
6  20  GLU n 
6  21  GLU n 
6  22  GLU n 
6  23  GLU n 
6  24  PHE n 
6  25  ASN n 
6  26  THR n 
6  27  GLY n 
6  28  PRO n 
6  29  LEU n 
6  30  SER n 
6  31  VAL n 
6  32  LEU n 
6  33  THR n 
6  34  GLN n 
6  35  SER n 
6  36  VAL n 
6  37  LYS n 
6  38  ASN n 
6  39  ASN n 
6  40  THR n 
6  41  GLN n 
6  42  VAL n 
6  43  LEU n 
6  44  ILE n 
6  45  ASN n 
6  46  CYS n 
6  47  ARG n 
6  48  ASN n 
6  49  ASN n 
6  50  LYS n 
6  51  LYS n 
6  52  LEU n 
6  53  LEU n 
6  54  GLY n 
6  55  ARG n 
6  56  VAL n 
6  57  LYS n 
6  58  ALA n 
6  59  PHE n 
6  60  ASP n 
6  61  ARG n 
6  62  HIS n 
6  63  CYS n 
6  64  ASN n 
6  65  MET n 
6  66  VAL n 
6  67  LEU n 
6  68  GLU n 
6  69  ASN n 
6  70  VAL n 
6  71  LYS n 
6  72  GLU n 
6  73  MET n 
6  74  TRP n 
6  75  THR n 
6  76  GLU n 
6  77  VAL n 
6  78  PRO n 
6  79  LYS n 
6  80  SER n 
6  81  GLY n 
6  82  LYS n 
6  83  GLY n 
6  84  LYS n 
6  85  LYS n 
6  86  LYS n 
6  87  SER n 
6  88  LYS n 
6  89  PRO n 
6  90  VAL n 
6  91  ASN n 
6  92  LYS n 
6  93  ASP n 
6  94  ARG n 
6  95  TYR n 
6  96  ILE n 
6  97  SER n 
6  98  LYS n 
6  99  MET n 
6  100 PHE n 
6  101 LEU n 
6  102 ARG n 
6  103 GLY n 
6  104 ASP n 
6  105 SER n 
6  106 VAL n 
6  107 ILE n 
6  108 VAL n 
6  109 VAL n 
6  110 LEU n 
6  111 ARG n 
6  112 ASN n 
6  113 PRO n 
6  114 LEU n 
6  115 ILE n 
6  116 ALA n 
6  117 GLY n 
6  118 LYS n 
7  1   MET n 
7  2   SER n 
7  3   LEU n 
7  4   PRO n 
7  5   LEU n 
7  6   ASN n 
7  7   PRO n 
7  8   LYS n 
7  9   PRO n 
7  10  PHE n 
7  11  LEU n 
7  12  ASN n 
7  13  GLY n 
7  14  LEU n 
7  15  THR n 
7  16  GLY n 
7  17  LYS n 
7  18  PRO n 
7  19  VAL n 
7  20  MET n 
7  21  VAL n 
7  22  LYS n 
7  23  LEU n 
7  24  LYS n 
7  25  TRP n 
7  26  GLY n 
7  27  MET n 
7  28  GLU n 
7  29  TYR n 
7  30  LYS n 
7  31  GLY n 
7  32  TYR n 
7  33  LEU n 
7  34  VAL n 
7  35  SER n 
7  36  VAL n 
7  37  ASP n 
7  38  GLY n 
7  39  TYR n 
7  40  MET n 
7  41  ASN n 
7  42  MET n 
7  43  GLN n 
7  44  LEU n 
7  45  ALA n 
7  46  ASN n 
7  47  THR n 
7  48  GLU n 
7  49  GLU n 
7  50  TYR n 
7  51  ILE n 
7  52  ASP n 
7  53  GLY n 
7  54  ALA n 
7  55  LEU n 
7  56  SER n 
7  57  GLY n 
7  58  HIS n 
7  59  LEU n 
7  60  GLY n 
7  61  GLU n 
7  62  VAL n 
7  63  LEU n 
7  64  ILE n 
7  65  ARG n 
7  66  CYS n 
7  67  ASN n 
7  68  ASN n 
7  69  VAL n 
7  70  LEU n 
7  71  TYR n 
7  72  ILE n 
7  73  ARG n 
7  74  GLY n 
7  75  VAL n 
7  76  GLU n 
7  77  GLU n 
7  78  GLU n 
7  79  GLU n 
7  80  GLU n 
7  81  ASP n 
7  82  GLY n 
7  83  GLU n 
7  84  MET n 
7  85  ARG n 
7  86  GLU n 
8  1   MET n 
8  2   ALA n 
8  3   TYR n 
8  4   ARG n 
8  5   GLY n 
8  6   GLN n 
8  7   GLY n 
8  8   GLN n 
8  9   LYS n 
8  10  VAL n 
8  11  GLN n 
8  12  LYS n 
8  13  VAL n 
8  14  MET n 
8  15  VAL n 
8  16  GLN n 
8  17  PRO n 
8  18  ILE n 
8  19  ASN n 
8  20  LEU n 
8  21  ILE n 
8  22  PHE n 
8  23  ARG n 
8  24  TYR n 
8  25  LEU n 
8  26  GLN n 
8  27  ASN n 
8  28  ARG n 
8  29  SER n 
8  30  ARG n 
8  31  ILE n 
8  32  GLN n 
8  33  VAL n 
8  34  TRP n 
8  35  LEU n 
8  36  TYR n 
8  37  GLU n 
8  38  GLN n 
8  39  VAL n 
8  40  ASN n 
8  41  MET n 
8  42  ARG n 
8  43  ILE n 
8  44  GLU n 
8  45  GLY n 
8  46  CYS n 
8  47  ILE n 
8  48  ILE n 
8  49  GLY n 
8  50  PHE n 
8  51  ASP n 
8  52  GLU n 
8  53  TYR n 
8  54  MET n 
8  55  ASN n 
8  56  LEU n 
8  57  VAL n 
8  58  LEU n 
8  59  ASP n 
8  60  ASP n 
8  61  ALA n 
8  62  GLU n 
8  63  GLU n 
8  64  ILE n 
8  65  HIS n 
8  66  SER n 
8  67  LYS n 
8  68  THR n 
8  69  LYS n 
8  70  SER n 
8  71  ARG n 
8  72  LYS n 
8  73  GLN n 
8  74  LEU n 
8  75  GLY n 
8  76  ARG n 
8  77  ILE n 
8  78  MET n 
8  79  LEU n 
8  80  LYS n 
8  81  GLY n 
8  82  ASP n 
8  83  ASN n 
8  84  ILE n 
8  85  THR n 
8  86  LEU n 
8  87  LEU n 
8  88  GLN n 
8  89  SER n 
8  90  VAL n 
8  91  SER n 
8  92  ASN n 
9  1   MET n 
9  2   SER n 
9  3   LYS n 
9  4   ALA n 
9  5   HIS n 
9  6   PRO n 
9  7   PRO n 
9  8   GLU n 
9  9   LEU n 
9  10  LYS n 
9  11  LYS n 
9  12  PHE n 
9  13  MET n 
9  14  ASP n 
9  15  LYS n 
9  16  LYS n 
9  17  LEU n 
9  18  SER n 
9  19  LEU n 
9  20  LYS n 
9  21  LEU n 
9  22  ASN n 
9  23  GLY n 
9  24  GLY n 
9  25  ARG n 
9  26  HIS n 
9  27  VAL n 
9  28  GLN n 
9  29  GLY n 
9  30  ILE n 
9  31  LEU n 
9  32  ARG n 
9  33  GLY n 
9  34  PHE n 
9  35  ASP n 
9  36  PRO n 
9  37  PHE n 
9  38  MET n 
9  39  ASN n 
9  40  LEU n 
9  41  VAL n 
9  42  ILE n 
9  43  ASP n 
9  44  GLU n 
9  45  CYS n 
9  46  VAL n 
9  47  GLU n 
9  48  MET n 
9  49  ALA n 
9  50  THR n 
9  51  SER n 
9  52  GLY n 
9  53  GLN n 
9  54  GLN n 
9  55  ASN n 
9  56  ASN n 
9  57  ILE n 
9  58  GLY n 
9  59  MET n 
9  60  VAL n 
9  61  VAL n 
9  62  ILE n 
9  63  ARG n 
9  64  GLY n 
9  65  ASN n 
9  66  SER n 
9  67  ILE n 
9  68  ILE n 
9  69  MET n 
9  70  LEU n 
9  71  GLU n 
9  72  ALA n 
9  73  LEU n 
9  74  GLU n 
9  75  ARG n 
9  76  VAL n 
10 1   A   n 
10 2   U   n 
10 3   A   n 
10 4   C   n 
10 5   U   n 
10 6   U   n 
10 7   A   n 
10 8   C   n 
10 9   C   n 
10 10  U   n 
10 11  G   n 
10 12  G   n 
10 13  C   n 
10 14  A   n 
10 15  G   n 
10 16  G   n 
10 17  G   n 
10 18  G   n 
10 19  A   n 
10 20  G   n 
10 21  A   n 
10 22  U   n 
10 23  A   n 
10 24  C   n 
10 25  C   n 
10 26  A   n 
10 27  U   n 
10 28  G   n 
10 29  A   n 
10 30  U   n 
10 31  C   n 
10 32  A   n 
10 33  C   n 
10 34  G   n 
10 35  A   n 
10 36  A   n 
10 37  G   n 
10 38  G   n 
10 39  U   n 
10 40  G   n 
10 41  G   n 
10 42  U   n 
10 43  U   n 
10 44  U   n 
10 45  U   n 
10 46  C   n 
10 47  C   n 
10 48  C   n 
10 49  A   n 
10 50  G   n 
10 51  G   n 
10 52  G   n 
10 53  C   n 
10 54  G   n 
10 55  A   n 
10 56  G   n 
10 57  G   n 
10 58  C   n 
10 59  U   n 
10 60  U   n 
10 61  A   n 
10 62  U   n 
10 63  C   n 
10 64  C   n 
10 65  A   n 
10 66  U   n 
10 67  U   n 
10 68  G   n 
10 69  C   n 
10 70  A   n 
10 71  C   n 
10 72  U   n 
10 73  C   n 
10 74  C   n 
10 75  G   n 
10 76  G   n 
10 77  A   n 
10 78  U   n 
10 79  G   n 
10 80  U   n 
10 81  G   n 
10 82  C   n 
10 83  U   n 
10 84  G   n 
10 85  A   n 
10 86  C   n 
10 87  C   n 
10 88  C   n 
10 89  C   n 
10 90  U   n 
10 91  G   n 
10 92  C   n 
10 93  G   n 
10 94  A   n 
10 95  U   n 
10 96  U   n 
10 97  U   n 
10 98  C   n 
10 99  C   n 
10 100 C   n 
10 101 C   n 
10 102 A   n 
10 103 A   n 
10 104 A   n 
10 105 U   n 
10 106 G   n 
10 107 U   n 
10 108 G   n 
10 109 G   n 
10 110 G   n 
10 111 A   n 
10 112 A   n 
10 113 A   n 
10 114 C   n 
10 115 U   n 
10 116 C   n 
10 117 G   n 
10 118 A   n 
10 119 C   n 
10 120 U   n 
10 121 G   n 
10 122 C   n 
10 123 A   n 
10 124 U   n 
10 125 A   n 
10 126 A   n 
10 127 U   n 
10 128 U   n 
10 129 U   n 
10 130 G   n 
10 131 U   n 
10 132 G   n 
10 133 G   n 
10 134 U   n 
10 135 A   n 
10 136 G   n 
10 137 U   n 
10 138 G   n 
10 139 G   n 
10 140 G   n 
10 141 G   n 
10 142 G   n 
10 143 A   n 
10 144 C   n 
10 145 U   n 
10 146 G   n 
10 147 C   n 
10 148 G   n 
10 149 U   n 
10 150 U   n 
10 151 C   n 
10 152 G   n 
10 153 C   n 
10 154 G   n 
10 155 C   n 
10 156 U   n 
10 157 U   n 
10 158 U   n 
10 159 C   n 
10 160 C   n 
10 161 C   n 
10 162 C   n 
10 163 U   n 
10 164 G   n 
11 1   DA  n 
11 2   DG  n 
11 3   DG  n 
11 4   DT  n 
11 5   DA  n 
11 6   DA  n 
11 7   DG  n 
11 8   DT  n 
11 9   DA  n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? 
2  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? 
3  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? 
4  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? 
5  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? 
6  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? 
7  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? 
8  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? 
9  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? 
10 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              11 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'DNA oligonucleotide' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP SNRPA_HUMAN  P09012 1  
;MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDK
PMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQ
PPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
;
1 ? 
2  UNP RU17_HUMAN   P08621 2  
;MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQ
EVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSA
YKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERE
RRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPS
EAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQD
NGLEGLGNDSRDMYMESEGGDGYLAPENGYLMEAAPE
;
1 ? 
3  UNP SMD3_HUMAN   P62318 3  
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
1 ? 
4  UNP Q66K91_HUMAN Q66K91 4  
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL
;
1 ? 
5  UNP SMD1_HUMAN   P62314 5  
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
1 ? 
6  UNP SMD2_HUMAN   P62316 6  
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
1 ? 
7  UNP RUXF_HUMAN   P62306 7  
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
1 ? 
8  UNP RUXE_HUMAN   P62304 8  
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
1 ? 
9  UNP D6W5G6_HUMAN D6W5G6 9  MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 1 ? 
10 PDB 3PGW         3PGW   10 
;AUACUUACCUGGCAGGGGAGAUACCAUGAUCACGAAGGUGGUUUUCCCAGGGCGAGGCUUAUCCAUUGCACUCCGGAUGU
GCUGACCCCUGCGAUUUCCCCAAAUGUGGGAAACUCGACUGCAUAAUUUGUGGUAGUGGGGGACUGCGUUCGCGCUUUCC
CCUG
;
1 ? 
11 PDB 3PGW         3PGW   11 AGGTAAGTA 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3PGW A 1 ? 282 ? P09012 1 ? 282 ? 1 282 
2  2  3PGW S 1 ? 437 ? P08621 1 ? 437 ? 1 437 
3  3  3PGW Z 1 ? 126 ? P62318 1 ? 126 ? 1 126 
4  4  3PGW B 1 ? 231 ? Q66K91 1 ? 231 ? 1 231 
5  5  3PGW X 1 ? 119 ? P62314 1 ? 119 ? 1 119 
6  6  3PGW Y 1 ? 118 ? P62316 1 ? 118 ? 1 118 
7  7  3PGW F 1 ? 86  ? P62306 1 ? 86  ? 1 86  
8  8  3PGW E 1 ? 92  ? P62304 1 ? 92  ? 1 92  
9  9  3PGW G 1 ? 76  ? D6W5G6 1 ? 76  ? 1 76  
10 1  3PGW P 1 ? 282 ? P09012 1 ? 282 ? 1 282 
11 2  3PGW L 1 ? 437 ? P08621 1 ? 437 ? 1 437 
12 3  3PGW W 1 ? 126 ? P62318 1 ? 126 ? 1 126 
13 4  3PGW Q 1 ? 231 ? Q66K91 1 ? 231 ? 1 231 
14 5  3PGW U 1 ? 119 ? P62314 1 ? 119 ? 1 119 
15 6  3PGW V 1 ? 118 ? P62316 1 ? 118 ? 1 118 
16 7  3PGW I 1 ? 86  ? P62306 1 ? 86  ? 1 86  
17 8  3PGW H 1 ? 92  ? P62304 1 ? 92  ? 1 92  
18 9  3PGW J 1 ? 76  ? D6W5G6 1 ? 76  ? 1 76  
19 10 3PGW R 1 ? 164 ? 3PGW   1 ? 164 ? 1 164 
20 10 3PGW N 1 ? 164 ? 3PGW   1 ? 164 ? 1 164 
21 11 3PGW D 1 ? 9   ? 3PGW   1 ? 9   ? 1 9   
22 11 3PGW M 1 ? 9   ? 3PGW   1 ? 9   ? 1 9   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3PGW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.43 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
;8-10% PEG 4000, 0.1 M Trisodium citrate, 2 mM EDTA, 100 mM NaCl, 1-2% Anapoe X-305, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2007-08-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'LN2 cooled fixed-exit Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.999 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.999 
# 
_reflns.entry_id                     3PGW 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             100 
_reflns.d_resolution_high            4.4 
_reflns.number_obs                   28079 
_reflns.number_all                   28274 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             4.4 
_reflns_shell.d_res_low              4.6 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.73 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3480 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3PGW 
_refine.ls_number_reflns_obs                     28077 
_refine.ls_number_reflns_all                     28077 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             100 
_refine.ls_d_res_high                            4.4 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.299 
_refine.ls_R_factor_R_free                       0.348 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1403 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MR, MIRAS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1716 
_refine_hist.pdbx_number_atoms_nucleic_acid   342 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2058 
_refine_hist.d_res_high                       4.4 
_refine_hist.d_res_low                        100 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d    0.004 ? ? ? 'X-RAY DIFFRACTION' ? 
f_angle_deg 1.201 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  3PGW 
_struct.title                     'Crystal structure of human U1 snRNP' 
_struct.pdbx_descriptor           'U1-A , U1-70K , Sm-D3 , Sm B, Sm-D1 , Sm-D2 , Sm-F , Sm-E , Sm G' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3PGW 
_struct_keywords.pdbx_keywords   splicing/DNA/RNA 
_struct_keywords.text            
'PROTEIN-RNA COMPLEX, U1 snRNA, Sm fold, Sm core, RRM, Splicing, mRNA, snRNPs, splicing factors, splicing-DNA-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 1  ? 
K N N 2  ? 
L N N 3  ? 
M N N 4  ? 
N N N 5  ? 
O N N 6  ? 
P N N 7  ? 
Q N N 8  ? 
R N N 9  ? 
S N N 10 ? 
T N N 10 ? 
U N N 11 ? 
V N N 11 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 'biological assembly 1: chains A, S, Z, B, X, Y, F, E, G, R, D' 
2 'biological assembly 2: chains P, L ,W, Q, U, V, I, H, J, N, M' 
# 
_database_PDB_matrix.entry_id          3PGW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3PGW 
_atom_sites.fract_transf_matrix[1][1]   0.002790 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001120 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011335 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007141 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
P 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    C CA . GLU A 1  5   ? -54.379  0.951   -91.554 1.00 256.28 ? 5   GLU A CA 1 
ATOM 2    C CA . THR A 1  6   ? -57.224  1.065   -94.101 1.00 249.92 ? 6   THR A CA 1 
ATOM 3    C CA . ARG A 1  7   ? -59.269  -0.683  -91.385 1.00 214.02 ? 7   ARG A CA 1 
ATOM 4    C CA . PRO A 1  8   ? -61.774  1.050   -89.026 1.00 190.91 ? 8   PRO A CA 1 
ATOM 5    C CA . ASN A 1  9   ? -60.672  1.491   -85.402 1.00 210.34 ? 9   ASN A CA 1 
ATOM 6    C CA . HIS A 1  10  ? -61.432  3.012   -81.984 1.00 166.27 ? 10  HIS A CA 1 
ATOM 7    C CA . THR A 1  11  ? -58.031  4.734   -82.063 1.00 202.87 ? 11  THR A CA 1 
ATOM 8    C CA . ILE A 1  12  ? -56.099  7.049   -84.383 1.00 211.93 ? 12  ILE A CA 1 
ATOM 9    C CA . TYR A 1  13  ? -52.336  7.083   -84.971 1.00 219.35 ? 13  TYR A CA 1 
ATOM 10   C CA . ILE A 1  14  ? -51.126  10.629  -85.683 1.00 160.69 ? 14  ILE A CA 1 
ATOM 11   C CA . ASN A 1  15  ? -47.553  10.870  -86.962 1.00 200.15 ? 15  ASN A CA 1 
ATOM 12   C CA . ASN A 1  16  ? -45.566  14.056  -87.662 1.00 198.82 ? 16  ASN A CA 1 
ATOM 13   C CA . LEU A 1  17  ? -46.453  16.594  -84.950 1.00 163.54 ? 17  LEU A CA 1 
ATOM 14   C CA . ASN A 1  18  ? -44.456  19.364  -83.266 1.00 214.75 ? 18  ASN A CA 1 
ATOM 15   C CA . GLU A 1  19  ? -42.280  16.989  -81.241 1.00 205.97 ? 19  GLU A CA 1 
ATOM 16   C CA . LYS A 1  20  ? -40.787  19.881  -79.264 1.00 209.87 ? 20  LYS A CA 1 
ATOM 17   C CA . ILE A 1  21  ? -44.186  20.191  -77.575 1.00 168.71 ? 21  ILE A CA 1 
ATOM 18   C CA . LYS A 1  22  ? -44.329  19.114  -73.934 1.00 194.20 ? 22  LYS A CA 1 
ATOM 19   C CA . LYS A 1  23  ? -46.461  16.198  -72.729 1.00 218.04 ? 23  LYS A CA 1 
ATOM 20   C CA . ASP A 1  24  ? -48.679  18.138  -70.318 1.00 231.57 ? 24  ASP A CA 1 
ATOM 21   C CA . GLU A 1  25  ? -49.606  20.749  -72.929 1.00 248.39 ? 25  GLU A CA 1 
ATOM 22   C CA . LEU A 1  26  ? -50.004  18.272  -75.807 1.00 134.91 ? 26  LEU A CA 1 
ATOM 23   C CA . LYS A 1  27  ? -52.534  16.281  -73.786 1.00 167.23 ? 27  LYS A CA 1 
ATOM 24   C CA . LYS A 1  28  ? -54.465  19.296  -72.512 1.00 201.31 ? 28  LYS A CA 1 
ATOM 25   C CA . SER A 1  29  ? -54.389  20.402  -76.150 1.00 211.84 ? 29  SER A CA 1 
ATOM 26   C CA . LEU A 1  30  ? -55.668  17.228  -77.829 1.00 161.88 ? 30  LEU A CA 1 
ATOM 27   C CA . TYR A 1  31  ? -58.342  16.402  -75.249 1.00 240.49 ? 31  TYR A CA 1 
ATOM 28   C CA . ALA A 1  32  ? -59.945  19.746  -76.115 1.00 204.27 ? 32  ALA A CA 1 
ATOM 29   C CA . ILE A 1  33  ? -59.595  19.450  -79.901 1.00 183.25 ? 33  ILE A CA 1 
ATOM 30   C CA . PHE A 1  34  ? -61.030  15.952  -80.423 1.00 160.81 ? 34  PHE A CA 1 
ATOM 31   C CA . SER A 1  35  ? -63.464  15.701  -77.498 1.00 172.43 ? 35  SER A CA 1 
ATOM 32   C CA . GLN A 1  36  ? -66.112  16.636  -80.077 1.00 199.04 ? 36  GLN A CA 1 
ATOM 33   C CA . PHE A 1  37  ? -66.004  14.181  -82.988 1.00 201.79 ? 37  PHE A CA 1 
ATOM 34   C CA . GLY A 1  38  ? -66.845  11.604  -80.346 1.00 218.37 ? 38  GLY A CA 1 
ATOM 35   C CA . GLN A 1  39  ? -65.836  10.318  -76.921 1.00 199.50 ? 39  GLN A CA 1 
ATOM 36   C CA . ILE A 1  40  ? -62.288  10.101  -75.550 1.00 183.18 ? 40  ILE A CA 1 
ATOM 37   C CA . LEU A 1  41  ? -61.534  7.598   -72.785 1.00 183.76 ? 41  LEU A CA 1 
ATOM 38   C CA . ASP A 1  42  ? -57.900  8.702   -72.401 1.00 217.98 ? 42  ASP A CA 1 
ATOM 39   C CA . ILE A 1  43  ? -55.239  9.838   -74.878 1.00 201.34 ? 43  ILE A CA 1 
ATOM 40   C CA . LEU A 1  44  ? -51.625  8.692   -74.791 1.00 173.44 ? 44  LEU A CA 1 
ATOM 41   C CA . VAL A 1  45  ? -48.282  9.786   -76.242 1.00 188.73 ? 45  VAL A CA 1 
ATOM 42   C CA . SER A 1  46  ? -44.645  9.557   -75.140 1.00 199.13 ? 46  SER A CA 1 
ATOM 43   C CA . ARG A 1  47  ? -41.519  11.659  -75.624 1.00 214.47 ? 47  ARG A CA 1 
ATOM 44   C CA . SER A 1  48  ? -39.368  8.565   -76.128 1.00 170.61 ? 48  SER A CA 1 
ATOM 45   C CA . LEU A 1  49  ? -37.181  8.192   -79.209 1.00 194.02 ? 49  LEU A CA 1 
ATOM 46   C CA . LYS A 1  50  ? -39.831  5.972   -80.783 1.00 181.08 ? 50  LYS A CA 1 
ATOM 47   C CA . MET A 1  51  ? -42.917  7.914   -79.671 1.00 197.74 ? 51  MET A CA 1 
ATOM 48   C CA . ARG A 1  52  ? -42.160  11.633  -80.035 1.00 220.90 ? 52  ARG A CA 1 
ATOM 49   C CA . GLY A 1  53  ? -44.167  13.082  -82.908 1.00 222.56 ? 53  GLY A CA 1 
ATOM 50   C CA . GLN A 1  54  ? -46.674  10.227  -82.737 1.00 187.51 ? 54  GLN A CA 1 
ATOM 51   C CA . ALA A 1  55  ? -49.968  9.890   -80.864 1.00 165.69 ? 55  ALA A CA 1 
ATOM 52   C CA . PHE A 1  56  ? -52.721  7.428   -79.949 1.00 159.40 ? 56  PHE A CA 1 
ATOM 53   C CA . VAL A 1  57  ? -56.292  8.381   -79.015 1.00 173.84 ? 57  VAL A CA 1 
ATOM 54   C CA . ILE A 1  58  ? -59.103  6.039   -77.969 1.00 179.39 ? 58  ILE A CA 1 
ATOM 55   C CA . PHE A 1  59  ? -62.637  6.616   -79.203 1.00 215.14 ? 59  PHE A CA 1 
ATOM 56   C CA . LYS A 1  60  ? -65.764  5.223   -77.561 1.00 197.94 ? 60  LYS A CA 1 
ATOM 57   C CA . GLU A 1  61  ? -67.678  4.749   -80.805 1.00 212.49 ? 61  GLU A CA 1 
ATOM 58   C CA . VAL A 1  62  ? -66.065  3.743   -84.104 1.00 223.32 ? 62  VAL A CA 1 
ATOM 59   C CA . SER A 1  63  ? -67.893  6.269   -86.285 1.00 239.30 ? 63  SER A CA 1 
ATOM 60   C CA . SER A 1  64  ? -66.749  8.944   -83.841 1.00 176.08 ? 64  SER A CA 1 
ATOM 61   C CA . ALA A 1  65  ? -63.115  8.183   -84.651 1.00 192.18 ? 65  ALA A CA 1 
ATOM 62   C CA . THR A 1  66  ? -63.829  7.965   -88.378 1.00 200.18 ? 66  THR A CA 1 
ATOM 63   C CA . ASN A 1  67  ? -65.449  11.409  -88.459 1.00 248.92 ? 67  ASN A CA 1 
ATOM 64   C CA . ALA A 1  68  ? -62.512  12.982  -86.620 1.00 193.26 ? 68  ALA A CA 1 
ATOM 65   C CA . LEU A 1  69  ? -60.122  11.676  -89.276 1.00 179.03 ? 69  LEU A CA 1 
ATOM 66   C CA . ARG A 1  70  ? -62.271  12.890  -92.181 1.00 267.17 ? 70  ARG A CA 1 
ATOM 67   C CA . SER A 1  71  ? -61.960  16.498  -91.002 1.00 227.91 ? 71  SER A CA 1 
ATOM 68   C CA . MET A 1  72  ? -58.602  16.752  -89.204 1.00 189.86 ? 72  MET A CA 1 
ATOM 69   C CA . GLN A 1  73  ? -56.518  14.647  -91.602 1.00 208.36 ? 73  GLN A CA 1 
ATOM 70   C CA . GLY A 1  74  ? -53.823  16.866  -93.086 1.00 202.04 ? 74  GLY A CA 1 
ATOM 71   C CA . PHE A 1  75  ? -54.535  19.744  -90.697 1.00 195.28 ? 75  PHE A CA 1 
ATOM 72   C CA . PRO A 1  76  ? -51.707  22.144  -89.688 1.00 213.02 ? 76  PRO A CA 1 
ATOM 73   C CA . PHE A 1  77  ? -51.072  21.649  -85.968 1.00 200.09 ? 77  PHE A CA 1 
ATOM 74   C CA . TYR A 1  78  ? -48.254  23.659  -84.381 1.00 200.56 ? 78  TYR A CA 1 
ATOM 75   C CA . ASP A 1  79  ? -46.502  24.277  -87.711 1.00 184.66 ? 79  ASP A CA 1 
ATOM 76   C CA . LYS A 1  80  ? -47.081  20.713  -88.944 1.00 201.13 ? 80  LYS A CA 1 
ATOM 77   C CA . PRO A 1  81  ? -50.060  19.014  -90.693 1.00 201.04 ? 81  PRO A CA 1 
ATOM 78   C CA . MET A 1  82  ? -51.211  15.941  -88.758 1.00 202.62 ? 82  MET A CA 1 
ATOM 79   C CA . ARG A 1  83  ? -51.062  12.683  -90.712 1.00 227.73 ? 83  ARG A CA 1 
ATOM 80   C CA . ILE A 1  84  ? -53.873  10.860  -88.910 1.00 175.35 ? 84  ILE A CA 1 
ATOM 81   C CA . GLN A 1  85  ? -54.609  7.187   -89.568 1.00 196.54 ? 85  GLN A CA 1 
ATOM 82   C CA . TYR A 1  86  ? -56.351  4.195   -87.992 1.00 248.89 ? 86  TYR A CA 1 
ATOM 83   C CA . ALA A 1  87  ? -54.665  2.110   -85.287 1.00 190.73 ? 87  ALA A CA 1 
ATOM 84   C CA . LYS A 1  88  ? -53.159  -1.119  -86.640 1.00 195.04 ? 88  LYS A CA 1 
ATOM 85   C CA . THR A 1  89  ? -54.200  -2.745  -83.366 1.00 199.70 ? 89  THR A CA 1 
ATOM 86   C CA . ASP A 1  90  ? -57.132  -2.265  -80.998 1.00 224.02 ? 90  ASP A CA 1 
ATOM 87   C CA . SER A 1  91  ? -56.103  -0.486  -77.792 1.00 197.79 ? 91  SER A CA 1 
ATOM 88   C CA . ASP A 1  92  ? -55.470  -2.546  -74.653 1.00 216.97 ? 92  ASP A CA 1 
ATOM 89   C CA . ILE A 1  93  ? -58.311  -0.712  -72.920 1.00 165.85 ? 93  ILE A CA 1 
ATOM 90   C CA . ILE A 1  94  ? -60.486  -1.648  -75.892 1.00 184.54 ? 94  ILE A CA 1 
ATOM 91   C CA . ALA A 1  95  ? -59.360  -5.265  -75.646 1.00 204.99 ? 95  ALA A CA 1 
ATOM 92   C CA . LYS A 1  96  ? -60.462  -5.516  -72.018 1.00 199.96 ? 96  LYS A CA 1 
ATOM 93   C CA . MET A 1  97  ? -63.937  -4.177  -72.828 1.00 197.55 ? 97  MET A CA 1 
ATOM 94   C CA . LYS A 1  98  ? -64.747  -5.547  -76.283 1.00 182.35 ? 98  LYS A CA 1 
ATOM 95   C CA . GLY A 1  99  ? -63.508  -8.977  -77.282 1.00 259.16 ? 99  GLY A CA 1 
ATOM 96   C CA . THR A 1  100 ? -63.422  -10.331 -73.732 1.00 322.69 ? 100 THR A CA 1 
ATOM 97   C CA . PHE A 1  101 ? -59.899  -11.693 -73.318 1.00 299.05 ? 101 PHE A CA 1 
ATOM 98   C CA . VAL A 1  102 ? -58.298  -10.086 -76.359 1.00 220.10 ? 102 VAL A CA 1 
ATOM 99   C CA . GLU A 1  103 ? -56.495  -8.286  -73.531 1.00 229.98 ? 103 GLU A CA 1 
ATOM 100  C CA . ARG A 1  104 ? -54.860  -11.296 -71.861 1.00 310.78 ? 104 ARG A CA 1 
ATOM 101  C CA . ASP A 1  105 ? -53.455  -12.543 -75.163 1.00 343.53 ? 105 ASP A CA 1 
ATOM 102  C CA . ARG A 1  106 ? -51.927  -9.085  -75.505 1.00 309.01 ? 106 ARG A CA 1 
ATOM 103  C CA . LYS A 1  107 ? -50.653  -9.400  -71.925 1.00 230.40 ? 107 LYS A CA 1 
ATOM 104  C CA . ARG A 1  108 ? -48.614  -12.579 -72.392 1.00 305.50 ? 108 ARG A CA 1 
ATOM 105  C CA . GLU A 1  109 ? -47.528  -11.169 -75.749 1.00 309.26 ? 109 GLU A CA 1 
ATOM 106  C CA . LYS A 1  110 ? -46.070  -8.095  -74.046 1.00 312.86 ? 110 LYS A CA 1 
ATOM 107  C CA . ARG A 1  111 ? -44.118  -10.188 -71.525 1.00 278.86 ? 111 ARG A CA 1 
ATOM 108  C CA . LYS A 1  112 ? -42.884  -12.604 -74.198 1.00 237.36 ? 112 LYS A CA 1 
ATOM 109  C CA . HIS B 2  34  ? -47.809  41.951  -4.152  1.00 229.50 ? 34  HIS S CA 1 
ATOM 110  C CA . ASN B 2  35  ? -45.282  39.124  -4.123  1.00 185.44 ? 35  ASN S CA 1 
ATOM 111  C CA . GLN B 2  36  ? -45.300  35.908  -2.094  1.00 236.28 ? 36  GLN S CA 1 
ATOM 112  C CA . PRO B 2  37  ? -42.189  33.925  -0.987  1.00 245.41 ? 37  PRO S CA 1 
ATOM 113  C CA . TYR B 2  38  ? -41.227  30.595  0.523   1.00 256.70 ? 38  TYR S CA 1 
ATOM 114  C CA . CYS B 2  39  ? -42.249  27.096  1.333   1.00 244.42 ? 39  CYS S CA 1 
ATOM 115  C CA . GLY B 2  40  ? -43.843  25.044  4.089   1.00 290.66 ? 40  GLY S CA 1 
ATOM 116  C CA . ILE B 2  41  ? -40.154  24.110  3.942   1.00 218.80 ? 41  ILE S CA 1 
ATOM 117  C CA . ALA B 2  42  ? -40.735  20.719  5.498   1.00 251.53 ? 42  ALA S CA 1 
ATOM 118  C CA . PRO B 2  43  ? -39.733  18.462  2.642   1.00 235.02 ? 43  PRO S CA 1 
ATOM 119  C CA . TYR B 2  44  ? -36.593  19.060  0.599   1.00 260.65 ? 44  TYR S CA 1 
ATOM 120  C CA . ILE B 2  45  ? -35.053  15.624  0.713   1.00 283.82 ? 45  ILE S CA 1 
ATOM 121  C CA . ARG B 2  46  ? -34.273  14.609  4.279   1.00 282.02 ? 46  ARG S CA 1 
ATOM 122  C CA . GLU B 2  47  ? -31.233  12.566  5.333   1.00 253.82 ? 47  GLU S CA 1 
ATOM 123  C CA . PHE B 2  48  ? -31.492  10.264  2.284   1.00 257.18 ? 48  PHE S CA 1 
ATOM 124  C CA . GLU B 2  49  ? -30.288  13.041  -0.033  1.00 303.17 ? 49  GLU S CA 1 
ATOM 125  C CA . ASP B 2  50  ? -26.878  12.891  1.643   1.00 389.72 ? 50  ASP S CA 1 
ATOM 126  C CA . PRO B 2  51  ? -26.201  9.418   0.204   1.00 367.07 ? 51  PRO S CA 1 
ATOM 127  C CA . ARG B 2  52  ? -27.942  10.289  -3.071  1.00 276.85 ? 52  ARG S CA 1 
ATOM 128  C CA . ASP B 2  53  ? -25.584  13.274  -3.236  1.00 361.96 ? 53  ASP S CA 1 
ATOM 129  C CA . ALA B 2  54  ? -22.396  11.191  -2.989  1.00 331.33 ? 54  ALA S CA 1 
ATOM 130  C CA . PRO B 2  55  ? -22.103  10.194  -6.694  1.00 352.70 ? 55  PRO S CA 1 
ATOM 131  C CA . PRO B 2  56  ? -22.331  13.792  -8.075  1.00 352.35 ? 56  PRO S CA 1 
ATOM 132  C CA . PRO B 2  57  ? -19.106  15.235  -6.541  1.00 329.33 ? 57  PRO S CA 1 
ATOM 133  C CA . THR B 2  58  ? -16.863  12.821  -8.484  1.00 355.07 ? 58  THR S CA 1 
ATOM 134  C CA . ARG B 2  59  ? -18.635  13.425  -11.806 1.00 282.83 ? 59  ARG S CA 1 
ATOM 135  C CA . ALA B 2  60  ? -15.926  15.752  -13.163 1.00 261.95 ? 60  ALA S CA 1 
ATOM 136  C CA . GLU B 2  61  ? -12.344  14.898  -14.167 1.00 222.20 ? 61  GLU S CA 1 
ATOM 137  C CA . THR B 2  62  ? -10.687  17.589  -16.234 1.00 255.36 ? 62  THR S CA 1 
ATOM 138  C CA . ARG B 2  63  ? -7.025   16.711  -15.638 1.00 271.80 ? 63  ARG S CA 1 
ATOM 139  C CA . GLU B 2  64  ? -7.488   13.949  -13.086 1.00 267.34 ? 64  GLU S CA 1 
ATOM 140  C CA . GLU B 2  65  ? -8.246   11.382  -15.790 1.00 299.93 ? 65  GLU S CA 1 
ATOM 141  C CA . ARG B 2  66  ? -5.063   12.042  -17.773 1.00 263.34 ? 66  ARG S CA 1 
ATOM 142  C CA . MET B 2  67  ? -2.756   12.469  -14.775 1.00 254.25 ? 67  MET S CA 1 
ATOM 143  C CA . GLU B 2  68  ? -4.175   9.413   -12.997 1.00 311.58 ? 68  GLU S CA 1 
ATOM 144  C CA . ARG B 2  69  ? -3.604   7.223   -16.051 1.00 281.52 ? 69  ARG S CA 1 
ATOM 145  C CA . LYS B 2  70  ? 0.017    8.354   -16.074 1.00 236.24 ? 70  LYS S CA 1 
ATOM 146  C CA . ARG B 2  71  ? 0.529    7.691   -12.358 1.00 258.19 ? 71  ARG S CA 1 
ATOM 147  C CA . ARG B 2  72  ? -1.567   4.514   -12.173 1.00 256.91 ? 72  ARG S CA 1 
ATOM 148  C CA . GLU B 2  73  ? -0.152   2.493   -15.066 1.00 312.56 ? 73  GLU S CA 1 
ATOM 149  C CA . LYS B 2  74  ? 3.517    3.474   -14.848 1.00 249.80 ? 74  LYS S CA 1 
ATOM 150  C CA . ILE B 2  75  ? 3.623    3.103   -11.060 1.00 252.47 ? 75  ILE S CA 1 
ATOM 151  C CA . GLU B 2  76  ? 2.117    -0.388  -11.255 1.00 260.84 ? 76  GLU S CA 1 
ATOM 152  C CA . ARG B 2  77  ? 4.919    -1.407  -13.613 1.00 249.09 ? 77  ARG S CA 1 
ATOM 153  C CA . ARG B 2  78  ? 7.301    0.082   -11.054 1.00 273.04 ? 78  ARG S CA 1 
ATOM 154  C CA . GLN B 2  79  ? 5.608    -2.049  -8.400  1.00 285.26 ? 79  GLN S CA 1 
ATOM 155  C CA . GLN B 2  80  ? 5.878    -5.342  -10.274 1.00 271.83 ? 80  GLN S CA 1 
ATOM 156  C CA . GLU B 2  81  ? 9.429    -4.129  -10.860 1.00 310.63 ? 81  GLU S CA 1 
ATOM 157  C CA . VAL B 2  82  ? 10.013   -4.271  -7.106  1.00 270.51 ? 82  VAL S CA 1 
ATOM 158  C CA . GLU B 2  83  ? 9.159    -7.964  -7.310  1.00 278.52 ? 83  GLU S CA 1 
ATOM 159  C CA . THR B 2  84  ? 11.691   -8.718  -10.039 1.00 268.08 ? 84  THR S CA 1 
ATOM 160  C CA . GLU B 2  85  ? 14.269   -6.485  -8.327  1.00 255.77 ? 85  GLU S CA 1 
ATOM 161  C CA . LEU B 2  86  ? 14.701   -8.583  -5.167  1.00 269.41 ? 86  LEU S CA 1 
ATOM 162  C CA . LYS B 2  87  ? 14.549   -11.432 -7.669  1.00 267.54 ? 87  LYS S CA 1 
ATOM 163  C CA . MET B 2  88  ? 17.533   -9.968  -9.520  1.00 300.32 ? 88  MET S CA 1 
ATOM 164  C CA . TRP B 2  89  ? 19.726   -7.701  -7.369  1.00 328.04 ? 89  TRP S CA 1 
ATOM 165  C CA . ASP B 2  90  ? 21.715   -8.990  -4.383  1.00 313.35 ? 90  ASP S CA 1 
ATOM 166  C CA . PRO B 2  91  ? 25.285   -9.593  -3.093  1.00 294.42 ? 91  PRO S CA 1 
ATOM 167  C CA . HIS B 2  92  ? 25.441   -12.556 -5.468  1.00 276.03 ? 92  HIS S CA 1 
ATOM 168  C CA . ASN B 2  93  ? 25.649   -10.090 -8.337  1.00 352.65 ? 93  ASN S CA 1 
ATOM 169  C CA . ASP B 2  94  ? 29.141   -9.360  -7.043  1.00 363.18 ? 94  ASP S CA 1 
ATOM 170  C CA . PRO B 2  95  ? 30.730   -12.834 -7.441  1.00 327.12 ? 95  PRO S CA 1 
ATOM 171  C CA . ASN B 2  96  ? 28.830   -14.330 -10.379 1.00 274.12 ? 96  ASN S CA 1 
ATOM 172  C CA . ALA B 2  97  ? 29.484   -11.014 -12.081 1.00 307.19 ? 97  ALA S CA 1 
ATOM 173  C CA . GLN B 2  98  ? 33.136   -10.250 -12.870 1.00 359.23 ? 98  GLN S CA 1 
ATOM 174  C CA . GLY B 2  99  ? 34.801   -7.967  -10.337 1.00 344.85 ? 99  GLY S CA 1 
ATOM 175  C CA . ASP B 2  100 ? 34.060   -8.880  -6.725  1.00 334.23 ? 100 ASP S CA 1 
ATOM 176  C CA . ALA B 2  101 ? 37.485   -8.309  -5.172  1.00 276.17 ? 101 ALA S CA 1 
ATOM 177  C CA . PHE B 2  102 ? 37.526   -5.231  -2.937  1.00 256.43 ? 102 PHE S CA 1 
ATOM 178  C CA . LYS B 2  103 ? 36.218   -2.288  -4.942  1.00 192.83 ? 103 LYS S CA 1 
ATOM 179  C CA . THR B 2  104 ? 36.381   -2.558  -8.736  1.00 272.72 ? 104 THR S CA 1 
ATOM 180  C CA . LEU B 2  105 ? 36.586   0.823   -10.465 1.00 262.46 ? 105 LEU S CA 1 
ATOM 181  C CA . PHE B 2  106 ? 33.399   1.399   -12.477 1.00 274.51 ? 106 PHE S CA 1 
ATOM 182  C CA . VAL B 2  107 ? 33.967   2.952   -15.911 1.00 250.85 ? 107 VAL S CA 1 
ATOM 183  C CA . ALA B 2  108 ? 30.885   4.063   -17.839 1.00 271.85 ? 108 ALA S CA 1 
ATOM 184  C CA . ARG B 2  109 ? 30.193   6.197   -20.918 1.00 272.41 ? 109 ARG S CA 1 
ATOM 185  C CA . VAL B 2  110 ? 32.492   4.369   -23.355 1.00 289.37 ? 110 VAL S CA 1 
ATOM 186  C CA . ASN B 2  111 ? 31.955   4.389   -27.145 1.00 286.08 ? 111 ASN S CA 1 
ATOM 187  C CA . TYR B 2  112 ? 29.635   1.833   -28.768 1.00 260.00 ? 112 TYR S CA 1 
ATOM 188  C CA . ASP B 2  113 ? 32.941   0.487   -30.074 1.00 287.97 ? 113 ASP S CA 1 
ATOM 189  C CA . THR B 2  114 ? 36.028   -0.292  -27.988 1.00 286.66 ? 114 THR S CA 1 
ATOM 190  C CA . THR B 2  115 ? 38.342   -3.130  -26.932 1.00 292.88 ? 115 THR S CA 1 
ATOM 191  C CA . GLU B 2  116 ? 40.078   -4.375  -23.781 1.00 295.67 ? 116 GLU S CA 1 
ATOM 192  C CA . SER B 2  117 ? 43.325   -3.466  -25.535 1.00 316.86 ? 117 SER S CA 1 
ATOM 193  C CA . LYS B 2  118 ? 42.439   0.226   -25.507 1.00 251.11 ? 118 LYS S CA 1 
ATOM 194  C CA . LEU B 2  119 ? 41.077   0.135   -21.952 1.00 242.23 ? 119 LEU S CA 1 
ATOM 195  C CA . ARG B 2  120 ? 43.808   -2.003  -20.374 1.00 257.85 ? 120 ARG S CA 1 
ATOM 196  C CA . ARG B 2  121 ? 46.233   0.388   -22.059 1.00 270.43 ? 121 ARG S CA 1 
ATOM 197  C CA . GLU B 2  122 ? 44.852   3.665   -20.693 1.00 262.21 ? 122 GLU S CA 1 
ATOM 198  C CA . PHE B 2  123 ? 43.742   2.610   -17.209 1.00 287.35 ? 123 PHE S CA 1 
ATOM 199  C CA . GLU B 2  124 ? 46.921   0.661   -16.476 1.00 245.75 ? 124 GLU S CA 1 
ATOM 200  C CA . VAL B 2  125 ? 48.825   3.875   -17.192 1.00 276.59 ? 125 VAL S CA 1 
ATOM 201  C CA . TYR B 2  126 ? 46.979   5.044   -14.080 1.00 269.13 ? 126 TYR S CA 1 
ATOM 202  C CA . GLY B 2  127 ? 48.026   2.006   -12.077 1.00 200.25 ? 127 GLY S CA 1 
ATOM 203  C CA . PRO B 2  128 ? 48.426   -1.816  -11.826 1.00 235.43 ? 128 PRO S CA 1 
ATOM 204  C CA . ILE B 2  129 ? 45.472   -3.673  -13.341 1.00 276.14 ? 129 ILE S CA 1 
ATOM 205  C CA . LYS B 2  130 ? 44.338   -6.856  -11.611 1.00 256.05 ? 130 LYS S CA 1 
ATOM 206  C CA . ARG B 2  131 ? 41.206   -7.670  -13.618 1.00 261.62 ? 131 ARG S CA 1 
ATOM 207  C CA . ILE B 2  132 ? 38.976   -6.282  -16.376 1.00 264.02 ? 132 ILE S CA 1 
ATOM 208  C CA . HIS B 2  133 ? 35.569   -7.111  -17.850 1.00 248.85 ? 133 HIS S CA 1 
ATOM 209  C CA . MET B 2  134 ? 33.172   -5.425  -20.257 1.00 294.19 ? 134 MET S CA 1 
ATOM 210  C CA . VAL B 2  135 ? 29.493   -6.342  -19.982 1.00 279.83 ? 135 VAL S CA 1 
ATOM 211  C CA . TYR B 2  136 ? 27.747   -6.673  -23.340 1.00 286.09 ? 136 TYR S CA 1 
ATOM 212  C CA . SER B 2  137 ? 24.171   -6.338  -24.550 1.00 288.42 ? 137 SER S CA 1 
ATOM 213  C CA . LYS B 2  138 ? 21.639   -8.887  -23.353 1.00 231.88 ? 138 LYS S CA 1 
ATOM 214  C CA . ARG B 2  139 ? 21.971   -10.333 -26.859 1.00 267.27 ? 139 ARG S CA 1 
ATOM 215  C CA . SER B 2  140 ? 24.085   -8.054  -29.069 1.00 298.13 ? 140 SER S CA 1 
ATOM 216  C CA . GLY B 2  141 ? 27.842   -8.564  -29.091 1.00 347.14 ? 141 GLY S CA 1 
ATOM 217  C CA . LYS B 2  142 ? 28.583   -4.835  -29.131 1.00 330.72 ? 142 LYS S CA 1 
ATOM 218  C CA . PRO B 2  143 ? 29.755   -3.531  -25.717 1.00 339.73 ? 143 PRO S CA 1 
ATOM 219  C CA . ARG B 2  144 ? 27.088   -1.539  -23.868 1.00 270.21 ? 144 ARG S CA 1 
ATOM 220  C CA . GLY B 2  145 ? 29.630   0.898   -22.453 1.00 220.61 ? 145 GLY S CA 1 
ATOM 221  C CA . TYR B 2  146 ? 30.085   -0.088  -18.811 1.00 241.85 ? 146 TYR S CA 1 
ATOM 222  C CA . ALA B 2  147 ? 33.119   -2.253  -18.045 1.00 224.83 ? 147 ALA S CA 1 
ATOM 223  C CA . PHE B 2  148 ? 34.472   -3.325  -14.660 1.00 230.94 ? 148 PHE S CA 1 
ATOM 224  C CA . ILE B 2  149 ? 38.192   -2.686  -14.187 1.00 230.32 ? 149 ILE S CA 1 
ATOM 225  C CA . GLU B 2  150 ? 39.923   -3.920  -11.044 1.00 251.13 ? 150 GLU S CA 1 
ATOM 226  C CA . TYR B 2  151 ? 42.936   -2.601  -9.128  1.00 276.33 ? 151 TYR S CA 1 
ATOM 227  C CA . GLU B 2  152 ? 45.293   -4.121  -6.555  1.00 286.72 ? 152 GLU S CA 1 
ATOM 228  C CA . HIS B 2  153 ? 45.470   -1.370  -3.929  1.00 269.81 ? 153 HIS S CA 1 
ATOM 229  C CA . GLU B 2  154 ? 42.619   0.864   -2.781  1.00 305.75 ? 154 GLU S CA 1 
ATOM 230  C CA . ARG B 2  155 ? 44.949   3.837   -3.176  1.00 264.27 ? 155 ARG S CA 1 
ATOM 231  C CA . ASP B 2  156 ? 45.584   2.621   -6.726  1.00 285.89 ? 156 ASP S CA 1 
ATOM 232  C CA . MET B 2  157 ? 41.875   2.700   -7.562  1.00 266.33 ? 157 MET S CA 1 
ATOM 233  C CA . HIS B 2  158 ? 41.612   6.247   -6.222  1.00 248.05 ? 158 HIS S CA 1 
ATOM 234  C CA . SER B 2  159 ? 44.685   7.262   -8.215  1.00 275.06 ? 159 SER S CA 1 
ATOM 235  C CA . ALA B 2  160 ? 43.034   6.114   -11.438 1.00 251.91 ? 160 ALA S CA 1 
ATOM 236  C CA . TYR B 2  161 ? 39.669   7.499   -10.321 1.00 232.43 ? 161 TYR S CA 1 
ATOM 237  C CA . LYS B 2  162 ? 41.066   10.961  -9.541  1.00 251.36 ? 162 LYS S CA 1 
ATOM 238  C CA . HIS B 2  163 ? 43.107   11.555  -12.701 1.00 299.09 ? 163 HIS S CA 1 
ATOM 239  C CA . ALA B 2  164 ? 40.503   9.873   -14.927 1.00 274.83 ? 164 ALA S CA 1 
ATOM 240  C CA . ASP B 2  165 ? 37.611   12.247  -14.191 1.00 295.43 ? 165 ASP S CA 1 
ATOM 241  C CA . GLY B 2  166 ? 35.491   12.422  -17.336 1.00 252.55 ? 166 GLY S CA 1 
ATOM 242  C CA . LYS B 2  167 ? 38.520   12.693  -19.623 1.00 264.59 ? 167 LYS S CA 1 
ATOM 243  C CA . LYS B 2  168 ? 38.404   12.428  -23.421 1.00 269.47 ? 168 LYS S CA 1 
ATOM 244  C CA . ILE B 2  169 ? 39.203   9.044   -24.983 1.00 261.07 ? 169 ILE S CA 1 
ATOM 245  C CA . ASP B 2  170 ? 38.280   7.322   -28.252 1.00 223.03 ? 170 ASP S CA 1 
ATOM 246  C CA . GLY B 2  171 ? 36.501   10.543  -29.202 1.00 234.10 ? 171 GLY S CA 1 
ATOM 247  C CA . ARG B 2  172 ? 33.993   10.727  -26.341 1.00 255.42 ? 172 ARG S CA 1 
ATOM 248  C CA . ARG B 2  173 ? 34.386   11.731  -22.694 1.00 267.16 ? 173 ARG S CA 1 
ATOM 249  C CA . VAL B 2  174 ? 34.025   8.895   -20.193 1.00 233.36 ? 174 VAL S CA 1 
ATOM 250  C CA . LEU B 2  175 ? 32.843   9.185   -16.589 1.00 222.68 ? 175 LEU S CA 1 
ATOM 251  C CA . VAL B 2  176 ? 34.011   6.740   -13.911 1.00 214.48 ? 176 VAL S CA 1 
ATOM 252  C CA . ASP B 2  177 ? 32.841   5.843   -10.393 1.00 201.60 ? 177 ASP S CA 1 
ATOM 253  C CA . VAL B 2  178 ? 32.321   3.039   -7.852  1.00 223.80 ? 178 VAL S CA 1 
ATOM 254  C CA . GLU B 2  179 ? 29.494   1.306   -5.964  1.00 243.64 ? 179 GLU S CA 1 
ATOM 255  C CA . ARG B 2  180 ? 29.803   -0.283  -2.531  1.00 275.32 ? 180 ARG S CA 1 
ATOM 256  C CA . GLY B 2  181 ? 26.153   -1.045  -1.976  1.00 257.67 ? 181 GLY S CA 1 
ATOM 257  C CA . ARG B 2  182 ? 22.729   0.500   -2.434  1.00 255.02 ? 182 ARG S CA 1 
ATOM 258  C CA . THR B 2  183 ? 21.717   0.318   -6.093  1.00 205.54 ? 183 THR S CA 1 
ATOM 259  C CA . VAL C 3  5   ? -25.900  49.795  -37.977 1.00 214.31 ? 5   VAL Z CA 1 
ATOM 260  C CA . PRO C 3  6   ? -29.440  50.879  -36.959 1.00 211.53 ? 6   PRO Z CA 1 
ATOM 261  C CA . ILE C 3  7   ? -28.055  53.437  -34.499 1.00 184.53 ? 7   ILE Z CA 1 
ATOM 262  C CA . LYS C 3  8   ? -26.280  55.063  -37.445 1.00 226.21 ? 8   LYS Z CA 1 
ATOM 263  C CA . VAL C 3  9   ? -29.634  55.601  -39.165 1.00 194.14 ? 9   VAL Z CA 1 
ATOM 264  C CA . LEU C 3  10  ? -31.066  57.645  -36.291 1.00 221.89 ? 10  LEU Z CA 1 
ATOM 265  C CA . HIS C 3  11  ? -28.173  60.090  -36.690 1.00 223.51 ? 11  HIS Z CA 1 
ATOM 266  C CA . GLU C 3  12  ? -28.807  60.160  -40.436 1.00 244.97 ? 12  GLU Z CA 1 
ATOM 267  C CA . ALA C 3  13  ? -32.356  61.185  -39.514 1.00 189.68 ? 13  ALA Z CA 1 
ATOM 268  C CA . GLU C 3  14  ? -31.285  64.110  -37.317 1.00 228.33 ? 14  GLU Z CA 1 
ATOM 269  C CA . GLY C 3  15  ? -32.906  67.338  -38.458 1.00 205.17 ? 15  GLY Z CA 1 
ATOM 270  C CA . HIS C 3  16  ? -36.094  65.675  -39.689 1.00 241.55 ? 16  HIS Z CA 1 
ATOM 271  C CA . ILE C 3  17  ? -39.634  64.747  -38.648 1.00 227.45 ? 17  ILE Z CA 1 
ATOM 272  C CA . VAL C 3  18  ? -39.903  61.643  -36.444 1.00 204.47 ? 18  VAL Z CA 1 
ATOM 273  C CA . THR C 3  19  ? -42.113  60.201  -33.702 1.00 203.41 ? 19  THR Z CA 1 
ATOM 274  C CA . CYS C 3  20  ? -41.133  58.682  -30.344 1.00 227.89 ? 20  CYS Z CA 1 
ATOM 275  C CA . GLU C 3  21  ? -42.867  56.309  -27.919 1.00 210.68 ? 21  GLU Z CA 1 
ATOM 276  C CA . THR C 3  22  ? -41.684  55.960  -24.307 1.00 187.35 ? 22  THR Z CA 1 
ATOM 277  C CA . ASN C 3  23  ? -42.129  53.071  -21.865 1.00 246.65 ? 23  ASN Z CA 1 
ATOM 278  C CA . THR C 3  24  ? -44.869  55.032  -20.121 1.00 231.05 ? 24  THR Z CA 1 
ATOM 279  C CA . GLY C 3  25  ? -46.853  55.056  -23.353 1.00 204.98 ? 25  GLY Z CA 1 
ATOM 280  C CA . GLU C 3  26  ? -46.656  58.704  -24.420 1.00 221.59 ? 26  GLU Z CA 1 
ATOM 281  C CA . VAL C 3  27  ? -45.948  59.453  -28.079 1.00 197.15 ? 27  VAL Z CA 1 
ATOM 282  C CA . TYR C 3  28  ? -43.812  62.449  -29.087 1.00 200.60 ? 28  TYR Z CA 1 
ATOM 283  C CA . ARG C 3  29  ? -43.837  63.693  -32.682 1.00 253.25 ? 29  ARG Z CA 1 
ATOM 284  C CA . GLY C 3  30  ? -41.447  66.462  -33.673 1.00 237.47 ? 30  GLY Z CA 1 
ATOM 285  C CA . LYS C 3  31  ? -38.163  67.332  -35.361 1.00 218.95 ? 31  LYS Z CA 1 
ATOM 286  C CA . LEU C 3  32  ? -35.181  65.473  -33.913 1.00 223.38 ? 32  LEU Z CA 1 
ATOM 287  C CA . ILE C 3  33  ? -32.429  68.018  -33.318 1.00 226.21 ? 33  ILE Z CA 1 
ATOM 288  C CA . GLU C 3  34  ? -29.633  65.812  -31.973 1.00 228.49 ? 34  GLU Z CA 1 
ATOM 289  C CA . ALA C 3  35  ? -29.604  62.103  -31.152 1.00 196.96 ? 35  ALA Z CA 1 
ATOM 290  C CA . GLU C 3  36  ? -26.854  59.964  -29.626 1.00 247.77 ? 36  GLU Z CA 1 
ATOM 291  C CA . ASP C 3  37  ? -25.429  56.450  -29.875 1.00 234.67 ? 37  ASP Z CA 1 
ATOM 292  C CA . ASN C 3  38  ? -27.194  55.636  -26.599 1.00 218.22 ? 38  ASN Z CA 1 
ATOM 293  C CA . MET C 3  39  ? -30.614  56.706  -27.890 1.00 181.29 ? 39  MET Z CA 1 
ATOM 294  C CA . ASN C 3  40  ? -30.745  60.044  -26.066 1.00 225.06 ? 40  ASN Z CA 1 
ATOM 295  C CA . CYS C 3  41  ? -32.702  62.569  -28.105 1.00 215.26 ? 41  CYS Z CA 1 
ATOM 296  C CA . GLN C 3  42  ? -33.492  66.283  -28.078 1.00 254.72 ? 42  GLN Z CA 1 
ATOM 297  C CA . MET C 3  43  ? -36.563  67.566  -29.919 1.00 225.67 ? 43  MET Z CA 1 
ATOM 298  C CA . SER C 3  44  ? -38.515  70.756  -30.629 1.00 240.11 ? 44  SER Z CA 1 
ATOM 299  C CA . ASN C 3  45  ? -41.983  71.404  -32.066 1.00 244.00 ? 45  ASN Z CA 1 
ATOM 300  C CA . ILE C 3  46  ? -43.504  68.218  -30.673 1.00 243.34 ? 46  ILE Z CA 1 
ATOM 301  C CA . THR C 3  47  ? -46.908  66.564  -30.355 1.00 243.78 ? 47  THR Z CA 1 
ATOM 302  C CA . VAL C 3  48  ? -47.347  64.424  -27.253 1.00 217.96 ? 48  VAL Z CA 1 
ATOM 303  C CA . THR C 3  49  ? -50.377  62.169  -27.584 1.00 217.12 ? 49  THR Z CA 1 
ATOM 304  C CA . TYR C 3  50  ? -50.749  60.760  -24.072 1.00 209.12 ? 50  TYR Z CA 1 
ATOM 305  C CA . ARG C 3  51  ? -52.352  57.414  -23.268 1.00 245.63 ? 51  ARG Z CA 1 
ATOM 306  C CA . ASP C 3  52  ? -55.888  58.768  -22.909 1.00 251.08 ? 52  ASP Z CA 1 
ATOM 307  C CA . GLY C 3  53  ? -55.503  60.669  -26.167 1.00 209.53 ? 53  GLY Z CA 1 
ATOM 308  C CA . ARG C 3  54  ? -55.026  64.290  -25.132 1.00 228.64 ? 54  ARG Z CA 1 
ATOM 309  C CA . VAL C 3  55  ? -52.451  66.110  -27.259 1.00 237.81 ? 55  VAL Z CA 1 
ATOM 310  C CA . ALA C 3  56  ? -50.239  68.695  -25.558 1.00 278.26 ? 56  ALA Z CA 1 
ATOM 311  C CA . GLN C 3  57  ? -47.954  71.275  -27.179 1.00 228.23 ? 57  GLN Z CA 1 
ATOM 312  C CA . LEU C 3  58  ? -44.402  71.940  -25.955 1.00 214.11 ? 58  LEU Z CA 1 
ATOM 313  C CA . GLU C 3  59  ? -41.490  73.848  -27.489 1.00 254.67 ? 59  GLU Z CA 1 
ATOM 314  C CA . GLN C 3  60  ? -38.694  71.351  -26.897 1.00 238.19 ? 60  GLN Z CA 1 
ATOM 315  C CA . VAL C 3  61  ? -37.993  68.353  -24.683 1.00 240.47 ? 61  VAL Z CA 1 
ATOM 316  C CA . TYR C 3  62  ? -35.329  65.753  -23.954 1.00 214.38 ? 62  TYR Z CA 1 
ATOM 317  C CA . ILE C 3  63  ? -36.059  62.027  -24.060 1.00 195.17 ? 63  ILE Z CA 1 
ATOM 318  C CA . ARG C 3  64  ? -34.124  59.277  -22.277 1.00 217.30 ? 64  ARG Z CA 1 
ATOM 319  C CA . GLY C 3  65  ? -33.287  56.277  -24.449 1.00 151.83 ? 65  GLY Z CA 1 
ATOM 320  C CA . SER C 3  66  ? -33.688  53.890  -21.525 1.00 186.73 ? 66  SER Z CA 1 
ATOM 321  C CA . LYS C 3  67  ? -37.431  54.398  -21.973 1.00 204.96 ? 67  LYS Z CA 1 
ATOM 322  C CA . ILE C 3  68  ? -37.705  54.700  -25.761 1.00 161.78 ? 68  ILE Z CA 1 
ATOM 323  C CA . ARG C 3  69  ? -39.831  51.793  -26.968 1.00 192.97 ? 69  ARG Z CA 1 
ATOM 324  C CA . PHE C 3  70  ? -39.247  52.667  -30.628 1.00 201.38 ? 70  PHE Z CA 1 
ATOM 325  C CA . LEU C 3  71  ? -39.008  55.593  -33.046 1.00 187.77 ? 71  LEU Z CA 1 
ATOM 326  C CA . ILE C 3  72  ? -40.617  56.240  -36.421 1.00 193.43 ? 72  ILE Z CA 1 
ATOM 327  C CA . LEU C 3  73  ? -38.191  57.556  -39.049 1.00 236.89 ? 73  LEU Z CA 1 
ATOM 328  C CA . PRO C 3  74  ? -38.693  59.384  -42.405 1.00 219.17 ? 74  PRO Z CA 1 
ATOM 329  C CA . ASP C 3  75  ? -39.472  57.372  -45.532 1.00 234.05 ? 75  ASP Z CA 1 
ATOM 330  C CA . MET C 3  76  ? -37.074  59.368  -47.707 1.00 269.10 ? 76  MET Z CA 1 
ATOM 331  C CA . LEU C 3  77  ? -34.416  57.663  -45.581 1.00 225.57 ? 77  LEU Z CA 1 
ATOM 332  C CA . LYS C 3  78  ? -35.695  54.110  -46.093 1.00 260.26 ? 78  LYS Z CA 1 
ATOM 333  C CA . ASN C 3  79  ? -35.680  54.349  -49.880 1.00 292.08 ? 79  ASN Z CA 1 
ATOM 334  C CA . ALA C 3  80  ? -32.437  56.328  -49.740 1.00 247.89 ? 80  ALA Z CA 1 
ATOM 335  C CA . PRO C 3  81  ? -29.792  53.517  -49.735 1.00 276.62 ? 81  PRO Z CA 1 
ATOM 336  C CA . MET C 3  82  ? -27.334  54.957  -47.184 1.00 249.22 ? 82  MET Z CA 1 
ATOM 337  C CA . LEU C 3  83  ? -27.307  51.752  -45.204 1.00 244.15 ? 83  LEU Z CA 1 
ATOM 338  C CA . LYS C 3  84  ? -27.418  49.285  -48.093 1.00 228.87 ? 84  LYS Z CA 1 
ATOM 339  C CA . SER D 4  6   ? -25.009  35.214  -36.561 1.00 272.88 ? 6   SER B CA 1 
ATOM 340  C CA . SER D 4  7   ? -26.600  32.739  -38.986 1.00 279.71 ? 7   SER B CA 1 
ATOM 341  C CA . LYS D 4  8   ? -30.054  33.696  -37.695 1.00 288.72 ? 8   LYS B CA 1 
ATOM 342  C CA . MET D 4  9   ? -28.844  37.271  -37.959 1.00 300.67 ? 9   MET B CA 1 
ATOM 343  C CA . LEU D 4  10  ? -28.144  36.472  -41.611 1.00 258.00 ? 10  LEU B CA 1 
ATOM 344  C CA . GLN D 4  11  ? -31.602  35.256  -42.673 1.00 249.69 ? 11  GLN B CA 1 
ATOM 345  C CA . HIS D 4  12  ? -33.374  38.228  -41.077 1.00 350.29 ? 12  HIS B CA 1 
ATOM 346  C CA . ILE D 4  13  ? -31.937  40.535  -43.745 1.00 304.72 ? 13  ILE B CA 1 
ATOM 347  C CA . ASP D 4  14  ? -34.306  41.163  -46.660 1.00 297.18 ? 14  ASP B CA 1 
ATOM 348  C CA . TYR D 4  15  ? -37.041  39.172  -44.917 1.00 260.01 ? 15  TYR B CA 1 
ATOM 349  C CA . ARG D 4  16  ? -40.487  40.055  -43.561 1.00 237.15 ? 16  ARG B CA 1 
ATOM 350  C CA . MET D 4  17  ? -40.653  39.155  -39.863 1.00 253.88 ? 17  MET B CA 1 
ATOM 351  C CA . ARG D 4  18  ? -42.865  38.955  -36.769 1.00 202.58 ? 18  ARG B CA 1 
ATOM 352  C CA . CYS D 4  19  ? -41.328  40.568  -33.682 1.00 209.23 ? 19  CYS B CA 1 
ATOM 353  C CA . ILE D 4  20  ? -43.455  40.004  -30.575 1.00 191.21 ? 20  ILE B CA 1 
ATOM 354  C CA . LEU D 4  21  ? -42.613  42.663  -27.983 1.00 198.21 ? 21  LEU B CA 1 
ATOM 355  C CA . GLN D 4  22  ? -42.534  42.356  -24.190 1.00 212.21 ? 22  GLN B CA 1 
ATOM 356  C CA . ASP D 4  23  ? -45.631  44.556  -23.972 1.00 218.18 ? 23  ASP B CA 1 
ATOM 357  C CA . GLY D 4  24  ? -47.929  42.399  -26.091 1.00 201.75 ? 24  GLY B CA 1 
ATOM 358  C CA . ARG D 4  25  ? -47.701  44.197  -29.430 1.00 164.79 ? 25  ARG B CA 1 
ATOM 359  C CA . ILE D 4  26  ? -46.790  42.217  -32.548 1.00 170.53 ? 26  ILE B CA 1 
ATOM 360  C CA . PHE D 4  27  ? -44.414  43.760  -35.101 1.00 212.72 ? 27  PHE B CA 1 
ATOM 361  C CA . ILE D 4  28  ? -44.494  42.837  -38.790 1.00 199.77 ? 28  ILE B CA 1 
ATOM 362  C CA . GLY D 4  29  ? -42.613  44.774  -41.469 1.00 226.57 ? 29  GLY B CA 1 
ATOM 363  C CA . THR D 4  30  ? -39.760  45.000  -43.971 1.00 263.70 ? 30  THR B CA 1 
ATOM 364  C CA . PHE D 4  31  ? -36.455  44.285  -42.233 1.00 269.46 ? 31  PHE B CA 1 
ATOM 365  C CA . LYS D 4  32  ? -33.305  46.225  -43.138 1.00 271.20 ? 32  LYS B CA 1 
ATOM 366  C CA . ALA D 4  33  ? -30.619  46.151  -40.435 1.00 272.94 ? 33  ALA B CA 1 
ATOM 367  C CA . PHE D 4  34  ? -29.954  45.428  -36.749 1.00 205.83 ? 34  PHE B CA 1 
ATOM 368  C CA . ASP D 4  35  ? -27.139  45.933  -34.223 1.00 231.67 ? 35  ASP B CA 1 
ATOM 369  C CA . LYS D 4  36  ? -25.376  43.968  -31.478 1.00 213.23 ? 36  LYS B CA 1 
ATOM 370  C CA . HIS D 4  37  ? -28.033  45.459  -29.199 1.00 205.53 ? 37  HIS B CA 1 
ATOM 371  C CA . MET D 4  38  ? -30.750  43.690  -31.214 1.00 196.24 ? 38  MET B CA 1 
ATOM 372  C CA . ASN D 4  39  ? -32.483  46.961  -32.040 1.00 204.85 ? 39  ASN B CA 1 
ATOM 373  C CA . LEU D 4  40  ? -34.342  46.544  -35.326 1.00 210.91 ? 40  LEU B CA 1 
ATOM 374  C CA . ILE D 4  41  ? -34.983  48.714  -38.374 1.00 214.48 ? 41  ILE B CA 1 
ATOM 375  C CA . LEU D 4  42  ? -38.260  47.939  -40.139 1.00 224.54 ? 42  LEU B CA 1 
ATOM 376  C CA . CYS D 4  43  ? -40.005  49.794  -42.965 1.00 275.85 ? 43  CYS B CA 1 
ATOM 377  C CA . ASP D 4  44  ? -43.715  49.728  -43.820 1.00 268.18 ? 44  ASP B CA 1 
ATOM 378  C CA . CYS D 4  45  ? -44.170  47.699  -40.630 1.00 283.75 ? 45  CYS B CA 1 
ATOM 379  C CA . ASP D 4  46  ? -47.574  47.489  -38.965 1.00 270.87 ? 46  ASP B CA 1 
ATOM 380  C CA . GLU D 4  47  ? -48.450  47.163  -35.272 1.00 212.89 ? 47  GLU B CA 1 
ATOM 381  C CA . PHE D 4  48  ? -51.124  44.571  -34.542 1.00 211.87 ? 48  PHE B CA 1 
ATOM 382  C CA . ARG D 4  49  ? -54.446  44.562  -32.714 1.00 250.96 ? 49  ARG B CA 1 
ATOM 383  C CA . LYS D 4  50  ? -56.693  42.222  -34.705 1.00 318.12 ? 50  LYS B CA 1 
ATOM 384  C CA . ILE D 4  51  ? -60.477  42.122  -34.415 1.00 341.71 ? 51  ILE B CA 1 
ATOM 385  C CA . LYS D 4  52  ? -60.318  40.296  -31.077 1.00 298.22 ? 52  LYS B CA 1 
ATOM 386  C CA . PRO D 4  53  ? -63.507  38.597  -29.660 1.00 320.87 ? 53  PRO B CA 1 
ATOM 387  C CA . LYS D 4  54  ? -66.950  40.136  -30.102 1.00 288.23 ? 54  LYS B CA 1 
ATOM 388  C CA . ASN D 4  55  ? -67.501  43.835  -29.377 1.00 343.19 ? 55  ASN B CA 1 
ATOM 389  C CA . SER D 4  56  ? -66.250  47.226  -28.228 1.00 288.89 ? 56  SER B CA 1 
