data_3PLA
# 
_entry.id   3PLA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3PLA         
NDB   NA0839       
RCSB  RCSB062511   
WWPDB D_1000062511 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3PLA 
_pdbx_database_status.recvd_initial_deposition_date   2010-11-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lin, J.'   1 
'Lai, S.'   2 
'Jia, R.'   3 
'Xu, A.'    4 
'Zhang, L.' 5 
'Lu, J.'    6 
'Ye, K.'    7 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for site-specific ribose methylation by box C/D RNA protein complexes.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            469 
_citation.page_first                559 
_citation.page_last                 563 
_citation.year                      2011 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21270896 
_citation.pdbx_database_id_DOI      10.1038/nature09688 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lin, J.'   1 ? 
primary 'Lai, S.'   2 ? 
primary 'Jia, R.'   3 ? 
primary 'Xu, A.'    4 ? 
primary 'Zhang, L.' 5 ? 
primary 'Lu, J.'    6 ? 
primary 'Ye, K.'    7 ? 
# 
_cell.entry_id           3PLA 
_cell.length_a           241.199 
_cell.length_b           241.199 
_cell.length_c           145.408 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3PLA 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Pre mRNA splicing protein'                         44168.531 3 ?       M2V 'UNP residues 1-380' ?               
2 polymer     man '50S ribosomal protein L7Ae'                        14075.301 3 ?       N2D ?                    ?               
3 polymer     man 
;Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
;
26439.375 3 2.1.1.- S2A ?                    ?               
4 polymer     syn 'C/D guide RNA'                                     12852.657 3 ?       ?   ?                    ?               
5 polymer     syn 
;RNA (5'-R(*CP*CP*AP*UP*GP*AP*GP*UP*GP*U)-3')
;
3177.932  3 ?       ?   ?                    'Substrate RNA' 
6 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE                           384.411   3 ?       ?   ?                    ?               
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 NOP5 
3 FIB  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MVKIYLIEHVIGAVAYDENGNIVDYITNPRDLGKITEELLNNEKGIPFSATVELLKKVNPQEVVVENEAEVPKLQALGYR
VSYEPYSKVSRIFRESLPKVAIDIKFASNEEDYYNFLHELSLEYTRRKLRSAAQKRDLLAIQAVRAMDDIDKTINLFSER
LREWYSIHFPELDKLIEDHEEYATIVSRFGDRGFLTIDSLKELGFNEQRINRILDAAKKSIGADISEDDLSAMRMIANTI
LDLYNIRRNLNNYLEGVMKEVAPNVTALVGPALGARLLSIAGSLDELAKMPASTIQVLGAEKALFRALRSGGRPPKHGII
FQYPAIHTSPRWQRGKIARALAAKLAIAARVDAFSGRFIGDQLNEQLKKRIDEIKEKFAQHHHHHHHH
;
;MVKIYLIEHVIGAVAYDENGNIVDYITNPRDLGKITEELLNNEKGIPFSATVELLKKVNPQEVVVENEAEVPKLQALGYR
VSYEPYSKVSRIFRESLPKVAIDIKFASNEEDYYNFLHELSLEYTRRKLRSAAQKRDLLAIQAVRAMDDIDKTINLFSER
LREWYSIHFPELDKLIEDHEEYATIVSRFGDRGFLTIDSLKELGFNEQRINRILDAAKKSIGADISEDDLSAMRMIANTI
LDLYNIRRNLNNYLEGVMKEVAPNVTALVGPALGARLLSIAGSLDELAKMPASTIQVLGAEKALFRALRSGGRPPKHGII
FQYPAIHTSPRWQRGKIARALAAKLAIAARVDAFSGRFIGDQLNEQLKKRIDEIKEKFAQHHHHHHHH
;
A,B,K ? 
2 'polypeptide(L)'   no no 
;MDAMSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPY
VYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKTSS
;
;MDAMSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPY
VYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKTSS
;
C,D,L ? 
3 'polypeptide(L)'   no no 
;MAEVITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKV
LYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQT
DIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYKG
;
;MAEVITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKV
LYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQT
DIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYKG
;
E,F,M ? 
4 polyribonucleotide no no GGGAGUCUUGUGAUGAAACACUCAUGGUCUGAAGACUCCC GGGAGUCUUGUGAUGAAACACUCAUGGUCUGAAGACUCCC G,H,N ? 
5 polyribonucleotide no no CCAUGAGUGU CCAUGAGUGU I,J,O ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   LYS n 
1 4   ILE n 
1 5   TYR n 
1 6   LEU n 
1 7   ILE n 
1 8   GLU n 
1 9   HIS n 
1 10  VAL n 
1 11  ILE n 
1 12  GLY n 
1 13  ALA n 
1 14  VAL n 
1 15  ALA n 
1 16  TYR n 
1 17  ASP n 
1 18  GLU n 
1 19  ASN n 
1 20  GLY n 
1 21  ASN n 
1 22  ILE n 
1 23  VAL n 
1 24  ASP n 
1 25  TYR n 
1 26  ILE n 
1 27  THR n 
1 28  ASN n 
1 29  PRO n 
1 30  ARG n 
1 31  ASP n 
1 32  LEU n 
1 33  GLY n 
1 34  LYS n 
1 35  ILE n 
1 36  THR n 
1 37  GLU n 
1 38  GLU n 
1 39  LEU n 
1 40  LEU n 
1 41  ASN n 
1 42  ASN n 
1 43  GLU n 
1 44  LYS n 
1 45  GLY n 
1 46  ILE n 
1 47  PRO n 
1 48  PHE n 
1 49  SER n 
1 50  ALA n 
1 51  THR n 
1 52  VAL n 
1 53  GLU n 
1 54  LEU n 
1 55  LEU n 
1 56  LYS n 
1 57  LYS n 
1 58  VAL n 
1 59  ASN n 
1 60  PRO n 
1 61  GLN n 
1 62  GLU n 
1 63  VAL n 
1 64  VAL n 
1 65  VAL n 
1 66  GLU n 
1 67  ASN n 
1 68  GLU n 
1 69  ALA n 
1 70  GLU n 
1 71  VAL n 
1 72  PRO n 
1 73  LYS n 
1 74  LEU n 
1 75  GLN n 
1 76  ALA n 
1 77  LEU n 
1 78  GLY n 
1 79  TYR n 
1 80  ARG n 
1 81  VAL n 
1 82  SER n 
1 83  TYR n 
1 84  GLU n 
1 85  PRO n 
1 86  TYR n 
1 87  SER n 
1 88  LYS n 
1 89  VAL n 
1 90  SER n 
1 91  ARG n 
1 92  ILE n 
1 93  PHE n 
1 94  ARG n 
1 95  GLU n 
1 96  SER n 
1 97  LEU n 
1 98  PRO n 
1 99  LYS n 
1 100 VAL n 
1 101 ALA n 
1 102 ILE n 
1 103 ASP n 
1 104 ILE n 
1 105 LYS n 
1 106 PHE n 
1 107 ALA n 
1 108 SER n 
1 109 ASN n 
1 110 GLU n 
1 111 GLU n 
1 112 ASP n 
1 113 TYR n 
1 114 TYR n 
1 115 ASN n 
1 116 PHE n 
1 117 LEU n 
1 118 HIS n 
1 119 GLU n 
1 120 LEU n 
1 121 SER n 
1 122 LEU n 
1 123 GLU n 
1 124 TYR n 
1 125 THR n 
1 126 ARG n 
1 127 ARG n 
1 128 LYS n 
1 129 LEU n 
1 130 ARG n 
1 131 SER n 
1 132 ALA n 
1 133 ALA n 
1 134 GLN n 
1 135 LYS n 
1 136 ARG n 
1 137 ASP n 
1 138 LEU n 
1 139 LEU n 
1 140 ALA n 
1 141 ILE n 
1 142 GLN n 
1 143 ALA n 
1 144 VAL n 
1 145 ARG n 
1 146 ALA n 
1 147 MET n 
1 148 ASP n 
1 149 ASP n 
1 150 ILE n 
1 151 ASP n 
1 152 LYS n 
1 153 THR n 
1 154 ILE n 
1 155 ASN n 
1 156 LEU n 
1 157 PHE n 
1 158 SER n 
1 159 GLU n 
1 160 ARG n 
1 161 LEU n 
1 162 ARG n 
1 163 GLU n 
1 164 TRP n 
1 165 TYR n 
1 166 SER n 
1 167 ILE n 
1 168 HIS n 
1 169 PHE n 
1 170 PRO n 
1 171 GLU n 
1 172 LEU n 
1 173 ASP n 
1 174 LYS n 
1 175 LEU n 
1 176 ILE n 
1 177 GLU n 
1 178 ASP n 
1 179 HIS n 
1 180 GLU n 
1 181 GLU n 
1 182 TYR n 
1 183 ALA n 
1 184 THR n 
1 185 ILE n 
1 186 VAL n 
1 187 SER n 
1 188 ARG n 
1 189 PHE n 
1 190 GLY n 
1 191 ASP n 
1 192 ARG n 
1 193 GLY n 
1 194 PHE n 
1 195 LEU n 
1 196 THR n 
1 197 ILE n 
1 198 ASP n 
1 199 SER n 
1 200 LEU n 
1 201 LYS n 
1 202 GLU n 
1 203 LEU n 
1 204 GLY n 
1 205 PHE n 
1 206 ASN n 
1 207 GLU n 
1 208 GLN n 
1 209 ARG n 
1 210 ILE n 
1 211 ASN n 
1 212 ARG n 
1 213 ILE n 
1 214 LEU n 
1 215 ASP n 
1 216 ALA n 
1 217 ALA n 
1 218 LYS n 
1 219 LYS n 
1 220 SER n 
1 221 ILE n 
1 222 GLY n 
1 223 ALA n 
1 224 ASP n 
1 225 ILE n 
1 226 SER n 
1 227 GLU n 
1 228 ASP n 
1 229 ASP n 
1 230 LEU n 
1 231 SER n 
1 232 ALA n 
1 233 MET n 
1 234 ARG n 
1 235 MET n 
1 236 ILE n 
1 237 ALA n 
1 238 ASN n 
1 239 THR n 
1 240 ILE n 
1 241 LEU n 
1 242 ASP n 
1 243 LEU n 
1 244 TYR n 
1 245 ASN n 
1 246 ILE n 
1 247 ARG n 
1 248 ARG n 
1 249 ASN n 
1 250 LEU n 
1 251 ASN n 
1 252 ASN n 
1 253 TYR n 
1 254 LEU n 
1 255 GLU n 
1 256 GLY n 
1 257 VAL n 
1 258 MET n 
1 259 LYS n 
1 260 GLU n 
1 261 VAL n 
1 262 ALA n 
1 263 PRO n 
1 264 ASN n 
1 265 VAL n 
1 266 THR n 
1 267 ALA n 
1 268 LEU n 
1 269 VAL n 
1 270 GLY n 
1 271 PRO n 
1 272 ALA n 
1 273 LEU n 
1 274 GLY n 
1 275 ALA n 
1 276 ARG n 
1 277 LEU n 
1 278 LEU n 
1 279 SER n 
1 280 ILE n 
1 281 ALA n 
1 282 GLY n 
1 283 SER n 
1 284 LEU n 
1 285 ASP n 
1 286 GLU n 
1 287 LEU n 
1 288 ALA n 
1 289 LYS n 
1 290 MET n 
1 291 PRO n 
1 292 ALA n 
1 293 SER n 
1 294 THR n 
1 295 ILE n 
1 296 GLN n 
1 297 VAL n 
1 298 LEU n 
1 299 GLY n 
1 300 ALA n 
1 301 GLU n 
1 302 LYS n 
1 303 ALA n 
1 304 LEU n 
1 305 PHE n 
1 306 ARG n 
1 307 ALA n 
1 308 LEU n 
1 309 ARG n 
1 310 SER n 
1 311 GLY n 
1 312 GLY n 
1 313 ARG n 
1 314 PRO n 
1 315 PRO n 
1 316 LYS n 
1 317 HIS n 
1 318 GLY n 
1 319 ILE n 
1 320 ILE n 
1 321 PHE n 
1 322 GLN n 
1 323 TYR n 
1 324 PRO n 
1 325 ALA n 
1 326 ILE n 
1 327 HIS n 
1 328 THR n 
1 329 SER n 
1 330 PRO n 
1 331 ARG n 
1 332 TRP n 
1 333 GLN n 
1 334 ARG n 
1 335 GLY n 
1 336 LYS n 
1 337 ILE n 
1 338 ALA n 
1 339 ARG n 
1 340 ALA n 
1 341 LEU n 
1 342 ALA n 
1 343 ALA n 
1 344 LYS n 
1 345 LEU n 
1 346 ALA n 
1 347 ILE n 
1 348 ALA n 
1 349 ALA n 
1 350 ARG n 
1 351 VAL n 
1 352 ASP n 
1 353 ALA n 
1 354 PHE n 
1 355 SER n 
1 356 GLY n 
1 357 ARG n 
1 358 PHE n 
1 359 ILE n 
1 360 GLY n 
1 361 ASP n 
1 362 GLN n 
1 363 LEU n 
1 364 ASN n 
1 365 GLU n 
1 366 GLN n 
1 367 LEU n 
1 368 LYS n 
1 369 LYS n 
1 370 ARG n 
1 371 ILE n 
1 372 ASP n 
1 373 GLU n 
1 374 ILE n 
1 375 LYS n 
1 376 GLU n 
1 377 LYS n 
1 378 PHE n 
1 379 ALA n 
1 380 GLN n 
1 381 HIS n 
1 382 HIS n 
1 383 HIS n 
1 384 HIS n 
1 385 HIS n 
1 386 HIS n 
1 387 HIS n 
1 388 HIS n 
2 1   MET n 
2 2   ASP n 
2 3   ALA n 
2 4   MET n 
2 5   SER n 
2 6   LYS n 
2 7   ALA n 
2 8   SER n 
2 9   TYR n 
2 10  VAL n 
2 11  LYS n 
2 12  PHE n 
2 13  GLU n 
2 14  VAL n 
2 15  PRO n 
2 16  GLN n 
2 17  ASP n 
2 18  LEU n 
2 19  ALA n 
2 20  ASP n 
2 21  LYS n 
2 22  VAL n 
2 23  LEU n 
2 24  GLU n 
2 25  ALA n 
2 26  VAL n 
2 27  ARG n 
2 28  LYS n 
2 29  ALA n 
2 30  LYS n 
2 31  GLU n 
2 32  SER n 
2 33  GLY n 
2 34  LYS n 
2 35  ILE n 
2 36  LYS n 
2 37  LYS n 
2 38  GLY n 
2 39  THR n 
2 40  ASN n 
2 41  GLU n 
2 42  THR n 
2 43  THR n 
2 44  LYS n 
2 45  ALA n 
2 46  VAL n 
2 47  GLU n 
2 48  ARG n 
2 49  GLY n 
2 50  GLN n 
2 51  ALA n 
2 52  LYS n 
2 53  LEU n 
2 54  VAL n 
2 55  ILE n 
2 56  ILE n 
2 57  ALA n 
2 58  GLU n 
2 59  ASP n 
2 60  VAL n 
2 61  GLN n 
2 62  PRO n 
2 63  GLU n 
2 64  GLU n 
2 65  ILE n 
2 66  VAL n 
2 67  ALA n 
2 68  HIS n 
2 69  LEU n 
2 70  PRO n 
2 71  LEU n 
2 72  LEU n 
2 73  CYS n 
2 74  ASP n 
2 75  GLU n 
2 76  LYS n 
2 77  LYS n 
2 78  ILE n 
2 79  PRO n 
2 80  TYR n 
2 81  VAL n 
2 82  TYR n 
2 83  VAL n 
2 84  SER n 
2 85  SER n 
2 86  LYS n 
2 87  LYS n 
2 88  ALA n 
2 89  LEU n 
2 90  GLY n 
2 91  GLU n 
2 92  ALA n 
2 93  CYS n 
2 94  GLY n 
2 95  LEU n 
2 96  GLN n 
2 97  VAL n 
2 98  ALA n 
2 99  THR n 
2 100 ALA n 
2 101 SER n 
2 102 ALA n 
2 103 ALA n 
2 104 ILE n 
2 105 LEU n 
2 106 GLU n 
2 107 PRO n 
2 108 GLY n 
2 109 GLU n 
2 110 ALA n 
2 111 LYS n 
2 112 ASP n 
2 113 LEU n 
2 114 VAL n 
2 115 ASP n 
2 116 GLU n 
2 117 ILE n 
2 118 ILE n 
2 119 LYS n 
2 120 ARG n 
2 121 VAL n 
2 122 ASN n 
2 123 GLU n 
2 124 ILE n 
2 125 LYS n 
2 126 GLY n 
2 127 LYS n 
2 128 THR n 
2 129 SER n 
2 130 SER n 
3 1   MET n 
3 2   ALA n 
3 3   GLU n 
3 4   VAL n 
3 5   ILE n 
3 6   THR n 
3 7   VAL n 
3 8   LYS n 
3 9   GLN n 
3 10  THR n 
3 11  ASN n 
3 12  MET n 
3 13  GLU n 
3 14  ASN n 
3 15  ILE n 
3 16  TYR n 
3 17  GLU n 
3 18  CYS n 
3 19  GLU n 
3 20  PHE n 
3 21  ASN n 
3 22  ASP n 
3 23  GLY n 
3 24  SER n 
3 25  PHE n 
3 26  ARG n 
3 27  LEU n 
3 28  CYS n 
3 29  THR n 
3 30  ARG n 
3 31  ASN n 
3 32  LEU n 
3 33  VAL n 
3 34  PRO n 
3 35  ASN n 
3 36  PHE n 
3 37  ASN n 
3 38  VAL n 
3 39  TYR n 
3 40  GLY n 
3 41  GLU n 
3 42  ARG n 
3 43  LEU n 
3 44  ILE n 
3 45  LYS n 
3 46  TYR n 
3 47  GLU n 
3 48  GLY n 
3 49  VAL n 
3 50  GLU n 
3 51  TYR n 
3 52  ARG n 
3 53  GLU n 
3 54  TRP n 
3 55  ASN n 
3 56  ALA n 
3 57  PHE n 
3 58  ARG n 
3 59  SER n 
3 60  LYS n 
3 61  LEU n 
3 62  ALA n 
3 63  GLY n 
3 64  ALA n 
3 65  ILE n 
3 66  LEU n 
3 67  LYS n 
3 68  GLY n 
3 69  LEU n 
3 70  LYS n 
3 71  THR n 
3 72  ASN n 
3 73  PRO n 
3 74  ILE n 
3 75  ARG n 
3 76  LYS n 
3 77  GLY n 
3 78  THR n 
3 79  LYS n 
3 80  VAL n 
3 81  LEU n 
3 82  TYR n 
3 83  LEU n 
3 84  GLY n 
3 85  ALA n 
3 86  ALA n 
3 87  SER n 
3 88  GLY n 
3 89  THR n 
3 90  THR n 
3 91  ILE n 
3 92  SER n 
3 93  HIS n 
3 94  VAL n 
3 95  SER n 
3 96  ASP n 
3 97  ILE n 
3 98  ILE n 
3 99  GLU n 
3 100 LEU n 
3 101 ASN n 
3 102 GLY n 
3 103 LYS n 
3 104 ALA n 
3 105 TYR n 
3 106 GLY n 
3 107 VAL n 
3 108 GLU n 
3 109 PHE n 
3 110 SER n 
3 111 PRO n 
3 112 ARG n 
3 113 VAL n 
3 114 VAL n 
3 115 ARG n 
3 116 GLU n 
3 117 LEU n 
3 118 LEU n 
3 119 LEU n 
3 120 VAL n 
3 121 ALA n 
3 122 GLN n 
3 123 ARG n 
3 124 ARG n 
3 125 PRO n 
3 126 ASN n 
3 127 ILE n 
3 128 PHE n 
3 129 PRO n 
3 130 LEU n 
3 131 LEU n 
3 132 ALA n 
3 133 ASP n 
3 134 ALA n 
3 135 ARG n 
3 136 PHE n 
3 137 PRO n 
3 138 GLN n 
3 139 SER n 
3 140 TYR n 
3 141 LYS n 
3 142 SER n 
3 143 VAL n 
3 144 VAL n 
3 145 GLU n 
3 146 ASN n 
3 147 VAL n 
3 148 ASP n 
3 149 VAL n 
3 150 LEU n 
3 151 TYR n 
3 152 VAL n 
3 153 ASP n 
3 154 ILE n 
3 155 ALA n 
3 156 GLN n 
3 157 PRO n 
3 158 ASP n 
3 159 GLN n 
3 160 THR n 
3 161 ASP n 
3 162 ILE n 
3 163 ALA n 
3 164 ILE n 
3 165 TYR n 
3 166 ASN n 
3 167 ALA n 
3 168 LYS n 
3 169 PHE n 
3 170 PHE n 
3 171 LEU n 
3 172 LYS n 
3 173 VAL n 
3 174 ASN n 
3 175 GLY n 
3 176 ASP n 
3 177 MET n 
3 178 LEU n 
3 179 LEU n 
3 180 VAL n 
3 181 ILE n 
3 182 LYS n 
3 183 ALA n 
3 184 ARG n 
3 185 SER n 
3 186 ILE n 
3 187 ASP n 
3 188 VAL n 
3 189 THR n 
3 190 LYS n 
3 191 ASP n 
3 192 PRO n 
3 193 LYS n 
3 194 GLU n 
3 195 ILE n 
3 196 TYR n 
3 197 LYS n 
3 198 THR n 
3 199 GLU n 
3 200 VAL n 
3 201 GLU n 
3 202 LYS n 
3 203 LEU n 
3 204 GLU n 
3 205 ASN n 
3 206 SER n 
3 207 ASN n 
3 208 PHE n 
3 209 GLU n 
3 210 THR n 
3 211 ILE n 
3 212 GLN n 
3 213 ILE n 
3 214 ILE n 
3 215 ASN n 
3 216 LEU n 
3 217 ASP n 
3 218 PRO n 
3 219 TYR n 
3 220 ASP n 
3 221 LYS n 
3 222 ASP n 
3 223 HIS n 
3 224 ALA n 
3 225 ILE n 
3 226 VAL n 
3 227 LEU n 
3 228 SER n 
3 229 LYS n 
3 230 TYR n 
3 231 LYS n 
3 232 GLY n 
4 1   G   n 
4 2   G   n 
4 3   G   n 
4 4   A   n 
4 5   G   n 
4 6   U   n 
4 7   C   n 
4 8   U   n 
4 9   U   n 
4 10  G   n 
4 11  U   n 
4 12  G   n 
4 13  A   n 
4 14  U   n 
4 15  G   n 
4 16  A   n 
4 17  A   n 
4 18  A   n 
4 19  C   n 
4 20  A   n 
4 21  C   n 
4 22  U   n 
4 23  C   n 
4 24  A   n 
4 25  U   n 
4 26  G   n 
4 27  G   n 
4 28  U   n 
4 29  C   n 
4 30  U   n 
4 31  G   n 
4 32  A   n 
4 33  A   n 
4 34  G   n 
4 35  A   n 
4 36  C   n 
4 37  U   n 
4 38  C   n 
4 39  C   n 
4 40  C   n 
5 1   C   n 
5 2   C   n 
5 3   A   n 
5 4   U   n 
5 5   G   n 
5 6   A   n 
5 7   G   n 
5 8   U   n 
5 9   G   n 
5 10  U   n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? SSO0939                  ? ?    ? ? ? ? 'Sulfolobus solfataricus' 2287   ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? 'BL21(DE3)/RIL+' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
2 1 sample ? ? ? ? ? 'rpl7ae, Ssol_1068'      ? 98/2 ? ? ? ? 'Sulfolobus solfataricus' 555311 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? 'BL21(DE3)/RIL+' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
3 1 sample ? ? ? ? ? 'flpA, SSO0940, C33_014' ? ?    ? ? ? ? 'Sulfolobus solfataricus' 2287   ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? 'BL21(DE3)/RIL+' ? ? ? ? ? ? ? plasmid ? ? ? pET28A ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
4 1 sample ? ? 'synthetic construct' ? 32630 'In vitro transcription' 
5 1 sample ? ? 'synthetic construct' ? 32630 'Chemical synthesis'     
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q97ZH3_SULSO Q97ZH3 1 
;MMKIYLIEHVIGAVAYDENGNIVDYITNPRDLGKITEELLNNEKGIPFSATVELLKKVNPQEVVVENEAEVPKLQALGYR
VSYEPYSKVSRIFRESLPKVAIDIKFASNEEDYYNFLHELSLEYTRRKLRSAAQKRDLLAIQAVRAMDDIDKTINLFSER
LREWYSIHFPELDKLIEDHEEYATIVSRFGDRGFLTIDSLKELGFNEQRINRILDAAKKSIGADISEDDLSAMRMIANTI
LDLYNIRRNLNNYLEGVMKEVAPNVTALVGPALGARLLSIAGSLDELAKMPASTIQVLGAEKALFRALRSGGRPPKHGII
FQYPAIHTSPRWQRGKIARALAAKLAIAARVDAFSGRFIGDQLNEQLKKRIDEIKEKFAQ
;
1 ? 
2 UNP D0KRE2_SULS9 D0KRE2 2 
;MNAMSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPY
VYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKTSS
;
1 ? 
3 UNP FLPA_SULSO   P58032 3 
;MSEVITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKV
LYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQT
DIAIYNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYKG
;
1 ? 
4 PDB 3PLA         3PLA   4 GGGAGUCUUGUGAUGAAACACUCAUGGUCUGAAGACUCCC 1 ? 
5 PDB 3PLA         3PLA   5 CCAUGAGUGU 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3PLA A 1 ? 380 ? Q97ZH3 1 ? 380 ? 1 380 
2  1 3PLA B 1 ? 380 ? Q97ZH3 1 ? 380 ? 1 380 
3  2 3PLA C 1 ? 130 ? D0KRE2 1 ? 130 ? 1 130 
4  2 3PLA D 1 ? 130 ? D0KRE2 1 ? 130 ? 1 130 
5  3 3PLA E 1 ? 232 ? P58032 1 ? 232 ? 1 232 
6  3 3PLA F 1 ? 232 ? P58032 1 ? 232 ? 1 232 
7  4 3PLA G 1 ? 40  ? 3PLA   1 ? 40  ? 1 40  
8  4 3PLA H 1 ? 40  ? 3PLA   1 ? 40  ? 1 40  
9  5 3PLA I 1 ? 10  ? 3PLA   1 ? 10  ? 1 10  
10 5 3PLA J 1 ? 10  ? 3PLA   1 ? 10  ? 1 10  
11 1 3PLA K 1 ? 380 ? Q97ZH3 1 ? 380 ? 1 380 
12 2 3PLA L 1 ? 130 ? D0KRE2 1 ? 130 ? 1 130 
13 3 3PLA M 1 ? 232 ? P58032 1 ? 232 ? 1 232 
14 4 3PLA N 1 ? 40  ? 3PLA   1 ? 40  ? 1 40  
15 5 3PLA O 1 ? 10  ? 3PLA   1 ? 10  ? 1 10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  3PLA VAL A 2   ? UNP Q97ZH3 MET 2 'ENGINEERED MUTATION' 2   1  
1  3PLA HIS A 381 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      381 2  
1  3PLA HIS A 382 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      382 3  
1  3PLA HIS A 383 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      383 4  
1  3PLA HIS A 384 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      384 5  
1  3PLA HIS A 385 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      385 6  
1  3PLA HIS A 386 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      386 7  
1  3PLA HIS A 387 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      387 8  
1  3PLA HIS A 388 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      388 9  
2  3PLA VAL B 2   ? UNP Q97ZH3 MET 2 'ENGINEERED MUTATION' 2   10 
2  3PLA HIS B 381 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      381 11 
2  3PLA HIS B 382 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      382 12 
2  3PLA HIS B 383 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      383 13 
2  3PLA HIS B 384 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      384 14 
2  3PLA HIS B 385 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      385 15 
2  3PLA HIS B 386 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      386 16 
2  3PLA HIS B 387 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      387 17 
2  3PLA HIS B 388 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      388 18 
3  3PLA ASP C 2   ? UNP D0KRE2 ASN 2 'ENGINEERED MUTATION' 2   19 
4  3PLA ASP D 2   ? UNP D0KRE2 ASN 2 'ENGINEERED MUTATION' 2   20 
5  3PLA ALA E 2   ? UNP P58032 SER 2 'ENGINEERED MUTATION' 2   21 
6  3PLA ALA F 2   ? UNP P58032 SER 2 'ENGINEERED MUTATION' 2   22 
11 3PLA VAL K 2   ? UNP Q97ZH3 MET 2 'ENGINEERED MUTATION' 2   23 
11 3PLA HIS K 381 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      381 24 
11 3PLA HIS K 382 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      382 25 
11 3PLA HIS K 383 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      383 26 
11 3PLA HIS K 384 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      384 27 
11 3PLA HIS K 385 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      385 28 
11 3PLA HIS K 386 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      386 29 
11 3PLA HIS K 387 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      387 30 
11 3PLA HIS K 388 ? UNP Q97ZH3 ?   ? 'EXPRESSION TAG'      388 31 
12 3PLA ASP L 2   ? UNP D0KRE2 ASN 2 'ENGINEERED MUTATION' 2   32 
13 3PLA ALA M 2   ? UNP P58032 SER 2 'ENGINEERED MUTATION' 2   33 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE    ? 'C14 H20 N6 O5 S' 384.411 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3PLA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.50 
_exptl_crystal.density_percent_sol   64.85 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'2.0M (NH4)2SO4, 2% PEG 400, 10mM MgCl2, 0.1M HEPES-Na (pH 6.0), VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX-225' 
_diffrn_detector.pdbx_collection_date   2010-07-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9789 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9789 
# 
_reflns.entry_id                     3PLA 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            3.15 
_reflns.number_obs                   70682 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.1 
_reflns.pdbx_Rmerge_I_obs            0.095 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.3 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.15 
_reflns_shell.d_res_low              3.2 
_reflns_shell.percent_possible_all   94.4 
_reflns_shell.Rmerge_I_obs           0.536 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_redundancy        4.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3PLA 
_refine.ls_number_reflns_obs                     66836 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.91 
_refine.ls_d_res_high                            3.15 
_refine.ls_percent_reflns_obs                    95.11 
_refine.ls_R_factor_obs                          0.24928 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.24776 
_refine.ls_R_factor_R_free                       0.27761 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3540 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.914 
_refine.correlation_coeff_Fo_to_Fc_free          0.890 
_refine.B_iso_mean                               88.687 
_refine.aniso_B[1][1]                            -1.18 
_refine.aniso_B[2][2]                            -1.18 
_refine.aniso_B[3][3]                            2.36 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRIES 3ICX, 3ID6, 3ID5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.495 
_refine.overall_SU_ML                            0.408 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             52.016 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        17247 
_refine_hist.pdbx_number_atoms_nucleic_acid   2721 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               20046 
_refine_hist.d_res_high                       3.15 
_refine_hist.d_res_low                        19.91 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.009  0.022  ? 20649 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.324  2.154  ? 28505 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.538  5.000  ? 2163  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.770 24.366 ? 804   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       20.228 15.000 ? 3282  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.803 15.000 ? 129   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.094  0.200  ? 3352  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 14372 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.698  1.500  ? 10836 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.066  2.000  ? 17508 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.920  3.000  ? 9813  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.599  4.500  ? 10997 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
'X-RAY DIFFRACTION' 1  1 'TIGHT POSITIONAL' A 1059 0.060  0.100  1  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 1  1 'TIGHT POSITIONAL' B 1059 0.050  0.100  2  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 1  1 'TIGHT POSITIONAL' K 1059 0.050  0.100  3  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 1  1 'TIGHT THERMAL'    A 1059 11.520 40.000 4  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 1  1 'TIGHT THERMAL'    B 1059 8.170  40.000 5  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 1  1 'TIGHT THERMAL'    K 1059 19.280 40.000 6  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2  1 'TIGHT POSITIONAL' A 448  0.070  0.100  7  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2  1 'TIGHT POSITIONAL' B 448  0.070  0.100  8  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2  1 'TIGHT POSITIONAL' K 448  0.070  0.100  9  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2  1 'TIGHT THERMAL'    A 448  5.730  40.000 10 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2  1 'TIGHT THERMAL'    B 448  7.620  40.000 11 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2  1 'TIGHT THERMAL'    K 448  11.950 40.000 12 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3  1 'TIGHT POSITIONAL' A 677  0.070  0.100  13 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3  2 'TIGHT POSITIONAL' B 677  0.080  0.100  14 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3  3 'TIGHT POSITIONAL' K 677  0.070  0.100  15 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3  1 'TIGHT THERMAL'    A 677  3.870  40.000 16 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3  2 'TIGHT THERMAL'    B 677  18.250 40.000 17 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3  3 'TIGHT THERMAL'    K 677  16.970 40.000 18 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 4  1 'TIGHT POSITIONAL' C 927  0.060  0.100  19 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 4  1 'TIGHT POSITIONAL' D 927  0.070  0.100  20 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 4  1 'TIGHT POSITIONAL' L 927  0.050  0.100  21 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 4  1 'TIGHT THERMAL'    C 927  3.570  40.000 22 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 4  1 'TIGHT THERMAL'    D 927  20.910 40.000 23 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 4  1 'TIGHT THERMAL'    L 927  21.120 40.000 24 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 5  1 'TIGHT POSITIONAL' E 1855 0.080  0.100  25 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 5  1 'TIGHT POSITIONAL' F 1855 0.070  0.100  26 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 5  1 'TIGHT POSITIONAL' M 1855 0.060  0.100  27 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 5  1 'TIGHT THERMAL'    E 1855 15.730 40.000 28 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 5  1 'TIGHT THERMAL'    F 1855 6.940  40.000 29 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 5  1 'TIGHT THERMAL'    M 1855 21.870 40.000 30 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 6  1 'TIGHT POSITIONAL' G 175  0.110  0.100  31 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 6  1 'TIGHT POSITIONAL' H 175  0.180  0.100  32 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 6  1 'TIGHT POSITIONAL' N 175  0.100  0.100  33 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 6  1 'TIGHT THERMAL'    G 175  23.640 40.000 34 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 6  1 'TIGHT THERMAL'    H 175  3.950  40.000 35 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 6  1 'TIGHT THERMAL'    N 175  20.260 40.000 36 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 7  1 'TIGHT POSITIONAL' G 212  0.160  0.100  37 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 7  1 'TIGHT POSITIONAL' H 212  0.290  0.100  38 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 7  1 'TIGHT POSITIONAL' N 212  0.160  0.100  39 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 7  1 'TIGHT THERMAL'    G 212  12.030 40.000 40 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 7  1 'TIGHT THERMAL'    H 212  7.760  40.000 41 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 7  1 'TIGHT THERMAL'    N 212  17.160 40.000 42 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 8  1 'TIGHT POSITIONAL' G 105  0.130  0.100  43 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 8  1 'TIGHT POSITIONAL' H 105  0.240  0.100  44 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 8  1 'TIGHT POSITIONAL' N 105  0.130  0.100  45 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 8  1 'TIGHT THERMAL'    G 105  5.290  40.000 46 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 8  1 'TIGHT THERMAL'    H 105  23.000 40.000 47 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 8  1 'TIGHT THERMAL'    N 105  20.880 40.000 48 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 9  1 'TIGHT POSITIONAL' C 210  0.080  0.100  49 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 9  1 'TIGHT POSITIONAL' I 210  0.080  0.100  50 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 9  1 'TIGHT POSITIONAL' J 210  0.070  0.100  51 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 9  1 'TIGHT THERMAL'    C 210  13.950 40.000 52 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 9  1 'TIGHT THERMAL'    I 210  6.200  40.000 53 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 9  1 'TIGHT THERMAL'    J 210  19.690 40.000 54 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 10 1 'TIGHT POSITIONAL' A 160  0.060  0.100  55 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 10 1 'TIGHT POSITIONAL' B 160  0.080  0.100  56 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 10 1 'TIGHT POSITIONAL' K 160  0.060  0.100  57 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 10 1 'TIGHT THERMAL'    A 160  8.160  40.000 58 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 10 1 'TIGHT THERMAL'    B 160  23.170 40.000 59 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 10 1 'TIGHT THERMAL'    K 160  15.120 40.000 60 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 11 1 'TIGHT POSITIONAL' A 439  0.080  0.100  61 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 11 1 'TIGHT POSITIONAL' B 439  0.070  0.100  62 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 11 1 'TIGHT POSITIONAL' K 439  0.070  0.100  63 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 11 1 'TIGHT THERMAL'    A 439  8.550  40.000 64 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 11 1 'TIGHT THERMAL'    B 439  8.770  40.000 65 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 11 1 'TIGHT THERMAL'    K 439  10.330 40.000 66 ? ? ? ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.150 
_refine_ls_shell.d_res_low                        3.230 
_refine_ls_shell.number_reflns_R_work             4702 
_refine_ls_shell.R_factor_R_work                  0.308 
_refine_ls_shell.percent_reflns_obs               93.68 
_refine_ls_shell.R_factor_R_free                  0.344 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             276 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1  1 A 
1  2 B 
1  3 K 
2  1 A 
2  2 B 
2  3 K 
3  1 A 
3  2 B 
3  3 K 
4  1 C 
4  2 D 
4  3 L 
5  1 E 
5  2 F 
5  3 M 
6  1 G 
6  2 H 
6  3 N 
7  1 G 
7  2 H 
7  3 N 
8  1 G 
8  2 H 
8  3 N 
9  1 I 
9  2 J 
9  3 O 
10 1 A 
10 2 B 
10 3 K 
11 1 A 
11 2 B 
11 3 K 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1  1 1 1 A 1   A 132 ? . . . . . . . . 
1  2 1 1 B 1   B 132 ? . . . . . . . . 
1  3 1 1 K 1   K 132 ? . . . . . . . . 
2  1 1 1 A 133 A 185 ? . . . . . . . . 
2  2 1 1 B 133 B 185 ? . . . . . . . . 
2  3 1 1 K 133 K 185 ? . . . . . . . . 
3  1 1 1 A 262 A 353 ? . . . . . . . . 
3  2 1 1 B 262 B 353 ? . . . . . . . . 
3  3 1 1 K 262 K 353 ? . . . . . . . . 
4  1 1 1 C 7   C 128 ? . . . . . . . . 
4  2 1 1 D 7   D 128 ? . . . . . . . . 
4  3 1 1 L 7   L 128 ? . . . . . . . . 
5  1 1 1 E 5   E 301 ? . . . . . . . . 
5  2 1 1 F 5   F 301 ? . . . . . . . . 
5  3 1 1 M 5   M 301 ? . . . . . . . . 
6  1 1 1 G 10  G 17  ? . . . . . . . . 
6  2 1 1 H 10  H 17  ? . . . . . . . . 
6  3 1 1 N 10  N 17  ? . . . . . . . . 
7  1 1 1 G 18  G 27  ? . . . . . . . . 
7  2 1 1 H 18  H 27  ? . . . . . . . . 
7  3 1 1 N 18  N 27  ? . . . . . . . . 
8  1 1 1 G 28  G 32  ? . . . . . . . . 
8  2 1 1 H 28  H 32  ? . . . . . . . . 
8  3 1 1 N 28  N 32  ? . . . . . . . . 
9  1 1 1 I 1   I 10  ? . . . . . . . . 
9  2 1 1 J 1   J 10  ? . . . . . . . . 
9  3 1 1 O 1   O 10  ? . . . . . . . . 
10 1 1 1 A 359 A 377 ? . . . . . . . . 
10 2 1 1 B 359 B 377 ? . . . . . . . . 
10 3 1 1 K 359 K 377 ? . . . . . . . . 
11 1 1 1 A 207 A 261 ? . . . . . . . . 
11 2 1 1 B 207 B 261 ? . . . . . . . . 
11 3 1 1 K 207 K 261 ? . . . . . . . . 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
# 
_struct.entry_id                  3PLA 
_struct.title                     
'Crystal structure of a catalytically active substrate-bound box C/D RNP from Sulfolobus solfataricus' 
_struct.pdbx_descriptor           
;Pre mRNA splicing protein, 50S ribosomal protein L7Ae, Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase (E.C.2.1.1.-)/RNA complex
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3PLA 
_struct_keywords.pdbx_keywords   TRANSFERASE/RNA 
_struct_keywords.text            
'RNA-binding, METHYLTRANSFERASE, SAM, Box C/D RNA, Guide RNA, RNA-Protein complex, TRANSFERASE-RNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 1 ? 
L N N 2 ? 
M N N 3 ? 
N N N 4 ? 
O N N 5 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ASP A 31  ? LYS A 44  ? ASP A 31  LYS A 44  1 ? 14 
HELX_P HELX_P2   2   PHE A 48  ? VAL A 58  ? PHE A 48  VAL A 58  1 ? 11 
HELX_P HELX_P3   3   GLU A 70  ? LEU A 77  ? GLU A 70  LEU A 77  1 ? 8  
HELX_P HELX_P4   4   SER A 87  ? SER A 96  ? SER A 87  SER A 96  1 ? 10 
HELX_P HELX_P5   5   LYS A 99  ? ILE A 104 ? LYS A 99  ILE A 104 1 ? 6  
HELX_P HELX_P6   6   GLU A 110 ? GLN A 134 ? GLU A 110 GLN A 134 1 ? 25 
HELX_P HELX_P7   7   ARG A 136 ? SER A 166 ? ARG A 136 SER A 166 1 ? 31 
HELX_P HELX_P8   8   ILE A 167 ? HIS A 168 ? ILE A 167 HIS A 168 5 ? 2  
HELX_P HELX_P9   9   PHE A 169 ? ASP A 173 ? PHE A 169 ASP A 173 5 ? 5  
HELX_P HELX_P10  10  ASP A 178 ? PHE A 189 ? ASP A 178 PHE A 189 1 ? 12 
HELX_P HELX_P11  11  ASP A 191 ? LEU A 195 ? ASP A 191 LEU A 195 5 ? 5  
HELX_P HELX_P12  12  THR A 196 ? GLU A 202 ? THR A 196 GLU A 202 1 ? 7  
HELX_P HELX_P13  13  ASN A 206 ? LYS A 219 ? ASN A 206 LYS A 219 1 ? 14 
HELX_P HELX_P14  14  SER A 226 ? ALA A 262 ? SER A 226 ALA A 262 1 ? 37 
HELX_P HELX_P15  15  ALA A 262 ? GLY A 282 ? ALA A 262 GLY A 282 1 ? 21 
HELX_P HELX_P16  16  SER A 283 ? LYS A 289 ? SER A 283 LYS A 289 1 ? 7  
HELX_P HELX_P17  17  PRO A 291 ? GLN A 296 ? PRO A 291 GLN A 296 1 ? 6  
HELX_P HELX_P18  18  ALA A 300 ? GLY A 311 ? ALA A 300 GLY A 311 1 ? 12 
HELX_P HELX_P19  19  GLY A 318 ? GLN A 322 ? GLY A 318 GLN A 322 5 ? 5  
HELX_P HELX_P20  20  TYR A 323 ? SER A 329 ? TYR A 323 SER A 329 1 ? 7  
HELX_P HELX_P21  21  PRO A 330 ? PHE A 354 ? PRO A 330 PHE A 354 1 ? 25 
HELX_P HELX_P22  22  ILE A 359 ? GLU A 376 ? ILE A 359 GLU A 376 1 ? 18 
HELX_P HELX_P23  23  ASP B 31  ? GLU B 43  ? ASP B 31  GLU B 43  1 ? 13 
HELX_P HELX_P24  24  PHE B 48  ? VAL B 58  ? PHE B 48  VAL B 58  1 ? 11 
HELX_P HELX_P25  25  GLU B 70  ? ALA B 76  ? GLU B 70  ALA B 76  1 ? 7  
HELX_P HELX_P26  26  SER B 87  ? SER B 96  ? SER B 87  SER B 96  1 ? 10 
HELX_P HELX_P27  27  LYS B 99  ? ILE B 104 ? LYS B 99  ILE B 104 1 ? 6  
HELX_P HELX_P28  28  GLU B 110 ? GLN B 134 ? GLU B 110 GLN B 134 1 ? 25 
HELX_P HELX_P29  29  ARG B 136 ? SER B 166 ? ARG B 136 SER B 166 1 ? 31 
HELX_P HELX_P30  30  ILE B 167 ? HIS B 168 ? ILE B 167 HIS B 168 5 ? 2  
HELX_P HELX_P31  31  PHE B 169 ? ASP B 173 ? PHE B 169 ASP B 173 5 ? 5  
HELX_P HELX_P32  32  ASP B 178 ? PHE B 189 ? ASP B 178 PHE B 189 1 ? 12 
HELX_P HELX_P33  33  ASP B 191 ? LEU B 195 ? ASP B 191 LEU B 195 5 ? 5  
HELX_P HELX_P34  34  THR B 196 ? GLU B 202 ? THR B 196 GLU B 202 1 ? 7  
HELX_P HELX_P35  35  ASN B 206 ? LYS B 219 ? ASN B 206 LYS B 219 1 ? 14 
HELX_P HELX_P36  36  SER B 226 ? ALA B 262 ? SER B 226 ALA B 262 1 ? 37 
HELX_P HELX_P37  37  ALA B 262 ? GLY B 270 ? ALA B 262 GLY B 270 1 ? 9  
HELX_P HELX_P38  38  GLY B 270 ? GLY B 282 ? GLY B 270 GLY B 282 1 ? 13 
HELX_P HELX_P39  39  SER B 283 ? LYS B 289 ? SER B 283 LYS B 289 1 ? 7  
HELX_P HELX_P40  40  PRO B 291 ? GLN B 296 ? PRO B 291 GLN B 296 1 ? 6  
HELX_P HELX_P41  41  ALA B 300 ? GLY B 311 ? ALA B 300 GLY B 311 1 ? 12 
HELX_P HELX_P42  42  GLY B 318 ? GLN B 322 ? GLY B 318 GLN B 322 5 ? 5  
HELX_P HELX_P43  43  TYR B 323 ? SER B 329 ? TYR B 323 SER B 329 1 ? 7  
HELX_P HELX_P44  44  PRO B 330 ? PHE B 354 ? PRO B 330 PHE B 354 1 ? 25 
HELX_P HELX_P45  45  ILE B 359 ? LYS B 375 ? ILE B 359 LYS B 375 1 ? 17 
HELX_P HELX_P46  46  PRO C 15  ? GLY C 33  ? PRO C 15  GLY C 33  1 ? 19 
HELX_P HELX_P47  47  GLY C 38  ? ARG C 48  ? GLY C 38  ARG C 48  1 ? 11 
HELX_P HELX_P48  48  PRO C 62  ? VAL C 66  ? PRO C 62  VAL C 66  5 ? 5  
HELX_P HELX_P49  49  ALA C 67  ? LYS C 76  ? ALA C 67  LYS C 76  1 ? 10 
HELX_P HELX_P50  50  SER C 85  ? CYS C 93  ? SER C 85  CYS C 93  1 ? 9  
HELX_P HELX_P51  51  ALA C 110 ? ILE C 124 ? ALA C 110 ILE C 124 1 ? 15 
HELX_P HELX_P52  52  PRO D 15  ? GLY D 33  ? PRO D 15  GLY D 33  1 ? 19 
HELX_P HELX_P53  53  GLY D 38  ? ARG D 48  ? GLY D 38  ARG D 48  1 ? 11 
HELX_P HELX_P54  54  PRO D 62  ? VAL D 66  ? PRO D 62  VAL D 66  5 ? 5  
HELX_P HELX_P55  55  ALA D 67  ? LYS D 77  ? ALA D 67  LYS D 77  1 ? 11 
HELX_P HELX_P56  56  SER D 85  ? CYS D 93  ? SER D 85  CYS D 93  1 ? 9  
HELX_P HELX_P57  57  ALA D 110 ? ILE D 124 ? ALA D 110 ILE D 124 1 ? 15 
HELX_P HELX_P58  58  SER E 59  ? LYS E 67  ? SER E 59  LYS E 67  1 ? 9  
HELX_P HELX_P59  59  GLY E 88  ? GLU E 99  ? GLY E 88  GLU E 99  1 ? 12 
HELX_P HELX_P60  60  SER E 110 ? ARG E 123 ? SER E 110 ARG E 123 1 ? 14 
HELX_P HELX_P61  61  PHE E 136 ? TYR E 140 ? PHE E 136 TYR E 140 5 ? 5  
HELX_P HELX_P62  62  ASP E 158 ? PHE E 170 ? ASP E 158 PHE E 170 1 ? 13 
HELX_P HELX_P63  63  ALA E 183 ? ASP E 187 ? ALA E 183 ASP E 187 1 ? 5  
HELX_P HELX_P64  64  ASP E 191 ? SER E 206 ? ASP E 191 SER E 206 1 ? 16 
HELX_P HELX_P65  65  SER F 59  ? LYS F 67  ? SER F 59  LYS F 67  1 ? 9  
HELX_P HELX_P66  66  GLY F 88  ? GLU F 99  ? GLY F 88  GLU F 99  1 ? 12 
HELX_P HELX_P67  67  SER F 110 ? ARG F 124 ? SER F 110 ARG F 124 1 ? 15 
HELX_P HELX_P68  68  PHE F 136 ? TYR F 140 ? PHE F 136 TYR F 140 5 ? 5  
HELX_P HELX_P69  69  ASP F 158 ? PHE F 170 ? ASP F 158 PHE F 170 1 ? 13 
HELX_P HELX_P70  70  ALA F 183 ? ASP F 187 ? ALA F 183 ASP F 187 1 ? 5  
HELX_P HELX_P71  71  ASP F 191 ? SER F 206 ? ASP F 191 SER F 206 1 ? 16 
HELX_P HELX_P72  72  ASP K 31  ? GLU K 43  ? ASP K 31  GLU K 43  1 ? 13 
HELX_P HELX_P73  73  PHE K 48  ? VAL K 58  ? PHE K 48  VAL K 58  1 ? 11 
HELX_P HELX_P74  74  GLU K 70  ? ALA K 76  ? GLU K 70  ALA K 76  1 ? 7  
HELX_P HELX_P75  75  SER K 87  ? SER K 96  ? SER K 87  SER K 96  1 ? 10 
HELX_P HELX_P76  76  LYS K 99  ? ILE K 104 ? LYS K 99  ILE K 104 1 ? 6  
HELX_P HELX_P77  77  GLU K 110 ? GLN K 134 ? GLU K 110 GLN K 134 1 ? 25 
HELX_P HELX_P78  78  ARG K 136 ? SER K 166 ? ARG K 136 SER K 166 1 ? 31 
HELX_P HELX_P79  79  ILE K 167 ? HIS K 168 ? ILE K 167 HIS K 168 5 ? 2  
HELX_P HELX_P80  80  PHE K 169 ? PRO K 170 ? PHE K 169 PRO K 170 5 ? 2  
HELX_P HELX_P81  81  GLU K 171 ? ILE K 176 ? GLU K 171 ILE K 176 1 ? 6  
HELX_P HELX_P82  82  ASP K 178 ? GLY K 190 ? ASP K 178 GLY K 190 1 ? 13 
HELX_P HELX_P83  83  ASP K 191 ? LEU K 195 ? ASP K 191 LEU K 195 5 ? 5  
HELX_P HELX_P84  84  THR K 196 ? GLU K 202 ? THR K 196 GLU K 202 1 ? 7  
HELX_P HELX_P85  85  ASN K 206 ? LYS K 219 ? ASN K 206 LYS K 219 1 ? 14 
HELX_P HELX_P86  86  SER K 226 ? ALA K 262 ? SER K 226 ALA K 262 1 ? 37 
HELX_P HELX_P87  87  ALA K 262 ? GLY K 270 ? ALA K 262 GLY K 270 1 ? 9  
HELX_P HELX_P88  88  GLY K 270 ? GLY K 282 ? GLY K 270 GLY K 282 1 ? 13 
HELX_P HELX_P89  89  SER K 283 ? LYS K 289 ? SER K 283 LYS K 289 1 ? 7  
HELX_P HELX_P90  90  PRO K 291 ? GLN K 296 ? PRO K 291 GLN K 296 1 ? 6  
HELX_P HELX_P91  91  ALA K 300 ? GLY K 311 ? ALA K 300 GLY K 311 1 ? 12 
HELX_P HELX_P92  92  GLY K 318 ? GLN K 322 ? GLY K 318 GLN K 322 5 ? 5  
HELX_P HELX_P93  93  TYR K 323 ? THR K 328 ? TYR K 323 THR K 328 1 ? 6  
HELX_P HELX_P94  94  PRO K 330 ? PHE K 354 ? PRO K 330 PHE K 354 1 ? 25 
HELX_P HELX_P95  95  ILE K 359 ? GLU K 376 ? ILE K 359 GLU K 376 1 ? 18 
HELX_P HELX_P96  96  PRO L 15  ? GLY L 33  ? PRO L 15  GLY L 33  1 ? 19 
HELX_P HELX_P97  97  GLY L 38  ? ARG L 48  ? GLY L 38  ARG L 48  1 ? 11 
HELX_P HELX_P98  98  PRO L 62  ? VAL L 66  ? PRO L 62  VAL L 66  5 ? 5  
HELX_P HELX_P99  99  ALA L 67  ? LYS L 76  ? ALA L 67  LYS L 76  1 ? 10 
HELX_P HELX_P100 100 SER L 85  ? CYS L 93  ? SER L 85  CYS L 93  1 ? 9  
HELX_P HELX_P101 101 ALA L 110 ? ILE L 124 ? ALA L 110 ILE L 124 1 ? 15 
HELX_P HELX_P102 102 SER M 59  ? LYS M 67  ? SER M 59  LYS M 67  1 ? 9  
HELX_P HELX_P103 103 GLY M 88  ? GLU M 99  ? GLY M 88  GLU M 99  1 ? 12 
HELX_P HELX_P104 104 SER M 110 ? ARG M 123 ? SER M 110 ARG M 123 1 ? 14 
HELX_P HELX_P105 105 PHE M 136 ? TYR M 140 ? PHE M 136 TYR M 140 5 ? 5  
HELX_P HELX_P106 106 ASP M 158 ? PHE M 170 ? ASP M 158 PHE M 170 1 ? 13 
HELX_P HELX_P107 107 ALA M 183 ? ASP M 187 ? ALA M 183 ASP M 187 1 ? 5  
HELX_P HELX_P108 108 ASP M 191 ? SER M 206 ? ASP M 191 SER M 206 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? G G 1  N2 ? ? ? 1_555 H C 40 O2 ? ? G G 1  H C 40 1_555 ? ? ? ? ? ? 'G-C PAIR'    ? ? 
hydrog2   hydrog ? ? G G 2  N1 ? ? ? 1_555 H C 39 N3 ? ? G G 2  H C 39 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog3   hydrog ? ? G G 2  N2 ? ? ? 1_555 H C 39 O2 ? ? G G 2  H C 39 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog4   hydrog ? ? G G 2  O6 ? ? ? 1_555 H C 39 N4 ? ? G G 2  H C 39 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog5   hydrog ? ? G G 2  N1 ? ? ? 1_555 H C 40 N3 ? ? G G 2  H C 40 1_555 ? ? ? ? ? ? 'G-C PAIR'    ? ? 
hydrog6   hydrog ? ? G G 3  N1 ? ? ? 1_555 H C 38 N3 ? ? G G 3  H C 38 1_555 ? ? ? ? ? ? 'G-C PAIR'    ? ? 
hydrog7   hydrog ? ? G A 4  N1 ? ? ? 1_555 H U 37 N3 ? ? G A 4  H U 37 1_555 ? ? ? ? ? ? 'A-U PAIR'    ? ? 
hydrog8   hydrog ? ? G G 5  N1 ? ? ? 1_555 H C 36 O2 ? ? G G 5  H C 36 1_555 ? ? ? ? ? ? 'G-C PAIR'    ? ? 
hydrog9   hydrog ? ? G U 6  N3 ? ? ? 1_555 H A 35 N1 ? ? G U 6  H A 35 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog10  hydrog ? ? G U 6  O4 ? ? ? 1_555 H A 35 N6 ? ? G U 6  H A 35 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog11  hydrog ? ? G C 7  N3 ? ? ? 1_555 H G 34 N1 ? ? G C 7  H G 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog12  hydrog ? ? G C 7  N4 ? ? ? 1_555 H G 34 O6 ? ? G C 7  H G 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog13  hydrog ? ? G C 7  O2 ? ? ? 1_555 H G 34 N2 ? ? G C 7  H G 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog14  hydrog ? ? G U 8  N3 ? ? ? 1_555 H A 33 N1 ? ? G U 8  H A 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog15  hydrog ? ? G U 8  O4 ? ? ? 1_555 H A 33 N6 ? ? G U 8  H A 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog16  hydrog ? ? G U 9  O2 ? ? ? 1_555 G G 10 N2 ? ? G U 9  G G 10 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? ? 
hydrog17  hydrog ? ? G G 12 N2 ? ? ? 1_555 H A 32 N7 ? ? G G 12 H A 32 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ? ? 
hydrog18  hydrog ? ? G G 12 N3 ? ? ? 1_555 H A 32 N6 ? ? G G 12 H A 32 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ? ? 
hydrog19  hydrog ? ? G A 13 N6 ? ? ? 1_555 H G 31 N3 ? ? G A 13 H G 31 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ? ? 
hydrog20  hydrog ? ? G A 13 N7 ? ? ? 1_555 H G 31 N2 ? ? G A 13 H G 31 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ? ? 
hydrog21  hydrog ? ? G U 14 N3 ? ? ? 1_555 H U 30 O2 ? ? G U 14 H U 30 1_555 ? ? ? ? ? ? TYPE_16_PAIR  ? ? 
hydrog22  hydrog ? ? G U 14 O4 ? ? ? 1_555 H U 30 N3 ? ? G U 14 H U 30 1_555 ? ? ? ? ? ? TYPE_16_PAIR  ? ? 
hydrog23  hydrog ? ? G G 15 N1 ? ? ? 1_555 H C 29 N3 ? ? G G 15 H C 29 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog24  hydrog ? ? G G 15 N2 ? ? ? 1_555 H C 29 O2 ? ? G G 15 H C 29 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog25  hydrog ? ? G G 15 O6 ? ? ? 1_555 H C 29 N4 ? ? G G 15 H C 29 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog26  hydrog ? ? G A 16 N1 ? ? ? 1_555 H C 29 N4 ? ? G A 16 H C 29 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? ? 
hydrog27  hydrog ? ? G A 18 N1 ? ? ? 1_555 I U 10 N3 ? ? G A 18 I U 10 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog28  hydrog ? ? G A 18 N6 ? ? ? 1_555 I U 10 O4 ? ? G A 18 I U 10 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog29  hydrog ? ? G C 19 N3 ? ? ? 1_555 I G 9  N1 ? ? G C 19 I G 9  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog30  hydrog ? ? G C 19 N4 ? ? ? 1_555 I G 9  O6 ? ? G C 19 I G 9  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog31  hydrog ? ? G C 19 O2 ? ? ? 1_555 I G 9  N2 ? ? G C 19 I G 9  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog32  hydrog ? ? G A 20 N1 ? ? ? 1_555 I U 8  N3 ? ? G A 20 I U 8  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog33  hydrog ? ? G A 20 N6 ? ? ? 1_555 I U 8  O4 ? ? G A 20 I U 8  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog34  hydrog ? ? G C 21 N3 ? ? ? 1_555 I G 7  N1 ? ? G C 21 I G 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog35  hydrog ? ? G C 21 N4 ? ? ? 1_555 I G 7  O6 ? ? G C 21 I G 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog36  hydrog ? ? G C 21 O2 ? ? ? 1_555 I G 7  N2 ? ? G C 21 I G 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog37  hydrog ? ? G U 22 N3 ? ? ? 1_555 I A 6  N1 ? ? G U 22 I A 6  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog38  hydrog ? ? G U 22 O4 ? ? ? 1_555 I A 6  N6 ? ? G U 22 I A 6  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog39  hydrog ? ? G C 23 N3 ? ? ? 1_555 I G 5  N1 ? ? G C 23 I G 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog40  hydrog ? ? G C 23 N4 ? ? ? 1_555 I G 5  O6 ? ? G C 23 I G 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog41  hydrog ? ? G C 23 O2 ? ? ? 1_555 I G 5  N2 ? ? G C 23 I G 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog42  hydrog ? ? G A 24 N1 ? ? ? 1_555 I U 4  N3 ? ? G A 24 I U 4  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog43  hydrog ? ? G A 24 N6 ? ? ? 1_555 I U 4  O4 ? ? G A 24 I U 4  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog44  hydrog ? ? G U 25 N3 ? ? ? 1_555 I A 3  N1 ? ? G U 25 I A 3  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog45  hydrog ? ? G U 25 O4 ? ? ? 1_555 I A 3  N6 ? ? G U 25 I A 3  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog46  hydrog ? ? G G 26 N1 ? ? ? 1_555 I C 2  N3 ? ? G G 26 I C 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog47  hydrog ? ? G G 26 N2 ? ? ? 1_555 I C 2  O2 ? ? G G 26 I C 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog48  hydrog ? ? G G 26 O6 ? ? ? 1_555 I C 2  N4 ? ? G G 26 I C 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog49  hydrog ? ? G G 27 N1 ? ? ? 1_555 I C 1  N3 ? ? G G 27 I C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog50  hydrog ? ? G G 27 N2 ? ? ? 1_555 I C 1  O2 ? ? G G 27 I C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog51  hydrog ? ? G G 27 O6 ? ? ? 1_555 I C 1  N4 ? ? G G 27 I C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog52  hydrog ? ? G C 29 N3 ? ? ? 1_555 H G 15 N1 ? ? G C 29 H G 15 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog53  hydrog ? ? G C 29 N4 ? ? ? 1_555 H G 15 O6 ? ? G C 29 H G 15 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog54  hydrog ? ? G C 29 O2 ? ? ? 1_555 H G 15 N2 ? ? G C 29 H G 15 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog55  hydrog ? ? G C 29 N4 ? ? ? 1_555 H A 16 N1 ? ? G C 29 H A 16 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? 
hydrog56  hydrog ? ? G U 30 N3 ? ? ? 1_555 H U 14 O4 ? ? G U 30 H U 14 1_555 ? ? ? ? ? ? TYPE_16_PAIR  ? ? 
hydrog57  hydrog ? ? G U 30 O2 ? ? ? 1_555 H U 14 N3 ? ? G U 30 H U 14 1_555 ? ? ? ? ? ? TYPE_16_PAIR  ? ? 
hydrog58  hydrog ? ? G G 31 N2 ? ? ? 1_555 H A 13 N7 ? ? G G 31 H A 13 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ? ? 
hydrog59  hydrog ? ? G G 31 N3 ? ? ? 1_555 H A 13 N6 ? ? G G 31 H A 13 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ? ? 
hydrog60  hydrog ? ? G A 32 N6 ? ? ? 1_555 H G 12 N3 ? ? G A 32 H G 12 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ? ? 
hydrog61  hydrog ? ? G A 32 N7 ? ? ? 1_555 H G 12 N2 ? ? G A 32 H G 12 1_555 ? ? ? ? ? ? TYPE_11_PAIR  ? ? 
hydrog62  hydrog ? ? H U 9  O2 ? ? ? 1_555 H G 10 N2 ? ? H U 9  H G 10 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? ? 
hydrog63  hydrog ? ? H A 18 N1 ? ? ? 1_555 J U 10 N3 ? ? H A 18 J U 10 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog64  hydrog ? ? H A 18 N6 ? ? ? 1_555 J U 10 O4 ? ? H A 18 J U 10 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog65  hydrog ? ? H C 19 N3 ? ? ? 1_555 J G 9  N1 ? ? H C 19 J G 9  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog66  hydrog ? ? H C 19 N4 ? ? ? 1_555 J G 9  O6 ? ? H C 19 J G 9  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog67  hydrog ? ? H C 19 O2 ? ? ? 1_555 J G 9  N2 ? ? H C 19 J G 9  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog68  hydrog ? ? H A 20 N1 ? ? ? 1_555 J U 8  N3 ? ? H A 20 J U 8  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog69  hydrog ? ? H A 20 N6 ? ? ? 1_555 J U 8  O4 ? ? H A 20 J U 8  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog70  hydrog ? ? H C 21 N3 ? ? ? 1_555 J G 7  N1 ? ? H C 21 J G 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog71  hydrog ? ? H C 21 N4 ? ? ? 1_555 J G 7  O6 ? ? H C 21 J G 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog72  hydrog ? ? H C 21 O2 ? ? ? 1_555 J G 7  N2 ? ? H C 21 J G 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog73  hydrog ? ? H U 22 N3 ? ? ? 1_555 J A 6  N1 ? ? H U 22 J A 6  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog74  hydrog ? ? H U 22 O4 ? ? ? 1_555 J A 6  N6 ? ? H U 22 J A 6  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog75  hydrog ? ? H C 23 N3 ? ? ? 1_555 J G 5  N1 ? ? H C 23 J G 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog76  hydrog ? ? H C 23 N4 ? ? ? 1_555 J G 5  O6 ? ? H C 23 J G 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog77  hydrog ? ? H C 23 O2 ? ? ? 1_555 J G 5  N2 ? ? H C 23 J G 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog78  hydrog ? ? H A 24 N1 ? ? ? 1_555 J U 4  N3 ? ? H A 24 J U 4  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog79  hydrog ? ? H A 24 N6 ? ? ? 1_555 J U 4  O4 ? ? H A 24 J U 4  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog80  hydrog ? ? H U 25 N3 ? ? ? 1_555 J A 3  N1 ? ? H U 25 J A 3  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog81  hydrog ? ? H U 25 O4 ? ? ? 1_555 J A 3  N6 ? ? H U 25 J A 3  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog82  hydrog ? ? H G 26 N1 ? ? ? 1_555 J C 2  N3 ? ? H G 26 J C 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog83  hydrog ? ? H G 26 N2 ? ? ? 1_555 J C 2  O2 ? ? H G 26 J C 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog84  hydrog ? ? H G 26 O6 ? ? ? 1_555 J C 2  N4 ? ? H G 26 J C 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog85  hydrog ? ? H G 27 N1 ? ? ? 1_555 J C 1  N3 ? ? H G 27 J C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog86  hydrog ? ? H G 27 N2 ? ? ? 1_555 J C 1  O2 ? ? H G 27 J C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog87  hydrog ? ? H G 27 O6 ? ? ? 1_555 J C 1  N4 ? ? H G 27 J C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog88  hydrog ? ? N U 9  O2 ? ? ? 1_555 N G 10 N2 ? ? N U 9  N G 10 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? ? 
hydrog89  hydrog ? ? N A 18 N1 ? ? ? 1_555 O U 10 N3 ? ? N A 18 O U 10 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog90  hydrog ? ? N A 18 N6 ? ? ? 1_555 O U 10 O4 ? ? N A 18 O U 10 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog91  hydrog ? ? N C 19 N3 ? ? ? 1_555 O G 9  N1 ? ? N C 19 O G 9  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog92  hydrog ? ? N C 19 N4 ? ? ? 1_555 O G 9  O6 ? ? N C 19 O G 9  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog93  hydrog ? ? N C 19 O2 ? ? ? 1_555 O G 9  N2 ? ? N C 19 O G 9  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog94  hydrog ? ? N A 20 N1 ? ? ? 1_555 O U 8  N3 ? ? N A 20 O U 8  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog95  hydrog ? ? N A 20 N6 ? ? ? 1_555 O U 8  O4 ? ? N A 20 O U 8  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog96  hydrog ? ? N C 21 N3 ? ? ? 1_555 O G 7  N1 ? ? N C 21 O G 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog97  hydrog ? ? N C 21 N4 ? ? ? 1_555 O G 7  O6 ? ? N C 21 O G 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog98  hydrog ? ? N C 21 O2 ? ? ? 1_555 O G 7  N2 ? ? N C 21 O G 7  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog99  hydrog ? ? N U 22 N3 ? ? ? 1_555 O A 6  N1 ? ? N U 22 O A 6  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog100 hydrog ? ? N U 22 O4 ? ? ? 1_555 O A 6  N6 ? ? N U 22 O A 6  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog101 hydrog ? ? N C 23 N3 ? ? ? 1_555 O G 5  N1 ? ? N C 23 O G 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog102 hydrog ? ? N C 23 N4 ? ? ? 1_555 O G 5  O6 ? ? N C 23 O G 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog103 hydrog ? ? N C 23 O2 ? ? ? 1_555 O G 5  N2 ? ? N C 23 O G 5  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog104 hydrog ? ? N A 24 N1 ? ? ? 1_555 O U 4  N3 ? ? N A 24 O U 4  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog105 hydrog ? ? N A 24 N6 ? ? ? 1_555 O U 4  O4 ? ? N A 24 O U 4  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog106 hydrog ? ? N U 25 N3 ? ? ? 1_555 O A 3  N1 ? ? N U 25 O A 3  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog107 hydrog ? ? N U 25 O4 ? ? ? 1_555 O A 3  N6 ? ? N U 25 O A 3  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog108 hydrog ? ? N G 26 N1 ? ? ? 1_555 O C 2  N3 ? ? N G 26 O C 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog109 hydrog ? ? N G 26 N2 ? ? ? 1_555 O C 2  O2 ? ? N G 26 O C 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog110 hydrog ? ? N G 26 O6 ? ? ? 1_555 O C 2  N4 ? ? N G 26 O C 2  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog111 hydrog ? ? N G 27 N1 ? ? ? 1_555 O C 1  N3 ? ? N G 27 O C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog112 hydrog ? ? N G 27 N2 ? ? ? 1_555 O C 1  O2 ? ? N G 27 O C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog113 hydrog ? ? N G 27 O6 ? ? ? 1_555 O C 1  N4 ? ? N G 27 O C 1  1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
E ? 5 ? 
F ? 7 ? 
G ? 5 ? 
H ? 7 ? 
I ? 5 ? 
J ? 4 ? 
K ? 5 ? 
L ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? anti-parallel 
H 6 7 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? parallel      
I 4 5 ? parallel      
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
L 1 2 ? parallel      
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? anti-parallel 
L 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 22  ? THR A 27  ? ILE A 22  THR A 27  
A 2 GLY A 12  ? TYR A 16  ? GLY A 12  TYR A 16  
A 3 ILE A 4   ? HIS A 9   ? ILE A 4   HIS A 9   
A 4 GLU A 62  ? VAL A 65  ? GLU A 62  VAL A 65  
A 5 ARG A 80  ? TYR A 83  ? ARG A 80  TYR A 83  
B 1 ILE B 22  ? THR B 27  ? ILE B 22  THR B 27  
B 2 GLY B 12  ? TYR B 16  ? GLY B 12  TYR B 16  
B 3 ILE B 4   ? HIS B 9   ? ILE B 4   HIS B 9   
B 4 GLU B 62  ? VAL B 65  ? GLU B 62  VAL B 65  
B 5 ARG B 80  ? TYR B 83  ? ARG B 80  TYR B 83  
C 1 LYS C 34  ? LYS C 37  ? LYS C 34  LYS C 37  
C 2 SER C 101 ? GLU C 106 ? SER C 101 GLU C 106 
C 3 LEU C 53  ? ALA C 57  ? LEU C 53  ALA C 57  
C 4 TYR C 80  ? VAL C 83  ? TYR C 80  VAL C 83  
D 1 LYS D 34  ? LYS D 37  ? LYS D 34  LYS D 37  
D 2 SER D 101 ? GLU D 106 ? SER D 101 GLU D 106 
D 3 LEU D 53  ? ALA D 57  ? LEU D 53  ALA D 57  
D 4 TYR D 80  ? VAL D 83  ? TYR D 80  VAL D 83  
E 1 THR E 6   ? GLN E 9   ? THR E 6   GLN E 9   
E 2 ILE E 15  ? GLU E 19  ? ILE E 15  GLU E 19  
E 3 PHE E 25  ? ARG E 30  ? PHE E 25  ARG E 30  
E 4 VAL E 49  ? GLU E 53  ? VAL E 49  GLU E 53  
E 5 LEU E 43  ? TYR E 46  ? LEU E 43  TYR E 46  
F 1 ILE E 127 ? LEU E 131 ? ILE E 127 LEU E 131 
F 2 LYS E 103 ? GLU E 108 ? LYS E 103 GLU E 108 
F 3 LYS E 79  ? LEU E 83  ? LYS E 79  LEU E 83  
F 4 VAL E 147 ? VAL E 152 ? VAL E 147 VAL E 152 
F 5 LEU E 171 ? LYS E 182 ? LEU E 171 LYS E 182 
F 6 HIS E 223 ? TYR E 230 ? HIS E 223 TYR E 230 
F 7 PHE E 208 ? ASN E 215 ? PHE E 208 ASN E 215 
G 1 THR F 6   ? GLN F 9   ? THR F 6   GLN F 9   
G 2 ILE F 15  ? GLU F 19  ? ILE F 15  GLU F 19  
G 3 PHE F 25  ? ARG F 30  ? PHE F 25  ARG F 30  
G 4 VAL F 49  ? GLU F 53  ? VAL F 49  GLU F 53  
G 5 LEU F 43  ? TYR F 46  ? LEU F 43  TYR F 46  
H 1 ILE F 127 ? LEU F 131 ? ILE F 127 LEU F 131 
H 2 LYS F 103 ? GLU F 108 ? LYS F 103 GLU F 108 
H 3 LYS F 79  ? LEU F 83  ? LYS F 79  LEU F 83  
H 4 VAL F 147 ? VAL F 152 ? VAL F 147 VAL F 152 
H 5 LEU F 171 ? LYS F 182 ? LEU F 171 LYS F 182 
H 6 HIS F 223 ? TYR F 230 ? HIS F 223 TYR F 230 
H 7 PHE F 208 ? ASN F 215 ? PHE F 208 ASN F 215 
I 1 ILE K 22  ? THR K 27  ? ILE K 22  THR K 27  
I 2 GLY K 12  ? TYR K 16  ? GLY K 12  TYR K 16  
I 3 ILE K 4   ? HIS K 9   ? ILE K 4   HIS K 9   
I 4 GLU K 62  ? VAL K 65  ? GLU K 62  VAL K 65  
I 5 ARG K 80  ? TYR K 83  ? ARG K 80  TYR K 83  
J 1 LYS L 34  ? LYS L 37  ? LYS L 34  LYS L 37  
J 2 SER L 101 ? GLU L 106 ? SER L 101 GLU L 106 
J 3 LEU L 53  ? ALA L 57  ? LEU L 53  ALA L 57  
J 4 TYR L 80  ? VAL L 83  ? TYR L 80  VAL L 83  
K 1 THR M 6   ? GLN M 9   ? THR M 6   GLN M 9   
K 2 ILE M 15  ? GLU M 19  ? ILE M 15  GLU M 19  
K 3 PHE M 25  ? ARG M 30  ? PHE M 25  ARG M 30  
K 4 VAL M 49  ? GLU M 53  ? VAL M 49  GLU M 53  
K 5 LEU M 43  ? TYR M 46  ? LEU M 43  TYR M 46  
L 1 ILE M 127 ? LEU M 131 ? ILE M 127 LEU M 131 
L 2 LYS M 103 ? GLU M 108 ? LYS M 103 GLU M 108 
L 3 LYS M 79  ? LEU M 83  ? LYS M 79  LEU M 83  
L 4 VAL M 147 ? VAL M 152 ? VAL M 147 VAL M 152 
L 5 LEU M 171 ? LYS M 182 ? LEU M 171 LYS M 182 
L 6 HIS M 223 ? TYR M 230 ? HIS M 223 TYR M 230 
L 7 PHE M 208 ? ASN M 215 ? PHE M 208 ASN M 215 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ASP A 24  ? O ASP A 24  N ALA A 15  ? N ALA A 15  
A 2 3 O VAL A 14  ? O VAL A 14  N ILE A 7   ? N ILE A 7   
A 3 4 N LEU A 6   ? N LEU A 6   O VAL A 64  ? O VAL A 64  
A 4 5 N VAL A 65  ? N VAL A 65  O SER A 82  ? O SER A 82  
B 1 2 O ASP B 24  ? O ASP B 24  N ALA B 15  ? N ALA B 15  
B 2 3 O TYR B 16  ? O TYR B 16  N TYR B 5   ? N TYR B 5   
B 3 4 N LEU B 6   ? N LEU B 6   O VAL B 64  ? O VAL B 64  
B 4 5 N VAL B 65  ? N VAL B 65  O SER B 82  ? O SER B 82  
C 1 2 N LYS C 36  ? N LYS C 36  O ALA C 103 ? O ALA C 103 
C 2 3 O ALA C 102 ? O ALA C 102 N ILE C 55  ? N ILE C 55  
C 3 4 N ILE C 56  ? N ILE C 56  O VAL C 81  ? O VAL C 81  
D 1 2 N LYS D 36  ? N LYS D 36  O ALA D 103 ? O ALA D 103 
D 2 3 O ALA D 102 ? O ALA D 102 N ILE D 55  ? N ILE D 55  
D 3 4 N ILE D 56  ? N ILE D 56  O VAL D 81  ? O VAL D 81  
E 1 2 N THR E 6   ? N THR E 6   O GLU E 19  ? O GLU E 19  
E 2 3 N TYR E 16  ? N TYR E 16  O CYS E 28  ? O CYS E 28  
E 3 4 N THR E 29  ? N THR E 29  O ARG E 52  ? O ARG E 52  
E 4 5 O TYR E 51  ? O TYR E 51  N ILE E 44  ? N ILE E 44  
F 1 2 O PHE E 128 ? O PHE E 128 N ALA E 104 ? N ALA E 104 
F 2 3 O LYS E 103 ? O LYS E 103 N VAL E 80  ? N VAL E 80  
F 3 4 N LEU E 81  ? N LEU E 81  O VAL E 149 ? O VAL E 149 
F 4 5 N VAL E 152 ? N VAL E 152 O LEU E 178 ? O LEU E 178 
F 5 6 N ILE E 181 ? N ILE E 181 O ALA E 224 ? O ALA E 224 
F 6 7 O LEU E 227 ? O LEU E 227 N ILE E 211 ? N ILE E 211 
G 1 2 N THR F 6   ? N THR F 6   O GLU F 19  ? O GLU F 19  
G 2 3 N TYR F 16  ? N TYR F 16  O CYS F 28  ? O CYS F 28  
G 3 4 N THR F 29  ? N THR F 29  O ARG F 52  ? O ARG F 52  
G 4 5 O TYR F 51  ? O TYR F 51  N ILE F 44  ? N ILE F 44  
H 1 2 O PHE F 128 ? O PHE F 128 N ALA F 104 ? N ALA F 104 
H 2 3 O LYS F 103 ? O LYS F 103 N VAL F 80  ? N VAL F 80  
H 3 4 N LYS F 79  ? N LYS F 79  O ASP F 148 ? O ASP F 148 
H 4 5 N VAL F 152 ? N VAL F 152 O LEU F 178 ? O LEU F 178 
H 5 6 N ILE F 181 ? N ILE F 181 O ALA F 224 ? O ALA F 224 
H 6 7 O LEU F 227 ? O LEU F 227 N GLN F 212 ? N GLN F 212 
I 1 2 O ASP K 24  ? O ASP K 24  N ALA K 15  ? N ALA K 15  
I 2 3 O TYR K 16  ? O TYR K 16  N TYR K 5   ? N TYR K 5   
I 3 4 N LEU K 6   ? N LEU K 6   O VAL K 64  ? O VAL K 64  
I 4 5 N VAL K 65  ? N VAL K 65  O SER K 82  ? O SER K 82  
J 1 2 N LYS L 36  ? N LYS L 36  O ALA L 103 ? O ALA L 103 
J 2 3 O ALA L 102 ? O ALA L 102 N ILE L 55  ? N ILE L 55  
J 3 4 N ILE L 56  ? N ILE L 56  O VAL L 81  ? O VAL L 81  
K 1 2 N THR M 6   ? N THR M 6   O GLU M 19  ? O GLU M 19  
K 2 3 N TYR M 16  ? N TYR M 16  O CYS M 28  ? O CYS M 28  
K 3 4 N THR M 29  ? N THR M 29  O ARG M 52  ? O ARG M 52  
K 4 5 O TYR M 51  ? O TYR M 51  N ILE M 44  ? N ILE M 44  
L 1 2 O PHE M 128 ? O PHE M 128 N ALA M 104 ? N ALA M 104 
L 2 3 O LYS M 103 ? O LYS M 103 N VAL M 80  ? N VAL M 80  
L 3 4 N LEU M 83  ? N LEU M 83  O TYR M 151 ? O TYR M 151 
L 4 5 N VAL M 152 ? N VAL M 152 O VAL M 180 ? O VAL M 180 
L 5 6 N ILE M 181 ? N ILE M 181 O ALA M 224 ? O ALA M 224 
L 6 7 O LEU M 227 ? O LEU M 227 N GLN M 212 ? N GLN M 212 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE SAH E 301' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE SAH F 301' 
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE SAH M 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 TYR E 82  ? TYR E 82  . ? 1_555 ? 
2  AC1 15 GLY E 84  ? GLY E 84  . ? 1_555 ? 
3  AC1 15 ALA E 86  ? ALA E 86  . ? 1_555 ? 
4  AC1 15 THR E 89  ? THR E 89  . ? 1_555 ? 
5  AC1 15 THR E 90  ? THR E 90  . ? 1_555 ? 
6  AC1 15 GLU E 108 ? GLU E 108 . ? 1_555 ? 
7  AC1 15 PHE E 109 ? PHE E 109 . ? 1_555 ? 
8  AC1 15 SER E 110 ? SER E 110 . ? 1_555 ? 
9  AC1 15 ASP E 133 ? ASP E 133 . ? 1_555 ? 
10 AC1 15 ALA E 134 ? ALA E 134 . ? 1_555 ? 
11 AC1 15 ASP E 153 ? ASP E 153 . ? 1_555 ? 
12 AC1 15 ILE E 154 ? ILE E 154 . ? 1_555 ? 
13 AC1 15 ALA E 155 ? ALA E 155 . ? 1_555 ? 
14 AC1 15 GLN E 156 ? GLN E 156 . ? 1_555 ? 
15 AC1 15 U   G 25  ? U   G 25  . ? 1_555 ? 
16 AC2 15 TYR F 82  ? TYR F 82  . ? 1_555 ? 
17 AC2 15 GLY F 84  ? GLY F 84  . ? 1_555 ? 
18 AC2 15 ALA F 86  ? ALA F 86  . ? 1_555 ? 
19 AC2 15 THR F 89  ? THR F 89  . ? 1_555 ? 
20 AC2 15 THR F 90  ? THR F 90  . ? 1_555 ? 
21 AC2 15 GLU F 108 ? GLU F 108 . ? 1_555 ? 
22 AC2 15 PHE F 109 ? PHE F 109 . ? 1_555 ? 
23 AC2 15 SER F 110 ? SER F 110 . ? 1_555 ? 
24 AC2 15 ASP F 133 ? ASP F 133 . ? 1_555 ? 
25 AC2 15 ALA F 134 ? ALA F 134 . ? 1_555 ? 
26 AC2 15 ASP F 153 ? ASP F 153 . ? 1_555 ? 
27 AC2 15 ILE F 154 ? ILE F 154 . ? 1_555 ? 
28 AC2 15 ALA F 155 ? ALA F 155 . ? 1_555 ? 
29 AC2 15 GLN F 156 ? GLN F 156 . ? 1_555 ? 
30 AC2 15 U   H 25  ? U   H 25  . ? 1_555 ? 
31 AC3 15 TYR M 82  ? TYR M 82  . ? 1_555 ? 
32 AC3 15 GLY M 84  ? GLY M 84  . ? 1_555 ? 
33 AC3 15 ALA M 86  ? ALA M 86  . ? 1_555 ? 
34 AC3 15 THR M 89  ? THR M 89  . ? 1_555 ? 
35 AC3 15 THR M 90  ? THR M 90  . ? 1_555 ? 
36 AC3 15 GLU M 108 ? GLU M 108 . ? 1_555 ? 
37 AC3 15 PHE M 109 ? PHE M 109 . ? 1_555 ? 
38 AC3 15 SER M 110 ? SER M 110 . ? 1_555 ? 
39 AC3 15 ASP M 133 ? ASP M 133 . ? 1_555 ? 
40 AC3 15 ALA M 134 ? ALA M 134 . ? 1_555 ? 
41 AC3 15 ASP M 153 ? ASP M 153 . ? 1_555 ? 
42 AC3 15 ILE M 154 ? ILE M 154 . ? 1_555 ? 
43 AC3 15 ALA M 155 ? ALA M 155 . ? 1_555 ? 
44 AC3 15 GLN M 156 ? GLN M 156 . ? 1_555 ? 
45 AC3 15 U   N 25  ? U   N 25  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3PLA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3PLA 
_atom_sites.fract_transf_matrix[1][1]   0.004146 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004146 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006877 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . LYS A 1 3   ? 43.373  -40.915  22.759  1.00 93.27  ? 3   LYS A N     1 
ATOM   2     C CA    . LYS A 1 3   ? 44.825  -40.885  22.409  1.00 90.99  ? 3   LYS A CA    1 
ATOM   3     C C     . LYS A 1 3   ? 45.530  -39.703  23.080  1.00 88.68  ? 3   LYS A C     1 
ATOM   4     O O     . LYS A 1 3   ? 45.157  -38.546  22.868  1.00 88.60  ? 3   LYS A O     1 
ATOM   5     C CB    . LYS A 1 3   ? 45.014  -40.839  20.886  1.00 91.56  ? 3   LYS A CB    1 
ATOM   6     C CG    . LYS A 1 3   ? 46.281  -41.535  20.391  1.00 90.96  ? 3   LYS A CG    1 
ATOM   7     C CD    . LYS A 1 3   ? 46.482  -41.365  18.882  1.00 91.63  ? 3   LYS A CD    1 
ATOM   8     C CE    . LYS A 1 3   ? 47.724  -42.116  18.401  1.00 91.17  ? 3   LYS A CE    1 
ATOM   9     N NZ    . LYS A 1 3   ? 48.033  -41.872  16.963  1.00 90.91  ? 3   LYS A NZ    1 
ATOM   10    N N     . ILE A 1 4   ? 46.543  -40.010  23.891  1.00 86.64  ? 4   ILE A N     1 
ATOM   11    C CA    . ILE A 1 4   ? 47.301  -38.999  24.635  1.00 84.29  ? 4   ILE A CA    1 
ATOM   12    C C     . ILE A 1 4   ? 48.751  -38.934  24.145  1.00 82.33  ? 4   ILE A C     1 
ATOM   13    O O     . ILE A 1 4   ? 49.434  -39.962  24.110  1.00 82.26  ? 4   ILE A O     1 
ATOM   14    C CB    . ILE A 1 4   ? 47.200  -39.237  26.186  1.00 84.22  ? 4   ILE A CB    1 
ATOM   15    C CG1   . ILE A 1 4   ? 46.030  -38.443  26.776  1.00 85.28  ? 4   ILE A CG1   1 
ATOM   16    C CG2   . ILE A 1 4   ? 48.470  -38.826  26.925  1.00 82.34  ? 4   ILE A CG2   1 
ATOM   17    C CD1   . ILE A 1 4   ? 44.649  -39.061  26.546  1.00 88.79  ? 4   ILE A CD1   1 
ATOM   18    N N     . TYR A 1 5   ? 49.196  -37.736  23.742  1.00 80.50  ? 5   TYR A N     1 
ATOM   19    C CA    . TYR A 1 5   ? 50.603  -37.493  23.380  1.00 78.39  ? 5   TYR A CA    1 
ATOM   20    C C     . TYR A 1 5   ? 51.354  -37.055  24.625  1.00 77.20  ? 5   TYR A C     1 
ATOM   21    O O     . TYR A 1 5   ? 50.963  -36.086  25.276  1.00 77.25  ? 5   TYR A O     1 
ATOM   22    C CB    . TYR A 1 5   ? 50.742  -36.432  22.267  1.00 60.25  ? 5   TYR A CB    1 
ATOM   23    C CG    . TYR A 1 5   ? 50.137  -36.846  20.922  1.00 61.52  ? 5   TYR A CG    1 
ATOM   24    C CD1   . TYR A 1 5   ? 50.956  -37.392  19.900  1.00 61.53  ? 5   TYR A CD1   1 
ATOM   25    C CD2   . TYR A 1 5   ? 48.739  -36.692  20.672  1.00 62.90  ? 5   TYR A CD2   1 
ATOM   26    C CE1   . TYR A 1 5   ? 50.402  -37.777  18.659  1.00 62.94  ? 5   TYR A CE1   1 
ATOM   27    C CE2   . TYR A 1 5   ? 48.184  -37.081  19.449  1.00 64.29  ? 5   TYR A CE2   1 
ATOM   28    C CZ    . TYR A 1 5   ? 49.023  -37.619  18.448  1.00 64.33  ? 5   TYR A CZ    1 
ATOM   29    O OH    . TYR A 1 5   ? 48.483  -37.997  17.234  1.00 65.78  ? 5   TYR A OH    1 
ATOM   30    N N     . LEU A 1 6   ? 52.421  -37.776  24.960  1.00 77.96  ? 6   LEU A N     1 
ATOM   31    C CA    . LEU A 1 6   ? 53.132  -37.527  26.212  1.00 78.69  ? 6   LEU A CA    1 
ATOM   32    C C     . LEU A 1 6   ? 54.489  -36.881  26.023  1.00 78.40  ? 6   LEU A C     1 
ATOM   33    O O     . LEU A 1 6   ? 55.287  -37.303  25.180  1.00 78.39  ? 6   LEU A O     1 
ATOM   34    C CB    . LEU A 1 6   ? 53.298  -38.817  27.016  1.00 79.43  ? 6   LEU A CB    1 
ATOM   35    C CG    . LEU A 1 6   ? 53.768  -38.644  28.469  1.00 79.64  ? 6   LEU A CG    1 
ATOM   36    C CD1   . LEU A 1 6   ? 53.012  -39.585  29.383  1.00 81.66  ? 6   LEU A CD1   1 
ATOM   37    C CD2   . LEU A 1 6   ? 55.276  -38.826  28.626  1.00 79.01  ? 6   LEU A CD2   1 
ATOM   38    N N     . ILE A 1 7   ? 54.747  -35.878  26.858  1.00 78.92  ? 7   ILE A N     1 
ATOM   39    C CA    . ILE A 1 7   ? 55.981  -35.101  26.822  1.00 78.71  ? 7   ILE A CA    1 
ATOM   40    C C     . ILE A 1 7   ? 56.815  -35.327  28.084  1.00 79.08  ? 7   ILE A C     1 
ATOM   41    O O     . ILE A 1 7   ? 56.270  -35.442  29.189  1.00 79.87  ? 7   ILE A O     1 
ATOM   42    C CB    . ILE A 1 7   ? 55.677  -33.591  26.603  1.00 78.36  ? 7   ILE A CB    1 
ATOM   43    C CG1   . ILE A 1 7   ? 55.804  -33.233  25.126  1.00 78.24  ? 7   ILE A CG1   1 
ATOM   44    C CG2   . ILE A 1 7   ? 56.613  -32.704  27.392  1.00 77.81  ? 7   ILE A CG2   1 
ATOM   45    C CD1   . ILE A 1 7   ? 54.647  -33.676  24.287  1.00 79.98  ? 7   ILE A CD1   1 
ATOM   46    N N     . GLU A 1 8   ? 58.131  -35.418  27.886  1.00 79.14  ? 8   GLU A N     1 
ATOM   47    C CA    . GLU A 1 8   ? 59.123  -35.439  28.961  1.00 79.48  ? 8   GLU A CA    1 
ATOM   48    C C     . GLU A 1 8   ? 60.135  -34.306  28.782  1.00 78.96  ? 8   GLU A C     1 
ATOM   49    O O     . GLU A 1 8   ? 60.716  -34.141  27.708  1.00 78.69  ? 8   GLU A O     1 
ATOM   50    C CB    . GLU A 1 8   ? 59.855  -36.780  28.991  1.00 79.78  ? 8   GLU A CB    1 
ATOM   51    C CG    . GLU A 1 8   ? 59.473  -37.686  30.146  1.00 81.13  ? 8   GLU A CG    1 
ATOM   52    C CD    . GLU A 1 8   ? 59.548  -39.162  29.777  1.00 82.16  ? 8   GLU A CD    1 
ATOM   53    O OE1   . GLU A 1 8   ? 58.544  -39.704  29.252  1.00 83.30  ? 8   GLU A OE1   1 
ATOM   54    O OE2   . GLU A 1 8   ? 60.605  -39.783  30.014  1.00 81.09  ? 8   GLU A OE2   1 
ATOM   55    N N     . HIS A 1 9   ? 60.343  -33.541  29.847  1.00 79.22  ? 9   HIS A N     1 
ATOM   56    C CA    . HIS A 1 9   ? 61.207  -32.368  29.825  1.00 78.99  ? 9   HIS A CA    1 
ATOM   57    C C     . HIS A 1 9   ? 61.801  -32.151  31.222  1.00 79.29  ? 9   HIS A C     1 
ATOM   58    O O     . HIS A 1 9   ? 61.388  -32.807  32.178  1.00 80.31  ? 9   HIS A O     1 
ATOM   59    C CB    . HIS A 1 9   ? 60.391  -31.147  29.380  1.00 79.06  ? 9   HIS A CB    1 
ATOM   60    C CG    . HIS A 1 9   ? 61.220  -29.936  29.100  1.00 79.40  ? 9   HIS A CG    1 
ATOM   61    N ND1   . HIS A 1 9   ? 61.854  -29.732  27.894  1.00 79.77  ? 9   HIS A ND1   1 
ATOM   62    C CD2   . HIS A 1 9   ? 61.528  -28.869  29.874  1.00 79.95  ? 9   HIS A CD2   1 
ATOM   63    C CE1   . HIS A 1 9   ? 62.519  -28.591  27.940  1.00 80.32  ? 9   HIS A CE1   1 
ATOM   64    N NE2   . HIS A 1 9   ? 62.333  -28.045  29.129  1.00 80.13  ? 9   HIS A NE2   1 
ATOM   65    N N     . VAL A 1 10  ? 62.773  -31.249  31.339  1.00 78.82  ? 10  VAL A N     1 
ATOM   66    C CA    . VAL A 1 10  ? 63.278  -30.803  32.636  1.00 79.25  ? 10  VAL A CA    1 
ATOM   67    C C     . VAL A 1 10  ? 62.131  -30.250  33.489  1.00 80.09  ? 10  VAL A C     1 
ATOM   68    O O     . VAL A 1 10  ? 62.116  -30.393  34.716  1.00 80.92  ? 10  VAL A O     1 
ATOM   69    C CB    . VAL A 1 10  ? 64.387  -29.742  32.452  1.00 79.00  ? 10  VAL A CB    1 
ATOM   70    C CG1   . VAL A 1 10  ? 64.601  -28.914  33.717  1.00 79.87  ? 10  VAL A CG1   1 
ATOM   71    C CG2   . VAL A 1 10  ? 65.683  -30.406  32.030  1.00 78.48  ? 10  VAL A CG2   1 
ATOM   72    N N     . ILE A 1 11  ? 61.163  -29.647  32.805  1.00 80.21  ? 11  ILE A N     1 
ATOM   73    C CA    . ILE A 1 11  ? 59.975  -29.031  33.401  1.00 81.00  ? 11  ILE A CA    1 
ATOM   74    C C     . ILE A 1 11  ? 59.017  -30.034  34.084  1.00 82.03  ? 11  ILE A C     1 
ATOM   75    O O     . ILE A 1 11  ? 58.201  -29.644  34.923  1.00 82.88  ? 11  ILE A O     1 
ATOM   76    C CB    . ILE A 1 11  ? 59.219  -28.227  32.313  1.00 80.56  ? 11  ILE A CB    1 
ATOM   77    C CG1   . ILE A 1 11  ? 58.553  -26.991  32.890  1.00 81.46  ? 11  ILE A CG1   1 
ATOM   78    C CG2   . ILE A 1 11  ? 58.213  -29.091  31.539  1.00 80.08  ? 11  ILE A CG2   1 
ATOM   79    C CD1   . ILE A 1 11  ? 57.638  -26.327  31.883  1.00 82.60  ? 11  ILE A CD1   1 
ATOM   80    N N     . GLY A 1 12  ? 59.118  -31.311  33.717  1.00 81.91  ? 12  GLY A N     1 
ATOM   81    C CA    . GLY A 1 12  ? 58.203  -32.340  34.211  1.00 83.26  ? 12  GLY A CA    1 
ATOM   82    C C     . GLY A 1 12  ? 57.633  -33.222  33.109  1.00 83.29  ? 12  GLY A C     1 
ATOM   83    O O     . GLY A 1 12  ? 58.228  -33.352  32.034  1.00 82.70  ? 12  GLY A O     1 
ATOM   84    N N     . ALA A 1 13  ? 56.487  -33.845  33.377  1.00 84.12  ? 13  ALA A N     1 
ATOM   85    C CA    . ALA A 1 13  ? 55.826  -34.678  32.378  1.00 84.16  ? 13  ALA A CA    1 
ATOM   86    C C     . ALA A 1 13  ? 54.433  -34.148  32.085  1.00 84.82  ? 13  ALA A C     1 
ATOM   87    O O     . ALA A 1 13  ? 53.608  -33.984  32.996  1.00 85.93  ? 13  ALA A O     1 
ATOM   88    C CB    . ALA A 1 13  ? 55.770  -36.116  32.830  1.00 84.80  ? 13  ALA A CB    1 
ATOM   89    N N     . VAL A 1 14  ? 54.180  -33.865  30.813  1.00 84.44  ? 14  VAL A N     1 
ATOM   90    C CA    . VAL A 1 14  ? 52.909  -33.278  30.400  1.00 85.24  ? 14  VAL A CA    1 
ATOM   91    C C     . VAL A 1 14  ? 52.209  -34.227  29.440  1.00 86.09  ? 14  VAL A C     1 
ATOM   92    O O     . VAL A 1 14  ? 52.860  -34.906  28.634  1.00 85.70  ? 14  VAL A O     1 
ATOM   93    C CB    . VAL A 1 14  ? 53.074  -31.859  29.751  1.00 84.58  ? 14  VAL A CB    1 
ATOM   94    C CG1   . VAL A 1 14  ? 51.728  -31.265  29.389  1.00 84.91  ? 14  VAL A CG1   1 
ATOM   95    C CG2   . VAL A 1 14  ? 53.799  -30.909  30.686  1.00 84.06  ? 14  VAL A CG2   1 
ATOM   96    N N     . ALA A 1 15  ? 50.883  -34.290  29.565  1.00 87.51  ? 15  ALA A N     1 
ATOM   97    C CA    . ALA A 1 15  ? 50.035  -35.011  28.624  1.00 88.29  ? 15  ALA A CA    1 
ATOM   98    C C     . ALA A 1 15  ? 49.274  -34.010  27.772  1.00 88.78  ? 15  ALA A C     1 
ATOM   99    O O     . ALA A 1 15  ? 48.786  -32.989  28.263  1.00 88.97  ? 15  ALA A O     1 
ATOM   100   C CB    . ALA A 1 15  ? 49.075  -35.930  29.357  1.00 89.51  ? 15  ALA A CB    1 
ATOM   101   N N     . TYR A 1 16  ? 49.200  -34.308  26.484  1.00 89.23  ? 16  TYR A N     1 
ATOM   102   C CA    . TYR A 1 16  ? 48.537  -33.448  25.520  1.00 90.17  ? 16  TYR A CA    1 
ATOM   103   C C     . TYR A 1 16  ? 47.599  -34.312  24.714  1.00 91.57  ? 16  TYR A C     1 
ATOM   104   O O     . TYR A 1 16  ? 47.896  -35.486  24.478  1.00 91.42  ? 16  TYR A O     1 
ATOM   105   C CB    . TYR A 1 16  ? 49.564  -32.850  24.549  1.00 89.56  ? 16  TYR A CB    1 
ATOM   106   C CG    . TYR A 1 16  ? 50.306  -31.615  25.013  1.00 88.35  ? 16  TYR A CG    1 
ATOM   107   C CD1   . TYR A 1 16  ? 51.576  -31.710  25.579  1.00 87.41  ? 16  TYR A CD1   1 
ATOM   108   C CD2   . TYR A 1 16  ? 49.755  -30.355  24.848  1.00 88.89  ? 16  TYR A CD2   1 
ATOM   109   C CE1   . TYR A 1 16  ? 52.271  -30.572  25.988  1.00 87.34  ? 16  TYR A CE1   1 
ATOM   110   C CE2   . TYR A 1 16  ? 50.432  -29.217  25.251  1.00 89.38  ? 16  TYR A CE2   1 
ATOM   111   C CZ    . TYR A 1 16  ? 51.690  -29.324  25.823  1.00 88.30  ? 16  TYR A CZ    1 
ATOM   112   O OH    . TYR A 1 16  ? 52.353  -28.174  26.224  1.00 88.12  ? 16  TYR A OH    1 
ATOM   113   N N     . ASP A 1 17  ? 46.485  -33.733  24.272  1.00 93.13  ? 17  ASP A N     1 
ATOM   114   C CA    . ASP A 1 17  ? 45.628  -34.400  23.290  1.00 95.26  ? 17  ASP A CA    1 
ATOM   115   C C     . ASP A 1 17  ? 46.197  -34.191  21.883  1.00 95.61  ? 17  ASP A C     1 
ATOM   116   O O     . ASP A 1 17  ? 47.282  -33.622  21.729  1.00 94.41  ? 17  ASP A O     1 
ATOM   117   C CB    . ASP A 1 17  ? 44.167  -33.927  23.392  1.00 96.82  ? 17  ASP A CB    1 
ATOM   118   C CG    . ASP A 1 17  ? 44.001  -32.433  23.122  1.00 97.36  ? 17  ASP A CG    1 
ATOM   119   O OD1   . ASP A 1 17  ? 42.879  -32.029  22.732  1.00 99.21  ? 17  ASP A OD1   1 
ATOM   120   O OD2   . ASP A 1 17  ? 44.973  -31.664  23.304  1.00 95.83  ? 17  ASP A OD2   1 
ATOM   121   N N     . GLU A 1 18  ? 45.481  -34.652  20.859  1.00 97.59  ? 18  GLU A N     1 
ATOM   122   C CA    . GLU A 1 18  ? 45.946  -34.479  19.477  1.00 98.51  ? 18  GLU A CA    1 
ATOM   123   C C     . GLU A 1 18  ? 45.894  -33.026  19.018  1.00 98.91  ? 18  GLU A C     1 
ATOM   124   O O     . GLU A 1 18  ? 46.587  -32.643  18.073  1.00 98.88  ? 18  GLU A O     1 
ATOM   125   C CB    . GLU A 1 18  ? 45.176  -35.376  18.507  1.00 100.30 ? 18  GLU A CB    1 
ATOM   126   C CG    . GLU A 1 18  ? 43.674  -35.169  18.520  1.00 102.80 ? 18  GLU A CG    1 
ATOM   127   C CD    . GLU A 1 18  ? 42.917  -36.455  18.270  1.00 104.86 ? 18  GLU A CD    1 
ATOM   128   O OE1   . GLU A 1 18  ? 43.251  -37.484  18.909  1.00 104.38 ? 18  GLU A OE1   1 
ATOM   129   O OE2   . GLU A 1 18  ? 41.987  -36.428  17.436  1.00 106.49 ? 18  GLU A OE2   1 
ATOM   130   N N     . ASN A 1 19  ? 45.078  -32.227  19.701  1.00 99.59  ? 19  ASN A N     1 
ATOM   131   C CA    . ASN A 1 19  ? 44.939  -30.808  19.394  1.00 100.21 ? 19  ASN A CA    1 
ATOM   132   C C     . ASN A 1 19  ? 46.103  -29.950  19.888  1.00 98.76  ? 19  ASN A C     1 
ATOM   133   O O     . ASN A 1 19  ? 46.458  -28.956  19.256  1.00 99.17  ? 19  ASN A O     1 
ATOM   134   C CB    . ASN A 1 19  ? 43.621  -30.276  19.951  1.00 101.37 ? 19  ASN A CB    1 
ATOM   135   C CG    . ASN A 1 19  ? 42.424  -30.978  19.366  1.00 103.35 ? 19  ASN A CG    1 
ATOM   136   O OD1   . ASN A 1 19  ? 42.365  -31.225  18.163  1.00 104.53 ? 19  ASN A OD1   1 
ATOM   137   N ND2   . ASN A 1 19  ? 41.459  -31.307  20.213  1.00 104.34 ? 19  ASN A ND2   1 
ATOM   138   N N     . GLY A 1 20  ? 46.693  -30.330  21.013  1.00 97.47  ? 20  GLY A N     1 
ATOM   139   C CA    . GLY A 1 20  ? 47.763  -29.542  21.606  1.00 96.34  ? 20  GLY A CA    1 
ATOM   140   C C     . GLY A 1 20  ? 47.299  -28.771  22.824  1.00 96.63  ? 20  GLY A C     1 
ATOM   141   O O     . GLY A 1 20  ? 47.761  -27.661  23.079  1.00 96.23  ? 20  GLY A O     1 
ATOM   142   N N     . ASN A 1 21  ? 46.373  -29.364  23.572  1.00 97.68  ? 21  ASN A N     1 
ATOM   143   C CA    . ASN A 1 21  ? 45.932  -28.822  24.850  1.00 98.27  ? 21  ASN A CA    1 
ATOM   144   C C     . ASN A 1 21  ? 46.421  -29.707  25.993  1.00 97.91  ? 21  ASN A C     1 
ATOM   145   O O     . ASN A 1 21  ? 46.335  -30.941  25.916  1.00 97.98  ? 21  ASN A O     1 
ATOM   146   C CB    . ASN A 1 21  ? 44.408  -28.718  24.888  1.00 99.88  ? 21  ASN A CB    1 
ATOM   147   C CG    . ASN A 1 21  ? 43.841  -28.000  23.680  1.00 101.08 ? 21  ASN A CG    1 
ATOM   148   O OD1   . ASN A 1 21  ? 43.306  -28.629  22.769  1.00 101.94 ? 21  ASN A OD1   1 
ATOM   149   N ND2   . ASN A 1 21  ? 43.961  -26.677  23.663  1.00 101.58 ? 21  ASN A ND2   1 
ATOM   150   N N     . ILE A 1 22  ? 46.939  -29.074  27.046  1.00 97.84  ? 22  ILE A N     1 
ATOM   151   C CA    . ILE A 1 22  ? 47.418  -29.794  28.228  1.00 97.87  ? 22  ILE A CA    1 
ATOM   152   C C     . ILE A 1 22  ? 46.235  -30.446  28.943  1.00 99.24  ? 22  ILE A C     1 
ATOM   153   O O     . ILE A 1 22  ? 45.455  -29.764  29.606  1.00 100.28 ? 22  ILE A O     1 
ATOM   154   C CB    . ILE A 1 22  ? 48.178  -28.861  29.218  1.00 97.44  ? 22  ILE A CB    1 
ATOM   155   C CG1   . ILE A 1 22  ? 49.359  -28.167  28.529  1.00 96.52  ? 22  ILE A CG1   1 
ATOM   156   C CG2   . ILE A 1 22  ? 48.656  -29.642  30.447  1.00 97.37  ? 22  ILE A CG2   1 
ATOM   157   C CD1   . ILE A 1 22  ? 49.743  -26.812  29.134  1.00 96.92  ? 22  ILE A CD1   1 
ATOM   158   N N     . VAL A 1 23  ? 46.101  -31.762  28.784  1.00 99.68  ? 23  VAL A N     1 
ATOM   159   C CA    . VAL A 1 23  ? 45.044  -32.530  29.459  1.00 101.11 ? 23  VAL A CA    1 
ATOM   160   C C     . VAL A 1 23  ? 45.366  -32.672  30.947  1.00 101.19 ? 23  VAL A C     1 
ATOM   161   O O     . VAL A 1 23  ? 44.512  -32.431  31.797  1.00 102.34 ? 23  VAL A O     1 
ATOM   162   C CB    . VAL A 1 23  ? 44.826  -33.928  28.819  1.00 101.40 ? 23  VAL A CB    1 
ATOM   163   C CG1   . VAL A 1 23  ? 43.633  -34.624  29.449  1.00 103.18 ? 23  VAL A CG1   1 
ATOM   164   C CG2   . VAL A 1 23  ? 44.613  -33.805  27.323  1.00 101.53 ? 23  VAL A CG2   1 
ATOM   165   N N     . ASP A 1 24  ? 46.601  -33.062  31.247  1.00 100.36 ? 24  ASP A N     1 
ATOM   166   C CA    . ASP A 1 24  ? 47.104  -33.092  32.614  1.00 100.78 ? 24  ASP A CA    1 
ATOM   167   C C     . ASP A 1 24  ? 48.633  -33.076  32.640  1.00 99.47  ? 24  ASP A C     1 
ATOM   168   O O     . ASP A 1 24  ? 49.290  -33.452  31.664  1.00 98.50  ? 24  ASP A O     1 
ATOM   169   C CB    . ASP A 1 24  ? 46.565  -34.313  33.368  1.00 102.06 ? 24  ASP A CB    1 
ATOM   170   C CG    . ASP A 1 24  ? 46.573  -34.127  34.885  1.00 103.31 ? 24  ASP A CG    1 
ATOM   171   O OD1   . ASP A 1 24  ? 46.799  -32.992  35.366  1.00 103.19 ? 24  ASP A OD1   1 
ATOM   172   O OD2   . ASP A 1 24  ? 46.345  -35.127  35.599  1.00 105.27 ? 24  ASP A OD2   1 
ATOM   173   N N     . TYR A 1 25  ? 49.187  -32.643  33.769  1.00 99.64  ? 25  TYR A N     1 
ATOM   174   C CA    . TYR A 1 25  ? 50.632  -32.515  33.940  1.00 98.58  ? 25  TYR A CA    1 
ATOM   175   C C     . TYR A 1 25  ? 51.064  -32.908  35.352  1.00 99.30  ? 25  TYR A C     1 
ATOM   176   O O     . TYR A 1 25  ? 50.274  -32.825  36.299  1.00 100.71 ? 25  TYR A O     1 
ATOM   177   C CB    . TYR A 1 25  ? 51.061  -31.072  33.653  1.00 97.89  ? 25  TYR A CB    1 
ATOM   178   C CG    . TYR A 1 25  ? 50.460  -30.030  34.590  1.00 98.37  ? 25  TYR A CG    1 
ATOM   179   C CD1   . TYR A 1 25  ? 51.086  -29.710  35.799  1.00 98.05  ? 25  TYR A CD1   1 
ATOM   180   C CD2   . TYR A 1 25  ? 49.276  -29.360  34.261  1.00 98.20  ? 25  TYR A CD2   1 
ATOM   181   C CE1   . TYR A 1 25  ? 50.552  -28.757  36.654  1.00 98.70  ? 25  TYR A CE1   1 
ATOM   182   C CE2   . TYR A 1 25  ? 48.737  -28.403  35.110  1.00 98.58  ? 25  TYR A CE2   1 
ATOM   183   C CZ    . TYR A 1 25  ? 49.384  -28.107  36.303  1.00 98.95  ? 25  TYR A CZ    1 
ATOM   184   O OH    . TYR A 1 25  ? 48.873  -27.164  37.156  1.00 99.80  ? 25  TYR A OH    1 
ATOM   185   N N     . ILE A 1 26  ? 52.312  -33.344  35.488  1.00 98.56  ? 26  ILE A N     1 
ATOM   186   C CA    . ILE A 1 26  ? 52.942  -33.425  36.807  1.00 99.16  ? 26  ILE A CA    1 
ATOM   187   C C     . ILE A 1 26  ? 54.298  -32.747  36.757  1.00 98.04  ? 26  ILE A C     1 
ATOM   188   O O     . ILE A 1 26  ? 55.180  -33.146  35.995  1.00 97.03  ? 26  ILE A O     1 
ATOM   189   C CB    . ILE A 1 26  ? 53.035  -34.874  37.355  1.00 100.02 ? 26  ILE A CB    1 
ATOM   190   C CG1   . ILE A 1 26  ? 51.632  -35.349  37.758  1.00 101.64 ? 26  ILE A CG1   1 
ATOM   191   C CG2   . ILE A 1 26  ? 54.024  -34.954  38.543  1.00 99.94  ? 26  ILE A CG2   1 
ATOM   192   C CD1   . ILE A 1 26  ? 51.532  -36.791  38.193  1.00 103.15 ? 26  ILE A CD1   1 
ATOM   193   N N     . THR A 1 27  ? 54.428  -31.700  37.563  1.00 98.40  ? 27  THR A N     1 
ATOM   194   C CA    . THR A 1 27  ? 55.642  -30.900  37.652  1.00 97.73  ? 27  THR A CA    1 
ATOM   195   C C     . THR A 1 27  ? 56.770  -31.661  38.361  1.00 98.08  ? 27  THR A C     1 
ATOM   196   O O     . THR A 1 27  ? 56.534  -32.373  39.343  1.00 99.47  ? 27  THR A O     1 
ATOM   197   C CB    . THR A 1 27  ? 55.356  -29.579  38.390  1.00 98.41  ? 27  THR A CB    1 
ATOM   198   O OG1   . THR A 1 27  ? 54.154  -28.994  37.871  1.00 98.52  ? 27  THR A OG1   1 
ATOM   199   C CG2   . THR A 1 27  ? 56.500  -28.604  38.228  1.00 97.75  ? 27  THR A CG2   1 
ATOM   200   N N     . ASN A 1 28  ? 57.985  -31.523  37.837  1.00 97.14  ? 28  ASN A N     1 
ATOM   201   C CA    . ASN A 1 28  ? 59.180  -32.083  38.457  1.00 97.44  ? 28  ASN A CA    1 
ATOM   202   C C     . ASN A 1 28  ? 59.583  -31.290  39.699  1.00 98.76  ? 28  ASN A C     1 
ATOM   203   O O     . ASN A 1 28  ? 59.209  -30.123  39.842  1.00 98.76  ? 28  ASN A O     1 
ATOM   204   C CB    . ASN A 1 28  ? 60.340  -32.096  37.456  1.00 96.07  ? 28  ASN A CB    1 
ATOM   205   C CG    . ASN A 1 28  ? 60.576  -33.461  36.837  1.00 95.50  ? 28  ASN A CG    1 
ATOM   206   O OD1   . ASN A 1 28  ? 60.221  -34.487  37.410  1.00 97.02  ? 28  ASN A OD1   1 
ATOM   207   N ND2   . ASN A 1 28  ? 61.201  -33.479  35.666  1.00 93.72  ? 28  ASN A ND2   1 
ATOM   208   N N     . PRO A 1 29  ? 60.336  -31.921  40.611  1.00 100.04 ? 29  PRO A N     1 
ATOM   209   C CA    . PRO A 1 29  ? 60.879  -31.133  41.707  1.00 101.60 ? 29  PRO A CA    1 
ATOM   210   C C     . PRO A 1 29  ? 62.034  -30.283  41.183  1.00 101.01 ? 29  PRO A C     1 
ATOM   211   O O     . PRO A 1 29  ? 62.796  -30.732  40.321  1.00 100.11 ? 29  PRO A O     1 
ATOM   212   C CB    . PRO A 1 29  ? 61.392  -32.194  42.686  1.00 102.98 ? 29  PRO A CB    1 
ATOM   213   C CG    . PRO A 1 29  ? 61.710  -33.381  41.829  1.00 101.80 ? 29  PRO A CG    1 
ATOM   214   C CD    . PRO A 1 29  ? 60.719  -33.344  40.696  1.00 100.43 ? 29  PRO A CD    1 
ATOM   215   N N     . ARG A 1 30  ? 62.156  -29.063  41.689  1.00 101.76 ? 30  ARG A N     1 
ATOM   216   C CA    . ARG A 1 30  ? 63.242  -28.177  41.287  1.00 101.16 ? 30  ARG A CA    1 
ATOM   217   C C     . ARG A 1 30  ? 64.558  -28.584  41.986  1.00 101.44 ? 30  ARG A C     1 
ATOM   218   O O     . ARG A 1 30  ? 65.113  -27.841  42.803  1.00 102.42 ? 30  ARG A O     1 
ATOM   219   C CB    . ARG A 1 30  ? 62.841  -26.737  41.592  1.00 102.10 ? 30  ARG A CB    1 
ATOM   220   C CG    . ARG A 1 30  ? 63.785  -25.676  41.080  1.00 103.17 ? 30  ARG A CG    1 
ATOM   221   C CD    . ARG A 1 30  ? 63.923  -24.602  42.152  1.00 107.39 ? 30  ARG A CD    1 
ATOM   222   N NE    . ARG A 1 30  ? 64.314  -23.303  41.615  1.00 108.52 ? 30  ARG A NE    1 
ATOM   223   C CZ    . ARG A 1 30  ? 63.496  -22.484  40.957  1.00 108.55 ? 30  ARG A CZ    1 
ATOM   224   N NH1   . ARG A 1 30  ? 62.231  -22.831  40.728  1.00 108.20 ? 30  ARG A NH1   1 
ATOM   225   N NH2   . ARG A 1 30  ? 63.951  -21.318  40.517  1.00 108.61 ? 30  ARG A NH2   1 
ATOM   226   N N     . ASP A 1 31  ? 65.047  -29.775  41.648  1.00 100.51 ? 31  ASP A N     1 
ATOM   227   C CA    . ASP A 1 31  ? 66.217  -30.358  42.295  1.00 101.11 ? 31  ASP A CA    1 
ATOM   228   C C     . ASP A 1 31  ? 67.232  -30.857  41.271  1.00 99.54  ? 31  ASP A C     1 
ATOM   229   O O     . ASP A 1 31  ? 66.968  -31.829  40.553  1.00 98.51  ? 31  ASP A O     1 
ATOM   230   C CB    . ASP A 1 31  ? 65.786  -31.507  43.211  1.00 102.72 ? 31  ASP A CB    1 
ATOM   231   C CG    . ASP A 1 31  ? 66.954  -32.161  43.928  1.00 104.32 ? 31  ASP A CG    1 
ATOM   232   O OD1   . ASP A 1 31  ? 67.597  -31.490  44.767  1.00 106.08 ? 31  ASP A OD1   1 
ATOM   233   O OD2   . ASP A 1 31  ? 67.218  -33.354  43.660  1.00 104.62 ? 31  ASP A OD2   1 
ATOM   234   N N     . LEU A 1 32  ? 68.390  -30.193  41.221  1.00 99.22  ? 32  LEU A N     1 
ATOM   235   C CA    . LEU A 1 32  ? 69.460  -30.531  40.277  1.00 97.85  ? 32  LEU A CA    1 
ATOM   236   C C     . LEU A 1 32  ? 69.782  -32.023  40.277  1.00 97.91  ? 32  LEU A C     1 
ATOM   237   O O     . LEU A 1 32  ? 69.747  -32.666  39.225  1.00 96.95  ? 32  LEU A O     1 
ATOM   238   C CB    . LEU A 1 32  ? 70.736  -29.732  40.570  1.00 98.39  ? 32  LEU A CB    1 
ATOM   239   C CG    . LEU A 1 32  ? 70.816  -28.237  40.251  1.00 97.81  ? 32  LEU A CG    1 
ATOM   240   C CD1   . LEU A 1 32  ? 72.178  -27.684  40.654  1.00 98.04  ? 32  LEU A CD1   1 
ATOM   241   C CD2   . LEU A 1 32  ? 70.561  -27.984  38.788  1.00 96.24  ? 32  LEU A CD2   1 
ATOM   242   N N     . GLY A 1 33  ? 70.083  -32.564  41.458  1.00 99.12  ? 33  GLY A N     1 
ATOM   243   C CA    . GLY A 1 33  ? 70.421  -33.980  41.612  1.00 99.17  ? 33  GLY A CA    1 
ATOM   244   C C     . GLY A 1 33  ? 69.494  -34.961  40.908  1.00 97.95  ? 33  GLY A C     1 
ATOM   245   O O     . GLY A 1 33  ? 69.950  -35.798  40.131  1.00 97.17  ? 33  GLY A O     1 
ATOM   246   N N     . LYS A 1 34  ? 68.192  -34.839  41.170  1.00 97.77  ? 34  LYS A N     1 
ATOM   247   C CA    . LYS A 1 34  ? 67.191  -35.806  40.708  1.00 97.02  ? 34  LYS A CA    1 
ATOM   248   C C     . LYS A 1 34  ? 66.857  -35.689  39.238  1.00 94.71  ? 34  LYS A C     1 
ATOM   249   O O     . LYS A 1 34  ? 66.636  -36.706  38.586  1.00 94.40  ? 34  LYS A O     1 
ATOM   250   C CB    . LYS A 1 34  ? 65.906  -35.714  41.536  1.00 98.19  ? 34  LYS A CB    1 
ATOM   251   C CG    . LYS A 1 34  ? 66.038  -36.304  42.935  1.00 101.24 ? 34  LYS A CG    1 
ATOM   252   C CD    . LYS A 1 34  ? 64.849  -35.944  43.816  1.00 103.64 ? 34  LYS A CD    1 
ATOM   253   C CE    . LYS A 1 34  ? 65.004  -36.514  45.218  1.00 106.16 ? 34  LYS A CE    1 
ATOM   254   N NZ    . LYS A 1 34  ? 63.755  -36.328  46.000  1.00 107.65 ? 34  LYS A NZ    1 
ATOM   255   N N     . ILE A 1 35  ? 66.812  -34.459  38.722  1.00 93.18  ? 35  ILE A N     1 
ATOM   256   C CA    . ILE A 1 35  ? 66.535  -34.235  37.298  1.00 91.09  ? 35  ILE A CA    1 
ATOM   257   C C     . ILE A 1 35  ? 67.671  -34.748  36.421  1.00 90.02  ? 35  ILE A C     1 
ATOM   258   O O     . ILE A 1 35  ? 67.428  -35.412  35.420  1.00 89.32  ? 35  ILE A O     1 
ATOM   259   C CB    . ILE A 1 35  ? 66.284  -32.751  36.951  1.00 90.48  ? 35  ILE A CB    1 
ATOM   260   C CG1   . ILE A 1 35  ? 65.314  -32.087  37.941  1.00 91.26  ? 35  ILE A CG1   1 
ATOM   261   C CG2   . ILE A 1 35  ? 65.797  -32.625  35.501  1.00 89.10  ? 35  ILE A CG2   1 
ATOM   262   C CD1   . ILE A 1 35  ? 63.855  -32.411  37.733  1.00 91.16  ? 35  ILE A CD1   1 
ATOM   263   N N     . THR A 1 36  ? 68.905  -34.430  36.802  1.00 90.05  ? 36  THR A N     1 
ATOM   264   C CA    . THR A 1 36  ? 70.094  -34.925  36.105  1.00 89.41  ? 36  THR A CA    1 
ATOM   265   C C     . THR A 1 36  ? 70.069  -36.447  35.956  1.00 89.89  ? 36  THR A C     1 
ATOM   266   O O     . THR A 1 36  ? 70.295  -36.964  34.863  1.00 89.20  ? 36  THR A O     1 
ATOM   267   C CB    . THR A 1 36  ? 71.393  -34.495  36.821  1.00 89.93  ? 36  THR A CB    1 
ATOM   268   O OG1   . THR A 1 36  ? 71.410  -33.073  36.965  1.00 89.09  ? 36  THR A OG1   1 
ATOM   269   C CG2   . THR A 1 36  ? 72.608  -34.922  36.030  1.00 89.43  ? 36  THR A CG2   1 
ATOM   270   N N     . GLU A 1 37  ? 69.777  -37.147  37.053  1.00 91.39  ? 37  GLU A N     1 
ATOM   271   C CA    . GLU A 1 37  ? 69.761  -38.612  37.084  1.00 92.36  ? 37  GLU A CA    1 
ATOM   272   C C     . GLU A 1 37  ? 68.669  -39.214  36.200  1.00 91.80  ? 37  GLU A C     1 
ATOM   273   O O     . GLU A 1 37  ? 68.891  -40.224  35.528  1.00 91.66  ? 37  GLU A O     1 
ATOM   274   C CB    . GLU A 1 37  ? 69.613  -39.124  38.518  1.00 94.16  ? 37  GLU A CB    1 
ATOM   275   C CG    . GLU A 1 37  ? 70.711  -38.660  39.477  1.00 95.70  ? 37  GLU A CG    1 
ATOM   276   C CD    . GLU A 1 37  ? 72.010  -39.445  39.371  1.00 96.61  ? 37  GLU A CD    1 
ATOM   277   O OE1   . GLU A 1 37  ? 72.148  -40.317  38.483  1.00 95.77  ? 37  GLU A OE1   1 
ATOM   278   O OE2   . GLU A 1 37  ? 72.903  -39.182  40.202  1.00 98.54  ? 37  GLU A OE2   1 
ATOM   279   N N     . GLU A 1 38  ? 67.498  -38.583  36.199  1.00 91.62  ? 38  GLU A N     1 
ATOM   280   C CA    . GLU A 1 38  ? 66.364  -39.050  35.402  1.00 91.38  ? 38  GLU A CA    1 
ATOM   281   C C     . GLU A 1 38  ? 66.533  -38.792  33.915  1.00 90.15  ? 38  GLU A C     1 
ATOM   282   O O     . GLU A 1 38  ? 65.973  -39.519  33.098  1.00 90.36  ? 38  GLU A O     1 
ATOM   283   C CB    . GLU A 1 38  ? 65.062  -38.428  35.893  1.00 91.59  ? 38  GLU A CB    1 
ATOM   284   C CG    . GLU A 1 38  ? 64.623  -38.982  37.231  1.00 93.60  ? 38  GLU A CG    1 
ATOM   285   C CD    . GLU A 1 38  ? 63.136  -38.915  37.425  1.00 94.23  ? 38  GLU A CD    1 
ATOM   286   O OE1   . GLU A 1 38  ? 62.538  -37.845  37.189  1.00 94.42  ? 38  GLU A OE1   1 
ATOM   287   O OE2   . GLU A 1 38  ? 62.563  -39.942  37.820  1.00 95.52  ? 38  GLU A OE2   1 
ATOM   288   N N     . LEU A 1 39  ? 67.288  -37.746  33.577  1.00 89.33  ? 39  LEU A N     1 
ATOM   289   C CA    . LEU A 1 39  ? 67.667  -37.453  32.193  1.00 88.06  ? 39  LEU A CA    1 
ATOM   290   C C     . LEU A 1 39  ? 68.688  -38.474  31.694  1.00 88.43  ? 39  LEU A C     1 
ATOM   291   O O     . LEU A 1 39  ? 68.555  -39.010  30.590  1.00 88.07  ? 39  LEU A O     1 
ATOM   292   C CB    . LEU A 1 39  ? 68.235  -36.037  32.079  1.00 87.24  ? 39  LEU A CB    1 
ATOM   293   C CG    . LEU A 1 39  ? 67.289  -34.856  32.266  1.00 86.13  ? 39  LEU A CG    1 
ATOM   294   C CD1   . LEU A 1 39  ? 68.091  -33.588  32.529  1.00 85.51  ? 39  LEU A CD1   1 
ATOM   295   C CD2   . LEU A 1 39  ? 66.375  -34.698  31.061  1.00 84.59  ? 39  LEU A CD2   1 
ATOM   296   N N     . LEU A 1 40  ? 69.704  -38.736  32.516  1.00 89.24  ? 40  LEU A N     1 
ATOM   297   C CA    . LEU A 1 40  ? 70.665  -39.792  32.249  1.00 90.00  ? 40  LEU A CA    1 
ATOM   298   C C     . LEU A 1 40  ? 69.940  -41.136  32.121  1.00 90.81  ? 40  LEU A C     1 
ATOM   299   O O     . LEU A 1 40  ? 70.248  -41.933  31.234  1.00 90.92  ? 40  LEU A O     1 
ATOM   300   C CB    . LEU A 1 40  ? 71.723  -39.854  33.358  1.00 91.02  ? 40  LEU A CB    1 
ATOM   301   C CG    . LEU A 1 40  ? 72.718  -38.702  33.581  1.00 91.28  ? 40  LEU A CG    1 
ATOM   302   C CD1   . LEU A 1 40  ? 73.382  -38.825  34.958  1.00 92.89  ? 40  LEU A CD1   1 
ATOM   303   C CD2   . LEU A 1 40  ? 73.781  -38.609  32.479  1.00 91.31  ? 40  LEU A CD2   1 
ATOM   304   N N     . ASN A 1 41  ? 68.968  -41.372  33.002  1.00 91.66  ? 41  ASN A N     1 
ATOM   305   C CA    . ASN A 1 41  ? 68.187  -42.605  32.977  1.00 92.63  ? 41  ASN A CA    1 
ATOM   306   C C     . ASN A 1 41  ? 67.291  -42.718  31.757  1.00 92.05  ? 41  ASN A C     1 
ATOM   307   O O     . ASN A 1 41  ? 67.149  -43.801  31.191  1.00 92.53  ? 41  ASN A O     1 
ATOM   308   C CB    . ASN A 1 41  ? 67.372  -42.762  34.260  1.00 93.71  ? 41  ASN A CB    1 
ATOM   309   C CG    . ASN A 1 41  ? 68.210  -43.288  35.423  1.00 95.58  ? 41  ASN A CG    1 
ATOM   310   O OD1   . ASN A 1 41  ? 69.183  -44.031  35.230  1.00 95.93  ? 41  ASN A OD1   1 
ATOM   311   N ND2   . ASN A 1 41  ? 67.833  -42.905  36.641  1.00 96.66  ? 41  ASN A ND2   1 
ATOM   312   N N     . ASN A 1 42  ? 66.712  -41.591  31.346  1.00 91.39  ? 42  ASN A N     1 
ATOM   313   C CA    . ASN A 1 42  ? 65.835  -41.526  30.173  1.00 91.06  ? 42  ASN A CA    1 
ATOM   314   C C     . ASN A 1 42  ? 66.533  -41.929  28.876  1.00 90.72  ? 42  ASN A C     1 
ATOM   315   O O     . ASN A 1 42  ? 65.884  -42.400  27.944  1.00 90.75  ? 42  ASN A O     1 
ATOM   316   C CB    . ASN A 1 42  ? 65.223  -40.129  30.032  1.00 90.43  ? 42  ASN A CB    1 
ATOM   317   C CG    . ASN A 1 42  ? 64.146  -40.065  28.959  1.00 91.18  ? 42  ASN A CG    1 
ATOM   318   O OD1   . ASN A 1 42  ? 63.331  -40.981  28.828  1.00 92.27  ? 42  ASN A OD1   1 
ATOM   319   N ND2   . ASN A 1 42  ? 64.136  -38.976  28.186  1.00 91.46  ? 42  ASN A ND2   1 
ATOM   320   N N     . GLU A 1 43  ? 67.851  -41.736  28.834  1.00 90.59  ? 43  GLU A N     1 
ATOM   321   C CA    . GLU A 1 43  ? 68.678  -42.146  27.701  1.00 90.69  ? 43  GLU A CA    1 
ATOM   322   C C     . GLU A 1 43  ? 68.566  -43.642  27.428  1.00 91.66  ? 43  GLU A C     1 
ATOM   323   O O     . GLU A 1 43  ? 68.525  -44.061  26.272  1.00 91.77  ? 43  GLU A O     1 
ATOM   324   C CB    . GLU A 1 43  ? 70.142  -41.768  27.937  1.00 90.55  ? 43  GLU A CB    1 
ATOM   325   C CG    . GLU A 1 43  ? 70.404  -40.272  27.947  1.00 90.54  ? 43  GLU A CG    1 
ATOM   326   C CD    . GLU A 1 43  ? 71.879  -39.937  27.812  1.00 91.59  ? 43  GLU A CD    1 
ATOM   327   O OE1   . GLU A 1 43  ? 72.594  -39.917  28.843  1.00 91.22  ? 43  GLU A OE1   1 
ATOM   328   O OE2   . GLU A 1 43  ? 72.317  -39.685  26.664  1.00 92.54  ? 43  GLU A OE2   1 
ATOM   329   N N     . LYS A 1 44  ? 68.501  -44.434  28.501  1.00 92.73  ? 44  LYS A N     1 
ATOM   330   C CA    . LYS A 1 44  ? 68.421  -45.902  28.414  1.00 93.82  ? 44  LYS A CA    1 
ATOM   331   C C     . LYS A 1 44  ? 66.997  -46.416  28.182  1.00 93.94  ? 44  LYS A C     1 
ATOM   332   O O     . LYS A 1 44  ? 66.793  -47.613  27.988  1.00 94.96  ? 44  LYS A O     1 
ATOM   333   C CB    . LYS A 1 44  ? 69.043  -46.560  29.658  1.00 94.90  ? 44  LYS A CB    1 
ATOM   334   C CG    . LYS A 1 44  ? 70.546  -46.329  29.782  1.00 95.42  ? 44  LYS A CG    1 
ATOM   335   C CD    . LYS A 1 44  ? 71.218  -47.292  30.756  1.00 97.21  ? 44  LYS A CD    1 
ATOM   336   C CE    . LYS A 1 44  ? 72.739  -47.183  30.638  1.00 97.65  ? 44  LYS A CE    1 
ATOM   337   N NZ    . LYS A 1 44  ? 73.462  -48.088  31.564  1.00 98.85  ? 44  LYS A NZ    1 
ATOM   338   N N     . GLY A 1 45  ? 66.029  -45.502  28.188  1.00 93.00  ? 45  GLY A N     1 
ATOM   339   C CA    . GLY A 1 45  ? 64.620  -45.836  27.984  1.00 93.11  ? 45  GLY A CA    1 
ATOM   340   C C     . GLY A 1 45  ? 63.746  -45.608  29.208  1.00 93.36  ? 45  GLY A C     1 
ATOM   341   O O     . GLY A 1 45  ? 62.520  -45.533  29.086  1.00 93.57  ? 45  GLY A O     1 
ATOM   342   N N     . ILE A 1 46  ? 64.386  -45.497  30.379  1.00 93.46  ? 46  ILE A N     1 
ATOM   343   C CA    . ILE A 1 46  ? 63.718  -45.379  31.690  1.00 93.77  ? 46  ILE A CA    1 
ATOM   344   C C     . ILE A 1 46  ? 62.889  -44.100  31.801  1.00 93.08  ? 46  ILE A C     1 
ATOM   345   O O     . ILE A 1 46  ? 63.432  -42.998  31.710  1.00 92.15  ? 46  ILE A O     1 
ATOM   346   C CB    . ILE A 1 46  ? 64.738  -45.450  32.875  1.00 94.17  ? 46  ILE A CB    1 
ATOM   347   C CG1   . ILE A 1 46  ? 65.291  -46.866  33.042  1.00 95.23  ? 46  ILE A CG1   1 
ATOM   348   C CG2   . ILE A 1 46  ? 64.104  -45.018  34.191  1.00 94.44  ? 46  ILE A CG2   1 
ATOM   349   C CD1   . ILE A 1 46  ? 66.571  -47.144  32.300  1.00 94.73  ? 46  ILE A CD1   1 
ATOM   350   N N     . PRO A 1 47  ? 61.567  -44.244  31.994  1.00 93.70  ? 47  PRO A N     1 
ATOM   351   C CA    . PRO A 1 47  ? 60.677  -43.088  32.121  1.00 93.31  ? 47  PRO A CA    1 
ATOM   352   C C     . PRO A 1 47  ? 60.933  -42.288  33.401  1.00 93.68  ? 47  PRO A C     1 
ATOM   353   O O     . PRO A 1 47  ? 61.400  -42.847  34.393  1.00 94.78  ? 47  PRO A O     1 
ATOM   354   C CB    . PRO A 1 47  ? 59.280  -43.723  32.159  1.00 94.14  ? 47  PRO A CB    1 
ATOM   355   C CG    . PRO A 1 47  ? 59.458  -45.097  31.580  1.00 94.76  ? 47  PRO A CG    1 
ATOM   356   C CD    . PRO A 1 47  ? 60.820  -45.514  32.005  1.00 94.95  ? 47  PRO A CD    1 
ATOM   357   N N     . PHE A 1 48  ? 60.643  -40.988  33.362  1.00 93.18  ? 48  PHE A N     1 
ATOM   358   C CA    . PHE A 1 48  ? 60.651  -40.130  34.549  1.00 93.87  ? 48  PHE A CA    1 
ATOM   359   C C     . PHE A 1 48  ? 59.663  -40.708  35.572  1.00 95.37  ? 48  PHE A C     1 
ATOM   360   O O     . PHE A 1 48  ? 58.693  -41.363  35.193  1.00 95.97  ? 48  PHE A O     1 
ATOM   361   C CB    . PHE A 1 48  ? 60.192  -38.712  34.178  1.00 93.26  ? 48  PHE A CB    1 
ATOM   362   C CG    . PHE A 1 48  ? 61.264  -37.827  33.558  1.00 92.73  ? 48  PHE A CG    1 
ATOM   363   C CD1   . PHE A 1 48  ? 62.000  -38.240  32.446  1.00 92.42  ? 48  PHE A CD1   1 
ATOM   364   C CD2   . PHE A 1 48  ? 61.490  -36.545  34.060  1.00 92.88  ? 48  PHE A CD2   1 
ATOM   365   C CE1   . PHE A 1 48  ? 62.965  -37.414  31.874  1.00 90.86  ? 48  PHE A CE1   1 
ATOM   366   C CE2   . PHE A 1 48  ? 62.453  -35.712  33.490  1.00 91.88  ? 48  PHE A CE2   1 
ATOM   367   C CZ    . PHE A 1 48  ? 63.189  -36.150  32.395  1.00 90.84  ? 48  PHE A CZ    1 
ATOM   368   N N     . SER A 1 49  ? 59.888  -40.457  36.859  1.00 96.30  ? 49  SER A N     1 
ATOM   369   C CA    . SER A 1 49  ? 58.920  -40.869  37.883  1.00 97.98  ? 49  SER A CA    1 
ATOM   370   C C     . SER A 1 49  ? 57.686  -39.956  37.884  1.00 98.28  ? 49  SER A C     1 
ATOM   371   O O     . SER A 1 49  ? 56.617  -40.336  38.377  1.00 99.56  ? 49  SER A O     1 
ATOM   372   C CB    . SER A 1 49  ? 59.559  -40.922  39.270  1.00 98.97  ? 49  SER A CB    1 
ATOM   373   O OG    . SER A 1 49  ? 59.866  -39.626  39.732  1.00 98.30  ? 49  SER A OG    1 
ATOM   374   N N     . ALA A 1 50  ? 57.844  -38.755  37.324  1.00 97.21  ? 50  ALA A N     1 
ATOM   375   C CA    . ALA A 1 50  ? 56.730  -37.833  37.128  1.00 97.14  ? 50  ALA A CA    1 
ATOM   376   C C     . ALA A 1 50  ? 55.821  -38.351  36.021  1.00 97.02  ? 50  ALA A C     1 
ATOM   377   O O     . ALA A 1 50  ? 54.619  -38.081  36.016  1.00 97.43  ? 50  ALA A O     1 
ATOM   378   C CB    . ALA A 1 50  ? 57.244  -36.446  36.790  1.00 95.93  ? 50  ALA A CB    1 
ATOM   379   N N     . THR A 1 51  ? 56.413  -39.095  35.089  1.00 96.64  ? 51  THR A N     1 
ATOM   380   C CA    . THR A 1 51  ? 55.689  -39.698  33.969  1.00 97.09  ? 51  THR A CA    1 
ATOM   381   C C     . THR A 1 51  ? 54.835  -40.883  34.441  1.00 98.92  ? 51  THR A C     1 
ATOM   382   O O     . THR A 1 51  ? 53.680  -41.041  34.016  1.00 99.34  ? 51  THR A O     1 
ATOM   383   C CB    . THR A 1 51  ? 56.674  -40.145  32.843  1.00 96.15  ? 51  THR A CB    1 
ATOM   384   O OG1   . THR A 1 51  ? 57.437  -39.021  32.396  1.00 94.62  ? 51  THR A OG1   1 
ATOM   385   C CG2   . THR A 1 51  ? 55.937  -40.746  31.650  1.00 96.33  ? 51  THR A CG2   1 
ATOM   386   N N     . VAL A 1 52  ? 55.416  -41.701  35.323  1.00 100.20 ? 52  VAL A N     1 
ATOM   387   C CA    . VAL A 1 52  ? 54.749  -42.873  35.904  1.00 102.17 ? 52  VAL A CA    1 
ATOM   388   C C     . VAL A 1 52  ? 53.474  -42.449  36.630  1.00 103.26 ? 52  VAL A C     1 
ATOM   389   O O     . VAL A 1 52  ? 52.410  -43.024  36.411  1.00 103.93 ? 52  VAL A O     1 
ATOM   390   C CB    . VAL A 1 52  ? 55.698  -43.651  36.865  1.00 103.14 ? 52  VAL A CB    1 
ATOM   391   C CG1   . VAL A 1 52  ? 54.976  -44.820  37.532  1.00 105.18 ? 52  VAL A CG1   1 
ATOM   392   C CG2   . VAL A 1 52  ? 56.939  -44.145  36.115  1.00 102.40 ? 52  VAL A CG2   1 
ATOM   393   N N     . GLU A 1 53  ? 53.601  -41.425  37.471  1.00 103.51 ? 53  GLU A N     1 
ATOM   394   C CA    . GLU A 1 53  ? 52.474  -40.853  38.193  1.00 105.06 ? 53  GLU A CA    1 
ATOM   395   C C     . GLU A 1 53  ? 51.419  -40.265  37.258  1.00 104.56 ? 53  GLU A C     1 
ATOM   396   O O     . GLU A 1 53  ? 50.218  -40.346  37.543  1.00 105.92 ? 53  GLU A O     1 
ATOM   397   C CB    . GLU A 1 53  ? 52.948  -39.766  39.159  1.00 105.25 ? 53  GLU A CB    1 
ATOM   398   C CG    . GLU A 1 53  ? 53.690  -40.250  40.397  1.00 107.81 ? 53  GLU A CG    1 
ATOM   399   C CD    . GLU A 1 53  ? 54.214  -39.089  41.243  1.00 109.53 ? 53  GLU A CD    1 
ATOM   400   O OE1   . GLU A 1 53  ? 53.501  -38.063  41.364  1.00 109.70 ? 53  GLU A OE1   1 
ATOM   401   O OE2   . GLU A 1 53  ? 55.340  -39.202  41.783  1.00 110.30 ? 53  GLU A OE2   1 
ATOM   402   N N     . LEU A 1 54  ? 51.864  -39.663  36.155  1.00 103.01 ? 54  LEU A N     1 
ATOM   403   C CA    . LEU A 1 54  ? 50.946  -39.002  35.225  1.00 102.63 ? 54  LEU A CA    1 
ATOM   404   C C     . LEU A 1 54  ? 50.117  -40.006  34.432  1.00 103.31 ? 54  LEU A C     1 
ATOM   405   O O     . LEU A 1 54  ? 48.922  -39.803  34.225  1.00 103.92 ? 54  LEU A O     1 
ATOM   406   C CB    . LEU A 1 54  ? 51.690  -38.054  34.277  1.00 100.99 ? 54  LEU A CB    1 
ATOM   407   C CG    . LEU A 1 54  ? 50.788  -37.230  33.346  1.00 100.53 ? 54  LEU A CG    1 
ATOM   408   C CD1   . LEU A 1 54  ? 50.147  -36.073  34.096  1.00 101.16 ? 54  LEU A CD1   1 
ATOM   409   C CD2   . LEU A 1 54  ? 51.540  -36.737  32.122  1.00 98.58  ? 54  LEU A CD2   1 
ATOM   410   N N     . LEU A 1 55  ? 50.757  -41.086  33.999  1.00 103.38 ? 55  LEU A N     1 
ATOM   411   C CA    . LEU A 1 55  ? 50.071  -42.134  33.253  1.00 104.49 ? 55  LEU A CA    1 
ATOM   412   C C     . LEU A 1 55  ? 49.087  -42.926  34.115  1.00 106.71 ? 55  LEU A C     1 
ATOM   413   O O     . LEU A 1 55  ? 48.345  -43.765  33.604  1.00 107.71 ? 55  LEU A O     1 
ATOM   414   C CB    . LEU A 1 55  ? 51.085  -43.067  32.596  1.00 103.95 ? 55  LEU A CB    1 
ATOM   415   C CG    . LEU A 1 55  ? 51.694  -42.583  31.279  1.00 102.40 ? 55  LEU A CG    1 
ATOM   416   C CD1   . LEU A 1 55  ? 53.068  -43.197  31.062  1.00 101.99 ? 55  LEU A CD1   1 
ATOM   417   C CD2   . LEU A 1 55  ? 50.778  -42.889  30.101  1.00 102.84 ? 55  LEU A CD2   1 
ATOM   418   N N     . LYS A 1 56  ? 49.091  -42.654  35.418  1.00 107.80 ? 56  LYS A N     1 
ATOM   419   C CA    . LYS A 1 56  ? 48.127  -43.232  36.344  1.00 110.01 ? 56  LYS A CA    1 
ATOM   420   C C     . LYS A 1 56  ? 46.925  -42.308  36.510  1.00 110.89 ? 56  LYS A C     1 
ATOM   421   O O     . LYS A 1 56  ? 45.783  -42.766  36.443  1.00 112.35 ? 56  LYS A O     1 
ATOM   422   C CB    . LYS A 1 56  ? 48.780  -43.526  37.698  1.00 110.81 ? 56  LYS A CB    1 
ATOM   423   C CG    . LYS A 1 56  ? 49.614  -44.793  37.727  1.00 110.93 ? 56  LYS A CG    1 
ATOM   424   C CD    . LYS A 1 56  ? 50.241  -45.012  39.089  1.00 111.67 ? 56  LYS A CD    1 
ATOM   425   C CE    . LYS A 1 56  ? 51.159  -46.217  39.056  1.00 112.17 ? 56  LYS A CE    1 
ATOM   426   N NZ    . LYS A 1 56  ? 51.795  -46.465  40.373  1.00 113.95 ? 56  LYS A NZ    1 
ATOM   427   N N     . LYS A 1 57  ? 47.185  -41.015  36.720  1.00 110.34 ? 57  LYS A N     1 
ATOM   428   C CA    . LYS A 1 57  ? 46.119  -40.016  36.886  1.00 111.39 ? 57  LYS A CA    1 
ATOM   429   C C     . LYS A 1 57  ? 45.147  -40.027  35.702  1.00 111.68 ? 57  LYS A C     1 
ATOM   430   O O     . LYS A 1 57  ? 43.939  -40.182  35.877  1.00 113.30 ? 57  LYS A O     1 
ATOM   431   C CB    . LYS A 1 57  ? 46.699  -38.614  37.097  1.00 110.19 ? 57  LYS A CB    1 
ATOM   432   C CG    . LYS A 1 57  ? 47.357  -38.403  38.447  1.00 111.28 ? 57  LYS A CG    1 
ATOM   433   C CD    . LYS A 1 57  ? 47.257  -36.947  38.898  1.00 112.13 ? 57  LYS A CD    1 
ATOM   434   C CE    . LYS A 1 57  ? 45.931  -36.665  39.607  1.00 114.36 ? 57  LYS A CE    1 
ATOM   435   N NZ    . LYS A 1 57  ? 45.853  -35.255  40.073  1.00 114.99 ? 57  LYS A NZ    1 
ATOM   436   N N     . VAL A 1 58  ? 45.692  -39.860  34.503  1.00 110.65 ? 58  VAL A N     1 
ATOM   437   C CA    . VAL A 1 58  ? 44.962  -40.094  33.264  1.00 111.14 ? 58  VAL A CA    1 
ATOM   438   C C     . VAL A 1 58  ? 45.048  -41.590  33.013  1.00 111.97 ? 58  VAL A C     1 
ATOM   439   O O     . VAL A 1 58  ? 46.039  -42.228  33.372  1.00 111.50 ? 58  VAL A O     1 
ATOM   440   C CB    . VAL A 1 58  ? 45.598  -39.322  32.071  1.00 109.65 ? 58  VAL A CB    1 
ATOM   441   C CG1   . VAL A 1 58  ? 44.802  -39.528  30.777  1.00 109.94 ? 58  VAL A CG1   1 
ATOM   442   C CG2   . VAL A 1 58  ? 45.719  -37.835  32.397  1.00 109.05 ? 58  VAL A CG2   1 
ATOM   443   N N     . ASN A 1 59  ? 44.011  -42.157  32.414  1.00 113.46 ? 59  ASN A N     1 
ATOM   444   C CA    . ASN A 1 59  ? 44.006  -43.586  32.119  1.00 114.72 ? 59  ASN A CA    1 
ATOM   445   C C     . ASN A 1 59  ? 43.840  -43.802  30.617  1.00 114.74 ? 59  ASN A C     1 
ATOM   446   O O     . ASN A 1 59  ? 42.754  -44.137  30.143  1.00 116.23 ? 59  ASN A O     1 
ATOM   447   C CB    . ASN A 1 59  ? 42.917  -44.308  32.936  1.00 116.84 ? 59  ASN A CB    1 
ATOM   448   C CG    . ASN A 1 59  ? 43.136  -45.811  33.019  1.00 117.38 ? 59  ASN A CG    1 
ATOM   449   O OD1   . ASN A 1 59  ? 44.273  -46.301  33.068  1.00 116.30 ? 59  ASN A OD1   1 
ATOM   450   N ND2   . ASN A 1 59  ? 42.038  -46.551  33.045  1.00 118.53 ? 59  ASN A ND2   1 
ATOM   451   N N     . PRO A 1 60  ? 44.926  -43.607  29.860  1.00 113.43 ? 60  PRO A N     1 
ATOM   452   C CA    . PRO A 1 60  ? 44.815  -43.564  28.412  1.00 113.54 ? 60  PRO A CA    1 
ATOM   453   C C     . PRO A 1 60  ? 45.018  -44.924  27.754  1.00 114.50 ? 60  PRO A C     1 
ATOM   454   O O     . PRO A 1 60  ? 45.931  -45.667  28.132  1.00 114.02 ? 60  PRO A O     1 
ATOM   455   C CB    . PRO A 1 60  ? 45.938  -42.596  28.012  1.00 111.74 ? 60  PRO A CB    1 
ATOM   456   C CG    . PRO A 1 60  ? 46.842  -42.466  29.246  1.00 110.63 ? 60  PRO A CG    1 
ATOM   457   C CD    . PRO A 1 60  ? 46.314  -43.392  30.296  1.00 111.97 ? 60  PRO A CD    1 
ATOM   458   N N     . GLN A 1 61  ? 44.175  -45.235  26.771  1.00 116.06 ? 61  GLN A N     1 
ATOM   459   C CA    . GLN A 1 61  ? 44.269  -46.512  26.061  1.00 117.72 ? 61  GLN A CA    1 
ATOM   460   C C     . GLN A 1 61  ? 45.446  -46.565  25.091  1.00 116.91 ? 61  GLN A C     1 
ATOM   461   O O     . GLN A 1 61  ? 46.235  -47.514  25.134  1.00 117.22 ? 61  GLN A O     1 
ATOM   462   C CB    . GLN A 1 61  ? 42.952  -46.911  25.367  1.00 119.74 ? 61  GLN A CB    1 
ATOM   463   C CG    . GLN A 1 61  ? 42.313  -45.857  24.470  1.00 120.32 ? 61  GLN A CG    1 
ATOM   464   C CD    . GLN A 1 61  ? 41.119  -45.165  25.113  1.00 121.80 ? 61  GLN A CD    1 
ATOM   465   O OE1   . GLN A 1 61  ? 40.180  -44.771  24.422  1.00 123.26 ? 61  GLN A OE1   1 
ATOM   466   N NE2   . GLN A 1 61  ? 41.146  -45.015  26.434  1.00 121.76 ? 61  GLN A NE2   1 
ATOM   467   N N     . GLU A 1 62  ? 45.565  -45.551  24.230  1.00 116.37 ? 62  GLU A N     1 
ATOM   468   C CA    . GLU A 1 62  ? 46.693  -45.449  23.296  1.00 115.42 ? 62  GLU A CA    1 
ATOM   469   C C     . GLU A 1 62  ? 47.543  -44.218  23.625  1.00 113.28 ? 62  GLU A C     1 
ATOM   470   O O     . GLU A 1 62  ? 47.082  -43.081  23.484  1.00 113.07 ? 62  GLU A O     1 
ATOM   471   C CB    . GLU A 1 62  ? 46.211  -45.411  21.831  1.00 116.60 ? 62  GLU A CB    1 
ATOM   472   C CG    . GLU A 1 62  ? 45.281  -46.571  21.390  1.00 119.83 ? 62  GLU A CG    1 
ATOM   473   C CD    . GLU A 1 62  ? 46.024  -47.832  20.924  1.00 121.49 ? 62  GLU A CD    1 
ATOM   474   O OE1   . GLU A 1 62  ? 45.917  -48.186  19.729  1.00 122.41 ? 62  GLU A OE1   1 
ATOM   475   O OE2   . GLU A 1 62  ? 46.706  -48.482  21.746  1.00 121.86 ? 62  GLU A OE2   1 
ATOM   476   N N     . VAL A 1 63  ? 48.771  -44.448  24.088  1.00 111.90 ? 63  VAL A N     1 
ATOM   477   C CA    . VAL A 1 63  ? 49.709  -43.347  24.355  1.00 109.94 ? 63  VAL A CA    1 
ATOM   478   C C     . VAL A 1 63  ? 50.853  -43.322  23.345  1.00 108.92 ? 63  VAL A C     1 
ATOM   479   O O     . VAL A 1 63  ? 51.266  -44.366  22.828  1.00 109.62 ? 63  VAL A O     1 
ATOM   480   C CB    . VAL A 1 63  ? 50.279  -43.356  25.805  1.00 109.20 ? 63  VAL A CB    1 
ATOM   481   C CG1   . VAL A 1 63  ? 49.185  -43.643  26.803  1.00 110.57 ? 63  VAL A CG1   1 
ATOM   482   C CG2   . VAL A 1 63  ? 51.392  -44.367  25.958  1.00 109.04 ? 63  VAL A CG2   1 
ATOM   483   N N     . VAL A 1 64  ? 51.355  -42.121  23.071  1.00 107.34 ? 64  VAL A N     1 
ATOM   484   C CA    . VAL A 1 64  ? 52.450  -41.939  22.128  1.00 106.14 ? 64  VAL A CA    1 
ATOM   485   C C     . VAL A 1 64  ? 53.516  -40.997  22.711  1.00 104.27 ? 64  VAL A C     1 
ATOM   486   O O     . VAL A 1 64  ? 53.217  -39.891  23.180  1.00 103.42 ? 64  VAL A O     1 
ATOM   487   C CB    . VAL A 1 64  ? 51.918  -41.543  20.710  1.00 106.89 ? 64  VAL A CB    1 
ATOM   488   C CG1   . VAL A 1 64  ? 50.928  -40.408  20.800  1.00 107.21 ? 64  VAL A CG1   1 
ATOM   489   C CG2   . VAL A 1 64  ? 53.051  -41.246  19.735  1.00 106.45 ? 64  VAL A CG2   1 
ATOM   490   N N     . VAL A 1 65  ? 54.755  -41.483  22.709  1.00 103.43 ? 65  VAL A N     1 
ATOM   491   C CA    . VAL A 1 65  ? 55.870  -40.790  23.335  1.00 102.07 ? 65  VAL A CA    1 
ATOM   492   C C     . VAL A 1 65  ? 56.833  -40.226  22.284  1.00 101.42 ? 65  VAL A C     1 
ATOM   493   O O     . VAL A 1 65  ? 56.657  -40.424  21.082  1.00 101.88 ? 65  VAL A O     1 
ATOM   494   C CB    . VAL A 1 65  ? 56.634  -41.718  24.310  1.00 101.90 ? 65  VAL A CB    1 
ATOM   495   C CG1   . VAL A 1 65  ? 57.432  -40.897  25.325  1.00 101.31 ? 65  VAL A CG1   1 
ATOM   496   C CG2   . VAL A 1 65  ? 55.673  -42.620  25.042  1.00 103.21 ? 65  VAL A CG2   1 
ATOM   497   N N     . GLU A 1 66  ? 57.853  -39.525  22.764  1.00 100.32 ? 66  GLU A N     1 
ATOM   498   C CA    . GLU A 1 66  ? 58.824  -38.851  21.927  1.00 99.64  ? 66  GLU A CA    1 
ATOM   499   C C     . GLU A 1 66  ? 59.958  -39.763  21.484  1.00 99.57  ? 66  GLU A C     1 
ATOM   500   O O     . GLU A 1 66  ? 60.430  -39.664  20.352  1.00 100.10 ? 66  GLU A O     1 
ATOM   501   C CB    . GLU A 1 66  ? 59.409  -37.680  22.706  1.00 98.68  ? 66  GLU A CB    1 
ATOM   502   C CG    . GLU A 1 66  ? 58.376  -36.756  23.312  1.00 99.17  ? 66  GLU A CG    1 
ATOM   503   C CD    . GLU A 1 66  ? 58.999  -35.625  24.101  1.00 99.05  ? 66  GLU A CD    1 
ATOM   504   O OE1   . GLU A 1 66  ? 59.695  -35.892  25.107  1.00 99.08  ? 66  GLU A OE1   1 
ATOM   505   O OE2   . GLU A 1 66  ? 58.782  -34.462  23.715  1.00 99.42  ? 66  GLU A OE2   1 
ATOM   506   N N     . ASN A 1 67  ? 60.383  -40.644  22.389  1.00 99.35  ? 67  ASN A N     1 
ATOM   507   C CA    . ASN A 1 67  ? 61.596  -41.446  22.245  1.00 99.13  ? 67  ASN A CA    1 
ATOM   508   C C     . ASN A 1 67  ? 61.270  -42.927  22.031  1.00 99.85  ? 67  ASN A C     1 
ATOM   509   O O     . ASN A 1 67  ? 60.417  -43.474  22.729  1.00 100.52 ? 67  ASN A O     1 
ATOM   510   C CB    . ASN A 1 67  ? 62.429  -41.278  23.518  1.00 98.69  ? 67  ASN A CB    1 
ATOM   511   C CG    . ASN A 1 67  ? 63.906  -41.153  23.242  1.00 98.76  ? 67  ASN A CG    1 
ATOM   512   O OD1   . ASN A 1 67  ? 64.579  -42.127  22.874  1.00 100.02 ? 67  ASN A OD1   1 
ATOM   513   N ND2   . ASN A 1 67  ? 64.430  -39.949  23.441  1.00 97.71  ? 67  ASN A ND2   1 
ATOM   514   N N     . GLU A 1 68  ? 61.949  -43.580  21.086  1.00 99.82  ? 68  GLU A N     1 
ATOM   515   C CA    . GLU A 1 68  ? 61.656  -44.988  20.768  1.00 100.62 ? 68  GLU A CA    1 
ATOM   516   C C     . GLU A 1 68  ? 62.171  -45.982  21.811  1.00 100.26 ? 68  GLU A C     1 
ATOM   517   O O     . GLU A 1 68  ? 61.782  -47.147  21.802  1.00 101.43 ? 68  GLU A O     1 
ATOM   518   C CB    . GLU A 1 68  ? 62.151  -45.375  19.362  1.00 101.53 ? 68  GLU A CB    1 
ATOM   519   C CG    . GLU A 1 68  ? 63.528  -46.058  19.290  1.00 103.05 ? 68  GLU A CG    1 
ATOM   520   C CD    . GLU A 1 68  ? 63.723  -46.905  18.026  1.00 106.37 ? 68  GLU A CD    1 
ATOM   521   O OE1   . GLU A 1 68  ? 62.857  -47.753  17.706  1.00 108.11 ? 68  GLU A OE1   1 
ATOM   522   O OE2   . GLU A 1 68  ? 64.761  -46.733  17.353  1.00 107.72 ? 68  GLU A OE2   1 
ATOM   523   N N     . ALA A 1 69  ? 63.044  -45.530  22.705  1.00 98.73  ? 69  ALA A N     1 
ATOM   524   C CA    . ALA A 1 69  ? 63.601  -46.419  23.720  1.00 98.57  ? 69  ALA A CA    1 
ATOM   525   C C     . ALA A 1 69  ? 62.659  -46.593  24.915  1.00 98.45  ? 69  ALA A C     1 
ATOM   526   O O     . ALA A 1 69  ? 62.756  -47.582  25.653  1.00 99.36  ? 69  ALA A O     1 
ATOM   527   C CB    . ALA A 1 69  ? 64.972  -45.935  24.169  1.00 97.88  ? 69  ALA A CB    1 
ATOM   528   N N     . GLU A 1 70  ? 61.752  -45.634  25.098  1.00 97.12  ? 70  GLU A N     1 
ATOM   529   C CA    . GLU A 1 70  ? 60.779  -45.682  26.188  1.00 96.75  ? 70  GLU A CA    1 
ATOM   530   C C     . GLU A 1 70  ? 59.681  -46.704  25.951  1.00 97.33  ? 70  GLU A C     1 
ATOM   531   O O     . GLU A 1 70  ? 59.173  -47.283  26.906  1.00 98.29  ? 70  GLU A O     1 
ATOM   532   C CB    . GLU A 1 70  ? 60.134  -44.321  26.404  1.00 95.95  ? 70  GLU A CB    1 
ATOM   533   C CG    . GLU A 1 70  ? 60.908  -43.407  27.306  1.00 96.15  ? 70  GLU A CG    1 
ATOM   534   C CD    . GLU A 1 70  ? 60.082  -42.220  27.753  1.00 97.58  ? 70  GLU A CD    1 
ATOM   535   O OE1   . GLU A 1 70  ? 59.138  -42.425  28.540  1.00 97.57  ? 70  GLU A OE1   1 
ATOM   536   O OE2   . GLU A 1 70  ? 60.375  -41.080  27.315  1.00 98.99  ? 70  GLU A OE2   1 
ATOM   537   N N     . VAL A 1 71  ? 59.324  -46.917  24.682  1.00 96.75  ? 71  VAL A N     1 
ATOM   538   C CA    . VAL A 1 71  ? 58.179  -47.760  24.296  1.00 97.09  ? 71  VAL A CA    1 
ATOM   539   C C     . VAL A 1 71  ? 58.105  -49.114  25.025  1.00 97.64  ? 71  VAL A C     1 
ATOM   540   O O     . VAL A 1 71  ? 57.093  -49.380  25.674  1.00 98.49  ? 71  VAL A O     1 
ATOM   541   C CB    . VAL A 1 71  ? 58.053  -47.936  22.745  1.00 97.60  ? 71  VAL A CB    1 
ATOM   542   C CG1   . VAL A 1 71  ? 56.894  -48.860  22.388  1.00 99.26  ? 71  VAL A CG1   1 
ATOM   543   C CG2   . VAL A 1 71  ? 57.863  -46.589  22.069  1.00 96.70  ? 71  VAL A CG2   1 
ATOM   544   N N     . PRO A 1 72  ? 59.166  -49.957  24.939  1.00 97.15  ? 72  PRO A N     1 
ATOM   545   C CA    . PRO A 1 72  ? 59.103  -51.269  25.596  1.00 97.94  ? 72  PRO A CA    1 
ATOM   546   C C     . PRO A 1 72  ? 59.040  -51.220  27.125  1.00 97.45  ? 72  PRO A C     1 
ATOM   547   O O     . PRO A 1 72  ? 58.499  -52.141  27.736  1.00 98.93  ? 72  PRO A O     1 
ATOM   548   C CB    . PRO A 1 72  ? 60.389  -51.964  25.133  1.00 98.17  ? 72  PRO A CB    1 
ATOM   549   C CG    . PRO A 1 72  ? 61.289  -50.886  24.736  1.00 97.07  ? 72  PRO A CG    1 
ATOM   550   C CD    . PRO A 1 72  ? 60.423  -49.799  24.186  1.00 96.49  ? 72  PRO A CD    1 
ATOM   551   N N     . LYS A 1 73  ? 59.580  -50.162  27.728  1.00 95.40  ? 73  LYS A N     1 
ATOM   552   C CA    . LYS A 1 73  ? 59.482  -49.949  29.176  1.00 94.85  ? 73  LYS A CA    1 
ATOM   553   C C     . LYS A 1 73  ? 58.054  -49.687  29.646  1.00 94.97  ? 73  LYS A C     1 
ATOM   554   O O     . LYS A 1 73  ? 57.640  -50.184  30.691  1.00 95.94  ? 73  LYS A O     1 
ATOM   555   C CB    . LYS A 1 73  ? 60.391  -48.801  29.624  1.00 93.31  ? 73  LYS A CB    1 
ATOM   556   C CG    . LYS A 1 73  ? 61.723  -49.248  30.205  1.00 93.33  ? 73  LYS A CG    1 
ATOM   557   C CD    . LYS A 1 73  ? 62.688  -49.709  29.131  1.00 92.16  ? 73  LYS A CD    1 
ATOM   558   C CE    . LYS A 1 73  ? 64.011  -50.092  29.731  1.00 91.58  ? 73  LYS A CE    1 
ATOM   559   N NZ    . LYS A 1 73  ? 64.965  -50.408  28.655  1.00 91.59  ? 73  LYS A NZ    1 
ATOM   560   N N     . LEU A 1 74  ? 57.315  -48.900  28.871  1.00 93.98  ? 74  LEU A N     1 
ATOM   561   C CA    . LEU A 1 74  ? 55.943  -48.538  29.210  1.00 94.32  ? 74  LEU A CA    1 
ATOM   562   C C     . LEU A 1 74  ? 54.936  -49.629  28.839  1.00 96.00  ? 74  LEU A C     1 
ATOM   563   O O     . LEU A 1 74  ? 53.804  -49.641  29.348  1.00 96.99  ? 74  LEU A O     1 
ATOM   564   C CB    . LEU A 1 74  ? 55.547  -47.213  28.550  1.00 93.03  ? 74  LEU A CB    1 
ATOM   565   C CG    . LEU A 1 74  ? 56.165  -45.892  29.016  1.00 91.21  ? 74  LEU A CG    1 
ATOM   566   C CD1   . LEU A 1 74  ? 55.555  -44.770  28.206  1.00 90.13  ? 74  LEU A CD1   1 
ATOM   567   C CD2   . LEU A 1 74  ? 55.971  -45.637  30.503  1.00 90.74  ? 74  LEU A CD2   1 
ATOM   568   N N     . GLN A 1 75  ? 55.341  -50.525  27.941  1.00 96.41  ? 75  GLN A N     1 
ATOM   569   C CA    . GLN A 1 75  ? 54.549  -51.712  27.613  1.00 98.02  ? 75  GLN A CA    1 
ATOM   570   C C     . GLN A 1 75  ? 54.638  -52.722  28.756  1.00 99.78  ? 75  GLN A C     1 
ATOM   571   O O     . GLN A 1 75  ? 53.652  -53.384  29.099  1.00 101.29 ? 75  GLN A O     1 
ATOM   572   C CB    . GLN A 1 75  ? 55.038  -52.351  26.312  1.00 98.07  ? 75  GLN A CB    1 
ATOM   573   C CG    . GLN A 1 75  ? 54.663  -51.586  25.057  1.00 95.69  ? 75  GLN A CG    1 
ATOM   574   C CD    . GLN A 1 75  ? 55.292  -52.172  23.814  1.00 93.80  ? 75  GLN A CD    1 
ATOM   575   O OE1   . GLN A 1 75  ? 56.387  -52.725  23.857  1.00 92.60  ? 75  GLN A OE1   1 
ATOM   576   N NE2   . GLN A 1 75  ? 54.600  -52.050  22.696  1.00 94.08  ? 75  GLN A NE2   1 
ATOM   577   N N     . ALA A 1 76  ? 55.832  -52.820  29.341  1.00 99.72  ? 76  ALA A N     1 
ATOM   578   C CA    . ALA A 1 76  ? 56.077  -53.649  30.515  1.00 101.31 ? 76  ALA A CA    1 
ATOM   579   C C     . ALA A 1 76  ? 55.310  -53.129  31.737  1.00 101.75 ? 76  ALA A C     1 
ATOM   580   O O     . ALA A 1 76  ? 55.041  -53.888  32.673  1.00 103.77 ? 76  ALA A O     1 
ATOM   581   C CB    . ALA A 1 76  ? 57.585  -53.739  30.807  1.00 100.68 ? 76  ALA A CB    1 
ATOM   582   N N     . LEU A 1 77  ? 54.946  -51.849  31.715  1.00 100.32 ? 77  LEU A N     1 
ATOM   583   C CA    . LEU A 1 77  ? 54.209  -51.241  32.815  1.00 100.73 ? 77  LEU A CA    1 
ATOM   584   C C     . LEU A 1 77  ? 52.694  -51.336  32.622  1.00 101.81 ? 77  LEU A C     1 
ATOM   585   O O     . LEU A 1 77  ? 51.930  -50.985  33.519  1.00 102.25 ? 77  LEU A O     1 
ATOM   586   C CB    . LEU A 1 77  ? 54.645  -49.788  33.021  1.00 98.93  ? 77  LEU A CB    1 
ATOM   587   C CG    . LEU A 1 77  ? 54.856  -49.335  34.471  1.00 99.55  ? 77  LEU A CG    1 
ATOM   588   C CD1   . LEU A 1 77  ? 56.244  -49.729  34.990  1.00 99.80  ? 77  LEU A CD1   1 
ATOM   589   C CD2   . LEU A 1 77  ? 54.657  -47.834  34.593  1.00 98.36  ? 77  LEU A CD2   1 
ATOM   590   N N     . GLY A 1 78  ? 52.267  -51.808  31.452  1.00 102.43 ? 78  GLY A N     1 
ATOM   591   C CA    . GLY A 1 78  ? 50.858  -52.143  31.233  1.00 104.54 ? 78  GLY A CA    1 
ATOM   592   C C     . GLY A 1 78  ? 50.090  -51.478  30.098  1.00 104.46 ? 78  GLY A C     1 
ATOM   593   O O     . GLY A 1 78  ? 48.952  -51.871  29.818  1.00 105.76 ? 78  GLY A O     1 
ATOM   594   N N     . TYR A 1 79  ? 50.704  -50.486  29.444  1.00 103.15 ? 79  TYR A N     1 
ATOM   595   C CA    . TYR A 1 79  ? 50.030  -49.677  28.413  1.00 102.88 ? 79  TYR A CA    1 
ATOM   596   C C     . TYR A 1 79  ? 50.381  -50.082  26.983  1.00 103.40 ? 79  TYR A C     1 
ATOM   597   O O     . TYR A 1 79  ? 51.464  -50.619  26.724  1.00 103.14 ? 79  TYR A O     1 
ATOM   598   C CB    . TYR A 1 79  ? 50.371  -48.196  28.577  1.00 100.84 ? 79  TYR A CB    1 
ATOM   599   C CG    . TYR A 1 79  ? 50.237  -47.658  29.974  1.00 100.14 ? 79  TYR A CG    1 
ATOM   600   C CD1   . TYR A 1 79  ? 51.316  -47.691  30.855  1.00 99.14  ? 79  TYR A CD1   1 
ATOM   601   C CD2   . TYR A 1 79  ? 49.040  -47.092  30.411  1.00 100.15 ? 79  TYR A CD2   1 
ATOM   602   C CE1   . TYR A 1 79  ? 51.203  -47.189  32.145  1.00 99.47  ? 79  TYR A CE1   1 
ATOM   603   C CE2   . TYR A 1 79  ? 48.916  -46.586  31.698  1.00 100.32 ? 79  TYR A CE2   1 
ATOM   604   C CZ    . TYR A 1 79  ? 50.001  -46.637  32.560  1.00 99.98  ? 79  TYR A CZ    1 
ATOM   605   O OH    . TYR A 1 79  ? 49.893  -46.138  33.839  1.00 100.70 ? 79  TYR A OH    1 
ATOM   606   N N     . ARG A 1 80  ? 49.461  -49.801  26.060  1.00 104.48 ? 80  ARG A N     1 
ATOM   607   C CA    . ARG A 1 80  ? 49.738  -49.892  24.625  1.00 105.12 ? 80  ARG A CA    1 
ATOM   608   C C     . ARG A 1 80  ? 50.364  -48.580  24.129  1.00 103.43 ? 80  ARG A C     1 
ATOM   609   O O     . ARG A 1 80  ? 49.759  -47.510  24.247  1.00 102.97 ? 80  ARG A O     1 
ATOM   610   C CB    . ARG A 1 80  ? 48.466  -50.250  23.845  1.00 106.97 ? 80  ARG A CB    1 
ATOM   611   C CG    . ARG A 1 80  ? 48.358  -51.732  23.433  1.00 109.80 ? 80  ARG A CG    1 
ATOM   612   C CD    . ARG A 1 80  ? 48.829  -51.954  21.985  1.00 111.87 ? 80  ARG A CD    1 
ATOM   613   N NE    . ARG A 1 80  ? 50.185  -51.442  21.737  1.00 111.00 ? 80  ARG A NE    1 
ATOM   614   C CZ    . ARG A 1 80  ? 50.758  -51.346  20.539  1.00 111.16 ? 80  ARG A CZ    1 
ATOM   615   N NH1   . ARG A 1 80  ? 50.105  -51.722  19.443  1.00 113.02 ? 80  ARG A NH1   1 
ATOM   616   N NH2   . ARG A 1 80  ? 51.993  -50.869  20.435  1.00 109.84 ? 80  ARG A NH2   1 
ATOM   617   N N     . VAL A 1 81  ? 51.583  -48.670  23.595  1.00 102.81 ? 81  VAL A N     1 
ATOM   618   C CA    . VAL A 1 81  ? 52.419  -47.486  23.345  1.00 101.15 ? 81  VAL A CA    1 
ATOM   619   C C     . VAL A 1 81  ? 53.102  -47.483  21.970  1.00 101.12 ? 81  VAL A C     1 
ATOM   620   O O     . VAL A 1 81  ? 53.518  -48.530  21.463  1.00 101.94 ? 81  VAL A O     1 
ATOM   621   C CB    . VAL A 1 81  ? 53.527  -47.330  24.438  1.00 100.03 ? 81  VAL A CB    1 
ATOM   622   C CG1   . VAL A 1 81  ? 54.094  -45.916  24.453  1.00 98.13  ? 81  VAL A CG1   1 
ATOM   623   C CG2   . VAL A 1 81  ? 52.999  -47.683  25.821  1.00 100.92 ? 81  VAL A CG2   1 
ATOM   624   N N     . SER A 1 82  ? 53.212  -46.286  21.387  1.00 100.33 ? 82  SER A N     1 
ATOM   625   C CA    . SER A 1 82  ? 54.063  -46.022  20.217  1.00 99.96  ? 82  SER A CA    1 
ATOM   626   C C     . SER A 1 82  ? 54.862  -44.721  20.411  1.00 98.13  ? 82  SER A C     1 
ATOM   627   O O     . SER A 1 82  ? 54.792  -44.101  21.477  1.00 97.13  ? 82  SER A O     1 
ATOM   628   C CB    . SER A 1 82  ? 53.218  -45.952  18.944  1.00 101.26 ? 82  SER A CB    1 
ATOM   629   O OG    . SER A 1 82  ? 52.312  -44.867  18.997  1.00 101.26 ? 82  SER A OG    1 
ATOM   630   N N     . TYR A 1 83  ? 55.625  -44.318  19.390  1.00 97.83  ? 83  TYR A N     1 
ATOM   631   C CA    . TYR A 1 83  ? 56.404  -43.066  19.432  1.00 96.11  ? 83  TYR A CA    1 
ATOM   632   C C     . TYR A 1 83  ? 56.347  -42.296  18.110  1.00 96.31  ? 83  TYR A C     1 
ATOM   633   O O     . TYR A 1 83  ? 56.436  -42.896  17.047  1.00 97.47  ? 83  TYR A O     1 
ATOM   634   C CB    . TYR A 1 83  ? 57.864  -43.344  19.813  1.00 95.10  ? 83  TYR A CB    1 
ATOM   635   C CG    . TYR A 1 83  ? 58.705  -43.879  18.678  1.00 95.49  ? 83  TYR A CG    1 
ATOM   636   C CD1   . TYR A 1 83  ? 59.569  -43.044  17.968  1.00 95.23  ? 83  TYR A CD1   1 
ATOM   637   C CD2   . TYR A 1 83  ? 58.628  -45.215  18.303  1.00 97.07  ? 83  TYR A CD2   1 
ATOM   638   C CE1   . TYR A 1 83  ? 60.337  -43.533  16.911  1.00 95.77  ? 83  TYR A CE1   1 
ATOM   639   C CE2   . TYR A 1 83  ? 59.391  -45.713  17.253  1.00 97.74  ? 83  TYR A CE2   1 
ATOM   640   C CZ    . TYR A 1 83  ? 60.241  -44.872  16.563  1.00 96.76  ? 83  TYR A CZ    1 
ATOM   641   O OH    . TYR A 1 83  ? 60.986  -45.386  15.529  1.00 97.62  ? 83  TYR A OH    1 
ATOM   642   N N     . GLU A 1 84  ? 56.183  -40.976  18.180  1.00 95.41  ? 84  GLU A N     1 
ATOM   643   C CA    . GLU A 1 84  ? 56.348  -40.111  17.008  1.00 95.39  ? 84  GLU A CA    1 
ATOM   644   C C     . GLU A 1 84  ? 57.535  -39.176  17.229  1.00 93.71  ? 84  GLU A C     1 
ATOM   645   O O     . GLU A 1 84  ? 57.569  -38.444  18.226  1.00 92.75  ? 84  GLU A O     1 
ATOM   646   C CB    . GLU A 1 84  ? 55.080  -39.315  16.694  1.00 96.21  ? 84  GLU A CB    1 
ATOM   647   C CG    . GLU A 1 84  ? 54.302  -39.851  15.504  1.00 99.05  ? 84  GLU A CG    1 
ATOM   648   C CD    . GLU A 1 84  ? 53.368  -38.814  14.877  1.00 101.66 ? 84  GLU A CD    1 
ATOM   649   O OE1   . GLU A 1 84  ? 53.783  -37.641  14.717  1.00 100.50 ? 84  GLU A OE1   1 
ATOM   650   O OE2   . GLU A 1 84  ? 52.216  -39.178  14.528  1.00 104.59 ? 84  GLU A OE2   1 
ATOM   651   N N     . PRO A 1 85  ? 58.516  -39.204  16.303  1.00 93.45  ? 85  PRO A N     1 
ATOM   652   C CA    . PRO A 1 85  ? 59.777  -38.459  16.407  1.00 91.90  ? 85  PRO A CA    1 
ATOM   653   C C     . PRO A 1 85  ? 59.620  -36.929  16.571  1.00 90.77  ? 85  PRO A C     1 
ATOM   654   O O     . PRO A 1 85  ? 59.667  -36.421  17.706  1.00 89.90  ? 85  PRO A O     1 
ATOM   655   C CB    . PRO A 1 85  ? 60.508  -38.820  15.101  1.00 92.68  ? 85  PRO A CB    1 
ATOM   656   C CG    . PRO A 1 85  ? 59.450  -39.306  14.185  1.00 94.66  ? 85  PRO A CG    1 
ATOM   657   C CD    . PRO A 1 85  ? 58.461  -39.997  15.062  1.00 94.96  ? 85  PRO A CD    1 
ATOM   658   N N     . TYR A 1 86  ? 59.439  -36.218  15.458  1.00 90.61  ? 86  TYR A N     1 
ATOM   659   C CA    . TYR A 1 86  ? 59.348  -34.761  15.449  1.00 89.41  ? 86  TYR A CA    1 
ATOM   660   C C     . TYR A 1 86  ? 57.889  -34.332  15.314  1.00 90.31  ? 86  TYR A C     1 
ATOM   661   O O     . TYR A 1 86  ? 57.543  -33.531  14.446  1.00 91.66  ? 86  TYR A O     1 
ATOM   662   C CB    . TYR A 1 86  ? 60.214  -34.175  14.317  1.00 89.50  ? 86  TYR A CB    1 
ATOM   663   C CG    . TYR A 1 86  ? 60.245  -35.013  13.048  1.00 89.40  ? 86  TYR A CG    1 
ATOM   664   C CD1   . TYR A 1 86  ? 59.264  -34.866  12.070  1.00 90.08  ? 86  TYR A CD1   1 
ATOM   665   C CD2   . TYR A 1 86  ? 61.252  -35.956  12.830  1.00 87.81  ? 86  TYR A CD2   1 
ATOM   666   C CE1   . TYR A 1 86  ? 59.274  -35.638  10.914  1.00 90.71  ? 86  TYR A CE1   1 
ATOM   667   C CE2   . TYR A 1 86  ? 61.271  -36.733  11.679  1.00 88.88  ? 86  TYR A CE2   1 
ATOM   668   C CZ    . TYR A 1 86  ? 60.276  -36.564  10.725  1.00 90.50  ? 86  TYR A CZ    1 
ATOM   669   O OH    . TYR A 1 86  ? 60.279  -37.314  9.573   1.00 92.60  ? 86  TYR A OH    1 
ATOM   670   N N     . SER A 1 87  ? 57.043  -34.866  16.192  1.00 89.90  ? 87  SER A N     1 
ATOM   671   C CA    . SER A 1 87  ? 55.584  -34.694  16.130  1.00 90.67  ? 87  SER A CA    1 
ATOM   672   C C     . SER A 1 87  ? 55.135  -33.247  16.259  1.00 90.44  ? 87  SER A C     1 
ATOM   673   O O     . SER A 1 87  ? 55.865  -32.425  16.798  1.00 89.40  ? 87  SER A O     1 
ATOM   674   C CB    . SER A 1 87  ? 54.915  -35.526  17.232  1.00 90.63  ? 87  SER A CB    1 
ATOM   675   O OG    . SER A 1 87  ? 55.248  -35.049  18.533  1.00 89.27  ? 87  SER A OG    1 
ATOM   676   N N     . LYS A 1 88  ? 53.927  -32.951  15.782  1.00 91.61  ? 88  LYS A N     1 
ATOM   677   C CA    . LYS A 1 88  ? 53.350  -31.607  15.901  1.00 91.97  ? 88  LYS A CA    1 
ATOM   678   C C     . LYS A 1 88  ? 53.173  -31.184  17.359  1.00 90.74  ? 88  LYS A C     1 
ATOM   679   O O     . LYS A 1 88  ? 53.356  -30.015  17.703  1.00 90.29  ? 88  LYS A O     1 
ATOM   680   C CB    . LYS A 1 88  ? 52.025  -31.502  15.138  1.00 93.75  ? 88  LYS A CB    1 
ATOM   681   C CG    . LYS A 1 88  ? 52.209  -31.413  13.622  1.00 96.35  ? 88  LYS A CG    1 
ATOM   682   C CD    . LYS A 1 88  ? 50.901  -31.141  12.878  1.00 99.64  ? 88  LYS A CD    1 
ATOM   683   C CE    . LYS A 1 88  ? 51.139  -30.967  11.368  1.00 101.51 ? 88  LYS A CE    1 
ATOM   684   N NZ    . LYS A 1 88  ? 49.874  -30.647  10.628  1.00 103.72 ? 88  LYS A NZ    1 
ATOM   685   N N     . VAL A 1 89  ? 52.843  -32.154  18.208  1.00 90.35  ? 89  VAL A N     1 
ATOM   686   C CA    . VAL A 1 89  ? 52.626  -31.929  19.641  1.00 89.38  ? 89  VAL A CA    1 
ATOM   687   C C     . VAL A 1 89  ? 53.916  -31.561  20.389  1.00 87.81  ? 89  VAL A C     1 
ATOM   688   O O     . VAL A 1 89  ? 53.925  -30.617  21.186  1.00 87.24  ? 89  VAL A O     1 
ATOM   689   C CB    . VAL A 1 89  ? 51.951  -33.158  20.301  1.00 89.70  ? 89  VAL A CB    1 
ATOM   690   C CG1   . VAL A 1 89  ? 51.777  -32.951  21.798  1.00 88.88  ? 89  VAL A CG1   1 
ATOM   691   C CG2   . VAL A 1 89  ? 50.605  -33.448  19.642  1.00 91.31  ? 89  VAL A CG2   1 
ATOM   692   N N     . SER A 1 90  ? 54.993  -32.305  20.127  1.00 87.16  ? 90  SER A N     1 
ATOM   693   C CA    . SER A 1 90  ? 56.306  -32.034  20.739  1.00 86.01  ? 90  SER A CA    1 
ATOM   694   C C     . SER A 1 90  ? 56.824  -30.642  20.389  1.00 85.93  ? 90  SER A C     1 
ATOM   695   O O     . SER A 1 90  ? 57.491  -29.987  21.200  1.00 85.12  ? 90  SER A O     1 
ATOM   696   C CB    . SER A 1 90  ? 57.339  -33.102  20.352  1.00 85.66  ? 90  SER A CB    1 
ATOM   697   O OG    . SER A 1 90  ? 57.580  -33.150  18.953  1.00 86.13  ? 90  SER A OG    1 
ATOM   698   N N     . ARG A 1 91  ? 56.504  -30.203  19.174  1.00 86.98  ? 91  ARG A N     1 
ATOM   699   C CA    . ARG A 1 91  ? 56.794  -28.852  18.731  1.00 87.27  ? 91  ARG A CA    1 
ATOM   700   C C     . ARG A 1 91  ? 55.888  -27.870  19.464  1.00 87.71  ? 91  ARG A C     1 
ATOM   701   O O     . ARG A 1 91  ? 56.378  -26.917  20.062  1.00 87.40  ? 91  ARG A O     1 
ATOM   702   C CB    . ARG A 1 91  ? 56.618  -28.719  17.217  1.00 88.50  ? 91  ARG A CB    1 
ATOM   703   C CG    . ARG A 1 91  ? 57.695  -29.392  16.374  1.00 88.19  ? 91  ARG A CG    1 
ATOM   704   C CD    . ARG A 1 91  ? 57.416  -29.192  14.876  1.00 89.58  ? 91  ARG A CD    1 
ATOM   705   N NE    . ARG A 1 91  ? 57.547  -27.790  14.469  1.00 89.16  ? 91  ARG A NE    1 
ATOM   706   C CZ    . ARG A 1 91  ? 58.677  -27.231  14.047  1.00 88.22  ? 91  ARG A CZ    1 
ATOM   707   N NH1   . ARG A 1 91  ? 59.791  -27.948  13.957  1.00 86.94  ? 91  ARG A NH1   1 
ATOM   708   N NH2   . ARG A 1 91  ? 58.693  -25.950  13.712  1.00 88.85  ? 91  ARG A NH2   1 
ATOM   709   N N     . ILE A 1 92  ? 54.576  -28.117  19.439  1.00 88.72  ? 92  ILE A N     1 
ATOM   710   C CA    . ILE A 1 92  ? 53.602  -27.255  20.135  1.00 89.37  ? 92  ILE A CA    1 
ATOM   711   C C     . ILE A 1 92  ? 54.001  -26.998  21.590  1.00 88.32  ? 92  ILE A C     1 
ATOM   712   O O     . ILE A 1 92  ? 53.854  -25.880  22.096  1.00 88.59  ? 92  ILE A O     1 
ATOM   713   C CB    . ILE A 1 92  ? 52.153  -27.825  20.070  1.00 90.45  ? 92  ILE A CB    1 
ATOM   714   C CG1   . ILE A 1 92  ? 51.560  -27.618  18.670  1.00 92.05  ? 92  ILE A CG1   1 
ATOM   715   C CG2   . ILE A 1 92  ? 51.253  -27.170  21.128  1.00 90.61  ? 92  ILE A CG2   1 
ATOM   716   C CD1   . ILE A 1 92  ? 50.293  -28.412  18.393  1.00 92.69  ? 92  ILE A CD1   1 
ATOM   717   N N     . PHE A 1 93  ? 54.509  -28.038  22.245  1.00 87.32  ? 93  PHE A N     1 
ATOM   718   C CA    . PHE A 1 93  ? 55.004  -27.927  23.604  1.00 86.54  ? 93  PHE A CA    1 
ATOM   719   C C     . PHE A 1 93  ? 56.176  -26.965  23.713  1.00 86.23  ? 93  PHE A C     1 
ATOM   720   O O     . PHE A 1 93  ? 56.173  -26.073  24.562  1.00 86.05  ? 93  PHE A O     1 
ATOM   721   C CB    . PHE A 1 93  ? 55.409  -29.303  24.140  1.00 85.88  ? 93  PHE A CB    1 
ATOM   722   C CG    . PHE A 1 93  ? 56.241  -29.244  25.393  1.00 84.49  ? 93  PHE A CG    1 
ATOM   723   C CD1   . PHE A 1 93  ? 55.687  -28.813  26.595  1.00 83.79  ? 93  PHE A CD1   1 
ATOM   724   C CD2   . PHE A 1 93  ? 57.577  -29.617  25.368  1.00 83.08  ? 93  PHE A CD2   1 
ATOM   725   C CE1   . PHE A 1 93  ? 56.451  -28.747  27.740  1.00 83.04  ? 93  PHE A CE1   1 
ATOM   726   C CE2   . PHE A 1 93  ? 58.348  -29.559  26.518  1.00 82.38  ? 93  PHE A CE2   1 
ATOM   727   C CZ    . PHE A 1 93  ? 57.782  -29.124  27.705  1.00 82.55  ? 93  PHE A CZ    1 
ATOM   728   N N     . ARG A 1 94  ? 57.172  -27.158  22.849  1.00 86.48  ? 94  ARG A N     1 
ATOM   729   C CA    . ARG A 1 94  ? 58.408  -26.375  22.890  1.00 86.48  ? 94  ARG A CA    1 
ATOM   730   C C     . ARG A 1 94  ? 58.234  -24.921  22.418  1.00 87.70  ? 94  ARG A C     1 
ATOM   731   O O     . ARG A 1 94  ? 58.994  -24.037  22.823  1.00 87.75  ? 94  ARG A O     1 
ATOM   732   C CB    . ARG A 1 94  ? 59.526  -27.095  22.128  1.00 85.78  ? 94  ARG A CB    1 
ATOM   733   C CG    . ARG A 1 94  ? 60.035  -28.356  22.832  1.00 84.72  ? 94  ARG A CG    1 
ATOM   734   C CD    . ARG A 1 94  ? 61.314  -28.894  22.213  1.00 83.37  ? 94  ARG A CD    1 
ATOM   735   N NE    . ARG A 1 94  ? 61.098  -29.354  20.842  1.00 84.10  ? 94  ARG A NE    1 
ATOM   736   C CZ    . ARG A 1 94  ? 60.834  -30.612  20.499  1.00 84.32  ? 94  ARG A CZ    1 
ATOM   737   N NH1   . ARG A 1 94  ? 60.649  -30.936  19.222  1.00 84.71  ? 94  ARG A NH1   1 
ATOM   738   N NH2   . ARG A 1 94  ? 60.754  -31.550  21.431  1.00 84.42  ? 94  ARG A NH2   1 
ATOM   739   N N     . GLU A 1 95  ? 57.224  -24.678  21.585  1.00 89.23  ? 95  GLU A N     1 
ATOM   740   C CA    . GLU A 1 95  ? 56.899  -23.329  21.114  1.00 90.98  ? 95  GLU A CA    1 
ATOM   741   C C     . GLU A 1 95  ? 56.512  -22.425  22.287  1.00 91.38  ? 95  GLU A C     1 
ATOM   742   O O     . GLU A 1 95  ? 56.708  -21.210  22.247  1.00 92.10  ? 95  GLU A O     1 
ATOM   743   C CB    . GLU A 1 95  ? 55.743  -23.361  20.094  1.00 92.41  ? 95  GLU A CB    1 
ATOM   744   C CG    . GLU A 1 95  ? 55.981  -24.163  18.802  1.00 93.50  ? 95  GLU A CG    1 
ATOM   745   C CD    . GLU A 1 95  ? 56.660  -23.361  17.691  1.00 95.50  ? 95  GLU A CD    1 
ATOM   746   O OE1   . GLU A 1 95  ? 57.084  -22.209  17.939  1.00 95.91  ? 95  GLU A OE1   1 
ATOM   747   O OE2   . GLU A 1 95  ? 56.766  -23.890  16.559  1.00 96.56  ? 95  GLU A OE2   1 
ATOM   748   N N     . SER A 1 96  ? 55.957  -23.038  23.327  1.00 91.50  ? 96  SER A N     1 
ATOM   749   C CA    . SER A 1 96  ? 55.430  -22.316  24.480  1.00 92.25  ? 96  SER A CA    1 
ATOM   750   C C     . SER A 1 96  ? 56.249  -22.636  25.717  1.00 91.49  ? 96  SER A C     1 
ATOM   751   O O     . SER A 1 96  ? 55.785  -22.449  26.845  1.00 91.45  ? 96  SER A O     1 
ATOM   752   C CB    . SER A 1 96  ? 53.965  -22.702  24.712  1.00 93.04  ? 96  SER A CB    1 
ATOM   753   O OG    . SER A 1 96  ? 53.842  -24.103  24.906  1.00 92.64  ? 96  SER A OG    1 
ATOM   754   N N     . LEU A 1 97  ? 57.473  -23.110  25.494  1.00 91.06  ? 97  LEU A N     1 
ATOM   755   C CA    . LEU A 1 97  ? 58.342  -23.545  26.588  1.00 90.95  ? 97  LEU A CA    1 
ATOM   756   C C     . LEU A 1 97  ? 58.955  -22.426  27.434  1.00 91.75  ? 97  LEU A C     1 
ATOM   757   O O     . LEU A 1 97  ? 59.182  -22.625  28.630  1.00 92.16  ? 97  LEU A O     1 
ATOM   758   C CB    . LEU A 1 97  ? 59.435  -24.496  26.104  1.00 89.86  ? 97  LEU A CB    1 
ATOM   759   C CG    . LEU A 1 97  ? 59.656  -25.763  26.942  1.00 88.70  ? 97  LEU A CG    1 
ATOM   760   C CD1   . LEU A 1 97  ? 60.568  -26.679  26.168  1.00 88.58  ? 97  LEU A CD1   1 
ATOM   761   C CD2   . LEU A 1 97  ? 60.212  -25.521  28.337  1.00 86.48  ? 97  LEU A CD2   1 
ATOM   762   N N     . PRO A 1 98  ? 59.238  -21.249  26.840  1.00 92.50  ? 98  PRO A N     1 
ATOM   763   C CA    . PRO A 1 98  ? 59.529  -20.171  27.779  1.00 93.18  ? 98  PRO A CA    1 
ATOM   764   C C     . PRO A 1 98  ? 58.383  -20.031  28.790  1.00 94.31  ? 98  PRO A C     1 
ATOM   765   O O     . PRO A 1 98  ? 58.640  -19.931  29.995  1.00 94.82  ? 98  PRO A O     1 
ATOM   766   C CB    . PRO A 1 98  ? 59.607  -18.932  26.883  1.00 93.95  ? 98  PRO A CB    1 
ATOM   767   C CG    . PRO A 1 98  ? 59.033  -19.363  25.541  1.00 94.03  ? 98  PRO A CG    1 
ATOM   768   C CD    . PRO A 1 98  ? 59.353  -20.807  25.440  1.00 92.76  ? 98  PRO A CD    1 
ATOM   769   N N     . LYS A 1 99  ? 57.137  -20.090  28.297  1.00 94.86  ? 99  LYS A N     1 
ATOM   770   C CA    . LYS A 1 99  ? 55.933  -19.804  29.095  1.00 95.53  ? 99  LYS A CA    1 
ATOM   771   C C     . LYS A 1 99  ? 55.463  -20.913  30.049  1.00 94.86  ? 99  LYS A C     1 
ATOM   772   O O     . LYS A 1 99  ? 55.356  -20.674  31.248  1.00 95.30  ? 99  LYS A O     1 
ATOM   773   C CB    . LYS A 1 99  ? 54.783  -19.305  28.190  1.00 96.67  ? 99  LYS A CB    1 
ATOM   774   C CG    . LYS A 1 99  ? 53.360  -19.538  28.734  1.00 98.23  ? 99  LYS A CG    1 
ATOM   775   C CD    . LYS A 1 99  ? 52.466  -18.307  28.591  1.00 100.96 ? 99  LYS A CD    1 
ATOM   776   C CE    . LYS A 1 99  ? 52.573  -17.388  29.811  1.00 101.81 ? 99  LYS A CE    1 
ATOM   777   N NZ    . LYS A 1 99  ? 51.880  -16.087  29.592  1.00 103.80 ? 99  LYS A NZ    1 
ATOM   778   N N     . VAL A 1 100 ? 55.187  -22.110  29.528  1.00 93.81  ? 100 VAL A N     1 
ATOM   779   C CA    . VAL A 1 100 ? 54.510  -23.154  30.319  1.00 93.47  ? 100 VAL A CA    1 
ATOM   780   C C     . VAL A 1 100 ? 55.286  -23.652  31.540  1.00 92.88  ? 100 VAL A C     1 
ATOM   781   O O     . VAL A 1 100 ? 54.786  -24.471  32.295  1.00 93.06  ? 100 VAL A O     1 
ATOM   782   C CB    . VAL A 1 100 ? 54.054  -24.373  29.469  1.00 93.10  ? 100 VAL A CB    1 
ATOM   783   C CG1   . VAL A 1 100 ? 53.009  -23.957  28.429  1.00 94.08  ? 100 VAL A CG1   1 
ATOM   784   C CG2   . VAL A 1 100 ? 55.246  -25.082  28.838  1.00 91.85  ? 100 VAL A CG2   1 
ATOM   785   N N     . ALA A 1 101 ? 56.503  -23.155  31.725  1.00 92.29  ? 101 ALA A N     1 
ATOM   786   C CA    . ALA A 1 101 ? 57.268  -23.421  32.939  1.00 91.93  ? 101 ALA A CA    1 
ATOM   787   C C     . ALA A 1 101 ? 56.617  -22.734  34.128  1.00 93.04  ? 101 ALA A C     1 
ATOM   788   O O     . ALA A 1 101 ? 56.610  -23.268  35.234  1.00 93.61  ? 101 ALA A O     1 
ATOM   789   C CB    . ALA A 1 101 ? 58.689  -22.941  32.774  1.00 91.44  ? 101 ALA A CB    1 
ATOM   790   N N     . ILE A 1 102 ? 56.078  -21.541  33.876  1.00 93.47  ? 102 ILE A N     1 
ATOM   791   C CA    . ILE A 1 102 ? 55.379  -20.731  34.873  1.00 94.37  ? 102 ILE A CA    1 
ATOM   792   C C     . ILE A 1 102 ? 53.976  -21.296  35.115  1.00 94.84  ? 102 ILE A C     1 
ATOM   793   O O     . ILE A 1 102 ? 53.532  -21.410  36.267  1.00 95.64  ? 102 ILE A O     1 
ATOM   794   C CB    . ILE A 1 102 ? 55.333  -19.233  34.429  1.00 94.81  ? 102 ILE A CB    1 
ATOM   795   C CG1   . ILE A 1 102 ? 56.636  -18.528  34.788  1.00 94.57  ? 102 ILE A CG1   1 
ATOM   796   C CG2   . ILE A 1 102 ? 54.190  -18.486  35.064  1.00 96.47  ? 102 ILE A CG2   1 
ATOM   797   C CD1   . ILE A 1 102 ? 57.744  -18.735  33.783  1.00 93.99  ? 102 ILE A CD1   1 
ATOM   798   N N     . ASP A 1 103 ? 53.308  -21.666  34.020  1.00 94.16  ? 103 ASP A N     1 
ATOM   799   C CA    . ASP A 1 103 ? 51.925  -22.142  34.048  1.00 94.69  ? 103 ASP A CA    1 
ATOM   800   C C     . ASP A 1 103 ? 51.750  -23.404  34.886  1.00 94.51  ? 103 ASP A C     1 
ATOM   801   O O     . ASP A 1 103 ? 50.797  -23.496  35.662  1.00 95.56  ? 103 ASP A O     1 
ATOM   802   C CB    . ASP A 1 103 ? 51.392  -22.358  32.626  1.00 94.35  ? 103 ASP A CB    1 
ATOM   803   C CG    . ASP A 1 103 ? 51.165  -21.050  31.871  1.00 95.24  ? 103 ASP A CG    1 
ATOM   804   O OD1   . ASP A 1 103 ? 51.206  -19.961  32.488  1.00 96.77  ? 103 ASP A OD1   1 
ATOM   805   O OD2   . ASP A 1 103 ? 50.937  -21.113  30.645  1.00 95.37  ? 103 ASP A OD2   1 
ATOM   806   N N     . ILE A 1 104 ? 52.668  -24.362  34.733  1.00 93.19  ? 104 ILE A N     1 
ATOM   807   C CA    . ILE A 1 104 ? 52.649  -25.587  35.544  1.00 93.19  ? 104 ILE A CA    1 
ATOM   808   C C     . ILE A 1 104 ? 53.475  -25.433  36.827  1.00 93.80  ? 104 ILE A C     1 
ATOM   809   O O     . ILE A 1 104 ? 53.774  -26.414  37.513  1.00 93.89  ? 104 ILE A O     1 
ATOM   810   C CB    . ILE A 1 104 ? 53.060  -26.878  34.752  1.00 91.92  ? 104 ILE A CB    1 
ATOM   811   C CG1   . ILE A 1 104 ? 54.579  -26.953  34.529  1.00 90.77  ? 104 ILE A CG1   1 
ATOM   812   C CG2   . ILE A 1 104 ? 52.246  -27.023  33.460  1.00 91.20  ? 104 ILE A CG2   1 
ATOM   813   C CD1   . ILE A 1 104 ? 55.110  -28.350  34.195  1.00 88.94  ? 104 ILE A CD1   1 
ATOM   814   N N     . LYS A 1 105 ? 53.823  -24.185  37.137  1.00 94.43  ? 105 LYS A N     1 
ATOM   815   C CA    . LYS A 1 105 ? 54.518  -23.823  38.375  1.00 95.58  ? 105 LYS A CA    1 
ATOM   816   C C     . LYS A 1 105 ? 55.769  -24.664  38.644  1.00 94.91  ? 105 LYS A C     1 
ATOM   817   O O     . LYS A 1 105 ? 55.884  -25.330  39.672  1.00 95.65  ? 105 LYS A O     1 
ATOM   818   C CB    . LYS A 1 105 ? 53.550  -23.807  39.575  1.00 97.35  ? 105 LYS A CB    1 
ATOM   819   C CG    . LYS A 1 105 ? 52.750  -22.500  39.704  1.00 99.04  ? 105 LYS A CG    1 
ATOM   820   C CD    . LYS A 1 105 ? 51.609  -22.621  40.713  1.00 101.47 ? 105 LYS A CD    1 
ATOM   821   C CE    . LYS A 1 105 ? 50.909  -21.281  40.926  1.00 102.61 ? 105 LYS A CE    1 
ATOM   822   N NZ    . LYS A 1 105 ? 49.702  -21.421  41.791  1.00 103.93 ? 105 LYS A NZ    1 
ATOM   823   N N     . PHE A 1 106 ? 56.694  -24.632  37.689  1.00 93.82  ? 106 PHE A N     1 
ATOM   824   C CA    . PHE A 1 106 ? 58.032  -25.200  37.859  1.00 93.36  ? 106 PHE A CA    1 
ATOM   825   C C     . PHE A 1 106 ? 58.978  -24.115  38.392  1.00 94.13  ? 106 PHE A C     1 
ATOM   826   O O     . PHE A 1 106 ? 59.916  -24.405  39.156  1.00 94.56  ? 106 PHE A O     1 
ATOM   827   C CB    . PHE A 1 106 ? 58.534  -25.786  36.534  1.00 91.74  ? 106 PHE A CB    1 
ATOM   828   C CG    . PHE A 1 106 ? 59.849  -26.514  36.636  1.00 90.57  ? 106 PHE A CG    1 
ATOM   829   C CD1   . PHE A 1 106 ? 60.998  -25.975  36.080  1.00 90.03  ? 106 PHE A CD1   1 
ATOM   830   C CD2   . PHE A 1 106 ? 59.938  -27.740  37.268  1.00 90.78  ? 106 PHE A CD2   1 
ATOM   831   C CE1   . PHE A 1 106 ? 62.222  -26.641  36.165  1.00 89.49  ? 106 PHE A CE1   1 
ATOM   832   C CE2   . PHE A 1 106 ? 61.156  -28.412  37.356  1.00 90.75  ? 106 PHE A CE2   1 
ATOM   833   C CZ    . PHE A 1 106 ? 62.299  -27.859  36.803  1.00 89.61  ? 106 PHE A CZ    1 
ATOM   834   N N     . ALA A 1 107 ? 58.719  -22.872  37.983  1.00 94.41  ? 107 ALA A N     1 
ATOM   835   C CA    . ALA A 1 107 ? 59.362  -21.691  38.559  1.00 95.52  ? 107 ALA A CA    1 
ATOM   836   C C     . ALA A 1 107 ? 58.347  -20.557  38.624  1.00 96.87  ? 107 ALA A C     1 
ATOM   837   O O     . ALA A 1 107 ? 57.367  -20.563  37.870  1.00 96.88  ? 107 ALA A O     1 
ATOM   838   C CB    . ALA A 1 107 ? 60.562  -21.283  37.742  1.00 94.55  ? 107 ALA A CB    1 
ATOM   839   N N     . SER A 1 108 ? 58.574  -19.596  39.523  1.00 98.36  ? 108 SER A N     1 
ATOM   840   C CA    . SER A 1 108 ? 57.644  -18.477  39.700  1.00 99.83  ? 108 SER A CA    1 
ATOM   841   C C     . SER A 1 108 ? 57.652  -17.519  38.500  1.00 99.33  ? 108 SER A C     1 
ATOM   842   O O     . SER A 1 108 ? 56.589  -17.055  38.069  1.00 99.84  ? 108 SER A O     1 
ATOM   843   C CB    . SER A 1 108 ? 57.906  -17.732  41.018  1.00 101.68 ? 108 SER A CB    1 
ATOM   844   O OG    . SER A 1 108 ? 59.206  -17.171  41.052  1.00 102.21 ? 108 SER A OG    1 
ATOM   845   N N     . ASN A 1 109 ? 58.847  -17.247  37.964  1.00 98.52  ? 109 ASN A N     1 
ATOM   846   C CA    . ASN A 1 109 ? 59.024  -16.389  36.778  1.00 97.95  ? 109 ASN A CA    1 
ATOM   847   C C     . ASN A 1 109 ? 60.056  -16.934  35.785  1.00 96.50  ? 109 ASN A C     1 
ATOM   848   O O     . ASN A 1 109 ? 60.705  -17.946  36.054  1.00 95.81  ? 109 ASN A O     1 
ATOM   849   C CB    . ASN A 1 109 ? 59.373  -14.952  37.190  1.00 99.18  ? 109 ASN A CB    1 
ATOM   850   C CG    . ASN A 1 109 ? 60.697  -14.847  37.930  1.00 98.91  ? 109 ASN A CG    1 
ATOM   851   O OD1   . ASN A 1 109 ? 61.258  -15.838  38.391  1.00 97.53  ? 109 ASN A OD1   1 
ATOM   852   N ND2   . ASN A 1 109 ? 61.197  -13.629  38.051  1.00 100.34 ? 109 ASN A ND2   1 
ATOM   853   N N     . GLU A 1 110 ? 60.201  -16.266  34.641  1.00 96.36  ? 110 GLU A N     1 
ATOM   854   C CA    . GLU A 1 110 ? 61.160  -16.688  33.603  1.00 95.32  ? 110 GLU A CA    1 
ATOM   855   C C     . GLU A 1 110 ? 62.607  -16.568  34.074  1.00 94.89  ? 110 GLU A C     1 
ATOM   856   O O     . GLU A 1 110 ? 63.433  -17.452  33.818  1.00 93.60  ? 110 GLU A O     1 
ATOM   857   C CB    . GLU A 1 110 ? 60.972  -15.881  32.315  1.00 95.69  ? 110 GLU A CB    1 
ATOM   858   C CG    . GLU A 1 110 ? 59.797  -16.329  31.445  1.00 96.51  ? 110 GLU A CG    1 
ATOM   859   C CD    . GLU A 1 110 ? 59.853  -15.759  30.030  1.00 98.15  ? 110 GLU A CD    1 
ATOM   860   O OE1   . GLU A 1 110 ? 60.967  -15.415  29.556  1.00 98.20  ? 110 GLU A OE1   1 
ATOM   861   O OE2   . GLU A 1 110 ? 58.779  -15.664  29.390  1.00 99.07  ? 110 GLU A OE2   1 
ATOM   862   N N     . GLU A 1 111 ? 62.879  -15.465  34.766  1.00 95.82  ? 111 GLU A N     1 
ATOM   863   C CA    . GLU A 1 111 ? 64.180  -15.152  35.351  1.00 96.05  ? 111 GLU A CA    1 
ATOM   864   C C     . GLU A 1 111 ? 64.910  -16.352  35.975  1.00 95.10  ? 111 GLU A C     1 
ATOM   865   O O     . GLU A 1 111 ? 66.081  -16.582  35.679  1.00 94.56  ? 111 GLU A O     1 
ATOM   866   C CB    . GLU A 1 111 ? 64.008  -14.011  36.366  1.00 98.06  ? 111 GLU A CB    1 
ATOM   867   C CG    . GLU A 1 111 ? 65.144  -13.812  37.361  1.00 99.70  ? 111 GLU A CG    1 
ATOM   868   C CD    . GLU A 1 111 ? 66.366  -13.156  36.756  1.00 100.73 ? 111 GLU A CD    1 
ATOM   869   O OE1   . GLU A 1 111 ? 67.461  -13.335  37.330  1.00 101.72 ? 111 GLU A OE1   1 
ATOM   870   O OE2   . GLU A 1 111 ? 66.239  -12.463  35.720  1.00 101.23 ? 111 GLU A OE2   1 
ATOM   871   N N     . ASP A 1 112 ? 64.236  -17.118  36.829  1.00 94.91  ? 112 ASP A N     1 
ATOM   872   C CA    . ASP A 1 112 ? 64.912  -18.251  37.455  1.00 94.23  ? 112 ASP A CA    1 
ATOM   873   C C     . ASP A 1 112 ? 64.459  -19.630  36.973  1.00 92.21  ? 112 ASP A C     1 
ATOM   874   O O     . ASP A 1 112 ? 64.817  -20.641  37.571  1.00 92.18  ? 112 ASP A O     1 
ATOM   875   C CB    . ASP A 1 112 ? 64.986  -18.130  38.998  1.00 96.26  ? 112 ASP A CB    1 
ATOM   876   C CG    . ASP A 1 112 ? 63.622  -18.239  39.691  1.00 98.38  ? 112 ASP A CG    1 
ATOM   877   O OD1   . ASP A 1 112 ? 63.487  -17.680  40.806  1.00 101.15 ? 112 ASP A OD1   1 
ATOM   878   O OD2   . ASP A 1 112 ? 62.696  -18.891  39.155  1.00 98.93  ? 112 ASP A OD2   1 
ATOM   879   N N     . TYR A 1 113 ? 63.688  -19.673  35.889  1.00 90.42  ? 113 TYR A N     1 
ATOM   880   C CA    . TYR A 1 113 ? 63.580  -20.913  35.120  1.00 88.22  ? 113 TYR A CA    1 
ATOM   881   C C     . TYR A 1 113 ? 64.920  -21.141  34.419  1.00 86.57  ? 113 TYR A C     1 
ATOM   882   O O     . TYR A 1 113 ? 65.470  -22.252  34.445  1.00 85.71  ? 113 TYR A O     1 
ATOM   883   C CB    . TYR A 1 113 ? 62.456  -20.849  34.080  1.00 87.89  ? 113 TYR A CB    1 
ATOM   884   C CG    . TYR A 1 113 ? 62.590  -21.889  32.974  1.00 87.01  ? 113 TYR A CG    1 
ATOM   885   C CD1   . TYR A 1 113 ? 62.505  -23.256  33.260  1.00 87.11  ? 113 TYR A CD1   1 
ATOM   886   C CD2   . TYR A 1 113 ? 62.800  -21.508  31.644  1.00 86.44  ? 113 TYR A CD2   1 
ATOM   887   C CE1   . TYR A 1 113 ? 62.632  -24.218  32.253  1.00 86.51  ? 113 TYR A CE1   1 
ATOM   888   C CE2   . TYR A 1 113 ? 62.925  -22.464  30.630  1.00 86.00  ? 113 TYR A CE2   1 
ATOM   889   C CZ    . TYR A 1 113 ? 62.843  -23.818  30.944  1.00 85.92  ? 113 TYR A CZ    1 
ATOM   890   O OH    . TYR A 1 113 ? 62.965  -24.777  29.964  1.00 85.34  ? 113 TYR A OH    1 
ATOM   891   N N     . TYR A 1 114 ? 65.430  -20.069  33.805  1.00 85.50  ? 114 TYR A N     1 
ATOM   892   C CA    . TYR A 1 114 ? 66.689  -20.091  33.070  1.00 83.63  ? 114 TYR A CA    1 
ATOM   893   C C     . TYR A 1 114 ? 67.912  -20.220  33.981  1.00 83.80  ? 114 TYR A C     1 
ATOM   894   O O     . TYR A 1 114 ? 68.846  -20.961  33.661  1.00 83.01  ? 114 TYR A O     1 
ATOM   895   C CB    . TYR A 1 114 ? 66.794  -18.870  32.158  1.00 83.50  ? 114 TYR A CB    1 
ATOM   896   C CG    . TYR A 1 114 ? 65.911  -18.962  30.939  1.00 81.55  ? 114 TYR A CG    1 
ATOM   897   C CD1   . TYR A 1 114 ? 65.048  -17.930  30.599  1.00 81.30  ? 114 TYR A CD1   1 
ATOM   898   C CD2   . TYR A 1 114 ? 65.935  -20.092  30.128  1.00 79.93  ? 114 TYR A CD2   1 
ATOM   899   C CE1   . TYR A 1 114 ? 64.237  -18.019  29.477  1.00 80.60  ? 114 TYR A CE1   1 
ATOM   900   C CE2   . TYR A 1 114 ? 65.131  -20.191  29.006  1.00 78.97  ? 114 TYR A CE2   1 
ATOM   901   C CZ    . TYR A 1 114 ? 64.285  -19.155  28.688  1.00 79.60  ? 114 TYR A CZ    1 
ATOM   902   O OH    . TYR A 1 114 ? 63.496  -19.261  27.570  1.00 80.50  ? 114 TYR A OH    1 
ATOM   903   N N     . ASN A 1 115 ? 67.904  -19.513  35.114  1.00 84.48  ? 115 ASN A N     1 
ATOM   904   C CA    . ASN A 1 115 ? 68.953  -19.678  36.121  1.00 84.64  ? 115 ASN A CA    1 
ATOM   905   C C     . ASN A 1 115 ? 69.100  -21.130  36.521  1.00 83.72  ? 115 ASN A C     1 
ATOM   906   O O     . ASN A 1 115 ? 70.213  -21.630  36.633  1.00 83.81  ? 115 ASN A O     1 
ATOM   907   C CB    . ASN A 1 115 ? 68.679  -18.826  37.354  1.00 86.31  ? 115 ASN A CB    1 
ATOM   908   C CG    . ASN A 1 115 ? 69.174  -17.412  37.196  1.00 87.74  ? 115 ASN A CG    1 
ATOM   909   O OD1   . ASN A 1 115 ? 70.289  -17.181  36.728  1.00 88.84  ? 115 ASN A OD1   1 
ATOM   910   N ND2   . ASN A 1 115 ? 68.350  -16.450  37.586  1.00 88.82  ? 115 ASN A ND2   1 
ATOM   911   N N     . PHE A 1 116 ? 67.968  -21.801  36.721  1.00 82.86  ? 116 PHE A N     1 
ATOM   912   C CA    . PHE A 1 116 ? 67.963  -23.216  37.033  1.00 81.91  ? 116 PHE A CA    1 
ATOM   913   C C     . PHE A 1 116 ? 68.435  -24.035  35.836  1.00 80.33  ? 116 PHE A C     1 
ATOM   914   O O     . PHE A 1 116 ? 69.362  -24.842  35.969  1.00 80.37  ? 116 PHE A O     1 
ATOM   915   C CB    . PHE A 1 116 ? 66.581  -23.679  37.506  1.00 82.11  ? 116 PHE A CB    1 
ATOM   916   C CG    . PHE A 1 116 ? 66.537  -25.127  37.901  1.00 81.98  ? 116 PHE A CG    1 
ATOM   917   C CD1   . PHE A 1 116 ? 67.114  -25.555  39.095  1.00 83.28  ? 116 PHE A CD1   1 
ATOM   918   C CD2   . PHE A 1 116 ? 65.933  -26.070  37.074  1.00 80.96  ? 116 PHE A CD2   1 
ATOM   919   C CE1   . PHE A 1 116 ? 67.090  -26.904  39.460  1.00 83.14  ? 116 PHE A CE1   1 
ATOM   920   C CE2   . PHE A 1 116 ? 65.900  -27.422  37.433  1.00 81.14  ? 116 PHE A CE2   1 
ATOM   921   C CZ    . PHE A 1 116 ? 66.481  -27.837  38.627  1.00 81.81  ? 116 PHE A CZ    1 
ATOM   922   N N     . LEU A 1 117 ? 67.813  -23.815  34.673  1.00 78.98  ? 117 LEU A N     1 
ATOM   923   C CA    . LEU A 1 117 ? 68.120  -24.587  33.463  1.00 77.33  ? 117 LEU A CA    1 
ATOM   924   C C     . LEU A 1 117 ? 69.603  -24.499  33.134  1.00 77.13  ? 117 LEU A C     1 
ATOM   925   O O     . LEU A 1 117 ? 70.235  -25.500  32.790  1.00 76.64  ? 117 LEU A O     1 
ATOM   926   C CB    . LEU A 1 117 ? 67.268  -24.121  32.283  1.00 76.61  ? 117 LEU A CB    1 
ATOM   927   C CG    . LEU A 1 117 ? 67.331  -24.915  30.976  1.00 75.67  ? 117 LEU A CG    1 
ATOM   928   C CD1   . LEU A 1 117 ? 66.509  -26.192  31.015  1.00 75.20  ? 117 LEU A CD1   1 
ATOM   929   C CD2   . LEU A 1 117 ? 66.841  -24.026  29.861  1.00 76.37  ? 117 LEU A CD2   1 
ATOM   930   N N     . HIS A 1 118 ? 70.155  -23.298  33.279  1.00 77.51  ? 118 HIS A N     1 
ATOM   931   C CA    . HIS A 1 118 ? 71.576  -23.070  33.068  1.00 77.38  ? 118 HIS A CA    1 
ATOM   932   C C     . HIS A 1 118 ? 72.431  -24.007  33.920  1.00 78.04  ? 118 HIS A C     1 
ATOM   933   O O     . HIS A 1 118 ? 73.327  -24.694  33.418  1.00 77.67  ? 118 HIS A O     1 
ATOM   934   C CB    . HIS A 1 118 ? 71.926  -21.620  33.367  1.00 77.79  ? 118 HIS A CB    1 
ATOM   935   C CG    . HIS A 1 118 ? 73.351  -21.300  33.097  1.00 77.08  ? 118 HIS A CG    1 
ATOM   936   N ND1   . HIS A 1 118 ? 74.287  -21.194  34.099  1.00 77.65  ? 118 HIS A ND1   1 
ATOM   937   C CD2   . HIS A 1 118 ? 74.014  -21.114  31.934  1.00 75.70  ? 118 HIS A CD2   1 
ATOM   938   C CE1   . HIS A 1 118 ? 75.465  -20.928  33.565  1.00 77.79  ? 118 HIS A CE1   1 
ATOM   939   N NE2   . HIS A 1 118 ? 75.327  -20.879  32.252  1.00 76.46  ? 118 HIS A NE2   1 
ATOM   940   N N     . GLU A 1 119 ? 72.127  -24.046  35.210  1.00 79.20  ? 119 GLU A N     1 
ATOM   941   C CA    . GLU A 1 119 ? 72.884  -24.854  36.154  1.00 79.97  ? 119 GLU A CA    1 
ATOM   942   C C     . GLU A 1 119 ? 72.600  -26.339  36.018  1.00 78.78  ? 119 GLU A C     1 
ATOM   943   O O     . GLU A 1 119 ? 73.444  -27.167  36.370  1.00 78.88  ? 119 GLU A O     1 
ATOM   944   C CB    . GLU A 1 119 ? 72.642  -24.374  37.573  1.00 81.66  ? 119 GLU A CB    1 
ATOM   945   C CG    . GLU A 1 119 ? 73.248  -23.018  37.819  1.00 84.92  ? 119 GLU A CG    1 
ATOM   946   C CD    . GLU A 1 119 ? 73.529  -22.769  39.281  1.00 90.48  ? 119 GLU A CD    1 
ATOM   947   O OE1   . GLU A 1 119 ? 73.000  -23.517  40.142  1.00 91.90  ? 119 GLU A OE1   1 
ATOM   948   O OE2   . GLU A 1 119 ? 74.285  -21.814  39.568  1.00 93.41  ? 119 GLU A OE2   1 
ATOM   949   N N     . LEU A 1 120 ? 71.425  -26.677  35.501  1.00 77.52  ? 120 LEU A N     1 
ATOM   950   C CA    . LEU A 1 120 ? 71.176  -28.057  35.137  1.00 77.03  ? 120 LEU A CA    1 
ATOM   951   C C     . LEU A 1 120 ? 72.095  -28.471  33.977  1.00 76.25  ? 120 LEU A C     1 
ATOM   952   O O     . LEU A 1 120 ? 72.813  -29.471  34.081  1.00 76.48  ? 120 LEU A O     1 
ATOM   953   C CB    . LEU A 1 120 ? 69.710  -28.297  34.790  1.00 76.56  ? 120 LEU A CB    1 
ATOM   954   C CG    . LEU A 1 120 ? 69.379  -29.761  34.485  1.00 76.48  ? 120 LEU A CG    1 
ATOM   955   C CD1   . LEU A 1 120 ? 68.009  -30.070  34.986  1.00 77.61  ? 120 LEU A CD1   1 
ATOM   956   C CD2   . LEU A 1 120 ? 69.492  -30.081  32.992  1.00 76.54  ? 120 LEU A CD2   1 
ATOM   957   N N     . SER A 1 121 ? 72.074  -27.696  32.888  1.00 75.21  ? 121 SER A N     1 
ATOM   958   C CA    . SER A 1 121 ? 72.943  -27.935  31.734  1.00 73.99  ? 121 SER A CA    1 
ATOM   959   C C     . SER A 1 121 ? 74.414  -27.986  32.144  1.00 73.96  ? 121 SER A C     1 
ATOM   960   O O     . SER A 1 121 ? 75.137  -28.894  31.736  1.00 73.88  ? 121 SER A O     1 
ATOM   961   C CB    . SER A 1 121 ? 72.740  -26.856  30.684  1.00 73.57  ? 121 SER A CB    1 
ATOM   962   O OG    . SER A 1 121 ? 73.459  -25.703  31.061  1.00 74.88  ? 121 SER A OG    1 
ATOM   963   N N     . LEU A 1 122 ? 74.852  -27.026  32.954  1.00 74.00  ? 122 LEU A N     1 
ATOM   964   C CA    . LEU A 1 122 ? 76.188  -27.107  33.522  1.00 74.65  ? 122 LEU A CA    1 
ATOM   965   C C     . LEU A 1 122 ? 76.412  -28.446  34.228  1.00 75.32  ? 122 LEU A C     1 
ATOM   966   O O     . LEU A 1 122 ? 77.342  -29.177  33.884  1.00 75.37  ? 122 LEU A O     1 
ATOM   967   C CB    . LEU A 1 122 ? 76.481  -25.943  34.468  1.00 75.46  ? 122 LEU A CB    1 
ATOM   968   C CG    . LEU A 1 122 ? 76.700  -24.528  33.934  1.00 74.64  ? 122 LEU A CG    1 
ATOM   969   C CD1   . LEU A 1 122 ? 77.355  -23.686  35.003  1.00 75.48  ? 122 LEU A CD1   1 
ATOM   970   C CD2   . LEU A 1 122 ? 77.550  -24.520  32.695  1.00 73.92  ? 122 LEU A CD2   1 
ATOM   971   N N     . GLU A 1 123 ? 75.546  -28.781  35.185  1.00 76.02  ? 123 GLU A N     1 
ATOM   972   C CA    . GLU A 1 123 ? 75.685  -30.040  35.925  1.00 76.95  ? 123 GLU A CA    1 
ATOM   973   C C     . GLU A 1 123 ? 75.468  -31.308  35.101  1.00 76.03  ? 123 GLU A C     1 
ATOM   974   O O     . GLU A 1 123 ? 76.113  -32.320  35.353  1.00 76.77  ? 123 GLU A O     1 
ATOM   975   C CB    . GLU A 1 123 ? 74.823  -30.058  37.188  1.00 77.87  ? 123 GLU A CB    1 
ATOM   976   C CG    . GLU A 1 123 ? 75.619  -29.761  38.469  1.00 80.60  ? 123 GLU A CG    1 
ATOM   977   C CD    . GLU A 1 123 ? 76.697  -30.814  38.771  1.00 82.50  ? 123 GLU A CD    1 
ATOM   978   O OE1   . GLU A 1 123 ? 76.482  -32.010  38.444  1.00 82.46  ? 123 GLU A OE1   1 
ATOM   979   O OE2   . GLU A 1 123 ? 77.757  -30.445  39.339  1.00 82.90  ? 123 GLU A OE2   1 
ATOM   980   N N     . TYR A 1 124 ? 74.583  -31.250  34.115  1.00 74.82  ? 124 TYR A N     1 
ATOM   981   C CA    . TYR A 1 124 ? 74.316  -32.399  33.271  1.00 74.34  ? 124 TYR A CA    1 
ATOM   982   C C     . TYR A 1 124 ? 75.486  -32.735  32.350  1.00 73.96  ? 124 TYR A C     1 
ATOM   983   O O     . TYR A 1 124 ? 75.718  -33.910  32.060  1.00 74.11  ? 124 TYR A O     1 
ATOM   984   C CB    . TYR A 1 124 ? 73.042  -32.185  32.459  1.00 73.81  ? 124 TYR A CB    1 
ATOM   985   C CG    . TYR A 1 124 ? 72.731  -33.285  31.472  1.00 75.37  ? 124 TYR A CG    1 
ATOM   986   C CD1   . TYR A 1 124 ? 72.433  -34.575  31.910  1.00 77.71  ? 124 TYR A CD1   1 
ATOM   987   C CD2   . TYR A 1 124 ? 72.720  -33.032  30.093  1.00 77.03  ? 124 TYR A CD2   1 
ATOM   988   C CE1   . TYR A 1 124 ? 72.136  -35.602  31.006  1.00 79.58  ? 124 TYR A CE1   1 
ATOM   989   C CE2   . TYR A 1 124 ? 72.425  -34.052  29.169  1.00 79.08  ? 124 TYR A CE2   1 
ATOM   990   C CZ    . TYR A 1 124 ? 72.128  -35.339  29.638  1.00 80.44  ? 124 TYR A CZ    1 
ATOM   991   O OH    . TYR A 1 124 ? 71.824  -36.363  28.752  1.00 81.45  ? 124 TYR A OH    1 
ATOM   992   N N     . THR A 1 125 ? 76.220  -31.727  31.878  1.00 73.39  ? 125 THR A N     1 
ATOM   993   C CA    . THR A 1 125 ? 77.356  -32.025  31.002  1.00 73.25  ? 125 THR A CA    1 
ATOM   994   C C     . THR A 1 125 ? 78.579  -32.399  31.832  1.00 73.92  ? 125 THR A C     1 
ATOM   995   O O     . THR A 1 125 ? 79.348  -33.290  31.462  1.00 73.97  ? 125 THR A O     1 
ATOM   996   C CB    . THR A 1 125 ? 77.671  -30.900  29.976  1.00 73.07  ? 125 THR A CB    1 
ATOM   997   O OG1   . THR A 1 125 ? 78.390  -29.830  30.604  1.00 74.20  ? 125 THR A OG1   1 
ATOM   998   C CG2   . THR A 1 125 ? 76.386  -30.381  29.337  1.00 72.28  ? 125 THR A CG2   1 
ATOM   999   N N     . ARG A 1 126 ? 78.732  -31.727  32.970  1.00 74.22  ? 126 ARG A N     1 
ATOM   1000  C CA    . ARG A 1 126 ? 79.770  -32.073  33.922  1.00 74.92  ? 126 ARG A CA    1 
ATOM   1001  C C     . ARG A 1 126 ? 79.723  -33.554  34.203  1.00 75.27  ? 126 ARG A C     1 
ATOM   1002  O O     . ARG A 1 126 ? 80.761  -34.202  34.282  1.00 76.23  ? 126 ARG A O     1 
ATOM   1003  C CB    . ARG A 1 126 ? 79.612  -31.286  35.215  1.00 75.72  ? 126 ARG A CB    1 
ATOM   1004  C CG    . ARG A 1 126 ? 80.600  -30.151  35.361  1.00 75.79  ? 126 ARG A CG    1 
ATOM   1005  C CD    . ARG A 1 126 ? 80.561  -29.589  36.759  1.00 76.66  ? 126 ARG A CD    1 
ATOM   1006  N NE    . ARG A 1 126 ? 79.580  -28.515  36.910  1.00 75.60  ? 126 ARG A NE    1 
ATOM   1007  C CZ    . ARG A 1 126 ? 79.906  -27.230  36.968  1.00 75.85  ? 126 ARG A CZ    1 
ATOM   1008  N NH1   . ARG A 1 126 ? 81.183  -26.873  36.873  1.00 76.25  ? 126 ARG A NH1   1 
ATOM   1009  N NH2   . ARG A 1 126 ? 78.964  -26.307  37.122  1.00 75.71  ? 126 ARG A NH2   1 
ATOM   1010  N N     . ARG A 1 127 ? 78.514  -34.088  34.328  1.00 74.74  ? 127 ARG A N     1 
ATOM   1011  C CA    . ARG A 1 127 ? 78.331  -35.500  34.618  1.00 75.61  ? 127 ARG A CA    1 
ATOM   1012  C C     . ARG A 1 127 ? 78.744  -36.382  33.427  1.00 74.71  ? 127 ARG A C     1 
ATOM   1013  O O     . ARG A 1 127 ? 79.388  -37.422  33.611  1.00 75.55  ? 127 ARG A O     1 
ATOM   1014  C CB    . ARG A 1 127 ? 76.887  -35.777  35.061  1.00 75.72  ? 127 ARG A CB    1 
ATOM   1015  C CG    . ARG A 1 127 ? 76.687  -37.058  35.885  1.00 78.92  ? 127 ARG A CG    1 