ATOM 390  C CA . LYS D 4  57  ? -68.574  49.548  -26.309 1.00 265.15 ? 57  LYS B CA 1 
ATOM 391  C CA . GLN D 4  58  ? -68.359  53.070  -24.818 1.00 292.06 ? 58  GLN B CA 1 
ATOM 392  C CA . ALA D 4  59  ? -66.901  54.554  -28.013 1.00 303.62 ? 59  ALA B CA 1 
ATOM 393  C CA . GLU D 4  60  ? -63.150  53.994  -27.582 1.00 307.01 ? 60  GLU B CA 1 
ATOM 394  C CA . ARG D 4  61  ? -60.922  53.920  -30.677 1.00 321.98 ? 61  ARG B CA 1 
ATOM 395  C CA . GLU D 4  62  ? -57.585  52.192  -31.306 1.00 338.44 ? 62  GLU B CA 1 
ATOM 396  C CA . GLU D 4  63  ? -54.542  53.530  -33.171 1.00 331.95 ? 63  GLU B CA 1 
ATOM 397  C CA . LYS D 4  64  ? -54.051  52.460  -36.797 1.00 275.24 ? 64  LYS B CA 1 
ATOM 398  C CA . ARG D 4  65  ? -51.865  49.445  -37.572 1.00 255.09 ? 65  ARG B CA 1 
ATOM 399  C CA . VAL D 4  66  ? -49.773  50.978  -40.375 1.00 215.49 ? 66  VAL B CA 1 
ATOM 400  C CA . LEU D 4  67  ? -46.495  52.530  -39.143 1.00 227.91 ? 67  LEU B CA 1 
ATOM 401  C CA . GLY D 4  68  ? -43.790  52.610  -41.810 1.00 232.66 ? 68  GLY B CA 1 
ATOM 402  C CA . LEU D 4  69  ? -40.162  52.844  -40.698 1.00 216.99 ? 69  LEU B CA 1 
ATOM 403  C CA . VAL D 4  70  ? -39.792  51.788  -37.068 1.00 255.45 ? 70  VAL B CA 1 
ATOM 404  C CA . LEU D 4  71  ? -36.583  51.798  -35.043 1.00 201.57 ? 71  LEU B CA 1 
ATOM 405  C CA . LEU D 4  72  ? -37.338  49.127  -32.456 1.00 211.27 ? 72  LEU B CA 1 
ATOM 406  C CA . ARG D 4  73  ? -35.125  49.290  -29.376 1.00 215.23 ? 73  ARG B CA 1 
ATOM 407  C CA . GLY D 4  74  ? -33.911  45.875  -28.246 1.00 182.81 ? 74  GLY B CA 1 
ATOM 408  C CA . GLU D 4  75  ? -34.824  46.337  -24.580 1.00 219.84 ? 75  GLU B CA 1 
ATOM 409  C CA . ASN D 4  76  ? -38.448  46.254  -25.810 1.00 226.48 ? 76  ASN B CA 1 
ATOM 410  C CA . LEU D 4  77  ? -38.193  43.151  -28.044 1.00 164.46 ? 77  LEU B CA 1 
ATOM 411  C CA . VAL D 4  78  ? -38.554  39.434  -27.255 1.00 159.51 ? 78  VAL B CA 1 
ATOM 412  C CA . SER D 4  79  ? -39.168  37.490  -30.506 1.00 179.49 ? 79  SER B CA 1 
ATOM 413  C CA . MET D 4  80  ? -38.646  37.189  -34.281 1.00 212.66 ? 80  MET B CA 1 
ATOM 414  C CA . THR D 4  81  ? -40.194  34.770  -36.801 1.00 225.65 ? 81  THR B CA 1 
ATOM 415  C CA . VAL D 4  82  ? -40.422  34.575  -40.603 1.00 267.15 ? 82  VAL B CA 1 
ATOM 416  C CA . GLU D 4  83  ? -43.499  35.870  -42.436 1.00 249.85 ? 83  GLU B CA 1 
ATOM 417  C CA . GLY D 4  84  ? -42.205  35.439  -45.980 1.00 261.74 ? 84  GLY B CA 1 
ATOM 418  C CA . PRO D 4  85  ? -39.853  36.650  -48.797 1.00 257.60 ? 85  PRO B CA 1 
ATOM 419  C CA . PRO D 4  86  ? -39.265  40.270  -49.918 1.00 276.03 ? 86  PRO B CA 1 
ATOM 420  C CA . MET E 5  1   ? -17.108  30.937  -15.268 1.00 229.67 ? 1   MET X CA 1 
ATOM 421  C CA . LYS E 5  2   ? -19.508  31.883  -18.043 1.00 237.46 ? 2   LYS X CA 1 
ATOM 422  C CA . LEU E 5  3   ? -21.522  28.664  -18.265 1.00 194.67 ? 3   LEU X CA 1 
ATOM 423  C CA . VAL E 5  4   ? -23.658  30.175  -21.008 1.00 184.16 ? 4   VAL X CA 1 
ATOM 424  C CA . ARG E 5  5   ? -21.356  28.222  -23.332 1.00 219.83 ? 5   ARG X CA 1 
ATOM 425  C CA . PHE E 5  6   ? -22.936  25.102  -21.840 1.00 224.40 ? 6   PHE X CA 1 
ATOM 426  C CA . LEU E 5  7   ? -26.155  26.072  -23.615 1.00 221.61 ? 7   LEU X CA 1 
ATOM 427  C CA . MET E 5  8   ? -24.291  27.004  -26.808 1.00 229.07 ? 8   MET X CA 1 
ATOM 428  C CA . LYS E 5  9   ? -22.911  23.475  -27.076 1.00 230.64 ? 9   LYS X CA 1 
ATOM 429  C CA . LEU E 5  10  ? -26.475  22.155  -26.747 1.00 216.58 ? 10  LEU X CA 1 
ATOM 430  C CA . SER E 5  11  ? -27.347  23.002  -30.360 1.00 191.99 ? 11  SER X CA 1 
ATOM 431  C CA . HIS E 5  12  ? -29.364  20.380  -32.264 1.00 239.72 ? 12  HIS X CA 1 
ATOM 432  C CA . GLU E 5  13  ? -31.010  19.275  -29.003 1.00 229.02 ? 13  GLU X CA 1 
ATOM 433  C CA . THR E 5  14  ? -34.687  19.321  -28.011 1.00 246.82 ? 14  THR X CA 1 
ATOM 434  C CA . VAL E 5  15  ? -35.413  21.888  -25.293 1.00 205.08 ? 15  VAL X CA 1 
ATOM 435  C CA . THR E 5  16  ? -38.344  23.316  -23.337 1.00 196.53 ? 16  THR X CA 1 
ATOM 436  C CA . ILE E 5  17  ? -37.593  27.047  -23.126 1.00 165.28 ? 17  ILE X CA 1 
ATOM 437  C CA . GLU E 5  18  ? -39.620  29.627  -21.206 1.00 179.34 ? 18  GLU X CA 1 
ATOM 438  C CA . LEU E 5  19  ? -39.456  33.426  -21.161 1.00 180.04 ? 19  LEU X CA 1 
ATOM 439  C CA . LYS E 5  20  ? -40.110  35.565  -18.089 1.00 218.90 ? 20  LYS X CA 1 
ATOM 440  C CA . ASN E 5  21  ? -43.508  35.700  -19.750 1.00 231.72 ? 21  ASN X CA 1 
ATOM 441  C CA . GLY E 5  22  ? -45.862  32.760  -20.029 1.00 169.30 ? 22  GLY X CA 1 
ATOM 442  C CA . THR E 5  23  ? -44.546  32.418  -23.558 1.00 170.06 ? 23  THR X CA 1 
ATOM 443  C CA . GLN E 5  24  ? -43.367  28.816  -23.293 1.00 204.95 ? 24  GLN X CA 1 
ATOM 444  C CA . VAL E 5  25  ? -41.495  27.412  -26.309 1.00 184.28 ? 25  VAL X CA 1 
ATOM 445  C CA . HIS E 5  26  ? -40.641  23.818  -27.260 1.00 209.63 ? 26  HIS X CA 1 
ATOM 446  C CA . GLY E 5  27  ? -38.165  22.831  -29.953 1.00 221.69 ? 27  GLY X CA 1 
ATOM 447  C CA . THR E 5  28  ? -34.638  21.983  -31.061 1.00 217.96 ? 28  THR X CA 1 
ATOM 448  C CA . ILE E 5  29  ? -31.899  24.596  -30.663 1.00 202.28 ? 29  ILE X CA 1 
ATOM 449  C CA . THR E 5  30  ? -30.095  26.010  -33.696 1.00 228.44 ? 30  THR X CA 1 
ATOM 450  C CA . GLY E 5  31  ? -27.776  28.570  -32.158 1.00 249.57 ? 31  GLY X CA 1 
ATOM 451  C CA . VAL E 5  32  ? -27.137  30.381  -28.889 1.00 208.25 ? 32  VAL X CA 1 
ATOM 452  C CA . ASP E 5  33  ? -24.748  33.311  -28.616 1.00 233.52 ? 33  ASP X CA 1 
ATOM 453  C CA . VAL E 5  34  ? -22.859  34.219  -25.450 1.00 250.78 ? 34  VAL X CA 1 
ATOM 454  C CA . SER E 5  35  ? -25.977  36.334  -24.869 1.00 210.34 ? 35  SER X CA 1 
ATOM 455  C CA . MET E 5  36  ? -28.491  33.485  -24.400 1.00 236.40 ? 36  MET X CA 1 
ATOM 456  C CA . ASN E 5  37  ? -30.451  34.670  -27.448 1.00 225.01 ? 37  ASN X CA 1 
ATOM 457  C CA . THR E 5  38  ? -31.847  31.306  -28.536 1.00 220.16 ? 38  THR X CA 1 
ATOM 458  C CA . HIS E 5  39  ? -33.089  30.254  -31.965 1.00 223.90 ? 39  HIS X CA 1 
ATOM 459  C CA . LEU E 5  40  ? -34.916  26.968  -32.578 1.00 199.68 ? 40  LEU X CA 1 
ATOM 460  C CA . LYS E 5  41  ? -36.310  24.798  -35.381 1.00 225.95 ? 41  LYS X CA 1 
ATOM 461  C CA . ALA E 5  42  ? -39.464  22.643  -35.204 1.00 245.35 ? 42  ALA X CA 1 
ATOM 462  C CA . VAL E 5  43  ? -41.013  25.232  -32.893 1.00 228.49 ? 43  VAL X CA 1 
ATOM 463  C CA . LYS E 5  44  ? -44.258  25.126  -30.920 1.00 201.03 ? 44  LYS X CA 1 
ATOM 464  C CA . MET E 5  45  ? -44.625  28.636  -29.499 1.00 227.69 ? 45  MET X CA 1 
ATOM 465  C CA . THR E 5  46  ? -47.272  28.614  -26.786 1.00 196.76 ? 46  THR X CA 1 
ATOM 466  C CA . LEU E 5  47  ? -47.960  32.200  -25.701 1.00 152.81 ? 47  LEU X CA 1 
ATOM 467  C CA . LYS E 5  48  ? -49.818  32.647  -22.415 1.00 237.14 ? 48  LYS X CA 1 
ATOM 468  C CA . ASN E 5  49  ? -53.565  32.079  -22.838 1.00 256.27 ? 49  ASN X CA 1 
ATOM 469  C CA . ARG E 5  50  ? -53.324  31.098  -26.503 1.00 219.24 ? 50  ARG X CA 1 
ATOM 470  C CA . GLU E 5  51  ? -53.360  28.248  -29.013 1.00 233.49 ? 51  GLU X CA 1 
ATOM 471  C CA . PRO E 5  52  ? -50.133  26.263  -29.537 1.00 231.72 ? 52  PRO X CA 1 
ATOM 472  C CA . VAL E 5  53  ? -48.757  27.936  -32.670 1.00 223.87 ? 53  VAL X CA 1 
ATOM 473  C CA . GLN E 5  54  ? -46.422  25.967  -34.941 1.00 203.43 ? 54  GLN X CA 1 
ATOM 474  C CA . LEU E 5  55  ? -43.296  27.647  -36.327 1.00 229.02 ? 55  LEU X CA 1 
ATOM 475  C CA . GLU E 5  56  ? -40.176  26.648  -38.265 1.00 232.63 ? 56  GLU X CA 1 
ATOM 476  C CA . THR E 5  57  ? -37.703  29.289  -37.116 1.00 211.15 ? 57  THR X CA 1 
ATOM 477  C CA . LEU E 5  58  ? -37.968  31.248  -33.881 1.00 187.11 ? 58  LEU X CA 1 
ATOM 478  C CA . SER E 5  59  ? -35.676  33.896  -32.448 1.00 219.21 ? 59  SER X CA 1 
ATOM 479  C CA . ILE E 5  60  ? -35.888  34.502  -28.711 1.00 196.60 ? 60  ILE X CA 1 
ATOM 480  C CA . ARG E 5  61  ? -33.859  37.112  -26.870 1.00 190.51 ? 61  ARG X CA 1 
ATOM 481  C CA . GLY E 5  62  ? -32.055  35.865  -23.779 1.00 222.40 ? 62  GLY X CA 1 
ATOM 482  C CA . ASN E 5  63  ? -32.429  39.005  -21.677 1.00 252.86 ? 63  ASN X CA 1 
ATOM 483  C CA . ASN E 5  64  ? -36.068  37.943  -21.316 1.00 219.55 ? 64  ASN X CA 1 
ATOM 484  C CA . ILE E 5  65  ? -35.578  34.204  -20.745 1.00 154.93 ? 65  ILE X CA 1 
ATOM 485  C CA . ARG E 5  66  ? -36.520  32.568  -17.440 1.00 193.53 ? 66  ARG X CA 1 
ATOM 486  C CA . TYR E 5  67  ? -34.996  29.089  -17.848 1.00 176.94 ? 67  TYR X CA 1 
ATOM 487  C CA . PHE E 5  68  ? -34.736  26.024  -20.107 1.00 169.98 ? 68  PHE X CA 1 
ATOM 488  C CA . ILE E 5  69  ? -35.723  22.416  -19.441 1.00 172.26 ? 69  ILE X CA 1 
ATOM 489  C CA . LEU E 5  70  ? -33.321  19.843  -20.894 1.00 215.90 ? 70  LEU X CA 1 
ATOM 490  C CA . PRO E 5  71  ? -34.201  16.199  -21.699 1.00 224.60 ? 71  PRO X CA 1 
ATOM 491  C CA . ASP E 5  72  ? -33.353  13.519  -19.125 1.00 243.76 ? 72  ASP X CA 1 
ATOM 492  C CA . SER E 5  73  ? -30.999  11.825  -21.592 1.00 237.65 ? 73  SER X CA 1 
ATOM 493  C CA . LEU E 5  74  ? -28.589  14.775  -21.700 1.00 229.96 ? 74  LEU X CA 1 
ATOM 494  C CA . PRO E 5  75  ? -25.121  13.972  -20.347 1.00 243.09 ? 75  PRO X CA 1 
ATOM 495  C CA . LEU E 5  76  ? -24.205  16.716  -17.885 1.00 238.87 ? 76  LEU X CA 1 
ATOM 496  C CA . ASP E 5  77  ? -21.011  15.131  -16.613 1.00 258.85 ? 77  ASP X CA 1 
ATOM 497  C CA . THR E 5  78  ? -19.636  15.367  -20.148 1.00 241.98 ? 78  THR X CA 1 
ATOM 498  C CA . LEU E 5  79  ? -21.112  18.816  -20.796 1.00 253.00 ? 79  LEU X CA 1 
ATOM 499  C CA . LEU E 5  80  ? -20.073  20.467  -17.538 1.00 219.23 ? 80  LEU X CA 1 
ATOM 500  C CA . VAL E 5  81  ? -16.630  18.863  -17.839 1.00 271.40 ? 81  VAL X CA 1 
ATOM 501  C CA . ASP E 5  82  ? -16.513  20.188  -21.402 1.00 308.11 ? 82  ASP X CA 1 
ATOM 502  C CA . VAL E 5  83  ? -17.411  23.827  -20.751 1.00 332.04 ? 83  VAL X CA 1 
ATOM 503  C CA . GLU E 5  84  ? -14.699  24.028  -18.068 1.00 360.17 ? 84  GLU X CA 1 
ATOM 504  C CA . PRO E 5  85  ? -11.847  23.767  -20.595 1.00 363.13 ? 85  PRO X CA 1 
ATOM 505  C CA . SER F 6  2   ? -5.248   40.206  -1.308  1.00 285.13 ? 2   SER Y CA 1 
ATOM 506  C CA . LEU F 6  3   ? -7.816   39.061  -3.881  1.00 282.26 ? 3   LEU Y CA 1 
ATOM 507  C CA . LEU F 6  4   ? -9.088   42.661  -3.897  1.00 268.93 ? 4   LEU Y CA 1 
ATOM 508  C CA . ASN F 6  5   ? -8.088   45.416  -6.412  1.00 302.37 ? 5   ASN Y CA 1 
ATOM 509  C CA . LYS F 6  6   ? -10.435  46.136  -9.309  1.00 316.53 ? 6   LYS Y CA 1 
ATOM 510  C CA . PRO F 6  7   ? -11.082  46.411  -12.048 1.00 299.74 ? 7   PRO Y CA 1 
ATOM 511  C CA . LYS F 6  8   ? -9.766   43.113  -13.465 1.00 321.69 ? 8   LYS Y CA 1 
ATOM 512  C CA . SER F 6  9   ? -6.964   44.750  -15.477 1.00 254.50 ? 9   SER Y CA 1 
ATOM 513  C CA . GLU F 6  10  ? -4.085   44.655  -13.038 1.00 289.38 ? 10  GLU Y CA 1 
ATOM 514  C CA . MET F 6  11  ? -5.499   41.153  -12.588 1.00 286.03 ? 11  MET Y CA 1 
ATOM 515  C CA . THR F 6  12  ? -4.853   39.665  -16.055 1.00 255.84 ? 12  THR Y CA 1 
ATOM 516  C CA . PRO F 6  13  ? -5.898   36.023  -16.657 1.00 254.81 ? 13  PRO Y CA 1 
ATOM 517  C CA . GLU F 6  14  ? -3.805   34.932  -13.665 1.00 298.75 ? 14  GLU Y CA 1 
ATOM 518  C CA . GLU F 6  15  ? -5.532   36.933  -10.923 1.00 274.70 ? 15  GLU Y CA 1 
ATOM 519  C CA . LEU F 6  16  ? -8.774   35.729  -12.498 1.00 240.07 ? 16  LEU Y CA 1 
ATOM 520  C CA . GLN F 6  17  ? -8.148   32.592  -10.457 1.00 261.40 ? 17  GLN Y CA 1 
ATOM 521  C CA . LYS F 6  18  ? -7.916   35.004  -7.540  1.00 294.31 ? 18  LYS Y CA 1 
ATOM 522  C CA . ARG F 6  19  ? -11.475  36.030  -8.380  1.00 240.62 ? 19  ARG Y CA 1 
ATOM 523  C CA . GLU F 6  20  ? -12.260  32.319  -8.308  1.00 240.48 ? 20  GLU Y CA 1 
ATOM 524  C CA . GLU F 6  21  ? -10.700  32.147  -4.841  1.00 258.14 ? 21  GLU Y CA 1 
ATOM 525  C CA . GLU F 6  22  ? -13.181  34.836  -3.867  1.00 207.41 ? 22  GLU Y CA 1 
ATOM 526  C CA . GLU F 6  23  ? -15.937  32.626  -5.249  1.00 210.80 ? 23  GLU Y CA 1 
ATOM 527  C CA . PHE F 6  24  ? -14.458  29.937  -3.006  1.00 253.38 ? 24  PHE Y CA 1 
ATOM 528  C CA . ASN F 6  25  ? -15.093  32.156  0.011   1.00 237.57 ? 25  ASN Y CA 1 
ATOM 529  C CA . THR F 6  26  ? -17.419  35.028  -0.924  1.00 297.32 ? 26  THR Y CA 1 
ATOM 530  C CA . GLY F 6  27  ? -21.122  35.094  -0.151  1.00 186.36 ? 27  GLY Y CA 1 
ATOM 531  C CA . PRO F 6  28  ? -21.808  33.114  -3.358  1.00 204.38 ? 28  PRO Y CA 1 
ATOM 532  C CA . LEU F 6  29  ? -19.449  30.433  -2.021  1.00 243.38 ? 29  LEU Y CA 1 
ATOM 533  C CA . SER F 6  30  ? -22.660  29.074  -0.539  1.00 197.27 ? 30  SER Y CA 1 
ATOM 534  C CA . VAL F 6  31  ? -23.707  27.628  -3.890  1.00 215.34 ? 31  VAL Y CA 1 
ATOM 535  C CA . LEU F 6  32  ? -20.222  26.108  -4.266  1.00 203.05 ? 32  LEU Y CA 1 
ATOM 536  C CA . THR F 6  33  ? -19.960  24.129  -1.020  1.00 235.61 ? 33  THR Y CA 1 
ATOM 537  C CA . GLN F 6  34  ? -23.709  23.544  -0.895  1.00 247.48 ? 34  GLN Y CA 1 
ATOM 538  C CA . SER F 6  35  ? -23.985  22.251  -4.464  1.00 234.33 ? 35  SER Y CA 1 
ATOM 539  C CA . VAL F 6  36  ? -20.926  21.473  -6.593  1.00 250.74 ? 36  VAL Y CA 1 
ATOM 540  C CA . LYS F 6  37  ? -18.867  20.258  -3.623  1.00 241.69 ? 37  LYS Y CA 1 
ATOM 541  C CA . ASN F 6  38  ? -21.759  18.856  -1.593  1.00 220.76 ? 38  ASN Y CA 1 
ATOM 542  C CA . ASN F 6  39  ? -24.840  17.966  -3.637  1.00 244.48 ? 39  ASN Y CA 1 
ATOM 543  C CA . THR F 6  40  ? -27.179  18.833  -0.753  1.00 242.00 ? 40  THR Y CA 1 
ATOM 544  C CA . GLN F 6  41  ? -30.698  20.150  -1.483  1.00 269.30 ? 41  GLN Y CA 1 
ATOM 545  C CA . VAL F 6  42  ? -31.533  23.820  -2.052  1.00 197.14 ? 42  VAL Y CA 1 
ATOM 546  C CA . LEU F 6  43  ? -34.556  26.148  -2.268  1.00 197.07 ? 43  LEU Y CA 1 
ATOM 547  C CA . ILE F 6  44  ? -34.561  28.809  -4.991  1.00 155.59 ? 44  ILE Y CA 1 
ATOM 548  C CA . ASN F 6  45  ? -36.931  31.783  -5.003  1.00 177.76 ? 45  ASN Y CA 1 
ATOM 549  C CA . CYS F 6  46  ? -36.996  33.318  -8.487  1.00 180.72 ? 46  CYS Y CA 1 
ATOM 550  C CA . ARG F 6  47  ? -40.372  34.287  -9.929  1.00 234.07 ? 47  ARG Y CA 1 
ATOM 551  C CA . ASN F 6  48  ? -42.330  36.770  -7.848  1.00 284.73 ? 48  ASN Y CA 1 
ATOM 552  C CA . ASN F 6  49  ? -44.456  33.813  -6.740  1.00 243.74 ? 49  ASN Y CA 1 
ATOM 553  C CA . LYS F 6  50  ? -42.859  30.442  -7.575  1.00 203.32 ? 50  LYS Y CA 1 
ATOM 554  C CA . LYS F 6  51  ? -39.941  28.680  -5.895  1.00 200.14 ? 51  LYS Y CA 1 
ATOM 555  C CA . LEU F 6  52  ? -37.785  25.626  -6.623  1.00 187.65 ? 52  LEU Y CA 1 
ATOM 556  C CA . LEU F 6  53  ? -36.251  22.693  -4.748  1.00 214.16 ? 53  LEU Y CA 1 
ATOM 557  C CA . GLY F 6  54  ? -33.507  20.416  -6.048  1.00 235.55 ? 54  GLY Y CA 1 
ATOM 558  C CA . ARG F 6  55  ? -29.825  19.520  -6.260  1.00 265.38 ? 55  ARG Y CA 1 
ATOM 559  C CA . VAL F 6  56  ? -27.602  21.964  -8.140  1.00 199.75 ? 56  VAL Y CA 1 
ATOM 560  C CA . LYS F 6  57  ? -24.951  20.347  -10.339 1.00 205.01 ? 57  LYS Y CA 1 
ATOM 561  C CA . ALA F 6  58  ? -22.980  23.465  -11.276 1.00 188.45 ? 58  ALA Y CA 1 
ATOM 562  C CA . PHE F 6  59  ? -23.332  27.259  -11.257 1.00 185.93 ? 59  PHE Y CA 1 
ATOM 563  C CA . ASP F 6  60  ? -21.639  30.538  -12.189 1.00 208.58 ? 60  ASP Y CA 1 
ATOM 564  C CA . ARG F 6  61  ? -21.376  34.238  -11.317 1.00 192.15 ? 61  ARG Y CA 1 
ATOM 565  C CA . HIS F 6  62  ? -24.798  35.108  -12.743 1.00 194.29 ? 62  HIS Y CA 1 
ATOM 566  C CA . CYS F 6  63  ? -26.458  32.424  -10.587 1.00 169.63 ? 63  CYS Y CA 1 
ATOM 567  C CA . ASN F 6  64  ? -27.741  30.427  -13.536 1.00 206.10 ? 64  ASN Y CA 1 
ATOM 568  C CA . MET F 6  65  ? -27.152  26.831  -12.566 1.00 169.66 ? 65  MET Y CA 1 
ATOM 569  C CA . VAL F 6  66  ? -28.005  23.366  -13.834 1.00 196.54 ? 66  VAL Y CA 1 
ATOM 570  C CA . LEU F 6  67  ? -30.405  21.589  -11.495 1.00 169.03 ? 67  LEU Y CA 1 
ATOM 571  C CA . GLU F 6  68  ? -31.634  18.081  -10.680 1.00 250.72 ? 68  GLU Y CA 1 
ATOM 572  C CA . ASN F 6  69  ? -34.993  16.816  -9.399  1.00 241.63 ? 69  ASN Y CA 1 
ATOM 573  C CA . VAL F 6  70  ? -36.611  20.247  -9.063  1.00 203.92 ? 70  VAL Y CA 1 
ATOM 574  C CA . LYS F 6  71  ? -40.104  20.524  -7.543  1.00 239.09 ? 71  LYS Y CA 1 
ATOM 575  C CA . GLU F 6  72  ? -42.590  23.343  -8.075  1.00 215.52 ? 72  GLU Y CA 1 
ATOM 576  C CA . MET F 6  73  ? -45.525  23.846  -5.700  1.00 266.11 ? 73  MET Y CA 1 
ATOM 577  C CA . TRP F 6  74  ? -47.605  26.794  -6.721  1.00 248.17 ? 74  TRP Y CA 1 
ATOM 578  C CA . THR F 6  75  ? -48.969  29.467  -4.362  1.00 286.98 ? 75  THR Y CA 1 
ATOM 579  C CA . GLU F 6  76  ? -52.231  29.808  -6.300  1.00 232.95 ? 76  GLU Y CA 1 
ATOM 580  C CA . VAL F 6  77  ? -55.310  31.555  -5.025  1.00 244.28 ? 77  VAL Y CA 1 
ATOM 581  C CA . PRO F 6  78  ? -57.835  28.996  -3.970  1.00 239.06 ? 78  PRO Y CA 1 
ATOM 582  C CA . LYS F 6  79  ? -61.388  29.738  -5.027  1.00 221.56 ? 79  LYS Y CA 1 
ATOM 583  C CA . SER F 6  80  ? -63.291  27.050  -3.124  1.00 298.83 ? 80  SER Y CA 1 
ATOM 584  C CA . GLY F 6  81  ? -64.835  24.604  -5.566  1.00 441.82 ? 81  GLY Y CA 1 
ATOM 585  C CA . LYS F 6  82  ? -67.518  21.925  -5.782  1.00 490.36 ? 82  LYS Y CA 1 
ATOM 586  C CA . GLY F 6  83  ? -67.082  18.685  -7.687  0.00 534.46 ? 83  GLY Y CA 1 
ATOM 587  C CA . LYS F 6  84  ? -64.455  15.931  -7.482  0.00 543.58 ? 84  LYS Y CA 1 
ATOM 588  C CA . LYS F 6  85  ? -61.878  15.233  -4.768  0.00 537.97 ? 85  LYS Y CA 1 
ATOM 589  C CA . LYS F 6  86  ? -59.376  17.971  -5.637  0.00 522.93 ? 86  LYS Y CA 1 
ATOM 590  C CA . SER F 6  87  ? -58.404  20.132  -2.635  0.00 496.07 ? 87  SER Y CA 1 
ATOM 591  C CA . LYS F 6  88  ? -59.784  23.503  -1.522  0.00 452.31 ? 88  LYS Y CA 1 
ATOM 592  C CA . PRO F 6  89  ? -56.371  25.229  -1.638  0.00 396.19 ? 89  PRO Y CA 1 
ATOM 593  C CA . VAL F 6  90  ? -54.038  25.452  -4.640  1.00 307.96 ? 90  VAL Y CA 1 
ATOM 594  C CA . ASN F 6  91  ? -50.540  23.950  -4.516  1.00 256.17 ? 91  ASN Y CA 1 
ATOM 595  C CA . LYS F 6  92  ? -50.056  22.277  -7.907  1.00 236.60 ? 92  LYS Y CA 1 
ATOM 596  C CA . ASP F 6  93  ? -46.811  20.370  -8.453  1.00 228.66 ? 93  ASP Y CA 1 
ATOM 597  C CA . ARG F 6  94  ? -44.139  20.272  -11.155 1.00 223.00 ? 94  ARG Y CA 1 
ATOM 598  C CA . TYR F 6  95  ? -41.496  17.527  -11.426 1.00 254.30 ? 95  TYR Y CA 1 
ATOM 599  C CA . ILE F 6  96  ? -38.284  18.089  -13.377 1.00 200.98 ? 96  ILE Y CA 1 
ATOM 600  C CA . SER F 6  97  ? -35.362  15.664  -13.626 1.00 215.30 ? 97  SER Y CA 1 
ATOM 601  C CA . LYS F 6  98  ? -32.953  18.136  -15.214 1.00 229.19 ? 98  LYS Y CA 1 
ATOM 602  C CA . MET F 6  99  ? -33.143  21.773  -16.304 1.00 182.46 ? 99  MET Y CA 1 
ATOM 603  C CA . PHE F 6  100 ? -31.068  24.940  -16.755 1.00 196.56 ? 100 PHE Y CA 1 
ATOM 604  C CA . LEU F 6  101 ? -32.070  28.050  -14.796 1.00 155.78 ? 101 LEU Y CA 1 
ATOM 605  C CA . ARG F 6  102 ? -31.520  31.756  -15.490 1.00 197.38 ? 102 ARG Y CA 1 
ATOM 606  C CA . GLY F 6  103 ? -30.042  34.138  -12.908 1.00 173.47 ? 103 GLY Y CA 1 
ATOM 607  C CA . ASP F 6  104 ? -31.769  37.498  -13.381 1.00 233.33 ? 104 ASP Y CA 1 
ATOM 608  C CA . SER F 6  105 ? -34.636  35.705  -11.616 1.00 203.93 ? 105 SER Y CA 1 
ATOM 609  C CA . VAL F 6  106 ? -33.186  34.106  -8.468  1.00 184.81 ? 106 VAL Y CA 1 
ATOM 610  C CA . ILE F 6  107 ? -33.323  36.366  -5.436  1.00 172.28 ? 107 ILE Y CA 1 
ATOM 611  C CA . VAL F 6  108 ? -32.827  33.803  -2.668  1.00 152.22 ? 108 VAL Y CA 1 
ATOM 612  C CA . VAL F 6  109 ? -31.190  30.407  -2.176  1.00 149.50 ? 109 VAL Y CA 1 
ATOM 613  C CA . LEU F 6  110 ? -31.315  28.088  0.823   1.00 175.57 ? 110 LEU Y CA 1 
ATOM 614  C CA . ARG F 6  111 ? -29.694  24.815  1.841   1.00 205.58 ? 111 ARG Y CA 1 
ATOM 615  C CA . ASN F 6  112 ? -30.806  22.632  4.732   1.00 177.73 ? 112 ASN Y CA 1 
ATOM 616  C CA . SER G 7  2   ? -17.762  60.174  14.329  1.00 259.87 ? 2   SER F CA 1 
ATOM 617  C CA . LEU G 7  3   ? -15.825  59.632  11.102  1.00 264.26 ? 3   LEU F CA 1 
ATOM 618  C CA . PRO G 7  4   ? -17.704  59.168  7.809   1.00 258.17 ? 4   PRO F CA 1 
ATOM 619  C CA . LEU G 7  5   ? -18.028  55.436  7.190   1.00 271.45 ? 5   LEU F CA 1 
ATOM 620  C CA . ASN G 7  6   ? -18.859  54.251  3.666   1.00 274.50 ? 6   ASN F CA 1 
ATOM 621  C CA . PRO G 7  7   ? -21.337  51.375  3.375   1.00 261.11 ? 7   PRO F CA 1 
ATOM 622  C CA . LYS G 7  8   ? -18.625  49.057  2.031   1.00 207.77 ? 8   LYS F CA 1 
ATOM 623  C CA . PRO G 7  9   ? -16.738  49.268  5.363   1.00 246.90 ? 9   PRO F CA 1 
ATOM 624  C CA . PHE G 7  10  ? -19.870  49.303  7.527   1.00 236.69 ? 10  PHE F CA 1 
ATOM 625  C CA . LEU G 7  11  ? -20.881  46.056  5.828   1.00 213.73 ? 11  LEU F CA 1 
ATOM 626  C CA . ASN G 7  12  ? -17.376  44.663  6.312   1.00 217.32 ? 12  ASN F CA 1 
ATOM 627  C CA . GLY G 7  13  ? -17.537  45.569  9.989   1.00 243.16 ? 13  GLY F CA 1 
ATOM 628  C CA . LEU G 7  14  ? -20.984  43.977  10.238  1.00 209.04 ? 14  LEU F CA 1 
ATOM 629  C CA . THR G 7  15  ? -19.908  40.448  9.303   1.00 196.94 ? 15  THR F CA 1 
ATOM 630  C CA . GLY G 7  16  ? -20.099  38.015  12.200  1.00 202.24 ? 16  GLY F CA 1 
ATOM 631  C CA . LYS G 7  17  ? -22.934  40.081  13.653  1.00 203.76 ? 17  LYS F CA 1 
ATOM 632  C CA . PRO G 7  18  ? -26.658  39.337  13.223  1.00 191.29 ? 18  PRO F CA 1 
ATOM 633  C CA . VAL G 7  19  ? -28.380  41.898  11.004  1.00 196.33 ? 19  VAL F CA 1 
ATOM 634  C CA . MET G 7  20  ? -31.692  42.477  9.254   1.00 233.83 ? 20  MET F CA 1 
ATOM 635  C CA . VAL G 7  21  ? -31.906  42.404  5.457   1.00 189.84 ? 21  VAL F CA 1 
ATOM 636  C CA . LYS G 7  22  ? -34.836  44.351  4.021   1.00 194.47 ? 22  LYS F CA 1 
ATOM 637  C CA . LEU G 7  23  ? -35.184  43.892  0.253   1.00 175.83 ? 23  LEU F CA 1 
ATOM 638  C CA . LYS G 7  24  ? -37.168  45.730  -2.426  1.00 197.27 ? 24  LYS F CA 1 
ATOM 639  C CA . TRP G 7  25  ? -40.189  43.868  -1.070  1.00 216.98 ? 25  TRP F CA 1 
ATOM 640  C CA . GLY G 7  26  ? -41.764  43.947  2.384   1.00 243.26 ? 26  GLY F CA 1 
ATOM 641  C CA . MET G 7  27  ? -39.632  40.969  3.406   1.00 195.72 ? 27  MET F CA 1 
ATOM 642  C CA . GLU G 7  28  ? -37.375  41.376  6.454   1.00 249.56 ? 28  GLU F CA 1 
ATOM 643  C CA . TYR G 7  29  ? -34.526  38.976  7.304   1.00 203.65 ? 29  TYR F CA 1 
ATOM 644  C CA . LYS G 7  30  ? -33.025  38.670  10.799  1.00 229.34 ? 30  LYS F CA 1 
ATOM 645  C CA . GLY G 7  31  ? -29.825  36.699  10.310  1.00 233.14 ? 31  GLY F CA 1 
ATOM 646  C CA . TYR G 7  32  ? -26.089  36.531  10.941  1.00 226.66 ? 32  TYR F CA 1 
ATOM 647  C CA . LEU G 7  33  ? -24.424  38.300  8.021   1.00 194.59 ? 33  LEU F CA 1 
ATOM 648  C CA . VAL G 7  34  ? -21.642  35.929  6.993   1.00 179.94 ? 34  VAL F CA 1 
ATOM 649  C CA . SER G 7  35  ? -19.962  36.499  3.637   1.00 194.31 ? 35  SER F CA 1 
ATOM 650  C CA . VAL G 7  36  ? -20.145  39.065  0.834   1.00 207.48 ? 36  VAL F CA 1 
ATOM 651  C CA . ASP G 7  37  ? -18.332  39.604  -2.468  1.00 283.68 ? 37  ASP F CA 1 
ATOM 652  C CA . GLY G 7  38  ? -17.034  42.876  -3.871  1.00 277.92 ? 38  GLY F CA 1 
ATOM 653  C CA . TYR G 7  39  ? -20.653  43.433  -4.802  1.00 266.72 ? 39  TYR F CA 1 
ATOM 654  C CA . MET G 7  40  ? -23.282  43.219  -2.067  1.00 227.79 ? 40  MET F CA 1 
ATOM 655  C CA . ASN G 7  41  ? -24.131  39.557  -2.707  1.00 223.77 ? 41  ASN F CA 1 
ATOM 656  C CA . MET G 7  42  ? -24.594  38.453  0.904   1.00 208.77 ? 42  MET F CA 1 
ATOM 657  C CA . GLN G 7  43  ? -25.148  35.212  2.804   1.00 196.22 ? 43  GLN F CA 1 
ATOM 658  C CA . LEU G 7  44  ? -26.939  34.720  6.120   1.00 206.46 ? 44  LEU F CA 1 
ATOM 659  C CA . ALA G 7  45  ? -26.969  31.795  8.560   1.00 221.75 ? 45  ALA F CA 1 
ATOM 660  C CA . ASN G 7  46  ? -29.598  30.661  11.068  1.00 228.81 ? 46  ASN F CA 1 
ATOM 661  C CA . THR G 7  47  ? -31.681  33.543  9.746   1.00 239.56 ? 47  THR F CA 1 
ATOM 662  C CA . GLU G 7  48  ? -35.314  33.908  10.766  1.00 255.47 ? 48  GLU F CA 1 
ATOM 663  C CA . GLU G 7  49  ? -37.727  35.893  8.606   1.00 232.59 ? 49  GLU F CA 1 
ATOM 664  C CA . TYR G 7  50  ? -40.818  37.904  9.379   1.00 264.87 ? 50  TYR F CA 1 
ATOM 665  C CA . ILE G 7  51  ? -43.139  39.255  6.711   1.00 220.18 ? 51  ILE F CA 1 
ATOM 666  C CA . ASP G 7  52  ? -45.399  42.144  7.683   1.00 247.89 ? 52  ASP F CA 1 
ATOM 667  C CA . GLY G 7  53  ? -43.425  41.940  10.921  1.00 206.35 ? 53  GLY F CA 1 
ATOM 668  C CA . ALA G 7  54  ? -44.109  38.425  12.216  1.00 221.56 ? 54  ALA F CA 1 
ATOM 669  C CA . LEU G 7  55  ? -41.272  35.886  12.446  1.00 224.44 ? 55  LEU F CA 1 
ATOM 670  C CA . SER G 7  56  ? -42.719  32.996  10.456  1.00 211.89 ? 56  SER F CA 1 
ATOM 671  C CA . GLY G 7  57  ? -39.883  30.775  9.282   1.00 271.47 ? 57  GLY F CA 1 
ATOM 672  C CA . HIS G 7  58  ? -36.357  30.043  10.471  1.00 251.81 ? 58  HIS F CA 1 
ATOM 673  C CA . LEU G 7  59  ? -33.951  29.040  7.706   1.00 200.48 ? 59  LEU F CA 1 
ATOM 674  C CA . GLY G 7  60  ? -30.514  27.533  8.241   1.00 236.24 ? 60  GLY F CA 1 
ATOM 675  C CA . GLU G 7  61  ? -28.768  29.393  5.434   1.00 225.75 ? 61  GLU F CA 1 
ATOM 676  C CA . VAL G 7  62  ? -29.930  31.900  2.829   1.00 226.73 ? 62  VAL F CA 1 
ATOM 677  C CA . LEU G 7  63  ? -28.198  33.460  -0.169  1.00 149.98 ? 63  LEU F CA 1 
ATOM 678  C CA . ILE G 7  64  ? -29.413  36.897  -1.254  1.00 196.32 ? 64  ILE F CA 1 
ATOM 679  C CA . ARG G 7  65  ? -28.415  38.404  -4.609  1.00 197.44 ? 65  ARG F CA 1 
ATOM 680  C CA . CYS G 7  66  ? -27.902  42.185  -4.502  1.00 210.71 ? 66  CYS F CA 1 
ATOM 681  C CA . ASN G 7  67  ? -30.908  42.236  -6.836  1.00 215.97 ? 67  ASN F CA 1 
ATOM 682  C CA . ASN G 7  68  ? -33.411  42.500  -3.976  1.00 183.21 ? 68  ASN F CA 1 
ATOM 683  C CA . VAL G 7  69  ? -31.556  44.069  -1.058  1.00 183.39 ? 69  VAL F CA 1 
ATOM 684  C CA . LEU G 7  70  ? -32.878  47.518  -0.200  1.00 183.14 ? 70  LEU F CA 1 
ATOM 685  C CA . TYR G 7  71  ? -31.018  48.141  3.044   1.00 199.57 ? 71  TYR F CA 1 
ATOM 686  C CA . ILE G 7  72  ? -29.386  46.174  5.861   1.00 192.15 ? 72  ILE F CA 1 
ATOM 687  C CA . ARG G 7  73  ? -29.394  47.073  9.555   1.00 219.31 ? 73  ARG F CA 1 
ATOM 688  C CA . GLY G 7  74  ? -27.395  45.653  12.444  1.00 209.95 ? 74  GLY F CA 1 
ATOM 689  C CA . VAL G 7  75  ? -29.512  44.655  15.425  1.00 231.86 ? 75  VAL F CA 1 
ATOM 690  C CA . GLU G 7  76  ? -27.827  43.856  18.737  1.00 245.25 ? 76  GLU F CA 1 
ATOM 691  C CA . GLU G 7  77  ? -30.945  44.644  20.762  1.00 247.28 ? 77  GLU F CA 1 
ATOM 692  C CA . GLU G 7  78  ? -32.688  41.923  18.746  1.00 302.62 ? 78  GLU F CA 1 
ATOM 693  C CA . GLU G 7  79  ? -30.260  39.198  19.831  1.00 322.09 ? 79  GLU F CA 1 
ATOM 694  C CA . GLU G 7  80  ? -31.503  40.040  23.319  1.00 356.86 ? 80  GLU F CA 1 
ATOM 695  C CA . ASP G 7  81  ? -35.040  39.861  21.920  1.00 373.43 ? 81  ASP F CA 1 
ATOM 696  C CA . GLY G 7  82  ? -34.659  36.288  20.700  1.00 361.17 ? 82  GLY F CA 1 
ATOM 697  C CA . GLU G 7  83  ? -34.023  35.422  24.346  1.00 333.03 ? 83  GLU F CA 1 
ATOM 698  C CA . MET G 7  84  ? -31.717  32.678  23.053  1.00 302.61 ? 84  MET F CA 1 
ATOM 699  C CA . ARG G 7  85  ? -28.569  32.260  25.163  1.00 291.65 ? 85  ARG F CA 1 
ATOM 700  C CA . GLU G 7  86  ? -26.928  29.430  23.222  1.00 282.53 ? 86  GLU F CA 1 
ATOM 701  C CA . GLY H 8  7   ? -22.591  80.766  -16.646 1.00 422.57 ? 7   GLY E CA 1 
ATOM 702  C CA . GLN H 8  8   ? -21.009  80.970  -13.197 1.00 379.31 ? 8   GLN E CA 1 
ATOM 703  C CA . LYS H 8  9   ? -17.912  78.879  -13.943 1.00 358.80 ? 9   LYS E CA 1 
ATOM 704  C CA . VAL H 8  10  ? -19.718  76.307  -16.090 1.00 359.36 ? 10  VAL E CA 1 
ATOM 705  C CA . GLN H 8  11  ? -22.095  76.066  -13.127 1.00 363.14 ? 11  GLN E CA 1 
ATOM 706  C CA . LYS H 8  12  ? -19.304  75.224  -10.699 1.00 346.01 ? 12  LYS E CA 1 
ATOM 707  C CA . VAL H 8  13  ? -18.328  72.444  -13.096 1.00 332.68 ? 13  VAL E CA 1 
ATOM 708  C CA . MET H 8  14  ? -21.838  71.031  -12.743 1.00 350.65 ? 14  MET E CA 1 
ATOM 709  C CA . VAL H 8  15  ? -22.101  71.468  -8.976  1.00 365.80 ? 15  VAL E CA 1 
ATOM 710  C CA . GLN H 8  16  ? -18.860  69.583  -8.332  1.00 384.08 ? 16  GLN E CA 1 
ATOM 711  C CA . PRO H 8  17  ? -19.819  66.684  -10.611 1.00 328.18 ? 17  PRO E CA 1 
ATOM 712  C CA . ILE H 8  18  ? -23.217  67.185  -8.972  1.00 245.47 ? 18  ILE E CA 1 
ATOM 713  C CA . ASN H 8  19  ? -22.439  64.482  -6.398  1.00 213.81 ? 19  ASN E CA 1 
ATOM 714  C CA . LEU H 8  20  ? -19.483  66.301  -4.847  1.00 266.26 ? 20  LEU E CA 1 
ATOM 715  C CA . ILE H 8  21  ? -22.011  68.992  -3.947  1.00 326.20 ? 21  ILE E CA 1 
ATOM 716  C CA . PHE H 8  22  ? -24.573  66.820  -2.202  1.00 251.21 ? 22  PHE E CA 1 
ATOM 717  C CA . ARG H 8  23  ? -21.625  64.783  -0.909  1.00 279.99 ? 23  ARG E CA 1 
ATOM 718  C CA . TYR H 8  24  ? -18.964  67.318  0.116   1.00 305.94 ? 24  TYR E CA 1 
ATOM 719  C CA . LEU H 8  25  ? -21.289  70.227  0.815   1.00 303.86 ? 25  LEU E CA 1 
ATOM 720  C CA . GLN H 8  26  ? -23.633  67.801  2.604   1.00 273.38 ? 26  GLN E CA 1 
ATOM 721  C CA . ASN H 8  27  ? -20.732  66.159  4.401   1.00 282.11 ? 27  ASN E CA 1 
ATOM 722  C CA . ARG H 8  28  ? -20.180  69.346  6.373   1.00 297.44 ? 28  ARG E CA 1 
ATOM 723  C CA . SER H 8  29  ? -23.980  69.489  6.590   1.00 302.72 ? 29  SER E CA 1 
ATOM 724  C CA . ARG H 8  30  ? -24.632  65.950  7.831   1.00 255.96 ? 30  ARG E CA 1 
ATOM 725  C CA . ILE H 8  31  ? -28.363  66.598  7.394   1.00 268.72 ? 31  ILE E CA 1 
ATOM 726  C CA . GLN H 8  32  ? -31.289  64.162  7.294   1.00 256.19 ? 32  GLN E CA 1 
ATOM 727  C CA . VAL H 8  33  ? -32.305  63.455  3.707   1.00 222.02 ? 33  VAL E CA 1 
ATOM 728  C CA . TRP H 8  34  ? -35.765  62.355  2.580   1.00 271.82 ? 34  TRP E CA 1 
ATOM 729  C CA . LEU H 8  35  ? -35.358  59.448  0.171   1.00 231.03 ? 35  LEU E CA 1 
ATOM 730  C CA . TYR H 8  36  ? -37.977  58.342  -2.348  1.00 241.56 ? 36  TYR E CA 1 
ATOM 731  C CA . GLU H 8  37  ? -37.683  55.145  -4.378  1.00 238.30 ? 37  GLU E CA 1 
ATOM 732  C CA . GLN H 8  38  ? -39.403  52.989  -7.003  1.00 204.73 ? 38  GLN E CA 1 
ATOM 733  C CA . VAL H 8  39  ? -42.057  52.384  -4.336  1.00 247.42 ? 39  VAL E CA 1 
ATOM 734  C CA . ASN H 8  40  ? -44.938  54.307  -2.767  1.00 259.23 ? 40  ASN E CA 1 
ATOM 735  C CA . MET H 8  41  ? -42.790  54.679  0.355   1.00 248.73 ? 41  MET E CA 1 
ATOM 736  C CA . ARG H 8  42  ? -40.282  57.100  1.877   1.00 264.20 ? 42  ARG E CA 1 
ATOM 737  C CA . ILE H 8  43  ? -37.183  56.900  4.098   1.00 201.95 ? 43  ILE E CA 1 
ATOM 738  C CA . GLU H 8  44  ? -35.582  59.943  5.756   1.00 234.81 ? 44  GLU E CA 1 
ATOM 739  C CA . GLY H 8  45  ? -32.261  59.873  7.600   1.00 242.87 ? 45  GLY E CA 1 
ATOM 740  C CA . CYS H 8  46  ? -28.830  61.425  8.166   1.00 236.83 ? 46  CYS E CA 1 
ATOM 741  C CA . ILE H 8  47  ? -26.182  60.799  5.509   1.00 235.99 ? 47  ILE E CA 1 
ATOM 742  C CA . ILE H 8  48  ? -22.896  59.501  6.926   1.00 217.50 ? 48  ILE E CA 1 
ATOM 743  C CA . GLY H 8  49  ? -21.632  57.278  4.132   1.00 216.75 ? 49  GLY E CA 1 
ATOM 744  C CA . PHE H 8  50  ? -21.548  57.143  0.348   1.00 248.34 ? 50  PHE E CA 1 
ATOM 745  C CA . ASP H 8  51  ? -20.349  55.040  -2.567  1.00 229.03 ? 51  ASP E CA 1 
ATOM 746  C CA . GLU H 8  52  ? -19.812  55.670  -6.281  1.00 235.88 ? 52  GLU E CA 1 
ATOM 747  C CA . TYR H 8  53  ? -22.366  52.971  -7.041  1.00 226.83 ? 53  TYR E CA 1 
ATOM 748  C CA . MET H 8  54  ? -24.887  55.094  -5.124  1.00 206.71 ? 54  MET E CA 1 
ATOM 749  C CA . ASN H 8  55  ? -24.713  53.026  -1.928  1.00 194.32 ? 55  ASN E CA 1 
ATOM 750  C CA . LEU H 8  56  ? -25.711  55.060  1.129   1.00 192.49 ? 56  LEU E CA 1 
ATOM 751  C CA . VAL H 8  57  ? -25.389  55.007  4.920   1.00 225.59 ? 57  VAL E CA 1 
ATOM 752  C CA . LEU H 8  58  ? -28.136  56.355  7.174   1.00 238.61 ? 58  LEU E CA 1 
ATOM 753  C CA . ASP H 8  59  ? -28.595  56.785  10.929  1.00 272.20 ? 59  ASP E CA 1 
ATOM 754  C CA . ASP H 8  60  ? -31.777  57.446  12.899  1.00 255.20 ? 60  ASP E CA 1 
ATOM 755  C CA . ALA H 8  61  ? -33.399  56.970  9.497   1.00 202.13 ? 61  ALA E CA 1 
ATOM 756  C CA . GLU H 8  62  ? -37.164  56.964  9.989   1.00 263.92 ? 62  GLU E CA 1 
ATOM 757  C CA . GLU H 8  63  ? -38.976  54.638  7.578   1.00 244.25 ? 63  GLU E CA 1 
ATOM 758  C CA . ILE H 8  64  ? -42.141  56.243  6.199   1.00 226.23 ? 64  ILE E CA 1 
ATOM 759  C CA . HIS H 8  65  ? -45.261  54.570  4.793   1.00 218.60 ? 65  HIS E CA 1 
ATOM 760  C CA . SER H 8  66  ? -47.687  55.954  2.206   1.00 284.94 ? 66  SER E CA 1 
ATOM 761  C CA . LYS H 8  67  ? -51.425  56.581  2.608   1.00 247.46 ? 67  LYS E CA 1 
ATOM 762  C CA . THR H 8  68  ? -50.846  56.185  6.352   1.00 213.33 ? 68  THR E CA 1 
ATOM 763  C CA . LYS H 8  69  ? -48.882  57.526  9.320   1.00 247.15 ? 69  LYS E CA 1 
ATOM 764  C CA . SER H 8  70  ? -45.146  56.861  9.524   1.00 280.73 ? 70  SER E CA 1 
ATOM 765  C CA . ARG H 8  71  ? -43.865  55.365  12.777  1.00 275.39 ? 71  ARG E CA 1 
ATOM 766  C CA . LYS H 8  72  ? -40.970  53.134  11.767  1.00 209.31 ? 72  LYS E CA 1 
ATOM 767  C CA . GLN H 8  73  ? -37.380  54.038  12.534  1.00 239.21 ? 73  GLN E CA 1 
ATOM 768  C CA . LEU H 8  74  ? -34.116  52.311  11.659  1.00 240.96 ? 74  LEU E CA 1 
ATOM 769  C CA . GLY H 8  75  ? -30.503  53.039  12.545  1.00 228.14 ? 75  GLY E CA 1 
ATOM 770  C CA . ARG H 8  76  ? -27.256  52.680  10.618  1.00 264.68 ? 76  ARG E CA 1 
ATOM 771  C CA . ILE H 8  77  ? -28.578  51.031  7.463   1.00 213.08 ? 77  ILE E CA 1 
ATOM 772  C CA . MET H 8  78  ? -26.815  50.790  4.114   1.00 211.38 ? 78  MET E CA 1 
ATOM 773  C CA . LEU H 8  79  ? -28.976  51.587  1.087   1.00 183.67 ? 79  LEU E CA 1 
ATOM 774  C CA . LYS H 8  80  ? -28.732  50.192  -2.413  1.00 213.30 ? 80  LYS E CA 1 
ATOM 775  C CA . GLY H 8  81  ? -28.606  53.002  -4.946  1.00 211.59 ? 81  GLY E CA 1 
ATOM 776  C CA . ASP H 8  82  ? -30.188  50.480  -7.282  1.00 221.53 ? 82  ASP E CA 1 
ATOM 777  C CA . ASN H 8  83  ? -33.484  51.313  -5.578  1.00 211.08 ? 83  ASN E CA 1 
ATOM 778  C CA . ILE H 8  84  ? -32.906  55.059  -5.179  1.00 193.96 ? 84  ILE E CA 1 
ATOM 779  C CA . THR H 8  85  ? -34.718  57.679  -7.256  1.00 207.75 ? 85  THR E CA 1 
ATOM 780  C CA . LEU H 8  86  ? -35.270  60.985  -5.468  1.00 194.20 ? 86  LEU E CA 1 
ATOM 781  C CA . LEU H 8  87  ? -32.763  62.408  -2.996  1.00 188.19 ? 87  LEU E CA 1 
ATOM 782  C CA . GLN H 8  88  ? -34.199  65.181  -0.836  1.00 244.52 ? 88  GLN E CA 1 
ATOM 783  C CA . SER H 8  89  ? -33.424  66.867  2.477   1.00 243.00 ? 89  SER E CA 1 
ATOM 784  C CA . VAL H 8  90  ? -35.666  67.927  5.358   1.00 225.92 ? 90  VAL E CA 1 
ATOM 785  C CA . MET I 9  1   ? -18.412  58.463  -20.768 1.00 212.65 ? 1   MET G CA 1 
ATOM 786  C CA . SER I 9  2   ? -20.656  61.530  -20.621 1.00 242.28 ? 2   SER G CA 1 
ATOM 787  C CA . LYS I 9  3   ? -21.277  61.512  -24.370 1.00 210.33 ? 3   LYS G CA 1 
ATOM 788  C CA . ALA I 9  4   ? -24.910  62.652  -24.664 1.00 225.77 ? 4   ALA G CA 1 
ATOM 789  C CA . HIS I 9  5   ? -25.131  64.336  -21.246 1.00 227.21 ? 5   HIS G CA 1 
ATOM 790  C CA . PRO I 9  6   ? -22.823  67.222  -22.357 1.00 315.34 ? 6   PRO G CA 1 
ATOM 791  C CA . PRO I 9  7   ? -24.404  68.547  -25.594 1.00 305.68 ? 7   PRO G CA 1 
ATOM 792  C CA . GLU I 9  8   ? -27.744  68.870  -23.786 1.00 269.65 ? 8   GLU G CA 1 
ATOM 793  C CA . LEU I 9  9   ? -27.045  70.682  -20.505 1.00 258.50 ? 9   LEU G CA 1 
ATOM 794  C CA . LYS I 9  10  ? -24.094  72.720  -21.760 1.00 236.79 ? 10  LYS G CA 1 
ATOM 795  C CA . LYS I 9  11  ? -26.675  74.312  -24.062 1.00 248.25 ? 11  LYS G CA 1 
ATOM 796  C CA . PHE I 9  12  ? -29.528  74.257  -21.534 1.00 250.41 ? 12  PHE G CA 1 
ATOM 797  C CA . MET I 9  13  ? -28.771  74.972  -17.886 1.00 257.18 ? 13  MET G CA 1 
ATOM 798  C CA . ASP I 9  14  ? -29.833  77.055  -14.874 1.00 302.21 ? 14  ASP G CA 1 
ATOM 799  C CA . LYS I 9  15  ? -33.291  77.102  -16.429 1.00 222.16 ? 15  LYS G CA 1 
ATOM 800  C CA . LYS I 9  16  ? -36.645  75.991  -15.047 1.00 213.52 ? 16  LYS G CA 1 
ATOM 801  C CA . LEU I 9  17  ? -38.040  72.735  -16.393 1.00 235.58 ? 17  LEU G CA 1 
ATOM 802  C CA . SER I 9  18  ? -39.959  69.669  -15.225 1.00 264.41 ? 18  SER G CA 1 
ATOM 803  C CA . LEU I 9  19  ? -38.365  66.246  -14.822 1.00 249.97 ? 19  LEU G CA 1 
ATOM 804  C CA . LYS I 9  20  ? -40.735  63.319  -15.379 1.00 200.90 ? 20  LYS G CA 1 
ATOM 805  C CA . LEU I 9  21  ? -39.980  60.405  -13.051 1.00 199.95 ? 21  LEU G CA 1 
ATOM 806  C CA . ASN I 9  22  ? -40.845  56.727  -13.431 1.00 231.60 ? 22  ASN G CA 1 
ATOM 807  C CA . GLY I 9  23  ? -42.907  56.785  -10.252 1.00 197.82 ? 23  GLY G CA 1 
ATOM 808  C CA . GLY I 9  24  ? -45.013  59.353  -12.054 1.00 194.94 ? 24  GLY G CA 1 
ATOM 809  C CA . ARG I 9  25  ? -43.605  61.999  -9.733  1.00 230.06 ? 25  ARG G CA 1 
ATOM 810  C CA . HIS I 9  26  ? -43.287  65.362  -11.461 1.00 242.26 ? 26  HIS G CA 1 
ATOM 811  C CA . VAL I 9  27  ? -40.926  68.016  -10.125 1.00 210.03 ? 27  VAL G CA 1 
ATOM 812  C CA . GLN I 9  28  ? -39.849  71.264  -11.775 1.00 253.17 ? 28  GLN G CA 1 
ATOM 813  C CA . GLY I 9  29  ? -37.054  73.720  -11.082 1.00 207.91 ? 29  GLY G CA 1 
ATOM 814  C CA . ILE I 9  30  ? -33.983  75.412  -12.520 1.00 271.43 ? 30  ILE G CA 1 
ATOM 815  C CA . LEU I 9  31  ? -31.325  72.997  -13.787 1.00 254.95 ? 31  LEU G CA 1 
ATOM 816  C CA . ARG I 9  32  ? -28.073  72.904  -11.808 1.00 244.63 ? 32  ARG G CA 1 
ATOM 817  C CA . GLY I 9  33  ? -25.940  69.871  -12.597 1.00 261.59 ? 33  GLY G CA 1 
ATOM 818  C CA . PHE I 9  34  ? -25.563  66.779  -14.748 1.00 214.87 ? 34  PHE G CA 1 
ATOM 819  C CA . ASP I 9  35  ? -23.392  63.688  -14.385 1.00 212.11 ? 35  ASP G CA 1 
ATOM 820  C CA . PRO I 9  36  ? -22.889  60.891  -16.910 1.00 227.84 ? 36  PRO G CA 1 
ATOM 821  C CA . PHE I 9  37  ? -25.618  58.368  -16.014 1.00 245.54 ? 37  PHE G CA 1 
ATOM 822  C CA . MET I 9  38  ? -28.413  60.967  -15.991 1.00 198.50 ? 38  MET G CA 1 
ATOM 823  C CA . ASN I 9  39  ? -27.876  61.839  -12.327 1.00 204.11 ? 39  ASN G CA 1 
ATOM 824  C CA . LEU I 9  40  ? -28.606  65.544  -11.859 1.00 217.58 ? 40  LEU G CA 1 
ATOM 825  C CA . VAL I 9  41  ? -29.476  68.358  -9.456  1.00 258.35 ? 41  VAL G CA 1 
ATOM 826  C CA . ILE I 9  42  ? -32.539  70.607  -9.664  1.00 240.86 ? 42  ILE G CA 1 
ATOM 827  C CA . ASP I 9  43  ? -33.215  73.530  -7.329  1.00 282.81 ? 43  ASP G CA 1 
ATOM 828  C CA . GLU I 9  44  ? -36.449  75.167  -6.150  1.00 297.76 ? 44  GLU G CA 1 
ATOM 829  C CA . CYS I 9  45  ? -37.737  71.737  -7.111  1.00 279.05 ? 45  CYS G CA 1 
ATOM 830  C CA . VAL I 9  46  ? -41.499  71.892  -6.699  1.00 240.04 ? 46  VAL G CA 1 
ATOM 831  C CA . GLU I 9  47  ? -43.333  68.704  -5.775  1.00 221.79 ? 47  GLU G CA 1 
ATOM 832  C CA . MET I 9  48  ? -46.630  67.910  -7.476  1.00 262.43 ? 48  MET G CA 1 
ATOM 833  C CA . ALA I 9  49  ? -49.151  66.321  -5.131  1.00 271.82 ? 49  ALA G CA 1 
ATOM 834  C CA . THR I 9  50  ? -51.665  63.947  -6.690  1.00 282.89 ? 50  THR G CA 1 
ATOM 835  C CA . SER I 9  51  ? -54.171  66.675  -5.809  1.00 273.91 ? 51  SER G CA 1 
ATOM 836  C CA . GLY I 9  52  ? -52.225  69.656  -7.133  1.00 243.29 ? 52  GLY G CA 1 
ATOM 837  C CA . GLN I 9  53  ? -49.349  72.061  -6.485  1.00 277.72 ? 53  GLN G CA 1 
ATOM 838  C CA . GLN I 9  54  ? -47.555  70.899  -3.340  1.00 295.11 ? 54  GLN G CA 1 
ATOM 839  C CA . ASN I 9  55  ? -44.551  71.634  -1.117  1.00 268.93 ? 55  ASN G CA 1 
ATOM 840  C CA . ASN I 9  56  ? -41.228  72.435  -2.807  1.00 263.99 ? 56  ASN G CA 1 
ATOM 841  C CA . ILE I 9  57  ? -37.548  72.355  -1.814  1.00 260.91 ? 57  ILE G CA 1 
ATOM 842  C CA . GLY I 9  58  ? -34.492  74.464  -2.607  1.00 310.10 ? 58  GLY G CA 1 
ATOM 843  C CA . MET I 9  59  ? -32.036  71.733  -3.626  1.00 223.28 ? 59  MET G CA 1 
ATOM 844  C CA . VAL I 9  60  ? -32.200  68.055  -4.622  1.00 233.78 ? 60  VAL G CA 1 
ATOM 845  C CA . VAL I 9  61  ? -30.300  65.451  -6.650  1.00 191.09 ? 61  VAL G CA 1 
ATOM 846  C CA . ILE I 9  62  ? -32.115  62.956  -8.875  1.00 194.75 ? 62  ILE G CA 1 
ATOM 847  C CA . ARG I 9  63  ? -30.684  59.650  -10.095 1.00 207.61 ? 63  ARG G CA 1 
ATOM 848  C CA . GLY I 9  64  ? -31.111  58.967  -13.798 1.00 178.56 ? 64  GLY G CA 1 
ATOM 849  C CA . ASN I 9  65  ? -32.704  55.522  -13.679 1.00 197.18 ? 65  ASN G CA 1 
ATOM 850  C CA . SER I 9  66  ? -35.991  57.091  -12.544 1.00 211.45 ? 66  SER G CA 1 
ATOM 851  C CA . ILE I 9  67  ? -35.850  59.869  -15.164 1.00 186.24 ? 67  ILE G CA 1 
ATOM 852  C CA . ILE I 9  68  ? -38.174  59.451  -18.161 1.00 201.08 ? 68  ILE G CA 1 
ATOM 853  C CA . MET I 9  69  ? -37.783  62.800  -19.944 1.00 217.70 ? 69  MET G CA 1 
ATOM 854  C CA . LEU I 9  70  ? -37.371  66.563  -19.437 1.00 211.08 ? 70  LEU G CA 1 
ATOM 855  C CA . GLU I 9  71  ? -40.120  69.182  -19.698 1.00 237.32 ? 71  GLU G CA 1 
ATOM 856  C CA . ALA I 9  72  ? -38.321  72.455  -20.474 1.00 203.75 ? 72  ALA G CA 1 
ATOM 857  C CA . LEU I 9  73  ? -39.773  75.676  -19.041 1.00 216.21 ? 73  LEU G CA 1 
ATOM 858  C CA . GLU I 9  74  ? -37.149  77.817  -20.778 1.00 250.31 ? 74  GLU G CA 1 
ATOM 859  C CA . ARG I 9  75  ? -35.542  78.914  -24.049 1.00 249.77 ? 75  ARG G CA 1 
ATOM 860  C CA . VAL I 9  76  ? -32.419  77.985  -26.023 1.00 312.86 ? 76  VAL G CA 1 
ATOM 861  C CA . ALA J 1  2   ? -122.372 87.732  97.476  1.00 255.61 ? 2   ALA P CA 1 
ATOM 862  C CA . VAL J 1  3   ? -121.368 91.205  96.291  1.00 275.21 ? 3   VAL P CA 1 
ATOM 863  C CA . PRO J 1  4   ? -119.089 90.744  93.255  1.00 303.01 ? 4   PRO P CA 1 
ATOM 864  C CA . GLU J 1  5   ? -119.969 87.161  92.314  1.00 323.50 ? 5   GLU P CA 1 
ATOM 865  C CA . THR J 1  6   ? -123.709 87.395  92.991  1.00 252.20 ? 6   THR P CA 1 
ATOM 866  C CA . ARG J 1  7   ? -124.060 89.734  90.018  1.00 213.89 ? 7   ARG P CA 1 
ATOM 867  C CA . PRO J 1  8   ? -125.416 88.022  86.851  1.00 190.97 ? 8   PRO P CA 1 
ATOM 868  C CA . ASN J 1  9   ? -122.945 87.554  83.986  1.00 212.01 ? 9   ASN P CA 1 
ATOM 869  C CA . HIS J 1  10  ? -122.326 86.049  80.533  1.00 165.23 ? 10  HIS P CA 1 
ATOM 870  C CA . THR J 1  11  ? -119.248 84.289  81.938  1.00 203.36 ? 11  THR P CA 1 
ATOM 871  C CA . ILE J 1  12  ? -118.441 81.948  84.825  1.00 212.60 ? 12  ILE P CA 1 
ATOM 872  C CA . TYR J 1  13  ? -115.212 81.901  86.843  1.00 218.40 ? 13  TYR P CA 1 
ATOM 873  C CA . ILE J 1  14  ? -114.375 78.355  87.970  1.00 164.28 ? 14  ILE P CA 1 
ATOM 874  C CA . ASN J 1  15  ? -111.582 78.061  90.534  1.00 201.13 ? 15  ASN P CA 1 
ATOM 875  C CA . ASN J 1  16  ? -110.020 74.879  91.958  1.00 198.82 ? 16  ASN P CA 1 
ATOM 876  C CA . LEU J 1  17  ? -109.804 72.388  89.072  1.00 163.14 ? 17  LEU P CA 1 
ATOM 877  C CA . ASN J 1  18  ? -107.326 69.598  88.315  1.00 215.01 ? 18  ASN P CA 1 
ATOM 878  C CA . GLU J 1  19  ? -104.496 71.939  87.319  1.00 206.31 ? 19  GLU P CA 1 
ATOM 879  C CA . LYS J 1  20  ? -102.387 69.028  86.064  1.00 209.56 ? 20  LYS P CA 1 
ATOM 880  C CA . ILE J 1  21  ? -104.871 68.790  83.189  1.00 168.21 ? 21  ILE P CA 1 
ATOM 881  C CA . LYS J 1  22  ? -103.535 69.822  79.783  1.00 196.47 ? 22  LYS P CA 1 
ATOM 882  C CA . LYS J 1  23  ? -104.984 72.761  77.849  1.00 218.42 ? 23  LYS P CA 1 
ATOM 883  C CA . ASP J 1  24  ? -106.087 70.857  74.744  1.00 232.55 ? 24  ASP P CA 1 
ATOM 884  C CA . GLU J 1  25  ? -108.014 68.277  76.768  1.00 249.41 ? 25  GLU P CA 1 
ATOM 885  C CA . LEU J 1  26  ? -109.463 70.752  79.280  1.00 135.43 ? 26  LEU P CA 1 
ATOM 886  C CA . LYS J 1  27  ? -110.989 72.746  76.423  1.00 168.55 ? 27  LYS P CA 1 
ATOM 887  C CA . LYS J 1  28  ? -112.261 69.727  74.497  1.00 201.33 ? 28  LYS P CA 1 
ATOM 888  C CA . SER J 1  29  ? -113.668 68.615  77.850  1.00 213.91 ? 29  SER P CA 1 
ATOM 889  C CA . LEU J 1  30  ? -115.488 71.793  78.905  1.00 161.36 ? 30  LEU P CA 1 
ATOM 890  C CA . TYR J 1  31  ? -116.915 72.674  75.488  1.00 239.54 ? 31  TYR P CA 1 
ATOM 891  C CA . ALA J 1  32  ? -118.742 69.336  75.630  1.00 206.60 ? 32  ALA P CA 1 
ATOM 892  C CA . ILE J 1  33  ? -119.903 69.610  79.253  1.00 183.08 ? 33  ILE P CA 1 
ATOM 893  C CA . PHE J 1  34  ? -121.436 73.105  79.202  1.00 158.04 ? 34  PHE P CA 1 
ATOM 894  C CA . SER J 1  35  ? -122.497 73.388  75.549  1.00 169.21 ? 35  SER P CA 1 
ATOM 895  C CA . GLN J 1  36  ? -125.959 72.471  76.858  1.00 197.14 ? 36  GLN P CA 1 
ATOM 896  C CA . PHE J 1  37  ? -126.968 74.917  79.598  1.00 202.80 ? 37  PHE P CA 1 
ATOM 897  C CA . GLY J 1  38  ? -126.693 77.499  76.845  1.00 217.84 ? 38  GLY P CA 1 
ATOM 898  C CA . GLN J 1  39  ? -124.417 78.789  74.095  1.00 200.09 ? 39  GLN P CA 1 
ATOM 899  C CA . ILE J 1  40  ? -120.615 78.999  74.231  1.00 183.11 ? 40  ILE P CA 1 
ATOM 900  C CA . LEU J 1  41  ? -118.814 81.502  72.001  1.00 183.78 ? 41  LEU P CA 1 
ATOM 901  C CA . ASP J 1  42  ? -115.325 80.379  73.067  1.00 218.75 ? 42  ASP P CA 1 
ATOM 902  C CA . ILE J 1  43  ? -113.878 79.203  76.388  1.00 199.06 ? 43  ILE P CA 1 
ATOM 903  C CA . LEU J 1  44  ? -110.514 80.300  77.753  1.00 176.95 ? 44  LEU P CA 1 
ATOM 904  C CA . VAL J 1  45  ? -108.032 79.165  80.405  1.00 187.26 ? 45  VAL P CA 1 
ATOM 905  C CA . SER J 1  46  ? -104.258 79.419  80.842  1.00 198.75 ? 46  SER P CA 1 
ATOM 906  C CA . ARG J 1  47  ? -101.572 77.294  82.482  1.00 213.29 ? 47  ARG P CA 1 
ATOM 907  C CA . SER J 1  48  ? -99.767  80.355  83.834  1.00 169.50 ? 48  SER P CA 1 
ATOM 908  C CA . LEU J 1  49  ? -98.995  80.698  87.536  1.00 192.37 ? 49  LEU P CA 1 
ATOM 909  C CA . LYS J 1  50  ? -102.047 82.923  87.944  1.00 177.70 ? 50  LYS P CA 1 
ATOM 910  C CA . MET J 1  51  ? -104.428 81.022  85.654  1.00 199.89 ? 51  MET P CA 1 
ATOM 911  C CA . ARG J 1  52  ? -103.921 77.293  86.268  1.00 221.55 ? 52  ARG P CA 1 
ATOM 912  C CA . GLY J 1  53  ? -106.902 75.867  88.129  1.00 224.94 ? 53  GLY P CA 1 
ATOM 913  C CA . GLN J 1  54  ? -109.103 78.763  87.019  1.00 190.10 ? 54  GLN P CA 1 
ATOM 914  C CA . ALA J 1  55  ? -111.412 79.078  84.013  1.00 170.45 ? 55  ALA P CA 1 
ATOM 915  C CA . PHE J 1  56  ? -113.573 81.559  82.102  1.00 162.91 ? 56  PHE P CA 1 
ATOM 916  C CA . VAL J 1  57  ? -116.452 80.663  79.769  1.00 174.95 ? 57  VAL P CA 1 
ATOM 917  C CA . ILE J 1  58  ? -118.614 83.018  77.705  1.00 176.76 ? 58  ILE P CA 1 
ATOM 918  C CA . PHE J 1  59  ? -122.350 82.448  77.457  1.00 214.77 ? 59  PHE P CA 1 
ATOM 919  C CA . LYS J 1  60  ? -124.568 83.876  74.726  1.00 196.91 ? 60  LYS P CA 1 
ATOM 920  C CA . GLU J 1  61  ? -127.606 84.355  76.950  1.00 216.41 ? 61  GLU P CA 1 
ATOM 921  C CA . VAL J 1  62  ? -127.425 85.348  80.622  1.00 222.84 ? 62  VAL P CA 1 
ATOM 922  C CA . SER J 1  63  ? -129.998 82.845  81.884  1.00 241.94 ? 63  SER P CA 1 
ATOM 923  C CA . SER J 1  64  ? -128.026 80.133  80.099  1.00 171.00 ? 64  SER P CA 1 
ATOM 924  C CA . ALA J 1  65  ? -125.002 80.899  82.270  1.00 193.95 ? 65  ALA P CA 1 
ATOM 925  C CA . THR J 1  66  ? -127.103 81.094  85.431  1.00 197.53 ? 66  THR P CA 1 
ATOM 926  C CA . ASN J 1  67  ? -128.614 77.651  84.836  1.00 248.69 ? 67  ASN P CA 1 
ATOM 927  C CA . ALA J 1  68  ? -125.183 76.089  84.325  1.00 194.38 ? 68  ALA P CA 1 
ATOM 928  C CA . LEU J 1  69  ? -124.044 77.372  87.720  1.00 175.26 ? 69  LEU P CA 1 
ATOM 929  C CA . ARG J 1  70  ? -127.186 76.177  89.521  1.00 267.25 ? 70  ARG P CA 1 
ATOM 930  C CA . SER J 1  71  ? -126.453 72.562  88.560  1.00 228.12 ? 71  SER P CA 1 
ATOM 931  C CA . MET J 1  72  ? -122.659 72.279  88.175  1.00 186.42 ? 72  MET P CA 1 
ATOM 932  C CA . GLN J 1  73  ? -121.684 74.328  91.249  1.00 208.64 ? 73  GLN P CA 1 
ATOM 933  C CA . GLY J 1  74  ? -119.790 72.096  93.661  1.00 208.42 ? 74  GLY P CA 1 
ATOM 934  C CA . PHE J 1  75  ? -119.519 69.246  91.152  1.00 199.53 ? 75  PHE P CA 1 
ATOM 935  C CA . PRO J 1  76  ? -116.533 66.833  91.335  1.00 212.30 ? 76  PRO P CA 1 
ATOM 936  C CA . PHE J 1  77  ? -114.475 67.319  88.170  1.00 200.87 ? 77  PHE P CA 1 
ATOM 937  C CA . TYR J 1  78  ? -111.263 65.304  87.820  1.00 199.82 ? 78  TYR P CA 1 
ATOM 938  C CA . ASP J 1  79  ? -110.975 64.669  91.568  1.00 182.03 ? 79  ASP P CA 1 
ATOM 939  C CA . LYS J 1  80  ? -112.001 68.226  92.493  1.00 202.03 ? 80  LYS P CA 1 
ATOM 940  C CA . PRO J 1  81  ? -115.430 69.927  92.902  1.00 198.58 ? 81  PRO P CA 1 
ATOM 941  C CA . MET J 1  82  ? -115.682 73.027  90.701  1.00 203.77 ? 82  MET P CA 1 
ATOM 942  C CA . ARG J 1  83  ? -116.270 76.295  92.552  1.00 225.66 ? 83  ARG P CA 1 
ATOM 943  C CA . ILE J 1  84  ? -118.129 78.134  89.789  1.00 172.54 ? 84  ILE P CA 1 
ATOM 944  C CA . GLN J 1  85  ? -119.032 81.812  90.140  1.00 197.37 ? 85  GLN P CA 1 
ATOM 945  C CA . TYR J 1  86  ? -120.041 84.809  88.026  1.00 250.31 ? 86  TYR P CA 1 
ATOM 946  C CA . ALA J 1  87  ? -117.415 86.891  86.216  1.00 190.63 ? 87  ALA P CA 1 
ATOM 947  C CA . LYS J 1  88  ? -116.532 90.096  88.081  1.00 194.13 ? 88  LYS P CA 1 
ATOM 948  C CA . THR J 1  89  ? -116.221 91.752  84.674  1.00 198.50 ? 89  THR P CA 1 
ATOM 949  C CA . ASP J 1  90  ? -117.991 91.292  81.344  1.00 221.90 ? 90  ASP P CA 1 
ATOM 950  C CA . SER J 1  91  ? -115.783 89.529  78.791  1.00 196.26 ? 91  SER P CA 1 
ATOM 951  C CA . ASP J 1  92  ? -113.947 91.592  76.170  1.00 216.80 ? 92  ASP P CA 1 
ATOM 952  C CA . ILE J 1  93  ? -115.856 89.780  73.429  1.00 163.31 ? 93  ILE P CA 1 
ATOM 953  C CA . ILE J 1  94  ? -119.022 90.724  75.308  1.00 183.11 ? 94  ILE P CA 1 
ATOM 954  C CA . ALA J 1  95  ? -117.906 94.352  75.574  1.00 204.58 ? 95  ALA P CA 1 
ATOM 955  C CA . LYS J 1  96  ? -117.454 94.553  71.817  1.00 202.05 ? 96  LYS P CA 1 
ATOM 956  C CA . MET J 1  97  ? -121.025 93.289  71.357  1.00 194.41 ? 97  MET P CA 1 
ATOM 957  C CA . LYS J 1  98  ? -123.032 94.955  74.119  1.00 183.89 ? 98  LYS P CA 1 
ATOM 958  C CA . GLY J 1  99  ? -122.181 98.469  75.228  1.00 258.76 ? 99  GLY P CA 1 
ATOM 959  C CA . THR J 1  100 ? -120.722 99.496  71.869  1.00 322.94 ? 100 THR P CA 1 
ATOM 960  C CA . PHE J 1  101 ? -117.263 100.828 72.705  1.00 298.37 ? 101 PHE P CA 1 
ATOM 961  C CA . VAL J 1  102 ? -116.971 99.498  76.245  1.00 221.46 ? 102 VAL P CA 1 
ATOM 962  C CA . GLU J 1  103 ? -114.272 97.479  74.482  1.00 229.39 ? 103 GLU P CA 1 
ATOM 963  C CA . ARG J 1  104 ? -112.075 100.359 73.289  1.00 311.30 ? 104 ARG P CA 1 
ATOM 964  C CA . ASP J 1  105 ? -111.995 101.934 76.740  1.00 344.04 ? 105 ASP P CA 1 
ATOM 965  C CA . ARG J 1  106 ? -110.786 98.549  77.968  1.00 308.47 ? 106 ARG P CA 1 
ATOM 966  C CA . LYS J 1  107 ? -108.246 98.533  75.127  1.00 231.90 ? 107 LYS P CA 1 
ATOM 967  C CA . ARG J 1  108 ? -106.448 101.764 76.010  1.00 306.78 ? 108 ARG P CA 1 
ATOM 968  C CA . GLU J 1  109 ? -106.778 100.670 79.637  1.00 309.60 ? 109 GLU P CA 1 
ATOM 969  C CA . LYS J 1  110 ? -104.839 97.479  78.919  1.00 311.46 ? 110 LYS P CA 1 
ATOM 970  C CA . ARG J 1  111 ? -102.047 99.339  77.126  1.00 278.79 ? 111 ARG P CA 1 
ATOM 971  C CA . LYS J 1  112 ? -101.387 101.907 79.864  1.00 296.70 ? 112 LYS P CA 1 
ATOM 972  C CA . PRO J 1  113 ? -100.251 99.345  82.481  1.00 327.38 ? 113 PRO P CA 1 
ATOM 973  C CA . LYS J 1  114 ? -98.200  97.107  80.179  1.00 246.31 ? 114 LYS P CA 1 
ATOM 974  C CA . HIS K 2  34  ? -81.567  46.116  12.436  1.00 231.41 ? 34  HIS L CA 1 
ATOM 975  C CA . ASN K 2  35  ? -79.429  49.136  13.359  1.00 188.83 ? 35  ASN L CA 1 
ATOM 976  C CA . GLN K 2  36  ? -78.795  52.430  11.613  1.00 235.36 ? 36  GLN L CA 1 
ATOM 977  C CA . PRO K 2  37  ? -75.559  54.474  11.665  1.00 247.44 ? 37  PRO L CA 1 
ATOM 978  C CA . TYR K 2  38  ? -74.098  57.897  10.875  1.00 257.34 ? 38  TYR L CA 1 
ATOM 979  C CA . CYS K 2  39  ? -75.373  61.299  9.620   1.00 243.17 ? 39  CYS L CA 1 
ATOM 980  C CA . GLY K 2  40  ? -75.651  63.550  6.624   1.00 292.00 ? 40  GLY L CA 1 
ATOM 981  C CA . ILE K 2  41  ? -72.330  64.573  8.098   1.00 219.67 ? 41  ILE L CA 1 
ATOM 982  C CA . ALA K 2  42  ? -72.479  67.983  6.483   1.00 249.34 ? 42  ALA L CA 1 
ATOM 983  C CA . PRO K 2  43  ? -72.666  70.162  9.561   1.00 236.36 ? 43  PRO L CA 1 
ATOM 984  C CA . TYR K 2  44  ? -70.453  69.602  12.586  1.00 261.74 ? 44  TYR L CA 1 
ATOM 985  C CA . ILE K 2  45  ? -69.137  73.093  13.138  1.00 283.55 ? 45  ILE L CA 1 
ATOM 986  C CA . ARG K 2  46  ? -67.159  74.236  10.103  1.00 282.71 ? 46  ARG L CA 1 
ATOM 987  C CA . GLU K 2  47  ? -64.093  76.485  10.279  1.00 253.00 ? 47  GLU L CA 1 
ATOM 988  C CA . PHE K 2  48  ? -65.449  78.652  13.094  1.00 256.29 ? 48  PHE L CA 1 
ATOM 989  C CA . GLU K 2  49  ? -65.096  75.795  15.596  1.00 302.32 ? 49  GLU L CA 1 
ATOM 990  C CA . ASP K 2  50  ? -61.325  76.131  15.279  1.00 389.39 ? 50  ASP L CA 1 
ATOM 991  C CA . PRO K 2  51  ? -61.381  79.565  16.951  1.00 367.44 ? 51  PRO L CA 1 
ATOM 992  C CA . ARG K 2  52  ? -64.133  78.507  19.364  1.00 278.51 ? 52  ARG L CA 1 
ATOM 993  C CA . ASP K 2  53  ? -61.838  75.610  20.269  1.00 362.85 ? 53  ASP L CA 1 
ATOM 994  C CA . ALA K 2  54  ? -58.882  77.808  21.266  1.00 334.02 ? 54  ALA L CA 1 
ATOM 995  C CA . PRO K 2  55  ? -60.014  78.662  24.843  1.00 351.79 ? 55  PRO L CA 1 
ATOM 996  C CA . PRO K 2  56  ? -60.540  75.007  25.972  1.00 351.76 ? 56  PRO L CA 1 
ATOM 997  C CA . PRO K 2  57  ? -56.910  73.758  25.655  1.00 330.08 ? 57  PRO L CA 1 
ATOM 998  C CA . THR K 2  58  ? -55.637  76.154  28.350  1.00 355.20 ? 58  THR L CA 1 
ATOM 999  C CA . ARG K 2  59  ? -58.459  75.370  30.789  1.00 283.05 ? 59  ARG L CA 1 
ATOM 1000 C CA . ALA K 2  60  ? -56.301  73.111  32.982  1.00 261.81 ? 60  ALA L CA 1 
ATOM 1001 C CA . GLU K 2  61  ? -53.371  73.942  35.273  1.00 219.44 ? 61  GLU L CA 1 
ATOM 1002 C CA . THR K 2  62  ? -52.762  71.075  37.801  1.00 255.57 ? 62  THR L CA 1 
ATOM 1003 C CA . ARG K 2  63  ? -49.080  71.798  38.472  1.00 271.80 ? 63  ARG L CA 1 
ATOM 1004 C CA . GLU K 2  64  ? -48.750  74.872  36.277  1.00 265.99 ? 64  GLU L CA 1 
ATOM 1005 C CA . GLU K 2  65  ? -50.274  77.112  38.948  1.00 300.91 ? 65  GLU L CA 1 
ATOM 1006 C CA . ARG K 2  66  ? -47.830  76.080  41.680  1.00 263.22 ? 66  ARG L CA 1 
ATOM 1007 C CA . MET K 2  67  ? -44.736  75.917  39.467  1.00 250.85 ? 67  MET L CA 1 
ATOM 1008 C CA . GLU K 2  68  ? -45.528  79.236  37.774  1.00 310.37 ? 68  GLU L CA 1 
ATOM 1009 C CA . ARG K 2  69  ? -45.897  80.993  41.126  1.00 281.48 ? 69  ARG L CA 1 
ATOM 1010 C CA . LYS K 2  70  ? -42.438  79.731  42.040  1.00 236.86 ? 70  LYS L CA 1 
ATOM 1011 C CA . ARG K 2  71  ? -40.845  80.804  38.752  1.00 257.69 ? 71  ARG L CA 1 
ATOM 1012 C CA . ARG K 2  72  ? -42.769  84.074  38.387  1.00 257.60 ? 72  ARG L CA 1 
ATOM 1013 C CA . GLU K 2  73  ? -42.268  85.657  41.807  1.00 311.34 ? 73  GLU L CA 1 
ATOM 1014 C CA . LYS K 2  74  ? -38.705  84.538  42.530  1.00 249.38 ? 74  LYS L CA 1 
ATOM 1015 C CA . ILE K 2  75  ? -37.479  85.387  39.027  1.00 252.00 ? 75  ILE L CA 1 
ATOM 1016 C CA . GLU K 2  76  ? -38.974  88.882  39.228  1.00 260.74 ? 76  GLU L CA 1 
ATOM 1017 C CA . ARG K 2  77  ? -36.979  89.494  42.404  1.00 249.80 ? 77  ARG L CA 1 
ATOM 1018 C CA . ARG K 2  78  ? -33.953  88.224  40.487  1.00 274.13 ? 78  ARG L CA 1 
ATOM 1019 C CA . GLN K 2  79  ? -34.769  90.737  37.754  1.00 284.07 ? 79  GLN L CA 1 
ATOM 1020 C CA . GLN K 2  80  ? -35.052  93.744  40.057  1.00 272.67 ? 80  GLN L CA 1 
ATOM 1021 C CA . GLU K 2  81  ? -31.839  92.310  41.486  1.00 309.97 ? 81  GLU L CA 1 
ATOM 1022 C CA . VAL K 2  82  ? -30.163  92.889  38.122  1.00 271.01 ? 82  VAL L CA 1 
ATOM 1023 C CA . GLU K 2  83  ? -31.023  96.565  38.522  1.00 279.93 ? 83  GLU L CA 1 
ATOM 1024 C CA . THR K 2  84  ? -29.411  96.889  41.946  1.00 267.35 ? 84  THR L CA 1 
ATOM 1025 C CA . GLU K 2  85  ? -26.465  94.754  40.793  1.00 254.40 ? 85  GLU L CA 1 
ATOM 1026 C CA . LEU K 2  86  ? -25.090  97.208  38.211  1.00 270.54 ? 86  LEU L CA 1 
ATOM 1027 C CA . LYS K 2  87  ? -25.958  99.749  40.893  1.00 267.00 ? 87  LYS L CA 1 
ATOM 1028 C CA . MET K 2  88  ? -23.669  97.934  43.330  1.00 300.58 ? 88  MET L CA 1 
ATOM 1029 C CA . TRP K 2  89  ? -20.952  95.848  41.644  1.00 328.05 ? 89  TRP L CA 1 
ATOM 1030 C CA . ASP K 2  90  ? -18.161  97.396  39.558  1.00 314.00 ? 90  ASP L CA 1 
ATOM 1031 C CA . PRO K 2  91  ? -14.367  98.005  39.464  1.00 292.37 ? 91  PRO L CA 1 
ATOM 1032 C CA . HIS K 2  92  ? -14.898  100.651 42.138  1.00 276.58 ? 92  HIS L CA 1 
ATOM 1033 C CA . ASN K 2  93  ? -15.569  97.840  44.589  1.00 351.91 ? 93  ASN L CA 1 
ATOM 1034 C CA . ASP K 2  94  ? -11.857  97.107  44.291  1.00 363.76 ? 94  ASP L CA 1 
ATOM 1035 C CA . PRO K 2  95  ? -10.454  100.437 45.590  1.00 327.91 ? 95  PRO L CA 1 
ATOM 1036 C CA . ASN K 2  96  ? -13.129  101.645 48.037  1.00 272.53 ? 96  ASN L CA 1 
ATOM 1037 C CA . ALA K 2  97  ? -12.975  98.075  49.335  1.00 305.80 ? 97  ALA L CA 1 
ATOM 1038 C CA . GLN K 2  98  ? -9.852   96.931  51.135  1.00 359.66 ? 98  GLN L CA 1 
ATOM 1039 C CA . GLY K 2  99  ? -7.421   95.175  48.831  1.00 344.23 ? 99  GLY L CA 1 
ATOM 1040 C CA . ASP K 2  100 ? -6.786   96.336  45.285  1.00 334.46 ? 100 ASP L CA 1 
ATOM 1041 C CA . ALA K 2  101 ? -3.067   95.696  44.821  1.00 276.03 ? 101 ALA L CA 1 
ATOM 1042 C CA . PHE K 2  102 ? -2.425   92.629  42.668  1.00 255.01 ? 102 PHE L CA 1 
ATOM 1043 C CA . LYS K 2  103 ? -4.361   89.687  44.092  1.00 191.44 ? 103 LYS L CA 1 
ATOM 1044 C CA . THR K 2  104 ? -5.379   89.922  47.760  1.00 270.64 ? 104 THR L CA 1 
ATOM 1045 C CA . LEU K 2  105 ? -5.817   86.504  49.389  1.00 261.25 ? 105 LEU L CA 1 
ATOM 1046 C CA . PHE K 2  106 ? -9.488   86.053  50.328  1.00 274.41 ? 106 PHE L CA 1 
ATOM 1047 C CA . VAL K 2  107 ? -10.062  84.421  53.723  1.00 249.27 ? 107 VAL L CA 1 
ATOM 1048 C CA . ALA K 2  108 ? -13.613  83.386  54.575  1.00 268.87 ? 108 ALA L CA 1 
ATOM 1049 C CA . ARG K 2  109 ? -15.325  81.251  57.234  1.00 271.30 ? 109 ARG L CA 1 
ATOM 1050 C CA . VAL K 2  110 ? -13.821  82.876  60.335  1.00 294.03 ? 110 VAL L CA 1 
ATOM 1051 C CA . ASN K 2  111 ? -15.457  82.905  63.769  1.00 287.62 ? 111 ASN L CA 1 
ATOM 1052 C CA . TYR K 2  112 ? -18.075  85.526  64.647  1.00 260.87 ? 112 TYR L CA 1 
ATOM 1053 C CA . ASP K 2  113 ? -15.297  86.716  66.952  1.00 286.75 ? 113 ASP L CA 1 
ATOM 1054 C CA . THR K 2  114 ? -11.688  87.407  65.963  1.00 284.72 ? 114 THR L CA 1 
ATOM 1055 C CA . THR K 2  115 ? -9.076   90.173  65.714  1.00 291.14 ? 115 THR L CA 1 
ATOM 1056 C CA . GLU K 2  116 ? -6.425   91.393  63.271  1.00 294.49 ? 116 GLU L CA 1 
ATOM 1057 C CA . SER K 2  117 ? -3.888   90.345  65.900  1.00 315.60 ? 117 SER L CA 1 
ATOM 1058 C CA . LYS K 2  118 ? -4.864   86.697  65.514  1.00 253.04 ? 118 LYS L CA 1 
ATOM 1059 C CA . LEU K 2  119 ? -5.052   86.859  61.714  1.00 242.11 ? 119 LEU L CA 1 
ATOM 1060 C CA . ARG K 2  120 ? -1.911   88.930  61.119  1.00 255.38 ? 120 ARG L CA 1 
ATOM 1061 C CA . ARG K 2  121 ? -0.177   86.419  63.384  1.00 271.49 ? 121 ARG L CA 1 
ATOM 1062 C CA . GLU K 2  122 ? -1.206   83.225  61.583  1.00 261.42 ? 122 GLU L CA 1 
ATOM 1063 C CA . PHE K 2  123 ? -1.138   84.346  57.950  1.00 286.62 ? 123 PHE L CA 1 
ATOM 1064 C CA . GLU K 2  124 ? 2.161    86.196  58.285  1.00 245.08 ? 124 GLU L CA 1 
ATOM 1065 C CA . VAL K 2  125 ? 3.643    82.903  59.465  1.00 277.94 ? 125 VAL L CA 1 
ATOM 1066 C CA . TYR K 2  126 ? 2.807    81.865  55.904  1.00 267.80 ? 126 TYR L CA 1 
ATOM 1067 C CA . GLY K 2  127 ? 4.505    84.882  54.370  1.00 199.08 ? 127 GLY L CA 1 
ATOM 1068 C CA . PRO K 2  128 ? 5.100    88.686  54.343  1.00 232.69 ? 128 PRO L CA 1 
ATOM 1069 C CA . ILE K 2  129 ? 1.889    90.634  54.948  1.00 275.54 ? 129 ILE L CA 1 
ATOM 1070 C CA . LYS K 2  130 ? 1.439    93.884  53.039  1.00 256.13 ? 130 LYS L CA 1 
ATOM 1071 C CA . ARG K 2  131 ? -2.126   94.800  54.012  1.00 260.19 ? 131 ARG L CA 1 
ATOM 1072 C CA . ILE K 2  132 ? -5.151   93.461  55.901  1.00 262.66 ? 132 ILE L CA 1 
ATOM 1073 C CA . HIS K 2  133 ? -8.813   94.397  56.323  1.00 247.55 ? 133 HIS L CA 1 
ATOM 1074 C CA . MET K 2  134 ? -11.883  92.754  57.823  1.00 295.26 ? 134 MET L CA 1 
ATOM 1075 C CA . VAL K 2  135 ? -15.272  93.791  56.449  1.00 281.20 ? 135 VAL L CA 1 
ATOM 1076 C CA . TYR K 2  136 ? -17.949  94.158  59.119  1.00 286.11 ? 136 TYR L CA 1 
ATOM 1077 C CA . SER K 2  137 ? -21.733  93.944  59.151  1.00 288.39 ? 137 SER L CA 1 
ATOM 1078 C CA . LYS K 2  138 ? -23.695  96.602  57.299  1.00 230.52 ? 138 LYS L CA 1 
ATOM 1079 C CA . ARG K 2  139 ? -24.408  97.990  60.772  1.00 267.86 ? 139 ARG L CA 1 
ATOM 1080 C CA . SER K 2  140 ? -23.155  95.605  63.471  1.00 299.34 ? 140 SER L CA 1 
ATOM 1081 C CA . GLY K 2  141 ? -19.569  95.973  64.648  1.00 346.64 ? 141 GLY L CA 1 
ATOM 1082 C CA . LYS K 2  142 ? -19.000  92.218  64.827  1.00 330.17 ? 142 LYS L CA 1 
ATOM 1083 C CA . PRO K 2  143 ? -16.861  90.897  61.927  1.00 339.02 ? 143 PRO L CA 1 
ATOM 1084 C CA . ARG K 2  144 ? -18.898  89.034  59.304  1.00 269.95 ? 144 ARG L CA 1 
ATOM 1085 C CA . GLY K 2  145 ? -16.117  86.531  58.673  1.00 218.44 ? 145 GLY L CA 1 
ATOM 1086 C CA . TYR K 2  146 ? -14.539  87.534  55.363  1.00 243.18 ? 146 TYR L CA 1 
ATOM 1087 C CA . ALA K 2  147 ? -11.354  89.597  55.631  1.00 221.32 ? 147 ALA L CA 1 
ATOM 1088 C CA . PHE K 2  148 ? -9.006   90.700  52.854  1.00 230.57 ? 148 PHE L CA 1 
ATOM 1089 C CA . ILE K 2  149 ? -5.339   89.926  53.508  1.00 231.54 ? 149 ILE L CA 1 
ATOM 1090 C CA . GLU K 2  150 ? -2.665   91.128  51.099  1.00 251.84 ? 150 GLU L CA 1 
ATOM 1091 C CA . TYR K 2  151 ? 0.746    89.716  50.162  1.00 275.19 ? 151 TYR L CA 1 
ATOM 1092 C CA . GLU K 2  152 ? 3.827    91.182  48.471  1.00 286.08 ? 152 GLU L CA 1 
ATOM 1093 C CA . HIS K 2  153 ? 4.704    88.468  45.950  1.00 271.09 ? 153 HIS L CA 1 
ATOM 1094 C CA . GLU K 2  154 ? 2.270    86.356  43.938  1.00 305.50 ? 154 GLU L CA 1 
ATOM 1095 C CA . ARG K 2  155 ? 4.278    83.296  44.951  1.00 264.42 ? 155 ARG L CA 1 
ATOM 1096 C CA . ASP K 2  156 ? 3.821    84.441  48.552  1.00 285.89 ? 156 ASP L CA 1 
ATOM 1097 C CA . MET K 2  157 ? 0.033    84.480  48.204  1.00 266.43 ? 157 MET L CA 1 
ATOM 1098 C CA . HIS K 2  158 ? 0.100    80.963  46.764  1.00 248.56 ? 158 HIS L CA 1 
ATOM 1099 C CA . SER K 2  159 ? 2.368    79.818  49.592  1.00 275.33 ? 159 SER L CA 1 
ATOM 1100 C CA . ALA K 2  160 ? -0.162   80.985  52.174  1.00 249.12 ? 160 ALA L CA 1 
ATOM 1101 C CA . TYR K 2  161 ? -3.061   79.731  50.050  1.00 230.85 ? 161 TYR L CA 1 
ATOM 1102 C CA . LYS K 2  162 ? -1.581   76.238  49.660  1.00 252.99 ? 162 LYS L CA 1 
ATOM 1103 C CA . HIS K 2  163 ? -0.627   75.509  53.274  1.00 299.01 ? 163 HIS L CA 1 
ATOM 1104 C CA . ALA K 2  164 ? -3.744   77.246  54.628  1.00 275.79 ? 164 ALA L CA 1 
ATOM 1105 C CA . ASP K 2  165 ? -6.333   74.985  52.977  1.00 295.22 ? 165 ASP L CA 1 
ATOM 1106 C CA . GLY K 2  166 ? -9.325   74.850  55.313  1.00 251.01 ? 166 GLY L CA 1 
ATOM 1107 C CA . LYS K 2  167 ? -7.148   74.444  58.407  1.00 266.37 ? 167 LYS L CA 1 
ATOM 1108 C CA . LYS K 2  168 ? -8.433   74.660  61.987  1.00 268.98 ? 168 LYS L CA 1 
ATOM 1109 C CA . ILE K 2  169 ? -8.067   77.995  63.795  1.00 260.81 ? 169 ILE L CA 1 
ATOM 1110 C CA . ASP K 2  170 ? -9.902   79.734  66.643  1.00 223.86 ? 170 ASP L CA 1 
ATOM 1111 C CA . GLY K 2  171 ? -11.974  76.562  66.948  1.00 234.32 ? 171 GLY L CA 1 
ATOM 1112 C CA . ARG K 2  172 ? -13.503  76.529  63.459  1.00 254.84 ? 172 ARG L CA 1 
ATOM 1113 C CA . ARG K 2  173 ? -12.042  75.552  60.088  1.00 266.69 ? 173 ARG L CA 1 
ATOM 1114 C CA . VAL K 2  174 ? -11.519  78.431  57.666  1.00 234.38 ? 174 VAL L CA 1 
ATOM 1115 C CA . LEU K 2  175 ? -11.545  78.231  53.866  1.00 223.96 ? 175 LEU L CA 1 
ATOM 1116 C CA . VAL K 2  176 ? -9.513   80.637  51.722  1.00 214.89 ? 176 VAL L CA 1 
ATOM 1117 C CA . ASP K 2  177 ? -9.040   81.605  48.071  1.00 224.09 ? 177 ASP L CA 1 
ATOM 1118 C CA . VAL K 2  178 ? -8.200   84.620  45.907  1.00 239.72 ? 178 VAL L CA 1 
ATOM 1119 C CA . GLU K 2  179 ? -10.401  85.594  43.006  1.00 266.65 ? 179 GLU L CA 1 
ATOM 1120 C CA . ARG K 2  180 ? -12.538  87.832  40.848  1.00 205.19 ? 180 ARG L CA 1 
ATOM 1121 C CA . GLY K 2  181 ? -13.295  87.303  37.170  1.00 218.36 ? 181 GLY L CA 1 
ATOM 1122 C CA . ILE L 3  3   ? -66.295  39.120  51.613  1.00 212.86 ? 3   ILE W CA 1 
ATOM 1123 C CA . GLY L 3  4   ? -69.850  39.550  50.343  1.00 256.94 ? 4   GLY W CA 1 
ATOM 1124 C CA . VAL L 3  5   ? -72.752  39.477  52.809  1.00 211.96 ? 5   VAL W CA 1 
ATOM 1125 C CA . PRO L 3  6   ? -75.649  38.077  50.712  1.00 210.75 ? 6   PRO W CA 1 
ATOM 1126 C CA . ILE L 3  7   ? -73.392  35.560  48.960  1.00 185.65 ? 7   ILE W CA 1 
ATOM 1127 C CA . LYS L 3  8   ? -72.735  34.072  52.400  1.00 224.92 ? 8   LYS W CA 1 
ATOM 1128 C CA . VAL L 3  9   ? -76.457  33.372  52.792  1.00 193.11 ? 9   VAL W CA 1 
ATOM 1129 C CA . LEU L 3  10  ? -76.652  31.227  49.655  1.00 219.11 ? 10  LEU W CA 1 
ATOM 1130 C CA . HIS L 3  11  ? -73.989  28.941  51.134  1.00 226.81 ? 11  HIS W CA 1 
ATOM 1131 C CA . GLU L 3  12  ? -75.912  28.860  54.412  1.00 246.65 ? 12  GLU W CA 1 
ATOM 1132 C CA . ALA L 3  13  ? -78.846  27.675  52.294  1.00 186.87 ? 13  ALA W CA 1 
ATOM 1133 C CA . GLU L 3  14  ? -76.942  24.773  50.719  1.00 225.77 ? 14  GLU W CA 1 
ATOM 1134 C CA . GLY L 3  15  ? -78.716  21.475  51.286  1.00 205.39 ? 15  GLY W CA 1 
ATOM 1135 C CA . HIS L 3  16  ? -82.197  23.000  51.260  1.00 239.86 ? 16  HIS W CA 1 
ATOM 1136 C CA . ILE L 3  17  ? -85.173  23.723  49.002  1.00 228.39 ? 17  ILE W CA 1 
ATOM 1137 C CA . VAL L 3  18  ? -84.766  26.794  46.772  1.00 203.29 ? 18  VAL W CA 1 
ATOM 1138 C CA . THR L 3  19  ? -85.903  28.112  43.388  1.00 201.49 ? 19  THR W CA 1 
ATOM 1139 C CA . CYS L 3  20  ? -83.860  29.671  40.571  1.00 228.22 ? 20  CYS W CA 1 
ATOM 1140 C CA . GLU L 3  21  ? -84.704  31.921  37.613  1.00 208.94 ? 21  GLU W CA 1 
ATOM 1141 C CA . THR L 3  22  ? -82.297  32.313  34.678  1.00 188.05 ? 22  THR W CA 1 
ATOM 1142 C CA . ASN L 3  23  ? -81.991  35.128  32.131  1.00 246.43 ? 23  ASN W CA 1 
ATOM 1143 C CA . THR L 3  24  ? -83.817  32.997  29.577  1.00 229.02 ? 24  THR W CA 1 
ATOM 1144 C CA . GLY L 3  25  ? -86.838  32.936  31.870  1.00 200.84 ? 25  GLY W CA 1 
ATOM 1145 C CA . GLU L 3  26  ? -86.893  29.320  33.055  1.00 221.38 ? 26  GLU W CA 1 
ATOM 1146 C CA . VAL L 3  27  ? -87.478  28.633  36.748  1.00 195.67 ? 27  VAL W CA 1 
ATOM 1147 C CA . TYR L 3  28  ? -85.757  25.731  38.527  1.00 201.63 ? 28  TYR W CA 1 
ATOM 1148 C CA . ARG L 3  29  ? -87.017  24.534  41.911  1.00 253.71 ? 29  ARG W CA 1 
ATOM 1149 C CA . GLY L 3  30  ? -85.050  21.894  43.790  1.00 236.10 ? 30  GLY W CA 1 
ATOM 1150 C CA . LYS L 3  31  ? -82.524  21.214  46.537  1.00 217.79 ? 31  LYS W CA 1 
ATOM 1151 C CA . LEU L 3  32  ? -79.301  23.201  46.211  1.00 221.65 ? 32  LEU W CA 1 
ATOM 1152 C CA . ILE L 3  33  ? -76.415  20.782  46.690  1.00 227.53 ? 33  ILE W CA 1 
ATOM 1153 C CA . GLU L 3  34  ? -73.398  23.079  46.354  1.00 229.44 ? 34  GLU W CA 1 
ATOM 1154 C CA . ALA L 3  35  ? -73.210  26.777  45.505  1.00 197.06 ? 35  ALA W CA 1 
ATOM 1155 C CA . GLU L 3  36  ? -70.195  29.049  45.039  1.00 248.69 ? 36  GLU W CA 1 
ATOM 1156 C CA . ASP L 3  37  ? -69.109  32.635  45.672  1.00 232.19 ? 37  ASP W CA 1 
ATOM 1157 C CA . ASN L 3  38  ? -69.624  33.333  41.962  1.00 218.89 ? 38  ASN W CA 1 
ATOM 1158 C CA . MET L 3  39  ? -73.229  32.105  41.966  1.00 179.43 ? 39  MET W CA 1 
ATOM 1159 C CA . ASN L 3  40  ? -72.575  28.722  40.345  1.00 221.77 ? 40  ASN W CA 1 
ATOM 1160 C CA . CYS L 3  41  ? -75.075  26.150  41.590  1.00 213.75 ? 41  CYS W CA 1 
ATOM 1161 C CA . GLN L 3  42  ? -75.594  22.392  41.410  1.00 254.74 ? 42  GLN W CA 1 
ATOM 1162 C CA . MET L 3  43  ? -79.089  20.995  42.028  1.00 226.59 ? 43  MET W CA 1 
ATOM 1163 C CA . SER L 3  44  ? -81.037  17.723  42.067  1.00 242.48 ? 44  SER W CA 1 
ATOM 1164 C CA . ASN L 3  45  ? -84.760  16.918  42.182  1.00 242.30 ? 45  ASN W CA 1 
ATOM 1165 C CA . ILE L 3  46  ? -85.789  20.026  40.263  1.00 243.34 ? 46  ILE W CA 1 
ATOM 1166 C CA . THR L 3  47  ? -88.926  21.528  38.735  1.00 241.11 ? 47  THR W CA 1 
ATOM 1167 C CA . VAL L 3  48  ? -88.320  23.599  35.615  1.00 220.25 ? 48  VAL W CA 1 
ATOM 1168 C CA . THR L 3  49  ? -91.356  25.711  34.779  1.00 217.92 ? 49  THR W CA 1 
ATOM 1169 C CA . TYR L 3  50  ? -90.502  27.057  31.328  1.00 211.22 ? 50  TYR W CA 1 
ATOM 1170 C CA . ARG L 3  51  ? -91.829  30.325  29.923  1.00 244.82 ? 51  ARG W CA 1 
ATOM 1171 C CA . ASP L 3  52  ? -94.953  28.811  28.367  1.00 252.14 ? 52  ASP W CA 1 
ATOM 1172 C CA . GLY L 3  53  ? -95.669  26.962  31.598  1.00 209.61 ? 53  GLY W CA 1 
ATOM 1173 C CA . ARG L 3  54  ? -94.734  23.354  30.878  1.00 228.29 ? 54  ARG W CA 1 
ATOM 1174 C CA . VAL L 3  55  ? -93.015  21.691  33.836  1.00 239.57 ? 55  VAL W CA 1 
ATOM 1175 C CA . ALA L 3  56  ? -90.240  19.188  33.127  1.00 276.68 ? 56  ALA W CA 1 
ATOM 1176 C CA . GLN L 3  57  ? -88.564  16.755  35.530  1.00 229.28 ? 57  GLN W CA 1 
ATOM 1177 C CA . LEU L 3  58  ? -84.787  16.236  35.667  1.00 214.99 ? 58  LEU W CA 1 
ATOM 1178 C CA . GLU L 3  59  ? -82.557  14.454  38.181  1.00 254.48 ? 59  GLU W CA 1 
ATOM 1179 C CA . GLN L 3  60  ? -79.834  17.070  38.569  1.00 237.48 ? 60  GLN W CA 1 
ATOM 1180 C CA . VAL L 3  61  ? -78.529  20.087  36.679  1.00 241.74 ? 61  VAL W CA 1 
ATOM 1181 C CA . TYR L 3  62  ? -75.882  22.796  36.890  1.00 216.13 ? 62  TYR W CA 1 
ATOM 1182 C CA . ILE L 3  63  ? -76.725  26.491  36.617  1.00 193.70 ? 63  ILE W CA 1 
ATOM 1183 C CA . ARG L 3  64  ? -74.405  29.315  35.554  1.00 216.92 ? 64  ARG W CA 1 
ATOM 1184 C CA . GLY L 3  65  ? -74.479  32.373  37.802  1.00 152.55 ? 65  GLY W CA 1 
ATOM 1185 C CA . SER L 3  66  ? -73.953  34.700  34.849  1.00 190.78 ? 66  SER W CA 1 
ATOM 1186 C CA . LYS L 3  67  ? -77.581  34.004  33.942  1.00 202.03 ? 67  LYS W CA 1 
ATOM 1187 C CA . ILE L 3  68  ? -79.173  33.731  37.392  1.00 163.20 ? 68  ILE W CA 1 
ATOM 1188 C CA . ARG L 3  69  ? -81.713  36.539  37.690  1.00 192.11 ? 69  ARG W CA 1 
ATOM 1189 C CA . PHE L 3  70  ? -82.444  35.745  41.342  1.00 203.78 ? 70  PHE W CA 1 
ATOM 1190 C CA . LEU L 3  71  ? -82.963  32.864  43.770  1.00 187.35 ? 71  LEU W CA 1 
ATOM 1191 C CA . ILE L 3  72  ? -85.655  32.182  46.357  1.00 193.00 ? 72  ILE W CA 1 
ATOM 1192 C CA . LEU L 3  73  ? -84.259  31.022  49.708  1.00 236.40 ? 73  LEU W CA 1 
ATOM 1193 C CA . PRO L 3  74  ? -85.875  29.213  52.703  1.00 220.19 ? 74  PRO W CA 1 
ATOM 1194 C CA . ASP L 3  75  ? -87.794  31.214  55.300  1.00 233.73 ? 75  ASP W CA 1 
ATOM 1195 C CA . MET L 3  76  ? -86.255  29.361  58.244  1.00 269.08 ? 76  MET W CA 1 
ATOM 1196 C CA . LEU L 3  77  ? -83.087  31.165  57.148  1.00 226.76 ? 77  LEU W CA 1 
ATOM 1197 C CA . LYS L 3  78  ? -84.584  34.668  57.062  1.00 259.16 ? 78  LYS W CA 1 
ATOM 1198 C CA . ASN L 3  79  ? -85.933  34.481  60.604  1.00 291.69 ? 79  ASN W CA 1 
ATOM 1199 C CA . ALA L 3  80  ? -82.784  32.645  61.693  1.00 249.64 ? 80  ALA W CA 1 
ATOM 1200 C CA . PRO L 3  81  ? -80.449  35.556  62.567  1.00 276.62 ? 81  PRO W CA 1 
ATOM 1201 C CA . MET L 3  82  ? -77.102  34.353  61.237  1.00 251.01 ? 82  MET W CA 1 
ATOM 1202 C CA . LEU L 3  83  ? -74.903  37.423  60.690  1.00 257.79 ? 83  LEU W CA 1 
ATOM 1203 C CA . LYS L 3  84  ? -77.469  38.762  58.212  1.00 229.57 ? 84  LYS W CA 1 
ATOM 1204 C CA . SER L 3  85  ? -79.268  39.819  61.393  1.00 250.81 ? 85  SER W CA 1 
ATOM 1205 C CA . MET L 3  86  ? -76.245  41.467  63.038  1.00 327.22 ? 86  MET W CA 1 
ATOM 1206 C CA . LYS L 3  87  ? -77.218  44.499  60.968  1.00 313.65 ? 87  LYS W CA 1 
ATOM 1207 C CA . ASN L 3  88  ? -80.666  44.311  62.594  1.00 364.57 ? 88  ASN W CA 1 
ATOM 1208 C CA . LYS L 3  89  ? -78.995  43.423  65.912  1.00 378.95 ? 89  LYS W CA 1 
ATOM 1209 C CA . ASN L 3  90  ? -78.770  47.128  66.760  1.00 354.29 ? 90  ASN W CA 1 
ATOM 1210 C CA . GLN L 3  91  ? -82.535  47.328  67.343  1.00 374.44 ? 91  GLN W CA 1 
ATOM 1211 C CA . GLY L 3  92  ? -82.999  43.956  69.029  1.00 392.02 ? 92  GLY W CA 1 
ATOM 1212 C CA . SER L 3  93  ? -79.686  43.961  70.886  1.00 359.46 ? 93  SER W CA 1 
ATOM 1213 C CA . GLY L 3  94  ? -79.812  40.159  70.772  1.00 239.57 ? 94  GLY W CA 1 
ATOM 1214 C CA . LYS M 4  5   ? -71.230  51.723  49.872  1.00 286.62 ? 5   LYS Q CA 1 
ATOM 1215 C CA . SER M 4  6   ? -72.228  54.193  52.578  1.00 288.17 ? 6   SER Q CA 1 
ATOM 1216 C CA . SER M 4  7   ? -75.188  56.506  53.204  1.00 279.22 ? 7   SER Q CA 1 
ATOM 1217 C CA . LYS M 4  8   ? -77.794  55.320  50.720  1.00 287.85 ? 8   LYS Q CA 1 
ATOM 1218 C CA . MET M 4  9   ? -76.517  51.856  51.523  1.00 301.02 ? 9   MET Q CA 1 
ATOM 1219 C CA . LEU M 4  10  ? -77.292  52.656  55.150  1.00 255.12 ? 10  LEU Q CA 1 
ATOM 1220 C CA . GLN M 4  11  ? -80.962  53.664  54.825  1.00 250.07 ? 11  GLN Q CA 1 
ATOM 1221 C CA . HIS M 4  12  ? -81.826  50.571  52.765  1.00 350.32 ? 12  HIS Q CA 1 
ATOM 1222 C CA . ILE M 4  13  ? -81.323  48.367  55.830  1.00 304.96 ? 13  ILE Q CA 1 
ATOM 1223 C CA . ASP M 4  14  ? -84.563  47.555  57.660  1.00 298.45 ? 14  ASP Q CA 1 
ATOM 1224 C CA . TYR M 4  15  ? -86.571  49.372  54.985  1.00 260.07 ? 15  TYR Q CA 1 
ATOM 1225 C CA . ARG M 4  16  ? -89.226  48.272  52.486  1.00 236.88 ? 16  ARG Q CA 1 
ATOM 1226 C CA . MET M 4  17  ? -88.073  49.200  48.974  1.00 254.48 ? 17  MET Q CA 1 
ATOM 1227 C CA . ARG M 4  18  ? -88.982  49.268  45.276  1.00 201.30 ? 18  ARG Q CA 1 
ATOM 1228 C CA . CYS M 4  19  ? -86.331  47.778  42.986  1.00 206.15 ? 19  CYS Q CA 1 
ATOM 1229 C CA . ILE M 4  20  ? -87.211  48.173  39.302  1.00 192.21 ? 20  ILE Q CA 1 
ATOM 1230 C CA . LEU M 4  21  ? -85.297  45.597  37.255  1.00 197.98 ? 21  LEU Q CA 1 
ATOM 1231 C CA . GLN M 4  22  ? -83.845  45.931  33.752  1.00 211.94 ? 22  GLN Q CA 1 
ATOM 1232 C CA . ASP M 4  23  ? -86.497  43.528  32.459  1.00 220.23 ? 23  ASP Q CA 1 
ATOM 1233 C CA . GLY M 4  24  ? -89.547  45.512  33.548  1.00 201.09 ? 24  GLY Q CA 1 
ATOM 1234 C CA . ARG M 4  25  ? -90.422  43.726  36.785  1.00 165.28 ? 25  ARG Q CA 1 
ATOM 1235 C CA . ILE M 4  26  ? -90.885  45.754  39.971  1.00 168.26 ? 26  ILE Q CA 1 
ATOM 1236 C CA . PHE M 4  27  ? -89.535  44.334  43.243  1.00 215.70 ? 27  PHE Q CA 1 
ATOM 1237 C CA . ILE M 4  28  ? -91.015  45.235  46.629  1.00 200.59 ? 28  ILE Q CA 1 
ATOM 1238 C CA . GLY M 4  29  ? -90.148  43.438  49.866  1.00 226.57 ? 29  GLY Q CA 1 
ATOM 1239 C CA . THR M 4  30  ? -88.399  43.402  53.241  1.00 264.37 ? 30  THR Q CA 1 
ATOM 1240 C CA . PHE M 4  31  ? -84.736  44.326  52.813  1.00 269.03 ? 31  PHE Q CA 1 
ATOM 1241 C CA . LYS M 4  32  ? -82.043  42.558  54.843  1.00 271.48 ? 32  LYS Q CA 1 
ATOM 1242 C CA . ALA M 4  33  ? -78.550  42.817  53.335  1.00 273.24 ? 33  ALA Q CA 1 
ATOM 1243 C CA . PHE M 4  34  ? -76.610  43.615  50.151  1.00 204.67 ? 34  PHE Q CA 1 
ATOM 1244 C CA . ASP M 4  35  ? -73.032  43.323  48.856  1.00 231.99 ? 35  ASP Q CA 1 
ATOM 1245 C CA . LYS M 4  36  ? -70.504  45.412  46.924  1.00 215.94 ? 36  LYS Q CA 1 
ATOM 1246 C CA . HIS M 4  37  ? -72.048  43.756  43.864  1.00 206.72 ? 37  HIS Q CA 1 
ATOM 1247 C CA . MET M 4  38  ? -75.414  45.345  44.721  1.00 199.06 ? 38  MET Q CA 1 
ATOM 1248 C CA . ASN M 4  39  ? -77.126  41.963  44.878  1.00 205.06 ? 39  ASN Q CA 1 
ATOM 1249 C CA . LEU M 4  40  ? -80.103  42.232  47.220  1.00 210.96 ? 40  LEU Q CA 1 
ATOM 1250 C CA . ILE M 4  41  ? -81.678  40.012  49.864  1.00 214.71 ? 41  ILE Q CA 1 
ATOM 1251 C CA . LEU M 4  42  ? -85.416  40.574  50.279  1.00 224.31 ? 42  LEU Q CA 1 
ATOM 1252 C CA . CYS M 4  43  ? -87.945  38.589  52.311  1.00 274.83 ? 43  CYS Q CA 1 
ATOM 1253 C CA . ASP M 4  44  ? -91.704  38.406  51.733  1.00 268.88 ? 44  ASP Q CA 1 
ATOM 1254 C CA . CYS M 4  45  ? -91.082  40.327  48.512  1.00 220.48 ? 45  CYS Q CA 1 
ATOM 1255 C CA . ASP M 4  46  ? -93.727  40.295  45.776  1.00 232.34 ? 46  ASP Q CA 1 
ATOM 1256 C CA . GLU M 4  47  ? -93.193  40.671  42.036  1.00 206.95 ? 47  GLU Q CA 1 
ATOM 1257 C CA . PHE M 4  48  ? -95.515  43.187  40.389  1.00 190.14 ? 48  PHE Q CA 1 
ATOM 1258 C CA . ARG M 4  49  ? -97.819  42.640  37.427  1.00 255.23 ? 49  ARG Q CA 1 
ATOM 1259 C CA . LYS M 4  50  ? -100.036 45.743  37.288  1.00 292.02 ? 50  LYS Q CA 1 
ATOM 1260 C CA . ILE M 4  51  ? -103.419 45.545  35.557  1.00 327.43 ? 51  ILE Q CA 1 
ATOM 1261 C CA . LYS M 4  52  ? -101.698 45.989  32.182  1.00 285.12 ? 52  LYS Q CA 1 
ATOM 1262 C CA . PRO M 4  53  ? -103.141 44.462  28.977  1.00 245.73 ? 53  PRO Q CA 1 
ATOM 1263 C CA . LYS M 4  64  ? -98.577  34.157  41.852  1.00 252.89 ? 64  LYS Q CA 1 
ATOM 1264 C CA . ARG M 4  65  ? -97.117  37.392  43.240  1.00 268.32 ? 65  ARG Q CA 1 
ATOM 1265 C CA . VAL M 4  66  ? -95.877  35.711  46.411  1.00 272.24 ? 66  VAL Q CA 1 
ATOM 1266 C CA . LEU M 4  67  ? -92.110  35.212  46.372  1.00 261.50 ? 67  LEU Q CA 1 
ATOM 1267 C CA . GLY M 4  68  ? -90.856  35.489  49.928  1.00 230.76 ? 68  GLY Q CA 1 
ATOM 1268 C CA . LEU M 4  69  ? -87.074  35.522  50.204  1.00 216.91 ? 69  LEU Q CA 1 
ATOM 1269 C CA . VAL M 4  70  ? -85.459  36.624  46.946  1.00 255.66 ? 70  VAL Q CA 1 
ATOM 1270 C CA . LEU M 4  71  ? -81.739  36.841  46.237  1.00 203.13 ? 71  LEU Q CA 1 
ATOM 1271 C CA . LEU M 4  72  ? -81.632  39.475  43.507  1.00 211.09 ? 72  LEU Q CA 1 
ATOM 1272 C CA . ARG M 4  73  ? -78.432  39.478  41.461  1.00 213.02 ? 73  ARG Q CA 1 
ATOM 1273 C CA . GLY M 4  74  ? -77.075  42.958  40.781  1.00 186.85 ? 74  GLY Q CA 1 
ATOM 1274 C CA . GLU M 4  75  ? -76.564  42.460  37.043  1.00 219.51 ? 75  GLU Q CA 1 
ATOM 1275 C CA . ASN M 4  76  ? -80.382  42.265  36.855  1.00 225.42 ? 76  ASN Q CA 1 
ATOM 1276 C CA . LEU M 4  77  ? -81.165  45.377  38.950  1.00 159.43 ? 77  LEU Q CA 1 
ATOM 1277 C CA . VAL M 4  78  ? -81.422  49.076  38.040  1.00 159.17 ? 78  VAL Q CA 1 
ATOM 1278 C CA . SER M 4  79  ? -83.286  50.952  40.820  1.00 174.60 ? 79  SER Q CA 1 
ATOM 1279 C CA . MET M 4  80  ? -84.293  51.268  44.494  1.00 215.40 ? 80  MET Q CA 1 
ATOM 1280 C CA . THR M 4  81  ? -86.825  53.561  46.204  1.00 226.06 ? 81  THR Q CA 1 
ATOM 1281 C CA . VAL M 4  82  ? -88.433  53.731  49.657  1.00 268.92 ? 82  VAL Q CA 1 
ATOM 1282 C CA . GLU M 4  83  ? -91.884  52.233  50.253  1.00 249.89 ? 83  GLU Q CA 1 
ATOM 1283 C CA . GLY M 4  84  ? -92.018  52.721  54.014  1.00 262.28 ? 84  GLY Q CA 1 
ATOM 1284 C CA . PRO M 4  85  ? -90.763  51.707  57.516  1.00 257.15 ? 85  PRO Q CA 1 
ATOM 1285 C CA . PRO M 4  86  ? -90.047  48.122  58.701  1.00 250.48 ? 86  PRO Q CA 1 
ATOM 1286 C CA . PRO M 4  87  ? -92.761  46.492  60.833  1.00 261.87 ? 87  PRO Q CA 1 
ATOM 1287 C CA . LYS M 4  88  ? -92.053  46.783  64.561  1.00 270.16 ? 88  LYS Q CA 1 
ATOM 1288 C CA . ASP M 4  89  ? -94.338  45.392  67.268  1.00 296.38 ? 89  ASP Q CA 1 
ATOM 1289 C CA . THR M 4  90  ? -93.169  46.288  70.784  1.00 274.46 ? 90  THR Q CA 1 
ATOM 1290 C CA . MET N 5  1   ? -57.743  58.577  34.298  1.00 231.89 ? 1   MET U CA 1 
ATOM 1291 C CA . LYS N 5  2   ? -60.919  57.495  36.144  1.00 237.05 ? 2   LYS U CA 1 
ATOM 1292 C CA . LEU N 5  3   ? -62.977  60.628  35.541  1.00 196.46 ? 3   LEU U CA 1 
ATOM 1293 C CA . VAL N 5  4   ? -65.875  58.980  37.376  1.00 184.09 ? 4   VAL U CA 1 
ATOM 1294 C CA . ARG N 5  5   ? -64.689  61.046  40.340  1.00 221.02 ? 5   ARG U CA 1 
ATOM 1295 C CA . PHE N 5  6   ? -65.759  64.073  38.312  1.00 224.59 ? 6   PHE U CA 1 
ATOM 1296 C CA . LEU N 5  7   ? -69.350  62.942  38.832  1.00 222.69 ? 7   LEU U CA 1 
ATOM 1297 C CA . MET N 5  8   ? -68.715  62.109  42.499  1.00 228.99 ? 8   MET U CA 1 
ATOM 1298 C CA . LYS N 5  9   ? -67.719  65.713  43.178  1.00 228.48 ? 9   LYS U CA 1 
ATOM 1299 C CA . LEU N 5  10  ? -70.989  66.833  41.563  1.00 218.10 ? 10  LEU U CA 1 
ATOM 1300 C CA . SER N 5  11  ? -73.059  65.955  44.641  1.00 192.36 ? 11  SER U CA 1 
ATOM 1301 C CA . HIS N 5  12  ? -75.771  68.460  45.608  1.00 239.70 ? 12  HIS U CA 1 
ATOM 1302 C CA . GLU N 5  13  ? -76.201  69.452  41.948  1.00 228.17 ? 13  GLU U CA 1 
ATOM 1303 C CA . THR N 5  14  ? -79.252  69.186  39.682  1.00 246.40 ? 14  THR U CA 1 
ATOM 1304 C CA . VAL N 5  15  ? -78.805  66.576  36.945  1.00 206.47 ? 15  VAL U CA 1 
ATOM 1305 C CA . THR N 5  16  ? -80.743  64.997  34.080  1.00 200.19 ? 16  THR U CA 1 
ATOM 1306 C CA . ILE N 5  17  ? -79.768  61.316  34.256  1.00 173.18 ? 17  ILE U CA 1 
ATOM 1307 C CA . GLU N 5  18  ? -80.804  58.622  31.783  1.00 181.38 ? 18  GLU U CA 1 
ATOM 1308 C CA . LEU N 5  19  ? -80.475  54.834  31.881  1.00 177.55 ? 19  LEU U CA 1 
ATOM 1309 C CA . LYS N 5  20  ? -79.847  52.632  28.847  1.00 217.48 ? 20  LYS U CA 1 
ATOM 1310 C CA . ASN N 5  21  ? -83.605  52.329  29.152  1.00 229.23 ? 21  ASN U CA 1 
ATOM 1311 C CA . GLY N 5  22  ? -86.122  55.082  28.482  1.00 166.21 ? 22  GLY U CA 1 
ATOM 1312 C CA . THR N 5  23  ? -86.193  55.581  32.229  1.00 170.33 ? 23  THR U CA 1 
ATOM 1313 C CA . GLN N 5  24  ? -85.080  59.203  32.418  1.00 206.55 ? 24  GLN U CA 1 
ATOM 1314 C CA . VAL N 5  25  ? -84.544  60.728  35.852  1.00 187.07 ? 25  VAL U CA 1 
ATOM 1315 C CA . HIS N 5  26  ? -84.315  64.374  36.936  1.00 211.48 ? 26  HIS U CA 1 
ATOM 1316 C CA . GLY N 5  27  ? -83.017  65.504  40.312  1.00 221.03 ? 27  GLY U CA 1 
ATOM 1317 C CA . THR N 5  28  ? -80.164  66.540  42.587  1.00 219.97 ? 28  THR U CA 1 
ATOM 1318 C CA . ILE N 5  29  ? -77.328  64.096  43.272  1.00 202.89 ? 29  ILE U CA 1 
ATOM 1319 C CA . THR N 5  30  ? -76.670  62.788  46.781  1.00 228.58 ? 30  THR U CA 1 
ATOM 1320 C CA . GLY N 5  31  ? -73.825  60.358  46.234  1.00 248.02 ? 31  GLY U CA 1 
ATOM 1321 C CA . VAL N 5  32  ? -71.981  58.552  43.458  1.00 206.84 ? 32  VAL U CA 1 
ATOM 1322 C CA . ASP N 5  33  ? -69.495  55.770  44.129  1.00 233.62 ? 33  ASP U CA 1 
ATOM 1323 C CA . VAL N 5  34  ? -66.539  55.002  41.874  1.00 249.97 ? 34  VAL U CA 1 
ATOM 1324 C CA . SER N 5  35  ? -69.118  52.718  40.245  1.00 211.68 ? 35  SER U CA 1 
ATOM 1325 C CA . MET N 5  36  ? -71.442  55.426  38.858  1.00 236.28 ? 36  MET U CA 1 
ATOM 1326 C CA . ASN N 5  37  ? -74.295  54.113  41.019  1.00 225.56 ? 37  ASN U CA 1 
ATOM 1327 C CA . THR N 5  38  ? -76.143  57.403  41.475  1.00 217.78 ? 38  THR U CA 1 
ATOM 1328 C CA . HIS N 5  39  ? -78.609  58.377  44.196  1.00 228.44 ? 39  HIS U CA 1 
ATOM 1329 C CA . LEU N 5  40  ? -80.719  61.545  44.045  1.00 197.82 ? 40  LEU U CA 1 
ATOM 1330 C CA . LYS N 5  41  ? -83.158  63.621  46.098  1.00 228.33 ? 41  LYS U CA 1 
ATOM 1331 C CA . ALA N 5  42  ? -86.137  65.609  44.770  1.00 246.41 ? 42  ALA U CA 1 
ATOM 1332 C CA . VAL N 5  43  ? -86.593  62.941  42.098  1.00 228.60 ? 43  VAL U CA 1 
ATOM 1333 C CA . LYS N 5  44  ? -88.892  62.869  39.075  1.00 201.55 ? 44  LYS U CA 1 
ATOM 1334 C CA . MET N 5  45  ? -88.538  59.348  37.677  1.00 229.80 ? 45  MET U CA 1 
ATOM 1335 C CA . THR N 5  46  ? -90.061  59.234  34.207  1.00 197.43 ? 46  THR U CA 1 
ATOM 1336 C CA . LEU N 5  47  ? -90.104  55.608  33.043  1.00 152.98 ? 47  LEU U CA 1 
ATOM 1337 C CA . LYS N 5  48  ? -90.620  55.041  29.320  1.00 236.87 ? 48  LYS U CA 1 
ATOM 1338 C CA . ASN N 5  49  ? -94.280  55.390  28.304  1.00 256.49 ? 49  ASN U CA 1 
ATOM 1339 C CA . ARG N 5  50  ? -95.430  56.384  31.788  1.00 216.69 ? 50  ARG U CA 1 
ATOM 1340 C CA . GLU N 5  51  ? -96.503  59.225  34.068  1.00 233.89 ? 51  GLU U CA 1 
ATOM 1341 C CA . PRO N 5  52  ? -93.800  61.394  35.686  1.00 233.24 ? 52  PRO U CA 1 
ATOM 1342 C CA . VAL N 5  53  ? -93.577  59.814  39.145  1.00 224.79 ? 53  VAL U CA 1 
ATOM 1343 C CA . GLN N 5  54  ? -92.322  61.907  42.066  1.00 205.38 ? 54  GLN U CA 1 
ATOM 1344 C CA . LEU N 5  55  ? -89.817  60.393  44.504  1.00 228.07 ? 55  LEU U CA 1 
ATOM 1345 C CA . GLU N 5  56  ? -87.672  61.575  47.418  1.00 232.02 ? 56  GLU U CA 1 
ATOM 1346 C CA . THR N 5  57  ? -84.800  59.094  47.309  1.00 214.58 ? 57  THR U CA 1 
ATOM 1347 C CA . LEU N 5  58  ? -83.776  57.107  44.247  1.00 184.35 ? 58  LEU U CA 1 
ATOM 1348 C CA . SER N 5  59  ? -80.979  54.600  43.786  1.00 220.43 ? 59  SER U CA 1 
ATOM 1349 C CA . ILE N 5  60  ? -79.809  53.951  40.238  1.00 197.08 ? 60  ILE U CA 1 
ATOM 1350 C CA . ARG N 5  61  ? -77.103  51.471  39.319  1.00 191.41 ? 61  ARG U CA 1 
ATOM 1351 C CA . GLY N 5  62  ? -74.402  52.819  37.027  1.00 219.09 ? 62  GLY U CA 1 
ATOM 1352 C CA . ASN N 5  63  ? -73.833  49.649  35.017  1.00 252.03 ? 63  ASN U CA 1 
ATOM 1353 C CA . ASN N 5  64  ? -77.140  50.520  33.341  1.00 222.52 ? 64  ASN U CA 1 
ATOM 1354 C CA . ILE N 5  65  ? -76.722  54.287  32.918  1.00 150.87 ? 65  ILE U CA 1 
ATOM 1355 C CA . ARG N 5  66  ? -76.476  55.857  29.460  1.00 193.61 ? 66  ARG U CA 1 
ATOM 1356 C CA . TYR N 5  67  ? -75.364  59.405  30.336  1.00 178.82 ? 67  TYR U CA 1 
ATOM 1357 C CA . PHE N 5  68  ? -76.111  62.483  32.465  1.00 173.15 ? 68  PHE U CA 1 
ATOM 1358 C CA . ILE N 5  69  ? -76.928  66.039  31.405  1.00 178.62 ? 69  ILE U CA 1 
ATOM 1359 C CA . LEU N 5  70  ? -75.352  68.750  33.564  1.00 215.95 ? 70  LEU U CA 1 
ATOM 1360 C CA . PRO N 5  71  ? -76.660  72.339  33.904  1.00 225.00 ? 71  PRO U CA 1 
ATOM 1361 C CA . ASP N 5  72  ? -75.077  75.068  31.765  1.00 243.47 ? 72  ASP U CA 1 
ATOM 1362 C CA . SER N 5  73  ? -73.867  76.874  34.890  1.00 237.53 ? 73  SER U CA 1 
ATOM 1363 C CA . LEU N 5  74  ? -71.500  74.072  35.922  1.00 230.06 ? 74  LEU U CA 1 
ATOM 1364 C CA . PRO N 5  75  ? -67.826  75.075  35.901  1.00 241.56 ? 75  PRO U CA 1 
ATOM 1365 C CA . LEU N 5  76  ? -65.973  72.363  33.993  1.00 240.50 ? 76  LEU U CA 1 
ATOM 1366 C CA . ASP N 5  77  ? -62.629  74.137  33.939  1.00 260.32 ? 77  ASP U CA 1 
ATOM 1367 C CA . THR N 5  78  ? -62.604  73.963  37.736  1.00 241.59 ? 78  THR U CA 1 
ATOM 1368 C CA . LEU N 5  79  ? -64.022  70.432  37.861  1.00 253.87 ? 79  LEU U CA 1 
ATOM 1369 C CA . LEU N 5  80  ? -61.786  68.850  35.230  1.00 215.74 ? 80  LEU U CA 1 
ATOM 1370 C CA . VAL N 5  81  ? -58.791  70.652  36.748  1.00 272.47 ? 81  VAL U CA 1 
ATOM 1371 C CA . ASP N 5  82  ? -59.901  69.344  40.140  1.00 308.09 ? 82  ASP U CA 1 
ATOM 1372 C CA . VAL N 5  83  ? -60.319  65.663  39.273  1.00 331.49 ? 83  VAL U CA 1 
ATOM 1373 C CA . GLU N 5  84  ? -56.818  65.581  37.743  1.00 359.35 ? 84  GLU U CA 1 
ATOM 1374 C CA . PRO N 5  85  ? -55.278  66.081  41.213  1.00 319.41 ? 85  PRO U CA 1 
ATOM 1375 C CA . SER O 6  2   ? -40.544  50.371  25.880  1.00 270.34 ? 2   SER V CA 1 
ATOM 1376 C CA . LEU O 6  3   ? -44.045  50.980  27.277  1.00 283.26 ? 3   LEU V CA 1 
ATOM 1377 C CA . LEU O 6  4   ? -44.838  47.317  26.506  1.00 268.09 ? 4   LEU V CA 1 
ATOM 1378 C CA . ASN O 6  5   ? -44.615  44.586  29.170  1.00 302.28 ? 5   ASN V CA 1 
ATOM 1379 C CA . LYS O 6  6   ? -47.832  43.157  30.684  1.00 316.86 ? 6   LYS V CA 1 
ATOM 1380 C CA . PRO O 6  7   ? -49.448  42.637  32.925  1.00 299.84 ? 7   PRO V CA 1 
ATOM 1381 C CA . LYS O 6  8   ? -49.154  45.842  34.963  1.00 320.89 ? 8   LYS V CA 1 
ATOM 1382 C CA . SER O 6  9   ? -47.220  44.217  37.821  1.00 253.81 ? 9   SER V CA 1 
ATOM 1383 C CA . GLU O 6  10  ? -43.635  44.754  36.786  1.00 289.08 ? 10  GLU V CA 1 
ATOM 1384 C CA . MET O 6  11  ? -45.123  48.177  36.051  1.00 285.13 ? 11  MET V CA 1 
ATOM 1385 C CA . THR O 6  12  ? -46.031  49.353  39.575  1.00 252.21 ? 12  THR V CA 1 
ATOM 1386 C CA . PRO O 6  13  ? -47.644  52.815  39.952  1.00 254.38 ? 13  PRO V CA 1 
ATOM 1387 C CA . GLU O 6  14  ? -44.669  54.337  38.122  1.00 298.01 ? 14  GLU V CA 1 
ATOM 1388 C CA . GLU O 6  15  ? -44.947  52.564  34.771  1.00 274.03 ? 15  GLU V CA 1 
ATOM 1389 C CA . LEU O 6  16  ? -48.656  53.361  35.001  1.00 241.46 ? 16  LEU V CA 1 
ATOM 1390 C CA . GLN O 6  17  ? -47.623  56.728  33.598  1.00 260.82 ? 17  GLN V CA 1 
ATOM 1391 C CA . LYS O 6  18  ? -46.004  54.649  30.867  1.00 294.96 ? 18  LYS V CA 1 
ATOM 1392 C CA . ARG O 6  19  ? -49.482  53.301  30.140  1.00 240.47 ? 19  ARG V CA 1 
ATOM 1393 C CA . GLU O 6  20  ? -50.556  56.936  30.003  1.00 240.67 ? 20  GLU V CA 1 
ATOM 1394 C CA . GLU O 6  21  ? -47.793  57.568  27.463  1.00 257.99 ? 21  GLU V CA 1 
ATOM 1395 C CA . GLU O 6  22  ? -49.398  54.824  25.409  1.00 209.23 ? 22  GLU V CA 1 
ATOM 1396 C CA . GLU O 6  23  ? -52.697  56.672  25.726  1.00 211.07 ? 23  GLU V CA 1 
ATOM 1397 C CA . PHE O 6  24  ? -50.759  59.667  24.416  1.00 253.66 ? 24  PHE V CA 1 
ATOM 1398 C CA . ASN O 6  25  ? -50.159  57.636  21.225  1.00 236.64 ? 25  ASN V CA 1 
ATOM 1399 C CA . THR O 6  26  ? -52.503  54.614  21.258  1.00 296.12 ? 26  THR V CA 1 
ATOM 1400 C CA . GLY O 6  27  ? -55.621  54.327  19.135  1.00 183.13 ? 27  GLY V CA 1 
ATOM 1401 C CA . PRO O 6  28  ? -57.577  56.255  21.805  1.00 204.42 ? 28  PRO V CA 1 
ATOM 1402 C CA . LEU O 6  29  ? -55.031  59.068  21.423  1.00 241.63 ? 29  LEU V CA 1 
ATOM 1403 C CA . SER O 6  30  ? -57.525  60.247  18.827  1.00 195.36 ? 30  SER V CA 1 
ATOM 1404 C CA . VAL O 6  31  ? -59.819  61.653  21.506  1.00 214.02 ? 31  VAL V CA 1 
ATOM 1405 C CA . LEU O 6  32  ? -56.807  63.343  23.140  1.00 202.80 ? 32  LEU V CA 1 
ATOM 1406 C CA . THR O 6  33  ? -55.437  65.332  20.192  1.00 237.05 ? 33  THR V CA 1 
ATOM 1407 C CA . GLN O 6  34  ? -58.895  65.725  18.676  1.00 246.93 ? 34  GLN V CA 1 
ATOM 1408 C CA . SER O 6  35  ? -60.558  67.030  21.835  1.00 233.83 ? 35  SER V CA 1 
ATOM 1409 C CA . VAL O 6  36  ? -58.539  67.931  24.941  1.00 248.34 ? 36  VAL V CA 1 
ATOM 1410 C CA . LYS O 6  37  ? -55.604  69.281  22.930  1.00 243.73 ? 37  LYS V CA 1 
ATOM 1411 C CA . ASN O 6  38  ? -57.601  70.497  19.933  1.00 222.86 ? 38  ASN V CA 1 
ATOM 1412 C CA . ASN O 6  39  ? -61.270  71.198  20.686  1.00 247.80 ? 39  ASN V CA 1 
ATOM 1413 C CA . THR O 6  40  ? -62.302  70.232  17.142  1.00 240.95 ? 40  THR V CA 1 
ATOM 1414 C CA . GLN O 6  41  ? -65.773  68.733  16.538  1.00 268.14 ? 41  GLN V CA 1 
ATOM 1415 C CA . VAL O 6  42  ? -66.560  65.022  16.837  1.00 197.72 ? 42  VAL V CA 1 
ATOM 1416 C CA . LEU O 6  43  ? -69.313  62.527  15.939  1.00 197.08 ? 43  LEU V CA 1 
ATOM 1417 C CA . ILE O 6  44  ? -70.212  59.874  18.517  1.00 159.56 ? 44  ILE V CA 1 
ATOM 1418 C CA . ASN O 6  45  ? -72.272  56.790  17.671  1.00 181.05 ? 45  ASN V CA 1 
ATOM 1419 C CA . CYS O 6  46  ? -73.570  55.251  20.902  1.00 182.87 ? 46  CYS V CA 1 
ATOM 1420 C CA . ARG O 6  47  ? -77.176  54.066  21.005  1.00 235.26 ? 47  ARG V CA 1 
ATOM 1421 C CA . ASN O 6  48  ? -78.073  51.498  18.368  1.00 282.55 ? 48  ASN V CA 1 
ATOM 1422 C CA . ASN O 6  49  ? -79.794  54.343  16.511  1.00 242.04 ? 49  ASN V CA 1 
ATOM 1423 C CA . LYS O 6  50  ? -78.786  57.787  17.832  1.00 202.35 ? 50  LYS V CA 1 
ATOM 1424 C CA . LYS O 6  51  ? -75.560  59.726  17.309  1.00 199.79 ? 51  LYS V CA 1 
ATOM 1425 C CA . LEU O 6  52  ? -73.985  62.881  18.749  1.00 192.56 ? 52  LEU V CA 1 
ATOM 1426 C CA . LEU O 6  53  ? -72.014  65.900  17.536  1.00 213.93 ? 53  LEU V CA 1 
ATOM 1427 C CA . GLY O 6  54  ? -70.057  68.310  19.719  1.00 233.76 ? 54  GLY V CA 1 
ATOM 1428 C CA . ARG O 6  55  ? -66.762  69.388  21.265  1.00 266.62 ? 55  ARG V CA 1 
ATOM 1429 C CA . VAL O 6  56  ? -65.261  67.065  23.872  1.00 200.45 ? 56  VAL V CA 1 
ATOM 1430 C CA . LYS O 6  57  ? -63.726  68.839  26.868  1.00 206.78 ? 57  LYS V CA 1 
ATOM 1431 C CA . ALA O 6  58  ? -62.103  65.834  28.548  1.00 193.68 ? 58  ALA V CA 1 
ATOM 1432 C CA . PHE O 6  59  ? -62.232  62.026  28.502  1.00 186.49 ? 59  PHE V CA 1 
ATOM 1433 C CA . ASP O 6  60  ? -60.800  58.841  30.017  1.00 206.81 ? 60  ASP V CA 1 
ATOM 1434 C CA . ARG O 6  61  ? -60.066  55.155  29.381  1.00 189.85 ? 61  ARG V CA 1 
ATOM 1435 C CA . HIS O 6  62  ? -63.740  54.154  29.476  1.00 194.02 ? 62  HIS V CA 1 
ATOM 1436 C CA . CYS O 6  63  ? -64.588  56.723  26.775  1.00 163.42 ? 63  CYS V CA 1 
ATOM 1437 C CA . ASN O 6  64  ? -66.999  58.618  28.996  1.00 207.46 ? 64  ASN V CA 1 
ATOM 1438 C CA . MET O 6  65  ? -66.288  62.246  28.230  1.00 168.41 ? 65  MET V CA 1 
ATOM 1439 C CA . VAL O 6  66  ? -67.791  65.622  29.059  1.00 198.42 ? 66  VAL V CA 1 
ATOM 1440 C CA . LEU O 6  67  ? -69.198  67.299  25.958  1.00 169.53 ? 67  LEU V CA 1 
ATOM 1441 C CA . GLU O 6  68  ? -70.190  70.741  24.694  1.00 250.72 ? 68  GLU V CA 1 
ATOM 1442 C CA . ASN O 6  69  ? -72.880  71.804  22.217  1.00 240.55 ? 69  ASN V CA 1 
ATOM 1443 C CA . VAL O 6  70  ? -74.090  68.301  21.338  1.00 203.62 ? 70  VAL V CA 1 
ATOM 1444 C CA . LYS O 6  71  ? -76.733  67.852  18.634  1.00 240.42 ? 71  LYS V CA 1 
ATOM 1445 C CA . GLU O 6  72  ? -79.090  64.902  18.273  1.00 218.01 ? 72  GLU V CA 1 
ATOM 1446 C CA . MET O 6  73  ? -80.837  64.257  14.947  1.00 265.74 ? 73  MET V CA 1 
ATOM 1447 C CA . TRP O 6  74  ? -83.056  61.234  15.247  1.00 249.22 ? 74  TRP V CA 1 
ATOM 1448 C CA . THR O 6  75  ? -83.158  58.783  12.321  1.00 240.15 ? 75  THR V CA 1 
ATOM 1449 C CA . GLU O 6  76  ? -86.968  58.565  12.180  1.00 270.49 ? 76  GLU V CA 1 
ATOM 1450 C CA . VAL O 6  90  ? -88.398  62.402  10.814  1.00 264.72 ? 90  VAL V CA 1 
ATOM 1451 C CA . ASN O 6  91  ? -85.085  63.847  11.994  1.00 254.71 ? 91  ASN V CA 1 
ATOM 1452 C CA . LYS O 6  92  ? -85.979  65.520  15.303  1.00 237.09 ? 92  LYS V CA 1 
ATOM 1453 C CA . ASP O 6  93  ? -83.280  67.613  16.970  1.00 231.79 ? 93  ASP V CA 1 
ATOM 1454 C CA . ARG O 6  94  ? -81.830  67.911  20.471  1.00 223.36 ? 94  ARG V CA 1 
ATOM 1455 C CA . TYR O 6  95  ? -79.607  70.760  21.681  1.00 252.97 ? 95  TYR V CA 1 
ATOM 1456 C CA . ILE O 6  96  ? -77.320  70.357  24.696  1.00 199.56 ? 96  ILE V CA 1 
ATOM 1457 C CA . SER O 6  97  ? -74.840  72.952  25.962  1.00 216.51 ? 97  SER V CA 1 
ATOM 1458 C CA . LYS O 6  98  ? -73.067  70.616  28.385  1.00 230.14 ? 98  LYS V CA 1 
ATOM 1459 C CA . MET O 6  99  ? -73.478  66.966  29.361  1.00 184.77 ? 99  MET V CA 1 
ATOM 1460 C CA . PHE O 6  100 ? -71.596  63.899  30.622  1.00 198.64 ? 100 PHE V CA 1 
ATOM 1461 C CA . LEU O 6  101 ? -71.643  60.746  28.484  1.00 149.93 ? 101 LEU V CA 1 
ATOM 1462 C CA . ARG O 6  102 ? -71.250  57.082  29.470  1.00 196.67 ? 102 ARG V CA 1 
ATOM 1463 C CA . GLY O 6  103 ? -68.781  54.834  27.672  1.00 173.22 ? 103 GLY V CA 1 
ATOM 1464 C CA . ASP O 6  104 ? -70.342  51.360  27.522  1.00 230.17 ? 104 ASP V CA 1 
ATOM 1465 C CA . SER O 6  105 ? -72.395  52.963  24.751  1.00 203.31 ? 105 SER V CA 1 
ATOM 1466 C CA . VAL O 6  106 ? -69.968  54.664  22.348  1.00 184.54 ? 106 VAL V CA 1 
ATOM 1467 C CA . ILE O 6  107 ? -68.882  52.380  19.527  1.00 174.31 ? 107 ILE V CA 1 
ATOM 1468 C CA . VAL O 6  108 ? -67.493  54.965  17.104  1.00 151.15 ? 108 VAL V CA 1 
ATOM 1469 C CA . VAL O 6  109 ? -65.968  58.447  17.156  1.00 148.95 ? 109 VAL V CA 1 
ATOM 1470 C CA . LEU O 6  110 ? -65.054  60.750  14.285  1.00 176.56 ? 110 LEU V CA 1 
ATOM 1471 C CA . ARG O 6  111 ? -63.370  64.127  13.844  1.00 206.37 ? 111 ARG V CA 1 
ATOM 1472 C CA . ASN O 6  112 ? -63.455  65.486  10.302  1.00 198.10 ? 112 ASN V CA 1 
ATOM 1473 C CA . PRO O 6  113 ? -64.595  69.085  10.015  1.00 270.67 ? 113 PRO V CA 1 
ATOM 1474 C CA . LEU O 6  114 ? -63.207  70.436  6.754   1.00 251.32 ? 114 LEU V CA 1 
ATOM 1475 C CA . ILE O 6  115 ? -62.183  74.061  7.178   1.00 277.71 ? 115 ILE V CA 1 
ATOM 1476 C CA . ALA O 6  116 ? -62.566  76.564  4.354   1.00 270.49 ? 116 ALA V CA 1 
ATOM 1477 C CA . GLY O 6  117 ? -61.659  80.226  3.926   1.00 233.79 ? 117 GLY V CA 1 
ATOM 1478 C CA . SER P 7  2   ? -44.035  28.237  8.459   1.00 261.91 ? 2   SER I CA 1 
ATOM 1479 C CA . LEU P 7  3   ? -45.127  27.880  12.089  1.00 219.30 ? 3   LEU I CA 1 
ATOM 1480 C CA . PRO P 7  4   ? -48.420  29.781  12.720  1.00 228.10 ? 4   PRO I CA 1 
ATOM 1481 C CA . LEU P 7  5   ? -48.258  33.026  14.717  1.00 225.81 ? 5   LEU I CA 1 
ATOM 1482 C CA . ASN P 7  6   ? -50.751  34.314  17.302  1.00 258.74 ? 6   ASN I CA 1 
ATOM 1483 C CA . PRO P 7  7   ? -53.384  37.017  16.571  1.00 247.35 ? 7   PRO I CA 1 
ATOM 1484 C CA . LYS P 7  8   ? -51.487  39.699  18.503  1.00 184.94 ? 8   LYS I CA 1 
ATOM 1485 C CA . PRO P 7  9   ? -48.892  39.661  15.712  1.00 218.58 ? 9   PRO I CA 1 
ATOM 1486 C CA . PHE P 7  10  ? -51.393  39.489  12.847  1.00 234.82 ? 10  PHE I CA 1 