ATOM   1016  C CD    . ARG A 1 127 ? 77.078  -36.882  37.351  1.00 83.50  ? 127 ARG A CD    1 
ATOM   1017  N NE    . ARG A 1 127 ? 76.414  -35.736  37.986  1.00 86.12  ? 127 ARG A NE    1 
ATOM   1018  C CZ    . ARG A 1 127 ? 75.280  -35.798  38.690  1.00 88.14  ? 127 ARG A CZ    1 
ATOM   1019  N NH1   . ARG A 1 127 ? 74.644  -36.958  38.863  1.00 89.69  ? 127 ARG A NH1   1 
ATOM   1020  N NH2   . ARG A 1 127 ? 74.775  -34.692  39.227  1.00 87.90  ? 127 ARG A NH2   1 
ATOM   1021  N N     . LYS A 1 128 ? 78.394  -35.959  32.214  1.00 73.07  ? 128 LYS A N     1 
ATOM   1022  C CA    . LYS A 1 128 ? 78.736  -36.729  31.020  1.00 72.34  ? 128 LYS A CA    1 
ATOM   1023  C C     . LYS A 1 128 ? 80.239  -36.697  30.786  1.00 72.83  ? 128 LYS A C     1 
ATOM   1024  O O     . LYS A 1 128 ? 80.834  -37.714  30.427  1.00 73.01  ? 128 LYS A O     1 
ATOM   1025  C CB    . LYS A 1 128 ? 77.988  -36.217  29.790  1.00 71.18  ? 128 LYS A CB    1 
ATOM   1026  C CG    . LYS A 1 128 ? 76.477  -36.149  29.950  1.00 70.85  ? 128 LYS A CG    1 
ATOM   1027  C CD    . LYS A 1 128 ? 75.761  -36.647  28.708  1.00 71.28  ? 128 LYS A CD    1 
ATOM   1028  C CE    . LYS A 1 128 ? 75.675  -38.178  28.708  1.00 72.85  ? 128 LYS A CE    1 
ATOM   1029  N NZ    . LYS A 1 128 ? 75.353  -38.773  27.363  1.00 73.47  ? 128 LYS A NZ    1 
ATOM   1030  N N     . LEU A 1 129 ? 80.837  -35.520  31.010  1.00 72.97  ? 129 LEU A N     1 
ATOM   1031  C CA    . LEU A 1 129 ? 82.287  -35.306  30.904  1.00 73.65  ? 129 LEU A CA    1 
ATOM   1032  C C     . LEU A 1 129 ? 83.093  -36.290  31.744  1.00 75.05  ? 129 LEU A C     1 
ATOM   1033  O O     . LEU A 1 129 ? 84.231  -36.620  31.401  1.00 75.54  ? 129 LEU A O     1 
ATOM   1034  C CB    . LEU A 1 129 ? 82.672  -33.877  31.324  1.00 73.72  ? 129 LEU A CB    1 
ATOM   1035  C CG    . LEU A 1 129 ? 83.022  -32.744  30.341  1.00 73.07  ? 129 LEU A CG    1 
ATOM   1036  C CD1   . LEU A 1 129 ? 83.764  -33.204  29.102  1.00 73.19  ? 129 LEU A CD1   1 
ATOM   1037  C CD2   . LEU A 1 129 ? 81.786  -32.012  29.929  1.00 73.22  ? 129 LEU A CD2   1 
ATOM   1038  N N     . ARG A 1 130 ? 82.500  -36.739  32.850  1.00 75.70  ? 130 ARG A N     1 
ATOM   1039  C CA    . ARG A 1 130 ? 83.180  -37.622  33.784  1.00 77.24  ? 130 ARG A CA    1 
ATOM   1040  C C     . ARG A 1 130 ? 83.196  -39.057  33.274  1.00 77.29  ? 130 ARG A C     1 
ATOM   1041  O O     . ARG A 1 130 ? 84.245  -39.698  33.250  1.00 77.96  ? 130 ARG A O     1 
ATOM   1042  C CB    . ARG A 1 130 ? 82.543  -37.539  35.167  1.00 78.12  ? 130 ARG A CB    1 
ATOM   1043  C CG    . ARG A 1 130 ? 83.549  -37.717  36.287  1.00 81.03  ? 130 ARG A CG    1 
ATOM   1044  C CD    . ARG A 1 130 ? 82.900  -38.252  37.548  1.00 84.03  ? 130 ARG A CD    1 
ATOM   1045  N NE    . ARG A 1 130 ? 83.888  -38.823  38.466  1.00 87.99  ? 130 ARG A NE    1 
ATOM   1046  C CZ    . ARG A 1 130 ? 84.410  -40.048  38.362  1.00 90.06  ? 130 ARG A CZ    1 
ATOM   1047  N NH1   . ARG A 1 130 ? 84.052  -40.853  37.370  1.00 90.07  ? 130 ARG A NH1   1 
ATOM   1048  N NH2   . ARG A 1 130 ? 85.296  -40.476  39.254  1.00 92.35  ? 130 ARG A NH2   1 
ATOM   1049  N N     . SER A 1 131 ? 82.035  -39.551  32.851  1.00 76.65  ? 131 SER A N     1 
ATOM   1050  C CA    . SER A 1 131 ? 81.935  -40.920  32.339  1.00 77.32  ? 131 SER A CA    1 
ATOM   1051  C C     . SER A 1 131 ? 82.654  -41.116  31.009  1.00 77.34  ? 131 SER A C     1 
ATOM   1052  O O     . SER A 1 131 ? 82.958  -42.243  30.625  1.00 78.34  ? 131 SER A O     1 
ATOM   1053  C CB    . SER A 1 131 ? 80.484  -41.431  32.283  1.00 76.56  ? 131 SER A CB    1 
ATOM   1054  O OG    . SER A 1 131 ? 79.543  -40.387  32.404  1.00 74.88  ? 131 SER A OG    1 
ATOM   1055  N N     . ALA A 1 132 ? 82.937  -40.021  30.314  1.00 76.82  ? 132 ALA A N     1 
ATOM   1056  C CA    . ALA A 1 132 ? 83.751  -40.086  29.107  1.00 76.95  ? 132 ALA A CA    1 
ATOM   1057  C C     . ALA A 1 132 ? 85.224  -40.266  29.477  1.00 78.43  ? 132 ALA A C     1 
ATOM   1058  O O     . ALA A 1 132 ? 85.931  -41.052  28.856  1.00 79.15  ? 132 ALA A O     1 
ATOM   1059  C CB    . ALA A 1 132 ? 83.548  -38.846  28.261  1.00 75.70  ? 132 ALA A CB    1 
ATOM   1060  N N     . ALA A 1 133 ? 85.667  -39.540  30.502  1.00 71.25  ? 133 ALA A N     1 
ATOM   1061  C CA    . ALA A 1 133 ? 87.035  -39.631  31.018  1.00 71.20  ? 133 ALA A CA    1 
ATOM   1062  C C     . ALA A 1 133 ? 87.286  -40.964  31.709  1.00 71.81  ? 133 ALA A C     1 
ATOM   1063  O O     . ALA A 1 133 ? 88.421  -41.426  31.781  1.00 71.79  ? 133 ALA A O     1 
ATOM   1064  C CB    . ALA A 1 133 ? 87.315  -38.487  31.985  1.00 71.03  ? 133 ALA A CB    1 
ATOM   1065  N N     . GLN A 1 134 ? 86.215  -41.579  32.206  1.00 72.61  ? 134 GLN A N     1 
ATOM   1066  C CA    . GLN A 1 134 ? 86.294  -42.822  32.975  1.00 73.10  ? 134 GLN A CA    1 
ATOM   1067  C C     . GLN A 1 134 ? 86.421  -44.100  32.105  1.00 73.19  ? 134 GLN A C     1 
ATOM   1068  O O     . GLN A 1 134 ? 86.505  -45.209  32.647  1.00 74.01  ? 134 GLN A O     1 
ATOM   1069  C CB    . GLN A 1 134 ? 85.087  -42.900  33.934  1.00 73.68  ? 134 GLN A CB    1 
ATOM   1070  C CG    . GLN A 1 134 ? 85.170  -43.943  35.048  1.00 74.95  ? 134 GLN A CG    1 
ATOM   1071  C CD    . GLN A 1 134 ? 86.241  -43.652  36.098  1.00 75.39  ? 134 GLN A CD    1 
ATOM   1072  O OE1   . GLN A 1 134 ? 87.176  -44.431  36.268  1.00 75.85  ? 134 GLN A OE1   1 
ATOM   1073  N NE2   . GLN A 1 134 ? 86.099  -42.542  36.813  1.00 75.36  ? 134 GLN A NE2   1 
ATOM   1074  N N     . LYS A 1 135 ? 86.434  -43.957  30.775  1.00 72.54  ? 135 LYS A N     1 
ATOM   1075  C CA    . LYS A 1 135 ? 86.609  -45.113  29.886  1.00 72.45  ? 135 LYS A CA    1 
ATOM   1076  C C     . LYS A 1 135 ? 88.037  -45.582  29.980  1.00 72.11  ? 135 LYS A C     1 
ATOM   1077  O O     . LYS A 1 135 ? 88.954  -44.760  29.966  1.00 71.89  ? 135 LYS A O     1 
ATOM   1078  C CB    . LYS A 1 135 ? 86.276  -44.769  28.440  1.00 72.32  ? 135 LYS A CB    1 
ATOM   1079  C CG    . LYS A 1 135 ? 84.792  -44.673  28.148  1.00 73.52  ? 135 LYS A CG    1 
ATOM   1080  C CD    . LYS A 1 135 ? 84.203  -46.008  27.711  1.00 76.03  ? 135 LYS A CD    1 
ATOM   1081  C CE    . LYS A 1 135 ? 82.722  -45.856  27.385  1.00 78.25  ? 135 LYS A CE    1 
ATOM   1082  N NZ    . LYS A 1 135 ? 82.172  -47.031  26.641  1.00 80.56  ? 135 LYS A NZ    1 
ATOM   1083  N N     . ARG A 1 136 ? 88.224  -46.896  30.099  1.00 72.31  ? 136 ARG A N     1 
ATOM   1084  C CA    . ARG A 1 136 ? 89.562  -47.492  30.297  1.00 71.90  ? 136 ARG A CA    1 
ATOM   1085  C C     . ARG A 1 136 ? 90.456  -47.477  29.055  1.00 70.83  ? 136 ARG A C     1 
ATOM   1086  O O     . ARG A 1 136 ? 91.679  -47.521  29.180  1.00 70.32  ? 136 ARG A O     1 
ATOM   1087  C CB    . ARG A 1 136 ? 89.500  -48.913  30.909  1.00 72.92  ? 136 ARG A CB    1 
ATOM   1088  C CG    . ARG A 1 136 ? 88.119  -49.624  30.924  1.00 75.56  ? 136 ARG A CG    1 
ATOM   1089  C CD    . ARG A 1 136 ? 87.388  -49.629  29.554  1.00 77.31  ? 136 ARG A CD    1 
ATOM   1090  N NE    . ARG A 1 136 ? 86.025  -50.157  29.635  1.00 78.05  ? 136 ARG A NE    1 
ATOM   1091  C CZ    . ARG A 1 136 ? 84.965  -49.461  30.033  1.00 78.24  ? 136 ARG A CZ    1 
ATOM   1092  N NH1   . ARG A 1 136 ? 85.083  -48.196  30.408  1.00 77.17  ? 136 ARG A NH1   1 
ATOM   1093  N NH2   . ARG A 1 136 ? 83.776  -50.043  30.066  1.00 80.43  ? 136 ARG A NH2   1 
ATOM   1094  N N     . ASP A 1 137 ? 89.856  -47.391  27.866  1.00 70.29  ? 137 ASP A N     1 
ATOM   1095  C CA    . ASP A 1 137 ? 90.641  -47.380  26.620  1.00 69.39  ? 137 ASP A CA    1 
ATOM   1096  C C     . ASP A 1 137 ? 91.455  -46.102  26.394  1.00 67.97  ? 137 ASP A C     1 
ATOM   1097  O O     . ASP A 1 137 ? 92.443  -46.117  25.653  1.00 67.84  ? 137 ASP A O     1 
ATOM   1098  C CB    . ASP A 1 137 ? 89.789  -47.743  25.384  1.00 69.91  ? 137 ASP A CB    1 
ATOM   1099  C CG    . ASP A 1 137 ? 88.692  -46.730  25.081  1.00 70.61  ? 137 ASP A CG    1 
ATOM   1100  O OD1   . ASP A 1 137 ? 87.966  -46.950  24.081  1.00 71.87  ? 137 ASP A OD1   1 
ATOM   1101  O OD2   . ASP A 1 137 ? 88.541  -45.728  25.820  1.00 71.13  ? 137 ASP A OD2   1 
ATOM   1102  N N     . LEU A 1 138 ? 91.055  -45.009  27.041  1.00 66.58  ? 138 LEU A N     1 
ATOM   1103  C CA    . LEU A 1 138 ? 91.751  -43.741  26.872  1.00 65.23  ? 138 LEU A CA    1 
ATOM   1104  C C     . LEU A 1 138 ? 93.169  -43.776  27.398  1.00 64.41  ? 138 LEU A C     1 
ATOM   1105  O O     . LEU A 1 138 ? 94.030  -43.058  26.890  1.00 64.36  ? 138 LEU A O     1 
ATOM   1106  C CB    . LEU A 1 138 ? 91.007  -42.608  27.557  1.00 65.05  ? 138 LEU A CB    1 
ATOM   1107  C CG    . LEU A 1 138 ? 89.640  -42.246  26.988  1.00 65.54  ? 138 LEU A CG    1 
ATOM   1108  C CD1   . LEU A 1 138 ? 89.061  -41.106  27.802  1.00 65.62  ? 138 LEU A CD1   1 
ATOM   1109  C CD2   . LEU A 1 138 ? 89.697  -41.896  25.501  1.00 65.25  ? 138 LEU A CD2   1 
ATOM   1110  N N     . LEU A 1 139 ? 93.404  -44.594  28.420  1.00 63.61  ? 139 LEU A N     1 
ATOM   1111  C CA    . LEU A 1 139 ? 94.720  -44.699  29.027  1.00 62.58  ? 139 LEU A CA    1 
ATOM   1112  C C     . LEU A 1 139 ? 95.613  -45.581  28.183  1.00 62.21  ? 139 LEU A C     1 
ATOM   1113  O O     . LEU A 1 139 ? 96.825  -45.392  28.124  1.00 61.88  ? 139 LEU A O     1 
ATOM   1114  C CB    . LEU A 1 139 ? 94.611  -45.267  30.435  1.00 63.01  ? 139 LEU A CB    1 
ATOM   1115  C CG    . LEU A 1 139 ? 93.838  -44.420  31.442  1.00 62.93  ? 139 LEU A CG    1 
ATOM   1116  C CD1   . LEU A 1 139 ? 93.324  -45.297  32.562  1.00 63.14  ? 139 LEU A CD1   1 
ATOM   1117  C CD2   . LEU A 1 139 ? 94.700  -43.290  31.982  1.00 62.00  ? 139 LEU A CD2   1 
ATOM   1118  N N     . ALA A 1 140 ? 95.007  -46.555  27.528  1.00 62.22  ? 140 ALA A N     1 
ATOM   1119  C CA    . ALA A 1 140 ? 95.729  -47.387  26.588  1.00 62.20  ? 140 ALA A CA    1 
ATOM   1120  C C     . ALA A 1 140 ? 96.282  -46.514  25.454  1.00 61.59  ? 140 ALA A C     1 
ATOM   1121  O O     . ALA A 1 140 ? 97.450  -46.640  25.058  1.00 61.56  ? 140 ALA A O     1 
ATOM   1122  C CB    . ALA A 1 140 ? 94.815  -48.445  26.047  1.00 62.94  ? 140 ALA A CB    1 
ATOM   1123  N N     . ILE A 1 141 ? 95.432  -45.613  24.962  1.00 60.93  ? 141 ILE A N     1 
ATOM   1124  C CA    . ILE A 1 141 ? 95.774  -44.700  23.880  1.00 59.84  ? 141 ILE A CA    1 
ATOM   1125  C C     . ILE A 1 141 ? 96.917  -43.753  24.267  1.00 58.85  ? 141 ILE A C     1 
ATOM   1126  O O     . ILE A 1 141 ? 97.898  -43.646  23.539  1.00 58.76  ? 141 ILE A O     1 
ATOM   1127  C CB    . ILE A 1 141 ? 94.525  -43.937  23.398  1.00 59.77  ? 141 ILE A CB    1 
ATOM   1128  C CG1   . ILE A 1 141 ? 93.606  -44.890  22.636  1.00 60.23  ? 141 ILE A CG1   1 
ATOM   1129  C CG2   . ILE A 1 141 ? 94.920  -42.792  22.508  1.00 59.76  ? 141 ILE A CG2   1 
ATOM   1130  C CD1   . ILE A 1 141 ? 92.189  -44.431  22.531  1.00 60.40  ? 141 ILE A CD1   1 
ATOM   1131  N N     . GLN A 1 142 ? 96.796  -43.090  25.416  1.00 58.20  ? 142 GLN A N     1 
ATOM   1132  C CA    . GLN A 1 142 ? 97.804  -42.135  25.872  1.00 57.40  ? 142 GLN A CA    1 
ATOM   1133  C C     . GLN A 1 142 ? 99.151  -42.800  26.054  1.00 57.18  ? 142 GLN A C     1 
ATOM   1134  O O     . GLN A 1 142 ? 100.173 -42.256  25.647  1.00 57.16  ? 142 GLN A O     1 
ATOM   1135  C CB    . GLN A 1 142 ? 97.400  -41.498  27.197  1.00 57.26  ? 142 GLN A CB    1 
ATOM   1136  C CG    . GLN A 1 142 ? 96.179  -40.621  27.132  1.00 58.44  ? 142 GLN A CG    1 
ATOM   1137  C CD    . GLN A 1 142 ? 96.317  -39.470  26.164  1.00 59.16  ? 142 GLN A CD    1 
ATOM   1138  O OE1   . GLN A 1 142 ? 95.386  -39.163  25.435  1.00 59.68  ? 142 GLN A OE1   1 
ATOM   1139  N NE2   . GLN A 1 142 ? 97.477  -38.831  26.149  1.00 59.90  ? 142 GLN A NE2   1 
ATOM   1140  N N     . ALA A 1 143 ? 99.152  -43.980  26.664  1.00 56.98  ? 143 ALA A N     1 
ATOM   1141  C CA    . ALA A 1 143 ? 100.384 -44.673  26.955  1.00 56.45  ? 143 ALA A CA    1 
ATOM   1142  C C     . ALA A 1 143 ? 101.139 -45.014  25.678  1.00 56.60  ? 143 ALA A C     1 
ATOM   1143  O O     . ALA A 1 143 ? 102.323 -44.718  25.579  1.00 56.38  ? 143 ALA A O     1 
ATOM   1144  C CB    . ALA A 1 143 ? 100.106 -45.902  27.746  1.00 57.04  ? 143 ALA A CB    1 
ATOM   1145  N N     . VAL A 1 144 ? 100.458 -45.623  24.702  1.00 57.14  ? 144 VAL A N     1 
ATOM   1146  C CA    . VAL A 1 144 ? 101.087 -45.965  23.415  1.00 57.33  ? 144 VAL A CA    1 
ATOM   1147  C C     . VAL A 1 144 ? 101.565 -44.714  22.656  1.00 57.27  ? 144 VAL A C     1 
ATOM   1148  O O     . VAL A 1 144 ? 102.618 -44.729  22.003  1.00 57.34  ? 144 VAL A O     1 
ATOM   1149  C CB    . VAL A 1 144 ? 100.178 -46.847  22.519  1.00 57.85  ? 144 VAL A CB    1 
ATOM   1150  C CG1   . VAL A 1 144 ? 99.052  -46.038  21.883  1.00 57.65  ? 144 VAL A CG1   1 
ATOM   1151  C CG2   . VAL A 1 144 ? 100.995 -47.540  21.445  1.00 57.91  ? 144 VAL A CG2   1 
ATOM   1152  N N     . ARG A 1 145 ? 100.797 -43.634  22.750  1.00 57.05  ? 145 ARG A N     1 
ATOM   1153  C CA    . ARG A 1 145 ? 101.237 -42.379  22.187  1.00 57.12  ? 145 ARG A CA    1 
ATOM   1154  C C     . ARG A 1 145 ? 102.556 -41.935  22.834  1.00 57.19  ? 145 ARG A C     1 
ATOM   1155  O O     . ARG A 1 145 ? 103.502 -41.575  22.124  1.00 57.45  ? 145 ARG A O     1 
ATOM   1156  C CB    . ARG A 1 145 ? 100.152 -41.313  22.312  1.00 56.96  ? 145 ARG A CB    1 
ATOM   1157  C CG    . ARG A 1 145 ? 99.153  -41.336  21.176  1.00 56.22  ? 145 ARG A CG    1 
ATOM   1158  C CD    . ARG A 1 145 ? 97.995  -40.358  21.419  1.00 54.76  ? 145 ARG A CD    1 
ATOM   1159  N NE    . ARG A 1 145 ? 96.839  -40.703  20.589  1.00 52.71  ? 145 ARG A NE    1 
ATOM   1160  C CZ    . ARG A 1 145 ? 95.693  -40.037  20.543  1.00 50.20  ? 145 ARG A CZ    1 
ATOM   1161  N NH1   . ARG A 1 145 ? 95.494  -38.962  21.279  1.00 48.70  ? 145 ARG A NH1   1 
ATOM   1162  N NH2   . ARG A 1 145 ? 94.735  -40.466  19.750  1.00 51.14  ? 145 ARG A NH2   1 
ATOM   1163  N N     . ALA A 1 146 ? 102.628 -41.990  24.164  1.00 57.29  ? 146 ALA A N     1 
ATOM   1164  C CA    . ALA A 1 146 ? 103.849 -41.617  24.880  1.00 57.48  ? 146 ALA A CA    1 
ATOM   1165  C C     . ALA A 1 146 ? 104.992 -42.582  24.554  1.00 57.86  ? 146 ALA A C     1 
ATOM   1166  O O     . ALA A 1 146 ? 106.151 -42.184  24.497  1.00 57.69  ? 146 ALA A O     1 
ATOM   1167  C CB    . ALA A 1 146 ? 103.603 -41.536  26.384  1.00 57.04  ? 146 ALA A CB    1 
ATOM   1168  N N     . MET A 1 147 ? 104.655 -43.842  24.316  1.00 58.80  ? 147 MET A N     1 
ATOM   1169  C CA    . MET A 1 147 ? 105.640 -44.819  23.894  1.00 60.01  ? 147 MET A CA    1 
ATOM   1170  C C     . MET A 1 147 ? 106.233 -44.467  22.532  1.00 60.17  ? 147 MET A C     1 
ATOM   1171  O O     . MET A 1 147 ? 107.440 -44.660  22.302  1.00 60.04  ? 147 MET A O     1 
ATOM   1172  C CB    . MET A 1 147 ? 105.025 -46.209  23.833  1.00 61.13  ? 147 MET A CB    1 
ATOM   1173  C CG    . MET A 1 147 ? 105.536 -47.157  24.893  1.00 63.57  ? 147 MET A CG    1 
ATOM   1174  S SD    . MET A 1 147 ? 105.278 -48.890  24.439  1.00 69.02  ? 147 MET A SD    1 
ATOM   1175  C CE    . MET A 1 147 ? 106.486 -49.122  23.134  1.00 68.64  ? 147 MET A CE    1 
ATOM   1176  N N     . ASP A 1 148 ? 105.384 -43.957  21.631  1.00 60.35  ? 148 ASP A N     1 
ATOM   1177  C CA    . ASP A 1 148 ? 105.826 -43.588  20.284  1.00 60.33  ? 148 ASP A CA    1 
ATOM   1178  C C     . ASP A 1 148 ? 106.632 -42.305  20.319  1.00 59.76  ? 148 ASP A C     1 
ATOM   1179  O O     . ASP A 1 148 ? 107.458 -42.066  19.438  1.00 60.11  ? 148 ASP A O     1 
ATOM   1180  C CB    . ASP A 1 148 ? 104.653 -43.481  19.318  1.00 60.77  ? 148 ASP A CB    1 
ATOM   1181  C CG    . ASP A 1 148 ? 104.110 -44.849  18.892  1.00 62.86  ? 148 ASP A CG    1 
ATOM   1182  O OD1   . ASP A 1 148 ? 104.522 -45.890  19.444  1.00 63.63  ? 148 ASP A OD1   1 
ATOM   1183  O OD2   . ASP A 1 148 ? 103.257 -44.894  17.982  1.00 65.85  ? 148 ASP A OD2   1 
ATOM   1184  N N     . ASP A 1 149 ? 106.397 -41.490  21.347  1.00 59.02  ? 149 ASP A N     1 
ATOM   1185  C CA    . ASP A 1 149 ? 107.205 -40.306  21.599  1.00 58.54  ? 149 ASP A CA    1 
ATOM   1186  C C     . ASP A 1 149 ? 108.574 -40.724  22.091  1.00 57.82  ? 149 ASP A C     1 
ATOM   1187  O O     . ASP A 1 149 ? 109.592 -40.183  21.663  1.00 57.62  ? 149 ASP A O     1 
ATOM   1188  C CB    . ASP A 1 149 ? 106.554 -39.414  22.658  1.00 58.74  ? 149 ASP A CB    1 
ATOM   1189  C CG    . ASP A 1 149 ? 105.230 -38.835  22.209  1.00 60.69  ? 149 ASP A CG    1 
ATOM   1190  O OD1   . ASP A 1 149 ? 104.997 -38.721  20.985  1.00 63.25  ? 149 ASP A OD1   1 
ATOM   1191  O OD2   . ASP A 1 149 ? 104.412 -38.488  23.090  1.00 62.49  ? 149 ASP A OD2   1 
ATOM   1192  N N     . ILE A 1 150 ? 108.598 -41.682  23.008  1.00 57.27  ? 150 ILE A N     1 
ATOM   1193  C CA    . ILE A 1 150 ? 109.853 -42.101  23.588  1.00 56.96  ? 150 ILE A CA    1 
ATOM   1194  C C     . ILE A 1 150 ? 110.697 -42.764  22.518  1.00 57.15  ? 150 ILE A C     1 
ATOM   1195  O O     . ILE A 1 150 ? 111.884 -42.440  22.388  1.00 57.23  ? 150 ILE A O     1 
ATOM   1196  C CB    . ILE A 1 150 ? 109.667 -43.037  24.778  1.00 57.05  ? 150 ILE A CB    1 
ATOM   1197  C CG1   . ILE A 1 150 ? 108.883 -42.328  25.870  1.00 57.00  ? 150 ILE A CG1   1 
ATOM   1198  C CG2   . ILE A 1 150 ? 111.021 -43.426  25.338  1.00 57.38  ? 150 ILE A CG2   1 
ATOM   1199  C CD1   . ILE A 1 150 ? 108.524 -43.202  27.013  1.00 57.98  ? 150 ILE A CD1   1 
ATOM   1200  N N     . ASP A 1 151 ? 110.079 -43.663  21.742  1.00 57.10  ? 151 ASP A N     1 
ATOM   1201  C CA    . ASP A 1 151 ? 110.746 -44.325  20.620  1.00 56.78  ? 151 ASP A CA    1 
ATOM   1202  C C     . ASP A 1 151 ? 111.459 -43.292  19.761  1.00 55.53  ? 151 ASP A C     1 
ATOM   1203  O O     . ASP A 1 151 ? 112.658 -43.414  19.489  1.00 55.50  ? 151 ASP A O     1 
ATOM   1204  C CB    . ASP A 1 151 ? 109.727 -45.072  19.762  1.00 57.94  ? 151 ASP A CB    1 
ATOM   1205  C CG    . ASP A 1 151 ? 109.380 -46.457  20.303  1.00 60.70  ? 151 ASP A CG    1 
ATOM   1206  O OD1   . ASP A 1 151 ? 110.198 -47.057  21.055  1.00 62.55  ? 151 ASP A OD1   1 
ATOM   1207  O OD2   . ASP A 1 151 ? 108.284 -46.957  19.936  1.00 63.59  ? 151 ASP A OD2   1 
ATOM   1208  N N     . LYS A 1 152 ? 110.704 -42.267  19.362  1.00 54.17  ? 152 LYS A N     1 
ATOM   1209  C CA    . LYS A 1 152 ? 111.180 -41.190  18.502  1.00 52.85  ? 152 LYS A CA    1 
ATOM   1210  C C     . LYS A 1 152 ? 112.362 -40.439  19.125  1.00 51.82  ? 152 LYS A C     1 
ATOM   1211  O O     . LYS A 1 152 ? 113.330 -40.105  18.436  1.00 52.10  ? 152 LYS A O     1 
ATOM   1212  C CB    . LYS A 1 152 ? 110.029 -40.242  18.210  1.00 52.57  ? 152 LYS A CB    1 
ATOM   1213  C CG    . LYS A 1 152 ? 110.265 -39.324  17.056  1.00 52.90  ? 152 LYS A CG    1 
ATOM   1214  C CD    . LYS A 1 152 ? 109.000 -38.548  16.711  1.00 53.60  ? 152 LYS A CD    1 
ATOM   1215  C CE    . LYS A 1 152 ? 109.229 -37.629  15.521  1.00 54.38  ? 152 LYS A CE    1 
ATOM   1216  N NZ    . LYS A 1 152 ? 108.020 -36.826  15.231  1.00 55.96  ? 152 LYS A NZ    1 
ATOM   1217  N N     . THR A 1 153 ? 112.281 -40.197  20.431  1.00 50.48  ? 153 THR A N     1 
ATOM   1218  C CA    . THR A 1 153 ? 113.308 -39.467  21.166  1.00 49.06  ? 153 THR A CA    1 
ATOM   1219  C C     . THR A 1 153 ? 114.586 -40.295  21.308  1.00 48.46  ? 153 THR A C     1 
ATOM   1220  O O     . THR A 1 153 ? 115.695 -39.789  21.088  1.00 48.45  ? 153 THR A O     1 
ATOM   1221  C CB    . THR A 1 153 ? 112.792 -39.051  22.562  1.00 48.89  ? 153 THR A CB    1 
ATOM   1222  O OG1   . THR A 1 153 ? 111.526 -38.396  22.419  1.00 49.04  ? 153 THR A OG1   1 
ATOM   1223  C CG2   . THR A 1 153 ? 113.796 -38.119  23.284  1.00 47.82  ? 153 THR A CG2   1 
ATOM   1224  N N     . ILE A 1 154 ? 114.431 -41.562  21.682  1.00 47.64  ? 154 ILE A N     1 
ATOM   1225  C CA    . ILE A 1 154 ? 115.562 -42.468  21.807  1.00 46.70  ? 154 ILE A CA    1 
ATOM   1226  C C     . ILE A 1 154 ? 116.372 -42.418  20.525  1.00 46.78  ? 154 ILE A C     1 
ATOM   1227  O O     . ILE A 1 154 ? 117.586 -42.253  20.564  1.00 46.65  ? 154 ILE A O     1 
ATOM   1228  C CB    . ILE A 1 154 ? 115.107 -43.905  22.084  1.00 46.67  ? 154 ILE A CB    1 
ATOM   1229  C CG1   . ILE A 1 154 ? 114.688 -44.056  23.550  1.00 45.92  ? 154 ILE A CG1   1 
ATOM   1230  C CG2   . ILE A 1 154 ? 116.211 -44.877  21.754  1.00 46.84  ? 154 ILE A CG2   1 
ATOM   1231  C CD1   . ILE A 1 154 ? 113.889 -45.322  23.848  1.00 44.36  ? 154 ILE A CD1   1 
ATOM   1232  N N     . ASN A 1 155 ? 115.687 -42.518  19.389  1.00 47.15  ? 155 ASN A N     1 
ATOM   1233  C CA    . ASN A 1 155 ? 116.356 -42.475  18.096  1.00 47.48  ? 155 ASN A CA    1 
ATOM   1234  C C     . ASN A 1 155 ? 117.030 -41.130  17.795  1.00 47.38  ? 155 ASN A C     1 
ATOM   1235  O O     . ASN A 1 155 ? 118.161 -41.090  17.295  1.00 47.54  ? 155 ASN A O     1 
ATOM   1236  C CB    . ASN A 1 155 ? 115.403 -42.875  16.977  1.00 47.74  ? 155 ASN A CB    1 
ATOM   1237  C CG    . ASN A 1 155 ? 116.130 -43.201  15.691  1.00 48.18  ? 155 ASN A CG    1 
ATOM   1238  O OD1   . ASN A 1 155 ? 115.669 -42.862  14.611  1.00 51.30  ? 155 ASN A OD1   1 
ATOM   1239  N ND2   . ASN A 1 155 ? 117.267 -43.854  15.799  1.00 46.74  ? 155 ASN A ND2   1 
ATOM   1240  N N     . LEU A 1 156 ? 116.351 -40.038  18.125  1.00 47.11  ? 156 LEU A N     1 
ATOM   1241  C CA    . LEU A 1 156 ? 116.929 -38.710  17.935  1.00 47.09  ? 156 LEU A CA    1 
ATOM   1242  C C     . LEU A 1 156 ? 118.184 -38.499  18.788  1.00 47.17  ? 156 LEU A C     1 
ATOM   1243  O O     . LEU A 1 156 ? 119.183 -37.986  18.300  1.00 47.47  ? 156 LEU A O     1 
ATOM   1244  C CB    . LEU A 1 156 ? 115.889 -37.610  18.211  1.00 46.70  ? 156 LEU A CB    1 
ATOM   1245  C CG    . LEU A 1 156 ? 116.456 -36.189  18.276  1.00 45.21  ? 156 LEU A CG    1 
ATOM   1246  C CD1   . LEU A 1 156 ? 116.758 -35.678  16.899  1.00 44.64  ? 156 LEU A CD1   1 
ATOM   1247  C CD2   . LEU A 1 156 ? 115.523 -35.260  19.004  1.00 43.94  ? 156 LEU A CD2   1 
ATOM   1248  N N     . PHE A 1 157 ? 118.125 -38.889  20.055  1.00 47.35  ? 157 PHE A N     1 
ATOM   1249  C CA    . PHE A 1 157 ? 119.241 -38.686  20.969  1.00 48.13  ? 157 PHE A CA    1 
ATOM   1250  C C     . PHE A 1 157 ? 120.441 -39.576  20.623  1.00 48.77  ? 157 PHE A C     1 
ATOM   1251  O O     . PHE A 1 157 ? 121.601 -39.152  20.702  1.00 48.86  ? 157 PHE A O     1 
ATOM   1252  C CB    . PHE A 1 157 ? 118.785 -38.955  22.398  1.00 47.94  ? 157 PHE A CB    1 
ATOM   1253  C CG    . PHE A 1 157 ? 117.956 -37.858  22.992  1.00 48.52  ? 157 PHE A CG    1 
ATOM   1254  C CD1   . PHE A 1 157 ? 117.729 -37.814  24.364  1.00 50.15  ? 157 PHE A CD1   1 
ATOM   1255  C CD2   . PHE A 1 157 ? 117.418 -36.856  22.201  1.00 47.60  ? 157 PHE A CD2   1 
ATOM   1256  C CE1   . PHE A 1 157 ? 116.957 -36.794  24.924  1.00 50.79  ? 157 PHE A CE1   1 
ATOM   1257  C CE2   . PHE A 1 157 ? 116.656 -35.840  22.754  1.00 47.99  ? 157 PHE A CE2   1 
ATOM   1258  C CZ    . PHE A 1 157 ? 116.411 -35.807  24.100  1.00 49.18  ? 157 PHE A CZ    1 
ATOM   1259  N N     . SER A 1 158 ? 120.145 -40.810  20.238  1.00 49.45  ? 158 SER A N     1 
ATOM   1260  C CA    . SER A 1 158 ? 121.165 -41.776  19.899  1.00 50.06  ? 158 SER A CA    1 
ATOM   1261  C C     . SER A 1 158 ? 121.903 -41.367  18.636  1.00 50.31  ? 158 SER A C     1 
ATOM   1262  O O     . SER A 1 158 ? 123.110 -41.565  18.530  1.00 50.20  ? 158 SER A O     1 
ATOM   1263  C CB    . SER A 1 158 ? 120.518 -43.137  19.717  1.00 50.67  ? 158 SER A CB    1 
ATOM   1264  O OG    . SER A 1 158 ? 119.796 -43.468  20.888  1.00 51.58  ? 158 SER A OG    1 
ATOM   1265  N N     . GLU A 1 159 ? 121.172 -40.804  17.679  1.00 50.52  ? 159 GLU A N     1 
ATOM   1266  C CA    . GLU A 1 159 ? 121.795 -40.280  16.478  1.00 51.17  ? 159 GLU A CA    1 
ATOM   1267  C C     . GLU A 1 159 ? 122.666 -39.069  16.824  1.00 50.37  ? 159 GLU A C     1 
ATOM   1268  O O     . GLU A 1 159 ? 123.784 -38.931  16.309  1.00 50.69  ? 159 GLU A O     1 
ATOM   1269  C CB    . GLU A 1 159 ? 120.744 -39.966  15.415  1.00 52.03  ? 159 GLU A CB    1 
ATOM   1270  C CG    . GLU A 1 159 ? 120.151 -41.242  14.817  1.00 55.61  ? 159 GLU A CG    1 
ATOM   1271  C CD    . GLU A 1 159 ? 119.061 -40.997  13.766  1.00 60.93  ? 159 GLU A CD    1 
ATOM   1272  O OE1   . GLU A 1 159 ? 117.965 -40.450  14.095  1.00 62.00  ? 159 GLU A OE1   1 
ATOM   1273  O OE2   . GLU A 1 159 ? 119.304 -41.390  12.601  1.00 62.52  ? 159 GLU A OE2   1 
ATOM   1274  N N     . ARG A 1 160 ? 122.168 -38.223  17.726  1.00 49.41  ? 160 ARG A N     1 
ATOM   1275  C CA    . ARG A 1 160 ? 122.923 -37.077  18.219  1.00 48.65  ? 160 ARG A CA    1 
ATOM   1276  C C     . ARG A 1 160 ? 124.161 -37.541  18.964  1.00 48.30  ? 160 ARG A C     1 
ATOM   1277  O O     . ARG A 1 160 ? 125.266 -37.066  18.681  1.00 48.75  ? 160 ARG A O     1 
ATOM   1278  C CB    . ARG A 1 160 ? 122.075 -36.205  19.145  1.00 48.37  ? 160 ARG A CB    1 
ATOM   1279  C CG    . ARG A 1 160 ? 122.760 -34.903  19.545  1.00 48.47  ? 160 ARG A CG    1 
ATOM   1280  C CD    . ARG A 1 160 ? 123.021 -34.027  18.332  1.00 49.10  ? 160 ARG A CD    1 
ATOM   1281  N NE    . ARG A 1 160 ? 121.752 -33.712  17.682  1.00 50.82  ? 160 ARG A NE    1 
ATOM   1282  C CZ    . ARG A 1 160 ? 121.597 -33.460  16.387  1.00 50.95  ? 160 ARG A CZ    1 
ATOM   1283  N NH1   . ARG A 1 160 ? 120.376 -33.201  15.926  1.00 49.64  ? 160 ARG A NH1   1 
ATOM   1284  N NH2   . ARG A 1 160 ? 122.647 -33.480  15.562  1.00 50.76  ? 160 ARG A NH2   1 
ATOM   1285  N N     . LEU A 1 161 ? 123.982 -38.472  19.905  1.00 47.12  ? 161 LEU A N     1 
ATOM   1286  C CA    . LEU A 1 161 ? 125.089 -38.914  20.720  1.00 46.19  ? 161 LEU A CA    1 
ATOM   1287  C C     . LEU A 1 161 ? 126.217 -39.460  19.878  1.00 46.60  ? 161 LEU A C     1 
ATOM   1288  O O     . LEU A 1 161 ? 127.355 -39.076  20.093  1.00 47.08  ? 161 LEU A O     1 
ATOM   1289  C CB    . LEU A 1 161 ? 124.659 -39.929  21.759  1.00 45.70  ? 161 LEU A CB    1 
ATOM   1290  C CG    . LEU A 1 161 ? 125.741 -40.446  22.711  1.00 44.43  ? 161 LEU A CG    1 
ATOM   1291  C CD1   . LEU A 1 161 ? 126.543 -39.343  23.378  1.00 42.56  ? 161 LEU A CD1   1 
ATOM   1292  C CD2   . LEU A 1 161 ? 125.083 -41.296  23.762  1.00 44.04  ? 161 LEU A CD2   1 
ATOM   1293  N N     . ARG A 1 162 ? 125.911 -40.315  18.905  1.00 47.10  ? 162 ARG A N     1 
ATOM   1294  C CA    . ARG A 1 162 ? 126.950 -40.934  18.069  1.00 47.69  ? 162 ARG A CA    1 
ATOM   1295  C C     . ARG A 1 162 ? 127.732 -39.881  17.309  1.00 48.95  ? 162 ARG A C     1 
ATOM   1296  O O     . ARG A 1 162 ? 128.969 -39.946  17.254  1.00 49.12  ? 162 ARG A O     1 
ATOM   1297  C CB    . ARG A 1 162 ? 126.368 -41.934  17.082  1.00 47.64  ? 162 ARG A CB    1 
ATOM   1298  C CG    . ARG A 1 162 ? 125.856 -43.206  17.699  1.00 46.58  ? 162 ARG A CG    1 
ATOM   1299  C CD    . ARG A 1 162 ? 124.938 -43.920  16.752  1.00 45.78  ? 162 ARG A CD    1 
ATOM   1300  N NE    . ARG A 1 162 ? 124.517 -45.209  17.275  1.00 47.18  ? 162 ARG A NE    1 
ATOM   1301  C CZ    . ARG A 1 162 ? 125.258 -46.319  17.262  1.00 48.52  ? 162 ARG A CZ    1 
ATOM   1302  N NH1   . ARG A 1 162 ? 124.773 -47.447  17.766  1.00 49.23  ? 162 ARG A NH1   1 
ATOM   1303  N NH2   . ARG A 1 162 ? 126.487 -46.310  16.763  1.00 49.07  ? 162 ARG A NH2   1 
ATOM   1304  N N     . GLU A 1 163 ? 127.013 -38.905  16.738  1.00 49.89  ? 163 GLU A N     1 
ATOM   1305  C CA    . GLU A 1 163 ? 127.653 -37.787  16.046  1.00 50.94  ? 163 GLU A CA    1 
ATOM   1306  C C     . GLU A 1 163 ? 128.533 -36.984  17.004  1.00 50.63  ? 163 GLU A C     1 
ATOM   1307  O O     . GLU A 1 163 ? 129.593 -36.467  16.612  1.00 50.89  ? 163 GLU A O     1 
ATOM   1308  C CB    . GLU A 1 163 ? 126.610 -36.888  15.400  1.00 51.57  ? 163 GLU A CB    1 
ATOM   1309  C CG    . GLU A 1 163 ? 126.098 -37.404  14.054  1.00 55.85  ? 163 GLU A CG    1 
ATOM   1310  C CD    . GLU A 1 163 ? 127.167 -37.339  12.961  1.00 61.30  ? 163 GLU A CD    1 
ATOM   1311  O OE1   . GLU A 1 163 ? 127.412 -38.368  12.284  1.00 63.21  ? 163 GLU A OE1   1 
ATOM   1312  O OE2   . GLU A 1 163 ? 127.778 -36.255  12.788  1.00 63.61  ? 163 GLU A OE2   1 
ATOM   1313  N N     . TRP A 1 164 ? 128.099 -36.910  18.265  1.00 49.93  ? 164 TRP A N     1 
ATOM   1314  C CA    . TRP A 1 164 ? 128.752 -36.083  19.261  1.00 49.32  ? 164 TRP A CA    1 
ATOM   1315  C C     . TRP A 1 164 ? 129.957 -36.815  19.796  1.00 49.20  ? 164 TRP A C     1 
ATOM   1316  O O     . TRP A 1 164 ? 131.069 -36.292  19.741  1.00 49.81  ? 164 TRP A O     1 
ATOM   1317  C CB    . TRP A 1 164 ? 127.789 -35.740  20.403  1.00 48.92  ? 164 TRP A CB    1 
ATOM   1318  C CG    . TRP A 1 164 ? 128.253 -34.604  21.309  1.00 48.61  ? 164 TRP A CG    1 
ATOM   1319  C CD1   . TRP A 1 164 ? 129.458 -33.955  21.272  1.00 48.52  ? 164 TRP A CD1   1 
ATOM   1320  C CD2   . TRP A 1 164 ? 127.524 -34.028  22.405  1.00 47.21  ? 164 TRP A CD2   1 
ATOM   1321  N NE1   . TRP A 1 164 ? 129.506 -32.993  22.257  1.00 48.65  ? 164 TRP A NE1   1 
ATOM   1322  C CE2   . TRP A 1 164 ? 128.336 -33.019  22.965  1.00 46.88  ? 164 TRP A CE2   1 
ATOM   1323  C CE3   . TRP A 1 164 ? 126.258 -34.263  22.957  1.00 46.49  ? 164 TRP A CE3   1 
ATOM   1324  C CZ2   . TRP A 1 164 ? 127.929 -32.247  24.044  1.00 46.65  ? 164 TRP A CZ2   1 
ATOM   1325  C CZ3   . TRP A 1 164 ? 125.855 -33.499  24.029  1.00 46.06  ? 164 TRP A CZ3   1 
ATOM   1326  C CH2   . TRP A 1 164 ? 126.688 -32.497  24.563  1.00 46.72  ? 164 TRP A CH2   1 
ATOM   1327  N N     . TYR A 1 165 ? 129.735 -38.024  20.309  1.00 48.69  ? 165 TYR A N     1 
ATOM   1328  C CA    . TYR A 1 165 ? 130.790 -38.772  20.965  1.00 48.37  ? 165 TYR A CA    1 
ATOM   1329  C C     . TYR A 1 165 ? 131.836 -39.187  19.972  1.00 49.07  ? 165 TYR A C     1 
ATOM   1330  O O     . TYR A 1 165 ? 132.958 -39.474  20.359  1.00 49.37  ? 165 TYR A O     1 
ATOM   1331  C CB    . TYR A 1 165 ? 130.260 -40.007  21.676  1.00 47.95  ? 165 TYR A CB    1 
ATOM   1332  C CG    . TYR A 1 165 ? 131.336 -40.752  22.463  1.00 48.04  ? 165 TYR A CG    1 
ATOM   1333  C CD1   . TYR A 1 165 ? 131.889 -40.200  23.633  1.00 47.69  ? 165 TYR A CD1   1 
ATOM   1334  C CD2   . TYR A 1 165 ? 131.811 -42.000  22.042  1.00 47.02  ? 165 TYR A CD2   1 
ATOM   1335  C CE1   . TYR A 1 165 ? 132.867 -40.864  24.351  1.00 46.16  ? 165 TYR A CE1   1 
ATOM   1336  C CE2   . TYR A 1 165 ? 132.788 -42.679  22.762  1.00 45.60  ? 165 TYR A CE2   1 
ATOM   1337  C CZ    . TYR A 1 165 ? 133.310 -42.100  23.916  1.00 46.60  ? 165 TYR A CZ    1 
ATOM   1338  O OH    . TYR A 1 165 ? 134.290 -42.747  24.643  1.00 47.71  ? 165 TYR A OH    1 
ATOM   1339  N N     . SER A 1 166 ? 131.479 -39.209  18.688  1.00 49.91  ? 166 SER A N     1 
ATOM   1340  C CA    . SER A 1 166 ? 132.449 -39.549  17.631  1.00 50.49  ? 166 SER A CA    1 
ATOM   1341  C C     . SER A 1 166 ? 133.556 -38.499  17.431  1.00 50.42  ? 166 SER A C     1 
ATOM   1342  O O     . SER A 1 166 ? 134.497 -38.726  16.673  1.00 50.98  ? 166 SER A O     1 
ATOM   1343  C CB    . SER A 1 166 ? 131.742 -39.889  16.310  1.00 50.74  ? 166 SER A CB    1 
ATOM   1344  O OG    . SER A 1 166 ? 131.283 -41.237  16.330  1.00 52.15  ? 166 SER A OG    1 
ATOM   1345  N N     . ILE A 1 167 ? 133.461 -37.358  18.113  1.00 49.98  ? 167 ILE A N     1 
ATOM   1346  C CA    . ILE A 1 167 ? 134.556 -36.393  18.072  1.00 50.16  ? 167 ILE A CA    1 
ATOM   1347  C C     . ILE A 1 167 ? 135.738 -36.970  18.851  1.00 50.31  ? 167 ILE A C     1 
ATOM   1348  O O     . ILE A 1 167 ? 136.903 -36.771  18.495  1.00 50.77  ? 167 ILE A O     1 
ATOM   1349  C CB    . ILE A 1 167 ? 134.153 -35.014  18.624  1.00 49.77  ? 167 ILE A CB    1 
ATOM   1350  C CG1   . ILE A 1 167 ? 133.039 -34.428  17.771  1.00 50.28  ? 167 ILE A CG1   1 
ATOM   1351  C CG2   . ILE A 1 167 ? 135.336 -34.068  18.607  1.00 49.31  ? 167 ILE A CG2   1 
ATOM   1352  C CD1   . ILE A 1 167 ? 132.355 -33.244  18.382  1.00 52.16  ? 167 ILE A CD1   1 
ATOM   1353  N N     . HIS A 1 168 ? 135.422 -37.712  19.900  1.00 49.91  ? 168 HIS A N     1 
ATOM   1354  C CA    . HIS A 1 168 ? 136.435 -38.294  20.744  1.00 50.11  ? 168 HIS A CA    1 
ATOM   1355  C C     . HIS A 1 168 ? 136.846 -39.705  20.326  1.00 50.79  ? 168 HIS A C     1 
ATOM   1356  O O     . HIS A 1 168 ? 138.013 -40.073  20.422  1.00 51.17  ? 168 HIS A O     1 
ATOM   1357  C CB    . HIS A 1 168 ? 135.919 -38.337  22.161  1.00 49.69  ? 168 HIS A CB    1 
ATOM   1358  C CG    . HIS A 1 168 ? 136.857 -38.990  23.118  1.00 49.42  ? 168 HIS A CG    1 
ATOM   1359  N ND1   . HIS A 1 168 ? 138.054 -38.417  23.493  1.00 49.20  ? 168 HIS A ND1   1 
ATOM   1360  C CD2   . HIS A 1 168 ? 136.769 -40.158  23.793  1.00 49.15  ? 168 HIS A CD2   1 
ATOM   1361  C CE1   . HIS A 1 168 ? 138.658 -39.201  24.367  1.00 49.54  ? 168 HIS A CE1   1 
ATOM   1362  N NE2   . HIS A 1 168 ? 137.902 -40.266  24.562  1.00 49.47  ? 168 HIS A NE2   1 
ATOM   1363  N N     . PHE A 1 169 ? 135.888 -40.503  19.879  1.00 51.21  ? 169 PHE A N     1 
ATOM   1364  C CA    . PHE A 1 169 ? 136.157 -41.904  19.644  1.00 51.96  ? 169 PHE A CA    1 
ATOM   1365  C C     . PHE A 1 169 ? 135.282 -42.366  18.489  1.00 52.66  ? 169 PHE A C     1 
ATOM   1366  O O     . PHE A 1 169 ? 134.313 -43.094  18.696  1.00 53.00  ? 169 PHE A O     1 
ATOM   1367  C CB    . PHE A 1 169 ? 135.934 -42.693  20.950  1.00 51.94  ? 169 PHE A CB    1 
ATOM   1368  C CG    . PHE A 1 169 ? 136.226 -44.173  20.865  1.00 51.74  ? 169 PHE A CG    1 
ATOM   1369  C CD1   . PHE A 1 169 ? 135.786 -45.015  21.877  1.00 50.92  ? 169 PHE A CD1   1 
ATOM   1370  C CD2   . PHE A 1 169 ? 136.925 -44.725  19.784  1.00 52.18  ? 169 PHE A CD2   1 
ATOM   1371  C CE1   . PHE A 1 169 ? 136.035 -46.376  21.824  1.00 51.06  ? 169 PHE A CE1   1 
ATOM   1372  C CE2   . PHE A 1 169 ? 137.178 -46.086  19.711  1.00 50.92  ? 169 PHE A CE2   1 
ATOM   1373  C CZ    . PHE A 1 169 ? 136.732 -46.913  20.732  1.00 51.88  ? 169 PHE A CZ    1 
ATOM   1374  N N     . PRO A 1 170 ? 135.657 -41.961  17.262  1.00 53.27  ? 170 PRO A N     1 
ATOM   1375  C CA    . PRO A 1 170 ? 134.869 -42.126  16.054  1.00 54.13  ? 170 PRO A CA    1 
ATOM   1376  C C     . PRO A 1 170 ? 134.704 -43.580  15.638  1.00 55.48  ? 170 PRO A C     1 
ATOM   1377  O O     . PRO A 1 170 ? 133.674 -43.936  15.063  1.00 56.02  ? 170 PRO A O     1 
ATOM   1378  C CB    . PRO A 1 170 ? 135.689 -41.387  14.988  1.00 54.32  ? 170 PRO A CB    1 
ATOM   1379  C CG    . PRO A 1 170 ? 136.809 -40.735  15.689  1.00 53.58  ? 170 PRO A CG    1 
ATOM   1380  C CD    . PRO A 1 170 ? 137.009 -41.476  16.951  1.00 53.22  ? 170 PRO A CD    1 
ATOM   1381  N N     . GLU A 1 171 ? 135.695 -44.417  15.930  1.00 56.47  ? 171 GLU A N     1 
ATOM   1382  C CA    . GLU A 1 171 ? 135.666 -45.806  15.470  1.00 58.13  ? 171 GLU A CA    1 
ATOM   1383  C C     . GLU A 1 171 ? 134.628 -46.666  16.196  1.00 58.88  ? 171 GLU A C     1 
ATOM   1384  O O     . GLU A 1 171 ? 134.250 -47.731  15.709  1.00 59.65  ? 171 GLU A O     1 
ATOM   1385  C CB    . GLU A 1 171 ? 137.051 -46.433  15.568  1.00 58.19  ? 171 GLU A CB    1 
ATOM   1386  C CG    . GLU A 1 171 ? 138.125 -45.659  14.800  1.00 59.24  ? 171 GLU A CG    1 
ATOM   1387  C CD    . GLU A 1 171 ? 138.764 -44.508  15.601  1.00 59.05  ? 171 GLU A CD    1 
ATOM   1388  O OE1   . GLU A 1 171 ? 139.770 -43.936  15.113  1.00 58.28  ? 171 GLU A OE1   1 
ATOM   1389  O OE2   . GLU A 1 171 ? 138.266 -44.182  16.705  1.00 57.81  ? 171 GLU A OE2   1 
ATOM   1390  N N     . LEU A 1 172 ? 134.164 -46.188  17.347  1.00 59.33  ? 172 LEU A N     1 
ATOM   1391  C CA    . LEU A 1 172 ? 133.215 -46.929  18.165  1.00 60.32  ? 172 LEU A CA    1 
ATOM   1392  C C     . LEU A 1 172 ? 131.839 -46.972  17.517  1.00 61.40  ? 172 LEU A C     1 
ATOM   1393  O O     . LEU A 1 172 ? 131.080 -47.924  17.724  1.00 61.94  ? 172 LEU A O     1 
ATOM   1394  C CB    . LEU A 1 172 ? 133.113 -46.301  19.557  1.00 59.61  ? 172 LEU A CB    1 
ATOM   1395  C CG    . LEU A 1 172 ? 132.236 -46.996  20.604  1.00 58.77  ? 172 LEU A CG    1 
ATOM   1396  C CD1   . LEU A 1 172 ? 132.921 -48.225  21.165  1.00 58.07  ? 172 LEU A CD1   1 
ATOM   1397  C CD2   . LEU A 1 172 ? 131.913 -46.015  21.711  1.00 57.38  ? 172 LEU A CD2   1 
ATOM   1398  N N     . ASP A 1 173 ? 131.532 -45.932  16.746  1.00 62.32  ? 173 ASP A N     1 
ATOM   1399  C CA    . ASP A 1 173 ? 130.242 -45.789  16.067  1.00 63.34  ? 173 ASP A CA    1 
ATOM   1400  C C     . ASP A 1 173 ? 129.883 -46.992  15.193  1.00 64.23  ? 173 ASP A C     1 
ATOM   1401  O O     . ASP A 1 173 ? 128.826 -47.571  15.377  1.00 64.38  ? 173 ASP A O     1 
ATOM   1402  C CB    . ASP A 1 173 ? 130.210 -44.475  15.262  1.00 63.67  ? 173 ASP A CB    1 
ATOM   1403  C CG    . ASP A 1 173 ? 128.988 -44.352  14.361  1.00 64.38  ? 173 ASP A CG    1 
ATOM   1404  O OD1   . ASP A 1 173 ? 129.182 -44.303  13.133  1.00 65.84  ? 173 ASP A OD1   1 
ATOM   1405  O OD2   . ASP A 1 173 ? 127.846 -44.296  14.864  1.00 64.74  ? 173 ASP A OD2   1 
ATOM   1406  N N     . LYS A 1 174 ? 130.759 -47.377  14.268  1.00 65.33  ? 174 LYS A N     1 
ATOM   1407  C CA    . LYS A 1 174 ? 130.471 -48.514  13.381  1.00 67.01  ? 174 LYS A CA    1 
ATOM   1408  C C     . LYS A 1 174 ? 130.721 -49.854  14.053  1.00 67.35  ? 174 LYS A C     1 
ATOM   1409  O O     . LYS A 1 174 ? 130.411 -50.900  13.486  1.00 68.27  ? 174 LYS A O     1 
ATOM   1410  C CB    . LYS A 1 174 ? 131.270 -48.440  12.073  1.00 67.99  ? 174 LYS A CB    1 
ATOM   1411  C CG    . LYS A 1 174 ? 130.704 -47.497  11.005  1.00 69.97  ? 174 LYS A CG    1 
ATOM   1412  C CD    . LYS A 1 174 ? 131.847 -46.636  10.427  1.00 74.03  ? 174 LYS A CD    1 
ATOM   1413  C CE    . LYS A 1 174 ? 132.486 -45.734  11.530  1.00 74.46  ? 174 LYS A CE    1 
ATOM   1414  N NZ    . LYS A 1 174 ? 133.979 -45.852  11.629  1.00 73.99  ? 174 LYS A NZ    1 
ATOM   1415  N N     . LEU A 1 175 ? 131.286 -49.825  15.253  1.00 67.10  ? 175 LEU A N     1 
ATOM   1416  C CA    . LEU A 1 175 ? 131.568 -51.058  15.981  1.00 67.96  ? 175 LEU A CA    1 
ATOM   1417  C C     . LEU A 1 175 ? 130.410 -51.488  16.878  1.00 68.11  ? 175 LEU A C     1 
ATOM   1418  O O     . LEU A 1 175 ? 130.305 -52.665  17.248  1.00 68.70  ? 175 LEU A O     1 
ATOM   1419  C CB    . LEU A 1 175 ? 132.846 -50.917  16.803  1.00 67.74  ? 175 LEU A CB    1 
ATOM   1420  C CG    . LEU A 1 175 ? 134.173 -51.408  16.219  1.00 69.01  ? 175 LEU A CG    1 
ATOM   1421  C CD1   . LEU A 1 175 ? 134.377 -50.969  14.764  1.00 70.58  ? 175 LEU A CD1   1 
ATOM   1422  C CD2   . LEU A 1 175 ? 135.319 -50.915  17.093  1.00 68.56  ? 175 LEU A CD2   1 
ATOM   1423  N N     . ILE A 1 176 ? 129.558 -50.531  17.242  1.00 67.51  ? 176 ILE A N     1 
ATOM   1424  C CA    . ILE A 1 176 ? 128.388 -50.835  18.045  1.00 67.68  ? 176 ILE A CA    1 
ATOM   1425  C C     . ILE A 1 176 ? 127.106 -50.454  17.317  1.00 68.06  ? 176 ILE A C     1 
ATOM   1426  O O     . ILE A 1 176 ? 126.745 -49.276  17.202  1.00 67.17  ? 176 ILE A O     1 
ATOM   1427  C CB    . ILE A 1 176 ? 128.452 -50.232  19.459  1.00 66.93  ? 176 ILE A CB    1 
ATOM   1428  C CG1   . ILE A 1 176 ? 129.396 -51.044  20.330  1.00 67.03  ? 176 ILE A CG1   1 
ATOM   1429  C CG2   . ILE A 1 176 ? 127.117 -50.334  20.127  1.00 67.40  ? 176 ILE A CG2   1 
ATOM   1430  C CD1   . ILE A 1 176 ? 130.768 -50.543  20.321  1.00 67.23  ? 176 ILE A CD1   1 
ATOM   1431  N N     . GLU A 1 177 ? 126.432 -51.492  16.824  1.00 69.34  ? 177 GLU A N     1 
ATOM   1432  C CA    . GLU A 1 177 ? 125.215 -51.354  16.065  1.00 69.77  ? 177 GLU A CA    1 
ATOM   1433  C C     . GLU A 1 177 ? 124.132 -50.854  16.976  1.00 68.88  ? 177 GLU A C     1 
ATOM   1434  O O     . GLU A 1 177 ? 123.409 -49.932  16.625  1.00 69.06  ? 177 GLU A O     1 
ATOM   1435  C CB    . GLU A 1 177 ? 124.799 -52.707  15.523  1.00 71.17  ? 177 GLU A CB    1 
ATOM   1436  C CG    . GLU A 1 177 ? 124.385 -52.678  14.070  1.00 75.19  ? 177 GLU A CG    1 
ATOM   1437  C CD    . GLU A 1 177 ? 125.579 -52.803  13.119  1.00 79.65  ? 177 GLU A CD    1 
ATOM   1438  O OE1   . GLU A 1 177 ? 126.744 -52.742  13.593  1.00 81.34  ? 177 GLU A OE1   1 
ATOM   1439  O OE2   . GLU A 1 177 ? 125.350 -52.973  11.897  1.00 81.06  ? 177 GLU A OE2   1 
ATOM   1440  N N     . ASP A 1 178 ? 124.036 -51.462  18.153  1.00 68.48  ? 178 ASP A N     1 
ATOM   1441  C CA    . ASP A 1 178 ? 122.912 -51.246  19.046  1.00 67.93  ? 178 ASP A CA    1 
ATOM   1442  C C     . ASP A 1 178 ? 123.025 -49.923  19.792  1.00 66.76  ? 178 ASP A C     1 
ATOM   1443  O O     . ASP A 1 178 ? 124.057 -49.638  20.409  1.00 66.95  ? 178 ASP A O     1 
ATOM   1444  C CB    . ASP A 1 178 ? 122.813 -52.405  20.033  1.00 68.58  ? 178 ASP A CB    1 
ATOM   1445  C CG    . ASP A 1 178 ? 121.657 -52.249  20.989  1.00 69.24  ? 178 ASP A CG    1 
ATOM   1446  O OD1   . ASP A 1 178 ? 121.896 -51.772  22.123  1.00 69.52  ? 178 ASP A OD1   1 
ATOM   1447  O OD2   . ASP A 1 178 ? 120.511 -52.574  20.598  1.00 70.78  ? 178 ASP A OD2   1 
ATOM   1448  N N     . HIS A 1 179 ? 121.967 -49.113  19.748  1.00 65.69  ? 179 HIS A N     1 
ATOM   1449  C CA    . HIS A 1 179 ? 121.995 -47.812  20.428  1.00 64.18  ? 179 HIS A CA    1 
ATOM   1450  C C     . HIS A 1 179 ? 122.164 -47.925  21.940  1.00 63.58  ? 179 HIS A C     1 
ATOM   1451  O O     . HIS A 1 179 ? 122.989 -47.215  22.512  1.00 62.87  ? 179 HIS A O     1 
ATOM   1452  C CB    . HIS A 1 179 ? 120.753 -46.991  20.108  1.00 63.88  ? 179 HIS A CB    1 
ATOM   1453  C CG    . HIS A 1 179 ? 120.630 -46.626  18.667  1.00 63.53  ? 179 HIS A CG    1 
ATOM   1454  N ND1   . HIS A 1 179 ? 121.659 -46.046  17.960  1.00 62.27  ? 179 HIS A ND1   1 
ATOM   1455  C CD2   . HIS A 1 179 ? 119.595 -46.745  17.802  1.00 63.83  ? 179 HIS A CD2   1 
ATOM   1456  C CE1   . HIS A 1 179 ? 121.269 -45.831  16.717  1.00 62.94  ? 179 HIS A CE1   1 
ATOM   1457  N NE2   . HIS A 1 179 ? 120.020 -46.246  16.594  1.00 63.68  ? 179 HIS A NE2   1 
ATOM   1458  N N     . GLU A 1 180 ? 121.394 -48.818  22.571  1.00 63.51  ? 180 GLU A N     1 
ATOM   1459  C CA    . GLU A 1 180 ? 121.464 -49.000  24.015  1.00 63.30  ? 180 GLU A CA    1 
ATOM   1460  C C     . GLU A 1 180 ? 122.884 -49.370  24.440  1.00 63.40  ? 180 GLU A C     1 
ATOM   1461  O O     . GLU A 1 180 ? 123.406 -48.794  25.409  1.00 63.27  ? 180 GLU A O     1 
ATOM   1462  C CB    . GLU A 1 180 ? 120.442 -50.018  24.529  1.00 63.84  ? 180 GLU A CB    1 
ATOM   1463  C CG    . GLU A 1 180 ? 120.423 -50.139  26.067  1.00 64.17  ? 180 GLU A CG    1 
ATOM   1464  C CD    . GLU A 1 180 ? 119.090 -50.647  26.649  1.00 64.97  ? 180 GLU A CD    1 
ATOM   1465  O OE1   . GLU A 1 180 ? 118.259 -51.218  25.907  1.00 65.27  ? 180 GLU A OE1   1 
ATOM   1466  O OE2   . GLU A 1 180 ? 118.869 -50.468  27.867  1.00 64.42  ? 180 GLU A OE2   1 
ATOM   1467  N N     . GLU A 1 181 ? 123.522 -50.292  23.712  1.00 63.16  ? 181 GLU A N     1 
ATOM   1468  C CA    . GLU A 1 181 ? 124.908 -50.646  24.030  1.00 62.90  ? 181 GLU A CA    1 
ATOM   1469  C C     . GLU A 1 181 ? 125.820 -49.436  23.897  1.00 61.51  ? 181 GLU A C     1 
ATOM   1470  O O     . GLU A 1 181 ? 126.536 -49.093  24.838  1.00 61.62  ? 181 GLU A O     1 
ATOM   1471  C CB    . GLU A 1 181 ? 125.418 -51.800  23.176  1.00 63.74  ? 181 GLU A CB    1 
ATOM   1472  C CG    . GLU A 1 181 ? 125.049 -53.171  23.720  1.00 65.94  ? 181 GLU A CG    1 
ATOM   1473  C CD    . GLU A 1 181 ? 125.062 -54.239  22.646  1.00 68.50  ? 181 GLU A CD    1 
ATOM   1474  O OE1   . GLU A 1 181 ? 125.948 -54.177  21.763  1.00 70.87  ? 181 GLU A OE1   1 
ATOM   1475  O OE2   . GLU A 1 181 ? 124.184 -55.132  22.674  1.00 69.01  ? 181 GLU A OE2   1 
ATOM   1476  N N     . TYR A 1 182 ? 125.770 -48.771  22.747  1.00 60.12  ? 182 TYR A N     1 
ATOM   1477  C CA    . TYR A 1 182 ? 126.569 -47.565  22.534  1.00 58.37  ? 182 TYR A CA    1 
ATOM   1478  C C     . TYR A 1 182 ? 126.460 -46.630  23.742  1.00 57.79  ? 182 TYR A C     1 
ATOM   1479  O O     . TYR A 1 182 ? 127.458 -46.297  24.370  1.00 57.55  ? 182 TYR A O     1 
ATOM   1480  C CB    . TYR A 1 182 ? 126.127 -46.841  21.264  1.00 57.58  ? 182 TYR A CB    1 
ATOM   1481  C CG    . TYR A 1 182 ? 127.079 -45.755  20.821  1.00 54.90  ? 182 TYR A CG    1 
ATOM   1482  C CD1   . TYR A 1 182 ? 128.141 -46.051  19.986  1.00 53.76  ? 182 TYR A CD1   1 
ATOM   1483  C CD2   . TYR A 1 182 ? 126.913 -44.435  21.226  1.00 52.49  ? 182 TYR A CD2   1 
ATOM   1484  C CE1   . TYR A 1 182 ? 129.020 -45.071  19.564  1.00 52.32  ? 182 TYR A CE1   1 
ATOM   1485  C CE2   . TYR A 1 182 ? 127.791 -43.436  20.805  1.00 50.23  ? 182 TYR A CE2   1 
ATOM   1486  C CZ    . TYR A 1 182 ? 128.845 -43.765  19.978  1.00 50.44  ? 182 TYR A CZ    1 
ATOM   1487  O OH    . TYR A 1 182 ? 129.734 -42.805  19.536  1.00 48.57  ? 182 TYR A OH    1 
ATOM   1488  N N     . ALA A 1 183 ? 125.230 -46.243  24.068  1.00 57.26  ? 183 ALA A N     1 
ATOM   1489  C CA    . ALA A 1 183 ? 124.958 -45.347  25.176  1.00 56.61  ? 183 ALA A CA    1 
ATOM   1490  C C     . ALA A 1 183 ? 125.586 -45.832  26.483  1.00 56.58  ? 183 ALA A C     1 
ATOM   1491  O O     . ALA A 1 183 ? 126.172 -45.029  27.220  1.00 56.35  ? 183 ALA A O     1 
ATOM   1492  C CB    . ALA A 1 183 ? 123.455 -45.146  25.336  1.00 56.51  ? 183 ALA A CB    1 
ATOM   1493  N N     . THR A 1 184 ? 125.485 -47.138  26.747  1.00 56.56  ? 184 THR A N     1 
ATOM   1494  C CA    . THR A 1 184 ? 126.029 -47.706  27.981  1.00 56.65  ? 184 THR A CA    1 
ATOM   1495  C C     . THR A 1 184 ? 127.521 -47.456  28.032  1.00 56.41  ? 184 THR A C     1 
ATOM   1496  O O     . THR A 1 184 ? 128.052 -47.162  29.089  1.00 56.92  ? 184 THR A O     1 
ATOM   1497  C CB    . THR A 1 184 ? 125.765 -49.233  28.150  1.00 57.26  ? 184 THR A CB    1 
ATOM   1498  O OG1   . THR A 1 184 ? 124.460 -49.573  27.686  1.00 57.36  ? 184 THR A OG1   1 
ATOM   1499  C CG2   . THR A 1 184 ? 125.846 -49.620  29.601  1.00 57.91  ? 184 THR A CG2   1 
ATOM   1500  N N     . ILE A 1 185 ? 128.197 -47.552  26.892  1.00 56.05  ? 185 ILE A N     1 
ATOM   1501  C CA    . ILE A 1 185 ? 129.639 -47.332  26.858  1.00 55.96  ? 185 ILE A CA    1 
ATOM   1502  C C     . ILE A 1 185 ? 129.994 -45.887  27.232  1.00 56.34  ? 185 ILE A C     1 
ATOM   1503  O O     . ILE A 1 185 ? 130.789 -45.647  28.151  1.00 56.47  ? 185 ILE A O     1 
ATOM   1504  C CB    . ILE A 1 185 ? 130.240 -47.713  25.504  1.00 55.43  ? 185 ILE A CB    1 
ATOM   1505  C CG1   . ILE A 1 185 ? 130.143 -49.227  25.298  1.00 55.48  ? 185 ILE A CG1   1 
ATOM   1506  C CG2   . ILE A 1 185 ? 131.672 -47.244  25.420  1.00 54.76  ? 185 ILE A CG2   1 
ATOM   1507  C CD1   . ILE A 1 185 ? 130.851 -49.739  24.056  1.00 53.57  ? 185 ILE A CD1   1 
ATOM   1508  N N     . VAL A 1 186 ? 129.376 -44.930  26.541  1.00 56.77  ? 186 VAL A N     1 
ATOM   1509  C CA    . VAL A 1 186 ? 129.607 -43.507  26.809  1.00 57.04  ? 186 VAL A CA    1 
ATOM   1510  C C     . VAL A 1 186 ? 129.194 -43.156  28.238  1.00 57.64  ? 186 VAL A C     1 
ATOM   1511  O O     . VAL A 1 186 ? 129.830 -42.328  28.898  1.00 58.01  ? 186 VAL A O     1 
ATOM   1512  C CB    . VAL A 1 186 ? 128.879 -42.580  25.798  1.00 56.54  ? 186 VAL A CB    1 
ATOM   1513  C CG1   . VAL A 1 186 ? 129.309 -41.128  26.009  1.00 56.42  ? 186 VAL A CG1   1 
ATOM   1514  C CG2   . VAL A 1 186 ? 129.181 -42.995  24.373  1.00 55.91  ? 186 VAL A CG2   1 
ATOM   1515  N N     . SER A 1 187 ? 128.141 -43.801  28.716  1.00 58.09  ? 187 SER A N     1 
ATOM   1516  C CA    . SER A 1 187 ? 127.706 -43.589  30.075  1.00 58.89  ? 187 SER A CA    1 
ATOM   1517  C C     . SER A 1 187 ? 128.676 -44.124  31.122  1.00 60.15  ? 187 SER A C     1 
ATOM   1518  O O     . SER A 1 187 ? 129.039 -43.396  32.040  1.00 60.65  ? 187 SER A O     1 
ATOM   1519  C CB    . SER A 1 187 ? 126.338 -44.193  30.288  1.00 58.83  ? 187 SER A CB    1 
ATOM   1520  O OG    . SER A 1 187 ? 126.054 -44.228  31.654  1.00 58.91  ? 187 SER A OG    1 
ATOM   1521  N N     . ARG A 1 188 ? 129.096 -45.382  30.987  1.00 61.40  ? 188 ARG A N     1 
ATOM   1522  C CA    . ARG A 1 188 ? 129.877 -46.056  32.040  1.00 62.92  ? 188 ARG A CA    1 
ATOM   1523  C C     . ARG A 1 188 ? 131.340 -45.649  32.080  1.00 63.15  ? 188 ARG A C     1 
ATOM   1524  O O     . ARG A 1 188 ? 131.923 -45.528  33.159  1.00 63.84  ? 188 ARG A O     1 
ATOM   1525  C CB    . ARG A 1 188 ? 129.754 -47.580  31.957  1.00 63.30  ? 188 ARG A CB    1 
ATOM   1526  C CG    . ARG A 1 188 ? 128.318 -48.047  32.100  1.00 66.41  ? 188 ARG A CG    1 
ATOM   1527  C CD    . ARG A 1 188 ? 128.131 -49.317  32.903  1.00 71.43  ? 188 ARG A CD    1 
ATOM   1528  N NE    . ARG A 1 188 ? 128.768 -50.473  32.281  1.00 76.05  ? 188 ARG A NE    1 
ATOM   1529  C CZ    . ARG A 1 188 ? 128.369 -51.738  32.429  1.00 79.06  ? 188 ARG A CZ    1 
ATOM   1530  N NH1   . ARG A 1 188 ? 127.299 -52.035  33.158  1.00 80.38  ? 188 ARG A NH1   1 
ATOM   1531  N NH2   . ARG A 1 188 ? 129.036 -52.715  31.827  1.00 80.71  ? 188 ARG A NH2   1 
ATOM   1532  N N     . PHE A 1 189 ? 131.927 -45.400  30.914  1.00 63.04  ? 189 PHE A N     1 
ATOM   1533  C CA    . PHE A 1 189 ? 133.371 -45.184  30.833  1.00 63.04  ? 189 PHE A CA    1 
ATOM   1534  C C     . PHE A 1 189 ? 133.790 -43.721  30.819  1.00 62.82  ? 189 PHE A C     1 
ATOM   1535  O O     . PHE A 1 189 ? 134.549 -43.292  31.690  1.00 63.51  ? 189 PHE A O     1 
ATOM   1536  C CB    . PHE A 1 189 ? 133.963 -45.975  29.667  1.00 62.78  ? 189 PHE A CB    1 
ATOM   1537  C CG    . PHE A 1 189 ? 133.716 -47.446  29.777  1.00 63.74  ? 189 PHE A CG    1 
ATOM   1538  C CD1   . PHE A 1 189 ? 132.657 -48.043  29.097  1.00 64.25  ? 189 PHE A CD1   1 
ATOM   1539  C CD2   . PHE A 1 189 ? 134.506 -48.232  30.612  1.00 64.97  ? 189 PHE A CD2   1 
ATOM   1540  C CE1   . PHE A 1 189 ? 132.407 -49.417  29.222  1.00 65.20  ? 189 PHE A CE1   1 
ATOM   1541  C CE2   . PHE A 1 189 ? 134.272 -49.596  30.747  1.00 66.15  ? 189 PHE A CE2   1 
ATOM   1542  C CZ    . PHE A 1 189 ? 133.215 -50.193  30.052  1.00 66.24  ? 189 PHE A CZ    1 
ATOM   1543  N N     . GLY A 1 190 ? 133.276 -42.959  29.861  1.00 62.33  ? 190 GLY A N     1 
ATOM   1544  C CA    . GLY A 1 190 ? 133.712 -41.585  29.651  1.00 61.96  ? 190 GLY A CA    1 
ATOM   1545  C C     . GLY A 1 190 ? 134.815 -41.533  28.606  1.00 61.83  ? 190 GLY A C     1 
ATOM   1546  O O     . GLY A 1 190 ? 134.574 -41.785  27.417  1.00 61.33  ? 190 GLY A O     1 
ATOM   1547  N N     . ASP A 1 191 ? 136.028 -41.202  29.048  1.00 62.00  ? 191 ASP A N     1 
ATOM   1548  C CA    . ASP A 1 191 ? 137.173 -41.142  28.149  1.00 61.87  ? 191 ASP A CA    1 
ATOM   1549  C C     . ASP A 1 191 ? 137.299 -42.513  27.522  1.00 61.58  ? 191 ASP A C     1 
ATOM   1550  O O     . ASP A 1 191 ? 136.844 -43.505  28.102  1.00 61.69  ? 191 ASP A O     1 
ATOM   1551  C CB    . ASP A 1 191 ? 138.445 -40.773  28.919  1.00 62.49  ? 191 ASP A CB    1 
ATOM   1552  C CG    . ASP A 1 191 ? 139.550 -40.204  28.024  1.00 63.97  ? 191 ASP A CG    1 
ATOM   1553  O OD1   . ASP A 1 191 ? 139.905 -39.013  28.219  1.00 65.28  ? 191 ASP A OD1   1 
ATOM   1554  O OD2   . ASP A 1 191 ? 140.077 -40.941  27.147  1.00 65.51  ? 191 ASP A OD2   1 
ATOM   1555  N N     . ARG A 1 192 ? 137.880 -42.566  26.326  1.00 61.24  ? 192 ARG A N     1 
ATOM   1556  C CA    . ARG A 1 192 ? 138.058 -43.837  25.623  1.00 60.94  ? 192 ARG A CA    1 
ATOM   1557  C C     . ARG A 1 192 ? 139.113 -44.681  26.323  1.00 61.60  ? 192 ARG A C     1 
ATOM   1558  O O     . ARG A 1 192 ? 139.064 -45.917  26.283  1.00 62.17  ? 192 ARG A O     1 
ATOM   1559  C CB    . ARG A 1 192 ? 138.390 -43.629  24.140  1.00 60.38  ? 192 ARG A CB    1 
ATOM   1560  C CG    . ARG A 1 192 ? 139.662 -42.849  23.843  1.00 58.58  ? 192 ARG A CG    1 
ATOM   1561  C CD    . ARG A 1 192 ? 139.705 -42.535  22.365  1.00 55.59  ? 192 ARG A CD    1 
ATOM   1562  N NE    . ARG A 1 192 ? 140.999 -42.044  21.908  1.00 52.87  ? 192 ARG A NE    1 
ATOM   1563  C CZ    . ARG A 1 192 ? 141.287 -40.763  21.713  1.00 52.66  ? 192 ARG A CZ    1 
ATOM   1564  N NH1   . ARG A 1 192 ? 142.479 -40.409  21.269  1.00 53.52  ? 192 ARG A NH1   1 
ATOM   1565  N NH2   . ARG A 1 192 ? 140.386 -39.826  21.950  1.00 52.49  ? 192 ARG A NH2   1 
ATOM   1566  N N     . GLY A 1 193 ? 140.039 -43.999  26.996  1.00 61.47  ? 193 GLY A N     1 
ATOM   1567  C CA    . GLY A 1 193 ? 141.105 -44.663  27.713  1.00 61.87  ? 193 GLY A CA    1 
ATOM   1568  C C     . GLY A 1 193 ? 140.705 -45.153  29.081  1.00 62.24  ? 193 GLY A C     1 
ATOM   1569  O O     . GLY A 1 193 ? 141.575 -45.458  29.882  1.00 62.94  ? 193 GLY A O     1 
ATOM   1570  N N     . PHE A 1 194 ? 139.403 -45.208  29.361  1.00 62.20  ? 194 PHE A N     1 
ATOM   1571  C CA    . PHE A 1 194 ? 138.911 -45.696  30.647  1.00 63.09  ? 194 PHE A CA    1 
ATOM   1572  C C     . PHE A 1 194 ? 138.132 -46.970  30.490  1.00 64.41  ? 194 PHE A C     1 
ATOM   1573  O O     . PHE A 1 194 ? 137.569 -47.471  31.466  1.00 65.21  ? 194 PHE A O     1 
ATOM   1574  C CB    . PHE A 1 194 ? 137.992 -44.698  31.346  1.00 62.46  ? 194 PHE A CB    1 
ATOM   1575  C CG    . PHE A 1 194 ? 138.661 -43.445  31.779  1.00 61.32  ? 194 PHE A CG    1 
ATOM   1576  C CD1   . PHE A 1 194 ? 140.037 -43.390  31.964  1.00 60.93  ? 194 PHE A CD1   1 
ATOM   1577  C CD2   . PHE A 1 194 ? 137.903 -42.315  32.031  1.00 60.46  ? 194 PHE A CD2   1 
ATOM   1578  C CE1   . PHE A 1 194 ? 140.656 -42.217  32.363  1.00 61.21  ? 194 PHE A CE1   1 
ATOM   1579  C CE2   . PHE A 1 194 ? 138.510 -41.133  32.438  1.00 61.84  ? 194 PHE A CE2   1 
ATOM   1580  C CZ    . PHE A 1 194 ? 139.898 -41.085  32.603  1.00 61.45  ? 194 PHE A CZ    1 
ATOM   1581  N N     . LEU A 1 195 ? 138.063 -47.478  29.263  1.00 65.55  ? 195 LEU A N     1 
ATOM   1582  C CA    . LEU A 1 195 ? 137.388 -48.750  28.988  1.00 66.86  ? 195 LEU A CA    1 
ATOM   1583  C C     . LEU A 1 195 ? 138.160 -49.876  29.646  1.00 68.39  ? 195 LEU A C     1 
ATOM   1584  O O     . LEU A 1 195 ? 139.395 -49.875  29.625  1.00 68.51  ? 195 LEU A O     1 
ATOM   1585  C CB    . LEU A 1 195 ? 137.309 -49.010  27.478  1.00 66.62  ? 195 LEU A CB    1 
ATOM   1586  C CG    . LEU A 1 195 ? 136.393 -48.176  26.582  1.00 65.76  ? 195 LEU A CG    1 
ATOM   1587  C CD1   . LEU A 1 195 ? 136.822 -48.329  25.144  1.00 66.42  ? 195 LEU A CD1   1 
ATOM   1588  C CD2   . LEU A 1 195 ? 134.970 -48.621  26.720  1.00 65.56  ? 195 LEU A CD2   1 
ATOM   1589  N N     . THR A 1 196 ? 137.452 -50.832  30.240  1.00 69.98  ? 196 THR A N     1 
ATOM   1590  C CA    . THR A 1 196 ? 138.154 -52.011  30.749  1.00 72.04  ? 196 THR A CA    1 
ATOM   1591  C C     . THR A 1 196 ? 137.438 -53.345  30.548  1.00 73.25  ? 196 THR A C     1 
ATOM   1592  O O     . THR A 1 196 ? 136.203 -53.392  30.485  1.00 73.20  ? 196 THR A O     1 
ATOM   1593  C CB    . THR A 1 196 ? 138.605 -51.844  32.203  1.00 72.76  ? 196 THR A CB    1 
ATOM   1594  O OG1   . THR A 1 196 ? 138.206 -50.555  32.697  1.00 71.51  ? 196 THR A OG1   1 
ATOM   1595  C CG2   . THR A 1 196 ? 140.144 -52.013  32.269  1.00 73.41  ? 196 THR A CG2   1 
ATOM   1596  N N     . ILE A 1 197 ? 138.242 -54.413  30.461  1.00 74.69  ? 197 ILE A N     1 
ATOM   1597  C CA    . ILE A 1 197 ? 137.806 -55.743  29.994  1.00 75.96  ? 197 ILE A CA    1 
ATOM   1598  C C     . ILE A 1 197 ? 136.583 -56.269  30.749  1.00 77.23  ? 197 ILE A C     1 
ATOM   1599  O O     . ILE A 1 197 ? 135.584 -56.647  30.143  1.00 77.35  ? 197 ILE A O     1 
ATOM   1600  C CB    . ILE A 1 197 ? 138.971 -56.806  30.029  1.00 76.66  ? 197 ILE A CB    1 
ATOM   1601  C CG1   . ILE A 1 197 ? 140.108 -56.449  29.065  1.00 75.73  ? 197 ILE A CG1   1 
ATOM   1602  C CG2   . ILE A 1 197 ? 138.468 -58.180  29.682  1.00 77.24  ? 197 ILE A CG2   1 
ATOM   1603  C CD1   . ILE A 1 197 ? 141.241 -55.622  29.696  1.00 75.44  ? 197 ILE A CD1   1 
ATOM   1604  N N     . ASP A 1 198 ? 136.657 -56.258  32.072  1.00 78.84  ? 198 ASP A N     1 
ATOM   1605  C CA    . ASP A 1 198 ? 135.661 -56.926  32.913  1.00 80.86  ? 198 ASP A CA    1 
ATOM   1606  C C     . ASP A 1 198 ? 134.374 -56.123  33.003  1.00 80.46  ? 198 ASP A C     1 
ATOM   1607  O O     . ASP A 1 198 ? 133.275 -56.684  33.000  1.00 81.10  ? 198 ASP A O     1 
ATOM   1608  C CB    . ASP A 1 198 ? 136.264 -57.220  34.290  1.00 82.09  ? 198 ASP A CB    1 
ATOM   1609  C CG    . ASP A 1 198 ? 137.738 -57.659  34.186  1.00 84.19  ? 198 ASP A CG    1 
ATOM   1610  O OD1   . ASP A 1 198 ? 138.012 -58.883  34.264  1.00 84.97  ? 198 ASP A OD1   1 
ATOM   1611  O OD2   . ASP A 1 198 ? 138.616 -56.773  33.973  1.00 85.50  ? 198 ASP A OD2   1 
ATOM   1612  N N     . SER A 1 199 ? 134.528 -54.803  33.056  1.00 79.98  ? 199 SER A N     1 
ATOM   1613  C CA    . SER A 1 199 ? 133.412 -53.869  32.967  1.00 79.21  ? 199 SER A CA    1 
ATOM   1614  C C     . SER A 1 199 ? 132.664 -54.057  31.649  1.00 78.81  ? 199 SER A C     1 
ATOM   1615  O O     . SER A 1 199 ? 131.459 -53.835  31.585  1.00 78.43  ? 199 SER A O     1 
ATOM   1616  C CB    . SER A 1 199 ? 133.900 -52.418  33.152  1.00 78.68  ? 199 SER A CB    1 
ATOM   1617  O OG    . SER A 1 199 ? 135.329 -52.301  33.074  1.00 78.47  ? 199 SER A OG    1 
ATOM   1618  N N     . LEU A 1 200 ? 133.387 -54.491  30.614  1.00 79.07  ? 200 LEU A N     1 
ATOM   1619  C CA    . LEU A 1 200 ? 132.791 -54.807  29.313  1.00 79.03  ? 200 LEU A CA    1 
ATOM   1620  C C     . LEU A 1 200 ? 132.235 -56.221  29.221  1.00 80.51  ? 200 LEU A C     1 
ATOM   1621  O O     . LEU A 1 200 ? 131.219 -56.427  28.565  1.00 80.65  ? 200 LEU A O     1 
ATOM   1622  C CB    . LEU A 1 200 ? 133.773 -54.565  28.171  1.00 78.34  ? 200 LEU A CB    1 
ATOM   1623  C CG    . LEU A 1 200 ? 133.861 -53.163  27.568  1.00 76.99  ? 200 LEU A CG    1 
ATOM   1624  C CD1   . LEU A 1 200 ? 134.915 -53.156  26.489  1.00 76.80  ? 200 LEU A CD1   1 
ATOM   1625  C CD2   . LEU A 1 200 ? 132.536 -52.674  26.997  1.00 75.69  ? 200 LEU A CD2   1 
ATOM   1626  N N     . LYS A 1 201 ? 132.896 -57.188  29.860  1.00 82.11  ? 201 LYS A N     1 
ATOM   1627  C CA    . LYS A 1 201 ? 132.379 -58.564  29.959  1.00 84.08  ? 201 LYS A CA    1 
ATOM   1628  C C     . LYS A 1 201 ? 130.995 -58.584  30.610  1.00 84.63  ? 201 LYS A C     1 
ATOM   1629  O O     . LYS A 1 201 ? 130.182 -59.475  30.352  1.00 85.30  ? 201 LYS A O     1 
ATOM   1630  C CB    . LYS A 1 201 ? 133.323 -59.447  30.789  1.00 85.44  ? 201 LYS A CB    1 
ATOM   1631  C CG    . LYS A 1 201 ? 134.558 -60.022  30.066  1.00 86.55  ? 201 LYS A CG    1 
ATOM   1632  C CD    . LYS A 1 201 ? 134.269 -61.326  29.299  1.00 89.22  ? 201 LYS A CD    1 
ATOM   1633  C CE    . LYS A 1 201 ? 133.877 -62.501  30.218  1.00 91.43  ? 201 LYS A CE    1 
ATOM   1634  N NZ    . LYS A 1 201 ? 135.007 -63.051  31.026  1.00 92.85  ? 201 LYS A NZ    1 
ATOM   1635  N N     . GLU A 1 202 ? 130.754 -57.580  31.451  1.00 84.69  ? 202 GLU A N     1 
ATOM   1636  C CA    . GLU A 1 202 ? 129.543 -57.429  32.257  1.00 85.31  ? 202 GLU A CA    1 
ATOM   1637  C C     . GLU A 1 202 ? 128.299 -57.068  31.431  1.00 84.65  ? 202 GLU A C     1 
ATOM   1638  O O     . GLU A 1 202 ? 127.178 -57.388  31.823  1.00 84.99  ? 202 GLU A O     1 
ATOM   1639  C CB    . GLU A 1 202 ? 129.813 -56.354  33.311  1.00 85.13  ? 202 GLU A CB    1 
ATOM   1640  C CG    . GLU A 1 202 ? 128.902 -56.332  34.527  1.00 86.51  ? 202 GLU A CG    1 
ATOM   1641  C CD    . GLU A 1 202 ? 129.343 -55.265  35.524  1.00 87.61  ? 202 GLU A CD    1 
ATOM   1642  O OE1   . GLU A 1 202 ? 130.303 -55.514  36.294  1.00 88.70  ? 202 GLU A OE1   1 
ATOM   1643  O OE2   . GLU A 1 202 ? 128.736 -54.170  35.527  1.00 87.11  ? 202 GLU A OE2   1 
ATOM   1644  N N     . LEU A 1 203 ? 128.499 -56.393  30.301  1.00 83.97  ? 203 LEU A N     1 
ATOM   1645  C CA    . LEU A 1 203 ? 127.398 -56.076  29.378  1.00 83.78  ? 203 LEU A CA    1 
ATOM   1646  C C     . LEU A 1 203 ? 126.907 -57.302  28.611  1.00 84.75  ? 203 LEU A C     1 
ATOM   1647  O O     . LEU A 1 203 ? 125.717 -57.418  28.293  1.00 85.10  ? 203 LEU A O     1 
ATOM   1648  C CB    . LEU A 1 203 ? 127.798 -54.978  28.378  1.00 82.67  ? 203 LEU A CB    1 
ATOM   1649  C CG    . LEU A 1 203 ? 128.010 -53.573  28.935  1.00 81.79  ? 203 LEU A CG    1 
ATOM   1650  C CD1   . LEU A 1 203 ? 128.352 -52.606  27.828  1.00 81.56  ? 203 LEU A CD1   1 
ATOM   1651  C CD2   . LEU A 1 203 ? 126.777 -53.101  29.684  1.00 81.71  ? 203 LEU A CD2   1 
ATOM   1652  N N     . GLY A 1 204 ? 127.835 -58.207  28.313  1.00 85.39  ? 204 GLY A N     1 
ATOM   1653  C CA    . GLY A 1 204 ? 127.530 -59.411  27.564  1.00 86.23  ? 204 GLY A CA    1 
ATOM   1654  C C     . GLY A 1 204 ? 128.476 -59.553  26.398  1.00 86.22  ? 204 GLY A C     1 
ATOM   1655  O O     . GLY A 1 204 ? 128.382 -60.506  25.633  1.00 87.06  ? 204 GLY A O     1 
ATOM   1656  N N     . PHE A 1 205 ? 129.396 -58.600  26.269  1.00 85.52  ? 205 PHE A N     1 
ATOM   1657  C CA    . PHE A 1 205 ? 130.348 -58.583  25.157  1.00 85.55  ? 205 PHE A CA    1 
ATOM   1658  C C     . PHE A 1 205 ? 131.252 -59.809  25.167  1.00 86.79  ? 205 PHE A C     1 
ATOM   1659  O O     . PHE A 1 205 ? 131.914 -60.109  26.165  1.00 87.08  ? 205 PHE A O     1 
ATOM   1660  C CB    . PHE A 1 205 ? 131.181 -57.288  25.139  1.00 84.35  ? 205 PHE A CB    1 
ATOM   1661  C CG    . PHE A 1 205 ? 130.424 -56.083  24.649  1.00 83.21  ? 205 PHE A CG    1 
ATOM   1662  C CD1   . PHE A 1 205 ? 130.220 -54.987  25.479  1.00 82.58  ? 205 PHE A CD1   1 
ATOM   1663  C CD2   . PHE A 1 205 ? 129.897 -56.050  23.360  1.00 83.29  ? 205 PHE A CD2   1 
ATOM   1664  C CE1   . PHE A 1 205 ? 129.512 -53.868  25.023  1.00 81.69  ? 205 PHE A CE1   1 
ATOM   1665  C CE2   . PHE A 1 205 ? 129.182 -54.941  22.899  1.00 82.15  ? 205 PHE A CE2   1 
ATOM   1666  C CZ    . PHE A 1 205 ? 128.992 -53.848  23.732  1.00 81.39  ? 205 PHE A CZ    1 
ATOM   1667  N N     . ASN A 1 206 ? 131.254 -60.521  24.048  1.00 87.60  ? 206 ASN A N     1 
ATOM   1668  C CA    . ASN A 1 206 ? 132.083 -61.699  23.914  1.00 89.11  ? 206 ASN A CA    1 
ATOM   1669  C C     . ASN A 1 206 ? 133.561 -61.338  23.850  1.00 88.85  ? 206 ASN A C     1 
ATOM   1670  O O     . ASN A 1 206 ? 133.947 -60.300  23.303  1.00 87.74  ? 206 ASN A O     1 
ATOM   1671  C CB    . ASN A 1 206 ? 131.658 -62.551  22.710  1.00 90.17  ? 206 ASN A CB    1 
ATOM   1672  C CG    . ASN A 1 206 ? 132.062 -61.938  21.375  1.00 90.18  ? 206 ASN A CG    1 
ATOM   1673  O OD1   . ASN A 1 206 ? 131.380 -61.059  20.842  1.00 90.34  ? 206 ASN A OD1   1 
ATOM   1674  N ND2   . ASN A 1 206 ? 133.164 -62.422  20.819  1.00 90.96  ? 206 ASN A ND2   1 
ATOM   1675  N N     . GLU A 1 207 ? 134.364 -62.206  24.451  1.00 89.98  ? 207 GLU A N     1 
ATOM   1676  C CA    . GLU A 1 207 ? 135.817 -62.140  24.425  1.00 90.21  ? 207 GLU A CA    1 
ATOM   1677  C C     . GLU A 1 207 ? 136.399 -61.348  23.249  1.00 89.17  ? 207 GLU A C     1 
ATOM   1678  O O     . GLU A 1 207 ? 137.183 -60.419  23.446  1.00 88.30  ? 207 GLU A O     1 
ATOM   1679  C CB    . GLU A 1 207 ? 136.359 -63.575  24.411  1.00 92.19  ? 207 GLU A CB    1 
ATOM   1680  C CG    . GLU A 1 207 ? 137.875 -63.706  24.561  1.00 93.50  ? 207 GLU A CG    1 
ATOM   1681  C CD    . GLU A 1 207 ? 138.365 -63.524  25.992  1.00 94.78  ? 207 GLU A CD    1 
ATOM   1682  O OE1   . GLU A 1 207 ? 139.597 -63.626  26.192  1.00 94.91  ? 207 GLU A OE1   1 
ATOM   1683  O OE2   . GLU A 1 207 ? 137.537 -63.283  26.910  1.00 95.39  ? 207 GLU A OE2   1 
ATOM   1684  N N     . GLN A 1 208 ? 136.004 -61.718  22.035  1.00 89.41  ? 208 GLN A N     1 
ATOM   1685  C CA    . GLN A 1 208 ? 136.617 -61.178  20.822  1.00 89.06  ? 208 GLN A CA    1 
ATOM   1686  C C     . GLN A 1 208 ? 136.314 -59.705  20.607  1.00 87.12  ? 208 GLN A C     1 
ATOM   1687  O O     . GLN A 1 208 ? 137.197 -58.961  20.172  1.00 86.72  ? 208 GLN A O     1 
ATOM   1688  C CB    . GLN A 1 208 ? 136.183 -61.963  19.583  1.00 90.35  ? 208 GLN A CB    1 
ATOM   1689  C CG    . GLN A 1 208 ? 136.467 -63.465  19.624  1.00 93.89  ? 208 GLN A CG    1 
ATOM   1690  C CD    . GLN A 1 208 ? 135.386 -64.287  18.903  1.00 97.70  ? 208 GLN A CD    1 
ATOM   1691  O OE1   . GLN A 1 208 ? 134.967 -63.961  17.781  1.00 98.25  ? 208 GLN A OE1   1 
ATOM   1692  N NE2   . GLN A 1 208 ? 134.924 -65.355  19.557  1.00 99.66  ? 208 GLN A NE2   1 
ATOM   1693  N N     . ARG A 1 209 ? 135.076 -59.291  20.907  1.00 85.82  ? 209 ARG A N     1 
ATOM   1694  C CA    . ARG A 1 209 ? 134.639 -57.911  20.657  1.00 83.62  ? 209 ARG A CA    1 
ATOM   1695  C C     . ARG A 1 209 ? 135.325 -56.929  21.607  1.00 81.58  ? 209 ARG A C     1 
ATOM   1696  O O     . ARG A 1 209 ? 135.794 -55.863  21.185  1.00 80.23  ? 209 ARG A O     1 
ATOM   1697  C CB    . ARG A 1 209 ? 133.109 -57.779  20.724  1.00 83.67  ? 209 ARG A CB    1 
ATOM   1698  C CG    . ARG A 1 209 ? 132.537 -56.845  19.647  1.00 84.48  ? 209 ARG A CG    1 
ATOM   1699  C CD    . ARG A 1 209 ? 131.233 -56.187  20.083  1.00 87.15  ? 209 ARG A CD    1 
ATOM   1700  N NE    . ARG A 1 209 ? 130.140 -57.147  20.263  1.00 90.49  ? 209 ARG A NE    1 
ATOM   1701  C CZ    . ARG A 1 209 ? 128.924 -57.027  19.728  1.00 91.49  ? 209 ARG A CZ    1 
ATOM   1702  N NH1   . ARG A 1 209 ? 128.627 -55.973  18.980  1.00 91.09  ? 209 ARG A NH1   1 
ATOM   1703  N NH2   . ARG A 1 209 ? 128.000 -57.960  19.952  1.00 92.82  ? 209 ARG A NH2   1 
ATOM   1704  N N     . ILE A 1 210 ? 135.406 -57.307  22.880  1.00 80.69  ? 210 ILE A N     1 
ATOM   1705  C CA    . ILE A 1 210 ? 136.092 -56.489  23.868  1.00 79.35  ? 210 ILE A CA    1 
ATOM   1706  C C     . ILE A 1 210 ? 137.442 -56.045  23.320  1.00 78.95  ? 210 ILE A C     1 
ATOM   1707  O O     . ILE A 1 210 ? 137.789 -54.862  23.390  1.00 78.14  ? 210 ILE A O     1 
ATOM   1708  C CB    . ILE A 1 210 ? 136.258 -57.223  25.206  1.00 79.71  ? 210 ILE A CB    1 
ATOM   1709  C CG1   . ILE A 1 210 ? 134.882 -57.515  25.804  1.00 79.12  ? 210 ILE A CG1   1 
ATOM   1710  C CG2   . ILE A 1 210 ? 137.092 -56.388  26.167  1.00 79.18  ? 210 ILE A CG2   1 
ATOM   1711  C CD1   . ILE A 1 210 ? 134.898 -58.409  27.009  1.00 78.75  ? 210 ILE A CD1   1 
ATOM   1712  N N     . ASN A 1 211 ? 138.172 -57.000  22.742  1.00 79.53  ? 211 ASN A N     1 
ATOM   1713  C CA    . ASN A 1 211 ? 139.496 -56.760  22.159  1.00 79.00  ? 211 ASN A CA    1 
ATOM   1714  C C     . ASN A 1 211 ? 139.493 -55.801  20.983  1.00 77.63  ? 211 ASN A C     1 
ATOM   1715  O O     . ASN A 1 211 ? 140.395 -54.980  20.857  1.00 77.06  ? 211 ASN A O     1 
ATOM   1716  C CB    . ASN A 1 211 ? 140.151 -58.080  21.753  1.00 80.45  ? 211 ASN A CB    1 
ATOM   1717  C CG    . ASN A 1 211 ? 140.562 -58.915  22.949  1.00 81.74  ? 211 ASN A CG    1 
ATOM   1718  O OD1   . ASN A 1 211 ? 141.270 -58.445  23.845  1.00 81.48  ? 211 ASN A OD1   1 
ATOM   1719  N ND2   . ASN A 1 211 ? 140.115 -60.162  22.973  1.00 83.75  ? 211 ASN A ND2   1 
ATOM   1720  N N     . ARG A 1 212 ? 138.478 -55.901  20.132  1.00 77.04  ? 212 ARG A N     1 
ATOM   1721  C CA    . ARG A 1 212 ? 138.390 -55.025  18.973  1.00 76.02  ? 212 ARG A CA    1 
ATOM   1722  C C     . ARG A 1 212 ? 138.112 -53.598  19.425  1.00 74.25  ? 212 ARG A C     1 
ATOM   1723  O O     . ARG A 1 212 ? 138.720 -52.668  18.902  1.00 74.03  ? 212 ARG A O     1 
ATOM   1724  C CB    . ARG A 1 212 ? 137.322 -55.508  17.994  1.00 76.59  ? 212 ARG A CB    1 
ATOM   1725  C CG    . ARG A 1 212 ? 137.602 -55.172  16.533  1.00 77.69  ? 212 ARG A CG    1 
ATOM   1726  C CD    . ARG A 1 212 ? 136.433 -55.606  15.628  1.00 80.89  ? 212 ARG A CD    1 
ATOM   1727  N NE    . ARG A 1 212 ? 135.829 -56.878  16.057  1.00 83.84  ? 212 ARG A NE    1 
ATOM   1728  C CZ    . ARG A 1 212 ? 134.693 -57.389  15.577  1.00 85.54  ? 212 ARG A CZ    1 
ATOM   1729  N NH1   . ARG A 1 212 ? 134.017 -56.741  14.635  1.00 86.45  ? 212 ARG A NH1   1 
ATOM   1730  N NH2   . ARG A 1 212 ? 134.225 -58.552  16.039  1.00 85.59  ? 212 ARG A NH2   1 
ATOM   1731  N N     . ILE A 1 213 ? 137.214 -53.435  20.401  1.00 72.93  ? 213 ILE A N     1 
ATOM   1732  C CA    . ILE A 1 213 ? 136.881 -52.121  20.959  1.00 70.90  ? 213 ILE A CA    1 
ATOM   1733  C C     . ILE A 1 213 ? 138.113 -51.455  21.585  1.00 70.44  ? 213 ILE A C     1 
ATOM   1734  O O     . ILE A 1 213 ? 138.417 -50.293  21.273  1.00 69.78  ? 213 ILE A O     1 
ATOM   1735  C CB    . ILE A 1 213 ? 135.763 -52.212  22.017  1.00 70.51  ? 213 ILE A CB    1 
ATOM   1736  C CG1   . ILE A 1 213 ? 134.460 -52.724  21.400  1.00 70.27  ? 213 ILE A CG1   1 
ATOM   1737  C CG2   . ILE A 1 213 ? 135.536 -50.867  22.655  1.00 69.30  ? 213 ILE A CG2   1 
ATOM   1738  C CD1   . ILE A 1 213 ? 133.455 -53.266  22.430  1.00 69.14  ? 213 ILE A CD1   1 
ATOM   1739  N N     . LEU A 1 214 ? 138.816 -52.196  22.453  1.00 70.39  ? 214 LEU A N     1 
ATOM   1740  C CA    . LEU A 1 214 ? 140.003 -51.689  23.148  1.00 69.63  ? 214 LEU A CA    1 
ATOM   1741  C C     . LEU A 1 214 ? 141.130 -51.305  22.203  1.00 69.62  ? 214 LEU A C     1 
ATOM   1742  O O     . LEU A 1 214 ? 141.775 -50.283  22.401  1.00 68.93  ? 214 LEU A O     1 
ATOM   1743  C CB    . LEU A 1 214 ? 140.513 -52.694  24.178  1.00 70.16  ? 214 LEU A CB    1 
ATOM   1744  C CG    . LEU A 1 214 ? 139.652 -53.000  25.403  1.00 69.88  ? 214 LEU A CG    1 
ATOM   1745  C CD1   . LEU A 1 214 ? 140.385 -53.965  26.313  1.00 69.31  ? 214 LEU A CD1   1 
ATOM   1746  C CD2   . LEU A 1 214 ? 139.277 -51.748  26.172  1.00 69.63  ? 214 LEU A CD2   1 
ATOM   1747  N N     . ASP A 1 215 ? 141.361 -52.120  21.178  1.00 70.57  ? 215 ASP A N     1 
ATOM   1748  C CA    . ASP A 1 215 ? 142.374 -51.810  20.169  1.00 71.33  ? 215 ASP A CA    1 
ATOM   1749  C C     . ASP A 1 215 ? 141.981 -50.589  19.332  1.00 70.91  ? 215 ASP A C     1 
ATOM   1750  O O     . ASP A 1 215 ? 142.842 -49.810  18.907  1.00 70.57  ? 215 ASP A O     1 
ATOM   1751  C CB    . ASP A 1 215 ? 142.639 -53.013  19.260  1.00 72.40  ? 215 ASP A CB    1 
ATOM   1752  C CG    . ASP A 1 215 ? 143.839 -52.799  18.332  1.00 74.02  ? 215 ASP A CG    1 
ATOM   1753  O OD1   . ASP A 1 215 ? 143.658 -52.804  17.090  1.00 77.37  ? 215 ASP A OD1   1 
ATOM   1754  O OD2   . ASP A 1 215 ? 144.966 -52.608  18.837  1.00 74.31  ? 215 ASP A OD2   1 
ATOM   1755  N N     . ALA A 1 216 ? 140.676 -50.440  19.100  1.00 71.08  ? 216 ALA A N     1 
ATOM   1756  C CA    . ALA A 1 216 ? 140.125 -49.301  18.388  1.00 70.87  ? 216 ALA A CA    1 
ATOM   1757  C C     . ALA A 1 216 ? 140.365 -48.028  19.173  1.00 70.68  ? 216 ALA A C     1 
ATOM   1758  O O     . ALA A 1 216 ? 140.660 -46.986  18.582  1.00 71.01  ? 216 ALA A O     1 
ATOM   1759  C CB    . ALA A 1 216 ? 138.648 -49.489  18.146  1.00 70.72  ? 216 ALA A CB    1 
ATOM   1760  N N     . ALA A 1 217 ? 140.244 -48.121  20.500  1.00 70.63  ? 217 ALA A N     1 
ATOM   1761  C CA    . ALA A 1 217 ? 140.444 -46.976  21.388  1.00 70.11  ? 217 ALA A CA    1 
ATOM   1762  C C     . ALA A 1 217 ? 141.905 -46.597  21.501  1.00 70.30  ? 217 ALA A C     1 
ATOM   1763  O O     . ALA A 1 217 ? 142.230 -45.432  21.606  1.00 70.08  ? 217 ALA A O     1 
ATOM   1764  C CB    . ALA A 1 217 ? 139.870 -47.263  22.760  1.00 70.12  ? 217 ALA A CB    1 
ATOM   1765  N N     . LYS A 1 218 ? 142.780 -47.594  21.501  1.00 71.35  ? 218 LYS A N     1 
ATOM   1766  C CA    . LYS A 1 218 ? 144.219 -47.370  21.548  1.00 71.91  ? 218 LYS A CA    1 
ATOM   1767  C C     . LYS A 1 218 ? 144.688 -46.621  20.295  1.00 71.72  ? 218 LYS A C     1 
ATOM   1768  O O     . LYS A 1 218 ? 145.346 -45.590  20.386  1.00 71.30  ? 218 LYS A O     1 
ATOM   1769  C CB    . LYS A 1 218 ? 144.955 -48.715  21.708  1.00 72.87  ? 218 LYS A CB    1 
ATOM   1770  C CG    . LYS A 1 218 ? 146.489 -48.669  21.556  1.00 74.16  ? 218 LYS A CG    1 
ATOM   1771  C CD    . LYS A 1 218 ? 147.167 -49.863  22.228  1.00 76.20  ? 218 LYS A CD    1 
ATOM   1772  C CE    . LYS A 1 218 ? 147.215 -49.679  23.750  1.00 77.05  ? 218 LYS A CE    1 
ATOM   1773  N NZ    . LYS A 1 218 ? 147.791 -50.851  24.482  1.00 78.51  ? 218 LYS A NZ    1 
ATOM   1774  N N     . LYS A 1 219 ? 144.328 -47.141  19.130  1.00 72.10  ? 219 LYS A N     1 
ATOM   1775  C CA    . LYS A 1 219 ? 144.793 -46.584  17.879  1.00 72.55  ? 219 LYS A CA    1 
ATOM   1776  C C     . LYS A 1 219 ? 143.869 -45.473  17.377  1.00 71.95  ? 219 LYS A C     1 
ATOM   1777  O O     . LYS A 1 219 ? 143.975 -45.045  16.223  1.00 72.28  ? 219 LYS A O     1 
ATOM   1778  C CB    . LYS A 1 219 ? 144.907 -47.684  16.822  1.00 73.59  ? 219 LYS A CB    1 
ATOM   1779  C CG    . LYS A 1 219 ? 145.861 -48.827  17.145  1.00 76.10  ? 219 LYS A CG    1 
ATOM   1780  C CD    . LYS A 1 219 ? 146.091 -49.687  15.885  1.00 81.10  ? 219 LYS A CD    1 
ATOM   1781  C CE    . LYS A 1 219 ? 146.560 -51.121  16.206  1.00 84.06  ? 219 LYS A CE    1 
ATOM   1782  N NZ    . LYS A 1 219 ? 147.975 -51.192  16.707  1.00 85.53  ? 219 LYS A NZ    1 
ATOM   1783  N N     . SER A 1 220 ? 142.975 -45.000  18.244  1.00 71.17  ? 220 SER A N     1 
ATOM   1784  C CA    . SER A 1 220 ? 141.932 -44.047  17.841  1.00 70.65  ? 220 SER A CA    1 
ATOM   1785  C C     . SER A 1 220 ? 142.489 -42.730  17.302  1.00 70.44  ? 220 SER A C     1 
ATOM   1786  O O     . SER A 1 220 ? 143.413 -42.159  17.885  1.00 70.65  ? 220 SER A O     1 
ATOM   1787  C CB    . SER A 1 220 ? 140.982 -43.776  19.006  1.00 70.04  ? 220 SER A CB    1 
ATOM   1788  O OG    . SER A 1 220 ? 139.976 -42.856  18.638  1.00 69.96  ? 220 SER A OG    1 
ATOM   1789  N N     . ILE A 1 221 ? 141.928 -42.263  16.187  1.00 70.03  ? 221 ILE A N     1 
ATOM   1790  C CA    . ILE A 1 221 ? 142.285 -40.960  15.632  1.00 69.63  ? 221 ILE A CA    1 
ATOM   1791  C C     . ILE A 1 221 ? 141.293 -39.889  16.088  1.00 68.83  ? 221 ILE A C     1 
ATOM   1792  O O     . ILE A 1 221 ? 141.050 -38.904  15.381  1.00 69.32  ? 221 ILE A O     1 
ATOM   1793  C CB    . ILE A 1 221 ? 142.406 -40.987  14.079  1.00 70.27  ? 221 ILE A CB    1 
ATOM   1794  C CG1   . ILE A 1 221 ? 141.205 -41.706  13.435  1.00 70.83  ? 221 ILE A CG1   1 
ATOM   1795  C CG2   . ILE A 1 221 ? 143.724 -41.629  13.679  1.00 71.07  ? 221 ILE A CG2   1 
ATOM   1796  C CD1   . ILE A 1 221 ? 140.894 -41.305  11.992  1.00 70.85  ? 221 ILE A CD1   1 
ATOM   1797  N N     . GLY A 1 222 ? 140.722 -40.095  17.272  1.00 67.76  ? 222 GLY A N     1 
ATOM   1798  C CA    . GLY A 1 222 ? 139.757 -39.165  17.848  1.00 66.82  ? 222 GLY A CA    1 
ATOM   1799  C C     . GLY A 1 222 ? 140.446 -38.030  18.570  1.00 66.50  ? 222 GLY A C     1 
ATOM   1800  O O     . GLY A 1 222 ? 141.676 -37.972  18.607  1.00 67.07  ? 222 GLY A O     1 
ATOM   1801  N N     . ALA A 1 223 ? 139.655 -37.135  19.156  1.00 65.90  ? 223 ALA A N     1 
ATOM   1802  C CA    . ALA A 1 223 ? 140.176 -35.924  19.796  1.00 65.49  ? 223 ALA A CA    1 
ATOM   1803  C C     . ALA A 1 223 ? 140.399 -36.085  21.292  1.00 65.20  ? 223 ALA A C     1 
ATOM   1804  O O     . ALA A 1 223 ? 139.586 -36.695  21.991  1.00 64.78  ? 223 ALA A O     1 
ATOM   1805  C CB    . ALA A 1 223 ? 139.241 -34.764  19.543  1.00 65.43  ? 223 ALA A CB    1 
ATOM   1806  N N     . ASP A 1 224 ? 141.506 -35.529  21.778  1.00 65.33  ? 224 ASP A N     1 
ATOM   1807  C CA    . ASP A 1 224 ? 141.754 -35.441  23.214  1.00 65.35  ? 224 ASP A CA    1 
ATOM   1808  C C     . ASP A 1 224 ? 141.007 -34.235  23.772  1.00 64.93  ? 224 ASP A C     1 
ATOM   1809  O O     . ASP A 1 224 ? 141.122 -33.109  23.272  1.00 64.98  ? 224 ASP A O     1 
ATOM   1810  C CB    . ASP A 1 224 ? 143.254 -35.406  23.538  1.00 66.09  ? 224 ASP A CB    1 
ATOM   1811  C CG    . ASP A 1 224 ? 143.886 -36.832  23.652  1.00 68.13  ? 224 ASP A CG    1 
ATOM   1812  O OD1   . ASP A 1 224 ? 143.548 -37.762  22.860  1.00 67.93  ? 224 ASP A OD1   1 
ATOM   1813  O OD2   . ASP A 1 224 ? 144.749 -37.010  24.549  1.00 70.33  ? 224 ASP A OD2   1 
ATOM   1814  N N     . ILE A 1 225 ? 140.242 -34.497  24.825  1.00 64.18  ? 225 ILE A N     1 
ATOM   1815  C CA    . ILE A 1 225 ? 139.136 -33.656  25.221  1.00 63.02  ? 225 ILE A CA    1 
ATOM   1816  C C     . ILE A 1 225 ? 139.031 -33.606  26.738  1.00 62.83  ? 225 ILE A C     1 
ATOM   1817  O O     . ILE A 1 225 ? 139.456 -34.541  27.424  1.00 62.69  ? 225 ILE A O     1 
ATOM   1818  C CB    . ILE A 1 225 ? 137.872 -34.193  24.524  1.00 62.58  ? 225 ILE A CB    1 
ATOM   1819  C CG1   . ILE A 1 225 ? 137.460 -33.216  23.449  1.00 63.01  ? 225 ILE A CG1   1 
ATOM   1820  C CG2   . ILE A 1 225 ? 136.726 -34.489  25.478  1.00 62.35  ? 225 ILE A CG2   1 
ATOM   1821  C CD1   . ILE A 1 225 ? 136.534 -33.810  22.445  1.00 65.47  ? 225 ILE A CD1   1 
ATOM   1822  N N     . SER A 1 226 ? 138.480 -32.508  27.257  1.00 62.68  ? 226 SER A N     1 
ATOM   1823  C CA    . SER A 1 226 ? 138.391 -32.286  28.705  1.00 62.68  ? 226 SER A CA    1 
ATOM   1824  C C     . SER A 1 226 ? 137.303 -33.127  29.374  1.00 62.36  ? 226 SER A C     1 
ATOM   1825  O O     . SER A 1 226 ? 136.457 -33.717  28.695  1.00 61.93  ? 226 SER A O     1 
ATOM   1826  C CB    . SER A 1 226 ? 138.178 -30.803  29.010  1.00 62.96  ? 226 SER A CB    1 
ATOM   1827  O OG    . SER A 1 226 ? 136.812 -30.462  28.908  1.00 62.58  ? 226 SER A OG    1 
ATOM   1828  N N     . GLU A 1 227 ? 137.331 -33.194  30.704  1.00 62.60  ? 227 GLU A N     1 
ATOM   1829  C CA    . GLU A 1 227 ? 136.268 -33.885  31.430  1.00 62.51  ? 227 GLU A CA    1 
ATOM   1830  C C     . GLU A 1 227 ? 134.968 -33.094  31.398  1.00 62.08  ? 227 GLU A C     1 
ATOM   1831  O O     . GLU A 1 227 ? 133.898 -33.674  31.498  1.00 62.12  ? 227 GLU A O     1 
ATOM   1832  C CB    . GLU A 1 227 ? 136.657 -34.215  32.870  1.00 63.13  ? 227 GLU A CB    1 
ATOM   1833  C CG    . GLU A 1 227 ? 137.577 -35.415  33.007  1.00 64.83  ? 227 GLU A CG    1 
ATOM   1834  C CD    . GLU A 1 227 ? 136.917 -36.754  32.649  1.00 66.96  ? 227 GLU A CD    1 
ATOM   1835  O OE1   . GLU A 1 227 ? 137.489 -37.499  31.805  1.00 67.88  ? 227 GLU A OE1   1 
ATOM   1836  O OE2   . GLU A 1 227 ? 135.842 -37.069  33.219  1.00 66.75  ? 227 GLU A OE2   1 
ATOM   1837  N N     . ASP A 1 228 ? 135.052 -31.777  31.249  1.00 61.83  ? 228 ASP A N     1 
ATOM   1838  C CA    . ASP A 1 228 ? 133.852 -30.985  31.073  1.00 61.47  ? 228 ASP A CA    1 
ATOM   1839  C C     . ASP A 1 228 ? 133.137 -31.436  29.814  1.00 60.18  ? 228 ASP A C     1 
ATOM   1840  O O     . ASP A 1 228 ? 131.940 -31.695  29.840  1.00 60.14  ? 228 ASP A O     1 
ATOM   1841  C CB    . ASP A 1 228 ? 134.171 -29.493  30.997  1.00 62.53  ? 228 ASP A CB    1 
ATOM   1842  C CG    . ASP A 1 228 ? 134.445 -28.879  32.359  1.00 65.13  ? 228 ASP A CG    1 
ATOM   1843  O OD1   . ASP A 1 228 ? 133.798 -29.276  33.356  1.00 68.02  ? 228 ASP A OD1   1 
ATOM   1844  O OD2   . ASP A 1 228 ? 135.317 -27.988  32.431  1.00 67.47  ? 228 ASP A OD2   1 
ATOM   1845  N N     . ASP A 1 229 ? 133.881 -31.554  28.720  1.00 59.18  ? 229 ASP A N     1 
ATOM   1846  C CA    . ASP A 1 229 ? 133.314 -31.966  27.441  1.00 58.03  ? 229 ASP A CA    1 
ATOM   1847  C C     . ASP A 1 229 ? 132.666 -33.354  27.484  1.00 57.41  ? 229 ASP A C     1 
ATOM   1848  O O     . ASP A 1 229 ? 131.599 -33.571  26.909  1.00 57.21  ? 229 ASP A O     1 
ATOM   1849  C CB    . ASP A 1 229 ? 134.385 -31.941  26.356  1.00 57.84  ? 229 ASP A CB    1 
ATOM   1850  C CG    . ASP A 1 229 ? 135.093 -30.612  26.260  1.00 58.00  ? 229 ASP A CG    1 
ATOM   1851  O OD1   . ASP A 1 229 ? 136.274 -30.616  25.855  1.00 57.76  ? 229 ASP A OD1   1 
ATOM   1852  O OD2   . ASP A 1 229 ? 134.483 -29.567  26.586  1.00 57.80  ? 229 ASP A OD2   1 
ATOM   1853  N N     . LEU A 1 230 ? 133.314 -34.294  28.156  1.00 57.07  ? 230 LEU A N     1 
ATOM   1854  C CA    . LEU A 1 230 ? 132.821 -35.658  28.183  1.00 56.49  ? 230 LEU A CA    1 
ATOM   1855  C C     . LEU A 1 230 ? 131.519 -35.800  28.976  1.00 56.44  ? 230 LEU A C     1 