ATOM 1487 C CA . LEU P 7  11  ? -53.088  42.698  13.964  1.00 213.94 ? 11  LEU I CA 1 
ATOM 1488 C CA . ASN P 7  12  ? -49.700  44.209  14.794  1.00 217.98 ? 12  ASN I CA 1 
ATOM 1489 C CA . GLY P 7  13  ? -48.464  43.242  11.345  1.00 241.65 ? 13  GLY I CA 1 
ATOM 1490 C CA . LEU P 7  14  ? -51.603  44.719  9.785   1.00 209.72 ? 14  LEU I CA 1 
ATOM 1491 C CA . THR P 7  15  ? -51.067  48.310  10.929  1.00 192.32 ? 15  THR I CA 1 
ATOM 1492 C CA . GLY P 7  16  ? -50.218  50.675  8.096   1.00 202.33 ? 16  GLY I CA 1 
ATOM 1493 C CA . LYS P 7  17  ? -52.266  48.498  5.754   1.00 204.65 ? 17  LYS I CA 1 
ATOM 1494 C CA . PRO P 7  18  ? -55.908  49.107  4.768   1.00 188.79 ? 18  PRO I CA 1 
ATOM 1495 C CA . VAL P 7  19  ? -58.254  46.521  6.270   1.00 195.12 ? 19  VAL I CA 1 
ATOM 1496 C CA . MET P 7  20  ? -61.965  45.849  6.656   1.00 232.75 ? 20  MET I CA 1 
ATOM 1497 C CA . VAL P 7  21  ? -63.568  45.976  10.102  1.00 188.52 ? 21  VAL I CA 1 
ATOM 1498 C CA . LYS P 7  22  ? -66.750  43.923  10.408  1.00 194.21 ? 22  LYS I CA 1 
ATOM 1499 C CA . LEU P 7  23  ? -68.503  44.451  13.752  1.00 171.63 ? 23  LEU I CA 1 
ATOM 1500 C CA . LYS P 7  24  ? -71.260  42.567  15.580  1.00 196.72 ? 24  LYS I CA 1 
ATOM 1501 C CA . TRP P 7  25  ? -73.631  44.271  13.149  1.00 217.49 ? 25  TRP I CA 1 
ATOM 1502 C CA . GLY P 7  26  ? -73.799  44.100  9.360   1.00 241.39 ? 26  GLY I CA 1 
ATOM 1503 C CA . MET P 7  27  ? -71.542  47.151  9.109   1.00 199.36 ? 27  MET I CA 1 
ATOM 1504 C CA . GLU P 7  28  ? -68.297  46.774  7.142   1.00 252.65 ? 28  GLU I CA 1 
ATOM 1505 C CA . TYR P 7  29  ? -65.402  49.261  7.335   1.00 204.62 ? 29  TYR I CA 1 
ATOM 1506 C CA . LYS P 7  30  ? -62.722  49.558  4.634   1.00 226.86 ? 30  LYS I CA 1 
ATOM 1507 C CA . GLY P 7  31  ? -60.010  51.667  6.233   1.00 234.64 ? 31  GLY I CA 1 
ATOM 1508 C CA . TYR P 7  32  ? -56.310  51.961  7.011   1.00 225.61 ? 32  TYR I CA 1 
ATOM 1509 C CA . LEU P 7  33  ? -55.802  50.314  10.396  1.00 196.14 ? 33  LEU I CA 1 
ATOM 1510 C CA . VAL P 7  34  ? -53.672  52.800  12.320  1.00 182.64 ? 34  VAL I CA 1 
ATOM 1511 C CA . SER P 7  35  ? -53.347  52.357  16.076  1.00 195.19 ? 35  SER I CA 1 
ATOM 1512 C CA . VAL P 7  36  ? -54.486  49.837  18.688  1.00 210.65 ? 36  VAL I CA 1 
ATOM 1513 C CA . ASP P 7  37  ? -53.993  49.414  22.438  1.00 282.90 ? 37  ASP I CA 1 
ATOM 1514 C CA . GLY P 7  38  ? -53.187  46.208  24.291  1.00 277.41 ? 38  GLY I CA 1 
ATOM 1515 C CA . TYR P 7  39  ? -56.875  45.538  23.822  1.00 266.15 ? 39  TYR I CA 1 
ATOM 1516 C CA . MET P 7  40  ? -58.323  45.595  20.309  1.00 227.75 ? 40  MET I CA 1 
ATOM 1517 C CA . ASN P 7  41  ? -59.441  49.236  20.503  1.00 224.69 ? 41  ASN I CA 1 
ATOM 1518 C CA . MET P 7  42  ? -58.583  50.250  16.939  1.00 208.85 ? 42  MET I CA 1 
ATOM 1519 C CA . GLN P 7  43  ? -58.470  53.445  14.890  1.00 198.01 ? 43  GLN I CA 1 
ATOM 1520 C CA . LEU P 7  44  ? -58.927  53.825  11.135  1.00 210.83 ? 44  LEU I CA 1 
ATOM 1521 C CA . ALA P 7  45  ? -58.150  56.700  8.761   1.00 224.72 ? 45  ALA I CA 1 
ATOM 1522 C CA . ASN P 7  46  ? -59.684  57.692  5.423   1.00 230.02 ? 46  ASN I CA 1 
ATOM 1523 C CA . THR P 7  47  ? -62.025  54.758  5.950   1.00 240.33 ? 47  THR I CA 1 
ATOM 1524 C CA . GLU P 7  48  ? -64.999  54.200  3.662   1.00 257.23 ? 48  GLU I CA 1 
ATOM 1525 C CA . GLU P 7  49  ? -67.989  52.231  4.894   1.00 232.60 ? 49  GLU I CA 1 
ATOM 1526 C CA . TYR P 7  50  ? -70.504  50.061  3.065   1.00 265.19 ? 50  TYR I CA 1 
ATOM 1527 C CA . ILE P 7  51  ? -73.618  48.663  4.717   1.00 219.92 ? 51  ILE I CA 1 
ATOM 1528 C CA . ASP P 7  52  ? -75.270  45.672  3.066   1.00 247.86 ? 52  ASP I CA 1 
ATOM 1529 C CA . GLY P 7  53  ? -72.245  45.921  0.784   1.00 211.51 ? 53  GLY I CA 1 
ATOM 1530 C CA . ALA P 7  54  ? -72.505  49.390  -0.766  1.00 220.48 ? 54  ALA I CA 1 
ATOM 1531 C CA . LEU P 7  55  ? -69.842  52.008  0.004   1.00 224.34 ? 55  LEU I CA 1 
ATOM 1532 C CA . SER P 7  56  ? -72.016  54.859  1.250   1.00 210.85 ? 56  SER I CA 1 
ATOM 1533 C CA . GLY P 7  57  ? -69.872  57.217  3.299   1.00 272.48 ? 57  GLY I CA 1 
ATOM 1534 C CA . HIS P 7  58  ? -66.179  58.069  3.455   1.00 252.81 ? 58  HIS I CA 1 
ATOM 1535 C CA . LEU P 7  59  ? -64.994  59.196  6.885   1.00 204.38 ? 59  LEU I CA 1 
ATOM 1536 C CA . GLY P 7  60  ? -61.645  60.820  7.599   1.00 235.02 ? 60  GLY I CA 1 
ATOM 1537 C CA . GLU P 7  61  ? -61.034  59.059  10.903  1.00 227.08 ? 61  GLU I CA 1 
ATOM 1538 C CA . VAL P 7  62  ? -62.989  56.559  12.989  1.00 227.02 ? 62  VAL I CA 1 
ATOM 1539 C CA . LEU P 7  63  ? -62.423  55.106  16.451  1.00 151.02 ? 63  LEU I CA 1 
ATOM 1540 C CA . ILE P 7  64  ? -63.900  51.663  17.106  1.00 199.53 ? 64  ILE I CA 1 
ATOM 1541 C CA . ARG P 7  65  ? -64.191  50.255  20.635  1.00 197.92 ? 65  ARG I CA 1 
ATOM 1542 C CA . CYS P 7  66  ? -63.551  46.495  20.806  1.00 210.03 ? 66  CYS I CA 1 
ATOM 1543 C CA . ASN P 7  67  ? -67.191  46.360  21.906  1.00 215.97 ? 67  ASN I CA 1 
ATOM 1544 C CA . ASN P 7  68  ? -68.435  45.970  18.326  1.00 186.95 ? 68  ASN I CA 1 
ATOM 1545 C CA . VAL P 7  69  ? -65.589  44.411  16.352  1.00 182.11 ? 69  VAL I CA 1 
ATOM 1546 C CA . LEU P 7  70  ? -66.385  40.896  15.175  1.00 186.16 ? 70  LEU I CA 1 
ATOM 1547 C CA . TYR P 7  71  ? -63.452  40.290  12.848  1.00 198.92 ? 71  TYR I CA 1 
ATOM 1548 C CA . ILE P 7  72  ? -60.949  42.282  10.788  1.00 189.69 ? 72  ILE I CA 1 
ATOM 1549 C CA . ARG P 7  73  ? -59.567  41.332  7.374   1.00 215.42 ? 73  ARG I CA 1 
ATOM 1550 C CA . GLY P 7  74  ? -56.714  42.924  5.470   1.00 228.96 ? 74  GLY I CA 1 
ATOM 1551 C CA . VAL P 7  75  ? -57.815  43.302  1.858   1.00 202.75 ? 75  VAL I CA 1 
ATOM 1552 C CA . MET Q 8  1   ? -61.428  -1.281  36.298  1.00 277.74 ? 1   MET H CA 1 
ATOM 1553 C CA . ALA Q 8  2   ? -61.548  1.322   39.094  1.00 337.39 ? 2   ALA H CA 1 
ATOM 1554 C CA . TYR Q 8  3   ? -63.523  4.142   37.437  1.00 350.35 ? 3   TYR H CA 1 
ATOM 1555 C CA . ARG Q 8  4   ? -61.636  3.413   34.217  1.00 351.64 ? 4   ARG H CA 1 
ATOM 1556 C CA . GLY Q 8  5   ? -58.087  4.185   35.315  1.00 362.07 ? 5   GLY H CA 1 
ATOM 1557 C CA . GLN Q 8  6   ? -59.042  7.091   37.576  1.00 317.81 ? 6   GLN H CA 1 
ATOM 1558 C CA . GLY Q 8  7   ? -61.046  8.270   34.593  1.00 364.11 ? 7   GLY H CA 1 
ATOM 1559 C CA . GLN Q 8  8   ? -58.306  8.045   31.973  1.00 378.71 ? 8   GLN H CA 1 
ATOM 1560 C CA . LYS Q 8  9   ? -55.688  10.178  33.740  1.00 358.96 ? 9   LYS H CA 1 
ATOM 1561 C CA . VAL Q 8  10  ? -58.155  12.708  35.156  1.00 360.39 ? 10  VAL H CA 1 
ATOM 1562 C CA . GLN Q 8  11  ? -59.400  12.924  31.563  1.00 363.22 ? 11  GLN H CA 1 
ATOM 1563 C CA . LYS Q 8  12  ? -55.972  13.845  30.221  1.00 345.16 ? 12  LYS H CA 1 
ATOM 1564 C CA . VAL Q 8  13  ? -55.919  16.618  32.817  1.00 331.51 ? 13  VAL H CA 1 
ATOM 1565 C CA . MET Q 8  14  ? -59.147  17.972  31.332  1.00 350.55 ? 14  MET H CA 1 
ATOM 1566 C CA . VAL Q 8  15  ? -58.122  17.594  27.689  1.00 365.04 ? 15  VAL H CA 1 
ATOM 1567 C CA . GLN Q 8  16  ? -54.879  19.508  28.213  1.00 384.56 ? 16  GLN H CA 1 
ATOM 1568 C CA . PRO Q 8  17  ? -56.563  22.430  29.969  1.00 327.45 ? 17  PRO H CA 1 
ATOM 1569 C CA . ILE Q 8  18  ? -59.233  21.848  27.323  1.00 245.40 ? 18  ILE H CA 1 
ATOM 1570 C CA . ASN Q 8  19  ? -57.670  24.564  25.159  1.00 212.28 ? 19  ASN H CA 1 
ATOM 1571 C CA . LEU Q 8  20  ? -54.340  22.788  24.672  1.00 266.62 ? 20  LEU H CA 1 
ATOM 1572 C CA . ILE Q 8  21  ? -56.397  20.115  22.921  1.00 327.37 ? 21  ILE H CA 1 
ATOM 1573 C CA . PHE Q 8  22  ? -58.287  22.249  20.433  1.00 250.00 ? 22  PHE H CA 1 
ATOM 1574 C CA . ARG Q 8  23  ? -55.100  24.333  20.232  1.00 279.40 ? 23  ARG H CA 1 
ATOM 1575 C CA . TYR Q 8  24  ? -52.194  21.868  20.139  1.00 306.17 ? 24  TYR H CA 1 
ATOM 1576 C CA . LEU Q 8  25  ? -54.078  18.909  18.703  1.00 303.20 ? 25  LEU H CA 1 
ATOM 1577 C CA . GLN Q 8  26  ? -55.674  21.315  16.224  1.00 273.06 ? 26  GLN H CA 1 
ATOM 1578 C CA . ASN Q 8  27  ? -52.300  22.972  15.522  1.00 282.98 ? 27  ASN H CA 1 
ATOM 1579 C CA . ARG Q 8  28  ? -50.848  19.868  13.918  1.00 297.40 ? 28  ARG H CA 1 
ATOM 1580 C CA . SER Q 8  29  ? -54.296  19.467  12.366  1.00 302.13 ? 29  SER H CA 1 
ATOM 1581 C CA . ARG Q 8  30  ? -54.685  22.988  10.961  1.00 256.28 ? 30  ARG H CA 1 
ATOM 1582 C CA . ILE Q 8  31  ? -58.303  22.159  10.084  1.00 268.67 ? 31  ILE H CA 1 
ATOM 1583 C CA . GLN Q 8  32  ? -61.217  24.408  9.135   1.00 255.73 ? 32  GLN H CA 1 
ATOM 1584 C CA . VAL Q 8  33  ? -63.461  25.026  12.134  1.00 221.63 ? 33  VAL H CA 1 
ATOM 1585 C CA . TRP Q 8  34  ? -67.154  25.917  11.968  1.00 271.26 ? 34  TRP H CA 1 
ATOM 1586 C CA . LEU Q 8  35  ? -67.759  28.818  14.341  1.00 230.93 ? 35  LEU H CA 1 
ATOM 1587 C CA . TYR Q 8  36  ? -71.146  29.754  15.782  1.00 241.24 ? 36  TYR H CA 1 
ATOM 1588 C CA . GLU Q 8  37  ? -71.763  32.954  17.733  1.00 237.14 ? 37  GLU H CA 1 
ATOM 1589 C CA . GLN Q 8  38  ? -74.414  34.991  19.555  1.00 203.87 ? 38  GLN H CA 1 
ATOM 1590 C CA . VAL Q 8  39  ? -76.001  35.482  16.125  1.00 247.84 ? 39  VAL H CA 1 
ATOM 1591 C CA . ASN Q 8  40  ? -78.036  33.397  13.682  1.00 259.98 ? 40  ASN H CA 1 
ATOM 1592 C CA . MET Q 8  41  ? -74.927  33.153  11.497  1.00 247.57 ? 41  MET H CA 1 
ATOM 1593 C CA . ARG Q 8  42  ? -71.904  30.905  10.974  1.00 264.70 ? 42  ARG H CA 1 
ATOM 1594 C CA . ILE Q 8  43  ? -68.244  31.303  9.963   1.00 200.57 ? 43  ILE H CA 1 
ATOM 1595 C CA . GLU Q 8  44  ? -66.004  28.363  9.011   1.00 235.42 ? 44  GLU H CA 1 
ATOM 1596 C CA . GLY Q 8  45  ? -62.260  28.628  8.420   1.00 245.64 ? 45  GLY H CA 1 
ATOM 1597 C CA . CYS Q 8  46  ? -58.768  27.281  9.120   1.00 237.89 ? 46  CYS H CA 1 
ATOM 1598 C CA . ILE Q 8  47  ? -57.245  28.062  12.517  1.00 234.98 ? 47  ILE H CA 1 
ATOM 1599 C CA . ILE Q 8  48  ? -53.748  29.551  12.319  1.00 217.23 ? 48  ILE H CA 1 
ATOM 1600 C CA . GLY Q 8  49  ? -53.643  31.799  15.367  1.00 215.86 ? 49  GLY H CA 1 
ATOM 1601 C CA . PHE Q 8  50  ? -54.878  31.931  18.945  1.00 246.69 ? 50  PHE H CA 1 
ATOM 1602 C CA . ASP Q 8  51  ? -54.877  34.054  22.083  1.00 229.30 ? 51  ASP H CA 1 
ATOM 1603 C CA . GLU Q 8  52  ? -55.676  33.423  25.749  1.00 234.81 ? 52  GLU H CA 1 
ATOM 1604 C CA . TYR Q 8  53  ? -58.443  36.007  25.488  1.00 225.93 ? 53  TYR H CA 1 
ATOM 1605 C CA . MET Q 8  54  ? -60.033  33.715  22.888  1.00 207.52 ? 54  MET H CA 1 
ATOM 1606 C CA . ASN Q 8  55  ? -58.923  35.842  19.928  1.00 195.71 ? 55  ASN H CA 1 
ATOM 1607 C CA . LEU Q 8  56  ? -58.628  33.759  16.761  1.00 191.52 ? 56  LEU H CA 1 
ATOM 1608 C CA . VAL Q 8  57  ? -57.046  33.857  13.298  1.00 224.02 ? 57  VAL H CA 1 
ATOM 1609 C CA . LEU Q 8  58  ? -58.751  32.378  10.243  1.00 237.98 ? 58  LEU H CA 1 
ATOM 1610 C CA . ASP Q 8  59  ? -57.850  31.954  6.569   1.00 269.46 ? 59  ASP H CA 1 
ATOM 1611 C CA . ASP Q 8  60  ? -60.100  31.135  3.618   1.00 254.51 ? 60  ASP H CA 1 
ATOM 1612 C CA . ALA Q 8  61  ? -62.826  31.473  6.242   1.00 204.24 ? 61  ALA H CA 1 
ATOM 1613 C CA . GLU Q 8  62  ? -66.175  31.270  4.464   1.00 265.33 ? 62  GLU H CA 1 
ATOM 1614 C CA . GLU Q 8  63  ? -68.838  33.471  6.066   1.00 244.44 ? 63  GLU H CA 1 
ATOM 1615 C CA . ILE Q 8  64  ? -72.194  31.686  6.279   1.00 228.12 ? 64  ILE H CA 1 
ATOM 1616 C CA . HIS Q 8  65  ? -75.702  33.155  6.478   1.00 219.56 ? 65  HIS H CA 1 
ATOM 1617 C CA . SER Q 8  66  ? -78.798  31.621  8.078   1.00 283.82 ? 66  SER H CA 1 
ATOM 1618 C CA . LYS Q 8  67  ? -82.124  30.794  6.406   1.00 247.34 ? 67  LYS H CA 1 
ATOM 1619 C CA . THR Q 8  68  ? -80.294  31.281  3.102   1.00 215.79 ? 68  THR H CA 1 
ATOM 1620 C CA . LYS Q 8  69  ? -77.364  30.066  1.004   1.00 247.50 ? 69  LYS H CA 1 
ATOM 1621 C CA . SER Q 8  70  ? -73.823  30.920  2.108   1.00 282.17 ? 70  SER H CA 1 
ATOM 1622 C CA . ARG Q 8  71  ? -71.587  32.533  -0.506  1.00 277.06 ? 71  ARG H CA 1 
ATOM 1623 C CA . LYS Q 8  72  ? -69.340  34.916  1.413   1.00 207.49 ? 72  LYS H CA 1 
ATOM 1624 C CA . GLN Q 8  73  ? -65.656  34.209  1.979   1.00 238.46 ? 73  GLN H CA 1 
ATOM 1625 C CA . LEU Q 8  74  ? -63.008  36.115  3.902   1.00 241.32 ? 74  LEU H CA 1 
ATOM 1626 C CA . GLY Q 8  75  ? -59.283  35.596  4.355   1.00 229.82 ? 75  GLY H CA 1 
ATOM 1627 C CA . ARG Q 8  76  ? -56.915  36.120  7.270   1.00 265.22 ? 76  ARG H CA 1 
ATOM 1628 C CA . ILE Q 8  77  ? -59.337  37.675  9.748   1.00 212.37 ? 77  ILE H CA 1 
ATOM 1629 C CA . MET Q 8  78  ? -58.889  37.977  13.501  1.00 210.94 ? 78  MET H CA 1 
ATOM 1630 C CA . LEU Q 8  79  ? -61.929  37.046  15.590  1.00 180.75 ? 79  LEU H CA 1 
ATOM 1631 C CA . LYS Q 8  80  ? -63.001  38.439  18.931  1.00 213.02 ? 80  LYS H CA 1 
ATOM 1632 C CA . GLY Q 8  81  ? -63.579  35.598  21.365  1.00 208.80 ? 81  GLY H CA 1 
ATOM 1633 C CA . ASP Q 8  82  ? -66.004  38.010  22.982  1.00 222.18 ? 82  ASP H CA 1 
ATOM 1634 C CA . ASN Q 8  83  ? -68.481  37.011  20.275  1.00 212.11 ? 83  ASN H CA 1 
ATOM 1635 C CA . ILE Q 8  84  ? -67.597  33.307  20.122  1.00 194.48 ? 84  ILE H CA 1 
ATOM 1636 C CA . THR Q 8  85  ? -69.842  30.559  21.488  1.00 206.39 ? 85  THR H CA 1 
ATOM 1637 C CA . LEU Q 8  86  ? -69.565  27.228  19.683  1.00 194.34 ? 86  LEU H CA 1 
ATOM 1638 C CA . LEU Q 8  87  ? -66.269  25.987  18.267  1.00 187.54 ? 87  LEU H CA 1 
ATOM 1639 C CA . GLN Q 8  88  ? -66.697  23.144  15.798  1.00 245.47 ? 88  GLN H CA 1 
ATOM 1640 C CA . SER Q 8  89  ? -64.435  21.242  13.405  1.00 220.00 ? 89  SER H CA 1 
ATOM 1641 C CA . MET R 9  1   ? -62.027  32.182  41.714  1.00 246.29 ? 1   MET J CA 1 
ATOM 1642 C CA . SER R 9  2   ? -62.197  29.098  39.505  1.00 195.09 ? 2   SER J CA 1 
ATOM 1643 C CA . LYS R 9  3   ? -63.418  27.461  42.716  1.00 232.35 ? 3   LYS J CA 1 
ATOM 1644 C CA . ALA R 9  4   ? -66.735  26.906  40.992  1.00 308.41 ? 4   ALA J CA 1 
ATOM 1645 C CA . HIS R 9  5   ? -65.716  24.361  38.339  1.00 348.05 ? 5   HIS J CA 1 
ATOM 1646 C CA . PRO R 9  6   ? -63.371  22.060  40.266  1.00 362.97 ? 6   PRO J CA 1 
ATOM 1647 C CA . PRO R 9  7   ? -66.096  20.787  42.649  1.00 306.58 ? 7   PRO J CA 1 
ATOM 1648 C CA . GLU R 9  8   ? -68.557  20.213  39.789  1.00 269.46 ? 8   GLU J CA 1 
ATOM 1649 C CA . LEU R 9  9   ? -66.654  18.367  37.048  1.00 259.02 ? 9   LEU J CA 1 
ATOM 1650 C CA . LYS R 9  10  ? -64.250  16.529  39.345  1.00 234.61 ? 10  LYS J CA 1 
ATOM 1651 C CA . LYS R 9  11  ? -67.409  14.853  40.650  1.00 249.86 ? 11  LYS J CA 1 
ATOM 1652 C CA . PHE R 9  12  ? -69.185  14.693  37.281  1.00 249.16 ? 12  PHE J CA 1 
ATOM 1653 C CA . MET R 9  13  ? -67.162  13.924  34.164  1.00 255.21 ? 13  MET J CA 1 
ATOM 1654 C CA . ASP R 9  14  ? -66.994  11.705  31.068  1.00 301.79 ? 14  ASP J CA 1 
ATOM 1655 C CA . LYS R 9  15  ? -70.776  11.504  31.299  1.00 221.21 ? 15  LYS J CA 1 
ATOM 1656 C CA . LYS R 9  16  ? -73.463  12.400  28.777  1.00 214.32 ? 16  LYS J CA 1 
ATOM 1657 C CA . LEU R 9  17  ? -75.360  15.616  29.420  1.00 235.32 ? 17  LEU J CA 1 
ATOM 1658 C CA . SER R 9  18  ? -76.878  18.538  27.521  1.00 261.26 ? 18  SER J CA 1 
ATOM 1659 C CA . LEU R 9  19  ? -75.384  22.029  27.570  1.00 250.34 ? 19  LEU J CA 1 
ATOM 1660 C CA . LYS R 9  20  ? -77.911  24.843  27.136  1.00 201.91 ? 20  LYS J CA 1 
ATOM 1661 C CA . LEU R 9  21  ? -76.509  27.732  25.093  1.00 200.18 ? 21  LEU J CA 1 
ATOM 1662 C CA . ASN R 9  22  ? -77.601  31.366  24.954  1.00 233.13 ? 22  ASN J CA 1 
ATOM 1663 C CA . GLY R 9  23  ? -78.393  31.104  21.258  1.00 197.12 ? 23  GLY J CA 1 
ATOM 1664 C CA . GLY R 9  24  ? -80.904  28.492  22.330  1.00 192.42 ? 24  GLY J CA 1 
ATOM 1665 C CA . ARG R 9  25  ? -78.685  25.850  20.760  1.00 230.72 ? 25  ARG J CA 1 
ATOM 1666 C CA . HIS R 9  26  ? -78.831  22.549  22.625  1.00 241.86 ? 26  HIS J CA 1 
ATOM 1667 C CA . VAL R 9  27  ? -76.022  20.016  22.311  1.00 212.32 ? 27  VAL J CA 1 
ATOM 1668 C CA . GLN R 9  28  ? -75.493  16.884  24.395  1.00 254.18 ? 28  GLN J CA 1 
ATOM 1669 C CA . GLY R 9  29  ? -72.534  14.566  24.835  1.00 206.28 ? 29  GLY J CA 1 
ATOM 1670 C CA . ILE R 9  30  ? -70.121  13.063  27.341  1.00 272.19 ? 30  ILE J CA 1 
ATOM 1671 C CA . LEU R 9  31  ? -68.193  15.651  29.360  1.00 255.96 ? 31  LEU J CA 1 
ATOM 1672 C CA . ARG R 9  32  ? -64.460  15.896  28.647  1.00 245.87 ? 32  ARG J CA 1 
ATOM 1673 C CA . GLY R 9  33  ? -62.852  19.078  29.946  1.00 261.80 ? 33  GLY J CA 1 
ATOM 1674 C CA . PHE R 9  34  ? -63.385  22.201  32.036  1.00 213.56 ? 34  PHE J CA 1 
ATOM 1675 C CA . ASP R 9  35  ? -61.382  25.418  32.295  1.00 211.07 ? 35  ASP J CA 1 
ATOM 1676 C CA . PRO R 9  36  ? -61.890  28.267  34.781  1.00 230.46 ? 36  PRO J CA 1 
ATOM 1677 C CA . PHE R 9  37  ? -64.236  30.593  32.845  1.00 243.91 ? 37  PHE J CA 1 
ATOM 1678 C CA . MET R 9  38  ? -66.745  27.865  31.952  1.00 196.03 ? 38  MET J CA 1 
ATOM 1679 C CA . ASN R 9  39  ? -64.893  26.922  28.765  1.00 204.82 ? 39  ASN J CA 1 
ATOM 1680 C CA . LEU R 9  40  ? -65.243  23.174  28.207  1.00 219.54 ? 40  LEU J CA 1 
ATOM 1681 C CA . VAL R 9  41  ? -65.084  20.268  25.761  1.00 258.58 ? 41  VAL J CA 1 
ATOM 1682 C CA . ILE R 9  42  ? -67.946  17.892  24.957  1.00 241.33 ? 42  ILE J CA 1 
ATOM 1683 C CA . ASP R 9  43  ? -67.612  14.877  22.665  1.00 283.54 ? 43  ASP J CA 1 
ATOM 1684 C CA . GLU R 9  44  ? -70.152  13.038  20.498  1.00 298.61 ? 44  GLU J CA 1 
ATOM 1685 C CA . CYS R 9  45  ? -71.843  16.412  20.816  1.00 281.15 ? 45  CYS J CA 1 
ATOM 1686 C CA . VAL R 9  46  ? -75.202  16.044  19.104  1.00 240.93 ? 46  VAL J CA 1 
ATOM 1687 C CA . GLU R 9  47  ? -76.734  19.103  17.465  1.00 222.11 ? 47  GLU J CA 1 
ATOM 1688 C CA . MET R 9  48  ? -80.454  19.741  17.846  1.00 264.56 ? 48  MET J CA 1 
ATOM 1689 C CA . ALA R 9  49  ? -82.037  21.141  14.698  1.00 270.92 ? 49  ALA J CA 1 
ATOM 1690 C CA . THR R 9  50  ? -85.038  23.409  15.186  1.00 283.53 ? 50  THR J CA 1 
ATOM 1691 C CA . SER R 9  51  ? -86.934  20.531  13.567  1.00 272.36 ? 51  SER J CA 1 
ATOM 1692 C CA . GLY R 9  52  ? -85.459  17.695  15.621  1.00 243.19 ? 52  GLY J CA 1 
ATOM 1693 C CA . GLN R 9  53  ? -82.449  15.419  16.103  1.00 278.32 ? 53  GLN J CA 1 
ATOM 1694 C CA . GLN R 9  54  ? -79.707  16.603  13.749  1.00 295.73 ? 54  GLN J CA 1 
ATOM 1695 C CA . ASN R 9  55  ? -76.077  16.003  12.765  1.00 269.17 ? 55  ASN J CA 1 
ATOM 1696 C CA . ASN R 9  56  ? -73.561  15.412  15.569  1.00 264.78 ? 56  ASN J CA 1 
ATOM 1697 C CA . ILE R 9  57  ? -69.778  15.691  15.953  1.00 259.39 ? 57  ILE J CA 1 
ATOM 1698 C CA . GLY R 9  58  ? -67.137  13.741  17.860  1.00 309.25 ? 58  GLY J CA 1 
ATOM 1699 C CA . MET R 9  59  ? -65.299  16.623  19.545  1.00 223.19 ? 59  MET J CA 1 
ATOM 1700 C CA . VAL R 9  60  ? -65.961  20.312  20.255  1.00 234.70 ? 60  VAL J CA 1 
ATOM 1701 C CA . VAL R 9  61  ? -64.995  23.061  22.708  1.00 191.44 ? 61  VAL J CA 1 
ATOM 1702 C CA . ILE R 9  62  ? -67.583  25.505  24.051  1.00 192.77 ? 62  ILE J CA 1 
ATOM 1703 C CA . ARG R 9  63  ? -66.816  28.906  25.570  1.00 206.20 ? 63  ARG J CA 1 
ATOM 1704 C CA . GLY R 9  64  ? -68.584  29.663  28.835  1.00 179.72 ? 64  GLY J CA 1 
ATOM 1705 C CA . ASN R 9  65  ? -70.165  33.023  28.042  1.00 196.33 ? 65  ASN J CA 1 
ATOM 1706 C CA . SER R 9  66  ? -72.755  31.237  25.886  1.00 211.98 ? 66  SER J CA 1 
ATOM 1707 C CA . ILE R 9  67  ? -73.416  28.546  28.517  1.00 186.89 ? 67  ILE J CA 1 
ATOM 1708 C CA . ILE R 9  68  ? -76.688  28.918  30.444  1.00 200.88 ? 68  ILE J CA 1 
ATOM 1709 C CA . MET R 9  69  ? -76.852  25.642  32.389  1.00 215.66 ? 69  MET J CA 1 
ATOM 1710 C CA . LEU R 9  70  ? -76.108  21.900  32.219  1.00 212.04 ? 70  LEU J CA 1 
ATOM 1711 C CA . GLU R 9  71  ? -78.660  19.151  31.581  1.00 238.55 ? 71  GLU J CA 1 
ATOM 1712 C CA . ALA R 9  72  ? -77.117  16.010  33.115  1.00 203.26 ? 72  ALA J CA 1 
ATOM 1713 C CA . LEU R 9  73  ? -77.930  12.760  31.274  1.00 208.64 ? 73  LEU J CA 1 
ATOM 1714 C CA . GLU R 9  74  ? -76.398  10.453  33.892  1.00 266.40 ? 74  GLU J CA 1 
ATOM 1715 C CA . ARG R 9  75  ? -75.386  10.681  37.542  1.00 286.02 ? 75  ARG J CA 1 
ATOM 1716 C CA . VAL R 9  76  ? -72.395  9.750   39.670  1.00 288.35 ? 76  VAL J CA 1 
ATOM 1717 P P  . U   S 10 2   ? -19.833  74.557  -29.583 1.00 521.34 ? 2   U   R P  1 
ATOM 1718 P P  . A   S 10 3   ? -16.980  73.848  -34.497 1.00 541.78 ? 3   A   R P  1 
ATOM 1719 P P  . C   S 10 4   ? -12.014  74.373  -37.407 1.00 494.40 ? 4   C   R P  1 
ATOM 1720 P P  . U   S 10 5   ? -6.367   75.507  -37.360 1.00 512.83 ? 5   U   R P  1 
ATOM 1721 P P  . U   S 10 6   ? -1.007   75.821  -35.162 1.00 524.80 ? 6   U   R P  1 
ATOM 1722 P P  . A   S 10 7   ? 2.512    74.290  -30.982 1.00 521.99 ? 7   A   R P  1 
ATOM 1723 P P  . C   S 10 8   ? 3.878    70.500  -26.543 1.00 556.70 ? 8   C   R P  1 
ATOM 1724 P P  . C   S 10 9   ? 2.978    65.487  -23.466 1.00 505.40 ? 9   C   R P  1 
ATOM 1725 P P  . U   S 10 10  ? 0.873    60.216  -21.802 1.00 474.96 ? 10  U   R P  1 
ATOM 1726 P P  . G   S 10 11  ? -3.840   54.957  -22.225 1.00 357.25 ? 11  G   R P  1 
ATOM 1727 P P  . G   S 10 12  ? -5.899   51.973  -26.997 1.00 308.08 ? 12  G   R P  1 
ATOM 1728 P P  . C   S 10 13  ? -3.131   48.168  -24.920 1.00 279.80 ? 13  C   R P  1 
ATOM 1729 P P  . A   S 10 14  ? -0.894   43.142  -24.922 1.00 273.71 ? 14  A   R P  1 
ATOM 1730 P P  . G   S 10 15  ? 0.072    37.864  -27.039 1.00 284.56 ? 15  G   R P  1 
ATOM 1731 P P  . G   S 10 16  ? -0.991   32.153  -29.372 1.00 267.99 ? 16  G   R P  1 
ATOM 1732 P P  . G   S 10 17  ? -2.580   28.165  -33.800 1.00 267.78 ? 17  G   R P  1 
ATOM 1733 P P  . G   S 10 18  ? -4.730   24.988  -30.164 1.00 268.64 ? 18  G   R P  1 
ATOM 1734 P P  . A   S 10 19  ? -5.818   20.827  -26.217 1.00 270.13 ? 19  A   R P  1 
ATOM 1735 P P  . G   S 10 20  ? -6.004   14.862  -24.184 1.00 278.52 ? 20  G   R P  1 
ATOM 1736 P P  . A   S 10 21  ? -3.109   9.615   -25.111 1.00 275.50 ? 21  A   R P  1 
ATOM 1737 P P  . U   S 10 22  ? 0.500    5.135   -27.068 1.00 348.34 ? 22  U   R P  1 
ATOM 1738 P P  . A   S 10 23  ? 2.377    1.651   -30.148 1.00 322.58 ? 23  A   R P  1 
ATOM 1739 P P  . C   S 10 24  ? 7.643    0.559   -32.456 1.00 285.96 ? 24  C   R P  1 
ATOM 1740 P P  . C   S 10 25  ? 13.606   2.086   -34.030 1.00 265.83 ? 25  C   R P  1 
ATOM 1741 P P  . A   S 10 26  ? 17.928   5.630   -33.161 1.00 275.61 ? 26  A   R P  1 
ATOM 1742 P P  . U   S 10 27  ? 21.128   8.946   -30.475 1.00 248.93 ? 27  U   R P  1 
ATOM 1743 P P  . G   S 10 28  ? 23.043   9.808   -26.739 1.00 309.08 ? 28  G   R P  1 
ATOM 1744 P P  . A   S 10 29  ? 21.649   10.288  -22.790 1.00 270.80 ? 29  A   R P  1 
ATOM 1745 P P  . U   S 10 30  ? 20.202   10.042  -17.871 1.00 381.22 ? 30  U   R P  1 
ATOM 1746 P P  . C   S 10 31  ? 19.676   4.551   -14.007 1.00 270.48 ? 31  C   R P  1 
ATOM 1747 P P  . A   S 10 32  ? 22.872   1.565   -11.845 1.00 318.40 ? 32  A   R P  1 
ATOM 1748 P P  . C   S 10 33  ? 22.679   -4.777  -11.450 1.00 267.48 ? 33  C   R P  1 
ATOM 1749 P P  . G   S 10 34  ? 25.219   -3.184  -15.045 1.00 270.26 ? 34  G   R P  1 
ATOM 1750 P P  . A   S 10 35  ? 20.515   -2.729  -20.290 1.00 292.66 ? 35  A   R P  1 
ATOM 1751 P P  . A   S 10 36  ? 14.911   1.474   -18.664 1.00 339.14 ? 36  A   R P  1 
ATOM 1752 P P  . G   S 10 37  ? 8.410    3.857   -20.032 1.00 320.90 ? 37  G   R P  1 
ATOM 1753 P P  . G   S 10 38  ? 6.377    9.806   -20.275 1.00 273.08 ? 38  G   R P  1 
ATOM 1754 P P  . U   S 10 39  ? 7.619    15.310  -22.121 1.00 279.85 ? 39  U   R P  1 
ATOM 1755 P P  . G   S 10 40  ? 9.261    18.764  -26.346 1.00 270.24 ? 40  G   R P  1 
ATOM 1756 P P  . G   S 10 41  ? 10.098   19.244  -32.058 1.00 259.65 ? 41  G   R P  1 
ATOM 1757 P P  . U   S 10 42  ? 9.148    16.365  -37.912 1.00 282.05 ? 42  U   R P  1 
ATOM 1758 P P  . U   S 10 43  ? 6.982    13.342  -41.441 1.00 280.74 ? 43  U   R P  1 
ATOM 1759 P P  . U   S 10 44  ? 1.443    10.106  -42.124 1.00 267.53 ? 44  U   R P  1 
ATOM 1760 P P  . U   S 10 45  ? -4.285   9.041   -40.875 1.00 271.36 ? 45  U   R P  1 
ATOM 1761 P P  . C   S 10 46  ? -9.818   9.451   -39.579 1.00 260.32 ? 46  C   R P  1 
ATOM 1762 P P  . C   S 10 47  ? -14.890  11.702  -37.149 1.00 303.70 ? 47  C   R P  1 
ATOM 1763 P P  . C   S 10 48  ? -16.719  18.320  -36.029 1.00 263.48 ? 48  C   R P  1 
ATOM 1764 P P  . A   S 10 49  ? -17.775  22.958  -37.952 1.00 284.64 ? 49  A   R P  1 
ATOM 1765 P P  . G   S 10 50  ? -17.538  27.278  -41.546 1.00 287.97 ? 50  G   R P  1 
ATOM 1766 P P  . G   S 10 51  ? -15.491  29.134  -47.170 1.00 278.50 ? 51  G   R P  1 
ATOM 1767 P P  . G   S 10 52  ? -13.053  28.304  -52.379 1.00 258.64 ? 52  G   R P  1 
ATOM 1768 P P  . C   S 10 53  ? -11.487  25.728  -57.084 1.00 297.65 ? 53  C   R P  1 
ATOM 1769 P P  . G   S 10 54  ? -12.755  22.212  -60.543 1.00 339.05 ? 54  G   R P  1 
ATOM 1770 P P  . A   S 10 55  ? -15.151  16.664  -63.061 1.00 315.18 ? 55  A   R P  1 
ATOM 1771 P P  . G   S 10 56  ? -19.183  11.584  -62.708 1.00 295.44 ? 56  G   R P  1 
ATOM 1772 P P  . G   S 10 57  ? -24.965  10.328  -62.312 1.00 264.08 ? 57  G   R P  1 
ATOM 1773 P P  . C   S 10 58  ? -30.863  11.856  -62.723 1.00 293.62 ? 58  C   R P  1 
ATOM 1774 P P  . U   S 10 59  ? -35.496  15.330  -63.064 1.00 279.29 ? 59  U   R P  1 
ATOM 1775 P P  . U   S 10 60  ? -37.296  19.860  -65.557 1.00 287.52 ? 60  U   R P  1 
ATOM 1776 P P  . A   S 10 61  ? -37.006  23.939  -70.436 1.00 230.99 ? 61  A   R P  1 
ATOM 1777 P P  . U   S 10 62  ? -35.054  25.532  -75.746 1.00 212.92 ? 62  U   R P  1 
ATOM 1778 P P  . C   S 10 63  ? -32.596  24.695  -80.601 1.00 208.27 ? 63  C   R P  1 
ATOM 1779 P P  . C   S 10 64  ? -29.534  21.356  -85.077 1.00 208.34 ? 64  C   R P  1 
ATOM 1780 P P  . A   S 10 65  ? -28.827  16.256  -87.610 1.00 212.52 ? 65  A   R P  1 
ATOM 1781 P P  . U   S 10 66  ? -31.679  11.460  -89.050 1.00 222.50 ? 66  U   R P  1 
ATOM 1782 P P  . U   S 10 67  ? -36.575  8.426   -89.453 1.00 226.20 ? 67  U   R P  1 
ATOM 1783 P P  . G   S 10 68  ? -41.473  5.680   -90.593 1.00 213.27 ? 68  G   R P  1 
ATOM 1784 P P  . C   S 10 69  ? -44.327  2.245   -86.184 1.00 236.02 ? 69  C   R P  1 
ATOM 1785 P P  . A   S 10 70  ? -45.724  -1.098  -81.494 1.00 183.20 ? 70  A   R P  1 
ATOM 1786 P P  . C   S 10 71  ? -45.732  -1.034  -75.351 1.00 195.11 ? 71  C   R P  1 
ATOM 1787 P P  . U   S 10 72  ? -48.085  -2.124  -70.753 1.00 242.16 ? 72  U   R P  1 
ATOM 1788 P P  . C   S 10 73  ? -44.934  2.564   -70.389 1.00 270.02 ? 73  C   R P  1 
ATOM 1789 P P  . C   S 10 74  ? -40.553  6.727   -71.334 1.00 257.32 ? 74  C   R P  1 
ATOM 1790 P P  . G   S 10 75  ? -35.483  6.643   -74.588 1.00 223.07 ? 75  G   R P  1 
ATOM 1791 P P  . G   S 10 76  ? -28.954  7.995   -73.826 1.00 245.22 ? 76  G   R P  1 
ATOM 1792 P P  . A   S 10 77  ? -24.058  11.183  -73.866 1.00 246.02 ? 77  A   R P  1 
ATOM 1793 P P  . U   S 10 78  ? -20.724  15.725  -72.897 1.00 246.54 ? 78  U   R P  1 
ATOM 1794 P P  . G   S 10 79  ? -20.070  21.121  -70.442 1.00 266.92 ? 79  G   R P  1 
ATOM 1795 P P  . U   S 10 80  ? -22.181  25.981  -67.084 1.00 259.02 ? 80  U   R P  1 
ATOM 1796 P P  . G   S 10 81  ? -24.738  28.585  -63.425 1.00 270.86 ? 81  G   R P  1 
ATOM 1797 P P  . C   S 10 82  ? -26.864  28.126  -58.340 1.00 263.44 ? 82  C   R P  1 
ATOM 1798 P P  . U   S 10 83  ? -27.208  25.254  -53.675 1.00 273.70 ? 83  U   R P  1 
ATOM 1799 P P  . G   S 10 84  ? -25.591  20.618  -50.191 1.00 328.11 ? 84  G   R P  1 
ATOM 1800 P P  . A   S 10 85  ? -23.243  14.823  -48.421 1.00 344.04 ? 85  A   R P  1 
ATOM 1801 P P  . C   S 10 86  ? -17.476  11.250  -49.309 1.00 289.43 ? 86  C   R P  1 
ATOM 1802 P P  . C   S 10 87  ? -11.970  9.679   -49.076 1.00 282.83 ? 87  C   R P  1 
ATOM 1803 P P  . C   S 10 88  ? -6.543   13.555  -47.496 1.00 262.36 ? 88  C   R P  1 
ATOM 1804 P P  . C   S 10 89  ? -2.697   17.629  -47.451 1.00 265.19 ? 89  C   R P  1 
ATOM 1805 P P  . U   S 10 90  ? -1.128   22.037  -45.236 1.00 271.71 ? 90  U   R P  1 
ATOM 1806 P P  . G   S 10 91  ? -1.555   27.302  -41.461 1.00 268.02 ? 91  G   R P  1 
ATOM 1807 P P  . C   S 10 92  ? -5.931   30.824  -37.221 1.00 274.88 ? 92  C   R P  1 
ATOM 1808 P P  . G   S 10 93  ? -6.404   32.904  -41.936 1.00 305.80 ? 93  G   R P  1 
ATOM 1809 P P  . A   S 10 94  ? -3.141   36.554  -46.968 1.00 325.79 ? 94  A   R P  1 
ATOM 1810 P P  . U   S 10 95  ? -0.044   40.787  -49.710 1.00 353.15 ? 95  U   R P  1 
ATOM 1811 P P  . U   S 10 96  ? 5.430    42.853  -49.600 1.00 378.73 ? 96  U   R P  1 
ATOM 1812 P P  . U   S 10 97  ? 10.784   42.425  -49.302 1.00 396.41 ? 97  U   R P  1 
ATOM 1813 P P  . C   S 10 98  ? 15.860   39.205  -49.111 1.00 434.89 ? 98  C   R P  1 
ATOM 1814 P P  . C   S 10 99  ? 18.882   34.321  -49.484 1.00 485.69 ? 99  C   R P  1 
ATOM 1815 P P  . C   S 10 100 ? 20.070   28.796  -50.658 1.00 478.79 ? 100 C   R P  1 
ATOM 1816 P P  . C   S 10 101 ? 19.516   23.789  -53.034 1.00 448.39 ? 101 C   R P  1 
ATOM 1817 P P  . A   S 10 102 ? 16.693   20.007  -56.867 1.00 443.34 ? 102 A   R P  1 
ATOM 1818 P P  . A   S 10 103 ? 15.436   17.900  -61.488 1.00 480.04 ? 103 A   R P  1 
ATOM 1819 P P  . A   S 10 104 ? 15.247   21.904  -65.089 1.00 444.77 ? 104 A   R P  1 
ATOM 1820 P P  . U   S 10 105 ? 14.149   27.422  -67.259 1.00 432.09 ? 105 U   R P  1 
ATOM 1821 P P  . G   S 10 106 ? 9.637    32.000  -66.450 1.00 452.69 ? 106 G   R P  1 
ATOM 1822 P P  . U   S 10 107 ? 6.328    30.673  -60.115 1.00 492.56 ? 107 U   R P  1 
ATOM 1823 P P  . G   S 10 108 ? 2.785    29.099  -55.320 1.00 505.02 ? 108 G   R P  1 
ATOM 1824 P P  . G   S 10 109 ? 2.605    26.956  -49.363 1.00 520.85 ? 109 G   R P  1 
ATOM 1825 P P  . G   S 10 110 ? 4.531    26.368  -43.853 1.00 452.67 ? 110 G   R P  1 
ATOM 1826 P P  . A   S 10 111 ? 6.991    28.227  -39.042 1.00 413.44 ? 111 A   R P  1 
ATOM 1827 P P  . A   S 10 112 ? 8.553    32.642  -35.921 1.00 342.44 ? 112 A   R P  1 
ATOM 1828 P P  . A   S 10 113 ? 8.561    38.205  -33.938 1.00 340.27 ? 113 A   R P  1 
ATOM 1829 P P  . C   S 10 114 ? 5.592    43.141  -34.405 1.00 349.14 ? 114 C   R P  1 
ATOM 1830 P P  . U   S 10 115 ? 6.530    47.154  -35.467 1.00 305.42 ? 115 U   R P  1 
ATOM 1831 P P  . C   S 10 116 ? 1.400    49.598  -36.592 1.00 320.23 ? 116 C   R P  1 
ATOM 1832 P P  . G   S 10 117 ? -4.760   50.147  -38.247 1.00 299.96 ? 117 G   R P  1 
ATOM 1833 P P  . A   S 10 118 ? -10.083  47.136  -38.929 1.00 280.26 ? 118 A   R P  1 
ATOM 1834 P P  . C   S 10 119 ? -14.500  42.146  -37.310 1.00 255.12 ? 119 C   R P  1 
ATOM 1835 P P  . U   S 10 120 ? -16.134  37.531  -33.030 1.00 226.90 ? 120 U   R P  1 
ATOM 1836 P P  . G   S 10 121 ? -16.034  35.435  -27.663 1.00 223.19 ? 121 G   R P  1 
ATOM 1837 P P  . C   S 10 122 ? -15.095  36.371  -21.702 1.00 202.37 ? 122 C   R P  1 
ATOM 1838 P P  . A   S 10 123 ? -14.574  39.223  -17.298 1.00 223.91 ? 123 A   R P  1 
ATOM 1839 P P  . U   S 10 124 ? -15.690  44.384  -14.432 1.00 210.82 ? 124 U   R P  1 
ATOM 1840 P P  . A   S 10 125 ? -20.135  39.883  -15.927 1.00 211.46 ? 125 A   R P  1 
ATOM 1841 P P  . A   S 10 126 ? -22.046  45.486  -15.286 1.00 218.35 ? 126 A   R P  1 
ATOM 1842 P P  . U   S 10 127 ? -25.624  49.746  -14.644 1.00 222.98 ? 127 U   R P  1 
ATOM 1843 P P  . U   S 10 128 ? -29.838  52.378  -17.850 1.00 261.77 ? 128 U   R P  1 
ATOM 1844 P P  . U   S 10 129 ? -25.952  50.193  -22.026 1.00 220.77 ? 129 U   R P  1 
ATOM 1845 P P  . G   S 10 130 ? -25.281  45.989  -23.719 1.00 353.04 ? 130 G   R P  1 
ATOM 1846 P P  . U   S 10 131 ? -24.068  40.701  -19.464 1.00 283.95 ? 131 U   R P  1 
ATOM 1847 P P  . G   S 10 132 ? -27.453  43.056  -16.110 1.00 380.40 ? 132 G   R P  1 
ATOM 1848 P P  . G   S 10 133 ? -31.457  44.191  -12.905 1.00 317.49 ? 133 G   R P  1 
ATOM 1849 P P  . U   S 10 134 ? -35.796  41.031  -14.123 1.00 223.16 ? 134 U   R P  1 
ATOM 1850 P P  . A   S 10 135 ? -40.972  42.310  -19.058 1.00 230.23 ? 135 A   R P  1 
ATOM 1851 P P  . G   S 10 136 ? -45.516  37.685  -17.248 1.00 270.97 ? 136 G   R P  1 
ATOM 1852 P P  . U   S 10 137 ? -47.617  35.695  -14.868 1.00 281.82 ? 137 U   R P  1 
ATOM 1853 P P  . G   S 10 138 ? -54.018  37.149  -12.884 1.00 307.19 ? 138 G   R P  1 
ATOM 1854 P P  . G   S 10 139 ? -59.036  38.451  -17.777 1.00 368.10 ? 139 G   R P  1 
ATOM 1855 P P  . G   S 10 140 ? -62.367  36.632  -22.263 1.00 404.72 ? 140 G   R P  1 
ATOM 1856 P P  . G   S 10 141 ? -66.947  34.121  -24.084 1.00 377.32 ? 141 G   R P  1 
ATOM 1857 P P  . G   S 10 142 ? -72.141  32.349  -23.157 1.00 361.66 ? 142 G   R P  1 
ATOM 1858 P P  . A   S 10 143 ? -76.857  32.273  -20.554 1.00 358.38 ? 143 A   R P  1 
ATOM 1859 P P  . C   S 10 144 ? -80.448  34.384  -15.894 1.00 356.06 ? 144 C   R P  1 
ATOM 1860 P P  . U   S 10 145 ? -82.876  37.447  -12.637 1.00 358.38 ? 145 U   R P  1 
ATOM 1861 P P  . G   S 10 146 ? -82.194  44.225  -11.683 1.00 402.83 ? 146 G   R P  1 
ATOM 1862 P P  . C   S 10 147 ? -81.842  50.206  -12.746 1.00 409.00 ? 147 C   R P  1 
ATOM 1863 P P  . G   S 10 148 ? -80.758  53.932  -17.221 1.00 467.21 ? 148 G   R P  1 
ATOM 1864 P P  . U   S 10 149 ? -80.328  54.834  -23.100 1.00 409.16 ? 149 U   R P  1 
ATOM 1865 P P  . U   S 10 150 ? -81.937  51.222  -28.941 1.00 415.46 ? 150 U   R P  1 
ATOM 1866 P P  . C   S 10 151 ? -81.474  46.230  -31.949 1.00 415.02 ? 151 C   R P  1 
ATOM 1867 P P  . G   S 10 152 ? -83.263  40.136  -29.302 1.00 479.94 ? 152 G   R P  1 
ATOM 1868 P P  . C   S 10 153 ? -77.032  38.099  -26.696 1.00 483.67 ? 153 C   R P  1 
ATOM 1869 P P  . G   S 10 154 ? -71.036  41.149  -24.420 1.00 491.99 ? 154 G   R P  1 
ATOM 1870 P P  . C   S 10 155 ? -67.788  44.571  -21.406 1.00 435.76 ? 155 C   R P  1 
ATOM 1871 P P  . U   S 10 156 ? -67.294  46.185  -14.728 1.00 392.08 ? 156 U   R P  1 
ATOM 1872 P P  . U   S 10 157 ? -69.753  43.999  -8.859  1.00 359.42 ? 157 U   R P  1 
ATOM 1873 P P  . U   S 10 158 ? -70.495  39.844  -5.221  1.00 349.82 ? 158 U   R P  1 
ATOM 1874 P P  . C   S 10 159 ? -70.616  33.648  -4.790  1.00 324.28 ? 159 C   R P  1 
ATOM 1875 P P  . C   S 10 160 ? -70.234  28.329  -5.656  1.00 331.59 ? 160 C   R P  1 
ATOM 1876 P P  . C   S 10 161 ? -68.444  23.544  -9.284  1.00 351.24 ? 161 C   R P  1 
ATOM 1877 P P  . C   S 10 162 ? -65.479  21.182  -12.944 1.00 363.48 ? 162 C   R P  1 
ATOM 1878 P P  . U   S 10 163 ? -60.478  21.281  -15.303 1.00 316.43 ? 163 U   R P  1 
ATOM 1879 P P  . G   S 10 164 ? -54.859  23.468  -16.089 1.00 304.29 ? 164 G   R P  1 
ATOM 1880 P P  . U   T 10 2   ? -38.699  28.238  70.981  1.00 521.52 ? 2   U   N P  1 
ATOM 1881 P P  . A   T 10 3   ? -35.161  30.147  66.838  1.00 541.89 ? 3   A   N P  1 
ATOM 1882 P P  . C   T 10 4   ? -32.674  29.250  61.671  1.00 494.41 ? 4   C   N P  1 
ATOM 1883 P P  . U   T 10 5   ? -32.338  26.190  56.814  1.00 512.73 ? 5   U   N P  1 
ATOM 1884 P P  . U   T 10 6   ? -34.239  22.811  52.538  1.00 524.09 ? 6   U   N P  1 
ATOM 1885 P P  . A   T 10 7   ? -38.732  20.601  49.833  1.00 521.95 ? 7   A   N P  1 
ATOM 1886 P P  . C   T 10 8   ? -44.566  20.784  48.554  1.00 556.84 ? 8   C   N P  1 
ATOM 1887 P P  . C   T 10 9   ? -49.842  23.508  48.656  1.00 505.71 ? 9   C   N P  1 
ATOM 1888 P P  . U   T 10 10  ? -54.092  27.591  49.459  1.00 475.15 ? 10  U   N P  1 
ATOM 1889 P P  . G   T 10 11  ? -56.262  33.786  52.453  1.00 412.58 ? 11  G   N P  1 
ATOM 1890 P P  . G   T 10 12  ? -51.452  37.753  49.613  1.00 308.18 ? 12  G   N P  1 
ATOM 1891 P P  . C   T 10 13  ? -47.684  41.271  48.842  1.00 279.17 ? 13  C   N P  1 
ATOM 1892 P P  . A   T 10 14  ? -45.552  46.255  49.741  1.00 271.52 ? 14  A   N P  1 
ATOM 1893 P P  . G   T 10 15  ? -45.443  51.522  52.169  1.00 284.74 ? 15  G   N P  1 
ATOM 1894 P P  . G   T 10 16  ? -47.242  57.196  54.007  1.00 267.46 ? 16  G   N P  1 
ATOM 1895 P P  . G   T 10 17  ? -50.829  60.949  57.520  1.00 268.13 ? 17  G   N P  1 
ATOM 1896 P P  . G   T 10 18  ? -51.699  64.149  53.425  1.00 269.33 ? 18  G   N P  1 
ATOM 1897 P P  . A   T 10 19  ? -51.270  68.488  49.586  1.00 269.83 ? 19  A   N P  1 
ATOM 1898 P P  . G   T 10 20  ? -50.590  74.517  47.885  1.00 278.24 ? 20  G   N P  1 
ATOM 1899 P P  . A   T 10 21  ? -47.976  79.588  49.912  1.00 276.28 ? 21  A   N P  1 
ATOM 1900 P P  . U   T 10 22  ? -45.053  83.799  53.173  1.00 347.46 ? 22  U   N P  1 
ATOM 1901 P P  . A   T 10 23  ? -44.165  87.046  56.896  1.00 320.28 ? 23  A   N P  1 
ATOM 1902 P P  . C   T 10 24  ? -39.953  87.836  60.891  1.00 286.49 ? 24  C   N P  1 
ATOM 1903 P P  . C   T 10 25  ? -34.919  85.916  64.220  1.00 266.86 ? 25  C   N P  1 
ATOM 1904 P P  . A   T 10 26  ? -30.642  82.205  64.640  1.00 276.55 ? 26  A   N P  1 
ATOM 1905 P P  . U   T 10 27  ? -26.852  78.825  63.049  1.00 248.87 ? 27  U   N P  1 
ATOM 1906 P P  . G   T 10 28  ? -23.845  77.986  60.069  1.00 309.46 ? 28  G   N P  1 
ATOM 1907 P P  . A   T 10 29  ? -23.856  77.723  55.859  1.00 273.14 ? 29  A   N P  1 
ATOM 1908 P P  . U   T 10 30  ? -23.597  78.187  50.781  1.00 381.34 ? 30  U   N P  1 
ATOM 1909 P P  . C   T 10 31  ? -22.618  83.809  47.198  1.00 270.74 ? 31  C   N P  1 
ATOM 1910 P P  . A   T 10 32  ? -18.718  86.744  46.368  1.00 318.86 ? 32  A   N P  1 
ATOM 1911 P P  . C   T 10 33  ? -18.621  93.062  46.283  1.00 268.34 ? 33  C   N P  1 
ATOM 1912 P P  . G   T 10 34  ? -17.472  91.256  50.332  1.00 268.37 ? 34  G   N P  1 
ATOM 1913 P P  . A   T 10 35  ? -23.652  90.857  53.701  1.00 292.06 ? 35  A   N P  1 
ATOM 1914 P P  . A   T 10 36  ? -28.546  86.964  50.224  1.00 340.27 ? 36  A   N P  1 
ATOM 1915 P P  . G   T 10 37  ? -35.174  84.859  49.250  1.00 321.67 ? 37  G   N P  1 
ATOM 1916 P P  . G   T 10 38  ? -37.411  79.030  48.488  1.00 275.53 ? 38  G   N P  1 
ATOM 1917 P P  . U   T 10 39  ? -37.022  73.378  50.393  1.00 281.31 ? 39  U   N P  1 
ATOM 1918 P P  . G   T 10 40  ? -36.997  69.756  54.752  1.00 272.00 ? 40  G   N P  1 
ATOM 1919 P P  . G   T 10 41  ? -38.107  69.004  60.421  1.00 261.44 ? 41  G   N P  1 
ATOM 1920 P P  . U   T 10 42  ? -40.908  71.755  65.717  1.00 283.38 ? 42  U   N P  1 
ATOM 1921 P P  . U   T 10 43  ? -43.981  74.771  68.500  1.00 279.92 ? 43  U   N P  1 
ATOM 1922 P P  . U   T 10 44  ? -49.329  78.224  67.442  1.00 268.85 ? 44  U   N P  1 
ATOM 1923 P P  . U   T 10 45  ? -54.259  79.662  64.455  1.00 272.33 ? 45  U   N P  1 
ATOM 1924 P P  . C   T 10 46  ? -59.060  79.621  61.404  1.00 261.10 ? 46  C   N P  1 
ATOM 1925 P P  . C   T 10 47  ? -63.125  77.661  57.355  1.00 303.06 ? 47  C   N P  1 
ATOM 1926 P P  . C   T 10 48  ? -63.984  70.829  55.194  1.00 264.43 ? 48  C   N P  1 
ATOM 1927 P P  . A   T 10 49  ? -65.451  66.353  56.494  1.00 284.11 ? 49  A   N P  1 
ATOM 1928 P P  . G   T 10 50  ? -66.599  61.978  59.837  1.00 286.93 ? 50  G   N P  1 
ATOM 1929 P P  . G   T 10 51  ? -66.832  60.061  65.798  1.00 278.24 ? 51  G   N P  1 
ATOM 1930 P P  . G   T 10 52  ? -66.562  60.759  71.519  1.00 257.60 ? 52  G   N P  1 
ATOM 1931 P P  . C   T 10 53  ? -66.883  63.264  76.513  1.00 297.97 ? 53  C   N P  1 
ATOM 1932 P P  . G   T 10 54  ? -69.363  66.730  79.271  1.00 339.69 ? 54  G   N P  1 
ATOM 1933 P P  . A   T 10 55  ? -72.508  72.278  80.798  1.00 315.36 ? 55  A   N P  1 
ATOM 1934 P P  . G   T 10 56  ? -76.117  77.365  78.998  1.00 297.39 ? 56  G   N P  1 
ATOM 1935 P P  . G   T 10 57  ? -81.271  78.705  76.468  1.00 263.77 ? 57  G   N P  1 
ATOM 1936 P P  . C   T 10 58  ? -86.890  77.219  74.574  1.00 294.85 ? 58  C   N P  1 
ATOM 1937 P P  . U   T 10 59  ? -91.331  73.788  73.082  1.00 279.73 ? 59  U   N P  1 
ATOM 1938 P P  . U   T 10 60  ? -93.949  69.264  74.601  1.00 286.27 ? 60  U   N P  1 
ATOM 1939 P P  . A   T 10 61  ? -95.590  65.107  79.132  1.00 231.83 ? 61  A   N P  1 
ATOM 1940 P P  . U   T 10 62  ? -95.806  63.417  84.782  1.00 213.85 ? 62  U   N P  1 
ATOM 1941 P P  . C   T 10 63  ? -95.352  64.181  90.201  1.00 209.47 ? 63  C   N P  1 
ATOM 1942 P P  . C   T 10 64  ? -94.202  67.418  95.602  1.00 208.84 ? 64  C   N P  1 
ATOM 1943 P P  . A   T 10 65  ? -94.468  72.455  98.318  1.00 213.21 ? 65  A   N P  1 
ATOM 1944 P P  . U   T 10 66  ? -97.716  77.283  98.593  1.00 221.29 ? 66  U   N P  1 
ATOM 1945 P P  . U   T 10 67  ? -102.363 80.319  97.165  1.00 224.40 ? 67  U   N P  1 
ATOM 1946 P P  . G   T 10 68  ? -107.308 83.114  96.367  1.00 215.78 ? 68  G   N P  1 
ATOM 1947 P P  . C   T 10 69  ? -108.264 86.641  91.264  1.00 236.82 ? 69  C   N P  1 
ATOM 1948 P P  . A   T 10 70  ? -107.760 90.052  86.410  1.00 182.48 ? 70  A   N P  1 
ATOM 1949 P P  . C   T 10 71  ? -105.397 90.095  80.784  1.00 194.22 ? 71  C   N P  1 
ATOM 1950 P P  . U   T 10 72  ? -105.819 91.269  75.664  1.00 243.09 ? 72  U   N P  1 
ATOM 1951 P P  . C   T 10 73  ? -102.782 86.535  76.384  1.00 270.66 ? 73  C   N P  1 
ATOM 1952 P P  . C   T 10 74  ? -99.109  82.319  78.939  1.00 257.46 ? 74  C   N P  1 
ATOM 1953 P P  . G   T 10 75  ? -95.630  82.356  83.878  1.00 222.49 ? 75  G   N P  1 
ATOM 1954 P P  . G   T 10 76  ? -89.335  80.928  85.649  1.00 245.26 ? 76  G   N P  1 
ATOM 1955 P P  . A   T 10 77  ? -84.877  77.689  87.470  1.00 246.71 ? 77  A   N P  1 
ATOM 1956 P P  . U   T 10 78  ? -81.465  73.088  87.691  1.00 247.82 ? 78  U   N P  1 
ATOM 1957 P P  . G   T 10 79  ? -79.932  67.769  85.647  1.00 266.48 ? 79  G   N P  1 
ATOM 1958 P P  . U   T 10 80  ? -80.564  62.937  81.693  1.00 258.81 ? 80  U   N P  1 
ATOM 1959 P P  . G   T 10 81  ? -81.548  60.449  77.281  1.00 271.42 ? 81  G   N P  1 
ATOM 1960 P P  . C   T 10 82  ? -81.586  60.981  71.761  1.00 263.62 ? 82  C   N P  1 
ATOM 1961 P P  . U   T 10 83  ? -80.110  63.918  67.392  1.00 274.79 ? 83  U   N P  1 
ATOM 1962 P P  . G   T 10 84  ? -77.292  68.602  64.873  1.00 327.55 ? 84  G   N P  1 
ATOM 1963 P P  . A   T 10 85  ? -74.414  74.375  64.185  1.00 343.39 ? 85  A   N P  1 
ATOM 1964 P P  . C   T 10 86  ? -69.415  77.865  67.269  1.00 290.26 ? 86  C   N P  1 
ATOM 1965 P P  . C   T 10 87  ? -64.213  79.416  69.188  1.00 281.97 ? 87  C   N P  1 
ATOM 1966 P P  . C   T 10 88  ? -58.610  75.531  69.752  1.00 263.27 ? 88  C   N P  1 
ATOM 1967 P P  . C   T 10 89  ? -55.079  71.378  71.071  1.00 265.69 ? 89  C   N P  1 
ATOM 1968 P P  . U   T 10 90  ? -52.784  67.006  69.575  1.00 270.35 ? 90  U   N P  1 
ATOM 1969 P P  . G   T 10 91  ? -51.741  61.819  65.786  1.00 268.11 ? 91  G   N P  1 
ATOM 1970 P P  . C   T 10 92  ? -54.553  58.501  60.221  1.00 273.23 ? 92  C   N P  1 
ATOM 1971 P P  . G   T 10 93  ? -56.692  56.231  64.321  1.00 304.71 ? 93  G   N P  1 
ATOM 1972 P P  . A   T 10 94  ? -55.413  52.153  69.917  1.00 326.07 ? 94  A   N P  1 
ATOM 1973 P P  . U   T 10 95  ? -53.518  47.607  73.238  1.00 352.19 ? 95  U   N P  1 
ATOM 1974 P P  . U   T 10 96  ? -48.394  45.260  74.805  1.00 379.08 ? 96  U   N P  1 
ATOM 1975 P P  . U   T 10 97  ? -43.234  45.415  76.325  1.00 395.81 ? 97  U   N P  1 
ATOM 1976 P P  . C   T 10 98  ? -38.298  48.393  78.062  1.00 434.62 ? 98  C   N P  1 
ATOM 1977 P P  . C   T 10 99  ? -35.414  53.072  79.737  1.00 486.00 ? 99  C   N P  1 
ATOM 1978 P P  . C   T 10 100 ? -34.516  58.452  81.631  1.00 478.21 ? 100 C   N P  1 
ATOM 1979 P P  . C   T 10 101 ? -35.659  63.329  84.013  1.00 448.26 ? 101 C   N P  1 
ATOM 1980 P P  . A   T 10 102 ? -39.493  67.053  86.950  1.00 442.98 ? 102 A   N P  1 
ATOM 1981 P P  . A   T 10 103 ? -42.152  68.980  91.023  1.00 480.25 ? 103 A   N P  1 
ATOM 1982 P P  . A   T 10 104 ? -43.651  64.787  94.072  1.00 444.88 ? 104 A   N P  1 
ATOM 1983 P P  . U   T 10 105 ? -45.572  59.223  95.372  1.00 432.11 ? 105 U   N P  1 
ATOM 1984 P P  . G   T 10 106 ? -49.700  54.945  92.804  1.00 452.75 ? 106 G   N P  1 
ATOM 1985 P P  . U   T 10 107 ? -50.671  56.780  85.832  1.00 492.68 ? 107 U   N P  1 
ATOM 1986 P P  . G   T 10 108 ? -52.358  58.792  80.252  1.00 504.52 ? 108 G   N P  1 
ATOM 1987 P P  . G   T 10 109 ? -50.483  61.271  74.743  1.00 520.35 ? 109 G   N P  1 
ATOM 1988 P P  . G   T 10 110 ? -46.804  62.059  70.237  1.00 452.49 ? 110 G   N P  1 
ATOM 1989 P P  . A   T 10 111 ? -42.944  60.326  66.403  1.00 413.32 ? 111 A   N P  1 
ATOM 1990 P P  . A   T 10 112 ? -40.581  56.023  63.681  1.00 341.48 ? 112 A   N P  1 
ATOM 1991 P P  . A   T 10 113 ? -40.084  50.585  61.415  1.00 340.47 ? 113 A   N P  1 
ATOM 1992 P P  . C   T 10 114 ? -43.187  45.804  60.528  1.00 349.33 ? 114 C   N P  1 
ATOM 1993 P P  . U   T 10 115 ? -42.747  41.673  61.579  1.00 305.04 ? 115 U   N P  1 
ATOM 1994 P P  . C   T 10 116 ? -48.042  39.445  60.758  1.00 320.40 ? 116 C   N P  1 
ATOM 1995 P P  . G   T 10 117 ? -54.372  39.135  60.345  1.00 299.96 ? 117 G   N P  1 
ATOM 1996 P P  . A   T 10 118 ? -59.419  42.204  59.219  1.00 279.93 ? 118 A   N P  1 
ATOM 1997 P P  . C   T 10 119 ? -62.860  47.292  56.142  1.00 254.05 ? 119 C   N P  1 
ATOM 1998 P P  . U   T 10 120 ? -62.725  51.993  51.667  1.00 225.23 ? 120 U   N P  1 
ATOM 1999 P P  . G   T 10 121 ? -60.584  54.050  46.742  1.00 222.24 ? 121 G   N P  1 
ATOM 2000 P P  . C   T 10 122 ? -57.528  53.229  41.554  1.00 201.58 ? 122 C   N P  1 
ATOM 2001 P P  . A   T 10 123 ? -55.315  50.450  37.606  1.00 222.18 ? 123 A   N P  1 
ATOM 2002 P P  . U   T 10 124 ? -55.291  45.049  34.496  1.00 211.23 ? 124 U   N P  1 
ATOM 2003 P P  . A   T 10 125 ? -60.131  49.328  34.174  1.00 209.51 ? 125 A   N P  1 
ATOM 2004 P P  . A   T 10 126 ? -61.484  43.652  33.024  1.00 215.94 ? 126 A   N P  1 
ATOM 2005 P P  . U   T 10 127 ? -64.394  39.169  31.303  1.00 224.32 ? 127 U   N P  1 
ATOM 2006 P P  . U   T 10 128 ? -69.417  36.496  32.766  1.00 260.99 ? 128 U   N P  1 
ATOM 2007 P P  . U   T 10 129 ? -67.371  38.809  38.057  1.00 218.69 ? 129 U   N P  1 
ATOM 2008 P P  . G   T 10 130 ? -67.518  43.063  39.753  1.00 352.77 ? 130 G   N P  1 
ATOM 2009 P P  . U   T 10 131 ? -65.089  48.348  36.052  1.00 283.36 ? 131 U   N P  1 
ATOM 2010 P P  . G   T 10 132 ? -67.006  45.806  31.792  1.00 380.68 ? 132 G   N P  1 
ATOM 2011 P P  . G   T 10 133 ? -69.460  44.500  27.375  1.00 318.53 ? 133 G   N P  1 
ATOM 2012 P P  . U   T 10 134 ? -74.037  47.436  26.879  1.00 223.49 ? 134 U   N P  1 
ATOM 2013 P P  . A   T 10 135 ? -80.596  45.970  29.642  1.00 230.56 ? 135 A   N P  1 
ATOM 2014 P P  . G   T 10 136 ? -84.251  50.350  25.908  1.00 315.72 ? 136 G   N P  1 
ATOM 2015 P P  . U   T 10 137 ? -87.941  51.542  19.615  1.00 341.56 ? 137 U   N P  1 
ATOM 2016 P P  . G   T 10 138 ? -91.201  47.323  17.626  1.00 308.95 ? 138 G   N P  1 
ATOM 2017 P P  . G   T 10 139 ? -97.642  45.079  19.731  1.00 369.27 ? 139 G   N P  1 
ATOM 2018 P P  . G   T 10 140 ? -102.564 45.980  22.817  1.00 405.96 ? 140 G   N P  1 
ATOM 2019 P P  . G   T 10 141 ? -107.625 48.192  23.184  1.00 377.91 ? 141 G   N P  1 
ATOM 2020 P P  . G   T 10 142 ? -112.101 50.332  20.693  1.00 362.48 ? 142 G   N P  1 
ATOM 2021 P P  . A   T 10 143 ? -115.417 51.198  16.527  1.00 359.39 ? 143 A   N P  1 
ATOM 2022 P P  . C   T 10 144 ? -116.748 50.273  10.478  1.00 356.67 ? 144 C   N P  1 
ATOM 2023 P P  . U   T 10 145 ? -117.518 48.102  5.950   1.00 358.71 ? 145 U   N P  1 
ATOM 2024 P P  . G   T 10 146 ? -116.166 41.679  3.897   1.00 402.82 ? 146 G   N P  1 
ATOM 2025 P P  . C   T 10 147 ? -115.933 35.614  3.650   1.00 408.69 ? 147 C   N P  1 
ATOM 2026 P P  . G   T 10 148 ? -116.510 30.958  7.266   1.00 466.86 ? 148 G   N P  1 
ATOM 2027 P P  . U   T 10 149 ? -118.384 28.767  12.480  1.00 408.92 ? 149 U   N P  1 
ATOM 2028 P P  . U   T 10 150 ? -122.347 31.048  17.840  1.00 415.42 ? 150 U   N P  1 
ATOM 2029 P P  . C   T 10 151 ? -123.378 35.220  21.759  1.00 415.56 ? 151 C   N P  1 
ATOM 2030 P P  . G   T 10 152 ? -124.308 41.831  20.044  1.00 480.28 ? 152 G   N P  1 
ATOM 2031 P P  . C   T 10 153 ? -117.669 44.138  20.632  1.00 483.85 ? 153 C   N P  1 
ATOM 2032 P P  . G   T 10 154 ? -111.110 41.439  20.314  1.00 492.44 ? 154 G   N P  1 
ATOM 2033 P P  . C   T 10 155 ? -106.748 38.641  18.168  1.00 435.58 ? 155 C   N P  1 
ATOM 2034 P P  . U   T 10 156 ? -103.574 38.524  12.056  1.00 392.59 ? 156 U   N P  1 
ATOM 2035 P P  . U   T 10 157 ? -103.638 42.055  6.336   1.00 360.50 ? 157 U   N P  1 
ATOM 2036 P P  . U   T 10 158 ? -103.095 46.956  3.693   1.00 350.25 ? 158 U   N P  1 
ATOM 2037 P P  . C   T 10 159 ? -103.357 53.081  4.594   1.00 325.35 ? 159 C   N P  1 
ATOM 2038 P P  . C   T 10 160 ? -103.664 58.083  6.715   1.00 332.54 ? 160 C   N P  1 
ATOM 2039 P P  . C   T 10 161 ? -103.715 61.861  11.686  1.00 351.80 ? 161 C   N P  1 
ATOM 2040 P P  . C   T 10 162 ? -102.554 63.234  16.655  1.00 364.55 ? 162 C   N P  1 
ATOM 2041 P P  . U   T 10 163 ? -98.900  62.414  20.715  1.00 319.10 ? 163 U   N P  1 
ATOM 2042 P P  . G   T 10 164 ? -93.926  59.903  23.130  1.00 305.52 ? 164 G   N P  1 
ATOM 2043 P P  . DG  U 11 2   ? -12.325  64.346  -32.787 1.00 476.38 ? 2   DG  D P  1 
ATOM 2044 P P  . DG  U 11 3   ? -13.710  65.990  -27.606 1.00 509.97 ? 3   DG  D P  1 
ATOM 2045 P P  . DT  U 11 4   ? -13.134  69.523  -23.254 1.00 525.55 ? 4   DT  D P  1 
ATOM 2046 P P  . DA  U 11 5   ? -10.867  73.790  -19.296 1.00 501.19 ? 5   DA  D P  1 
ATOM 2047 P P  . DA  U 11 6   ? -9.267   79.230  -19.908 1.00 500.51 ? 6   DA  D P  1 
ATOM 2048 P P  . DG  U 11 7   ? -8.510   84.089  -22.780 1.00 522.85 ? 7   DG  D P  1 
ATOM 2049 P P  . DT  U 11 8   ? -9.312   87.803  -26.868 1.00 475.80 ? 8   DT  D P  1 
ATOM 2050 P P  . DA  U 11 9   ? -10.418  89.726  -33.480 1.00 431.43 ? 9   DA  D P  1 
ATOM 2051 P P  . DG  V 11 2   ? -42.042  34.939  60.158  1.00 476.77 ? 2   DG  M P  1 
ATOM 2052 P P  . DG  V 11 3   ? -45.389  31.581  63.174  1.00 509.83 ? 3   DG  M P  1 
ATOM 2053 P P  . DT  V 11 4   ? -47.097  26.449  64.762  1.00 525.33 ? 4   DT  M P  1 
ATOM 2054 P P  . DA  V 11 5   ? -48.130  20.315  64.897  1.00 501.11 ? 5   DA  M P  1 
ATOM 2055 P P  . DA  V 11 6   ? -44.699  15.727  64.952  1.00 500.46 ? 6   DA  M P  1 
ATOM 2056 P P  . DG  V 11 7   ? -39.666  13.083  64.968  1.00 522.49 ? 7   DG  M P  1 
ATOM 2057 P P  . DT  V 11 8   ? -34.144  12.535  65.793  1.00 476.14 ? 8   DT  M P  1 
ATOM 2058 P P  . DA  V 11 9   ? -27.563  14.731  65.780  1.00 431.00 ? 9   DA  M P  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1  1   MET 1   1   ?   ?   ?   A . n 
A 1  2   ALA 2   2   ?   ?   ?   A . n 
A 1  3   VAL 3   3   ?   ?   ?   A . n 
A 1  4   PRO 4   4   ?   ?   ?   A . n 
A 1  5   GLU 5   5   5   GLU GLU A . n 
A 1  6   THR 6   6   6   THR THR A . n 
A 1  7   ARG 7   7   7   ARG ARG A . n 
A 1  8   PRO 8   8   8   PRO PRO A . n 
A 1  9   ASN 9   9   9   ASN ASN A . n 
A 1  10  HIS 10  10  10  HIS HIS A . n 
A 1  11  THR 11  11  11  THR THR A . n 
A 1  12  ILE 12  12  12  ILE ILE A . n 
A 1  13  TYR 13  13  13  TYR TYR A . n 
A 1  14  ILE 14  14  14  ILE ILE A . n 
A 1  15  ASN 15  15  15  ASN ASN A . n 
A 1  16  ASN 16  16  16  ASN ASN A . n 
A 1  17  LEU 17  17  17  LEU LEU A . n 
A 1  18  ASN 18  18  18  ASN ASN A . n 
A 1  19  GLU 19  19  19  GLU GLU A . n 
A 1  20  LYS 20  20  20  LYS LYS A . n 
A 1  21  ILE 21  21  21  ILE ILE A . n 
A 1  22  LYS 22  22  22  LYS LYS A . n 
A 1  23  LYS 23  23  23  LYS LYS A . n 
A 1  24  ASP 24  24  24  ASP ASP A . n 
A 1  25  GLU 25  25  25  GLU GLU A . n 
A 1  26  LEU 26  26  26  LEU LEU A . n 
A 1  27  LYS 27  27  27  LYS LYS A . n 
A 1  28  LYS 28  28  28  LYS LYS A . n 
A 1  29  SER 29  29  29  SER SER A . n 
A 1  30  LEU 30  30  30  LEU LEU A . n 
A 1  31  TYR 31  31  31  TYR TYR A . n 
A 1  32  ALA 32  32  32  ALA ALA A . n 
A 1  33  ILE 33  33  33  ILE ILE A . n 
A 1  34  PHE 34  34  34  PHE PHE A . n 
A 1  35  SER 35  35  35  SER SER A . n 
A 1  36  GLN 36  36  36  GLN GLN A . n 
A 1  37  PHE 37  37  37  PHE PHE A . n 
A 1  38  GLY 38  38  38  GLY GLY A . n 
A 1  39  GLN 39  39  39  GLN GLN A . n 
A 1  40  ILE 40  40  40  ILE ILE A . n 
A 1  41  LEU 41  41  41  LEU LEU A . n 
A 1  42  ASP 42  42  42  ASP ASP A . n 
A 1  43  ILE 43  43  43  ILE ILE A . n 
A 1  44  LEU 44  44  44  LEU LEU A . n 
A 1  45  VAL 45  45  45  VAL VAL A . n 
A 1  46  SER 46  46  46  SER SER A . n 
A 1  47  ARG 47  47  47  ARG ARG A . n 
A 1  48  SER 48  48  48  SER SER A . n 
A 1  49  LEU 49  49  49  LEU LEU A . n 
A 1  50  LYS 50  50  50  LYS LYS A . n 
A 1  51  MET 51  51  51  MET MET A . n 
A 1  52  ARG 52  52  52  ARG ARG A . n 
A 1  53  GLY 53  53  53  GLY GLY A . n 
A 1  54  GLN 54  54  54  GLN GLN A . n 
A 1  55  ALA 55  55  55  ALA ALA A . n 
A 1  56  PHE 56  56  56  PHE PHE A . n 
A 1  57  VAL 57  57  57  VAL VAL A . n 
A 1  58  ILE 58  58  58  ILE ILE A . n 
A 1  59  PHE 59  59  59  PHE PHE A . n 
A 1  60  LYS 60  60  60  LYS LYS A . n 
A 1  61  GLU 61  61  61  GLU GLU A . n 
A 1  62  VAL 62  62  62  VAL VAL A . n 
A 1  63  SER 63  63  63  SER SER A . n 
A 1  64  SER 64  64  64  SER SER A . n 
A 1  65  ALA 65  65  65  ALA ALA A . n 
A 1  66  THR 66  66  66  THR THR A . n 
A 1  67  ASN 67  67  67  ASN ASN A . n 
A 1  68  ALA 68  68  68  ALA ALA A . n 
A 1  69  LEU 69  69  69  LEU LEU A . n 
A 1  70  ARG 70  70  70  ARG ARG A . n 
A 1  71  SER 71  71  71  SER SER A . n 
A 1  72  MET 72  72  72  MET MET A . n 
A 1  73  GLN 73  73  73  GLN GLN A . n 
A 1  74  GLY 74  74  74  GLY GLY A . n 
A 1  75  PHE 75  75  75  PHE PHE A . n 
A 1  76  PRO 76  76  76  PRO PRO A . n 
A 1  77  PHE 77  77  77  PHE PHE A . n 
A 1  78  TYR 78  78  78  TYR TYR A . n 
A 1  79  ASP 79  79  79  ASP ASP A . n 
A 1  80  LYS 80  80  80  LYS LYS A . n 
A 1  81  PRO 81  81  81  PRO PRO A . n 
A 1  82  MET 82  82  82  MET MET A . n 
A 1  83  ARG 83  83  83  ARG ARG A . n 
A 1  84  ILE 84  84  84  ILE ILE A . n 
A 1  85  GLN 85  85  85  GLN GLN A . n 
A 1  86  TYR 86  86  86  TYR TYR A . n 
A 1  87  ALA 87  87  87  ALA ALA A . n 
A 1  88  LYS 88  88  88  LYS LYS A . n 
A 1  89  THR 89  89  89  THR THR A . n 
A 1  90  ASP 90  90  90  ASP ASP A . n 
A 1  91  SER 91  91  91  SER SER A . n 
A 1  92  ASP 92  92  92  ASP ASP A . n 
A 1  93  ILE 93  93  93  ILE ILE A . n 
A 1  94  ILE 94  94  94  ILE ILE A . n 
A 1  95  ALA 95  95  95  ALA ALA A . n 
A 1  96  LYS 96  96  96  LYS LYS A . n 
A 1  97  MET 97  97  97  MET MET A . n 
A 1  98  LYS 98  98  98  LYS LYS A . n 
A 1  99  GLY 99  99  99  GLY GLY A . n 
A 1  100 THR 100 100 100 THR THR A . n 
A 1  101 PHE 101 101 101 PHE PHE A . n 
A 1  102 VAL 102 102 102 VAL VAL A . n 
A 1  103 GLU 103 103 103 GLU GLU A . n 
A 1  104 ARG 104 104 104 ARG ARG A . n 
A 1  105 ASP 105 105 105 ASP ASP A . n 
A 1  106 ARG 106 106 106 ARG ARG A . n 
A 1  107 LYS 107 107 107 LYS LYS A . n 
A 1  108 ARG 108 108 108 ARG ARG A . n 
A 1  109 GLU 109 109 109 GLU GLU A . n 
A 1  110 LYS 110 110 110 LYS LYS A . n 
A 1  111 ARG 111 111 111 ARG ARG A . n 
A 1  112 LYS 112 112 112 LYS LYS A . n 
A 1  113 PRO 113 113 ?   ?   ?   A . n 
A 1  114 LYS 114 114 ?   ?   ?   A . n 
A 1  115 SER 115 115 ?   ?   ?   A . n 
A 1  116 GLN 116 116 ?   ?   ?   A . n 
A 1  117 GLU 117 117 ?   ?   ?   A . n 
A 1  118 THR 118 118 ?   ?   ?   A . n 
A 1  119 PRO 119 119 ?   ?   ?   A . n 
A 1  120 ALA 120 120 ?   ?   ?   A . n 
A 1  121 THR 121 121 ?   ?   ?   A . n 
A 1  122 LYS 122 122 ?   ?   ?   A . n 
A 1  123 LYS 123 123 ?   ?   ?   A . n 
A 1  124 ALA 124 124 ?   ?   ?   A . n 
A 1  125 VAL 125 125 ?   ?   ?   A . n 
A 1  126 GLN 126 126 ?   ?   ?   A . n 
A 1  127 GLY 127 127 ?   ?   ?   A . n 
A 1  128 GLY 128 128 ?   ?   ?   A . n 
A 1  129 GLY 129 129 ?   ?   ?   A . n 
A 1  130 ALA 130 130 ?   ?   ?   A . n 
A 1  131 THR 131 131 ?   ?   ?   A . n 
A 1  132 PRO 132 132 ?   ?   ?   A . n 
A 1  133 VAL 133 133 ?   ?   ?   A . n 
A 1  134 VAL 134 134 ?   ?   ?   A . n 
A 1  135 GLY 135 135 ?   ?   ?   A . n 
A 1  136 ALA 136 136 ?   ?   ?   A . n 
A 1  137 VAL 137 137 ?   ?   ?   A . n 
A 1  138 GLN 138 138 ?   ?   ?   A . n 
A 1  139 GLY 139 139 ?   ?   ?   A . n 
A 1  140 PRO 140 140 ?   ?   ?   A . n 
A 1  141 VAL 141 141 ?   ?   ?   A . n 
A 1  142 PRO 142 142 ?   ?   ?   A . n 
A 1  143 GLY 143 143 ?   ?   ?   A . n 
A 1  144 MET 144 144 ?   ?   ?   A . n 
A 1  145 PRO 145 145 ?   ?   ?   A . n 
A 1  146 PRO 146 146 ?   ?   ?   A . n 
A 1  147 MET 147 147 ?   ?   ?   A . n 
A 1  148 THR 148 148 ?   ?   ?   A . n 
A 1  149 GLN 149 149 ?   ?   ?   A . n 
A 1  150 ALA 150 150 ?   ?   ?   A . n 
A 1  151 PRO 151 151 ?   ?   ?   A . n 
A 1  152 ARG 152 152 ?   ?   ?   A . n 
A 1  153 ILE 153 153 ?   ?   ?   A . n 
A 1  154 MET 154 154 ?   ?   ?   A . n 
A 1  155 HIS 155 155 ?   ?   ?   A . n 
A 1  156 HIS 156 156 ?   ?   ?   A . n 
A 1  157 MET 157 157 ?   ?   ?   A . n 
A 1  158 PRO 158 158 ?   ?   ?   A . n 
A 1  159 GLY 159 159 ?   ?   ?   A . n 
A 1  160 GLN 160 160 ?   ?   ?   A . n 
A 1  161 PRO 161 161 ?   ?   ?   A . n 
A 1  162 PRO 162 162 ?   ?   ?   A . n 
A 1  163 TYR 163 163 ?   ?   ?   A . n 
A 1  164 MET 164 164 ?   ?   ?   A . n 
A 1  165 PRO 165 165 ?   ?   ?   A . n 
A 1  166 PRO 166 166 ?   ?   ?   A . n 
A 1  167 PRO 167 167 ?   ?   ?   A . n 
A 1  168 GLY 168 168 ?   ?   ?   A . n 
A 1  169 MET 169 169 ?   ?   ?   A . n 
A 1  170 ILE 170 170 ?   ?   ?   A . n 
A 1  171 PRO 171 171 ?   ?   ?   A . n 
A 1  172 PRO 172 172 ?   ?   ?   A . n 
A 1  173 PRO 173 173 ?   ?   ?   A . n 
A 1  174 GLY 174 174 ?   ?   ?   A . n 
A 1  175 LEU 175 175 ?   ?   ?   A . n 
A 1  176 ALA 176 176 ?   ?   ?   A . n 
A 1  177 PRO 177 177 ?   ?   ?   A . n 
A 1  178 GLY 178 178 ?   ?   ?   A . n 
A 1  179 GLN 179 179 ?   ?   ?   A . n 
A 1  180 ILE 180 180 ?   ?   ?   A . n 
A 1  181 PRO 181 181 ?   ?   ?   A . n 
A 1  182 PRO 182 182 ?   ?   ?   A . n 
A 1  183 GLY 183 183 ?   ?   ?   A . n 
A 1  184 ALA 184 184 ?   ?   ?   A . n 
A 1  185 MET 185 185 ?   ?   ?   A . n 
A 1  186 PRO 186 186 ?   ?   ?   A . n 
A 1  187 PRO 187 187 ?   ?   ?   A . n 
A 1  188 GLN 188 188 ?   ?   ?   A . n 
A 1  189 GLN 189 189 ?   ?   ?   A . n 
A 1  190 LEU 190 190 ?   ?   ?   A . n 
A 1  191 MET 191 191 ?   ?   ?   A . n 
A 1  192 PRO 192 192 ?   ?   ?   A . n 
A 1  193 GLY 193 193 ?   ?   ?   A . n 
A 1  194 GLN 194 194 ?   ?   ?   A . n 
A 1  195 MET 195 195 ?   ?   ?   A . n 
A 1  196 PRO 196 196 ?   ?   ?   A . n 
A 1  197 PRO 197 197 ?   ?   ?   A . n 
A 1  198 ALA 198 198 ?   ?   ?   A . n 
A 1  199 GLN 199 199 ?   ?   ?   A . n 
A 1  200 PRO 200 200 ?   ?   ?   A . n 
A 1  201 LEU 201 201 ?   ?   ?   A . n 
A 1  202 SER 202 202 ?   ?   ?   A . n 
A 1  203 GLU 203 203 ?   ?   ?   A . n 
A 1  204 ASN 204 204 ?   ?   ?   A . n 
A 1  205 PRO 205 205 ?   ?   ?   A . n 
A 1  206 PRO 206 206 ?   ?   ?   A . n 
A 1  207 ASN 207 207 ?   ?   ?   A . n 
A 1  208 HIS 208 208 ?   ?   ?   A . n 
A 1  209 ILE 209 209 ?   ?   ?   A . n 
A 1  210 LEU 210 210 ?   ?   ?   A . n 
A 1  211 PHE 211 211 ?   ?   ?   A . n 
A 1  212 LEU 212 212 ?   ?   ?   A . n 
A 1  213 THR 213 213 ?   ?   ?   A . n 
A 1  214 ASN 214 214 ?   ?   ?   A . n 
A 1  215 LEU 215 215 ?   ?   ?   A . n 
A 1  216 PRO 216 216 ?   ?   ?   A . n 
A 1  217 GLU 217 217 ?   ?   ?   A . n 
A 1  218 GLU 218 218 ?   ?   ?   A . n 
A 1  219 THR 219 219 ?   ?   ?   A . n 
A 1  220 ASN 220 220 ?   ?   ?   A . n 
A 1  221 GLU 221 221 ?   ?   ?   A . n 
A 1  222 LEU 222 222 ?   ?   ?   A . n 
A 1  223 MET 223 223 ?   ?   ?   A . n 
A 1  224 LEU 224 224 ?   ?   ?   A . n 
A 1  225 SER 225 225 ?   ?   ?   A . n 
A 1  226 MET 226 226 ?   ?   ?   A . n 
A 1  227 LEU 227 227 ?   ?   ?   A . n 
A 1  228 PHE 228 228 ?   ?   ?   A . n 
A 1  229 ASN 229 229 ?   ?   ?   A . n 
A 1  230 GLN 230 230 ?   ?   ?   A . n 
A 1  231 PHE 231 231 ?   ?   ?   A . n 
A 1  232 PRO 232 232 ?   ?   ?   A . n 
A 1  233 GLY 233 233 ?   ?   ?   A . n 
A 1  234 PHE 234 234 ?   ?   ?   A . n 
A 1  235 LYS 235 235 ?   ?   ?   A . n 
A 1  236 GLU 236 236 ?   ?   ?   A . n 
A 1  237 VAL 237 237 ?   ?   ?   A . n 
A 1  238 ARG 238 238 ?   ?   ?   A . n 
A 1  239 LEU 239 239 ?   ?   ?   A . n 
A 1  240 VAL 240 240 ?   ?   ?   A . n 
A 1  241 PRO 241 241 ?   ?   ?   A . n 
A 1  242 GLY 242 242 ?   ?   ?   A . n 
A 1  243 ARG 243 243 ?   ?   ?   A . n 
A 1  244 HIS 244 244 ?   ?   ?   A . n 
A 1  245 ASP 245 245 ?   ?   ?   A . n 
A 1  246 ILE 246 246 ?   ?   ?   A . n 
A 1  247 ALA 247 247 ?   ?   ?   A . n 
A 1  248 PHE 248 248 ?   ?   ?   A . n 
A 1  249 VAL 249 249 ?   ?   ?   A . n 
A 1  250 GLU 250 250 ?   ?   ?   A . n 
A 1  251 PHE 251 251 ?   ?   ?   A . n 
A 1  252 ASP 252 252 ?   ?   ?   A . n 
A 1  253 ASN 253 253 ?   ?   ?   A . n 
A 1  254 GLU 254 254 ?   ?   ?   A . n 
A 1  255 VAL 255 255 ?   ?   ?   A . n 
A 1  256 GLN 256 256 ?   ?   ?   A . n 
A 1  257 ALA 257 257 ?   ?   ?   A . n 
A 1  258 GLY 258 258 ?   ?   ?   A . n 
A 1  259 ALA 259 259 ?   ?   ?   A . n 
A 1  260 ALA 260 260 ?   ?   ?   A . n 
A 1  261 ARG 261 261 ?   ?   ?   A . n 
A 1  262 ASP 262 262 ?   ?   ?   A . n 
A 1  263 ALA 263 263 ?   ?   ?   A . n 
A 1  264 LEU 264 264 ?   ?   ?   A . n 
A 1  265 GLN 265 265 ?   ?   ?   A . n 
A 1  266 GLY 266 266 ?   ?   ?   A . n 
A 1  267 PHE 267 267 ?   ?   ?   A . n 
A 1  268 LYS 268 268 ?   ?   ?   A . n 
A 1  269 ILE 269 269 ?   ?   ?   A . n 
A 1  270 THR 270 270 ?   ?   ?   A . n 
A 1  271 GLN 271 271 ?   ?   ?   A . n 
A 1  272 ASN 272 272 ?   ?   ?   A . n 
A 1  273 ASN 273 273 ?   ?   ?   A . n 
A 1  274 ALA 274 274 ?   ?   ?   A . n 
A 1  275 MET 275 275 ?   ?   ?   A . n 
A 1  276 LYS 276 276 ?   ?   ?   A . n 
A 1  277 ILE 277 277 ?   ?   ?   A . n 
A 1  278 SER 278 278 ?   ?   ?   A . n 
A 1  279 PHE 279 279 ?   ?   ?   A . n 
A 1  280 ALA 280 280 ?   ?   ?   A . n 
A 1  281 LYS 281 281 ?   ?   ?   A . n 
A 1  282 LYS 282 282 ?   ?   ?   A . n 
B 2  1   MET 1   1   ?   ?   ?   S . n 
B 2  2   THR 2   2   ?   ?   ?   S . n 
B 2  3   GLN 3   3   ?   ?   ?   S . n 
B 2  4   PHE 4   4   ?   ?   ?   S . n 
B 2  5   LEU 5   5   ?   ?   ?   S . n 
B 2  6   PRO 6   6   ?   ?   ?   S . n 
B 2  7   PRO 7   7   ?   ?   ?   S . n 
B 2  8   ASN 8   8   ?   ?   ?   S . n 
B 2  9   LEU 9   9   ?   ?   ?   S . n 
B 2  10  LEU 10  10  ?   ?   ?   S . n 
B 2  11  ALA 11  11  ?   ?   ?   S . n 
B 2  12  LEU 12  12  ?   ?   ?   S . n 
B 2  13  PHE 13  13  ?   ?   ?   S . n 
B 2  14  ALA 14  14  ?   ?   ?   S . n 
B 2  15  PRO 15  15  ?   ?   ?   S . n 
B 2  16  ARG 16  16  ?   ?   ?   S . n 
B 2  17  ASP 17  17  ?   ?   ?   S . n 
B 2  18  PRO 18  18  ?   ?   ?   S . n 
B 2  19  ILE 19  19  ?   ?   ?   S . n 
B 2  20  PRO 20  20  ?   ?   ?   S . n 
B 2  21  TYR 21  21  ?   ?   ?   S . n 
B 2  22  LEU 22  22  ?   ?   ?   S . n 
B 2  23  PRO 23  23  ?   ?   ?   S . n 
B 2  24  PRO 24  24  ?   ?   ?   S . n 
B 2  25  LEU 25  25  ?   ?   ?   S . n 
B 2  26  GLU 26  26  ?   ?   ?   S . n 
B 2  27  LYS 27  27  ?   ?   ?   S . n 
B 2  28  LEU 28  28  ?   ?   ?   S . n 
B 2  29  PRO 29  29  ?   ?   ?   S . n 
B 2  30  HIS 30  30  ?   ?   ?   S . n 
B 2  31  GLU 31  31  ?   ?   ?   S . n 
B 2  32  LYS 32  32  ?   ?   ?   S . n 
B 2  33  HIS 33  33  ?   ?   ?   S . n 
B 2  34  HIS 34  34  34  HIS HIS S . n 
B 2  35  ASN 35  35  35  ASN ASN S . n 
B 2  36  GLN 36  36  36  GLN GLN S . n 
B 2  37  PRO 37  37  37  PRO PRO S . n 
B 2  38  TYR 38  38  38  TYR TYR S . n 
B 2  39  CYS 39  39  39  CYS CYS S . n 
B 2  40  GLY 40  40  40  GLY GLY S . n 
B 2  41  ILE 41  41  41  ILE ILE S . n 
B 2  42  ALA 42  42  42  ALA ALA S . n 
B 2  43  PRO 43  43  43  PRO PRO S . n 
B 2  44  TYR 44  44  44  TYR TYR S . n 
B 2  45  ILE 45  45  45  ILE ILE S . n 
B 2  46  ARG 46  46  46  ARG ARG S . n 
B 2  47  GLU 47  47  47  GLU GLU S . n 
B 2  48  PHE 48  48  48  PHE PHE S . n 
B 2  49  GLU 49  49  49  GLU GLU S . n 
B 2  50  ASP 50  50  50  ASP ASP S . n 
B 2  51  PRO 51  51  51  PRO PRO S . n 
B 2  52  ARG 52  52  52  ARG ARG S . n 
B 2  53  ASP 53  53  53  ASP ASP S . n 
B 2  54  ALA 54  54  54  ALA ALA S . n 
B 2  55  PRO 55  55  55  PRO PRO S . n 
B 2  56  PRO 56  56  56  PRO PRO S . n 
B 2  57  PRO 57  57  57  PRO PRO S . n 
B 2  58  THR 58  58  58  THR THR S . n 
B 2  59  ARG 59  59  59  ARG ARG S . n 
B 2  60  ALA 60  60  60  ALA ALA S . n 
B 2  61  GLU 61  61  61  GLU GLU S . n 
B 2  62  THR 62  62  62  THR THR S . n 
B 2  63  ARG 63  63  63  ARG ARG S . n 
B 2  64  GLU 64  64  64  GLU GLU S . n 
B 2  65  GLU 65  65  65  GLU GLU S . n 
B 2  66  ARG 66  66  66  ARG ARG S . n 
B 2  67  MET 67  67  67  MET MET S . n 
B 2  68  GLU 68  68  68  GLU GLU S . n 
B 2  69  ARG 69  69  69  ARG ARG S . n 
B 2  70  LYS 70  70  70  LYS LYS S . n 
B 2  71  ARG 71  71  71  ARG ARG S . n 
B 2  72  ARG 72  72  72  ARG ARG S . n 
B 2  73  GLU 73  73  73  GLU GLU S . n 
B 2  74  LYS 74  74  74  LYS LYS S . n 
B 2  75  ILE 75  75  75  ILE ILE S . n 
B 2  76  GLU 76  76  76  GLU GLU S . n 
B 2  77  ARG 77  77  77  ARG ARG S . n 
B 2  78  ARG 78  78  78  ARG ARG S . n 
B 2  79  GLN 79  79  79  GLN GLN S . n 
B 2  80  GLN 80  80  80  GLN GLN S . n 
B 2  81  GLU 81  81  81  GLU GLU S . n 
B 2  82  VAL 82  82  82  VAL VAL S . n 
B 2  83  GLU 83  83  83  GLU GLU S . n 
B 2  84  THR 84  84  84  THR THR S . n 
B 2  85  GLU 85  85  85  GLU GLU S . n 
B 2  86  LEU 86  86  86  LEU LEU S . n 
B 2  87  LYS 87  87  87  LYS LYS S . n 
B 2  88  MET 88  88  88  MET MET S . n 
B 2  89  TRP 89  89  89  TRP TRP S . n 
B 2  90  ASP 90  90  90  ASP ASP S . n 
B 2  91  PRO 91  91  91  PRO PRO S . n 
B 2  92  HIS 92  92  92  HIS HIS S . n 
B 2  93  ASN 93  93  93  ASN ASN S . n 
B 2  94  ASP 94  94  94  ASP ASP S . n 
B 2  95  PRO 95  95  95  PRO PRO S . n 
B 2  96  ASN 96  96  96  ASN ASN S . n 
B 2  97  ALA 97  97  97  ALA ALA S . n 
B 2  98  GLN 98  98  98  GLN GLN S . n 
B 2  99  GLY 99  99  99  GLY GLY S . n 
B 2  100 ASP 100 100 100 ASP ASP S . n 
B 2  101 ALA 101 101 101 ALA ALA S . n 
B 2  102 PHE 102 102 102 PHE PHE S . n 
B 2  103 LYS 103 103 103 LYS LYS S . n 
B 2  104 THR 104 104 104 THR THR S . n 
B 2  105 LEU 105 105 105 LEU LEU S . n 
B 2  106 PHE 106 106 106 PHE PHE S . n 
B 2  107 VAL 107 107 107 VAL VAL S . n 
B 2  108 ALA 108 108 108 ALA ALA S . n 
B 2  109 ARG 109 109 109 ARG ARG S . n 
B 2  110 VAL 110 110 110 VAL VAL S . n 
B 2  111 ASN 111 111 111 ASN ASN S . n 
B 2  112 TYR 112 112 112 TYR TYR S . n 
B 2  113 ASP 113 113 113 ASP ASP S . n 
B 2  114 THR 114 114 114 THR THR S . n 
B 2  115 THR 115 115 115 THR THR S . n 
B 2  116 GLU 116 116 116 GLU GLU S . n 
B 2  117 SER 117 117 117 SER SER S . n 
B 2  118 LYS 118 118 118 LYS LYS S . n 
B 2  119 LEU 119 119 119 LEU LEU S . n 
B 2  120 ARG 120 120 120 ARG ARG S . n 
B 2  121 ARG 121 121 121 ARG ARG S . n 
B 2  122 GLU 122 122 122 GLU GLU S . n 
B 2  123 PHE 123 123 123 PHE PHE S . n 
B 2  124 GLU 124 124 124 GLU GLU S . n 
B 2  125 VAL 125 125 125 VAL VAL S . n 
B 2  126 TYR 126 126 126 TYR TYR S . n 
B 2  127 GLY 127 127 127 GLY GLY S . n 
B 2  128 PRO 128 128 128 PRO PRO S . n 
B 2  129 ILE 129 129 129 ILE ILE S . n 
B 2  130 LYS 130 130 130 LYS LYS S . n 
B 2  131 ARG 131 131 131 ARG ARG S . n 
B 2  132 ILE 132 132 132 ILE ILE S . n 
B 2  133 HIS 133 133 133 HIS HIS S . n 
B 2  134 MET 134 134 134 MET MET S . n 
B 2  135 VAL 135 135 135 VAL VAL S . n 
B 2  136 TYR 136 136 136 TYR TYR S . n 
B 2  137 SER 137 137 137 SER SER S . n 
B 2  138 LYS 138 138 138 LYS LYS S . n 
B 2  139 ARG 139 139 139 ARG ARG S . n 
B 2  140 SER 140 140 140 SER SER S . n 
B 2  141 GLY 141 141 141 GLY GLY S . n 
B 2  142 LYS 142 142 142 LYS LYS S . n 
B 2  143 PRO 143 143 143 PRO PRO S . n 
B 2  144 ARG 144 144 144 ARG ARG S . n 
B 2  145 GLY 145 145 145 GLY GLY S . n 
B 2  146 TYR 146 146 146 TYR TYR S . n 
B 2  147 ALA 147 147 147 ALA ALA S . n 
B 2  148 PHE 148 148 148 PHE PHE S . n 
B 2  149 ILE 149 149 149 ILE ILE S . n 
B 2  150 GLU 150 150 150 GLU GLU S . n 
B 2  151 TYR 151 151 151 TYR TYR S . n 
B 2  152 GLU 152 152 152 GLU GLU S . n 
B 2  153 HIS 153 153 153 HIS HIS S . n 
B 2  154 GLU 154 154 154 GLU GLU S . n 
B 2  155 ARG 155 155 155 ARG ARG S . n 
B 2  156 ASP 156 156 156 ASP ASP S . n 
B 2  157 MET 157 157 157 MET MET S . n 
B 2  158 HIS 158 158 158 HIS HIS S . n 
B 2  159 SER 159 159 159 SER SER S . n 
B 2  160 ALA 160 160 160 ALA ALA S . n 
B 2  161 TYR 161 161 161 TYR TYR S . n 
B 2  162 LYS 162 162 162 LYS LYS S . n 
B 2  163 HIS 163 163 163 HIS HIS S . n 
B 2  164 ALA 164 164 164 ALA ALA S . n 
B 2  165 ASP 165 165 165 ASP ASP S . n 
B 2  166 GLY 166 166 166 GLY GLY S . n 
B 2  167 LYS 167 167 167 LYS LYS S . n 
B 2  168 LYS 168 168 168 LYS LYS S . n 
B 2  169 ILE 169 169 169 ILE ILE S . n 
B 2  170 ASP 170 170 170 ASP ASP S . n 
B 2  171 GLY 171 171 171 GLY GLY S . n 
B 2  172 ARG 172 172 172 ARG ARG S . n 
B 2  173 ARG 173 173 173 ARG ARG S . n 
B 2  174 VAL 174 174 174 VAL VAL S . n 
B 2  175 LEU 175 175 175 LEU LEU S . n 
B 2  176 VAL 176 176 176 VAL VAL S . n 
B 2  177 ASP 177 177 177 ASP ASP S . n 
B 2  178 VAL 178 178 178 VAL VAL S . n 
B 2  179 GLU 179 179 179 GLU GLU S . n 
B 2  180 ARG 180 180 180 ARG ARG S . n 
B 2  181 GLY 181 181 181 GLY GLY S . n 
B 2  182 ARG 182 182 182 ARG ARG S . n 
B 2  183 THR 183 183 183 THR THR S . n 
B 2  184 VAL 184 184 ?   ?   ?   S . n 
B 2  185 LYS 185 185 ?   ?   ?   S . n 
B 2  186 GLY 186 186 ?   ?   ?   S . n 
B 2  187 TRP 187 187 ?   ?   ?   S . n 
B 2  188 ARG 188 188 ?   ?   ?   S . n 
B 2  189 PRO 189 189 ?   ?   ?   S . n 
B 2  190 ARG 190 190 ?   ?   ?   S . n 
B 2  191 ARG 191 191 ?   ?   ?   S . n 
B 2  192 LEU 192 192 ?   ?   ?   S . n 
B 2  193 GLY 193 193 ?   ?   ?   S . n 
B 2  194 GLY 194 194 ?   ?   ?   S . n 
B 2  195 GLY 195 195 ?   ?   ?   S . n 
B 2  196 LEU 196 196 ?   ?   ?   S . n 
B 2  197 GLY 197 197 ?   ?   ?   S . n 
B 2  198 GLY 198 198 ?   ?   ?   S . n 
B 2  199 THR 199 199 ?   ?   ?   S . n 
B 2  200 ARG 200 200 ?   ?   ?   S . n 
B 2  201 ARG 201 201 ?   ?   ?   S . n 
B 2  202 GLY 202 202 ?   ?   ?   S . n 
B 2  203 GLY 203 203 ?   ?   ?   S . n 
B 2  204 ALA 204 204 ?   ?   ?   S . n 
B 2  205 ASP 205 205 ?   ?   ?   S . n 
B 2  206 VAL 206 206 ?   ?   ?   S . n 
B 2  207 ASN 207 207 ?   ?   ?   S . n 
B 2  208 ILE 208 208 ?   ?   ?   S . n 
B 2  209 ARG 209 209 ?   ?   ?   S . n 
B 2  210 HIS 210 210 ?   ?   ?   S . n 
B 2  211 SER 211 211 ?   ?   ?   S . n 
B 2  212 GLY 212 212 ?   ?   ?   S . n 
B 2  213 ARG 213 213 ?   ?   ?   S . n 
B 2  214 ASP 214 214 ?   ?   ?   S . n 
B 2  215 ASP 215 215 ?   ?   ?   S . n 
B 2  216 THR 216 216 ?   ?   ?   S . n 
B 2  217 SER 217 217 ?   ?   ?   S . n 
B 2  218 ARG 218 218 ?   ?   ?   S . n 
B 2  219 TYR 219 219 ?   ?   ?   S . n 
B 2  220 ASP 220 220 ?   ?   ?   S . n 
B 2  221 GLU 221 221 ?   ?   ?   S . n 
B 2  222 ARG 222 222 ?   ?   ?   S . n 
B 2  223 PRO 223 223 ?   ?   ?   S . n 
B 2  224 GLY 224 224 ?   ?   ?   S . n 
B 2  225 PRO 225 225 ?   ?   ?   S . n 
B 2  226 SER 226 226 ?   ?   ?   S . n 
B 2  227 PRO 227 227 ?   ?   ?   S . n 
B 2  228 LEU 228 228 ?   ?   ?   S . n 
B 2  229 PRO 229 229 ?   ?   ?   S . n 
B 2  230 HIS 230 230 ?   ?   ?   S . n 
B 2  231 ARG 231 231 ?   ?   ?   S . n 
B 2  232 ASP 232 232 ?   ?   ?   S . n 
B 2  233 ARG 233 233 ?   ?   ?   S . n 
B 2  234 ASP 234 234 ?   ?   ?   S . n 
B 2  235 ARG 235 235 ?   ?   ?   S . n 
B 2  236 ASP 236 236 ?   ?   ?   S . n 
B 2  237 ARG 237 237 ?   ?   ?   S . n 
B 2  238 GLU 238 238 ?   ?   ?   S . n 
B 2  239 ARG 239 239 ?   ?   ?   S . n 
B 2  240 GLU 240 240 ?   ?   ?   S . n 
B 2  241 ARG 241 241 ?   ?   ?   S . n 
B 2  242 ARG 242 242 ?   ?   ?   S . n 
B 2  243 GLU 243 243 ?   ?   ?   S . n 
B 2  244 ARG 244 244 ?   ?   ?   S . n 
B 2  245 SER 245 245 ?   ?   ?   S . n 
B 2  246 ARG 246 246 ?   ?   ?   S . n 
B 2  247 GLU 247 247 ?   ?   ?   S . n 
B 2  248 ARG 248 248 ?   ?   ?   S . n 
B 2  249 ASP 249 249 ?   ?   ?   S . n 
B 2  250 LYS 250 250 ?   ?   ?   S . n 
B 2  251 GLU 251 251 ?   ?   ?   S . n 
B 2  252 ARG 252 252 ?   ?   ?   S . n 
B 2  253 GLU 253 253 ?   ?   ?   S . n 
B 2  254 ARG 254 254 ?   ?   ?   S . n 
B 2  255 ARG 255 255 ?   ?   ?   S . n 
B 2  256 ARG 256 256 ?   ?   ?   S . n 
B 2  257 SER 257 257 ?   ?   ?   S . n 
B 2  258 ARG 258 258 ?   ?   ?   S . n 
B 2  259 SER 259 259 ?   ?   ?   S . n 
B 2  260 ARG 260 260 ?   ?   ?   S . n 
B 2  261 ASP 261 261 ?   ?   ?   S . n 
B 2  262 ARG 262 262 ?   ?   ?   S . n 
B 2  263 ARG 263 263 ?   ?   ?   S . n 
B 2  264 ARG 264 264 ?   ?   ?   S . n 
B 2  265 ARG 265 265 ?   ?   ?   S . n 
B 2  266 SER 266 266 ?   ?   ?   S . n 
B 2  267 ARG 267 267 ?   ?   ?   S . n 
B 2  268 SER 268 268 ?   ?   ?   S . n 
B 2  269 ARG 269 269 ?   ?   ?   S . n 
B 2  270 ASP 270 270 ?   ?   ?   S . n 
B 2  271 LYS 271 271 ?   ?   ?   S . n 
B 2  272 GLU 272 272 ?   ?   ?   S . n 
B 2  273 GLU 273 273 ?   ?   ?   S . n 
B 2  274 ARG 274 274 ?   ?   ?   S . n 
B 2  275 ARG 275 275 ?   ?   ?   S . n 
B 2  276 ARG 276 276 ?   ?   ?   S . n 
B 2  277 SER 277 277 ?   ?   ?   S . n 
B 2  278 ARG 278 278 ?   ?   ?   S . n 
B 2  279 GLU 279 279 ?   ?   ?   S . n 
B 2  280 ARG 280 280 ?   ?   ?   S . n 
B 2  281 SER 281 281 ?   ?   ?   S . n 
B 2  282 LYS 282 282 ?   ?   ?   S . n 
B 2  283 ASP 283 283 ?   ?   ?   S . n 
B 2  284 LYS 284 284 ?   ?   ?   S . n 
B 2  285 ASP 285 285 ?   ?   ?   S . n 
B 2  286 ARG 286 286 ?   ?   ?   S . n 
B 2  287 ASP 287 287 ?   ?   ?   S . n 
B 2  288 ARG 288 288 ?   ?   ?   S . n 
B 2  289 LYS 289 289 ?   ?   ?   S . n 
B 2  290 ARG 290 290 ?   ?   ?   S . n 
B 2  291 ARG 291 291 ?   ?   ?   S . n 
B 2  292 SER 292 292 ?   ?   ?   S . n 
B 2  293 SER 293 293 ?   ?   ?   S . n 
B 2  294 ARG 294 294 ?   ?   ?   S . n 
B 2  295 SER 295 295 ?   ?   ?   S . n 
B 2  296 ARG 296 296 ?   ?   ?   S . n 
B 2  297 GLU 297 297 ?   ?   ?   S . n 
B 2  298 ARG 298 298 ?   ?   ?   S . n 
B 2  299 ALA 299 299 ?   ?   ?   S . n 
B 2  300 ARG 300 300 ?   ?   ?   S . n 
B 2  301 ARG 301 301 ?   ?   ?   S . n 
B 2  302 GLU 302 302 ?   ?   ?   S . n 
B 2  303 ARG 303 303 ?   ?   ?   S . n 
B 2  304 GLU 304 304 ?   ?   ?   S . n 
B 2  305 ARG 305 305 ?   ?   ?   S . n 
B 2  306 LYS 306 306 ?   ?   ?   S . n 
B 2  307 GLU 307 307 ?   ?   ?   S . n 
B 2  308 GLU 308 308 ?   ?   ?   S . n 
B 2  309 LEU 309 309 ?   ?   ?   S . n 
B 2  310 ARG 310 310 ?   ?   ?   S . n 
B 2  311 GLY 311 311 ?   ?   ?   S . n 
B 2  312 GLY 312 312 ?   ?   ?   S . n 
B 2  313 GLY 313 313 ?   ?   ?   S . n 
B 2  314 GLY 314 314 ?   ?   ?   S . n 
B 2  315 ASP 315 315 ?   ?   ?   S . n 
B 2  316 MET 316 316 ?   ?   ?   S . n 
B 2  317 ALA 317 317 ?   ?   ?   S . n 
B 2  318 GLU 318 318 ?   ?   ?   S . n 
B 2  319 PRO 319 319 ?   ?   ?   S . n 
B 2  320 SER 320 320 ?   ?   ?   S . n 
B 2  321 GLU 321 321 ?   ?   ?   S . n 
B 2  322 ALA 322 322 ?   ?   ?   S . n 
B 2  323 GLY 323 323 ?   ?   ?   S . n 
B 2  324 ASP 324 324 ?   ?   ?   S . n 
B 2  325 ALA 325 325 ?   ?   ?   S . n 
B 2  326 PRO 326 326 ?   ?   ?   S . n 
B 2  327 PRO 327 327 ?   ?   ?   S . n 
B 2  328 ASP 328 328 ?   ?   ?   S . n 
B 2  329 ASP 329 329 ?   ?   ?   S . n 
B 2  330 GLY 330 330 ?   ?   ?   S . n 
B 2  331 PRO 331 331 ?   ?   ?   S . n 
B 2  332 PRO 332 332 ?   ?   ?   S . n 
B 2  333 GLY 333 333 ?   ?   ?   S . n 
B 2  334 GLU 334 334 ?   ?   ?   S . n 
B 2  335 LEU 335 335 ?   ?   ?   S . n 
B 2  336 GLY 336 336 ?   ?   ?   S . n 
B 2  337 PRO 337 337 ?   ?   ?   S . n 
B 2  338 ASP 338 338 ?   ?   ?   S . n 
B 2  339 GLY 339 339 ?   ?   ?   S . n 
B 2  340 PRO 340 340 ?   ?   ?   S . n 
B 2  341 ASP 341 341 ?   ?   ?   S . n 
B 2  342 GLY 342 342 ?   ?   ?   S . n 
B 2  343 PRO 343 343 ?   ?   ?   S . n 
B 2  344 GLU 344 344 ?   ?   ?   S . n 
B 2  345 GLU 345 345 ?   ?   ?   S . n 
B 2  346 LYS 346 346 ?   ?   ?   S . n 
B 2  347 GLY 347 347 ?   ?   ?   S . n 
B 2  348 ARG 348 348 ?   ?   ?   S . n 
B 2  349 ASP 349 349 ?   ?   ?   S . n 
B 2  350 ARG 350 350 ?   ?   ?   S . n 
B 2  351 ASP 351 351 ?   ?   ?   S . n 
B 2  352 ARG 352 352 ?   ?   ?   S . n 
B 2  353 GLU 353 353 ?   ?   ?   S . n 
B 2  354 ARG 354 354 ?   ?   ?   S . n 
B 2  355 ARG 355 355 ?   ?   ?   S . n 
B 2  356 ARG 356 356 ?   ?   ?   S . n 
B 2  357 SER 357 357 ?   ?   ?   S . n 
B 2  358 HIS 358 358 ?   ?   ?   S . n 
B 2  359 ARG 359 359 ?   ?   ?   S . n 
B 2  360 SER 360 360 ?   ?   ?   S . n 
B 2  361 GLU 361 361 ?   ?   ?   S . n 
B 2  362 ARG 362 362 ?   ?   ?   S . n 
B 2  363 GLU 363 363 ?   ?   ?   S . n 
B 2  364 ARG 364 364 ?   ?   ?   S . n 
B 2  365 ARG 365 365 ?   ?   ?   S . n 
B 2  366 ARG 366 366 ?   ?   ?   S . n 
B 2  367 ASP 367 367 ?   ?   ?   S . n 
B 2  368 ARG 368 368 ?   ?   ?   S . n 
B 2  369 ASP 369 369 ?   ?   ?   S . n 
B 2  370 ARG 370 370 ?   ?   ?   S . n 
B 2  371 ASP 371 371 ?   ?   ?   S . n 
B 2  372 ARG 372 372 ?   ?   ?   S . n 
B 2  373 ASP 373 373 ?   ?   ?   S . n 
B 2  374 ARG 374 374 ?   ?   ?   S . n 
B 2  375 ASP 375 375 ?   ?   ?   S . n 
B 2  376 ARG 376 376 ?   ?   ?   S . n 
B 2  377 GLU 377 377 ?   ?   ?   S . n 
B 2  378 HIS 378 378 ?   ?   ?   S . n 
B 2  379 LYS 379 379 ?   ?   ?   S . n 
B 2  380 ARG 380 380 ?   ?   ?   S . n 
B 2  381 GLY 381 381 ?   ?   ?   S . n 
B 2  382 GLU 382 382 ?   ?   ?   S . n 
B 2  383 ARG 383 383 ?   ?   ?   S . n 
B 2  384 GLY 384 384 ?   ?   ?   S . n 
B 2  385 SER 385 385 ?   ?   ?   S . n 
B 2  386 GLU 386 386 ?   ?   ?   S . n 
B 2  387 ARG 387 387 ?   ?   ?   S . n 
B 2  388 GLY 388 388 ?   ?   ?   S . n 
B 2  389 ARG 389 389 ?   ?   ?   S . n 
B 2  390 ASP 390 390 ?   ?   ?   S . n 
B 2  391 GLU 391 391 ?   ?   ?   S . n 
B 2  392 ALA 392 392 ?   ?   ?   S . n 
B 2  393 ARG 393 393 ?   ?   ?   S . n 
B 2  394 GLY 394 394 ?   ?   ?   S . n 
B 2  395 GLY 395 395 ?   ?   ?   S . n 
B 2  396 GLY 396 396 ?   ?   ?   S . n 
B 2  397 GLY 397 397 ?   ?   ?   S . n 
B 2  398 GLY 398 398 ?   ?   ?   S . n 
B 2  399 GLN 399 399 ?   ?   ?   S . n 
B 2  400 ASP 400 400 ?   ?   ?   S . n 
B 2  401 ASN 401 401 ?   ?   ?   S . n 
B 2  402 GLY 402 402 ?   ?   ?   S . n 
B 2  403 LEU 403 403 ?   ?   ?   S . n 
B 2  404 GLU 404 404 ?   ?   ?   S . n 
B 2  405 GLY 405 405 ?   ?   ?   S . n 
B 2  406 LEU 406 406 ?   ?   ?   S . n 
B 2  407 GLY 407 407 ?   ?   ?   S . n 
B 2  408 ASN 408 408 ?   ?   ?   S . n 
B 2  409 ASP 409 409 ?   ?   ?   S . n 
B 2  410 SER 410 410 ?   ?   ?   S . n 
B 2  411 ARG 411 411 ?   ?   ?   S . n 
B 2  412 ASP 412 412 ?   ?   ?   S . n 
B 2  413 MET 413 413 ?   ?   ?   S . n 
B 2  414 TYR 414 414 ?   ?   ?   S . n 
B 2  415 MET 415 415 ?   ?   ?   S . n 
B 2  416 GLU 416 416 ?   ?   ?   S . n 
B 2  417 SER 417 417 ?   ?   ?   S . n 
B 2  418 GLU 418 418 ?   ?   ?   S . n 
B 2  419 GLY 419 419 ?   ?   ?   S . n 
B 2  420 GLY 420 420 ?   ?   ?   S . n 
B 2  421 ASP 421 421 ?   ?   ?   S . n 
B 2  422 GLY 422 422 ?   ?   ?   S . n 
B 2  423 TYR 423 423 ?   ?   ?   S . n 
B 2  424 LEU 424 424 ?   ?   ?   S . n 
B 2  425 ALA 425 425 ?   ?   ?   S . n 
B 2  426 PRO 426 426 ?   ?   ?   S . n 
B 2  427 GLU 427 427 ?   ?   ?   S . n 
B 2  428 ASN 428 428 ?   ?   ?   S . n 
B 2  429 GLY 429 429 ?   ?   ?   S . n 
B 2  430 TYR 430 430 ?   ?   ?   S . n 
B 2  431 LEU 431 431 ?   ?   ?   S . n 
B 2  432 MET 432 432 ?   ?   ?   S . n 
B 2  433 GLU 433 433 ?   ?   ?   S . n 
B 2  434 ALA 434 434 ?   ?   ?   S . n 
B 2  435 ALA 435 435 ?   ?   ?   S . n 
B 2  436 PRO 436 436 ?   ?   ?   S . n 
B 2  437 GLU 437 437 ?   ?   ?   S . n 
C 3  1   MET 1   1   ?   ?   ?   Z . n 
C 3  2   SER 2   2   ?   ?   ?   Z . n 
C 3  3   ILE 3   3   ?   ?   ?   Z . n 
C 3  4   GLY 4   4   ?   ?   ?   Z . n 
C 3  5   VAL 5   5   5   VAL VAL Z . n 
C 3  6   PRO 6   6   6   PRO PRO Z . n 
C 3  7   ILE 7   7   7   ILE ILE Z . n 
C 3  8   LYS 8   8   8   LYS LYS Z . n 
C 3  9   VAL 9   9   9   VAL VAL Z . n 
C 3  10  LEU 10  10  10  LEU LEU Z . n 
C 3  11  HIS 11  11  11  HIS HIS Z . n 
C 3  12  GLU 12  12  12  GLU GLU Z . n 
C 3  13  ALA 13  13  13  ALA ALA Z . n 
C 3  14  GLU 14  14  14  GLU GLU Z . n 
C 3  15  GLY 15  15  15  GLY GLY Z . n 
C 3  16  HIS 16  16  16  HIS HIS Z . n 
C 3  17  ILE 17  17  17  ILE ILE Z . n 
C 3  18  VAL 18  18  18  VAL VAL Z . n 
C 3  19  THR 19  19  19  THR THR Z . n 
C 3  20  CYS 20  20  20  CYS CYS Z . n 
C 3  21  GLU 21  21  21  GLU GLU Z . n 
C 3  22  THR 22  22  22  THR THR Z . n 
C 3  23  ASN 23  23  23  ASN ASN Z . n 
C 3  24  THR 24  24  24  THR THR Z . n 
C 3  25  GLY 25  25  25  GLY GLY Z . n 
C 3  26  GLU 26  26  26  GLU GLU Z . n 
C 3  27  VAL 27  27  27  VAL VAL Z . n 
C 3  28  TYR 28  28  28  TYR TYR Z . n 
C 3  29  ARG 29  29  29  ARG ARG Z . n 
C 3  30  GLY 30  30  30  GLY GLY Z . n 
C 3  31  LYS 31  31  31  LYS LYS Z . n 
C 3  32  LEU 32  32  32  LEU LEU Z . n 
C 3  33  ILE 33  33  33  ILE ILE Z . n 
C 3  34  GLU 34  34  34  GLU GLU Z . n 
C 3  35  ALA 35  35  35  ALA ALA Z . n 
C 3  36  GLU 36  36  36  GLU GLU Z . n 
C 3  37  ASP 37  37  37  ASP ASP Z . n 
C 3  38  ASN 38  38  38  ASN ASN Z . n 
C 3  39  MET 39  39  39  MET MET Z . n 
C 3  40  ASN 40  40  40  ASN ASN Z . n 
C 3  41  CYS 41  41  41  CYS CYS Z . n 
C 3  42  GLN 42  42  42  GLN GLN Z . n 
C 3  43  MET 43  43  43  MET MET Z . n 
C 3  44  SER 44  44  44  SER SER Z . n 
C 3  45  ASN 45  45  45  ASN ASN Z . n 
C 3  46  ILE 46  46  46  ILE ILE Z . n 
C 3  47  THR 47  47  47  THR THR Z . n 
C 3  48  VAL 48  48  48  VAL VAL Z . n 
C 3  49  THR 49  49  49  THR THR Z . n 
C 3  50  TYR 50  50  50  TYR TYR Z . n 
C 3  51  ARG 51  51  51  ARG ARG Z . n 
C 3  52  ASP 52  52  52  ASP ASP Z . n 
C 3  53  GLY 53  53  53  GLY GLY Z . n 
C 3  54  ARG 54  54  54  ARG ARG Z . n 
C 3  55  VAL 55  55  55  VAL VAL Z . n 
C 3  56  ALA 56  56  56  ALA ALA Z . n 
C 3  57  GLN 57  57  57  GLN GLN Z . n 
C 3  58  LEU 58  58  58  LEU LEU Z . n 
C 3  59  GLU 59  59  59  GLU GLU Z . n 
C 3  60  GLN 60  60  60  GLN GLN Z . n 
C 3  61  VAL 61  61  61  VAL VAL Z . n 
C 3  62  TYR 62  62  62  TYR TYR Z . n 
C 3  63  ILE 63  63  63  ILE ILE Z . n 
C 3  64  ARG 64  64  64  ARG ARG Z . n 
C 3  65  GLY 65  65  65  GLY GLY Z . n 
C 3  66  SER 66  66  66  SER SER Z . n 
C 3  67  LYS 67  67  67  LYS LYS Z . n 
C 3  68  ILE 68  68  68  ILE ILE Z . n 
C 3  69  ARG 69  69  69  ARG ARG Z . n 
C 3  70  PHE 70  70  70  PHE PHE Z . n 
C 3  71  LEU 71  71  71  LEU LEU Z . n 
C 3  72  ILE 72  72  72  ILE ILE Z . n 
C 3  73  LEU 73  73  73  LEU LEU Z . n 
C 3  74  PRO 74  74  74  PRO PRO Z . n 
C 3  75  ASP 75  75  75  ASP ASP Z . n 
C 3  76  MET 76  76  76  MET MET Z . n 
C 3  77  LEU 77  77  77  LEU LEU Z . n 
C 3  78  LYS 78  78  78  LYS LYS Z . n 
C 3  79  ASN 79  79  79  ASN ASN Z . n 
C 3  80  ALA 80  80  80  ALA ALA Z . n 
C 3  81  PRO 81  81  81  PRO PRO Z . n 
C 3  82  MET 82  82  82  MET MET Z . n 
C 3  83  LEU 83  83  83  LEU LEU Z . n 
C 3  84  LYS 84  84  84  LYS LYS Z . n 
C 3  85  SER 85  85  ?   ?   ?   Z . n 
C 3  86  MET 86  86  ?   ?   ?   Z . n 
C 3  87  LYS 87  87  ?   ?   ?   Z . n 
C 3  88  ASN 88  88  ?   ?   ?   Z . n 
C 3  89  LYS 89  89  ?   ?   ?   Z . n 
C 3  90  ASN 90  90  ?   ?   ?   Z . n 
C 3  91  GLN 91  91  ?   ?   ?   Z . n 
C 3  92  GLY 92  92  ?   ?   ?   Z . n 
C 3  93  SER 93  93  ?   ?   ?   Z . n 
C 3  94  GLY 94  94  ?   ?   ?   Z . n 
C 3  95  ALA 95  95  ?   ?   ?   Z . n 
C 3  96  GLY 96  96  ?   ?   ?   Z . n 
C 3  97  ARG 97  97  ?   ?   ?   Z . n 
C 3  98  GLY 98  98  ?   ?   ?   Z . n 
C 3  99  LYS 99  99  ?   ?   ?   Z . n 
C 3  100 ALA 100 100 ?   ?   ?   Z . n 
C 3  101 ALA 101 101 ?   ?   ?   Z . n 
C 3  102 ILE 102 102 ?   ?   ?   Z . n 
C 3  103 LEU 103 103 ?   ?   ?   Z . n 
C 3  104 LYS 104 104 ?   ?   ?   Z . n 
C 3  105 ALA 105 105 ?   ?   ?   Z . n 
C 3  106 GLN 106 106 ?   ?   ?   Z . n 
C 3  107 VAL 107 107 ?   ?   ?   Z . n 
C 3  108 ALA 108 108 ?   ?   ?   Z . n 
C 3  109 ALA 109 109 ?   ?   ?   Z . n 
C 3  110 ARG 110 110 ?   ?   ?   Z . n 
C 3  111 GLY 111 111 ?   ?   ?   Z . n 
C 3  112 ARG 112 112 ?   ?   ?   Z . n 
C 3  113 GLY 113 113 ?   ?   ?   Z . n 
C 3  114 ARG 114 114 ?   ?   ?   Z . n 
C 3  115 GLY 115 115 ?   ?   ?   Z . n 
C 3  116 MET 116 116 ?   ?   ?   Z . n 
C 3  117 GLY 117 117 ?   ?   ?   Z . n 
C 3  118 ARG 118 118 ?   ?   ?   Z . n 
C 3  119 GLY 119 119 ?   ?   ?   Z . n 
C 3  120 ASN 120 120 ?   ?   ?   Z . n 
C 3  121 ILE 121 121 ?   ?   ?   Z . n 
C 3  122 PHE 122 122 ?   ?   ?   Z . n 
C 3  123 GLN 123 123 ?   ?   ?   Z . n 
C 3  124 LYS 124 124 ?   ?   ?   Z . n 
C 3  125 ARG 125 125 ?   ?   ?   Z . n 
C 3  126 ARG 126 126 ?   ?   ?   Z . n 
D 4  1   MET 1   1   ?   ?   ?   B . n 
D 4  2   THR 2   2   ?   ?   ?   B . n 
D 4  3   VAL 3   3   ?   ?   ?   B . n 
D 4  4   GLY 4   4   ?   ?   ?   B . n 
D 4  5   LYS 5   5   ?   ?   ?   B . n 
D 4  6   SER 6   6   6   SER SER B . n 
D 4  7   SER 7   7   7   SER SER B . n 
D 4  8   LYS 8   8   8   LYS LYS B . n 
D 4  9   MET 9   9   9   MET MET B . n 
D 4  10  LEU 10  10  10  LEU LEU B . n 
D 4  11  GLN 11  11  11  GLN GLN B . n 
D 4  12  HIS 12  12  12  HIS HIS B . n 
D 4  13  ILE 13  13  13  ILE ILE B . n 
D 4  14  ASP 14  14  14  ASP ASP B . n 
D 4  15  TYR 15  15  15  TYR TYR B . n 
D 4  16  ARG 16  16  16  ARG ARG B . n 
D 4  17  MET 17  17  17  MET MET B . n 
D 4  18  ARG 18  18  18  ARG ARG B . n 
D 4  19  CYS 19  19  19  CYS CYS B . n 
D 4  20  ILE 20  20  20  ILE ILE B . n 
D 4  21  LEU 21  21  21  LEU LEU B . n 
D 4  22  GLN 22  22  22  GLN GLN B . n 
D 4  23  ASP 23  23  23  ASP ASP B . n 
D 4  24  GLY 24  24  24  GLY GLY B . n 
D 4  25  ARG 25  25  25  ARG ARG B . n 
D 4  26  ILE 26  26  26  ILE ILE B . n 
D 4  27  PHE 27  27  27  PHE PHE B . n 
D 4  28  ILE 28  28  28  ILE ILE B . n 
D 4  29  GLY 29  29  29  GLY GLY B . n 
D 4  30  THR 30  30  30  THR THR B . n 
D 4  31  PHE 31  31  31  PHE PHE B . n 
D 4  32  LYS 32  32  32  LYS LYS B . n 
D 4  33  ALA 33  33  33  ALA ALA B . n 
D 4  34  PHE 34  34  34  PHE PHE B . n 
D 4  35  ASP 35  35  35  ASP ASP B . n 
D 4  36  LYS 36  36  36  LYS LYS B . n 
D 4  37  HIS 37  37  37  HIS HIS B . n 
D 4  38  MET 38  38  38  MET MET B . n 
D 4  39  ASN 39  39  39  ASN ASN B . n 
D 4  40  LEU 40  40  40  LEU LEU B . n 
D 4  41  ILE 41  41  41  ILE ILE B . n 
D 4  42  LEU 42  42  42  LEU LEU B . n 
D 4  43  CYS 43  43  43  CYS CYS B . n 
D 4  44  ASP 44  44  44  ASP ASP B . n 
D 4  45  CYS 45  45  45  CYS CYS B . n 
D 4  46  ASP 46  46  46  ASP ASP B . n 
D 4  47  GLU 47  47  47  GLU GLU B . n 
D 4  48  PHE 48  48  48  PHE PHE B . n 
D 4  49  ARG 49  49  49  ARG ARG B . n 
D 4  50  LYS 50  50  50  LYS LYS B . n 
D 4  51  ILE 51  51  51  ILE ILE B . n 
D 4  52  LYS 52  52  52  LYS LYS B . n 
D 4  53  PRO 53  53  53  PRO PRO B . n 
D 4  54  LYS 54  54  54  LYS LYS B . n 
D 4  55  ASN 55  55  55  ASN ASN B . n 
D 4  56  SER 56  56  56  SER SER B . n 
D 4  57  LYS 57  57  57  LYS LYS B . n 
D 4  58  GLN 58  58  58  GLN GLN B . n 
D 4  59  ALA 59  59  59  ALA ALA B . n 
D 4  60  GLU 60  60  60  GLU GLU B . n 
D 4  61  ARG 61  61  61  ARG ARG B . n 
D 4  62  GLU 62  62  62  GLU GLU B . n 
D 4  63  GLU 63  63  63  GLU GLU B . n 
D 4  64  LYS 64  64  64  LYS LYS B . n 
D 4  65  ARG 65  65  65  ARG ARG B . n 
D 4  66  VAL 66  66  66  VAL VAL B . n 
D 4  67  LEU 67  67  67  LEU LEU B . n 
D 4  68  GLY 68  68  68  GLY GLY B . n 
D 4  69  LEU 69  69  69  LEU LEU B . n 
D 4  70  VAL 70  70  70  VAL VAL B . n 
D 4  71  LEU 71  71  71  LEU LEU B . n 
D 4  72  LEU 72  72  72  LEU LEU B . n 
D 4  73  ARG 73  73  73  ARG ARG B . n 
D 4  74  GLY 74  74  74  GLY GLY B . n 
D 4  75  GLU 75  75  75  GLU GLU B . n 
D 4  76  ASN 76  76  76  ASN ASN B . n 
D 4  77  LEU 77  77  77  LEU LEU B . n 
D 4  78  VAL 78  78  78  VAL VAL B . n 
D 4  79  SER 79  79  79  SER SER B . n 
D 4  80  MET 80  80  80  MET MET B . n 
D 4  81  THR 81  81  81  THR THR B . n 
D 4  82  VAL 82  82  82  VAL VAL B . n 
D 4  83  GLU 83  83  83  GLU GLU B . n 
D 4  84  GLY 84  84  84  GLY GLY B . n 
D 4  85  PRO 85  85  85  PRO PRO B . n 
D 4  86  PRO 86  86  86  PRO PRO B . n 
D 4  87  PRO 87  87  ?   ?   ?   B . n 
D 4  88  LYS 88  88  ?   ?   ?   B . n 
D 4  89  ASP 89  89  ?   ?   ?   B . n 
D 4  90  THR 90  90  ?   ?   ?   B . n 
D 4  91  GLY 91  91  ?   ?   ?   B . n 
D 4  92  ILE 92  92  ?   ?   ?   B . n 
D 4  93  ALA 93  93  ?   ?   ?   B . n 
D 4  94  ARG 94  94  ?   ?   ?   B . n 
D 4  95  VAL 95  95  ?   ?   ?   B . n 
D 4  96  PRO 96  96  ?   ?   ?   B . n 
D 4  97  LEU 97  97  ?   ?   ?   B . n 
D 4  98  ALA 98  98  ?   ?   ?   B . n 
D 4  99  GLY 99  99  ?   ?   ?   B . n 
D 4  100 ALA 100 100 ?   ?   ?   B . n 
D 4  101 ALA 101 101 ?   ?   ?   B . n 
D 4  102 GLY 102 102 ?   ?   ?   B . n 
D 4  103 GLY 103 103 ?   ?   ?   B . n 
D 4  104 PRO 104 104 ?   ?   ?   B . n 
D 4  105 GLY 105 105 ?   ?   ?   B . n 
D 4  106 ILE 106 106 ?   ?   ?   B . n 
D 4  107 GLY 107 107 ?   ?   ?   B . n 
D 4  108 ARG 108 108 ?   ?   ?   B . n 
D 4  109 ALA 109 109 ?   ?   ?   B . n 
D 4  110 ALA 110 110 ?   ?   ?   B . n 
D 4  111 GLY 111 111 ?   ?   ?   B . n 
D 4  112 ARG 112 112 ?   ?   ?   B . n 
D 4  113 GLY 113 113 ?   ?   ?   B . n 
D 4  114 ILE 114 114 ?   ?   ?   B . n 
D 4  115 PRO 115 115 ?   ?   ?   B . n 
D 4  116 ALA 116 116 ?   ?   ?   B . n 
D 4  117 GLY 117 117 ?   ?   ?   B . n 
D 4  118 VAL 118 118 ?   ?   ?   B . n 
D 4  119 PRO 119 119 ?   ?   ?   B . n 
D 4  120 MET 120 120 ?   ?   ?   B . n 
D 4  121 PRO 121 121 ?   ?   ?   B . n 
D 4  122 GLN 122 122 ?   ?   ?   B . n 
D 4  123 ALA 123 123 ?   ?   ?   B . n 
D 4  124 PRO 124 124 ?   ?   ?   B . n 
D 4  125 ALA 125 125 ?   ?   ?   B . n 
D 4  126 GLY 126 126 ?   ?   ?   B . n 
D 4  127 LEU 127 127 ?   ?   ?   B . n 
D 4  128 ALA 128 128 ?   ?   ?   B . n 
D 4  129 GLY 129 129 ?   ?   ?   B . n 
D 4  130 PRO 130 130 ?   ?   ?   B . n 
D 4  131 VAL 131 131 ?   ?   ?   B . n 
D 4  132 ARG 132 132 ?   ?   ?   B . n 
D 4  133 GLY 133 133 ?   ?   ?   B . n 
D 4  134 VAL 134 134 ?   ?   ?   B . n 
D 4  135 GLY 135 135 ?   ?   ?   B . n 
D 4  136 GLY 136 136 ?   ?   ?   B . n 
D 4  137 PRO 137 137 ?   ?   ?   B . n 
D 4  138 SER 138 138 ?   ?   ?   B . n 
D 4  139 GLN 139 139 ?   ?   ?   B . n 
D 4  140 GLN 140 140 ?   ?   ?   B . n 
D 4  141 VAL 141 141 ?   ?   ?   B . n 
D 4  142 MET 142 142 ?   ?   ?   B . n 
D 4  143 THR 143 143 ?   ?   ?   B . n 
D 4  144 PRO 144 144 ?   ?   ?   B . n 
D 4  145 GLN 145 145 ?   ?   ?   B . n 
D 4  146 GLY 146 146 ?   ?   ?   B . n 
D 4  147 ARG 147 147 ?   ?   ?   B . n 
D 4  148 GLY 148 148 ?   ?   ?   B . n 
D 4  149 THR 149 149 ?   ?   ?   B . n 
D 4  150 VAL 150 150 ?   ?   ?   B . n 
D 4  151 ALA 151 151 ?   ?   ?   B . n 
D 4  152 ALA 152 152 ?   ?   ?   B . n 
D 4  153 ALA 153 153 ?   ?   ?   B . n 
D 4  154 ALA 154 154 ?   ?   ?   B . n 
D 4  155 ALA 155 155 ?   ?   ?   B . n 
D 4  156 ALA 156 156 ?   ?   ?   B . n 
D 4  157 ALA 157 157 ?   ?   ?   B . n 
D 4  158 THR 158 158 ?   ?   ?   B . n 
D 4  159 ALA 159 159 ?   ?   ?   B . n 
D 4  160 SER 160 160 ?   ?   ?   B . n 
D 4  161 ILE 161 161 ?   ?   ?   B . n 
D 4  162 ALA 162 162 ?   ?   ?   B . n 
D 4  163 GLY 163 163 ?   ?   ?   B . n 
D 4  164 ALA 164 164 ?   ?   ?   B . n 
D 4  165 PRO 165 165 ?   ?   ?   B . n 
D 4  166 THR 166 166 ?   ?   ?   B . n 
D 4  167 GLN 167 167 ?   ?   ?   B . n 
D 4  168 TYR 168 168 ?   ?   ?   B . n 
D 4  169 PRO 169 169 ?   ?   ?   B . n 
D 4  170 PRO 170 170 ?   ?   ?   B . n 
D 4  171 GLY 171 171 ?   ?   ?   B . n 
D 4  172 ARG 172 172 ?   ?   ?   B . n 
D 4  173 GLY 173 173 ?   ?   ?   B . n 
D 4  174 GLY 174 174 ?   ?   ?   B . n 
D 4  175 PRO 175 175 ?   ?   ?   B . n 
D 4  176 PRO 176 176 ?   ?   ?   B . n 
D 4  177 PRO 177 177 ?   ?   ?   B . n 
D 4  178 PRO 178 178 ?   ?   ?   B . n 
D 4  179 MET 179 179 ?   ?   ?   B . n 
D 4  180 GLY 180 180 ?   ?   ?   B . n 
D 4  181 ARG 181 181 ?   ?   ?   B . n 
D 4  182 GLY 182 182 ?   ?   ?   B . n 
D 4  183 ALA 183 183 ?   ?   ?   B . n 
D 4  184 PRO 184 184 ?   ?   ?   B . n 
D 4  185 PRO 185 185 ?   ?   ?   B . n 
D 4  186 PRO 186 186 ?   ?   ?   B . n 
D 4  187 GLY 187 187 ?   ?   ?   B . n 
D 4  188 MET 188 188 ?   ?   ?   B . n 
D 4  189 MET 189 189 ?   ?   ?   B . n 
D 4  190 GLY 190 190 ?   ?   ?   B . n 
D 4  191 PRO 191 191 ?   ?   ?   B . n 
D 4  192 PRO 192 192 ?   ?   ?   B . n 
D 4  193 PRO 193 193 ?   ?   ?   B . n 
D 4  194 GLY 194 194 ?   ?   ?   B . n 
D 4  195 MET 195 195 ?   ?   ?   B . n 
D 4  196 ARG 196 196 ?   ?   ?   B . n 
D 4  197 PRO 197 197 ?   ?   ?   B . n 
D 4  198 PRO 198 198 ?   ?   ?   B . n 
D 4  199 MET 199 199 ?   ?   ?   B . n 
D 4  200 GLY 200 200 ?   ?   ?   B . n 
D 4  201 PRO 201 201 ?   ?   ?   B . n 
D 4  202 PRO 202 202 ?   ?   ?   B . n 
D 4  203 MET 203 203 ?   ?   ?   B . n 
D 4  204 GLY 204 204 ?   ?   ?   B . n 
D 4  205 ILE 205 205 ?   ?   ?   B . n 
D 4  206 PRO 206 206 ?   ?   ?   B . n 
D 4  207 PRO 207 207 ?   ?   ?   B . n 
D 4  208 GLY 208 208 ?   ?   ?   B . n 
D 4  209 ARG 209 209 ?   ?   ?   B . n 
D 4  210 GLY 210 210 ?   ?   ?   B . n 
D 4  211 THR 211 211 ?   ?   ?   B . n 
D 4  212 PRO 212 212 ?   ?   ?   B . n 
D 4  213 MET 213 213 ?   ?   ?   B . n 
D 4  214 GLY 214 214 ?   ?   ?   B . n 
D 4  215 MET 215 215 ?   ?   ?   B . n 
D 4  216 PRO 216 216 ?   ?   ?   B . n 
D 4  217 PRO 217 217 ?   ?   ?   B . n 
D 4  218 PRO 218 218 ?   ?   ?   B . n 
D 4  219 GLY 219 219 ?   ?   ?   B . n 
D 4  220 MET 220 220 ?   ?   ?   B . n 
D 4  221 ARG 221 221 ?   ?   ?   B . n 
D 4  222 PRO 222 222 ?   ?   ?   B . n 
D 4  223 PRO 223 223 ?   ?   ?   B . n 
D 4  224 PRO 224 224 ?   ?   ?   B . n 
D 4  225 PRO 225 225 ?   ?   ?   B . n 
D 4  226 GLY 226 226 ?   ?   ?   B . n 
D 4  227 MET 227 227 ?   ?   ?   B . n 
D 4  228 ARG 228 228 ?   ?   ?   B . n 
D 4  229 GLY 229 229 ?   ?   ?   B . n 
D 4  230 LEU 230 230 ?   ?   ?   B . n 
D 4  231 LEU 231 231 ?   ?   ?   B . n 
E 5  1   MET 1   1   1   MET MET X . n 
E 5  2   LYS 2   2   2   LYS LYS X . n 
E 5  3   LEU 3   3   3   LEU LEU X . n 
E 5  4   VAL 4   4   4   VAL VAL X . n 
E 5  5   ARG 5   5   5   ARG ARG X . n 
E 5  6   PHE 6   6   6   PHE PHE X . n 
E 5  7   LEU 7   7   7   LEU LEU X . n 
E 5  8   MET 8   8   8   MET MET X . n 
E 5  9   LYS 9   9   9   LYS LYS X . n 
E 5  10  LEU 10  10  10  LEU LEU X . n 
E 5  11  SER 11  11  11  SER SER X . n 
E 5  12  HIS 12  12  12  HIS HIS X . n 
E 5  13  GLU 13  13  13  GLU GLU X . n 
E 5  14  THR 14  14  14  THR THR X . n 
E 5  15  VAL 15  15  15  VAL VAL X . n 
E 5  16  THR 16  16  16  THR THR X . n 
E 5  17  ILE 17  17  17  ILE ILE X . n 
E 5  18  GLU 18  18  18  GLU GLU X . n 
E 5  19  LEU 19  19  19  LEU LEU X . n 
E 5  20  LYS 20  20  20  LYS LYS X . n 
E 5  21  ASN 21  21  21  ASN ASN X . n 
E 5  22  GLY 22  22  22  GLY GLY X . n 
E 5  23  THR 23  23  23  THR THR X . n 
E 5  24  GLN 24  24  24  GLN GLN X . n 
E 5  25  VAL 25  25  25  VAL VAL X . n 
E 5  26  HIS 26  26  26  HIS HIS X . n 
E 5  27  GLY 27  27  27  GLY GLY X . n 
E 5  28  THR 28  28  28  THR THR X . n 
E 5  29  ILE 29  29  29  ILE ILE X . n 
E 5  30  THR 30  30  30  THR THR X . n 
E 5  31  GLY 31  31  31  GLY GLY X . n 
E 5  32  VAL 32  32  32  VAL VAL X . n 
E 5  33  ASP 33  33  33  ASP ASP X . n 
E 5  34  VAL 34  34  34  VAL VAL X . n 
E 5  35  SER 35  35  35  SER SER X . n 
E 5  36  MET 36  36  36  MET MET X . n 
E 5  37  ASN 37  37  37  ASN ASN X . n 
E 5  38  THR 38  38  38  THR THR X . n 
E 5  39  HIS 39  39  39  HIS HIS X . n 
E 5  40  LEU 40  40  40  LEU LEU X . n 
E 5  41  LYS 41  41  41  LYS LYS X . n 
E 5  42  ALA 42  42  42  ALA ALA X . n 
E 5  43  VAL 43  43  43  VAL VAL X . n 
E 5  44  LYS 44  44  44  LYS LYS X . n 
E 5  45  MET 45  45  45  MET MET X . n 
E 5  46  THR 46  46  46  THR THR X . n 
E 5  47  LEU 47  47  47  LEU LEU X . n 
E 5  48  LYS 48  48  48  LYS LYS X . n 
E 5  49  ASN 49  49  49  ASN ASN X . n 
E 5  50  ARG 50  50  50  ARG ARG X . n 
E 5  51  GLU 51  51  51  GLU GLU X . n 
E 5  52  PRO 52  52  52  PRO PRO X . n 
E 5  53  VAL 53  53  53  VAL VAL X . n 
E 5  54  GLN 54  54  54  GLN GLN X . n 
E 5  55  LEU 55  55  55  LEU LEU X . n 
E 5  56  GLU 56  56  56  GLU GLU X . n 
E 5  57  THR 57  57  57  THR THR X . n 
E 5  58  LEU 58  58  58  LEU LEU X . n 
E 5  59  SER 59  59  59  SER SER X . n 
E 5  60  ILE 60  60  60  ILE ILE X . n 
E 5  61  ARG 61  61  61  ARG ARG X . n 
E 5  62  GLY 62  62  62  GLY GLY X . n 
E 5  63  ASN 63  63  63  ASN ASN X . n 
E 5  64  ASN 64  64  64  ASN ASN X . n 