ATOM   1856  O O     . LEU A 1 230 ? 130.578 -36.477  28.530  1.00 56.08  ? 230 LEU A O     1 
ATOM   1857  C CB    . LEU A 1 230 ? 133.892 -36.594  28.717  1.00 56.54  ? 230 LEU A CB    1 
ATOM   1858  C CG    . LEU A 1 230 ? 135.032 -36.908  27.754  1.00 56.53  ? 230 LEU A CG    1 
ATOM   1859  C CD1   . LEU A 1 230 ? 136.305 -37.187  28.541  1.00 57.93  ? 230 LEU A CD1   1 
ATOM   1860  C CD2   . LEU A 1 230 ? 134.683 -38.079  26.845  1.00 55.07  ? 230 LEU A CD2   1 
ATOM   1861  N N     . SER A 1 231 ? 131.446 -35.154  30.136  1.00 56.36  ? 231 SER A N     1 
ATOM   1862  C CA    . SER A 1 231 ? 130.238 -35.272  30.942  1.00 56.27  ? 231 SER A CA    1 
ATOM   1863  C C     . SER A 1 231 ? 129.037 -34.645  30.256  1.00 55.75  ? 231 SER A C     1 
ATOM   1864  O O     . SER A 1 231 ? 127.904 -35.102  30.455  1.00 55.60  ? 231 SER A O     1 
ATOM   1865  C CB    . SER A 1 231 ? 130.428 -34.727  32.349  1.00 56.72  ? 231 SER A CB    1 
ATOM   1866  O OG    . SER A 1 231 ? 131.548 -33.891  32.397  1.00 57.45  ? 231 SER A OG    1 
ATOM   1867  N N     . ALA A 1 232 ? 129.297 -33.634  29.427  1.00 55.30  ? 232 ALA A N     1 
ATOM   1868  C CA    . ALA A 1 232 ? 128.256 -33.018  28.607  1.00 54.76  ? 232 ALA A CA    1 
ATOM   1869  C C     . ALA A 1 232 ? 127.621 -34.063  27.706  1.00 54.28  ? 232 ALA A C     1 
ATOM   1870  O O     . ALA A 1 232 ? 126.390 -34.181  27.675  1.00 54.17  ? 232 ALA A O     1 
ATOM   1871  C CB    . ALA A 1 232 ? 128.821 -31.880  27.781  1.00 55.05  ? 232 ALA A CB    1 
ATOM   1872  N N     . MET A 1 233 ? 128.464 -34.822  26.990  1.00 53.77  ? 233 MET A N     1 
ATOM   1873  C CA    . MET A 1 233 ? 128.013 -35.955  26.174  1.00 53.07  ? 233 MET A CA    1 
ATOM   1874  C C     . MET A 1 233 ? 127.331 -37.016  27.046  1.00 53.35  ? 233 MET A C     1 
ATOM   1875  O O     . MET A 1 233 ? 126.268 -37.542  26.689  1.00 53.41  ? 233 MET A O     1 
ATOM   1876  C CB    . MET A 1 233 ? 129.171 -36.598  25.427  1.00 52.55  ? 233 MET A CB    1 
ATOM   1877  C CG    . MET A 1 233 ? 130.076 -35.653  24.671  1.00 51.91  ? 233 MET A CG    1 
ATOM   1878  S SD    . MET A 1 233 ? 131.573 -36.522  24.121  1.00 49.30  ? 233 MET A SD    1 
ATOM   1879  C CE    . MET A 1 233 ? 132.623 -35.175  23.607  1.00 49.59  ? 233 MET A CE    1 
ATOM   1880  N N     . ARG A 1 234 ? 127.925 -37.307  28.203  1.00 53.65  ? 234 ARG A N     1 
ATOM   1881  C CA    . ARG A 1 234 ? 127.388 -38.338  29.108  1.00 53.81  ? 234 ARG A CA    1 
ATOM   1882  C C     . ARG A 1 234 ? 125.981 -38.055  29.656  1.00 53.46  ? 234 ARG A C     1 
ATOM   1883  O O     . ARG A 1 234 ? 125.259 -38.984  30.029  1.00 52.73  ? 234 ARG A O     1 
ATOM   1884  C CB    . ARG A 1 234 ? 128.377 -38.625  30.237  1.00 54.45  ? 234 ARG A CB    1 
ATOM   1885  C CG    . ARG A 1 234 ? 129.725 -39.119  29.719  1.00 55.01  ? 234 ARG A CG    1 
ATOM   1886  C CD    . ARG A 1 234 ? 130.742 -39.217  30.827  1.00 55.96  ? 234 ARG A CD    1 
ATOM   1887  N NE    . ARG A 1 234 ? 130.715 -40.529  31.460  1.00 56.08  ? 234 ARG A NE    1 
ATOM   1888  C CZ    . ARG A 1 234 ? 131.479 -40.871  32.487  1.00 56.30  ? 234 ARG A CZ    1 
ATOM   1889  N NH1   . ARG A 1 234 ? 132.319 -39.988  33.008  1.00 55.93  ? 234 ARG A NH1   1 
ATOM   1890  N NH2   . ARG A 1 234 ? 131.396 -42.092  32.995  1.00 57.01  ? 234 ARG A NH2   1 
ATOM   1891  N N     . MET A 1 235 ? 125.591 -36.777  29.678  1.00 53.45  ? 235 MET A N     1 
ATOM   1892  C CA    . MET A 1 235 ? 124.223 -36.411  30.072  1.00 53.69  ? 235 MET A CA    1 
ATOM   1893  C C     . MET A 1 235 ? 123.213 -36.994  29.109  1.00 53.06  ? 235 MET A C     1 
ATOM   1894  O O     . MET A 1 235 ? 122.180 -37.508  29.545  1.00 53.47  ? 235 MET A O     1 
ATOM   1895  C CB    . MET A 1 235 ? 124.003 -34.904  30.151  1.00 53.81  ? 235 MET A CB    1 
ATOM   1896  C CG    . MET A 1 235 ? 125.101 -34.130  30.810  1.00 56.01  ? 235 MET A CG    1 
ATOM   1897  S SD    . MET A 1 235 ? 124.515 -32.513  31.327  1.00 59.93  ? 235 MET A SD    1 
ATOM   1898  C CE    . MET A 1 235 ? 124.225 -32.803  33.081  1.00 62.04  ? 235 MET A CE    1 
ATOM   1899  N N     . ILE A 1 236 ? 123.514 -36.915  27.811  1.00 52.12  ? 236 ILE A N     1 
ATOM   1900  C CA    . ILE A 1 236 ? 122.646 -37.472  26.791  1.00 51.54  ? 236 ILE A CA    1 
ATOM   1901  C C     . ILE A 1 236 ? 122.618 -38.997  26.913  1.00 51.62  ? 236 ILE A C     1 
ATOM   1902  O O     . ILE A 1 236 ? 121.544 -39.604  26.836  1.00 51.91  ? 236 ILE A O     1 
ATOM   1903  C CB    . ILE A 1 236 ? 123.032 -36.994  25.364  1.00 51.50  ? 236 ILE A CB    1 
ATOM   1904  C CG1   . ILE A 1 236 ? 122.359 -35.668  25.044  1.00 52.01  ? 236 ILE A CG1   1 
ATOM   1905  C CG2   . ILE A 1 236 ? 122.572 -37.976  24.286  1.00 51.35  ? 236 ILE A CG2   1 
ATOM   1906  C CD1   . ILE A 1 236 ? 123.048 -34.486  25.614  1.00 53.79  ? 236 ILE A CD1   1 
ATOM   1907  N N     . ALA A 1 237 ? 123.781 -39.610  27.143  1.00 51.36  ? 237 ALA A N     1 
ATOM   1908  C CA    . ALA A 1 237 ? 123.870 -41.065  27.273  1.00 51.02  ? 237 ALA A CA    1 
ATOM   1909  C C     . ALA A 1 237 ? 122.991 -41.587  28.397  1.00 51.04  ? 237 ALA A C     1 
ATOM   1910  O O     . ALA A 1 237 ? 122.292 -42.583  28.236  1.00 51.41  ? 237 ALA A O     1 
ATOM   1911  C CB    . ALA A 1 237 ? 125.296 -41.490  27.490  1.00 51.43  ? 237 ALA A CB    1 
ATOM   1912  N N     . ASN A 1 238 ? 123.010 -40.899  29.530  1.00 50.86  ? 238 ASN A N     1 
ATOM   1913  C CA    . ASN A 1 238 ? 122.217 -41.322  30.667  1.00 51.03  ? 238 ASN A CA    1 
ATOM   1914  C C     . ASN A 1 238 ? 120.733 -41.138  30.451  1.00 50.91  ? 238 ASN A C     1 
ATOM   1915  O O     . ASN A 1 238 ? 119.929 -41.908  30.975  1.00 51.17  ? 238 ASN A O     1 
ATOM   1916  C CB    . ASN A 1 238 ? 122.677 -40.605  31.927  1.00 51.36  ? 238 ASN A CB    1 
ATOM   1917  C CG    . ASN A 1 238 ? 124.070 -41.038  32.359  1.00 51.31  ? 238 ASN A CG    1 
ATOM   1918  O OD1   . ASN A 1 238 ? 124.462 -42.197  32.192  1.00 49.41  ? 238 ASN A OD1   1 
ATOM   1919  N ND2   . ASN A 1 238 ? 124.831 -40.097  32.898  1.00 51.81  ? 238 ASN A ND2   1 
ATOM   1920  N N     . THR A 1 239 ? 120.379 -40.123  29.666  1.00 50.66  ? 239 THR A N     1 
ATOM   1921  C CA    . THR A 1 239 ? 118.990 -39.882  29.301  1.00 50.55  ? 239 THR A CA    1 
ATOM   1922  C C     . THR A 1 239 ? 118.511 -40.972  28.369  1.00 50.80  ? 239 THR A C     1 
ATOM   1923  O O     . THR A 1 239 ? 117.382 -41.449  28.492  1.00 50.99  ? 239 THR A O     1 
ATOM   1924  C CB    . THR A 1 239 ? 118.817 -38.548  28.605  1.00 50.14  ? 239 THR A CB    1 
ATOM   1925  O OG1   . THR A 1 239 ? 119.508 -37.546  29.343  1.00 50.27  ? 239 THR A OG1   1 
ATOM   1926  C CG2   . THR A 1 239 ? 117.341 -38.177  28.521  1.00 50.73  ? 239 THR A CG2   1 
ATOM   1927  N N     . ILE A 1 240 ? 119.367 -41.369  27.435  1.00 50.93  ? 240 ILE A N     1 
ATOM   1928  C CA    . ILE A 1 240 ? 119.023 -42.454  26.545  1.00 51.71  ? 240 ILE A CA    1 
ATOM   1929  C C     . ILE A 1 240 ? 118.702 -43.685  27.388  1.00 52.84  ? 240 ILE A C     1 
ATOM   1930  O O     . ILE A 1 240 ? 117.619 -44.278  27.236  1.00 53.17  ? 240 ILE A O     1 
ATOM   1931  C CB    . ILE A 1 240 ? 120.122 -42.707  25.494  1.00 51.79  ? 240 ILE A CB    1 
ATOM   1932  C CG1   . ILE A 1 240 ? 120.120 -41.556  24.483  1.00 52.06  ? 240 ILE A CG1   1 
ATOM   1933  C CG2   . ILE A 1 240 ? 119.916 -44.049  24.776  1.00 51.28  ? 240 ILE A CG2   1 
ATOM   1934  C CD1   . ILE A 1 240 ? 121.388 -41.415  23.648  1.00 52.86  ? 240 ILE A CD1   1 
ATOM   1935  N N     . LEU A 1 241 ? 119.608 -44.032  28.306  1.00 53.45  ? 241 LEU A N     1 
ATOM   1936  C CA    . LEU A 1 241 ? 119.430 -45.227  29.113  1.00 54.55  ? 241 LEU A CA    1 
ATOM   1937  C C     . LEU A 1 241 ? 118.156 -45.162  29.932  1.00 55.57  ? 241 LEU A C     1 
ATOM   1938  O O     . LEU A 1 241 ? 117.364 -46.102  29.904  1.00 56.15  ? 241 LEU A O     1 
ATOM   1939  C CB    . LEU A 1 241 ? 120.659 -45.519  29.964  1.00 54.70  ? 241 LEU A CB    1 
ATOM   1940  C CG    . LEU A 1 241 ? 121.847 -46.003  29.119  1.00 54.62  ? 241 LEU A CG    1 
ATOM   1941  C CD1   . LEU A 1 241 ? 123.131 -45.994  29.917  1.00 53.99  ? 241 LEU A CD1   1 
ATOM   1942  C CD2   . LEU A 1 241 ? 121.590 -47.389  28.499  1.00 55.01  ? 241 LEU A CD2   1 
ATOM   1943  N N     . ASP A 1 242 ? 117.933 -44.042  30.617  1.00 56.48  ? 242 ASP A N     1 
ATOM   1944  C CA    . ASP A 1 242 ? 116.676 -43.815  31.342  1.00 57.92  ? 242 ASP A CA    1 
ATOM   1945  C C     . ASP A 1 242 ? 115.458 -44.165  30.494  1.00 58.07  ? 242 ASP A C     1 
ATOM   1946  O O     . ASP A 1 242 ? 114.585 -44.911  30.935  1.00 58.14  ? 242 ASP A O     1 
ATOM   1947  C CB    . ASP A 1 242 ? 116.552 -42.354  31.765  1.00 58.17  ? 242 ASP A CB    1 
ATOM   1948  C CG    . ASP A 1 242 ? 117.429 -42.003  32.934  1.00 61.29  ? 242 ASP A CG    1 
ATOM   1949  O OD1   . ASP A 1 242 ? 118.023 -42.933  33.547  1.00 65.14  ? 242 ASP A OD1   1 
ATOM   1950  O OD2   . ASP A 1 242 ? 117.517 -40.784  33.242  1.00 63.76  ? 242 ASP A OD2   1 
ATOM   1951  N N     . LEU A 1 243 ? 115.431 -43.616  29.275  1.00 58.25  ? 243 LEU A N     1 
ATOM   1952  C CA    . LEU A 1 243 ? 114.291 -43.710  28.369  1.00 58.59  ? 243 LEU A CA    1 
ATOM   1953  C C     . LEU A 1 243 ? 114.012 -45.144  27.946  1.00 59.52  ? 243 LEU A C     1 
ATOM   1954  O O     . LEU A 1 243 ? 112.851 -45.505  27.727  1.00 59.65  ? 243 LEU A O     1 
ATOM   1955  C CB    . LEU A 1 243 ? 114.502 -42.821  27.139  1.00 58.15  ? 243 LEU A CB    1 
ATOM   1956  C CG    . LEU A 1 243 ? 114.469 -41.294  27.315  1.00 57.74  ? 243 LEU A CG    1 
ATOM   1957  C CD1   . LEU A 1 243 ? 115.067 -40.619  26.093  1.00 57.68  ? 243 LEU A CD1   1 
ATOM   1958  C CD2   . LEU A 1 243 ? 113.065 -40.760  27.572  1.00 56.93  ? 243 LEU A CD2   1 
ATOM   1959  N N     . TYR A 1 244 ? 115.073 -45.952  27.836  1.00 60.27  ? 244 TYR A N     1 
ATOM   1960  C CA    . TYR A 1 244 ? 114.925 -47.373  27.527  1.00 61.30  ? 244 TYR A CA    1 
ATOM   1961  C C     . TYR A 1 244 ? 114.219 -48.122  28.650  1.00 62.64  ? 244 TYR A C     1 
ATOM   1962  O O     . TYR A 1 244 ? 113.425 -49.026  28.383  1.00 63.10  ? 244 TYR A O     1 
ATOM   1963  C CB    . TYR A 1 244 ? 116.269 -48.024  27.214  1.00 61.14  ? 244 TYR A CB    1 
ATOM   1964  C CG    . TYR A 1 244 ? 116.638 -47.984  25.753  1.00 59.97  ? 244 TYR A CG    1 
ATOM   1965  C CD1   . TYR A 1 244 ? 117.555 -47.052  25.279  1.00 58.86  ? 244 TYR A CD1   1 
ATOM   1966  C CD2   . TYR A 1 244 ? 116.072 -48.877  24.840  1.00 59.20  ? 244 TYR A CD2   1 
ATOM   1967  C CE1   . TYR A 1 244 ? 117.907 -47.012  23.932  1.00 58.45  ? 244 TYR A CE1   1 
ATOM   1968  C CE2   . TYR A 1 244 ? 116.412 -48.841  23.492  1.00 58.52  ? 244 TYR A CE2   1 
ATOM   1969  C CZ    . TYR A 1 244 ? 117.332 -47.903  23.048  1.00 58.12  ? 244 TYR A CZ    1 
ATOM   1970  O OH    . TYR A 1 244 ? 117.686 -47.832  21.725  1.00 57.20  ? 244 TYR A OH    1 
ATOM   1971  N N     . ASN A 1 245 ? 114.501 -47.740  29.896  1.00 63.66  ? 245 ASN A N     1 
ATOM   1972  C CA    . ASN A 1 245 ? 113.815 -48.332  31.045  1.00 65.36  ? 245 ASN A CA    1 
ATOM   1973  C C     . ASN A 1 245 ? 112.376 -47.889  31.095  1.00 65.42  ? 245 ASN A C     1 
ATOM   1974  O O     . ASN A 1 245 ? 111.483 -48.694  31.309  1.00 66.17  ? 245 ASN A O     1 
ATOM   1975  C CB    . ASN A 1 245 ? 114.520 -48.008  32.372  1.00 65.88  ? 245 ASN A CB    1 
ATOM   1976  C CG    . ASN A 1 245 ? 115.834 -48.774  32.541  1.00 67.62  ? 245 ASN A CG    1 
ATOM   1977  O OD1   . ASN A 1 245 ? 115.997 -49.899  32.045  1.00 68.51  ? 245 ASN A OD1   1 
ATOM   1978  N ND2   . ASN A 1 245 ? 116.779 -48.159  33.242  1.00 68.99  ? 245 ASN A ND2   1 
ATOM   1979  N N     . ILE A 1 246 ? 112.155 -46.602  30.880  1.00 65.43  ? 246 ILE A N     1 
ATOM   1980  C CA    . ILE A 1 246 ? 110.810 -46.062  30.862  1.00 66.01  ? 246 ILE A CA    1 
ATOM   1981  C C     . ILE A 1 246 ? 110.009 -46.739  29.751  1.00 66.58  ? 246 ILE A C     1 
ATOM   1982  O O     . ILE A 1 246 ? 108.836 -47.050  29.934  1.00 67.25  ? 246 ILE A O     1 
ATOM   1983  C CB    . ILE A 1 246 ? 110.821 -44.516  30.734  1.00 65.44  ? 246 ILE A CB    1 
ATOM   1984  C CG1   . ILE A 1 246 ? 111.444 -43.901  31.995  1.00 66.20  ? 246 ILE A CG1   1 
ATOM   1985  C CG2   . ILE A 1 246 ? 109.413 -43.959  30.516  1.00 65.08  ? 246 ILE A CG2   1 
ATOM   1986  C CD1   . ILE A 1 246 ? 111.873 -42.433  31.859  1.00 66.77  ? 246 ILE A CD1   1 
ATOM   1987  N N     . ARG A 1 247 ? 110.642 -47.005  28.616  1.00 66.91  ? 247 ARG A N     1 
ATOM   1988  C CA    . ARG A 1 247 ? 109.931 -47.654  27.526  1.00 67.92  ? 247 ARG A CA    1 
ATOM   1989  C C     . ARG A 1 247 ? 109.423 -49.037  27.916  1.00 68.77  ? 247 ARG A C     1 
ATOM   1990  O O     . ARG A 1 247 ? 108.245 -49.343  27.722  1.00 68.94  ? 247 ARG A O     1 
ATOM   1991  C CB    . ARG A 1 247 ? 110.789 -47.745  26.273  1.00 67.92  ? 247 ARG A CB    1 
ATOM   1992  C CG    . ARG A 1 247 ? 109.942 -47.835  25.032  1.00 70.61  ? 247 ARG A CG    1 
ATOM   1993  C CD    . ARG A 1 247 ? 110.779 -47.915  23.795  1.00 76.55  ? 247 ARG A CD    1 
ATOM   1994  N NE    . ARG A 1 247 ? 111.169 -49.291  23.494  1.00 82.31  ? 247 ARG A NE    1 
ATOM   1995  C CZ    . ARG A 1 247 ? 110.455 -50.132  22.745  1.00 86.07  ? 247 ARG A CZ    1 
ATOM   1996  N NH1   . ARG A 1 247 ? 109.296 -49.749  22.203  1.00 85.80  ? 247 ARG A NH1   1 
ATOM   1997  N NH2   . ARG A 1 247 ? 110.907 -51.369  22.535  1.00 88.59  ? 247 ARG A NH2   1 
ATOM   1998  N N     . ARG A 1 248 ? 110.322 -49.856  28.467  1.00 69.53  ? 248 ARG A N     1 
ATOM   1999  C CA    . ARG A 1 248 ? 110.023 -51.226  28.872  1.00 70.47  ? 248 ARG A CA    1 
ATOM   2000  C C     . ARG A 1 248 ? 108.965 -51.251  29.965  1.00 71.22  ? 248 ARG A C     1 
ATOM   2001  O O     . ARG A 1 248 ? 108.093 -52.120  29.974  1.00 71.72  ? 248 ARG A O     1 
ATOM   2002  C CB    . ARG A 1 248 ? 111.291 -51.929  29.346  1.00 70.79  ? 248 ARG A CB    1 
ATOM   2003  C CG    . ARG A 1 248 ? 112.176 -52.453  28.227  1.00 71.02  ? 248 ARG A CG    1 
ATOM   2004  C CD    . ARG A 1 248 ? 113.375 -53.213  28.796  1.00 71.51  ? 248 ARG A CD    1 
ATOM   2005  N NE    . ARG A 1 248 ? 114.432 -52.313  29.265  1.00 70.12  ? 248 ARG A NE    1 
ATOM   2006  C CZ    . ARG A 1 248 ? 115.500 -51.964  28.547  1.00 69.06  ? 248 ARG A CZ    1 
ATOM   2007  N NH1   . ARG A 1 248 ? 115.677 -52.439  27.313  1.00 68.10  ? 248 ARG A NH1   1 
ATOM   2008  N NH2   . ARG A 1 248 ? 116.394 -51.135  29.066  1.00 67.89  ? 248 ARG A NH2   1 
ATOM   2009  N N     . ASN A 1 249 ? 109.047 -50.289  30.881  1.00 71.50  ? 249 ASN A N     1 
ATOM   2010  C CA    . ASN A 1 249 ? 108.021 -50.094  31.894  1.00 72.70  ? 249 ASN A CA    1 
ATOM   2011  C C     . ASN A 1 249 ? 106.649 -49.780  31.293  1.00 73.09  ? 249 ASN A C     1 
ATOM   2012  O O     . ASN A 1 249 ? 105.622 -50.288  31.761  1.00 73.89  ? 249 ASN A O     1 
ATOM   2013  C CB    . ASN A 1 249 ? 108.435 -48.985  32.845  1.00 72.29  ? 249 ASN A CB    1 
ATOM   2014  C CG    . ASN A 1 249 ? 109.318 -49.481  33.950  1.00 74.25  ? 249 ASN A CG    1 
ATOM   2015  O OD1   . ASN A 1 249 ? 108.873 -50.207  34.834  1.00 77.38  ? 249 ASN A OD1   1 
ATOM   2016  N ND2   . ASN A 1 249 ? 110.579 -49.090  33.917  1.00 75.83  ? 249 ASN A ND2   1 
ATOM   2017  N N     . LEU A 1 250 ? 106.647 -48.945  30.253  1.00 72.89  ? 250 LEU A N     1 
ATOM   2018  C CA    . LEU A 1 250 ? 105.431 -48.548  29.560  1.00 72.89  ? 250 LEU A CA    1 
ATOM   2019  C C     . LEU A 1 250 ? 104.848 -49.681  28.728  1.00 73.83  ? 250 LEU A C     1 
ATOM   2020  O O     . LEU A 1 250 ? 103.630 -49.761  28.577  1.00 74.35  ? 250 LEU A O     1 
ATOM   2021  C CB    . LEU A 1 250 ? 105.690 -47.334  28.669  1.00 72.23  ? 250 LEU A CB    1 
ATOM   2022  C CG    . LEU A 1 250 ? 105.317 -45.936  29.163  1.00 71.61  ? 250 LEU A CG    1 
ATOM   2023  C CD1   . LEU A 1 250 ? 105.481 -44.960  28.029  1.00 70.29  ? 250 LEU A CD1   1 
ATOM   2024  C CD2   . LEU A 1 250 ? 103.881 -45.898  29.668  1.00 72.24  ? 250 LEU A CD2   1 
ATOM   2025  N N     . ASN A 1 251 ? 105.708 -50.545  28.185  1.00 74.35  ? 251 ASN A N     1 
ATOM   2026  C CA    . ASN A 1 251 ? 105.244 -51.715  27.436  1.00 75.26  ? 251 ASN A CA    1 
ATOM   2027  C C     . ASN A 1 251 ? 104.472 -52.669  28.341  1.00 76.23  ? 251 ASN A C     1 
ATOM   2028  O O     . ASN A 1 251 ? 103.388 -53.139  27.977  1.00 76.60  ? 251 ASN A O     1 
ATOM   2029  C CB    . ASN A 1 251 ? 106.404 -52.441  26.746  1.00 75.61  ? 251 ASN A CB    1 
ATOM   2030  C CG    . ASN A 1 251 ? 106.061 -52.871  25.325  1.00 76.52  ? 251 ASN A CG    1 
ATOM   2031  O OD1   . ASN A 1 251 ? 104.959 -53.352  25.046  1.00 77.35  ? 251 ASN A OD1   1 
ATOM   2032  N ND2   . ASN A 1 251 ? 107.005 -52.685  24.414  1.00 77.31  ? 251 ASN A ND2   1 
ATOM   2033  N N     . ASN A 1 252 ? 105.025 -52.927  29.528  1.00 76.66  ? 252 ASN A N     1 
ATOM   2034  C CA    . ASN A 1 252 ? 104.366 -53.775  30.520  1.00 77.65  ? 252 ASN A CA    1 
ATOM   2035  C C     . ASN A 1 252 ? 103.083 -53.172  31.035  1.00 77.12  ? 252 ASN A C     1 
ATOM   2036  O O     . ASN A 1 252 ? 102.090 -53.881  31.179  1.00 78.15  ? 252 ASN A O     1 
ATOM   2037  C CB    . ASN A 1 252 ? 105.286 -54.097  31.696  1.00 78.35  ? 252 ASN A CB    1 
ATOM   2038  C CG    . ASN A 1 252 ? 106.492 -54.919  31.286  1.00 79.79  ? 252 ASN A CG    1 
ATOM   2039  O OD1   . ASN A 1 252 ? 106.535 -55.494  30.188  1.00 80.14  ? 252 ASN A OD1   1 
ATOM   2040  N ND2   . ASN A 1 252 ? 107.490 -54.976  32.168  1.00 81.42  ? 252 ASN A ND2   1 
ATOM   2041  N N     . TYR A 1 253 ? 103.093 -51.873  31.311  1.00 75.72  ? 253 TYR A N     1 
ATOM   2042  C CA    . TYR A 1 253 ? 101.870 -51.215  31.728  1.00 75.40  ? 253 TYR A CA    1 
ATOM   2043  C C     . TYR A 1 253 ? 100.831 -51.369  30.638  1.00 75.52  ? 253 TYR A C     1 
ATOM   2044  O O     . TYR A 1 253 ? 99.681  -51.728  30.916  1.00 76.21  ? 253 TYR A O     1 
ATOM   2045  C CB    . TYR A 1 253 ? 102.090 -49.738  32.030  1.00 74.48  ? 253 TYR A CB    1 
ATOM   2046  C CG    . TYR A 1 253 ? 100.800 -48.953  32.157  1.00 73.78  ? 253 TYR A CG    1 
ATOM   2047  C CD1   . TYR A 1 253 ? 100.301 -48.222  31.085  1.00 73.12  ? 253 TYR A CD1   1 
ATOM   2048  C CD2   . TYR A 1 253 ? 100.077 -48.951  33.345  1.00 74.18  ? 253 TYR A CD2   1 
ATOM   2049  C CE1   . TYR A 1 253 ? 99.122  -47.508  31.195  1.00 73.16  ? 253 TYR A CE1   1 
ATOM   2050  C CE2   . TYR A 1 253 ? 98.896  -48.237  33.469  1.00 73.67  ? 253 TYR A CE2   1 
ATOM   2051  C CZ    . TYR A 1 253 ? 98.424  -47.520  32.390  1.00 74.03  ? 253 TYR A CZ    1 
ATOM   2052  O OH    . TYR A 1 253 ? 97.250  -46.810  32.499  1.00 75.49  ? 253 TYR A OH    1 
ATOM   2053  N N     . LEU A 1 254 ? 101.252 -51.110  29.401  1.00 75.01  ? 254 LEU A N     1 
ATOM   2054  C CA    . LEU A 1 254 ? 100.369 -51.179  28.237  1.00 75.14  ? 254 LEU A CA    1 
ATOM   2055  C C     . LEU A 1 254 ? 99.763  -52.583  28.057  1.00 76.15  ? 254 LEU A C     1 
ATOM   2056  O O     . LEU A 1 254 ? 98.549  -52.720  27.903  1.00 76.58  ? 254 LEU A O     1 
ATOM   2057  C CB    . LEU A 1 254 ? 101.115 -50.708  26.976  1.00 74.61  ? 254 LEU A CB    1 
ATOM   2058  C CG    . LEU A 1 254 ? 100.412 -50.083  25.760  1.00 73.36  ? 254 LEU A CG    1 
ATOM   2059  C CD1   . LEU A 1 254 ? 100.228 -51.112  24.665  1.00 73.68  ? 254 LEU A CD1   1 
ATOM   2060  C CD2   . LEU A 1 254 ? 99.098  -49.387  26.113  1.00 71.27  ? 254 LEU A CD2   1 
ATOM   2061  N N     . GLU A 1 255 ? 100.608 -53.611  28.115  1.00 76.60  ? 255 GLU A N     1 
ATOM   2062  C CA    . GLU A 1 255 ? 100.167 -55.010  28.045  1.00 77.74  ? 255 GLU A CA    1 
ATOM   2063  C C     . GLU A 1 255 ? 99.035  -55.316  29.027  1.00 77.80  ? 255 GLU A C     1 
ATOM   2064  O O     . GLU A 1 255 ? 98.079  -56.012  28.688  1.00 78.35  ? 255 GLU A O     1 
ATOM   2065  C CB    . GLU A 1 255 ? 101.355 -55.949  28.299  1.00 78.62  ? 255 GLU A CB    1 
ATOM   2066  C CG    . GLU A 1 255 ? 101.098 -57.432  27.996  1.00 80.92  ? 255 GLU A CG    1 
ATOM   2067  C CD    . GLU A 1 255 ? 102.255 -58.335  28.428  1.00 83.37  ? 255 GLU A CD    1 
ATOM   2068  O OE1   . GLU A 1 255 ? 101.989 -59.405  29.022  1.00 85.30  ? 255 GLU A OE1   1 
ATOM   2069  O OE2   . GLU A 1 255 ? 103.431 -57.977  28.183  1.00 83.23  ? 255 GLU A OE2   1 
ATOM   2070  N N     . GLY A 1 256 ? 99.160  -54.791  30.242  1.00 77.15  ? 256 GLY A N     1 
ATOM   2071  C CA    . GLY A 1 256 ? 98.156  -54.984  31.277  1.00 77.24  ? 256 GLY A CA    1 
ATOM   2072  C C     . GLY A 1 256 ? 96.812  -54.399  30.895  1.00 76.60  ? 256 GLY A C     1 
ATOM   2073  O O     . GLY A 1 256 ? 95.790  -55.067  31.016  1.00 77.49  ? 256 GLY A O     1 
ATOM   2074  N N     . VAL A 1 257 ? 96.821  -53.154  30.420  1.00 75.18  ? 257 VAL A N     1 
ATOM   2075  C CA    . VAL A 1 257 ? 95.588  -52.445  30.076  1.00 74.37  ? 257 VAL A CA    1 
ATOM   2076  C C     . VAL A 1 257 ? 94.947  -53.033  28.833  1.00 74.67  ? 257 VAL A C     1 
ATOM   2077  O O     . VAL A 1 257 ? 93.725  -53.114  28.742  1.00 74.87  ? 257 VAL A O     1 
ATOM   2078  C CB    . VAL A 1 257 ? 95.826  -50.936  29.850  1.00 73.10  ? 257 VAL A CB    1 
ATOM   2079  C CG1   . VAL A 1 257 ? 94.508  -50.216  29.639  1.00 72.56  ? 257 VAL A CG1   1 
ATOM   2080  C CG2   . VAL A 1 257 ? 96.534  -50.335  31.027  1.00 72.78  ? 257 VAL A CG2   1 
ATOM   2081  N N     . MET A 1 258 ? 95.785  -53.451  27.890  1.00 74.82  ? 258 MET A N     1 
ATOM   2082  C CA    . MET A 1 258 ? 95.336  -53.861  26.564  1.00 75.41  ? 258 MET A CA    1 
ATOM   2083  C C     . MET A 1 258 ? 94.637  -55.206  26.611  1.00 76.73  ? 258 MET A C     1 
ATOM   2084  O O     . MET A 1 258 ? 93.676  -55.438  25.872  1.00 76.92  ? 258 MET A O     1 
ATOM   2085  C CB    . MET A 1 258 ? 96.512  -53.875  25.576  1.00 75.15  ? 258 MET A CB    1 
ATOM   2086  C CG    . MET A 1 258 ? 96.142  -53.663  24.089  1.00 75.73  ? 258 MET A CG    1 
ATOM   2087  S SD    . MET A 1 258 ? 95.172  -52.189  23.665  1.00 73.99  ? 258 MET A SD    1 
ATOM   2088  C CE    . MET A 1 258 ? 95.965  -51.005  24.736  1.00 74.05  ? 258 MET A CE    1 
ATOM   2089  N N     . LYS A 1 259 ? 95.115  -56.075  27.500  1.00 77.85  ? 259 LYS A N     1 
ATOM   2090  C CA    . LYS A 1 259 ? 94.503  -57.386  27.727  1.00 79.57  ? 259 LYS A CA    1 
ATOM   2091  C C     . LYS A 1 259 ? 93.185  -57.236  28.464  1.00 79.95  ? 259 LYS A C     1 
ATOM   2092  O O     . LYS A 1 259 ? 92.219  -57.962  28.200  1.00 80.90  ? 259 LYS A O     1 
ATOM   2093  C CB    . LYS A 1 259 ? 95.453  -58.305  28.490  1.00 80.32  ? 259 LYS A CB    1 
ATOM   2094  C CG    . LYS A 1 259 ? 96.531  -58.901  27.596  1.00 81.10  ? 259 LYS A CG    1 
ATOM   2095  C CD    . LYS A 1 259 ? 97.459  -59.824  28.344  1.00 82.87  ? 259 LYS A CD    1 
ATOM   2096  C CE    . LYS A 1 259 ? 98.485  -60.402  27.391  1.00 84.53  ? 259 LYS A CE    1 
ATOM   2097  N NZ    . LYS A 1 259 ? 99.571  -61.123  28.110  1.00 86.92  ? 259 LYS A NZ    1 
ATOM   2098  N N     . GLU A 1 260 ? 93.155  -56.271  29.374  1.00 79.41  ? 260 GLU A N     1 
ATOM   2099  C CA    . GLU A 1 260 ? 91.930  -55.881  30.045  1.00 79.94  ? 260 GLU A CA    1 
ATOM   2100  C C     . GLU A 1 260 ? 90.890  -55.270  29.084  1.00 79.54  ? 260 GLU A C     1 
ATOM   2101  O O     . GLU A 1 260 ? 89.738  -55.702  29.068  1.00 80.18  ? 260 GLU A O     1 
ATOM   2102  C CB    . GLU A 1 260 ? 92.251  -54.925  31.196  1.00 79.31  ? 260 GLU A CB    1 
ATOM   2103  C CG    . GLU A 1 260 ? 91.175  -54.849  32.257  1.00 81.39  ? 260 GLU A CG    1 
ATOM   2104  C CD    . GLU A 1 260 ? 90.224  -53.682  32.060  1.00 82.90  ? 260 GLU A CD    1 
ATOM   2105  O OE1   . GLU A 1 260 ? 89.986  -52.949  33.044  1.00 84.29  ? 260 GLU A OE1   1 
ATOM   2106  O OE2   . GLU A 1 260 ? 89.712  -53.485  30.935  1.00 83.20  ? 260 GLU A OE2   1 
ATOM   2107  N N     . VAL A 1 261 ? 91.293  -54.286  28.280  1.00 78.67  ? 261 VAL A N     1 
ATOM   2108  C CA    . VAL A 1 261 ? 90.322  -53.514  27.493  1.00 78.56  ? 261 VAL A CA    1 
ATOM   2109  C C     . VAL A 1 261 ? 89.994  -54.094  26.112  1.00 79.21  ? 261 VAL A C     1 
ATOM   2110  O O     . VAL A 1 261 ? 88.878  -53.898  25.608  1.00 79.34  ? 261 VAL A O     1 
ATOM   2111  C CB    . VAL A 1 261 ? 90.691  -52.000  27.397  1.00 77.32  ? 261 VAL A CB    1 
ATOM   2112  C CG1   . VAL A 1 261 ? 91.781  -51.745  26.381  1.00 76.93  ? 261 VAL A CG1   1 
ATOM   2113  C CG2   . VAL A 1 261 ? 89.468  -51.189  27.041  1.00 77.75  ? 261 VAL A CG2   1 
ATOM   2114  N N     . ALA A 1 262 ? 90.956  -54.794  25.509  1.00 76.25  ? 262 ALA A N     1 
ATOM   2115  C CA    . ALA A 1 262 ? 90.760  -55.383  24.179  1.00 75.72  ? 262 ALA A CA    1 
ATOM   2116  C C     . ALA A 1 262 ? 91.551  -56.685  23.979  1.00 76.46  ? 262 ALA A C     1 
ATOM   2117  O O     . ALA A 1 262 ? 92.487  -56.726  23.165  1.00 75.98  ? 262 ALA A O     1 
ATOM   2118  C CB    . ALA A 1 262 ? 91.098  -54.366  23.086  1.00 74.35  ? 262 ALA A CB    1 
ATOM   2119  N N     . PRO A 1 263 ? 91.166  -57.756  24.710  1.00 77.69  ? 263 PRO A N     1 
ATOM   2120  C CA    . PRO A 1 263 ? 91.880  -59.028  24.706  1.00 78.66  ? 263 PRO A CA    1 
ATOM   2121  C C     . PRO A 1 263 ? 91.950  -59.725  23.352  1.00 78.31  ? 263 PRO A C     1 
ATOM   2122  O O     . PRO A 1 263 ? 92.962  -60.343  23.037  1.00 78.87  ? 263 PRO A O     1 
ATOM   2123  C CB    . PRO A 1 263 ? 91.073  -59.877  25.681  1.00 80.17  ? 263 PRO A CB    1 
ATOM   2124  C CG    . PRO A 1 263 ? 89.745  -59.222  25.744  1.00 79.68  ? 263 PRO A CG    1 
ATOM   2125  C CD    . PRO A 1 263 ? 90.038  -57.790  25.655  1.00 78.44  ? 263 PRO A CD    1 
ATOM   2126  N N     . ASN A 1 264 ? 90.890  -59.642  22.563  1.00 77.83  ? 264 ASN A N     1 
ATOM   2127  C CA    . ASN A 1 264 ? 90.890  -60.296  21.259  1.00 77.88  ? 264 ASN A CA    1 
ATOM   2128  C C     . ASN A 1 264 ? 91.857  -59.648  20.267  1.00 76.88  ? 264 ASN A C     1 
ATOM   2129  O O     . ASN A 1 264 ? 92.623  -60.345  19.576  1.00 76.97  ? 264 ASN A O     1 
ATOM   2130  C CB    . ASN A 1 264 ? 89.473  -60.365  20.699  1.00 77.69  ? 264 ASN A CB    1 
ATOM   2131  C CG    . ASN A 1 264 ? 88.569  -61.246  21.542  1.00 80.14  ? 264 ASN A CG    1 
ATOM   2132  O OD1   . ASN A 1 264 ? 88.603  -62.475  21.423  1.00 83.42  ? 264 ASN A OD1   1 
ATOM   2133  N ND2   . ASN A 1 264 ? 87.760  -60.628  22.404  1.00 79.70  ? 264 ASN A ND2   1 
ATOM   2134  N N     . VAL A 1 265 ? 91.824  -58.313  20.218  1.00 75.99  ? 265 VAL A N     1 
ATOM   2135  C CA    . VAL A 1 265 ? 92.745  -57.526  19.396  1.00 74.57  ? 265 VAL A CA    1 
ATOM   2136  C C     . VAL A 1 265 ? 94.180  -57.779  19.839  1.00 74.98  ? 265 VAL A C     1 
ATOM   2137  O O     . VAL A 1 265 ? 95.058  -58.013  18.996  1.00 74.91  ? 265 VAL A O     1 
ATOM   2138  C CB    . VAL A 1 265 ? 92.424  -56.025  19.447  1.00 73.53  ? 265 VAL A CB    1 
ATOM   2139  C CG1   . VAL A 1 265 ? 93.549  -55.221  18.837  1.00 72.61  ? 265 VAL A CG1   1 
ATOM   2140  C CG2   . VAL A 1 265 ? 91.124  -55.744  18.708  1.00 73.39  ? 265 VAL A CG2   1 
ATOM   2141  N N     . THR A 1 266 ? 94.404  -57.758  21.157  1.00 75.46  ? 266 THR A N     1 
ATOM   2142  C CA    . THR A 1 266 ? 95.730  -58.004  21.727  1.00 75.82  ? 266 THR A CA    1 
ATOM   2143  C C     . THR A 1 266 ? 96.253  -59.370  21.295  1.00 76.46  ? 266 THR A C     1 
ATOM   2144  O O     . THR A 1 266 ? 97.392  -59.493  20.860  1.00 76.53  ? 266 THR A O     1 
ATOM   2145  C CB    . THR A 1 266 ? 95.721  -57.904  23.258  1.00 76.78  ? 266 THR A CB    1 
ATOM   2146  O OG1   . THR A 1 266 ? 94.956  -56.763  23.653  1.00 76.25  ? 266 THR A OG1   1 
ATOM   2147  C CG2   . THR A 1 266 ? 97.132  -57.760  23.791  1.00 77.29  ? 266 THR A CG2   1 
ATOM   2148  N N     . ALA A 1 267 ? 95.402  -60.386  21.390  1.00 77.12  ? 267 ALA A N     1 
ATOM   2149  C CA    . ALA A 1 267 ? 95.746  -61.737  20.944  1.00 77.84  ? 267 ALA A CA    1 
ATOM   2150  C C     . ALA A 1 267 ? 96.310  -61.750  19.512  1.00 76.79  ? 267 ALA A C     1 
ATOM   2151  O O     . ALA A 1 267 ? 97.229  -62.523  19.202  1.00 77.47  ? 267 ALA A O     1 
ATOM   2152  C CB    . ALA A 1 267 ? 94.526  -62.667  21.061  1.00 78.44  ? 267 ALA A CB    1 
ATOM   2153  N N     . LEU A 1 268 ? 95.772  -60.881  18.655  1.00 74.99  ? 268 LEU A N     1 
ATOM   2154  C CA    . LEU A 1 268 ? 96.129  -60.887  17.239  1.00 73.76  ? 268 LEU A CA    1 
ATOM   2155  C C     . LEU A 1 268 ? 97.421  -60.139  16.914  1.00 72.90  ? 268 LEU A C     1 
ATOM   2156  O O     . LEU A 1 268 ? 98.279  -60.671  16.201  1.00 73.34  ? 268 LEU A O     1 
ATOM   2157  C CB    . LEU A 1 268 ? 94.963  -60.397  16.366  1.00 72.81  ? 268 LEU A CB    1 
ATOM   2158  C CG    . LEU A 1 268 ? 93.948  -61.462  15.940  1.00 73.08  ? 268 LEU A CG    1 
ATOM   2159  C CD1   . LEU A 1 268 ? 92.724  -60.842  15.290  1.00 72.35  ? 268 LEU A CD1   1 
ATOM   2160  C CD2   . LEU A 1 268 ? 94.587  -62.454  14.988  1.00 73.33  ? 268 LEU A CD2   1 
ATOM   2161  N N     . VAL A 1 269 ? 97.570  -58.923  17.437  1.00 71.63  ? 269 VAL A N     1 
ATOM   2162  C CA    . VAL A 1 269 ? 98.689  -58.065  17.031  1.00 70.67  ? 269 VAL A CA    1 
ATOM   2163  C C     . VAL A 1 269 ? 99.590  -57.582  18.160  1.00 70.76  ? 269 VAL A C     1 
ATOM   2164  O O     . VAL A 1 269 ? 100.507 -56.797  17.928  1.00 70.38  ? 269 VAL A O     1 
ATOM   2165  C CB    . VAL A 1 269 ? 98.221  -56.838  16.208  1.00 69.49  ? 269 VAL A CB    1 
ATOM   2166  C CG1   . VAL A 1 269 ? 97.727  -57.276  14.825  1.00 69.20  ? 269 VAL A CG1   1 
ATOM   2167  C CG2   . VAL A 1 269 ? 97.163  -56.033  16.969  1.00 69.15  ? 269 VAL A CG2   1 
ATOM   2168  N N     . GLY A 1 270 ? 99.333  -58.047  19.373  1.00 71.28  ? 270 GLY A N     1 
ATOM   2169  C CA    . GLY A 1 270 ? 100.125 -57.637  20.520  1.00 71.73  ? 270 GLY A CA    1 
ATOM   2170  C C     . GLY A 1 270 ? 99.534  -56.407  21.169  1.00 71.11  ? 270 GLY A C     1 
ATOM   2171  O O     . GLY A 1 270 ? 98.618  -55.800  20.619  1.00 70.11  ? 270 GLY A O     1 
ATOM   2172  N N     . PRO A 1 271 ? 100.049 -56.032  22.351  1.00 71.97  ? 271 PRO A N     1 
ATOM   2173  C CA    . PRO A 1 271 ? 99.533  -54.855  23.037  1.00 71.70  ? 271 PRO A CA    1 
ATOM   2174  C C     . PRO A 1 271 ? 99.762  -53.567  22.237  1.00 70.63  ? 271 PRO A C     1 
ATOM   2175  O O     . PRO A 1 271 ? 98.794  -52.869  21.930  1.00 69.76  ? 271 PRO A O     1 
ATOM   2176  C CB    . PRO A 1 271 ? 100.320 -54.841  24.354  1.00 72.99  ? 271 PRO A CB    1 
ATOM   2177  C CG    . PRO A 1 271 ? 100.789 -56.236  24.528  1.00 74.14  ? 271 PRO A CG    1 
ATOM   2178  C CD    . PRO A 1 271 ? 101.078 -56.717  23.149  1.00 73.47  ? 271 PRO A CD    1 
ATOM   2179  N N     . ALA A 1 272 ? 101.019 -53.280  21.885  1.00 70.92  ? 272 ALA A N     1 
ATOM   2180  C CA    . ALA A 1 272 ? 101.401 -52.004  21.254  1.00 70.02  ? 272 ALA A CA    1 
ATOM   2181  C C     . ALA A 1 272 ? 100.599 -51.714  19.990  1.00 68.69  ? 272 ALA A C     1 
ATOM   2182  O O     . ALA A 1 272 ? 99.904  -50.701  19.910  1.00 68.36  ? 272 ALA A O     1 
ATOM   2183  C CB    . ALA A 1 272 ? 102.899 -51.966  20.957  1.00 70.46  ? 272 ALA A CB    1 
ATOM   2184  N N     . LEU A 1 273 ? 100.676 -52.619  19.020  1.00 68.12  ? 273 LEU A N     1 
ATOM   2185  C CA    . LEU A 1 273 ? 100.016 -52.421  17.741  1.00 66.71  ? 273 LEU A CA    1 
ATOM   2186  C C     . LEU A 1 273 ? 98.494  -52.366  17.881  1.00 66.48  ? 273 LEU A C     1 
ATOM   2187  O O     . LEU A 1 273 ? 97.826  -51.683  17.112  1.00 66.00  ? 273 LEU A O     1 
ATOM   2188  C CB    . LEU A 1 273 ? 100.449 -53.490  16.740  1.00 66.52  ? 273 LEU A CB    1 
ATOM   2189  C CG    . LEU A 1 273 ? 99.958  -53.383  15.297  1.00 64.92  ? 273 LEU A CG    1 
ATOM   2190  C CD1   . LEU A 1 273 ? 100.187 -52.010  14.765  1.00 63.60  ? 273 LEU A CD1   1 
ATOM   2191  C CD2   . LEU A 1 273 ? 100.648 -54.408  14.410  1.00 65.20  ? 273 LEU A CD2   1 
ATOM   2192  N N     . GLY A 1 274 ? 97.948  -53.076  18.862  1.00 67.10  ? 274 GLY A N     1 
ATOM   2193  C CA    . GLY A 1 274 ? 96.516  -52.988  19.149  1.00 67.05  ? 274 GLY A CA    1 
ATOM   2194  C C     . GLY A 1 274 ? 96.138  -51.600  19.654  1.00 66.97  ? 274 GLY A C     1 
ATOM   2195  O O     . GLY A 1 274 ? 95.184  -50.977  19.157  1.00 66.48  ? 274 GLY A O     1 
ATOM   2196  N N     . ALA A 1 275 ? 96.902  -51.120  20.638  1.00 67.25  ? 275 ALA A N     1 
ATOM   2197  C CA    . ALA A 1 275 ? 96.750  -49.776  21.186  1.00 67.03  ? 275 ALA A CA    1 
ATOM   2198  C C     . ALA A 1 275 ? 96.918  -48.704  20.111  1.00 66.27  ? 275 ALA A C     1 
ATOM   2199  O O     . ALA A 1 275 ? 96.136  -47.753  20.036  1.00 66.26  ? 275 ALA A O     1 
ATOM   2200  C CB    . ALA A 1 275 ? 97.744  -49.553  22.291  1.00 67.63  ? 275 ALA A CB    1 
ATOM   2201  N N     . ARG A 1 276 ? 97.945  -48.866  19.285  1.00 65.72  ? 276 ARG A N     1 
ATOM   2202  C CA    . ARG A 1 276 ? 98.218  -47.964  18.178  1.00 64.86  ? 276 ARG A CA    1 
ATOM   2203  C C     . ARG A 1 276 ? 96.972  -47.799  17.287  1.00 64.27  ? 276 ARG A C     1 
ATOM   2204  O O     . ARG A 1 276 ? 96.597  -46.684  16.892  1.00 63.46  ? 276 ARG A O     1 
ATOM   2205  C CB    . ARG A 1 276 ? 99.373  -48.545  17.383  1.00 64.50  ? 276 ARG A CB    1 
ATOM   2206  C CG    . ARG A 1 276 ? 100.345 -47.549  16.896  1.00 64.75  ? 276 ARG A CG    1 
ATOM   2207  C CD    . ARG A 1 276 ? 101.673 -48.219  16.691  1.00 66.60  ? 276 ARG A CD    1 
ATOM   2208  N NE    . ARG A 1 276 ? 102.563 -48.109  17.845  1.00 68.14  ? 276 ARG A NE    1 
ATOM   2209  C CZ    . ARG A 1 276 ? 103.524 -48.986  18.127  1.00 70.20  ? 276 ARG A CZ    1 
ATOM   2210  N NH1   . ARG A 1 276 ? 104.301 -48.813  19.191  1.00 72.52  ? 276 ARG A NH1   1 
ATOM   2211  N NH2   . ARG A 1 276 ? 103.706 -50.052  17.356  1.00 69.85  ? 276 ARG A NH2   1 
ATOM   2212  N N     . LEU A 1 277 ? 96.323  -48.927  17.011  1.00 64.46  ? 277 LEU A N     1 
ATOM   2213  C CA    . LEU A 1 277 ? 95.097  -48.966  16.228  1.00 64.47  ? 277 LEU A CA    1 
ATOM   2214  C C     . LEU A 1 277 ? 93.937  -48.285  16.935  1.00 64.74  ? 277 LEU A C     1 
ATOM   2215  O O     . LEU A 1 277 ? 93.087  -47.671  16.287  1.00 64.72  ? 277 LEU A O     1 
ATOM   2216  C CB    . LEU A 1 277 ? 94.720  -50.409  15.902  1.00 64.64  ? 277 LEU A CB    1 
ATOM   2217  C CG    . LEU A 1 277 ? 95.507  -51.065  14.771  1.00 64.82  ? 277 LEU A CG    1 
ATOM   2218  C CD1   . LEU A 1 277 ? 95.590  -52.544  15.036  1.00 65.99  ? 277 LEU A CD1   1 
ATOM   2219  C CD2   . LEU A 1 277 ? 94.881  -50.784  13.409  1.00 63.99  ? 277 LEU A CD2   1 
ATOM   2220  N N     . LEU A 1 278 ? 93.894  -48.411  18.257  1.00 65.20  ? 278 LEU A N     1 
ATOM   2221  C CA    . LEU A 1 278 ? 92.904  -47.691  19.054  1.00 65.46  ? 278 LEU A CA    1 
ATOM   2222  C C     . LEU A 1 278 ? 93.123  -46.184  18.967  1.00 65.40  ? 278 LEU A C     1 
ATOM   2223  O O     . LEU A 1 278 ? 92.166  -45.417  18.833  1.00 65.45  ? 278 LEU A O     1 
ATOM   2224  C CB    . LEU A 1 278 ? 92.966  -48.139  20.513  1.00 66.13  ? 278 LEU A CB    1 
ATOM   2225  C CG    . LEU A 1 278 ? 92.713  -49.616  20.804  1.00 66.28  ? 278 LEU A CG    1 
ATOM   2226  C CD1   . LEU A 1 278 ? 92.965  -49.861  22.269  1.00 67.32  ? 278 LEU A CD1   1 
ATOM   2227  C CD2   . LEU A 1 278 ? 91.290  -50.030  20.423  1.00 66.58  ? 278 LEU A CD2   1 
ATOM   2228  N N     . SER A 1 279 ? 94.394  -45.782  19.023  1.00 65.38  ? 279 SER A N     1 
ATOM   2229  C CA    . SER A 1 279 ? 94.798  -44.372  18.994  1.00 65.26  ? 279 SER A CA    1 
ATOM   2230  C C     . SER A 1 279 ? 94.497  -43.673  17.675  1.00 64.64  ? 279 SER A C     1 
ATOM   2231  O O     . SER A 1 279 ? 94.206  -42.480  17.678  1.00 64.71  ? 279 SER A O     1 
ATOM   2232  C CB    . SER A 1 279 ? 96.291  -44.230  19.305  1.00 65.74  ? 279 SER A CB    1 
ATOM   2233  O OG    . SER A 1 279 ? 96.724  -42.893  19.114  1.00 64.99  ? 279 SER A OG    1 
ATOM   2234  N N     . ILE A 1 280 ? 94.599  -44.397  16.559  1.00 63.84  ? 280 ILE A N     1 
ATOM   2235  C CA    . ILE A 1 280 ? 94.259  -43.826  15.256  1.00 63.53  ? 280 ILE A CA    1 
ATOM   2236  C C     . ILE A 1 280 ? 92.740  -43.796  15.086  1.00 64.16  ? 280 ILE A C     1 
ATOM   2237  O O     . ILE A 1 280 ? 92.184  -42.824  14.577  1.00 64.64  ? 280 ILE A O     1 
ATOM   2238  C CB    . ILE A 1 280 ? 94.930  -44.572  14.082  1.00 62.77  ? 280 ILE A CB    1 
ATOM   2239  C CG1   . ILE A 1 280 ? 96.445  -44.540  14.223  1.00 62.55  ? 280 ILE A CG1   1 
ATOM   2240  C CG2   . ILE A 1 280 ? 94.568  -43.946  12.750  1.00 62.19  ? 280 ILE A CG2   1 
ATOM   2241  C CD1   . ILE A 1 280 ? 97.171  -45.356  13.176  1.00 61.72  ? 280 ILE A CD1   1 
ATOM   2242  N N     . ALA A 1 281 ? 92.065  -44.847  15.531  1.00 64.77  ? 281 ALA A N     1 
ATOM   2243  C CA    . ALA A 1 281 ? 90.607  -44.889  15.457  1.00 65.84  ? 281 ALA A CA    1 
ATOM   2244  C C     . ALA A 1 281 ? 89.919  -43.902  16.417  1.00 67.16  ? 281 ALA A C     1 
ATOM   2245  O O     . ALA A 1 281 ? 88.840  -43.377  16.107  1.00 67.89  ? 281 ALA A O     1 
ATOM   2246  C CB    . ALA A 1 281 ? 90.107  -46.293  15.692  1.00 65.84  ? 281 ALA A CB    1 
ATOM   2247  N N     . GLY A 1 282 ? 90.532  -43.656  17.576  1.00 67.74  ? 282 GLY A N     1 
ATOM   2248  C CA    . GLY A 1 282 ? 89.961  -42.745  18.562  1.00 68.93  ? 282 GLY A CA    1 
ATOM   2249  C C     . GLY A 1 282 ? 89.424  -43.445  19.788  1.00 69.78  ? 282 GLY A C     1 
ATOM   2250  O O     . GLY A 1 282 ? 89.558  -42.944  20.898  1.00 70.55  ? 282 GLY A O     1 
ATOM   2251  N N     . SER A 1 283 ? 88.802  -44.597  19.580  1.00 70.24  ? 283 SER A N     1 
ATOM   2252  C CA    . SER A 1 283 ? 88.306  -45.430  20.667  1.00 71.68  ? 283 SER A CA    1 
ATOM   2253  C C     . SER A 1 283 ? 88.199  -46.879  20.198  1.00 72.16  ? 283 SER A C     1 
ATOM   2254  O O     . SER A 1 283 ? 88.437  -47.169  19.017  1.00 71.69  ? 283 SER A O     1 
ATOM   2255  C CB    . SER A 1 283 ? 86.936  -44.939  21.145  1.00 72.52  ? 283 SER A CB    1 
ATOM   2256  O OG    . SER A 1 283 ? 85.950  -45.094  20.141  1.00 72.14  ? 283 SER A OG    1 
ATOM   2257  N N     . LEU A 1 284 ? 87.847  -47.783  21.118  1.00 73.43  ? 284 LEU A N     1 
ATOM   2258  C CA    . LEU A 1 284 ? 87.583  -49.180  20.760  1.00 73.94  ? 284 LEU A CA    1 
ATOM   2259  C C     . LEU A 1 284 ? 86.271  -49.305  19.970  1.00 74.61  ? 284 LEU A C     1 
ATOM   2260  O O     . LEU A 1 284 ? 86.201  -50.042  18.978  1.00 74.02  ? 284 LEU A O     1 
ATOM   2261  C CB    . LEU A 1 284 ? 87.555  -50.070  22.012  1.00 74.69  ? 284 LEU A CB    1 
ATOM   2262  C CG    . LEU A 1 284 ? 87.209  -51.563  21.861  1.00 74.33  ? 284 LEU A CG    1 
ATOM   2263  C CD1   . LEU A 1 284 ? 88.260  -52.326  21.066  1.00 73.00  ? 284 LEU A CD1   1 
ATOM   2264  C CD2   . LEU A 1 284 ? 87.007  -52.202  23.224  1.00 74.78  ? 284 LEU A CD2   1 
ATOM   2265  N N     . ASP A 1 285 ? 85.250  -48.567  20.418  1.00 75.92  ? 285 ASP A N     1 
ATOM   2266  C CA    . ASP A 1 285 ? 83.928  -48.546  19.783  1.00 77.19  ? 285 ASP A CA    1 
ATOM   2267  C C     . ASP A 1 285 ? 83.979  -47.976  18.373  1.00 76.96  ? 285 ASP A C     1 
ATOM   2268  O O     . ASP A 1 285 ? 83.128  -48.301  17.534  1.00 77.39  ? 285 ASP A O     1 
ATOM   2269  C CB    . ASP A 1 285 ? 82.925  -47.738  20.612  1.00 78.26  ? 285 ASP A CB    1 
ATOM   2270  C CG    . ASP A 1 285 ? 82.894  -48.165  22.060  1.00 80.66  ? 285 ASP A CG    1 
ATOM   2271  O OD1   . ASP A 1 285 ? 83.739  -47.670  22.843  1.00 83.19  ? 285 ASP A OD1   1 
ATOM   2272  O OD2   . ASP A 1 285 ? 82.031  -48.994  22.420  1.00 82.78  ? 285 ASP A OD2   1 
ATOM   2273  N N     . GLU A 1 286 ? 84.962  -47.111  18.123  1.00 76.66  ? 286 GLU A N     1 
ATOM   2274  C CA    . GLU A 1 286 ? 85.186  -46.584  16.782  1.00 76.33  ? 286 GLU A CA    1 
ATOM   2275  C C     . GLU A 1 286 ? 85.952  -47.587  15.925  1.00 75.03  ? 286 GLU A C     1 
ATOM   2276  O O     . GLU A 1 286 ? 85.648  -47.762  14.744  1.00 75.07  ? 286 GLU A O     1 
ATOM   2277  C CB    . GLU A 1 286 ? 85.869  -45.218  16.819  1.00 76.45  ? 286 GLU A CB    1 
ATOM   2278  C CG    . GLU A 1 286 ? 84.887  -44.088  17.115  1.00 79.78  ? 286 GLU A CG    1 
ATOM   2279  C CD    . GLU A 1 286 ? 85.292  -42.763  16.491  1.00 83.40  ? 286 GLU A CD    1 
ATOM   2280  O OE1   . GLU A 1 286 ? 84.742  -41.721  16.921  1.00 84.87  ? 286 GLU A OE1   1 
ATOM   2281  O OE2   . GLU A 1 286 ? 86.151  -42.763  15.571  1.00 84.35  ? 286 GLU A OE2   1 
ATOM   2282  N N     . LEU A 1 287 ? 86.920  -48.264  16.526  1.00 73.98  ? 287 LEU A N     1 
ATOM   2283  C CA    . LEU A 1 287 ? 87.633  -49.308  15.823  1.00 73.06  ? 287 LEU A CA    1 
ATOM   2284  C C     . LEU A 1 287 ? 86.660  -50.403  15.380  1.00 73.45  ? 287 LEU A C     1 
ATOM   2285  O O     . LEU A 1 287 ? 86.715  -50.852  14.232  1.00 73.46  ? 287 LEU A O     1 
ATOM   2286  C CB    . LEU A 1 287 ? 88.747  -49.882  16.699  1.00 72.87  ? 287 LEU A CB    1 
ATOM   2287  C CG    . LEU A 1 287 ? 89.734  -50.859  16.057  1.00 71.78  ? 287 LEU A CG    1 
ATOM   2288  C CD1   . LEU A 1 287 ? 90.752  -50.173  15.161  1.00 70.71  ? 287 LEU A CD1   1 
ATOM   2289  C CD2   . LEU A 1 287 ? 90.431  -51.591  17.159  1.00 72.17  ? 287 LEU A CD2   1 
ATOM   2290  N N     . ALA A 1 288 ? 85.758  -50.808  16.277  1.00 73.68  ? 288 ALA A N     1 
ATOM   2291  C CA    . ALA A 1 288 ? 84.795  -51.872  15.983  1.00 73.69  ? 288 ALA A CA    1 
ATOM   2292  C C     . ALA A 1 288 ? 83.901  -51.544  14.801  1.00 73.64  ? 288 ALA A C     1 
ATOM   2293  O O     . ALA A 1 288 ? 83.607  -52.422  14.003  1.00 73.70  ? 288 ALA A O     1 
ATOM   2294  C CB    . ALA A 1 288 ? 83.957  -52.182  17.189  1.00 74.59  ? 288 ALA A CB    1 
ATOM   2295  N N     . LYS A 1 289 ? 83.486  -50.281  14.692  1.00 73.56  ? 289 LYS A N     1 
ATOM   2296  C CA    . LYS A 1 289 ? 82.580  -49.827  13.632  1.00 73.86  ? 289 LYS A CA    1 
ATOM   2297  C C     . LYS A 1 289 ? 83.238  -49.751  12.248  1.00 73.08  ? 289 LYS A C     1 
ATOM   2298  O O     . LYS A 1 289 ? 82.578  -49.436  11.250  1.00 73.63  ? 289 LYS A O     1 
ATOM   2299  C CB    . LYS A 1 289 ? 82.002  -48.460  13.979  1.00 74.49  ? 289 LYS A CB    1 
ATOM   2300  C CG    . LYS A 1 289 ? 81.024  -48.456  15.127  1.00 76.79  ? 289 LYS A CG    1 
ATOM   2301  C CD    . LYS A 1 289 ? 80.631  -47.026  15.473  1.00 79.40  ? 289 LYS A CD    1 
ATOM   2302  C CE    . LYS A 1 289 ? 80.188  -46.920  16.916  1.00 81.52  ? 289 LYS A CE    1 
ATOM   2303  N NZ    . LYS A 1 289 ? 79.402  -45.675  17.112  1.00 84.41  ? 289 LYS A NZ    1 
ATOM   2304  N N     . MET A 1 290 ? 84.533  -50.030  12.181  1.00 71.75  ? 290 MET A N     1 
ATOM   2305  C CA    . MET A 1 290 ? 85.262  -49.883  10.929  1.00 70.85  ? 290 MET A CA    1 
ATOM   2306  C C     . MET A 1 290 ? 85.169  -51.142  10.075  1.00 70.50  ? 290 MET A C     1 
ATOM   2307  O O     . MET A 1 290 ? 85.177  -52.235  10.612  1.00 70.75  ? 290 MET A O     1 
ATOM   2308  C CB    . MET A 1 290 ? 86.732  -49.553  11.209  1.00 70.26  ? 290 MET A CB    1 
ATOM   2309  C CG    . MET A 1 290 ? 86.978  -48.201  11.858  1.00 70.43  ? 290 MET A CG    1 
ATOM   2310  S SD    . MET A 1 290 ? 88.730  -47.743  11.943  1.00 70.87  ? 290 MET A SD    1 
ATOM   2311  C CE    . MET A 1 290 ? 88.584  -46.035  12.465  1.00 69.84  ? 290 MET A CE    1 
ATOM   2312  N N     . PRO A 1 291 ? 85.088  -50.994  8.739   1.00 70.28  ? 291 PRO A N     1 
ATOM   2313  C CA    . PRO A 1 291 ? 85.262  -52.147  7.859   1.00 70.32  ? 291 PRO A CA    1 
ATOM   2314  C C     . PRO A 1 291 ? 86.734  -52.530  7.826   1.00 69.57  ? 291 PRO A C     1 
ATOM   2315  O O     . PRO A 1 291 ? 87.573  -51.710  8.188   1.00 69.50  ? 291 PRO A O     1 
ATOM   2316  C CB    . PRO A 1 291 ? 84.830  -51.614  6.493   1.00 70.64  ? 291 PRO A CB    1 
ATOM   2317  C CG    . PRO A 1 291 ? 85.090  -50.185  6.548   1.00 70.51  ? 291 PRO A CG    1 
ATOM   2318  C CD    . PRO A 1 291 ? 84.849  -49.760  7.972   1.00 70.73  ? 291 PRO A CD    1 
ATOM   2319  N N     . ALA A 1 292 ? 87.062  -53.748  7.405   1.00 69.38  ? 292 ALA A N     1 
ATOM   2320  C CA    . ALA A 1 292 ? 88.462  -54.167  7.423   1.00 68.49  ? 292 ALA A CA    1 
ATOM   2321  C C     . ALA A 1 292 ? 89.286  -53.309  6.488   1.00 68.05  ? 292 ALA A C     1 
ATOM   2322  O O     . ALA A 1 292 ? 90.445  -53.015  6.782   1.00 67.73  ? 292 ALA A O     1 
ATOM   2323  C CB    . ALA A 1 292 ? 88.606  -55.610  7.061   1.00 69.09  ? 292 ALA A CB    1 
ATOM   2324  N N     . SER A 1 293 ? 88.676  -52.891  5.376   1.00 68.18  ? 293 SER A N     1 
ATOM   2325  C CA    . SER A 1 293 ? 89.371  -52.095  4.349   1.00 67.85  ? 293 SER A CA    1 
ATOM   2326  C C     . SER A 1 293 ? 89.837  -50.726  4.847   1.00 66.78  ? 293 SER A C     1 
ATOM   2327  O O     . SER A 1 293 ? 90.630  -50.058  4.182   1.00 66.91  ? 293 SER A O     1 
ATOM   2328  C CB    . SER A 1 293 ? 88.489  -51.915  3.116   1.00 68.80  ? 293 SER A CB    1 
ATOM   2329  O OG    . SER A 1 293 ? 87.339  -51.162  3.440   1.00 70.23  ? 293 SER A OG    1 
ATOM   2330  N N     . THR A 1 294 ? 89.316  -50.310  5.999   1.00 65.72  ? 294 THR A N     1 
ATOM   2331  C CA    . THR A 1 294 ? 89.783  -49.124  6.691   1.00 64.23  ? 294 THR A CA    1 
ATOM   2332  C C     . THR A 1 294 ? 90.909  -49.521  7.630   1.00 62.88  ? 294 THR A C     1 
ATOM   2333  O O     . THR A 1 294 ? 92.000  -48.966  7.562   1.00 62.27  ? 294 THR A O     1 
ATOM   2334  C CB    . THR A 1 294 ? 88.654  -48.472  7.503   1.00 64.65  ? 294 THR A CB    1 
ATOM   2335  O OG1   . THR A 1 294 ? 87.616  -48.024  6.619   1.00 65.16  ? 294 THR A OG1   1 
ATOM   2336  C CG2   . THR A 1 294 ? 89.196  -47.285  8.299   1.00 64.85  ? 294 THR A CG2   1 
ATOM   2337  N N     . ILE A 1 295 ? 90.627  -50.484  8.505   1.00 62.20  ? 295 ILE A N     1 
ATOM   2338  C CA    . ILE A 1 295 ? 91.595  -50.982  9.486   1.00 61.44  ? 295 ILE A CA    1 
ATOM   2339  C C     . ILE A 1 295 ? 92.904  -51.379  8.831   1.00 61.26  ? 295 ILE A C     1 
ATOM   2340  O O     . ILE A 1 295 ? 93.962  -51.239  9.429   1.00 61.05  ? 295 ILE A O     1 
ATOM   2341  C CB    . ILE A 1 295 ? 91.032  -52.168  10.294  1.00 61.49  ? 295 ILE A CB    1 
ATOM   2342  C CG1   . ILE A 1 295 ? 90.113  -51.649  11.400  1.00 61.50  ? 295 ILE A CG1   1 
ATOM   2343  C CG2   . ILE A 1 295 ? 92.146  -52.977  10.906  1.00 60.82  ? 295 ILE A CG2   1 
ATOM   2344  C CD1   . ILE A 1 295 ? 89.304  -52.713  12.104  1.00 61.49  ? 295 ILE A CD1   1 
ATOM   2345  N N     . GLN A 1 296 ? 92.817  -51.849  7.592   1.00 61.59  ? 296 GLN A N     1 
ATOM   2346  C CA    . GLN A 1 296 ? 93.984  -52.261  6.815   1.00 61.70  ? 296 GLN A CA    1 
ATOM   2347  C C     . GLN A 1 296 ? 94.897  -51.092  6.419   1.00 61.13  ? 296 GLN A C     1 
ATOM   2348  O O     . GLN A 1 296 ? 96.072  -51.300  6.125   1.00 61.30  ? 296 GLN A O     1 
ATOM   2349  C CB    . GLN A 1 296 ? 93.536  -53.024  5.564   1.00 62.30  ? 296 GLN A CB    1 
ATOM   2350  C CG    . GLN A 1 296 ? 94.666  -53.627  4.749   1.00 63.20  ? 296 GLN A CG    1 
ATOM   2351  C CD    . GLN A 1 296 ? 94.177  -54.345  3.521   1.00 65.28  ? 296 GLN A CD    1 
ATOM   2352  O OE1   . GLN A 1 296 ? 93.028  -54.801  3.462   1.00 67.64  ? 296 GLN A OE1   1 
ATOM   2353  N NE2   . GLN A 1 296 ? 95.045  -54.457  2.524   1.00 65.40  ? 296 GLN A NE2   1 
ATOM   2354  N N     . VAL A 1 297 ? 94.363  -49.874  6.411   1.00 60.64  ? 297 VAL A N     1 
ATOM   2355  C CA    . VAL A 1 297 ? 95.128  -48.721  5.924   1.00 60.14  ? 297 VAL A CA    1 
ATOM   2356  C C     . VAL A 1 297 ? 95.319  -47.580  6.937   1.00 59.76  ? 297 VAL A C     1 
ATOM   2357  O O     . VAL A 1 297 ? 96.046  -46.635  6.647   1.00 59.61  ? 297 VAL A O     1 
ATOM   2358  C CB    . VAL A 1 297 ? 94.565  -48.170  4.585   1.00 60.52  ? 297 VAL A CB    1 
ATOM   2359  C CG1   . VAL A 1 297 ? 94.754  -49.177  3.464   1.00 60.36  ? 297 VAL A CG1   1 
ATOM   2360  C CG2   . VAL A 1 297 ? 93.091  -47.775  4.722   1.00 61.25  ? 297 VAL A CG2   1 
ATOM   2361  N N     . LEU A 1 298 ? 94.675  -47.673  8.105   1.00 59.49  ? 298 LEU A N     1 
ATOM   2362  C CA    . LEU A 1 298 ? 94.908  -46.748  9.223   1.00 59.38  ? 298 LEU A CA    1 
ATOM   2363  C C     . LEU A 1 298 ? 96.400  -46.494  9.375   1.00 59.80  ? 298 LEU A C     1 
ATOM   2364  O O     . LEU A 1 298 ? 97.190  -47.422  9.266   1.00 60.19  ? 298 LEU A O     1 
ATOM   2365  C CB    . LEU A 1 298 ? 94.350  -47.320  10.529  1.00 58.97  ? 298 LEU A CB    1 
ATOM   2366  C CG    . LEU A 1 298 ? 92.849  -47.526  10.692  1.00 58.12  ? 298 LEU A CG    1 
ATOM   2367  C CD1   . LEU A 1 298 ? 92.592  -48.134  12.022  1.00 57.72  ? 298 LEU A CD1   1 
ATOM   2368  C CD2   . LEU A 1 298 ? 92.095  -46.226  10.594  1.00 58.48  ? 298 LEU A CD2   1 
ATOM   2369  N N     . GLY A 1 299 ? 96.784  -45.252  9.652   1.00 60.54  ? 299 GLY A N     1 
ATOM   2370  C CA    . GLY A 1 299 ? 98.144  -44.782  9.342   1.00 61.49  ? 299 GLY A CA    1 
ATOM   2371  C C     . GLY A 1 299 ? 98.056  -44.486  7.859   1.00 62.11  ? 299 GLY A C     1 
ATOM   2372  O O     . GLY A 1 299 ? 96.958  -44.293  7.349   1.00 62.50  ? 299 GLY A O     1 
ATOM   2373  N N     . ALA A 1 300 ? 99.170  -44.455  7.138   1.00 62.71  ? 300 ALA A N     1 
ATOM   2374  C CA    . ALA A 1 300 ? 99.102  -44.405  5.646   1.00 62.96  ? 300 ALA A CA    1 
ATOM   2375  C C     . ALA A 1 300 ? 98.015  -43.501  5.015   1.00 62.92  ? 300 ALA A C     1 
ATOM   2376  O O     . ALA A 1 300 ? 97.588  -43.743  3.886   1.00 62.87  ? 300 ALA A O     1 
ATOM   2377  C CB    . ALA A 1 300 ? 98.973  -45.825  5.077   1.00 62.75  ? 300 ALA A CB    1 
ATOM   2378  N N     . GLU A 1 301 ? 97.572  -42.469  5.729   1.00 62.93  ? 301 GLU A N     1 
ATOM   2379  C CA    . GLU A 1 301 ? 96.542  -41.602  5.181   1.00 63.16  ? 301 GLU A CA    1 
ATOM   2380  C C     . GLU A 1 301 ? 97.080  -40.768  4.025   1.00 64.15  ? 301 GLU A C     1 
ATOM   2381  O O     . GLU A 1 301 ? 96.380  -40.581  3.025   1.00 64.99  ? 301 GLU A O     1 
ATOM   2382  C CB    . GLU A 1 301 ? 95.886  -40.732  6.249   1.00 62.94  ? 301 GLU A CB    1 
ATOM   2383  C CG    . GLU A 1 301 ? 94.940  -41.490  7.133   1.00 61.50  ? 301 GLU A CG    1 
ATOM   2384  C CD    . GLU A 1 301 ? 95.634  -42.128  8.318   1.00 60.62  ? 301 GLU A CD    1 
ATOM   2385  O OE1   . GLU A 1 301 ? 96.844  -41.869  8.518   1.00 60.22  ? 301 GLU A OE1   1 
ATOM   2386  O OE2   . GLU A 1 301 ? 94.969  -42.891  9.055   1.00 60.61  ? 301 GLU A OE2   1 
ATOM   2387  N N     . LYS A 1 302 ? 98.317  -40.285  4.135   1.00 64.41  ? 302 LYS A N     1 
ATOM   2388  C CA    . LYS A 1 302 ? 98.908  -39.553  3.014   1.00 65.47  ? 302 LYS A CA    1 
ATOM   2389  C C     . LYS A 1 302 ? 98.901  -40.425  1.764   1.00 65.28  ? 302 LYS A C     1 
ATOM   2390  O O     . LYS A 1 302 ? 98.618  -39.948  0.667   1.00 66.28  ? 302 LYS A O     1 
ATOM   2391  C CB    . LYS A 1 302 ? 100.337 -39.089  3.298   1.00 65.96  ? 302 LYS A CB    1 
ATOM   2392  C CG    . LYS A 1 302 ? 100.950 -38.375  2.095   1.00 67.60  ? 302 LYS A CG    1 
ATOM   2393  C CD    . LYS A 1 302 ? 102.375 -37.953  2.327   1.00 70.69  ? 302 LYS A CD    1 
ATOM   2394  C CE    . LYS A 1 302 ? 102.899 -37.179  1.119   1.00 72.72  ? 302 LYS A CE    1 
ATOM   2395  N NZ    . LYS A 1 302 ? 104.031 -36.286  1.497   1.00 74.16  ? 302 LYS A NZ    1 
ATOM   2396  N N     . ALA A 1 303 ? 99.209  -41.703  1.949   1.00 64.12  ? 303 ALA A N     1 
ATOM   2397  C CA    . ALA A 1 303 ? 99.218  -42.649  0.859   1.00 63.85  ? 303 ALA A CA    1 
ATOM   2398  C C     . ALA A 1 303 ? 97.817  -42.887  0.334   1.00 63.76  ? 303 ALA A C     1 
ATOM   2399  O O     . ALA A 1 303 ? 97.628  -43.009  -0.881  1.00 64.50  ? 303 ALA A O     1 
ATOM   2400  C CB    . ALA A 1 303 ? 99.845  -43.964  1.302   1.00 63.61  ? 303 ALA A CB    1 
ATOM   2401  N N     . LEU A 1 304 ? 96.839  -42.951  1.238   1.00 62.84  ? 304 LEU A N     1 
ATOM   2402  C CA    . LEU A 1 304 ? 95.475  -43.283  0.839   1.00 62.73  ? 304 LEU A CA    1 
ATOM   2403  C C     . LEU A 1 304 ? 94.873  -42.156  0.021   1.00 63.50  ? 304 LEU A C     1 
ATOM   2404  O O     . LEU A 1 304 ? 94.474  -42.362  -1.121  1.00 64.09  ? 304 LEU A O     1 
ATOM   2405  C CB    . LEU A 1 304 ? 94.585  -43.601  2.043   1.00 62.14  ? 304 LEU A CB    1 
ATOM   2406  C CG    . LEU A 1 304 ? 93.568  -44.750  1.947   1.00 62.01  ? 304 LEU A CG    1 
ATOM   2407  C CD1   . LEU A 1 304 ? 92.426  -44.512  2.915   1.00 63.32  ? 304 LEU A CD1   1 
ATOM   2408  C CD2   . LEU A 1 304 ? 92.992  -44.950  0.564   1.00 63.11  ? 304 LEU A CD2   1 
ATOM   2409  N N     . PHE A 1 305 ? 94.837  -40.961  0.592   1.00 63.64  ? 305 PHE A N     1 
ATOM   2410  C CA    . PHE A 1 305 ? 94.178  -39.853  -0.074  1.00 64.86  ? 305 PHE A CA    1 
ATOM   2411  C C     . PHE A 1 305 ? 94.878  -39.419  -1.355  1.00 66.02  ? 305 PHE A C     1 
ATOM   2412  O O     . PHE A 1 305 ? 94.275  -38.747  -2.191  1.00 67.32  ? 305 PHE A O     1 
ATOM   2413  C CB    . PHE A 1 305 ? 93.928  -38.692  0.888   1.00 64.93  ? 305 PHE A CB    1 
ATOM   2414  C CG    . PHE A 1 305 ? 92.916  -39.016  1.958   1.00 64.14  ? 305 PHE A CG    1 
ATOM   2415  C CD1   . PHE A 1 305 ? 91.551  -39.080  1.653   1.00 63.83  ? 305 PHE A CD1   1 
ATOM   2416  C CD2   . PHE A 1 305 ? 93.325  -39.278  3.263   1.00 62.78  ? 305 PHE A CD2   1 
ATOM   2417  C CE1   . PHE A 1 305 ? 90.619  -39.398  2.627   1.00 62.43  ? 305 PHE A CE1   1 
ATOM   2418  C CE2   . PHE A 1 305 ? 92.402  -39.585  4.243   1.00 62.02  ? 305 PHE A CE2   1 
ATOM   2419  C CZ    . PHE A 1 305 ? 91.042  -39.650  3.922   1.00 62.17  ? 305 PHE A CZ    1 
ATOM   2420  N N     . ARG A 1 306 ? 96.135  -39.825  -1.520  1.00 65.77  ? 306 ARG A N     1 
ATOM   2421  C CA    . ARG A 1 306 ? 96.856  -39.556  -2.751  1.00 66.71  ? 306 ARG A CA    1 
ATOM   2422  C C     . ARG A 1 306 ? 96.230  -40.419  -3.816  1.00 67.52  ? 306 ARG A C     1 
ATOM   2423  O O     . ARG A 1 306 ? 95.964  -39.956  -4.918  1.00 68.91  ? 306 ARG A O     1 
ATOM   2424  C CB    . ARG A 1 306 ? 98.337  -39.886  -2.612  1.00 66.00  ? 306 ARG A CB    1 
ATOM   2425  C CG    . ARG A 1 306 ? 99.183  -39.366  -3.746  1.00 66.89  ? 306 ARG A CG    1 
ATOM   2426  C CD    . ARG A 1 306 ? 100.366 -40.271  -4.012  1.00 67.23  ? 306 ARG A CD    1 
ATOM   2427  N NE    . ARG A 1 306 ? 101.503 -40.022  -3.123  1.00 67.73  ? 306 ARG A NE    1 
ATOM   2428  C CZ    . ARG A 1 306 ? 101.916 -40.844  -2.157  1.00 67.02  ? 306 ARG A CZ    1 
ATOM   2429  N NH1   . ARG A 1 306 ? 102.963 -40.515  -1.425  1.00 67.40  ? 306 ARG A NH1   1 
ATOM   2430  N NH2   . ARG A 1 306 ? 101.295 -41.992  -1.918  1.00 67.04  ? 306 ARG A NH2   1 
ATOM   2431  N N     . ALA A 1 307 ? 95.974  -41.675  -3.462  1.00 67.45  ? 307 ALA A N     1 
ATOM   2432  C CA    . ALA A 1 307 ? 95.382  -42.646  -4.383  1.00 68.33  ? 307 ALA A CA    1 
ATOM   2433  C C     . ALA A 1 307 ? 93.939  -42.306  -4.685  1.00 69.32  ? 307 ALA A C     1 
ATOM   2434  O O     . ALA A 1 307 ? 93.512  -42.419  -5.821  1.00 70.33  ? 307 ALA A O     1 
ATOM   2435  C CB    . ALA A 1 307 ? 95.484  -44.055  -3.822  1.00 67.34  ? 307 ALA A CB    1 
ATOM   2436  N N     . LEU A 1 308 ? 93.199  -41.879  -3.669  1.00 69.58  ? 308 LEU A N     1 
ATOM   2437  C CA    . LEU A 1 308 ? 91.798  -41.542  -3.858  1.00 71.41  ? 308 LEU A CA    1 
ATOM   2438  C C     . LEU A 1 308 ? 91.596  -40.294  -4.703  1.00 73.70  ? 308 LEU A C     1 
ATOM   2439  O O     . LEU A 1 308 ? 90.611  -40.211  -5.431  1.00 75.08  ? 308 LEU A O     1 
ATOM   2440  C CB    . LEU A 1 308 ? 91.069  -41.394  -2.526  1.00 70.54  ? 308 LEU A CB    1 
ATOM   2441  C CG    . LEU A 1 308 ? 90.973  -42.600  -1.595  1.00 69.41  ? 308 LEU A CG    1 
ATOM   2442  C CD1   . LEU A 1 308 ? 90.237  -42.184  -0.347  1.00 69.52  ? 308 LEU A CD1   1 
ATOM   2443  C CD2   . LEU A 1 308 ? 90.275  -43.788  -2.232  1.00 69.96  ? 308 LEU A CD2   1 
ATOM   2444  N N     . ARG A 1 309 ? 92.516  -39.335  -4.612  1.00 74.86  ? 309 ARG A N     1 
ATOM   2445  C CA    . ARG A 1 309 ? 92.407  -38.096  -5.386  1.00 77.69  ? 309 ARG A CA    1 
ATOM   2446  C C     . ARG A 1 309 ? 92.762  -38.296  -6.848  1.00 79.05  ? 309 ARG A C     1 
ATOM   2447  O O     . ARG A 1 309 ? 92.165  -37.673  -7.723  1.00 80.96  ? 309 ARG A O     1 
ATOM   2448  C CB    . ARG A 1 309 ? 93.290  -36.996  -4.804  1.00 78.02  ? 309 ARG A CB    1 
ATOM   2449  C CG    . ARG A 1 309 ? 92.701  -36.295  -3.584  1.00 80.49  ? 309 ARG A CG    1 
ATOM   2450  C CD    . ARG A 1 309 ? 93.756  -35.412  -2.918  1.00 85.45  ? 309 ARG A CD    1 
ATOM   2451  N NE    . ARG A 1 309 ? 93.265  -34.693  -1.738  1.00 88.31  ? 309 ARG A NE    1 
ATOM   2452  C CZ    . ARG A 1 309 ? 92.642  -33.514  -1.774  1.00 91.18  ? 309 ARG A CZ    1 
ATOM   2453  N NH1   . ARG A 1 309 ? 92.403  -32.914  -2.936  1.00 93.73  ? 309 ARG A NH1   1 
ATOM   2454  N NH2   . ARG A 1 309 ? 92.246  -32.934  -0.645  1.00 91.91  ? 309 ARG A NH2   1 
ATOM   2455  N N     . SER A 1 310 ? 93.722  -39.179  -7.108  1.00 78.73  ? 310 SER A N     1 
ATOM   2456  C CA    . SER A 1 310 ? 94.279  -39.341  -8.448  1.00 80.08  ? 310 SER A CA    1 
ATOM   2457  C C     . SER A 1 310 ? 93.922  -40.658  -9.134  1.00 80.07  ? 310 SER A C     1 
ATOM   2458  O O     . SER A 1 310 ? 94.169  -40.820  -10.326 1.00 81.33  ? 310 SER A O     1 
ATOM   2459  C CB    . SER A 1 310 ? 95.800  -39.193  -8.391  1.00 79.93  ? 310 SER A CB    1 
ATOM   2460  O OG    . SER A 1 310 ? 96.372  -40.190  -7.557  1.00 78.86  ? 310 SER A OG    1 
ATOM   2461  N N     . GLY A 1 311 ? 93.357  -41.599  -8.387  1.00 78.90  ? 311 GLY A N     1 
ATOM   2462  C CA    . GLY A 1 311 ? 93.029  -42.909  -8.943  1.00 79.07  ? 311 GLY A CA    1 
ATOM   2463  C C     . GLY A 1 311 ? 94.260  -43.762  -9.206  1.00 78.59  ? 311 GLY A C     1 
ATOM   2464  O O     . GLY A 1 311 ? 94.257  -44.626  -10.086 1.00 79.34  ? 311 GLY A O     1 
ATOM   2465  N N     . GLY A 1 312 ? 95.319  -43.512  -8.446  1.00 77.61  ? 312 GLY A N     1 
ATOM   2466  C CA    . GLY A 1 312 ? 96.527  -44.319  -8.527  1.00 77.06  ? 312 GLY A CA    1 
ATOM   2467  C C     . GLY A 1 312 ? 96.440  -45.529  -7.618  1.00 75.89  ? 312 GLY A C     1 
ATOM   2468  O O     . GLY A 1 312 ? 95.348  -45.923  -7.195  1.00 75.43  ? 312 GLY A O     1 
ATOM   2469  N N     . ARG A 1 313 ? 97.604  -46.107  -7.316  1.00 75.42  ? 313 ARG A N     1 
ATOM   2470  C CA    . ARG A 1 313 ? 97.713  -47.301  -6.479  1.00 74.52  ? 313 ARG A CA    1 
ATOM   2471  C C     . ARG A 1 313 ? 97.618  -46.939  -5.005  1.00 72.93  ? 313 ARG A C     1 
ATOM   2472  O O     . ARG A 1 313 ? 98.353  -46.062  -4.541  1.00 72.91  ? 313 ARG A O     1 
ATOM   2473  C CB    . ARG A 1 313 ? 99.041  -48.012  -6.733  1.00 74.96  ? 313 ARG A CB    1 
ATOM   2474  C CG    . ARG A 1 313 ? 99.271  -48.399  -8.170  1.00 77.65  ? 313 ARG A CG    1 
ATOM   2475  C CD    . ARG A 1 313 ? 100.761 -48.346  -8.528  1.00 81.12  ? 313 ARG A CD    1 
ATOM   2476  N NE    . ARG A 1 313 ? 100.915 -48.176  -9.971  1.00 84.78  ? 313 ARG A NE    1 
ATOM   2477  C CZ    . ARG A 1 313 ? 100.846 -49.163  -10.866 1.00 87.13  ? 313 ARG A CZ    1 
ATOM   2478  N NH1   . ARG A 1 313 ? 100.652 -50.423  -10.476 1.00 87.23  ? 313 ARG A NH1   1 
ATOM   2479  N NH2   . ARG A 1 313 ? 100.971 -48.890  -12.160 1.00 89.06  ? 313 ARG A NH2   1 
ATOM   2480  N N     . PRO A 1 314 ? 96.715  -47.614  -4.266  1.00 71.88  ? 314 PRO A N     1 
ATOM   2481  C CA    . PRO A 1 314 ? 96.552  -47.416  -2.822  1.00 70.68  ? 314 PRO A CA    1 
ATOM   2482  C C     . PRO A 1 314 ? 97.608  -48.147  -1.970  1.00 69.81  ? 314 PRO A C     1 
ATOM   2483  O O     . PRO A 1 314 ? 98.304  -49.036  -2.461  1.00 70.05  ? 314 PRO A O     1 
ATOM   2484  C CB    . PRO A 1 314 ? 95.152  -47.981  -2.555  1.00 70.49  ? 314 PRO A CB    1 
ATOM   2485  C CG    . PRO A 1 314 ? 94.957  -49.013  -3.598  1.00 71.11  ? 314 PRO A CG    1 
ATOM   2486  C CD    . PRO A 1 314 ? 95.728  -48.568  -4.805  1.00 72.17  ? 314 PRO A CD    1 
ATOM   2487  N N     . PRO A 1 315 ? 97.733  -47.768  -0.695  1.00 69.04  ? 315 PRO A N     1 
ATOM   2488  C CA    . PRO A 1 315 ? 98.616  -48.525  0.188   1.00 68.63  ? 315 PRO A CA    1 
ATOM   2489  C C     . PRO A 1 315 ? 98.053  -49.910  0.466   1.00 68.46  ? 315 PRO A C     1 
ATOM   2490  O O     . PRO A 1 315 ? 96.837  -50.084  0.503   1.00 68.10  ? 315 PRO A O     1 
ATOM   2491  C CB    . PRO A 1 315 ? 98.640  -47.684  1.476   1.00 68.25  ? 315 PRO A CB    1 
ATOM   2492  C CG    . PRO A 1 315 ? 97.427  -46.820  1.407   1.00 68.04  ? 315 PRO A CG    1 
ATOM   2493  C CD    . PRO A 1 315 ? 97.184  -46.566  -0.044  1.00 68.92  ? 315 PRO A CD    1 
ATOM   2494  N N     . LYS A 1 316 ? 98.936  -50.885  0.650   1.00 68.79  ? 316 LYS A N     1 
ATOM   2495  C CA    . LYS A 1 316 ? 98.520  -52.253  0.972   1.00 69.04  ? 316 LYS A CA    1 
ATOM   2496  C C     . LYS A 1 316 ? 98.208  -52.365  2.454   1.00 68.71  ? 316 LYS A C     1 
ATOM   2497  O O     . LYS A 1 316 ? 97.372  -53.172  2.862   1.00 68.71  ? 316 LYS A O     1 
ATOM   2498  C CB    . LYS A 1 316 ? 99.625  -53.260  0.650   1.00 69.38  ? 316 LYS A CB    1 
ATOM   2499  C CG    . LYS A 1 316 ? 100.061 -53.350  -0.796  1.00 69.83  ? 316 LYS A CG    1 
ATOM   2500  C CD    . LYS A 1 316 ? 101.050 -54.498  -0.956  1.00 69.37  ? 316 LYS A CD    1 
ATOM   2501  C CE    . LYS A 1 316 ? 102.173 -54.127  -1.884  1.00 69.80  ? 316 LYS A CE    1 
ATOM   2502  N NZ    . LYS A 1 316 ? 102.747 -52.803  -1.511  1.00 69.17  ? 316 LYS A NZ    1 
ATOM   2503  N N     . HIS A 1 317 ? 98.895  -51.542  3.245   1.00 68.54  ? 317 HIS A N     1 
ATOM   2504  C CA    . HIS A 1 317 ? 98.923  -51.664  4.698   1.00 68.36  ? 317 HIS A CA    1 
ATOM   2505  C C     . HIS A 1 317 ? 99.274  -50.318  5.329   1.00 68.38  ? 317 HIS A C     1 
ATOM   2506  O O     . HIS A 1 317 ? 100.083 -49.558  4.795   1.00 68.45  ? 317 HIS A O     1 
ATOM   2507  C CB    . HIS A 1 317 ? 99.973  -52.691  5.091   1.00 68.46  ? 317 HIS A CB    1 
ATOM   2508  C CG    . HIS A 1 317 ? 101.176 -52.661  4.204   1.00 69.18  ? 317 HIS A CG    1 
ATOM   2509  N ND1   . HIS A 1 317 ? 101.982 -51.550  4.082   1.00 69.49  ? 317 HIS A ND1   1 
ATOM   2510  C CD2   . HIS A 1 317 ? 101.693 -53.591  3.370   1.00 70.20  ? 317 HIS A CD2   1 
ATOM   2511  C CE1   . HIS A 1 317 ? 102.948 -51.797  3.215   1.00 69.74  ? 317 HIS A CE1   1 
ATOM   2512  N NE2   . HIS A 1 317 ? 102.798 -53.031  2.772   1.00 71.00  ? 317 HIS A NE2   1 
ATOM   2513  N N     . GLY A 1 318 ? 98.658  -50.033  6.470   1.00 68.60  ? 318 GLY A N     1 
ATOM   2514  C CA    . GLY A 1 318 ? 98.931  -48.817  7.208   1.00 68.81  ? 318 GLY A CA    1 
ATOM   2515  C C     . GLY A 1 318 ? 99.844  -49.157  8.355   1.00 69.36  ? 318 GLY A C     1 
ATOM   2516  O O     . GLY A 1 318 ? 100.960 -49.622  8.138   1.00 69.83  ? 318 GLY A O     1 
ATOM   2517  N N     . ILE A 1 319 ? 99.364  -48.948  9.580   1.00 69.63  ? 319 ILE A N     1 
ATOM   2518  C CA    . ILE A 1 319 ? 100.159 -49.230  10.782  1.00 70.12  ? 319 ILE A CA    1 
ATOM   2519  C C     . ILE A 1 319 ? 100.297 -50.737  11.003  1.00 70.59  ? 319 ILE A C     1 
ATOM   2520  O O     . ILE A 1 319 ? 101.152 -51.201  11.760  1.00 70.84  ? 319 ILE A O     1 
ATOM   2521  C CB    . ILE A 1 319 ? 99.601  -48.504  12.037  1.00 70.05  ? 319 ILE A CB    1 
ATOM   2522  C CG1   . ILE A 1 319 ? 100.702 -48.323  13.081  1.00 70.93  ? 319 ILE A CG1   1 
ATOM   2523  C CG2   . ILE A 1 319 ? 98.370  -49.206  12.608  1.00 69.88  ? 319 ILE A CG2   1 
ATOM   2524  C CD1   . ILE A 1 319 ? 101.848 -47.440  12.591  1.00 72.82  ? 319 ILE A CD1   1 
ATOM   2525  N N     . ILE A 1 320 ? 99.452  -51.482  10.293  1.00 70.84  ? 320 ILE A N     1 
ATOM   2526  C CA    . ILE A 1 320 ? 99.466  -52.950  10.249  1.00 71.37  ? 320 ILE A CA    1 
ATOM   2527  C C     . ILE A 1 320 ? 100.804 -53.531  9.721   1.00 71.95  ? 320 ILE A C     1 
ATOM   2528  O O     . ILE A 1 320 ? 101.165 -54.671  10.027  1.00 72.56  ? 320 ILE A O     1 
ATOM   2529  C CB    . ILE A 1 320 ? 98.185  -53.452  9.483   1.00 71.14  ? 320 ILE A CB    1 
ATOM   2530  C CG1   . ILE A 1 320 ? 96.973  -53.327  10.393  1.00 71.65  ? 320 ILE A CG1   1 
ATOM   2531  C CG2   . ILE A 1 320 ? 98.271  -54.869  9.013   1.00 71.23  ? 320 ILE A CG2   1 
ATOM   2532  C CD1   . ILE A 1 320 ? 97.298  -53.546  11.869  1.00 72.34  ? 320 ILE A CD1   1 
ATOM   2533  N N     . PHE A 1 321 ? 101.550 -52.728  8.965   1.00 71.79  ? 321 PHE A N     1 
ATOM   2534  C CA    . PHE A 1 321 ? 102.858 -53.128  8.449   1.00 72.39  ? 321 PHE A CA    1 
ATOM   2535  C C     . PHE A 1 321 ? 103.754 -53.683  9.545   1.00 73.07  ? 321 PHE A C     1 
ATOM   2536  O O     . PHE A 1 321 ? 104.598 -54.533  9.286   1.00 73.70  ? 321 PHE A O     1 
ATOM   2537  C CB    . PHE A 1 321 ? 103.534 -51.929  7.780   1.00 72.35  ? 321 PHE A CB    1 
ATOM   2538  C CG    . PHE A 1 321 ? 104.760 -52.274  6.975   1.00 72.98  ? 321 PHE A CG    1 
ATOM   2539  C CD1   . PHE A 1 321 ? 104.665 -53.053  5.825   1.00 73.00  ? 321 PHE A CD1   1 
ATOM   2540  C CD2   . PHE A 1 321 ? 106.010 -51.781  7.343   1.00 73.83  ? 321 PHE A CD2   1 
ATOM   2541  C CE1   . PHE A 1 321 ? 105.809 -53.356  5.062   1.00 73.88  ? 321 PHE A CE1   1 
ATOM   2542  C CE2   . PHE A 1 321 ? 107.162 -52.078  6.582   1.00 74.47  ? 321 PHE A CE2   1 
ATOM   2543  C CZ    . PHE A 1 321 ? 107.059 -52.866  5.445   1.00 73.77  ? 321 PHE A CZ    1 
ATOM   2544  N N     . GLN A 1 322 ? 103.554 -53.204  10.768  1.00 73.24  ? 322 GLN A N     1 
ATOM   2545  C CA    . GLN A 1 322 ? 104.407 -53.567  11.895  1.00 74.51  ? 322 GLN A CA    1 
ATOM   2546  C C     . GLN A 1 322 ? 104.270 -55.027  12.326  1.00 75.74  ? 322 GLN A C     1 
ATOM   2547  O O     . GLN A 1 322 ? 105.154 -55.558  13.008  1.00 76.68  ? 322 GLN A O     1 
ATOM   2548  C CB    . GLN A 1 322 ? 104.149 -52.636  13.082  1.00 74.29  ? 322 GLN A CB    1 
ATOM   2549  C CG    . GLN A 1 322 ? 104.867 -51.300  12.998  1.00 73.33  ? 322 GLN A CG    1 
ATOM   2550  C CD    . GLN A 1 322 ? 104.188 -50.211  13.827  1.00 72.69  ? 322 GLN A CD    1 
ATOM   2551  O OE1   . GLN A 1 322 ? 103.457 -50.490  14.782  1.00 71.71  ? 322 GLN A OE1   1 
ATOM   2552  N NE2   . GLN A 1 322 ? 104.436 -48.955  13.459  1.00 72.93  ? 322 GLN A NE2   1 
ATOM   2553  N N     . TYR A 1 323 ? 103.162 -55.660  11.931  1.00 76.13  ? 323 TYR A N     1 
ATOM   2554  C CA    . TYR A 1 323 ? 102.907 -57.081  12.191  1.00 77.35  ? 323 TYR A CA    1 
ATOM   2555  C C     . TYR A 1 323 ? 104.027 -57.927  11.568  1.00 78.75  ? 323 TYR A C     1 
ATOM   2556  O O     . TYR A 1 323 ? 104.251 -57.845  10.351  1.00 78.61  ? 323 TYR A O     1 
ATOM   2557  C CB    . TYR A 1 323 ? 101.546 -57.478  11.616  1.00 76.56  ? 323 TYR A CB    1 
ATOM   2558  C CG    . TYR A 1 323 ? 101.063 -58.852  12.009  1.00 77.81  ? 323 TYR A CG    1 
ATOM   2559  C CD1   . TYR A 1 323 ? 100.765 -59.155  13.340  1.00 79.04  ? 323 TYR A CD1   1 
ATOM   2560  C CD2   . TYR A 1 323 ? 100.868 -59.846  11.049  1.00 78.71  ? 323 TYR A CD2   1 
ATOM   2561  C CE1   . TYR A 1 323 ? 100.311 -60.426  13.713  1.00 80.05  ? 323 TYR A CE1   1 
ATOM   2562  C CE2   . TYR A 1 323 ? 100.406 -61.119  11.409  1.00 79.84  ? 323 TYR A CE2   1 
ATOM   2563  C CZ    . TYR A 1 323 ? 100.136 -61.402  12.746  1.00 80.67  ? 323 TYR A CZ    1 
ATOM   2564  O OH    . TYR A 1 323 ? 99.686  -62.650  13.125  1.00 82.04  ? 323 TYR A OH    1 
ATOM   2565  N N     . PRO A 1 324 ? 104.747 -58.723  12.398  1.00 80.31  ? 324 PRO A N     1 
ATOM   2566  C CA    . PRO A 1 324 ? 105.894 -59.506  11.932  1.00 81.69  ? 324 PRO A CA    1 
ATOM   2567  C C     . PRO A 1 324 ? 105.650 -60.191  10.582  1.00 82.31  ? 324 PRO A C     1 
ATOM   2568  O O     . PRO A 1 324 ? 106.482 -60.064  9.671   1.00 82.69  ? 324 PRO A O     1 
ATOM   2569  C CB    . PRO A 1 324 ? 106.079 -60.543  13.039  1.00 82.76  ? 324 PRO A CB    1 
ATOM   2570  C CG    . PRO A 1 324 ? 105.628 -59.853  14.250  1.00 82.30  ? 324 PRO A CG    1 
ATOM   2571  C CD    . PRO A 1 324 ? 104.494 -58.950  13.836  1.00 80.83  ? 324 PRO A CD    1 
ATOM   2572  N N     . ALA A 1 325 ? 104.510 -60.874  10.447  1.00 82.53  ? 325 ALA A N     1 
ATOM   2573  C CA    . ALA A 1 325 ? 104.181 -61.593  9.215   1.00 83.14  ? 325 ALA A CA    1 
ATOM   2574  C C     . ALA A 1 325 ? 104.269 -60.747  7.944   1.00 82.65  ? 325 ALA A C     1 
ATOM   2575  O O     . ALA A 1 325 ? 104.589 -61.276  6.880   1.00 83.19  ? 325 ALA A O     1 
ATOM   2576  C CB    . ALA A 1 325 ? 102.821 -62.236  9.320   1.00 83.13  ? 325 ALA A CB    1 
ATOM   2577  N N     . ILE A 1 326 ? 104.002 -59.445  8.058   1.00 81.95  ? 326 ILE A N     1 
ATOM   2578  C CA    . ILE A 1 326 ? 103.998 -58.560  6.884   1.00 81.71  ? 326 ILE A CA    1 
ATOM   2579  C C     . ILE A 1 326 ? 105.382 -58.075  6.449   1.00 82.30  ? 326 ILE A C     1 
ATOM   2580  O O     . ILE A 1 326 ? 105.806 -58.348  5.327   1.00 82.67  ? 326 ILE A O     1 
ATOM   2581  C CB    . ILE A 1 326 ? 103.004 -57.375  7.025   1.00 80.55  ? 326 ILE A CB    1 
ATOM   2582  C CG1   . ILE A 1 326 ? 101.565 -57.902  7.062   1.00 80.44  ? 326 ILE A CG1   1 
ATOM   2583  C CG2   . ILE A 1 326 ? 103.179 -56.370  5.871   1.00 79.82  ? 326 ILE A CG2   1 
ATOM   2584  C CD1   . ILE A 1 326 ? 100.514 -56.826  7.230   1.00 79.24  ? 326 ILE A CD1   1 
ATOM   2585  N N     . HIS A 1 327 ? 106.081 -57.346  7.315   1.00 82.74  ? 327 HIS A N     1 
ATOM   2586  C CA    . HIS A 1 327 ? 107.299 -56.662  6.870   1.00 83.57  ? 327 HIS A CA    1 
ATOM   2587  C C     . HIS A 1 327 ? 108.442 -57.627  6.559   1.00 85.39  ? 327 HIS A C     1 
ATOM   2588  O O     . HIS A 1 327 ? 109.360 -57.295  5.807   1.00 85.79  ? 327 HIS A O     1 
ATOM   2589  C CB    . HIS A 1 327 ? 107.721 -55.542  7.830   1.00 83.08  ? 327 HIS A CB    1 
ATOM   2590  C CG    . HIS A 1 327 ? 108.120 -56.012  9.193   1.00 83.74  ? 327 HIS A CG    1 
ATOM   2591  N ND1   . HIS A 1 327 ? 107.212 -56.198  10.213  1.00 83.75  ? 327 HIS A ND1   1 
ATOM   2592  C CD2   . HIS A 1 327 ? 109.335 -56.299  9.716   1.00 84.64  ? 327 HIS A CD2   1 
ATOM   2593  C CE1   . HIS A 1 327 ? 107.849 -56.593  11.301  1.00 84.40  ? 327 HIS A CE1   1 
ATOM   2594  N NE2   . HIS A 1 327 ? 109.138 -56.664  11.026  1.00 85.05  ? 327 HIS A NE2   1 
ATOM   2595  N N     . THR A 1 328 ? 108.361 -58.832  7.114   1.00 86.82  ? 328 THR A N     1 
ATOM   2596  C CA    . THR A 1 328 ? 109.333 -59.872  6.815   1.00 88.75  ? 328 THR A CA    1 
ATOM   2597  C C     . THR A 1 328 ? 109.017 -60.579  5.502   1.00 89.48  ? 328 THR A C     1 
ATOM   2598  O O     . THR A 1 328 ? 109.930 -61.033  4.819   1.00 90.91  ? 328 THR A O     1 
ATOM   2599  C CB    . THR A 1 328 ? 109.393 -60.923  7.915   1.00 89.71  ? 328 THR A CB    1 
ATOM   2600  O OG1   . THR A 1 328 ? 108.960 -60.347  9.151   1.00 88.78  ? 328 THR A OG1   1 
ATOM   2601  C CG2   . THR A 1 328 ? 110.821 -61.449  8.049   1.00 91.97  ? 328 THR A CG2   1 
ATOM   2602  N N     . SER A 1 329 ? 107.730 -60.678  5.162   1.00 89.07  ? 329 SER A N     1 
ATOM   2603  C CA    . SER A 1 329 ? 107.290 -61.307  3.919   1.00 89.71  ? 329 SER A CA    1 
ATOM   2604  C C     . SER A 1 329 ? 107.629 -60.501  2.673   1.00 89.92  ? 329 SER A C     1 
ATOM   2605  O O     . SER A 1 329 ? 107.648 -59.273  2.714   1.00 88.75  ? 329 SER A O     1 
ATOM   2606  C CB    . SER A 1 329 ? 105.792 -61.549  3.950   1.00 88.92  ? 329 SER A CB    1 
ATOM   2607  O OG    . SER A 1 329 ? 105.491 -62.596  4.842   1.00 89.85  ? 329 SER A OG    1 
ATOM   2608  N N     . PRO A 1 330 ? 107.904 -61.200  1.555   1.00 91.64  ? 330 PRO A N     1 
ATOM   2609  C CA    . PRO A 1 330 ? 108.114 -60.569  0.250   1.00 92.23  ? 330 PRO A CA    1 
ATOM   2610  C C     . PRO A 1 330 ? 106.968 -59.642  -0.156  1.00 91.78  ? 330 PRO A C     1 
ATOM   2611  O O     . PRO A 1 330 ? 105.842 -59.789  0.337   1.00 91.34  ? 330 PRO A O     1 
ATOM   2612  C CB    . PRO A 1 330 ? 108.201 -61.762  -0.711  1.00 93.40  ? 330 PRO A CB    1 
ATOM   2613  C CG    . PRO A 1 330 ? 107.862 -62.977  0.104   1.00 93.71  ? 330 PRO A CG    1 
ATOM   2614  C CD    . PRO A 1 330 ? 108.198 -62.642  1.502   1.00 93.06  ? 330 PRO A CD    1 
ATOM   2615  N N     . ARG A 1 331 ? 107.261 -58.708  -1.060  1.00 92.37  ? 331 ARG A N     1 
ATOM   2616  C CA    . ARG A 1 331 ? 106.333 -57.618  -1.397  1.00 92.17  ? 331 ARG A CA    1 
ATOM   2617  C C     . ARG A 1 331 ? 104.986 -58.081  -1.962  1.00 92.30  ? 331 ARG A C     1 
ATOM   2618  O O     . ARG A 1 331 ? 103.964 -57.460  -1.686  1.00 91.57  ? 331 ARG A O     1 
ATOM   2619  C CB    . ARG A 1 331 ? 106.991 -56.583  -2.335  1.00 92.55  ? 331 ARG A CB    1 
ATOM   2620  C CG    . ARG A 1 331 ? 108.525 -56.706  -2.481  1.00 94.20  ? 331 ARG A CG    1 
ATOM   2621  C CD    . ARG A 1 331 ? 109.235 -55.354  -2.412  1.00 94.57  ? 331 ARG A CD    1 
ATOM   2622  N NE    . ARG A 1 331 ? 109.860 -55.144  -1.103  1.00 94.86  ? 331 ARG A NE    1 
ATOM   2623  C CZ    . ARG A 1 331 ? 110.381 -53.992  -0.683  1.00 94.51  ? 331 ARG A CZ    1 
ATOM   2624  N NH1   . ARG A 1 331 ? 110.350 -52.926  -1.467  1.00 94.53  ? 331 ARG A NH1   1 
ATOM   2625  N NH2   . ARG A 1 331 ? 110.926 -53.901  0.527   1.00 94.14  ? 331 ARG A NH2   1 
ATOM   2626  N N     . TRP A 1 332 ? 104.985 -59.167  -2.734  1.00 93.73  ? 332 TRP A N     1 
ATOM   2627  C CA    . TRP A 1 332 ? 103.754 -59.672  -3.368  1.00 94.47  ? 332 TRP A CA    1 
ATOM   2628  C C     . TRP A 1 332 ? 102.813 -60.449  -2.432  1.00 93.93  ? 332 TRP A C     1 
ATOM   2629  O O     . TRP A 1 332 ? 101.634 -60.642  -2.757  1.00 94.05  ? 332 TRP A O     1 
ATOM   2630  C CB    . TRP A 1 332 ? 104.080 -60.524  -4.593  1.00 96.25  ? 332 TRP A CB    1 
ATOM   2631  C CG    . TRP A 1 332 ? 104.936 -61.725  -4.280  1.00 99.56  ? 332 TRP A CG    1 
ATOM   2632  C CD1   . TRP A 1 332 ? 104.504 -62.988  -3.948  1.00 101.45 ? 332 TRP A CD1   1 
ATOM   2633  C CD2   . TRP A 1 332 ? 106.369 -61.776  -4.276  1.00 101.93 ? 332 TRP A CD2   1 
ATOM   2634  N NE1   . TRP A 1 332 ? 105.584 -63.818  -3.737  1.00 103.41 ? 332 TRP A NE1   1 
ATOM   2635  C CE2   . TRP A 1 332 ? 106.740 -63.103  -3.932  1.00 104.00 ? 332 TRP A CE2   1 
ATOM   2636  C CE3   . TRP A 1 332 ? 107.378 -60.833  -4.536  1.00 102.50 ? 332 TRP A CE3   1 
ATOM   2637  C CZ2   . TRP A 1 332 ? 108.087 -63.512  -3.838  1.00 106.13 ? 332 TRP A CZ2   1 
ATOM   2638  C CZ3   . TRP A 1 332 ? 108.718 -61.236  -4.439  1.00 104.73 ? 332 TRP A CZ3   1 
ATOM   2639  C CH2   . TRP A 1 332 ? 109.057 -62.567  -4.093  1.00 106.27 ? 332 TRP A CH2   1 
ATOM   2640  N N     . GLN A 1 333 ? 103.337 -60.905  -1.293  1.00 93.37  ? 333 GLN A N     1 
ATOM   2641  C CA    . GLN A 1 333 ? 102.532 -61.601  -0.285  1.00 92.62  ? 333 GLN A CA    1 
ATOM   2642  C C     . GLN A 1 333 ? 101.897 -60.625  0.698   1.00 90.88  ? 333 GLN A C     1 
ATOM   2643  O O     . GLN A 1 333 ? 100.878 -60.944  1.319   1.00 90.73  ? 333 GLN A O     1 
ATOM   2644  C CB    . GLN A 1 333 ? 103.375 -62.611  0.494   1.00 93.46  ? 333 GLN A CB    1 
ATOM   2645  C CG    . GLN A 1 333 ? 103.738 -63.860  -0.297  1.00 95.85  ? 333 GLN A CG    1 
ATOM   2646  C CD    . GLN A 1 333 ? 104.727 -64.781  0.422   1.00 97.62  ? 333 GLN A CD    1 
ATOM   2647  O OE1   . GLN A 1 333 ? 104.856 -64.759  1.654   1.00 97.83  ? 333 GLN A OE1   1 
ATOM   2648  N NE2   . GLN A 1 333 ? 105.426 -65.602  -0.356  1.00 98.27  ? 333 GLN A NE2   1 
ATOM   2649  N N     . ARG A 1 334 ? 102.503 -59.442  0.834   1.00 89.34  ? 334 ARG A N     1 
ATOM   2650  C CA    . ARG A 1 334 ? 102.120 -58.472  1.865   1.00 87.38  ? 334 ARG A CA    1 
ATOM   2651  C C     . ARG A 1 334 ? 100.657 -58.055  1.776   1.00 86.10  ? 334 ARG A C     1 
ATOM   2652  O O     . ARG A 1 334 ? 99.944  -58.062  2.777   1.00 85.36  ? 334 ARG A O     1 
ATOM   2653  C CB    . ARG A 1 334 ? 103.023 -57.241  1.807   1.00 86.99  ? 334 ARG A CB    1 
ATOM   2654  C CG    . ARG A 1 334 ? 104.409 -57.474  2.338   1.00 87.46  ? 334 ARG A CG    1 
ATOM   2655  C CD    . ARG A 1 334 ? 105.245 -56.225  2.213   1.00 86.87  ? 334 ARG A CD    1 
ATOM   2656  N NE    . ARG A 1 334 ? 106.635 -56.484  2.576   1.00 87.65  ? 334 ARG A NE    1 
ATOM   2657  C CZ    . ARG A 1 334 ? 107.666 -55.763  2.146   1.00 88.09  ? 334 ARG A CZ    1 
ATOM   2658  N NH1   . ARG A 1 334 ? 107.468 -54.731  1.336   1.00 88.19  ? 334 ARG A NH1   1 
ATOM   2659  N NH2   . ARG A 1 334 ? 108.897 -56.069  2.523   1.00 88.42  ? 334 ARG A NH2   1 
ATOM   2660  N N     . GLY A 1 335 ? 100.221 -57.706  0.569   1.00 85.56  ? 335 GLY A N     1 
ATOM   2661  C CA    . GLY A 1 335 ? 98.844  -57.311  0.333   1.00 84.58  ? 335 GLY A CA    1 
ATOM   2662  C C     . GLY A 1 335 ? 97.835  -58.296  0.887   1.00 84.53  ? 335 GLY A C     1 
ATOM   2663  O O     . GLY A 1 335 ? 96.899  -57.900  1.581   1.00 83.99  ? 335 GLY A O     1 
ATOM   2664  N N     . LYS A 1 336 ? 98.031  -59.581  0.587   1.00 85.08  ? 336 LYS A N     1 
ATOM   2665  C CA    . LYS A 1 336 ? 97.114  -60.638  1.024   1.00 85.17  ? 336 LYS A CA    1 
ATOM   2666  C C     . LYS A 1 336 ? 97.126  -60.871  2.533   1.00 84.36  ? 336 LYS A C     1 
ATOM   2667  O O     . LYS A 1 336 ? 96.075  -61.092  3.133   1.00 84.25  ? 336 LYS A O     1 
ATOM   2668  C CB    . LYS A 1 336 ? 97.420  -61.946  0.307   1.00 86.63  ? 336 LYS A CB    1 
ATOM   2669  C CG    . LYS A 1 336 ? 97.297  -61.872  -1.191  1.00 88.18  ? 336 LYS A CG    1 
ATOM   2670  C CD    . LYS A 1 336 ? 98.132  -62.963  -1.844  1.00 90.75  ? 336 LYS A CD    1 
ATOM   2671  C CE    . LYS A 1 336 ? 98.733  -62.456  -3.145  1.00 91.83  ? 336 LYS A CE    1 
ATOM   2672  N NZ    . LYS A 1 336 ? 99.398  -63.526  -3.930  1.00 93.15  ? 336 LYS A NZ    1 
ATOM   2673  N N     . ILE A 1 337 ? 98.309  -60.829  3.141   1.00 83.75  ? 337 ILE A N     1 
ATOM   2674  C CA    . ILE A 1 337 ? 98.433  -61.007  4.592   1.00 83.21  ? 337 ILE A CA    1 
ATOM   2675  C C     . ILE A 1 337 ? 97.770  -59.856  5.343   1.00 81.76  ? 337 ILE A C     1 
ATOM   2676  O O     . ILE A 1 337 ? 97.147  -60.069  6.388   1.00 81.69  ? 337 ILE A O     1 
ATOM   2677  C CB    . ILE A 1 337 ? 99.903  -61.134  5.039   1.00 83.59  ? 337 ILE A CB    1 
ATOM   2678  C CG1   . ILE A 1 337 ? 100.589 -62.289  4.302   1.00 85.02  ? 337 ILE A CG1   1 
ATOM   2679  C CG2   . ILE A 1 337 ? 99.977  -61.352  6.542   1.00 83.77  ? 337 ILE A CG2   1 
ATOM   2680  C CD1   . ILE A 1 337 ? 102.110 -62.220  4.292   1.00 85.54  ? 337 ILE A CD1   1 
ATOM   2681  N N     . ALA A 1 338 ? 97.912  -58.645  4.797   1.00 80.59  ? 338 ALA A N     1 
ATOM   2682  C CA    . ALA A 1 338 ? 97.290  -57.437  5.349   1.00 79.03  ? 338 ALA A CA    1 
ATOM   2683  C C     . ALA A 1 338 ? 95.776  -57.556  5.314   1.00 78.63  ? 338 ALA A C     1 
ATOM   2684  O O     . ALA A 1 338 ? 95.112  -57.383  6.333   1.00 78.36  ? 338 ALA A O     1 
ATOM   2685  C CB    . ALA A 1 338 ? 97.738  -56.213  4.579   1.00 78.46  ? 338 ALA A CB    1 
ATOM   2686  N N     . ARG A 1 339 ? 95.249  -57.886  4.138   1.00 78.54  ? 339 ARG A N     1 
ATOM   2687  C CA    . ARG A 1 339 ? 93.812  -58.044  3.921   1.00 78.28  ? 339 ARG A CA    1 
ATOM   2688  C C     . ARG A 1 339 ? 93.197  -59.059  4.878   1.00 78.44  ? 339 ARG A C     1 
ATOM   2689  O O     . ARG A 1 339 ? 92.091  -58.864  5.382   1.00 78.27  ? 339 ARG A O     1 
ATOM   2690  C CB    . ARG A 1 339 ? 93.548  -58.476  2.482   1.00 78.86  ? 339 ARG A CB    1 
ATOM   2691  C CG    . ARG A 1 339 ? 92.396  -57.758  1.854   1.00 79.05  ? 339 ARG A CG    1 
ATOM   2692  C CD    . ARG A 1 339 ? 91.998  -58.365  0.525   1.00 80.77  ? 339 ARG A CD    1 
ATOM   2693  N NE    . ARG A 1 339 ? 93.078  -58.390  -0.460  1.00 81.19  ? 339 ARG A NE    1 
ATOM   2694  C CZ    . ARG A 1 339 ? 93.686  -59.502  -0.856  1.00 82.03  ? 339 ARG A CZ    1 