E 5  65  ILE 65  65  65  ILE ILE X . n 
E 5  66  ARG 66  66  66  ARG ARG X . n 
E 5  67  TYR 67  67  67  TYR TYR X . n 
E 5  68  PHE 68  68  68  PHE PHE X . n 
E 5  69  ILE 69  69  69  ILE ILE X . n 
E 5  70  LEU 70  70  70  LEU LEU X . n 
E 5  71  PRO 71  71  71  PRO PRO X . n 
E 5  72  ASP 72  72  72  ASP ASP X . n 
E 5  73  SER 73  73  73  SER SER X . n 
E 5  74  LEU 74  74  74  LEU LEU X . n 
E 5  75  PRO 75  75  75  PRO PRO X . n 
E 5  76  LEU 76  76  76  LEU LEU X . n 
E 5  77  ASP 77  77  77  ASP ASP X . n 
E 5  78  THR 78  78  78  THR THR X . n 
E 5  79  LEU 79  79  79  LEU LEU X . n 
E 5  80  LEU 80  80  80  LEU LEU X . n 
E 5  81  VAL 81  81  81  VAL VAL X . n 
E 5  82  ASP 82  82  82  ASP ASP X . n 
E 5  83  VAL 83  83  83  VAL VAL X . n 
E 5  84  GLU 84  84  84  GLU GLU X . n 
E 5  85  PRO 85  85  85  PRO PRO X . n 
E 5  86  LYS 86  86  ?   ?   ?   X . n 
E 5  87  VAL 87  87  ?   ?   ?   X . n 
E 5  88  LYS 88  88  ?   ?   ?   X . n 
E 5  89  SER 89  89  ?   ?   ?   X . n 
E 5  90  LYS 90  90  ?   ?   ?   X . n 
E 5  91  LYS 91  91  ?   ?   ?   X . n 
E 5  92  ARG 92  92  ?   ?   ?   X . n 
E 5  93  GLU 93  93  ?   ?   ?   X . n 
E 5  94  ALA 94  94  ?   ?   ?   X . n 
E 5  95  VAL 95  95  ?   ?   ?   X . n 
E 5  96  ALA 96  96  ?   ?   ?   X . n 
E 5  97  GLY 97  97  ?   ?   ?   X . n 
E 5  98  ARG 98  98  ?   ?   ?   X . n 
E 5  99  GLY 99  99  ?   ?   ?   X . n 
E 5  100 ARG 100 100 ?   ?   ?   X . n 
E 5  101 GLY 101 101 ?   ?   ?   X . n 
E 5  102 ARG 102 102 ?   ?   ?   X . n 
E 5  103 GLY 103 103 ?   ?   ?   X . n 
E 5  104 ARG 104 104 ?   ?   ?   X . n 
E 5  105 GLY 105 105 ?   ?   ?   X . n 
E 5  106 ARG 106 106 ?   ?   ?   X . n 
E 5  107 GLY 107 107 ?   ?   ?   X . n 
E 5  108 ARG 108 108 ?   ?   ?   X . n 
E 5  109 GLY 109 109 ?   ?   ?   X . n 
E 5  110 ARG 110 110 ?   ?   ?   X . n 
E 5  111 GLY 111 111 ?   ?   ?   X . n 
E 5  112 ARG 112 112 ?   ?   ?   X . n 
E 5  113 GLY 113 113 ?   ?   ?   X . n 
E 5  114 ARG 114 114 ?   ?   ?   X . n 
E 5  115 GLY 115 115 ?   ?   ?   X . n 
E 5  116 GLY 116 116 ?   ?   ?   X . n 
E 5  117 PRO 117 117 ?   ?   ?   X . n 
E 5  118 ARG 118 118 ?   ?   ?   X . n 
E 5  119 ARG 119 119 ?   ?   ?   X . n 
F 6  1   MET 1   1   ?   ?   ?   Y . n 
F 6  2   SER 2   2   2   SER SER Y . n 
F 6  3   LEU 3   3   3   LEU LEU Y . n 
F 6  4   LEU 4   4   4   LEU LEU Y . n 
F 6  5   ASN 5   5   5   ASN ASN Y . n 
F 6  6   LYS 6   6   6   LYS LYS Y . n 
F 6  7   PRO 7   7   7   PRO PRO Y . n 
F 6  8   LYS 8   8   8   LYS LYS Y . n 
F 6  9   SER 9   9   9   SER SER Y . n 
F 6  10  GLU 10  10  10  GLU GLU Y . n 
F 6  11  MET 11  11  11  MET MET Y . n 
F 6  12  THR 12  12  12  THR THR Y . n 
F 6  13  PRO 13  13  13  PRO PRO Y . n 
F 6  14  GLU 14  14  14  GLU GLU Y . n 
F 6  15  GLU 15  15  15  GLU GLU Y . n 
F 6  16  LEU 16  16  16  LEU LEU Y . n 
F 6  17  GLN 17  17  17  GLN GLN Y . n 
F 6  18  LYS 18  18  18  LYS LYS Y . n 
F 6  19  ARG 19  19  19  ARG ARG Y . n 
F 6  20  GLU 20  20  20  GLU GLU Y . n 
F 6  21  GLU 21  21  21  GLU GLU Y . n 
F 6  22  GLU 22  22  22  GLU GLU Y . n 
F 6  23  GLU 23  23  23  GLU GLU Y . n 
F 6  24  PHE 24  24  24  PHE PHE Y . n 
F 6  25  ASN 25  25  25  ASN ASN Y . n 
F 6  26  THR 26  26  26  THR THR Y . n 
F 6  27  GLY 27  27  27  GLY GLY Y . n 
F 6  28  PRO 28  28  28  PRO PRO Y . n 
F 6  29  LEU 29  29  29  LEU LEU Y . n 
F 6  30  SER 30  30  30  SER SER Y . n 
F 6  31  VAL 31  31  31  VAL VAL Y . n 
F 6  32  LEU 32  32  32  LEU LEU Y . n 
F 6  33  THR 33  33  33  THR THR Y . n 
F 6  34  GLN 34  34  34  GLN GLN Y . n 
F 6  35  SER 35  35  35  SER SER Y . n 
F 6  36  VAL 36  36  36  VAL VAL Y . n 
F 6  37  LYS 37  37  37  LYS LYS Y . n 
F 6  38  ASN 38  38  38  ASN ASN Y . n 
F 6  39  ASN 39  39  39  ASN ASN Y . n 
F 6  40  THR 40  40  40  THR THR Y . n 
F 6  41  GLN 41  41  41  GLN GLN Y . n 
F 6  42  VAL 42  42  42  VAL VAL Y . n 
F 6  43  LEU 43  43  43  LEU LEU Y . n 
F 6  44  ILE 44  44  44  ILE ILE Y . n 
F 6  45  ASN 45  45  45  ASN ASN Y . n 
F 6  46  CYS 46  46  46  CYS CYS Y . n 
F 6  47  ARG 47  47  47  ARG ARG Y . n 
F 6  48  ASN 48  48  48  ASN ASN Y . n 
F 6  49  ASN 49  49  49  ASN ASN Y . n 
F 6  50  LYS 50  50  50  LYS LYS Y . n 
F 6  51  LYS 51  51  51  LYS LYS Y . n 
F 6  52  LEU 52  52  52  LEU LEU Y . n 
F 6  53  LEU 53  53  53  LEU LEU Y . n 
F 6  54  GLY 54  54  54  GLY GLY Y . n 
F 6  55  ARG 55  55  55  ARG ARG Y . n 
F 6  56  VAL 56  56  56  VAL VAL Y . n 
F 6  57  LYS 57  57  57  LYS LYS Y . n 
F 6  58  ALA 58  58  58  ALA ALA Y . n 
F 6  59  PHE 59  59  59  PHE PHE Y . n 
F 6  60  ASP 60  60  60  ASP ASP Y . n 
F 6  61  ARG 61  61  61  ARG ARG Y . n 
F 6  62  HIS 62  62  62  HIS HIS Y . n 
F 6  63  CYS 63  63  63  CYS CYS Y . n 
F 6  64  ASN 64  64  64  ASN ASN Y . n 
F 6  65  MET 65  65  65  MET MET Y . n 
F 6  66  VAL 66  66  66  VAL VAL Y . n 
F 6  67  LEU 67  67  67  LEU LEU Y . n 
F 6  68  GLU 68  68  68  GLU GLU Y . n 
F 6  69  ASN 69  69  69  ASN ASN Y . n 
F 6  70  VAL 70  70  70  VAL VAL Y . n 
F 6  71  LYS 71  71  71  LYS LYS Y . n 
F 6  72  GLU 72  72  72  GLU GLU Y . n 
F 6  73  MET 73  73  73  MET MET Y . n 
F 6  74  TRP 74  74  74  TRP TRP Y . n 
F 6  75  THR 75  75  75  THR THR Y . n 
F 6  76  GLU 76  76  76  GLU GLU Y . n 
F 6  77  VAL 77  77  77  VAL VAL Y . n 
F 6  78  PRO 78  78  78  PRO PRO Y . n 
F 6  79  LYS 79  79  79  LYS LYS Y . n 
F 6  80  SER 80  80  80  SER SER Y . n 
F 6  81  GLY 81  81  81  GLY GLY Y . n 
F 6  82  LYS 82  82  82  LYS LYS Y . n 
F 6  83  GLY 83  83  83  GLY GLY Y . n 
F 6  84  LYS 84  84  84  LYS LYS Y . n 
F 6  85  LYS 85  85  85  LYS LYS Y . n 
F 6  86  LYS 86  86  86  LYS LYS Y . n 
F 6  87  SER 87  87  87  SER SER Y . n 
F 6  88  LYS 88  88  88  LYS LYS Y . n 
F 6  89  PRO 89  89  89  PRO PRO Y . n 
F 6  90  VAL 90  90  90  VAL VAL Y . n 
F 6  91  ASN 91  91  91  ASN ASN Y . n 
F 6  92  LYS 92  92  92  LYS LYS Y . n 
F 6  93  ASP 93  93  93  ASP ASP Y . n 
F 6  94  ARG 94  94  94  ARG ARG Y . n 
F 6  95  TYR 95  95  95  TYR TYR Y . n 
F 6  96  ILE 96  96  96  ILE ILE Y . n 
F 6  97  SER 97  97  97  SER SER Y . n 
F 6  98  LYS 98  98  98  LYS LYS Y . n 
F 6  99  MET 99  99  99  MET MET Y . n 
F 6  100 PHE 100 100 100 PHE PHE Y . n 
F 6  101 LEU 101 101 101 LEU LEU Y . n 
F 6  102 ARG 102 102 102 ARG ARG Y . n 
F 6  103 GLY 103 103 103 GLY GLY Y . n 
F 6  104 ASP 104 104 104 ASP ASP Y . n 
F 6  105 SER 105 105 105 SER SER Y . n 
F 6  106 VAL 106 106 106 VAL VAL Y . n 
F 6  107 ILE 107 107 107 ILE ILE Y . n 
F 6  108 VAL 108 108 108 VAL VAL Y . n 
F 6  109 VAL 109 109 109 VAL VAL Y . n 
F 6  110 LEU 110 110 110 LEU LEU Y . n 
F 6  111 ARG 111 111 111 ARG ARG Y . n 
F 6  112 ASN 112 112 112 ASN ASN Y . n 
F 6  113 PRO 113 113 ?   ?   ?   Y . n 
F 6  114 LEU 114 114 ?   ?   ?   Y . n 
F 6  115 ILE 115 115 ?   ?   ?   Y . n 
F 6  116 ALA 116 116 ?   ?   ?   Y . n 
F 6  117 GLY 117 117 ?   ?   ?   Y . n 
F 6  118 LYS 118 118 ?   ?   ?   Y . n 
G 7  1   MET 1   1   ?   ?   ?   F . n 
G 7  2   SER 2   2   2   SER SER F . n 
G 7  3   LEU 3   3   3   LEU LEU F . n 
G 7  4   PRO 4   4   4   PRO PRO F . n 
G 7  5   LEU 5   5   5   LEU LEU F . n 
G 7  6   ASN 6   6   6   ASN ASN F . n 
G 7  7   PRO 7   7   7   PRO PRO F . n 
G 7  8   LYS 8   8   8   LYS LYS F . n 
G 7  9   PRO 9   9   9   PRO PRO F . n 
G 7  10  PHE 10  10  10  PHE PHE F . n 
G 7  11  LEU 11  11  11  LEU LEU F . n 
G 7  12  ASN 12  12  12  ASN ASN F . n 
G 7  13  GLY 13  13  13  GLY GLY F . n 
G 7  14  LEU 14  14  14  LEU LEU F . n 
G 7  15  THR 15  15  15  THR THR F . n 
G 7  16  GLY 16  16  16  GLY GLY F . n 
G 7  17  LYS 17  17  17  LYS LYS F . n 
G 7  18  PRO 18  18  18  PRO PRO F . n 
G 7  19  VAL 19  19  19  VAL VAL F . n 
G 7  20  MET 20  20  20  MET MET F . n 
G 7  21  VAL 21  21  21  VAL VAL F . n 
G 7  22  LYS 22  22  22  LYS LYS F . n 
G 7  23  LEU 23  23  23  LEU LEU F . n 
G 7  24  LYS 24  24  24  LYS LYS F . n 
G 7  25  TRP 25  25  25  TRP TRP F . n 
G 7  26  GLY 26  26  26  GLY GLY F . n 
G 7  27  MET 27  27  27  MET MET F . n 
G 7  28  GLU 28  28  28  GLU GLU F . n 
G 7  29  TYR 29  29  29  TYR TYR F . n 
G 7  30  LYS 30  30  30  LYS LYS F . n 
G 7  31  GLY 31  31  31  GLY GLY F . n 
G 7  32  TYR 32  32  32  TYR TYR F . n 
G 7  33  LEU 33  33  33  LEU LEU F . n 
G 7  34  VAL 34  34  34  VAL VAL F . n 
G 7  35  SER 35  35  35  SER SER F . n 
G 7  36  VAL 36  36  36  VAL VAL F . n 
G 7  37  ASP 37  37  37  ASP ASP F . n 
G 7  38  GLY 38  38  38  GLY GLY F . n 
G 7  39  TYR 39  39  39  TYR TYR F . n 
G 7  40  MET 40  40  40  MET MET F . n 
G 7  41  ASN 41  41  41  ASN ASN F . n 
G 7  42  MET 42  42  42  MET MET F . n 
G 7  43  GLN 43  43  43  GLN GLN F . n 
G 7  44  LEU 44  44  44  LEU LEU F . n 
G 7  45  ALA 45  45  45  ALA ALA F . n 
G 7  46  ASN 46  46  46  ASN ASN F . n 
G 7  47  THR 47  47  47  THR THR F . n 
G 7  48  GLU 48  48  48  GLU GLU F . n 
G 7  49  GLU 49  49  49  GLU GLU F . n 
G 7  50  TYR 50  50  50  TYR TYR F . n 
G 7  51  ILE 51  51  51  ILE ILE F . n 
G 7  52  ASP 52  52  52  ASP ASP F . n 
G 7  53  GLY 53  53  53  GLY GLY F . n 
G 7  54  ALA 54  54  54  ALA ALA F . n 
G 7  55  LEU 55  55  55  LEU LEU F . n 
G 7  56  SER 56  56  56  SER SER F . n 
G 7  57  GLY 57  57  57  GLY GLY F . n 
G 7  58  HIS 58  58  58  HIS HIS F . n 
G 7  59  LEU 59  59  59  LEU LEU F . n 
G 7  60  GLY 60  60  60  GLY GLY F . n 
G 7  61  GLU 61  61  61  GLU GLU F . n 
G 7  62  VAL 62  62  62  VAL VAL F . n 
G 7  63  LEU 63  63  63  LEU LEU F . n 
G 7  64  ILE 64  64  64  ILE ILE F . n 
G 7  65  ARG 65  65  65  ARG ARG F . n 
G 7  66  CYS 66  66  66  CYS CYS F . n 
G 7  67  ASN 67  67  67  ASN ASN F . n 
G 7  68  ASN 68  68  68  ASN ASN F . n 
G 7  69  VAL 69  69  69  VAL VAL F . n 
G 7  70  LEU 70  70  70  LEU LEU F . n 
G 7  71  TYR 71  71  71  TYR TYR F . n 
G 7  72  ILE 72  72  72  ILE ILE F . n 
G 7  73  ARG 73  73  73  ARG ARG F . n 
G 7  74  GLY 74  74  74  GLY GLY F . n 
G 7  75  VAL 75  75  75  VAL VAL F . n 
G 7  76  GLU 76  76  76  GLU GLU F . n 
G 7  77  GLU 77  77  77  GLU GLU F . n 
G 7  78  GLU 78  78  78  GLU GLU F . n 
G 7  79  GLU 79  79  79  GLU GLU F . n 
G 7  80  GLU 80  80  80  GLU GLU F . n 
G 7  81  ASP 81  81  81  ASP ASP F . n 
G 7  82  GLY 82  82  82  GLY GLY F . n 
G 7  83  GLU 83  83  83  GLU GLU F . n 
G 7  84  MET 84  84  84  MET MET F . n 
G 7  85  ARG 85  85  85  ARG ARG F . n 
G 7  86  GLU 86  86  86  GLU GLU F . n 
H 8  1   MET 1   1   ?   ?   ?   E . n 
H 8  2   ALA 2   2   ?   ?   ?   E . n 
H 8  3   TYR 3   3   ?   ?   ?   E . n 
H 8  4   ARG 4   4   ?   ?   ?   E . n 
H 8  5   GLY 5   5   ?   ?   ?   E . n 
H 8  6   GLN 6   6   ?   ?   ?   E . n 
H 8  7   GLY 7   7   7   GLY GLY E . n 
H 8  8   GLN 8   8   8   GLN GLN E . n 
H 8  9   LYS 9   9   9   LYS LYS E . n 
H 8  10  VAL 10  10  10  VAL VAL E . n 
H 8  11  GLN 11  11  11  GLN GLN E . n 
H 8  12  LYS 12  12  12  LYS LYS E . n 
H 8  13  VAL 13  13  13  VAL VAL E . n 
H 8  14  MET 14  14  14  MET MET E . n 
H 8  15  VAL 15  15  15  VAL VAL E . n 
H 8  16  GLN 16  16  16  GLN GLN E . n 
H 8  17  PRO 17  17  17  PRO PRO E . n 
H 8  18  ILE 18  18  18  ILE ILE E . n 
H 8  19  ASN 19  19  19  ASN ASN E . n 
H 8  20  LEU 20  20  20  LEU LEU E . n 
H 8  21  ILE 21  21  21  ILE ILE E . n 
H 8  22  PHE 22  22  22  PHE PHE E . n 
H 8  23  ARG 23  23  23  ARG ARG E . n 
H 8  24  TYR 24  24  24  TYR TYR E . n 
H 8  25  LEU 25  25  25  LEU LEU E . n 
H 8  26  GLN 26  26  26  GLN GLN E . n 
H 8  27  ASN 27  27  27  ASN ASN E . n 
H 8  28  ARG 28  28  28  ARG ARG E . n 
H 8  29  SER 29  29  29  SER SER E . n 
H 8  30  ARG 30  30  30  ARG ARG E . n 
H 8  31  ILE 31  31  31  ILE ILE E . n 
H 8  32  GLN 32  32  32  GLN GLN E . n 
H 8  33  VAL 33  33  33  VAL VAL E . n 
H 8  34  TRP 34  34  34  TRP TRP E . n 
H 8  35  LEU 35  35  35  LEU LEU E . n 
H 8  36  TYR 36  36  36  TYR TYR E . n 
H 8  37  GLU 37  37  37  GLU GLU E . n 
H 8  38  GLN 38  38  38  GLN GLN E . n 
H 8  39  VAL 39  39  39  VAL VAL E . n 
H 8  40  ASN 40  40  40  ASN ASN E . n 
H 8  41  MET 41  41  41  MET MET E . n 
H 8  42  ARG 42  42  42  ARG ARG E . n 
H 8  43  ILE 43  43  43  ILE ILE E . n 
H 8  44  GLU 44  44  44  GLU GLU E . n 
H 8  45  GLY 45  45  45  GLY GLY E . n 
H 8  46  CYS 46  46  46  CYS CYS E . n 
H 8  47  ILE 47  47  47  ILE ILE E . n 
H 8  48  ILE 48  48  48  ILE ILE E . n 
H 8  49  GLY 49  49  49  GLY GLY E . n 
H 8  50  PHE 50  50  50  PHE PHE E . n 
H 8  51  ASP 51  51  51  ASP ASP E . n 
H 8  52  GLU 52  52  52  GLU GLU E . n 
H 8  53  TYR 53  53  53  TYR TYR E . n 
H 8  54  MET 54  54  54  MET MET E . n 
H 8  55  ASN 55  55  55  ASN ASN E . n 
H 8  56  LEU 56  56  56  LEU LEU E . n 
H 8  57  VAL 57  57  57  VAL VAL E . n 
H 8  58  LEU 58  58  58  LEU LEU E . n 
H 8  59  ASP 59  59  59  ASP ASP E . n 
H 8  60  ASP 60  60  60  ASP ASP E . n 
H 8  61  ALA 61  61  61  ALA ALA E . n 
H 8  62  GLU 62  62  62  GLU GLU E . n 
H 8  63  GLU 63  63  63  GLU GLU E . n 
H 8  64  ILE 64  64  64  ILE ILE E . n 
H 8  65  HIS 65  65  65  HIS HIS E . n 
H 8  66  SER 66  66  66  SER SER E . n 
H 8  67  LYS 67  67  67  LYS LYS E . n 
H 8  68  THR 68  68  68  THR THR E . n 
H 8  69  LYS 69  69  69  LYS LYS E . n 
H 8  70  SER 70  70  70  SER SER E . n 
H 8  71  ARG 71  71  71  ARG ARG E . n 
H 8  72  LYS 72  72  72  LYS LYS E . n 
H 8  73  GLN 73  73  73  GLN GLN E . n 
H 8  74  LEU 74  74  74  LEU LEU E . n 
H 8  75  GLY 75  75  75  GLY GLY E . n 
H 8  76  ARG 76  76  76  ARG ARG E . n 
H 8  77  ILE 77  77  77  ILE ILE E . n 
H 8  78  MET 78  78  78  MET MET E . n 
H 8  79  LEU 79  79  79  LEU LEU E . n 
H 8  80  LYS 80  80  80  LYS LYS E . n 
H 8  81  GLY 81  81  81  GLY GLY E . n 
H 8  82  ASP 82  82  82  ASP ASP E . n 
H 8  83  ASN 83  83  83  ASN ASN E . n 
H 8  84  ILE 84  84  84  ILE ILE E . n 
H 8  85  THR 85  85  85  THR THR E . n 
H 8  86  LEU 86  86  86  LEU LEU E . n 
H 8  87  LEU 87  87  87  LEU LEU E . n 
H 8  88  GLN 88  88  88  GLN GLN E . n 
H 8  89  SER 89  89  89  SER SER E . n 
H 8  90  VAL 90  90  90  VAL VAL E . n 
H 8  91  SER 91  91  ?   ?   ?   E . n 
H 8  92  ASN 92  92  ?   ?   ?   E . n 
I 9  1   MET 1   1   1   MET MET G . n 
I 9  2   SER 2   2   2   SER SER G . n 
I 9  3   LYS 3   3   3   LYS LYS G . n 
I 9  4   ALA 4   4   4   ALA ALA G . n 
I 9  5   HIS 5   5   5   HIS HIS G . n 
I 9  6   PRO 6   6   6   PRO PRO G . n 
I 9  7   PRO 7   7   7   PRO PRO G . n 
I 9  8   GLU 8   8   8   GLU GLU G . n 
I 9  9   LEU 9   9   9   LEU LEU G . n 
I 9  10  LYS 10  10  10  LYS LYS G . n 
I 9  11  LYS 11  11  11  LYS LYS G . n 
I 9  12  PHE 12  12  12  PHE PHE G . n 
I 9  13  MET 13  13  13  MET MET G . n 
I 9  14  ASP 14  14  14  ASP ASP G . n 
I 9  15  LYS 15  15  15  LYS LYS G . n 
I 9  16  LYS 16  16  16  LYS LYS G . n 
I 9  17  LEU 17  17  17  LEU LEU G . n 
I 9  18  SER 18  18  18  SER SER G . n 
I 9  19  LEU 19  19  19  LEU LEU G . n 
I 9  20  LYS 20  20  20  LYS LYS G . n 
I 9  21  LEU 21  21  21  LEU LEU G . n 
I 9  22  ASN 22  22  22  ASN ASN G . n 
I 9  23  GLY 23  23  23  GLY GLY G . n 
I 9  24  GLY 24  24  24  GLY GLY G . n 
I 9  25  ARG 25  25  25  ARG ARG G . n 
I 9  26  HIS 26  26  26  HIS HIS G . n 
I 9  27  VAL 27  27  27  VAL VAL G . n 
I 9  28  GLN 28  28  28  GLN GLN G . n 
I 9  29  GLY 29  29  29  GLY GLY G . n 
I 9  30  ILE 30  30  30  ILE ILE G . n 
I 9  31  LEU 31  31  31  LEU LEU G . n 
I 9  32  ARG 32  32  32  ARG ARG G . n 
I 9  33  GLY 33  33  33  GLY GLY G . n 
I 9  34  PHE 34  34  34  PHE PHE G . n 
I 9  35  ASP 35  35  35  ASP ASP G . n 
I 9  36  PRO 36  36  36  PRO PRO G . n 
I 9  37  PHE 37  37  37  PHE PHE G . n 
I 9  38  MET 38  38  38  MET MET G . n 
I 9  39  ASN 39  39  39  ASN ASN G . n 
I 9  40  LEU 40  40  40  LEU LEU G . n 
I 9  41  VAL 41  41  41  VAL VAL G . n 
I 9  42  ILE 42  42  42  ILE ILE G . n 
I 9  43  ASP 43  43  43  ASP ASP G . n 
I 9  44  GLU 44  44  44  GLU GLU G . n 
I 9  45  CYS 45  45  45  CYS CYS G . n 
I 9  46  VAL 46  46  46  VAL VAL G . n 
I 9  47  GLU 47  47  47  GLU GLU G . n 
I 9  48  MET 48  48  48  MET MET G . n 
I 9  49  ALA 49  49  49  ALA ALA G . n 
I 9  50  THR 50  50  50  THR THR G . n 
I 9  51  SER 51  51  51  SER SER G . n 
I 9  52  GLY 52  52  52  GLY GLY G . n 
I 9  53  GLN 53  53  53  GLN GLN G . n 
I 9  54  GLN 54  54  54  GLN GLN G . n 
I 9  55  ASN 55  55  55  ASN ASN G . n 
I 9  56  ASN 56  56  56  ASN ASN G . n 
I 9  57  ILE 57  57  57  ILE ILE G . n 
I 9  58  GLY 58  58  58  GLY GLY G . n 
I 9  59  MET 59  59  59  MET MET G . n 
I 9  60  VAL 60  60  60  VAL VAL G . n 
I 9  61  VAL 61  61  61  VAL VAL G . n 
I 9  62  ILE 62  62  62  ILE ILE G . n 
I 9  63  ARG 63  63  63  ARG ARG G . n 
I 9  64  GLY 64  64  64  GLY GLY G . n 
I 9  65  ASN 65  65  65  ASN ASN G . n 
I 9  66  SER 66  66  66  SER SER G . n 
I 9  67  ILE 67  67  67  ILE ILE G . n 
I 9  68  ILE 68  68  68  ILE ILE G . n 
I 9  69  MET 69  69  69  MET MET G . n 
I 9  70  LEU 70  70  70  LEU LEU G . n 
I 9  71  GLU 71  71  71  GLU GLU G . n 
I 9  72  ALA 72  72  72  ALA ALA G . n 
I 9  73  LEU 73  73  73  LEU LEU G . n 
I 9  74  GLU 74  74  74  GLU GLU G . n 
I 9  75  ARG 75  75  75  ARG ARG G . n 
I 9  76  VAL 76  76  76  VAL VAL G . n 
J 1  1   MET 1   1   ?   ?   ?   P . n 
J 1  2   ALA 2   2   2   ALA ALA P . n 
J 1  3   VAL 3   3   3   VAL VAL P . n 
J 1  4   PRO 4   4   4   PRO PRO P . n 
J 1  5   GLU 5   5   5   GLU GLU P . n 
J 1  6   THR 6   6   6   THR THR P . n 
J 1  7   ARG 7   7   7   ARG ARG P . n 
J 1  8   PRO 8   8   8   PRO PRO P . n 
J 1  9   ASN 9   9   9   ASN ASN P . n 
J 1  10  HIS 10  10  10  HIS HIS P . n 
J 1  11  THR 11  11  11  THR THR P . n 
J 1  12  ILE 12  12  12  ILE ILE P . n 
J 1  13  TYR 13  13  13  TYR TYR P . n 
J 1  14  ILE 14  14  14  ILE ILE P . n 
J 1  15  ASN 15  15  15  ASN ASN P . n 
J 1  16  ASN 16  16  16  ASN ASN P . n 
J 1  17  LEU 17  17  17  LEU LEU P . n 
J 1  18  ASN 18  18  18  ASN ASN P . n 
J 1  19  GLU 19  19  19  GLU GLU P . n 
J 1  20  LYS 20  20  20  LYS LYS P . n 
J 1  21  ILE 21  21  21  ILE ILE P . n 
J 1  22  LYS 22  22  22  LYS LYS P . n 
J 1  23  LYS 23  23  23  LYS LYS P . n 
J 1  24  ASP 24  24  24  ASP ASP P . n 
J 1  25  GLU 25  25  25  GLU GLU P . n 
J 1  26  LEU 26  26  26  LEU LEU P . n 
J 1  27  LYS 27  27  27  LYS LYS P . n 
J 1  28  LYS 28  28  28  LYS LYS P . n 
J 1  29  SER 29  29  29  SER SER P . n 
J 1  30  LEU 30  30  30  LEU LEU P . n 
J 1  31  TYR 31  31  31  TYR TYR P . n 
J 1  32  ALA 32  32  32  ALA ALA P . n 
J 1  33  ILE 33  33  33  ILE ILE P . n 
J 1  34  PHE 34  34  34  PHE PHE P . n 
J 1  35  SER 35  35  35  SER SER P . n 
J 1  36  GLN 36  36  36  GLN GLN P . n 
J 1  37  PHE 37  37  37  PHE PHE P . n 
J 1  38  GLY 38  38  38  GLY GLY P . n 
J 1  39  GLN 39  39  39  GLN GLN P . n 
J 1  40  ILE 40  40  40  ILE ILE P . n 
J 1  41  LEU 41  41  41  LEU LEU P . n 
J 1  42  ASP 42  42  42  ASP ASP P . n 
J 1  43  ILE 43  43  43  ILE ILE P . n 
J 1  44  LEU 44  44  44  LEU LEU P . n 
J 1  45  VAL 45  45  45  VAL VAL P . n 
J 1  46  SER 46  46  46  SER SER P . n 
J 1  47  ARG 47  47  47  ARG ARG P . n 
J 1  48  SER 48  48  48  SER SER P . n 
J 1  49  LEU 49  49  49  LEU LEU P . n 
J 1  50  LYS 50  50  50  LYS LYS P . n 
J 1  51  MET 51  51  51  MET MET P . n 
J 1  52  ARG 52  52  52  ARG ARG P . n 
J 1  53  GLY 53  53  53  GLY GLY P . n 
J 1  54  GLN 54  54  54  GLN GLN P . n 
J 1  55  ALA 55  55  55  ALA ALA P . n 
J 1  56  PHE 56  56  56  PHE PHE P . n 
J 1  57  VAL 57  57  57  VAL VAL P . n 
J 1  58  ILE 58  58  58  ILE ILE P . n 
J 1  59  PHE 59  59  59  PHE PHE P . n 
J 1  60  LYS 60  60  60  LYS LYS P . n 
J 1  61  GLU 61  61  61  GLU GLU P . n 
J 1  62  VAL 62  62  62  VAL VAL P . n 
J 1  63  SER 63  63  63  SER SER P . n 
J 1  64  SER 64  64  64  SER SER P . n 
J 1  65  ALA 65  65  65  ALA ALA P . n 
J 1  66  THR 66  66  66  THR THR P . n 
J 1  67  ASN 67  67  67  ASN ASN P . n 
J 1  68  ALA 68  68  68  ALA ALA P . n 
J 1  69  LEU 69  69  69  LEU LEU P . n 
J 1  70  ARG 70  70  70  ARG ARG P . n 
J 1  71  SER 71  71  71  SER SER P . n 
J 1  72  MET 72  72  72  MET MET P . n 
J 1  73  GLN 73  73  73  GLN GLN P . n 
J 1  74  GLY 74  74  74  GLY GLY P . n 
J 1  75  PHE 75  75  75  PHE PHE P . n 
J 1  76  PRO 76  76  76  PRO PRO P . n 
J 1  77  PHE 77  77  77  PHE PHE P . n 
J 1  78  TYR 78  78  78  TYR TYR P . n 
J 1  79  ASP 79  79  79  ASP ASP P . n 
J 1  80  LYS 80  80  80  LYS LYS P . n 
J 1  81  PRO 81  81  81  PRO PRO P . n 
J 1  82  MET 82  82  82  MET MET P . n 
J 1  83  ARG 83  83  83  ARG ARG P . n 
J 1  84  ILE 84  84  84  ILE ILE P . n 
J 1  85  GLN 85  85  85  GLN GLN P . n 
J 1  86  TYR 86  86  86  TYR TYR P . n 
J 1  87  ALA 87  87  87  ALA ALA P . n 
J 1  88  LYS 88  88  88  LYS LYS P . n 
J 1  89  THR 89  89  89  THR THR P . n 
J 1  90  ASP 90  90  90  ASP ASP P . n 
J 1  91  SER 91  91  91  SER SER P . n 
J 1  92  ASP 92  92  92  ASP ASP P . n 
J 1  93  ILE 93  93  93  ILE ILE P . n 
J 1  94  ILE 94  94  94  ILE ILE P . n 
J 1  95  ALA 95  95  95  ALA ALA P . n 
J 1  96  LYS 96  96  96  LYS LYS P . n 
J 1  97  MET 97  97  97  MET MET P . n 
J 1  98  LYS 98  98  98  LYS LYS P . n 
J 1  99  GLY 99  99  99  GLY GLY P . n 
J 1  100 THR 100 100 100 THR THR P . n 
J 1  101 PHE 101 101 101 PHE PHE P . n 
J 1  102 VAL 102 102 102 VAL VAL P . n 
J 1  103 GLU 103 103 103 GLU GLU P . n 
J 1  104 ARG 104 104 104 ARG ARG P . n 
J 1  105 ASP 105 105 105 ASP ASP P . n 
J 1  106 ARG 106 106 106 ARG ARG P . n 
J 1  107 LYS 107 107 107 LYS LYS P . n 
J 1  108 ARG 108 108 108 ARG ARG P . n 
J 1  109 GLU 109 109 109 GLU GLU P . n 
J 1  110 LYS 110 110 110 LYS LYS P . n 
J 1  111 ARG 111 111 111 ARG ARG P . n 
J 1  112 LYS 112 112 112 LYS LYS P . n 
J 1  113 PRO 113 113 113 PRO PRO P . n 
J 1  114 LYS 114 114 114 LYS LYS P . n 
J 1  115 SER 115 115 ?   ?   ?   P . n 
J 1  116 GLN 116 116 ?   ?   ?   P . n 
J 1  117 GLU 117 117 ?   ?   ?   P . n 
J 1  118 THR 118 118 ?   ?   ?   P . n 
J 1  119 PRO 119 119 ?   ?   ?   P . n 
J 1  120 ALA 120 120 ?   ?   ?   P . n 
J 1  121 THR 121 121 ?   ?   ?   P . n 
J 1  122 LYS 122 122 ?   ?   ?   P . n 
J 1  123 LYS 123 123 ?   ?   ?   P . n 
J 1  124 ALA 124 124 ?   ?   ?   P . n 
J 1  125 VAL 125 125 ?   ?   ?   P . n 
J 1  126 GLN 126 126 ?   ?   ?   P . n 
J 1  127 GLY 127 127 ?   ?   ?   P . n 
J 1  128 GLY 128 128 ?   ?   ?   P . n 
J 1  129 GLY 129 129 ?   ?   ?   P . n 
J 1  130 ALA 130 130 ?   ?   ?   P . n 
J 1  131 THR 131 131 ?   ?   ?   P . n 
J 1  132 PRO 132 132 ?   ?   ?   P . n 
J 1  133 VAL 133 133 ?   ?   ?   P . n 
J 1  134 VAL 134 134 ?   ?   ?   P . n 
J 1  135 GLY 135 135 ?   ?   ?   P . n 
J 1  136 ALA 136 136 ?   ?   ?   P . n 
J 1  137 VAL 137 137 ?   ?   ?   P . n 
J 1  138 GLN 138 138 ?   ?   ?   P . n 
J 1  139 GLY 139 139 ?   ?   ?   P . n 
J 1  140 PRO 140 140 ?   ?   ?   P . n 
J 1  141 VAL 141 141 ?   ?   ?   P . n 
J 1  142 PRO 142 142 ?   ?   ?   P . n 
J 1  143 GLY 143 143 ?   ?   ?   P . n 
J 1  144 MET 144 144 ?   ?   ?   P . n 
J 1  145 PRO 145 145 ?   ?   ?   P . n 
J 1  146 PRO 146 146 ?   ?   ?   P . n 
J 1  147 MET 147 147 ?   ?   ?   P . n 
J 1  148 THR 148 148 ?   ?   ?   P . n 
J 1  149 GLN 149 149 ?   ?   ?   P . n 
J 1  150 ALA 150 150 ?   ?   ?   P . n 
J 1  151 PRO 151 151 ?   ?   ?   P . n 
J 1  152 ARG 152 152 ?   ?   ?   P . n 
J 1  153 ILE 153 153 ?   ?   ?   P . n 
J 1  154 MET 154 154 ?   ?   ?   P . n 
J 1  155 HIS 155 155 ?   ?   ?   P . n 
J 1  156 HIS 156 156 ?   ?   ?   P . n 
J 1  157 MET 157 157 ?   ?   ?   P . n 
J 1  158 PRO 158 158 ?   ?   ?   P . n 
J 1  159 GLY 159 159 ?   ?   ?   P . n 
J 1  160 GLN 160 160 ?   ?   ?   P . n 
J 1  161 PRO 161 161 ?   ?   ?   P . n 
J 1  162 PRO 162 162 ?   ?   ?   P . n 
J 1  163 TYR 163 163 ?   ?   ?   P . n 
J 1  164 MET 164 164 ?   ?   ?   P . n 
J 1  165 PRO 165 165 ?   ?   ?   P . n 
J 1  166 PRO 166 166 ?   ?   ?   P . n 
J 1  167 PRO 167 167 ?   ?   ?   P . n 
J 1  168 GLY 168 168 ?   ?   ?   P . n 
J 1  169 MET 169 169 ?   ?   ?   P . n 
J 1  170 ILE 170 170 ?   ?   ?   P . n 
J 1  171 PRO 171 171 ?   ?   ?   P . n 
J 1  172 PRO 172 172 ?   ?   ?   P . n 
J 1  173 PRO 173 173 ?   ?   ?   P . n 
J 1  174 GLY 174 174 ?   ?   ?   P . n 
J 1  175 LEU 175 175 ?   ?   ?   P . n 
J 1  176 ALA 176 176 ?   ?   ?   P . n 
J 1  177 PRO 177 177 ?   ?   ?   P . n 
J 1  178 GLY 178 178 ?   ?   ?   P . n 
J 1  179 GLN 179 179 ?   ?   ?   P . n 
J 1  180 ILE 180 180 ?   ?   ?   P . n 
J 1  181 PRO 181 181 ?   ?   ?   P . n 
J 1  182 PRO 182 182 ?   ?   ?   P . n 
J 1  183 GLY 183 183 ?   ?   ?   P . n 
J 1  184 ALA 184 184 ?   ?   ?   P . n 
J 1  185 MET 185 185 ?   ?   ?   P . n 
J 1  186 PRO 186 186 ?   ?   ?   P . n 
J 1  187 PRO 187 187 ?   ?   ?   P . n 
J 1  188 GLN 188 188 ?   ?   ?   P . n 
J 1  189 GLN 189 189 ?   ?   ?   P . n 
J 1  190 LEU 190 190 ?   ?   ?   P . n 
J 1  191 MET 191 191 ?   ?   ?   P . n 
J 1  192 PRO 192 192 ?   ?   ?   P . n 
J 1  193 GLY 193 193 ?   ?   ?   P . n 
J 1  194 GLN 194 194 ?   ?   ?   P . n 
J 1  195 MET 195 195 ?   ?   ?   P . n 
J 1  196 PRO 196 196 ?   ?   ?   P . n 
J 1  197 PRO 197 197 ?   ?   ?   P . n 
J 1  198 ALA 198 198 ?   ?   ?   P . n 
J 1  199 GLN 199 199 ?   ?   ?   P . n 
J 1  200 PRO 200 200 ?   ?   ?   P . n 
J 1  201 LEU 201 201 ?   ?   ?   P . n 
J 1  202 SER 202 202 ?   ?   ?   P . n 
J 1  203 GLU 203 203 ?   ?   ?   P . n 
J 1  204 ASN 204 204 ?   ?   ?   P . n 
J 1  205 PRO 205 205 ?   ?   ?   P . n 
J 1  206 PRO 206 206 ?   ?   ?   P . n 
J 1  207 ASN 207 207 ?   ?   ?   P . n 
J 1  208 HIS 208 208 ?   ?   ?   P . n 
J 1  209 ILE 209 209 ?   ?   ?   P . n 
J 1  210 LEU 210 210 ?   ?   ?   P . n 
J 1  211 PHE 211 211 ?   ?   ?   P . n 
J 1  212 LEU 212 212 ?   ?   ?   P . n 
J 1  213 THR 213 213 ?   ?   ?   P . n 
J 1  214 ASN 214 214 ?   ?   ?   P . n 
J 1  215 LEU 215 215 ?   ?   ?   P . n 
J 1  216 PRO 216 216 ?   ?   ?   P . n 
J 1  217 GLU 217 217 ?   ?   ?   P . n 
J 1  218 GLU 218 218 ?   ?   ?   P . n 
J 1  219 THR 219 219 ?   ?   ?   P . n 
J 1  220 ASN 220 220 ?   ?   ?   P . n 
J 1  221 GLU 221 221 ?   ?   ?   P . n 
J 1  222 LEU 222 222 ?   ?   ?   P . n 
J 1  223 MET 223 223 ?   ?   ?   P . n 
J 1  224 LEU 224 224 ?   ?   ?   P . n 
J 1  225 SER 225 225 ?   ?   ?   P . n 
J 1  226 MET 226 226 ?   ?   ?   P . n 
J 1  227 LEU 227 227 ?   ?   ?   P . n 
J 1  228 PHE 228 228 ?   ?   ?   P . n 
J 1  229 ASN 229 229 ?   ?   ?   P . n 
J 1  230 GLN 230 230 ?   ?   ?   P . n 
J 1  231 PHE 231 231 ?   ?   ?   P . n 
J 1  232 PRO 232 232 ?   ?   ?   P . n 
J 1  233 GLY 233 233 ?   ?   ?   P . n 
J 1  234 PHE 234 234 ?   ?   ?   P . n 
J 1  235 LYS 235 235 ?   ?   ?   P . n 
J 1  236 GLU 236 236 ?   ?   ?   P . n 
J 1  237 VAL 237 237 ?   ?   ?   P . n 
J 1  238 ARG 238 238 ?   ?   ?   P . n 
J 1  239 LEU 239 239 ?   ?   ?   P . n 
J 1  240 VAL 240 240 ?   ?   ?   P . n 
J 1  241 PRO 241 241 ?   ?   ?   P . n 
J 1  242 GLY 242 242 ?   ?   ?   P . n 
J 1  243 ARG 243 243 ?   ?   ?   P . n 
J 1  244 HIS 244 244 ?   ?   ?   P . n 
J 1  245 ASP 245 245 ?   ?   ?   P . n 
J 1  246 ILE 246 246 ?   ?   ?   P . n 
J 1  247 ALA 247 247 ?   ?   ?   P . n 
J 1  248 PHE 248 248 ?   ?   ?   P . n 
J 1  249 VAL 249 249 ?   ?   ?   P . n 
J 1  250 GLU 250 250 ?   ?   ?   P . n 
J 1  251 PHE 251 251 ?   ?   ?   P . n 
J 1  252 ASP 252 252 ?   ?   ?   P . n 
J 1  253 ASN 253 253 ?   ?   ?   P . n 
J 1  254 GLU 254 254 ?   ?   ?   P . n 
J 1  255 VAL 255 255 ?   ?   ?   P . n 
J 1  256 GLN 256 256 ?   ?   ?   P . n 
J 1  257 ALA 257 257 ?   ?   ?   P . n 
J 1  258 GLY 258 258 ?   ?   ?   P . n 
J 1  259 ALA 259 259 ?   ?   ?   P . n 
J 1  260 ALA 260 260 ?   ?   ?   P . n 
J 1  261 ARG 261 261 ?   ?   ?   P . n 
J 1  262 ASP 262 262 ?   ?   ?   P . n 
J 1  263 ALA 263 263 ?   ?   ?   P . n 
J 1  264 LEU 264 264 ?   ?   ?   P . n 
J 1  265 GLN 265 265 ?   ?   ?   P . n 
J 1  266 GLY 266 266 ?   ?   ?   P . n 
J 1  267 PHE 267 267 ?   ?   ?   P . n 
J 1  268 LYS 268 268 ?   ?   ?   P . n 
J 1  269 ILE 269 269 ?   ?   ?   P . n 
J 1  270 THR 270 270 ?   ?   ?   P . n 
J 1  271 GLN 271 271 ?   ?   ?   P . n 
J 1  272 ASN 272 272 ?   ?   ?   P . n 
J 1  273 ASN 273 273 ?   ?   ?   P . n 
J 1  274 ALA 274 274 ?   ?   ?   P . n 
J 1  275 MET 275 275 ?   ?   ?   P . n 
J 1  276 LYS 276 276 ?   ?   ?   P . n 
J 1  277 ILE 277 277 ?   ?   ?   P . n 
J 1  278 SER 278 278 ?   ?   ?   P . n 
J 1  279 PHE 279 279 ?   ?   ?   P . n 
J 1  280 ALA 280 280 ?   ?   ?   P . n 
J 1  281 LYS 281 281 ?   ?   ?   P . n 
J 1  282 LYS 282 282 ?   ?   ?   P . n 
K 2  1   MET 1   1   ?   ?   ?   L . n 
K 2  2   THR 2   2   ?   ?   ?   L . n 
K 2  3   GLN 3   3   ?   ?   ?   L . n 
K 2  4   PHE 4   4   ?   ?   ?   L . n 
K 2  5   LEU 5   5   ?   ?   ?   L . n 
K 2  6   PRO 6   6   ?   ?   ?   L . n 
K 2  7   PRO 7   7   ?   ?   ?   L . n 
K 2  8   ASN 8   8   ?   ?   ?   L . n 
K 2  9   LEU 9   9   ?   ?   ?   L . n 
K 2  10  LEU 10  10  ?   ?   ?   L . n 
K 2  11  ALA 11  11  ?   ?   ?   L . n 
K 2  12  LEU 12  12  ?   ?   ?   L . n 
K 2  13  PHE 13  13  ?   ?   ?   L . n 
K 2  14  ALA 14  14  ?   ?   ?   L . n 
K 2  15  PRO 15  15  ?   ?   ?   L . n 
K 2  16  ARG 16  16  ?   ?   ?   L . n 
K 2  17  ASP 17  17  ?   ?   ?   L . n 
K 2  18  PRO 18  18  ?   ?   ?   L . n 
K 2  19  ILE 19  19  ?   ?   ?   L . n 
K 2  20  PRO 20  20  ?   ?   ?   L . n 
K 2  21  TYR 21  21  ?   ?   ?   L . n 
K 2  22  LEU 22  22  ?   ?   ?   L . n 
K 2  23  PRO 23  23  ?   ?   ?   L . n 
K 2  24  PRO 24  24  ?   ?   ?   L . n 
K 2  25  LEU 25  25  ?   ?   ?   L . n 
K 2  26  GLU 26  26  ?   ?   ?   L . n 
K 2  27  LYS 27  27  ?   ?   ?   L . n 
K 2  28  LEU 28  28  ?   ?   ?   L . n 
K 2  29  PRO 29  29  ?   ?   ?   L . n 
K 2  30  HIS 30  30  ?   ?   ?   L . n 
K 2  31  GLU 31  31  ?   ?   ?   L . n 
K 2  32  LYS 32  32  ?   ?   ?   L . n 
K 2  33  HIS 33  33  ?   ?   ?   L . n 
K 2  34  HIS 34  34  34  HIS HIS L . n 
K 2  35  ASN 35  35  35  ASN ASN L . n 
K 2  36  GLN 36  36  36  GLN GLN L . n 
K 2  37  PRO 37  37  37  PRO PRO L . n 
K 2  38  TYR 38  38  38  TYR TYR L . n 
K 2  39  CYS 39  39  39  CYS CYS L . n 
K 2  40  GLY 40  40  40  GLY GLY L . n 
K 2  41  ILE 41  41  41  ILE ILE L . n 
K 2  42  ALA 42  42  42  ALA ALA L . n 
K 2  43  PRO 43  43  43  PRO PRO L . n 
K 2  44  TYR 44  44  44  TYR TYR L . n 
K 2  45  ILE 45  45  45  ILE ILE L . n 
K 2  46  ARG 46  46  46  ARG ARG L . n 
K 2  47  GLU 47  47  47  GLU GLU L . n 
K 2  48  PHE 48  48  48  PHE PHE L . n 
K 2  49  GLU 49  49  49  GLU GLU L . n 
K 2  50  ASP 50  50  50  ASP ASP L . n 
K 2  51  PRO 51  51  51  PRO PRO L . n 
K 2  52  ARG 52  52  52  ARG ARG L . n 
K 2  53  ASP 53  53  53  ASP ASP L . n 
K 2  54  ALA 54  54  54  ALA ALA L . n 
K 2  55  PRO 55  55  55  PRO PRO L . n 
K 2  56  PRO 56  56  56  PRO PRO L . n 
K 2  57  PRO 57  57  57  PRO PRO L . n 
K 2  58  THR 58  58  58  THR THR L . n 
K 2  59  ARG 59  59  59  ARG ARG L . n 
K 2  60  ALA 60  60  60  ALA ALA L . n 
K 2  61  GLU 61  61  61  GLU GLU L . n 
K 2  62  THR 62  62  62  THR THR L . n 
K 2  63  ARG 63  63  63  ARG ARG L . n 
K 2  64  GLU 64  64  64  GLU GLU L . n 
K 2  65  GLU 65  65  65  GLU GLU L . n 
K 2  66  ARG 66  66  66  ARG ARG L . n 
K 2  67  MET 67  67  67  MET MET L . n 
K 2  68  GLU 68  68  68  GLU GLU L . n 
K 2  69  ARG 69  69  69  ARG ARG L . n 
K 2  70  LYS 70  70  70  LYS LYS L . n 
K 2  71  ARG 71  71  71  ARG ARG L . n 
K 2  72  ARG 72  72  72  ARG ARG L . n 
K 2  73  GLU 73  73  73  GLU GLU L . n 
K 2  74  LYS 74  74  74  LYS LYS L . n 
K 2  75  ILE 75  75  75  ILE ILE L . n 
K 2  76  GLU 76  76  76  GLU GLU L . n 
K 2  77  ARG 77  77  77  ARG ARG L . n 
K 2  78  ARG 78  78  78  ARG ARG L . n 
K 2  79  GLN 79  79  79  GLN GLN L . n 
K 2  80  GLN 80  80  80  GLN GLN L . n 
K 2  81  GLU 81  81  81  GLU GLU L . n 
K 2  82  VAL 82  82  82  VAL VAL L . n 
K 2  83  GLU 83  83  83  GLU GLU L . n 
K 2  84  THR 84  84  84  THR THR L . n 
K 2  85  GLU 85  85  85  GLU GLU L . n 
K 2  86  LEU 86  86  86  LEU LEU L . n 
K 2  87  LYS 87  87  87  LYS LYS L . n 
K 2  88  MET 88  88  88  MET MET L . n 
K 2  89  TRP 89  89  89  TRP TRP L . n 
K 2  90  ASP 90  90  90  ASP ASP L . n 
K 2  91  PRO 91  91  91  PRO PRO L . n 
K 2  92  HIS 92  92  92  HIS HIS L . n 
K 2  93  ASN 93  93  93  ASN ASN L . n 
K 2  94  ASP 94  94  94  ASP ASP L . n 
K 2  95  PRO 95  95  95  PRO PRO L . n 
K 2  96  ASN 96  96  96  ASN ASN L . n 
K 2  97  ALA 97  97  97  ALA ALA L . n 
K 2  98  GLN 98  98  98  GLN GLN L . n 
K 2  99  GLY 99  99  99  GLY GLY L . n 
K 2  100 ASP 100 100 100 ASP ASP L . n 
K 2  101 ALA 101 101 101 ALA ALA L . n 
K 2  102 PHE 102 102 102 PHE PHE L . n 
K 2  103 LYS 103 103 103 LYS LYS L . n 
K 2  104 THR 104 104 104 THR THR L . n 
K 2  105 LEU 105 105 105 LEU LEU L . n 
K 2  106 PHE 106 106 106 PHE PHE L . n 
K 2  107 VAL 107 107 107 VAL VAL L . n 
K 2  108 ALA 108 108 108 ALA ALA L . n 
K 2  109 ARG 109 109 109 ARG ARG L . n 
K 2  110 VAL 110 110 110 VAL VAL L . n 
K 2  111 ASN 111 111 111 ASN ASN L . n 
K 2  112 TYR 112 112 112 TYR TYR L . n 
K 2  113 ASP 113 113 113 ASP ASP L . n 
K 2  114 THR 114 114 114 THR THR L . n 
K 2  115 THR 115 115 115 THR THR L . n 
K 2  116 GLU 116 116 116 GLU GLU L . n 
K 2  117 SER 117 117 117 SER SER L . n 
K 2  118 LYS 118 118 118 LYS LYS L . n 
K 2  119 LEU 119 119 119 LEU LEU L . n 
K 2  120 ARG 120 120 120 ARG ARG L . n 
K 2  121 ARG 121 121 121 ARG ARG L . n 
K 2  122 GLU 122 122 122 GLU GLU L . n 
K 2  123 PHE 123 123 123 PHE PHE L . n 
K 2  124 GLU 124 124 124 GLU GLU L . n 
K 2  125 VAL 125 125 125 VAL VAL L . n 
K 2  126 TYR 126 126 126 TYR TYR L . n 
K 2  127 GLY 127 127 127 GLY GLY L . n 
K 2  128 PRO 128 128 128 PRO PRO L . n 
K 2  129 ILE 129 129 129 ILE ILE L . n 
K 2  130 LYS 130 130 130 LYS LYS L . n 
K 2  131 ARG 131 131 131 ARG ARG L . n 
K 2  132 ILE 132 132 132 ILE ILE L . n 
K 2  133 HIS 133 133 133 HIS HIS L . n 
K 2  134 MET 134 134 134 MET MET L . n 
K 2  135 VAL 135 135 135 VAL VAL L . n 
K 2  136 TYR 136 136 136 TYR TYR L . n 
K 2  137 SER 137 137 137 SER SER L . n 
K 2  138 LYS 138 138 138 LYS LYS L . n 
K 2  139 ARG 139 139 139 ARG ARG L . n 
K 2  140 SER 140 140 140 SER SER L . n 
K 2  141 GLY 141 141 141 GLY GLY L . n 
K 2  142 LYS 142 142 142 LYS LYS L . n 
K 2  143 PRO 143 143 143 PRO PRO L . n 
K 2  144 ARG 144 144 144 ARG ARG L . n 
K 2  145 GLY 145 145 145 GLY GLY L . n 
K 2  146 TYR 146 146 146 TYR TYR L . n 
K 2  147 ALA 147 147 147 ALA ALA L . n 
K 2  148 PHE 148 148 148 PHE PHE L . n 
K 2  149 ILE 149 149 149 ILE ILE L . n 
K 2  150 GLU 150 150 150 GLU GLU L . n 
K 2  151 TYR 151 151 151 TYR TYR L . n 
K 2  152 GLU 152 152 152 GLU GLU L . n 
K 2  153 HIS 153 153 153 HIS HIS L . n 
K 2  154 GLU 154 154 154 GLU GLU L . n 
K 2  155 ARG 155 155 155 ARG ARG L . n 
K 2  156 ASP 156 156 156 ASP ASP L . n 
K 2  157 MET 157 157 157 MET MET L . n 
K 2  158 HIS 158 158 158 HIS HIS L . n 
K 2  159 SER 159 159 159 SER SER L . n 
K 2  160 ALA 160 160 160 ALA ALA L . n 
K 2  161 TYR 161 161 161 TYR TYR L . n 
K 2  162 LYS 162 162 162 LYS LYS L . n 
K 2  163 HIS 163 163 163 HIS HIS L . n 
K 2  164 ALA 164 164 164 ALA ALA L . n 
K 2  165 ASP 165 165 165 ASP ASP L . n 
K 2  166 GLY 166 166 166 GLY GLY L . n 
K 2  167 LYS 167 167 167 LYS LYS L . n 
K 2  168 LYS 168 168 168 LYS LYS L . n 
K 2  169 ILE 169 169 169 ILE ILE L . n 
K 2  170 ASP 170 170 170 ASP ASP L . n 
K 2  171 GLY 171 171 171 GLY GLY L . n 
K 2  172 ARG 172 172 172 ARG ARG L . n 
K 2  173 ARG 173 173 173 ARG ARG L . n 
K 2  174 VAL 174 174 174 VAL VAL L . n 
K 2  175 LEU 175 175 175 LEU LEU L . n 
K 2  176 VAL 176 176 176 VAL VAL L . n 
K 2  177 ASP 177 177 177 ASP ASP L . n 
K 2  178 VAL 178 178 178 VAL VAL L . n 
K 2  179 GLU 179 179 179 GLU GLU L . n 
K 2  180 ARG 180 180 180 ARG ARG L . n 
K 2  181 GLY 181 181 181 GLY GLY L . n 
K 2  182 ARG 182 182 ?   ?   ?   L . n 
K 2  183 THR 183 183 ?   ?   ?   L . n 
K 2  184 VAL 184 184 ?   ?   ?   L . n 
K 2  185 LYS 185 185 ?   ?   ?   L . n 
K 2  186 GLY 186 186 ?   ?   ?   L . n 
K 2  187 TRP 187 187 ?   ?   ?   L . n 
K 2  188 ARG 188 188 ?   ?   ?   L . n 
K 2  189 PRO 189 189 ?   ?   ?   L . n 
K 2  190 ARG 190 190 ?   ?   ?   L . n 
K 2  191 ARG 191 191 ?   ?   ?   L . n 
K 2  192 LEU 192 192 ?   ?   ?   L . n 
K 2  193 GLY 193 193 ?   ?   ?   L . n 
K 2  194 GLY 194 194 ?   ?   ?   L . n 
K 2  195 GLY 195 195 ?   ?   ?   L . n 
K 2  196 LEU 196 196 ?   ?   ?   L . n 
K 2  197 GLY 197 197 ?   ?   ?   L . n 
K 2  198 GLY 198 198 ?   ?   ?   L . n 
K 2  199 THR 199 199 ?   ?   ?   L . n 
K 2  200 ARG 200 200 ?   ?   ?   L . n 
K 2  201 ARG 201 201 ?   ?   ?   L . n 
K 2  202 GLY 202 202 ?   ?   ?   L . n 
K 2  203 GLY 203 203 ?   ?   ?   L . n 
K 2  204 ALA 204 204 ?   ?   ?   L . n 
K 2  205 ASP 205 205 ?   ?   ?   L . n 
K 2  206 VAL 206 206 ?   ?   ?   L . n 
K 2  207 ASN 207 207 ?   ?   ?   L . n 
K 2  208 ILE 208 208 ?   ?   ?   L . n 
K 2  209 ARG 209 209 ?   ?   ?   L . n 
K 2  210 HIS 210 210 ?   ?   ?   L . n 
K 2  211 SER 211 211 ?   ?   ?   L . n 
K 2  212 GLY 212 212 ?   ?   ?   L . n 
K 2  213 ARG 213 213 ?   ?   ?   L . n 
K 2  214 ASP 214 214 ?   ?   ?   L . n 
K 2  215 ASP 215 215 ?   ?   ?   L . n 
K 2  216 THR 216 216 ?   ?   ?   L . n 
K 2  217 SER 217 217 ?   ?   ?   L . n 
K 2  218 ARG 218 218 ?   ?   ?   L . n 
K 2  219 TYR 219 219 ?   ?   ?   L . n 
K 2  220 ASP 220 220 ?   ?   ?   L . n 
K 2  221 GLU 221 221 ?   ?   ?   L . n 
K 2  222 ARG 222 222 ?   ?   ?   L . n 
K 2  223 PRO 223 223 ?   ?   ?   L . n 
K 2  224 GLY 224 224 ?   ?   ?   L . n 
K 2  225 PRO 225 225 ?   ?   ?   L . n 
K 2  226 SER 226 226 ?   ?   ?   L . n 
K 2  227 PRO 227 227 ?   ?   ?   L . n 
K 2  228 LEU 228 228 ?   ?   ?   L . n 
K 2  229 PRO 229 229 ?   ?   ?   L . n 
K 2  230 HIS 230 230 ?   ?   ?   L . n 
K 2  231 ARG 231 231 ?   ?   ?   L . n 
K 2  232 ASP 232 232 ?   ?   ?   L . n 
K 2  233 ARG 233 233 ?   ?   ?   L . n 
K 2  234 ASP 234 234 ?   ?   ?   L . n 
K 2  235 ARG 235 235 ?   ?   ?   L . n 
K 2  236 ASP 236 236 ?   ?   ?   L . n 
K 2  237 ARG 237 237 ?   ?   ?   L . n 
K 2  238 GLU 238 238 ?   ?   ?   L . n 
K 2  239 ARG 239 239 ?   ?   ?   L . n 
K 2  240 GLU 240 240 ?   ?   ?   L . n 
K 2  241 ARG 241 241 ?   ?   ?   L . n 
K 2  242 ARG 242 242 ?   ?   ?   L . n 
K 2  243 GLU 243 243 ?   ?   ?   L . n 
K 2  244 ARG 244 244 ?   ?   ?   L . n 
K 2  245 SER 245 245 ?   ?   ?   L . n 
K 2  246 ARG 246 246 ?   ?   ?   L . n 
K 2  247 GLU 247 247 ?   ?   ?   L . n 
K 2  248 ARG 248 248 ?   ?   ?   L . n 
K 2  249 ASP 249 249 ?   ?   ?   L . n 
K 2  250 LYS 250 250 ?   ?   ?   L . n 
K 2  251 GLU 251 251 ?   ?   ?   L . n 
K 2  252 ARG 252 252 ?   ?   ?   L . n 
K 2  253 GLU 253 253 ?   ?   ?   L . n 
K 2  254 ARG 254 254 ?   ?   ?   L . n 
K 2  255 ARG 255 255 ?   ?   ?   L . n 
K 2  256 ARG 256 256 ?   ?   ?   L . n 
K 2  257 SER 257 257 ?   ?   ?   L . n 
K 2  258 ARG 258 258 ?   ?   ?   L . n 
K 2  259 SER 259 259 ?   ?   ?   L . n 
K 2  260 ARG 260 260 ?   ?   ?   L . n 
K 2  261 ASP 261 261 ?   ?   ?   L . n 
K 2  262 ARG 262 262 ?   ?   ?   L . n 
K 2  263 ARG 263 263 ?   ?   ?   L . n 
K 2  264 ARG 264 264 ?   ?   ?   L . n 
K 2  265 ARG 265 265 ?   ?   ?   L . n 
K 2  266 SER 266 266 ?   ?   ?   L . n 
K 2  267 ARG 267 267 ?   ?   ?   L . n 
K 2  268 SER 268 268 ?   ?   ?   L . n 
K 2  269 ARG 269 269 ?   ?   ?   L . n 
K 2  270 ASP 270 270 ?   ?   ?   L . n 
K 2  271 LYS 271 271 ?   ?   ?   L . n 
K 2  272 GLU 272 272 ?   ?   ?   L . n 
K 2  273 GLU 273 273 ?   ?   ?   L . n 
K 2  274 ARG 274 274 ?   ?   ?   L . n 
K 2  275 ARG 275 275 ?   ?   ?   L . n 
K 2  276 ARG 276 276 ?   ?   ?   L . n 
K 2  277 SER 277 277 ?   ?   ?   L . n 
K 2  278 ARG 278 278 ?   ?   ?   L . n 
K 2  279 GLU 279 279 ?   ?   ?   L . n 
K 2  280 ARG 280 280 ?   ?   ?   L . n 
K 2  281 SER 281 281 ?   ?   ?   L . n 
K 2  282 LYS 282 282 ?   ?   ?   L . n 
K 2  283 ASP 283 283 ?   ?   ?   L . n 
K 2  284 LYS 284 284 ?   ?   ?   L . n 
K 2  285 ASP 285 285 ?   ?   ?   L . n 
K 2  286 ARG 286 286 ?   ?   ?   L . n 
K 2  287 ASP 287 287 ?   ?   ?   L . n 
K 2  288 ARG 288 288 ?   ?   ?   L . n 
K 2  289 LYS 289 289 ?   ?   ?   L . n 
K 2  290 ARG 290 290 ?   ?   ?   L . n 
K 2  291 ARG 291 291 ?   ?   ?   L . n 
K 2  292 SER 292 292 ?   ?   ?   L . n 
K 2  293 SER 293 293 ?   ?   ?   L . n 
K 2  294 ARG 294 294 ?   ?   ?   L . n 
K 2  295 SER 295 295 ?   ?   ?   L . n 
K 2  296 ARG 296 296 ?   ?   ?   L . n 
K 2  297 GLU 297 297 ?   ?   ?   L . n 
K 2  298 ARG 298 298 ?   ?   ?   L . n 
K 2  299 ALA 299 299 ?   ?   ?   L . n 
K 2  300 ARG 300 300 ?   ?   ?   L . n 
K 2  301 ARG 301 301 ?   ?   ?   L . n 
K 2  302 GLU 302 302 ?   ?   ?   L . n 
K 2  303 ARG 303 303 ?   ?   ?   L . n 
K 2  304 GLU 304 304 ?   ?   ?   L . n 
K 2  305 ARG 305 305 ?   ?   ?   L . n 
K 2  306 LYS 306 306 ?   ?   ?   L . n 
K 2  307 GLU 307 307 ?   ?   ?   L . n 
K 2  308 GLU 308 308 ?   ?   ?   L . n 
K 2  309 LEU 309 309 ?   ?   ?   L . n 
K 2  310 ARG 310 310 ?   ?   ?   L . n 
K 2  311 GLY 311 311 ?   ?   ?   L . n 
K 2  312 GLY 312 312 ?   ?   ?   L . n 
K 2  313 GLY 313 313 ?   ?   ?   L . n 
K 2  314 GLY 314 314 ?   ?   ?   L . n 
K 2  315 ASP 315 315 ?   ?   ?   L . n 
K 2  316 MET 316 316 ?   ?   ?   L . n 
K 2  317 ALA 317 317 ?   ?   ?   L . n 
K 2  318 GLU 318 318 ?   ?   ?   L . n 
K 2  319 PRO 319 319 ?   ?   ?   L . n 
K 2  320 SER 320 320 ?   ?   ?   L . n 
K 2  321 GLU 321 321 ?   ?   ?   L . n 
K 2  322 ALA 322 322 ?   ?   ?   L . n 
K 2  323 GLY 323 323 ?   ?   ?   L . n 
K 2  324 ASP 324 324 ?   ?   ?   L . n 
K 2  325 ALA 325 325 ?   ?   ?   L . n 
K 2  326 PRO 326 326 ?   ?   ?   L . n 
K 2  327 PRO 327 327 ?   ?   ?   L . n 
K 2  328 ASP 328 328 ?   ?   ?   L . n 
K 2  329 ASP 329 329 ?   ?   ?   L . n 
K 2  330 GLY 330 330 ?   ?   ?   L . n 
K 2  331 PRO 331 331 ?   ?   ?   L . n 
K 2  332 PRO 332 332 ?   ?   ?   L . n 
K 2  333 GLY 333 333 ?   ?   ?   L . n 
K 2  334 GLU 334 334 ?   ?   ?   L . n 
K 2  335 LEU 335 335 ?   ?   ?   L . n 
K 2  336 GLY 336 336 ?   ?   ?   L . n 
K 2  337 PRO 337 337 ?   ?   ?   L . n 
K 2  338 ASP 338 338 ?   ?   ?   L . n 
K 2  339 GLY 339 339 ?   ?   ?   L . n 
K 2  340 PRO 340 340 ?   ?   ?   L . n 
K 2  341 ASP 341 341 ?   ?   ?   L . n 
K 2  342 GLY 342 342 ?   ?   ?   L . n 
K 2  343 PRO 343 343 ?   ?   ?   L . n 
K 2  344 GLU 344 344 ?   ?   ?   L . n 
K 2  345 GLU 345 345 ?   ?   ?   L . n 
K 2  346 LYS 346 346 ?   ?   ?   L . n 
K 2  347 GLY 347 347 ?   ?   ?   L . n 
K 2  348 ARG 348 348 ?   ?   ?   L . n 
K 2  349 ASP 349 349 ?   ?   ?   L . n 
K 2  350 ARG 350 350 ?   ?   ?   L . n 
K 2  351 ASP 351 351 ?   ?   ?   L . n 
K 2  352 ARG 352 352 ?   ?   ?   L . n 
K 2  353 GLU 353 353 ?   ?   ?   L . n 
K 2  354 ARG 354 354 ?   ?   ?   L . n 
K 2  355 ARG 355 355 ?   ?   ?   L . n 
K 2  356 ARG 356 356 ?   ?   ?   L . n 
K 2  357 SER 357 357 ?   ?   ?   L . n 
K 2  358 HIS 358 358 ?   ?   ?   L . n 
K 2  359 ARG 359 359 ?   ?   ?   L . n 
K 2  360 SER 360 360 ?   ?   ?   L . n 
K 2  361 GLU 361 361 ?   ?   ?   L . n 
K 2  362 ARG 362 362 ?   ?   ?   L . n 
K 2  363 GLU 363 363 ?   ?   ?   L . n 
K 2  364 ARG 364 364 ?   ?   ?   L . n 
K 2  365 ARG 365 365 ?   ?   ?   L . n 
K 2  366 ARG 366 366 ?   ?   ?   L . n 
K 2  367 ASP 367 367 ?   ?   ?   L . n 
K 2  368 ARG 368 368 ?   ?   ?   L . n 
K 2  369 ASP 369 369 ?   ?   ?   L . n 
K 2  370 ARG 370 370 ?   ?   ?   L . n 
K 2  371 ASP 371 371 ?   ?   ?   L . n 
K 2  372 ARG 372 372 ?   ?   ?   L . n 
K 2  373 ASP 373 373 ?   ?   ?   L . n 
K 2  374 ARG 374 374 ?   ?   ?   L . n 
K 2  375 ASP 375 375 ?   ?   ?   L . n 
K 2  376 ARG 376 376 ?   ?   ?   L . n 
K 2  377 GLU 377 377 ?   ?   ?   L . n 
K 2  378 HIS 378 378 ?   ?   ?   L . n 
K 2  379 LYS 379 379 ?   ?   ?   L . n 
K 2  380 ARG 380 380 ?   ?   ?   L . n 
K 2  381 GLY 381 381 ?   ?   ?   L . n 
K 2  382 GLU 382 382 ?   ?   ?   L . n 
K 2  383 ARG 383 383 ?   ?   ?   L . n 
K 2  384 GLY 384 384 ?   ?   ?   L . n 
K 2  385 SER 385 385 ?   ?   ?   L . n 
K 2  386 GLU 386 386 ?   ?   ?   L . n 
K 2  387 ARG 387 387 ?   ?   ?   L . n 
K 2  388 GLY 388 388 ?   ?   ?   L . n 
K 2  389 ARG 389 389 ?   ?   ?   L . n 
K 2  390 ASP 390 390 ?   ?   ?   L . n 
K 2  391 GLU 391 391 ?   ?   ?   L . n 
K 2  392 ALA 392 392 ?   ?   ?   L . n 
K 2  393 ARG 393 393 ?   ?   ?   L . n 
K 2  394 GLY 394 394 ?   ?   ?   L . n 
K 2  395 GLY 395 395 ?   ?   ?   L . n 
K 2  396 GLY 396 396 ?   ?   ?   L . n 
K 2  397 GLY 397 397 ?   ?   ?   L . n 
K 2  398 GLY 398 398 ?   ?   ?   L . n 
K 2  399 GLN 399 399 ?   ?   ?   L . n 
K 2  400 ASP 400 400 ?   ?   ?   L . n 
K 2  401 ASN 401 401 ?   ?   ?   L . n 
K 2  402 GLY 402 402 ?   ?   ?   L . n 
K 2  403 LEU 403 403 ?   ?   ?   L . n 
K 2  404 GLU 404 404 ?   ?   ?   L . n 
K 2  405 GLY 405 405 ?   ?   ?   L . n 
K 2  406 LEU 406 406 ?   ?   ?   L . n 
K 2  407 GLY 407 407 ?   ?   ?   L . n 
K 2  408 ASN 408 408 ?   ?   ?   L . n 
K 2  409 ASP 409 409 ?   ?   ?   L . n 
K 2  410 SER 410 410 ?   ?   ?   L . n 
K 2  411 ARG 411 411 ?   ?   ?   L . n 
K 2  412 ASP 412 412 ?   ?   ?   L . n 
K 2  413 MET 413 413 ?   ?   ?   L . n 
K 2  414 TYR 414 414 ?   ?   ?   L . n 
K 2  415 MET 415 415 ?   ?   ?   L . n 
K 2  416 GLU 416 416 ?   ?   ?   L . n 
K 2  417 SER 417 417 ?   ?   ?   L . n 
K 2  418 GLU 418 418 ?   ?   ?   L . n 
K 2  419 GLY 419 419 ?   ?   ?   L . n 
K 2  420 GLY 420 420 ?   ?   ?   L . n 
K 2  421 ASP 421 421 ?   ?   ?   L . n 
K 2  422 GLY 422 422 ?   ?   ?   L . n 
K 2  423 TYR 423 423 ?   ?   ?   L . n 
K 2  424 LEU 424 424 ?   ?   ?   L . n 
K 2  425 ALA 425 425 ?   ?   ?   L . n 
K 2  426 PRO 426 426 ?   ?   ?   L . n 
K 2  427 GLU 427 427 ?   ?   ?   L . n 
K 2  428 ASN 428 428 ?   ?   ?   L . n 
K 2  429 GLY 429 429 ?   ?   ?   L . n 
K 2  430 TYR 430 430 ?   ?   ?   L . n 
K 2  431 LEU 431 431 ?   ?   ?   L . n 
K 2  432 MET 432 432 ?   ?   ?   L . n 
K 2  433 GLU 433 433 ?   ?   ?   L . n 
K 2  434 ALA 434 434 ?   ?   ?   L . n 
K 2  435 ALA 435 435 ?   ?   ?   L . n 
K 2  436 PRO 436 436 ?   ?   ?   L . n 
K 2  437 GLU 437 437 ?   ?   ?   L . n 
L 3  1   MET 1   1   ?   ?   ?   W . n 
L 3  2   SER 2   2   ?   ?   ?   W . n 
L 3  3   ILE 3   3   3   ILE ILE W . n 
L 3  4   GLY 4   4   4   GLY GLY W . n 
L 3  5   VAL 5   5   5   VAL VAL W . n 
L 3  6   PRO 6   6   6   PRO PRO W . n 
L 3  7   ILE 7   7   7   ILE ILE W . n 
L 3  8   LYS 8   8   8   LYS LYS W . n 
L 3  9   VAL 9   9   9   VAL VAL W . n 
L 3  10  LEU 10  10  10  LEU LEU W . n 
L 3  11  HIS 11  11  11  HIS HIS W . n 
L 3  12  GLU 12  12  12  GLU GLU W . n 
L 3  13  ALA 13  13  13  ALA ALA W . n 
L 3  14  GLU 14  14  14  GLU GLU W . n 
L 3  15  GLY 15  15  15  GLY GLY W . n 
L 3  16  HIS 16  16  16  HIS HIS W . n 
L 3  17  ILE 17  17  17  ILE ILE W . n 
L 3  18  VAL 18  18  18  VAL VAL W . n 
L 3  19  THR 19  19  19  THR THR W . n 
L 3  20  CYS 20  20  20  CYS CYS W . n 
L 3  21  GLU 21  21  21  GLU GLU W . n 
L 3  22  THR 22  22  22  THR THR W . n 
L 3  23  ASN 23  23  23  ASN ASN W . n 
L 3  24  THR 24  24  24  THR THR W . n 
L 3  25  GLY 25  25  25  GLY GLY W . n 
L 3  26  GLU 26  26  26  GLU GLU W . n 
L 3  27  VAL 27  27  27  VAL VAL W . n 
L 3  28  TYR 28  28  28  TYR TYR W . n 
L 3  29  ARG 29  29  29  ARG ARG W . n 
L 3  30  GLY 30  30  30  GLY GLY W . n 
L 3  31  LYS 31  31  31  LYS LYS W . n 
L 3  32  LEU 32  32  32  LEU LEU W . n 
L 3  33  ILE 33  33  33  ILE ILE W . n 
L 3  34  GLU 34  34  34  GLU GLU W . n 
L 3  35  ALA 35  35  35  ALA ALA W . n 
L 3  36  GLU 36  36  36  GLU GLU W . n 
L 3  37  ASP 37  37  37  ASP ASP W . n 
L 3  38  ASN 38  38  38  ASN ASN W . n 
L 3  39  MET 39  39  39  MET MET W . n 
L 3  40  ASN 40  40  40  ASN ASN W . n 
L 3  41  CYS 41  41  41  CYS CYS W . n 
L 3  42  GLN 42  42  42  GLN GLN W . n 
L 3  43  MET 43  43  43  MET MET W . n 
L 3  44  SER 44  44  44  SER SER W . n 
L 3  45  ASN 45  45  45  ASN ASN W . n 
L 3  46  ILE 46  46  46  ILE ILE W . n 
L 3  47  THR 47  47  47  THR THR W . n 
L 3  48  VAL 48  48  48  VAL VAL W . n 
L 3  49  THR 49  49  49  THR THR W . n 
L 3  50  TYR 50  50  50  TYR TYR W . n 
L 3  51  ARG 51  51  51  ARG ARG W . n 
L 3  52  ASP 52  52  52  ASP ASP W . n 
L 3  53  GLY 53  53  53  GLY GLY W . n 
L 3  54  ARG 54  54  54  ARG ARG W . n 
L 3  55  VAL 55  55  55  VAL VAL W . n 
L 3  56  ALA 56  56  56  ALA ALA W . n 
L 3  57  GLN 57  57  57  GLN GLN W . n 
L 3  58  LEU 58  58  58  LEU LEU W . n 
L 3  59  GLU 59  59  59  GLU GLU W . n 
L 3  60  GLN 60  60  60  GLN GLN W . n 
L 3  61  VAL 61  61  61  VAL VAL W . n 
L 3  62  TYR 62  62  62  TYR TYR W . n 
L 3  63  ILE 63  63  63  ILE ILE W . n 
L 3  64  ARG 64  64  64  ARG ARG W . n 
L 3  65  GLY 65  65  65  GLY GLY W . n 
L 3  66  SER 66  66  66  SER SER W . n 
L 3  67  LYS 67  67  67  LYS LYS W . n 
L 3  68  ILE 68  68  68  ILE ILE W . n 
L 3  69  ARG 69  69  69  ARG ARG W . n 
L 3  70  PHE 70  70  70  PHE PHE W . n 
L 3  71  LEU 71  71  71  LEU LEU W . n 
L 3  72  ILE 72  72  72  ILE ILE W . n 
L 3  73  LEU 73  73  73  LEU LEU W . n 
L 3  74  PRO 74  74  74  PRO PRO W . n 
L 3  75  ASP 75  75  75  ASP ASP W . n 
L 3  76  MET 76  76  76  MET MET W . n 
L 3  77  LEU 77  77  77  LEU LEU W . n 
L 3  78  LYS 78  78  78  LYS LYS W . n 
L 3  79  ASN 79  79  79  ASN ASN W . n 
L 3  80  ALA 80  80  80  ALA ALA W . n 
L 3  81  PRO 81  81  81  PRO PRO W . n 
L 3  82  MET 82  82  82  MET MET W . n 
L 3  83  LEU 83  83  83  LEU LEU W . n 
L 3  84  LYS 84  84  84  LYS LYS W . n 
L 3  85  SER 85  85  85  SER SER W . n 
L 3  86  MET 86  86  86  MET MET W . n 
L 3  87  LYS 87  87  87  LYS LYS W . n 
L 3  88  ASN 88  88  88  ASN ASN W . n 
L 3  89  LYS 89  89  89  LYS LYS W . n 
L 3  90  ASN 90  90  90  ASN ASN W . n 
L 3  91  GLN 91  91  91  GLN GLN W . n 
L 3  92  GLY 92  92  92  GLY GLY W . n 
L 3  93  SER 93  93  93  SER SER W . n 
L 3  94  GLY 94  94  94  GLY GLY W . n 
L 3  95  ALA 95  95  ?   ?   ?   W . n 
L 3  96  GLY 96  96  ?   ?   ?   W . n 
L 3  97  ARG 97  97  ?   ?   ?   W . n 
L 3  98  GLY 98  98  ?   ?   ?   W . n 
L 3  99  LYS 99  99  ?   ?   ?   W . n 
L 3  100 ALA 100 100 ?   ?   ?   W . n 
L 3  101 ALA 101 101 ?   ?   ?   W . n 
L 3  102 ILE 102 102 ?   ?   ?   W . n 
L 3  103 LEU 103 103 ?   ?   ?   W . n 
L 3  104 LYS 104 104 ?   ?   ?   W . n 
L 3  105 ALA 105 105 ?   ?   ?   W . n 
L 3  106 GLN 106 106 ?   ?   ?   W . n 
L 3  107 VAL 107 107 ?   ?   ?   W . n 
L 3  108 ALA 108 108 ?   ?   ?   W . n 
L 3  109 ALA 109 109 ?   ?   ?   W . n 
L 3  110 ARG 110 110 ?   ?   ?   W . n 
L 3  111 GLY 111 111 ?   ?   ?   W . n 
L 3  112 ARG 112 112 ?   ?   ?   W . n 
L 3  113 GLY 113 113 ?   ?   ?   W . n 
L 3  114 ARG 114 114 ?   ?   ?   W . n 
L 3  115 GLY 115 115 ?   ?   ?   W . n 
L 3  116 MET 116 116 ?   ?   ?   W . n 
L 3  117 GLY 117 117 ?   ?   ?   W . n 
L 3  118 ARG 118 118 ?   ?   ?   W . n 
L 3  119 GLY 119 119 ?   ?   ?   W . n 
L 3  120 ASN 120 120 ?   ?   ?   W . n 
L 3  121 ILE 121 121 ?   ?   ?   W . n 
L 3  122 PHE 122 122 ?   ?   ?   W . n 
L 3  123 GLN 123 123 ?   ?   ?   W . n 
L 3  124 LYS 124 124 ?   ?   ?   W . n 
L 3  125 ARG 125 125 ?   ?   ?   W . n 
L 3  126 ARG 126 126 ?   ?   ?   W . n 
M 4  1   MET 1   1   ?   ?   ?   Q . n 
M 4  2   THR 2   2   ?   ?   ?   Q . n 
M 4  3   VAL 3   3   ?   ?   ?   Q . n 
M 4  4   GLY 4   4   ?   ?   ?   Q . n 
M 4  5   LYS 5   5   5   LYS LYS Q . n 
M 4  6   SER 6   6   6   SER SER Q . n 
M 4  7   SER 7   7   7   SER SER Q . n 
M 4  8   LYS 8   8   8   LYS LYS Q . n 
M 4  9   MET 9   9   9   MET MET Q . n 
M 4  10  LEU 10  10  10  LEU LEU Q . n 
M 4  11  GLN 11  11  11  GLN GLN Q . n 
M 4  12  HIS 12  12  12  HIS HIS Q . n 
M 4  13  ILE 13  13  13  ILE ILE Q . n 
M 4  14  ASP 14  14  14  ASP ASP Q . n 
M 4  15  TYR 15  15  15  TYR TYR Q . n 
M 4  16  ARG 16  16  16  ARG ARG Q . n 
M 4  17  MET 17  17  17  MET MET Q . n 
M 4  18  ARG 18  18  18  ARG ARG Q . n 
M 4  19  CYS 19  19  19  CYS CYS Q . n 
M 4  20  ILE 20  20  20  ILE ILE Q . n 
M 4  21  LEU 21  21  21  LEU LEU Q . n 
M 4  22  GLN 22  22  22  GLN GLN Q . n 
M 4  23  ASP 23  23  23  ASP ASP Q . n 
M 4  24  GLY 24  24  24  GLY GLY Q . n 
M 4  25  ARG 25  25  25  ARG ARG Q . n 
M 4  26  ILE 26  26  26  ILE ILE Q . n 
M 4  27  PHE 27  27  27  PHE PHE Q . n 
M 4  28  ILE 28  28  28  ILE ILE Q . n 
M 4  29  GLY 29  29  29  GLY GLY Q . n 
M 4  30  THR 30  30  30  THR THR Q . n 
M 4  31  PHE 31  31  31  PHE PHE Q . n 
M 4  32  LYS 32  32  32  LYS LYS Q . n 
M 4  33  ALA 33  33  33  ALA ALA Q . n 
M 4  34  PHE 34  34  34  PHE PHE Q . n 
M 4  35  ASP 35  35  35  ASP ASP Q . n 
M 4  36  LYS 36  36  36  LYS LYS Q . n 
M 4  37  HIS 37  37  37  HIS HIS Q . n 
M 4  38  MET 38  38  38  MET MET Q . n 
M 4  39  ASN 39  39  39  ASN ASN Q . n 
M 4  40  LEU 40  40  40  LEU LEU Q . n 
M 4  41  ILE 41  41  41  ILE ILE Q . n 
M 4  42  LEU 42  42  42  LEU LEU Q . n 
M 4  43  CYS 43  43  43  CYS CYS Q . n 
M 4  44  ASP 44  44  44  ASP ASP Q . n 
M 4  45  CYS 45  45  45  CYS CYS Q . n 
M 4  46  ASP 46  46  46  ASP ASP Q . n 
M 4  47  GLU 47  47  47  GLU GLU Q . n 
M 4  48  PHE 48  48  48  PHE PHE Q . n 
M 4  49  ARG 49  49  49  ARG ARG Q . n 
M 4  50  LYS 50  50  50  LYS LYS Q . n 
M 4  51  ILE 51  51  51  ILE ILE Q . n 
M 4  52  LYS 52  52  52  LYS LYS Q . n 
M 4  53  PRO 53  53  53  PRO PRO Q . n 
M 4  54  LYS 54  54  ?   ?   ?   Q . n 
M 4  55  ASN 55  55  ?   ?   ?   Q . n 
M 4  56  SER 56  56  ?   ?   ?   Q . n 
M 4  57  LYS 57  57  ?   ?   ?   Q . n 
M 4  58  GLN 58  58  ?   ?   ?   Q . n 
M 4  59  ALA 59  59  ?   ?   ?   Q . n 
M 4  60  GLU 60  60  ?   ?   ?   Q . n 
M 4  61  ARG 61  61  ?   ?   ?   Q . n 
M 4  62  GLU 62  62  ?   ?   ?   Q . n 
M 4  63  GLU 63  63  ?   ?   ?   Q . n 
M 4  64  LYS 64  64  64  LYS LYS Q . n 
M 4  65  ARG 65  65  65  ARG ARG Q . n 
M 4  66  VAL 66  66  66  VAL VAL Q . n 
M 4  67  LEU 67  67  67  LEU LEU Q . n 
M 4  68  GLY 68  68  68  GLY GLY Q . n 
M 4  69  LEU 69  69  69  LEU LEU Q . n 
M 4  70  VAL 70  70  70  VAL VAL Q . n 
M 4  71  LEU 71  71  71  LEU LEU Q . n 
M 4  72  LEU 72  72  72  LEU LEU Q . n 
M 4  73  ARG 73  73  73  ARG ARG Q . n 
M 4  74  GLY 74  74  74  GLY GLY Q . n 
M 4  75  GLU 75  75  75  GLU GLU Q . n 
M 4  76  ASN 76  76  76  ASN ASN Q . n 
M 4  77  LEU 77  77  77  LEU LEU Q . n 
M 4  78  VAL 78  78  78  VAL VAL Q . n 
M 4  79  SER 79  79  79  SER SER Q . n 
M 4  80  MET 80  80  80  MET MET Q . n 
M 4  81  THR 81  81  81  THR THR Q . n 
M 4  82  VAL 82  82  82  VAL VAL Q . n 
M 4  83  GLU 83  83  83  GLU GLU Q . n 
M 4  84  GLY 84  84  84  GLY GLY Q . n 
M 4  85  PRO 85  85  85  PRO PRO Q . n 
M 4  86  PRO 86  86  86  PRO PRO Q . n 
M 4  87  PRO 87  87  87  PRO PRO Q . n 
M 4  88  LYS 88  88  88  LYS LYS Q . n 
M 4  89  ASP 89  89  89  ASP ASP Q . n 
M 4  90  THR 90  90  90  THR THR Q . n 
M 4  91  GLY 91  91  ?   ?   ?   Q . n 
M 4  92  ILE 92  92  ?   ?   ?   Q . n 
M 4  93  ALA 93  93  ?   ?   ?   Q . n 
M 4  94  ARG 94  94  ?   ?   ?   Q . n 
M 4  95  VAL 95  95  ?   ?   ?   Q . n 
M 4  96  PRO 96  96  ?   ?   ?   Q . n 
M 4  97  LEU 97  97  ?   ?   ?   Q . n 
M 4  98  ALA 98  98  ?   ?   ?   Q . n 
M 4  99  GLY 99  99  ?   ?   ?   Q . n 
M 4  100 ALA 100 100 ?   ?   ?   Q . n 
M 4  101 ALA 101 101 ?   ?   ?   Q . n 
M 4  102 GLY 102 102 ?   ?   ?   Q . n 
M 4  103 GLY 103 103 ?   ?   ?   Q . n 
M 4  104 PRO 104 104 ?   ?   ?   Q . n 
M 4  105 GLY 105 105 ?   ?   ?   Q . n 
M 4  106 ILE 106 106 ?   ?   ?   Q . n 
M 4  107 GLY 107 107 ?   ?   ?   Q . n 
M 4  108 ARG 108 108 ?   ?   ?   Q . n 
M 4  109 ALA 109 109 ?   ?   ?   Q . n 
M 4  110 ALA 110 110 ?   ?   ?   Q . n 
M 4  111 GLY 111 111 ?   ?   ?   Q . n 
M 4  112 ARG 112 112 ?   ?   ?   Q . n 
M 4  113 GLY 113 113 ?   ?   ?   Q . n 
M 4  114 ILE 114 114 ?   ?   ?   Q . n 
M 4  115 PRO 115 115 ?   ?   ?   Q . n 
M 4  116 ALA 116 116 ?   ?   ?   Q . n 
M 4  117 GLY 117 117 ?   ?   ?   Q . n 
M 4  118 VAL 118 118 ?   ?   ?   Q . n 
M 4  119 PRO 119 119 ?   ?   ?   Q . n 
M 4  120 MET 120 120 ?   ?   ?   Q . n 
M 4  121 PRO 121 121 ?   ?   ?   Q . n 
M 4  122 GLN 122 122 ?   ?   ?   Q . n 
M 4  123 ALA 123 123 ?   ?   ?   Q . n 
M 4  124 PRO 124 124 ?   ?   ?   Q . n 
M 4  125 ALA 125 125 ?   ?   ?   Q . n 
M 4  126 GLY 126 126 ?   ?   ?   Q . n 
M 4  127 LEU 127 127 ?   ?   ?   Q . n 
M 4  128 ALA 128 128 ?   ?   ?   Q . n 
M 4  129 GLY 129 129 ?   ?   ?   Q . n 
M 4  130 PRO 130 130 ?   ?   ?   Q . n 
M 4  131 VAL 131 131 ?   ?   ?   Q . n 
M 4  132 ARG 132 132 ?   ?   ?   Q . n 
M 4  133 GLY 133 133 ?   ?   ?   Q . n 
M 4  134 VAL 134 134 ?   ?   ?   Q . n 
M 4  135 GLY 135 135 ?   ?   ?   Q . n 
M 4  136 GLY 136 136 ?   ?   ?   Q . n 
M 4  137 PRO 137 137 ?   ?   ?   Q . n 
M 4  138 SER 138 138 ?   ?   ?   Q . n 
M 4  139 GLN 139 139 ?   ?   ?   Q . n 
M 4  140 GLN 140 140 ?   ?   ?   Q . n 
M 4  141 VAL 141 141 ?   ?   ?   Q . n 
M 4  142 MET 142 142 ?   ?   ?   Q . n 
M 4  143 THR 143 143 ?   ?   ?   Q . n 
M 4  144 PRO 144 144 ?   ?   ?   Q . n 
M 4  145 GLN 145 145 ?   ?   ?   Q . n 
M 4  146 GLY 146 146 ?   ?   ?   Q . n 
M 4  147 ARG 147 147 ?   ?   ?   Q . n 
M 4  148 GLY 148 148 ?   ?   ?   Q . n 
M 4  149 THR 149 149 ?   ?   ?   Q . n 
M 4  150 VAL 150 150 ?   ?   ?   Q . n 
M 4  151 ALA 151 151 ?   ?   ?   Q . n 
M 4  152 ALA 152 152 ?   ?   ?   Q . n 
M 4  153 ALA 153 153 ?   ?   ?   Q . n 
M 4  154 ALA 154 154 ?   ?   ?   Q . n 
M 4  155 ALA 155 155 ?   ?   ?   Q . n 
M 4  156 ALA 156 156 ?   ?   ?   Q . n 
M 4  157 ALA 157 157 ?   ?   ?   Q . n 
M 4  158 THR 158 158 ?   ?   ?   Q . n 
M 4  159 ALA 159 159 ?   ?   ?   Q . n 
M 4  160 SER 160 160 ?   ?   ?   Q . n 
M 4  161 ILE 161 161 ?   ?   ?   Q . n 
M 4  162 ALA 162 162 ?   ?   ?   Q . n 
M 4  163 GLY 163 163 ?   ?   ?   Q . n 
M 4  164 ALA 164 164 ?   ?   ?   Q . n 
M 4  165 PRO 165 165 ?   ?   ?   Q . n 
M 4  166 THR 166 166 ?   ?   ?   Q . n 
M 4  167 GLN 167 167 ?   ?   ?   Q . n 
M 4  168 TYR 168 168 ?   ?   ?   Q . n 
M 4  169 PRO 169 169 ?   ?   ?   Q . n 
M 4  170 PRO 170 170 ?   ?   ?   Q . n 
M 4  171 GLY 171 171 ?   ?   ?   Q . n 
M 4  172 ARG 172 172 ?   ?   ?   Q . n 
M 4  173 GLY 173 173 ?   ?   ?   Q . n 
M 4  174 GLY 174 174 ?   ?   ?   Q . n 
M 4  175 PRO 175 175 ?   ?   ?   Q . n 
M 4  176 PRO 176 176 ?   ?   ?   Q . n 
M 4  177 PRO 177 177 ?   ?   ?   Q . n 
M 4  178 PRO 178 178 ?   ?   ?   Q . n 
M 4  179 MET 179 179 ?   ?   ?   Q . n 
M 4  180 GLY 180 180 ?   ?   ?   Q . n 
M 4  181 ARG 181 181 ?   ?   ?   Q . n 
M 4  182 GLY 182 182 ?   ?   ?   Q . n 
M 4  183 ALA 183 183 ?   ?   ?   Q . n 
M 4  184 PRO 184 184 ?   ?   ?   Q . n 
M 4  185 PRO 185 185 ?   ?   ?   Q . n 
M 4  186 PRO 186 186 ?   ?   ?   Q . n 
M 4  187 GLY 187 187 ?   ?   ?   Q . n 
M 4  188 MET 188 188 ?   ?   ?   Q . n 
M 4  189 MET 189 189 ?   ?   ?   Q . n 
M 4  190 GLY 190 190 ?   ?   ?   Q . n 
M 4  191 PRO 191 191 ?   ?   ?   Q . n 
M 4  192 PRO 192 192 ?   ?   ?   Q . n 
M 4  193 PRO 193 193 ?   ?   ?   Q . n 
M 4  194 GLY 194 194 ?   ?   ?   Q . n 
M 4  195 MET 195 195 ?   ?   ?   Q . n 
M 4  196 ARG 196 196 ?   ?   ?   Q . n 
M 4  197 PRO 197 197 ?   ?   ?   Q . n 
M 4  198 PRO 198 198 ?   ?   ?   Q . n 
M 4  199 MET 199 199 ?   ?   ?   Q . n 
M 4  200 GLY 200 200 ?   ?   ?   Q . n 
M 4  201 PRO 201 201 ?   ?   ?   Q . n 
M 4  202 PRO 202 202 ?   ?   ?   Q . n 
M 4  203 MET 203 203 ?   ?   ?   Q . n 
M 4  204 GLY 204 204 ?   ?   ?   Q . n 
M 4  205 ILE 205 205 ?   ?   ?   Q . n 
M 4  206 PRO 206 206 ?   ?   ?   Q . n 
M 4  207 PRO 207 207 ?   ?   ?   Q . n 
M 4  208 GLY 208 208 ?   ?   ?   Q . n 
M 4  209 ARG 209 209 ?   ?   ?   Q . n 
M 4  210 GLY 210 210 ?   ?   ?   Q . n 
M 4  211 THR 211 211 ?   ?   ?   Q . n 
M 4  212 PRO 212 212 ?   ?   ?   Q . n 
M 4  213 MET 213 213 ?   ?   ?   Q . n 
M 4  214 GLY 214 214 ?   ?   ?   Q . n 
M 4  215 MET 215 215 ?   ?   ?   Q . n 
M 4  216 PRO 216 216 ?   ?   ?   Q . n 
M 4  217 PRO 217 217 ?   ?   ?   Q . n 
M 4  218 PRO 218 218 ?   ?   ?   Q . n 
M 4  219 GLY 219 219 ?   ?   ?   Q . n 
M 4  220 MET 220 220 ?   ?   ?   Q . n 
M 4  221 ARG 221 221 ?   ?   ?   Q . n 
M 4  222 PRO 222 222 ?   ?   ?   Q . n 
M 4  223 PRO 223 223 ?   ?   ?   Q . n 
M 4  224 PRO 224 224 ?   ?   ?   Q . n 
M 4  225 PRO 225 225 ?   ?   ?   Q . n 
M 4  226 GLY 226 226 ?   ?   ?   Q . n 
M 4  227 MET 227 227 ?   ?   ?   Q . n 
M 4  228 ARG 228 228 ?   ?   ?   Q . n 
M 4  229 GLY 229 229 ?   ?   ?   Q . n 
M 4  230 LEU 230 230 ?   ?   ?   Q . n 
M 4  231 LEU 231 231 ?   ?   ?   Q . n 
N 5  1   MET 1   1   1   MET MET U . n 
N 5  2   LYS 2   2   2   LYS LYS U . n 
N 5  3   LEU 3   3   3   LEU LEU U . n 
N 5  4   VAL 4   4   4   VAL VAL U . n 
N 5  5   ARG 5   5   5   ARG ARG U . n 
N 5  6   PHE 6   6   6   PHE PHE U . n 
N 5  7   LEU 7   7   7   LEU LEU U . n 
N 5  8   MET 8   8   8   MET MET U . n 
N 5  9   LYS 9   9   9   LYS LYS U . n 
N 5  10  LEU 10  10  10  LEU LEU U . n 
N 5  11  SER 11  11  11  SER SER U . n 
N 5  12  HIS 12  12  12  HIS HIS U . n 
N 5  13  GLU 13  13  13  GLU GLU U . n 
N 5  14  THR 14  14  14  THR THR U . n 
N 5  15  VAL 15  15  15  VAL VAL U . n 
N 5  16  THR 16  16  16  THR THR U . n 
N 5  17  ILE 17  17  17  ILE ILE U . n 
N 5  18  GLU 18  18  18  GLU GLU U . n 
N 5  19  LEU 19  19  19  LEU LEU U . n 
N 5  20  LYS 20  20  20  LYS LYS U . n 
N 5  21  ASN 21  21  21  ASN ASN U . n 
N 5  22  GLY 22  22  22  GLY GLY U . n 
N 5  23  THR 23  23  23  THR THR U . n 
N 5  24  GLN 24  24  24  GLN GLN U . n 
N 5  25  VAL 25  25  25  VAL VAL U . n 
N 5  26  HIS 26  26  26  HIS HIS U . n 
N 5  27  GLY 27  27  27  GLY GLY U . n 
N 5  28  THR 28  28  28  THR THR U . n 
N 5  29  ILE 29  29  29  ILE ILE U . n 
N 5  30  THR 30  30  30  THR THR U . n 
N 5  31  GLY 31  31  31  GLY GLY U . n 
N 5  32  VAL 32  32  32  VAL VAL U . n 
N 5  33  ASP 33  33  33  ASP ASP U . n 
N 5  34  VAL 34  34  34  VAL VAL U . n 
N 5  35  SER 35  35  35  SER SER U . n 
N 5  36  MET 36  36  36  MET MET U . n 
N 5  37  ASN 37  37  37  ASN ASN U . n 
N 5  38  THR 38  38  38  THR THR U . n 
N 5  39  HIS 39  39  39  HIS HIS U . n 
N 5  40  LEU 40  40  40  LEU LEU U . n 
N 5  41  LYS 41  41  41  LYS LYS U . n 
N 5  42  ALA 42  42  42  ALA ALA U . n 
N 5  43  VAL 43  43  43  VAL VAL U . n 
N 5  44  LYS 44  44  44  LYS LYS U . n 
N 5  45  MET 45  45  45  MET MET U . n 
N 5  46  THR 46  46  46  THR THR U . n 
N 5  47  LEU 47  47  47  LEU LEU U . n 
N 5  48  LYS 48  48  48  LYS LYS U . n 
N 5  49  ASN 49  49  49  ASN ASN U . n 
N 5  50  ARG 50  50  50  ARG ARG U . n 
N 5  51  GLU 51  51  51  GLU GLU U . n 
N 5  52  PRO 52  52  52  PRO PRO U . n 
N 5  53  VAL 53  53  53  VAL VAL U . n 
N 5  54  GLN 54  54  54  GLN GLN U . n 
N 5  55  LEU 55  55  55  LEU LEU U . n 
N 5  56  GLU 56  56  56  GLU GLU U . n 
N 5  57  THR 57  57  57  THR THR U . n 
N 5  58  LEU 58  58  58  LEU LEU U . n 
N 5  59  SER 59  59  59  SER SER U . n 
N 5  60  ILE 60  60  60  ILE ILE U . n 
N 5  61  ARG 61  61  61  ARG ARG U . n 
N 5  62  GLY 62  62  62  GLY GLY U . n 
N 5  63  ASN 63  63  63  ASN ASN U . n 
N 5  64  ASN 64  64  64  ASN ASN U . n 
N 5  65  ILE 65  65  65  ILE ILE U . n 
N 5  66  ARG 66  66  66  ARG ARG U . n 
N 5  67  TYR 67  67  67  TYR TYR U . n 
N 5  68  PHE 68  68  68  PHE PHE U . n 
N 5  69  ILE 69  69  69  ILE ILE U . n 
N 5  70  LEU 70  70  70  LEU LEU U . n 
N 5  71  PRO 71  71  71  PRO PRO U . n 
N 5  72  ASP 72  72  72  ASP ASP U . n 
N 5  73  SER 73  73  73  SER SER U . n 
N 5  74  LEU 74  74  74  LEU LEU U . n 
N 5  75  PRO 75  75  75  PRO PRO U . n 
N 5  76  LEU 76  76  76  LEU LEU U . n 
N 5  77  ASP 77  77  77  ASP ASP U . n 
N 5  78  THR 78  78  78  THR THR U . n 
N 5  79  LEU 79  79  79  LEU LEU U . n 
N 5  80  LEU 80  80  80  LEU LEU U . n 
N 5  81  VAL 81  81  81  VAL VAL U . n 
N 5  82  ASP 82  82  82  ASP ASP U . n 
N 5  83  VAL 83  83  83  VAL VAL U . n 
N 5  84  GLU 84  84  84  GLU GLU U . n 
N 5  85  PRO 85  85  85  PRO PRO U . n 
N 5  86  LYS 86  86  ?   ?   ?   U . n 
N 5  87  VAL 87  87  ?   ?   ?   U . n 
N 5  88  LYS 88  88  ?   ?   ?   U . n 
N 5  89  SER 89  89  ?   ?   ?   U . n 
N 5  90  LYS 90  90  ?   ?   ?   U . n 
N 5  91  LYS 91  91  ?   ?   ?   U . n 
N 5  92  ARG 92  92  ?   ?   ?   U . n 
N 5  93  GLU 93  93  ?   ?   ?   U . n 
N 5  94  ALA 94  94  ?   ?   ?   U . n 
N 5  95  VAL 95  95  ?   ?   ?   U . n 
N 5  96  ALA 96  96  ?   ?   ?   U . n 
N 5  97  GLY 97  97  ?   ?   ?   U . n 
N 5  98  ARG 98  98  ?   ?   ?   U . n 
N 5  99  GLY 99  99  ?   ?   ?   U . n 
N 5  100 ARG 100 100 ?   ?   ?   U . n 
N 5  101 GLY 101 101 ?   ?   ?   U . n 
N 5  102 ARG 102 102 ?   ?   ?   U . n 
N 5  103 GLY 103 103 ?   ?   ?   U . n 
N 5  104 ARG 104 104 ?   ?   ?   U . n 
N 5  105 GLY 105 105 ?   ?   ?   U . n 
N 5  106 ARG 106 106 ?   ?   ?   U . n 
N 5  107 GLY 107 107 ?   ?   ?   U . n 
N 5  108 ARG 108 108 ?   ?   ?   U . n 
N 5  109 GLY 109 109 ?   ?   ?   U . n 
N 5  110 ARG 110 110 ?   ?   ?   U . n 
N 5  111 GLY 111 111 ?   ?   ?   U . n 
N 5  112 ARG 112 112 ?   ?   ?   U . n 
N 5  113 GLY 113 113 ?   ?   ?   U . n 
N 5  114 ARG 114 114 ?   ?   ?   U . n 
N 5  115 GLY 115 115 ?   ?   ?   U . n 
N 5  116 GLY 116 116 ?   ?   ?   U . n 
N 5  117 PRO 117 117 ?   ?   ?   U . n 
N 5  118 ARG 118 118 ?   ?   ?   U . n 
N 5  119 ARG 119 119 ?   ?   ?   U . n 
O 6  1   MET 1   1   ?   ?   ?   V . n 
O 6  2   SER 2   2   2   SER SER V . n 
O 6  3   LEU 3   3   3   LEU LEU V . n 
O 6  4   LEU 4   4   4   LEU LEU V . n 
O 6  5   ASN 5   5   5   ASN ASN V . n 
O 6  6   LYS 6   6   6   LYS LYS V . n 
O 6  7   PRO 7   7   7   PRO PRO V . n 
O 6  8   LYS 8   8   8   LYS LYS V . n 
O 6  9   SER 9   9   9   SER SER V . n 
O 6  10  GLU 10  10  10  GLU GLU V . n 
O 6  11  MET 11  11  11  MET MET V . n 
O 6  12  THR 12  12  12  THR THR V . n 
O 6  13  PRO 13  13  13  PRO PRO V . n 
O 6  14  GLU 14  14  14  GLU GLU V . n 
O 6  15  GLU 15  15  15  GLU GLU V . n 
O 6  16  LEU 16  16  16  LEU LEU V . n 
O 6  17  GLN 17  17  17  GLN GLN V . n 
O 6  18  LYS 18  18  18  LYS LYS V . n 
O 6  19  ARG 19  19  19  ARG ARG V . n 
O 6  20  GLU 20  20  20  GLU GLU V . n 
O 6  21  GLU 21  21  21  GLU GLU V . n 
O 6  22  GLU 22  22  22  GLU GLU V . n 
O 6  23  GLU 23  23  23  GLU GLU V . n 
O 6  24  PHE 24  24  24  PHE PHE V . n 
O 6  25  ASN 25  25  25  ASN ASN V . n 
O 6  26  THR 26  26  26  THR THR V . n 
O 6  27  GLY 27  27  27  GLY GLY V . n 
O 6  28  PRO 28  28  28  PRO PRO V . n 
O 6  29  LEU 29  29  29  LEU LEU V . n 
O 6  30  SER 30  30  30  SER SER V . n 
O 6  31  VAL 31  31  31  VAL VAL V . n 
O 6  32  LEU 32  32  32  LEU LEU V . n 
O 6  33  THR 33  33  33  THR THR V . n 
O 6  34  GLN 34  34  34  GLN GLN V . n 
O 6  35  SER 35  35  35  SER SER V . n 
O 6  36  VAL 36  36  36  VAL VAL V . n 
O 6  37  LYS 37  37  37  LYS LYS V . n 
O 6  38  ASN 38  38  38  ASN ASN V . n 
O 6  39  ASN 39  39  39  ASN ASN V . n 
O 6  40  THR 40  40  40  THR THR V . n 
O 6  41  GLN 41  41  41  GLN GLN V . n 
O 6  42  VAL 42  42  42  VAL VAL V . n 
O 6  43  LEU 43  43  43  LEU LEU V . n 
O 6  44  ILE 44  44  44  ILE ILE V . n 
O 6  45  ASN 45  45  45  ASN ASN V . n 
O 6  46  CYS 46  46  46  CYS CYS V . n 
O 6  47  ARG 47  47  47  ARG ARG V . n 
O 6  48  ASN 48  48  48  ASN ASN V . n 
O 6  49  ASN 49  49  49  ASN ASN V . n 
O 6  50  LYS 50  50  50  LYS LYS V . n 
O 6  51  LYS 51  51  51  LYS LYS V . n 
O 6  52  LEU 52  52  52  LEU LEU V . n 
O 6  53  LEU 53  53  53  LEU LEU V . n 
O 6  54  GLY 54  54  54  GLY GLY V . n 
O 6  55  ARG 55  55  55  ARG ARG V . n 
O 6  56  VAL 56  56  56  VAL VAL V . n 
O 6  57  LYS 57  57  57  LYS LYS V . n 
O 6  58  ALA 58  58  58  ALA ALA V . n 
O 6  59  PHE 59  59  59  PHE PHE V . n 
O 6  60  ASP 60  60  60  ASP ASP V . n 
O 6  61  ARG 61  61  61  ARG ARG V . n 
O 6  62  HIS 62  62  62  HIS HIS V . n 
O 6  63  CYS 63  63  63  CYS CYS V . n 
O 6  64  ASN 64  64  64  ASN ASN V . n 
O 6  65  MET 65  65  65  MET MET V . n 
O 6  66  VAL 66  66  66  VAL VAL V . n 
O 6  67  LEU 67  67  67  LEU LEU V . n 
O 6  68  GLU 68  68  68  GLU GLU V . n 
O 6  69  ASN 69  69  69  ASN ASN V . n 
O 6  70  VAL 70  70  70  VAL VAL V . n 
O 6  71  LYS 71  71  71  LYS LYS V . n 
O 6  72  GLU 72  72  72  GLU GLU V . n 
O 6  73  MET 73  73  73  MET MET V . n 
O 6  74  TRP 74  74  74  TRP TRP V . n 
O 6  75  THR 75  75  75  THR THR V . n 
O 6  76  GLU 76  76  76  GLU GLU V . n 
O 6  77  VAL 77  77  ?   ?   ?   V . n 
O 6  78  PRO 78  78  ?   ?   ?   V . n 
O 6  79  LYS 79  79  ?   ?   ?   V . n 
O 6  80  SER 80  80  ?   ?   ?   V . n 
O 6  81  GLY 81  81  ?   ?   ?   V . n 
O 6  82  LYS 82  82  ?   ?   ?   V . n 
O 6  83  GLY 83  83  ?   ?   ?   V . n 
O 6  84  LYS 84  84  ?   ?   ?   V . n 
O 6  85  LYS 85  85  ?   ?   ?   V . n 
O 6  86  LYS 86  86  ?   ?   ?   V . n 
O 6  87  SER 87  87  ?   ?   ?   V . n 
O 6  88  LYS 88  88  ?   ?   ?   V . n 
O 6  89  PRO 89  89  ?   ?   ?   V . n 
O 6  90  VAL 90  90  90  VAL VAL V . n 
O 6  91  ASN 91  91  91  ASN ASN V . n 
O 6  92  LYS 92  92  92  LYS LYS V . n 
O 6  93  ASP 93  93  93  ASP ASP V . n 
O 6  94  ARG 94  94  94  ARG ARG V . n 
O 6  95  TYR 95  95  95  TYR TYR V . n 
O 6  96  ILE 96  96  96  ILE ILE V . n 
O 6  97  SER 97  97  97  SER SER V . n 
O 6  98  LYS 98  98  98  LYS LYS V . n 
O 6  99  MET 99  99  99  MET MET V . n 
O 6  100 PHE 100 100 100 PHE PHE V . n 
O 6  101 LEU 101 101 101 LEU LEU V . n 
O 6  102 ARG 102 102 102 ARG ARG V . n 
O 6  103 GLY 103 103 103 GLY GLY V . n 
O 6  104 ASP 104 104 104 ASP ASP V . n 
O 6  105 SER 105 105 105 SER SER V . n 
O 6  106 VAL 106 106 106 VAL VAL V . n 
O 6  107 ILE 107 107 107 ILE ILE V . n 
O 6  108 VAL 108 108 108 VAL VAL V . n 
O 6  109 VAL 109 109 109 VAL VAL V . n 
O 6  110 LEU 110 110 110 LEU LEU V . n 
O 6  111 ARG 111 111 111 ARG ARG V . n 
O 6  112 ASN 112 112 112 ASN ASN V . n 
O 6  113 PRO 113 113 113 PRO PRO V . n 
O 6  114 LEU 114 114 114 LEU LEU V . n 
O 6  115 ILE 115 115 115 ILE ILE V . n 
O 6  116 ALA 116 116 116 ALA ALA V . n 
O 6  117 GLY 117 117 117 GLY GLY V . n 
O 6  118 LYS 118 118 ?   ?   ?   V . n 
P 7  1   MET 1   1   ?   ?   ?   I . n 
P 7  2   SER 2   2   2   SER SER I . n 
P 7  3   LEU 3   3   3   LEU LEU I . n 
P 7  4   PRO 4   4   4   PRO PRO I . n 
P 7  5   LEU 5   5   5   LEU LEU I . n 
P 7  6   ASN 6   6   6   ASN ASN I . n 
P 7  7   PRO 7   7   7   PRO PRO I . n 
P 7  8   LYS 8   8   8   LYS LYS I . n 
P 7  9   PRO 9   9   9   PRO PRO I . n 
P 7  10  PHE 10  10  10  PHE PHE I . n 
P 7  11  LEU 11  11  11  LEU LEU I . n 
P 7  12  ASN 12  12  12  ASN ASN I . n 
P 7  13  GLY 13  13  13  GLY GLY I . n 
P 7  14  LEU 14  14  14  LEU LEU I . n 
P 7  15  THR 15  15  15  THR THR I . n 
P 7  16  GLY 16  16  16  GLY GLY I . n 
P 7  17  LYS 17  17  17  LYS LYS I . n 
P 7  18  PRO 18  18  18  PRO PRO I . n 
P 7  19  VAL 19  19  19  VAL VAL I . n 
P 7  20  MET 20  20  20  MET MET I . n 
P 7  21  VAL 21  21  21  VAL VAL I . n 
P 7  22  LYS 22  22  22  LYS LYS I . n 
P 7  23  LEU 23  23  23  LEU LEU I . n 
P 7  24  LYS 24  24  24  LYS LYS I . n 
P 7  25  TRP 25  25  25  TRP TRP I . n 
P 7  26  GLY 26  26  26  GLY GLY I . n 
P 7  27  MET 27  27  27  MET MET I . n 
P 7  28  GLU 28  28  28  GLU GLU I . n 
P 7  29  TYR 29  29  29  TYR TYR I . n 
P 7  30  LYS 30  30  30  LYS LYS I . n 
P 7  31  GLY 31  31  31  GLY GLY I . n 
P 7  32  TYR 32  32  32  TYR TYR I . n 
P 7  33  LEU 33  33  33  LEU LEU I . n 
P 7  34  VAL 34  34  34  VAL VAL I . n 
P 7  35  SER 35  35  35  SER SER I . n 
P 7  36  VAL 36  36  36  VAL VAL I . n 
P 7  37  ASP 37  37  37  ASP ASP I . n 
P 7  38  GLY 38  38  38  GLY GLY I . n 
P 7  39  TYR 39  39  39  TYR TYR I . n 
P 7  40  MET 40  40  40  MET MET I . n 
P 7  41  ASN 41  41  41  ASN ASN I . n 
P 7  42  MET 42  42  42  MET MET I . n 
P 7  43  GLN 43  43  43  GLN GLN I . n 
P 7  44  LEU 44  44  44  LEU LEU I . n 
P 7  45  ALA 45  45  45  ALA ALA I . n 
P 7  46  ASN 46  46  46  ASN ASN I . n 
P 7  47  THR 47  47  47  THR THR I . n 
P 7  48  GLU 48  48  48  GLU GLU I . n 
P 7  49  GLU 49  49  49  GLU GLU I . n 
P 7  50  TYR 50  50  50  TYR TYR I . n 
P 7  51  ILE 51  51  51  ILE ILE I . n 
P 7  52  ASP 52  52  52  ASP ASP I . n 
P 7  53  GLY 53  53  53  GLY GLY I . n 
P 7  54  ALA 54  54  54  ALA ALA I . n 
P 7  55  LEU 55  55  55  LEU LEU I . n 
P 7  56  SER 56  56  56  SER SER I . n 
P 7  57  GLY 57  57  57  GLY GLY I . n 
P 7  58  HIS 58  58  58  HIS HIS I . n 
P 7  59  LEU 59  59  59  LEU LEU I . n 
P 7  60  GLY 60  60  60  GLY GLY I . n 
P 7  61  GLU 61  61  61  GLU GLU I . n 
P 7  62  VAL 62  62  62  VAL VAL I . n 
P 7  63  LEU 63  63  63  LEU LEU I . n 
P 7  64  ILE 64  64  64  ILE ILE I . n 
P 7  65  ARG 65  65  65  ARG ARG I . n 
P 7  66  CYS 66  66  66  CYS CYS I . n 
P 7  67  ASN 67  67  67  ASN ASN I . n 
P 7  68  ASN 68  68  68  ASN ASN I . n 
P 7  69  VAL 69  69  69  VAL VAL I . n 
P 7  70  LEU 70  70  70  LEU LEU I . n 
P 7  71  TYR 71  71  71  TYR TYR I . n 
P 7  72  ILE 72  72  72  ILE ILE I . n 
P 7  73  ARG 73  73  73  ARG ARG I . n 
P 7  74  GLY 74  74  74  GLY GLY I . n 
P 7  75  VAL 75  75  75  VAL VAL I . n 
P 7  76  GLU 76  76  ?   ?   ?   I . n 
P 7  77  GLU 77  77  ?   ?   ?   I . n 
P 7  78  GLU 78  78  ?   ?   ?   I . n 
P 7  79  GLU 79  79  ?   ?   ?   I . n 
P 7  80  GLU 80  80  ?   ?   ?   I . n 
P 7  81  ASP 81  81  ?   ?   ?   I . n 
P 7  82  GLY 82  82  ?   ?   ?   I . n 
P 7  83  GLU 83  83  ?   ?   ?   I . n 
P 7  84  MET 84  84  ?   ?   ?   I . n 
P 7  85  ARG 85  85  ?   ?   ?   I . n 
P 7  86  GLU 86  86  ?   ?   ?   I . n 
Q 8  1   MET 1   1   1   MET MET H . n 
Q 8  2   ALA 2   2   2   ALA ALA H . n 
Q 8  3   TYR 3   3   3   TYR TYR H . n 
Q 8  4   ARG 4   4   4   ARG ARG H . n 
Q 8  5   GLY 5   5   5   GLY GLY H . n 
Q 8  6   GLN 6   6   6   GLN GLN H . n 
Q 8  7   GLY 7   7   7   GLY GLY H . n 
Q 8  8   GLN 8   8   8   GLN GLN H . n 
Q 8  9   LYS 9   9   9   LYS LYS H . n 
Q 8  10  VAL 10  10  10  VAL VAL H . n 
Q 8  11  GLN 11  11  11  GLN GLN H . n 
Q 8  12  LYS 12  12  12  LYS LYS H . n 
Q 8  13  VAL 13  13  13  VAL VAL H . n 
Q 8  14  MET 14  14  14  MET MET H . n 
Q 8  15  VAL 15  15  15  VAL VAL H . n 
Q 8  16  GLN 16  16  16  GLN GLN H . n 
Q 8  17  PRO 17  17  17  PRO PRO H . n 
Q 8  18  ILE 18  18  18  ILE ILE H . n 
Q 8  19  ASN 19  19  19  ASN ASN H . n 
Q 8  20  LEU 20  20  20  LEU LEU H . n 
Q 8  21  ILE 21  21  21  ILE ILE H . n 
Q 8  22  PHE 22  22  22  PHE PHE H . n 
Q 8  23  ARG 23  23  23  ARG ARG H . n 
Q 8  24  TYR 24  24  24  TYR TYR H . n 
Q 8  25  LEU 25  25  25  LEU LEU H . n 
Q 8  26  GLN 26  26  26  GLN GLN H . n 
Q 8  27  ASN 27  27  27  ASN ASN H . n 
Q 8  28  ARG 28  28  28  ARG ARG H . n 
Q 8  29  SER 29  29  29  SER SER H . n 
Q 8  30  ARG 30  30  30  ARG ARG H . n 
Q 8  31  ILE 31  31  31  ILE ILE H . n 
Q 8  32  GLN 32  32  32  GLN GLN H . n 
Q 8  33  VAL 33  33  33  VAL VAL H . n 
Q 8  34  TRP 34  34  34  TRP TRP H . n 
Q 8  35  LEU 35  35  35  LEU LEU H . n 
Q 8  36  TYR 36  36  36  TYR TYR H . n 
Q 8  37  GLU 37  37  37  GLU GLU H . n 
Q 8  38  GLN 38  38  38  GLN GLN H . n 
Q 8  39  VAL 39  39  39  VAL VAL H . n 
Q 8  40  ASN 40  40  40  ASN ASN H . n 
Q 8  41  MET 41  41  41  MET MET H . n 
Q 8  42  ARG 42  42  42  ARG ARG H . n 
Q 8  43  ILE 43  43  43  ILE ILE H . n 
Q 8  44  GLU 44  44  44  GLU GLU H . n 
Q 8  45  GLY 45  45  45  GLY GLY H . n 
Q 8  46  CYS 46  46  46  CYS CYS H . n 
Q 8  47  ILE 47  47  47  ILE ILE H . n 
Q 8  48  ILE 48  48  48  ILE ILE H . n 
Q 8  49  GLY 49  49  49  GLY GLY H . n 
Q 8  50  PHE 50  50  50  PHE PHE H . n 
Q 8  51  ASP 51  51  51  ASP ASP H . n 
Q 8  52  GLU 52  52  52  GLU GLU H . n 
Q 8  53  TYR 53  53  53  TYR TYR H . n 
Q 8  54  MET 54  54  54  MET MET H . n 
Q 8  55  ASN 55  55  55  ASN ASN H . n 
Q 8  56  LEU 56  56  56  LEU LEU H . n 
Q 8  57  VAL 57  57  57  VAL VAL H . n 
Q 8  58  LEU 58  58  58  LEU LEU H . n 
Q 8  59  ASP 59  59  59  ASP ASP H . n 
Q 8  60  ASP 60  60  60  ASP ASP H . n 
Q 8  61  ALA 61  61  61  ALA ALA H . n 
Q 8  62  GLU 62  62  62  GLU GLU H . n 
Q 8  63  GLU 63  63  63  GLU GLU H . n 
Q 8  64  ILE 64  64  64  ILE ILE H . n 
Q 8  65  HIS 65  65  65  HIS HIS H . n 
Q 8  66  SER 66  66  66  SER SER H . n 
Q 8  67  LYS 67  67  67  LYS LYS H . n 
Q 8  68  THR 68  68  68  THR THR H . n 
Q 8  69  LYS 69  69  69  LYS LYS H . n 
Q 8  70  SER 70  70  70  SER SER H . n 
Q 8  71  ARG 71  71  71  ARG ARG H . n 
Q 8  72  LYS 72  72  72  LYS LYS H . n 
Q 8  73  GLN 73  73  73  GLN GLN H . n 
Q 8  74  LEU 74  74  74  LEU LEU H . n 
Q 8  75  GLY 75  75  75  GLY GLY H . n 
Q 8  76  ARG 76  76  76  ARG ARG H . n 
Q 8  77  ILE 77  77  77  ILE ILE H . n 
Q 8  78  MET 78  78  78  MET MET H . n 
Q 8  79  LEU 79  79  79  LEU LEU H . n 
Q 8  80  LYS 80  80  80  LYS LYS H . n 
Q 8  81  GLY 81  81  81  GLY GLY H . n 
Q 8  82  ASP 82  82  82  ASP ASP H . n 
Q 8  83  ASN 83  83  83  ASN ASN H . n 
Q 8  84  ILE 84  84  84  ILE ILE H . n 
Q 8  85  THR 85  85  85  THR THR H . n 
Q 8  86  LEU 86  86  86  LEU LEU H . n 
Q 8  87  LEU 87  87  87  LEU LEU H . n 
Q 8  88  GLN 88  88  88  GLN GLN H . n 
Q 8  89  SER 89  89  89  SER SER H . n 
Q 8  90  VAL 90  90  ?   ?   ?   H . n 
Q 8  91  SER 91  91  ?   ?   ?   H . n 
Q 8  92  ASN 92  92  ?   ?   ?   H . n 
R 9  1   MET 1   1   1   MET MET J . n 
R 9  2   SER 2   2   2   SER SER J . n 
R 9  3   LYS 3   3   3   LYS LYS J . n 
R 9  4   ALA 4   4   4   ALA ALA J . n 
R 9  5   HIS 5   5   5   HIS HIS J . n 
R 9  6   PRO 6   6   6   PRO PRO J . n 
R 9  7   PRO 7   7   7   PRO PRO J . n 
R 9  8   GLU 8   8   8   GLU GLU J . n 
R 9  9   LEU 9   9   9   LEU LEU J . n 
R 9  10  LYS 10  10  10  LYS LYS J . n 
R 9  11  LYS 11  11  11  LYS LYS J . n 
R 9  12  PHE 12  12  12  PHE PHE J . n 
R 9  13  MET 13  13  13  MET MET J . n 
R 9  14  ASP 14  14  14  ASP ASP J . n 
R 9  15  LYS 15  15  15  LYS LYS J . n 
R 9  16  LYS 16  16  16  LYS LYS J . n 
R 9  17  LEU 17  17  17  LEU LEU J . n 
R 9  18  SER 18  18  18  SER SER J . n 
R 9  19  LEU 19  19  19  LEU LEU J . n 
R 9  20  LYS 20  20  20  LYS LYS J . n 
R 9  21  LEU 21  21  21  LEU LEU J . n 
R 9  22  ASN 22  22  22  ASN ASN J . n 
R 9  23  GLY 23  23  23  GLY GLY J . n 
R 9  24  GLY 24  24  24  GLY GLY J . n 
R 9  25  ARG 25  25  25  ARG ARG J . n 
R 9  26  HIS 26  26  26  HIS HIS J . n 
R 9  27  VAL 27  27  27  VAL VAL J . n 
R 9  28  GLN 28  28  28  GLN GLN J . n 
R 9  29  GLY 29  29  29  GLY GLY J . n 
R 9  30  ILE 30  30  30  ILE ILE J . n 
R 9  31  LEU 31  31  31  LEU LEU J . n 
R 9  32  ARG 32  32  32  ARG ARG J . n 
R 9  33  GLY 33  33  33  GLY GLY J . n 
R 9  34  PHE 34  34  34  PHE PHE J . n 
R 9  35  ASP 35  35  35  ASP ASP J . n 
R 9  36  PRO 36  36  36  PRO PRO J . n 
R 9  37  PHE 37  37  37  PHE PHE J . n 
R 9  38  MET 38  38  38  MET MET J . n 
R 9  39  ASN 39  39  39  ASN ASN J . n 
R 9  40  LEU 40  40  40  LEU LEU J . n 
R 9  41  VAL 41  41  41  VAL VAL J . n 
R 9  42  ILE 42  42  42  ILE ILE J . n 
R 9  43  ASP 43  43  43  ASP ASP J . n 
R 9  44  GLU 44  44  44  GLU GLU J . n 
R 9  45  CYS 45  45  45  CYS CYS J . n 
R 9  46  VAL 46  46  46  VAL VAL J . n 
R 9  47  GLU 47  47  47  GLU GLU J . n 
R 9  48  MET 48  48  48  MET MET J . n 
R 9  49  ALA 49  49  49  ALA ALA J . n 
R 9  50  THR 50  50  50  THR THR J . n 
R 9  51  SER 51  51  51  SER SER J . n 
R 9  52  GLY 52  52  52  GLY GLY J . n 
R 9  53  GLN 53  53  53  GLN GLN J . n 
R 9  54  GLN 54  54  54  GLN GLN J . n 
R 9  55  ASN 55  55  55  ASN ASN J . n 
R 9  56  ASN 56  56  56  ASN ASN J . n 
R 9  57  ILE 57  57  57  ILE ILE J . n 
R 9  58  GLY 58  58  58  GLY GLY J . n 
R 9  59  MET 59  59  59  MET MET J . n 
R 9  60  VAL 60  60  60  VAL VAL J . n 
R 9  61  VAL 61  61  61  VAL VAL J . n 
R 9  62  ILE 62  62  62  ILE ILE J . n 
R 9  63  ARG 63  63  63  ARG ARG J . n 
R 9  64  GLY 64  64  64  GLY GLY J . n 
R 9  65  ASN 65  65  65  ASN ASN J . n 
R 9  66  SER 66  66  66  SER SER J . n 
R 9  67  ILE 67  67  67  ILE ILE J . n 
R 9  68  ILE 68  68  68  ILE ILE J . n 
R 9  69  MET 69  69  69  MET MET J . n 
R 9  70  LEU 70  70  70  LEU LEU J . n 
R 9  71  GLU 71  71  71  GLU GLU J . n 
R 9  72  ALA 72  72  72  ALA ALA J . n 
R 9  73  LEU 73  73  73  LEU LEU J . n 
R 9  74  GLU 74  74  74  GLU GLU J . n 
R 9  75  ARG 75  75  75  ARG ARG J . n 
R 9  76  VAL 76  76  76  VAL VAL J . n 
S 10 1   A   1   1   ?   ?   ?   R . n 
S 10 2   U   2   2   2   U   URI R . n 
S 10 3   A   3   3   3   A   ADE R . n 
S 10 4   C   4   4   4   C   CYT R . n 
S 10 5   U   5   5   5   U   URI R . n 
S 10 6   U   6   6   6   U   URI R . n 
S 10 7   A   7   7   7   A   ADE R . n 
S 10 8   C   8   8   8   C   CYT R . n 
S 10 9   C   9   9   9   C   CYT R . n 
S 10 10  U   10  10  10  U   URI R . n 
S 10 11  G   11  11  11  G   GUA R . n 
S 10 12  G   12  12  12  G   GUA R . n 
S 10 13  C   13  13  13  C   CYT R . n 
S 10 14  A   14  14  14  A   ADE R . n 
S 10 15  G   15  15  15  G   GUA R . n 
S 10 16  G   16  16  16  G   GUA R . n 
S 10 17  G   17  17  17  G   GUA R . n 
S 10 18  G   18  18  18  G   GUA R . n 
S 10 19  A   19  19  19  A   ADE R . n 
S 10 20  G   20  20  20  G   GUA R . n 
S 10 21  A   21  21  21  A   ADE R . n 
S 10 22  U   22  22  22  U   URI R . n 
S 10 23  A   23  23  23  A   ADE R . n 
S 10 24  C   24  24  24  C   CYT R . n 
S 10 25  C   25  25  25  C   CYT R . n 
S 10 26  A   26  26  26  A   ADE R . n 
S 10 27  U   27  27  27  U   URI R . n 
S 10 28  G   28  28  28  G   GUA R . n 
S 10 29  A   29  29  29  A   ADE R . n 
S 10 30  U   30  30  30  U   URI R . n 
S 10 31  C   31  31  31  C   CYT R . n 
S 10 32  A   32  32  32  A   ADE R . n 
S 10 33  C   33  33  33  C   CYT R . n 
S 10 34  G   34  34  34  G   GUA R . n 
S 10 35  A   35  35  35  A   ADE R . n 
S 10 36  A   36  36  36  A   ADE R . n 
S 10 37  G   37  37  37  G   GUA R . n 
S 10 38  G   38  38  38  G   GUA R . n 
S 10 39  U   39  39  39  U   URI R . n 
S 10 40  G   40  40  40  G   GUA R . n 
S 10 41  G   41  41  41  G   GUA R . n 
S 10 42  U   42  42  42  U   URI R . n 
S 10 43  U   43  43  43  U   URI R . n 
S 10 44  U   44  44  44  U   URI R . n 
S 10 45  U   45  45  45  U   URI R . n 
S 10 46  C   46  46  46  C   CYT R . n 
S 10 47  C   47  47  47  C   CYT R . n 
S 10 48  C   48  48  48  C   CYT R . n 
S 10 49  A   49  49  49  A   ADE R . n 
S 10 50  G   50  50  50  G   GUA R . n 
S 10 51  G   51  51  51  G   GUA R . n 
S 10 52  G   52  52  52  G   GUA R . n 
S 10 53  C   53  53  53  C   CYT R . n 
S 10 54  G   54  54  54  G   GUA R . n 
S 10 55  A   55  55  55  A   ADE R . n 
S 10 56  G   56  56  56  G   GUA R . n 
S 10 57  G   57  57  57  G   GUA R . n 
S 10 58  C   58  58  58  C   CYT R . n 
S 10 59  U   59  59  59  U   URI R . n 
S 10 60  U   60  60  60  U   URI R . n 
S 10 61  A   61  61  61  A   ADE R . n 
S 10 62  U   62  62  62  U   URI R . n 
S 10 63  C   63  63  63  C   CYT R . n 
S 10 64  C   64  64  64  C   CYT R . n 
S 10 65  A   65  65  65  A   ADE R . n 
S 10 66  U   66  66  66  U   URI R . n 
S 10 67  U   67  67  67  U   URI R . n 
S 10 68  G   68  68  68  G   GUA R . n 
S 10 69  C   69  69  69  C   CYT R . n 
S 10 70  A   70  70  70  A   ADE R . n 
S 10 71  C   71  71  71  C   CYT R . n 
S 10 72  U   72  72  72  U   URI R . n 
S 10 73  C   73  73  73  C   CYT R . n 
S 10 74  C   74  74  74  C   CYT R . n 
S 10 75  G   75  75  75  G   GUA R . n 
S 10 76  G   76  76  76  G   GUA R . n 
S 10 77  A   77  77  77  A   ADE R . n 
S 10 78  U   78  78  78  U   URI R . n 
S 10 79  G   79  79  79  G   GUA R . n 
S 10 80  U   80  80  80  U   URI R . n 
S 10 81  G   81  81  81  G   GUA R . n 
S 10 82  C   82  82  82  C   CYT R . n 
S 10 83  U   83  83  83  U   URI R . n 
S 10 84  G   84  84  84  G   GUA R . n 
S 10 85  A   85  85  85  A   ADE R . n 
S 10 86  C   86  86  86  C   CYT R . n 
S 10 87  C   87  87  87  C   CYT R . n 
S 10 88  C   88  88  88  C   CYT R . n 
S 10 89  C   89  89  89  C   CYT R . n 
S 10 90  U   90  90  90  U   URI R . n 
S 10 91  G   91  91  91  G   GUA R . n 
S 10 92  C   92  92  92  C   CYT R . n 
S 10 93  G   93  93  93  G   GUA R . n 
S 10 94  A   94  94  94  A   ADE R . n 
S 10 95  U   95  95  95  U   URI R . n 
S 10 96  U   96  96  96  U   URI R . n 
S 10 97  U   97  97  97  U   URI R . n 
S 10 98  C   98  98  98  C   CYT R . n 
S 10 99  C   99  99  99  C   CYT R . n 
S 10 100 C   100 100 100 C   CYT R . n 
S 10 101 C   101 101 101 C   CYT R . n 
S 10 102 A   102 102 102 A   ADE R . n 
S 10 103 A   103 103 103 A   ADE R . n 
S 10 104 A   104 104 104 A   ADE R . n 
S 10 105 U   105 105 105 U   URI R . n 
S 10 106 G   106 106 106 G   GUA R . n 
S 10 107 U   107 107 107 U   URI R . n 
S 10 108 G   108 108 108 G   GUA R . n 
S 10 109 G   109 109 109 G   GUA R . n 
S 10 110 G   110 110 110 G   GUA R . n 
S 10 111 A   111 111 111 A   ADE R . n 
S 10 112 A   112 112 112 A   ADE R . n 
S 10 113 A   113 113 113 A   ADE R . n 
S 10 114 C   114 114 114 C   CYT R . n 
S 10 115 U   115 115 115 U   URI R . n 
S 10 116 C   116 116 116 C   CYT R . n 
S 10 117 G   117 117 117 G   GUA R . n 
S 10 118 A   118 118 118 A   ADE R . n 
S 10 119 C   119 119 119 C   CYT R . n 
S 10 120 U   120 120 120 U   URI R . n 
S 10 121 G   121 121 121 G   GUA R . n 
S 10 122 C   122 122 122 C   CYT R . n 
S 10 123 A   123 123 123 A   ADE R . n 
S 10 124 U   124 124 124 U   URI R . n 
S 10 125 A   125 125 125 A   ADE R . n 
S 10 126 A   126 126 126 A   ADE R . n 
S 10 127 U   127 127 127 U   URI R . n 
S 10 128 U   128 128 128 U   URI R . n 
S 10 129 U   129 129 129 U   URI R . n 
S 10 130 G   130 130 130 G   GUA R . n 
S 10 131 U   131 131 131 U   URI R . n 
S 10 132 G   132 132 132 G   GUA R . n 
S 10 133 G   133 133 133 G   GUA R . n 
S 10 134 U   134 134 134 U   URI R . n 
S 10 135 A   135 135 135 A   ADE R . n 
S 10 136 G   136 136 136 G   GUA R . n 
S 10 137 U   137 137 137 U   URI R . n 
S 10 138 G   138 138 138 G   GUA R . n 
S 10 139 G   139 139 139 G   GUA R . n 
S 10 140 G   140 140 140 G   GUA R . n 
S 10 141 G   141 141 141 G   GUA R . n 
S 10 142 G   142 142 142 G   GUA R . n 
S 10 143 A   143 143 143 A   ADE R . n 
S 10 144 C   144 144 144 C   CYT R . n 
S 10 145 U   145 145 145 U   URI R . n 
S 10 146 G   146 146 146 G   GUA R . n 
S 10 147 C   147 147 147 C   CYT R . n 
S 10 148 G   148 148 148 G   GUA R . n 
S 10 149 U   149 149 149 U   URI R . n 
S 10 150 U   150 150 150 U   URI R . n 
S 10 151 C   151 151 151 C   CYT R . n 
S 10 152 G   152 152 152 G   GUA R . n 
S 10 153 C   153 153 153 C   CYT R . n 
S 10 154 G   154 154 154 G   GUA R . n 
S 10 155 C   155 155 155 C   CYT R . n 
S 10 156 U   156 156 156 U   URI R . n 
S 10 157 U   157 157 157 U   URI R . n 
S 10 158 U   158 158 158 U   URI R . n 
S 10 159 C   159 159 159 C   CYT R . n 
S 10 160 C   160 160 160 C   CYT R . n 
S 10 161 C   161 161 161 C   CYT R . n 
S 10 162 C   162 162 162 C   CYT R . n 
S 10 163 U   163 163 163 U   URI R . n 
S 10 164 G   164 164 164 G   GUA R . n 
T 10 1   A   1   1   ?   ?   ?   N . n 
T 10 2   U   2   2   2   U   URI N . n 
T 10 3   A   3   3   3   A   ADE N . n 
T 10 4   C   4   4   4   C   CYT N . n 
T 10 5   U   5   5   5   U   URI N . n 
T 10 6   U   6   6   6   U   URI N . n 
T 10 7   A   7   7   7   A   ADE N . n 
T 10 8   C   8   8   8   C   CYT N . n 
T 10 9   C   9   9   9   C   CYT N . n 
T 10 10  U   10  10  10  U   URI N . n 
T 10 11  G   11  11  11  G   GUA N . n 
T 10 12  G   12  12  12  G   GUA N . n 
T 10 13  C   13  13  13  C   CYT N . n 
T 10 14  A   14  14  14  A   ADE N . n 
T 10 15  G   15  15  15  G   GUA N . n 
T 10 16  G   16  16  16  G   GUA N . n 
T 10 17  G   17  17  17  G   GUA N . n 
T 10 18  G   18  18  18  G   GUA N . n 
T 10 19  A   19  19  19  A   ADE N . n 
T 10 20  G   20  20  20  G   GUA N . n 
T 10 21  A   21  21  21  A   ADE N . n 
T 10 22  U   22  22  22  U   URI N . n 
T 10 23  A   23  23  23  A   ADE N . n 
T 10 24  C   24  24  24  C   CYT N . n 
T 10 25  C   25  25  25  C   CYT N . n 
T 10 26  A   26  26  26  A   ADE N . n 
T 10 27  U   27  27  27  U   URI N . n 
T 10 28  G   28  28  28  G   GUA N . n 
T 10 29  A   29  29  29  A   ADE N . n 
T 10 30  U   30  30  30  U   URI N . n 
T 10 31  C   31  31  31  C   CYT N . n 
T 10 32  A   32  32  32  A   ADE N . n 
T 10 33  C   33  33  33  C   CYT N . n 
T 10 34  G   34  34  34  G   GUA N . n 
T 10 35  A   35  35  35  A   ADE N . n 
T 10 36  A   36  36  36  A   ADE N . n 
T 10 37  G   37  37  37  G   GUA N . n 
T 10 38  G   38  38  38  G   GUA N . n 
T 10 39  U   39  39  39  U   URI N . n 
T 10 40  G   40  40  40  G   GUA N . n 
T 10 41  G   41  41  41  G   GUA N . n 
T 10 42  U   42  42  42  U   URI N . n 
T 10 43  U   43  43  43  U   URI N . n 
T 10 44  U   44  44  44  U   URI N . n 
T 10 45  U   45  45  45  U   URI N . n 
T 10 46  C   46  46  46  C   CYT N . n 
T 10 47  C   47  47  47  C   CYT N . n 
T 10 48  C   48  48  48  C   CYT N . n 
T 10 49  A   49  49  49  A   ADE N . n 
T 10 50  G   50  50  50  G   GUA N . n 
T 10 51  G   51  51  51  G   GUA N . n 
T 10 52  G   52  52  52  G   GUA N . n 
T 10 53  C   53  53  53  C   CYT N . n 
T 10 54  G   54  54  54  G   GUA N . n 
T 10 55  A   55  55  55  A   ADE N . n 
T 10 56  G   56  56  56  G   GUA N . n 
T 10 57  G   57  57  57  G   GUA N . n 
T 10 58  C   58  58  58  C   CYT N . n 
T 10 59  U   59  59  59  U   URI N . n 
T 10 60  U   60  60  60  U   URI N . n 
T 10 61  A   61  61  61  A   ADE N . n 
T 10 62  U   62  62  62  U   URI N . n 
T 10 63  C   63  63  63  C   CYT N . n 
T 10 64  C   64  64  64  C   CYT N . n 
T 10 65  A   65  65  65  A   ADE N . n 
T 10 66  U   66  66  66  U   URI N . n 
T 10 67  U   67  67  67  U   URI N . n 
T 10 68  G   68  68  68  G   GUA N . n 
T 10 69  C   69  69  69  C   CYT N . n 
T 10 70  A   70  70  70  A   ADE N . n 
T 10 71  C   71  71  71  C   CYT N . n 
T 10 72  U   72  72  72  U   URI N . n 
T 10 73  C   73  73  73  C   CYT N . n 
T 10 74  C   74  74  74  C   CYT N . n 
T 10 75  G   75  75  75  G   GUA N . n 
T 10 76  G   76  76  76  G   GUA N . n 
T 10 77  A   77  77  77  A   ADE N . n 
T 10 78  U   78  78  78  U   URI N . n 
T 10 79  G   79  79  79  G   GUA N . n 
T 10 80  U   80  80  80  U   URI N . n 
T 10 81  G   81  81  81  G   GUA N . n 
T 10 82  C   82  82  82  C   CYT N . n 
T 10 83  U   83  83  83  U   URI N . n 
T 10 84  G   84  84  84  G   GUA N . n 
T 10 85  A   85  85  85  A   ADE N . n 
T 10 86  C   86  86  86  C   CYT N . n 
T 10 87  C   87  87  87  C   CYT N . n 
T 10 88  C   88  88  88  C   CYT N . n 
T 10 89  C   89  89  89  C   CYT N . n 
T 10 90  U   90  90  90  U   URI N . n 
T 10 91  G   91  91  91  G   GUA N . n 
T 10 92  C   92  92  92  C   CYT N . n 
T 10 93  G   93  93  93  G   GUA N . n 
T 10 94  A   94  94  94  A   ADE N . n 
T 10 95  U   95  95  95  U   URI N . n 
T 10 96  U   96  96  96  U   URI N . n 
T 10 97  U   97  97  97  U   URI N . n 
T 10 98  C   98  98  98  C   CYT N . n 
T 10 99  C   99  99  99  C   CYT N . n 
T 10 100 C   100 100 100 C   CYT N . n 
T 10 101 C   101 101 101 C   CYT N . n 
T 10 102 A   102 102 102 A   ADE N . n 
T 10 103 A   103 103 103 A   ADE N . n 
T 10 104 A   104 104 104 A   ADE N . n 
T 10 105 U   105 105 105 U   URI N . n 
T 10 106 G   106 106 106 G   GUA N . n 
T 10 107 U   107 107 107 U   URI N . n 
T 10 108 G   108 108 108 G   GUA N . n 
T 10 109 G   109 109 109 G   GUA N . n 
T 10 110 G   110 110 110 G   GUA N . n 
T 10 111 A   111 111 111 A   ADE N . n 
T 10 112 A   112 112 112 A   ADE N . n 
T 10 113 A   113 113 113 A   ADE N . n 
T 10 114 C   114 114 114 C   CYT N . n 
T 10 115 U   115 115 115 U   URI N . n 
T 10 116 C   116 116 116 C   CYT N . n 
T 10 117 G   117 117 117 G   GUA N . n 
T 10 118 A   118 118 118 A   ADE N . n 
T 10 119 C   119 119 119 C   CYT N . n 
T 10 120 U   120 120 120 U   URI N . n 
T 10 121 G   121 121 121 G   GUA N . n 
T 10 122 C   122 122 122 C   CYT N . n 
T 10 123 A   123 123 123 A   ADE N . n 
T 10 124 U   124 124 124 U   URI N . n 
T 10 125 A   125 125 125 A   ADE N . n 
T 10 126 A   126 126 126 A   ADE N . n 
T 10 127 U   127 127 127 U   URI N . n 
T 10 128 U   128 128 128 U   URI N . n 
T 10 129 U   129 129 129 U   URI N . n 
T 10 130 G   130 130 130 G   GUA N . n 
T 10 131 U   131 131 131 U   URI N . n 
T 10 132 G   132 132 132 G   GUA N . n 
T 10 133 G   133 133 133 G   GUA N . n 
T 10 134 U   134 134 134 U   URI N . n 
T 10 135 A   135 135 135 A   ADE N . n 
T 10 136 G   136 136 136 G   GUA N . n 
T 10 137 U   137 137 137 U   URI N . n 
T 10 138 G   138 138 138 G   GUA N . n 
T 10 139 G   139 139 139 G   GUA N . n 
T 10 140 G   140 140 140 G   GUA N . n 
T 10 141 G   141 141 141 G   GUA N . n 
T 10 142 G   142 142 142 G   GUA N . n 
T 10 143 A   143 143 143 A   ADE N . n 
T 10 144 C   144 144 144 C   CYT N . n 
T 10 145 U   145 145 145 U   URI N . n 
T 10 146 G   146 146 146 G   GUA N . n 
T 10 147 C   147 147 147 C   CYT N . n 
T 10 148 G   148 148 148 G   GUA N . n 
T 10 149 U   149 149 149 U   URI N . n 
T 10 150 U   150 150 150 U   URI N . n 
T 10 151 C   151 151 151 C   CYT N . n 
T 10 152 G   152 152 152 G   GUA N . n 
T 10 153 C   153 153 153 C   CYT N . n 
T 10 154 G   154 154 154 G   GUA N . n 
T 10 155 C   155 155 155 C   CYT N . n 
T 10 156 U   156 156 156 U   URI N . n 
T 10 157 U   157 157 157 U   URI N . n 
T 10 158 U   158 158 158 U   URI N . n 
T 10 159 C   159 159 159 C   CYT N . n 
T 10 160 C   160 160 160 C   CYT N . n 
T 10 161 C   161 161 161 C   CYT N . n 
T 10 162 C   162 162 162 C   CYT N . n 
T 10 163 U   163 163 163 U   URI N . n 
T 10 164 G   164 164 164 G   GUA N . n 
U 11 1   DA  1   1   ?   ?   ?   D . n 
U 11 2   DG  2   2   2   DG  GUA D . n 
U 11 3   DG  3   3   3   DG  GUA D . n 
U 11 4   DT  4   4   4   DT  THY D . n 
U 11 5   DA  5   5   5   DA  ADE D . n 
U 11 6   DA  6   6   6   DA  ADE D . n 
U 11 7   DG  7   7   7   DG  GUA D . n 
U 11 8   DT  8   8   8   DT  THY D . n 
U 11 9   DA  9   9   9   DA  ADE D . n 
V 11 1   DA  1   1   ?   ?   ?   M . n 
V 11 2   DG  2   2   2   DG  GUA M . n 
V 11 3   DG  3   3   3   DG  GUA M . n 
V 11 4   DT  4   4   4   DT  THY M . n 
V 11 5   DA  5   5   5   DA  ADE M . n 
V 11 6   DA  6   6   6   DA  ADE M . n 
V 11 7   DG  7   7   7   DG  GUA M . n 
V 11 8   DT  8   8   8   DT  THY M . n 
V 11 9   DA  9   9   9   DA  ADE M . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? undecameric 11 
2 author_defined_assembly ? undecameric 11 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,S,U 
2 1 J,K,L,M,N,O,P,Q,R,T,V 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-12-29 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
gclient 'data collection' .   ? 1 
MAR345  'data collection' .   ? 2 
RemDAq  'data collection' .   ? 3 
PHASER  phasing           .   ? 4 
SHARP   phasing           .   ? 5 
PHENIX  refinement        .   ? 6 
CNS     refinement        1.3 ? 7 
XDS     'data reduction'  .   ? 8 
XDS     'data scaling'    .   ? 9 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1    1 Y 1 A MET 1   ? A MET 1   
2    1 Y 1 A ALA 2   ? A ALA 2   
3    1 Y 1 A VAL 3   ? A VAL 3   
4    1 Y 1 A PRO 4   ? A PRO 4   
5    1 Y 1 A PRO 113 ? A PRO 113 
6    1 Y 1 A LYS 114 ? A LYS 114 
7    1 Y 1 A SER 115 ? A SER 115 
8    1 Y 1 A GLN 116 ? A GLN 116 
9    1 Y 1 A GLU 117 ? A GLU 117 
10   1 Y 1 A THR 118 ? A THR 118 
11   1 Y 1 A PRO 119 ? A PRO 119 
12   1 Y 1 A ALA 120 ? A ALA 120 
13   1 Y 1 A THR 121 ? A THR 121 
14   1 Y 1 A LYS 122 ? A LYS 122 
15   1 Y 1 A LYS 123 ? A LYS 123 
16   1 Y 1 A ALA 124 ? A ALA 124 
17   1 Y 1 A VAL 125 ? A VAL 125 
18   1 Y 1 A GLN 126 ? A GLN 126 
19   1 Y 1 A GLY 127 ? A GLY 127 
20   1 Y 1 A GLY 128 ? A GLY 128 
21   1 Y 1 A GLY 129 ? A GLY 129 
22   1 Y 1 A ALA 130 ? A ALA 130 
23   1 Y 1 A THR 131 ? A THR 131 
24   1 Y 1 A PRO 132 ? A PRO 132 
25   1 Y 1 A VAL 133 ? A VAL 133 
26   1 Y 1 A VAL 134 ? A VAL 134 
27   1 Y 1 A GLY 135 ? A GLY 135 
28   1 Y 1 A ALA 136 ? A ALA 136 
29   1 Y 1 A VAL 137 ? A VAL 137 
30   1 Y 1 A GLN 138 ? A GLN 138 
31   1 Y 1 A GLY 139 ? A GLY 139 
32   1 Y 1 A PRO 140 ? A PRO 140 
33   1 Y 1 A VAL 141 ? A VAL 141 