ATOM   2695  N NH1   . ARG A 1 339 ? 93.310  -60.660  -0.342  1.00 83.66  ? 339 ARG A NH1   1 
ATOM   2696  N NH2   . ARG A 1 339 ? 94.658  -59.465  -1.762  1.00 81.90  ? 339 ARG A NH2   1 
ATOM   2697  N N     . ALA A 1 340 ? 93.930  -60.142  5.122   1.00 78.79  ? 340 ALA A N     1 
ATOM   2698  C CA    . ALA A 1 340 ? 93.478  -61.219  5.989   1.00 79.11  ? 340 ALA A CA    1 
ATOM   2699  C C     . ALA A 1 340 ? 93.523  -60.791  7.454   1.00 78.53  ? 340 ALA A C     1 
ATOM   2700  O O     . ALA A 1 340 ? 92.596  -61.089  8.217   1.00 78.76  ? 340 ALA A O     1 
ATOM   2701  C CB    . ALA A 1 340 ? 94.320  -62.461  5.759   1.00 79.95  ? 340 ALA A CB    1 
ATOM   2702  N N     . LEU A 1 341 ? 94.596  -60.084  7.832   1.00 77.71  ? 341 LEU A N     1 
ATOM   2703  C CA    . LEU A 1 341 ? 94.769  -59.584  9.199   1.00 76.96  ? 341 LEU A CA    1 
ATOM   2704  C C     . LEU A 1 341 ? 93.659  -58.594  9.528   1.00 76.38  ? 341 LEU A C     1 
ATOM   2705  O O     . LEU A 1 341 ? 92.919  -58.783  10.504  1.00 76.55  ? 341 LEU A O     1 
ATOM   2706  C CB    . LEU A 1 341 ? 96.133  -58.909  9.380   1.00 76.32  ? 341 LEU A CB    1 
ATOM   2707  C CG    . LEU A 1 341 ? 96.825  -58.986  10.753  1.00 76.20  ? 341 LEU A CG    1 
ATOM   2708  C CD1   . LEU A 1 341 ? 97.631  -57.734  11.014  1.00 74.78  ? 341 LEU A CD1   1 
ATOM   2709  C CD2   . LEU A 1 341 ? 95.879  -59.224  11.922  1.00 75.74  ? 341 LEU A CD2   1 
ATOM   2710  N N     . ALA A 1 342 ? 93.543  -57.556  8.691   1.00 75.56  ? 342 ALA A N     1 
ATOM   2711  C CA    . ALA A 1 342 ? 92.521  -56.519  8.836   1.00 74.86  ? 342 ALA A CA    1 
ATOM   2712  C C     . ALA A 1 342 ? 91.159  -57.150  8.997   1.00 75.41  ? 342 ALA A C     1 
ATOM   2713  O O     . ALA A 1 342 ? 90.396  -56.752  9.873   1.00 75.35  ? 342 ALA A O     1 
ATOM   2714  C CB    . ALA A 1 342 ? 92.527  -55.574  7.648   1.00 74.20  ? 342 ALA A CB    1 
ATOM   2715  N N     . ALA A 1 343 ? 90.871  -58.145  8.158   1.00 76.22  ? 343 ALA A N     1 
ATOM   2716  C CA    . ALA A 1 343 ? 89.614  -58.872  8.229   1.00 77.10  ? 343 ALA A CA    1 
ATOM   2717  C C     . ALA A 1 343 ? 89.384  -59.452  9.634   1.00 77.59  ? 343 ALA A C     1 
ATOM   2718  O O     . ALA A 1 343 ? 88.331  -59.208  10.243  1.00 77.77  ? 343 ALA A O     1 
ATOM   2719  C CB    . ALA A 1 343 ? 89.563  -59.950  7.165   1.00 77.95  ? 343 ALA A CB    1 
ATOM   2720  N N     . LYS A 1 344 ? 90.378  -60.173  10.156  1.00 77.71  ? 344 LYS A N     1 
ATOM   2721  C CA    . LYS A 1 344 ? 90.276  -60.758  11.496  1.00 78.33  ? 344 LYS A CA    1 
ATOM   2722  C C     . LYS A 1 344 ? 90.246  -59.703  12.602  1.00 77.59  ? 344 LYS A C     1 
ATOM   2723  O O     . LYS A 1 344 ? 89.524  -59.862  13.594  1.00 77.93  ? 344 LYS A O     1 
ATOM   2724  C CB    . LYS A 1 344 ? 91.401  -61.770  11.757  1.00 79.14  ? 344 LYS A CB    1 
ATOM   2725  C CG    . LYS A 1 344 ? 91.375  -63.015  10.864  1.00 80.71  ? 344 LYS A CG    1 
ATOM   2726  C CD    . LYS A 1 344 ? 90.068  -63.797  10.982  1.00 82.67  ? 344 LYS A CD    1 
ATOM   2727  C CE    . LYS A 1 344 ? 89.900  -64.764  9.813   1.00 84.36  ? 344 LYS A CE    1 
ATOM   2728  N NZ    . LYS A 1 344 ? 88.484  -65.191  9.629   1.00 85.42  ? 344 LYS A NZ    1 
ATOM   2729  N N     . LEU A 1 345 ? 91.025  -58.632  12.420  1.00 76.51  ? 345 LEU A N     1 
ATOM   2730  C CA    . LEU A 1 345 ? 91.072  -57.511  13.367  1.00 75.80  ? 345 LEU A CA    1 
ATOM   2731  C C     . LEU A 1 345 ? 89.702  -56.878  13.587  1.00 76.07  ? 345 LEU A C     1 
ATOM   2732  O O     . LEU A 1 345 ? 89.345  -56.534  14.719  1.00 76.22  ? 345 LEU A O     1 
ATOM   2733  C CB    . LEU A 1 345 ? 92.061  -56.444  12.899  1.00 74.52  ? 345 LEU A CB    1 
ATOM   2734  C CG    . LEU A 1 345 ? 93.531  -56.680  13.245  1.00 74.25  ? 345 LEU A CG    1 
ATOM   2735  C CD1   . LEU A 1 345 ? 94.429  -55.798  12.394  1.00 71.97  ? 345 LEU A CD1   1 
ATOM   2736  C CD2   . LEU A 1 345 ? 93.816  -56.485  14.741  1.00 73.71  ? 345 LEU A CD2   1 
ATOM   2737  N N     . ALA A 1 346 ? 88.945  -56.734  12.497  1.00 76.28  ? 346 ALA A N     1 
ATOM   2738  C CA    . ALA A 1 346 ? 87.624  -56.126  12.536  1.00 76.52  ? 346 ALA A CA    1 
ATOM   2739  C C     . ALA A 1 346 ? 86.721  -56.984  13.403  1.00 77.80  ? 346 ALA A C     1 
ATOM   2740  O O     . ALA A 1 346 ? 86.020  -56.465  14.276  1.00 78.21  ? 346 ALA A O     1 
ATOM   2741  C CB    . ALA A 1 346 ? 87.063  -55.978  11.134  1.00 76.32  ? 346 ALA A CB    1 
ATOM   2742  N N     . ILE A 1 347 ? 86.770  -58.298  13.173  1.00 78.78  ? 347 ILE A N     1 
ATOM   2743  C CA    . ILE A 1 347 ? 86.036  -59.275  13.979  1.00 80.01  ? 347 ILE A CA    1 
ATOM   2744  C C     . ILE A 1 347 ? 86.494  -59.220  15.445  1.00 80.43  ? 347 ILE A C     1 
ATOM   2745  O O     . ILE A 1 347 ? 85.664  -59.208  16.364  1.00 80.98  ? 347 ILE A O     1 
ATOM   2746  C CB    . ILE A 1 347 ? 86.204  -60.712  13.424  1.00 80.77  ? 347 ILE A CB    1 
ATOM   2747  C CG1   . ILE A 1 347 ? 85.829  -60.768  11.935  1.00 80.51  ? 347 ILE A CG1   1 
ATOM   2748  C CG2   . ILE A 1 347 ? 85.376  -61.701  14.250  1.00 82.31  ? 347 ILE A CG2   1 
ATOM   2749  C CD1   . ILE A 1 347 ? 86.106  -62.107  11.250  1.00 80.83  ? 347 ILE A CD1   1 
ATOM   2750  N N     . ALA A 1 348 ? 87.814  -59.177  15.645  1.00 80.21  ? 348 ALA A N     1 
ATOM   2751  C CA    . ALA A 1 348 ? 88.406  -59.071  16.974  1.00 80.63  ? 348 ALA A CA    1 
ATOM   2752  C C     . ALA A 1 348 ? 87.902  -57.829  17.682  1.00 80.50  ? 348 ALA A C     1 
ATOM   2753  O O     . ALA A 1 348 ? 87.492  -57.898  18.835  1.00 81.34  ? 348 ALA A O     1 
ATOM   2754  C CB    . ALA A 1 348 ? 89.923  -59.062  16.892  1.00 80.12  ? 348 ALA A CB    1 
ATOM   2755  N N     . ALA A 1 349 ? 87.914  -56.700  16.978  1.00 80.05  ? 349 ALA A N     1 
ATOM   2756  C CA    . ALA A 1 349 ? 87.484  -55.429  17.554  1.00 80.16  ? 349 ALA A CA    1 
ATOM   2757  C C     . ALA A 1 349 ? 86.030  -55.504  18.015  1.00 81.14  ? 349 ALA A C     1 
ATOM   2758  O O     . ALA A 1 349 ? 85.691  -55.053  19.110  1.00 81.35  ? 349 ALA A O     1 
ATOM   2759  C CB    . ALA A 1 349 ? 87.679  -54.301  16.558  1.00 79.18  ? 349 ALA A CB    1 
ATOM   2760  N N     . ARG A 1 350 ? 85.191  -56.113  17.185  1.00 81.98  ? 350 ARG A N     1 
ATOM   2761  C CA    . ARG A 1 350 ? 83.760  -56.185  17.446  1.00 83.45  ? 350 ARG A CA    1 
ATOM   2762  C C     . ARG A 1 350 ? 83.386  -57.083  18.623  1.00 85.32  ? 350 ARG A C     1 
ATOM   2763  O O     . ARG A 1 350 ? 82.488  -56.745  19.392  1.00 85.84  ? 350 ARG A O     1 
ATOM   2764  C CB    . ARG A 1 350 ? 83.004  -56.589  16.184  1.00 83.39  ? 350 ARG A CB    1 
ATOM   2765  C CG    . ARG A 1 350 ? 82.858  -55.455  15.198  1.00 82.27  ? 350 ARG A CG    1 
ATOM   2766  C CD    . ARG A 1 350 ? 82.506  -55.970  13.826  1.00 81.53  ? 350 ARG A CD    1 
ATOM   2767  N NE    . ARG A 1 350 ? 82.998  -55.087  12.770  1.00 80.45  ? 350 ARG A NE    1 
ATOM   2768  C CZ    . ARG A 1 350 ? 82.919  -55.353  11.469  1.00 80.01  ? 350 ARG A CZ    1 
ATOM   2769  N NH1   . ARG A 1 350 ? 82.367  -56.479  11.048  1.00 80.74  ? 350 ARG A NH1   1 
ATOM   2770  N NH2   . ARG A 1 350 ? 83.388  -54.493  10.584  1.00 79.36  ? 350 ARG A NH2   1 
ATOM   2771  N N     . VAL A 1 351 ? 84.069  -58.216  18.774  1.00 86.88  ? 351 VAL A N     1 
ATOM   2772  C CA    . VAL A 1 351 ? 83.843  -59.072  19.948  1.00 89.17  ? 351 VAL A CA    1 
ATOM   2773  C C     . VAL A 1 351 ? 84.352  -58.386  21.224  1.00 89.91  ? 351 VAL A C     1 
ATOM   2774  O O     . VAL A 1 351 ? 83.724  -58.477  22.286  1.00 90.73  ? 351 VAL A O     1 
ATOM   2775  C CB    . VAL A 1 351 ? 84.389  -60.529  19.754  1.00 89.82  ? 351 VAL A CB    1 
ATOM   2776  C CG1   . VAL A 1 351 ? 85.808  -60.522  19.263  1.00 89.07  ? 351 VAL A CG1   1 
ATOM   2777  C CG2   . VAL A 1 351 ? 84.256  -61.368  21.031  1.00 91.27  ? 351 VAL A CG2   1 
ATOM   2778  N N     . ASP A 1 352 ? 85.460  -57.658  21.084  1.00 90.00  ? 352 ASP A N     1 
ATOM   2779  C CA    . ASP A 1 352 ? 86.020  -56.847  22.161  1.00 91.15  ? 352 ASP A CA    1 
ATOM   2780  C C     . ASP A 1 352 ? 85.118  -55.700  22.584  1.00 91.72  ? 352 ASP A C     1 
ATOM   2781  O O     . ASP A 1 352 ? 84.946  -55.445  23.777  1.00 92.45  ? 352 ASP A O     1 
ATOM   2782  C CB    . ASP A 1 352 ? 87.371  -56.276  21.742  1.00 90.34  ? 352 ASP A CB    1 
ATOM   2783  C CG    . ASP A 1 352 ? 88.514  -57.236  21.990  1.00 92.00  ? 352 ASP A CG    1 
ATOM   2784  O OD1   . ASP A 1 352 ? 88.428  -58.048  22.942  1.00 95.01  ? 352 ASP A OD1   1 
ATOM   2785  O OD2   . ASP A 1 352 ? 89.507  -57.172  21.233  1.00 91.79  ? 352 ASP A OD2   1 
ATOM   2786  N N     . ALA A 1 353 ? 84.558  -55.003  21.598  1.00 91.91  ? 353 ALA A N     1 
ATOM   2787  C CA    . ALA A 1 353 ? 83.743  -53.817  21.853  1.00 92.76  ? 353 ALA A CA    1 
ATOM   2788  C C     . ALA A 1 353 ? 82.379  -54.163  22.410  1.00 94.48  ? 353 ALA A C     1 
ATOM   2789  O O     . ALA A 1 353 ? 81.952  -53.597  23.413  1.00 94.85  ? 353 ALA A O     1 
ATOM   2790  C CB    . ALA A 1 353 ? 83.591  -52.994  20.591  1.00 91.81  ? 353 ALA A CB    1 
ATOM   2791  N N     . PHE A 1 354 ? 81.703  -55.098  21.750  1.00 96.06  ? 354 PHE A N     1 
ATOM   2792  C CA    . PHE A 1 354 ? 80.328  -55.451  22.109  1.00 98.42  ? 354 PHE A CA    1 
ATOM   2793  C C     . PHE A 1 354 ? 80.254  -56.556  23.164  1.00 100.15 ? 354 PHE A C     1 
ATOM   2794  O O     . PHE A 1 354 ? 79.296  -57.330  23.198  1.00 101.22 ? 354 PHE A O     1 
ATOM   2795  C CB    . PHE A 1 354 ? 79.492  -55.754  20.854  1.00 98.53  ? 354 PHE A CB    1 
ATOM   2796  C CG    . PHE A 1 354 ? 79.524  -54.644  19.838  1.00 98.16  ? 354 PHE A CG    1 
ATOM   2797  C CD1   . PHE A 1 354 ? 78.786  -53.481  20.038  1.00 99.43  ? 354 PHE A CD1   1 
ATOM   2798  C CD2   . PHE A 1 354 ? 80.318  -54.744  18.704  1.00 97.72  ? 354 PHE A CD2   1 
ATOM   2799  C CE1   . PHE A 1 354 ? 78.827  -52.442  19.117  1.00 99.41  ? 354 PHE A CE1   1 
ATOM   2800  C CE2   . PHE A 1 354 ? 80.365  -53.714  17.775  1.00 97.89  ? 354 PHE A CE2   1 
ATOM   2801  C CZ    . PHE A 1 354 ? 79.618  -52.558  17.984  1.00 98.73  ? 354 PHE A CZ    1 
ATOM   2802  N N     . SER A 1 355 ? 81.293  -56.602  24.006  1.00 100.93 ? 355 SER A N     1 
ATOM   2803  C CA    . SER A 1 355 ? 81.320  -57.328  25.291  1.00 102.81 ? 355 SER A CA    1 
ATOM   2804  C C     . SER A 1 355 ? 81.925  -58.735  25.241  1.00 103.57 ? 355 SER A C     1 
ATOM   2805  O O     . SER A 1 355 ? 82.560  -59.161  26.206  1.00 104.20 ? 355 SER A O     1 
ATOM   2806  C CB    . SER A 1 355 ? 79.931  -57.337  25.960  1.00 104.18 ? 355 SER A CB    1 
ATOM   2807  O OG    . SER A 1 355 ? 80.021  -57.426  27.371  1.00 105.74 ? 355 SER A OG    1 
ATOM   2808  N N     . GLY A 1 356 ? 81.740  -59.433  24.118  1.00 103.71 ? 356 GLY A N     1 
ATOM   2809  C CA    . GLY A 1 356 ? 82.136  -60.840  23.970  1.00 105.08 ? 356 GLY A CA    1 
ATOM   2810  C C     . GLY A 1 356 ? 83.451  -61.276  24.603  1.00 105.75 ? 356 GLY A C     1 
ATOM   2811  O O     . GLY A 1 356 ? 84.480  -60.610  24.454  1.00 104.72 ? 356 GLY A O     1 
ATOM   2812  N N     . ARG A 1 357 ? 83.406  -62.405  25.310  1.00 107.66 ? 357 ARG A N     1 
ATOM   2813  C CA    . ARG A 1 357 ? 84.581  -62.955  25.990  1.00 108.76 ? 357 ARG A CA    1 
ATOM   2814  C C     . ARG A 1 357 ? 85.545  -63.628  25.011  1.00 108.29 ? 357 ARG A C     1 
ATOM   2815  O O     . ARG A 1 357 ? 85.124  -64.295  24.056  1.00 108.34 ? 357 ARG A O     1 
ATOM   2816  C CB    . ARG A 1 357 ? 84.162  -63.930  27.104  1.00 111.13 ? 357 ARG A CB    1 
ATOM   2817  C CG    . ARG A 1 357 ? 85.294  -64.807  27.690  1.00 113.33 ? 357 ARG A CG    1 
ATOM   2818  C CD    . ARG A 1 357 ? 84.786  -66.184  28.147  1.00 117.72 ? 357 ARG A CD    1 
ATOM   2819  N NE    . ARG A 1 357 ? 83.698  -66.707  27.304  1.00 120.04 ? 357 ARG A NE    1 
ATOM   2820  C CZ    . ARG A 1 357 ? 83.856  -67.357  26.146  1.00 120.80 ? 357 ARG A CZ    1 
ATOM   2821  N NH1   . ARG A 1 357 ? 85.073  -67.586  25.652  1.00 121.01 ? 357 ARG A NH1   1 
ATOM   2822  N NH2   . ARG A 1 357 ? 82.788  -67.781  25.472  1.00 120.93 ? 357 ARG A NH2   1 
ATOM   2823  N N     . PHE A 1 358 ? 86.836  -63.436  25.295  1.00 107.91 ? 358 PHE A N     1 
ATOM   2824  C CA    . PHE A 1 358 ? 87.988  -63.930  24.528  1.00 107.28 ? 358 PHE A CA    1 
ATOM   2825  C C     . PHE A 1 358 ? 87.755  -65.098  23.565  1.00 107.60 ? 358 PHE A C     1 
ATOM   2826  O O     . PHE A 1 358 ? 87.345  -66.183  23.975  1.00 109.22 ? 358 PHE A O     1 
ATOM   2827  C CB    . PHE A 1 358 ? 89.118  -64.273  25.505  1.00 108.30 ? 358 PHE A CB    1 
ATOM   2828  C CG    . PHE A 1 358 ? 90.443  -64.495  24.846  1.00 108.33 ? 358 PHE A CG    1 
ATOM   2829  C CD1   . PHE A 1 358 ? 91.287  -63.420  24.577  1.00 107.66 ? 358 PHE A CD1   1 
ATOM   2830  C CD2   . PHE A 1 358 ? 90.857  -65.779  24.504  1.00 109.70 ? 358 PHE A CD2   1 
ATOM   2831  C CE1   . PHE A 1 358 ? 92.517  -63.620  23.968  1.00 107.90 ? 358 PHE A CE1   1 
ATOM   2832  C CE2   . PHE A 1 358 ? 92.083  -65.994  23.898  1.00 109.65 ? 358 PHE A CE2   1 
ATOM   2833  C CZ    . PHE A 1 358 ? 92.918  -64.916  23.628  1.00 108.98 ? 358 PHE A CZ    1 
ATOM   2834  N N     . ILE A 1 359 ? 88.029  -64.851  22.285  1.00 106.18 ? 359 ILE A N     1 
ATOM   2835  C CA    . ILE A 1 359 ? 88.033  -65.879  21.236  1.00 106.59 ? 359 ILE A CA    1 
ATOM   2836  C C     . ILE A 1 359 ? 89.261  -65.705  20.330  1.00 105.73 ? 359 ILE A C     1 
ATOM   2837  O O     . ILE A 1 359 ? 89.262  -66.110  19.162  1.00 105.28 ? 359 ILE A O     1 
ATOM   2838  C CB    . ILE A 1 359 ? 86.734  -65.868  20.371  1.00 106.28 ? 359 ILE A CB    1 
ATOM   2839  C CG1   . ILE A 1 359 ? 86.513  -64.500  19.715  1.00 104.40 ? 359 ILE A CG1   1 
ATOM   2840  C CG2   . ILE A 1 359 ? 85.511  -66.295  21.193  1.00 107.73 ? 359 ILE A CG2   1 
ATOM   2841  C CD1   . ILE A 1 359 ? 85.825  -64.566  18.369  1.00 103.28 ? 359 ILE A CD1   1 
ATOM   2842  N N     . GLY A 1 360 ? 90.310  -65.109  20.890  1.00 105.61 ? 360 GLY A N     1 
ATOM   2843  C CA    . GLY A 1 360 ? 91.509  -64.761  20.138  1.00 105.16 ? 360 GLY A CA    1 
ATOM   2844  C C     . GLY A 1 360 ? 92.333  -65.935  19.654  1.00 106.55 ? 360 GLY A C     1 
ATOM   2845  O O     . GLY A 1 360 ? 93.112  -65.799  18.709  1.00 105.87 ? 360 GLY A O     1 
ATOM   2846  N N     . ASP A 1 361 ? 92.161  -67.085  20.301  1.00 108.74 ? 361 ASP A N     1 
ATOM   2847  C CA    . ASP A 1 361 ? 92.930  -68.281  19.971  1.00 110.51 ? 361 ASP A CA    1 
ATOM   2848  C C     . ASP A 1 361 ? 92.574  -68.841  18.598  1.00 110.57 ? 361 ASP A C     1 
ATOM   2849  O O     . ASP A 1 361 ? 93.469  -69.096  17.789  1.00 110.63 ? 361 ASP A O     1 
ATOM   2850  C CB    . ASP A 1 361 ? 92.771  -69.353  21.056  1.00 112.83 ? 361 ASP A CB    1 
ATOM   2851  C CG    . ASP A 1 361 ? 93.570  -69.039  22.315  1.00 113.79 ? 361 ASP A CG    1 
ATOM   2852  O OD1   . ASP A 1 361 ? 94.175  -67.947  22.387  1.00 113.38 ? 361 ASP A OD1   1 
ATOM   2853  O OD2   . ASP A 1 361 ? 93.594  -69.886  23.237  1.00 115.58 ? 361 ASP A OD2   1 
ATOM   2854  N N     . GLN A 1 362 ? 91.276  -69.025  18.342  1.00 110.78 ? 362 GLN A N     1 
ATOM   2855  C CA    . GLN A 1 362 ? 90.797  -69.520  17.044  1.00 110.84 ? 362 GLN A CA    1 
ATOM   2856  C C     . GLN A 1 362 ? 91.026  -68.492  15.955  1.00 109.00 ? 362 GLN A C     1 
ATOM   2857  O O     . GLN A 1 362 ? 91.288  -68.849  14.811  1.00 109.03 ? 362 GLN A O     1 
ATOM   2858  C CB    . GLN A 1 362 ? 89.320  -69.942  17.077  1.00 111.59 ? 362 GLN A CB    1 
ATOM   2859  C CG    . GLN A 1 362 ? 88.461  -69.211  18.094  1.00 111.28 ? 362 GLN A CG    1 
ATOM   2860  C CD    . GLN A 1 362 ? 88.397  -69.947  19.420  1.00 112.75 ? 362 GLN A CD    1 
ATOM   2861  O OE1   . GLN A 1 362 ? 87.697  -70.951  19.540  1.00 114.12 ? 362 GLN A OE1   1 
ATOM   2862  N NE2   . GLN A 1 362 ? 89.129  -69.454  20.424  1.00 111.78 ? 362 GLN A NE2   1 
ATOM   2863  N N     . LEU A 1 363 ? 90.938  -67.217  16.320  1.00 107.65 ? 363 LEU A N     1 
ATOM   2864  C CA    . LEU A 1 363 ? 91.246  -66.141  15.387  1.00 106.15 ? 363 LEU A CA    1 
ATOM   2865  C C     . LEU A 1 363 ? 92.702  -66.203  14.907  1.00 106.26 ? 363 LEU A C     1 
ATOM   2866  O O     . LEU A 1 363 ? 92.959  -66.122  13.703  1.00 105.79 ? 363 LEU A O     1 
ATOM   2867  C CB    . LEU A 1 363 ? 90.897  -64.779  15.993  1.00 104.83 ? 363 LEU A CB    1 
ATOM   2868  C CG    . LEU A 1 363 ? 89.612  -64.076  15.529  1.00 103.55 ? 363 LEU A CG    1 
ATOM   2869  C CD1   . LEU A 1 363 ? 88.366  -64.952  15.621  1.00 104.20 ? 363 LEU A CD1   1 
ATOM   2870  C CD2   . LEU A 1 363 ? 89.418  -62.798  16.325  1.00 102.79 ? 363 LEU A CD2   1 
ATOM   2871  N N     . ASN A 1 364 ? 93.639  -66.366  15.844  1.00 107.21 ? 364 ASN A N     1 
ATOM   2872  C CA    . ASN A 1 364 ? 95.061  -66.542  15.515  1.00 107.80 ? 364 ASN A CA    1 
ATOM   2873  C C     . ASN A 1 364 ? 95.309  -67.741  14.620  1.00 109.11 ? 364 ASN A C     1 
ATOM   2874  O O     . ASN A 1 364 ? 96.066  -67.665  13.654  1.00 108.72 ? 364 ASN A O     1 
ATOM   2875  C CB    . ASN A 1 364 ? 95.903  -66.687  16.784  1.00 108.73 ? 364 ASN A CB    1 
ATOM   2876  C CG    . ASN A 1 364 ? 96.679  -65.431  17.118  1.00 108.09 ? 364 ASN A CG    1 
ATOM   2877  O OD1   . ASN A 1 364 ? 97.456  -64.926  16.306  1.00 108.01 ? 364 ASN A OD1   1 
ATOM   2878  N ND2   . ASN A 1 364 ? 96.482  -64.924  18.324  1.00 108.71 ? 364 ASN A ND2   1 
ATOM   2879  N N     . GLU A 1 365 ? 94.656  -68.845  14.968  1.00 111.04 ? 365 GLU A N     1 
ATOM   2880  C CA    . GLU A 1 365 ? 94.759  -70.107  14.250  1.00 112.94 ? 365 GLU A CA    1 
ATOM   2881  C C     . GLU A 1 365 ? 94.225  -69.975  12.823  1.00 112.18 ? 365 GLU A C     1 
ATOM   2882  O O     . GLU A 1 365 ? 94.870  -70.434  11.873  1.00 112.61 ? 365 GLU A O     1 
ATOM   2883  C CB    . GLU A 1 365 ? 93.992  -71.184  15.015  1.00 114.88 ? 365 GLU A CB    1 
ATOM   2884  C CG    . GLU A 1 365 ? 94.495  -72.594  14.795  1.00 118.33 ? 365 GLU A CG    1 
ATOM   2885  C CD    . GLU A 1 365 ? 93.933  -73.578  15.812  1.00 122.38 ? 365 GLU A CD    1 
ATOM   2886  O OE1   . GLU A 1 365 ? 94.382  -74.747  15.802  1.00 125.49 ? 365 GLU A OE1   1 
ATOM   2887  O OE2   . GLU A 1 365 ? 93.049  -73.192  16.620  1.00 122.53 ? 365 GLU A OE2   1 
ATOM   2888  N N     . GLN A 1 366 ? 93.057  -69.340  12.689  1.00 111.21 ? 366 GLN A N     1 
ATOM   2889  C CA    . GLN A 1 366 ? 92.456  -69.021  11.388  1.00 110.45 ? 366 GLN A CA    1 
ATOM   2890  C C     . GLN A 1 366 ? 93.395  -68.166  10.552  1.00 109.04 ? 366 GLN A C     1 
ATOM   2891  O O     . GLN A 1 366 ? 93.549  -68.391  9.349   1.00 109.03 ? 366 GLN A O     1 
ATOM   2892  C CB    . GLN A 1 366 ? 91.133  -68.272  11.569  1.00 109.69 ? 366 GLN A CB    1 
ATOM   2893  C CG    . GLN A 1 366 ? 89.956  -69.140  11.990  1.00 111.58 ? 366 GLN A CG    1 
ATOM   2894  C CD    . GLN A 1 366 ? 88.780  -68.326  12.515  1.00 111.46 ? 366 GLN A CD    1 
ATOM   2895  O OE1   . GLN A 1 366 ? 88.333  -67.368  11.877  1.00 110.61 ? 366 GLN A OE1   1 
ATOM   2896  N NE2   . GLN A 1 366 ? 88.269  -68.709  13.684  1.00 112.26 ? 366 GLN A NE2   1 
ATOM   2897  N N     . LEU A 1 367 ? 94.019  -67.188  11.205  1.00 107.89 ? 367 LEU A N     1 
ATOM   2898  C CA    . LEU A 1 367 ? 94.960  -66.293  10.546  1.00 106.79 ? 367 LEU A CA    1 
ATOM   2899  C C     . LEU A 1 367 ? 96.224  -67.023  10.085  1.00 107.61 ? 367 LEU A C     1 
ATOM   2900  O O     . LEU A 1 367 ? 96.618  -66.907  8.925   1.00 107.48 ? 367 LEU A O     1 
ATOM   2901  C CB    . LEU A 1 367 ? 95.310  -65.103  11.452  1.00 105.70 ? 367 LEU A CB    1 
ATOM   2902  C CG    . LEU A 1 367 ? 96.223  -64.002  10.892  1.00 104.42 ? 367 LEU A CG    1 
ATOM   2903  C CD1   . LEU A 1 367 ? 95.594  -63.294  9.694   1.00 103.32 ? 367 LEU A CD1   1 
ATOM   2904  C CD2   . LEU A 1 367 ? 96.589  -62.999  11.981  1.00 103.35 ? 367 LEU A CD2   1 
ATOM   2905  N N     . LYS A 1 368 ? 96.842  -67.786  10.980  1.00 108.62 ? 368 LYS A N     1 
ATOM   2906  C CA    . LYS A 1 368 ? 98.081  -68.485  10.648  1.00 109.64 ? 368 LYS A CA    1 
ATOM   2907  C C     . LYS A 1 368 ? 97.892  -69.535  9.564   1.00 110.77 ? 368 LYS A C     1 
ATOM   2908  O O     . LYS A 1 368 ? 98.817  -69.805  8.802   1.00 111.28 ? 368 LYS A O     1 
ATOM   2909  C CB    . LYS A 1 368 ? 98.724  -69.080  11.896  1.00 110.94 ? 368 LYS A CB    1 
ATOM   2910  C CG    . LYS A 1 368 ? 99.435  -68.033  12.741  1.00 110.38 ? 368 LYS A CG    1 
ATOM   2911  C CD    . LYS A 1 368 ? 99.570  -68.457  14.195  1.00 112.05 ? 368 LYS A CD    1 
ATOM   2912  C CE    . LYS A 1 368 ? 99.905  -67.259  15.074  1.00 111.33 ? 368 LYS A CE    1 
ATOM   2913  N NZ    . LYS A 1 368 ? 99.783  -67.556  16.531  1.00 112.31 ? 368 LYS A NZ    1 
ATOM   2914  N N     . LYS A 1 369 ? 96.694  -70.113  9.498   1.00 111.34 ? 369 LYS A N     1 
ATOM   2915  C CA    . LYS A 1 369 ? 96.307  -70.991  8.393   1.00 112.41 ? 369 LYS A CA    1 
ATOM   2916  C C     . LYS A 1 369 ? 96.345  -70.242  7.065   1.00 111.18 ? 369 LYS A C     1 
ATOM   2917  O O     . LYS A 1 369 ? 96.983  -70.692  6.106   1.00 111.72 ? 369 LYS A O     1 
ATOM   2918  C CB    . LYS A 1 369 ? 94.898  -71.544  8.611   1.00 113.18 ? 369 LYS A CB    1 
ATOM   2919  C CG    . LYS A 1 369 ? 94.837  -72.801  9.446   1.00 115.76 ? 369 LYS A CG    1 
ATOM   2920  C CD    . LYS A 1 369 ? 93.423  -73.345  9.483   1.00 117.41 ? 369 LYS A CD    1 
ATOM   2921  C CE    . LYS A 1 369 ? 93.271  -74.383  10.573  1.00 119.72 ? 369 LYS A CE    1 
ATOM   2922  N NZ    . LYS A 1 369 ? 91.906  -74.966  10.552  1.00 121.42 ? 369 LYS A NZ    1 
ATOM   2923  N N     . ARG A 1 370 ? 95.656  -69.100  7.033   1.00 109.55 ? 370 ARG A N     1 
ATOM   2924  C CA    . ARG A 1 370 ? 95.561  -68.250  5.852   1.00 108.42 ? 370 ARG A CA    1 
ATOM   2925  C C     . ARG A 1 370 ? 96.952  -67.798  5.408   1.00 108.20 ? 370 ARG A C     1 
ATOM   2926  O O     . ARG A 1 370 ? 97.237  -67.727  4.213   1.00 108.05 ? 370 ARG A O     1 
ATOM   2927  C CB    . ARG A 1 370 ? 94.677  -67.029  6.147   1.00 106.76 ? 370 ARG A CB    1 
ATOM   2928  C CG    . ARG A 1 370 ? 93.735  -66.569  5.018   1.00 105.68 ? 370 ARG A CG    1 
ATOM   2929  C CD    . ARG A 1 370 ? 94.116  -67.118  3.654   1.00 105.20 ? 370 ARG A CD    1 
ATOM   2930  N NE    . ARG A 1 370 ? 94.257  -66.074  2.645   1.00 103.16 ? 370 ARG A NE    1 
ATOM   2931  C CZ    . ARG A 1 370 ? 94.626  -66.293  1.386   1.00 103.06 ? 370 ARG A CZ    1 
ATOM   2932  N NH1   . ARG A 1 370 ? 94.733  -65.278  0.539   1.00 102.30 ? 370 ARG A NH1   1 
ATOM   2933  N NH2   . ARG A 1 370 ? 94.888  -67.523  0.967   1.00 103.91 ? 370 ARG A NH2   1 
ATOM   2934  N N     . ILE A 1 371 ? 97.817  -67.517  6.380   1.00 108.34 ? 371 ILE A N     1 
ATOM   2935  C CA    . ILE A 1 371 ? 99.185  -67.084  6.100   1.00 108.60 ? 371 ILE A CA    1 
ATOM   2936  C C     . ILE A 1 371 ? 100.021 -68.224  5.511   1.00 110.56 ? 371 ILE A C     1 
ATOM   2937  O O     . ILE A 1 371 ? 100.729 -68.026  4.523   1.00 110.67 ? 371 ILE A O     1 
ATOM   2938  C CB    . ILE A 1 371 ? 99.867  -66.459  7.352   1.00 108.02 ? 371 ILE A CB    1 
ATOM   2939  C CG1   . ILE A 1 371 ? 99.125  -65.187  7.789   1.00 106.30 ? 371 ILE A CG1   1 
ATOM   2940  C CG2   . ILE A 1 371 ? 101.325 -66.112  7.062   1.00 108.29 ? 371 ILE A CG2   1 
ATOM   2941  C CD1   . ILE A 1 371 ? 99.451  -64.712  9.198   1.00 105.58 ? 371 ILE A CD1   1 
ATOM   2942  N N     . ASP A 1 372 ? 99.915  -69.413  6.103   1.00 112.49 ? 372 ASP A N     1 
ATOM   2943  C CA    . ASP A 1 372 ? 100.624 -70.597  5.615   1.00 114.72 ? 372 ASP A CA    1 
ATOM   2944  C C     . ASP A 1 372 ? 100.276 -70.959  4.175   1.00 115.63 ? 372 ASP A C     1 
ATOM   2945  O O     . ASP A 1 372 ? 101.131 -71.435  3.427   1.00 116.59 ? 372 ASP A O     1 
ATOM   2946  C CB    . ASP A 1 372 ? 100.364 -71.784  6.537   1.00 116.30 ? 372 ASP A CB    1 
ATOM   2947  C CG    . ASP A 1 372 ? 101.176 -71.711  7.810   1.00 116.67 ? 372 ASP A CG    1 
ATOM   2948  O OD1   . ASP A 1 372 ? 101.896 -70.706  7.991   1.00 115.48 ? 372 ASP A OD1   1 
ATOM   2949  O OD2   . ASP A 1 372 ? 101.104 -72.653  8.628   1.00 118.35 ? 372 ASP A OD2   1 
ATOM   2950  N N     . GLU A 1 373 ? 99.020  -70.727  3.799   1.00 115.62 ? 373 GLU A N     1 
ATOM   2951  C CA    . GLU A 1 373 ? 98.561  -70.948  2.431   1.00 116.67 ? 373 GLU A CA    1 
ATOM   2952  C C     . GLU A 1 373 ? 99.171  -69.933  1.474   1.00 115.88 ? 373 GLU A C     1 
ATOM   2953  O O     . GLU A 1 373 ? 99.646  -70.293  0.396   1.00 116.85 ? 373 GLU A O     1 
ATOM   2954  C CB    . GLU A 1 373 ? 97.035  -70.885  2.359   1.00 116.44 ? 373 GLU A CB    1 
ATOM   2955  C CG    . GLU A 1 373 ? 96.329  -72.066  3.010   1.00 118.50 ? 373 GLU A CG    1 
ATOM   2956  C CD    . GLU A 1 373 ? 94.821  -71.880  3.110   1.00 119.07 ? 373 GLU A CD    1 
ATOM   2957  O OE1   . GLU A 1 373 ? 94.271  -70.998  2.410   1.00 118.23 ? 373 GLU A OE1   1 
ATOM   2958  O OE2   . GLU A 1 373 ? 94.184  -72.621  3.893   1.00 120.12 ? 373 GLU A OE2   1 
ATOM   2959  N N     . ILE A 1 374 ? 99.155  -68.667  1.884   1.00 114.54 ? 374 ILE A N     1 
ATOM   2960  C CA    . ILE A 1 374 ? 99.731  -67.580  1.102   1.00 114.10 ? 374 ILE A CA    1 
ATOM   2961  C C     . ILE A 1 374 ? 101.193 -67.872  0.770   1.00 115.32 ? 374 ILE A C     1 
ATOM   2962  O O     . ILE A 1 374 ? 101.632 -67.686  -0.367  1.00 115.64 ? 374 ILE A O     1 
ATOM   2963  C CB    . ILE A 1 374 ? 99.608  -66.223  1.848   1.00 112.29 ? 374 ILE A CB    1 
ATOM   2964  C CG1   . ILE A 1 374 ? 98.146  -65.795  1.945   1.00 111.68 ? 374 ILE A CG1   1 
ATOM   2965  C CG2   . ILE A 1 374 ? 100.395 -65.121  1.142   1.00 111.68 ? 374 ILE A CG2   1 
ATOM   2966  C CD1   . ILE A 1 374 ? 97.903  -64.648  2.903   1.00 110.59 ? 374 ILE A CD1   1 
ATOM   2967  N N     . LYS A 1 375 ? 101.934 -68.355  1.761   1.00 116.47 ? 375 LYS A N     1 
ATOM   2968  C CA    . LYS A 1 375 ? 103.369 -68.561  1.610   1.00 117.87 ? 375 LYS A CA    1 
ATOM   2969  C C     . LYS A 1 375 ? 103.729 -69.757  0.737   1.00 120.30 ? 375 LYS A C     1 
ATOM   2970  O O     . LYS A 1 375 ? 104.847 -69.837  0.232   1.00 121.12 ? 375 LYS A O     1 
ATOM   2971  C CB    . LYS A 1 375 ? 104.051 -68.653  2.974   1.00 118.02 ? 375 LYS A CB    1 
ATOM   2972  C CG    . LYS A 1 375 ? 103.946 -67.365  3.766   1.00 116.31 ? 375 LYS A CG    1 
ATOM   2973  C CD    . LYS A 1 375 ? 105.172 -67.105  4.598   1.00 116.36 ? 375 LYS A CD    1 
ATOM   2974  C CE    . LYS A 1 375 ? 105.048 -65.754  5.253   1.00 114.99 ? 375 LYS A CE    1 
ATOM   2975  N NZ    . LYS A 1 375 ? 106.272 -65.378  6.002   1.00 116.30 ? 375 LYS A NZ    1 
ATOM   2976  N N     . GLU A 1 376 ? 102.784 -70.674  0.543   1.00 121.93 ? 376 GLU A N     1 
ATOM   2977  C CA    . GLU A 1 376 ? 103.033 -71.843  -0.298  1.00 124.52 ? 376 GLU A CA    1 
ATOM   2978  C C     . GLU A 1 376 ? 102.627 -71.578  -1.750  1.00 124.75 ? 376 GLU A C     1 
ATOM   2979  O O     . GLU A 1 376 ? 101.696 -72.190  -2.273  1.00 125.60 ? 376 GLU A O     1 
ATOM   2980  C CB    . GLU A 1 376 ? 102.379 -73.104  0.288   1.00 126.03 ? 376 GLU A CB    1 
ATOM   2981  C CG    . GLU A 1 376 ? 102.930 -73.455  1.675   1.00 127.13 ? 376 GLU A CG    1 
ATOM   2982  C CD    . GLU A 1 376 ? 102.957 -74.947  1.984   1.00 130.36 ? 376 GLU A CD    1 
ATOM   2983  O OE1   . GLU A 1 376 ? 103.427 -75.748  1.139   1.00 132.24 ? 376 GLU A OE1   1 
ATOM   2984  O OE2   . GLU A 1 376 ? 102.532 -75.314  3.101   1.00 130.90 ? 376 GLU A OE2   1 
ATOM   2985  N N     . LYS A 1 377 ? 103.345 -70.640  -2.374  1.00 124.28 ? 377 LYS A N     1 
ATOM   2986  C CA    . LYS A 1 377 ? 103.178 -70.277  -3.787  1.00 124.58 ? 377 LYS A CA    1 
ATOM   2987  C C     . LYS A 1 377 ? 104.451 -69.645  -4.362  1.00 124.55 ? 377 LYS A C     1 
ATOM   2988  O O     . LYS A 1 377 ? 105.546 -70.206  -4.252  1.00 125.69 ? 377 LYS A O     1 
ATOM   2989  C CB    . LYS A 1 377 ? 101.981 -69.338  -3.973  1.00 122.99 ? 377 LYS A CB    1 
ATOM   2990  C CG    . LYS A 1 377 ? 100.703 -70.059  -4.337  1.00 124.05 ? 377 LYS A CG    1 
ATOM   2991  C CD    . LYS A 1 377 ? 99.493  -69.432  -3.678  1.00 123.27 ? 377 LYS A CD    1 
ATOM   2992  C CE    . LYS A 1 377 ? 98.313  -70.395  -3.708  1.00 124.64 ? 377 LYS A CE    1 
ATOM   2993  N NZ    . LYS A 1 377 ? 97.147  -69.875  -2.948  1.00 123.33 ? 377 LYS A NZ    1 
ATOM   2994  N N     . LYS B 1 3   ? 169.383 -22.288  -14.840 1.00 104.55 ? 3   LYS B N     1 
ATOM   2995  C CA    . LYS B 1 3   ? 168.030 -22.338  -14.223 1.00 101.21 ? 3   LYS B CA    1 
ATOM   2996  C C     . LYS B 1 3   ? 167.645 -23.779  -13.889 1.00 98.73  ? 3   LYS B C     1 
ATOM   2997  O O     . LYS B 1 3   ? 167.677 -24.661  -14.756 1.00 99.31  ? 3   LYS B O     1 
ATOM   2998  C CB    . LYS B 1 3   ? 166.985 -21.696  -15.144 1.00 101.93 ? 3   LYS B CB    1 
ATOM   2999  C CG    . LYS B 1 3   ? 165.801 -21.077  -14.407 1.00 100.33 ? 3   LYS B CG    1 
ATOM   3000  C CD    . LYS B 1 3   ? 164.774 -20.494  -15.366 1.00 101.45 ? 3   LYS B CD    1 
ATOM   3001  C CE    . LYS B 1 3   ? 163.647 -19.809  -14.602 1.00 100.09 ? 3   LYS B CE    1 
ATOM   3002  N NZ    . LYS B 1 3   ? 162.505 -19.427  -15.484 1.00 101.15 ? 3   LYS B NZ    1 
ATOM   3003  N N     . ILE B 1 4   ? 167.287 -23.997  -12.622 1.00 95.70  ? 4   ILE B N     1 
ATOM   3004  C CA    . ILE B 1 4   ? 166.943 -25.323  -12.095 1.00 92.92  ? 4   ILE B CA    1 
ATOM   3005  C C     . ILE B 1 4   ? 165.487 -25.386  -11.610 1.00 90.04  ? 4   ILE B C     1 
ATOM   3006  O O     . ILE B 1 4   ? 165.075 -24.602  -10.749 1.00 89.06  ? 4   ILE B O     1 
ATOM   3007  C CB    . ILE B 1 4   ? 167.949 -25.767  -10.976 1.00 92.67  ? 4   ILE B CB    1 
ATOM   3008  C CG1   . ILE B 1 4   ? 169.168 -26.469  -11.588 1.00 94.49  ? 4   ILE B CG1   1 
ATOM   3009  C CG2   . ILE B 1 4   ? 167.306 -26.707  -9.961  1.00 90.55  ? 4   ILE B CG2   1 
ATOM   3010  C CD1   . ILE B 1 4   ? 170.244 -25.533  -12.138 1.00 96.95  ? 4   ILE B CD1   1 
ATOM   3011  N N     . TYR B 1 5   ? 164.721 -26.314  -12.190 1.00 88.45  ? 5   TYR B N     1 
ATOM   3012  C CA    . TYR B 1 5   ? 163.338 -26.592  -11.779 1.00 85.51  ? 5   TYR B CA    1 
ATOM   3013  C C     . TYR B 1 5   ? 163.333 -27.656  -10.688 1.00 82.96  ? 5   TYR B C     1 
ATOM   3014  O O     . TYR B 1 5   ? 163.761 -28.793  -10.907 1.00 83.14  ? 5   TYR B O     1 
ATOM   3015  C CB    . TYR B 1 5   ? 162.470 -27.043  -12.973 1.00 62.41  ? 5   TYR B CB    1 
ATOM   3016  C CG    . TYR B 1 5   ? 162.277 -25.978  -14.046 1.00 64.04  ? 5   TYR B CG    1 
ATOM   3017  C CD1   . TYR B 1 5   ? 161.175 -25.094  -14.005 1.00 63.60  ? 5   TYR B CD1   1 
ATOM   3018  C CD2   . TYR B 1 5   ? 163.195 -25.853  -15.109 1.00 66.24  ? 5   TYR B CD2   1 
ATOM   3019  C CE1   . TYR B 1 5   ? 160.992 -24.096  -14.989 1.00 65.33  ? 5   TYR B CE1   1 
ATOM   3020  C CE2   . TYR B 1 5   ? 163.031 -24.859  -16.098 1.00 68.04  ? 5   TYR B CE2   1 
ATOM   3021  C CZ    . TYR B 1 5   ? 161.923 -23.990  -16.020 1.00 67.55  ? 5   TYR B CZ    1 
ATOM   3022  O OH    . TYR B 1 5   ? 161.766 -23.027  -17.003 1.00 69.54  ? 5   TYR B OH    1 
ATOM   3023  N N     . LEU B 1 6   ? 162.848 -27.278  -9.511  1.00 80.23  ? 6   LEU B N     1 
ATOM   3024  C CA    . LEU B 1 6   ? 162.885 -28.161  -8.352  1.00 78.28  ? 6   LEU B CA    1 
ATOM   3025  C C     . LEU B 1 6   ? 161.550 -28.870  -8.094  1.00 77.39  ? 6   LEU B C     1 
ATOM   3026  O O     . LEU B 1 6   ? 160.475 -28.263  -8.162  1.00 77.08  ? 6   LEU B O     1 
ATOM   3027  C CB    . LEU B 1 6   ? 163.343 -27.389  -7.114  1.00 78.04  ? 6   LEU B CB    1 
ATOM   3028  C CG    . LEU B 1 6   ? 163.790 -28.250  -5.933  1.00 78.27  ? 6   LEU B CG    1 
ATOM   3029  C CD1   . LEU B 1 6   ? 165.007 -27.647  -5.283  1.00 80.13  ? 6   LEU B CD1   1 
ATOM   3030  C CD2   . LEU B 1 6   ? 162.670 -28.449  -4.919  1.00 77.39  ? 6   LEU B CD2   1 
ATOM   3031  N N     . ILE B 1 7   ? 161.651 -30.163  -7.797  1.00 77.46  ? 7   ILE B N     1 
ATOM   3032  C CA    . ILE B 1 7   ? 160.510 -31.011  -7.487  1.00 76.60  ? 7   ILE B CA    1 
ATOM   3033  C C     . ILE B 1 7   ? 160.596 -31.503  -6.041  1.00 76.29  ? 7   ILE B C     1 
ATOM   3034  O O     . ILE B 1 7   ? 161.680 -31.822  -5.549  1.00 76.94  ? 7   ILE B O     1 
ATOM   3035  C CB    . ILE B 1 7   ? 160.428 -32.200  -8.478  1.00 76.84  ? 7   ILE B CB    1 
ATOM   3036  C CG1   . ILE B 1 7   ? 159.509 -31.865  -9.641  1.00 77.11  ? 7   ILE B CG1   1 
ATOM   3037  C CG2   . ILE B 1 7   ? 159.888 -33.442  -7.825  1.00 76.01  ? 7   ILE B CG2   1 
ATOM   3038  C CD1   . ILE B 1 7   ? 160.091 -30.895  -10.634 1.00 79.02  ? 7   ILE B CD1   1 
ATOM   3039  N N     . GLU B 1 8   ? 159.448 -31.521  -5.363  1.00 75.69  ? 8   GLU B N     1 
ATOM   3040  C CA    . GLU B 1 8   ? 159.298 -32.177  -4.063  1.00 75.38  ? 8   GLU B CA    1 
ATOM   3041  C C     . GLU B 1 8   ? 158.229 -33.254  -4.172  1.00 74.59  ? 8   GLU B C     1 
ATOM   3042  O O     . GLU B 1 8   ? 157.178 -33.022  -4.758  1.00 74.44  ? 8   GLU B O     1 
ATOM   3043  C CB    . GLU B 1 8   ? 158.926 -31.162  -2.976  1.00 75.12  ? 8   GLU B CB    1 
ATOM   3044  C CG    . GLU B 1 8   ? 160.042 -30.849  -1.992  1.00 76.81  ? 8   GLU B CG    1 
ATOM   3045  C CD    . GLU B 1 8   ? 160.060 -29.389  -1.574  1.00 79.15  ? 8   GLU B CD    1 
ATOM   3046  O OE1   . GLU B 1 8   ? 160.443 -28.543  -2.408  1.00 81.66  ? 8   GLU B OE1   1 
ATOM   3047  O OE2   . GLU B 1 8   ? 159.711 -29.075  -0.418  1.00 79.87  ? 8   GLU B OE2   1 
ATOM   3048  N N     . HIS B 1 9   ? 158.508 -34.429  -3.620  1.00 74.49  ? 9   HIS B N     1 
ATOM   3049  C CA    . HIS B 1 9   ? 157.584 -35.557  -3.672  1.00 74.14  ? 9   HIS B CA    1 
ATOM   3050  C C     . HIS B 1 9   ? 157.875 -36.458  -2.487  1.00 74.59  ? 9   HIS B C     1 
ATOM   3051  O O     . HIS B 1 9   ? 158.885 -36.270  -1.810  1.00 75.20  ? 9   HIS B O     1 
ATOM   3052  C CB    . HIS B 1 9   ? 157.766 -36.328  -4.986  1.00 74.64  ? 9   HIS B CB    1 
ATOM   3053  C CG    . HIS B 1 9   ? 156.753 -37.410  -5.209  1.00 73.69  ? 9   HIS B CG    1 
ATOM   3054  N ND1   . HIS B 1 9   ? 155.520 -37.171  -5.770  1.00 73.14  ? 9   HIS B ND1   1 
ATOM   3055  C CD2   . HIS B 1 9   ? 156.797 -38.740  -4.958  1.00 73.24  ? 9   HIS B CD2   1 
ATOM   3056  C CE1   . HIS B 1 9   ? 154.842 -38.302  -5.843  1.00 72.63  ? 9   HIS B CE1   1 
ATOM   3057  N NE2   . HIS B 1 9   ? 155.596 -39.270  -5.358  1.00 72.64  ? 9   HIS B NE2   1 
ATOM   3058  N N     . VAL B 1 10  ? 156.989 -37.423  -2.229  1.00 74.66  ? 10  VAL B N     1 
ATOM   3059  C CA    . VAL B 1 10  ? 157.240 -38.479  -1.244  1.00 75.40  ? 10  VAL B CA    1 
ATOM   3060  C C     . VAL B 1 10  ? 158.596 -39.135  -1.518  1.00 76.77  ? 10  VAL B C     1 
ATOM   3061  O O     . VAL B 1 10  ? 159.334 -39.479  -0.598  1.00 77.30  ? 10  VAL B O     1 
ATOM   3062  C CB    . VAL B 1 10  ? 156.113 -39.539  -1.259  1.00 75.16  ? 10  VAL B CB    1 
ATOM   3063  C CG1   . VAL B 1 10  ? 156.556 -40.832  -0.592  1.00 76.13  ? 10  VAL B CG1   1 
ATOM   3064  C CG2   . VAL B 1 10  ? 154.876 -39.008  -0.570  1.00 74.61  ? 10  VAL B CG2   1 
ATOM   3065  N N     . ILE B 1 11  ? 158.906 -39.258  -2.805  1.00 77.89  ? 11  ILE B N     1 
ATOM   3066  C CA    . ILE B 1 11  ? 160.115 -39.882  -3.346  1.00 79.41  ? 11  ILE B CA    1 
ATOM   3067  C C     . ILE B 1 11  ? 161.421 -39.158  -2.963  1.00 80.04  ? 11  ILE B C     1 
ATOM   3068  O O     . ILE B 1 11  ? 162.488 -39.762  -2.955  1.00 81.15  ? 11  ILE B O     1 
ATOM   3069  C CB    . ILE B 1 11  ? 159.985 -39.976  -4.899  1.00 79.78  ? 11  ILE B CB    1 
ATOM   3070  C CG1   . ILE B 1 11  ? 160.653 -41.214  -5.464  1.00 81.23  ? 11  ILE B CG1   1 
ATOM   3071  C CG2   . ILE B 1 11  ? 160.536 -38.742  -5.605  1.00 80.30  ? 11  ILE B CG2   1 
ATOM   3072  C CD1   . ILE B 1 11  ? 160.648 -41.185  -6.979  1.00 82.13  ? 11  ILE B CD1   1 
ATOM   3073  N N     . GLY B 1 12  ? 161.330 -37.870  -2.652  1.00 79.64  ? 12  GLY B N     1 
ATOM   3074  C CA    . GLY B 1 12  ? 162.508 -37.082  -2.317  1.00 80.71  ? 12  GLY B CA    1 
ATOM   3075  C C     . GLY B 1 12  ? 162.508 -35.726  -2.994  1.00 80.91  ? 12  GLY B C     1 
ATOM   3076  O O     . GLY B 1 12  ? 161.455 -35.197  -3.353  1.00 80.31  ? 12  GLY B O     1 
ATOM   3077  N N     . ALA B 1 13  ? 163.695 -35.158  -3.161  1.00 82.12  ? 13  ALA B N     1 
ATOM   3078  C CA    . ALA B 1 13  ? 163.837 -33.864  -3.805  1.00 82.64  ? 13  ALA B CA    1 
ATOM   3079  C C     . ALA B 1 13  ? 164.692 -33.996  -5.060  1.00 84.11  ? 13  ALA B C     1 
ATOM   3080  O O     . ALA B 1 13  ? 165.843 -34.419  -4.987  1.00 85.28  ? 13  ALA B O     1 
ATOM   3081  C CB    . ALA B 1 13  ? 164.442 -32.861  -2.837  1.00 82.78  ? 13  ALA B CB    1 
ATOM   3082  N N     . VAL B 1 14  ? 164.117 -33.642  -6.208  1.00 84.46  ? 14  VAL B N     1 
ATOM   3083  C CA    . VAL B 1 14  ? 164.782 -33.787  -7.501  1.00 86.08  ? 14  VAL B CA    1 
ATOM   3084  C C     . VAL B 1 14  ? 164.918 -32.441  -8.207  1.00 87.17  ? 14  VAL B C     1 
ATOM   3085  O O     . VAL B 1 14  ? 163.979 -31.645  -8.241  1.00 86.54  ? 14  VAL B O     1 
ATOM   3086  C CB    . VAL B 1 14  ? 164.028 -34.780  -8.421  1.00 85.92  ? 14  VAL B CB    1 
ATOM   3087  C CG1   . VAL B 1 14  ? 164.724 -34.914  -9.757  1.00 87.46  ? 14  VAL B CG1   1 
ATOM   3088  C CG2   . VAL B 1 14  ? 163.921 -36.143  -7.764  1.00 85.67  ? 14  VAL B CG2   1 
ATOM   3089  N N     . ALA B 1 15  ? 166.101 -32.194  -8.762  1.00 89.31  ? 15  ALA B N     1 
ATOM   3090  C CA    . ALA B 1 15  ? 166.356 -30.998  -9.548  1.00 90.70  ? 15  ALA B CA    1 
ATOM   3091  C C     . ALA B 1 15  ? 166.359 -31.354  -11.024 1.00 92.38  ? 15  ALA B C     1 
ATOM   3092  O O     . ALA B 1 15  ? 167.016 -32.306  -11.441 1.00 93.34  ? 15  ALA B O     1 
ATOM   3093  C CB    . ALA B 1 15  ? 167.676 -30.375  -9.147  1.00 91.72  ? 15  ALA B CB    1 
ATOM   3094  N N     . TYR B 1 16  ? 165.602 -30.595  -11.804 1.00 93.28  ? 16  TYR B N     1 
ATOM   3095  C CA    . TYR B 1 16  ? 165.547 -30.762  -13.249 1.00 95.56  ? 16  TYR B CA    1 
ATOM   3096  C C     . TYR B 1 16  ? 166.077 -29.503  -13.919 1.00 97.90  ? 16  TYR B C     1 
ATOM   3097  O O     . TYR B 1 16  ? 165.997 -28.419  -13.350 1.00 97.48  ? 16  TYR B O     1 
ATOM   3098  C CB    . TYR B 1 16  ? 164.103 -30.993  -13.705 1.00 94.69  ? 16  TYR B CB    1 
ATOM   3099  C CG    . TYR B 1 16  ? 163.572 -32.403  -13.538 1.00 93.47  ? 16  TYR B CG    1 
ATOM   3100  C CD1   . TYR B 1 16  ? 162.954 -32.800  -12.355 1.00 91.51  ? 16  TYR B CD1   1 
ATOM   3101  C CD2   . TYR B 1 16  ? 163.664 -33.332  -14.576 1.00 94.10  ? 16  TYR B CD2   1 
ATOM   3102  C CE1   . TYR B 1 16  ? 162.460 -34.095  -12.201 1.00 90.72  ? 16  TYR B CE1   1 
ATOM   3103  C CE2   . TYR B 1 16  ? 163.174 -34.623  -14.433 1.00 93.28  ? 16  TYR B CE2   1 
ATOM   3104  C CZ    . TYR B 1 16  ? 162.578 -34.997  -13.242 1.00 91.76  ? 16  TYR B CZ    1 
ATOM   3105  O OH    . TYR B 1 16  ? 162.096 -36.273  -13.091 1.00 91.77  ? 16  TYR B OH    1 
ATOM   3106  N N     . ASP B 1 17  ? 166.625 -29.648  -15.122 1.00 101.05 ? 17  ASP B N     1 
ATOM   3107  C CA    . ASP B 1 17  ? 166.926 -28.495  -15.970 1.00 103.99 ? 17  ASP B CA    1 
ATOM   3108  C C     . ASP B 1 17  ? 165.661 -28.148  -16.760 1.00 104.78 ? 17  ASP B C     1 
ATOM   3109  O O     . ASP B 1 17  ? 164.620 -28.780  -16.566 1.00 103.57 ? 17  ASP B O     1 
ATOM   3110  C CB    . ASP B 1 17  ? 168.117 -28.785  -16.895 1.00 106.44 ? 17  ASP B CB    1 
ATOM   3111  C CG    . ASP B 1 17  ? 167.865 -29.947  -17.846 1.00 107.49 ? 17  ASP B CG    1 
ATOM   3112  O OD1   . ASP B 1 17  ? 168.546 -29.996  -18.892 1.00 110.26 ? 17  ASP B OD1   1 
ATOM   3113  O OD2   . ASP B 1 17  ? 167.002 -30.808  -17.561 1.00 105.78 ? 17  ASP B OD2   1 
ATOM   3114  N N     . GLU B 1 18  ? 165.734 -27.156  -17.642 1.00 107.42 ? 18  GLU B N     1 
ATOM   3115  C CA    . GLU B 1 18  ? 164.554 -26.772  -18.423 1.00 108.62 ? 18  GLU B CA    1 
ATOM   3116  C C     . GLU B 1 18  ? 164.111 -27.849  -19.414 1.00 109.87 ? 18  GLU B C     1 
ATOM   3117  O O     . GLU B 1 18  ? 162.952 -27.864  -19.836 1.00 109.87 ? 18  GLU B O     1 
ATOM   3118  C CB    . GLU B 1 18  ? 164.759 -25.428  -19.127 1.00 110.86 ? 18  GLU B CB    1 
ATOM   3119  C CG    . GLU B 1 18  ? 165.944 -25.374  -20.079 1.00 113.99 ? 18  GLU B CG    1 
ATOM   3120  C CD    . GLU B 1 18  ? 166.576 -23.997  -20.130 1.00 116.02 ? 18  GLU B CD    1 
ATOM   3121  O OE1   . GLU B 1 18  ? 166.849 -23.425  -19.050 1.00 115.32 ? 18  GLU B OE1   1 
ATOM   3122  O OE2   . GLU B 1 18  ? 166.809 -23.489  -21.247 1.00 118.58 ? 18  GLU B OE2   1 
ATOM   3123  N N     . ASN B 1 19  ? 165.033 -28.744  -19.769 1.00 111.28 ? 19  ASN B N     1 
ATOM   3124  C CA    . ASN B 1 19  ? 164.747 -29.821  -20.717 1.00 112.81 ? 19  ASN B CA    1 
ATOM   3125  C C     . ASN B 1 19  ? 163.943 -30.974  -20.117 1.00 110.78 ? 19  ASN B C     1 
ATOM   3126  O O     . ASN B 1 19  ? 163.197 -31.649  -20.827 1.00 111.44 ? 19  ASN B O     1 
ATOM   3127  C CB    . ASN B 1 19  ? 166.042 -30.353  -21.339 1.00 115.10 ? 19  ASN B CB    1 
ATOM   3128  C CG    . ASN B 1 19  ? 166.755 -29.313  -22.190 1.00 118.35 ? 19  ASN B CG    1 
ATOM   3129  O OD1   . ASN B 1 19  ? 166.124 -28.564  -22.940 1.00 119.90 ? 19  ASN B OD1   1 
ATOM   3130  N ND2   . ASN B 1 19  ? 168.082 -29.270  -22.082 1.00 119.79 ? 19  ASN B ND2   1 
ATOM   3131  N N     . GLY B 1 20  ? 164.096 -31.197  -18.817 1.00 108.63 ? 20  GLY B N     1 
ATOM   3132  C CA    . GLY B 1 20  ? 163.416 -32.299  -18.151 1.00 106.85 ? 20  GLY B CA    1 
ATOM   3133  C C     . GLY B 1 20  ? 164.347 -33.464  -17.890 1.00 107.15 ? 20  GLY B C     1 
ATOM   3134  O O     . GLY B 1 20  ? 163.926 -34.619  -17.930 1.00 106.75 ? 20  GLY B O     1 
ATOM   3135  N N     . ASN B 1 21  ? 165.614 -33.150  -17.625 1.00 108.08 ? 21  ASN B N     1 
ATOM   3136  C CA    . ASN B 1 21  ? 166.626 -34.146  -17.278 1.00 108.56 ? 21  ASN B CA    1 
ATOM   3137  C C     . ASN B 1 21  ? 167.057 -33.973  -15.833 1.00 107.12 ? 21  ASN B C     1 
ATOM   3138  O O     . ASN B 1 21  ? 167.353 -32.856  -15.401 1.00 106.99 ? 21  ASN B O     1 
ATOM   3139  C CB    . ASN B 1 21  ? 167.853 -34.014  -18.184 1.00 111.10 ? 21  ASN B CB    1 
ATOM   3140  C CG    . ASN B 1 21  ? 167.500 -34.017  -19.658 1.00 112.98 ? 21  ASN B CG    1 
ATOM   3141  O OD1   . ASN B 1 21  ? 167.578 -32.987  -20.325 1.00 114.21 ? 21  ASN B OD1   1 
ATOM   3142  N ND2   . ASN B 1 21  ? 167.107 -35.176  -20.175 1.00 113.22 ? 21  ASN B ND2   1 
ATOM   3143  N N     . ILE B 1 22  ? 167.097 -35.077  -15.092 1.00 106.33 ? 22  ILE B N     1 
ATOM   3144  C CA    . ILE B 1 22  ? 167.494 -35.044  -13.691 1.00 105.29 ? 22  ILE B CA    1 
ATOM   3145  C C     . ILE B 1 22  ? 168.948 -34.593  -13.588 1.00 107.11 ? 22  ILE B C     1 
ATOM   3146  O O     . ILE B 1 22  ? 169.866 -35.316  -13.985 1.00 108.77 ? 22  ILE B O     1 
ATOM   3147  C CB    . ILE B 1 22  ? 167.300 -36.411  -13.002 1.00 104.33 ? 22  ILE B CB    1 
ATOM   3148  C CG1   . ILE B 1 22  ? 165.840 -36.868  -13.122 1.00 102.99 ? 22  ILE B CG1   1 
ATOM   3149  C CG2   . ILE B 1 22  ? 167.740 -36.338  -11.539 1.00 103.23 ? 22  ILE B CG2   1 
ATOM   3150  C CD1   . ILE B 1 22  ? 165.634 -38.378  -13.030 1.00 103.00 ? 22  ILE B CD1   1 
ATOM   3151  N N     . VAL B 1 23  ? 169.141 -33.377  -13.083 1.00 107.10 ? 23  VAL B N     1 
ATOM   3152  C CA    . VAL B 1 23  ? 170.477 -32.825  -12.883 1.00 108.75 ? 23  VAL B CA    1 
ATOM   3153  C C     . VAL B 1 23  ? 171.089 -33.399  -11.607 1.00 108.23 ? 23  VAL B C     1 
ATOM   3154  O O     . VAL B 1 23  ? 172.256 -33.774  -11.594 1.00 109.95 ? 23  VAL B O     1 
ATOM   3155  C CB    . VAL B 1 23  ? 170.468 -31.277  -12.842 1.00 108.92 ? 23  VAL B CB    1 
ATOM   3156  C CG1   . VAL B 1 23  ? 171.891 -30.726  -12.708 1.00 110.98 ? 23  VAL B CG1   1 
ATOM   3157  C CG2   . VAL B 1 23  ? 169.806 -30.716  -14.094 1.00 109.80 ? 23  VAL B CG2   1 
ATOM   3158  N N     . ASP B 1 24  ? 170.294 -33.467  -10.544 1.00 106.44 ? 24  ASP B N     1 
ATOM   3159  C CA    . ASP B 1 24  ? 170.708 -34.085  -9.284  1.00 106.11 ? 24  ASP B CA    1 
ATOM   3160  C C     . ASP B 1 24  ? 169.487 -34.344  -8.399  1.00 104.26 ? 24  ASP B C     1 
ATOM   3161  O O     . ASP B 1 24  ? 168.476 -33.642  -8.493  1.00 103.18 ? 24  ASP B O     1 
ATOM   3162  C CB    . ASP B 1 24  ? 171.736 -33.210  -8.544  1.00 106.83 ? 24  ASP B CB    1 
ATOM   3163  C CG    . ASP B 1 24  ? 172.577 -34.000  -7.538  1.00 107.18 ? 24  ASP B CG    1 
ATOM   3164  O OD1   . ASP B 1 24  ? 172.482 -35.245  -7.516  1.00 107.04 ? 24  ASP B OD1   1 
ATOM   3165  O OD2   . ASP B 1 24  ? 173.341 -33.373  -6.770  1.00 107.17 ? 24  ASP B OD2   1 
ATOM   3166  N N     . TYR B 1 25  ? 169.592 -35.352  -7.540  1.00 104.06 ? 25  TYR B N     1 
ATOM   3167  C CA    . TYR B 1 25  ? 168.493 -35.752  -6.672  1.00 102.55 ? 25  TYR B CA    1 
ATOM   3168  C C     . TYR B 1 25  ? 169.013 -36.110  -5.291  1.00 102.66 ? 25  TYR B C     1 
ATOM   3169  O O     . TYR B 1 25  ? 170.165 -36.508  -5.151  1.00 104.16 ? 25  TYR B O     1 
ATOM   3170  C CB    . TYR B 1 25  ? 167.769 -36.962  -7.269  1.00 102.33 ? 25  TYR B CB    1 
ATOM   3171  C CG    . TYR B 1 25  ? 168.648 -38.185  -7.397  1.00 103.76 ? 25  TYR B CG    1 
ATOM   3172  C CD1   . TYR B 1 25  ? 168.739 -39.110  -6.358  1.00 103.95 ? 25  TYR B CD1   1 
ATOM   3173  C CD2   . TYR B 1 25  ? 169.395 -38.415  -8.554  1.00 105.74 ? 25  TYR B CD2   1 
ATOM   3174  C CE1   . TYR B 1 25  ? 169.553 -40.233  -6.464  1.00 106.02 ? 25  TYR B CE1   1 
ATOM   3175  C CE2   . TYR B 1 25  ? 170.214 -39.539  -8.674  1.00 107.51 ? 25  TYR B CE2   1 
ATOM   3176  C CZ    . TYR B 1 25  ? 170.289 -40.442  -7.622  1.00 107.27 ? 25  TYR B CZ    1 
ATOM   3177  O OH    . TYR B 1 25  ? 171.092 -41.553  -7.720  1.00 108.17 ? 25  TYR B OH    1 
ATOM   3178  N N     . ILE B 1 26  ? 168.168 -35.959  -4.276  1.00 101.47 ? 26  ILE B N     1 
ATOM   3179  C CA    . ILE B 1 26  ? 168.431 -36.547  -2.960  1.00 101.63 ? 26  ILE B CA    1 
ATOM   3180  C C     . ILE B 1 26  ? 167.207 -37.317  -2.511  1.00 100.46 ? 26  ILE B C     1 
ATOM   3181  O O     . ILE B 1 26  ? 166.137 -36.743  -2.318  1.00 99.40  ? 26  ILE B O     1 
ATOM   3182  C CB    . ILE B 1 26  ? 168.852 -35.510  -1.889  1.00 101.71 ? 26  ILE B CB    1 
ATOM   3183  C CG1   . ILE B 1 26  ? 170.255 -34.990  -2.206  1.00 103.62 ? 26  ILE B CG1   1 
ATOM   3184  C CG2   . ILE B 1 26  ? 168.810 -36.138  -0.488  1.00 101.34 ? 26  ILE B CG2   1 
ATOM   3185  C CD1   . ILE B 1 26  ? 170.759 -33.917  -1.287  1.00 104.77 ? 26  ILE B CD1   1 
ATOM   3186  N N     . THR B 1 27  ? 167.383 -38.624  -2.363  1.00 101.10 ? 27  THR B N     1 
ATOM   3187  C CA    . THR B 1 27  ? 166.307 -39.530  -1.990  1.00 100.41 ? 27  THR B CA    1 
ATOM   3188  C C     . THR B 1 27  ? 165.918 -39.342  -0.521  1.00 99.95  ? 27  THR B C     1 
ATOM   3189  O O     . THR B 1 27  ? 166.780 -39.138  0.338   1.00 101.04 ? 27  THR B O     1 
ATOM   3190  C CB    . THR B 1 27  ? 166.715 -40.997  -2.258  1.00 101.54 ? 27  THR B CB    1 
ATOM   3191  O OG1   . THR B 1 27  ? 167.312 -41.095  -3.560  1.00 102.71 ? 27  THR B OG1   1 
ATOM   3192  C CG2   . THR B 1 27  ? 165.512 -41.924  -2.188  1.00 100.61 ? 27  THR B CG2   1 
ATOM   3193  N N     . ASN B 1 28  ? 164.614 -39.385  -0.252  1.00 98.54  ? 28  ASN B N     1 
ATOM   3194  C CA    . ASN B 1 28  ? 164.093 -39.343  1.110   1.00 98.02  ? 28  ASN B CA    1 
ATOM   3195  C C     . ASN B 1 28  ? 164.381 -40.649  1.849   1.00 98.93  ? 28  ASN B C     1 
ATOM   3196  O O     . ASN B 1 28  ? 164.635 -41.677  1.213   1.00 99.44  ? 28  ASN B O     1 
ATOM   3197  C CB    . ASN B 1 28  ? 162.583 -39.077  1.096   1.00 96.65  ? 28  ASN B CB    1 
ATOM   3198  C CG    . ASN B 1 28  ? 162.232 -37.622  1.358   1.00 95.84  ? 28  ASN B CG    1 
ATOM   3199  O OD1   . ASN B 1 28  ? 162.961 -36.901  2.039   1.00 96.63  ? 28  ASN B OD1   1 
ATOM   3200  N ND2   . ASN B 1 28  ? 161.091 -37.190  0.834   1.00 94.62  ? 28  ASN B ND2   1 
ATOM   3201  N N     . PRO B 1 29  ? 164.361 -40.613  3.196   1.00 99.23  ? 29  PRO B N     1 
ATOM   3202  C CA    . PRO B 1 29  ? 164.396 -41.869  3.938   1.00 100.19 ? 29  PRO B CA    1 
ATOM   3203  C C     . PRO B 1 29  ? 163.037 -42.555  3.853   1.00 99.34  ? 29  PRO B C     1 
ATOM   3204  O O     . PRO B 1 29  ? 162.013 -41.888  3.933   1.00 98.25  ? 29  PRO B O     1 
ATOM   3205  C CB    . PRO B 1 29  ? 164.668 -41.416  5.371   1.00 100.98 ? 29  PRO B CB    1 
ATOM   3206  C CG    . PRO B 1 29  ? 164.111 -40.036  5.440   1.00 99.68  ? 29  PRO B CG    1 
ATOM   3207  C CD    . PRO B 1 29  ? 164.359 -39.439  4.091   1.00 98.99  ? 29  PRO B CD    1 
ATOM   3208  N N     . ARG B 1 30  ? 163.027 -43.872  3.682   1.00 100.04 ? 30  ARG B N     1 
ATOM   3209  C CA    . ARG B 1 30  ? 161.780 -44.637  3.647   1.00 99.51  ? 30  ARG B CA    1 
ATOM   3210  C C     . ARG B 1 30  ? 161.204 -44.808  5.078   1.00 99.78  ? 30  ARG B C     1 
ATOM   3211  O O     . ARG B 1 30  ? 161.188 -45.907  5.644   1.00 100.99 ? 30  ARG B O     1 
ATOM   3212  C CB    . ARG B 1 30  ? 162.023 -45.974  2.944   1.00 100.51 ? 30  ARG B CB    1 
ATOM   3213  C CG    . ARG B 1 30  ? 160.796 -46.805  2.670   1.00 101.02 ? 30  ARG B CG    1 
ATOM   3214  C CD    . ARG B 1 30  ? 161.101 -48.260  2.999   1.00 104.84 ? 30  ARG B CD    1 
ATOM   3215  N NE    . ARG B 1 30  ? 160.224 -49.184  2.293   1.00 106.10 ? 30  ARG B NE    1 
ATOM   3216  C CZ    . ARG B 1 30  ? 160.321 -49.462  0.997   1.00 106.84 ? 30  ARG B CZ    1 
ATOM   3217  N NH1   . ARG B 1 30  ? 161.252 -48.877  0.248   1.00 106.79 ? 30  ARG B NH1   1 
ATOM   3218  N NH2   . ARG B 1 30  ? 159.477 -50.322  0.446   1.00 107.62 ? 30  ARG B NH2   1 
ATOM   3219  N N     . ASP B 1 31  ? 160.738 -43.695  5.646   1.00 98.63  ? 31  ASP B N     1 
ATOM   3220  C CA    . ASP B 1 31  ? 160.223 -43.640  7.011   1.00 98.94  ? 31  ASP B CA    1 
ATOM   3221  C C     . ASP B 1 31  ? 158.886 -42.898  7.037   1.00 97.43  ? 31  ASP B C     1 
ATOM   3222  O O     . ASP B 1 31  ? 158.843 -41.688  6.794   1.00 96.50  ? 31  ASP B O     1 
ATOM   3223  C CB    . ASP B 1 31  ? 161.243 -42.936  7.927   1.00 99.95  ? 31  ASP B CB    1 
ATOM   3224  C CG    . ASP B 1 31  ? 160.739 -42.759  9.361   1.00 100.64 ? 31  ASP B CG    1 
ATOM   3225  O OD1   . ASP B 1 31  ? 160.562 -43.767  10.073  1.00 102.35 ? 31  ASP B OD1   1 
ATOM   3226  O OD2   . ASP B 1 31  ? 160.532 -41.606  9.785   1.00 99.38  ? 31  ASP B OD2   1 
ATOM   3227  N N     . LEU B 1 32  ? 157.805 -43.620  7.337   1.00 97.23  ? 32  LEU B N     1 
ATOM   3228  C CA    . LEU B 1 32  ? 156.460 -43.034  7.412   1.00 95.77  ? 32  LEU B CA    1 
ATOM   3229  C C     . LEU B 1 32  ? 156.419 -41.787  8.283   1.00 95.62  ? 32  LEU B C     1 
ATOM   3230  O O     . LEU B 1 32  ? 155.907 -40.761  7.855   1.00 94.62  ? 32  LEU B O     1 
ATOM   3231  C CB    . LEU B 1 32  ? 155.438 -44.036  7.949   1.00 96.39  ? 32  LEU B CB    1 
ATOM   3232  C CG    . LEU B 1 32  ? 155.013 -45.251  7.131   1.00 96.06  ? 32  LEU B CG    1 
ATOM   3233  C CD1   . LEU B 1 32  ? 154.047 -46.105  7.947   1.00 97.10  ? 32  LEU B CD1   1 
ATOM   3234  C CD2   . LEU B 1 32  ? 154.383 -44.824  5.837   1.00 93.98  ? 32  LEU B CD2   1 
ATOM   3235  N N     . GLY B 1 33  ? 156.958 -41.884  9.497   1.00 97.00  ? 33  GLY B N     1 
ATOM   3236  C CA    . GLY B 1 33  ? 156.973 -40.773  10.443  1.00 97.10  ? 33  GLY B CA    1 
ATOM   3237  C C     . GLY B 1 33  ? 157.470 -39.463  9.856   1.00 96.02  ? 33  GLY B C     1 
ATOM   3238  O O     . GLY B 1 33  ? 156.759 -38.458  9.893   1.00 94.95  ? 33  GLY B O     1 
ATOM   3239  N N     . LYS B 1 34  ? 158.680 -39.486  9.294   1.00 96.31  ? 34  LYS B N     1 
ATOM   3240  C CA    . LYS B 1 34  ? 159.359 -38.267  8.831   1.00 95.83  ? 34  LYS B CA    1 
ATOM   3241  C C     . LYS B 1 34  ? 158.758 -37.640  7.578   1.00 94.02  ? 34  LYS B C     1 
ATOM   3242  O O     . LYS B 1 34  ? 158.656 -36.414  7.488   1.00 93.40  ? 34  LYS B O     1 
ATOM   3243  C CB    . LYS B 1 34  ? 160.858 -38.511  8.636   1.00 96.92  ? 34  LYS B CB    1 
ATOM   3244  C CG    . LYS B 1 34  ? 161.641 -38.526  9.938   1.00 99.62  ? 34  LYS B CG    1 
ATOM   3245  C CD    . LYS B 1 34  ? 163.078 -38.962  9.728   1.00 102.32 ? 34  LYS B CD    1 
ATOM   3246  C CE    . LYS B 1 34  ? 163.806 -39.057  11.056  1.00 105.19 ? 34  LYS B CE    1 
ATOM   3247  N NZ    . LYS B 1 34  ? 165.234 -39.411  10.859  1.00 107.61 ? 34  LYS B NZ    1 
ATOM   3248  N N     . ILE B 1 35  ? 158.366 -38.475  6.617   1.00 93.36  ? 35  ILE B N     1 
ATOM   3249  C CA    . ILE B 1 35  ? 157.715 -37.988  5.394   1.00 91.78  ? 35  ILE B CA    1 
ATOM   3250  C C     . ILE B 1 35  ? 156.398 -37.269  5.703   1.00 90.69  ? 35  ILE B C     1 
ATOM   3251  O O     . ILE B 1 35  ? 156.209 -36.125  5.298   1.00 89.76  ? 35  ILE B O     1 
ATOM   3252  C CB    . ILE B 1 35  ? 157.456 -39.115  4.350   1.00 91.68  ? 35  ILE B CB    1 
ATOM   3253  C CG1   . ILE B 1 35  ? 158.680 -40.023  4.167   1.00 92.43  ? 35  ILE B CG1   1 
ATOM   3254  C CG2   . ILE B 1 35  ? 157.011 -38.508  3.012   1.00 90.51  ? 35  ILE B CG2   1 
ATOM   3255  C CD1   . ILE B 1 35  ? 159.831 -39.395  3.406   1.00 93.04  ? 35  ILE B CD1   1 
ATOM   3256  N N     . THR B 1 36  ? 155.503 -37.949  6.421   1.00 90.89  ? 36  THR B N     1 
ATOM   3257  C CA    . THR B 1 36  ? 154.224 -37.375  6.844   1.00 90.38  ? 36  THR B CA    1 
ATOM   3258  C C     . THR B 1 36  ? 154.408 -35.974  7.428   1.00 90.44  ? 36  THR B C     1 
ATOM   3259  O O     . THR B 1 36  ? 153.748 -35.028  6.993   1.00 89.53  ? 36  THR B O     1 
ATOM   3260  C CB    . THR B 1 36  ? 153.491 -38.281  7.867   1.00 91.14  ? 36  THR B CB    1 
ATOM   3261  O OG1   . THR B 1 36  ? 153.336 -39.597  7.325   1.00 91.05  ? 36  THR B OG1   1 
ATOM   3262  C CG2   . THR B 1 36  ? 152.118 -37.727  8.196   1.00 90.67  ? 36  THR B CG2   1 
ATOM   3263  N N     . GLU B 1 37  ? 155.323 -35.850  8.387   1.00 91.67  ? 37  GLU B N     1 
ATOM   3264  C CA    . GLU B 1 37  ? 155.610 -34.575  9.040   1.00 92.15  ? 37  GLU B CA    1 
ATOM   3265  C C     . GLU B 1 37  ? 156.093 -33.518  8.061   1.00 91.19  ? 37  GLU B C     1 
ATOM   3266  O O     . GLU B 1 37  ? 155.693 -32.357  8.157   1.00 90.90  ? 37  GLU B O     1 
ATOM   3267  C CB    . GLU B 1 37  ? 156.644 -34.748  10.157  1.00 93.87  ? 37  GLU B CB    1 
ATOM   3268  C CG    . GLU B 1 37  ? 156.244 -35.727  11.253  1.00 96.24  ? 37  GLU B CG    1 
ATOM   3269  C CD    . GLU B 1 37  ? 155.240 -35.162  12.243  1.00 98.24  ? 37  GLU B CD    1 
ATOM   3270  O OE1   . GLU B 1 37  ? 154.693 -34.059  12.006  1.00 97.76  ? 37  GLU B OE1   1 
ATOM   3271  O OE2   . GLU B 1 37  ? 155.003 -35.833  13.273  1.00 100.45 ? 37  GLU B OE2   1 
ATOM   3272  N N     . GLU B 1 38  ? 156.948 -33.920  7.123   1.00 91.05  ? 38  GLU B N     1 
ATOM   3273  C CA    . GLU B 1 38  ? 157.510 -32.978  6.150   1.00 90.63  ? 38  GLU B CA    1 
ATOM   3274  C C     . GLU B 1 38  ? 156.482 -32.514  5.120   1.00 89.27  ? 38  GLU B C     1 
ATOM   3275  O O     . GLU B 1 38  ? 156.557 -31.385  4.627   1.00 89.10  ? 38  GLU B O     1 
ATOM   3276  C CB    . GLU B 1 38  ? 158.762 -33.546  5.477   1.00 91.19  ? 38  GLU B CB    1 
ATOM   3277  C CG    . GLU B 1 38  ? 159.986 -33.535  6.402   1.00 93.35  ? 38  GLU B CG    1 
ATOM   3278  C CD    . GLU B 1 38  ? 161.305 -33.431  5.656   1.00 94.73  ? 38  GLU B CD    1 
ATOM   3279  O OE1   . GLU B 1 38  ? 161.492 -34.164  4.657   1.00 95.23  ? 38  GLU B OE1   1 
ATOM   3280  O OE2   . GLU B 1 38  ? 162.156 -32.613  6.074   1.00 95.47  ? 38  GLU B OE2   1 
ATOM   3281  N N     . LEU B 1 39  ? 155.524 -33.392  4.821   1.00 88.49  ? 39  LEU B N     1 
ATOM   3282  C CA    . LEU B 1 39  ? 154.385 -33.074  3.967   1.00 87.05  ? 39  LEU B CA    1 
ATOM   3283  C C     . LEU B 1 39  ? 153.423 -32.121  4.661   1.00 86.77  ? 39  LEU B C     1 
ATOM   3284  O O     . LEU B 1 39  ? 152.938 -31.174  4.040   1.00 86.44  ? 39  LEU B O     1 
ATOM   3285  C CB    . LEU B 1 39  ? 153.643 -34.346  3.582   1.00 86.79  ? 39  LEU B CB    1 
ATOM   3286  C CG    . LEU B 1 39  ? 154.345 -35.318  2.646   1.00 86.18  ? 39  LEU B CG    1 
ATOM   3287  C CD1   . LEU B 1 39  ? 153.638 -36.663  2.709   1.00 85.51  ? 39  LEU B CD1   1 
ATOM   3288  C CD2   . LEU B 1 39  ? 154.381 -34.764  1.223   1.00 85.20  ? 39  LEU B CD2   1 
ATOM   3289  N N     . LEU B 1 40  ? 153.142 -32.384  5.938   1.00 87.00  ? 40  LEU B N     1 
ATOM   3290  C CA    . LEU B 1 40  ? 152.343 -31.477  6.759   1.00 86.96  ? 40  LEU B CA    1 
ATOM   3291  C C     . LEU B 1 40  ? 153.036 -30.128  6.846   1.00 87.26  ? 40  LEU B C     1 
ATOM   3292  O O     . LEU B 1 40  ? 152.391 -29.084  6.761   1.00 87.12  ? 40  LEU B O     1 
ATOM   3293  C CB    . LEU B 1 40  ? 152.123 -32.031  8.172   1.00 87.60  ? 40  LEU B CB    1 
ATOM   3294  C CG    . LEU B 1 40  ? 151.202 -33.233  8.423   1.00 87.59  ? 40  LEU B CG    1 
ATOM   3295  C CD1   . LEU B 1 40  ? 151.418 -33.788  9.821   1.00 88.35  ? 40  LEU B CD1   1 
ATOM   3296  C CD2   . LEU B 1 40  ? 149.736 -32.900  8.219   1.00 86.71  ? 40  LEU B CD2   1 
ATOM   3297  N N     . ASN B 1 41  ? 154.354 -30.155  7.009   1.00 87.97  ? 41  ASN B N     1 
ATOM   3298  C CA    . ASN B 1 41  ? 155.137 -28.932  7.078   1.00 88.52  ? 41  ASN B CA    1 
ATOM   3299  C C     . ASN B 1 41  ? 155.204 -28.185  5.749   1.00 87.95  ? 41  ASN B C     1 
ATOM   3300  O O     . ASN B 1 41  ? 155.215 -26.956  5.734   1.00 88.09  ? 41  ASN B O     1 
ATOM   3301  C CB    . ASN B 1 41  ? 156.546 -29.213  7.611   1.00 89.71  ? 41  ASN B CB    1 
ATOM   3302  C CG    . ASN B 1 41  ? 156.569 -29.462  9.115   1.00 90.74  ? 41  ASN B CG    1 
ATOM   3303  O OD1   . ASN B 1 41  ? 155.797 -28.873  9.872   1.00 90.08  ? 41  ASN B OD1   1 
ATOM   3304  N ND2   . ASN B 1 41  ? 157.475 -30.332  9.552   1.00 92.41  ? 41  ASN B ND2   1 
ATOM   3305  N N     . ASN B 1 42  ? 155.235 -28.923  4.640   1.00 87.65  ? 42  ASN B N     1 
ATOM   3306  C CA    . ASN B 1 42  ? 155.309 -28.309  3.312   1.00 87.55  ? 42  ASN B CA    1 
ATOM   3307  C C     . ASN B 1 42  ? 154.121 -27.404  3.007   1.00 87.47  ? 42  ASN B C     1 
ATOM   3308  O O     . ASN B 1 42  ? 154.250 -26.419  2.281   1.00 87.55  ? 42  ASN B O     1 
ATOM   3309  C CB    . ASN B 1 42  ? 155.440 -29.369  2.226   1.00 87.10  ? 42  ASN B CB    1 
ATOM   3310  C CG    . ASN B 1 42  ? 155.917 -28.794  0.909   1.00 87.03  ? 42  ASN B CG    1 
ATOM   3311  O OD1   . ASN B 1 42  ? 156.692 -27.834  0.874   1.00 86.88  ? 42  ASN B OD1   1 
ATOM   3312  N ND2   . ASN B 1 42  ? 155.461 -29.385  -0.186  1.00 86.76  ? 42  ASN B ND2   1 
ATOM   3313  N N     . GLU B 1 43  ? 152.971 -27.759  3.578   1.00 87.78  ? 43  GLU B N     1 
ATOM   3314  C CA    . GLU B 1 43  ? 151.725 -27.002  3.457   1.00 87.96  ? 43  GLU B CA    1 
ATOM   3315  C C     . GLU B 1 43  ? 151.859 -25.562  3.920   1.00 88.31  ? 43  GLU B C     1 
ATOM   3316  O O     . GLU B 1 43  ? 151.202 -24.677  3.381   1.00 88.59  ? 43  GLU B O     1 
ATOM   3317  C CB    . GLU B 1 43  ? 150.624 -27.653  4.289   1.00 87.98  ? 43  GLU B CB    1 
ATOM   3318  C CG    . GLU B 1 43  ? 150.253 -29.058  3.898   1.00 89.38  ? 43  GLU B CG    1 
ATOM   3319  C CD    . GLU B 1 43  ? 148.899 -29.447  4.457   1.00 91.97  ? 43  GLU B CD    1 
ATOM   3320  O OE1   . GLU B 1 43  ? 148.863 -30.184  5.469   1.00 92.92  ? 43  GLU B OE1   1 
ATOM   3321  O OE2   . GLU B 1 43  ? 147.870 -28.992  3.897   1.00 93.20  ? 43  GLU B OE2   1 
ATOM   3322  N N     . LYS B 1 44  ? 152.687 -25.344  4.938   1.00 88.82  ? 44  LYS B N     1 
ATOM   3323  C CA    . LYS B 1 44  ? 152.909 -24.022  5.496   1.00 89.32  ? 44  LYS B CA    1 
ATOM   3324  C C     . LYS B 1 44  ? 154.077 -23.335  4.802   1.00 89.69  ? 44  LYS B C     1 
ATOM   3325  O O     . LYS B 1 44  ? 154.448 -22.221  5.168   1.00 90.48  ? 44  LYS B O     1 
ATOM   3326  C CB    . LYS B 1 44  ? 153.166 -24.114  7.001   1.00 90.12  ? 44  LYS B CB    1 
ATOM   3327  C CG    . LYS B 1 44  ? 152.000 -24.673  7.794   1.00 90.82  ? 44  LYS B CG    1 
ATOM   3328  C CD    . LYS B 1 44  ? 152.138 -24.405  9.285   1.00 92.64  ? 44  LYS B CD    1 
ATOM   3329  C CE    . LYS B 1 44  ? 150.809 -24.661  9.998   1.00 93.21  ? 44  LYS B CE    1 
ATOM   3330  N NZ    . LYS B 1 44  ? 150.876 -24.358  11.453  1.00 94.88  ? 44  LYS B NZ    1 
ATOM   3331  N N     . GLY B 1 45  ? 154.658 -24.006  3.808   1.00 89.45  ? 45  GLY B N     1 
ATOM   3332  C CA    . GLY B 1 45  ? 155.733 -23.430  3.001   1.00 89.81  ? 45  GLY B CA    1 
ATOM   3333  C C     . GLY B 1 45  ? 157.130 -23.889  3.371   1.00 90.40  ? 45  GLY B C     1 
ATOM   3334  O O     . GLY B 1 45  ? 158.095 -23.495  2.728   1.00 91.05  ? 45  GLY B O     1 
ATOM   3335  N N     . ILE B 1 46  ? 157.238 -24.716  4.408   1.00 90.55  ? 46  ILE B N     1 
ATOM   3336  C CA    . ILE B 1 46  ? 158.526 -25.235  4.873   1.00 91.42  ? 46  ILE B CA    1 
ATOM   3337  C C     . ILE B 1 46  ? 159.070 -26.272  3.886   1.00 91.46  ? 46  ILE B C     1 
ATOM   3338  O O     . ILE B 1 46  ? 158.381 -27.245  3.559   1.00 90.96  ? 46  ILE B O     1 
ATOM   3339  C CB    . ILE B 1 46  ? 158.424 -25.844  6.301   1.00 91.72  ? 46  ILE B CB    1 
ATOM   3340  C CG1   . ILE B 1 46  ? 158.295 -24.746  7.356   1.00 92.49  ? 46  ILE B CG1   1 
ATOM   3341  C CG2   . ILE B 1 46  ? 159.637 -26.681  6.630   1.00 92.72  ? 46  ILE B CG2   1 
ATOM   3342  C CD1   . ILE B 1 46  ? 156.867 -24.366  7.704   1.00 92.44  ? 46  ILE B CD1   1 
ATOM   3343  N N     . PRO B 1 47  ? 160.305 -26.061  3.397   1.00 92.29  ? 47  PRO B N     1 
ATOM   3344  C CA    . PRO B 1 47  ? 160.897 -26.980  2.436   1.00 92.65  ? 47  PRO B CA    1 
ATOM   3345  C C     . PRO B 1 47  ? 161.302 -28.286  3.102   1.00 93.39  ? 47  PRO B C     1 
ATOM   3346  O O     . PRO B 1 47  ? 161.593 -28.297  4.298   1.00 94.13  ? 47  PRO B O     1 
ATOM   3347  C CB    . PRO B 1 47  ? 162.149 -26.231  1.964   1.00 93.57  ? 47  PRO B CB    1 
ATOM   3348  C CG    . PRO B 1 47  ? 161.987 -24.831  2.434   1.00 93.35  ? 47  PRO B CG    1 
ATOM   3349  C CD    . PRO B 1 47  ? 161.196 -24.925  3.676   1.00 93.12  ? 47  PRO B CD    1 
ATOM   3350  N N     . PHE B 1 48  ? 161.309 -29.372  2.331   1.00 93.68  ? 48  PHE B N     1 
ATOM   3351  C CA    . PHE B 1 48  ? 161.845 -30.659  2.782   1.00 94.63  ? 48  PHE B CA    1 
ATOM   3352  C C     . PHE B 1 48  ? 163.294 -30.464  3.234   1.00 96.12  ? 48  PHE B C     1 
ATOM   3353  O O     . PHE B 1 48  ? 163.980 -29.556  2.757   1.00 96.64  ? 48  PHE B O     1 
ATOM   3354  C CB    . PHE B 1 48  ? 161.815 -31.678  1.634   1.00 94.52  ? 48  PHE B CB    1 
ATOM   3355  C CG    . PHE B 1 48  ? 160.469 -32.336  1.403   1.00 94.40  ? 48  PHE B CG    1 
ATOM   3356  C CD1   . PHE B 1 48  ? 159.315 -31.580  1.204   1.00 94.00  ? 48  PHE B CD1   1 
ATOM   3357  C CD2   . PHE B 1 48  ? 160.369 -33.726  1.345   1.00 95.31  ? 48  PHE B CD2   1 
ATOM   3358  C CE1   . PHE B 1 48  ? 158.085 -32.193  0.968   1.00 93.37  ? 48  PHE B CE1   1 
ATOM   3359  C CE2   . PHE B 1 48  ? 159.140 -34.349  1.113   1.00 94.83  ? 48  PHE B CE2   1 
ATOM   3360  C CZ    . PHE B 1 48  ? 157.997 -33.579  0.926   1.00 93.80  ? 48  PHE B CZ    1 
ATOM   3361  N N     . SER B 1 49  ? 163.764 -31.303  4.152   1.00 97.10  ? 49  SER B N     1 
ATOM   3362  C CA    . SER B 1 49  ? 165.167 -31.254  4.536   1.00 98.77  ? 49  SER B CA    1 
ATOM   3363  C C     . SER B 1 49  ? 166.038 -31.855  3.428   1.00 99.48  ? 49  SER B C     1 
ATOM   3364  O O     . SER B 1 49  ? 167.211 -31.508  3.301   1.00 100.83 ? 49  SER B O     1 
ATOM   3365  C CB    . SER B 1 49  ? 165.392 -31.959  5.864   1.00 99.62  ? 49  SER B CB    1 
ATOM   3366  O OG    . SER B 1 49  ? 165.031 -33.319  5.760   1.00 99.93  ? 49  SER B OG    1 
ATOM   3367  N N     . ALA B 1 50  ? 165.452 -32.742  2.624   1.00 98.90  ? 50  ALA B N     1 
ATOM   3368  C CA    . ALA B 1 50  ? 166.109 -33.263  1.429   1.00 99.66  ? 50  ALA B CA    1 
ATOM   3369  C C     . ALA B 1 50  ? 166.331 -32.163  0.394   1.00 100.08 ? 50  ALA B C     1 
ATOM   3370  O O     . ALA B 1 50  ? 167.314 -32.187  -0.346  1.00 101.44 ? 50  ALA B O     1 
ATOM   3371  C CB    . ALA B 1 50  ? 165.299 -34.392  0.826   1.00 98.81  ? 50  ALA B CB    1 
ATOM   3372  N N     . THR B 1 51  ? 165.413 -31.203  0.346   1.00 99.53  ? 51  THR B N     1 
ATOM   3373  C CA    . THR B 1 51  ? 165.490 -30.088  -0.592  1.00 99.97  ? 51  THR B CA    1 
ATOM   3374  C C     . THR B 1 51  ? 166.602 -29.127  -0.196  1.00 101.49 ? 51  THR B C     1 
ATOM   3375  O O     . THR B 1 51  ? 167.303 -28.597  -1.056  1.00 102.49 ? 51  THR B O     1 
ATOM   3376  C CB    . THR B 1 51  ? 164.137 -29.344  -0.683  1.00 98.80  ? 51  THR B CB    1 
ATOM   3377  O OG1   . THR B 1 51  ? 163.120 -30.261  -1.100  1.00 98.03  ? 51  THR B OG1   1 
ATOM   3378  C CG2   . THR B 1 51  ? 164.197 -28.188  -1.675  1.00 98.92  ? 51  THR B CG2   1 
ATOM   3379  N N     . VAL B 1 52  ? 166.762 -28.918  1.107   1.00 102.25 ? 52  VAL B N     1 
ATOM   3380  C CA    . VAL B 1 52  ? 167.801 -28.035  1.639   1.00 104.07 ? 52  VAL B CA    1 
ATOM   3381  C C     . VAL B 1 52  ? 169.188 -28.547  1.259   1.00 105.90 ? 52  VAL B C     1 
ATOM   3382  O O     . VAL B 1 52  ? 170.037 -27.769  0.823   1.00 107.13 ? 52  VAL B O     1 
ATOM   3383  C CB    . VAL B 1 52  ? 167.686 -27.878  3.176   1.00 104.26 ? 52  VAL B CB    1 
ATOM   3384  C CG1   . VAL B 1 52  ? 168.818 -27.017  3.723   1.00 105.92 ? 52  VAL B CG1   1 
ATOM   3385  C CG2   . VAL B 1 52  ? 166.335 -27.276  3.551   1.00 103.05 ? 52  VAL B CG2   1 
ATOM   3386  N N     . GLU B 1 53  ? 169.398 -29.854  1.413   1.00 106.53 ? 53  GLU B N     1 
ATOM   3387  C CA    . GLU B 1 53  ? 170.653 -30.508  1.031   1.00 108.50 ? 53  GLU B CA    1 
ATOM   3388  C C     . GLU B 1 53  ? 170.905 -30.457  -0.473  1.00 108.81 ? 53  GLU B C     1 
ATOM   3389  O O     . GLU B 1 53  ? 172.052 -30.339  -0.907  1.00 110.27 ? 53  GLU B O     1 
ATOM   3390  C CB    . GLU B 1 53  ? 170.658 -31.967  1.480   1.00 108.66 ? 53  GLU B CB    1 
ATOM   3391  C CG    . GLU B 1 53  ? 170.855 -32.191  2.962   1.00 110.40 ? 53  GLU B CG    1 
ATOM   3392  C CD    . GLU B 1 53  ? 170.723 -33.660  3.346   1.00 112.16 ? 53  GLU B CD    1 
ATOM   3393  O OE1   . GLU B 1 53  ? 171.316 -34.524  2.654   1.00 113.36 ? 53  GLU B OE1   1 
ATOM   3394  O OE2   . GLU B 1 53  ? 170.024 -33.949  4.345   1.00 112.45 ? 53  GLU B OE2   1 
ATOM   3395  N N     . LEU B 1 54  ? 169.832 -30.562  -1.257  1.00 107.75 ? 54  LEU B N     1 
ATOM   3396  C CA    . LEU B 1 54  ? 169.932 -30.566  -2.715  1.00 108.41 ? 54  LEU B CA    1 
ATOM   3397  C C     . LEU B 1 54  ? 170.300 -29.196  -3.271  1.00 109.41 ? 54  LEU B C     1 
ATOM   3398  O O     . LEU B 1 54  ? 171.094 -29.094  -4.211  1.00 110.91 ? 54  LEU B O     1 
ATOM   3399  C CB    . LEU B 1 54  ? 168.637 -31.072  -3.362  1.00 106.96 ? 54  LEU B CB    1 
ATOM   3400  C CG    . LEU B 1 54  ? 168.698 -31.315  -4.880  1.00 107.58 ? 54  LEU B CG    1 
ATOM   3401  C CD1   . LEU B 1 54  ? 169.457 -32.604  -5.221  1.00 108.45 ? 54  LEU B CD1   1 
ATOM   3402  C CD2   . LEU B 1 54  ? 167.309 -31.324  -5.497  1.00 105.94 ? 54  LEU B CD2   1 
ATOM   3403  N N     . LEU B 1 55  ? 169.731 -28.146  -2.685  1.00 108.99 ? 55  LEU B N     1 
ATOM   3404  C CA    . LEU B 1 55  ? 170.042 -26.775  -3.093  1.00 110.08 ? 55  LEU B CA    1 
ATOM   3405  C C     . LEU B 1 55  ? 171.457 -26.333  -2.708  1.00 112.09 ? 55  LEU B C     1 
ATOM   3406  O O     . LEU B 1 55  ? 171.900 -25.250  -3.100  1.00 113.20 ? 55  LEU B O     1 
ATOM   3407  C CB    . LEU B 1 55  ? 169.002 -25.799  -2.539  1.00 108.88 ? 55  LEU B CB    1 
ATOM   3408  C CG    . LEU B 1 55  ? 167.690 -25.743  -3.316  1.00 107.56 ? 55  LEU B CG    1 
ATOM   3409  C CD1   . LEU B 1 55  ? 166.575 -25.260  -2.417  1.00 106.17 ? 55  LEU B CD1   1 
ATOM   3410  C CD2   . LEU B 1 55  ? 167.818 -24.864  -4.555  1.00 108.52 ? 55  LEU B CD2   1 
ATOM   3411  N N     . LYS B 1 56  ? 172.151 -27.173  -1.941  1.00 112.84 ? 56  LYS B N     1 
ATOM   3412  C CA    . LYS B 1 56  ? 173.549 -26.946  -1.594  1.00 114.92 ? 56  LYS B CA    1 
ATOM   3413  C C     . LYS B 1 56  ? 174.467 -27.649  -2.579  1.00 116.36 ? 56  LYS B C     1 
ATOM   3414  O O     . LYS B 1 56  ? 175.392 -27.031  -3.103  1.00 118.06 ? 56  LYS B O     1 
ATOM   3415  C CB    . LYS B 1 56  ? 173.842 -27.410  -0.169  1.00 115.13 ? 56  LYS B CB    1 
ATOM   3416  C CG    . LYS B 1 56  ? 173.343 -26.454  0.886   1.00 115.09 ? 56  LYS B CG    1 
ATOM   3417  C CD    . LYS B 1 56  ? 173.654 -26.959  2.275   1.00 116.47 ? 56  LYS B CD    1 
ATOM   3418  C CE    . LYS B 1 56  ? 173.101 -26.007  3.316   1.00 116.80 ? 56  LYS B CE    1 
ATOM   3419  N NZ    . LYS B 1 56  ? 173.374 -26.498  4.688   1.00 118.15 ? 56  LYS B NZ    1 
ATOM   3420  N N     . LYS B 1 57  ? 174.201 -28.932  -2.831  1.00 115.96 ? 57  LYS B N     1 
ATOM   3421  C CA    . LYS B 1 57  ? 174.999 -29.737  -3.763  1.00 117.51 ? 57  LYS B CA    1 
ATOM   3422  C C     . LYS B 1 57  ? 175.062 -29.086  -5.142  1.00 118.20 ? 57  LYS B C     1 
ATOM   3423  O O     . LYS B 1 57  ? 176.142 -28.942  -5.716  1.00 120.30 ? 57  LYS B O     1 
ATOM   3424  C CB    . LYS B 1 57  ? 174.459 -31.168  -3.878  1.00 116.75 ? 57  LYS B CB    1 
ATOM   3425  C CG    . LYS B 1 57  ? 174.704 -32.048  -2.652  1.00 117.37 ? 57  LYS B CG    1 
ATOM   3426  C CD    . LYS B 1 57  ? 174.723 -33.534  -3.015  1.00 118.03 ? 57  LYS B CD    1 
ATOM   3427  C CE    . LYS B 1 57  ? 176.094 -33.958  -3.533  1.00 120.49 ? 57  LYS B CE    1 
ATOM   3428  N NZ    . LYS B 1 57  ? 176.109 -35.386  -3.944  1.00 120.84 ? 57  LYS B NZ    1 
ATOM   3429  N N     . VAL B 1 58  ? 173.902 -28.709  -5.670  1.00 116.73 ? 58  VAL B N     1 
ATOM   3430  C CA    . VAL B 1 58  ? 173.845 -27.866  -6.852  1.00 117.42 ? 58  VAL B CA    1 
ATOM   3431  C C     . VAL B 1 58  ? 173.896 -26.444  -6.319  1.00 117.59 ? 58  VAL B C     1 
ATOM   3432  O O     . VAL B 1 58  ? 173.400 -26.173  -5.228  1.00 116.44 ? 58  VAL B O     1 
ATOM   3433  C CB    . VAL B 1 58  ? 172.548 -28.085  -7.666  1.00 116.06 ? 58  VAL B CB    1 
ATOM   3434  C CG1   . VAL B 1 58  ? 172.585 -27.290  -8.964  1.00 117.46 ? 58  VAL B CG1   1 
ATOM   3435  C CG2   . VAL B 1 58  ? 172.342 -29.557  -7.971  1.00 115.71 ? 58  VAL B CG2   1 
ATOM   3436  N N     . ASN B 1 59  ? 174.507 -25.542  -7.071  1.00 119.20 ? 59  ASN B N     1 
ATOM   3437  C CA    . ASN B 1 59  ? 174.572 -24.156  -6.656  1.00 119.64 ? 59  ASN B CA    1 
ATOM   3438  C C     . ASN B 1 59  ? 173.906 -23.276  -7.710  1.00 119.86 ? 59  ASN B C     1 
ATOM   3439  O O     . ASN B 1 59  ? 174.587 -22.625  -8.507  1.00 122.03 ? 59  ASN B O     1 
ATOM   3440  C CB    . ASN B 1 59  ? 176.026 -23.752  -6.415  1.00 122.00 ? 59  ASN B CB    1 
ATOM   3441  C CG    . ASN B 1 59  ? 176.160 -22.593  -5.457  1.00 122.29 ? 59  ASN B CG    1 
ATOM   3442  O OD1   . ASN B 1 59  ? 175.351 -22.426  -4.543  1.00 120.87 ? 59  ASN B OD1   1 
ATOM   3443  N ND2   . ASN B 1 59  ? 177.195 -21.787  -5.653  1.00 124.59 ? 59  ASN B ND2   1 
ATOM   3444  N N     . PRO B 1 60  ? 172.563 -23.260  -7.726  1.00 117.94 ? 60  PRO B N     1 
ATOM   3445  C CA    . PRO B 1 60  ? 171.844 -22.624  -8.822  1.00 118.22 ? 60  PRO B CA    1 
ATOM   3446  C C     . PRO B 1 60  ? 171.520 -21.155  -8.558  1.00 118.44 ? 60  PRO B C     1 
ATOM   3447  O O     . PRO B 1 60  ? 171.161 -20.793  -7.435  1.00 117.32 ? 60  PRO B O     1 
ATOM   3448  C CB    . PRO B 1 60  ? 170.554 -23.453  -8.911  1.00 116.26 ? 60  PRO B CB    1 
ATOM   3449  C CG    . PRO B 1 60  ? 170.464 -24.232  -7.591  1.00 114.54 ? 60  PRO B CG    1 
ATOM   3450  C CD    . PRO B 1 60  ? 171.633 -23.838  -6.742  1.00 115.65 ? 60  PRO B CD    1 
ATOM   3451  N N     . GLN B 1 61  ? 171.640 -20.320  -9.588  1.00 120.10 ? 61  GLN B N     1 
ATOM   3452  C CA    . GLN B 1 61  ? 171.337 -18.892  -9.449  1.00 120.67 ? 61  GLN B CA    1 
ATOM   3453  C C     . GLN B 1 61  ? 169.831 -18.611  -9.441  1.00 118.88 ? 61  GLN B C     1 
ATOM   3454  O O     . GLN B 1 61  ? 169.329 -17.949  -8.530  1.00 118.07 ? 61  GLN B O     1 
ATOM   3455  C CB    . GLN B 1 61  ? 172.078 -18.026  -10.490 1.00 123.47 ? 61  GLN B CB    1 
ATOM   3456  C CG    . GLN B 1 61  ? 171.949 -18.470  -11.952 1.00 124.98 ? 61  GLN B CG    1 
ATOM   3457  C CD    . GLN B 1 61  ? 173.168 -19.221  -12.479 1.00 127.03 ? 61  GLN B CD    1 
ATOM   3458  O OE1   . GLN B 1 61  ? 173.507 -19.108  -13.655 1.00 129.27 ? 61  GLN B OE1   1 
ATOM   3459  N NE2   . GLN B 1 61  ? 173.827 -19.989  -11.615 1.00 126.58 ? 61  GLN B NE2   1 
ATOM   3460  N N     . GLU B 1 62  ? 169.118 -19.123  -10.444 1.00 118.53 ? 62  GLU B N     1 
ATOM   3461  C CA    . GLU B 1 62  ? 167.664 -18.951  -10.529 1.00 116.88 ? 62  GLU B CA    1 
ATOM   3462  C C     . GLU B 1 62  ? 166.958 -20.302  -10.380 1.00 114.57 ? 62  GLU B C     1 
ATOM   3463  O O     . GLU B 1 62  ? 167.093 -21.182  -11.233 1.00 114.94 ? 62  GLU B O     1 
ATOM   3464  C CB    . GLU B 1 62  ? 167.255 -18.250  -11.840 1.00 118.60 ? 62  GLU B CB    1 
ATOM   3465  C CG    . GLU B 1 62  ? 167.967 -16.907  -12.126 1.00 121.71 ? 62  GLU B CG    1 
ATOM   3466  C CD    . GLU B 1 62  ? 167.338 -15.696  -11.423 1.00 122.36 ? 62  GLU B CD    1 
ATOM   3467  O OE1   . GLU B 1 62  ? 166.840 -14.794  -12.133 1.00 123.93 ? 62  GLU B OE1   1 
ATOM   3468  O OE2   . GLU B 1 62  ? 167.345 -15.633  -10.172 1.00 121.16 ? 62  GLU B OE2   1 
ATOM   3469  N N     . VAL B 1 63  ? 166.228 -20.465  -9.275  1.00 112.17 ? 63  VAL B N     1 
ATOM   3470  C CA    . VAL B 1 63  ? 165.446 -21.684  -9.027  1.00 109.78 ? 63  VAL B CA    1 
ATOM   3471  C C     . VAL B 1 63  ? 163.940 -21.422  -9.077  1.00 108.20 ? 63  VAL B C     1 
ATOM   3472  O O     . VAL B 1 63  ? 163.469 -20.323  -8.764  1.00 108.12 ? 63  VAL B O     1 
ATOM   3473  C CB    . VAL B 1 63  ? 165.820 -22.393  -7.691  1.00 108.54 ? 63  VAL B CB    1 
ATOM   3474  C CG1   . VAL B 1 63  ? 167.321 -22.523  -7.559  1.00 109.97 ? 63  VAL B CG1   1 
ATOM   3475  C CG2   . VAL B 1 63  ? 165.250 -21.656  -6.493  1.00 107.16 ? 63  VAL B CG2   1 
ATOM   3476  N N     . VAL B 1 64  ? 163.197 -22.449  -9.478  1.00 106.84 ? 64  VAL B N     1 
ATOM   3477  C CA    . VAL B 1 64  ? 161.745 -22.357  -9.619  1.00 105.27 ? 64  VAL B CA    1 
ATOM   3478  C C     . VAL B 1 64  ? 161.060 -23.597  -9.033  1.00 103.05 ? 64  VAL B C     1 
ATOM   3479  O O     . VAL B 1 64  ? 161.326 -24.730  -9.434  1.00 102.84 ? 64  VAL B O     1 
ATOM   3480  C CB    . VAL B 1 64  ? 161.322 -22.041  -11.101 1.00 106.67 ? 64  VAL B CB    1 
ATOM   3481  C CG1   . VAL B 1 64  ? 162.056 -22.921  -12.078 1.00 107.86 ? 64  VAL B CG1   1 
ATOM   3482  C CG2   . VAL B 1 64  ? 159.814 -22.139  -11.301 1.00 105.72 ? 64  VAL B CG2   1 
ATOM   3483  N N     . VAL B 1 65  ? 160.188 -23.351  -8.064  1.00 101.27 ? 65  VAL B N     1 
ATOM   3484  C CA    . VAL B 1 65  ? 159.535 -24.407  -7.312  1.00 99.57  ? 65  VAL B CA    1 
ATOM   3485  C C     . VAL B 1 65  ? 158.088 -24.594  -7.773  1.00 98.89  ? 65  VAL B C     1 
ATOM   3486  O O     . VAL B 1 65  ? 157.607 -23.878  -8.651  1.00 99.55  ? 65  VAL B O     1 
ATOM   3487  C CB    . VAL B 1 65  ? 159.577 -24.108  -5.792  1.00 98.72  ? 65  VAL B CB    1 
ATOM   3488  C CG1   . VAL B 1 65  ? 159.322 -25.380  -4.977  1.00 97.83  ? 65  VAL B CG1   1 
ATOM   3489  C CG2   . VAL B 1 65  ? 160.914 -23.496  -5.405  1.00 99.22  ? 65  VAL B CG2   1 
ATOM   3490  N N     . GLU B 1 66  ? 157.404 -25.558  -7.162  1.00 97.59  ? 66  GLU B N     1 
ATOM   3491  C CA    . GLU B 1 66  ? 156.036 -25.920  -7.522  1.00 96.98  ? 66  GLU B CA    1 
ATOM   3492  C C     . GLU B 1 66  ? 154.979 -25.096  -6.786  1.00 96.25  ? 66  GLU B C     1 
ATOM   3493  O O     . GLU B 1 66  ? 153.923 -24.797  -7.342  1.00 96.35  ? 66  GLU B O     1 
ATOM   3494  C CB    . GLU B 1 66  ? 155.812 -27.400  -7.229  1.00 96.09  ? 66  GLU B CB    1 
ATOM   3495  C CG    . GLU B 1 66  ? 156.812 -28.326  -7.891  1.00 96.75  ? 66  GLU B CG    1 
ATOM   3496  C CD    . GLU B 1 66  ? 156.650 -29.767  -7.455  1.00 96.01  ? 66  GLU B CD    1 
ATOM   3497  O OE1   . GLU B 1 66  ? 156.913 -30.071  -6.276  1.00 95.68  ? 66  GLU B OE1   1 
ATOM   3498  O OE2   . GLU B 1 66  ? 156.269 -30.603  -8.297  1.00 96.21  ? 66  GLU B OE2   1 
ATOM   3499  N N     . ASN B 1 67  ? 155.288 -24.737  -5.539  1.00 95.78  ? 67  ASN B N     1 
ATOM   3500  C CA    . ASN B 1 67  ? 154.347 -24.137  -4.593  1.00 95.12  ? 67  ASN B CA    1 
ATOM   3501  C C     . ASN B 1 67  ? 154.731 -22.695  -4.262  1.00 95.15  ? 67  ASN B C     1 
ATOM   3502  O O     . ASN B 1 67  ? 155.901 -22.411  -4.018  1.00 95.64  ? 67  ASN B O     1 
ATOM   3503  C CB    . ASN B 1 67  ? 154.347 -24.968  -3.305  1.00 94.61  ? 67  ASN B CB    1 
ATOM   3504  C CG    . ASN B 1 67  ? 152.948 -25.201  -2.744  1.00 95.63  ? 67  ASN B CG    1 
ATOM   3505  O OD1   . ASN B 1 67  ? 152.282 -24.277  -2.228  1.00 97.49  ? 67  ASN B OD1   1 
ATOM   3506  N ND2   . ASN B 1 67  ? 152.500 -26.454  -2.820  1.00 95.99  ? 67  ASN B ND2   1 
ATOM   3507  N N     . GLU B 1 68  ? 153.753 -21.792  -4.225  1.00 94.82  ? 68  GLU B N     1 
ATOM   3508  C CA    . GLU B 1 68  ? 154.040 -20.370  -3.993  1.00 95.24  ? 68  GLU B CA    1 
ATOM   3509  C C     . GLU B 1 68  ? 154.356 -20.034  -2.540  1.00 94.63  ? 68  GLU B C     1 
ATOM   3510  O O     . GLU B 1 68  ? 154.933 -18.987  -2.257  1.00 95.46  ? 68  GLU B O     1 
ATOM   3511  C CB    . GLU B 1 68  ? 152.924 -19.460  -4.540  1.00 95.76  ? 68  GLU B CB    1 
ATOM   3512  C CG    . GLU B 1 68  ? 151.803 -19.090  -3.573  1.00 95.26  ? 68  GLU B CG    1 
ATOM   3513  C CD    . GLU B 1 68  ? 151.114 -17.770  -3.937  1.00 95.80  ? 68  GLU B CD    1 
ATOM   3514  O OE1   . GLU B 1 68  ? 151.815 -16.749  -4.136  1.00 96.11  ? 68  GLU B OE1   1 
ATOM   3515  O OE2   . GLU B 1 68  ? 149.866 -17.751  -4.002  1.00 95.22  ? 68  GLU B OE2   1 
ATOM   3516  N N     . ALA B 1 69  ? 153.974 -20.921  -1.628  1.00 93.46  ? 69  ALA B N     1 
ATOM   3517  C CA    . ALA B 1 69  ? 154.253 -20.743  -0.206  1.00 92.98  ? 69  ALA B CA    1 
ATOM   3518  C C     . ALA B 1 69  ? 155.725 -20.982  0.130   1.00 93.16  ? 69  ALA B C     1 
ATOM   3519  O O     . ALA B 1 69  ? 156.230 -20.432  1.103   1.00 93.60  ? 69  ALA B O     1 
ATOM   3520  C CB    . ALA B 1 69  ? 153.355 -21.652  0.631   1.00 92.22  ? 69  ALA B CB    1 
ATOM   3521  N N     . GLU B 1 70  ? 156.401 -21.797  -0.678  1.00 93.01  ? 70  GLU B N     1 
ATOM   3522  C CA    . GLU B 1 70  ? 157.821 -22.098  -0.489  1.00 93.41  ? 70  GLU B CA    1 
ATOM   3523  C C     . GLU B 1 70  ? 158.748 -20.920  -0.810  1.00 94.48  ? 70  GLU B C     1 
ATOM   3524  O O     . GLU B 1 70  ? 159.768 -20.724  -0.142  1.00 95.24  ? 70  GLU B O     1 
ATOM   3525  C CB    . GLU B 1 70  ? 158.234 -23.311  -1.324  1.00 93.23  ? 70  GLU B CB    1 
ATOM   3526  C CG    . GLU B 1 70  ? 157.946 -24.653  -0.673  1.00 92.93  ? 70  GLU B CG    1 
ATOM   3527  C CD    . GLU B 1 70  ? 158.744 -25.795  -1.290  1.00 93.29  ? 70  GLU B CD    1 
ATOM   3528  O OE1   . GLU B 1 70  ? 159.971 -25.849  -1.071  1.00 93.27  ? 70  GLU B OE1   1 
ATOM   3529  O OE2   . GLU B 1 70  ? 158.140 -26.645  -1.986  1.00 93.54  ? 70  GLU B OE2   1 
ATOM   3530  N N     . VAL B 1 71  ? 158.386 -20.138  -1.824  1.00 94.70  ? 71  VAL B N     1 
ATOM   3531  C CA    . VAL B 1 71  ? 159.243 -19.058  -2.323  1.00 95.81  ? 71  VAL B CA    1 
ATOM   3532  C C     . VAL B 1 71  ? 159.905 -18.210  -1.229  1.00 96.36  ? 71  VAL B C     1 
ATOM   3533  O O     . VAL B 1 71  ? 161.136 -18.138  -1.189  1.00 97.37  ? 71  VAL B O     1 
ATOM   3534  C CB    . VAL B 1 71  ? 158.515 -18.166  -3.354  1.00 96.31  ? 71  VAL B CB    1 
ATOM   3535  C CG1   . VAL B 1 71  ? 159.417 -17.024  -3.812  1.00 97.64  ? 71  VAL B CG1   1 
ATOM   3536  C CG2   . VAL B 1 71  ? 158.068 -19.002  -4.539  1.00 96.38  ? 71  VAL B CG2   1 
ATOM   3537  N N     . PRO B 1 72  ? 159.107 -17.581  -0.333  1.00 95.87  ? 72  PRO B N     1 
ATOM   3538  C CA    . PRO B 1 72  ? 159.740 -16.700  0.653   1.00 96.60  ? 72  PRO B CA    1 
ATOM   3539  C C     . PRO B 1 72  ? 160.646 -17.435  1.656   1.00 96.47  ? 72  PRO B C     1 
ATOM   3540  O O     . PRO B 1 72  ? 161.562 -16.822  2.220   1.00 97.60  ? 72  PRO B O     1 
ATOM   3541  C CB    . PRO B 1 72  ? 158.546 -16.040  1.356   1.00 96.18  ? 72  PRO B CB    1 
ATOM   3542  C CG    . PRO B 1 72  ? 157.431 -16.977  1.160   1.00 94.89  ? 72  PRO B CG    1 
ATOM   3543  C CD    . PRO B 1 72  ? 157.640 -17.600  -0.177  1.00 94.78  ? 72  PRO B CD    1 
ATOM   3544  N N     . LYS B 1 73  ? 160.398 -18.729  1.856   1.00 95.05  ? 73  LYS B N     1 
ATOM   3545  C CA    . LYS B 1 73  ? 161.227 -19.540  2.741   1.00 95.08  ? 73  LYS B CA    1 
ATOM   3546  C C     . LYS B 1 73  ? 162.613 -19.799  2.171   1.00 95.91  ? 73  LYS B C     1 
ATOM   3547  O O     . LYS B 1 73  ? 163.595 -19.814  2.909   1.00 96.78  ? 73  LYS B O     1 
ATOM   3548  C CB    . LYS B 1 73  ? 160.542 -20.866  3.083   1.00 93.90  ? 73  LYS B CB    1 
ATOM   3549  C CG    . LYS B 1 73  ? 159.850 -20.885  4.441   1.00 93.58  ? 73  LYS B CG    1 
ATOM   3550  C CD    . LYS B 1 73  ? 158.579 -20.056  4.431   1.00 93.44  ? 73  LYS B CD    1 
ATOM   3551  C CE    . LYS B 1 73  ? 157.880 -20.082  5.771   1.00 93.32  ? 73  LYS B CE    1 
ATOM   3552  N NZ    . LYS B 1 73  ? 156.542 -19.441  5.669   1.00 92.22  ? 73  LYS B NZ    1 
ATOM   3553  N N     . LEU B 1 74  ? 162.684 -19.999  0.861   1.00 95.89  ? 74  LEU B N     1 
ATOM   3554  C CA    . LEU B 1 74  ? 163.955 -20.261  0.194   1.00 97.03  ? 74  LEU B CA    1 
ATOM   3555  C C     . LEU B 1 74  ? 164.719 -18.979  -0.105  1.00 98.73  ? 74  LEU B C     1 
ATOM   3556  O O     . LEU B 1 74  ? 165.923 -19.011  -0.357  1.00 99.89  ? 74  LEU B O     1 
ATOM   3557  C CB    . LEU B 1 74  ? 163.745 -21.052  -1.096  1.00 96.55  ? 74  LEU B CB    1 
ATOM   3558  C CG    . LEU B 1 74  ? 163.267 -22.498  -0.995  1.00 95.08  ? 74  LEU B CG    1 
ATOM   3559  C CD1   . LEU B 1 74  ? 163.130 -23.075  -2.381  1.00 94.79  ? 74  LEU B CD1   1 
ATOM   3560  C CD2   . LEU B 1 74  ? 164.210 -23.344  -0.163  1.00 95.49  ? 74  LEU B CD2   1 
ATOM   3561  N N     . GLN B 1 75  ? 164.013 -17.855  -0.088  1.00 99.12  ? 75  GLN B N     1 
ATOM   3562  C CA    . GLN B 1 75  ? 164.651 -16.555  -0.234  1.00 101.04 ? 75  GLN B CA    1 
ATOM   3563  C C     . GLN B 1 75  ? 165.372 -16.193  1.056   1.00 102.02 ? 75  GLN B C     1 
ATOM   3564  O O     . GLN B 1 75  ? 166.453 -15.600  1.027   1.00 103.62 ? 75  GLN B O     1 
ATOM   3565  C CB    . GLN B 1 75  ? 163.618 -15.482  -0.562  1.00 101.05 ? 75  GLN B CB    1 
ATOM   3566  C CG    . GLN B 1 75  ? 163.059 -15.546  -1.969  1.00 100.85 ? 75  GLN B CG    1 
ATOM   3567  C CD    . GLN B 1 75  ? 162.002 -14.499  -2.196  1.00 100.48 ? 75  GLN B CD    1 
ATOM   3568  O OE1   . GLN B 1 75  ? 161.211 -14.194  -1.300  1.00 99.35  ? 75  GLN B OE1   1 
ATOM   3569  N NE2   . GLN B 1 75  ? 161.985 -13.930  -3.393  1.00 101.71 ? 75  GLN B NE2   1 
ATOM   3570  N N     . ALA B 1 76  ? 164.759 -16.559  2.182   1.00 101.39 ? 76  ALA B N     1 
ATOM   3571  C CA    . ALA B 1 76  ? 165.340 -16.336  3.504   1.00 102.38 ? 76  ALA B CA    1 
ATOM   3572  C C     . ALA B 1 76  ? 166.560 -17.225  3.710   1.00 103.20 ? 76  ALA B C     1 
ATOM   3573  O O     . ALA B 1 76  ? 167.374 -16.970  4.598   1.00 104.42 ? 76  ALA B O     1 
ATOM   3574  C CB    . ALA B 1 76  ? 164.302 -16.581  4.601   1.00 101.35 ? 76  ALA B CB    1 
ATOM   3575  N N     . LEU B 1 77  ? 166.682 -18.256  2.874   1.00 102.79 ? 77  LEU B N     1 
ATOM   3576  C CA    . LEU B 1 77  ? 167.801 -19.189  2.944   1.00 103.69 ? 77  LEU B CA    1 
ATOM   3577  C C     . LEU B 1 77  ? 168.947 -18.815  1.994   1.00 105.45 ? 77  LEU B C     1 
ATOM   3578  O O     . LEU B 1 77  ? 170.008 -19.433  2.033   1.00 106.42 ? 77  LEU B O     1 
ATOM   3579  C CB    . LEU B 1 77  ? 167.323 -20.622  2.691   1.00 102.30 ? 77  LEU B CB    1 
ATOM   3580  C CG    . LEU B 1 77  ? 167.814 -21.699  3.662   1.00 102.36 ? 77  LEU B CG    1 
ATOM   3581  C CD1   . LEU B 1 77  ? 166.916 -21.792  4.891   1.00 101.02 ? 77  LEU B CD1   1 
ATOM   3582  C CD2   . LEU B 1 77  ? 167.878 -23.039  2.965   1.00 102.01 ? 77  LEU B CD2   1 
ATOM   3583  N N     . GLY B 1 78  ? 168.734 -17.808  1.148   1.00 106.23 ? 78  GLY B N     1 
ATOM   3584  C CA    . GLY B 1 78  ? 169.823 -17.230  0.355   1.00 108.62 ? 78  GLY B CA    1 
ATOM   3585  C C     . GLY B 1 78  ? 169.672 -17.185  -1.159  1.00 109.33 ? 78  GLY B C     1 
ATOM   3586  O O     . GLY B 1 78  ? 170.479 -16.546  -1.841  1.00 111.09 ? 78  GLY B O     1 
ATOM   3587  N N     . TYR B 1 79  ? 168.642 -17.847  -1.687  1.00 108.35 ? 79  TYR B N     1 
ATOM   3588  C CA    . TYR B 1 79  ? 168.463 -17.999  -3.140  1.00 109.00 ? 79  TYR B CA    1 
ATOM   3589  C C     . TYR B 1 79  ? 167.447 -17.021  -3.747  1.00 108.96 ? 79  TYR B C     1 
ATOM   3590  O O     . TYR B 1 79  ? 166.548 -16.527  -3.056  1.00 107.86 ? 79  TYR B O     1 
ATOM   3591  C CB    . TYR B 1 79  ? 168.045 -19.438  -3.494  1.00 107.83 ? 79  TYR B CB    1 
ATOM   3592  C CG    . TYR B 1 79  ? 168.873 -20.542  -2.860  1.00 108.54 ? 79  TYR B CG    1 
ATOM   3593  C CD1   . TYR B 1 79  ? 168.493 -21.111  -1.646  1.00 107.87 ? 79  TYR B CD1   1 
ATOM   3594  C CD2   . TYR B 1 79  ? 170.025 -21.034  -3.485  1.00 110.84 ? 79  TYR B CD2   1 
ATOM   3595  C CE1   . TYR B 1 79  ? 169.241 -22.128  -1.060  1.00 108.58 ? 79  TYR B CE1   1 
ATOM   3596  C CE2   . TYR B 1 79  ? 170.782 -22.057  -2.905  1.00 111.03 ? 79  TYR B CE2   1 
ATOM   3597  C CZ    . TYR B 1 79  ? 170.381 -22.594  -1.694  1.00 110.04 ? 79  TYR B CZ    1 
ATOM   3598  O OH    . TYR B 1 79  ? 171.115 -23.599  -1.109  1.00 110.82 ? 79  TYR B OH    1 
ATOM   3599  N N     . ARG B 1 80  ? 167.611 -16.753  -5.044  1.00 110.35 ? 80  ARG B N     1 
ATOM   3600  C CA    . ARG B 1 80  ? 166.603 -16.058  -5.849  1.00 110.60 ? 80  ARG B CA    1 
ATOM   3601  C C     . ARG B 1 80  ? 165.602 -17.072  -6.417  1.00 108.92 ? 80  ARG B C     1 
ATOM   3602  O O     . ARG B 1 80  ? 165.982 -17.966  -7.183  1.00 109.13 ? 80  ARG B O     1 
ATOM   3603  C CB    . ARG B 1 80  ? 167.264 -15.233  -6.965  1.00 113.03 ? 80  ARG B CB    1 
ATOM   3604  C CG    . ARG B 1 80  ? 167.352 -13.726  -6.670  1.00 115.50 ? 80  ARG B CG    1 
ATOM   3605  C CD    . ARG B 1 80  ? 166.158 -12.927  -7.251  1.00 117.52 ? 80  ARG B CD    1 
ATOM   3606  N NE    . ARG B 1 80  ? 164.840 -13.461  -6.874  1.00 116.24 ? 80  ARG B NE    1 
ATOM   3607  C CZ    . ARG B 1 80  ? 163.681 -13.074  -7.407  1.00 116.37 ? 80  ARG B CZ    1 
ATOM   3608  N NH1   . ARG B 1 80  ? 163.646 -12.136  -8.348  1.00 118.35 ? 80  ARG B NH1   1 
ATOM   3609  N NH2   . ARG B 1 80  ? 162.547 -13.630  -7.000  1.00 114.73 ? 80  ARG B NH2   1 
ATOM   3610  N N     . VAL B 1 81  ? 164.330 -16.932  -6.026  1.00 107.22 ? 81  VAL B N     1 
ATOM   3611  C CA    . VAL B 1 81  ? 163.320 -17.977  -6.252  1.00 105.45 ? 81  VAL B CA    1 
ATOM   3612  C C     . VAL B 1 81  ? 162.001 -17.474  -6.849  1.00 105.00 ? 81  VAL B C     1 
ATOM   3613  O O     . VAL B 1 81  ? 161.557 -16.364  -6.551  1.00 105.28 ? 81  VAL B O     1 
ATOM   3614  C CB    . VAL B 1 81  ? 162.986 -18.732  -4.936  1.00 103.73 ? 81  VAL B CB    1 
ATOM   3615  C CG1   . VAL B 1 81  ? 162.272 -20.039  -5.229  1.00 102.50 ? 81  VAL B CG1   1 
ATOM   3616  C CG2   . VAL B 1 81  ? 164.242 -19.005  -4.123  1.00 104.50 ? 81  VAL B CG2   1 
ATOM   3617  N N     . SER B 1 82  ? 161.389 -18.310  -7.689  1.00 104.39 ? 82  SER B N     1 
ATOM   3618  C CA    . SER B 1 82  ? 160.025 -18.102  -8.186  1.00 103.81 ? 82  SER B CA    1 
ATOM   3619  C C     . SER B 1 82  ? 159.276 -19.436  -8.187  1.00 102.11 ? 82  SER B C     1 
ATOM   3620  O O     . SER B 1 82  ? 159.802 -20.434  -7.698  1.00 101.34 ? 82  SER B O     1 
ATOM   3621  C CB    . SER B 1 82  ? 160.047 -17.493  -9.589  1.00 105.70 ? 82  SER B CB    1 
ATOM   3622  O OG    . SER B 1 82  ? 160.709 -18.350  -10.501 1.00 106.64 ? 82  SER B OG    1 
ATOM   3623  N N     . TYR B 1 83  ? 158.055 -19.457  -8.721  1.00 101.61 ? 83  TYR B N     1 
ATOM   3624  C CA    . TYR B 1 83  ? 157.281 -20.703  -8.805  1.00 100.39 ? 83  TYR B CA    1 
ATOM   3625  C C     . TYR B 1 83  ? 156.468 -20.801  -10.099 1.00 101.44 ? 83  TYR B C     1 
ATOM   3626  O O     . TYR B 1 83  ? 155.910 -19.817  -10.552 1.00 102.32 ? 83  TYR B O     1 
ATOM   3627  C CB    . TYR B 1 83  ? 156.362 -20.863  -7.578  1.00 98.55  ? 83  TYR B CB    1 
ATOM   3628  C CG    . TYR B 1 83  ? 155.101 -20.023  -7.631  1.00 97.64  ? 83  TYR B CG    1 
ATOM   3629  C CD1   . TYR B 1 83  ? 153.880 -20.584  -8.009  1.00 96.13  ? 83  TYR B CD1   1 
ATOM   3630  C CD2   . TYR B 1 83  ? 155.131 -18.665  -7.323  1.00 97.76  ? 83  TYR B CD2   1 
ATOM   3631  C CE1   . TYR B 1 83  ? 152.725 -19.813  -8.078  1.00 95.47  ? 83  TYR B CE1   1 
ATOM   3632  C CE2   . TYR B 1 83  ? 153.974 -17.888  -7.389  1.00 97.20  ? 83  TYR B CE2   1 
ATOM   3633  C CZ    . TYR B 1 83  ? 152.782 -18.470  -7.767  1.00 95.67  ? 83  TYR B CZ    1 
ATOM   3634  O OH    . TYR B 1 83  ? 151.650 -17.705  -7.826  1.00 95.59  ? 83  TYR B OH    1 
ATOM   3635  N N     . GLU B 1 84  ? 156.400 -21.990  -10.689 1.00 101.74 ? 84  GLU B N     1 
ATOM   3636  C CA    . GLU B 1 84  ? 155.506 -22.231  -11.827 1.00 103.04 ? 84  GLU B CA    1 
ATOM   3637  C C     . GLU B 1 84  ? 154.489 -23.309  -11.490 1.00 101.66 ? 84  GLU B C     1 
ATOM   3638  O O     . GLU B 1 84  ? 154.873 -24.424  -11.123 1.00 100.95 ? 84  GLU B O     1 
ATOM   3639  C CB    . GLU B 1 84  ? 156.279 -22.614  -13.094 1.00 105.02 ? 84  GLU B CB    1 
ATOM   3640  C CG    . GLU B 1 84  ? 156.385 -21.495  -14.116 1.00 108.16 ? 84  GLU B CG    1 
ATOM   3641  C CD    . GLU B 1 84  ? 156.569 -22.010  -15.532 1.00 111.57 ? 84  GLU B CD    1 
ATOM   3642  O OE1   . GLU B 1 84  ? 155.959 -23.046  -15.879 1.00 111.52 ? 84  GLU B OE1   1 
ATOM   3643  O OE2   . GLU B 1 84  ? 157.319 -21.369  -16.304 1.00 115.03 ? 84  GLU B OE2   1 
ATOM   3644  N N     . PRO B 1 85  ? 153.189 -22.984  -11.621 1.00 101.63 ? 85  PRO B N     1 
ATOM   3645  C CA    . PRO B 1 85  ? 152.102 -23.852  -11.156 1.00 100.50 ? 85  PRO B CA    1 
ATOM   3646  C C     . PRO B 1 85  ? 152.093 -25.254  -11.782 1.00 100.44 ? 85  PRO B C     1 
ATOM   3647  O O     . PRO B 1 85  ? 152.630 -26.204  -11.192 1.00 99.76  ? 85  PRO B O     1 
ATOM   3648  C CB    . PRO B 1 85  ? 150.830 -23.062  -11.517 1.00 101.13 ? 85  PRO B CB    1 
ATOM   3649  C CG    . PRO B 1 85  ? 151.259 -22.035  -12.505 1.00 102.97 ? 85  PRO B CG    1 
ATOM   3650  C CD    . PRO B 1 85  ? 152.678 -21.718  -12.177 1.00 102.99 ? 85  PRO B CD    1 
ATOM   3651  N N     . TYR B 1 86  ? 151.489 -25.373  -12.958 1.00 101.25 ? 86  TYR B N     1 
ATOM   3652  C CA    . TYR B 1 86  ? 151.356 -26.651  -13.634 1.00 101.26 ? 86  TYR B CA    1 
ATOM   3653  C C     . TYR B 1 86  ? 152.415 -26.757  -14.733 1.00 102.64 ? 86  TYR B C     1 
ATOM   3654  O O     . TYR B 1 86  ? 152.097 -26.992  -15.901 1.00 104.35 ? 86  TYR B O     1 
ATOM   3655  C CB    . TYR B 1 86  ? 149.931 -26.803  -14.189 1.00 101.85 ? 86  TYR B CB    1 
ATOM   3656  C CG    . TYR B 1 86  ? 149.308 -25.502  -14.669 1.00 102.98 ? 86  TYR B CG    1 
ATOM   3657  C CD1   . TYR B 1 86  ? 149.526 -25.036  -15.960 1.00 105.24 ? 86  TYR B CD1   1 
ATOM   3658  C CD2   . TYR B 1 86  ? 148.503 -24.741  -13.827 1.00 102.43 ? 86  TYR B CD2   1 
ATOM   3659  C CE1   . TYR B 1 86  ? 148.961 -23.844  -16.401 1.00 107.09 ? 86  TYR B CE1   1 
ATOM   3660  C CE2   . TYR B 1 86  ? 147.934 -23.548  -14.255 1.00 104.12 ? 86  TYR B CE2   1 
ATOM   3661  C CZ    . TYR B 1 86  ? 148.164 -23.105  -15.544 1.00 106.46 ? 86  TYR B CZ    1 
ATOM   3662  O OH    . TYR B 1 86  ? 147.595 -21.921  -15.973 1.00 108.50 ? 86  TYR B OH    1 
ATOM   3663  N N     . SER B 1 87  ? 153.678 -26.586  -14.339 1.00 102.06 ? 87  SER B N     1 
ATOM   3664  C CA    . SER B 1 87  ? 154.809 -26.518  -15.275 1.00 103.28 ? 87  SER B CA    1 
ATOM   3665  C C     . SER B 1 87  ? 155.022 -27.814  -16.052 1.00 103.65 ? 87  SER B C     1 
ATOM   3666  O O     . SER B 1 87  ? 154.673 -28.895  -15.569 1.00 102.54 ? 87  SER B O     1 
ATOM   3667  C CB    . SER B 1 87  ? 156.094 -26.164  -14.526 1.00 102.81 ? 87  SER B CB    1 
ATOM   3668  O OG    . SER B 1 87  ? 156.521 -27.260  -13.736 1.00 101.53 ? 87  SER B OG    1 
ATOM   3669  N N     . LYS B 1 88  ? 155.606 -27.695  -17.245 1.00 105.20 ? 88  LYS B N     1 
ATOM   3670  C CA    . LYS B 1 88  ? 155.939 -28.853  -18.079 1.00 105.71 ? 88  LYS B CA    1 
ATOM   3671  C C     . LYS B 1 88  ? 156.871 -29.824  -17.347 1.00 104.18 ? 88  LYS B C     1 
ATOM   3672  O O     . LYS B 1 88  ? 156.731 -31.042  -17.468 1.00 103.90 ? 88  LYS B O     1 
ATOM   3673  C CB    . LYS B 1 88  ? 156.566 -28.408  -19.406 1.00 108.52 ? 88  LYS B CB    1 
ATOM   3674  C CG    . LYS B 1 88  ? 155.595 -27.738  -20.373 1.00 110.39 ? 88  LYS B CG    1 
ATOM   3675  C CD    . LYS B 1 88  ? 156.228 -27.523  -21.743 1.00 113.53 ? 88  LYS B CD    1 
ATOM   3676  C CE    . LYS B 1 88  ? 155.193 -27.046  -22.754 1.00 115.53 ? 88  LYS B CE    1 
ATOM   3677  N NZ    . LYS B 1 88  ? 155.797 -26.768  -24.086 1.00 118.16 ? 88  LYS B NZ    1 
ATOM   3678  N N     . VAL B 1 89  ? 157.806 -29.268  -16.577 1.00 102.96 ? 89  VAL B N     1 
ATOM   3679  C CA    . VAL B 1 89  ? 158.759 -30.045  -15.790 1.00 101.53 ? 89  VAL B CA    1 
ATOM   3680  C C     . VAL B 1 89  ? 158.067 -30.909  -14.741 1.00 99.29  ? 89  VAL B C     1 
ATOM   3681  O O     . VAL B 1 89  ? 158.314 -32.112  -14.661 1.00 99.03  ? 89  VAL B O     1 
ATOM   3682  C CB    . VAL B 1 89  ? 159.786 -29.124  -15.099 1.00 101.39 ? 89  VAL B CB    1 
ATOM   3683  C CG1   . VAL B 1 89  ? 160.698 -29.929  -14.191 1.00 100.40 ? 89  VAL B CG1   1 
ATOM   3684  C CG2   . VAL B 1 89  ? 160.594 -28.368  -16.135 1.00 103.57 ? 89  VAL B CG2   1 
ATOM   3685  N N     . SER B 1 90  ? 157.205 -30.287  -13.939 1.00 97.73  ? 90  SER B N     1 
ATOM   3686  C CA    . SER B 1 90  ? 156.459 -30.993  -12.901 1.00 95.72  ? 90  SER B CA    1 
ATOM   3687  C C     . SER B 1 90  ? 155.652 -32.146  -13.494 1.00 95.53  ? 90  SER B C     1 
ATOM   3688  O O     . SER B 1 90  ? 155.566 -33.219  -12.896 1.00 94.61  ? 90  SER B O     1 
ATOM   3689  C CB    . SER B 1 90  ? 155.545 -30.029  -12.144 1.00 94.87  ? 90  SER B CB    1 
ATOM   3690  O OG    . SER B 1 90  ? 154.631 -29.387  -13.019 1.00 96.04  ? 90  SER B OG    1 
ATOM   3691  N N     . ARG B 1 91  ? 155.075 -31.916  -14.672 1.00 96.30  ? 91  ARG B N     1 
ATOM   3692  C CA    . ARG B 1 91  ? 154.378 -32.966  -15.407 1.00 96.54  ? 91  ARG B CA    1 
ATOM   3693  C C     . ARG B 1 91  ? 155.362 -34.049  -15.849 1.00 97.30  ? 91  ARG B C     1 
ATOM   3694  O O     . ARG B 1 91  ? 155.138 -35.226  -15.582 1.00 96.89  ? 91  ARG B O     1 
ATOM   3695  C CB    . ARG B 1 91  ? 153.622 -32.399  -16.615 1.00 98.07  ? 91  ARG B CB    1 
ATOM   3696  C CG    . ARG B 1 91  ? 152.349 -31.629  -16.278 1.00 96.66  ? 91  ARG B CG    1 
ATOM   3697  C CD    . ARG B 1 91  ? 151.660 -31.091  -17.530 1.00 97.25  ? 91  ARG B CD    1 
ATOM   3698  N NE    . ARG B 1 91  ? 151.128 -32.166  -18.361 1.00 97.73  ? 91  ARG B NE    1 
ATOM   3699  C CZ    . ARG B 1 91  ? 149.902 -32.670  -18.257 1.00 96.87  ? 91  ARG B CZ    1 
ATOM   3700  N NH1   . ARG B 1 91  ? 149.050 -32.196  -17.357 1.00 94.84  ? 91  ARG B NH1   1 
ATOM   3701  N NH2   . ARG B 1 91  ? 149.526 -33.654  -19.060 1.00 98.03  ? 91  ARG B NH2   1 
ATOM   3702  N N     . ILE B 1 92  ? 156.455 -33.644  -16.501 1.00 98.39  ? 92  ILE B N     1 
ATOM   3703  C CA    . ILE B 1 92  ? 157.495 -34.581  -16.952 1.00 99.03  ? 92  ILE B CA    1 
ATOM   3704  C C     . ILE B 1 92  ? 157.917 -35.541  -15.829 1.00 97.34  ? 92  ILE B C     1 
ATOM   3705  O O     . ILE B 1 92  ? 158.096 -36.737  -16.068 1.00 97.82  ? 92  ILE B O     1 
ATOM   3706  C CB    . ILE B 1 92  ? 158.723 -33.839  -17.578 1.00 100.60 ? 92  ILE B CB    1 
ATOM   3707  C CG1   . ILE B 1 92  ? 158.390 -33.353  -18.994 1.00 102.62 ? 92  ILE B CG1   1 
ATOM   3708  C CG2   . ILE B 1 92  ? 159.967 -34.737  -17.614 1.00 101.49 ? 92  ILE B CG2   1 
ATOM   3709  C CD1   . ILE B 1 92  ? 159.371 -32.338  -19.569 1.00 104.10 ? 92  ILE B CD1   1 
ATOM   3710  N N     . PHE B 1 93  ? 158.042 -35.016  -14.610 1.00 95.44  ? 93  PHE B N     1 
ATOM   3711  C CA    . PHE B 1 93  ? 158.408 -35.821  -13.446 1.00 94.00  ? 93  PHE B CA    1 
ATOM   3712  C C     . PHE B 1 93  ? 157.366 -36.880  -13.078 1.00 93.07  ? 93  PHE B C     1 
ATOM   3713  O O     . PHE B 1 93  ? 157.712 -38.030  -12.802 1.00 93.14  ? 93  PHE B O     1 
ATOM   3714  C CB    . PHE B 1 93  ? 158.693 -34.928  -12.231 1.00 92.85  ? 93  PHE B CB    1 
ATOM   3715  C CG    . PHE B 1 93  ? 158.700 -35.673  -10.923 1.00 91.31  ? 93  PHE B CG    1 
ATOM   3716  C CD1   . PHE B 1 93  ? 159.732 -36.547  -10.609 1.00 91.29  ? 93  PHE B CD1   1 
ATOM   3717  C CD2   . PHE B 1 93  ? 157.664 -35.511  -10.014 1.00 89.91  ? 93  PHE B CD2   1 
ATOM   3718  C CE1   . PHE B 1 93  ? 159.733 -37.244  -9.410  1.00 90.15  ? 93  PHE B CE1   1 
ATOM   3719  C CE2   . PHE B 1 93  ? 157.660 -36.204  -8.809  1.00 88.67  ? 93  PHE B CE2   1 
ATOM   3720  C CZ    . PHE B 1 93  ? 158.698 -37.070  -8.509  1.00 88.88  ? 93  PHE B CZ    1 
ATOM   3721  N N     . ARG B 1 94  ? 156.098 -36.484  -13.060 1.00 92.34  ? 94  ARG B N     1 
ATOM   3722  C CA    . ARG B 1 94  ? 155.011 -37.377  -12.655 1.00 91.44  ? 94  ARG B CA    1 
ATOM   3723  C C     . ARG B 1 94  ? 154.661 -38.413  -13.720 1.00 93.01  ? 94  ARG B C     1 
ATOM   3724  O O     . ARG B 1 94  ? 154.096 -39.460  -13.405 1.00 92.56  ? 94  ARG B O     1 
ATOM   3725  C CB    . ARG B 1 94  ? 153.763 -36.572  -12.278 1.00 90.43  ? 94  ARG B CB    1 
ATOM   3726  C CG    . ARG B 1 94  ? 153.869 -35.803  -10.964 1.00 87.61  ? 94  ARG B CG    1 
ATOM   3727  C CD    . ARG B 1 94  ? 152.533 -35.182  -10.569 1.00 83.86  ? 94  ARG B CD    1 
ATOM   3728  N NE    . ARG B 1 94  ? 152.164 -34.062  -11.432 1.00 81.81  ? 94  ARG B NE    1 
ATOM   3729  C CZ    . ARG B 1 94  ? 152.457 -32.787  -11.187 1.00 80.68  ? 94  ARG B CZ    1 
ATOM   3730  N NH1   . ARG B 1 94  ? 152.079 -31.844  -12.036 1.00 80.95  ? 94  ARG B NH1   1 
ATOM   3731  N NH2   . ARG B 1 94  ? 153.125 -32.447  -10.096 1.00 79.79  ? 94  ARG B NH2   1 
ATOM   3732  N N     . GLU B 1 95  ? 154.994 -38.105  -14.976 1.00 95.13  ? 95  GLU B N     1 
ATOM   3733  C CA    . GLU B 1 95  ? 154.782 -39.007  -16.117 1.00 97.13  ? 95  GLU B CA    1 
ATOM   3734  C C     . GLU B 1 95  ? 155.648 -40.256  -15.979 1.00 97.66  ? 95  GLU B C     1 
ATOM   3735  O O     . GLU B 1 95  ? 155.275 -41.339  -16.438 1.00 98.46  ? 95  GLU B O     1 
ATOM   3736  C CB    . GLU B 1 95  ? 155.135 -38.308  -17.437 1.00 99.13  ? 95  GLU B CB    1 
ATOM   3737  C CG    . GLU B 1 95  ? 154.351 -37.033  -17.759 1.00 99.71  ? 95  GLU B CG    1 
ATOM   3738  C CD    . GLU B 1 95  ? 153.091 -37.289  -18.551 1.00 101.60 ? 95  GLU B CD    1 
ATOM   3739  O OE1   . GLU B 1 95  ? 152.693 -38.467  -18.678 1.00 102.53 ? 95  GLU B OE1   1 
ATOM   3740  O OE2   . GLU B 1 95  ? 152.498 -36.305  -19.049 1.00 102.87 ? 95  GLU B OE2   1 
ATOM   3741  N N     . SER B 1 96  ? 156.808 -40.077  -15.346 1.00 97.47  ? 96  SER B N     1 
ATOM   3742  C CA    . SER B 1 96  ? 157.799 -41.129  -15.159 1.00 98.01  ? 96  SER B CA    1 
ATOM   3743  C C     . SER B 1 96  ? 157.881 -41.547  -13.699 1.00 96.83  ? 96  SER B C     1 
ATOM   3744  O O     . SER B 1 96  ? 158.872 -42.146  -13.277 1.00 97.16  ? 96  SER B O     1 
ATOM   3745  C CB    . SER B 1 96  ? 159.169 -40.633  -15.622 1.00 99.06  ? 96  SER B CB    1 
ATOM   3746  O OG    . SER B 1 96  ? 159.567 -39.488  -14.887 1.00 97.01  ? 96  SER B OG    1 
ATOM   3747  N N     . LEU B 1 97  ? 156.834 -41.238  -12.937 1.00 95.83  ? 97  LEU B N     1 
ATOM   3748  C CA    . LEU B 1 97  ? 156.839 -41.452  -11.488 1.00 94.89  ? 97  LEU B CA    1 
ATOM   3749  C C     . LEU B 1 97  ? 156.615 -42.901  -11.052 1.00 95.23  ? 97  LEU B C     1 
ATOM   3750  O O     . LEU B 1 97  ? 157.112 -43.307  -10.001 1.00 95.32  ? 97  LEU B O     1 
ATOM   3751  C CB    . LEU B 1 97  ? 155.833 -40.540  -10.792 1.00 93.55  ? 97  LEU B CB    1 
ATOM   3752  C CG    . LEU B 1 97  ? 156.266 -39.844  -9.502  1.00 92.36  ? 97  LEU B CG    1 
ATOM   3753  C CD1   . LEU B 1 97  ? 155.172 -38.862  -9.112  1.00 92.29  ? 97  LEU B CD1   1 
ATOM   3754  C CD2   . LEU B 1 97  ? 156.559 -40.801  -8.357  1.00 91.22  ? 97  LEU B CD2   1 
ATOM   3755  N N     . PRO B 1 98  ? 155.865 -43.695  -11.830 1.00 95.93  ? 98  PRO B N     1 
ATOM   3756  C CA    . PRO B 1 98  ? 155.977 -45.092  -11.432 1.00 96.35  ? 98  PRO B CA    1 
ATOM   3757  C C     . PRO B 1 98  ? 157.459 -45.506  -11.429 1.00 97.26  ? 98  PRO B C     1 
ATOM   3758  O O     . PRO B 1 98  ? 157.916 -46.122  -10.468 1.00 97.04  ? 98  PRO B O     1 
ATOM   3759  C CB    . PRO B 1 98  ? 155.177 -45.838  -12.510 1.00 97.52  ? 98  PRO B CB    1 
ATOM   3760  C CG    . PRO B 1 98  ? 154.901 -44.815  -13.600 1.00 97.96  ? 98  PRO B CG    1 
ATOM   3761  C CD    . PRO B 1 98  ? 154.900 -43.495  -12.925 1.00 96.45  ? 98  PRO B CD    1 
ATOM   3762  N N     . LYS B 1 99  ? 158.199 -45.082  -12.463 1.00 98.35  ? 99  LYS B N     1 
ATOM   3763  C CA    . LYS B 1 99  ? 159.584 -45.511  -12.737 1.00 99.50  ? 99  LYS B CA    1 
ATOM   3764  C C     . LYS B 1 99  ? 160.693 -44.871  -11.892 1.00 98.75  ? 99  LYS B C     1 
ATOM   3765  O O     . LYS B 1 99  ? 161.493 -45.589  -11.292 1.00 99.09  ? 99  LYS B O     1 
ATOM   3766  C CB    . LYS B 1 99  ? 159.905 -45.366  -14.241 1.00 101.36 ? 99  LYS B CB    1 
ATOM   3767  C CG    . LYS B 1 99  ? 161.393 -45.123  -14.585 1.00 103.17 ? 99  LYS B CG    1 
ATOM   3768  C CD    . LYS B 1 99  ? 161.877 -46.000  -15.734 1.00 105.88 ? 99  LYS B CD    1 
ATOM   3769  C CE    . LYS B 1 99  ? 162.318 -47.365  -15.220 1.00 106.92 ? 99  LYS B CE    1 
ATOM   3770  N NZ    . LYS B 1 99  ? 162.624 -48.302  -16.330 1.00 110.31 ? 99  LYS B NZ    1 
ATOM   3771  N N     . VAL B 1 100 ? 160.752 -43.541  -11.857 1.00 97.78  ? 100 VAL B N     1 
ATOM   3772  C CA    . VAL B 1 100 ? 161.889 -42.849  -11.228 1.00 97.48  ? 100 VAL B CA    1 
ATOM   3773  C C     . VAL B 1 100 ? 162.009 -43.043  -9.715  1.00 96.40  ? 100 VAL B C     1 
ATOM   3774  O O     . VAL B 1 100 ? 162.944 -42.530  -9.096  1.00 96.39  ? 100 VAL B O     1 
ATOM   3775  C CB    . VAL B 1 100 ? 161.950 -41.342  -11.569 1.00 97.14  ? 100 VAL B CB    1 
ATOM   3776  C CG1   . VAL B 1 100 ? 162.175 -41.147  -13.065 1.00 99.01  ? 100 VAL B CG1   1 
ATOM   3777  C CG2   . VAL B 1 100 ? 160.710 -40.616  -11.078 1.00 95.32  ? 100 VAL B CG2   1 
ATOM   3778  N N     . ALA B 1 101 ? 161.069 -43.785  -9.134  1.00 95.56  ? 101 ALA B N     1 
ATOM   3779  C CA    . ALA B 1 101 ? 161.183 -44.236  -7.751  1.00 94.88  ? 101 ALA B CA    1 
ATOM   3780  C C     . ALA B 1 101 ? 162.311 -45.257  -7.624  1.00 96.12  ? 101 ALA B C     1 
ATOM   3781  O O     . ALA B 1 101 ? 163.076 -45.233  -6.656  1.00 96.30  ? 101 ALA B O     1 
ATOM   3782  C CB    . ALA B 1 101 ? 159.869 -44.826  -7.275  1.00 94.18  ? 101 ALA B CB    1 
ATOM   3783  N N     . ILE B 1 102 ? 162.404 -46.139  -8.620  1.00 97.08  ? 102 ILE B N     1 
ATOM   3784  C CA    . ILE B 1 102 ? 163.410 -47.198  -8.662  1.00 98.46  ? 102 ILE B CA    1 
ATOM   3785  C C     . ILE B 1 102 ? 164.780 -46.616  -9.028  1.00 99.45  ? 102 ILE B C     1 
ATOM   3786  O O     . ILE B 1 102 ? 165.802 -46.975  -8.427  1.00 100.15 ? 102 ILE B O     1 
ATOM   3787  C CB    . ILE B 1 102 ? 162.981 -48.333  -9.644  1.00 99.38  ? 102 ILE B CB    1 
ATOM   3788  C CG1   . ILE B 1 102 ? 162.004 -49.306  -8.971  1.00 98.77  ? 102 ILE B CG1   1 
ATOM   3789  C CG2   . ILE B 1 102 ? 164.177 -49.103  -10.169 1.00 101.33 ? 102 ILE B CG2   1 
ATOM   3790  C CD1   . ILE B 1 102 ? 160.536 -48.902  -9.066  1.00 97.38  ? 102 ILE B CD1   1 
ATOM   3791  N N     . ASP B 1 103 ? 164.776 -45.699  -9.994  1.00 99.55  ? 103 ASP B N     1 
ATOM   3792  C CA    . ASP B 1 103 ? 165.991 -45.057  -10.499 1.00 100.75 ? 103 ASP B CA    1 
ATOM   3793  C C     . ASP B 1 103 ? 166.778 -44.283  -9.444  1.00 100.19 ? 103 ASP B C     1 
ATOM   3794  O O     . ASP B 1 103 ? 167.996 -44.358  -9.423  1.00 101.48 ? 103 ASP B O     1 
ATOM   3795  C CB    . ASP B 1 103 ? 165.673 -44.154  -11.698 1.00 101.10 ? 103 ASP B CB    1 
ATOM   3796  C CG    . ASP B 1 103 ? 165.224 -44.939  -12.925 1.00 103.00 ? 103 ASP B CG    1 
ATOM   3797  O OD1   . ASP B 1 103 ? 165.468 -46.167  -12.987 1.00 104.65 ? 103 ASP B OD1   1 
ATOM   3798  O OD2   . ASP B 1 103 ? 164.626 -44.322  -13.835 1.00 104.07 ? 103 ASP B OD2   1 
ATOM   3799  N N     . ILE B 1 104 ? 166.095 -43.542  -8.576  1.00 98.67  ? 104 ILE B N     1 
ATOM   3800  C CA    . ILE B 1 104 ? 166.782 -42.815  -7.497  1.00 98.41  ? 104 ILE B CA    1 
ATOM   3801  C C     . ILE B 1 104 ? 166.898 -43.652  -6.216  1.00 98.45  ? 104 ILE B C     1 
ATOM   3802  O O     . ILE B 1 104 ? 167.299 -43.150  -5.161  1.00 98.20  ? 104 ILE B O     1 
ATOM   3803  C CB    . ILE B 1 104 ? 166.165 -41.404  -7.212  1.00 96.97  ? 104 ILE B CB    1 
ATOM   3804  C CG1   . ILE B 1 104 ? 164.790 -41.505  -6.546  1.00 95.22  ? 104 ILE B CG1   1 
ATOM   3805  C CG2   . ILE B 1 104 ? 166.099 -40.580  -8.489  1.00 97.63  ? 104 ILE B CG2   1 
ATOM   3806  C CD1   . ILE B 1 104 ? 164.349 -40.226  -5.857  1.00 93.48  ? 104 ILE B CD1   1 
ATOM   3807  N N     . LYS B 1 105 ? 166.561 -44.937  -6.343  1.00 98.93  ? 105 LYS B N     1 
ATOM   3808  C CA    . LYS B 1 105 ? 166.623 -45.923  -5.254  1.00 99.36  ? 105 LYS B CA    1 
ATOM   3809  C C     . LYS B 1 105 ? 165.842 -45.546  -3.988  1.00 98.20  ? 105 LYS B C     1 
ATOM   3810  O O     . LYS B 1 105 ? 166.388 -45.505  -2.880  1.00 98.56  ? 105 LYS B O     1 
ATOM   3811  C CB    . LYS B 1 105 ? 168.071 -46.334  -4.945  1.00 100.87 ? 105 LYS B CB    1 
ATOM   3812  C CG    . LYS B 1 105 ? 168.588 -47.402  -5.879  1.00 102.35 ? 105 LYS B CG    1 
ATOM   3813  C CD    . LYS B 1 105 ? 170.090 -47.580  -5.772  1.00 104.07 ? 105 LYS B CD    1 
ATOM   3814  C CE    . LYS B 1 105 ? 170.559 -48.746  -6.641  1.00 105.51 ? 105 LYS B CE    1 
ATOM   3815  N NZ    . LYS B 1 105 ? 172.033 -48.957  -6.575  1.00 107.26 ? 105 LYS B NZ    1 
ATOM   3816  N N     . PHE B 1 106 ? 164.558 -45.261  -4.179  1.00 96.92  ? 106 PHE B N     1 
ATOM   3817  C CA    . PHE B 1 106 ? 163.645 -45.029  -3.073  1.00 96.00  ? 106 PHE B CA    1 
ATOM   3818  C C     . PHE B 1 106 ? 163.035 -46.363  -2.661  1.00 96.42  ? 106 PHE B C     1 
ATOM   3819  O O     . PHE B 1 106 ? 162.771 -46.601  -1.479  1.00 96.61  ? 106 PHE B O     1 
ATOM   3820  C CB    . PHE B 1 106 ? 162.561 -44.018  -3.470  1.00 94.64  ? 106 PHE B CB    1 
ATOM   3821  C CG    . PHE B 1 106 ? 161.650 -43.625  -2.341  1.00 93.54  ? 106 PHE B CG    1 
ATOM   3822  C CD1   . PHE B 1 106 ? 160.321 -44.030  -2.335  1.00 92.69  ? 106 PHE B CD1   1 
ATOM   3823  C CD2   . PHE B 1 106 ? 162.126 -42.858  -1.282  1.00 93.24  ? 106 PHE B CD2   1 
ATOM   3824  C CE1   . PHE B 1 106 ? 159.481 -43.678  -1.302  1.00 91.99  ? 106 PHE B CE1   1 
ATOM   3825  C CE2   . PHE B 1 106 ? 161.296 -42.502  -0.243  1.00 92.78  ? 106 PHE B CE2   1 
ATOM   3826  C CZ    . PHE B 1 106 ? 159.967 -42.910  -0.252  1.00 92.46  ? 106 PHE B CZ    1 
ATOM   3827  N N     . ALA B 1 107 ? 162.808 -47.219  -3.654  1.00 96.85  ? 107 ALA B N     1 
ATOM   3828  C CA    . ALA B 1 107 ? 162.423 -48.606  -3.433  1.00 97.73  ? 107 ALA B CA    1 
ATOM   3829  C C     . ALA B 1 107 ? 163.100 -49.476  -4.482  1.00 99.22  ? 107 ALA B C     1 
ATOM   3830  O O     . ALA B 1 107 ? 163.431 -49.007  -5.574  1.00 99.20  ? 107 ALA B O     1 
ATOM   3831  C CB    . ALA B 1 107 ? 160.918 -48.773  -3.490  1.00 96.67  ? 107 ALA B CB    1 
ATOM   3832  N N     . SER B 1 108 ? 163.314 -50.740  -4.139  1.00 100.69 ? 108 SER B N     1 
ATOM   3833  C CA    . SER B 1 108 ? 163.947 -51.681  -5.051  1.00 102.43 ? 108 SER B CA    1 
ATOM   3834  C C     . SER B 1 108 ? 163.081 -51.931  -6.289  1.00 102.37 ? 108 SER B C     1 
ATOM   3835  O O     . SER B 1 108 ? 163.582 -51.905  -7.414  1.00 103.11 ? 108 SER B O     1 
ATOM   3836  C CB    . SER B 1 108 ? 164.277 -52.994  -4.331  1.00 103.98 ? 108 SER B CB    1 
ATOM   3837  O OG    . SER B 1 108 ? 163.125 -53.551  -3.722  1.00 103.54 ? 108 SER B OG    1 
ATOM   3838  N N     . ASN B 1 109 ? 161.786 -52.162  -6.077  1.00 101.73 ? 109 ASN B N     1 
ATOM   3839  C CA    . ASN B 1 109 ? 160.846 -52.388  -7.174  1.00 101.70 ? 109 ASN B CA    1 
ATOM   3840  C C     . ASN B 1 109 ? 159.556 -51.586  -7.024  1.00 100.31 ? 109 ASN B C     1 
ATOM   3841  O O     . ASN B 1 109 ? 159.337 -50.938  -5.999  1.00 99.39  ? 109 ASN B O     1 
ATOM   3842  C CB    . ASN B 1 109 ? 160.540 -53.883  -7.332  1.00 103.02 ? 109 ASN B CB    1 
ATOM   3843  C CG    . ASN B 1 109 ? 159.857 -54.489  -6.110  1.00 102.79 ? 109 ASN B CG    1 
ATOM   3844  O OD1   . ASN B 1 109 ? 159.775 -53.876  -5.048  1.00 101.33 ? 109 ASN B OD1   1 
ATOM   3845  N ND2   . ASN B 1 109 ? 159.372 -55.714  -6.263  1.00 104.43 ? 109 ASN B ND2   1 
ATOM   3846  N N     . GLU B 1 110 ? 158.714 -51.633  -8.057  1.00 100.48 ? 110 GLU B N     1 
ATOM   3847  C CA    . GLU B 1 110 ? 157.400 -50.980  -8.051  1.00 99.24  ? 110 GLU B CA    1 
ATOM   3848  C C     . GLU B 1 110 ? 156.478 -51.561  -6.991  1.00 98.56  ? 110 GLU B C     1 
ATOM   3849  O O     . GLU B 1 110 ? 155.702 -50.841  -6.374  1.00 97.25  ? 110 GLU B O     1 
ATOM   3850  C CB    . GLU B 1 110 ? 156.725 -51.128  -9.413  1.00 100.00 ? 110 GLU B CB    1 
ATOM   3851  C CG    . GLU B 1 110 ? 157.300 -50.244  -10.503 1.00 101.49 ? 110 GLU B CG    1 
ATOM   3852  C CD    . GLU B 1 110 ? 156.332 -50.038  -11.660 1.00 104.01 ? 110 GLU B CD    1 
ATOM   3853  O OE1   . GLU B 1 110 ? 155.113 -50.305  -11.497 1.00 104.75 ? 110 GLU B OE1   1 
ATOM   3854  O OE2   . GLU B 1 110 ? 156.793 -49.597  -12.736 1.00 105.31 ? 110 GLU B OE2   1 
ATOM   3855  N N     . GLU B 1 111 ? 156.577 -52.871  -6.799  1.00 99.61  ? 111 GLU B N     1 
ATOM   3856  C CA    . GLU B 1 111 ? 155.765 -53.610  -5.846  1.00 99.65  ? 111 GLU B CA    1 
ATOM   3857  C C     . GLU B 1 111 ? 155.686 -52.957  -4.468  1.00 98.50  ? 111 GLU B C     1 
ATOM   3858  O O     . GLU B 1 111 ? 154.601 -52.842  -3.902  1.00 98.13  ? 111 GLU B O     1 
ATOM   3859  C CB    . GLU B 1 111 ? 156.277 -55.051  -5.742  1.00 101.53 ? 111 GLU B CB    1 
ATOM   3860  C CG    . GLU B 1 111 ? 155.783 -55.852  -4.538  1.00 102.45 ? 111 GLU B CG    1 
ATOM   3861  C CD    . GLU B 1 111 ? 154.289 -56.099  -4.554  1.00 102.44 ? 111 GLU B CD    1 
ATOM   3862  O OE1   . GLU B 1 111 ? 153.704 -56.213  -3.457  1.00 102.82 ? 111 GLU B OE1   1 
ATOM   3863  O OE2   . GLU B 1 111 ? 153.699 -56.174  -5.653  1.00 102.63 ? 111 GLU B OE2   1 
ATOM   3864  N N     . ASP B 1 112 ? 156.817 -52.524  -3.921  1.00 98.11  ? 112 ASP B N     1 
ATOM   3865  C CA    . ASP B 1 112 ? 156.774 -51.905  -2.599  1.00 97.22  ? 112 ASP B CA    1 
ATOM   3866  C C     . ASP B 1 112 ? 157.129 -50.424  -2.570  1.00 95.54  ? 112 ASP B C     1 
ATOM   3867  O O     . ASP B 1 112 ? 157.491 -49.883  -1.524  1.00 95.45  ? 112 ASP B O     1 
ATOM   3868  C CB    . ASP B 1 112 ? 157.530 -52.728  -1.533  1.00 98.68  ? 112 ASP B CB    1 
ATOM   3869  C CG    . ASP B 1 112 ? 159.024 -52.794  -1.774  1.00 99.76  ? 112 ASP B CG    1 
ATOM   3870  O OD1   . ASP B 1 112 ? 159.612 -53.823  -1.385  1.00 101.59 ? 112 ASP B OD1   1 
ATOM   3871  O OD2   . ASP B 1 112 ? 159.615 -51.836  -2.329  1.00 99.67  ? 112 ASP B OD2   1 
ATOM   3872  N N     . TYR B 1 113 ? 157.018 -49.766  -3.719  1.00 94.34  ? 113 TYR B N     1 
ATOM   3873  C CA    . TYR B 1 113 ? 156.852 -48.314  -3.731  1.00 92.47  ? 113 TYR B CA    1 
ATOM   3874  C C     . TYR B 1 113 ? 155.394 -48.035  -3.368  1.00 91.20  ? 113 TYR B C     1 
ATOM   3875  O O     . TYR B 1 113 ? 155.095 -47.224  -2.490  1.00 90.30  ? 113 TYR B O     1 
ATOM   3876  C CB    . TYR B 1 113 ? 157.196 -47.723  -5.101  1.00 92.37  ? 113 TYR B CB    1 
ATOM   3877  C CG    . TYR B 1 113 ? 156.642 -46.335  -5.333  1.00 91.28  ? 113 TYR B CG    1 
ATOM   3878  C CD1   . TYR B 1 113 ? 157.181 -45.228  -4.682  1.00 91.13  ? 113 TYR B CD1   1 
ATOM   3879  C CD2   . TYR B 1 113 ? 155.577 -46.128  -6.206  1.00 91.61  ? 113 TYR B CD2   1 
ATOM   3880  C CE1   . TYR B 1 113 ? 156.670 -43.944  -4.891  1.00 90.65  ? 113 TYR B CE1   1 
ATOM   3881  C CE2   . TYR B 1 113 ? 155.060 -44.852  -6.426  1.00 91.25  ? 113 TYR B CE2   1 
ATOM   3882  C CZ    . TYR B 1 113 ? 155.611 -43.763  -5.765  1.00 90.77  ? 113 TYR B CZ    1 
ATOM   3883  O OH    . TYR B 1 113 ? 155.097 -42.499  -5.976  1.00 90.60  ? 113 TYR B OH    1 
ATOM   3884  N N     . TYR B 1 114 ? 154.502 -48.754  -4.043  1.00 90.98  ? 114 TYR B N     1 
ATOM   3885  C CA    . TYR B 1 114 ? 153.076 -48.638  -3.845  1.00 89.88  ? 114 TYR B CA    1 
ATOM   3886  C C     . TYR B 1 114 ? 152.595 -49.162  -2.500  1.00 89.77  ? 114 TYR B C     1 
ATOM   3887  O O     . TYR B 1 114 ? 151.628 -48.646  -1.955  1.00 89.37  ? 114 TYR B O     1 
ATOM   3888  C CB    . TYR B 1 114 ? 152.343 -49.334  -4.982  1.00 90.61  ? 114 TYR B CB    1 
ATOM   3889  C CG    . TYR B 1 114 ? 152.374 -48.561  -6.281  1.00 90.52  ? 114 TYR B CG    1 
ATOM   3890  C CD1   . TYR B 1 114 ? 152.774 -49.168  -7.470  1.00 91.63  ? 114 TYR B CD1   1 
ATOM   3891  C CD2   . TYR B 1 114 ? 152.000 -47.219  -6.322  1.00 89.76  ? 114 TYR B CD2   1 
ATOM   3892  C CE1   . TYR B 1 114 ? 152.797 -48.454  -8.667  1.00 91.51  ? 114 TYR B CE1   1 
ATOM   3893  C CE2   . TYR B 1 114 ? 152.021 -46.499  -7.509  1.00 89.36  ? 114 TYR B CE2   1 
ATOM   3894  C CZ    . TYR B 1 114 ? 152.417 -47.118  -8.675  1.00 90.51  ? 114 TYR B CZ    1 
ATOM   3895  O OH    . TYR B 1 114 ? 152.426 -46.393  -9.844  1.00 90.89  ? 114 TYR B OH    1 
ATOM   3896  N N     . ASN B 1 115 ? 153.251 -50.183  -1.966  1.00 90.27  ? 115 ASN B N     1 
ATOM   3897  C CA    . ASN B 1 115 ? 152.955 -50.614  -0.603  1.00 90.44  ? 115 ASN B CA    1 
ATOM   3898  C C     . ASN B 1 115 ? 153.247 -49.516  0.411   1.00 88.97  ? 115 ASN B C     1 
ATOM   3899  O O     . ASN B 1 115 ? 152.478 -49.301  1.353   1.00 88.81  ? 115 ASN B O     1 
ATOM   3900  C CB    . ASN B 1 115 ? 153.719 -51.888  -0.248  1.00 92.25  ? 115 ASN B CB    1 
ATOM   3901  C CG    . ASN B 1 115 ? 152.968 -53.133  -0.651  1.00 94.61  ? 115 ASN B CG    1 
ATOM   3902  O OD1   . ASN B 1 115 ? 151.753 -53.228  -0.445  1.00 96.00  ? 115 ASN B OD1   1 
ATOM   3903  N ND2   . ASN B 1 115 ? 153.678 -54.097  -1.238  1.00 96.90  ? 115 ASN B ND2   1 
ATOM   3904  N N     . PHE B 1 116 ? 154.354 -48.812  0.198   1.00 87.65  ? 116 PHE B N     1 
ATOM   3905  C CA    . PHE B 1 116 ? 154.754 -47.732  1.080   1.00 86.14  ? 116 PHE B CA    1 
ATOM   3906  C C     . PHE B 1 116 ? 153.847 -46.524  0.915   1.00 84.40  ? 116 PHE B C     1 
ATOM   3907  O O     . PHE B 1 116 ? 153.348 -45.989  1.907   1.00 84.25  ? 116 PHE B O     1 
ATOM   3908  C CB    . PHE B 1 116 ? 156.204 -47.336  0.824   1.00 86.16  ? 116 PHE B CB    1 
ATOM   3909  C CG    . PHE B 1 116 ? 156.701 -46.255  1.734   1.00 85.03  ? 116 PHE B CG    1 
ATOM   3910  C CD1   . PHE B 1 116 ? 157.062 -46.543  3.049   1.00 85.79  ? 116 PHE B CD1   1 
ATOM   3911  C CD2   . PHE B 1 116 ? 156.806 -44.949  1.282   1.00 83.00  ? 116 PHE B CD2   1 
ATOM   3912  C CE1   . PHE B 1 116 ? 157.523 -45.540  3.899   1.00 85.04  ? 116 PHE B CE1   1 
ATOM   3913  C CE2   . PHE B 1 116 ? 157.265 -43.940  2.120   1.00 82.37  ? 116 PHE B CE2   1 
ATOM   3914  C CZ    . PHE B 1 116 ? 157.624 -44.234  3.431   1.00 83.37  ? 116 PHE B CZ    1 
ATOM   3915  N N     . LEU B 1 117 ? 153.640 -46.106  -0.336  1.00 82.97  ? 117 LEU B N     1 
ATOM   3916  C CA    . LEU B 1 117 ? 152.802 -44.948  -0.659  1.00 80.95  ? 117 LEU B CA    1 
ATOM   3917  C C     . LEU B 1 117 ? 151.379 -45.129  -0.170  1.00 80.54  ? 117 LEU B C     1 
ATOM   3918  O O     . LEU B 1 117 ? 150.763 -44.169  0.282   1.00 80.14  ? 117 LEU B O     1 
ATOM   3919  C CB    . LEU B 1 117 ? 152.793 -44.679  -2.163  1.00 80.69  ? 117 LEU B CB    1 
ATOM   3920  C CG    . LEU B 1 117 ? 152.146 -43.391  -2.680  1.00 79.05  ? 117 LEU B CG    1 
ATOM   3921  C CD1   . LEU B 1 117 ? 153.126 -42.234  -2.630  1.00 77.92  ? 117 LEU B CD1   1 
ATOM   3922  C CD2   . LEU B 1 117 ? 151.649 -43.591  -4.095  1.00 78.78  ? 117 LEU B CD2   1 
ATOM   3923  N N     . HIS B 1 118 ? 150.861 -46.352  -0.266  1.00 80.85  ? 118 HIS B N     1 
ATOM   3924  C CA    . HIS B 1 118 ? 149.544 -46.686  0.280   1.00 80.71  ? 118 HIS B CA    1 
ATOM   3925  C C     . HIS B 1 118 ? 149.501 -46.425  1.778   1.00 80.78  ? 118 HIS B C     1 
ATOM   3926  O O     . HIS B 1 118 ? 148.553 -45.831  2.288   1.00 80.47  ? 118 HIS B O     1 
ATOM   3927  C CB    . HIS B 1 118 ? 149.179 -48.140  -0.023  1.00 81.69  ? 118 HIS B CB    1 
ATOM   3928  C CG    . HIS B 1 118 ? 147.814 -48.534  0.445   1.00 81.86  ? 118 HIS B CG    1 
ATOM   3929  N ND1   . HIS B 1 118 ? 147.601 -49.244  1.606   1.00 83.41  ? 118 HIS B ND1   1 
ATOM   3930  C CD2   . HIS B 1 118 ? 146.590 -48.322  -0.094  1.00 81.47  ? 118 HIS B CD2   1 
ATOM   3931  C CE1   . HIS B 1 118 ? 146.305 -49.454  1.761   1.00 83.55  ? 118 HIS B CE1   1 
ATOM   3932  N NE2   . HIS B 1 118 ? 145.669 -48.903  0.743   1.00 81.91  ? 118 HIS B NE2   1 
ATOM   3933  N N     . GLU B 1 119 ? 150.547 -46.844  2.478   1.00 81.45  ? 119 GLU B N     1 
ATOM   3934  C CA    . GLU B 1 119 ? 150.589 -46.681  3.925   1.00 82.10  ? 119 GLU B CA    1 
ATOM   3935  C C     . GLU B 1 119 ? 150.935 -45.274  4.363   1.00 80.75  ? 119 GLU B C     1 
ATOM   3936  O O     . GLU B 1 119 ? 150.574 -44.854  5.463   1.00 80.98  ? 119 GLU B O     1 
ATOM   3937  C CB    . GLU B 1 119 ? 151.519 -47.703  4.557   1.00 83.55  ? 119 GLU B CB    1 
ATOM   3938  C CG    . GLU B 1 119 ? 150.921 -49.080  4.525   1.00 86.21  ? 119 GLU B CG    1 
ATOM   3939  C CD    . GLU B 1 119 ? 151.359 -49.916  5.689   1.00 90.71  ? 119 GLU B CD    1 
ATOM   3940  O OE1   . GLU B 1 119 ? 152.346 -49.529  6.365   1.00 91.91  ? 119 GLU B OE1   1 
ATOM   3941  O OE2   . GLU B 1 119 ? 150.714 -50.963  5.927   1.00 93.25  ? 119 GLU B OE2   1 
ATOM   3942  N N     . LEU B 1 120 ? 151.626 -44.543  3.499   1.00 79.47  ? 120 LEU B N     1 
ATOM   3943  C CA    . LEU B 1 120 ? 151.837 -43.134  3.734   1.00 78.44  ? 120 LEU B CA    1 
ATOM   3944  C C     . LEU B 1 120 ? 150.503 -42.420  3.649   1.00 77.55  ? 120 LEU B C     1 
ATOM   3945  O O     . LEU B 1 120 ? 150.133 -41.695  4.573   1.00 77.78  ? 120 LEU B O     1 
ATOM   3946  C CB    . LEU B 1 120 ? 152.806 -42.542  2.725   1.00 77.93  ? 120 LEU B CB    1 
ATOM   3947  C CG    . LEU B 1 120 ? 153.091 -41.063  2.991   1.00 77.79  ? 120 LEU B CG    1 
ATOM   3948  C CD1   . LEU B 1 120 ? 154.543 -40.795  2.750   1.00 79.34  ? 120 LEU B CD1   1 
ATOM   3949  C CD2   . LEU B 1 120 ? 152.227 -40.133  2.142   1.00 77.14  ? 120 LEU B CD2   1 
ATOM   3950  N N     . SER B 1 121 ? 149.789 -42.628  2.540   1.00 76.63  ? 121 SER B N     1 
ATOM   3951  C CA    . SER B 1 121 ? 148.478 -42.021  2.341   1.00 75.36  ? 121 SER B CA    1 
ATOM   3952  C C     . SER B 1 121 ? 147.570 -42.343  3.525   1.00 75.56  ? 121 SER B C     1 
ATOM   3953  O O     . SER B 1 121 ? 146.957 -41.443  4.094   1.00 75.16  ? 121 SER B O     1 
ATOM   3954  C CB    . SER B 1 121 ? 147.854 -42.465  1.013   1.00 75.21  ? 121 SER B CB    1 
ATOM   3955  O OG    . SER B 1 121 ? 147.293 -43.755  1.119   1.00 75.75  ? 121 SER B OG    1 
ATOM   3956  N N     . LEU B 1 122 ? 147.517 -43.616  3.916   1.00 76.11  ? 122 LEU B N     1 
ATOM   3957  C CA    . LEU B 1 122 ? 146.714 -44.021  5.072   1.00 76.74  ? 122 LEU B CA    1 
ATOM   3958  C C     . LEU B 1 122 ? 147.069 -43.215  6.311   1.00 76.58  ? 122 LEU B C     1 
ATOM   3959  O O     . LEU B 1 122 ? 146.186 -42.708  6.996   1.00 76.67  ? 122 LEU B O     1 
ATOM   3960  C CB    . LEU B 1 122 ? 146.840 -45.519  5.367   1.00 77.95  ? 122 LEU B CB    1 
ATOM   3961  C CG    . LEU B 1 122 ? 146.132 -46.538  4.470   1.00 78.28  ? 122 LEU B CG    1 
ATOM   3962  C CD1   . LEU B 1 122 ? 146.074 -47.871  5.185   1.00 80.46  ? 122 LEU B CD1   1 
ATOM   3963  C CD2   . LEU B 1 122 ? 144.725 -46.107  4.059   1.00 78.10  ? 122 LEU B CD2   1 
ATOM   3964  N N     . GLU B 1 123 ? 148.364 -43.085  6.578   1.00 76.40  ? 123 GLU B N     1 
ATOM   3965  C CA    . GLU B 1 123 ? 148.838 -42.360  7.756   1.00 76.48  ? 123 GLU B CA    1 
ATOM   3966  C C     . GLU B 1 123 ? 148.741 -40.843  7.627   1.00 75.02  ? 123 GLU B C     1 
ATOM   3967  O O     . GLU B 1 123 ? 148.560 -40.141  8.620   1.00 75.23  ? 123 GLU B O     1 
ATOM   3968  C CB    . GLU B 1 123 ? 150.264 -42.784  8.131   1.00 77.23  ? 123 GLU B CB    1 
ATOM   3969  C CG    . GLU B 1 123 ? 150.327 -43.740  9.324   1.00 79.14  ? 123 GLU B CG    1 
ATOM   3970  C CD    . GLU B 1 123 ? 149.858 -43.094  10.624  1.00 79.92  ? 123 GLU B CD    1 
ATOM   3971  O OE1   . GLU B 1 123 ? 150.039 -41.866  10.794  1.00 78.56  ? 123 GLU B OE1   1 
ATOM   3972  O OE2   . GLU B 1 123 ? 149.308 -43.816  11.480  1.00 82.20  ? 123 GLU B OE2   1 
ATOM   3973  N N     . TYR B 1 124 ? 148.863 -40.342  6.404   1.00 73.59  ? 124 TYR B N     1 
ATOM   3974  C CA    . TYR B 1 124 ? 148.807 -38.907  6.151   1.00 72.33  ? 124 TYR B CA    1 
ATOM   3975  C C     . TYR B 1 124 ? 147.383 -38.370  6.278   1.00 71.38  ? 124 TYR B C     1 
ATOM   3976  O O     . TYR B 1 124 ? 147.181 -37.243  6.689   1.00 70.83  ? 124 TYR B O     1 
ATOM   3977  C CB    . TYR B 1 124 ? 149.390 -38.582  4.775   1.00 71.79  ? 124 TYR B CB    1 
ATOM   3978  C CG    . TYR B 1 124 ? 149.307 -37.123  4.382   1.00 72.79  ? 124 TYR B CG    1 
ATOM   3979  C CD1   . TYR B 1 124 ? 150.032 -36.149  5.076   1.00 73.80  ? 124 TYR B CD1   1 
ATOM   3980  C CD2   . TYR B 1 124 ? 148.518 -36.717  3.295   1.00 73.91  ? 124 TYR B CD2   1 
ATOM   3981  C CE1   . TYR B 1 124 ? 149.967 -34.803  4.705   1.00 74.73  ? 124 TYR B CE1   1 
ATOM   3982  C CE2   . TYR B 1 124 ? 148.445 -35.369  2.913   1.00 74.43  ? 124 TYR B CE2   1 
ATOM   3983  C CZ    . TYR B 1 124 ? 149.174 -34.421  3.623   1.00 75.04  ? 124 TYR B CZ    1 
ATOM   3984  O OH    . TYR B 1 124 ? 149.109 -33.093  3.265   1.00 75.73  ? 124 TYR B OH    1 
ATOM   3985  N N     . THR B 1 125 ? 146.394 -39.177  5.919   1.00 71.11  ? 125 THR B N     1 
ATOM   3986  C CA    . THR B 1 125 ? 145.016 -38.755  6.114   1.00 70.61  ? 125 THR B CA    1 
ATOM   3987  C C     . THR B 1 125 ? 144.576 -39.009  7.563   1.00 71.63  ? 125 THR B C     1 
ATOM   3988  O O     . THR B 1 125 ? 143.817 -38.216  8.119   1.00 72.11  ? 125 THR B O     1 
ATOM   3989  C CB    . THR B 1 125 ? 144.009 -39.349  5.066   1.00 70.48  ? 125 THR B CB    1 
ATOM   3990  O OG1   . THR B 1 125 ? 143.673 -40.696  5.400   1.00 71.17  ? 125 THR B OG1   1 
ATOM   3991  C CG2   . THR B 1 125 ? 144.573 -39.291  3.666   1.00 68.77  ? 125 THR B CG2   1 
ATOM   3992  N N     . ARG B 1 126 ? 145.070 -40.091  8.174   1.00 72.06  ? 126 ARG B N     1 
ATOM   3993  C CA    . ARG B 1 126 ? 144.835 -40.368  9.596   1.00 72.64  ? 126 ARG B CA    1 
ATOM   3994  C C     . ARG B 1 126 ? 145.249 -39.185  10.465  1.00 72.21  ? 126 ARG B C     1 
ATOM   3995  O O     . ARG B 1 126 ? 144.612 -38.890  11.478  1.00 73.07  ? 126 ARG B O     1 
ATOM   3996  C CB    . ARG B 1 126 ? 145.602 -41.608  10.038  1.00 73.68  ? 126 ARG B CB    1 
ATOM   3997  C CG    . ARG B 1 126 ? 144.753 -42.825  10.289  1.00 75.54  ? 126 ARG B CG    1 
ATOM   3998  C CD    . ARG B 1 126 ? 145.585 -43.946  10.926  1.00 78.69  ? 126 ARG B CD    1 
ATOM   3999  N NE    . ARG B 1 126 ? 146.177 -44.839  9.922   1.00 79.41  ? 126 ARG B NE    1 
ATOM   4000  C CZ    . ARG B 1 126 ? 145.713 -46.054  9.627   1.00 80.83  ? 126 ARG B CZ    1 
ATOM   4001  N NH1   . ARG B 1 126 ? 144.655 -46.546  10.263  1.00 82.76  ? 126 ARG B NH1   1 
ATOM   4002  N NH2   . ARG B 1 126 ? 146.303 -46.781  8.690   1.00 80.80  ? 126 ARG B NH2   1 
ATOM   4003  N N     . ARG B 1 127 ? 146.317 -38.510  10.057  1.00 70.80  ? 127 ARG B N     1 
ATOM   4004  C CA    . ARG B 1 127 ? 146.838 -37.383  10.808  1.00 70.61  ? 127 ARG B CA    1 
ATOM   4005  C C     . ARG B 1 127 ? 145.953 -36.168  10.603  1.00 69.05  ? 127 ARG B C     1 
ATOM   4006  O O     . ARG B 1 127 ? 145.623 -35.487  11.566  1.00 69.99  ? 127 ARG B O     1 
ATOM   4007  C CB    . ARG B 1 127 ? 148.288 -37.086  10.409  1.00 70.57  ? 127 ARG B CB    1 
ATOM   4008  C CG    . ARG B 1 127 ? 149.112 -36.283  11.443  1.00 73.36  ? 127 ARG B CG    1 
ATOM   4009  C CD    . ARG B 1 127 ? 149.645 -37.128  12.609  1.00 78.42  ? 127 ARG B CD    1 
ATOM   4010  N NE    . ARG B 1 127 ? 150.353 -38.347  12.180  1.00 81.94  ? 127 ARG B NE    1 
ATOM   4011  C CZ    . ARG B 1 127 ? 151.680 -38.476  12.083  1.00 83.17  ? 127 ARG B CZ    1 
ATOM   4012  N NH1   . ARG B 1 127 ? 152.476 -37.450  12.370  1.00 83.98  ? 127 ARG B NH1   1 
ATOM   4013  N NH2   . ARG B 1 127 ? 152.213 -39.633  11.692  1.00 83.28  ? 127 ARG B NH2   1 
ATOM   4014  N N     . LYS B 1 128 ? 145.559 -35.908  9.357   1.00 66.95  ? 128 LYS B N     1 
ATOM   4015  C CA    . LYS B 1 128 ? 144.662 -34.786  9.041   1.00 65.47  ? 128 LYS B CA    1 
ATOM   4016  C C     . LYS B 1 128 ? 143.303 -34.944  9.704   1.00 65.42  ? 128 LYS B C     1 
ATOM   4017  O O     . LYS B 1 128 ? 142.822 -34.015  10.326  1.00 65.67  ? 128 LYS B O     1 
ATOM   4018  C CB    . LYS B 1 128 ? 144.505 -34.583  7.531   1.00 64.50  ? 128 LYS B CB    1 
ATOM   4019  C CG    . LYS B 1 128 ? 145.838 -34.471  6.784   1.00 64.96  ? 128 LYS B CG    1 
ATOM   4020  C CD    . LYS B 1 128 ? 145.806 -33.447  5.665   1.00 65.88  ? 128 LYS B CD    1 
ATOM   4021  C CE    . LYS B 1 128 ? 146.211 -32.080  6.191   1.00 67.56  ? 128 LYS B CE    1 
ATOM   4022  N NZ    . LYS B 1 128 ? 145.690 -30.965  5.340   1.00 68.84  ? 128 LYS B NZ    1 
ATOM   4023  N N     . LEU B 1 129 ? 142.703 -36.125  9.579   1.00 65.10  ? 129 LEU B N     1 
ATOM   4024  C CA    . LEU B 1 129 ? 141.469 -36.472  10.287  1.00 65.55  ? 129 LEU B CA    1 
ATOM   4025  C C     . LEU B 1 129 ? 141.469 -36.085  11.773  1.00 66.45  ? 129 LEU B C     1 
ATOM   4026  O O     . LEU B 1 129 ? 140.416 -35.797  12.354  1.00 67.03  ? 129 LEU B O     1 
ATOM   4027  C CB    . LEU B 1 129 ? 141.210 -37.977  10.182  1.00 66.33  ? 129 LEU B CB    1 
ATOM   4028  C CG    . LEU B 1 129 ? 140.211 -38.616  9.214   1.00 66.13  ? 129 LEU B CG    1 
ATOM   4029  C CD1   . LEU B 1 129 ? 138.972 -37.754  8.979   1.00 66.65  ? 129 LEU B CD1   1 
ATOM   4030  C CD2   . LEU B 1 129 ? 140.889 -38.950  7.918   1.00 66.05  ? 129 LEU B CD2   1 
ATOM   4031  N N     . ARG B 1 130 ? 142.655 -36.095  12.379  1.00 66.39  ? 130 ARG B N     1 
ATOM   4032  C CA    . ARG B 1 130 ? 142.797 -35.867  13.809  1.00 67.36  ? 130 ARG B CA    1 
ATOM   4033  C C     . ARG B 1 130 ? 142.723 -34.394  14.151  1.00 66.45  ? 130 ARG B C     1 
ATOM   4034  O O     . ARG B 1 130 ? 141.950 -34.018  15.027  1.00 67.80  ? 130 ARG B O     1 
ATOM   4035  C CB    . ARG B 1 130 ? 144.087 -36.479  14.348  1.00 68.15  ? 130 ARG B CB    1 
ATOM   4036  C CG    . ARG B 1 130 ? 143.951 -36.968  15.767  1.00 71.43  ? 130 ARG B CG    1 
ATOM   4037  C CD    . ARG B 1 130 ? 145.271 -36.893  16.509  1.00 75.11  ? 130 ARG B CD    1 
ATOM   4038  N NE    . ARG B 1 130 ? 145.060 -36.950  17.954  1.00 79.85  ? 130 ARG B NE    1 
ATOM   4039  C CZ    . ARG B 1 130 ? 144.747 -35.904  18.723  1.00 81.54  ? 130 ARG B CZ    1 
ATOM   4040  N NH1   . ARG B 1 130 ? 144.611 -34.689  18.190  1.00 80.33  ? 130 ARG B NH1   1 
ATOM   4041  N NH2   . ARG B 1 130 ? 144.568 -36.074  20.032  1.00 83.78  ? 130 ARG B NH2   1 
ATOM   4042  N N     . SER B 1 131 ? 143.505 -33.556  13.465  1.00 64.26  ? 131 SER B N     1 
ATOM   4043  C CA    . SER B 1 131 ? 143.455 -32.099  13.712  1.00 63.38  ? 131 SER B CA    1 
ATOM   4044  C C     . SER B 1 131 ? 142.129 -31.461  13.317  1.00 62.98  ? 131 SER B C     1 
ATOM   4045  O O     . SER B 1 131 ? 141.777 -30.402  13.823  1.00 63.59  ? 131 SER B O     1 
ATOM   4046  C CB    . SER B 1 131 ? 144.632 -31.345  13.090  1.00 61.72  ? 131 SER B CB    1 
ATOM   4047  O OG    . SER B 1 131 ? 145.309 -32.148  12.163  1.00 60.10  ? 131 SER B OG    1 
ATOM   4048  N N     . ALA B 1 132 ? 141.404 -32.118  12.418  1.00 62.33  ? 132 ALA B N     1 
ATOM   4049  C CA    . ALA B 1 132 ? 140.041 -31.748  12.088  1.00 62.07  ? 132 ALA B CA    1 
ATOM   4050  C C     . ALA B 1 132 ? 139.169 -31.955  13.323  1.00 63.84  ? 132 ALA B C     1 
ATOM   4051  O O     . ALA B 1 132 ? 138.402 -31.069  13.704  1.00 64.27  ? 132 ALA B O     1 
ATOM   4052  C CB    . ALA B 1 132 ? 139.536 -32.584  10.911  1.00 60.91  ? 132 ALA B CB    1 
ATOM   4053  N N     . ALA B 1 133 ? 139.327 -33.120  13.954  1.00 61.87  ? 133 ALA B N     1 
ATOM   4054  C CA    . ALA B 1 133 ? 138.527 -33.541  15.105  1.00 61.83  ? 133 ALA B CA    1 
ATOM   4055  C C     . ALA B 1 133 ? 138.859 -32.732  16.332  1.00 61.70  ? 133 ALA B C     1 
ATOM   4056  O O     . ALA B 1 133 ? 138.058 -32.641  17.262  1.00 61.41  ? 133 ALA B O     1 
ATOM   4057  C CB    . ALA B 1 133 ? 138.755 -35.014  15.392  1.00 62.83  ? 133 ALA B CB    1 
ATOM   4058  N N     . GLN B 1 134 ? 140.050 -32.145  16.321  1.00 62.23  ? 134 GLN B N     1 
ATOM   4059  C CA    . GLN B 1 134 ? 140.608 -31.461  17.475  1.00 62.38  ? 134 GLN B CA    1 
ATOM   4060  C C     . GLN B 1 134 ? 140.196 -29.985  17.552  1.00 61.30  ? 134 GLN B C     1 
ATOM   4061  O O     . GLN B 1 134 ? 140.497 -29.311  18.522  1.00 61.63  ? 134 GLN B O     1 
ATOM   4062  C CB    . GLN B 1 134 ? 142.131 -31.626  17.463  1.00 63.38  ? 134 GLN B CB    1 
ATOM   4063  C CG    . GLN B 1 134 ? 142.836 -31.246  18.762  1.00 66.01  ? 134 GLN B CG    1 
ATOM   4064  C CD    . GLN B 1 134 ? 142.464 -32.139  19.941  1.00 68.39  ? 134 GLN B CD    1 
ATOM   4065  O OE1   . GLN B 1 134 ? 142.035 -31.652  20.992  1.00 68.28  ? 134 GLN B OE1   1 
ATOM   4066  N NE2   . GLN B 1 134 ? 142.636 -33.449  19.774  1.00 70.26  ? 134 GLN B NE2   1 
ATOM   4067  N N     . LYS B 1 135 ? 139.500 -29.487  16.538  1.00 60.68  ? 135 LYS B N     1 
ATOM   4068  C CA    . LYS B 1 135 ? 138.947 -28.136  16.567  1.00 59.91  ? 135 LYS B CA    1 
ATOM   4069  C C     . LYS B 1 135 ? 137.881 -28.003  17.645  1.00 59.57  ? 135 LYS B C     1 
ATOM   4070  O O     . LYS B 1 135 ? 137.006 -28.856  17.776  1.00 59.51  ? 135 LYS B O     1 
ATOM   4071  C CB    . LYS B 1 135 ? 138.364 -27.769  15.206  1.00 59.68  ? 135 LYS B CB    1 
ATOM   4072  C CG    . LYS B 1 135 ? 139.405 -27.538  14.120  1.00 60.75  ? 135 LYS B CG    1 
ATOM   4073  C CD    . LYS B 1 135 ? 139.918 -26.105  14.110  1.00 62.66  ? 135 LYS B CD    1 
ATOM   4074  C CE    . LYS B 1 135 ? 140.821 -25.856  12.903  1.00 65.06  ? 135 LYS B CE    1 
ATOM   4075  N NZ    . LYS B 1 135 ? 140.971 -24.395  12.570  1.00 66.27  ? 135 LYS B NZ    1 
ATOM   4076  N N     . ARG B 1 136 ? 137.965 -26.923  18.413  1.00 59.69  ? 136 ARG B N     1 
ATOM   4077  C CA    . ARG B 1 136 ? 137.105 -26.717  19.597  1.00 59.78  ? 136 ARG B CA    1 
ATOM   4078  C C     . ARG B 1 136 ? 135.677 -26.299  19.270  1.00 58.04  ? 136 ARG B C     1 
ATOM   4079  O O     . ARG B 1 136 ? 134.769 -26.577  20.050  1.00 58.00  ? 136 ARG B O     1 
ATOM   4080  C CB    . ARG B 1 136 ? 137.740 -25.754  20.638  1.00 60.67  ? 136 ARG B CB    1 
ATOM   4081  C CG    . ARG B 1 136 ? 138.961 -24.887  20.160  1.00 64.61  ? 136 ARG B CG    1 
ATOM   4082  C CD    . ARG B 1 136 ? 138.769 -24.143  18.779  1.00 68.50  ? 136 ARG B CD    1 
ATOM   4083  N NE    . ARG B 1 136 ? 140.002 -23.502  18.294  1.00 71.07  ? 136 ARG B NE    1 
ATOM   4084  C CZ    . ARG B 1 136 ? 141.026 -24.140  17.716  1.00 71.91  ? 136 ARG B CZ    1 
ATOM   4085  N NH1   . ARG B 1 136 ? 140.991 -25.455  17.543  1.00 71.70  ? 136 ARG B NH1   1 
ATOM   4086  N NH2   . ARG B 1 136 ? 142.099 -23.458  17.319  1.00 72.32  ? 136 ARG B NH2   1 
ATOM   4087  N N     . ASP B 1 137 ? 135.475 -25.657  18.122  1.00 56.73  ? 137 ASP B N     1 
ATOM   4088  C CA    . ASP B 1 137 ? 134.124 -25.244  17.705  1.00 55.24  ? 137 ASP B CA    1 
ATOM   4089  C C     . ASP B 1 137 ? 133.142 -26.401  17.454  1.00 54.50  ? 137 ASP B C     1 
ATOM   4090  O O     . ASP B 1 137 ? 131.940 -26.208  17.537  1.00 54.32  ? 137 ASP B O     1 
ATOM   4091  C CB    . ASP B 1 137 ? 134.148 -24.260  16.511  1.00 54.74  ? 137 ASP B CB    1 
ATOM   4092  C CG    . ASP B 1 137 ? 134.728 -24.863  15.227  1.00 54.73  ? 137 ASP B CG    1 
ATOM   4093  O OD1   . ASP B 1 137 ? 134.957 -24.090  14.274  1.00 54.95  ? 137 ASP B OD1   1 
ATOM   4094  O OD2   . ASP B 1 137 ? 134.964 -26.085  15.142  1.00 54.80  ? 137 ASP B OD2   1 
ATOM   4095  N N     . LEU B 1 138 ? 133.649 -27.592  17.154  1.00 54.10  ? 138 LEU B N     1 
ATOM   4096  C CA    . LEU B 1 138 ? 132.784 -28.740  16.870  1.00 53.50  ? 138 LEU B CA    1 
ATOM   4097  C C     . LEU B 1 138 ? 131.904 -29.111  18.052  1.00 53.18  ? 138 LEU B C     1 
ATOM   4098  O O     . LEU B 1 138 ? 130.733 -29.461  17.875  1.00 53.40  ? 138 LEU B O     1 
ATOM   4099  C CB    . LEU B 1 138 ? 133.607 -29.953  16.446  1.00 53.98  ? 138 LEU B CB    1 
ATOM   4100  C CG    . LEU B 1 138 ? 134.344 -29.804  15.117  1.00 53.51  ? 138 LEU B CG    1 
ATOM   4101  C CD1   . LEU B 1 138 ? 135.240 -31.006  14.899  1.00 53.79  ? 138 LEU B CD1   1 
ATOM   4102  C CD2   . LEU B 1 138 ? 133.366 -29.612  13.960  1.00 51.78  ? 138 LEU B CD2   1 
ATOM   4103  N N     . LEU B 1 139 ? 132.474 -29.026  19.252  1.00 52.72  ? 139 LEU B N     1 
ATOM   4104  C CA    . LEU B 1 139 ? 131.766 -29.344  20.492  1.00 51.96  ? 139 LEU B CA    1 
ATOM   4105  C C     . LEU B 1 139 ? 130.701 -28.307  20.806  1.00 50.59  ? 139 LEU B C     1 
ATOM   4106  O O     . LEU B 1 139 ? 129.633 -28.637  21.288  1.00 50.32  ? 139 LEU B O     1 
ATOM   4107  C CB    . LEU B 1 139 ? 132.753 -29.447  21.657  1.00 52.86  ? 139 LEU B CB    1 
ATOM   4108  C CG    . LEU B 1 139 ? 133.815 -30.548  21.552  1.00 54.23  ? 139 LEU B CG    1 
ATOM   4109  C CD1   . LEU B 1 139 ? 135.055 -30.141  22.326  1.00 55.07  ? 139 LEU B CD1   1 
ATOM   4110  C CD2   . LEU B 1 139 ? 133.274 -31.907  22.015  1.00 54.20  ? 139 LEU B CD2   1 
ATOM   4111  N N     . ALA B 1 140 ? 131.007 -27.044  20.542  1.00 49.61  ? 140 ALA B N     1 
ATOM   4112  C CA    . ALA B 1 140 ? 130.020 -25.974  20.626  1.00 48.39  ? 140 ALA B CA    1 
ATOM   4113  C C     . ALA B 1 140 ? 128.806 -26.298  19.747  1.00 47.52  ? 140 ALA B C     1 
ATOM   4114  O O     . ALA B 1 140 ? 127.666 -26.182  20.196  1.00 47.29  ? 140 ALA B O     1 
ATOM   4115  C CB    . ALA B 1 140 ? 130.650 -24.657  20.195  1.00 48.40  ? 140 ALA B CB    1 
ATOM   4116  N N     . ILE B 1 141 ? 129.066 -26.726  18.511  1.00 46.67  ? 141 ILE B N     1 
ATOM   4117  C CA    . ILE B 1 141 ? 128.020 -27.096  17.573  1.00 46.04  ? 141 ILE B CA    1 
ATOM   4118  C C     . ILE B 1 141 ? 127.185 -28.290  18.071  1.00 46.46  ? 141 ILE B C     1 
ATOM   4119  O O     . ILE B 1 141 ? 125.935 -28.218  18.085  1.00 46.35  ? 141 ILE B O     1 
ATOM   4120  C CB    . ILE B 1 141 ? 128.585 -27.362  16.161  1.00 46.01  ? 141 ILE B CB    1 
ATOM   4121  C CG1   . ILE B 1 141 ? 129.023 -26.049  15.511  1.00 45.12  ? 141 ILE B CG1   1 
ATOM   4122  C CG2   . ILE B 1 141 ? 127.537 -28.033  15.280  1.00 45.76  ? 141 ILE B CG2   1 
ATOM   4123  C CD1   . ILE B 1 141 ? 130.024 -26.202  14.388  1.00 44.07  ? 141 ILE B CD1   1 
ATOM   4124  N N     . GLN B 1 142 ? 127.860 -29.372  18.485  1.00 46.54  ? 142 GLN B N     1 
ATOM   4125  C CA    . GLN B 1 142 ? 127.159 -30.585  18.922  1.00 46.34  ? 142 GLN B CA    1 
ATOM   4126  C C     . GLN B 1 142 ? 126.258 -30.286  20.105  1.00 46.35  ? 142 GLN B C     1 
ATOM   4127  O O     . GLN B 1 142 ? 125.118 -30.750  20.181  1.00 46.10  ? 142 GLN B O     1 
ATOM   4128  C CB    . GLN B 1 142 ? 128.135 -31.697  19.287  1.00 46.55  ? 142 GLN B CB    1 
ATOM   4129  C CG    . GLN B 1 142 ? 128.975 -32.244  18.136  1.00 46.61  ? 142 GLN B CG    1 
ATOM   4130  C CD    . GLN B 1 142 ? 128.172 -32.805  16.975  1.00 46.21  ? 142 GLN B CD    1 
ATOM   4131  O OE1   . GLN B 1 142 ? 128.508 -32.544  15.832  1.00 46.99  ? 142 GLN B OE1   1 
ATOM   4132  N NE2   . GLN B 1 142 ? 127.121 -33.574  17.257  1.00 45.01  ? 142 GLN B NE2   1 
ATOM   4133  N N     . ALA B 1 143 ? 126.780 -29.475  21.012  1.00 46.78  ? 143 ALA B N     1 
ATOM   4134  C CA    . ALA B 1 143 ? 126.122 -29.200  22.257  1.00 47.27  ? 143 ALA B CA    1 
ATOM   4135  C C     . ALA B 1 143 ? 124.800 -28.510  21.988  1.00 47.58  ? 143 ALA B C     1 
ATOM   4136  O O     . ALA B 1 143 ? 123.752 -28.936  22.508  1.00 47.82  ? 143 ALA B O     1 
ATOM   4137  C CB    . ALA B 1 143 ? 127.010 -28.358  23.132  1.00 47.34  ? 143 ALA B CB    1 
ATOM   4138  N N     . VAL B 1 144 ? 124.840 -27.461  21.162  1.00 48.02  ? 144 VAL B N     1 
ATOM   4139  C CA    . VAL B 1 144 ? 123.627 -26.678  20.860  1.00 48.00  ? 144 VAL B CA    1 
ATOM   4140  C C     . VAL B 1 144 ? 122.623 -27.532  20.095  1.00 48.60  ? 144 VAL B C     1 
ATOM   4141  O O     . VAL B 1 144 ? 121.409 -27.356  20.242  1.00 48.32  ? 144 VAL B O     1 
ATOM   4142  C CB    . VAL B 1 144 ? 123.926 -25.356  20.101  1.00 47.49  ? 144 VAL B CB    1 
ATOM   4143  C CG1   . VAL B 1 144 ? 124.458 -25.628  18.709  1.00 47.08  ? 144 VAL B CG1   1 
ATOM   4144  C CG2   . VAL B 1 144 ? 122.689 -24.491  20.030  1.00 46.17  ? 144 VAL B CG2   1 
ATOM   4145  N N     . ARG B 1 145 ? 123.140 -28.466  19.299  1.00 49.58  ? 145 ARG B N     1 
ATOM   4146  C CA    . ARG B 1 145 ? 122.284 -29.356  18.524  1.00 50.96  ? 145 ARG B CA    1 
ATOM   4147  C C     . ARG B 1 145 ? 121.500 -30.299  19.430  1.00 51.60  ? 145 ARG B C     1 
ATOM   4148  O O     . ARG B 1 145 ? 120.302 -30.535  19.208  1.00 51.68  ? 145 ARG B O     1 
ATOM   4149  C CB    . ARG B 1 145 ? 123.097 -30.130  17.490  1.00 51.49  ? 145 ARG B CB    1 
ATOM   4150  C CG    . ARG B 1 145 ? 123.392 -29.325  16.246  1.00 51.64  ? 145 ARG B CG    1 
ATOM   4151  C CD    . ARG B 1 145 ? 124.253 -30.112  15.302  1.00 52.37  ? 145 ARG B CD    1 
ATOM   4152  N NE    . ARG B 1 145 ? 124.649 -29.306  14.153  1.00 51.94  ? 145 ARG B NE    1 
ATOM   4153  C CZ    . ARG B 1 145 ? 125.410 -29.741  13.155  1.00 51.75  ? 145 ARG B CZ    1 
ATOM   4154  N NH1   . ARG B 1 145 ? 125.871 -30.986  13.143  1.00 51.04  ? 145 ARG B NH1   1 
ATOM   4155  N NH2   . ARG B 1 145 ? 125.705 -28.923  12.159  1.00 52.56  ? 145 ARG B NH2   1 
ATOM   4156  N N     . ALA B 1 146 ? 122.184 -30.816  20.453  1.00 52.40  ? 146 ALA B N     1 
ATOM   4157  C CA    . ALA B 1 146 ? 121.556 -31.607  21.514  1.00 52.89  ? 146 ALA B CA    1 
ATOM   4158  C C     . ALA B 1 146 ? 120.601 -30.747  22.345  1.00 52.72  ? 146 ALA B C     1 
ATOM   4159  O O     . ALA B 1 146 ? 119.499 -31.171  22.657  1.00 52.34  ? 146 ALA B O     1 
ATOM   4160  C CB    . ALA B 1 146 ? 122.620 -32.254  22.397  1.00 53.09  ? 146 ALA B CB    1 
ATOM   4161  N N     . MET B 1 147 ? 121.017 -29.528  22.676  1.00 53.33  ? 147 MET B N     1 
ATOM   4162  C CA    . MET B 1 147 ? 120.134 -28.586  23.366  1.00 54.22  ? 147 MET B CA    1 
ATOM   4163  C C     . MET B 1 147 ? 118.829 -28.389  22.629  1.00 54.58  ? 147 MET B C     1 
ATOM   4164  O O     . MET B 1 147 ? 117.759 -28.348  23.243  1.00 54.71  ? 147 MET B O     1 
ATOM   4165  C CB    . MET B 1 147 ? 120.802 -27.236  23.535  1.00 54.24  ? 147 MET B CB    1 
ATOM   4166  C CG    . MET B 1 147 ? 121.140 -26.928  24.954  1.00 56.08  ? 147 MET B CG    1 
ATOM   4167  S SD    . MET B 1 147 ? 121.440 -25.183  25.163  1.00 58.85  ? 147 MET B SD    1 
ATOM   4168  C CE    . MET B 1 147 ? 119.757 -24.616  25.430  1.00 59.65  ? 147 MET B CE    1 
ATOM   4169  N N     . ASP B 1 148 ? 118.931 -28.263  21.307  1.00 54.97  ? 148 ASP B N     1 
ATOM   4170  C CA    . ASP B 1 148 ? 117.777 -28.071  20.476  1.00 55.14  ? 148 ASP B CA    1 
ATOM   4171  C C     . ASP B 1 148 ? 116.906 -29.322  20.458  1.00 55.51  ? 148 ASP B C     1 
ATOM   4172  O O     . ASP B 1 148 ? 115.681 -29.224  20.495  1.00 55.65  ? 148 ASP B O     1 
ATOM   4173  C CB    . ASP B 1 148 ? 118.219 -27.608  19.099  1.00 55.35  ? 148 ASP B CB    1 
ATOM   4174  C CG    . ASP B 1 148 ? 118.537 -26.111  19.075  1.00 56.58  ? 148 ASP B CG    1 
ATOM   4175  O OD1   . ASP B 1 148 ? 118.683 -25.527  20.174  1.00 57.56  ? 148 ASP B OD1   1 
ATOM   4176  O OD2   . ASP B 1 148 ? 118.615 -25.507  17.971  1.00 57.82  ? 148 ASP B OD2   1 
ATOM   4177  N N     . ASP B 1 149 ? 117.538 -30.493  20.467  1.00 56.00  ? 149 ASP B N     1 
ATOM   4178  C CA    . ASP B 1 149 ? 116.815 -31.765  20.614  1.00 56.59  ? 149 ASP B CA    1 
ATOM   4179  C C     . ASP B 1 149 ? 116.063 -31.839  21.953  1.00 56.05  ? 149 ASP B C     1 
ATOM   4180  O O     . ASP B 1 149 ? 114.922 -32.305  22.021  1.00 55.94  ? 149 ASP B O     1 
ATOM   4181  C CB    . ASP B 1 149 ? 117.783 -32.949  20.508  1.00 57.37  ? 149 ASP B CB    1 
ATOM   4182  C CG    . ASP B 1 149 ? 118.490 -33.024  19.155  1.00 59.92  ? 149 ASP B CG    1 
ATOM   4183  O OD1   . ASP B 1 149 ? 118.003 -32.406  18.166  1.00 62.12  ? 149 ASP B OD1   1 
ATOM   4184  O OD2   . ASP B 1 149 ? 119.542 -33.713  19.081  1.00 61.71  ? 149 ASP B OD2   1 
ATOM   4185  N N     . ILE B 1 150 ? 116.716 -31.376  23.015  1.00 55.36  ? 150 ILE B N     1 
ATOM   4186  C CA    . ILE B 1 150 ? 116.126 -31.420  24.331  1.00 54.96  ? 150 ILE B CA    1 
ATOM   4187  C C     . ILE B 1 150 ? 114.947 -30.471  24.403  1.00 54.42  ? 150 ILE B C     1 
ATOM   4188  O O     . ILE B 1 150 ? 113.866 -30.867  24.848  1.00 54.87  ? 150 ILE B O     1 
ATOM   4189  C CB    . ILE B 1 150 ? 117.143 -31.114  25.420  1.00 55.02  ? 150 ILE B CB    1 
ATOM   4190  C CG1   . ILE B 1 150 ? 118.140 -32.275  25.509  1.00 56.17  ? 150 ILE B CG1   1 
ATOM   4191  C CG2   . ILE B 1 150 ? 116.433 -30.968  26.742  1.00 55.46  ? 150 ILE B CG2   1 
ATOM   4192  C CD1   . ILE B 1 150 ? 119.301 -32.047  26.441  1.00 57.83  ? 150 ILE B CD1   1 
ATOM   4193  N N     . ASP B 1 151 ? 115.148 -29.235  23.941  1.00 53.49  ? 151 ASP B N     1 
ATOM   4194  C CA    . ASP B 1 151 ? 114.056 -28.263  23.818  1.00 52.40  ? 151 ASP B CA    1 
ATOM   4195  C C     . ASP B 1 151 ? 112.854 -28.934  23.162  1.00 51.27  ? 151 ASP B C     1 
ATOM   4196  O O     . ASP B 1 151 ? 111.770 -28.972  23.740  1.00 51.33  ? 151 ASP B O     1 
ATOM   4197  C CB    . ASP B 1 151 ? 114.489 -27.046  22.989  1.00 52.65  ? 151 ASP B CB    1 
ATOM   4198  C CG    . ASP B 1 151 ? 115.403 -26.086  23.757  1.00 53.58  ? 151 ASP B CG    1 
ATOM   4199  O OD1   . ASP B 1 151 ? 115.382 -26.040  25.007  1.00 52.42  ? 151 ASP B OD1   1 
ATOM   4200  O OD2   . ASP B 1 151 ? 116.144 -25.342  23.084  1.00 56.80  ? 151 ASP B OD2   1 
ATOM   4201  N N     . LYS B 1 152 ? 113.082 -29.498  21.979  1.00 49.74  ? 152 LYS B N     1 
ATOM   4202  C CA    . LYS B 1 152 ? 112.045 -30.131  21.192  1.00 48.88  ? 152 LYS B CA    1 
ATOM   4203  C C     . LYS B 1 152 ? 111.310 -31.200  21.980  1.00 49.00  ? 152 LYS B C     1 
ATOM   4204  O O     . LYS B 1 152 ? 110.080 -31.315  21.900  1.00 49.26  ? 152 LYS B O     1 
ATOM   4205  C CB    . LYS B 1 152 ? 112.650 -30.736  19.931  1.00 48.72  ? 152 LYS B CB    1 
ATOM   4206  C CG    . LYS B 1 152 ? 111.637 -31.139  18.900  1.00 47.60  ? 152 LYS B CG    1 
ATOM   4207  C CD    . LYS B 1 152 ? 112.308 -31.475  17.595  1.00 47.73  ? 152 LYS B CD    1 
ATOM   4208  C CE    . LYS B 1 152 ? 111.270 -31.643  16.501  1.00 49.31  ? 152 LYS B CE    1 
ATOM   4209  N NZ    . LYS B 1 152 ? 111.840 -31.869  15.149  1.00 49.63  ? 152 LYS B NZ    1 
ATOM   4210  N N     . THR B 1 153 ? 112.073 -31.979  22.743  1.00 48.88  ? 153 THR B N     1 
ATOM   4211  C CA    . THR B 1 153 ? 111.544 -33.134  23.472  1.00 48.57  ? 153 THR B CA    1 
ATOM   4212  C C     . THR B 1 153 ? 110.755 -32.696  24.686  1.00 47.75  ? 153 THR B C     1 
ATOM   4213  O O     . THR B 1 153 ? 109.681 -33.237  24.942  1.00 47.79  ? 153 THR B O     1 
ATOM   4214  C CB    . THR B 1 153 ? 112.670 -34.070  23.920  1.00 49.11  ? 153 THR B CB    1 
ATOM   4215  O OG1   . THR B 1 153 ? 113.428 -34.468  22.777  1.00 49.64  ? 153 THR B OG1   1 
ATOM   4216  C CG2   . THR B 1 153 ? 112.102 -35.302  24.623  1.00 49.64  ? 153 THR B CG2   1 
ATOM   4217  N N     . ILE B 1 154 ? 111.292 -31.728  25.432  1.00 46.66  ? 154 ILE B N     1 
ATOM   4218  C CA    . ILE B 1 154 ? 110.589 -31.179  26.580  1.00 46.14  ? 154 ILE B CA    1 
ATOM   4219  C C     . ILE B 1 154 ? 109.178 -30.851  26.116  1.00 46.53  ? 154 ILE B C     1 
ATOM   4220  O O     . ILE B 1 154 ? 108.195 -31.353  26.680  1.00 46.68  ? 154 ILE B O     1 
ATOM   4221  C CB    . ILE B 1 154 ? 111.288 -29.933  27.160  1.00 45.53  ? 154 ILE B CB    1 
ATOM   4222  C CG1   . ILE B 1 154 ? 112.440 -30.348  28.065  1.00 44.94  ? 154 ILE B CG1   1 
ATOM   4223  C CG2   . ILE B 1 154 ? 110.330 -29.117  27.983  1.00 45.38  ? 154 ILE B CG2   1 
ATOM   4224  C CD1   . ILE B 1 154 ? 113.404 -29.248  28.386  1.00 41.53  ? 154 ILE B CD1   1 
ATOM   4225  N N     . ASN B 1 155 ? 109.085 -30.058  25.050  1.00 46.62  ? 155 ASN B N     1 
ATOM   4226  C CA    . ASN B 1 155 ? 107.796 -29.659  24.526  1.00 46.92  ? 155 ASN B CA    1 
ATOM   4227  C C     . ASN B 1 155 ? 106.905 -30.826  24.109  1.00 47.12  ? 155 ASN B C     1 
ATOM   4228  O O     . ASN B 1 155 ? 105.715 -30.824  24.400  1.00 47.28  ? 155 ASN B O     1 
ATOM   4229  C CB    . ASN B 1 155 ? 107.938 -28.672  23.384  1.00 47.07  ? 155 ASN B CB    1 
ATOM   4230  C CG    . ASN B 1 155 ? 106.618 -28.021  23.038  1.00 48.54  ? 155 ASN B CG    1 
ATOM   4231  O OD1   . ASN B 1 155 ? 106.239 -27.912  21.868  1.00 52.35  ? 155 ASN B OD1   1 
ATOM   4232  N ND2   . ASN B 1 155 ? 105.895 -27.601  24.059  1.00 47.48  ? 155 ASN B ND2   1 
ATOM   4233  N N     . LEU B 1 156 ? 107.477 -31.824  23.442  1.00 47.41  ? 156 LEU B N     1 
ATOM   4234  C CA    . LEU B 1 156 ? 106.695 -32.998  23.028  1.00 47.98  ? 156 LEU B CA    1 
ATOM   4235  C C     . LEU B 1 156 ? 106.105 -33.745  24.244  1.00 48.25  ? 156 LEU B C     1 
ATOM   4236  O O     . LEU B 1 156 ? 104.918 -34.081  24.269  1.00 48.56  ? 156 LEU B O     1 
ATOM   4237  C CB    . LEU B 1 156 ? 107.528 -33.939  22.126  1.00 47.98  ? 156 LEU B CB    1 
ATOM   4238  C CG    . LEU B 1 156 ? 106.905 -35.306  21.777  1.00 48.31  ? 156 LEU B CG    1 
ATOM   4239  C CD1   . LEU B 1 156 ? 105.649 -35.177  20.920  1.00 48.37  ? 156 LEU B CD1   1 
ATOM   4240  C CD2   . LEU B 1 156 ? 107.888 -36.237  21.112  1.00 47.57  ? 156 LEU B CD2   1 
ATOM   4241  N N     . PHE B 1 157 ? 106.944 -33.979  25.249  1.00 48.12  ? 157 PHE B N     1 
ATOM   4242  C CA    . PHE B 1 157 ? 106.544 -34.689  26.453  1.00 48.27  ? 157 PHE B CA    1 
ATOM   4243  C C     . PHE B 1 157 ? 105.554 -33.889  27.282  1.00 48.56  ? 157 PHE B C     1 
ATOM   4244  O O     . PHE B 1 157 ? 104.591 -34.437  27.783  1.00 48.76  ? 157 PHE B O     1 
ATOM   4245  C CB    . PHE B 1 157 ? 107.773 -35.039  27.289  1.00 47.75  ? 157 PHE B CB    1 
ATOM   4246  C CG    . PHE B 1 157 ? 108.598 -36.141  26.718  1.00 46.98  ? 157 PHE B CG    1 
ATOM   4247  C CD1   . PHE B 1 157 ? 109.532 -36.790  27.504  1.00 46.70  ? 157 PHE B CD1   1 
ATOM   4248  C CD2   . PHE B 1 157 ? 108.432 -36.553  25.396  1.00 47.27  ? 157 PHE B CD2   1 
ATOM   4249  C CE1   . PHE B 1 157 ? 110.312 -37.822  26.985  1.00 47.75  ? 157 PHE B CE1   1 
ATOM   4250  C CE2   . PHE B 1 157 ? 109.201 -37.589  24.861  1.00 47.49  ? 157 PHE B CE2   1 
ATOM   4251  C CZ    . PHE B 1 157 ? 110.144 -38.224  25.659  1.00 48.00  ? 157 PHE B CZ    1 
ATOM   4252  N N     . SER B 1 158 ? 105.791 -32.591  27.421  1.00 48.90  ? 158 SER B N     1 
ATOM   4253  C CA    . SER B 1 158 ? 104.900 -31.752  28.205  1.00 49.77  ? 158 SER B CA    1 
ATOM   4254  C C     . SER B 1 158 ? 103.532 -31.709  27.574  1.00 50.41  ? 158 SER B C     1 
ATOM   4255  O O     . SER B 1 158 ? 102.528 -31.711  28.286  1.00 50.68  ? 158 SER B O     1 
ATOM   4256  C CB    . SER B 1 158 ? 105.443 -30.342  28.296  1.00 49.53  ? 158 SER B CB    1 
ATOM   4257  O OG    . SER B 1 158 ? 106.757 -30.387  28.782  1.00 50.68  ? 158 SER B OG    1 
ATOM   4258  N N     . GLU B 1 159 ? 103.504 -31.654  26.240  1.00 50.92  ? 159 GLU B N     1 
ATOM   4259  C CA    . GLU B 1 159 ? 102.250 -31.664  25.493  1.00 51.77  ? 159 GLU B CA    1 
ATOM   4260  C C     . GLU B 1 159 ? 101.498 -32.974  25.754  1.00 52.10  ? 159 GLU B C     1 
ATOM   4261  O O     . GLU B 1 159 ? 100.299 -32.946  26.064  1.00 52.22  ? 159 GLU B O     1 
ATOM   4262  C CB    . GLU B 1 159 ? 102.478 -31.371  23.998  1.00 51.67  ? 159 GLU B CB    1 
ATOM   4263  C CG    . GLU B 1 159 ? 102.645 -29.874  23.741  1.00 53.70  ? 159 GLU B CG    1 
ATOM   4264  C CD    . GLU B 1 159 ? 103.050 -29.485  22.299  1.00 57.67  ? 159 GLU B CD    1 
ATOM   4265  O OE1   . GLU B 1 159 ? 104.083 -29.966  21.764  1.00 58.78  ? 159 GLU B OE1   1 
ATOM   4266  O OE2   . GLU B 1 159 ? 102.346 -28.643  21.705  1.00 58.58  ? 159 GLU B OE2   1 
ATOM   4267  N N     . ARG B 1 160 ? 102.232 -34.092  25.680  1.00 52.42  ? 160 ARG B N     1 
ATOM   4268  C CA    . ARG B 1 160 ? 101.723 -35.440  25.975  1.00 52.98  ? 160 ARG B CA    1 
ATOM   4269  C C     . ARG B 1 160 ? 101.220 -35.557  27.411  1.00 53.17  ? 160 ARG B C     1 
ATOM   4270  O O     . ARG B 1 160 ? 100.095 -35.995  27.651  1.00 53.55  ? 160 ARG B O     1 
ATOM   4271  C CB    . ARG B 1 160 ? 102.812 -36.486  25.731  1.00 53.01  ? 160 ARG B CB    1 
ATOM   4272  C CG    . ARG B 1 160 ? 102.329 -37.932  25.772  1.00 54.28  ? 160 ARG B CG    1 
ATOM   4273  C CD    . ARG B 1 160 ? 101.358 -38.269  24.637  1.00 55.31  ? 160 ARG B CD    1 
ATOM   4274  N NE    . ARG B 1 160 ? 101.906 -37.954  23.317  1.00 56.76  ? 160 ARG B NE    1 
ATOM   4275  C CZ    . ARG B 1 160 ? 101.174 -37.624  22.247  1.00 58.42  ? 160 ARG B CZ    1 
ATOM   4276  N NH1   . ARG B 1 160 ? 101.780 -37.349  21.091  1.00 57.70  ? 160 ARG B NH1   1 
ATOM   4277  N NH2   . ARG B 1 160 ? 99.839  -37.560  22.324  1.00 58.45  ? 160 ARG B NH2   1 
ATOM   4278  N N     . LEU B 1 161 ? 102.057 -35.148  28.359  1.00 53.08  ? 161 LEU B N     1 
ATOM   4279  C CA    . LEU B 1 161 ? 101.732 -35.242  29.770  1.00 53.06  ? 161 LEU B CA    1 
ATOM   4280  C C     . LEU B 1 161 ? 100.415 -34.577  30.080  1.00 53.34  ? 161 LEU B C     1 
ATOM   4281  O O     . LEU B 1 161 ? 99.580  -35.173  30.745  1.00 54.07  ? 161 LEU B O     1 
ATOM   4282  C CB    . LEU B 1 161 ? 102.833 -34.640  30.634  1.00 52.61  ? 161 LEU B CB    1 
ATOM   4283  C CG    . LEU B 1 161 ? 102.592 -34.721  32.135  1.00 52.66  ? 161 LEU B CG    1 
ATOM   4284  C CD1   . LEU B 1 161 ? 102.293 -36.151  32.550  1.00 54.34  ? 161 LEU B CD1   1 
ATOM   4285  C CD2   . LEU B 1 161 ? 103.785 -34.193  32.884  1.00 52.77  ? 161 LEU B CD2   1 
ATOM   4286  N N     . ARG B 1 162 ? 100.233 -33.352  29.595  1.00 53.39  ? 162 ARG B N     1 
ATOM   4287  C CA    . ARG B 1 162 ? 99.004  -32.584  29.841  1.00 53.64  ? 162 ARG B CA    1 
ATOM   4288  C C     . ARG B 1 162 ? 97.784  -33.292  29.275  1.00 54.75  ? 162 ARG B C     1 
ATOM   4289  O O     . ARG B 1 162 ? 96.772  -33.411  29.956  1.00 55.25  ? 162 ARG B O     1 
ATOM   4290  C CB    . ARG B 1 162 ? 99.100  -31.174  29.262  1.00 53.14  ? 162 ARG B CB    1 
ATOM   4291  C CG    . ARG B 1 162 ? 100.087 -30.291  29.965  1.00 50.49  ? 162 ARG B CG    1 
ATOM   4292  C CD    . ARG B 1 162 ? 100.376 -29.091  29.150  1.00 46.97  ? 162 ARG B CD    1 
ATOM   4293  N NE    . ARG B 1 162 ? 101.246 -28.184  29.872  1.00 47.43  ? 162 ARG B NE    1 
ATOM   4294  C CZ    . ARG B 1 162 ? 100.841 -27.293  30.777  1.00 48.31  ? 162 ARG B CZ    1 
ATOM   4295  N NH1   . ARG B 1 162 ? 101.739 -26.510  31.369  1.00 49.80  ? 162 ARG B NH1   1 
ATOM   4296  N NH2   . ARG B 1 162 ? 99.554  -27.172  31.099  1.00 46.88  ? 162 ARG B NH2   1 
ATOM   4297  N N     . GLU B 1 163 ? 97.890  -33.780  28.041  1.00 55.65  ? 163 GLU B N     1 
ATOM   4298  C CA    . GLU B 1 163 ? 96.819  -34.576  27.443  1.00 57.05  ? 163 GLU B CA    1 
ATOM   4299  C C     . GLU B 1 163 ? 96.520  -35.843  28.246  1.00 58.25  ? 163 GLU B C     1 
ATOM   4300  O O     . GLU B 1 163 ? 95.350  -36.155  28.485  1.00 58.97  ? 163 GLU B O     1 
ATOM   4301  C CB    . GLU B 1 163 ? 97.135  -34.923  25.994  1.00 56.87  ? 163 GLU B CB    1 
ATOM   4302  C CG    . GLU B 1 163 ? 96.827  -33.786  25.040  1.00 57.95  ? 163 GLU B CG    1 
ATOM   4303  C CD    . GLU B 1 163 ? 95.344  -33.435  24.997  1.00 59.61  ? 163 GLU B CD    1 
ATOM   4304  O OE1   . GLU B 1 163 ? 94.988  -32.258  25.196  1.00 59.07  ? 163 GLU B OE1   1 
ATOM   4305  O OE2   . GLU B 1 163 ? 94.522  -34.342  24.778  1.00 62.00  ? 163 GLU B OE2   1 
ATOM   4306  N N     . TRP B 1 164 ? 97.573  -36.546  28.672  1.00 58.89  ? 164 TRP B N     1 
ATOM   4307  C CA    . TRP B 1 164 ? 97.459  -37.758  29.491  1.00 60.09  ? 164 TRP B CA    1 
ATOM   4308  C C     . TRP B 1 164 ? 96.908  -37.482  30.910  1.00 60.87  ? 164 TRP B C     1 
ATOM   4309  O O     . TRP B 1 164 ? 95.865  -38.037  31.289  1.00 61.34  ? 164 TRP B O     1 
ATOM   4310  C CB    . TRP B 1 164 ? 98.834  -38.426  29.608  1.00 60.20  ? 164 TRP B CB    1 
ATOM   4311  C CG    . TRP B 1 164 ? 98.834  -39.885  30.062  1.00 60.59  ? 164 TRP B CG    1 
ATOM   4312  C CD1   . TRP B 1 164 ? 97.786  -40.592  30.580  1.00 60.51  ? 164 TRP B CD1   1 
ATOM   4313  C CD2   . TRP B 1 164 ? 99.957  -40.785  30.053  1.00 59.39  ? 164 TRP B CD2   1 
ATOM   4314  N NE1   . TRP B 1 164 ? 98.183  -41.876  30.870  1.00 60.73  ? 164 TRP B NE1   1 
ATOM   4315  C CE2   . TRP B 1 164 ? 99.507  -42.018  30.558  1.00 59.21  ? 164 TRP B CE2   1 
ATOM   4316  C CE3   . TRP B 1 164 ? 101.293 -40.667  29.655  1.00 57.97  ? 164 TRP B CE3   1 
ATOM   4317  C CZ2   . TRP B 1 164 ? 100.339 -43.117  30.678  1.00 58.84  ? 164 TRP B CZ2   1 
ATOM   4318  C CZ3   . TRP B 1 164 ? 102.118 -41.759  29.782  1.00 57.80  ? 164 TRP B CZ3   1 
ATOM   4319  C CH2   . TRP B 1 164 ? 101.640 -42.969  30.288  1.00 58.11  ? 164 TRP B CH2   1 
ATOM   4320  N N     . TYR B 1 165 ? 97.616  -36.639  31.679  1.00 60.95  ? 165 TYR B N     1 
ATOM   4321  C CA    . TYR B 1 165 ? 97.277  -36.359  33.079  1.00 61.34  ? 165 TYR B CA    1 
ATOM   4322  C C     . TYR B 1 165 ? 95.914  -35.702  33.239  1.00 61.90  ? 165 TYR B C     1 
ATOM   4323  O O     . TYR B 1 165 ? 95.295  -35.811  34.309  1.00 62.32  ? 165 TYR B O     1 
ATOM   4324  C CB    . TYR B 1 165 ? 98.351  -35.510  33.785  1.00 61.00  ? 165 TYR B CB    1 
ATOM   4325  C CG    . TYR B 1 165 ? 98.080  -35.343  35.275  1.00 61.03  ? 165 TYR B CG    1 
ATOM   4326  C CD1   . TYR B 1 165 ? 98.200  -36.422  36.150  1.00 61.92  ? 165 TYR B CD1   1 
ATOM   4327  C CD2   . TYR B 1 165 ? 97.678  -34.122  35.801  1.00 60.15  ? 165 TYR B CD2   1 
ATOM   4328  C CE1   . TYR B 1 165 ? 97.930  -36.286  37.511  1.00 61.79  ? 165 TYR B CE1   1 
ATOM   4329  C CE2   . TYR B 1 165 ? 97.418  -33.976  37.161  1.00 60.82  ? 165 TYR B CE2   1 
ATOM   4330  C CZ    . TYR B 1 165 ? 97.541  -35.062  38.011  1.00 61.01  ? 165 TYR B CZ    1 
ATOM   4331  O OH    . TYR B 1 165 ? 97.276  -34.924  39.355  1.00 59.90  ? 165 TYR B OH    1 
ATOM   4332  N N     . SER B 1 166 ? 95.453  -35.026  32.182  1.00 61.96  ? 166 SER B N     1 
ATOM   4333  C CA    . SER B 1 166 ? 94.128  -34.398  32.193  1.00 62.17  ? 166 SER B CA    1 
ATOM   4334  C C     . SER B 1 166 ? 92.954  -35.374  32.186  1.00 62.51  ? 166 SER B C     1 
ATOM   4335  O O     . SER B 1 166 ? 91.818  -34.956  32.382  1.00 63.06  ? 166 SER B O     1 
ATOM   4336  C CB    . SER B 1 166 ? 93.982  -33.369  31.077  1.00 61.88  ? 166 SER B CB    1 
ATOM   4337  O OG    . SER B 1 166 ? 94.430  -32.120  31.554  1.00 62.49  ? 166 SER B OG    1 
ATOM   4338  N N     . ILE B 1 167 ? 93.212  -36.663  31.965  1.00 62.56  ? 167 ILE B N     1 
ATOM   4339  C CA    . ILE B 1 167 ? 92.166  -37.671  32.167  1.00 63.01  ? 167 ILE B CA    1 
ATOM   4340  C C     . ILE B 1 167 ? 91.751  -37.661  33.642  1.00 63.47  ? 167 ILE B C     1 
ATOM   4341  O O     . ILE B 1 167 ? 90.564  -37.754  33.967  1.00 63.82  ? 167 ILE B O     1 
ATOM   4342  C CB    . ILE B 1 167 ? 92.622  -39.082  31.751  1.00 63.20  ? 167 ILE B CB    1 
ATOM   4343  C CG1   . ILE B 1 167 ? 92.959  -39.099  30.258  1.00 62.49  ? 167 ILE B CG1   1 
ATOM   4344  C CG2   . ILE B 1 167 ? 91.547  -40.112  32.093  1.00 63.09  ? 167 ILE B CG2   1 
ATOM   4345  C CD1   . ILE B 1 167 ? 93.624  -40.350  29.793  1.00 62.46  ? 167 ILE B CD1   1 
ATOM   4346  N N     . HIS B 1 168 ? 92.742  -37.501  34.517  1.00 63.35  ? 168 HIS B N     1 
ATOM   4347  C CA    . HIS B 1 168 ? 92.536  -37.500  35.955  1.00 63.75  ? 168 HIS B CA    1 
ATOM   4348  C C     . HIS B 1 168 ? 92.184  -36.131  36.536  1.00 63.77  ? 168 HIS B C     1 
ATOM   4349  O O     . HIS B 1 168 ? 91.309  -36.023  37.396  1.00 64.35  ? 168 HIS B O     1 
ATOM   4350  C CB    . HIS B 1 168 ? 93.779  -38.046  36.644  1.00 63.80  ? 168 HIS B CB    1 
ATOM   4351  C CG    . HIS B 1 168 ? 93.697  -38.025  38.136  1.00 64.46  ? 168 HIS B CG    1 
ATOM   4352  N ND1   . HIS B 1 168 ? 92.880  -38.876  38.846  1.00 64.81  ? 168 HIS B ND1   1 
ATOM   4353  C CD2   . HIS B 1 168 ? 94.331  -37.256  39.052  1.00 64.89  ? 168 HIS B CD2   1 
ATOM   4354  C CE1   . HIS B 1 168 ? 93.019  -38.636  40.137  1.00 65.67  ? 168 HIS B CE1   1 
ATOM   4355  N NE2   . HIS B 1 168 ? 93.889  -37.653  40.289  1.00 64.99  ? 168 HIS B NE2   1 
ATOM   4356  N N     . PHE B 1 169 ? 92.873  -35.091  36.076  1.00 63.32  ? 169 PHE B N     1 
ATOM   4357  C CA    . PHE B 1 169 ? 92.757  -33.766  36.684  1.00 63.06  ? 169 PHE B CA    1 
ATOM   4358  C C     . PHE B 1 169 ? 92.802  -32.661  35.606  1.00 63.22  ? 169 PHE B C     1 
ATOM   4359  O O     . PHE B 1 169 ? 93.769  -31.885  35.527  1.00 62.88  ? 169 PHE B O     1 
ATOM   4360  C CB    . PHE B 1 169 ? 93.837  -33.614  37.769  1.00 62.37  ? 169 PHE B CB    1 
ATOM   4361  C CG    . PHE B 1 169 ? 93.773  -32.327  38.538  1.00 61.35  ? 169 PHE B CG    1 
ATOM   4362  C CD1   . PHE B 1 169 ? 94.866  -31.918  39.299  1.00 60.19  ? 169 PHE B CD1   1 
ATOM   4363  C CD2   . PHE B 1 169 ? 92.638  -31.513  38.508  1.00 60.47  ? 169 PHE B CD2   1 
ATOM   4364  C CE1   . PHE B 1 169 ? 94.834  -30.723  40.022  1.00 58.72  ? 169 PHE B CE1   1 
ATOM   4365  C CE2   . PHE B 1 169 ? 92.599  -30.311  39.219  1.00 59.35  ? 169 PHE B CE2   1 
ATOM   4366  C CZ    . PHE B 1 169 ? 93.701  -29.918  39.979  1.00 58.55  ? 169 PHE B CZ    1 
ATOM   4367  N N     . PRO B 1 170 ? 91.726  -32.572  34.789  1.00 63.77  ? 170 PRO B N     1 
ATOM   4368  C CA    . PRO B 1 170 ? 91.682  -31.735  33.572  1.00 63.97  ? 170 PRO B CA    1 
ATOM   4369  C C     . PRO B 1 170 ? 91.849  -30.248  33.849  1.00 64.36  ? 170 PRO B C     1 
ATOM   4370  O O     . PRO B 1 170 ? 92.458  -29.528  33.057  1.00 64.11  ? 170 PRO B O     1 
ATOM   4371  C CB    . PRO B 1 170 ? 90.285  -32.003  32.986  1.00 64.21  ? 170 PRO B CB    1 
ATOM   4372  C CG    . PRO B 1 170 ? 89.685  -33.097  33.799  1.00 64.51  ? 170 PRO B CG    1 
ATOM   4373  C CD    . PRO B 1 170 ? 90.404  -33.136  35.111  1.00 64.13  ? 170 PRO B CD    1 