34   1 Y 1 A PRO 142 ? A PRO 142 
35   1 Y 1 A GLY 143 ? A GLY 143 
36   1 Y 1 A MET 144 ? A MET 144 
37   1 Y 1 A PRO 145 ? A PRO 145 
38   1 Y 1 A PRO 146 ? A PRO 146 
39   1 Y 1 A MET 147 ? A MET 147 
40   1 Y 1 A THR 148 ? A THR 148 
41   1 Y 1 A GLN 149 ? A GLN 149 
42   1 Y 1 A ALA 150 ? A ALA 150 
43   1 Y 1 A PRO 151 ? A PRO 151 
44   1 Y 1 A ARG 152 ? A ARG 152 
45   1 Y 1 A ILE 153 ? A ILE 153 
46   1 Y 1 A MET 154 ? A MET 154 
47   1 Y 1 A HIS 155 ? A HIS 155 
48   1 Y 1 A HIS 156 ? A HIS 156 
49   1 Y 1 A MET 157 ? A MET 157 
50   1 Y 1 A PRO 158 ? A PRO 158 
51   1 Y 1 A GLY 159 ? A GLY 159 
52   1 Y 1 A GLN 160 ? A GLN 160 
53   1 Y 1 A PRO 161 ? A PRO 161 
54   1 Y 1 A PRO 162 ? A PRO 162 
55   1 Y 1 A TYR 163 ? A TYR 163 
56   1 Y 1 A MET 164 ? A MET 164 
57   1 Y 1 A PRO 165 ? A PRO 165 
58   1 Y 1 A PRO 166 ? A PRO 166 
59   1 Y 1 A PRO 167 ? A PRO 167 
60   1 Y 1 A GLY 168 ? A GLY 168 
61   1 Y 1 A MET 169 ? A MET 169 
62   1 Y 1 A ILE 170 ? A ILE 170 
63   1 Y 1 A PRO 171 ? A PRO 171 
64   1 Y 1 A PRO 172 ? A PRO 172 
65   1 Y 1 A PRO 173 ? A PRO 173 
66   1 Y 1 A GLY 174 ? A GLY 174 
67   1 Y 1 A LEU 175 ? A LEU 175 
68   1 Y 1 A ALA 176 ? A ALA 176 
69   1 Y 1 A PRO 177 ? A PRO 177 
70   1 Y 1 A GLY 178 ? A GLY 178 
71   1 Y 1 A GLN 179 ? A GLN 179 
72   1 Y 1 A ILE 180 ? A ILE 180 
73   1 Y 1 A PRO 181 ? A PRO 181 
74   1 Y 1 A PRO 182 ? A PRO 182 
75   1 Y 1 A GLY 183 ? A GLY 183 
76   1 Y 1 A ALA 184 ? A ALA 184 
77   1 Y 1 A MET 185 ? A MET 185 
78   1 Y 1 A PRO 186 ? A PRO 186 
79   1 Y 1 A PRO 187 ? A PRO 187 
80   1 Y 1 A GLN 188 ? A GLN 188 
81   1 Y 1 A GLN 189 ? A GLN 189 
82   1 Y 1 A LEU 190 ? A LEU 190 
83   1 Y 1 A MET 191 ? A MET 191 
84   1 Y 1 A PRO 192 ? A PRO 192 
85   1 Y 1 A GLY 193 ? A GLY 193 
86   1 Y 1 A GLN 194 ? A GLN 194 
87   1 Y 1 A MET 195 ? A MET 195 
88   1 Y 1 A PRO 196 ? A PRO 196 
89   1 Y 1 A PRO 197 ? A PRO 197 
90   1 Y 1 A ALA 198 ? A ALA 198 
91   1 Y 1 A GLN 199 ? A GLN 199 
92   1 Y 1 A PRO 200 ? A PRO 200 
93   1 Y 1 A LEU 201 ? A LEU 201 
94   1 Y 1 A SER 202 ? A SER 202 
95   1 Y 1 A GLU 203 ? A GLU 203 
96   1 Y 1 A ASN 204 ? A ASN 204 
97   1 Y 1 A PRO 205 ? A PRO 205 
98   1 Y 1 A PRO 206 ? A PRO 206 
99   1 Y 1 A ASN 207 ? A ASN 207 
100  1 Y 1 A HIS 208 ? A HIS 208 
101  1 Y 1 A ILE 209 ? A ILE 209 
102  1 Y 1 A LEU 210 ? A LEU 210 
103  1 Y 1 A PHE 211 ? A PHE 211 
104  1 Y 1 A LEU 212 ? A LEU 212 
105  1 Y 1 A THR 213 ? A THR 213 
106  1 Y 1 A ASN 214 ? A ASN 214 
107  1 Y 1 A LEU 215 ? A LEU 215 
108  1 Y 1 A PRO 216 ? A PRO 216 
109  1 Y 1 A GLU 217 ? A GLU 217 
110  1 Y 1 A GLU 218 ? A GLU 218 
111  1 Y 1 A THR 219 ? A THR 219 
112  1 Y 1 A ASN 220 ? A ASN 220 
113  1 Y 1 A GLU 221 ? A GLU 221 
114  1 Y 1 A LEU 222 ? A LEU 222 
115  1 Y 1 A MET 223 ? A MET 223 
116  1 Y 1 A LEU 224 ? A LEU 224 
117  1 Y 1 A SER 225 ? A SER 225 
118  1 Y 1 A MET 226 ? A MET 226 
119  1 Y 1 A LEU 227 ? A LEU 227 
120  1 Y 1 A PHE 228 ? A PHE 228 
121  1 Y 1 A ASN 229 ? A ASN 229 
122  1 Y 1 A GLN 230 ? A GLN 230 
123  1 Y 1 A PHE 231 ? A PHE 231 
124  1 Y 1 A PRO 232 ? A PRO 232 
125  1 Y 1 A GLY 233 ? A GLY 233 
126  1 Y 1 A PHE 234 ? A PHE 234 
127  1 Y 1 A LYS 235 ? A LYS 235 
128  1 Y 1 A GLU 236 ? A GLU 236 
129  1 Y 1 A VAL 237 ? A VAL 237 
130  1 Y 1 A ARG 238 ? A ARG 238 
131  1 Y 1 A LEU 239 ? A LEU 239 
132  1 Y 1 A VAL 240 ? A VAL 240 
133  1 Y 1 A PRO 241 ? A PRO 241 
134  1 Y 1 A GLY 242 ? A GLY 242 
135  1 Y 1 A ARG 243 ? A ARG 243 
136  1 Y 1 A HIS 244 ? A HIS 244 
137  1 Y 1 A ASP 245 ? A ASP 245 
138  1 Y 1 A ILE 246 ? A ILE 246 
139  1 Y 1 A ALA 247 ? A ALA 247 
140  1 Y 1 A PHE 248 ? A PHE 248 
141  1 Y 1 A VAL 249 ? A VAL 249 
142  1 Y 1 A GLU 250 ? A GLU 250 
143  1 Y 1 A PHE 251 ? A PHE 251 
144  1 Y 1 A ASP 252 ? A ASP 252 
145  1 Y 1 A ASN 253 ? A ASN 253 
146  1 Y 1 A GLU 254 ? A GLU 254 
147  1 Y 1 A VAL 255 ? A VAL 255 
148  1 Y 1 A GLN 256 ? A GLN 256 
149  1 Y 1 A ALA 257 ? A ALA 257 
150  1 Y 1 A GLY 258 ? A GLY 258 
151  1 Y 1 A ALA 259 ? A ALA 259 
152  1 Y 1 A ALA 260 ? A ALA 260 
153  1 Y 1 A ARG 261 ? A ARG 261 
154  1 Y 1 A ASP 262 ? A ASP 262 
155  1 Y 1 A ALA 263 ? A ALA 263 
156  1 Y 1 A LEU 264 ? A LEU 264 
157  1 Y 1 A GLN 265 ? A GLN 265 
158  1 Y 1 A GLY 266 ? A GLY 266 
159  1 Y 1 A PHE 267 ? A PHE 267 
160  1 Y 1 A LYS 268 ? A LYS 268 
161  1 Y 1 A ILE 269 ? A ILE 269 
162  1 Y 1 A THR 270 ? A THR 270 
163  1 Y 1 A GLN 271 ? A GLN 271 
164  1 Y 1 A ASN 272 ? A ASN 272 
165  1 Y 1 A ASN 273 ? A ASN 273 
166  1 Y 1 A ALA 274 ? A ALA 274 
167  1 Y 1 A MET 275 ? A MET 275 
168  1 Y 1 A LYS 276 ? A LYS 276 
169  1 Y 1 A ILE 277 ? A ILE 277 
170  1 Y 1 A SER 278 ? A SER 278 
171  1 Y 1 A PHE 279 ? A PHE 279 
172  1 Y 1 A ALA 280 ? A ALA 280 
173  1 Y 1 A LYS 281 ? A LYS 281 
174  1 Y 1 A LYS 282 ? A LYS 282 
175  1 Y 1 S MET 1   ? B MET 1   
176  1 Y 1 S THR 2   ? B THR 2   
177  1 Y 1 S GLN 3   ? B GLN 3   
178  1 Y 1 S PHE 4   ? B PHE 4   
179  1 Y 1 S LEU 5   ? B LEU 5   
180  1 Y 1 S PRO 6   ? B PRO 6   
181  1 Y 1 S PRO 7   ? B PRO 7   
182  1 Y 1 S ASN 8   ? B ASN 8   
183  1 Y 1 S LEU 9   ? B LEU 9   
184  1 Y 1 S LEU 10  ? B LEU 10  
185  1 Y 1 S ALA 11  ? B ALA 11  
186  1 Y 1 S LEU 12  ? B LEU 12  
187  1 Y 1 S PHE 13  ? B PHE 13  
188  1 Y 1 S ALA 14  ? B ALA 14  
189  1 Y 1 S PRO 15  ? B PRO 15  
190  1 Y 1 S ARG 16  ? B ARG 16  
191  1 Y 1 S ASP 17  ? B ASP 17  
192  1 Y 1 S PRO 18  ? B PRO 18  
193  1 Y 1 S ILE 19  ? B ILE 19  
194  1 Y 1 S PRO 20  ? B PRO 20  
195  1 Y 1 S TYR 21  ? B TYR 21  
196  1 Y 1 S LEU 22  ? B LEU 22  
197  1 Y 1 S PRO 23  ? B PRO 23  
198  1 Y 1 S PRO 24  ? B PRO 24  
199  1 Y 1 S LEU 25  ? B LEU 25  
200  1 Y 1 S GLU 26  ? B GLU 26  
201  1 Y 1 S LYS 27  ? B LYS 27  
202  1 Y 1 S LEU 28  ? B LEU 28  
203  1 Y 1 S PRO 29  ? B PRO 29  
204  1 Y 1 S HIS 30  ? B HIS 30  
205  1 Y 1 S GLU 31  ? B GLU 31  
206  1 Y 1 S LYS 32  ? B LYS 32  
207  1 Y 1 S HIS 33  ? B HIS 33  
208  1 Y 1 S VAL 184 ? B VAL 184 
209  1 Y 1 S LYS 185 ? B LYS 185 
210  1 Y 1 S GLY 186 ? B GLY 186 
211  1 Y 1 S TRP 187 ? B TRP 187 
212  1 Y 1 S ARG 188 ? B ARG 188 
213  1 Y 1 S PRO 189 ? B PRO 189 
214  1 Y 1 S ARG 190 ? B ARG 190 
215  1 Y 1 S ARG 191 ? B ARG 191 
216  1 Y 1 S LEU 192 ? B LEU 192 
217  1 Y 1 S GLY 193 ? B GLY 193 
218  1 Y 1 S GLY 194 ? B GLY 194 
219  1 Y 1 S GLY 195 ? B GLY 195 
220  1 Y 1 S LEU 196 ? B LEU 196 
221  1 Y 1 S GLY 197 ? B GLY 197 
222  1 Y 1 S GLY 198 ? B GLY 198 
223  1 Y 1 S THR 199 ? B THR 199 
224  1 Y 1 S ARG 200 ? B ARG 200 
225  1 Y 1 S ARG 201 ? B ARG 201 
226  1 Y 1 S GLY 202 ? B GLY 202 
227  1 Y 1 S GLY 203 ? B GLY 203 
228  1 Y 1 S ALA 204 ? B ALA 204 
229  1 Y 1 S ASP 205 ? B ASP 205 
230  1 Y 1 S VAL 206 ? B VAL 206 
231  1 Y 1 S ASN 207 ? B ASN 207 
232  1 Y 1 S ILE 208 ? B ILE 208 
233  1 Y 1 S ARG 209 ? B ARG 209 
234  1 Y 1 S HIS 210 ? B HIS 210 
235  1 Y 1 S SER 211 ? B SER 211 
236  1 Y 1 S GLY 212 ? B GLY 212 
237  1 Y 1 S ARG 213 ? B ARG 213 
238  1 Y 1 S ASP 214 ? B ASP 214 
239  1 Y 1 S ASP 215 ? B ASP 215 
240  1 Y 1 S THR 216 ? B THR 216 
241  1 Y 1 S SER 217 ? B SER 217 
242  1 Y 1 S ARG 218 ? B ARG 218 
243  1 Y 1 S TYR 219 ? B TYR 219 
244  1 Y 1 S ASP 220 ? B ASP 220 
245  1 Y 1 S GLU 221 ? B GLU 221 
246  1 Y 1 S ARG 222 ? B ARG 222 
247  1 Y 1 S PRO 223 ? B PRO 223 
248  1 Y 1 S GLY 224 ? B GLY 224 
249  1 Y 1 S PRO 225 ? B PRO 225 
250  1 Y 1 S SER 226 ? B SER 226 
251  1 Y 1 S PRO 227 ? B PRO 227 
252  1 Y 1 S LEU 228 ? B LEU 228 
253  1 Y 1 S PRO 229 ? B PRO 229 
254  1 Y 1 S HIS 230 ? B HIS 230 
255  1 Y 1 S ARG 231 ? B ARG 231 
256  1 Y 1 S ASP 232 ? B ASP 232 
257  1 Y 1 S ARG 233 ? B ARG 233 
258  1 Y 1 S ASP 234 ? B ASP 234 
259  1 Y 1 S ARG 235 ? B ARG 235 
260  1 Y 1 S ASP 236 ? B ASP 236 
261  1 Y 1 S ARG 237 ? B ARG 237 
262  1 Y 1 S GLU 238 ? B GLU 238 
263  1 Y 1 S ARG 239 ? B ARG 239 
264  1 Y 1 S GLU 240 ? B GLU 240 
265  1 Y 1 S ARG 241 ? B ARG 241 
266  1 Y 1 S ARG 242 ? B ARG 242 
267  1 Y 1 S GLU 243 ? B GLU 243 
268  1 Y 1 S ARG 244 ? B ARG 244 
269  1 Y 1 S SER 245 ? B SER 245 
270  1 Y 1 S ARG 246 ? B ARG 246 
271  1 Y 1 S GLU 247 ? B GLU 247 
272  1 Y 1 S ARG 248 ? B ARG 248 
273  1 Y 1 S ASP 249 ? B ASP 249 
274  1 Y 1 S LYS 250 ? B LYS 250 
275  1 Y 1 S GLU 251 ? B GLU 251 
276  1 Y 1 S ARG 252 ? B ARG 252 
277  1 Y 1 S GLU 253 ? B GLU 253 
278  1 Y 1 S ARG 254 ? B ARG 254 
279  1 Y 1 S ARG 255 ? B ARG 255 
280  1 Y 1 S ARG 256 ? B ARG 256 
281  1 Y 1 S SER 257 ? B SER 257 
282  1 Y 1 S ARG 258 ? B ARG 258 
283  1 Y 1 S SER 259 ? B SER 259 
284  1 Y 1 S ARG 260 ? B ARG 260 
285  1 Y 1 S ASP 261 ? B ASP 261 
286  1 Y 1 S ARG 262 ? B ARG 262 
287  1 Y 1 S ARG 263 ? B ARG 263 
288  1 Y 1 S ARG 264 ? B ARG 264 
289  1 Y 1 S ARG 265 ? B ARG 265 
290  1 Y 1 S SER 266 ? B SER 266 
291  1 Y 1 S ARG 267 ? B ARG 267 
292  1 Y 1 S SER 268 ? B SER 268 
293  1 Y 1 S ARG 269 ? B ARG 269 
294  1 Y 1 S ASP 270 ? B ASP 270 
295  1 Y 1 S LYS 271 ? B LYS 271 
296  1 Y 1 S GLU 272 ? B GLU 272 
297  1 Y 1 S GLU 273 ? B GLU 273 
298  1 Y 1 S ARG 274 ? B ARG 274 
299  1 Y 1 S ARG 275 ? B ARG 275 
300  1 Y 1 S ARG 276 ? B ARG 276 
301  1 Y 1 S SER 277 ? B SER 277 
302  1 Y 1 S ARG 278 ? B ARG 278 
303  1 Y 1 S GLU 279 ? B GLU 279 
304  1 Y 1 S ARG 280 ? B ARG 280 
305  1 Y 1 S SER 281 ? B SER 281 
306  1 Y 1 S LYS 282 ? B LYS 282 
307  1 Y 1 S ASP 283 ? B ASP 283 
308  1 Y 1 S LYS 284 ? B LYS 284 
309  1 Y 1 S ASP 285 ? B ASP 285 
310  1 Y 1 S ARG 286 ? B ARG 286 
311  1 Y 1 S ASP 287 ? B ASP 287 
312  1 Y 1 S ARG 288 ? B ARG 288 
313  1 Y 1 S LYS 289 ? B LYS 289 
314  1 Y 1 S ARG 290 ? B ARG 290 
315  1 Y 1 S ARG 291 ? B ARG 291 
316  1 Y 1 S SER 292 ? B SER 292 
317  1 Y 1 S SER 293 ? B SER 293 
318  1 Y 1 S ARG 294 ? B ARG 294 
319  1 Y 1 S SER 295 ? B SER 295 
320  1 Y 1 S ARG 296 ? B ARG 296 
321  1 Y 1 S GLU 297 ? B GLU 297 
322  1 Y 1 S ARG 298 ? B ARG 298 
323  1 Y 1 S ALA 299 ? B ALA 299 
324  1 Y 1 S ARG 300 ? B ARG 300 
325  1 Y 1 S ARG 301 ? B ARG 301 
326  1 Y 1 S GLU 302 ? B GLU 302 
327  1 Y 1 S ARG 303 ? B ARG 303 
328  1 Y 1 S GLU 304 ? B GLU 304 
329  1 Y 1 S ARG 305 ? B ARG 305 
330  1 Y 1 S LYS 306 ? B LYS 306 
331  1 Y 1 S GLU 307 ? B GLU 307 
332  1 Y 1 S GLU 308 ? B GLU 308 
333  1 Y 1 S LEU 309 ? B LEU 309 
334  1 Y 1 S ARG 310 ? B ARG 310 
335  1 Y 1 S GLY 311 ? B GLY 311 
336  1 Y 1 S GLY 312 ? B GLY 312 
337  1 Y 1 S GLY 313 ? B GLY 313 
338  1 Y 1 S GLY 314 ? B GLY 314 
339  1 Y 1 S ASP 315 ? B ASP 315 
340  1 Y 1 S MET 316 ? B MET 316 
341  1 Y 1 S ALA 317 ? B ALA 317 
342  1 Y 1 S GLU 318 ? B GLU 318 
343  1 Y 1 S PRO 319 ? B PRO 319 
344  1 Y 1 S SER 320 ? B SER 320 
345  1 Y 1 S GLU 321 ? B GLU 321 
346  1 Y 1 S ALA 322 ? B ALA 322 
347  1 Y 1 S GLY 323 ? B GLY 323 
348  1 Y 1 S ASP 324 ? B ASP 324 
349  1 Y 1 S ALA 325 ? B ALA 325 
350  1 Y 1 S PRO 326 ? B PRO 326 
351  1 Y 1 S PRO 327 ? B PRO 327 
352  1 Y 1 S ASP 328 ? B ASP 328 
353  1 Y 1 S ASP 329 ? B ASP 329 
354  1 Y 1 S GLY 330 ? B GLY 330 
355  1 Y 1 S PRO 331 ? B PRO 331 
356  1 Y 1 S PRO 332 ? B PRO 332 
357  1 Y 1 S GLY 333 ? B GLY 333 
358  1 Y 1 S GLU 334 ? B GLU 334 
359  1 Y 1 S LEU 335 ? B LEU 335 
360  1 Y 1 S GLY 336 ? B GLY 336 
361  1 Y 1 S PRO 337 ? B PRO 337 
362  1 Y 1 S ASP 338 ? B ASP 338 
363  1 Y 1 S GLY 339 ? B GLY 339 
364  1 Y 1 S PRO 340 ? B PRO 340 
365  1 Y 1 S ASP 341 ? B ASP 341 
366  1 Y 1 S GLY 342 ? B GLY 342 
367  1 Y 1 S PRO 343 ? B PRO 343 
368  1 Y 1 S GLU 344 ? B GLU 344 
369  1 Y 1 S GLU 345 ? B GLU 345 
370  1 Y 1 S LYS 346 ? B LYS 346 
371  1 Y 1 S GLY 347 ? B GLY 347 
372  1 Y 1 S ARG 348 ? B ARG 348 
373  1 Y 1 S ASP 349 ? B ASP 349 
374  1 Y 1 S ARG 350 ? B ARG 350 
375  1 Y 1 S ASP 351 ? B ASP 351 
376  1 Y 1 S ARG 352 ? B ARG 352 
377  1 Y 1 S GLU 353 ? B GLU 353 
378  1 Y 1 S ARG 354 ? B ARG 354 
379  1 Y 1 S ARG 355 ? B ARG 355 
380  1 Y 1 S ARG 356 ? B ARG 356 
381  1 Y 1 S SER 357 ? B SER 357 
382  1 Y 1 S HIS 358 ? B HIS 358 
383  1 Y 1 S ARG 359 ? B ARG 359 
384  1 Y 1 S SER 360 ? B SER 360 
385  1 Y 1 S GLU 361 ? B GLU 361 
386  1 Y 1 S ARG 362 ? B ARG 362 
387  1 Y 1 S GLU 363 ? B GLU 363 
388  1 Y 1 S ARG 364 ? B ARG 364 
389  1 Y 1 S ARG 365 ? B ARG 365 
390  1 Y 1 S ARG 366 ? B ARG 366 
391  1 Y 1 S ASP 367 ? B ASP 367 
392  1 Y 1 S ARG 368 ? B ARG 368 
393  1 Y 1 S ASP 369 ? B ASP 369 
394  1 Y 1 S ARG 370 ? B ARG 370 
395  1 Y 1 S ASP 371 ? B ASP 371 
396  1 Y 1 S ARG 372 ? B ARG 372 
397  1 Y 1 S ASP 373 ? B ASP 373 
398  1 Y 1 S ARG 374 ? B ARG 374 
399  1 Y 1 S ASP 375 ? B ASP 375 
400  1 Y 1 S ARG 376 ? B ARG 376 
401  1 Y 1 S GLU 377 ? B GLU 377 
402  1 Y 1 S HIS 378 ? B HIS 378 
403  1 Y 1 S LYS 379 ? B LYS 379 
404  1 Y 1 S ARG 380 ? B ARG 380 
405  1 Y 1 S GLY 381 ? B GLY 381 
406  1 Y 1 S GLU 382 ? B GLU 382 
407  1 Y 1 S ARG 383 ? B ARG 383 
408  1 Y 1 S GLY 384 ? B GLY 384 
409  1 Y 1 S SER 385 ? B SER 385 
410  1 Y 1 S GLU 386 ? B GLU 386 
411  1 Y 1 S ARG 387 ? B ARG 387 
412  1 Y 1 S GLY 388 ? B GLY 388 
413  1 Y 1 S ARG 389 ? B ARG 389 
414  1 Y 1 S ASP 390 ? B ASP 390 
415  1 Y 1 S GLU 391 ? B GLU 391 
416  1 Y 1 S ALA 392 ? B ALA 392 
417  1 Y 1 S ARG 393 ? B ARG 393 
418  1 Y 1 S GLY 394 ? B GLY 394 
419  1 Y 1 S GLY 395 ? B GLY 395 
420  1 Y 1 S GLY 396 ? B GLY 396 
421  1 Y 1 S GLY 397 ? B GLY 397 
422  1 Y 1 S GLY 398 ? B GLY 398 
423  1 Y 1 S GLN 399 ? B GLN 399 
424  1 Y 1 S ASP 400 ? B ASP 400 
425  1 Y 1 S ASN 401 ? B ASN 401 
426  1 Y 1 S GLY 402 ? B GLY 402 
427  1 Y 1 S LEU 403 ? B LEU 403 
428  1 Y 1 S GLU 404 ? B GLU 404 
429  1 Y 1 S GLY 405 ? B GLY 405 
430  1 Y 1 S LEU 406 ? B LEU 406 
431  1 Y 1 S GLY 407 ? B GLY 407 
432  1 Y 1 S ASN 408 ? B ASN 408 
433  1 Y 1 S ASP 409 ? B ASP 409 
434  1 Y 1 S SER 410 ? B SER 410 
435  1 Y 1 S ARG 411 ? B ARG 411 
436  1 Y 1 S ASP 412 ? B ASP 412 
437  1 Y 1 S MET 413 ? B MET 413 
438  1 Y 1 S TYR 414 ? B TYR 414 
439  1 Y 1 S MET 415 ? B MET 415 
440  1 Y 1 S GLU 416 ? B GLU 416 
441  1 Y 1 S SER 417 ? B SER 417 
442  1 Y 1 S GLU 418 ? B GLU 418 
443  1 Y 1 S GLY 419 ? B GLY 419 
444  1 Y 1 S GLY 420 ? B GLY 420 
445  1 Y 1 S ASP 421 ? B ASP 421 
446  1 Y 1 S GLY 422 ? B GLY 422 
447  1 Y 1 S TYR 423 ? B TYR 423 
448  1 Y 1 S LEU 424 ? B LEU 424 
449  1 Y 1 S ALA 425 ? B ALA 425 
450  1 Y 1 S PRO 426 ? B PRO 426 
451  1 Y 1 S GLU 427 ? B GLU 427 
452  1 Y 1 S ASN 428 ? B ASN 428 
453  1 Y 1 S GLY 429 ? B GLY 429 
454  1 Y 1 S TYR 430 ? B TYR 430 
455  1 Y 1 S LEU 431 ? B LEU 431 
456  1 Y 1 S MET 432 ? B MET 432 
457  1 Y 1 S GLU 433 ? B GLU 433 
458  1 Y 1 S ALA 434 ? B ALA 434 
459  1 Y 1 S ALA 435 ? B ALA 435 
460  1 Y 1 S PRO 436 ? B PRO 436 
461  1 Y 1 S GLU 437 ? B GLU 437 
462  1 Y 1 Z MET 1   ? C MET 1   
463  1 Y 1 Z SER 2   ? C SER 2   
464  1 Y 1 Z ILE 3   ? C ILE 3   
465  1 Y 1 Z GLY 4   ? C GLY 4   
466  1 Y 1 Z SER 85  ? C SER 85  
467  1 Y 1 Z MET 86  ? C MET 86  
468  1 Y 1 Z LYS 87  ? C LYS 87  
469  1 Y 1 Z ASN 88  ? C ASN 88  
470  1 Y 1 Z LYS 89  ? C LYS 89  
471  1 Y 1 Z ASN 90  ? C ASN 90  
472  1 Y 1 Z GLN 91  ? C GLN 91  
473  1 Y 1 Z GLY 92  ? C GLY 92  
474  1 Y 1 Z SER 93  ? C SER 93  
475  1 Y 1 Z GLY 94  ? C GLY 94  
476  1 Y 1 Z ALA 95  ? C ALA 95  
477  1 Y 1 Z GLY 96  ? C GLY 96  
478  1 Y 1 Z ARG 97  ? C ARG 97  
479  1 Y 1 Z GLY 98  ? C GLY 98  
480  1 Y 1 Z LYS 99  ? C LYS 99  
481  1 Y 1 Z ALA 100 ? C ALA 100 
482  1 Y 1 Z ALA 101 ? C ALA 101 
483  1 Y 1 Z ILE 102 ? C ILE 102 
484  1 Y 1 Z LEU 103 ? C LEU 103 
485  1 Y 1 Z LYS 104 ? C LYS 104 
486  1 Y 1 Z ALA 105 ? C ALA 105 
487  1 Y 1 Z GLN 106 ? C GLN 106 
488  1 Y 1 Z VAL 107 ? C VAL 107 
489  1 Y 1 Z ALA 108 ? C ALA 108 
490  1 Y 1 Z ALA 109 ? C ALA 109 
491  1 Y 1 Z ARG 110 ? C ARG 110 
492  1 Y 1 Z GLY 111 ? C GLY 111 
493  1 Y 1 Z ARG 112 ? C ARG 112 
494  1 Y 1 Z GLY 113 ? C GLY 113 
495  1 Y 1 Z ARG 114 ? C ARG 114 
496  1 Y 1 Z GLY 115 ? C GLY 115 
497  1 Y 1 Z MET 116 ? C MET 116 
498  1 Y 1 Z GLY 117 ? C GLY 117 
499  1 Y 1 Z ARG 118 ? C ARG 118 
500  1 Y 1 Z GLY 119 ? C GLY 119 
501  1 Y 1 Z ASN 120 ? C ASN 120 
502  1 Y 1 Z ILE 121 ? C ILE 121 
503  1 Y 1 Z PHE 122 ? C PHE 122 
504  1 Y 1 Z GLN 123 ? C GLN 123 
505  1 Y 1 Z LYS 124 ? C LYS 124 
506  1 Y 1 Z ARG 125 ? C ARG 125 
507  1 Y 1 Z ARG 126 ? C ARG 126 
508  1 Y 1 B MET 1   ? D MET 1   
509  1 Y 1 B THR 2   ? D THR 2   
510  1 Y 1 B VAL 3   ? D VAL 3   
511  1 Y 1 B GLY 4   ? D GLY 4   
512  1 Y 1 B LYS 5   ? D LYS 5   
513  1 Y 1 B PRO 87  ? D PRO 87  
514  1 Y 1 B LYS 88  ? D LYS 88  
515  1 Y 1 B ASP 89  ? D ASP 89  
516  1 Y 1 B THR 90  ? D THR 90  
517  1 Y 1 B GLY 91  ? D GLY 91  
518  1 Y 1 B ILE 92  ? D ILE 92  
519  1 Y 1 B ALA 93  ? D ALA 93  
520  1 Y 1 B ARG 94  ? D ARG 94  
521  1 Y 1 B VAL 95  ? D VAL 95  
522  1 Y 1 B PRO 96  ? D PRO 96  
523  1 Y 1 B LEU 97  ? D LEU 97  
524  1 Y 1 B ALA 98  ? D ALA 98  
525  1 Y 1 B GLY 99  ? D GLY 99  
526  1 Y 1 B ALA 100 ? D ALA 100 
527  1 Y 1 B ALA 101 ? D ALA 101 
528  1 Y 1 B GLY 102 ? D GLY 102 
529  1 Y 1 B GLY 103 ? D GLY 103 
530  1 Y 1 B PRO 104 ? D PRO 104 
531  1 Y 1 B GLY 105 ? D GLY 105 
532  1 Y 1 B ILE 106 ? D ILE 106 
533  1 Y 1 B GLY 107 ? D GLY 107 
534  1 Y 1 B ARG 108 ? D ARG 108 
535  1 Y 1 B ALA 109 ? D ALA 109 
536  1 Y 1 B ALA 110 ? D ALA 110 
537  1 Y 1 B GLY 111 ? D GLY 111 
538  1 Y 1 B ARG 112 ? D ARG 112 
539  1 Y 1 B GLY 113 ? D GLY 113 
540  1 Y 1 B ILE 114 ? D ILE 114 
541  1 Y 1 B PRO 115 ? D PRO 115 
542  1 Y 1 B ALA 116 ? D ALA 116 
543  1 Y 1 B GLY 117 ? D GLY 117 
544  1 Y 1 B VAL 118 ? D VAL 118 
545  1 Y 1 B PRO 119 ? D PRO 119 
546  1 Y 1 B MET 120 ? D MET 120 
547  1 Y 1 B PRO 121 ? D PRO 121 
548  1 Y 1 B GLN 122 ? D GLN 122 
549  1 Y 1 B ALA 123 ? D ALA 123 
550  1 Y 1 B PRO 124 ? D PRO 124 
551  1 Y 1 B ALA 125 ? D ALA 125 
552  1 Y 1 B GLY 126 ? D GLY 126 
553  1 Y 1 B LEU 127 ? D LEU 127 
554  1 Y 1 B ALA 128 ? D ALA 128 
555  1 Y 1 B GLY 129 ? D GLY 129 
556  1 Y 1 B PRO 130 ? D PRO 130 
557  1 Y 1 B VAL 131 ? D VAL 131 
558  1 Y 1 B ARG 132 ? D ARG 132 
559  1 Y 1 B GLY 133 ? D GLY 133 
560  1 Y 1 B VAL 134 ? D VAL 134 
561  1 Y 1 B GLY 135 ? D GLY 135 
562  1 Y 1 B GLY 136 ? D GLY 136 
563  1 Y 1 B PRO 137 ? D PRO 137 
564  1 Y 1 B SER 138 ? D SER 138 
565  1 Y 1 B GLN 139 ? D GLN 139 
566  1 Y 1 B GLN 140 ? D GLN 140 
567  1 Y 1 B VAL 141 ? D VAL 141 
568  1 Y 1 B MET 142 ? D MET 142 
569  1 Y 1 B THR 143 ? D THR 143 
570  1 Y 1 B PRO 144 ? D PRO 144 
571  1 Y 1 B GLN 145 ? D GLN 145 
572  1 Y 1 B GLY 146 ? D GLY 146 
573  1 Y 1 B ARG 147 ? D ARG 147 
574  1 Y 1 B GLY 148 ? D GLY 148 
575  1 Y 1 B THR 149 ? D THR 149 
576  1 Y 1 B VAL 150 ? D VAL 150 
577  1 Y 1 B ALA 151 ? D ALA 151 
578  1 Y 1 B ALA 152 ? D ALA 152 
579  1 Y 1 B ALA 153 ? D ALA 153 
580  1 Y 1 B ALA 154 ? D ALA 154 
581  1 Y 1 B ALA 155 ? D ALA 155 
582  1 Y 1 B ALA 156 ? D ALA 156 
583  1 Y 1 B ALA 157 ? D ALA 157 
584  1 Y 1 B THR 158 ? D THR 158 
585  1 Y 1 B ALA 159 ? D ALA 159 
586  1 Y 1 B SER 160 ? D SER 160 
587  1 Y 1 B ILE 161 ? D ILE 161 
588  1 Y 1 B ALA 162 ? D ALA 162 
589  1 Y 1 B GLY 163 ? D GLY 163 
590  1 Y 1 B ALA 164 ? D ALA 164 
591  1 Y 1 B PRO 165 ? D PRO 165 
592  1 Y 1 B THR 166 ? D THR 166 
593  1 Y 1 B GLN 167 ? D GLN 167 
594  1 Y 1 B TYR 168 ? D TYR 168 
595  1 Y 1 B PRO 169 ? D PRO 169 
596  1 Y 1 B PRO 170 ? D PRO 170 
597  1 Y 1 B GLY 171 ? D GLY 171 
598  1 Y 1 B ARG 172 ? D ARG 172 
599  1 Y 1 B GLY 173 ? D GLY 173 
600  1 Y 1 B GLY 174 ? D GLY 174 
601  1 Y 1 B PRO 175 ? D PRO 175 
602  1 Y 1 B PRO 176 ? D PRO 176 
603  1 Y 1 B PRO 177 ? D PRO 177 
604  1 Y 1 B PRO 178 ? D PRO 178 
605  1 Y 1 B MET 179 ? D MET 179 
606  1 Y 1 B GLY 180 ? D GLY 180 
607  1 Y 1 B ARG 181 ? D ARG 181 
608  1 Y 1 B GLY 182 ? D GLY 182 
609  1 Y 1 B ALA 183 ? D ALA 183 
610  1 Y 1 B PRO 184 ? D PRO 184 
611  1 Y 1 B PRO 185 ? D PRO 185 
612  1 Y 1 B PRO 186 ? D PRO 186 
613  1 Y 1 B GLY 187 ? D GLY 187 
614  1 Y 1 B MET 188 ? D MET 188 
615  1 Y 1 B MET 189 ? D MET 189 
616  1 Y 1 B GLY 190 ? D GLY 190 
617  1 Y 1 B PRO 191 ? D PRO 191 
618  1 Y 1 B PRO 192 ? D PRO 192 
619  1 Y 1 B PRO 193 ? D PRO 193 
620  1 Y 1 B GLY 194 ? D GLY 194 
621  1 Y 1 B MET 195 ? D MET 195 
622  1 Y 1 B ARG 196 ? D ARG 196 
623  1 Y 1 B PRO 197 ? D PRO 197 
624  1 Y 1 B PRO 198 ? D PRO 198 
625  1 Y 1 B MET 199 ? D MET 199 
626  1 Y 1 B GLY 200 ? D GLY 200 
627  1 Y 1 B PRO 201 ? D PRO 201 
628  1 Y 1 B PRO 202 ? D PRO 202 
629  1 Y 1 B MET 203 ? D MET 203 
630  1 Y 1 B GLY 204 ? D GLY 204 
631  1 Y 1 B ILE 205 ? D ILE 205 
632  1 Y 1 B PRO 206 ? D PRO 206 
633  1 Y 1 B PRO 207 ? D PRO 207 
634  1 Y 1 B GLY 208 ? D GLY 208 
635  1 Y 1 B ARG 209 ? D ARG 209 
636  1 Y 1 B GLY 210 ? D GLY 210 
637  1 Y 1 B THR 211 ? D THR 211 
638  1 Y 1 B PRO 212 ? D PRO 212 
639  1 Y 1 B MET 213 ? D MET 213 
640  1 Y 1 B GLY 214 ? D GLY 214 
641  1 Y 1 B MET 215 ? D MET 215 
642  1 Y 1 B PRO 216 ? D PRO 216 
643  1 Y 1 B PRO 217 ? D PRO 217 
644  1 Y 1 B PRO 218 ? D PRO 218 
645  1 Y 1 B GLY 219 ? D GLY 219 
646  1 Y 1 B MET 220 ? D MET 220 
647  1 Y 1 B ARG 221 ? D ARG 221 
648  1 Y 1 B PRO 222 ? D PRO 222 
649  1 Y 1 B PRO 223 ? D PRO 223 
650  1 Y 1 B PRO 224 ? D PRO 224 
651  1 Y 1 B PRO 225 ? D PRO 225 
652  1 Y 1 B GLY 226 ? D GLY 226 
653  1 Y 1 B MET 227 ? D MET 227 
654  1 Y 1 B ARG 228 ? D ARG 228 
655  1 Y 1 B GLY 229 ? D GLY 229 
656  1 Y 1 B LEU 230 ? D LEU 230 
657  1 Y 1 B LEU 231 ? D LEU 231 
658  1 Y 1 X LYS 86  ? E LYS 86  
659  1 Y 1 X VAL 87  ? E VAL 87  
660  1 Y 1 X LYS 88  ? E LYS 88  
661  1 Y 1 X SER 89  ? E SER 89  
662  1 Y 1 X LYS 90  ? E LYS 90  
663  1 Y 1 X LYS 91  ? E LYS 91  
664  1 Y 1 X ARG 92  ? E ARG 92  
665  1 Y 1 X GLU 93  ? E GLU 93  
666  1 Y 1 X ALA 94  ? E ALA 94  
667  1 Y 1 X VAL 95  ? E VAL 95  
668  1 Y 1 X ALA 96  ? E ALA 96  
669  1 Y 1 X GLY 97  ? E GLY 97  
670  1 Y 1 X ARG 98  ? E ARG 98  
671  1 Y 1 X GLY 99  ? E GLY 99  
672  1 Y 1 X ARG 100 ? E ARG 100 
673  1 Y 1 X GLY 101 ? E GLY 101 
674  1 Y 1 X ARG 102 ? E ARG 102 
675  1 Y 1 X GLY 103 ? E GLY 103 
676  1 Y 1 X ARG 104 ? E ARG 104 
677  1 Y 1 X GLY 105 ? E GLY 105 
678  1 Y 1 X ARG 106 ? E ARG 106 
679  1 Y 1 X GLY 107 ? E GLY 107 
680  1 Y 1 X ARG 108 ? E ARG 108 
681  1 Y 1 X GLY 109 ? E GLY 109 
682  1 Y 1 X ARG 110 ? E ARG 110 
683  1 Y 1 X GLY 111 ? E GLY 111 
684  1 Y 1 X ARG 112 ? E ARG 112 
685  1 Y 1 X GLY 113 ? E GLY 113 
686  1 Y 1 X ARG 114 ? E ARG 114 
687  1 Y 1 X GLY 115 ? E GLY 115 
688  1 Y 1 X GLY 116 ? E GLY 116 
689  1 Y 1 X PRO 117 ? E PRO 117 
690  1 Y 1 X ARG 118 ? E ARG 118 
691  1 Y 1 X ARG 119 ? E ARG 119 
692  1 Y 1 Y MET 1   ? F MET 1   
693  1 Y 1 Y PRO 113 ? F PRO 113 
694  1 Y 1 Y LEU 114 ? F LEU 114 
695  1 Y 1 Y ILE 115 ? F ILE 115 
696  1 Y 1 Y ALA 116 ? F ALA 116 
697  1 Y 1 Y GLY 117 ? F GLY 117 
698  1 Y 1 Y LYS 118 ? F LYS 118 
699  1 Y 1 F MET 1   ? G MET 1   
700  1 Y 1 E MET 1   ? H MET 1   
701  1 Y 1 E ALA 2   ? H ALA 2   
702  1 Y 1 E TYR 3   ? H TYR 3   
703  1 Y 1 E ARG 4   ? H ARG 4   
704  1 Y 1 E GLY 5   ? H GLY 5   
705  1 Y 1 E GLN 6   ? H GLN 6   
706  1 Y 1 E SER 91  ? H SER 91  
707  1 Y 1 E ASN 92  ? H ASN 92  
708  1 Y 1 P MET 1   ? J MET 1   
709  1 Y 1 P SER 115 ? J SER 115 
710  1 Y 1 P GLN 116 ? J GLN 116 
711  1 Y 1 P GLU 117 ? J GLU 117 
712  1 Y 1 P THR 118 ? J THR 118 
713  1 Y 1 P PRO 119 ? J PRO 119 
714  1 Y 1 P ALA 120 ? J ALA 120 
715  1 Y 1 P THR 121 ? J THR 121 
716  1 Y 1 P LYS 122 ? J LYS 122 
717  1 Y 1 P LYS 123 ? J LYS 123 
718  1 Y 1 P ALA 124 ? J ALA 124 
719  1 Y 1 P VAL 125 ? J VAL 125 
720  1 Y 1 P GLN 126 ? J GLN 126 
721  1 Y 1 P GLY 127 ? J GLY 127 
722  1 Y 1 P GLY 128 ? J GLY 128 
723  1 Y 1 P GLY 129 ? J GLY 129 
724  1 Y 1 P ALA 130 ? J ALA 130 
725  1 Y 1 P THR 131 ? J THR 131 
726  1 Y 1 P PRO 132 ? J PRO 132 
727  1 Y 1 P VAL 133 ? J VAL 133 
728  1 Y 1 P VAL 134 ? J VAL 134 
729  1 Y 1 P GLY 135 ? J GLY 135 
730  1 Y 1 P ALA 136 ? J ALA 136 
731  1 Y 1 P VAL 137 ? J VAL 137 
732  1 Y 1 P GLN 138 ? J GLN 138 
733  1 Y 1 P GLY 139 ? J GLY 139 
734  1 Y 1 P PRO 140 ? J PRO 140 
735  1 Y 1 P VAL 141 ? J VAL 141 
736  1 Y 1 P PRO 142 ? J PRO 142 
737  1 Y 1 P GLY 143 ? J GLY 143 
738  1 Y 1 P MET 144 ? J MET 144 
739  1 Y 1 P PRO 145 ? J PRO 145 
740  1 Y 1 P PRO 146 ? J PRO 146 
741  1 Y 1 P MET 147 ? J MET 147 
742  1 Y 1 P THR 148 ? J THR 148 
743  1 Y 1 P GLN 149 ? J GLN 149 
744  1 Y 1 P ALA 150 ? J ALA 150 
745  1 Y 1 P PRO 151 ? J PRO 151 
746  1 Y 1 P ARG 152 ? J ARG 152 
747  1 Y 1 P ILE 153 ? J ILE 153 
748  1 Y 1 P MET 154 ? J MET 154 
749  1 Y 1 P HIS 155 ? J HIS 155 
750  1 Y 1 P HIS 156 ? J HIS 156 
751  1 Y 1 P MET 157 ? J MET 157 
752  1 Y 1 P PRO 158 ? J PRO 158 
753  1 Y 1 P GLY 159 ? J GLY 159 
754  1 Y 1 P GLN 160 ? J GLN 160 
755  1 Y 1 P PRO 161 ? J PRO 161 
756  1 Y 1 P PRO 162 ? J PRO 162 
757  1 Y 1 P TYR 163 ? J TYR 163 
758  1 Y 1 P MET 164 ? J MET 164 
759  1 Y 1 P PRO 165 ? J PRO 165 
760  1 Y 1 P PRO 166 ? J PRO 166 
761  1 Y 1 P PRO 167 ? J PRO 167 
762  1 Y 1 P GLY 168 ? J GLY 168 
763  1 Y 1 P MET 169 ? J MET 169 
764  1 Y 1 P ILE 170 ? J ILE 170 
765  1 Y 1 P PRO 171 ? J PRO 171 
766  1 Y 1 P PRO 172 ? J PRO 172 
767  1 Y 1 P PRO 173 ? J PRO 173 
768  1 Y 1 P GLY 174 ? J GLY 174 
769  1 Y 1 P LEU 175 ? J LEU 175 
770  1 Y 1 P ALA 176 ? J ALA 176 
771  1 Y 1 P PRO 177 ? J PRO 177 
772  1 Y 1 P GLY 178 ? J GLY 178 
773  1 Y 1 P GLN 179 ? J GLN 179 
774  1 Y 1 P ILE 180 ? J ILE 180 
775  1 Y 1 P PRO 181 ? J PRO 181 
776  1 Y 1 P PRO 182 ? J PRO 182 
777  1 Y 1 P GLY 183 ? J GLY 183 
778  1 Y 1 P ALA 184 ? J ALA 184 
779  1 Y 1 P MET 185 ? J MET 185 
780  1 Y 1 P PRO 186 ? J PRO 186 
781  1 Y 1 P PRO 187 ? J PRO 187 
782  1 Y 1 P GLN 188 ? J GLN 188 
783  1 Y 1 P GLN 189 ? J GLN 189 
784  1 Y 1 P LEU 190 ? J LEU 190 
785  1 Y 1 P MET 191 ? J MET 191 
786  1 Y 1 P PRO 192 ? J PRO 192 
787  1 Y 1 P GLY 193 ? J GLY 193 
788  1 Y 1 P GLN 194 ? J GLN 194 
789  1 Y 1 P MET 195 ? J MET 195 
790  1 Y 1 P PRO 196 ? J PRO 196 
791  1 Y 1 P PRO 197 ? J PRO 197 
792  1 Y 1 P ALA 198 ? J ALA 198 
793  1 Y 1 P GLN 199 ? J GLN 199 
794  1 Y 1 P PRO 200 ? J PRO 200 
795  1 Y 1 P LEU 201 ? J LEU 201 
796  1 Y 1 P SER 202 ? J SER 202 
797  1 Y 1 P GLU 203 ? J GLU 203 
798  1 Y 1 P ASN 204 ? J ASN 204 
799  1 Y 1 P PRO 205 ? J PRO 205 
800  1 Y 1 P PRO 206 ? J PRO 206 
801  1 Y 1 P ASN 207 ? J ASN 207 
802  1 Y 1 P HIS 208 ? J HIS 208 
803  1 Y 1 P ILE 209 ? J ILE 209 
804  1 Y 1 P LEU 210 ? J LEU 210 
805  1 Y 1 P PHE 211 ? J PHE 211 
806  1 Y 1 P LEU 212 ? J LEU 212 
807  1 Y 1 P THR 213 ? J THR 213 
808  1 Y 1 P ASN 214 ? J ASN 214 
809  1 Y 1 P LEU 215 ? J LEU 215 
810  1 Y 1 P PRO 216 ? J PRO 216 
811  1 Y 1 P GLU 217 ? J GLU 217 
812  1 Y 1 P GLU 218 ? J GLU 218 
813  1 Y 1 P THR 219 ? J THR 219 
814  1 Y 1 P ASN 220 ? J ASN 220 
815  1 Y 1 P GLU 221 ? J GLU 221 
816  1 Y 1 P LEU 222 ? J LEU 222 
817  1 Y 1 P MET 223 ? J MET 223 
818  1 Y 1 P LEU 224 ? J LEU 224 
819  1 Y 1 P SER 225 ? J SER 225 
820  1 Y 1 P MET 226 ? J MET 226 
821  1 Y 1 P LEU 227 ? J LEU 227 
822  1 Y 1 P PHE 228 ? J PHE 228 
823  1 Y 1 P ASN 229 ? J ASN 229 
824  1 Y 1 P GLN 230 ? J GLN 230 
825  1 Y 1 P PHE 231 ? J PHE 231 
826  1 Y 1 P PRO 232 ? J PRO 232 
827  1 Y 1 P GLY 233 ? J GLY 233 
828  1 Y 1 P PHE 234 ? J PHE 234 
829  1 Y 1 P LYS 235 ? J LYS 235 
830  1 Y 1 P GLU 236 ? J GLU 236 
831  1 Y 1 P VAL 237 ? J VAL 237 
832  1 Y 1 P ARG 238 ? J ARG 238 
833  1 Y 1 P LEU 239 ? J LEU 239 
834  1 Y 1 P VAL 240 ? J VAL 240 
835  1 Y 1 P PRO 241 ? J PRO 241 
836  1 Y 1 P GLY 242 ? J GLY 242 
837  1 Y 1 P ARG 243 ? J ARG 243 
838  1 Y 1 P HIS 244 ? J HIS 244 
839  1 Y 1 P ASP 245 ? J ASP 245 
840  1 Y 1 P ILE 246 ? J ILE 246 
841  1 Y 1 P ALA 247 ? J ALA 247 
842  1 Y 1 P PHE 248 ? J PHE 248 
843  1 Y 1 P VAL 249 ? J VAL 249 
844  1 Y 1 P GLU 250 ? J GLU 250 
845  1 Y 1 P PHE 251 ? J PHE 251 
846  1 Y 1 P ASP 252 ? J ASP 252 
847  1 Y 1 P ASN 253 ? J ASN 253 
848  1 Y 1 P GLU 254 ? J GLU 254 
849  1 Y 1 P VAL 255 ? J VAL 255 
850  1 Y 1 P GLN 256 ? J GLN 256 
851  1 Y 1 P ALA 257 ? J ALA 257 
852  1 Y 1 P GLY 258 ? J GLY 258 
853  1 Y 1 P ALA 259 ? J ALA 259 
854  1 Y 1 P ALA 260 ? J ALA 260 
855  1 Y 1 P ARG 261 ? J ARG 261 
856  1 Y 1 P ASP 262 ? J ASP 262 
857  1 Y 1 P ALA 263 ? J ALA 263 
858  1 Y 1 P LEU 264 ? J LEU 264 
859  1 Y 1 P GLN 265 ? J GLN 265 
860  1 Y 1 P GLY 266 ? J GLY 266 
861  1 Y 1 P PHE 267 ? J PHE 267 
862  1 Y 1 P LYS 268 ? J LYS 268 
863  1 Y 1 P ILE 269 ? J ILE 269 
864  1 Y 1 P THR 270 ? J THR 270 
865  1 Y 1 P GLN 271 ? J GLN 271 
866  1 Y 1 P ASN 272 ? J ASN 272 
867  1 Y 1 P ASN 273 ? J ASN 273 
868  1 Y 1 P ALA 274 ? J ALA 274 
869  1 Y 1 P MET 275 ? J MET 275 
870  1 Y 1 P LYS 276 ? J LYS 276 
871  1 Y 1 P ILE 277 ? J ILE 277 
872  1 Y 1 P SER 278 ? J SER 278 
873  1 Y 1 P PHE 279 ? J PHE 279 
874  1 Y 1 P ALA 280 ? J ALA 280 
875  1 Y 1 P LYS 281 ? J LYS 281 
876  1 Y 1 P LYS 282 ? J LYS 282 
877  1 Y 1 L MET 1   ? K MET 1   
878  1 Y 1 L THR 2   ? K THR 2   
879  1 Y 1 L GLN 3   ? K GLN 3   
880  1 Y 1 L PHE 4   ? K PHE 4   
881  1 Y 1 L LEU 5   ? K LEU 5   
882  1 Y 1 L PRO 6   ? K PRO 6   
883  1 Y 1 L PRO 7   ? K PRO 7   
884  1 Y 1 L ASN 8   ? K ASN 8   
885  1 Y 1 L LEU 9   ? K LEU 9   
886  1 Y 1 L LEU 10  ? K LEU 10  
887  1 Y 1 L ALA 11  ? K ALA 11  
888  1 Y 1 L LEU 12  ? K LEU 12  
889  1 Y 1 L PHE 13  ? K PHE 13  
890  1 Y 1 L ALA 14  ? K ALA 14  
891  1 Y 1 L PRO 15  ? K PRO 15  
892  1 Y 1 L ARG 16  ? K ARG 16  
893  1 Y 1 L ASP 17  ? K ASP 17  
894  1 Y 1 L PRO 18  ? K PRO 18  
895  1 Y 1 L ILE 19  ? K ILE 19  
896  1 Y 1 L PRO 20  ? K PRO 20  
897  1 Y 1 L TYR 21  ? K TYR 21  
898  1 Y 1 L LEU 22  ? K LEU 22  
899  1 Y 1 L PRO 23  ? K PRO 23  
900  1 Y 1 L PRO 24  ? K PRO 24  
901  1 Y 1 L LEU 25  ? K LEU 25  
902  1 Y 1 L GLU 26  ? K GLU 26  
903  1 Y 1 L LYS 27  ? K LYS 27  
904  1 Y 1 L LEU 28  ? K LEU 28  
905  1 Y 1 L PRO 29  ? K PRO 29  
906  1 Y 1 L HIS 30  ? K HIS 30  
907  1 Y 1 L GLU 31  ? K GLU 31  
908  1 Y 1 L LYS 32  ? K LYS 32  
909  1 Y 1 L HIS 33  ? K HIS 33  
910  1 Y 1 L ARG 182 ? K ARG 182 
911  1 Y 1 L THR 183 ? K THR 183 
912  1 Y 1 L VAL 184 ? K VAL 184 
913  1 Y 1 L LYS 185 ? K LYS 185 
914  1 Y 1 L GLY 186 ? K GLY 186 
915  1 Y 1 L TRP 187 ? K TRP 187 
916  1 Y 1 L ARG 188 ? K ARG 188 
917  1 Y 1 L PRO 189 ? K PRO 189 
918  1 Y 1 L ARG 190 ? K ARG 190 
919  1 Y 1 L ARG 191 ? K ARG 191 
920  1 Y 1 L LEU 192 ? K LEU 192 
921  1 Y 1 L GLY 193 ? K GLY 193 
922  1 Y 1 L GLY 194 ? K GLY 194 
923  1 Y 1 L GLY 195 ? K GLY 195 
924  1 Y 1 L LEU 196 ? K LEU 196 
925  1 Y 1 L GLY 197 ? K GLY 197 
926  1 Y 1 L GLY 198 ? K GLY 198 
927  1 Y 1 L THR 199 ? K THR 199 
928  1 Y 1 L ARG 200 ? K ARG 200 
929  1 Y 1 L ARG 201 ? K ARG 201 
930  1 Y 1 L GLY 202 ? K GLY 202 
931  1 Y 1 L GLY 203 ? K GLY 203 
932  1 Y 1 L ALA 204 ? K ALA 204 
933  1 Y 1 L ASP 205 ? K ASP 205 
934  1 Y 1 L VAL 206 ? K VAL 206 
935  1 Y 1 L ASN 207 ? K ASN 207 
936  1 Y 1 L ILE 208 ? K ILE 208 
937  1 Y 1 L ARG 209 ? K ARG 209 
938  1 Y 1 L HIS 210 ? K HIS 210 
939  1 Y 1 L SER 211 ? K SER 211 
940  1 Y 1 L GLY 212 ? K GLY 212 
941  1 Y 1 L ARG 213 ? K ARG 213 
942  1 Y 1 L ASP 214 ? K ASP 214 
943  1 Y 1 L ASP 215 ? K ASP 215 
944  1 Y 1 L THR 216 ? K THR 216 
945  1 Y 1 L SER 217 ? K SER 217 
946  1 Y 1 L ARG 218 ? K ARG 218 
947  1 Y 1 L TYR 219 ? K TYR 219 
948  1 Y 1 L ASP 220 ? K ASP 220 
949  1 Y 1 L GLU 221 ? K GLU 221 
950  1 Y 1 L ARG 222 ? K ARG 222 
951  1 Y 1 L PRO 223 ? K PRO 223 
952  1 Y 1 L GLY 224 ? K GLY 224 
953  1 Y 1 L PRO 225 ? K PRO 225 
954  1 Y 1 L SER 226 ? K SER 226 
955  1 Y 1 L PRO 227 ? K PRO 227 
956  1 Y 1 L LEU 228 ? K LEU 228 
957  1 Y 1 L PRO 229 ? K PRO 229 
958  1 Y 1 L HIS 230 ? K HIS 230 
959  1 Y 1 L ARG 231 ? K ARG 231 
960  1 Y 1 L ASP 232 ? K ASP 232 
961  1 Y 1 L ARG 233 ? K ARG 233 
962  1 Y 1 L ASP 234 ? K ASP 234 
963  1 Y 1 L ARG 235 ? K ARG 235 
964  1 Y 1 L ASP 236 ? K ASP 236 
965  1 Y 1 L ARG 237 ? K ARG 237 
966  1 Y 1 L GLU 238 ? K GLU 238 
967  1 Y 1 L ARG 239 ? K ARG 239 
968  1 Y 1 L GLU 240 ? K GLU 240 
969  1 Y 1 L ARG 241 ? K ARG 241 
970  1 Y 1 L ARG 242 ? K ARG 242 
971  1 Y 1 L GLU 243 ? K GLU 243 
972  1 Y 1 L ARG 244 ? K ARG 244 
973  1 Y 1 L SER 245 ? K SER 245 
974  1 Y 1 L ARG 246 ? K ARG 246 
975  1 Y 1 L GLU 247 ? K GLU 247 
976  1 Y 1 L ARG 248 ? K ARG 248 
977  1 Y 1 L ASP 249 ? K ASP 249 
978  1 Y 1 L LYS 250 ? K LYS 250 
979  1 Y 1 L GLU 251 ? K GLU 251 
980  1 Y 1 L ARG 252 ? K ARG 252 
981  1 Y 1 L GLU 253 ? K GLU 253 
982  1 Y 1 L ARG 254 ? K ARG 254 
983  1 Y 1 L ARG 255 ? K ARG 255 
984  1 Y 1 L ARG 256 ? K ARG 256 
985  1 Y 1 L SER 257 ? K SER 257 
986  1 Y 1 L ARG 258 ? K ARG 258 
987  1 Y 1 L SER 259 ? K SER 259 
988  1 Y 1 L ARG 260 ? K ARG 260 
989  1 Y 1 L ASP 261 ? K ASP 261 
990  1 Y 1 L ARG 262 ? K ARG 262 
991  1 Y 1 L ARG 263 ? K ARG 263 
992  1 Y 1 L ARG 264 ? K ARG 264 
993  1 Y 1 L ARG 265 ? K ARG 265 
994  1 Y 1 L SER 266 ? K SER 266 
995  1 Y 1 L ARG 267 ? K ARG 267 
996  1 Y 1 L SER 268 ? K SER 268 
997  1 Y 1 L ARG 269 ? K ARG 269 
998  1 Y 1 L ASP 270 ? K ASP 270 
999  1 Y 1 L LYS 271 ? K LYS 271 
1000 1 Y 1 L GLU 272 ? K GLU 272 
1001 1 Y 1 L GLU 273 ? K GLU 273 
1002 1 Y 1 L ARG 274 ? K ARG 274 
1003 1 Y 1 L ARG 275 ? K ARG 275 
1004 1 Y 1 L ARG 276 ? K ARG 276 
1005 1 Y 1 L SER 277 ? K SER 277 
1006 1 Y 1 L ARG 278 ? K ARG 278 
1007 1 Y 1 L GLU 279 ? K GLU 279 
1008 1 Y 1 L ARG 280 ? K ARG 280 
1009 1 Y 1 L SER 281 ? K SER 281 
1010 1 Y 1 L LYS 282 ? K LYS 282 
1011 1 Y 1 L ASP 283 ? K ASP 283 
1012 1 Y 1 L LYS 284 ? K LYS 284 
1013 1 Y 1 L ASP 285 ? K ASP 285 
1014 1 Y 1 L ARG 286 ? K ARG 286 
1015 1 Y 1 L ASP 287 ? K ASP 287 
1016 1 Y 1 L ARG 288 ? K ARG 288 
1017 1 Y 1 L LYS 289 ? K LYS 289 
1018 1 Y 1 L ARG 290 ? K ARG 290 
1019 1 Y 1 L ARG 291 ? K ARG 291 
1020 1 Y 1 L SER 292 ? K SER 292 
1021 1 Y 1 L SER 293 ? K SER 293 
1022 1 Y 1 L ARG 294 ? K ARG 294 
1023 1 Y 1 L SER 295 ? K SER 295 
1024 1 Y 1 L ARG 296 ? K ARG 296 
1025 1 Y 1 L GLU 297 ? K GLU 297 
1026 1 Y 1 L ARG 298 ? K ARG 298 
1027 1 Y 1 L ALA 299 ? K ALA 299 
1028 1 Y 1 L ARG 300 ? K ARG 300 
1029 1 Y 1 L ARG 301 ? K ARG 301 
1030 1 Y 1 L GLU 302 ? K GLU 302 
1031 1 Y 1 L ARG 303 ? K ARG 303 
1032 1 Y 1 L GLU 304 ? K GLU 304 
1033 1 Y 1 L ARG 305 ? K ARG 305 
1034 1 Y 1 L LYS 306 ? K LYS 306 
1035 1 Y 1 L GLU 307 ? K GLU 307 
1036 1 Y 1 L GLU 308 ? K GLU 308 
1037 1 Y 1 L LEU 309 ? K LEU 309 
1038 1 Y 1 L ARG 310 ? K ARG 310 
1039 1 Y 1 L GLY 311 ? K GLY 311 
1040 1 Y 1 L GLY 312 ? K GLY 312 
1041 1 Y 1 L GLY 313 ? K GLY 313 
1042 1 Y 1 L GLY 314 ? K GLY 314 
1043 1 Y 1 L ASP 315 ? K ASP 315 
1044 1 Y 1 L MET 316 ? K MET 316 
1045 1 Y 1 L ALA 317 ? K ALA 317 
1046 1 Y 1 L GLU 318 ? K GLU 318 
1047 1 Y 1 L PRO 319 ? K PRO 319 
1048 1 Y 1 L SER 320 ? K SER 320 
1049 1 Y 1 L GLU 321 ? K GLU 321 
1050 1 Y 1 L ALA 322 ? K ALA 322 
1051 1 Y 1 L GLY 323 ? K GLY 323 
1052 1 Y 1 L ASP 324 ? K ASP 324 
1053 1 Y 1 L ALA 325 ? K ALA 325 
1054 1 Y 1 L PRO 326 ? K PRO 326 
1055 1 Y 1 L PRO 327 ? K PRO 327 
1056 1 Y 1 L ASP 328 ? K ASP 328 
1057 1 Y 1 L ASP 329 ? K ASP 329 
1058 1 Y 1 L GLY 330 ? K GLY 330 
1059 1 Y 1 L PRO 331 ? K PRO 331 
1060 1 Y 1 L PRO 332 ? K PRO 332 
1061 1 Y 1 L GLY 333 ? K GLY 333 
1062 1 Y 1 L GLU 334 ? K GLU 334 
1063 1 Y 1 L LEU 335 ? K LEU 335 
1064 1 Y 1 L GLY 336 ? K GLY 336 
1065 1 Y 1 L PRO 337 ? K PRO 337 
1066 1 Y 1 L ASP 338 ? K ASP 338 
1067 1 Y 1 L GLY 339 ? K GLY 339 
1068 1 Y 1 L PRO 340 ? K PRO 340 
1069 1 Y 1 L ASP 341 ? K ASP 341 
1070 1 Y 1 L GLY 342 ? K GLY 342 
1071 1 Y 1 L PRO 343 ? K PRO 343 
1072 1 Y 1 L GLU 344 ? K GLU 344 
1073 1 Y 1 L GLU 345 ? K GLU 345 
1074 1 Y 1 L LYS 346 ? K LYS 346 
1075 1 Y 1 L GLY 347 ? K GLY 347 
1076 1 Y 1 L ARG 348 ? K ARG 348 
1077 1 Y 1 L ASP 349 ? K ASP 349 
1078 1 Y 1 L ARG 350 ? K ARG 350 
1079 1 Y 1 L ASP 351 ? K ASP 351 
1080 1 Y 1 L ARG 352 ? K ARG 352 
1081 1 Y 1 L GLU 353 ? K GLU 353 
1082 1 Y 1 L ARG 354 ? K ARG 354 
1083 1 Y 1 L ARG 355 ? K ARG 355 
1084 1 Y 1 L ARG 356 ? K ARG 356 
1085 1 Y 1 L SER 357 ? K SER 357 
1086 1 Y 1 L HIS 358 ? K HIS 358 
1087 1 Y 1 L ARG 359 ? K ARG 359 
1088 1 Y 1 L SER 360 ? K SER 360 
1089 1 Y 1 L GLU 361 ? K GLU 361 
1090 1 Y 1 L ARG 362 ? K ARG 362 
1091 1 Y 1 L GLU 363 ? K GLU 363 
1092 1 Y 1 L ARG 364 ? K ARG 364 
1093 1 Y 1 L ARG 365 ? K ARG 365 
1094 1 Y 1 L ARG 366 ? K ARG 366 
1095 1 Y 1 L ASP 367 ? K ASP 367 
1096 1 Y 1 L ARG 368 ? K ARG 368 
1097 1 Y 1 L ASP 369 ? K ASP 369 
1098 1 Y 1 L ARG 370 ? K ARG 370 
1099 1 Y 1 L ASP 371 ? K ASP 371 
1100 1 Y 1 L ARG 372 ? K ARG 372 
1101 1 Y 1 L ASP 373 ? K ASP 373 
1102 1 Y 1 L ARG 374 ? K ARG 374 
1103 1 Y 1 L ASP 375 ? K ASP 375 
1104 1 Y 1 L ARG 376 ? K ARG 376 
1105 1 Y 1 L GLU 377 ? K GLU 377 
1106 1 Y 1 L HIS 378 ? K HIS 378 
1107 1 Y 1 L LYS 379 ? K LYS 379 
1108 1 Y 1 L ARG 380 ? K ARG 380 
1109 1 Y 1 L GLY 381 ? K GLY 381 
1110 1 Y 1 L GLU 382 ? K GLU 382 
1111 1 Y 1 L ARG 383 ? K ARG 383 
1112 1 Y 1 L GLY 384 ? K GLY 384 
1113 1 Y 1 L SER 385 ? K SER 385 
1114 1 Y 1 L GLU 386 ? K GLU 386 
1115 1 Y 1 L ARG 387 ? K ARG 387 
1116 1 Y 1 L GLY 388 ? K GLY 388 
1117 1 Y 1 L ARG 389 ? K ARG 389 
1118 1 Y 1 L ASP 390 ? K ASP 390 
1119 1 Y 1 L GLU 391 ? K GLU 391 
1120 1 Y 1 L ALA 392 ? K ALA 392 
1121 1 Y 1 L ARG 393 ? K ARG 393 
1122 1 Y 1 L GLY 394 ? K GLY 394 
1123 1 Y 1 L GLY 395 ? K GLY 395 
1124 1 Y 1 L GLY 396 ? K GLY 396 
1125 1 Y 1 L GLY 397 ? K GLY 397 
1126 1 Y 1 L GLY 398 ? K GLY 398 
1127 1 Y 1 L GLN 399 ? K GLN 399 
1128 1 Y 1 L ASP 400 ? K ASP 400 
1129 1 Y 1 L ASN 401 ? K ASN 401 
1130 1 Y 1 L GLY 402 ? K GLY 402 
1131 1 Y 1 L LEU 403 ? K LEU 403 
1132 1 Y 1 L GLU 404 ? K GLU 404 
1133 1 Y 1 L GLY 405 ? K GLY 405 
1134 1 Y 1 L LEU 406 ? K LEU 406 
1135 1 Y 1 L GLY 407 ? K GLY 407 
1136 1 Y 1 L ASN 408 ? K ASN 408 
1137 1 Y 1 L ASP 409 ? K ASP 409 
1138 1 Y 1 L SER 410 ? K SER 410 
1139 1 Y 1 L ARG 411 ? K ARG 411 
1140 1 Y 1 L ASP 412 ? K ASP 412 
1141 1 Y 1 L MET 413 ? K MET 413 
1142 1 Y 1 L TYR 414 ? K TYR 414 
1143 1 Y 1 L MET 415 ? K MET 415 
1144 1 Y 1 L GLU 416 ? K GLU 416 
1145 1 Y 1 L SER 417 ? K SER 417 
1146 1 Y 1 L GLU 418 ? K GLU 418 
1147 1 Y 1 L GLY 419 ? K GLY 419 
1148 1 Y 1 L GLY 420 ? K GLY 420 
1149 1 Y 1 L ASP 421 ? K ASP 421 
1150 1 Y 1 L GLY 422 ? K GLY 422 
1151 1 Y 1 L TYR 423 ? K TYR 423 
1152 1 Y 1 L LEU 424 ? K LEU 424 
1153 1 Y 1 L ALA 425 ? K ALA 425 
1154 1 Y 1 L PRO 426 ? K PRO 426 
1155 1 Y 1 L GLU 427 ? K GLU 427 
1156 1 Y 1 L ASN 428 ? K ASN 428 
1157 1 Y 1 L GLY 429 ? K GLY 429 
1158 1 Y 1 L TYR 430 ? K TYR 430 
1159 1 Y 1 L LEU 431 ? K LEU 431 
1160 1 Y 1 L MET 432 ? K MET 432 
1161 1 Y 1 L GLU 433 ? K GLU 433 
1162 1 Y 1 L ALA 434 ? K ALA 434 
1163 1 Y 1 L ALA 435 ? K ALA 435 
1164 1 Y 1 L PRO 436 ? K PRO 436 
1165 1 Y 1 L GLU 437 ? K GLU 437 
1166 1 Y 1 W MET 1   ? L MET 1   
1167 1 Y 1 W SER 2   ? L SER 2   
1168 1 Y 1 W ALA 95  ? L ALA 95  
1169 1 Y 1 W GLY 96  ? L GLY 96  
1170 1 Y 1 W ARG 97  ? L ARG 97  
1171 1 Y 1 W GLY 98  ? L GLY 98  
1172 1 Y 1 W LYS 99  ? L LYS 99  
1173 1 Y 1 W ALA 100 ? L ALA 100 
1174 1 Y 1 W ALA 101 ? L ALA 101 
1175 1 Y 1 W ILE 102 ? L ILE 102 
1176 1 Y 1 W LEU 103 ? L LEU 103 
1177 1 Y 1 W LYS 104 ? L LYS 104 
1178 1 Y 1 W ALA 105 ? L ALA 105 
1179 1 Y 1 W GLN 106 ? L GLN 106 
1180 1 Y 1 W VAL 107 ? L VAL 107 
1181 1 Y 1 W ALA 108 ? L ALA 108 
1182 1 Y 1 W ALA 109 ? L ALA 109 
1183 1 Y 1 W ARG 110 ? L ARG 110 
1184 1 Y 1 W GLY 111 ? L GLY 111 
1185 1 Y 1 W ARG 112 ? L ARG 112 
1186 1 Y 1 W GLY 113 ? L GLY 113 
1187 1 Y 1 W ARG 114 ? L ARG 114 
1188 1 Y 1 W GLY 115 ? L GLY 115 
1189 1 Y 1 W MET 116 ? L MET 116 
1190 1 Y 1 W GLY 117 ? L GLY 117 
1191 1 Y 1 W ARG 118 ? L ARG 118 
1192 1 Y 1 W GLY 119 ? L GLY 119 
1193 1 Y 1 W ASN 120 ? L ASN 120 
1194 1 Y 1 W ILE 121 ? L ILE 121 
1195 1 Y 1 W PHE 122 ? L PHE 122 
1196 1 Y 1 W GLN 123 ? L GLN 123 
1197 1 Y 1 W LYS 124 ? L LYS 124 
1198 1 Y 1 W ARG 125 ? L ARG 125 
1199 1 Y 1 W ARG 126 ? L ARG 126 
1200 1 Y 1 Q MET 1   ? M MET 1   
1201 1 Y 1 Q THR 2   ? M THR 2   
1202 1 Y 1 Q VAL 3   ? M VAL 3   
1203 1 Y 1 Q GLY 4   ? M GLY 4   
1204 1 Y 1 Q LYS 54  ? M LYS 54  
1205 1 Y 1 Q ASN 55  ? M ASN 55  
1206 1 Y 1 Q SER 56  ? M SER 56  
1207 1 Y 1 Q LYS 57  ? M LYS 57  
1208 1 Y 1 Q GLN 58  ? M GLN 58  
1209 1 Y 1 Q ALA 59  ? M ALA 59  
1210 1 Y 1 Q GLU 60  ? M GLU 60  
1211 1 Y 1 Q ARG 61  ? M ARG 61  
1212 1 Y 1 Q GLU 62  ? M GLU 62  
1213 1 Y 1 Q GLU 63  ? M GLU 63  
1214 1 Y 1 Q GLY 91  ? M GLY 91  
1215 1 Y 1 Q ILE 92  ? M ILE 92  
1216 1 Y 1 Q ALA 93  ? M ALA 93  
1217 1 Y 1 Q ARG 94  ? M ARG 94  
1218 1 Y 1 Q VAL 95  ? M VAL 95  
1219 1 Y 1 Q PRO 96  ? M PRO 96  
1220 1 Y 1 Q LEU 97  ? M LEU 97  
1221 1 Y 1 Q ALA 98  ? M ALA 98  
1222 1 Y 1 Q GLY 99  ? M GLY 99  
1223 1 Y 1 Q ALA 100 ? M ALA 100 
1224 1 Y 1 Q ALA 101 ? M ALA 101 
1225 1 Y 1 Q GLY 102 ? M GLY 102 
1226 1 Y 1 Q GLY 103 ? M GLY 103 
1227 1 Y 1 Q PRO 104 ? M PRO 104 
1228 1 Y 1 Q GLY 105 ? M GLY 105 
1229 1 Y 1 Q ILE 106 ? M ILE 106 
1230 1 Y 1 Q GLY 107 ? M GLY 107 
1231 1 Y 1 Q ARG 108 ? M ARG 108 
1232 1 Y 1 Q ALA 109 ? M ALA 109 
1233 1 Y 1 Q ALA 110 ? M ALA 110 
1234 1 Y 1 Q GLY 111 ? M GLY 111 
1235 1 Y 1 Q ARG 112 ? M ARG 112 
1236 1 Y 1 Q GLY 113 ? M GLY 113 
1237 1 Y 1 Q ILE 114 ? M ILE 114 
1238 1 Y 1 Q PRO 115 ? M PRO 115 
1239 1 Y 1 Q ALA 116 ? M ALA 116 
1240 1 Y 1 Q GLY 117 ? M GLY 117 
1241 1 Y 1 Q VAL 118 ? M VAL 118 
1242 1 Y 1 Q PRO 119 ? M PRO 119 
1243 1 Y 1 Q MET 120 ? M MET 120 
1244 1 Y 1 Q PRO 121 ? M PRO 121 
1245 1 Y 1 Q GLN 122 ? M GLN 122 
1246 1 Y 1 Q ALA 123 ? M ALA 123 
1247 1 Y 1 Q PRO 124 ? M PRO 124 
1248 1 Y 1 Q ALA 125 ? M ALA 125 
1249 1 Y 1 Q GLY 126 ? M GLY 126 
1250 1 Y 1 Q LEU 127 ? M LEU 127 
1251 1 Y 1 Q ALA 128 ? M ALA 128 
1252 1 Y 1 Q GLY 129 ? M GLY 129 
1253 1 Y 1 Q PRO 130 ? M PRO 130 
1254 1 Y 1 Q VAL 131 ? M VAL 131 
1255 1 Y 1 Q ARG 132 ? M ARG 132 
1256 1 Y 1 Q GLY 133 ? M GLY 133 
1257 1 Y 1 Q VAL 134 ? M VAL 134 
1258 1 Y 1 Q GLY 135 ? M GLY 135 
1259 1 Y 1 Q GLY 136 ? M GLY 136 
1260 1 Y 1 Q PRO 137 ? M PRO 137 
1261 1 Y 1 Q SER 138 ? M SER 138 
1262 1 Y 1 Q GLN 139 ? M GLN 139 
1263 1 Y 1 Q GLN 140 ? M GLN 140 
1264 1 Y 1 Q VAL 141 ? M VAL 141 
1265 1 Y 1 Q MET 142 ? M MET 142 
1266 1 Y 1 Q THR 143 ? M THR 143 
1267 1 Y 1 Q PRO 144 ? M PRO 144 
1268 1 Y 1 Q GLN 145 ? M GLN 145 
1269 1 Y 1 Q GLY 146 ? M GLY 146 
1270 1 Y 1 Q ARG 147 ? M ARG 147 
1271 1 Y 1 Q GLY 148 ? M GLY 148 
1272 1 Y 1 Q THR 149 ? M THR 149 
1273 1 Y 1 Q VAL 150 ? M VAL 150 
1274 1 Y 1 Q ALA 151 ? M ALA 151 
1275 1 Y 1 Q ALA 152 ? M ALA 152 
1276 1 Y 1 Q ALA 153 ? M ALA 153 
1277 1 Y 1 Q ALA 154 ? M ALA 154 
1278 1 Y 1 Q ALA 155 ? M ALA 155 
1279 1 Y 1 Q ALA 156 ? M ALA 156 
1280 1 Y 1 Q ALA 157 ? M ALA 157 
1281 1 Y 1 Q THR 158 ? M THR 158 
1282 1 Y 1 Q ALA 159 ? M ALA 159 
1283 1 Y 1 Q SER 160 ? M SER 160 
1284 1 Y 1 Q ILE 161 ? M ILE 161 
1285 1 Y 1 Q ALA 162 ? M ALA 162 
1286 1 Y 1 Q GLY 163 ? M GLY 163 
1287 1 Y 1 Q ALA 164 ? M ALA 164 
1288 1 Y 1 Q PRO 165 ? M PRO 165 
1289 1 Y 1 Q THR 166 ? M THR 166 
1290 1 Y 1 Q GLN 167 ? M GLN 167 
1291 1 Y 1 Q TYR 168 ? M TYR 168 
1292 1 Y 1 Q PRO 169 ? M PRO 169 
1293 1 Y 1 Q PRO 170 ? M PRO 170 
1294 1 Y 1 Q GLY 171 ? M GLY 171 
1295 1 Y 1 Q ARG 172 ? M ARG 172 
1296 1 Y 1 Q GLY 173 ? M GLY 173 
1297 1 Y 1 Q GLY 174 ? M GLY 174 
1298 1 Y 1 Q PRO 175 ? M PRO 175 
1299 1 Y 1 Q PRO 176 ? M PRO 176 
1300 1 Y 1 Q PRO 177 ? M PRO 177 
1301 1 Y 1 Q PRO 178 ? M PRO 178 
1302 1 Y 1 Q MET 179 ? M MET 179 
1303 1 Y 1 Q GLY 180 ? M GLY 180 
1304 1 Y 1 Q ARG 181 ? M ARG 181 
1305 1 Y 1 Q GLY 182 ? M GLY 182 
1306 1 Y 1 Q ALA 183 ? M ALA 183 
1307 1 Y 1 Q PRO 184 ? M PRO 184 
1308 1 Y 1 Q PRO 185 ? M PRO 185 
1309 1 Y 1 Q PRO 186 ? M PRO 186 
1310 1 Y 1 Q GLY 187 ? M GLY 187 
1311 1 Y 1 Q MET 188 ? M MET 188 
1312 1 Y 1 Q MET 189 ? M MET 189 
1313 1 Y 1 Q GLY 190 ? M GLY 190 
1314 1 Y 1 Q PRO 191 ? M PRO 191 
1315 1 Y 1 Q PRO 192 ? M PRO 192 
1316 1 Y 1 Q PRO 193 ? M PRO 193 
1317 1 Y 1 Q GLY 194 ? M GLY 194 
1318 1 Y 1 Q MET 195 ? M MET 195 
1319 1 Y 1 Q ARG 196 ? M ARG 196 
1320 1 Y 1 Q PRO 197 ? M PRO 197 
1321 1 Y 1 Q PRO 198 ? M PRO 198 
1322 1 Y 1 Q MET 199 ? M MET 199 
1323 1 Y 1 Q GLY 200 ? M GLY 200 
1324 1 Y 1 Q PRO 201 ? M PRO 201 
1325 1 Y 1 Q PRO 202 ? M PRO 202 
1326 1 Y 1 Q MET 203 ? M MET 203 
1327 1 Y 1 Q GLY 204 ? M GLY 204 
1328 1 Y 1 Q ILE 205 ? M ILE 205 
1329 1 Y 1 Q PRO 206 ? M PRO 206 
1330 1 Y 1 Q PRO 207 ? M PRO 207 
1331 1 Y 1 Q GLY 208 ? M GLY 208 
1332 1 Y 1 Q ARG 209 ? M ARG 209 
1333 1 Y 1 Q GLY 210 ? M GLY 210 
1334 1 Y 1 Q THR 211 ? M THR 211 
1335 1 Y 1 Q PRO 212 ? M PRO 212 
1336 1 Y 1 Q MET 213 ? M MET 213 
1337 1 Y 1 Q GLY 214 ? M GLY 214 
1338 1 Y 1 Q MET 215 ? M MET 215 
1339 1 Y 1 Q PRO 216 ? M PRO 216 
1340 1 Y 1 Q PRO 217 ? M PRO 217 
1341 1 Y 1 Q PRO 218 ? M PRO 218 
1342 1 Y 1 Q GLY 219 ? M GLY 219 
1343 1 Y 1 Q MET 220 ? M MET 220 
1344 1 Y 1 Q ARG 221 ? M ARG 221 
1345 1 Y 1 Q PRO 222 ? M PRO 222 
1346 1 Y 1 Q PRO 223 ? M PRO 223 
1347 1 Y 1 Q PRO 224 ? M PRO 224 
1348 1 Y 1 Q PRO 225 ? M PRO 225 
1349 1 Y 1 Q GLY 226 ? M GLY 226 
1350 1 Y 1 Q MET 227 ? M MET 227 
1351 1 Y 1 Q ARG 228 ? M ARG 228 
1352 1 Y 1 Q GLY 229 ? M GLY 229 
1353 1 Y 1 Q LEU 230 ? M LEU 230 
1354 1 Y 1 Q LEU 231 ? M LEU 231 
1355 1 Y 1 U LYS 86  ? N LYS 86  
1356 1 Y 1 U VAL 87  ? N VAL 87  
1357 1 Y 1 U LYS 88  ? N LYS 88  
1358 1 Y 1 U SER 89  ? N SER 89  
1359 1 Y 1 U LYS 90  ? N LYS 90  
1360 1 Y 1 U LYS 91  ? N LYS 91  
1361 1 Y 1 U ARG 92  ? N ARG 92  
1362 1 Y 1 U GLU 93  ? N GLU 93  
1363 1 Y 1 U ALA 94  ? N ALA 94  
1364 1 Y 1 U VAL 95  ? N VAL 95  
1365 1 Y 1 U ALA 96  ? N ALA 96  
1366 1 Y 1 U GLY 97  ? N GLY 97  
1367 1 Y 1 U ARG 98  ? N ARG 98  
1368 1 Y 1 U GLY 99  ? N GLY 99  
1369 1 Y 1 U ARG 100 ? N ARG 100 
1370 1 Y 1 U GLY 101 ? N GLY 101 
1371 1 Y 1 U ARG 102 ? N ARG 102 
1372 1 Y 1 U GLY 103 ? N GLY 103 
1373 1 Y 1 U ARG 104 ? N ARG 104 
1374 1 Y 1 U GLY 105 ? N GLY 105 
1375 1 Y 1 U ARG 106 ? N ARG 106 
1376 1 Y 1 U GLY 107 ? N GLY 107 
1377 1 Y 1 U ARG 108 ? N ARG 108 
1378 1 Y 1 U GLY 109 ? N GLY 109 
1379 1 Y 1 U ARG 110 ? N ARG 110 
1380 1 Y 1 U GLY 111 ? N GLY 111 
1381 1 Y 1 U ARG 112 ? N ARG 112 
1382 1 Y 1 U GLY 113 ? N GLY 113 
1383 1 Y 1 U ARG 114 ? N ARG 114 
1384 1 Y 1 U GLY 115 ? N GLY 115 
1385 1 Y 1 U GLY 116 ? N GLY 116 
1386 1 Y 1 U PRO 117 ? N PRO 117 
1387 1 Y 1 U ARG 118 ? N ARG 118 
1388 1 Y 1 U ARG 119 ? N ARG 119 
1389 1 Y 1 V MET 1   ? O MET 1   
1390 1 Y 1 V VAL 77  ? O VAL 77  
1391 1 Y 1 V PRO 78  ? O PRO 78  
1392 1 Y 1 V LYS 79  ? O LYS 79  
1393 1 Y 1 V SER 80  ? O SER 80  
1394 1 Y 1 V GLY 81  ? O GLY 81  
1395 1 Y 1 V LYS 82  ? O LYS 82  
1396 1 Y 1 V GLY 83  ? O GLY 83  
1397 1 Y 1 V LYS 84  ? O LYS 84  
1398 1 Y 1 V LYS 85  ? O LYS 85  
1399 1 Y 1 V LYS 86  ? O LYS 86  
1400 1 Y 1 V SER 87  ? O SER 87  
1401 1 Y 1 V LYS 88  ? O LYS 88  
1402 1 Y 1 V PRO 89  ? O PRO 89  
1403 1 Y 1 V LYS 118 ? O LYS 118 
1404 1 Y 1 I MET 1   ? P MET 1   
1405 1 Y 1 I GLU 76  ? P GLU 76  
1406 1 Y 1 I GLU 77  ? P GLU 77  
1407 1 Y 1 I GLU 78  ? P GLU 78  
1408 1 Y 1 I GLU 79  ? P GLU 79  
1409 1 Y 1 I GLU 80  ? P GLU 80  
1410 1 Y 1 I ASP 81  ? P ASP 81  
1411 1 Y 1 I GLY 82  ? P GLY 82  
1412 1 Y 1 I GLU 83  ? P GLU 83  
1413 1 Y 1 I MET 84  ? P MET 84  
1414 1 Y 1 I ARG 85  ? P ARG 85  
1415 1 Y 1 I GLU 86  ? P GLU 86  
1416 1 Y 1 H VAL 90  ? Q VAL 90  
1417 1 Y 1 H SER 91  ? Q SER 91  
1418 1 Y 1 H ASN 92  ? Q ASN 92  
1419 1 Y 1 R A   1   ? S A   1   
1420 1 Y 1 N A   1   ? T A   1   
1421 1 Y 1 D DA  1   ? U DA  1   
1422 1 Y 1 M DA  1   ? V DA  1   
# 
loop_
_pdbx_coordinate_model.asym_id 
_pdbx_coordinate_model.type 
A 'CA ATOMS ONLY' 
B 'CA ATOMS ONLY' 
C 'CA ATOMS ONLY' 
D 'CA ATOMS ONLY' 
E 'CA ATOMS ONLY' 
F 'CA ATOMS ONLY' 
G 'CA ATOMS ONLY' 
H 'CA ATOMS ONLY' 
I 'CA ATOMS ONLY' 
J 'CA ATOMS ONLY' 
K 'CA ATOMS ONLY' 
L 'CA ATOMS ONLY' 
M 'CA ATOMS ONLY' 
N 'CA ATOMS ONLY' 
O 'CA ATOMS ONLY' 
P 'CA ATOMS ONLY' 
Q 'CA ATOMS ONLY' 
R 'CA ATOMS ONLY' 
S 'P ATOMS ONLY'  
T 'P ATOMS ONLY'  
U 'P ATOMS ONLY'  
V 'P ATOMS ONLY'  
#