ATOM   4374  N N     . GLU B 1 171 ? 91.323  -29.807  34.982  1.00 65.39  ? 171 GLU B N     1 
ATOM   4375  C CA    . GLU B 1 171 ? 91.339  -28.401  35.356  1.00 66.55  ? 171 GLU B CA    1 
ATOM   4376  C C     . GLU B 1 171 ? 92.754  -27.828  35.603  1.00 66.50  ? 171 GLU B C     1 
ATOM   4377  O O     . GLU B 1 171 ? 92.959  -26.605  35.547  1.00 66.65  ? 171 GLU B O     1 
ATOM   4378  C CB    . GLU B 1 171 ? 90.434  -28.179  36.573  1.00 67.23  ? 171 GLU B CB    1 
ATOM   4379  C CG    . GLU B 1 171 ? 88.965  -28.578  36.347  1.00 68.78  ? 171 GLU B CG    1 
ATOM   4380  C CD    . GLU B 1 171 ? 88.649  -30.052  36.659  1.00 69.47  ? 171 GLU B CD    1 
ATOM   4381  O OE1   . GLU B 1 171 ? 87.453  -30.424  36.605  1.00 69.50  ? 171 GLU B OE1   1 
ATOM   4382  O OE2   . GLU B 1 171 ? 89.581  -30.833  36.956  1.00 68.98  ? 171 GLU B OE2   1 
ATOM   4383  N N     . LEU B 1 172 ? 93.720  -28.710  35.857  1.00 66.31  ? 172 LEU B N     1 
ATOM   4384  C CA    . LEU B 1 172 ? 95.079  -28.284  36.192  1.00 66.41  ? 172 LEU B CA    1 
ATOM   4385  C C     . LEU B 1 172 ? 95.858  -27.729  34.994  1.00 66.53  ? 172 LEU B C     1 
ATOM   4386  O O     . LEU B 1 172 ? 96.795  -26.938  35.168  1.00 66.52  ? 172 LEU B O     1 
ATOM   4387  C CB    . LEU B 1 172 ? 95.847  -29.438  36.819  1.00 65.86  ? 172 LEU B CB    1 
ATOM   4388  C CG    . LEU B 1 172 ? 97.246  -29.125  37.348  1.00 65.67  ? 172 LEU B CG    1 
ATOM   4389  C CD1   . LEU B 1 172 ? 97.206  -28.292  38.609  1.00 65.07  ? 172 LEU B CD1   1 
ATOM   4390  C CD2   . LEU B 1 172 ? 97.981  -30.433  37.601  1.00 66.69  ? 172 LEU B CD2   1 
ATOM   4391  N N     . ASP B 1 173 ? 95.450  -28.145  33.792  1.00 66.73  ? 173 ASP B N     1 
ATOM   4392  C CA    . ASP B 1 173 ? 96.104  -27.782  32.531  1.00 66.42  ? 173 ASP B CA    1 
ATOM   4393  C C     . ASP B 1 173 ? 96.054  -26.290  32.209  1.00 66.65  ? 173 ASP B C     1 
ATOM   4394  O O     . ASP B 1 173 ? 97.078  -25.702  31.897  1.00 66.43  ? 173 ASP B O     1 
ATOM   4395  C CB    . ASP B 1 173 ? 95.493  -28.594  31.383  1.00 66.66  ? 173 ASP B CB    1 
ATOM   4396  C CG    . ASP B 1 173 ? 95.941  -28.118  30.007  1.00 66.36  ? 173 ASP B CG    1 
ATOM   4397  O OD1   . ASP B 1 173 ? 95.075  -27.720  29.214  1.00 67.40  ? 173 ASP B OD1   1 
ATOM   4398  O OD2   . ASP B 1 173 ? 97.148  -28.143  29.709  1.00 66.08  ? 173 ASP B OD2   1 
ATOM   4399  N N     . LYS B 1 174 ? 94.871  -25.685  32.273  1.00 67.43  ? 174 LYS B N     1 
ATOM   4400  C CA    . LYS B 1 174 ? 94.733  -24.236  32.041  1.00 68.35  ? 174 LYS B CA    1 
ATOM   4401  C C     . LYS B 1 174 ? 95.109  -23.401  33.253  1.00 68.50  ? 174 LYS B C     1 
ATOM   4402  O O     . LYS B 1 174 ? 95.151  -22.185  33.168  1.00 69.08  ? 174 LYS B O     1 
ATOM   4403  C CB    . LYS B 1 174 ? 93.317  -23.869  31.587  1.00 69.08  ? 174 LYS B CB    1 
ATOM   4404  C CG    . LYS B 1 174 ? 93.050  -24.183  30.113  1.00 71.06  ? 174 LYS B CG    1 
ATOM   4405  C CD    . LYS B 1 174 ? 91.737  -24.959  29.940  1.00 75.60  ? 174 LYS B CD    1 
ATOM   4406  C CE    . LYS B 1 174 ? 91.807  -26.383  30.574  1.00 76.89  ? 174 LYS B CE    1 
ATOM   4407  N NZ    . LYS B 1 174 ? 90.603  -26.720  31.406  1.00 78.13  ? 174 LYS B NZ    1 
ATOM   4408  N N     . LEU B 1 175 ? 95.380  -24.055  34.376  1.00 68.43  ? 175 LEU B N     1 
ATOM   4409  C CA    . LEU B 1 175 ? 95.750  -23.361  35.604  1.00 68.85  ? 175 LEU B CA    1 
ATOM   4410  C C     . LEU B 1 175 ? 97.257  -23.175  35.742  1.00 68.33  ? 175 LEU B C     1 
ATOM   4411  O O     . LEU B 1 175 ? 97.713  -22.193  36.337  1.00 68.73  ? 175 LEU B O     1 
ATOM   4412  C CB    . LEU B 1 175 ? 95.209  -24.112  36.812  1.00 69.30  ? 175 LEU B CB    1 
ATOM   4413  C CG    . LEU B 1 175 ? 93.892  -23.653  37.421  1.00 70.41  ? 175 LEU B CG    1 
ATOM   4414  C CD1   . LEU B 1 175 ? 92.809  -23.403  36.370  1.00 70.79  ? 175 LEU B CD1   1 
ATOM   4415  C CD2   . LEU B 1 175 ? 93.471  -24.733  38.392  1.00 71.15  ? 175 LEU B CD2   1 
ATOM   4416  N N     . ILE B 1 176 ? 98.018  -24.124  35.203  1.00 67.09  ? 176 ILE B N     1 
ATOM   4417  C CA    . ILE B 1 176 ? 99.468  -24.013  35.183  1.00 66.68  ? 176 ILE B CA    1 
ATOM   4418  C C     . ILE B 1 176 ? 100.013 -23.822  33.752  1.00 66.39  ? 176 ILE B C     1 
ATOM   4419  O O     . ILE B 1 176 ? 100.042 -24.744  32.933  1.00 65.79  ? 176 ILE B O     1 
ATOM   4420  C CB    . ILE B 1 176 ? 100.146 -25.175  35.937  1.00 66.16  ? 176 ILE B CB    1 
ATOM   4421  C CG1   . ILE B 1 176 ? 100.057 -24.956  37.440  1.00 67.04  ? 176 ILE B CG1   1 
ATOM   4422  C CG2   . ILE B 1 176 ? 101.599 -25.207  35.654  1.00 65.91  ? 176 ILE B CG2   1 
ATOM   4423  C CD1   . ILE B 1 176 ? 98.822  -25.458  38.074  1.00 68.14  ? 176 ILE B CD1   1 
ATOM   4424  N N     . GLU B 1 177 ? 100.431 -22.595  33.468  1.00 66.99  ? 177 GLU B N     1 
ATOM   4425  C CA    . GLU B 1 177 ? 100.974 -22.229  32.170  1.00 66.87  ? 177 GLU B CA    1 
ATOM   4426  C C     . GLU B 1 177 ? 102.265 -22.989  31.946  1.00 65.92  ? 177 GLU B C     1 
ATOM   4427  O O     . GLU B 1 177 ? 102.466 -23.605  30.905  1.00 65.61  ? 177 GLU B O     1 
ATOM   4428  C CB    . GLU B 1 177 ? 101.270 -20.724  32.147  1.00 67.65  ? 177 GLU B CB    1 
ATOM   4429  C CG    . GLU B 1 177 ? 100.728 -19.973  30.940  1.00 69.99  ? 177 GLU B CG    1 
ATOM   4430  C CD    . GLU B 1 177 ? 99.221  -19.673  31.032  1.00 74.04  ? 177 GLU B CD    1 
ATOM   4431  O OE1   . GLU B 1 177 ? 98.566  -20.084  32.025  1.00 75.93  ? 177 GLU B OE1   1 
ATOM   4432  O OE2   . GLU B 1 177 ? 98.684  -19.020  30.101  1.00 75.68  ? 177 GLU B OE2   1 
ATOM   4433  N N     . ASP B 1 178 ? 103.113 -22.961  32.966  1.00 65.84  ? 178 ASP B N     1 
ATOM   4434  C CA    . ASP B 1 178 ? 104.499 -23.375  32.881  1.00 65.21  ? 178 ASP B CA    1 
ATOM   4435  C C     . ASP B 1 178 ? 104.651 -24.887  32.890  1.00 64.14  ? 178 ASP B C     1 
ATOM   4436  O O     . ASP B 1 178 ? 104.226 -25.548  33.822  1.00 63.99  ? 178 ASP B O     1 
ATOM   4437  C CB    . ASP B 1 178 ? 105.266 -22.759  34.052  1.00 66.12  ? 178 ASP B CB    1 
ATOM   4438  C CG    . ASP B 1 178 ? 106.758 -22.941  33.935  1.00 67.46  ? 178 ASP B CG    1 
ATOM   4439  O OD1   . ASP B 1 178 ? 107.305 -23.813  34.638  1.00 69.60  ? 178 ASP B OD1   1 
ATOM   4440  O OD2   . ASP B 1 178 ? 107.387 -22.215  33.137  1.00 69.52  ? 178 ASP B OD2   1 
ATOM   4441  N N     . HIS B 1 179 ? 105.281 -25.427  31.853  1.00 63.44  ? 179 HIS B N     1 
ATOM   4442  C CA    . HIS B 1 179 ? 105.515 -26.870  31.752  1.00 62.81  ? 179 HIS B CA    1 
ATOM   4443  C C     . HIS B 1 179 ? 106.295 -27.461  32.927  1.00 62.57  ? 179 HIS B C     1 
ATOM   4444  O O     . HIS B 1 179 ? 105.914 -28.507  33.458  1.00 62.65  ? 179 HIS B O     1 
ATOM   4445  C CB    . HIS B 1 179 ? 106.224 -27.218  30.451  1.00 62.42  ? 179 HIS B CB    1 
ATOM   4446  C CG    . HIS B 1 179 ? 105.433 -26.890  29.225  1.00 63.10  ? 179 HIS B CG    1 
ATOM   4447  N ND1   . HIS B 1 179 ? 104.132 -27.306  29.047  1.00 62.94  ? 179 HIS B ND1   1 
ATOM   4448  C CD2   . HIS B 1 179 ? 105.768 -26.204  28.105  1.00 63.31  ? 179 HIS B CD2   1 
ATOM   4449  C CE1   . HIS B 1 179 ? 103.701 -26.889  27.870  1.00 63.81  ? 179 HIS B CE1   1 
ATOM   4450  N NE2   . HIS B 1 179 ? 104.676 -26.221  27.277  1.00 63.06  ? 179 HIS B NE2   1 
ATOM   4451  N N     . GLU B 1 180 ? 107.377 -26.804  33.339  1.00 62.19  ? 180 GLU B N     1 
ATOM   4452  C CA    . GLU B 1 180 ? 108.175 -27.334  34.444  1.00 61.87  ? 180 GLU B CA    1 
ATOM   4453  C C     . GLU B 1 180 ? 107.351 -27.448  35.727  1.00 62.27  ? 180 GLU B C     1 
ATOM   4454  O O     . GLU B 1 180 ? 107.408 -28.467  36.409  1.00 62.56  ? 180 GLU B O     1 
ATOM   4455  C CB    . GLU B 1 180 ? 109.454 -26.528  34.667  1.00 61.81  ? 180 GLU B CB    1 
ATOM   4456  C CG    . GLU B 1 180 ? 110.371 -27.186  35.687  1.00 61.81  ? 180 GLU B CG    1 
ATOM   4457  C CD    . GLU B 1 180 ? 111.821 -26.736  35.615  1.00 61.83  ? 180 GLU B CD    1 
ATOM   4458  O OE1   . GLU B 1 180 ? 112.128 -25.695  34.997  1.00 62.13  ? 180 GLU B OE1   1 
ATOM   4459  O OE2   . GLU B 1 180 ? 112.668 -27.437  36.196  1.00 61.59  ? 180 GLU B OE2   1 
ATOM   4460  N N     . GLU B 1 181 ? 106.571 -26.412  36.030  1.00 62.34  ? 181 GLU B N     1 
ATOM   4461  C CA    . GLU B 1 181 ? 105.691 -26.422  37.186  1.00 62.78  ? 181 GLU B CA    1 
ATOM   4462  C C     . GLU B 1 181 ? 104.689 -27.543  37.077  1.00 62.55  ? 181 GLU B C     1 
ATOM   4463  O O     . GLU B 1 181 ? 104.595 -28.365  37.983  1.00 63.20  ? 181 GLU B O     1 
ATOM   4464  C CB    . GLU B 1 181 ? 104.964 -25.097  37.334  1.00 63.22  ? 181 GLU B CB    1 
ATOM   4465  C CG    . GLU B 1 181 ? 105.792 -24.039  38.012  1.00 64.86  ? 181 GLU B CG    1 
ATOM   4466  C CD    . GLU B 1 181 ? 105.178 -22.666  37.923  1.00 66.35  ? 181 GLU B CD    1 
ATOM   4467  O OE1   . GLU B 1 181 ? 103.926 -22.555  37.931  1.00 66.85  ? 181 GLU B OE1   1 
ATOM   4468  O OE2   . GLU B 1 181 ? 105.965 -21.697  37.849  1.00 67.26  ? 181 GLU B OE2   1 
ATOM   4469  N N     . TYR B 1 182 ? 103.958 -27.598  35.966  1.00 61.95  ? 182 TYR B N     1 
ATOM   4470  C CA    . TYR B 1 182 ? 102.978 -28.665  35.745  1.00 61.77  ? 182 TYR B CA    1 
ATOM   4471  C C     . TYR B 1 182 ? 103.577 -30.033  36.032  1.00 62.51  ? 182 TYR B C     1 
ATOM   4472  O O     . TYR B 1 182 ? 103.006 -30.815  36.795  1.00 62.95  ? 182 TYR B O     1 
ATOM   4473  C CB    . TYR B 1 182 ? 102.443 -28.630  34.321  1.00 60.72  ? 182 TYR B CB    1 
ATOM   4474  C CG    . TYR B 1 182 ? 101.245 -29.519  34.070  1.00 58.66  ? 182 TYR B CG    1 
ATOM   4475  C CD1   . TYR B 1 182 ? 99.949  -29.046  34.266  1.00 56.75  ? 182 TYR B CD1   1 
ATOM   4476  C CD2   . TYR B 1 182 ? 101.408 -30.823  33.604  1.00 57.39  ? 182 TYR B CD2   1 
ATOM   4477  C CE1   . TYR B 1 182 ? 98.847  -29.848  34.018  1.00 55.74  ? 182 TYR B CE1   1 
ATOM   4478  C CE2   . TYR B 1 182 ? 100.313 -31.638  33.347  1.00 56.01  ? 182 TYR B CE2   1 
ATOM   4479  C CZ    . TYR B 1 182 ? 99.036  -31.147  33.558  1.00 56.21  ? 182 TYR B CZ    1 
ATOM   4480  O OH    . TYR B 1 182 ? 97.949  -31.960  33.296  1.00 57.40  ? 182 TYR B OH    1 
ATOM   4481  N N     . ALA B 1 183 ? 104.732 -30.307  35.429  1.00 63.00  ? 183 ALA B N     1 
ATOM   4482  C CA    . ALA B 1 183 ? 105.440 -31.571  35.648  1.00 64.01  ? 183 ALA B CA    1 
ATOM   4483  C C     . ALA B 1 183 ? 105.787 -31.830  37.130  1.00 65.06  ? 183 ALA B C     1 
ATOM   4484  O O     . ALA B 1 183 ? 105.623 -32.958  37.621  1.00 65.48  ? 183 ALA B O     1 
ATOM   4485  C CB    . ALA B 1 183 ? 106.693 -31.646  34.773  1.00 63.80  ? 183 ALA B CB    1 
ATOM   4486  N N     . THR B 1 184 ? 106.245 -30.791  37.833  1.00 65.60  ? 184 THR B N     1 
ATOM   4487  C CA    . THR B 1 184 ? 106.594 -30.915  39.252  1.00 66.79  ? 184 THR B CA    1 
ATOM   4488  C C     . THR B 1 184 ? 105.411 -31.409  40.095  1.00 67.56  ? 184 THR B C     1 
ATOM   4489  O O     . THR B 1 184 ? 105.584 -32.207  41.016  1.00 68.13  ? 184 THR B O     1 
ATOM   4490  C CB    . THR B 1 184 ? 107.137 -29.599  39.829  1.00 66.97  ? 184 THR B CB    1 
ATOM   4491  O OG1   . THR B 1 184 ? 108.037 -29.012  38.890  1.00 66.27  ? 184 THR B OG1   1 
ATOM   4492  C CG2   . THR B 1 184 ? 107.893 -29.858  41.108  1.00 67.92  ? 184 THR B CG2   1 
ATOM   4493  N N     . ILE B 1 185 ? 104.215 -30.944  39.757  1.00 67.78  ? 185 ILE B N     1 
ATOM   4494  C CA    . ILE B 1 185 ? 103.008 -31.333  40.468  1.00 68.65  ? 185 ILE B CA    1 
ATOM   4495  C C     . ILE B 1 185 ? 102.672 -32.804  40.255  1.00 69.11  ? 185 ILE B C     1 
ATOM   4496  O O     . ILE B 1 185 ? 102.414 -33.516  41.213  1.00 69.80  ? 185 ILE B O     1 
ATOM   4497  C CB    . ILE B 1 185 ? 101.817 -30.421  40.088  1.00 68.62  ? 185 ILE B CB    1 
ATOM   4498  C CG1   . ILE B 1 185 ? 102.062 -29.003  40.633  1.00 68.40  ? 185 ILE B CG1   1 
ATOM   4499  C CG2   . ILE B 1 185 ? 100.478 -31.027  40.564  1.00 68.69  ? 185 ILE B CG2   1 
ATOM   4500  C CD1   . ILE B 1 185 ? 101.041 -27.972  40.220  1.00 68.50  ? 185 ILE B CD1   1 
ATOM   4501  N N     . VAL B 1 186 ? 102.689 -33.262  39.008  1.00 69.27  ? 186 VAL B N     1 
ATOM   4502  C CA    . VAL B 1 186 ? 102.393 -34.669  38.710  1.00 70.19  ? 186 VAL B CA    1 
ATOM   4503  C C     . VAL B 1 186 ? 103.502 -35.559  39.253  1.00 71.23  ? 186 VAL B C     1 
ATOM   4504  O O     . VAL B 1 186 ? 103.262 -36.692  39.652  1.00 71.64  ? 186 VAL B O     1 
ATOM   4505  C CB    . VAL B 1 186 ? 102.215 -34.924  37.182  1.00 69.55  ? 186 VAL B CB    1 
ATOM   4506  C CG1   . VAL B 1 186 ? 101.942 -36.401  36.886  1.00 69.90  ? 186 VAL B CG1   1 
ATOM   4507  C CG2   . VAL B 1 186 ? 101.101 -34.074  36.632  1.00 69.21  ? 186 VAL B CG2   1 
ATOM   4508  N N     . SER B 1 187 ? 104.720 -35.035  39.266  1.00 72.09  ? 187 SER B N     1 
ATOM   4509  C CA    . SER B 1 187 ? 105.845 -35.807  39.735  1.00 73.64  ? 187 SER B CA    1 
ATOM   4510  C C     . SER B 1 187 ? 105.766 -36.035  41.234  1.00 75.22  ? 187 SER B C     1 
ATOM   4511  O O     . SER B 1 187 ? 106.086 -37.119  41.702  1.00 76.08  ? 187 SER B O     1 
ATOM   4512  C CB    . SER B 1 187 ? 107.157 -35.125  39.385  1.00 73.38  ? 187 SER B CB    1 
ATOM   4513  O OG    . SER B 1 187 ? 108.207 -35.661  40.170  1.00 74.52  ? 187 SER B OG    1 
ATOM   4514  N N     . ARG B 1 188 ? 105.347 -35.018  41.981  1.00 76.29  ? 188 ARG B N     1 
ATOM   4515  C CA    . ARG B 1 188 ? 105.338 -35.112  43.436  1.00 78.28  ? 188 ARG B CA    1 
ATOM   4516  C C     . ARG B 1 188 ? 104.068 -35.744  43.989  1.00 78.77  ? 188 ARG B C     1 
ATOM   4517  O O     . ARG B 1 188 ? 104.089 -36.286  45.095  1.00 80.09  ? 188 ARG B O     1 
ATOM   4518  C CB    . ARG B 1 188 ? 105.577 -33.745  44.092  1.00 78.87  ? 188 ARG B CB    1 
ATOM   4519  C CG    . ARG B 1 188 ? 107.050 -33.292  44.109  1.00 81.34  ? 188 ARG B CG    1 
ATOM   4520  C CD    . ARG B 1 188 ? 107.298 -32.042  45.013  1.00 85.40  ? 188 ARG B CD    1 
ATOM   4521  N NE    . ARG B 1 188 ? 106.408 -30.899  44.717  1.00 86.37  ? 188 ARG B NE    1 
ATOM   4522  C CZ    . ARG B 1 188 ? 106.538 -29.661  45.210  1.00 86.79  ? 188 ARG B CZ    1 
ATOM   4523  N NH1   . ARG B 1 188 ? 107.533 -29.350  46.036  1.00 88.00  ? 188 ARG B NH1   1 
ATOM   4524  N NH2   . ARG B 1 188 ? 105.662 -28.722  44.869  1.00 85.89  ? 188 ARG B NH2   1 
ATOM   4525  N N     . PHE B 1 189 ? 102.982 -35.715  43.224  1.00 78.21  ? 189 PHE B N     1 
ATOM   4526  C CA    . PHE B 1 189 ? 101.680 -36.119  43.768  1.00 78.80  ? 189 PHE B CA    1 
ATOM   4527  C C     . PHE B 1 189 ? 100.946 -37.298  43.108  1.00 78.72  ? 189 PHE B C     1 
ATOM   4528  O O     . PHE B 1 189 ? 100.485 -38.204  43.800  1.00 79.47  ? 189 PHE B O     1 
ATOM   4529  C CB    . PHE B 1 189 ? 100.751 -34.905  43.847  1.00 78.65  ? 189 PHE B CB    1 
ATOM   4530  C CG    . PHE B 1 189 ? 101.265 -33.817  44.730  1.00 79.31  ? 189 PHE B CG    1 
ATOM   4531  C CD1   . PHE B 1 189 ? 101.817 -32.672  44.183  1.00 79.22  ? 189 PHE B CD1   1 
ATOM   4532  C CD2   . PHE B 1 189 ? 101.210 -33.944  46.110  1.00 80.90  ? 189 PHE B CD2   1 
ATOM   4533  C CE1   . PHE B 1 189 ? 102.296 -31.659  44.992  1.00 80.14  ? 189 PHE B CE1   1 
ATOM   4534  C CE2   . PHE B 1 189 ? 101.688 -32.942  46.927  1.00 82.26  ? 189 PHE B CE2   1 
ATOM   4535  C CZ    . PHE B 1 189 ? 102.236 -31.791  46.362  1.00 81.89  ? 189 PHE B CZ    1 
ATOM   4536  N N     . GLY B 1 190 ? 100.818 -37.280  41.787  1.00 78.10  ? 190 GLY B N     1 
ATOM   4537  C CA    . GLY B 1 190 ? 99.957  -38.230  41.101  1.00 78.19  ? 190 GLY B CA    1 
ATOM   4538  C C     . GLY B 1 190 ? 98.517  -37.833  41.347  1.00 78.45  ? 190 GLY B C     1 
ATOM   4539  O O     . GLY B 1 190 ? 98.041  -36.867  40.761  1.00 78.05  ? 190 GLY B O     1 
ATOM   4540  N N     . ASP B 1 191 ? 97.839  -38.560  42.234  1.00 79.40  ? 191 ASP B N     1 
ATOM   4541  C CA    . ASP B 1 191 ? 96.433  -38.312  42.565  1.00 79.83  ? 191 ASP B CA    1 
ATOM   4542  C C     . ASP B 1 191 ? 96.223  -36.887  43.068  1.00 80.10  ? 191 ASP B C     1 
ATOM   4543  O O     . ASP B 1 191 ? 97.105  -36.317  43.707  1.00 80.40  ? 191 ASP B O     1 
ATOM   4544  C CB    . ASP B 1 191 ? 95.953  -39.314  43.619  1.00 80.71  ? 191 ASP B CB    1 
ATOM   4545  C CG    . ASP B 1 191 ? 94.451  -39.533  43.585  1.00 80.58  ? 191 ASP B CG    1 
ATOM   4546  O OD1   . ASP B 1 191 ? 94.038  -40.651  43.218  1.00 80.87  ? 191 ASP B OD1   1 
ATOM   4547  O OD2   . ASP B 1 191 ? 93.683  -38.600  43.910  1.00 80.05  ? 191 ASP B OD2   1 
ATOM   4548  N N     . ARG B 1 192 ? 95.058  -36.319  42.767  1.00 80.41  ? 192 ARG B N     1 
ATOM   4549  C CA    . ARG B 1 192 ? 94.726  -34.938  43.152  1.00 80.97  ? 192 ARG B CA    1 
ATOM   4550  C C     . ARG B 1 192 ? 94.277  -34.814  44.621  1.00 82.31  ? 192 ARG B C     1 
ATOM   4551  O O     . ARG B 1 192 ? 94.209  -33.717  45.180  1.00 82.51  ? 192 ARG B O     1 
ATOM   4552  C CB    . ARG B 1 192 ? 93.676  -34.347  42.195  1.00 80.40  ? 192 ARG B CB    1 
ATOM   4553  C CG    . ARG B 1 192 ? 92.404  -35.177  42.069  1.00 80.12  ? 192 ARG B CG    1 
ATOM   4554  C CD    . ARG B 1 192 ? 91.442  -34.580  41.074  1.00 78.95  ? 192 ARG B CD    1 
ATOM   4555  N NE    . ARG B 1 192 ? 90.107  -35.159  41.200  1.00 79.74  ? 192 ARG B NE    1 
ATOM   4556  C CZ    . ARG B 1 192 ? 89.688  -36.259  40.575  1.00 80.73  ? 192 ARG B CZ    1 
ATOM   4557  N NH1   . ARG B 1 192 ? 88.450  -36.694  40.760  1.00 81.54  ? 192 ARG B NH1   1 
ATOM   4558  N NH2   . ARG B 1 192 ? 90.495  -36.932  39.765  1.00 80.89  ? 192 ARG B NH2   1 
ATOM   4559  N N     . GLY B 1 193 ? 93.974  -35.948  45.238  1.00 83.42  ? 193 GLY B N     1 
ATOM   4560  C CA    . GLY B 1 193 ? 93.631  -35.971  46.650  1.00 85.34  ? 193 GLY B CA    1 
ATOM   4561  C C     . GLY B 1 193 ? 94.847  -36.077  47.555  1.00 86.51  ? 193 GLY B C     1 
ATOM   4562  O O     . GLY B 1 193 ? 94.705  -36.249  48.767  1.00 87.77  ? 193 GLY B O     1 
ATOM   4563  N N     . PHE B 1 194 ? 96.038  -35.990  46.966  1.00 86.40  ? 194 PHE B N     1 
ATOM   4564  C CA    . PHE B 1 194 ? 97.296  -35.995  47.711  1.00 87.42  ? 194 PHE B CA    1 
ATOM   4565  C C     . PHE B 1 194 ? 97.836  -34.577  47.825  1.00 87.60  ? 194 PHE B C     1 
ATOM   4566  O O     . PHE B 1 194 ? 98.948  -34.361  48.313  1.00 88.03  ? 194 PHE B O     1 
ATOM   4567  C CB    . PHE B 1 194 ? 98.329  -36.888  47.011  1.00 87.19  ? 194 PHE B CB    1 
ATOM   4568  C CG    . PHE B 1 194 ? 98.222  -38.348  47.364  1.00 88.50  ? 194 PHE B CG    1 
ATOM   4569  C CD1   . PHE B 1 194 ? 97.112  -39.100  46.974  1.00 89.35  ? 194 PHE B CD1   1 
ATOM   4570  C CD2   . PHE B 1 194 ? 99.241  -38.976  48.074  1.00 89.77  ? 194 PHE B CD2   1 
ATOM   4571  C CE1   . PHE B 1 194 ? 97.010  -40.453  47.298  1.00 90.36  ? 194 PHE B CE1   1 
ATOM   4572  C CE2   . PHE B 1 194 ? 99.152  -40.328  48.403  1.00 91.16  ? 194 PHE B CE2   1 
ATOM   4573  C CZ    . PHE B 1 194 ? 98.036  -41.069  48.012  1.00 91.21  ? 194 PHE B CZ    1 
ATOM   4574  N N     . LEU B 1 195 ? 97.038  -33.615  47.376  1.00 87.69  ? 195 LEU B N     1 
ATOM   4575  C CA    . LEU B 1 195 ? 97.485  -32.237  47.254  1.00 88.31  ? 195 LEU B CA    1 
ATOM   4576  C C     . LEU B 1 195 ? 97.221  -31.454  48.534  1.00 90.27  ? 195 LEU B C     1 
ATOM   4577  O O     . LEU B 1 195 ? 96.104  -31.476  49.058  1.00 90.89  ? 195 LEU B O     1 
ATOM   4578  C CB    . LEU B 1 195 ? 96.821  -31.567  46.043  1.00 87.27  ? 195 LEU B CB    1 
ATOM   4579  C CG    . LEU B 1 195 ? 97.289  -31.962  44.633  1.00 85.19  ? 195 LEU B CG    1 
ATOM   4580  C CD1   . LEU B 1 195 ? 96.307  -31.470  43.610  1.00 83.88  ? 195 LEU B CD1   1 
ATOM   4581  C CD2   . LEU B 1 195 ? 98.658  -31.404  44.328  1.00 83.99  ? 195 LEU B CD2   1 
ATOM   4582  N N     . THR B 1 196 ? 98.256  -30.769  49.030  1.00 91.70  ? 196 THR B N     1 
ATOM   4583  C CA    . THR B 1 196 ? 98.214  -30.104  50.339  1.00 93.91  ? 196 THR B CA    1 
ATOM   4584  C C     . THR B 1 196 ? 98.836  -28.703  50.335  1.00 94.88  ? 196 THR B C     1 
ATOM   4585  O O     . THR B 1 196 ? 99.910  -28.489  49.762  1.00 94.48  ? 196 THR B O     1 
ATOM   4586  C CB    . THR B 1 196 ? 98.945  -30.948  51.416  1.00 94.83  ? 196 THR B CB    1 
ATOM   4587  O OG1   . THR B 1 196 ? 98.670  -32.340  51.210  1.00 94.61  ? 196 THR B OG1   1 
ATOM   4588  C CG2   . THR B 1 196 ? 98.525  -30.534  52.838  1.00 96.43  ? 196 THR B CG2   1 
ATOM   4589  N N     . ILE B 1 197 ? 98.154  -27.767  50.998  1.00 96.65  ? 197 ILE B N     1 
ATOM   4590  C CA    . ILE B 1 197 ? 98.679  -26.426  51.293  1.00 98.10  ? 197 ILE B CA    1 
ATOM   4591  C C     . ILE B 1 197 ? 100.167 -26.476  51.677  1.00 99.36  ? 197 ILE B C     1 
ATOM   4592  O O     . ILE B 1 197 ? 100.963 -25.666  51.197  1.00 99.21  ? 197 ILE B O     1 
ATOM   4593  C CB    . ILE B 1 197 ? 97.873  -25.733  52.443  1.00 99.34  ? 197 ILE B CB    1 
ATOM   4594  C CG1   . ILE B 1 197 ? 96.373  -25.678  52.119  1.00 99.07  ? 197 ILE B CG1   1 
ATOM   4595  C CG2   . ILE B 1 197 ? 98.401  -24.331  52.711  1.00 99.89  ? 197 ILE B CG2   1 
ATOM   4596  C CD1   . ILE B 1 197 ? 95.450  -25.506  53.327  1.00 99.69  ? 197 ILE B CD1   1 
ATOM   4597  N N     . ASP B 1 198 ? 100.529 -27.439  52.530  1.00 100.99 ? 198 ASP B N     1 
ATOM   4598  C CA    . ASP B 1 198 ? 101.901 -27.589  53.034  1.00 102.50 ? 198 ASP B CA    1 
ATOM   4599  C C     . ASP B 1 198 ? 102.885 -27.934  51.921  1.00 101.70 ? 198 ASP B C     1 
ATOM   4600  O O     . ASP B 1 198 ? 103.859 -27.212  51.695  1.00 101.80 ? 198 ASP B O     1 
ATOM   4601  C CB    . ASP B 1 198 ? 101.972 -28.665  54.131  1.00 103.67 ? 198 ASP B CB    1 
ATOM   4602  C CG    . ASP B 1 198 ? 100.977 -28.432  55.261  1.00 105.46 ? 198 ASP B CG    1 
ATOM   4603  O OD1   . ASP B 1 198 ? 101.109 -27.410  55.979  1.00 106.20 ? 198 ASP B OD1   1 
ATOM   4604  O OD2   . ASP B 1 198 ? 100.073 -29.288  55.433  1.00 105.82 ? 198 ASP B OD2   1 
ATOM   4605  N N     . SER B 1 199 ? 102.611 -29.037  51.229  1.00 101.35 ? 199 SER B N     1 
ATOM   4606  C CA    . SER B 1 199 ? 103.492 -29.561  50.183  1.00 101.01 ? 199 SER B CA    1 
ATOM   4607  C C     . SER B 1 199 ? 103.607 -28.632  48.976  1.00 100.49 ? 199 SER B C     1 
ATOM   4608  O O     . SER B 1 199 ? 104.626 -28.640  48.277  1.00 99.95  ? 199 SER B O     1 
ATOM   4609  C CB    . SER B 1 199 ? 103.008 -30.938  49.735  1.00 100.27 ? 199 SER B CB    1 
ATOM   4610  O OG    . SER B 1 199 ? 101.622 -30.906  49.443  1.00 99.90  ? 199 SER B OG    1 
ATOM   4611  N N     . LEU B 1 200 ? 102.562 -27.838  48.743  1.00 100.94 ? 200 LEU B N     1 
ATOM   4612  C CA    . LEU B 1 200 ? 102.544 -26.880  47.641  1.00 100.73 ? 200 LEU B CA    1 
ATOM   4613  C C     . LEU B 1 200 ? 103.279 -25.586  47.983  1.00 102.18 ? 200 LEU B C     1 
ATOM   4614  O O     . LEU B 1 200 ? 103.911 -24.988  47.110  1.00 101.76 ? 200 LEU B O     1 
ATOM   4615  C CB    . LEU B 1 200 ? 101.110 -26.599  47.180  1.00 100.12 ? 200 LEU B CB    1 
ATOM   4616  C CG    . LEU B 1 200 ? 100.336 -27.750  46.519  1.00 98.96  ? 200 LEU B CG    1 
ATOM   4617  C CD1   . LEU B 1 200 ? 98.924  -27.314  46.175  1.00 98.70  ? 200 LEU B CD1   1 
ATOM   4618  C CD2   . LEU B 1 200 ? 101.029 -28.300  45.276  1.00 97.32  ? 200 LEU B CD2   1 
ATOM   4619  N N     . LYS B 1 201 ? 103.196 -25.158  49.245  1.00 104.44 ? 201 LYS B N     1 
ATOM   4620  C CA    . LYS B 1 201 ? 103.988 -24.024  49.740  1.00 106.25 ? 201 LYS B CA    1 
ATOM   4621  C C     . LYS B 1 201 ? 105.468 -24.344  49.633  1.00 106.68 ? 201 LYS B C     1 
ATOM   4622  O O     . LYS B 1 201 ? 106.281 -23.459  49.373  1.00 106.85 ? 201 LYS B O     1 
ATOM   4623  C CB    . LYS B 1 201 ? 103.644 -23.700  51.198  1.00 107.95 ? 201 LYS B CB    1 
ATOM   4624  C CG    . LYS B 1 201 ? 102.603 -22.586  51.388  1.00 109.16 ? 201 LYS B CG    1 
ATOM   4625  C CD    . LYS B 1 201 ? 103.228 -21.179  51.472  1.00 109.96 ? 201 LYS B CD    1 
ATOM   4626  C CE    . LYS B 1 201 ? 103.494 -20.750  52.914  1.00 111.46 ? 201 LYS B CE    1 
ATOM   4627  N NZ    . LYS B 1 201 ? 102.240 -20.504  53.681  1.00 111.96 ? 201 LYS B NZ    1 
ATOM   4628  N N     . GLU B 1 202 ? 105.790 -25.623  49.818  1.00 107.27 ? 202 GLU B N     1 
ATOM   4629  C CA    . GLU B 1 202 ? 107.155 -26.141  49.788  1.00 108.13 ? 202 GLU B CA    1 
ATOM   4630  C C     . GLU B 1 202 ? 107.766 -26.194  48.371  1.00 107.24 ? 202 GLU B C     1 
ATOM   4631  O O     . GLU B 1 202 ? 108.712 -26.951  48.116  1.00 107.02 ? 202 GLU B O     1 
ATOM   4632  C CB    . GLU B 1 202 ? 107.171 -27.529  50.435  1.00 108.55 ? 202 GLU B CB    1 
ATOM   4633  C CG    . GLU B 1 202 ? 108.526 -27.985  50.969  1.00 110.27 ? 202 GLU B CG    1 
ATOM   4634  C CD    . GLU B 1 202 ? 108.486 -29.406  51.525  1.00 112.00 ? 202 GLU B CD    1 
ATOM   4635  O OE1   . GLU B 1 202 ? 107.384 -29.879  51.894  1.00 112.47 ? 202 GLU B OE1   1 
ATOM   4636  O OE2   . GLU B 1 202 ? 109.558 -30.052  51.592  1.00 112.30 ? 202 GLU B OE2   1 
ATOM   4637  N N     . LEU B 1 203 ? 107.214 -25.400  47.452  1.00 107.14 ? 203 LEU B N     1 
ATOM   4638  C CA    . LEU B 1 203 ? 107.845 -25.153  46.150  1.00 106.56 ? 203 LEU B CA    1 
ATOM   4639  C C     . LEU B 1 203 ? 107.645 -23.701  45.726  1.00 106.74 ? 203 LEU B C     1 
ATOM   4640  O O     . LEU B 1 203 ? 108.157 -23.268  44.695  1.00 106.13 ? 203 LEU B O     1 
ATOM   4641  C CB    . LEU B 1 203 ? 107.313 -26.095  45.070  1.00 105.47 ? 203 LEU B CB    1 
ATOM   4642  C CG    . LEU B 1 203 ? 108.262 -26.689  44.006  1.00 105.32 ? 203 LEU B CG    1 
ATOM   4643  C CD1   . LEU B 1 203 ? 107.547 -26.718  42.648  1.00 105.35 ? 203 LEU B CD1   1 
ATOM   4644  C CD2   . LEU B 1 203 ? 109.630 -25.993  43.860  1.00 105.86 ? 203 LEU B CD2   1 
ATOM   4645  N N     . GLY B 1 204 ? 106.888 -22.956  46.524  1.00 107.92 ? 204 GLY B N     1 
ATOM   4646  C CA    . GLY B 1 204 ? 106.805 -21.515  46.362  1.00 108.59 ? 204 GLY B CA    1 
ATOM   4647  C C     . GLY B 1 204 ? 105.619 -21.018  45.569  1.00 108.19 ? 204 GLY B C     1 
ATOM   4648  O O     . GLY B 1 204 ? 105.623 -19.873  45.120  1.00 108.56 ? 204 GLY B O     1 
ATOM   4649  N N     . PHE B 1 205 ? 104.609 -21.868  45.384  1.00 107.66 ? 205 PHE B N     1 
ATOM   4650  C CA    . PHE B 1 205 ? 103.356 -21.413  44.788  1.00 107.56 ? 205 PHE B CA    1 
ATOM   4651  C C     . PHE B 1 205 ? 102.705 -20.433  45.757  1.00 109.06 ? 205 PHE B C     1 
ATOM   4652  O O     . PHE B 1 205 ? 102.697 -20.660  46.966  1.00 110.04 ? 205 PHE B O     1 
ATOM   4653  C CB    . PHE B 1 205 ? 102.417 -22.583  44.464  1.00 106.75 ? 205 PHE B CB    1 
ATOM   4654  C CG    . PHE B 1 205 ? 102.936 -23.510  43.386  1.00 105.53 ? 205 PHE B CG    1 
ATOM   4655  C CD1   . PHE B 1 205 ? 103.287 -24.825  43.687  1.00 104.88 ? 205 PHE B CD1   1 
ATOM   4656  C CD2   . PHE B 1 205 ? 103.074 -23.068  42.068  1.00 105.08 ? 205 PHE B CD2   1 
ATOM   4657  C CE1   . PHE B 1 205 ? 103.766 -25.684  42.698  1.00 103.66 ? 205 PHE B CE1   1 
ATOM   4658  C CE2   . PHE B 1 205 ? 103.559 -23.922  41.070  1.00 103.52 ? 205 PHE B CE2   1 
ATOM   4659  C CZ    . PHE B 1 205 ? 103.903 -25.229  41.388  1.00 103.01 ? 205 PHE B CZ    1 
ATOM   4660  N N     . ASN B 1 206 ? 102.192 -19.327  45.227  1.00 109.53 ? 206 ASN B N     1 
ATOM   4661  C CA    . ASN B 1 206 ? 101.688 -18.246  46.069  1.00 111.03 ? 206 ASN B CA    1 
ATOM   4662  C C     . ASN B 1 206 ? 100.330 -18.542  46.698  1.00 111.35 ? 206 ASN B C     1 
ATOM   4663  O O     . ASN B 1 206 ? 99.497  -19.253  46.120  1.00 110.31 ? 206 ASN B O     1 
ATOM   4664  C CB    . ASN B 1 206 ? 101.661 -16.912  45.308  1.00 111.47 ? 206 ASN B CB    1 
ATOM   4665  C CG    . ASN B 1 206 ? 100.503 -16.815  44.335  1.00 111.33 ? 206 ASN B CG    1 
ATOM   4666  O OD1   . ASN B 1 206 ? 100.593 -17.269  43.191  1.00 110.79 ? 206 ASN B OD1   1 
ATOM   4667  N ND2   . ASN B 1 206 ? 99.404  -16.215  44.786  1.00 112.76 ? 206 ASN B ND2   1 
ATOM   4668  N N     . GLU B 1 207 ? 100.136 -17.975  47.887  1.00 112.76 ? 207 GLU B N     1 
ATOM   4669  C CA    . GLU B 1 207 ? 98.915  -18.107  48.673  1.00 113.48 ? 207 GLU B CA    1 
ATOM   4670  C C     . GLU B 1 207 ? 97.667  -18.351  47.819  1.00 112.33 ? 207 GLU B C     1 
ATOM   4671  O O     . GLU B 1 207 ? 97.043  -19.411  47.914  1.00 111.66 ? 207 GLU B O     1 
ATOM   4672  C CB    . GLU B 1 207 ? 98.736  -16.852  49.540  1.00 115.56 ? 207 GLU B CB    1 
ATOM   4673  C CG    . GLU B 1 207 ? 97.644  -16.944  50.610  1.00 117.76 ? 207 GLU B CG    1 
ATOM   4674  C CD    . GLU B 1 207 ? 98.072  -17.721  51.849  1.00 119.79 ? 207 GLU B CD    1 
ATOM   4675  O OE1   . GLU B 1 207 ? 97.194  -17.986  52.699  1.00 121.24 ? 207 GLU B OE1   1 
ATOM   4676  O OE2   . GLU B 1 207 ? 99.273  -18.061  51.980  1.00 120.09 ? 207 GLU B OE2   1 
ATOM   4677  N N     . GLN B 1 208 ? 97.332  -17.374  46.976  1.00 112.00 ? 208 GLN B N     1 
ATOM   4678  C CA    . GLN B 1 208 ? 96.079  -17.378  46.214  1.00 111.19 ? 208 GLN B CA    1 
ATOM   4679  C C     . GLN B 1 208 ? 95.991  -18.518  45.200  1.00 108.99 ? 208 GLN B C     1 
ATOM   4680  O O     . GLN B 1 208 ? 94.909  -19.074  44.983  1.00 108.66 ? 208 GLN B O     1 
ATOM   4681  C CB    . GLN B 1 208 ? 95.870  -16.033  45.512  1.00 111.96 ? 208 GLN B CB    1 
ATOM   4682  C CG    . GLN B 1 208 ? 95.817  -14.828  46.456  1.00 114.58 ? 208 GLN B CG    1 
ATOM   4683  C CD    . GLN B 1 208 ? 96.279  -13.538  45.789  1.00 116.18 ? 208 GLN B CD    1 
ATOM   4684  O OE1   . GLN B 1 208 ? 95.781  -13.158  44.726  1.00 116.57 ? 208 GLN B OE1   1 
ATOM   4685  N NE2   . GLN B 1 208 ? 97.235  -12.857  46.414  1.00 116.93 ? 208 GLN B NE2   1 
ATOM   4686  N N     . ARG B 1 209 ? 97.120  -18.869  44.588  1.00 107.26 ? 209 ARG B N     1 
ATOM   4687  C CA    . ARG B 1 209 ? 97.109  -19.898  43.556  1.00 105.11 ? 209 ARG B CA    1 
ATOM   4688  C C     . ARG B 1 209 ? 96.910  -21.293  44.139  1.00 103.96 ? 209 ARG B C     1 
ATOM   4689  O O     . ARG B 1 209 ? 96.160  -22.096  43.573  1.00 103.19 ? 209 ARG B O     1 
ATOM   4690  C CB    . ARG B 1 209 ? 98.358  -19.839  42.676  1.00 104.46 ? 209 ARG B CB    1 
ATOM   4691  C CG    . ARG B 1 209 ? 98.064  -20.151  41.204  1.00 104.02 ? 209 ARG B CG    1 
ATOM   4692  C CD    . ARG B 1 209 ? 99.268  -20.739  40.498  1.00 104.35 ? 209 ARG B CD    1 
ATOM   4693  N NE    . ARG B 1 209 ? 100.379 -19.795  40.416  1.00 106.45 ? 209 ARG B NE    1 
ATOM   4694  C CZ    . ARG B 1 209 ? 100.830 -19.253  39.287  1.00 107.12 ? 209 ARG B CZ    1 
ATOM   4695  N NH1   . ARG B 1 209 ? 100.274 -19.568  38.122  1.00 106.97 ? 209 ARG B NH1   1 
ATOM   4696  N NH2   . ARG B 1 209 ? 101.849 -18.400  39.321  1.00 107.61 ? 209 ARG B NH2   1 
ATOM   4697  N N     . ILE B 1 210 ? 97.560  -21.567  45.272  1.00 103.57 ? 210 ILE B N     1 
ATOM   4698  C CA    . ILE B 1 210 ? 97.418  -22.856  45.969  1.00 102.47 ? 210 ILE B CA    1 
ATOM   4699  C C     . ILE B 1 210 ? 95.951  -23.182  46.229  1.00 102.33 ? 210 ILE B C     1 
ATOM   4700  O O     . ILE B 1 210 ? 95.517  -24.325  46.070  1.00 101.49 ? 210 ILE B O     1 
ATOM   4701  C CB    . ILE B 1 210 ? 98.207  -22.893  47.298  1.00 103.24 ? 210 ILE B CB    1 
ATOM   4702  C CG1   . ILE B 1 210 ? 99.705  -22.768  47.026  1.00 102.64 ? 210 ILE B CG1   1 
ATOM   4703  C CG2   . ILE B 1 210 ? 97.932  -24.183  48.056  1.00 102.93 ? 210 ILE B CG2   1 
ATOM   4704  C CD1   . ILE B 1 210 ? 100.553 -22.610  48.261  1.00 103.62 ? 210 ILE B CD1   1 
ATOM   4705  N N     . ASN B 1 211 ? 95.198  -22.155  46.613  1.00 102.87 ? 211 ASN B N     1 
ATOM   4706  C CA    . ASN B 1 211 ? 93.767  -22.278  46.863  1.00 102.82 ? 211 ASN B CA    1 
ATOM   4707  C C     . ASN B 1 211 ? 92.942  -22.619  45.628  1.00 101.40 ? 211 ASN B C     1 
ATOM   4708  O O     . ASN B 1 211 ? 92.007  -23.426  45.706  1.00 101.25 ? 211 ASN B O     1 
ATOM   4709  C CB    . ASN B 1 211 ? 93.237  -21.003  47.511  1.00 104.21 ? 211 ASN B CB    1 
ATOM   4710  C CG    . ASN B 1 211 ? 93.716  -20.843  48.930  1.00 105.66 ? 211 ASN B CG    1 
ATOM   4711  O OD1   . ASN B 1 211 ? 93.673  -21.785  49.726  1.00 105.64 ? 211 ASN B OD1   1 
ATOM   4712  N ND2   . ASN B 1 211 ? 94.182  -19.645  49.260  1.00 107.51 ? 211 ASN B ND2   1 
ATOM   4713  N N     . ARG B 1 212 ? 93.290  -22.007  44.497  1.00 100.18 ? 212 ARG B N     1 
ATOM   4714  C CA    . ARG B 1 212 ? 92.584  -22.259  43.245  1.00 98.69  ? 212 ARG B CA    1 
ATOM   4715  C C     . ARG B 1 212 ? 92.860  -23.677  42.732  1.00 96.69  ? 212 ARG B C     1 
ATOM   4716  O O     . ARG B 1 212 ? 91.960  -24.341  42.220  1.00 96.05  ? 212 ARG B O     1 
ATOM   4717  C CB    . ARG B 1 212 ? 92.953  -21.212  42.198  1.00 98.79  ? 212 ARG B CB    1 
ATOM   4718  C CG    . ARG B 1 212 ? 91.790  -20.810  41.288  1.00 100.09 ? 212 ARG B CG    1 
ATOM   4719  C CD    . ARG B 1 212 ? 92.236  -19.836  40.200  1.00 102.26 ? 212 ARG B CD    1 
ATOM   4720  N NE    . ARG B 1 212 ? 93.215  -18.866  40.700  1.00 104.73 ? 212 ARG B NE    1 
ATOM   4721  C CZ    . ARG B 1 212 ? 93.934  -18.047  39.934  1.00 106.01 ? 212 ARG B CZ    1 
ATOM   4722  N NH1   . ARG B 1 212 ? 93.790  -18.060  38.611  1.00 106.30 ? 212 ARG B NH1   1 
ATOM   4723  N NH2   . ARG B 1 212 ? 94.801  -17.209  40.494  1.00 107.06 ? 212 ARG B NH2   1 
ATOM   4724  N N     . ILE B 1 213 ? 94.101  -24.133  42.890  1.00 95.28  ? 213 ILE B N     1 
ATOM   4725  C CA    . ILE B 1 213 ? 94.480  -25.499  42.540  1.00 93.65  ? 213 ILE B CA    1 
ATOM   4726  C C     . ILE B 1 213 ? 93.684  -26.516  43.362  1.00 93.74  ? 213 ILE B C     1 
ATOM   4727  O O     . ILE B 1 213 ? 93.047  -27.412  42.800  1.00 93.27  ? 213 ILE B O     1 
ATOM   4728  C CB    . ILE B 1 213 ? 96.002  -25.737  42.722  1.00 93.26  ? 213 ILE B CB    1 
ATOM   4729  C CG1   . ILE B 1 213 ? 96.804  -24.824  41.790  1.00 92.76  ? 213 ILE B CG1   1 
ATOM   4730  C CG2   . ILE B 1 213 ? 96.363  -27.196  42.464  1.00 92.17  ? 213 ILE B CG2   1 
ATOM   4731  C CD1   . ILE B 1 213 ? 98.271  -24.663  42.172  1.00 92.04  ? 213 ILE B CD1   1 
ATOM   4732  N N     . LEU B 1 214 ? 93.712  -26.360  44.688  1.00 94.32  ? 214 LEU B N     1 
ATOM   4733  C CA    . LEU B 1 214 ? 93.053  -27.292  45.615  1.00 94.22  ? 214 LEU B CA    1 
ATOM   4734  C C     . LEU B 1 214 ? 91.536  -27.317  45.467  1.00 94.31  ? 214 LEU B C     1 
ATOM   4735  O O     . LEU B 1 214 ? 90.914  -28.375  45.583  1.00 94.15  ? 214 LEU B O     1 
ATOM   4736  C CB    . LEU B 1 214 ? 93.425  -26.977  47.062  1.00 95.05  ? 214 LEU B CB    1 
ATOM   4737  C CG    . LEU B 1 214 ? 94.884  -27.151  47.468  1.00 94.64  ? 214 LEU B CG    1 
ATOM   4738  C CD1   . LEU B 1 214 ? 95.082  -26.612  48.862  1.00 95.65  ? 214 LEU B CD1   1 
ATOM   4739  C CD2   . LEU B 1 214 ? 95.314  -28.601  47.385  1.00 93.44  ? 214 LEU B CD2   1 
ATOM   4740  N N     . ASP B 1 215 ? 90.946  -26.151  45.219  1.00 94.56  ? 215 ASP B N     1 
ATOM   4741  C CA    . ASP B 1 215 ? 89.516  -26.069  44.957  1.00 94.82  ? 215 ASP B CA    1 
ATOM   4742  C C     . ASP B 1 215 ? 89.151  -26.783  43.656  1.00 93.80  ? 215 ASP B C     1 
ATOM   4743  O O     . ASP B 1 215 ? 88.144  -27.497  43.603  1.00 94.02  ? 215 ASP B O     1 
ATOM   4744  C CB    . ASP B 1 215 ? 89.042  -24.620  44.917  1.00 95.58  ? 215 ASP B CB    1 
ATOM   4745  C CG    . ASP B 1 215 ? 87.528  -24.507  44.905  1.00 97.04  ? 215 ASP B CG    1 
ATOM   4746  O OD1   . ASP B 1 215 ? 86.993  -23.816  44.017  1.00 97.54  ? 215 ASP B OD1   1 
ATOM   4747  O OD2   . ASP B 1 215 ? 86.866  -25.120  45.777  1.00 99.20  ? 215 ASP B OD2   1 
ATOM   4748  N N     . ALA B 1 216 ? 89.980  -26.588  42.622  1.00 92.82  ? 216 ALA B N     1 
ATOM   4749  C CA    . ALA B 1 216 ? 89.825  -27.251  41.318  1.00 91.38  ? 216 ALA B CA    1 
ATOM   4750  C C     . ALA B 1 216 ? 89.973  -28.759  41.422  1.00 90.72  ? 216 ALA B C     1 
ATOM   4751  O O     . ALA B 1 216 ? 89.276  -29.494  40.734  1.00 90.19  ? 216 ALA B O     1 
ATOM   4752  C CB    . ALA B 1 216 ? 90.818  -26.703  40.321  1.00 90.82  ? 216 ALA B CB    1 
ATOM   4753  N N     . ALA B 1 217 ? 90.887  -29.208  42.280  1.00 90.69  ? 217 ALA B N     1 
ATOM   4754  C CA    . ALA B 1 217 ? 91.066  -30.630  42.546  1.00 90.67  ? 217 ALA B CA    1 
ATOM   4755  C C     . ALA B 1 217 ? 89.878  -31.207  43.319  1.00 91.49  ? 217 ALA B C     1 
ATOM   4756  O O     . ALA B 1 217 ? 89.493  -32.361  43.101  1.00 91.71  ? 217 ALA B O     1 
ATOM   4757  C CB    . ALA B 1 217 ? 92.360  -30.874  43.294  1.00 90.57  ? 217 ALA B CB    1 
ATOM   4758  N N     . LYS B 1 218 ? 89.301  -30.405  44.215  1.00 92.17  ? 218 LYS B N     1 
ATOM   4759  C CA    . LYS B 1 218 ? 88.132  -30.824  44.981  1.00 92.70  ? 218 LYS B CA    1 
ATOM   4760  C C     . LYS B 1 218 ? 86.925  -31.002  44.066  1.00 92.12  ? 218 LYS B C     1 
ATOM   4761  O O     . LYS B 1 218 ? 86.309  -32.063  44.054  1.00 92.11  ? 218 LYS B O     1 
ATOM   4762  C CB    . LYS B 1 218 ? 87.832  -29.823  46.105  1.00 93.92  ? 218 LYS B CB    1 
ATOM   4763  C CG    . LYS B 1 218 ? 86.546  -30.116  46.905  1.00 95.65  ? 218 LYS B CG    1 
ATOM   4764  C CD    . LYS B 1 218 ? 86.593  -29.526  48.313  1.00 97.72  ? 218 LYS B CD    1 
ATOM   4765  C CE    . LYS B 1 218 ? 87.400  -30.418  49.262  1.00 98.51  ? 218 LYS B CE    1 
ATOM   4766  N NZ    . LYS B 1 218 ? 87.522  -29.833  50.628  1.00 100.18 ? 218 LYS B NZ    1 
ATOM   4767  N N     . LYS B 1 219 ? 86.617  -29.967  43.288  1.00 91.71  ? 219 LYS B N     1 
ATOM   4768  C CA    . LYS B 1 219 ? 85.460  -29.972  42.390  1.00 91.56  ? 219 LYS B CA    1 
ATOM   4769  C C     . LYS B 1 219 ? 85.747  -30.570  41.008  1.00 90.68  ? 219 LYS B C     1 
ATOM   4770  O O     . LYS B 1 219 ? 84.995  -30.314  40.068  1.00 90.72  ? 219 LYS B O     1 
ATOM   4771  C CB    . LYS B 1 219 ? 84.917  -28.548  42.202  1.00 91.96  ? 219 LYS B CB    1 
ATOM   4772  C CG    . LYS B 1 219 ? 84.495  -27.833  43.471  1.00 93.06  ? 219 LYS B CG    1 
ATOM   4773  C CD    . LYS B 1 219 ? 83.750  -26.549  43.134  1.00 93.65  ? 219 LYS B CD    1 
ATOM   4774  C CE    . LYS B 1 219 ? 83.774  -25.559  44.292  1.00 95.15  ? 219 LYS B CE    1 
ATOM   4775  N NZ    . LYS B 1 219 ? 82.993  -26.025  45.482  1.00 96.18  ? 219 LYS B NZ    1 
ATOM   4776  N N     . SER B 1 220 ? 86.818  -31.357  40.886  1.00 90.01  ? 220 SER B N     1 
ATOM   4777  C CA    . SER B 1 220 ? 87.253  -31.901  39.590  1.00 89.04  ? 220 SER B CA    1 
ATOM   4778  C C     . SER B 1 220 ? 86.295  -32.929  39.002  1.00 88.87  ? 220 SER B C     1 
ATOM   4779  O O     . SER B 1 220 ? 85.827  -33.827  39.702  1.00 89.31  ? 220 SER B O     1 
ATOM   4780  C CB    . SER B 1 220 ? 88.651  -32.513  39.692  1.00 88.68  ? 220 SER B CB    1 
ATOM   4781  O OG    . SER B 1 220 ? 89.067  -33.043  38.440  1.00 88.30  ? 220 SER B OG    1 
ATOM   4782  N N     . ILE B 1 221 ? 86.024  -32.787  37.707  1.00 88.23  ? 221 ILE B N     1 
ATOM   4783  C CA    . ILE B 1 221 ? 85.200  -33.735  36.957  1.00 87.90  ? 221 ILE B CA    1 
ATOM   4784  C C     . ILE B 1 221 ? 86.087  -34.743  36.230  1.00 87.25  ? 221 ILE B C     1 
ATOM   4785  O O     . ILE B 1 221 ? 85.735  -35.259  35.167  1.00 86.98  ? 221 ILE B O     1 
ATOM   4786  C CB    . ILE B 1 221 ? 84.251  -33.019  35.960  1.00 88.18  ? 221 ILE B CB    1 
ATOM   4787  C CG1   . ILE B 1 221 ? 85.010  -31.977  35.137  1.00 87.82  ? 221 ILE B CG1   1 
ATOM   4788  C CG2   . ILE B 1 221 ? 83.093  -32.370  36.702  1.00 88.63  ? 221 ILE B CG2   1 
ATOM   4789  C CD1   . ILE B 1 221 ? 84.370  -31.667  33.815  1.00 88.98  ? 221 ILE B CD1   1 
ATOM   4790  N N     . GLY B 1 222 ? 87.243  -35.014  36.826  1.00 86.96  ? 222 GLY B N     1 
ATOM   4791  C CA    . GLY B 1 222 ? 88.210  -35.953  36.273  1.00 86.90  ? 222 GLY B CA    1 
ATOM   4792  C C     . GLY B 1 222 ? 87.835  -37.388  36.563  1.00 87.43  ? 222 GLY B C     1 
ATOM   4793  O O     . GLY B 1 222 ? 86.758  -37.661  37.084  1.00 88.17  ? 222 GLY B O     1 
ATOM   4794  N N     . ALA B 1 223 ? 88.721  -38.312  36.224  1.00 87.36  ? 223 ALA B N     1 
ATOM   4795  C CA    . ALA B 1 223 ? 88.445  -39.722  36.432  1.00 88.07  ? 223 ALA B CA    1 
ATOM   4796  C C     . ALA B 1 223 ? 89.183  -40.249  37.649  1.00 88.48  ? 223 ALA B C     1 
ATOM   4797  O O     . ALA B 1 223 ? 90.297  -39.821  37.946  1.00 88.17  ? 223 ALA B O     1 
ATOM   4798  C CB    . ALA B 1 223 ? 88.815  -40.522  35.200  1.00 88.18  ? 223 ALA B CB    1 
ATOM   4799  N N     . ASP B 1 224 ? 88.544  -41.174  38.357  1.00 89.40  ? 224 ASP B N     1 
ATOM   4800  C CA    . ASP B 1 224 ? 89.199  -41.879  39.443  1.00 90.07  ? 224 ASP B CA    1 
ATOM   4801  C C     . ASP B 1 224 ? 89.953  -43.069  38.879  1.00 90.18  ? 224 ASP B C     1 
ATOM   4802  O O     . ASP B 1 224 ? 89.402  -43.872  38.120  1.00 90.46  ? 224 ASP B O     1 
ATOM   4803  C CB    . ASP B 1 224 ? 88.199  -42.288  40.519  1.00 91.18  ? 224 ASP B CB    1 
ATOM   4804  C CG    . ASP B 1 224 ? 87.910  -41.158  41.497  1.00 92.20  ? 224 ASP B CG    1 
ATOM   4805  O OD1   . ASP B 1 224 ? 87.972  -39.974  41.079  1.00 92.48  ? 224 ASP B OD1   1 
ATOM   4806  O OD2   . ASP B 1 224 ? 87.628  -41.456  42.684  1.00 93.56  ? 224 ASP B OD2   1 
ATOM   4807  N N     . ILE B 1 225 ? 91.219  -43.170  39.272  1.00 89.91  ? 225 ILE B N     1 
ATOM   4808  C CA    . ILE B 1 225 ? 92.213  -43.921  38.520  1.00 89.57  ? 225 ILE B CA    1 
ATOM   4809  C C     . ILE B 1 225 ? 93.221  -44.578  39.453  1.00 89.63  ? 225 ILE B C     1 
ATOM   4810  O O     . ILE B 1 225 ? 93.553  -44.015  40.498  1.00 89.60  ? 225 ILE B O     1 
ATOM   4811  C CB    . ILE B 1 225 ? 92.867  -42.970  37.470  1.00 88.85  ? 225 ILE B CB    1 
ATOM   4812  C CG1   . ILE B 1 225 ? 92.407  -43.357  36.066  1.00 89.33  ? 225 ILE B CG1   1 
ATOM   4813  C CG2   . ILE B 1 225 ? 94.394  -42.913  37.577  1.00 88.91  ? 225 ILE B CG2   1 
ATOM   4814  C CD1   . ILE B 1 225 ? 92.554  -42.252  35.055  1.00 90.21  ? 225 ILE B CD1   1 
ATOM   4815  N N     . SER B 1 226 ? 93.694  -45.765  39.068  1.00 89.81  ? 226 SER B N     1 
ATOM   4816  C CA    . SER B 1 226 ? 94.580  -46.584  39.905  1.00 90.41  ? 226 SER B CA    1 
ATOM   4817  C C     . SER B 1 226 ? 95.984  -45.999  40.074  1.00 89.99  ? 226 SER B C     1 
ATOM   4818  O O     . SER B 1 226 ? 96.387  -45.108  39.328  1.00 89.10  ? 226 SER B O     1 
ATOM   4819  C CB    . SER B 1 226 ? 94.687  -48.000  39.340  1.00 91.34  ? 226 SER B CB    1 
ATOM   4820  O OG    . SER B 1 226 ? 95.683  -48.071  38.335  1.00 90.71  ? 226 SER B OG    1 
ATOM   4821  N N     . GLU B 1 227 ? 96.724  -46.515  41.056  1.00 90.69  ? 227 GLU B N     1 
ATOM   4822  C CA    . GLU B 1 227 ? 98.107  -46.096  41.289  1.00 90.39  ? 227 GLU B CA    1 
ATOM   4823  C C     . GLU B 1 227 ? 99.027  -46.533  40.160  1.00 89.64  ? 227 GLU B C     1 
ATOM   4824  O O     . GLU B 1 227 ? 100.021 -45.859  39.883  1.00 89.13  ? 227 GLU B O     1 
ATOM   4825  C CB    . GLU B 1 227 ? 98.640  -46.608  42.632  1.00 91.77  ? 227 GLU B CB    1 
ATOM   4826  C CG    . GLU B 1 227 ? 98.165  -45.805  43.844  1.00 94.04  ? 227 GLU B CG    1 
ATOM   4827  C CD    . GLU B 1 227 ? 98.527  -44.325  43.762  1.00 95.74  ? 227 GLU B CD    1 
ATOM   4828  O OE1   . GLU B 1 227 ? 97.618  -43.497  43.505  1.00 95.72  ? 227 GLU B OE1   1 
ATOM   4829  O OE2   . GLU B 1 227 ? 99.721  -43.996  43.946  1.00 97.15  ? 227 GLU B OE2   1 
ATOM   4830  N N     . ASP B 1 228 ? 98.697  -47.652  39.514  1.00 89.46  ? 228 ASP B N     1 
ATOM   4831  C CA    . ASP B 1 228 ? 99.422  -48.099  38.319  1.00 88.63  ? 228 ASP B CA    1 
ATOM   4832  C C     . ASP B 1 228 ? 99.302  -47.095  37.173  1.00 86.43  ? 228 ASP B C     1 
ATOM   4833  O O     . ASP B 1 228 ? 100.278 -46.831  36.474  1.00 86.09  ? 228 ASP B O     1 
ATOM   4834  C CB    . ASP B 1 228 ? 98.926  -49.469  37.845  1.00 89.98  ? 228 ASP B CB    1 
ATOM   4835  C CG    . ASP B 1 228 ? 99.343  -50.597  38.765  1.00 92.13  ? 228 ASP B CG    1 
ATOM   4836  O OD1   . ASP B 1 228 ? 100.456 -50.546  39.344  1.00 92.94  ? 228 ASP B OD1   1 
ATOM   4837  O OD2   . ASP B 1 228 ? 98.548  -51.549  38.898  1.00 94.08  ? 228 ASP B OD2   1 
ATOM   4838  N N     . ASP B 1 229 ? 98.103  -46.546  36.989  1.00 84.61  ? 229 ASP B N     1 
ATOM   4839  C CA    . ASP B 1 229 ? 97.852  -45.566  35.946  1.00 82.41  ? 229 ASP B CA    1 
ATOM   4840  C C     . ASP B 1 229 ? 98.615  -44.279  36.211  1.00 80.89  ? 229 ASP B C     1 
ATOM   4841  O O     . ASP B 1 229 ? 99.233  -43.720  35.304  1.00 80.57  ? 229 ASP B O     1 
ATOM   4842  C CB    . ASP B 1 229 ? 96.364  -45.251  35.844  1.00 82.17  ? 229 ASP B CB    1 
ATOM   4843  C CG    . ASP B 1 229 ? 95.535  -46.448  35.446  1.00 83.01  ? 229 ASP B CG    1 
ATOM   4844  O OD1   . ASP B 1 229 ? 94.335  -46.473  35.788  1.00 82.70  ? 229 ASP B OD1   1 
ATOM   4845  O OD2   . ASP B 1 229 ? 96.073  -47.363  34.788  1.00 84.15  ? 229 ASP B OD2   1 
ATOM   4846  N N     . LEU B 1 230 ? 98.576  -43.805  37.451  1.00 79.68  ? 230 LEU B N     1 
ATOM   4847  C CA    . LEU B 1 230 ? 99.222  -42.545  37.774  1.00 77.72  ? 230 LEU B CA    1 
ATOM   4848  C C     . LEU B 1 230 ? 100.735 -42.619  37.625  1.00 76.84  ? 230 LEU B C     1 
ATOM   4849  O O     . LEU B 1 230 ? 101.327 -41.712  37.060  1.00 76.29  ? 230 LEU B O     1 
ATOM   4850  C CB    . LEU B 1 230 ? 98.823  -42.050  39.162  1.00 78.08  ? 230 LEU B CB    1 
ATOM   4851  C CG    . LEU B 1 230 ? 97.371  -41.593  39.302  1.00 77.83  ? 230 LEU B CG    1 
ATOM   4852  C CD1   . LEU B 1 230 ? 96.894  -41.769  40.735  1.00 80.20  ? 230 LEU B CD1   1 
ATOM   4853  C CD2   . LEU B 1 230 ? 97.196  -40.162  38.860  1.00 76.90  ? 230 LEU B CD2   1 
ATOM   4854  N N     . SER B 1 231 ? 101.362 -43.694  38.099  1.00 76.45  ? 231 SER B N     1 
ATOM   4855  C CA    . SER B 1 231 ? 102.823 -43.773  38.023  1.00 75.58  ? 231 SER B CA    1 
ATOM   4856  C C     . SER B 1 231 ? 103.315 -43.874  36.583  1.00 74.20  ? 231 SER B C     1 
ATOM   4857  O O     . SER B 1 231 ? 104.403 -43.381  36.253  1.00 73.87  ? 231 SER B O     1 
ATOM   4858  C CB    . SER B 1 231 ? 103.409 -44.871  38.917  1.00 76.77  ? 231 SER B CB    1 
ATOM   4859  O OG    . SER B 1 231 ? 102.455 -45.871  39.189  1.00 78.20  ? 231 SER B OG    1 
ATOM   4860  N N     . ALA B 1 232 ? 102.501 -44.470  35.720  1.00 72.89  ? 232 ALA B N     1 
ATOM   4861  C CA    . ALA B 1 232 ? 102.811 -44.467  34.299  1.00 71.27  ? 232 ALA B CA    1 
ATOM   4862  C C     . ALA B 1 232 ? 103.043 -43.026  33.848  1.00 69.28  ? 232 ALA B C     1 
ATOM   4863  O O     . ALA B 1 232 ? 104.082 -42.712  33.283  1.00 68.56  ? 232 ALA B O     1 
ATOM   4864  C CB    . ALA B 1 232 ? 101.692 -45.134  33.496  1.00 71.53  ? 232 ALA B CB    1 
ATOM   4865  N N     . MET B 1 233 ? 102.078 -42.158  34.147  1.00 67.99  ? 233 MET B N     1 
ATOM   4866  C CA    . MET B 1 233 ? 102.141 -40.733  33.834  1.00 66.33  ? 233 MET B CA    1 
ATOM   4867  C C     . MET B 1 233 ? 103.349 -40.052  34.476  1.00 65.71  ? 233 MET B C     1 
ATOM   4868  O O     . MET B 1 233 ? 104.059 -39.267  33.834  1.00 64.92  ? 233 MET B O     1 
ATOM   4869  C CB    . MET B 1 233 ? 100.862 -40.048  34.310  1.00 66.06  ? 233 MET B CB    1 
ATOM   4870  C CG    . MET B 1 233 ? 99.591  -40.727  33.845  1.00 66.12  ? 233 MET B CG    1 
ATOM   4871  S SD    . MET B 1 233 ? 98.159  -39.855  34.474  1.00 65.67  ? 233 MET B SD    1 
ATOM   4872  C CE    . MET B 1 233 ? 96.839  -40.977  34.031  1.00 66.17  ? 233 MET B CE    1 
ATOM   4873  N N     . ARG B 1 234 ? 103.585 -40.379  35.744  1.00 65.82  ? 234 ARG B N     1 
ATOM   4874  C CA    . ARG B 1 234 ? 104.660 -39.778  36.519  1.00 65.41  ? 234 ARG B CA    1 
ATOM   4875  C C     . ARG B 1 234 ? 106.049 -40.096  35.974  1.00 65.29  ? 234 ARG B C     1 
ATOM   4876  O O     . ARG B 1 234 ? 106.988 -39.331  36.209  1.00 64.86  ? 234 ARG B O     1 
ATOM   4877  C CB    . ARG B 1 234 ? 104.548 -40.161  37.985  1.00 66.02  ? 234 ARG B CB    1 
ATOM   4878  C CG    . ARG B 1 234 ? 103.225 -39.780  38.593  1.00 66.35  ? 234 ARG B CG    1 
ATOM   4879  C CD    . ARG B 1 234 ? 103.071 -40.366  39.980  1.00 69.06  ? 234 ARG B CD    1 
ATOM   4880  N NE    . ARG B 1 234 ? 103.647 -39.496  41.003  1.00 70.66  ? 234 ARG B NE    1 
ATOM   4881  C CZ    . ARG B 1 234 ? 103.797 -39.826  42.282  1.00 72.63  ? 234 ARG B CZ    1 
ATOM   4882  N NH1   . ARG B 1 234 ? 103.422 -41.019  42.719  1.00 74.89  ? 234 ARG B NH1   1 
ATOM   4883  N NH2   . ARG B 1 234 ? 104.330 -38.960  43.130  1.00 73.63  ? 234 ARG B NH2   1 
ATOM   4884  N N     . MET B 1 235 ? 106.184 -41.200  35.235  1.00 65.57  ? 235 MET B N     1 
ATOM   4885  C CA    . MET B 1 235 ? 107.458 -41.487  34.558  1.00 65.52  ? 235 MET B CA    1 
ATOM   4886  C C     . MET B 1 235 ? 107.775 -40.379  33.574  1.00 64.08  ? 235 MET B C     1 
ATOM   4887  O O     . MET B 1 235 ? 108.917 -39.943  33.479  1.00 64.03  ? 235 MET B O     1 
ATOM   4888  C CB    . MET B 1 235 ? 107.459 -42.810  33.796  1.00 66.33  ? 235 MET B CB    1 
ATOM   4889  C CG    . MET B 1 235 ? 106.931 -44.014  34.522  1.00 68.52  ? 235 MET B CG    1 
ATOM   4890  S SD    . MET B 1 235 ? 107.496 -45.521  33.701  1.00 71.55  ? 235 MET B SD    1 
ATOM   4891  C CE    . MET B 1 235 ? 108.784 -46.000  34.860  1.00 72.70  ? 235 MET B CE    1 
ATOM   4892  N N     . ILE B 1 236 ? 106.760 -39.933  32.836  1.00 63.17  ? 236 ILE B N     1 
ATOM   4893  C CA    . ILE B 1 236 ? 106.949 -38.857  31.867  1.00 61.87  ? 236 ILE B CA    1 
ATOM   4894  C C     . ILE B 1 236 ? 107.294 -37.564  32.611  1.00 61.18  ? 236 ILE B C     1 
ATOM   4895  O O     . ILE B 1 236 ? 108.287 -36.896  32.276  1.00 60.75  ? 236 ILE B O     1 
ATOM   4896  C CB    . ILE B 1 236 ? 105.749 -38.737  30.864  1.00 61.43  ? 236 ILE B CB    1 
ATOM   4897  C CG1   . ILE B 1 236 ? 105.987 -39.642  29.663  1.00 61.07  ? 236 ILE B CG1   1 
ATOM   4898  C CG2   . ILE B 1 236 ? 105.588 -37.323  30.323  1.00 60.81  ? 236 ILE B CG2   1 
ATOM   4899  C CD1   . ILE B 1 236 ? 105.710 -41.084  29.926  1.00 61.95  ? 236 ILE B CD1   1 
ATOM   4900  N N     . ALA B 1 237 ? 106.512 -37.249  33.647  1.00 60.62  ? 237 ALA B N     1 
ATOM   4901  C CA    . ALA B 1 237 ? 106.753 -36.043  34.430  1.00 60.03  ? 237 ALA B CA    1 
ATOM   4902  C C     . ALA B 1 237 ? 108.199 -35.954  34.913  1.00 60.05  ? 237 ALA B C     1 
ATOM   4903  O O     . ALA B 1 237 ? 108.812 -34.892  34.817  1.00 59.79  ? 237 ALA B O     1 
ATOM   4904  C CB    . ALA B 1 237 ? 105.788 -35.942  35.587  1.00 60.29  ? 237 ALA B CB    1 
ATOM   4905  N N     . ASN B 1 238 ? 108.746 -37.069  35.399  1.00 60.32  ? 238 ASN B N     1 
ATOM   4906  C CA    . ASN B 1 238 ? 110.122 -37.085  35.889  1.00 60.44  ? 238 ASN B CA    1 
ATOM   4907  C C     . ASN B 1 238 ? 111.139 -36.957  34.772  1.00 60.02  ? 238 ASN B C     1 
ATOM   4908  O O     . ASN B 1 238 ? 112.200 -36.358  34.958  1.00 60.51  ? 238 ASN B O     1 
ATOM   4909  C CB    . ASN B 1 238 ? 110.410 -38.331  36.722  1.00 61.31  ? 238 ASN B CB    1 
ATOM   4910  C CG    . ASN B 1 238 ? 109.607 -38.372  37.989  1.00 61.64  ? 238 ASN B CG    1 
ATOM   4911  O OD1   . ASN B 1 238 ? 109.445 -37.369  38.672  1.00 60.65  ? 238 ASN B OD1   1 
ATOM   4912  N ND2   . ASN B 1 238 ? 109.088 -39.541  38.312  1.00 63.66  ? 238 ASN B ND2   1 
ATOM   4913  N N     . THR B 1 239 ? 110.814 -37.502  33.608  1.00 59.47  ? 239 THR B N     1 
ATOM   4914  C CA    . THR B 1 239 ? 111.674 -37.339  32.444  1.00 59.09  ? 239 THR B CA    1 
ATOM   4915  C C     . THR B 1 239 ? 111.758 -35.866  32.028  1.00 58.14  ? 239 THR B C     1 
ATOM   4916  O O     . THR B 1 239 ? 112.846 -35.355  31.744  1.00 57.83  ? 239 THR B O     1 
ATOM   4917  C CB    . THR B 1 239 ? 111.168 -38.159  31.263  1.00 59.18  ? 239 THR B CB    1 
ATOM   4918  O OG1   . THR B 1 239 ? 110.872 -39.488  31.705  1.00 59.77  ? 239 THR B OG1   1 
ATOM   4919  C CG2   . THR B 1 239 ? 112.230 -38.198  30.161  1.00 59.64  ? 239 THR B CG2   1 
ATOM   4920  N N     . ILE B 1 240 ? 110.600 -35.204  32.003  1.00 57.26  ? 240 ILE B N     1 
ATOM   4921  C CA    . ILE B 1 240 ? 110.516 -33.781  31.731  1.00 56.33  ? 240 ILE B CA    1 
ATOM   4922  C C     . ILE B 1 240 ? 111.376 -32.980  32.709  1.00 56.25  ? 240 ILE B C     1 
ATOM   4923  O O     . ILE B 1 240 ? 112.120 -32.073  32.308  1.00 55.55  ? 240 ILE B O     1 
ATOM   4924  C CB    . ILE B 1 240 ? 109.050 -33.312  31.762  1.00 56.38  ? 240 ILE B CB    1 
ATOM   4925  C CG1   . ILE B 1 240 ? 108.292 -33.965  30.603  1.00 56.48  ? 240 ILE B CG1   1 
ATOM   4926  C CG2   . ILE B 1 240 ? 108.947 -31.774  31.692  1.00 55.79  ? 240 ILE B CG2   1 
ATOM   4927  C CD1   . ILE B 1 240 ? 106.811 -33.688  30.570  1.00 56.99  ? 240 ILE B CD1   1 
ATOM   4928  N N     . LEU B 1 241 ? 111.288 -33.335  33.986  1.00 56.72  ? 241 LEU B N     1 
ATOM   4929  C CA    . LEU B 1 241 ? 112.056 -32.649  35.008  1.00 57.19  ? 241 LEU B CA    1 
ATOM   4930  C C     . LEU B 1 241 ? 113.547 -32.880  34.817  1.00 57.65  ? 241 LEU B C     1 
ATOM   4931  O O     . LEU B 1 241 ? 114.339 -31.916  34.913  1.00 57.84  ? 241 LEU B O     1 
ATOM   4932  C CB    . LEU B 1 241 ? 111.579 -33.023  36.409  1.00 57.70  ? 241 LEU B CB    1 
ATOM   4933  C CG    . LEU B 1 241 ? 110.242 -32.372  36.795  1.00 57.76  ? 241 LEU B CG    1 
ATOM   4934  C CD1   . LEU B 1 241 ? 109.728 -32.869  38.140  1.00 56.96  ? 241 LEU B CD1   1 
ATOM   4935  C CD2   . LEU B 1 241 ? 110.337 -30.837  36.772  1.00 57.91  ? 241 LEU B CD2   1 
ATOM   4936  N N     . ASP B 1 242 ? 113.917 -34.130  34.508  1.00 57.72  ? 242 ASP B N     1 
ATOM   4937  C CA    . ASP B 1 242 ? 115.310 -34.478  34.167  1.00 58.27  ? 242 ASP B CA    1 
ATOM   4938  C C     . ASP B 1 242 ? 115.898 -33.655  33.015  1.00 57.20  ? 242 ASP B C     1 
ATOM   4939  O O     . ASP B 1 242 ? 117.010 -33.140  33.126  1.00 56.97  ? 242 ASP B O     1 
ATOM   4940  C CB    . ASP B 1 242 ? 115.439 -35.961  33.826  1.00 59.29  ? 242 ASP B CB    1 
ATOM   4941  C CG    . ASP B 1 242 ? 115.424 -36.861  35.057  1.00 62.24  ? 242 ASP B CG    1 
ATOM   4942  O OD1   . ASP B 1 242 ? 115.427 -36.334  36.202  1.00 64.83  ? 242 ASP B OD1   1 
ATOM   4943  O OD2   . ASP B 1 242 ? 115.406 -38.106  34.868  1.00 63.40  ? 242 ASP B OD2   1 
ATOM   4944  N N     . LEU B 1 243 ? 115.143 -33.543  31.919  1.00 56.52  ? 243 LEU B N     1 
ATOM   4945  C CA    . LEU B 1 243 ? 115.542 -32.762  30.739  1.00 55.79  ? 243 LEU B CA    1 
ATOM   4946  C C     . LEU B 1 243 ? 115.771 -31.282  31.021  1.00 55.64  ? 243 LEU B C     1 
ATOM   4947  O O     . LEU B 1 243 ? 116.770 -30.723  30.560  1.00 55.22  ? 243 LEU B O     1 
ATOM   4948  C CB    . LEU B 1 243 ? 114.541 -32.930  29.600  1.00 55.26  ? 243 LEU B CB    1 
ATOM   4949  C CG    . LEU B 1 243 ? 114.403 -34.354  29.057  1.00 56.42  ? 243 LEU B CG    1 
ATOM   4950  C CD1   . LEU B 1 243 ? 113.209 -34.426  28.140  1.00 57.12  ? 243 LEU B CD1   1 
ATOM   4951  C CD2   . LEU B 1 243 ? 115.656 -34.834  28.331  1.00 57.04  ? 243 LEU B CD2   1 
ATOM   4952  N N     . TYR B 1 244 ? 114.869 -30.653  31.786  1.00 55.85  ? 244 TYR B N     1 
ATOM   4953  C CA    . TYR B 1 244 ? 115.080 -29.264  32.234  1.00 55.95  ? 244 TYR B CA    1 
ATOM   4954  C C     . TYR B 1 244 ? 116.419 -29.035  32.936  1.00 56.79  ? 244 TYR B C     1 
ATOM   4955  O O     . TYR B 1 244 ? 117.099 -28.054  32.648  1.00 56.52  ? 244 TYR B O     1 
ATOM   4956  C CB    . TYR B 1 244 ? 113.941 -28.782  33.119  1.00 55.84  ? 244 TYR B CB    1 
ATOM   4957  C CG    . TYR B 1 244 ? 112.795 -28.210  32.340  1.00 55.10  ? 244 TYR B CG    1 
ATOM   4958  C CD1   . TYR B 1 244 ? 111.628 -28.944  32.141  1.00 54.30  ? 244 TYR B CD1   1 
ATOM   4959  C CD2   . TYR B 1 244 ? 112.878 -26.936  31.780  1.00 55.12  ? 244 TYR B CD2   1 
ATOM   4960  C CE1   . TYR B 1 244 ? 110.574 -28.424  31.418  1.00 53.40  ? 244 TYR B CE1   1 
ATOM   4961  C CE2   . TYR B 1 244 ? 111.822 -26.405  31.044  1.00 54.30  ? 244 TYR B CE2   1 
ATOM   4962  C CZ    . TYR B 1 244 ? 110.679 -27.157  30.872  1.00 54.06  ? 244 TYR B CZ    1 
ATOM   4963  O OH    . TYR B 1 244 ? 109.635 -26.640  30.151  1.00 55.78  ? 244 TYR B OH    1 
ATOM   4964  N N     . ASN B 1 245 ? 116.787 -29.939  33.845  1.00 57.87  ? 245 ASN B N     1 
ATOM   4965  C CA    . ASN B 1 245 ? 118.080 -29.875  34.499  1.00 59.44  ? 245 ASN B CA    1 
ATOM   4966  C C     . ASN B 1 245 ? 119.225 -30.078  33.541  1.00 59.21  ? 245 ASN B C     1 
ATOM   4967  O O     . ASN B 1 245 ? 120.209 -29.334  33.593  1.00 59.70  ? 245 ASN B O     1 
ATOM   4968  C CB    . ASN B 1 245 ? 118.183 -30.894  35.623  1.00 60.93  ? 245 ASN B CB    1 
ATOM   4969  C CG    . ASN B 1 245 ? 117.513 -30.419  36.898  1.00 64.32  ? 245 ASN B CG    1 
ATOM   4970  O OD1   . ASN B 1 245 ? 117.434 -29.212  37.172  1.00 66.94  ? 245 ASN B OD1   1 
ATOM   4971  N ND2   . ASN B 1 245 ? 117.027 -31.369  37.694  1.00 67.50  ? 245 ASN B ND2   1 
ATOM   4972  N N     . ILE B 1 246 ? 119.103 -31.083  32.674  1.00 58.90  ? 246 ILE B N     1 
ATOM   4973  C CA    . ILE B 1 246 ? 120.119 -31.351  31.658  1.00 58.82  ? 246 ILE B CA    1 
ATOM   4974  C C     . ILE B 1 246 ? 120.265 -30.128  30.736  1.00 58.30  ? 246 ILE B C     1 
ATOM   4975  O O     . ILE B 1 246 ? 121.386 -29.727  30.394  1.00 58.28  ? 246 ILE B O     1 
ATOM   4976  C CB    . ILE B 1 246 ? 119.809 -32.655  30.881  1.00 58.89  ? 246 ILE B CB    1 
ATOM   4977  C CG1   . ILE B 1 246 ? 120.079 -33.873  31.769  1.00 60.02  ? 246 ILE B CG1   1 
ATOM   4978  C CG2   . ILE B 1 246 ? 120.646 -32.768  29.618  1.00 58.97  ? 246 ILE B CG2   1 
ATOM   4979  C CD1   . ILE B 1 246 ? 119.544 -35.192  31.214  1.00 60.39  ? 246 ILE B CD1   1 
ATOM   4980  N N     . ARG B 1 247 ? 119.139 -29.508  30.383  1.00 57.74  ? 247 ARG B N     1 
ATOM   4981  C CA    . ARG B 1 247 ? 119.166 -28.312  29.546  1.00 57.41  ? 247 ARG B CA    1 
ATOM   4982  C C     . ARG B 1 247 ? 120.005 -27.207  30.180  1.00 57.40  ? 247 ARG B C     1 
ATOM   4983  O O     . ARG B 1 247 ? 120.916 -26.672  29.557  1.00 57.17  ? 247 ARG B O     1 
ATOM   4984  C CB    . ARG B 1 247 ? 117.758 -27.817  29.253  1.00 56.95  ? 247 ARG B CB    1 
ATOM   4985  C CG    . ARG B 1 247 ? 117.660 -27.162  27.920  1.00 58.86  ? 247 ARG B CG    1 
ATOM   4986  C CD    . ARG B 1 247 ? 116.267 -26.638  27.654  1.00 65.12  ? 247 ARG B CD    1 
ATOM   4987  N NE    . ARG B 1 247 ? 116.043 -25.315  28.240  1.00 70.87  ? 247 ARG B NE    1 
ATOM   4988  C CZ    . ARG B 1 247 ? 116.396 -24.151  27.678  1.00 74.12  ? 247 ARG B CZ    1 
ATOM   4989  N NH1   . ARG B 1 247 ? 117.004 -24.096  26.479  1.00 72.76  ? 247 ARG B NH1   1 
ATOM   4990  N NH2   . ARG B 1 247 ? 116.135 -23.023  28.332  1.00 75.68  ? 247 ARG B NH2   1 
ATOM   4991  N N     . ARG B 1 248 ? 119.704 -26.889  31.431  1.00 57.91  ? 248 ARG B N     1 
ATOM   4992  C CA    . ARG B 1 248 ? 120.397 -25.829  32.147  1.00 58.69  ? 248 ARG B CA    1 
ATOM   4993  C C     . ARG B 1 248 ? 121.893 -26.096  32.293  1.00 59.35  ? 248 ARG B C     1 
ATOM   4994  O O     . ARG B 1 248 ? 122.717 -25.151  32.271  1.00 59.47  ? 248 ARG B O     1 
ATOM   4995  C CB    . ARG B 1 248 ? 119.765 -25.618  33.512  1.00 59.21  ? 248 ARG B CB    1 
ATOM   4996  C CG    . ARG B 1 248 ? 118.473 -24.845  33.452  1.00 59.62  ? 248 ARG B CG    1 
ATOM   4997  C CD    . ARG B 1 248 ? 117.971 -24.516  34.839  1.00 60.98  ? 248 ARG B CD    1 
ATOM   4998  N NE    . ARG B 1 248 ? 117.159 -25.609  35.357  1.00 62.40  ? 248 ARG B NE    1 
ATOM   4999  C CZ    . ARG B 1 248 ? 115.838 -25.710  35.191  1.00 62.77  ? 248 ARG B CZ    1 
ATOM   5000  N NH1   . ARG B 1 248 ? 115.168 -24.775  34.521  1.00 61.86  ? 248 ARG B NH1   1 
ATOM   5001  N NH2   . ARG B 1 248 ? 115.182 -26.749  35.698  1.00 62.40  ? 248 ARG B NH2   1 
ATOM   5002  N N     . ASN B 1 249 ? 122.235 -27.376  32.442  1.00 59.33  ? 249 ASN B N     1 
ATOM   5003  C CA    . ASN B 1 249 ? 123.624 -27.789  32.473  1.00 59.83  ? 249 ASN B CA    1 
ATOM   5004  C C     . ASN B 1 249 ? 124.309 -27.574  31.137  1.00 59.00  ? 249 ASN B C     1 
ATOM   5005  O O     . ASN B 1 249 ? 125.425 -27.073  31.092  1.00 59.02  ? 249 ASN B O     1 
ATOM   5006  C CB    . ASN B 1 249 ? 123.740 -29.237  32.916  1.00 60.52  ? 249 ASN B CB    1 
ATOM   5007  C CG    . ASN B 1 249 ? 123.750 -29.376  34.417  1.00 62.93  ? 249 ASN B CG    1 
ATOM   5008  O OD1   . ASN B 1 249 ? 124.642 -28.864  35.087  1.00 66.00  ? 249 ASN B OD1   1 
ATOM   5009  N ND2   . ASN B 1 249 ? 122.760 -30.066  34.960  1.00 65.14  ? 249 ASN B ND2   1 
ATOM   5010  N N     . LEU B 1 250 ? 123.620 -27.938  30.057  1.00 58.49  ? 250 LEU B N     1 
ATOM   5011  C CA    . LEU B 1 250 ? 124.113 -27.738  28.681  1.00 58.25  ? 250 LEU B CA    1 
ATOM   5012  C C     . LEU B 1 250 ? 124.307 -26.264  28.295  1.00 58.00  ? 250 LEU B C     1 
ATOM   5013  O O     . LEU B 1 250 ? 125.258 -25.914  27.586  1.00 57.85  ? 250 LEU B O     1 
ATOM   5014  C CB    . LEU B 1 250 ? 123.178 -28.401  27.659  1.00 57.73  ? 250 LEU B CB    1 
ATOM   5015  C CG    . LEU B 1 250 ? 123.557 -29.776  27.118  1.00 57.99  ? 250 LEU B CG    1 
ATOM   5016  C CD1   . LEU B 1 250 ? 122.591 -30.169  26.027  1.00 56.15  ? 250 LEU B CD1   1 
ATOM   5017  C CD2   . LEU B 1 250 ? 124.994 -29.782  26.599  1.00 57.95  ? 250 LEU B CD2   1 
ATOM   5018  N N     . ASN B 1 251 ? 123.394 -25.412  28.744  1.00 57.64  ? 251 ASN B N     1 
ATOM   5019  C CA    . ASN B 1 251 ? 123.556 -23.997  28.539  1.00 57.61  ? 251 ASN B CA    1 
ATOM   5020  C C     . ASN B 1 251 ? 124.870 -23.484  29.165  1.00 58.30  ? 251 ASN B C     1 
ATOM   5021  O O     . ASN B 1 251 ? 125.654 -22.827  28.485  1.00 58.28  ? 251 ASN B O     1 
ATOM   5022  C CB    . ASN B 1 251 ? 122.327 -23.236  29.037  1.00 57.55  ? 251 ASN B CB    1 
ATOM   5023  C CG    . ASN B 1 251 ? 121.886 -22.149  28.071  1.00 57.59  ? 251 ASN B CG    1 
ATOM   5024  O OD1   . ASN B 1 251 ? 122.703 -21.521  27.398  1.00 57.86  ? 251 ASN B OD1   1 
ATOM   5025  N ND2   . ASN B 1 251 ? 120.584 -21.929  27.989  1.00 58.96  ? 251 ASN B ND2   1 
ATOM   5026  N N     . ASN B 1 252 ? 125.131 -23.815  30.432  1.00 59.08  ? 252 ASN B N     1 
ATOM   5027  C CA    . ASN B 1 252 ? 126.372 -23.377  31.097  1.00 60.06  ? 252 ASN B CA    1 
ATOM   5028  C C     . ASN B 1 252 ? 127.620 -23.913  30.428  1.00 59.51  ? 252 ASN B C     1 
ATOM   5029  O O     . ASN B 1 252 ? 128.590 -23.170  30.240  1.00 59.70  ? 252 ASN B O     1 
ATOM   5030  C CB    . ASN B 1 252 ? 126.403 -23.750  32.578  1.00 61.45  ? 252 ASN B CB    1 
ATOM   5031  C CG    . ASN B 1 252 ? 125.219 -23.183  33.355  1.00 64.37  ? 252 ASN B CG    1 
ATOM   5032  O OD1   . ASN B 1 252 ? 124.655 -22.137  32.994  1.00 65.80  ? 252 ASN B OD1   1 
ATOM   5033  N ND2   . ASN B 1 252 ? 124.835 -23.878  34.439  1.00 67.31  ? 252 ASN B ND2   1 
ATOM   5034  N N     . TYR B 1 253 ? 127.599 -25.200  30.071  1.00 58.71  ? 253 TYR B N     1 
ATOM   5035  C CA    . TYR B 1 253 ? 128.686 -25.785  29.283  1.00 57.86  ? 253 TYR B CA    1 
ATOM   5036  C C     . TYR B 1 253 ? 128.875 -24.988  27.979  1.00 57.07  ? 253 TYR B C     1 
ATOM   5037  O O     . TYR B 1 253 ? 129.993 -24.570  27.661  1.00 56.95  ? 253 TYR B O     1 
ATOM   5038  C CB    . TYR B 1 253 ? 128.438 -27.271  28.999  1.00 57.38  ? 253 TYR B CB    1 
ATOM   5039  C CG    . TYR B 1 253 ? 129.405 -27.857  27.999  1.00 57.35  ? 253 TYR B CG    1 
ATOM   5040  C CD1   . TYR B 1 253 ? 129.061 -27.970  26.657  1.00 57.77  ? 253 TYR B CD1   1 
ATOM   5041  C CD2   . TYR B 1 253 ? 130.665 -28.276  28.384  1.00 58.03  ? 253 TYR B CD2   1 
ATOM   5042  C CE1   . TYR B 1 253 ? 129.946 -28.491  25.726  1.00 57.90  ? 253 TYR B CE1   1 
ATOM   5043  C CE2   . TYR B 1 253 ? 131.559 -28.801  27.462  1.00 58.66  ? 253 TYR B CE2   1 
ATOM   5044  C CZ    . TYR B 1 253 ? 131.194 -28.905  26.132  1.00 58.64  ? 253 TYR B CZ    1 
ATOM   5045  O OH    . TYR B 1 253 ? 132.064 -29.423  25.197  1.00 59.44  ? 253 TYR B OH    1 
ATOM   5046  N N     . LEU B 1 254 ? 127.767 -24.760  27.261  1.00 56.02  ? 254 LEU B N     1 
ATOM   5047  C CA    . LEU B 1 254 ? 127.781 -24.092  25.962  1.00 55.11  ? 254 LEU B CA    1 
ATOM   5048  C C     . LEU B 1 254 ? 128.388 -22.703  26.057  1.00 55.14  ? 254 LEU B C     1 
ATOM   5049  O O     . LEU B 1 254 ? 129.259 -22.347  25.246  1.00 55.19  ? 254 LEU B O     1 
ATOM   5050  C CB    . LEU B 1 254 ? 126.368 -24.022  25.382  1.00 54.80  ? 254 LEU B CB    1 
ATOM   5051  C CG    . LEU B 1 254 ? 126.131 -23.969  23.860  1.00 54.24  ? 254 LEU B CG    1 
ATOM   5052  C CD1   . LEU B 1 254 ? 125.762 -22.588  23.409  1.00 53.06  ? 254 LEU B CD1   1 
ATOM   5053  C CD2   . LEU B 1 254 ? 127.308 -24.532  23.041  1.00 53.77  ? 254 LEU B CD2   1 
ATOM   5054  N N     . GLU B 1 255 ? 127.930 -21.946  27.062  1.00 54.82  ? 255 GLU B N     1 
ATOM   5055  C CA    . GLU B 1 255 ? 128.476 -20.631  27.434  1.00 54.47  ? 255 GLU B CA    1 
ATOM   5056  C C     . GLU B 1 255 ? 129.991 -20.666  27.643  1.00 54.27  ? 255 GLU B C     1 
ATOM   5057  O O     . GLU B 1 255 ? 130.700 -19.757  27.221  1.00 54.03  ? 255 GLU B O     1 
ATOM   5058  C CB    . GLU B 1 255 ? 127.778 -20.115  28.694  1.00 54.83  ? 255 GLU B CB    1 
ATOM   5059  C CG    . GLU B 1 255 ? 128.193 -18.720  29.102  1.00 57.67  ? 255 GLU B CG    1 
ATOM   5060  C CD    . GLU B 1 255 ? 127.659 -18.293  30.474  1.00 61.81  ? 255 GLU B CD    1 
ATOM   5061  O OE1   . GLU B 1 255 ? 128.375 -17.552  31.199  1.00 62.99  ? 255 GLU B OE1   1 
ATOM   5062  O OE2   . GLU B 1 255 ? 126.519 -18.682  30.822  1.00 63.13  ? 255 GLU B OE2   1 
ATOM   5063  N N     . GLY B 1 256 ? 130.477 -21.724  28.293  1.00 54.10  ? 256 GLY B N     1 
ATOM   5064  C CA    . GLY B 1 256 ? 131.902 -21.891  28.554  1.00 54.13  ? 256 GLY B CA    1 
ATOM   5065  C C     . GLY B 1 256 ? 132.701 -22.001  27.275  1.00 53.65  ? 256 GLY B C     1 
ATOM   5066  O O     . GLY B 1 256 ? 133.675 -21.274  27.087  1.00 54.13  ? 256 GLY B O     1 
ATOM   5067  N N     . VAL B 1 257 ? 132.272 -22.898  26.387  1.00 52.83  ? 257 VAL B N     1 
ATOM   5068  C CA    . VAL B 1 257 ? 132.963 -23.141  25.124  1.00 52.14  ? 257 VAL B CA    1 
ATOM   5069  C C     . VAL B 1 257 ? 132.822 -21.957  24.173  1.00 52.28  ? 257 VAL B C     1 
ATOM   5070  O O     . VAL B 1 257 ? 133.785 -21.569  23.504  1.00 52.32  ? 257 VAL B O     1 
ATOM   5071  C CB    . VAL B 1 257 ? 132.448 -24.399  24.429  1.00 51.27  ? 257 VAL B CB    1 
ATOM   5072  C CG1   . VAL B 1 257 ? 133.251 -24.671  23.183  1.00 50.28  ? 257 VAL B CG1   1 
ATOM   5073  C CG2   . VAL B 1 257 ? 132.549 -25.578  25.351  1.00 51.84  ? 257 VAL B CG2   1 
ATOM   5074  N N     . MET B 1 258 ? 131.625 -21.380  24.131  1.00 52.39  ? 258 MET B N     1 
ATOM   5075  C CA    . MET B 1 258 ? 131.316 -20.327  23.178  1.00 52.71  ? 258 MET B CA    1 
ATOM   5076  C C     . MET B 1 258 ? 132.114 -19.046  23.398  1.00 53.60  ? 258 MET B C     1 
ATOM   5077  O O     . MET B 1 258 ? 132.523 -18.394  22.441  1.00 53.43  ? 258 MET B O     1 
ATOM   5078  C CB    . MET B 1 258 ? 129.822 -20.047  23.191  1.00 52.43  ? 258 MET B CB    1 
ATOM   5079  C CG    . MET B 1 258 ? 129.274 -19.580  21.838  1.00 53.34  ? 258 MET B CG    1 
ATOM   5080  S SD    . MET B 1 258 ? 129.758 -20.581  20.421  1.00 50.83  ? 258 MET B SD    1 
ATOM   5081  C CE    . MET B 1 258 ? 129.226 -22.155  21.039  1.00 50.48  ? 258 MET B CE    1 
ATOM   5082  N N     . LYS B 1 259 ? 132.332 -18.702  24.666  1.00 55.04  ? 259 LYS B N     1 
ATOM   5083  C CA    . LYS B 1 259 ? 133.150 -17.556  25.055  1.00 56.24  ? 259 LYS B CA    1 
ATOM   5084  C C     . LYS B 1 259 ? 134.584 -17.816  24.669  1.00 56.95  ? 259 LYS B C     1 
ATOM   5085  O O     . LYS B 1 259 ? 135.305 -16.901  24.253  1.00 57.57  ? 259 LYS B O     1 
ATOM   5086  C CB    . LYS B 1 259 ? 133.042 -17.292  26.559  1.00 56.75  ? 259 LYS B CB    1 
ATOM   5087  C CG    . LYS B 1 259 ? 131.689 -16.746  26.959  1.00 57.24  ? 259 LYS B CG    1 
ATOM   5088  C CD    . LYS B 1 259 ? 131.658 -16.112  28.319  1.00 59.01  ? 259 LYS B CD    1 
ATOM   5089  C CE    . LYS B 1 259 ? 130.289 -15.493  28.526  1.00 60.56  ? 259 LYS B CE    1 
ATOM   5090  N NZ    . LYS B 1 259 ? 130.072 -15.077  29.942  1.00 64.76  ? 259 LYS B NZ    1 
ATOM   5091  N N     . GLU B 1 260 ? 134.988 -19.074  24.795  1.00 57.26  ? 260 GLU B N     1 
ATOM   5092  C CA    . GLU B 1 260 ? 136.339 -19.471  24.454  1.00 58.33  ? 260 GLU B CA    1 
ATOM   5093  C C     . GLU B 1 260 ? 136.549 -19.448  22.934  1.00 57.53  ? 260 GLU B C     1 
ATOM   5094  O O     . GLU B 1 260 ? 137.539 -18.881  22.448  1.00 57.92  ? 260 GLU B O     1 
ATOM   5095  C CB    . GLU B 1 260 ? 136.652 -20.843  25.064  1.00 59.06  ? 260 GLU B CB    1 
ATOM   5096  C CG    . GLU B 1 260 ? 138.122 -21.221  25.100  1.00 62.31  ? 260 GLU B CG    1 
ATOM   5097  C CD    . GLU B 1 260 ? 138.524 -22.132  23.952  1.00 65.31  ? 260 GLU B CD    1 
ATOM   5098  O OE1   . GLU B 1 260 ? 139.149 -23.180  24.203  1.00 67.81  ? 260 GLU B OE1   1 
ATOM   5099  O OE2   . GLU B 1 260 ? 138.214 -21.815  22.789  1.00 67.58  ? 260 GLU B OE2   1 
ATOM   5100  N N     . VAL B 1 261 ? 135.613 -20.035  22.186  1.00 56.45  ? 261 VAL B N     1 
ATOM   5101  C CA    . VAL B 1 261 ? 135.818 -20.253  20.751  1.00 55.58  ? 261 VAL B CA    1 
ATOM   5102  C C     . VAL B 1 261 ? 135.420 -19.064  19.890  1.00 54.88  ? 261 VAL B C     1 
ATOM   5103  O O     . VAL B 1 261 ? 136.057 -18.792  18.881  1.00 55.21  ? 261 VAL B O     1 
ATOM   5104  C CB    . VAL B 1 261 ? 135.163 -21.565  20.248  1.00 55.22  ? 261 VAL B CB    1 
ATOM   5105  C CG1   . VAL B 1 261 ? 133.670 -21.436  20.113  1.00 54.64  ? 261 VAL B CG1   1 
ATOM   5106  C CG2   . VAL B 1 261 ? 135.746 -21.959  18.911  1.00 56.71  ? 261 VAL B CG2   1 
ATOM   5107  N N     . ALA B 1 262 ? 134.376 -18.352  20.295  1.00 54.43  ? 262 ALA B N     1 
ATOM   5108  C CA    . ALA B 1 262 ? 133.914 -17.177  19.550  1.00 52.95  ? 262 ALA B CA    1 
ATOM   5109  C C     . ALA B 1 262 ? 133.273 -16.132  20.484  1.00 52.28  ? 262 ALA B C     1 
ATOM   5110  O O     . ALA B 1 262 ? 132.047 -15.966  20.506  1.00 51.90  ? 262 ALA B O     1 
ATOM   5111  C CB    . ALA B 1 262 ? 132.956 -17.589  18.415  1.00 52.40  ? 262 ALA B CB    1 
ATOM   5112  N N     . PRO B 1 263 ? 134.114 -15.429  21.256  1.00 51.99  ? 263 PRO B N     1 
ATOM   5113  C CA    . PRO B 1 263 ? 133.724 -14.461  22.265  1.00 51.82  ? 263 PRO B CA    1 
ATOM   5114  C C     . PRO B 1 263 ? 132.930 -13.291  21.724  1.00 50.69  ? 263 PRO B C     1 
ATOM   5115  O O     . PRO B 1 263 ? 131.959 -12.891  22.351  1.00 51.02  ? 263 PRO B O     1 
ATOM   5116  C CB    . PRO B 1 263 ? 135.065 -13.951  22.782  1.00 52.95  ? 263 PRO B CB    1 
ATOM   5117  C CG    . PRO B 1 263 ? 136.040 -14.266  21.682  1.00 52.77  ? 263 PRO B CG    1 
ATOM   5118  C CD    . PRO B 1 263 ? 135.575 -15.568  21.185  1.00 52.43  ? 263 PRO B CD    1 
ATOM   5119  N N     . ASN B 1 264 ? 133.346 -12.742  20.585  1.00 49.56  ? 264 ASN B N     1 
ATOM   5120  C CA    . ASN B 1 264 ? 132.697 -11.560  19.998  1.00 48.54  ? 264 ASN B CA    1 
ATOM   5121  C C     . ASN B 1 264 ? 131.291 -11.845  19.511  1.00 47.42  ? 264 ASN B C     1 
ATOM   5122  O O     . ASN B 1 264 ? 130.371 -11.048  19.728  1.00 47.04  ? 264 ASN B O     1 
ATOM   5123  C CB    . ASN B 1 264 ? 133.536 -10.980  18.864  1.00 48.35  ? 264 ASN B CB    1 
ATOM   5124  C CG    . ASN B 1 264 ? 134.813 -10.342  19.364  1.00 50.29  ? 264 ASN B CG    1 
ATOM   5125  O OD1   . ASN B 1 264 ? 134.783 -9.240   19.917  1.00 51.72  ? 264 ASN B OD1   1 
ATOM   5126  N ND2   . ASN B 1 264 ? 135.945 -11.032  19.186  1.00 51.40  ? 264 ASN B ND2   1 
ATOM   5127  N N     . VAL B 1 265 ? 131.137 -12.989  18.851  1.00 46.63  ? 265 VAL B N     1 
ATOM   5128  C CA    . VAL B 1 265 ? 129.827 -13.474  18.451  1.00 45.45  ? 265 VAL B CA    1 
ATOM   5129  C C     . VAL B 1 265 ? 128.926 -13.646  19.671  1.00 45.44  ? 265 VAL B C     1 
ATOM   5130  O O     . VAL B 1 265 ? 127.764 -13.222  19.650  1.00 45.04  ? 265 VAL B O     1 
ATOM   5131  C CB    . VAL B 1 265 ? 129.923 -14.786  17.647  1.00 45.14  ? 265 VAL B CB    1 
ATOM   5132  C CG1   . VAL B 1 265 ? 128.556 -15.489  17.593  1.00 44.53  ? 265 VAL B CG1   1 
ATOM   5133  C CG2   . VAL B 1 265 ? 130.441 -14.483  16.250  1.00 44.17  ? 265 VAL B CG2   1 
ATOM   5134  N N     . THR B 1 266 ? 129.480 -14.241  20.728  1.00 45.49  ? 266 THR B N     1 
ATOM   5135  C CA    . THR B 1 266 ? 128.728 -14.550  21.936  1.00 46.00  ? 266 THR B CA    1 
ATOM   5136  C C     . THR B 1 266 ? 128.332 -13.263  22.658  1.00 46.15  ? 266 THR B C     1 
ATOM   5137  O O     . THR B 1 266 ? 127.243 -13.164  23.238  1.00 46.32  ? 266 THR B O     1 
ATOM   5138  C CB    . THR B 1 266 ? 129.544 -15.467  22.851  1.00 46.98  ? 266 THR B CB    1 
ATOM   5139  O OG1   . THR B 1 266 ? 130.117 -16.509  22.059  1.00 47.76  ? 266 THR B OG1   1 
ATOM   5140  C CG2   . THR B 1 266 ? 128.684 -16.088  23.952  1.00 47.44  ? 266 THR B CG2   1 
ATOM   5141  N N     . ALA B 1 267 ? 129.212 -12.269  22.601  1.00 45.90  ? 267 ALA B N     1 
ATOM   5142  C CA    . ALA B 1 267 ? 128.889 -10.945  23.102  1.00 46.04  ? 267 ALA B CA    1 
ATOM   5143  C C     . ALA B 1 267 ? 127.626 -10.402  22.433  1.00 45.72  ? 267 ALA B C     1 
ATOM   5144  O O     . ALA B 1 267 ? 126.812 -9.760   23.080  1.00 46.16  ? 267 ALA B O     1 
ATOM   5145  C CB    . ALA B 1 267 ? 130.049 -10.005  22.883  1.00 45.95  ? 267 ALA B CB    1 
ATOM   5146  N N     . LEU B 1 268 ? 127.458 -10.682  21.143  1.00 45.21  ? 268 LEU B N     1 
ATOM   5147  C CA    . LEU B 1 268 ? 126.350 -10.134  20.383  1.00 44.88  ? 268 LEU B CA    1 
ATOM   5148  C C     . LEU B 1 268 ? 125.015 -10.817  20.601  1.00 45.01  ? 268 LEU B C     1 
ATOM   5149  O O     . LEU B 1 268 ? 124.030 -10.142  20.880  1.00 45.52  ? 268 LEU B O     1 
ATOM   5150  C CB    . LEU B 1 268 ? 126.683 -10.074  18.893  1.00 44.12  ? 268 LEU B CB    1 
ATOM   5151  C CG    . LEU B 1 268 ? 127.484 -8.818   18.542  1.00 44.94  ? 268 LEU B CG    1 
ATOM   5152  C CD1   . LEU B 1 268 ? 127.978 -8.841   17.086  1.00 44.00  ? 268 LEU B CD1   1 
ATOM   5153  C CD2   . LEU B 1 268 ? 126.652 -7.553   18.838  1.00 45.21  ? 268 LEU B CD2   1 
ATOM   5154  N N     . VAL B 1 269 ? 124.972 -12.138  20.479  1.00 45.02  ? 269 VAL B N     1 
ATOM   5155  C CA    . VAL B 1 269 ? 123.691 -12.857  20.430  1.00 45.37  ? 269 VAL B CA    1 
ATOM   5156  C C     . VAL B 1 269 ? 123.507 -13.906  21.530  1.00 46.62  ? 269 VAL B C     1 
ATOM   5157  O O     . VAL B 1 269 ? 122.465 -14.566  21.612  1.00 46.81  ? 269 VAL B O     1 
ATOM   5158  C CB    . VAL B 1 269 ? 123.485 -13.557  19.069  1.00 44.64  ? 269 VAL B CB    1 
ATOM   5159  C CG1   . VAL B 1 269 ? 123.223 -12.545  17.975  1.00 44.21  ? 269 VAL B CG1   1 
ATOM   5160  C CG2   . VAL B 1 269 ? 124.683 -14.456  18.723  1.00 44.59  ? 269 VAL B CG2   1 
ATOM   5161  N N     . GLY B 1 270 ? 124.526 -14.074  22.363  1.00 47.63  ? 270 GLY B N     1 
ATOM   5162  C CA    . GLY B 1 270 ? 124.470 -15.065  23.426  1.00 48.76  ? 270 GLY B CA    1 
ATOM   5163  C C     . GLY B 1 270 ? 125.116 -16.341  22.948  1.00 49.21  ? 270 GLY B C     1 
ATOM   5164  O O     . GLY B 1 270 ? 125.354 -16.504  21.744  1.00 48.88  ? 270 GLY B O     1 
ATOM   5165  N N     . PRO B 1 271 ? 125.405 -17.267  23.883  1.00 49.97  ? 271 PRO B N     1 
ATOM   5166  C CA    . PRO B 1 271 ? 126.021 -18.526  23.524  1.00 49.91  ? 271 PRO B CA    1 
ATOM   5167  C C     . PRO B 1 271 ? 125.141 -19.327  22.569  1.00 49.63  ? 271 PRO B C     1 
ATOM   5168  O O     . PRO B 1 271 ? 125.601 -19.614  21.477  1.00 49.46  ? 271 PRO B O     1 
ATOM   5169  C CB    . PRO B 1 271 ? 126.175 -19.231  24.865  1.00 50.77  ? 271 PRO B CB    1 
ATOM   5170  C CG    . PRO B 1 271 ? 126.143 -18.176  25.833  1.00 51.23  ? 271 PRO B CG    1 
ATOM   5171  C CD    . PRO B 1 271 ? 125.175 -17.195  25.325  1.00 50.82  ? 271 PRO B CD    1 
ATOM   5172  N N     . ALA B 1 272 ? 123.897 -19.637  22.959  1.00 50.05  ? 272 ALA B N     1 
ATOM   5173  C CA    . ALA B 1 272 ? 123.001 -20.536  22.210  1.00 50.15  ? 272 ALA B CA    1 
ATOM   5174  C C     . ALA B 1 272 ? 122.844 -20.157  20.734  1.00 49.87  ? 272 ALA B C     1 
ATOM   5175  O O     . ALA B 1 272 ? 123.219 -20.922  19.827  1.00 50.24  ? 272 ALA B O     1 
ATOM   5176  C CB    . ALA B 1 272 ? 121.628 -20.612  22.887  1.00 50.46  ? 272 ALA B CB    1 
ATOM   5177  N N     . LEU B 1 273 ? 122.295 -18.969  20.492  1.00 49.50  ? 273 LEU B N     1 
ATOM   5178  C CA    . LEU B 1 273 ? 122.118 -18.464  19.144  1.00 48.17  ? 273 LEU B CA    1 
ATOM   5179  C C     . LEU B 1 273 ? 123.459 -18.379  18.398  1.00 47.94  ? 273 LEU B C     1 
ATOM   5180  O O     . LEU B 1 273 ? 123.521 -18.683  17.221  1.00 47.69  ? 273 LEU B O     1 
ATOM   5181  C CB    . LEU B 1 273 ? 121.394 -17.116  19.201  1.00 47.74  ? 273 LEU B CB    1 
ATOM   5182  C CG    . LEU B 1 273 ? 121.060 -16.420  17.891  1.00 45.96  ? 273 LEU B CG    1 
ATOM   5183  C CD1   . LEU B 1 273 ? 120.432 -17.420  16.962  1.00 46.71  ? 273 LEU B CD1   1 
ATOM   5184  C CD2   . LEU B 1 273 ? 120.147 -15.247  18.140  1.00 43.88  ? 273 LEU B CD2   1 
ATOM   5185  N N     . GLY B 1 274 ? 124.528 -17.978  19.080  1.00 48.23  ? 274 GLY B N     1 
ATOM   5186  C CA    . GLY B 1 274 ? 125.854 -17.972  18.462  1.00 48.88  ? 274 GLY B CA    1 
ATOM   5187  C C     . GLY B 1 274 ? 126.261 -19.350  17.952  1.00 49.51  ? 274 GLY B C     1 
ATOM   5188  O O     . GLY B 1 274 ? 126.634 -19.525  16.785  1.00 49.41  ? 274 GLY B O     1 
ATOM   5189  N N     . ALA B 1 275 ? 126.178 -20.333  18.839  1.00 50.41  ? 275 ALA B N     1 
ATOM   5190  C CA    . ALA B 1 275 ? 126.450 -21.716  18.495  1.00 51.10  ? 275 ALA B CA    1 
ATOM   5191  C C     . ALA B 1 275 ? 125.566 -22.137  17.331  1.00 51.20  ? 275 ALA B C     1 
ATOM   5192  O O     . ALA B 1 275 ? 126.030 -22.799  16.389  1.00 51.62  ? 275 ALA B O     1 
ATOM   5193  C CB    . ALA B 1 275 ? 126.201 -22.604  19.685  1.00 51.63  ? 275 ALA B CB    1 
ATOM   5194  N N     . ARG B 1 276 ? 124.296 -21.734  17.396  1.00 50.96  ? 276 ARG B N     1 
ATOM   5195  C CA    . ARG B 1 276 ? 123.293 -22.135  16.416  1.00 50.57  ? 276 ARG B CA    1 
ATOM   5196  C C     . ARG B 1 276 ? 123.694 -21.677  15.005  1.00 50.12  ? 276 ARG B C     1 
ATOM   5197  O O     . ARG B 1 276 ? 123.518 -22.406  14.017  1.00 50.85  ? 276 ARG B O     1 
ATOM   5198  C CB    . ARG B 1 276 ? 121.961 -21.548  16.819  1.00 50.07  ? 276 ARG B CB    1 
ATOM   5199  C CG    . ARG B 1 276 ? 120.809 -22.428  16.548  1.00 50.88  ? 276 ARG B CG    1 
ATOM   5200  C CD    . ARG B 1 276 ? 119.645 -22.002  17.429  1.00 51.87  ? 276 ARG B CD    1 
ATOM   5201  N NE    . ARG B 1 276 ? 119.598 -22.690  18.717  1.00 50.27  ? 276 ARG B NE    1 
ATOM   5202  C CZ    . ARG B 1 276 ? 119.052 -22.175  19.813  1.00 50.69  ? 276 ARG B CZ    1 
ATOM   5203  N NH1   . ARG B 1 276 ? 119.038 -22.883  20.943  1.00 53.50  ? 276 ARG B NH1   1 
ATOM   5204  N NH2   . ARG B 1 276 ? 118.532 -20.953  19.790  1.00 47.76  ? 276 ARG B NH2   1 
ATOM   5205  N N     . LEU B 1 277 ? 124.273 -20.483  14.923  1.00 48.94  ? 277 LEU B N     1 
ATOM   5206  C CA    . LEU B 1 277 ? 124.766 -19.978  13.662  1.00 48.01  ? 277 LEU B CA    1 
ATOM   5207  C C     . LEU B 1 277 ? 125.960 -20.785  13.196  1.00 47.97  ? 277 LEU B C     1 
ATOM   5208  O O     . LEU B 1 277 ? 126.056 -21.089  12.016  1.00 47.66  ? 277 LEU B O     1 
ATOM   5209  C CB    . LEU B 1 277 ? 125.115 -18.498  13.776  1.00 47.68  ? 277 LEU B CB    1 
ATOM   5210  C CG    . LEU B 1 277 ? 123.897 -17.577  13.868  1.00 47.52  ? 277 LEU B CG    1 
ATOM   5211  C CD1   . LEU B 1 277 ? 124.207 -16.435  14.821  1.00 47.99  ? 277 LEU B CD1   1 
ATOM   5212  C CD2   . LEU B 1 277 ? 123.462 -17.071  12.481  1.00 45.95  ? 277 LEU B CD2   1 
ATOM   5213  N N     . LEU B 1 278 ? 126.857 -21.135  14.123  1.00 48.06  ? 278 LEU B N     1 
ATOM   5214  C CA    . LEU B 1 278 ? 128.021 -21.967  13.798  1.00 48.25  ? 278 LEU B CA    1 
ATOM   5215  C C     . LEU B 1 278 ? 127.559 -23.287  13.212  1.00 48.90  ? 278 LEU B C     1 
ATOM   5216  O O     . LEU B 1 278 ? 128.088 -23.729  12.189  1.00 49.21  ? 278 LEU B O     1 
ATOM   5217  C CB    . LEU B 1 278 ? 128.883 -22.240  15.031  1.00 48.54  ? 278 LEU B CB    1 
ATOM   5218  C CG    . LEU B 1 278 ? 129.617 -21.094  15.720  1.00 48.08  ? 278 LEU B CG    1 
ATOM   5219  C CD1   . LEU B 1 278 ? 130.184 -21.557  17.026  1.00 47.76  ? 278 LEU B CD1   1 
ATOM   5220  C CD2   . LEU B 1 278 ? 130.722 -20.565  14.849  1.00 47.96  ? 278 LEU B CD2   1 
ATOM   5221  N N     . SER B 1 279 ? 126.557 -23.890  13.863  1.00 49.06  ? 279 SER B N     1 
ATOM   5222  C CA    . SER B 1 279 ? 125.969 -25.162  13.453  1.00 49.62  ? 279 SER B CA    1 
ATOM   5223  C C     . SER B 1 279 ? 125.486 -25.163  12.007  1.00 49.27  ? 279 SER B C     1 
ATOM   5224  O O     . SER B 1 279 ? 125.735 -26.116  11.258  1.00 49.53  ? 279 SER B O     1 
ATOM   5225  C CB    . SER B 1 279 ? 124.803 -25.521  14.374  1.00 50.01  ? 279 SER B CB    1 
ATOM   5226  O OG    . SER B 1 279 ? 124.095 -26.662  13.893  1.00 51.24  ? 279 SER B OG    1 
ATOM   5227  N N     . ILE B 1 280 ? 124.782 -24.096  11.632  1.00 48.54  ? 280 ILE B N     1 
ATOM   5228  C CA    . ILE B 1 280 ? 124.238 -23.948  10.280  1.00 48.26  ? 280 ILE B CA    1 
ATOM   5229  C C     . ILE B 1 280 ? 125.372 -23.656  9.285   1.00 48.34  ? 280 ILE B C     1 
ATOM   5230  O O     . ILE B 1 280 ? 125.411 -24.227  8.197   1.00 49.12  ? 280 ILE B O     1 
ATOM   5231  C CB    . ILE B 1 280 ? 123.148 -22.837  10.226  1.00 47.45  ? 280 ILE B CB    1 
ATOM   5232  C CG1   . ILE B 1 280 ? 121.963 -23.186  11.138  1.00 46.58  ? 280 ILE B CG1   1 
ATOM   5233  C CG2   . ILE B 1 280 ? 122.695 -22.578  8.790   1.00 47.67  ? 280 ILE B CG2   1 
ATOM   5234  C CD1   . ILE B 1 280 ? 120.969 -22.047  11.325  1.00 45.25  ? 280 ILE B CD1   1 
ATOM   5235  N N     . ALA B 1 281 ? 126.305 -22.792  9.674   1.00 47.89  ? 281 ALA B N     1 
ATOM   5236  C CA    . ALA B 1 281 ? 127.432 -22.460  8.831   1.00 48.03  ? 281 ALA B CA    1 
ATOM   5237  C C     . ALA B 1 281 ? 128.372 -23.640  8.692   1.00 49.39  ? 281 ALA B C     1 
ATOM   5238  O O     . ALA B 1 281 ? 128.995 -23.797  7.641   1.00 50.23  ? 281 ALA B O     1 
ATOM   5239  C CB    . ALA B 1 281 ? 128.170 -21.269  9.380   1.00 47.63  ? 281 ALA B CB    1 
ATOM   5240  N N     . GLY B 1 282 ? 128.474 -24.461  9.744   1.00 50.08  ? 282 GLY B N     1 
ATOM   5241  C CA    . GLY B 1 282 ? 129.334 -25.656  9.749   1.00 51.19  ? 282 GLY B CA    1 
ATOM   5242  C C     . GLY B 1 282 ? 130.562 -25.511  10.637  1.00 51.72  ? 282 GLY B C     1 
ATOM   5243  O O     . GLY B 1 282 ? 131.009 -26.470  11.264  1.00 52.93  ? 282 GLY B O     1 
ATOM   5244  N N     . SER B 1 283 ? 131.115 -24.306  10.690  1.00 51.16  ? 283 SER B N     1 
ATOM   5245  C CA    . SER B 1 283 ? 132.291 -24.027  11.483  1.00 51.25  ? 283 SER B CA    1 
ATOM   5246  C C     . SER B 1 283 ? 132.353 -22.539  11.688  1.00 50.71  ? 283 SER B C     1 
ATOM   5247  O O     . SER B 1 283 ? 131.583 -21.797  11.090  1.00 49.79  ? 283 SER B O     1 
ATOM   5248  C CB    . SER B 1 283 ? 133.545 -24.474  10.742  1.00 52.32  ? 283 SER B CB    1 
ATOM   5249  O OG    . SER B 1 283 ? 133.803 -23.645  9.616   1.00 52.12  ? 283 SER B OG    1 
ATOM   5250  N N     . LEU B 1 284 ? 133.285 -22.103  12.529  1.00 51.67  ? 284 LEU B N     1 
ATOM   5251  C CA    . LEU B 1 284 ? 133.522 -20.680  12.744  1.00 51.65  ? 284 LEU B CA    1 
ATOM   5252  C C     . LEU B 1 284 ? 134.113 -20.019  11.502  1.00 52.41  ? 284 LEU B C     1 
ATOM   5253  O O     . LEU B 1 284 ? 133.642 -18.974  11.091  1.00 51.78  ? 284 LEU B O     1 
ATOM   5254  C CB    . LEU B 1 284 ? 134.424 -20.450  13.953  1.00 51.46  ? 284 LEU B CB    1 
ATOM   5255  C CG    . LEU B 1 284 ? 134.856 -19.006  14.173  1.00 49.55  ? 284 LEU B CG    1 
ATOM   5256  C CD1   . LEU B 1 284 ? 133.670 -18.162  14.547  1.00 49.30  ? 284 LEU B CD1   1 
ATOM   5257  C CD2   . LEU B 1 284 ? 135.891 -18.957  15.244  1.00 49.49  ? 284 LEU B CD2   1 
ATOM   5258  N N     . ASP B 1 285 ? 135.132 -20.639  10.911  1.00 54.36  ? 285 ASP B N     1 
ATOM   5259  C CA    . ASP B 1 285 ? 135.776 -20.111  9.715   1.00 55.98  ? 285 ASP B CA    1 
ATOM   5260  C C     . ASP B 1 285 ? 134.791 -20.004  8.553   1.00 56.04  ? 285 ASP B C     1 
ATOM   5261  O O     . ASP B 1 285 ? 134.900 -19.086  7.728   1.00 56.56  ? 285 ASP B O     1 
ATOM   5262  C CB    . ASP B 1 285 ? 136.979 -20.961  9.314   1.00 57.61  ? 285 ASP B CB    1 
ATOM   5263  C CG    . ASP B 1 285 ? 137.924 -21.215  10.479  1.00 61.54  ? 285 ASP B CG    1 
ATOM   5264  O OD1   . ASP B 1 285 ? 137.511 -21.927  11.442  1.00 66.56  ? 285 ASP B OD1   1 
ATOM   5265  O OD2   . ASP B 1 285 ? 139.074 -20.708  10.441  1.00 63.79  ? 285 ASP B OD2   1 
ATOM   5266  N N     . GLU B 1 286 ? 133.825 -20.922  8.487   1.00 55.89  ? 286 GLU B N     1 
ATOM   5267  C CA    . GLU B 1 286 ? 132.791 -20.825  7.476   1.00 55.55  ? 286 GLU B CA    1 
ATOM   5268  C C     . GLU B 1 286 ? 131.855 -19.662  7.754   1.00 54.05  ? 286 GLU B C     1 
ATOM   5269  O O     . GLU B 1 286 ? 131.515 -18.917  6.840   1.00 54.52  ? 286 GLU B O     1 
ATOM   5270  C CB    . GLU B 1 286 ? 132.034 -22.130  7.306   1.00 56.26  ? 286 GLU B CB    1 
ATOM   5271  C CG    . GLU B 1 286 ? 132.780 -23.088  6.382   1.00 61.08  ? 286 GLU B CG    1 
ATOM   5272  C CD    . GLU B 1 286 ? 131.865 -23.919  5.465   1.00 66.41  ? 286 GLU B CD    1 
ATOM   5273  O OE1   . GLU B 1 286 ? 132.386 -24.863  4.825   1.00 68.94  ? 286 GLU B OE1   1 
ATOM   5274  O OE2   . GLU B 1 286 ? 130.642 -23.636  5.365   1.00 67.67  ? 286 GLU B OE2   1 
ATOM   5275  N N     . LEU B 1 287 ? 131.460 -19.478  9.008   1.00 52.55  ? 287 LEU B N     1 
ATOM   5276  C CA    . LEU B 1 287 ? 130.673 -18.309  9.376   1.00 50.44  ? 287 LEU B CA    1 
ATOM   5277  C C     . LEU B 1 287 ? 131.436 -17.016  9.068   1.00 50.03  ? 287 LEU B C     1 
ATOM   5278  O O     . LEU B 1 287 ? 130.836 -16.009  8.702   1.00 49.67  ? 287 LEU B O     1 
ATOM   5279  C CB    . LEU B 1 287 ? 130.310 -18.366  10.850  1.00 49.92  ? 287 LEU B CB    1 
ATOM   5280  C CG    . LEU B 1 287 ? 129.328 -17.331  11.378  1.00 48.39  ? 287 LEU B CG    1 
ATOM   5281  C CD1   . LEU B 1 287 ? 127.944 -17.719  10.984  1.00 48.31  ? 287 LEU B CD1   1 
ATOM   5282  C CD2   . LEU B 1 287 ? 129.418 -17.285  12.873  1.00 48.61  ? 287 LEU B CD2   1 
ATOM   5283  N N     . ALA B 1 288 ? 132.759 -17.061  9.198   1.00 50.03  ? 288 ALA B N     1 
ATOM   5284  C CA    . ALA B 1 288 ? 133.592 -15.885  9.040   1.00 50.03  ? 288 ALA B CA    1 
ATOM   5285  C C     . ALA B 1 288 ? 133.685 -15.482  7.585   1.00 50.57  ? 288 ALA B C     1 
ATOM   5286  O O     . ALA B 1 288 ? 133.779 -14.289  7.262   1.00 50.99  ? 288 ALA B O     1 
ATOM   5287  C CB    . ALA B 1 288 ? 134.946 -16.139  9.581   1.00 50.20  ? 288 ALA B CB    1 
ATOM   5288  N N     . LYS B 1 289 ? 133.643 -16.476  6.704   1.00 50.82  ? 289 LYS B N     1 
ATOM   5289  C CA    . LYS B 1 289 ? 133.706 -16.229  5.267   1.00 51.03  ? 289 LYS B CA    1 
ATOM   5290  C C     . LYS B 1 289 ? 132.410 -15.695  4.659   1.00 50.33  ? 289 LYS B C     1 
ATOM   5291  O O     . LYS B 1 289 ? 132.383 -15.342  3.477   1.00 50.78  ? 289 LYS B O     1 
ATOM   5292  C CB    . LYS B 1 289 ? 134.130 -17.497  4.537   1.00 51.94  ? 289 LYS B CB    1 
ATOM   5293  C CG    . LYS B 1 289 ? 135.594 -17.819  4.711   1.00 54.15  ? 289 LYS B CG    1 
ATOM   5294  C CD    . LYS B 1 289 ? 135.957 -19.071  3.976   1.00 57.58  ? 289 LYS B CD    1 
ATOM   5295  C CE    . LYS B 1 289 ? 137.046 -19.795  4.736   1.00 61.26  ? 289 LYS B CE    1 
ATOM   5296  N NZ    . LYS B 1 289 ? 137.599 -20.901  3.909   1.00 64.11  ? 289 LYS B NZ    1 
ATOM   5297  N N     . MET B 1 290 ? 131.345 -15.641  5.454   1.00 49.41  ? 290 MET B N     1 
ATOM   5298  C CA    . MET B 1 290 ? 130.018 -15.304  4.942   1.00 48.95  ? 290 MET B CA    1 
ATOM   5299  C C     . MET B 1 290 ? 129.812 -13.807  4.863   1.00 48.77  ? 290 MET B C     1 
ATOM   5300  O O     . MET B 1 290 ? 130.417 -13.080  5.644   1.00 48.98  ? 290 MET B O     1 
ATOM   5301  C CB    . MET B 1 290 ? 128.939 -15.923  5.826   1.00 48.43  ? 290 MET B CB    1 
ATOM   5302  C CG    . MET B 1 290 ? 128.971 -17.418  5.827   1.00 48.09  ? 290 MET B CG    1 
ATOM   5303  S SD    . MET B 1 290 ? 127.432 -18.096  6.408   1.00 48.95  ? 290 MET B SD    1 
ATOM   5304  C CE    . MET B 1 290 ? 127.747 -19.824  6.080   1.00 49.61  ? 290 MET B CE    1 
ATOM   5305  N N     . PRO B 1 291 ? 128.969 -13.342  3.917   1.00 48.91  ? 291 PRO B N     1 
ATOM   5306  C CA    . PRO B 1 291 ? 128.503 -11.946  3.909   1.00 48.74  ? 291 PRO B CA    1 
ATOM   5307  C C     . PRO B 1 291 ? 127.365 -11.797  4.887   1.00 48.12  ? 291 PRO B C     1 
ATOM   5308  O O     . PRO B 1 291 ? 126.748 -12.800  5.238   1.00 48.42  ? 291 PRO B O     1 
ATOM   5309  C CB    . PRO B 1 291 ? 127.968 -11.756  2.488   1.00 49.08  ? 291 PRO B CB    1 
ATOM   5310  C CG    . PRO B 1 291 ? 127.518 -13.105  2.086   1.00 49.49  ? 291 PRO B CG    1 
ATOM   5311  C CD    . PRO B 1 291 ? 128.496 -14.077  2.727   1.00 49.46  ? 291 PRO B CD    1 
ATOM   5312  N N     . ALA B 1 292 ? 127.078 -10.569  5.322   1.00 47.75  ? 292 ALA B N     1 
ATOM   5313  C CA    . ALA B 1 292 ? 126.008 -10.357  6.286   1.00 47.06  ? 292 ALA B CA    1 
ATOM   5314  C C     . ALA B 1 292 ? 124.725 -10.884  5.686   1.00 47.26  ? 292 ALA B C     1 
ATOM   5315  O O     . ALA B 1 292 ? 123.978 -11.592  6.354   1.00 47.27  ? 292 ALA B O     1 
ATOM   5316  C CB    . ALA B 1 292 ? 125.872 -8.907   6.656   1.00 46.40  ? 292 ALA B CB    1 
ATOM   5317  N N     . SER B 1 293 ? 124.506 -10.590  4.405   1.00 47.77  ? 293 SER B N     1 
ATOM   5318  C CA    . SER B 1 293 ? 123.258 -10.952  3.729   1.00 48.17  ? 293 SER B CA    1 
ATOM   5319  C C     . SER B 1 293 ? 122.954 -12.464  3.748   1.00 48.29  ? 293 SER B C     1 
ATOM   5320  O O     . SER B 1 293 ? 121.818 -12.885  3.493   1.00 48.75  ? 293 SER B O     1 
ATOM   5321  C CB    . SER B 1 293 ? 123.273 -10.427  2.300   1.00 48.53  ? 293 SER B CB    1 
ATOM   5322  O OG    . SER B 1 293 ? 124.274 -11.083  1.551   1.00 49.83  ? 293 SER B OG    1 
ATOM   5323  N N     . THR B 1 294 ? 123.967 -13.272  4.047   1.00 47.98  ? 294 THR B N     1 
ATOM   5324  C CA    . THR B 1 294 ? 123.775 -14.694  4.230   1.00 47.72  ? 294 THR B CA    1 
ATOM   5325  C C     . THR B 1 294 ? 123.410 -14.928  5.681   1.00 47.62  ? 294 THR B C     1 
ATOM   5326  O O     . THR B 1 294 ? 122.360 -15.510  5.977   1.00 47.67  ? 294 THR B O     1 
ATOM   5327  C CB    . THR B 1 294 ? 125.045 -15.473  3.852   1.00 48.00  ? 294 THR B CB    1 
ATOM   5328  O OG1   . THR B 1 294 ? 125.212 -15.422  2.436   1.00 48.58  ? 294 THR B OG1   1 
ATOM   5329  C CG2   . THR B 1 294 ? 124.943 -16.918  4.254   1.00 47.75  ? 294 THR B CG2   1 
ATOM   5330  N N     . ILE B 1 295 ? 124.281 -14.463  6.579   1.00 47.43  ? 295 ILE B N     1 
ATOM   5331  C CA    . ILE B 1 295 ? 124.090 -14.588  8.023   1.00 47.41  ? 295 ILE B CA    1 
ATOM   5332  C C     . ILE B 1 295 ? 122.661 -14.191  8.420   1.00 47.54  ? 295 ILE B C     1 
ATOM   5333  O O     . ILE B 1 295 ? 122.002 -14.880  9.199   1.00 47.99  ? 295 ILE B O     1 
ATOM   5334  C CB    . ILE B 1 295 ? 125.152 -13.767  8.767   1.00 47.13  ? 295 ILE B CB    1 
ATOM   5335  C CG1   . ILE B 1 295 ? 126.478 -14.531  8.733   1.00 48.31  ? 295 ILE B CG1   1 
ATOM   5336  C CG2   . ILE B 1 295 ? 124.734 -13.479  10.198  1.00 46.91  ? 295 ILE B CG2   1 
ATOM   5337  C CD1   . ILE B 1 295 ? 127.709 -13.676  9.011   1.00 49.71  ? 295 ILE B CD1   1 
ATOM   5338  N N     . GLN B 1 296 ? 122.177 -13.106  7.826   1.00 47.62  ? 296 GLN B N     1 
ATOM   5339  C CA    . GLN B 1 296 ? 120.837 -12.599  8.056   1.00 47.43  ? 296 GLN B CA    1 
ATOM   5340  C C     . GLN B 1 296 ? 119.744 -13.617  7.747   1.00 48.14  ? 296 GLN B C     1 
ATOM   5341  O O     . GLN B 1 296 ? 118.661 -13.555  8.337   1.00 48.75  ? 296 GLN B O     1 
ATOM   5342  C CB    . GLN B 1 296 ? 120.614 -11.347  7.217   1.00 47.15  ? 296 GLN B CB    1 
ATOM   5343  C CG    . GLN B 1 296 ? 119.293 -10.628  7.489   1.00 46.59  ? 296 GLN B CG    1 
ATOM   5344  C CD    . GLN B 1 296 ? 119.181 -9.295   6.771   1.00 45.48  ? 296 GLN B CD    1 
ATOM   5345  O OE1   . GLN B 1 296 ? 120.183 -8.731   6.314   1.00 46.71  ? 296 GLN B OE1   1 
ATOM   5346  N NE2   . GLN B 1 296 ? 117.966 -8.782   6.671   1.00 43.01  ? 296 GLN B NE2   1 
ATOM   5347  N N     . VAL B 1 297 ? 120.011 -14.553  6.833   1.00 48.46  ? 297 VAL B N     1 
ATOM   5348  C CA    . VAL B 1 297 ? 118.967 -15.518  6.420   1.00 48.45  ? 297 VAL B CA    1 
ATOM   5349  C C     . VAL B 1 297 ? 119.169 -16.999  6.823   1.00 48.91  ? 297 VAL B C     1 
ATOM   5350  O O     . VAL B 1 297 ? 118.221 -17.762  6.735   1.00 49.00  ? 297 VAL B O     1 
ATOM   5351  C CB    . VAL B 1 297 ? 118.607 -15.405  4.910   1.00 48.39  ? 297 VAL B CB    1 
ATOM   5352  C CG1   . VAL B 1 297 ? 118.145 -14.007  4.572   1.00 47.55  ? 297 VAL B CG1   1 
ATOM   5353  C CG2   . VAL B 1 297 ? 119.782 -15.792  4.045   1.00 48.94  ? 297 VAL B CG2   1 
ATOM   5354  N N     . LEU B 1 298 ? 120.370 -17.390  7.271   1.00 49.15  ? 298 LEU B N     1 
ATOM   5355  C CA    . LEU B 1 298 ? 120.622 -18.750  7.804   1.00 49.94  ? 298 LEU B CA    1 
ATOM   5356  C C     . LEU B 1 298 ? 119.472 -19.261  8.704   1.00 50.61  ? 298 LEU B C     1 
ATOM   5357  O O     . LEU B 1 298 ? 118.955 -18.517  9.536   1.00 50.98  ? 298 LEU B O     1 
ATOM   5358  C CB    . LEU B 1 298 ? 121.939 -18.777  8.587   1.00 49.68  ? 298 LEU B CB    1 
ATOM   5359  C CG    . LEU B 1 298 ? 123.233 -18.349  7.898   1.00 49.68  ? 298 LEU B CG    1 
ATOM   5360  C CD1   . LEU B 1 298 ? 124.361 -18.384  8.894   1.00 50.40  ? 298 LEU B CD1   1 
ATOM   5361  C CD2   . LEU B 1 298 ? 123.566 -19.246  6.729   1.00 50.11  ? 298 LEU B CD2   1 
ATOM   5362  N N     . GLY B 1 299 ? 119.103 -20.533  8.573   1.00 51.36  ? 299 GLY B N     1 
ATOM   5363  C CA    . GLY B 1 299 ? 117.755 -20.989  8.966   1.00 51.96  ? 299 GLY B CA    1 
ATOM   5364  C C     . GLY B 1 299 ? 116.974 -20.669  7.719   1.00 52.29  ? 299 GLY B C     1 
ATOM   5365  O O     . GLY B 1 299 ? 117.585 -20.463  6.688   1.00 53.47  ? 299 GLY B O     1 
ATOM   5366  N N     . ALA B 1 300 ? 115.657 -20.600  7.750   1.00 52.46  ? 300 ALA B N     1 
ATOM   5367  C CA    . ALA B 1 300 ? 114.929 -19.913  6.618   1.00 52.80  ? 300 ALA B CA    1 
ATOM   5368  C C     . ALA B 1 300 ? 115.369 -20.206  5.161   1.00 52.80  ? 300 ALA B C     1 
ATOM   5369  O O     . ALA B 1 300 ? 115.145 -19.389  4.272   1.00 52.33  ? 300 ALA B O     1 
ATOM   5370  C CB    . ALA B 1 300 ? 114.895 -18.371  6.830   1.00 51.83  ? 300 ALA B CB    1 
ATOM   5371  N N     . GLU B 1 301 ? 115.991 -21.356  4.928   1.00 53.48  ? 301 GLU B N     1 
ATOM   5372  C CA    . GLU B 1 301 ? 116.391 -21.746  3.587   1.00 54.15  ? 301 GLU B CA    1 
ATOM   5373  C C     . GLU B 1 301 ? 115.178 -22.000  2.680   1.00 55.30  ? 301 GLU B C     1 
ATOM   5374  O O     . GLU B 1 301 ? 115.164 -21.573  1.524   1.00 55.68  ? 301 GLU B O     1 
ATOM   5375  C CB    . GLU B 1 301 ? 117.329 -22.950  3.632   1.00 54.21  ? 301 GLU B CB    1 
ATOM   5376  C CG    . GLU B 1 301 ? 118.756 -22.572  3.998   1.00 53.55  ? 301 GLU B CG    1 
ATOM   5377  C CD    . GLU B 1 301 ? 119.013 -22.491  5.505   1.00 52.32  ? 301 GLU B CD    1 
ATOM   5378  O OE1   . GLU B 1 301 ? 118.248 -23.125  6.273   1.00 52.38  ? 301 GLU B OE1   1 
ATOM   5379  O OE2   . GLU B 1 301 ? 119.990 -21.809  5.917   1.00 49.25  ? 301 GLU B OE2   1 
ATOM   5380  N N     . LYS B 1 302 ? 114.161 -22.678  3.210   1.00 56.15  ? 302 LYS B N     1 
ATOM   5381  C CA    . LYS B 1 302 ? 112.924 -22.896  2.476   1.00 57.33  ? 302 LYS B CA    1 
ATOM   5382  C C     . LYS B 1 302 ? 112.360 -21.557  1.992   1.00 57.08  ? 302 LYS B C     1 
ATOM   5383  O O     . LYS B 1 302 ? 111.947 -21.430  0.832   1.00 57.79  ? 302 LYS B O     1 
ATOM   5384  C CB    . LYS B 1 302 ? 111.883 -23.627  3.342   1.00 58.05  ? 302 LYS B CB    1 
ATOM   5385  C CG    . LYS B 1 302 ? 110.499 -23.699  2.693   1.00 59.70  ? 302 LYS B CG    1 
ATOM   5386  C CD    . LYS B 1 302 ? 109.438 -24.375  3.548   1.00 62.25  ? 302 LYS B CD    1 
ATOM   5387  C CE    . LYS B 1 302 ? 108.144 -24.536  2.730   1.00 64.45  ? 302 LYS B CE    1 
ATOM   5388  N NZ    . LYS B 1 302 ? 107.361 -25.765  3.078   1.00 65.57  ? 302 LYS B NZ    1 
ATOM   5389  N N     . ALA B 1 303 ? 112.350 -20.564  2.884   1.00 56.15  ? 303 ALA B N     1 
ATOM   5390  C CA    . ALA B 1 303 ? 111.817 -19.250  2.550   1.00 55.65  ? 303 ALA B CA    1 
ATOM   5391  C C     . ALA B 1 303 ? 112.673 -18.544  1.505   1.00 55.45  ? 303 ALA B C     1 
ATOM   5392  O O     . ALA B 1 303 ? 112.126 -17.879  0.621   1.00 55.89  ? 303 ALA B O     1 
ATOM   5393  C CB    . ALA B 1 303 ? 111.682 -18.399  3.788   1.00 55.05  ? 303 ALA B CB    1 
ATOM   5394  N N     . LEU B 1 304 ? 114.001 -18.705  1.606   1.00 54.72  ? 304 LEU B N     1 
ATOM   5395  C CA    . LEU B 1 304 ? 114.947 -18.018  0.726   1.00 53.97  ? 304 LEU B CA    1 
ATOM   5396  C C     . LEU B 1 304 ? 114.819 -18.541  -0.694  1.00 54.86  ? 304 LEU B C     1 
ATOM   5397  O O     . LEU B 1 304 ? 114.489 -17.786  -1.607  1.00 55.41  ? 304 LEU B O     1 
ATOM   5398  C CB    . LEU B 1 304 ? 116.390 -18.170  1.204   1.00 53.20  ? 304 LEU B CB    1 
ATOM   5399  C CG    . LEU B 1 304 ? 117.379 -17.008  1.014   1.00 52.33  ? 304 LEU B CG    1 
ATOM   5400  C CD1   . LEU B 1 304 ? 118.798 -17.536  0.804   1.00 52.36  ? 304 LEU B CD1   1 
ATOM   5401  C CD2   . LEU B 1 304 ? 117.025 -16.070  -0.113  1.00 51.18  ? 304 LEU B CD2   1 
ATOM   5402  N N     . PHE B 1 305 ? 115.064 -19.834  -0.880  1.00 55.06  ? 305 PHE B N     1 
ATOM   5403  C CA    . PHE B 1 305 ? 115.049 -20.414  -2.218  1.00 55.29  ? 305 PHE B CA    1 
ATOM   5404  C C     . PHE B 1 305 ? 113.678 -20.306  -2.884  1.00 55.84  ? 305 PHE B C     1 
ATOM   5405  O O     . PHE B 1 305 ? 113.582 -20.339  -4.103  1.00 56.45  ? 305 PHE B O     1 
ATOM   5406  C CB    . PHE B 1 305 ? 115.564 -21.849  -2.186  1.00 55.71  ? 305 PHE B CB    1 
ATOM   5407  C CG    . PHE B 1 305 ? 117.006 -21.943  -1.849  1.00 54.84  ? 305 PHE B CG    1 
ATOM   5408  C CD1   . PHE B 1 305 ? 117.963 -21.478  -2.740  1.00 55.70  ? 305 PHE B CD1   1 
ATOM   5409  C CD2   . PHE B 1 305 ? 117.414 -22.470  -0.642  1.00 54.53  ? 305 PHE B CD2   1 
ATOM   5410  C CE1   . PHE B 1 305 ? 119.317 -21.540  -2.440  1.00 56.00  ? 305 PHE B CE1   1 
ATOM   5411  C CE2   . PHE B 1 305 ? 118.763 -22.542  -0.323  1.00 55.76  ? 305 PHE B CE2   1 
ATOM   5412  C CZ    . PHE B 1 305 ? 119.723 -22.074  -1.226  1.00 56.25  ? 305 PHE B CZ    1 
ATOM   5413  N N     . ARG B 1 306 ? 112.621 -20.162  -2.086  1.00 55.53  ? 306 ARG B N     1 
ATOM   5414  C CA    . ARG B 1 306 ? 111.292 -19.909  -2.641  1.00 55.94  ? 306 ARG B CA    1 
ATOM   5415  C C     . ARG B 1 306 ? 111.316 -18.543  -3.322  1.00 55.78  ? 306 ARG B C     1 
ATOM   5416  O O     . ARG B 1 306 ? 110.879 -18.403  -4.473  1.00 56.27  ? 306 ARG B O     1 
ATOM   5417  C CB    . ARG B 1 306 ? 110.212 -19.964  -1.551  1.00 55.67  ? 306 ARG B CB    1 
ATOM   5418  C CG    . ARG B 1 306 ? 108.789 -19.911  -2.076  1.00 55.65  ? 306 ARG B CG    1 
ATOM   5419  C CD    . ARG B 1 306 ? 107.865 -19.126  -1.158  1.00 54.97  ? 306 ARG B CD    1 
ATOM   5420  N NE    . ARG B 1 306 ? 107.397 -19.908  -0.011  1.00 54.65  ? 306 ARG B NE    1 
ATOM   5421  C CZ    . ARG B 1 306 ? 107.774 -19.709  1.250   1.00 53.30  ? 306 ARG B CZ    1 
ATOM   5422  N NH1   . ARG B 1 306 ? 107.284 -20.471  2.210   1.00 53.37  ? 306 ARG B NH1   1 
ATOM   5423  N NH2   . ARG B 1 306 ? 108.642 -18.756  1.556   1.00 52.84  ? 306 ARG B NH2   1 
ATOM   5424  N N     . ALA B 1 307 ? 111.857 -17.556  -2.604  1.00 55.02  ? 307 ALA B N     1 
ATOM   5425  C CA    . ALA B 1 307 ? 112.025 -16.202  -3.120  1.00 55.21  ? 307 ALA B CA    1 
ATOM   5426  C C     . ALA B 1 307 ? 112.951 -16.153  -4.345  1.00 56.26  ? 307 ALA B C     1 
ATOM   5427  O O     . ALA B 1 307 ? 112.613 -15.512  -5.338  1.00 57.37  ? 307 ALA B O     1 
ATOM   5428  C CB    . ALA B 1 307 ? 112.519 -15.280  -2.039  1.00 53.54  ? 307 ALA B CB    1 
ATOM   5429  N N     . LEU B 1 308 ? 114.091 -16.847  -4.286  1.00 56.44  ? 308 LEU B N     1 
ATOM   5430  C CA    . LEU B 1 308 ? 115.058 -16.865  -5.390  1.00 57.04  ? 308 LEU B CA    1 
ATOM   5431  C C     . LEU B 1 308 ? 114.570 -17.577  -6.657  1.00 58.69  ? 308 LEU B C     1 
ATOM   5432  O O     . LEU B 1 308 ? 114.911 -17.176  -7.763  1.00 59.34  ? 308 LEU B O     1 
ATOM   5433  C CB    . LEU B 1 308 ? 116.393 -17.453  -4.938  1.00 56.63  ? 308 LEU B CB    1 
ATOM   5434  C CG    . LEU B 1 308 ? 117.161 -16.816  -3.769  1.00 55.48  ? 308 LEU B CG    1 
ATOM   5435  C CD1   . LEU B 1 308 ? 118.449 -17.600  -3.497  1.00 55.50  ? 308 LEU B CD1   1 
ATOM   5436  C CD2   . LEU B 1 308 ? 117.480 -15.343  -3.987  1.00 54.10  ? 308 LEU B CD2   1 
ATOM   5437  N N     . ARG B 1 309 ? 113.774 -18.628  -6.500  1.00 59.91  ? 309 ARG B N     1 
ATOM   5438  C CA    . ARG B 1 309 ? 113.211 -19.343  -7.655  1.00 62.03  ? 309 ARG B CA    1 
ATOM   5439  C C     . ARG B 1 309 ? 112.138 -18.537  -8.382  1.00 62.06  ? 309 ARG B C     1 
ATOM   5440  O O     . ARG B 1 309 ? 112.057 -18.588  -9.604  1.00 63.12  ? 309 ARG B O     1 
ATOM   5441  C CB    . ARG B 1 309 ? 112.648 -20.705  -7.240  1.00 63.08  ? 309 ARG B CB    1 
ATOM   5442  C CG    . ARG B 1 309 ? 113.719 -21.762  -6.978  1.00 66.83  ? 309 ARG B CG    1 
ATOM   5443  C CD    . ARG B 1 309 ? 113.152 -23.001  -6.272  1.00 74.26  ? 309 ARG B CD    1 
ATOM   5444  N NE    . ARG B 1 309 ? 114.140 -24.084  -6.179  1.00 80.13  ? 309 ARG B NE    1 
ATOM   5445  C CZ    . ARG B 1 309 ? 114.402 -24.966  -7.156  1.00 84.24  ? 309 ARG B CZ    1 
ATOM   5446  N NH1   . ARG B 1 309 ? 113.751 -24.905  -8.317  1.00 85.62  ? 309 ARG B NH1   1 
ATOM   5447  N NH2   . ARG B 1 309 ? 115.324 -25.915  -6.976  1.00 85.72  ? 309 ARG B NH2   1 
ATOM   5448  N N     . SER B 1 310 ? 111.344 -17.781  -7.625  1.00 61.05  ? 310 SER B N     1 
ATOM   5449  C CA    . SER B 1 310 ? 110.157 -17.118  -8.160  1.00 61.32  ? 310 SER B CA    1 
ATOM   5450  C C     . SER B 1 310 ? 110.267 -15.599  -8.289  1.00 60.46  ? 310 SER B C     1 
ATOM   5451  O O     . SER B 1 310 ? 109.454 -14.973  -8.967  1.00 61.05  ? 310 SER B O     1 
ATOM   5452  C CB    . SER B 1 310 ? 108.946 -17.461  -7.293  1.00 61.45  ? 310 SER B CB    1 
ATOM   5453  O OG    . SER B 1 310 ? 109.112 -16.953  -5.982  1.00 60.90  ? 310 SER B OG    1 
ATOM   5454  N N     . GLY B 1 311 ? 111.253 -15.005  -7.632  1.00 58.92  ? 311 GLY B N     1 
ATOM   5455  C CA    . GLY B 1 311 ? 111.367 -13.550  -7.599  1.00 57.95  ? 311 GLY B CA    1 
ATOM   5456  C C     . GLY B 1 311 ? 110.405 -12.927  -6.596  1.00 57.13  ? 311 GLY B C     1 
ATOM   5457  O O     . GLY B 1 311 ? 110.111 -11.730  -6.660  1.00 56.98  ? 311 GLY B O     1 
ATOM   5458  N N     . GLY B 1 312 ? 109.910 -13.740  -5.667  1.00 56.35  ? 312 GLY B N     1 
ATOM   5459  C CA    . GLY B 1 312 ? 109.047 -13.243  -4.607  1.00 55.78  ? 312 GLY B CA    1 
ATOM   5460  C C     . GLY B 1 312 ? 109.787 -12.493  -3.512  1.00 54.57  ? 312 GLY B C     1 
ATOM   5461  O O     . GLY B 1 312 ? 110.947 -12.111  -3.671  1.00 53.68  ? 312 GLY B O     1 
ATOM   5462  N N     . ARG B 1 313 ? 109.097 -12.293  -2.394  1.00 54.41  ? 313 ARG B N     1 
ATOM   5463  C CA    . ARG B 1 313 ? 109.657 -11.594  -1.244  1.00 53.90  ? 313 ARG B CA    1 
ATOM   5464  C C     . ARG B 1 313 ? 110.483 -12.542  -0.386  1.00 52.46  ? 313 ARG B C     1 
ATOM   5465  O O     . ARG B 1 313 ? 110.011 -13.624  -0.020  1.00 52.56  ? 313 ARG B O     1 
ATOM   5466  C CB    . ARG B 1 313 ? 108.547 -11.003  -0.380  1.00 54.80  ? 313 ARG B CB    1 
ATOM   5467  C CG    . ARG B 1 313 ? 107.613 -10.053  -1.082  1.00 58.44  ? 313 ARG B CG    1 
ATOM   5468  C CD    . ARG B 1 313 ? 106.238 -10.124  -0.412  1.00 65.47  ? 313 ARG B CD    1 
ATOM   5469  N NE    . ARG B 1 313 ? 105.189 -9.728   -1.352  1.00 72.65  ? 313 ARG B NE    1 
ATOM   5470  C CZ    . ARG B 1 313 ? 104.876 -8.463   -1.645  1.00 75.50  ? 313 ARG B CZ    1 
ATOM   5471  N NH1   . ARG B 1 313 ? 105.530 -7.448   -1.060  1.00 75.62  ? 313 ARG B NH1   1 
ATOM   5472  N NH2   . ARG B 1 313 ? 103.906 -8.215   -2.524  1.00 77.03  ? 313 ARG B NH2   1 
ATOM   5473  N N     . PRO B 1 314 ? 111.714 -12.127  -0.046  1.00 51.17  ? 314 PRO B N     1 
ATOM   5474  C CA    . PRO B 1 314 ? 112.642 -12.937  0.727   1.00 50.15  ? 314 PRO B CA    1 
ATOM   5475  C C     . PRO B 1 314 ? 112.391 -12.842  2.233   1.00 49.25  ? 314 PRO B C     1 
ATOM   5476  O O     . PRO B 1 314 ? 111.740 -11.900  2.688   1.00 49.16  ? 314 PRO B O     1 
ATOM   5477  C CB    . PRO B 1 314 ? 113.989 -12.311  0.379   1.00 49.76  ? 314 PRO B CB    1 
ATOM   5478  C CG    . PRO B 1 314 ? 113.675 -10.882  0.185   1.00 49.99  ? 314 PRO B CG    1 
ATOM   5479  C CD    . PRO B 1 314 ? 112.312 -10.837  -0.433  1.00 51.05  ? 314 PRO B CD    1 
ATOM   5480  N N     . PRO B 1 315 ? 112.902 -13.813  3.007   1.00 48.68  ? 315 PRO B N     1 
ATOM   5481  C CA    . PRO B 1 315 ? 112.875 -13.685  4.469   1.00 48.18  ? 315 PRO B CA    1 
ATOM   5482  C C     . PRO B 1 315 ? 113.730 -12.516  4.952   1.00 47.55  ? 315 PRO B C     1 
ATOM   5483  O O     . PRO B 1 315 ? 114.813 -12.281  4.402   1.00 47.10  ? 315 PRO B O     1 
ATOM   5484  C CB    . PRO B 1 315 ? 113.482 -15.009  4.959   1.00 48.14  ? 315 PRO B CB    1 
ATOM   5485  C CG    . PRO B 1 315 ? 114.204 -15.582  3.776   1.00 48.48  ? 315 PRO B CG    1 
ATOM   5486  C CD    . PRO B 1 315 ? 113.427 -15.121  2.575   1.00 48.83  ? 315 PRO B CD    1 
ATOM   5487  N N     . LYS B 1 316 ? 113.234 -11.789  5.958   1.00 47.37  ? 316 LYS B N     1 
ATOM   5488  C CA    . LYS B 1 316 ? 113.976 -10.683  6.579   1.00 46.49  ? 316 LYS B CA    1 
ATOM   5489  C C     . LYS B 1 316 ? 115.011 -11.229  7.547   1.00 45.59  ? 316 LYS B C     1 
ATOM   5490  O O     . LYS B 1 316 ? 115.962 -10.543  7.903   1.00 45.19  ? 316 LYS B O     1 
ATOM   5491  C CB    . LYS B 1 316 ? 113.043 -9.780   7.371   1.00 47.04  ? 316 LYS B CB    1 
ATOM   5492  C CG    . LYS B 1 316 ? 111.933 -9.087   6.605   1.00 48.64  ? 316 LYS B CG    1 
ATOM   5493  C CD    . LYS B 1 316 ? 111.099 -8.257   7.595   1.00 49.42  ? 316 LYS B CD    1 
ATOM   5494  C CE    . LYS B 1 316 ? 109.627 -8.334   7.277   1.00 50.39  ? 316 LYS B CE    1 
ATOM   5495  N NZ    . LYS B 1 316 ? 109.130 -9.745   7.144   1.00 50.16  ? 316 LYS B NZ    1 
ATOM   5496  N N     . HIS B 1 317 ? 114.809 -12.469  7.976   1.00 45.14  ? 317 HIS B N     1 
ATOM   5497  C CA    . HIS B 1 317 ? 115.584 -13.048  9.045   1.00 44.64  ? 317 HIS B CA    1 
ATOM   5498  C C     . HIS B 1 317 ? 115.371 -14.554  9.117   1.00 44.95  ? 317 HIS B C     1 
ATOM   5499  O O     . HIS B 1 317 ? 114.242 -15.037  9.000   1.00 44.32  ? 317 HIS B O     1 
ATOM   5500  C CB    . HIS B 1 317 ? 115.173 -12.413  10.369  1.00 44.56  ? 317 HIS B CB    1 
ATOM   5501  C CG    . HIS B 1 317 ? 113.698 -12.233  10.506  1.00 45.12  ? 317 HIS B CG    1 
ATOM   5502  N ND1   . HIS B 1 317 ? 112.812 -13.289  10.451  1.00 46.73  ? 317 HIS B ND1   1 
ATOM   5503  C CD2   . HIS B 1 317 ? 112.951 -11.122  10.685  1.00 45.77  ? 317 HIS B CD2   1 
ATOM   5504  C CE1   . HIS B 1 317 ? 111.580 -12.833  10.587  1.00 47.95  ? 317 HIS B CE1   1 
ATOM   5505  N NE2   . HIS B 1 317 ? 111.637 -11.521  10.737  1.00 48.07  ? 317 HIS B NE2   1 
ATOM   5506  N N     . GLY B 1 318 ? 116.473 -15.279  9.314   1.00 45.53  ? 318 GLY B N     1 
ATOM   5507  C CA    . GLY B 1 318 ? 116.450 -16.714  9.597   1.00 46.70  ? 318 GLY B CA    1 
ATOM   5508  C C     . GLY B 1 318 ? 116.504 -17.031  11.089  1.00 47.52  ? 318 GLY B C     1 
ATOM   5509  O O     . GLY B 1 318 ? 115.653 -16.585  11.855  1.00 47.89  ? 318 GLY B O     1 
ATOM   5510  N N     . ILE B 1 319 ? 117.517 -17.783  11.515  1.00 48.15  ? 319 ILE B N     1 
ATOM   5511  C CA    . ILE B 1 319 ? 117.650 -18.167  12.930  1.00 48.62  ? 319 ILE B CA    1 
ATOM   5512  C C     . ILE B 1 319 ? 117.865 -16.975  13.858  1.00 48.53  ? 319 ILE B C     1 
ATOM   5513  O O     . ILE B 1 319 ? 117.665 -17.081  15.056  1.00 48.80  ? 319 ILE B O     1 
ATOM   5514  C CB    . ILE B 1 319 ? 118.734 -19.266  13.148  1.00 48.74  ? 319 ILE B CB    1 
ATOM   5515  C CG1   . ILE B 1 319 ? 118.479 -20.007  14.458  1.00 49.86  ? 319 ILE B CG1   1 
ATOM   5516  C CG2   . ILE B 1 319 ? 120.134 -18.690  13.156  1.00 48.26  ? 319 ILE B CG2   1 
ATOM   5517  C CD1   . ILE B 1 319 ? 117.130 -20.707  14.525  1.00 51.89  ? 319 ILE B CD1   1 
ATOM   5518  N N     . ILE B 1 320 ? 118.244 -15.849  13.258  1.00 48.75  ? 320 ILE B N     1 
ATOM   5519  C CA    . ILE B 1 320 ? 118.450 -14.542  13.888  1.00 49.29  ? 320 ILE B CA    1 
ATOM   5520  C C     . ILE B 1 320 ? 117.142 -13.998  14.496  1.00 50.03  ? 320 ILE B C     1 
ATOM   5521  O O     . ILE B 1 320 ? 117.155 -13.130  15.387  1.00 50.43  ? 320 ILE B O     1 
ATOM   5522  C CB    . ILE B 1 320 ? 119.103 -13.565  12.820  1.00 49.03  ? 320 ILE B CB    1 
ATOM   5523  C CG1   . ILE B 1 320 ? 120.590 -13.852  12.695  1.00 50.01  ? 320 ILE B CG1   1 
ATOM   5524  C CG2   . ILE B 1 320 ? 118.959 -12.110  13.130  1.00 49.37  ? 320 ILE B CG2   1 
ATOM   5525  C CD1   . ILE B 1 320 ? 121.199 -14.404  13.971  1.00 52.45  ? 320 ILE B CD1   1 
ATOM   5526  N N     . PHE B 1 321 ? 116.009 -14.531  14.043  1.00 50.32  ? 321 PHE B N     1 
ATOM   5527  C CA    . PHE B 1 321 ? 114.718 -14.120  14.583  1.00 50.87  ? 321 PHE B CA    1 
ATOM   5528  C C     . PHE B 1 321 ? 114.691 -14.187  16.106  1.00 52.03  ? 321 PHE B C     1 
ATOM   5529  O O     . PHE B 1 321 ? 114.029 -13.379  16.763  1.00 52.92  ? 321 PHE B O     1 
ATOM   5530  C CB    . PHE B 1 321 ? 113.603 -14.980  14.001  1.00 50.60  ? 321 PHE B CB    1 
ATOM   5531  C CG    . PHE B 1 321 ? 112.220 -14.469  14.305  1.00 50.21  ? 321 PHE B CG    1 
ATOM   5532  C CD1   . PHE B 1 321 ? 111.770 -13.263  13.768  1.00 48.86  ? 321 PHE B CD1   1 
ATOM   5533  C CD2   . PHE B 1 321 ? 111.362 -15.192  15.129  1.00 48.75  ? 321 PHE B CD2   1 
ATOM   5534  C CE1   . PHE B 1 321 ? 110.484 -12.800  14.050  1.00 48.08  ? 321 PHE B CE1   1 
ATOM   5535  C CE2   . PHE B 1 321 ? 110.084 -14.738  15.401  1.00 47.10  ? 321 PHE B CE2   1 
ATOM   5536  C CZ    . PHE B 1 321 ? 109.646 -13.541  14.868  1.00 46.82  ? 321 PHE B CZ    1 
ATOM   5537  N N     . GLN B 1 322 ? 115.432 -15.148  16.651  1.00 52.73  ? 322 GLN B N     1 
ATOM   5538  C CA    . GLN B 1 322 ? 115.509 -15.402  18.092  1.00 53.98  ? 322 GLN B CA    1 
ATOM   5539  C C     . GLN B 1 322 ? 116.077 -14.272  18.964  1.00 53.70  ? 322 GLN B C     1 
ATOM   5540  O O     . GLN B 1 322 ? 115.794 -14.227  20.160  1.00 54.39  ? 322 GLN B O     1 
ATOM   5541  C CB    . GLN B 1 322 ? 116.283 -16.700  18.333  1.00 54.46  ? 322 GLN B CB    1 
ATOM   5542  C CG    . GLN B 1 322 ? 115.439 -17.945  18.072  1.00 57.88  ? 322 GLN B CG    1 
ATOM   5543  C CD    . GLN B 1 322 ? 116.270 -19.179  17.748  1.00 61.51  ? 322 GLN B CD    1 
ATOM   5544  O OE1   . GLN B 1 322 ? 117.485 -19.211  17.990  1.00 62.47  ? 322 GLN B OE1   1 
ATOM   5545  N NE2   . GLN B 1 322 ? 115.613 -20.212  17.198  1.00 62.57  ? 322 GLN B NE2   1 
ATOM   5546  N N     . TYR B 1 323 ? 116.866 -13.376  18.366  1.00 52.87  ? 323 TYR B N     1 
ATOM   5547  C CA    . TYR B 1 323 ? 117.415 -12.208  19.052  1.00 52.89  ? 323 TYR B CA    1 
ATOM   5548  C C     . TYR B 1 323 ? 116.260 -11.393  19.568  1.00 53.60  ? 323 TYR B C     1 
ATOM   5549  O O     . TYR B 1 323 ? 115.365 -11.072  18.789  1.00 53.57  ? 323 TYR B O     1 
ATOM   5550  C CB    . TYR B 1 323 ? 118.213 -11.356  18.071  1.00 52.27  ? 323 TYR B CB    1 
ATOM   5551  C CG    . TYR B 1 323 ? 119.029 -10.226  18.680  1.00 52.43  ? 323 TYR B CG    1 
ATOM   5552  C CD1   . TYR B 1 323 ? 120.110 -10.489  19.536  1.00 53.09  ? 323 TYR B CD1   1 
ATOM   5553  C CD2   . TYR B 1 323 ? 118.759 -8.898   18.360  1.00 52.00  ? 323 TYR B CD2   1 
ATOM   5554  C CE1   . TYR B 1 323 ? 120.878 -9.450   20.081  1.00 52.15  ? 323 TYR B CE1   1 
ATOM   5555  C CE2   . TYR B 1 323 ? 119.525 -7.856   18.888  1.00 51.65  ? 323 TYR B CE2   1 
ATOM   5556  C CZ    . TYR B 1 323 ? 120.576 -8.139   19.744  1.00 52.17  ? 323 TYR B CZ    1 
ATOM   5557  O OH    . TYR B 1 323 ? 121.319 -7.107   20.258  1.00 51.98  ? 323 TYR B OH    1 
ATOM   5558  N N     . PRO B 1 324 ? 116.259 -11.063  20.879  1.00 54.38  ? 324 PRO B N     1 
ATOM   5559  C CA    . PRO B 1 324 ? 115.129 -10.403  21.522  1.00 54.96  ? 324 PRO B CA    1 
ATOM   5560  C C     . PRO B 1 324 ? 114.680 -9.130   20.784  1.00 54.81  ? 324 PRO B C     1 
ATOM   5561  O O     . PRO B 1 324 ? 113.477 -8.929   20.579  1.00 54.77  ? 324 PRO B O     1 
ATOM   5562  C CB    . PRO B 1 324 ? 115.673 -10.069  22.912  1.00 55.78  ? 324 PRO B CB    1 
ATOM   5563  C CG    . PRO B 1 324 ? 116.669 -11.089  23.163  1.00 55.59  ? 324 PRO B CG    1 
ATOM   5564  C CD    . PRO B 1 324 ? 117.345 -11.297  21.844  1.00 54.95  ? 324 PRO B CD    1 
ATOM   5565  N N     . ALA B 1 325 ? 115.634 -8.299   20.361  1.00 54.43  ? 325 ALA B N     1 
ATOM   5566  C CA    . ALA B 1 325 ? 115.294 -7.040   19.700  1.00 54.38  ? 325 ALA B CA    1 
ATOM   5567  C C     . ALA B 1 325 ? 114.453 -7.231   18.433  1.00 54.07  ? 325 ALA B C     1 
ATOM   5568  O O     . ALA B 1 325 ? 113.660 -6.366   18.099  1.00 54.41  ? 325 ALA B O     1 
ATOM   5569  C CB    . ALA B 1 325 ? 116.542 -6.201   19.424  1.00 53.90  ? 325 ALA B CB    1 
ATOM   5570  N N     . ILE B 1 326 ? 114.608 -8.362   17.748  1.00 53.74  ? 326 ILE B N     1 
ATOM   5571  C CA    . ILE B 1 326 ? 113.804 -8.656   16.560  1.00 53.75  ? 326 ILE B CA    1 
ATOM   5572  C C     . ILE B 1 326 ? 112.383 -9.158   16.843  1.00 55.01  ? 326 ILE B C     1 
ATOM   5573  O O     . ILE B 1 326 ? 111.425 -8.501   16.460  1.00 55.70  ? 326 ILE B O     1 
ATOM   5574  C CB    . ILE B 1 326 ? 114.500 -9.619   15.623  1.00 52.87  ? 326 ILE B CB    1 
ATOM   5575  C CG1   . ILE B 1 326 ? 115.704 -8.937   15.000  1.00 52.63  ? 326 ILE B CG1   1 
ATOM   5576  C CG2   . ILE B 1 326 ? 113.548 -10.091  14.534  1.00 52.31  ? 326 ILE B CG2   1 
ATOM   5577  C CD1   . ILE B 1 326 ? 116.565 -9.881   14.171  1.00 52.06  ? 326 ILE B CD1   1 
ATOM   5578  N N     . HIS B 1 327 ? 112.228 -10.313  17.485  1.00 55.96  ? 327 HIS B N     1 
ATOM   5579  C CA    . HIS B 1 327 ? 110.889 -10.886  17.640  1.00 57.50  ? 327 HIS B CA    1 
ATOM   5580  C C     . HIS B 1 327 ? 109.935 -10.073  18.537  1.00 59.00  ? 327 HIS B C     1 
ATOM   5581  O O     . HIS B 1 327 ? 108.725 -10.199  18.420  1.00 59.70  ? 327 HIS B O     1 
ATOM   5582  C CB    . HIS B 1 327 ? 110.946 -12.369  18.039  1.00 57.62  ? 327 HIS B CB    1 
ATOM   5583  C CG    . HIS B 1 327 ? 111.417 -12.611  19.436  1.00 59.04  ? 327 HIS B CG    1 
ATOM   5584  N ND1   . HIS B 1 327 ? 112.753 -12.732  19.760  1.00 59.34  ? 327 HIS B ND1   1 
ATOM   5585  C CD2   . HIS B 1 327 ? 110.732 -12.769  20.595  1.00 60.13  ? 327 HIS B CD2   1 
ATOM   5586  C CE1   . HIS B 1 327 ? 112.872 -12.944  21.060  1.00 59.72  ? 327 HIS B CE1   1 
ATOM   5587  N NE2   . HIS B 1 327 ? 111.662 -12.971  21.589  1.00 60.79  ? 327 HIS B NE2   1 
ATOM   5588  N N     . THR B 1 328 ? 110.475 -9.217   19.400  1.00 60.41  ? 328 THR B N     1 
ATOM   5589  C CA    . THR B 1 328 ? 109.645 -8.353   20.244  1.00 62.27  ? 328 THR B CA    1 
ATOM   5590  C C     . THR B 1 328 ? 109.210 -7.089   19.517  1.00 62.84  ? 328 THR B C     1 
ATOM   5591  O O     . THR B 1 328 ? 108.122 -6.589   19.758  1.00 63.97  ? 328 THR B O     1 
ATOM   5592  C CB    . THR B 1 328 ? 110.354 -7.944   21.548  1.00 62.88  ? 328 THR B CB    1 
ATOM   5593  O OG1   . THR B 1 328 ? 111.333 -8.928   21.898  1.00 62.04  ? 328 THR B OG1   1 
ATOM   5594  C CG2   . THR B 1 328 ? 109.332 -7.822   22.691  1.00 65.22  ? 328 THR B CG2   1 
ATOM   5595  N N     . SER B 1 329 ? 110.068 -6.580   18.637  1.00 62.87  ? 329 SER B N     1 
ATOM   5596  C CA    . SER B 1 329 ? 109.773 -5.404   17.813  1.00 63.56  ? 329 SER B CA    1 
ATOM   5597  C C     . SER B 1 329 ? 108.674 -5.621   16.777  1.00 63.98  ? 329 SER B C     1 
ATOM   5598  O O     . SER B 1 329 ? 108.500 -6.729   16.268  1.00 63.44  ? 329 SER B O     1 
ATOM   5599  C CB    . SER B 1 329 ? 111.032 -4.947   17.085  1.00 62.93  ? 329 SER B CB    1 
ATOM   5600  O OG    . SER B 1 329 ? 111.941 -4.343   17.984  1.00 64.03  ? 329 SER B OG    1 
ATOM   5601  N N     . PRO B 1 330 ? 107.935 -4.550   16.457  1.00 65.24  ? 330 PRO B N     1 
ATOM   5602  C CA    . PRO B 1 330 ? 106.915 -4.548   15.412  1.00 66.11  ? 330 PRO B CA    1 
ATOM   5603  C C     . PRO B 1 330 ? 107.475 -4.912   14.037  1.00 65.98  ? 330 PRO B C     1 
ATOM   5604  O O     . PRO B 1 330 ? 108.671 -4.745   13.796  1.00 65.69  ? 330 PRO B O     1 
ATOM   5605  C CB    . PRO B 1 330 ? 106.404 -3.105   15.423  1.00 67.01  ? 330 PRO B CB    1 
ATOM   5606  C CG    . PRO B 1 330 ? 107.407 -2.331   16.224  1.00 66.76  ? 330 PRO B CG    1 
ATOM   5607  C CD    . PRO B 1 330 ? 107.924 -3.293   17.216  1.00 66.13  ? 330 PRO B CD    1 
ATOM   5608  N N     . ARG B 1 331 ? 106.599 -5.376   13.145  1.00 66.83  ? 331 ARG B N     1 
ATOM   5609  C CA    . ARG B 1 331 ? 107.005 -6.043   11.903  1.00 67.14  ? 331 ARG B CA    1 
ATOM   5610  C C     . ARG B 1 331 ? 107.799 -5.165   10.932  1.00 66.62  ? 331 ARG B C     1 
ATOM   5611  O O     . ARG B 1 331 ? 108.606 -5.683   10.157  1.00 66.47  ? 331 ARG B O     1 
ATOM   5612  C CB    . ARG B 1 331 ? 105.799 -6.680   11.190  1.00 68.17  ? 331 ARG B CB    1 
ATOM   5613  C CG    . ARG B 1 331 ? 104.495 -6.742   12.033  1.00 72.24  ? 331 ARG B CG    1 
ATOM   5614  C CD    . ARG B 1 331 ? 103.750 -8.084   11.877  1.00 77.55  ? 331 ARG B CD    1 
ATOM   5615  N NE    . ARG B 1 331 ? 103.859 -8.932   13.073  1.00 81.28  ? 331 ARG B NE    1 
ATOM   5616  C CZ    . ARG B 1 331 ? 103.645 -10.250  13.099  1.00 83.37  ? 331 ARG B CZ    1 
ATOM   5617  N NH1   . ARG B 1 331 ? 103.327 -10.901  11.978  1.00 84.37  ? 331 ARG B NH1   1 
ATOM   5618  N NH2   . ARG B 1 331 ? 103.765 -10.923  14.246  1.00 83.62  ? 331 ARG B NH2   1 
ATOM   5619  N N     . TRP B 1 332 ? 107.583 -3.851   10.971  1.00 66.83  ? 332 TRP B N     1 
ATOM   5620  C CA    . TRP B 1 332 ? 108.280 -2.944   10.052  1.00 66.44  ? 332 TRP B CA    1 
ATOM   5621  C C     . TRP B 1 332 ? 109.655 -2.551   10.535  1.00 65.28  ? 332 TRP B C     1 
ATOM   5622  O O     . TRP B 1 332 ? 110.428 -1.970   9.766   1.00 65.86  ? 332 TRP B O     1 
ATOM   5623  C CB    . TRP B 1 332 ? 107.475 -1.680   9.762   1.00 67.88  ? 332 TRP B CB    1 
ATOM   5624  C CG    . TRP B 1 332 ? 107.150 -0.906   10.974  1.00 70.19  ? 332 TRP B CG    1 
ATOM   5625  C CD1   . TRP B 1 332 ? 107.867 0.128    11.516  1.00 71.85  ? 332 TRP B CD1   1 
ATOM   5626  C CD2   . TRP B 1 332 ? 106.020 -1.104   11.820  1.00 72.74  ? 332 TRP B CD2   1 
ATOM   5627  N NE1   . TRP B 1 332 ? 107.248 0.586    12.656  1.00 73.34  ? 332 TRP B NE1   1 
ATOM   5628  C CE2   . TRP B 1 332 ? 106.110 -0.154   12.868  1.00 74.43  ? 332 TRP B CE2   1 
ATOM   5629  C CE3   . TRP B 1 332 ? 104.932 -1.998   11.799  1.00 74.20  ? 332 TRP B CE3   1 
ATOM   5630  C CZ2   . TRP B 1 332 ? 105.142 -0.063   13.893  1.00 76.58  ? 332 TRP B CZ2   1 
ATOM   5631  C CZ3   . TRP B 1 332 ? 103.968 -1.914   12.819  1.00 76.43  ? 332 TRP B CZ3   1 
ATOM   5632  C CH2   . TRP B 1 332 ? 104.080 -0.946   13.849  1.00 77.27  ? 332 TRP B CH2   1 
ATOM   5633  N N     . GLN B 1 333 ? 109.957 -2.839   11.799  1.00 63.67  ? 333 GLN B N     1 
ATOM   5634  C CA    . GLN B 1 333 ? 111.293 -2.582   12.332  1.00 62.09  ? 333 GLN B CA    1 
ATOM   5635  C C     . GLN B 1 333 ? 112.238 -3.764   12.161  1.00 60.33  ? 333 GLN B C     1 
ATOM   5636  O O     . GLN B 1 333 ? 113.461 -3.591   12.119  1.00 59.79  ? 333 GLN B O     1 
ATOM   5637  C CB    . GLN B 1 333 ? 111.224 -2.221   13.805  1.00 62.65  ? 333 GLN B CB    1 
ATOM   5638  C CG    . GLN B 1 333 ? 110.763 -0.811   14.072  1.00 64.15  ? 333 GLN B CG    1 
ATOM   5639  C CD    . GLN B 1 333 ? 110.532 -0.551   15.550  1.00 64.24  ? 333 GLN B CD    1 
ATOM   5640  O OE1   . GLN B 1 333 ? 111.190 -1.136   16.412  1.00 62.96  ? 333 GLN B OE1   1 
ATOM   5641  N NE2   . GLN B 1 333 ? 109.592 0.332    15.846  1.00 65.06  ? 333 GLN B NE2   1 
ATOM   5642  N N     . ARG B 1 334 ? 111.664 -4.960   12.059  1.00 58.86  ? 334 ARG B N     1 
ATOM   5643  C CA    . ARG B 1 334 ? 112.430 -6.200   12.119  1.00 57.08  ? 334 ARG B CA    1 
ATOM   5644  C C     . ARG B 1 334 ? 113.510 -6.351   11.040  1.00 55.86  ? 334 ARG B C     1 
ATOM   5645  O O     . ARG B 1 334 ? 114.638 -6.734   11.347  1.00 55.39  ? 334 ARG B O     1 
ATOM   5646  C CB    . ARG B 1 334 ? 111.492 -7.397   12.107  1.00 56.98  ? 334 ARG B CB    1 
ATOM   5647  C CG    . ARG B 1 334 ? 110.668 -7.535   13.351  1.00 57.11  ? 334 ARG B CG    1 
ATOM   5648  C CD    . ARG B 1 334 ? 109.732 -8.701   13.185  1.00 59.26  ? 334 ARG B CD    1 
ATOM   5649  N NE    . ARG B 1 334 ? 108.831 -8.863   14.322  1.00 61.49  ? 334 ARG B NE    1 
ATOM   5650  C CZ    . ARG B 1 334 ? 107.711 -9.579   14.285  1.00 63.75  ? 334 ARG B CZ    1 
ATOM   5651  N NH1   . ARG B 1 334 ? 107.333 -10.198  13.172  1.00 65.00  ? 334 ARG B NH1   1 
ATOM   5652  N NH2   . ARG B 1 334 ? 106.956 -9.672   15.362  1.00 65.58  ? 334 ARG B NH2   1 
ATOM   5653  N N     . GLY B 1 335 ? 113.163 -6.047   9.793   1.00 55.10  ? 335 GLY B N     1 
ATOM   5654  C CA    . GLY B 1 335 ? 114.106 -6.149   8.685   1.00 53.76  ? 335 GLY B CA    1 
ATOM   5655  C C     . GLY B 1 335 ? 115.332 -5.277   8.863   1.00 53.33  ? 335 GLY B C     1 
ATOM   5656  O O     . GLY B 1 335 ? 116.441 -5.701   8.566   1.00 53.02  ? 335 GLY B O     1 
ATOM   5657  N N     . LYS B 1 336 ? 115.132 -4.051   9.337   1.00 53.44  ? 336 LYS B N     1 
ATOM   5658  C CA    . LYS B 1 336 ? 116.234 -3.159   9.661   1.00 52.97  ? 336 LYS B CA    1 
ATOM   5659  C C     . LYS B 1 336 ? 117.094 -3.706   10.787  1.00 52.54  ? 336 LYS B C     1 
ATOM   5660  O O     . LYS B 1 336 ? 118.318 -3.752   10.656  1.00 53.08  ? 336 LYS B O     1 
ATOM   5661  C CB    . LYS B 1 336 ? 115.711 -1.783   10.027  1.00 53.63  ? 336 LYS B CB    1 
ATOM   5662  C CG    . LYS B 1 336 ? 115.136 -1.054   8.834   1.00 55.20  ? 336 LYS B CG    1 
ATOM   5663  C CD    . LYS B 1 336 ? 114.262 0.121    9.228   1.00 56.26  ? 336 LYS B CD    1 
ATOM   5664  C CE    . LYS B 1 336 ? 113.012 0.081    8.394   1.00 57.76  ? 336 LYS B CE    1 
ATOM   5665  N NZ    . LYS B 1 336 ? 112.124 1.191    8.702   1.00 60.85  ? 336 LYS B NZ    1 
ATOM   5666  N N     . ILE B 1 337 ? 116.470 -4.132   11.887  1.00 51.97  ? 337 ILE B N     1 
ATOM   5667  C CA    . ILE B 1 337 ? 117.221 -4.690   13.022  1.00 50.88  ? 337 ILE B CA    1 
ATOM   5668  C C     . ILE B 1 337 ? 118.045 -5.889   12.589  1.00 49.87  ? 337 ILE B C     1 
ATOM   5669  O O     . ILE B 1 337 ? 119.228 -5.971   12.917  1.00 49.76  ? 337 ILE B O     1 
ATOM   5670  C CB    . ILE B 1 337 ? 116.318 -5.053   14.213  1.00 51.03  ? 337 ILE B CB    1 
ATOM   5671  C CG1   . ILE B 1 337 ? 115.519 -3.823   14.645  1.00 52.12  ? 337 ILE B CG1   1 
ATOM   5672  C CG2   . ILE B 1 337 ? 117.153 -5.521   15.383  1.00 50.78  ? 337 ILE B CG2   1 
ATOM   5673  C CD1   . ILE B 1 337 ? 114.414 -4.086   15.647  1.00 52.19  ? 337 ILE B CD1   1 
ATOM   5674  N N     . ALA B 1 338 ? 117.419 -6.795   11.839  1.00 49.28  ? 338 ALA B N     1 
ATOM   5675  C CA    . ALA B 1 338 ? 118.095 -7.980   11.296  1.00 48.81  ? 338 ALA B CA    1 
ATOM   5676  C C     . ALA B 1 338 ? 119.332 -7.617   10.464  1.00 48.80  ? 338 ALA B C     1 
ATOM   5677  O O     . ALA B 1 338 ? 120.427 -8.159   10.683  1.00 48.56  ? 338 ALA B O     1 
ATOM   5678  C CB    . ALA B 1 338 ? 117.136 -8.816   10.481  1.00 48.26  ? 338 ALA B CB    1 
ATOM   5679  N N     . ARG B 1 339 ? 119.149 -6.681   9.536   1.00 49.03  ? 339 ARG B N     1 
ATOM   5680  C CA    . ARG B 1 339 ? 120.214 -6.227   8.655   1.00 49.26  ? 339 ARG B CA    1 
ATOM   5681  C C     . ARG B 1 339 ? 121.400 -5.677   9.444   1.00 49.74  ? 339 ARG B C     1 
ATOM   5682  O O     . ARG B 1 339 ? 122.549 -5.950   9.101   1.00 50.01  ? 339 ARG B O     1 
ATOM   5683  C CB    . ARG B 1 339 ? 119.689 -5.156   7.698   1.00 49.60  ? 339 ARG B CB    1 
ATOM   5684  C CG    . ARG B 1 339 ? 120.255 -5.282   6.309   1.00 49.38  ? 339 ARG B CG    1 
ATOM   5685  C CD    . ARG B 1 339 ? 119.818 -4.175   5.365   1.00 49.73  ? 339 ARG B CD    1 
ATOM   5686  N NE    . ARG B 1 339 ? 118.390 -3.845   5.338   1.00 48.47  ? 339 ARG B NE    1 
ATOM   5687  C CZ    . ARG B 1 339 ? 117.894 -2.694   5.785   1.00 49.80  ? 339 ARG B CZ    1 
ATOM   5688  N NH1   . ARG B 1 339 ? 118.690 -1.775   6.313   1.00 49.84  ? 339 ARG B NH1   1 
ATOM   5689  N NH2   . ARG B 1 339 ? 116.602 -2.449   5.706   1.00 51.62  ? 339 ARG B NH2   1 
ATOM   5690  N N     . ALA B 1 340 ? 121.112 -4.907   10.496  1.00 50.19  ? 340 ALA B N     1 
ATOM   5691  C CA    . ALA B 1 340 ? 122.138 -4.297   11.333  1.00 50.54  ? 340 ALA B CA    1 
ATOM   5692  C C     . ALA B 1 340 ? 122.867 -5.359   12.153  1.00 50.72  ? 340 ALA B C     1 
ATOM   5693  O O     . ALA B 1 340 ? 124.099 -5.335   12.262  1.00 50.54  ? 340 ALA B O     1 
ATOM   5694  C CB    . ALA B 1 340 ? 121.514 -3.270   12.235  1.00 50.97  ? 340 ALA B CB    1 
ATOM   5695  N N     . LEU B 1 341 ? 122.095 -6.294   12.715  1.00 51.03  ? 341 LEU B N     1 
ATOM   5696  C CA    . LEU B 1 341 ? 122.647 -7.405   13.489  1.00 51.33  ? 341 LEU B CA    1 
ATOM   5697  C C     . LEU B 1 341 ? 123.609 -8.221   12.633  1.00 51.48  ? 341 LEU B C     1 
ATOM   5698  O O     . LEU B 1 341 ? 124.776 -8.415   13.008  1.00 51.94  ? 341 LEU B O     1 
ATOM   5699  C CB    . LEU B 1 341 ? 121.542 -8.326   14.016  1.00 50.93  ? 341 LEU B CB    1 
ATOM   5700  C CG    . LEU B 1 341 ? 121.743 -8.990   15.389  1.00 50.83  ? 341 LEU B CG    1 
ATOM   5701  C CD1   . LEU B 1 341 ? 121.007 -10.328  15.434  1.00 49.57  ? 341 LEU B CD1   1 
ATOM   5702  C CD2   . LEU B 1 341 ? 123.196 -9.165   15.804  1.00 48.46  ? 341 LEU B CD2   1 
ATOM   5703  N N     . ALA B 1 342 ? 123.109 -8.683   11.482  1.00 51.24  ? 342 ALA B N     1 
ATOM   5704  C CA    . ALA B 1 342 ? 123.877 -9.545   10.584  1.00 50.78  ? 342 ALA B CA    1 
ATOM   5705  C C     . ALA B 1 342 ? 125.192 -8.880   10.239  1.00 50.92  ? 342 ALA B C     1 
ATOM   5706  O O     . ALA B 1 342 ? 126.245 -9.508   10.336  1.00 51.14  ? 342 ALA B O     1 
ATOM   5707  C CB    . ALA B 1 342 ? 123.091 -9.861   9.330   1.00 50.47  ? 342 ALA B CB    1 
ATOM   5708  N N     . ALA B 1 343 ? 125.132 -7.603   9.862   1.00 50.97  ? 343 ALA B N     1 
ATOM   5709  C CA    . ALA B 1 343 ? 126.339 -6.855   9.542   1.00 51.17  ? 343 ALA B CA    1 
ATOM   5710  C C     . ALA B 1 343 ? 127.366 -7.006   10.682  1.00 51.33  ? 343 ALA B C     1 
ATOM   5711  O O     . ALA B 1 343 ? 128.508 -7.427   10.446  1.00 51.24  ? 343 ALA B O     1 
ATOM   5712  C CB    . ALA B 1 343 ? 126.011 -5.396   9.263   1.00 51.22  ? 343 ALA B CB    1 
ATOM   5713  N N     . LYS B 1 344 ? 126.936 -6.721   11.914  1.00 51.17  ? 344 LYS B N     1 
ATOM   5714  C CA    . LYS B 1 344 ? 127.826 -6.785   13.077  1.00 51.27  ? 344 LYS B CA    1 
ATOM   5715  C C     . LYS B 1 344 ? 128.333 -8.200   13.345  1.00 50.64  ? 344 LYS B C     1 
ATOM   5716  O O     . LYS B 1 344 ? 129.512 -8.394   13.653  1.00 51.16  ? 344 LYS B O     1 
ATOM   5717  C CB    . LYS B 1 344 ? 127.159 -6.186   14.332  1.00 51.70  ? 344 LYS B CB    1 
ATOM   5718  C CG    . LYS B 1 344 ? 126.906 -4.661   14.248  1.00 53.38  ? 344 LYS B CG    1 
ATOM   5719  C CD    . LYS B 1 344 ? 128.142 -3.891   13.716  1.00 54.40  ? 344 LYS B CD    1 
ATOM   5720  C CE    . LYS B 1 344 ? 127.860 -2.415   13.401  1.00 54.54  ? 344 LYS B CE    1 
ATOM   5721  N NZ    . LYS B 1 344 ? 129.094 -1.744   12.861  1.00 53.33  ? 344 LYS B NZ    1 
ATOM   5722  N N     . LEU B 1 345 ? 127.445 -9.180   13.213  1.00 49.48  ? 345 LEU B N     1 
ATOM   5723  C CA    . LEU B 1 345 ? 127.801 -10.583  13.360  1.00 48.78  ? 345 LEU B CA    1 
ATOM   5724  C C     . LEU B 1 345 ? 128.905 -11.026  12.388  1.00 48.69  ? 345 LEU B C     1 
ATOM   5725  O O     . LEU B 1 345 ? 129.818 -11.759  12.751  1.00 48.15  ? 345 LEU B O     1 
ATOM   5726  C CB    . LEU B 1 345 ? 126.560 -11.433  13.152  1.00 48.52  ? 345 LEU B CB    1 
ATOM   5727  C CG    . LEU B 1 345 ? 125.607 -11.544  14.337  1.00 49.34  ? 345 LEU B CG    1 
ATOM   5728  C CD1   . LEU B 1 345 ? 124.263 -12.114  13.884  1.00 48.84  ? 345 LEU B CD1   1 
ATOM   5729  C CD2   . LEU B 1 345 ? 126.224 -12.392  15.468  1.00 49.12  ? 345 LEU B CD2   1 
ATOM   5730  N N     . ALA B 1 346 ? 128.816 -10.571  11.142  1.00 48.88  ? 346 ALA B N     1 
ATOM   5731  C CA    . ALA B 1 346 ? 129.843 -10.859  10.164  1.00 49.09  ? 346 ALA B CA    1 
ATOM   5732  C C     . ALA B 1 346 ? 131.194 -10.334  10.650  1.00 49.77  ? 346 ALA B C     1 
ATOM   5733  O O     . ALA B 1 346 ? 132.182 -11.067  10.626  1.00 50.45  ? 346 ALA B O     1 
ATOM   5734  C CB    . ALA B 1 346 ? 129.482 -10.279  8.830   1.00 48.77  ? 346 ALA B CB    1 
ATOM   5735  N N     . ILE B 1 347 ? 131.233 -9.084   11.113  1.00 49.90  ? 347 ILE B N     1 
ATOM   5736  C CA    . ILE B 1 347 ? 132.453 -8.528   11.705  1.00 50.43  ? 347 ILE B CA    1 
ATOM   5737  C C     . ILE B 1 347 ? 132.886 -9.320   12.975  1.00 51.00  ? 347 ILE B C     1 
ATOM   5738  O O     . ILE B 1 347 ? 134.071 -9.670   13.145  1.00 50.97  ? 347 ILE B O     1 
ATOM   5739  C CB    . ILE B 1 347 ? 132.281 -7.043   12.033  1.00 50.43  ? 347 ILE B CB    1 
ATOM   5740  C CG1   . ILE B 1 347 ? 131.701 -6.298   10.841  1.00 50.04  ? 347 ILE B CG1   1 
ATOM   5741  C CG2   . ILE B 1 347 ? 133.608 -6.432   12.426  1.00 51.33  ? 347 ILE B CG2   1 
ATOM   5742  C CD1   . ILE B 1 347 ? 131.313 -4.847   11.143  1.00 51.38  ? 347 ILE B CD1   1 
ATOM   5743  N N     . ALA B 1 348 ? 131.918 -9.614   13.842  1.00 51.07  ? 348 ALA B N     1 
ATOM   5744  C CA    . ALA B 1 348 ? 132.170 -10.386  15.047  1.00 52.11  ? 348 ALA B CA    1 
ATOM   5745  C C     . ALA B 1 348 ? 132.800 -11.734  14.736  1.00 52.89  ? 348 ALA B C     1 
ATOM   5746  O O     . ALA B 1 348 ? 133.801 -12.106  15.343  1.00 53.55  ? 348 ALA B O     1 
ATOM   5747  C CB    . ALA B 1 348 ? 130.895 -10.583  15.811  1.00 52.10  ? 348 ALA B CB    1 
ATOM   5748  N N     . ALA B 1 349 ? 132.207 -12.458  13.785  1.00 53.44  ? 349 ALA B N     1 
ATOM   5749  C CA    . ALA B 1 349 ? 132.696 -13.780  13.387  1.00 53.98  ? 349 ALA B CA    1 
ATOM   5750  C C     . ALA B 1 349 ? 134.110 -13.684  12.851  1.00 54.87  ? 349 ALA B C     1 
ATOM   5751  O O     . ALA B 1 349 ? 134.910 -14.589  13.085  1.00 55.75  ? 349 ALA B O     1 
ATOM   5752  C CB    . ALA B 1 349 ? 131.784 -14.408  12.353  1.00 53.45  ? 349 ALA B CB    1 
ATOM   5753  N N     . ARG B 1 350 ? 134.416 -12.585  12.153  1.00 54.87  ? 350 ARG B N     1 
ATOM   5754  C CA    . ARG B 1 350 ? 135.704 -12.430  11.506  1.00 55.41  ? 350 ARG B CA    1 
ATOM   5755  C C     . ARG B 1 350 ? 136.788 -12.076  12.498  1.00 56.32  ? 350 ARG B C     1 
ATOM   5756  O O     . ARG B 1 350 ? 137.886 -12.610  12.416  1.00 57.10  ? 350 ARG B O     1 
ATOM   5757  C CB    . ARG B 1 350 ? 135.641 -11.423  10.362  1.00 55.43  ? 350 ARG B CB    1 
ATOM   5758  C CG    . ARG B 1 350 ? 135.087 -11.997  9.080   1.00 54.54  ? 350 ARG B CG    1 
ATOM   5759  C CD    . ARG B 1 350 ? 134.817 -10.913  8.067   1.00 54.77  ? 350 ARG B CD    1 
ATOM   5760  N NE    . ARG B 1 350 ? 133.610 -11.220  7.313   1.00 55.76  ? 350 ARG B NE    1 
ATOM   5761  C CZ    . ARG B 1 350 ? 132.938 -10.355  6.556   1.00 55.93  ? 350 ARG B CZ    1 
ATOM   5762  N NH1   . ARG B 1 350 ? 133.346 -9.105   6.415   1.00 56.20  ? 350 ARG B NH1   1 
ATOM   5763  N NH2   . ARG B 1 350 ? 131.844 -10.745  5.933   1.00 56.58  ? 350 ARG B NH2   1 
ATOM   5764  N N     . VAL B 1 351 ? 136.505 -11.200  13.452  1.00 56.82  ? 351 VAL B N     1 
ATOM   5765  C CA    . VAL B 1 351 ? 137.523 -10.943  14.482  1.00 58.29  ? 351 VAL B CA    1 
ATOM   5766  C C     . VAL B 1 351 ? 137.745 -12.203  15.331  1.00 59.04  ? 351 VAL B C     1 
ATOM   5767  O O     . VAL B 1 351 ? 138.883 -12.518  15.687  1.00 59.97  ? 351 VAL B O     1 
ATOM   5768  C CB    . VAL B 1 351 ? 137.277 -9.640   15.323  1.00 58.25  ? 351 VAL B CB    1 
ATOM   5769  C CG1   . VAL B 1 351 ? 135.864 -9.563   15.828  1.00 58.46  ? 351 VAL B CG1   1 
ATOM   5770  C CG2   . VAL B 1 351 ? 138.248 -9.544   16.482  1.00 58.74  ? 351 VAL B CG2   1 
ATOM   5771  N N     . ASP B 1 352 ? 136.664 -12.939  15.594  1.00 59.09  ? 352 ASP B N     1 
ATOM   5772  C CA    . ASP B 1 352 ? 136.734 -14.241  16.258  1.00 60.14  ? 352 ASP B CA    1 
ATOM   5773  C C     . ASP B 1 352 ? 137.539 -15.307  15.511  1.00 60.53  ? 352 ASP B C     1 
ATOM   5774  O O     . ASP B 1 352 ? 138.219 -16.127  16.132  1.00 60.97  ? 352 ASP B O     1 
ATOM   5775  C CB    . ASP B 1 352 ? 135.332 -14.778  16.522  1.00 60.02  ? 352 ASP B CB    1 
ATOM   5776  C CG    . ASP B 1 352 ? 134.710 -14.194  17.777  1.00 62.18  ? 352 ASP B CG    1 
ATOM   5777  O OD1   . ASP B 1 352 ? 135.457 -13.842  18.715  1.00 65.12  ? 352 ASP B OD1   1 
ATOM   5778  O OD2   . ASP B 1 352 ? 133.463 -14.091  17.839  1.00 64.39  ? 352 ASP B OD2   1 
ATOM   5779  N N     . ALA B 1 353 ? 137.447 -15.296  14.185  1.00 60.55  ? 353 ALA B N     1 
ATOM   5780  C CA    . ALA B 1 353 ? 138.047 -16.341  13.368  1.00 61.31  ? 353 ALA B CA    1 
ATOM   5781  C C     . ALA B 1 353 ? 139.515 -16.084  13.121  1.00 62.13  ? 353 ALA B C     1 
ATOM   5782  O O     . ALA B 1 353 ? 140.341 -16.943  13.390  1.00 62.97  ? 353 ALA B O     1 
ATOM   5783  C CB    . ALA B 1 353 ? 137.310 -16.490  12.055  1.00 60.85  ? 353 ALA B CB    1 
ATOM   5784  N N     . PHE B 1 354 ? 139.830 -14.893  12.622  1.00 62.37  ? 354 PHE B N     1 
ATOM   5785  C CA    . PHE B 1 354 ? 141.197 -14.527  12.229  1.00 63.44  ? 354 PHE B CA    1 
ATOM   5786  C C     . PHE B 1 354 ? 141.940 -13.862  13.388  1.00 64.44  ? 354 PHE B C     1 
ATOM   5787  O O     . PHE B 1 354 ? 142.823 -13.011  13.210  1.00 64.75  ? 354 PHE B O     1 
ATOM   5788  C CB    . PHE B 1 354 ? 141.170 -13.677  10.958  1.00 62.96  ? 354 PHE B CB    1 
ATOM   5789  C CG    . PHE B 1 354 ? 140.272 -14.238  9.909   1.00 62.15  ? 354 PHE B CG    1 
ATOM   5790  C CD1   . PHE B 1 354 ? 140.725 -15.225  9.051   1.00 63.35  ? 354 PHE B CD1   1 
ATOM   5791  C CD2   . PHE B 1 354 ? 138.953 -13.828  9.816   1.00 61.14  ? 354 PHE B CD2   1 
ATOM   5792  C CE1   . PHE B 1 354 ? 139.883 -15.780  8.095   1.00 62.97  ? 354 PHE B CE1   1 
ATOM   5793  C CE2   . PHE B 1 354 ? 138.107 -14.373  8.869   1.00 60.98  ? 354 PHE B CE2   1 
ATOM   5794  C CZ    . PHE B 1 354 ? 138.574 -15.356  8.009   1.00 61.66  ? 354 PHE B CZ    1 
ATOM   5795  N N     . SER B 1 355 ? 141.498 -14.251  14.583  1.00 65.15  ? 355 SER B N     1 
ATOM   5796  C CA    . SER B 1 355 ? 142.285 -14.255  15.825  1.00 66.28  ? 355 SER B CA    1 
ATOM   5797  C C     . SER B 1 355 ? 141.912 -13.281  16.926  1.00 65.75  ? 355 SER B C     1 
ATOM   5798  O O     . SER B 1 355 ? 141.866 -12.059  16.722  1.00 65.34  ? 355 SER B O     1 
ATOM   5799  C CB    . SER B 1 355 ? 143.812 -14.268  15.576  1.00 67.69  ? 355 SER B CB    1 
ATOM   5800  O OG    . SER B 1 355 ? 144.499 -15.014  16.585  1.00 69.46  ? 355 SER B OG    1 
ATOM   5801  N N     . GLY B 1 356 ? 141.597 -13.886  18.070  1.00 65.65  ? 356 GLY B N     1 
ATOM   5802  C CA    . GLY B 1 356 ? 141.814 -13.310  19.389  1.00 66.32  ? 356 GLY B CA    1 
ATOM   5803  C C     . GLY B 1 356 ? 140.881 -12.235  19.904  1.00 65.86  ? 356 GLY B C     1 
ATOM   5804  O O     . GLY B 1 356 ? 139.812 -12.518  20.462  1.00 65.49  ? 356 GLY B O     1 
ATOM   5805  N N     . ARG B 1 357 ? 141.310 -10.994  19.700  1.00 65.71  ? 357 ARG B N     1 
ATOM   5806  C CA    . ARG B 1 357 ? 140.810 -9.844   20.432  1.00 65.43  ? 357 ARG B CA    1 
ATOM   5807  C C     . ARG B 1 357 ? 139.320 -9.804   20.687  1.00 64.40  ? 357 ARG B C     1 
ATOM   5808  O O     . ARG B 1 357 ? 138.509 -10.092  19.814  1.00 63.69  ? 357 ARG B O     1 
ATOM   5809  C CB    . ARG B 1 357 ? 141.278 -8.543   19.784  1.00 65.71  ? 357 ARG B CB    1 
ATOM   5810  C CG    . ARG B 1 357 ? 141.726 -8.678   18.353  1.00 65.55  ? 357 ARG B CG    1 
ATOM   5811  C CD    . ARG B 1 357 ? 142.447 -7.420   17.965  1.00 68.14  ? 357 ARG B CD    1 
ATOM   5812  N NE    . ARG B 1 357 ? 141.513 -6.311   17.799  1.00 68.95  ? 357 ARG B NE    1 
ATOM   5813  C CZ    . ARG B 1 357 ? 141.079 -5.861   16.624  1.00 69.16  ? 357 ARG B CZ    1 
ATOM   5814  N NH1   . ARG B 1 357 ? 140.225 -4.848   16.584  1.00 70.44  ? 357 ARG B NH1   1 
ATOM   5815  N NH2   . ARG B 1 357 ? 141.501 -6.408   15.491  1.00 68.69  ? 357 ARG B NH2   1 
ATOM   5816  N N     . PHE B 1 358 ? 138.978 -9.465   21.919  1.00 64.49  ? 358 PHE B N     1 
ATOM   5817  C CA    . PHE B 1 358 ? 137.614 -9.182   22.252  1.00 63.60  ? 358 PHE B CA    1 
ATOM   5818  C C     . PHE B 1 358 ? 137.387 -7.720   21.949  1.00 63.95  ? 358 PHE B C     1 
ATOM   5819  O O     . PHE B 1 358 ? 138.119 -6.868   22.461  1.00 65.18  ? 358 PHE B O     1 
ATOM   5820  C CB    . PHE B 1 358 ? 137.336 -9.461   23.722  1.00 63.84  ? 358 PHE B CB    1 
ATOM   5821  C CG    . PHE B 1 358 ? 135.942 -9.138   24.125  1.00 62.01  ? 358 PHE B CG    1 
ATOM   5822  C CD1   . PHE B 1 358 ? 134.883 -9.933   23.701  1.00 60.40  ? 358 PHE B CD1   1 
ATOM   5823  C CD2   . PHE B 1 358 ? 135.677 -8.029   24.904  1.00 61.80  ? 358 PHE B CD2   1 
ATOM   5824  C CE1   . PHE B 1 358 ? 133.585 -9.631   24.058  1.00 59.82  ? 358 PHE B CE1   1 
ATOM   5825  C CE2   . PHE B 1 358 ? 134.376 -7.711   25.268  1.00 61.39  ? 358 PHE B CE2   1 
ATOM   5826  C CZ    . PHE B 1 358 ? 133.329 -8.512   24.847  1.00 60.61  ? 358 PHE B CZ    1 
ATOM   5827  N N     . ILE B 1 359 ? 136.397 -7.448   21.095  1.00 63.25  ? 359 ILE B N     1 
ATOM   5828  C CA    . ILE B 1 359 ? 135.937 -6.095   20.781  1.00 63.31  ? 359 ILE B CA    1 
ATOM   5829  C C     . ILE B 1 359 ? 134.407 -6.057   20.783  1.00 62.97  ? 359 ILE B C     1 
ATOM   5830  O O     . ILE B 1 359 ? 133.787 -5.221   20.103  1.00 63.14  ? 359 ILE B O     1 
ATOM   5831  C CB    . ILE B 1 359 ? 136.441 -5.614   19.401  1.00 63.10  ? 359 ILE B CB    1 
ATOM   5832  C CG1   . ILE B 1 359 ? 135.907 -6.519   18.288  1.00 62.29  ? 359 ILE B CG1   1 
ATOM   5833  C CG2   . ILE B 1 359 ? 137.975 -5.524   19.357  1.00 64.33  ? 359 ILE B CG2   1 
ATOM   5834  C CD1   . ILE B 1 359 ? 135.552 -5.785   17.016  1.00 61.98  ? 359 ILE B CD1   1 
ATOM   5835  N N     . GLY B 1 360 ? 133.801 -6.966   21.546  1.00 62.81  ? 360 GLY B N     1 
ATOM   5836  C CA    . GLY B 1 360 ? 132.349 -7.124   21.596  1.00 62.10  ? 360 GLY B CA    1 
ATOM   5837  C C     . GLY B 1 360 ? 131.584 -6.000   22.256  1.00 62.71  ? 360 GLY B C     1 
ATOM   5838  O O     . GLY B 1 360 ? 130.371 -5.940   22.150  1.00 62.17  ? 360 GLY B O     1 
ATOM   5839  N N     . ASP B 1 361 ? 132.286 -5.106   22.944  1.00 64.34  ? 361 ASP B N     1 
ATOM   5840  C CA    . ASP B 1 361 ? 131.617 -4.033   23.682  1.00 65.60  ? 361 ASP B CA    1 
ATOM   5841  C C     . ASP B 1 361 ? 131.224 -2.884   22.778  1.00 65.81  ? 361 ASP B C     1 
ATOM   5842  O O     . ASP B 1 361 ? 130.096 -2.405   22.856  1.00 65.86  ? 361 ASP B O     1 
ATOM   5843  C CB    . ASP B 1 361 ? 132.471 -3.540   24.845  1.00 66.73  ? 361 ASP B CB    1 
ATOM   5844  C CG    . ASP B 1 361 ? 132.421 -4.471   26.043  1.00 67.72  ? 361 ASP B CG    1 
ATOM   5845  O OD1   . ASP B 1 361 ? 131.853 -5.583   25.932  1.00 66.94  ? 361 ASP B OD1   1 
ATOM   5846  O OD2   . ASP B 1 361 ? 132.959 -4.091   27.107  1.00 70.08  ? 361 ASP B OD2   1 
ATOM   5847  N N     . GLN B 1 362 ? 132.154 -2.450   21.924  1.00 66.36  ? 362 GLN B N     1 
ATOM   5848  C CA    . GLN B 1 362 ? 131.872 -1.420   20.922  1.00 66.83  ? 362 GLN B CA    1 
ATOM   5849  C C     . GLN B 1 362 ? 130.887 -1.939   19.895  1.00 65.76  ? 362 GLN B C     1 
ATOM   5850  O O     . GLN B 1 362 ? 129.969 -1.222   19.506  1.00 65.83  ? 362 GLN B O     1 
ATOM   5851  C CB    . GLN B 1 362 ? 133.137 -0.897   20.230  1.00 67.36  ? 362 GLN B CB    1 
ATOM   5852  C CG    . GLN B 1 362 ? 134.286 -1.876   20.141  1.00 69.58  ? 362 GLN B CG    1 
ATOM   5853  C CD    . GLN B 1 362 ? 135.193 -1.786   21.355  1.00 74.31  ? 362 GLN B CD    1 
ATOM   5854  O OE1   . GLN B 1 362 ? 135.928 -0.806   21.519  1.00 77.25  ? 362 GLN B OE1   1 
ATOM   5855  N NE2   . GLN B 1 362 ? 135.141 -2.807   22.224  1.00 75.23  ? 362 GLN B NE2   1 
ATOM   5856  N N     . LEU B 1 363 ? 131.066 -3.192   19.476  1.00 65.01  ? 363 LEU B N     1 
ATOM   5857  C CA    . LEU B 1 363 ? 130.107 -3.845   18.585  1.00 63.93  ? 363 LEU B CA    1 
ATOM   5858  C C     . LEU B 1 363 ? 128.676 -3.787   19.113  1.00 63.59  ? 363 LEU B C     1 
ATOM   5859  O O     . LEU B 1 363 ? 127.764 -3.453   18.375  1.00 63.25  ? 363 LEU B O     1 
ATOM   5860  C CB    . LEU B 1 363 ? 130.526 -5.284   18.300  1.00 63.53  ? 363 LEU B CB    1 
ATOM   5861  C CG    . LEU B 1 363 ? 131.126 -5.585   16.918  1.00 63.85  ? 363 LEU B CG    1 
ATOM   5862  C CD1   . LEU B 1 363 ? 132.208 -4.597   16.495  1.00 64.93  ? 363 LEU B CD1   1 
ATOM   5863  C CD2   . LEU B 1 363 ? 131.653 -7.014   16.888  1.00 63.65  ? 363 LEU B CD2   1 
ATOM   5864  N N     . ASN B 1 364 ? 128.489 -4.098   20.389  1.00 64.02  ? 364 ASN B N     1 
ATOM   5865  C CA    . ASN B 1 364 ? 127.182 -3.992   21.024  1.00 64.37  ? 364 ASN B CA    1 
ATOM   5866  C C     . ASN B 1 364 ? 126.660 -2.568   21.074  1.00 65.28  ? 364 ASN B C     1 
ATOM   5867  O O     . ASN B 1 364 ? 125.459 -2.312   20.899  1.00 64.83  ? 364 ASN B O     1 
ATOM   5868  C CB    . ASN B 1 364 ? 127.252 -4.537   22.435  1.00 64.86  ? 364 ASN B CB    1 
ATOM   5869  C CG    . ASN B 1 364 ? 126.596 -5.867   22.563  1.00 64.37  ? 364 ASN B CG    1 
ATOM   5870  O OD1   . ASN B 1 364 ? 125.443 -6.037   22.174  1.00 64.38  ? 364 ASN B OD1   1 
ATOM   5871  N ND2   . ASN B 1 364 ? 127.314 -6.828   23.127  1.00 64.95  ? 364 ASN B ND2   1 
ATOM   5872  N N     . GLU B 1 365 ? 127.589 -1.653   21.323  1.00 66.52  ? 365 GLU B N     1 
ATOM   5873  C CA    . GLU B 1 365 ? 127.292 -0.245   21.460  1.00 68.24  ? 365 GLU B CA    1 
ATOM   5874  C C     . GLU B 1 365 ? 126.851 0.343    20.120  1.00 67.72  ? 365 GLU B C     1 
ATOM   5875  O O     . GLU B 1 365 ? 125.848 1.063    20.048  1.00 68.44  ? 365 GLU B O     1 
ATOM   5876  C CB    . GLU B 1 365 ? 128.525 0.476    21.983  1.00 69.43  ? 365 GLU B CB    1 
ATOM   5877  C CG    . GLU B 1 365 ? 128.249 1.831    22.578  1.00 73.46  ? 365 GLU B CG    1 
ATOM   5878  C CD    . GLU B 1 365 ? 129.375 2.302    23.482  1.00 78.43  ? 365 GLU B CD    1 
ATOM   5879  O OE1   . GLU B 1 365 ? 129.150 3.258    24.266  1.00 82.11  ? 365 GLU B OE1   1 
ATOM   5880  O OE2   . GLU B 1 365 ? 130.484 1.716    23.418  1.00 78.98  ? 365 GLU B OE2   1 
ATOM   5881  N N     . GLN B 1 366 ? 127.602 0.023    19.068  1.00 66.66  ? 366 GLN B N     1 
ATOM   5882  C CA    . GLN B 1 366 ? 127.246 0.394    17.719  1.00 65.66  ? 366 GLN B CA    1 
ATOM   5883  C C     . GLN B 1 366 ? 125.893 -0.192   17.342  1.00 65.03  ? 366 GLN B C     1 
ATOM   5884  O O     . GLN B 1 366 ? 125.068 0.502    16.754  1.00 65.17  ? 366 GLN B O     1 
ATOM   5885  C CB    . GLN B 1 366 ? 128.296 -0.115   16.746  1.00 65.24  ? 366 GLN B CB    1 
ATOM   5886  C CG    . GLN B 1 366 ? 129.644 0.549    16.834  1.00 65.95  ? 366 GLN B CG    1 
ATOM   5887  C CD    . GLN B 1 366 ? 130.714 -0.300   16.185  1.00 66.73  ? 366 GLN B CD    1 
ATOM   5888  O OE1   . GLN B 1 366 ? 130.522 -0.826   15.082  1.00 67.45  ? 366 GLN B OE1   1 
ATOM   5889  N NE2   . GLN B 1 366 ? 131.846 -0.453   16.867  1.00 67.10  ? 366 GLN B NE2   1 
ATOM   5890  N N     . LEU B 1 367 ? 125.666 -1.463   17.680  1.00 64.57  ? 367 LEU B N     1 
ATOM   5891  C CA    . LEU B 1 367 ? 124.396 -2.129   17.377  1.00 64.29  ? 367 LEU B CA    1 
ATOM   5892  C C     . LEU B 1 367 ? 123.207 -1.466   18.074  1.00 65.31  ? 367 LEU B C     1 
ATOM   5893  O O     . LEU B 1 367 ? 122.193 -1.192   17.439  1.00 65.11  ? 367 LEU B O     1 
ATOM   5894  C CB    . LEU B 1 367 ? 124.451 -3.630   17.699  1.00 63.52  ? 367 LEU B CB    1 
ATOM   5895  C CG    . LEU B 1 367 ? 123.212 -4.483   17.364  1.00 62.86  ? 367 LEU B CG    1 
ATOM   5896  C CD1   . LEU B 1 367 ? 122.917 -4.530   15.863  1.00 62.28  ? 367 LEU B CD1   1 
ATOM   5897  C CD2   . LEU B 1 367 ? 123.333 -5.895   17.912  1.00 61.98  ? 367 LEU B CD2   1 
ATOM   5898  N N     . LYS B 1 368 ? 123.340 -1.193   19.369  1.00 66.70  ? 368 LYS B N     1 
ATOM   5899  C CA    . LYS B 1 368 ? 122.257 -0.565   20.118  1.00 68.31  ? 368 LYS B CA    1 
ATOM   5900  C C     . LYS B 1 368 ? 121.979 0.872    19.685  1.00 69.04  ? 368 LYS B C     1 
ATOM   5901  O O     . LYS B 1 368 ? 120.853 1.339    19.825  1.00 69.68  ? 368 LYS B O     1 
ATOM   5902  C CB    . LYS B 1 368 ? 122.489 -0.683   21.628  1.00 69.59  ? 368 LYS B CB    1 
ATOM   5903  C CG    . LYS B 1 368 ? 122.285 -2.119   22.146  1.00 70.82  ? 368 LYS B CG    1 
ATOM   5904  C CD    . LYS B 1 368 ? 122.918 -2.366   23.513  1.00 74.06  ? 368 LYS B CD    1 
ATOM   5905  C CE    . LYS B 1 368 ? 123.053 -3.878   23.792  1.00 74.50  ? 368 LYS B CE    1 
ATOM   5906  N NZ    . LYS B 1 368 ? 124.052 -4.220   24.876  1.00 74.89  ? 368 LYS B NZ    1 
ATOM   5907  N N     . LYS B 1 369 ? 122.991 1.558    19.153  1.00 69.46  ? 369 LYS B N     1 
ATOM   5908  C CA    . LYS B 1 369 ? 122.806 2.872    18.524  1.00 70.72  ? 369 LYS B CA    1 
ATOM   5909  C C     . LYS B 1 369 ? 121.909 2.763    17.308  1.00 70.45  ? 369 LYS B C     1 
ATOM   5910  O O     . LYS B 1 369 ? 120.967 3.539    17.144  1.00 71.50  ? 369 LYS B O     1 
ATOM   5911  C CB    . LYS B 1 369 ? 124.135 3.466    18.071  1.00 70.78  ? 369 LYS B CB    1 
ATOM   5912  C CG    . LYS B 1 369 ? 124.740 4.420    19.050  1.00 73.89  ? 369 LYS B CG    1 
ATOM   5913  C CD    . LYS B 1 369 ? 126.038 4.990    18.518  1.00 76.32  ? 369 LYS B CD    1 
ATOM   5914  C CE    . LYS B 1 369 ? 126.979 5.347    19.677  1.00 78.75  ? 369 LYS B CE    1 
ATOM   5915  N NZ    . LYS B 1 369 ? 128.241 5.977    19.189  1.00 79.22  ? 369 LYS B NZ    1 
ATOM   5916  N N     . ARG B 1 370 ? 122.229 1.796    16.451  1.00 69.59  ? 370 ARG B N     1 
ATOM   5917  C CA    . ARG B 1 370 ? 121.471 1.511    15.240  1.00 68.71  ? 370 ARG B CA    1 
ATOM   5918  C C     . ARG B 1 370 ? 120.031 1.123    15.575  1.00 68.74  ? 370 ARG B C     1 
ATOM   5919  O O     . ARG B 1 370 ? 119.119 1.485    14.856  1.00 68.90  ? 370 ARG B O     1 
ATOM   5920  C CB    . ARG B 1 370 ? 122.150 0.374    14.454  1.00 67.67  ? 370 ARG B CB    1 
ATOM   5921  C CG    . ARG B 1 370 ? 122.118 0.477    12.923  1.00 66.29  ? 370 ARG B CG    1 
ATOM   5922  C CD    . ARG B 1 370 ? 121.192 1.575    12.442  1.00 66.17  ? 370 ARG B CD    1 
ATOM   5923  N NE    . ARG B 1 370 ? 120.258 1.095    11.435  1.00 65.79  ? 370 ARG B NE    1 
ATOM   5924  C CZ    . ARG B 1 370 ? 119.331 1.850    10.859  1.00 64.70  ? 370 ARG B CZ    1 
ATOM   5925  N NH1   . ARG B 1 370 ? 118.517 1.328    9.945   1.00 62.95  ? 370 ARG B NH1   1 
ATOM   5926  N NH2   . ARG B 1 370 ? 119.229 3.126    11.197  1.00 64.44  ? 370 ARG B NH2   1 
ATOM   5927  N N     . ILE B 1 371 ? 119.834 0.391    16.666  1.00 68.94  ? 371 ILE B N     1 
ATOM   5928  C CA    . ILE B 1 371 ? 118.502 -0.039   17.062  1.00 69.50  ? 371 ILE B CA    1 
ATOM   5929  C C     . ILE B 1 371 ? 117.681 1.135    17.613  1.00 71.84  ? 371 ILE B C     1 
ATOM   5930  O O     . ILE B 1 371 ? 116.503 1.303    17.273  1.00 72.18  ? 371 ILE B O     1 
ATOM   5931  C CB    . ILE B 1 371 ? 118.565 -1.214   18.051  1.00 68.90  ? 371 ILE B CB    1 
ATOM   5932  C CG1   . ILE B 1 371 ? 119.232 -2.418   17.377  1.00 66.85  ? 371 ILE B CG1   1 
ATOM   5933  C CG2   . ILE B 1 371 ? 117.172 -1.588   18.527  1.00 68.89  ? 371 ILE B CG2   1 
ATOM   5934  C CD1   . ILE B 1 371 ? 119.737 -3.466   18.311  1.00 65.27  ? 371 ILE B CD1   1 
ATOM   5935  N N     . ASP B 1 372 ? 118.308 1.965    18.440  1.00 73.96  ? 372 ASP B N     1 
ATOM   5936  C CA    . ASP B 1 372 ? 117.640 3.143    18.982  1.00 76.46  ? 372 ASP B CA    1 
ATOM   5937  C C     . ASP B 1 372 ? 117.144 4.103    17.906  1.00 77.65  ? 372 ASP B C     1 
ATOM   5938  O O     . ASP B 1 372 ? 116.095 4.730    18.061  1.00 78.64  ? 372 ASP B O     1 
ATOM   5939  C CB    . ASP B 1 372 ? 118.552 3.854    19.970  1.00 77.30  ? 372 ASP B CB    1 
ATOM   5940  C CG    . ASP B 1 372 ? 118.610 3.143    21.297  1.00 78.14  ? 372 ASP B CG    1 
ATOM   5941  O OD1   . ASP B 1 372 ? 117.961 2.075    21.420  1.00 77.20  ? 372 ASP B OD1   1 
ATOM   5942  O OD2   . ASP B 1 372 ? 119.293 3.653    22.214  1.00 79.85  ? 372 ASP B OD2   1 
ATOM   5943  N N     . GLU B 1 373 ? 117.900 4.203    16.817  1.00 78.12  ? 373 GLU B N     1 
ATOM   5944  C CA    . GLU B 1 373 ? 117.527 5.042    15.691  1.00 79.65  ? 373 GLU B CA    1 
ATOM   5945  C C     . GLU B 1 373 ? 116.329 4.457    14.976  1.00 79.37  ? 373 GLU B C     1 
ATOM   5946  O O     . GLU B 1 373 ? 115.378 5.178    14.659  1.00 80.40  ? 373 GLU B O     1 
ATOM   5947  C CB    . GLU B 1 373 ? 118.687 5.180    14.716  1.00 79.41  ? 373 GLU B CB    1 
ATOM   5948  C CG    . GLU B 1 373 ? 119.831 6.020    15.257  1.00 83.35  ? 373 GLU B CG    1 
ATOM   5949  C CD    . GLU B 1 373 ? 121.044 6.049    14.328  1.00 86.54  ? 373 GLU B CD    1 
ATOM   5950  O OE1   . GLU B 1 373 ? 120.887 5.730    13.122  1.00 86.59  ? 373 GLU B OE1   1 
ATOM   5951  O OE2   . GLU B 1 373 ? 122.151 6.403    14.813  1.00 88.60  ? 373 GLU B OE2   1 
ATOM   5952  N N     . ILE B 1 374 ? 116.384 3.150    14.730  1.00 78.54  ? 374 ILE B N     1 
ATOM   5953  C CA    . ILE B 1 374 ? 115.304 2.424    14.076  1.00 78.35  ? 374 ILE B CA    1 
ATOM   5954  C C     . ILE B 1 374 ? 114.008 2.623    14.843  1.00 79.89  ? 374 ILE B C     1 
ATOM   5955  O O     . ILE B 1 374 ? 112.952 2.837    14.247  1.00 80.31  ? 374 ILE B O     1 
ATOM   5956  C CB    . ILE B 1 374 ? 115.621 0.920    13.968  1.00 76.93  ? 374 ILE B CB    1 
ATOM   5957  C CG1   . ILE B 1 374 ? 116.753 0.683    12.973  1.00 75.70  ? 374 ILE B CG1   1 
ATOM   5958  C CG2   . ILE B 1 374 ? 114.385 0.124    13.566  1.00 76.48  ? 374 ILE B CG2   1 
ATOM   5959  C CD1   . ILE B 1 374 ? 117.331 -0.714   13.018  1.00 74.59  ? 374 ILE B CD1   1 
ATOM   5960  N N     . LYS B 1 375 ? 114.102 2.584    16.168  1.00 81.35  ? 375 LYS B N     1 
ATOM   5961  C CA    . LYS B 1 375 ? 112.916 2.680    17.017  1.00 83.36  ? 375 LYS B CA    1 
ATOM   5962  C C     . LYS B 1 375 ? 112.300 4.084    17.127  1.00 85.65  ? 375 LYS B C     1 
ATOM   5963  O O     . LYS B 1 375 ? 111.190 4.230    17.646  1.00 86.64  ? 375 LYS B O     1 
ATOM   5964  C CB    . LYS B 1 375 ? 113.186 2.095    18.409  1.00 83.24  ? 375 LYS B CB    1 
ATOM   5965  C CG    . LYS B 1 375 ? 113.499 0.623    18.387  1.00 81.71  ? 375 LYS B CG    1 
ATOM   5966  C CD    . LYS B 1 375 ? 112.737 -0.140   19.443  1.00 81.58  ? 375 LYS B CD    1 
ATOM   5967  C CE    . LYS B 1 375 ? 112.905 -1.622   19.223  1.00 80.07  ? 375 LYS B CE    1 
ATOM   5968  N NZ    . LYS B 1 375 ? 112.214 -2.421   20.253  1.00 81.65  ? 375 LYS B NZ    1 
ATOM   5969  N N     . GLU B 1 376 ? 113.001 5.107    16.641  1.00 87.05  ? 376 GLU B N     1 
ATOM   5970  C CA    . GLU B 1 376 ? 112.465 6.461    16.697  1.00 89.66  ? 376 GLU B CA    1 
ATOM   5971  C C     . GLU B 1 376 ? 111.884 6.930    15.360  1.00 90.25  ? 376 GLU B C     1 
ATOM   5972  O O     . GLU B 1 376 ? 112.384 7.861    14.740  1.00 90.71  ? 376 GLU B O     1 
ATOM   5973  C CB    . GLU B 1 376 ? 113.491 7.424    17.288  1.00 90.59  ? 376 GLU B CB    1 
ATOM   5974  C CG    . GLU B 1 376 ? 113.854 7.035    18.726  1.00 92.79  ? 376 GLU B CG    1 
ATOM   5975  C CD    . GLU B 1 376 ? 114.139 8.224    19.641  1.00 96.35  ? 376 GLU B CD    1 
ATOM   5976  O OE1   . GLU B 1 376 ? 113.374 9.217    19.597  1.00 97.45  ? 376 GLU B OE1   1 
ATOM   5977  O OE2   . GLU B 1 376 ? 115.122 8.150    20.422  1.00 97.27  ? 376 GLU B OE2   1 
ATOM   5978  N N     . LYS B 1 377 ? 110.819 6.243    14.941  1.00 90.94  ? 377 LYS B N     1 
ATOM   5979  C CA    . LYS B 1 377 ? 110.068 6.512    13.702  1.00 91.93  ? 377 LYS B CA    1 
ATOM   5980  C C     . LYS B 1 377 ? 108.657 5.908    13.765  1.00 92.25  ? 377 LYS B C     1 
ATOM   5981  O O     . LYS B 1 377 ? 107.922 6.092    14.744  1.00 93.29  ? 377 LYS B O     1 
ATOM   5982  C CB    . LYS B 1 377 ? 110.803 5.960    12.476  1.00 90.90  ? 377 LYS B CB    1 
ATOM   5983  C CG    . LYS B 1 377 ? 111.754 6.956    11.841  1.00 92.40  ? 377 LYS B CG    1 
ATOM   5984  C CD    . LYS B 1 377 ? 113.042 6.269    11.395  1.00 93.42  ? 377 LYS B CD    1 
ATOM   5985  C CE    . LYS B 1 377 ? 114.175 7.283    11.200  1.00 94.11  ? 377 LYS B CE    1 
ATOM   5986  N NZ    . LYS B 1 377 ? 115.449 6.645    10.754  1.00 92.68  ? 377 LYS B NZ    1 
ATOM   5987  N N     . ALA C 2 7   ? 69.202  -64.663  19.917  1.00 136.25 ? 7   ALA C N     1 
ATOM   5988  C CA    . ALA C 2 7   ? 70.397  -63.782  19.773  1.00 134.77 ? 7   ALA C CA    1 
ATOM   5989  C C     . ALA C 2 7   ? 70.138  -62.410  20.396  1.00 133.90 ? 7   ALA C C     1 
ATOM   5990  O O     . ALA C 2 7   ? 68.984  -61.999  20.539  1.00 133.91 ? 7   ALA C O     1 
ATOM   5991  C CB    . ALA C 2 7   ? 70.781  -63.649  18.307  1.00 133.09 ? 7   ALA C CB    1 
ATOM   5992  N N     . SER C 2 8   ? 71.211  -61.706  20.762  1.00 133.36 ? 8   SER C N     1 
ATOM   5993  C CA    . SER C 2 8   ? 71.095  -60.432  21.491  1.00 132.81 ? 8   SER C CA    1 
ATOM   5994  C C     . SER C 2 8   ? 71.313  -59.176  20.639  1.00 130.56 ? 8   SER C C     1 
ATOM   5995  O O     . SER C 2 8   ? 70.976  -58.073  21.069  1.00 130.12 ? 8   SER C O     1 
ATOM   5996  C CB    . SER C 2 8   ? 72.022  -60.417  22.714  1.00 134.19 ? 8   SER C CB    1 
ATOM   5997  O OG    . SER C 2 8   ? 73.360  -60.133  22.347  1.00 133.53 ? 8   SER C OG    1 
ATOM   5998  N N     . TYR C 2 9   ? 71.879  -59.343  19.445  1.00 129.33 ? 9   TYR C N     1 
ATOM   5999  C CA    . TYR C 2 9   ? 72.020  -58.234  18.491  1.00 127.48 ? 9   TYR C CA    1 
ATOM   6000  C C     . TYR C 2 9   ? 70.744  -58.013  17.645  1.00 126.50 ? 9   TYR C C     1 
ATOM   6001  O O     . TYR C 2 9   ? 70.652  -57.054  16.868  1.00 125.07 ? 9   TYR C O     1 
ATOM   6002  C CB    . TYR C 2 9   ? 73.265  -58.426  17.602  1.00 126.94 ? 9   TYR C CB    1 
ATOM   6003  C CG    . TYR C 2 9   ? 73.211  -59.613  16.651  1.00 127.69 ? 9   TYR C CG    1 
ATOM   6004  C CD1   . TYR C 2 9   ? 72.710  -59.471  15.351  1.00 127.14 ? 9   TYR C CD1   1 
ATOM   6005  C CD2   . TYR C 2 9   ? 73.670  -60.874  17.045  1.00 129.56 ? 9   TYR C CD2   1 
ATOM   6006  C CE1   . TYR C 2 9   ? 72.654  -60.559  14.471  1.00 127.42 ? 9   TYR C CE1   1 
ATOM   6007  C CE2   . TYR C 2 9   ? 73.621  -61.968  16.169  1.00 129.98 ? 9   TYR C CE2   1 
ATOM   6008  C CZ    . TYR C 2 9   ? 73.115  -61.798  14.886  1.00 128.75 ? 9   TYR C CZ    1 
ATOM   6009  O OH    . TYR C 2 9   ? 73.071  -62.864  14.022  1.00 129.03 ? 9   TYR C OH    1 
ATOM   6010  N N     . VAL C 2 10  ? 69.773  -58.915  17.809  1.00 127.29 ? 10  VAL C N     1 
ATOM   6011  C CA    . VAL C 2 10  ? 68.467  -58.827  17.149  1.00 126.62 ? 10  VAL C CA    1 
ATOM   6012  C C     . VAL C 2 10  ? 67.534  -57.945  17.985  1.00 126.62 ? 10  VAL C C     1 
ATOM   6013  O O     . VAL C 2 10  ? 67.120  -58.325  19.085  1.00 127.95 ? 10  VAL C O     1 
ATOM   6014  C CB    . VAL C 2 10  ? 67.832  -60.231  16.932  1.00 127.90 ? 10  VAL C CB    1 
ATOM   6015  C CG1   . VAL C 2 10  ? 66.503  -60.117  16.205  1.00 127.73 ? 10  VAL C CG1   1 
ATOM   6016  C CG2   . VAL C 2 10  ? 68.779  -61.146  16.158  1.00 127.98 ? 10  VAL C CG2   1 
ATOM   6017  N N     . LYS C 2 11  ? 67.214  -56.769  17.452  1.00 125.01 ? 11  LYS C N     1 
ATOM   6018  C CA    . LYS C 2 11  ? 66.449  -55.760  18.186  1.00 124.77 ? 11  LYS C CA    1 
ATOM   6019  C C     . LYS C 2 11  ? 64.948  -56.057  18.284  1.00 125.35 ? 11  LYS C C     1 
ATOM   6020  O O     . LYS C 2 11  ? 64.351  -55.884  19.347  1.00 126.44 ? 11  LYS C O     1 
ATOM   6021  C CB    . LYS C 2 11  ? 66.700  -54.363  17.595  1.00 123.46 ? 11  LYS C CB    1 
ATOM   6022  C CG    . LYS C 2 11  ? 67.761  -53.533  18.328  1.00 123.40 ? 11  LYS C CG    1 
ATOM   6023  C CD    . LYS C 2 11  ? 69.112  -54.249  18.448  1.00 123.89 ? 11  LYS C CD    1 
ATOM   6024  C CE    . LYS C 2 11  ? 70.038  -53.542  19.438  1.00 124.47 ? 11  LYS C CE    1 
ATOM   6025  N NZ    . LYS C 2 11  ? 71.204  -54.384  19.833  1.00 124.88 ? 11  LYS C NZ    1 
ATOM   6026  N N     . PHE C 2 12  ? 64.352  -56.511  17.182  1.00 124.64 ? 12  PHE C N     1 
ATOM   6027  C CA    . PHE C 2 12  ? 62.912  -56.779  17.124  1.00 125.13 ? 12  PHE C CA    1 
ATOM   6028  C C     . PHE C 2 12  ? 62.587  -58.115  16.451  1.00 125.57 ? 12  PHE C C     1 
ATOM   6029  O O     . PHE C 2 12  ? 63.476  -58.798  15.943  1.00 125.08 ? 12  PHE C O     1 
ATOM   6030  C CB    . PHE C 2 12  ? 62.169  -55.626  16.433  1.00 124.39 ? 12  PHE C CB    1 
ATOM   6031  C CG    . PHE C 2 12  ? 62.790  -55.188  15.134  1.00 122.94 ? 12  PHE C CG    1 
ATOM   6032  C CD1   . PHE C 2 12  ? 62.495  -55.850  13.944  1.00 122.62 ? 12  PHE C CD1   1 
ATOM   6033  C CD2   . PHE C 2 12  ? 63.663  -54.103  15.099  1.00 122.01 ? 12  PHE C CD2   1 
ATOM   6034  C CE1   . PHE C 2 12  ? 63.066  -55.446  12.741  1.00 121.54 ? 12  PHE C CE1   1 
ATOM   6035  C CE2   . PHE C 2 12  ? 64.241  -53.691  13.901  1.00 120.96 ? 12  PHE C CE2   1 
ATOM   6036  C CZ    . PHE C 2 12  ? 63.940  -54.364  12.718  1.00 120.87 ? 12  PHE C CZ    1 
ATOM   6037  N N     . GLU C 2 13  ? 61.304  -58.471  16.448  1.00 126.44 ? 13  GLU C N     1 
ATOM   6038  C CA    . GLU C 2 13  ? 60.848  -59.758  15.922  1.00 127.24 ? 13  GLU C CA    1 
ATOM   6039  C C     . GLU C 2 13  ? 60.293  -59.662  14.495  1.00 126.46 ? 13  GLU C C     1 
ATOM   6040  O O     . GLU C 2 13  ? 59.404  -58.859  14.216  1.00 126.33 ? 13  GLU C O     1 
ATOM   6041  C CB    . GLU C 2 13  ? 59.802  -60.368  16.863  1.00 129.30 ? 13  GLU C CB    1 
ATOM   6042  C CG    . GLU C 2 13  ? 59.555  -61.862  16.661  1.00 131.05 ? 13  GLU C CG    1 
ATOM   6043  C CD    . GLU C 2 13  ? 60.578  -62.751  17.362  1.00 131.67 ? 13  GLU C CD    1 
ATOM   6044  O OE1   . GLU C 2 13  ? 61.743  -62.331  17.546  1.00 130.19 ? 13  GLU C OE1   1 
ATOM   6045  O OE2   . GLU C 2 13  ? 60.208  -63.886  17.728  1.00 133.74 ? 13  GLU C OE2   1 
ATOM   6046  N N     . VAL C 2 14  ? 60.825  -60.498  13.607  1.00 126.00 ? 14  VAL C N     1 
ATOM   6047  C CA    . VAL C 2 14  ? 60.393  -60.543  12.212  1.00 125.56 ? 14  VAL C CA    1 
ATOM   6048  C C     . VAL C 2 14  ? 59.621  -61.833  11.934  1.00 127.25 ? 14  VAL C C     1 
ATOM   6049  O O     . VAL C 2 14  ? 60.199  -62.921  12.002  1.00 128.00 ? 14  VAL C O     1 
ATOM   6050  C CB    . VAL C 2 14  ? 61.593  -60.472  11.238  1.00 124.22 ? 14  VAL C CB    1 
ATOM   6051  C CG1   . VAL C 2 14  ? 61.111  -60.372  9.795   1.00 124.19 ? 14  VAL C CG1   1 
ATOM   6052  C CG2   . VAL C 2 14  ? 62.499  -59.303  11.578  1.00 122.86 ? 14  VAL C CG2   1 
ATOM   6053  N N     . PRO C 2 15  ? 58.313  -61.721  11.626  1.00 128.02 ? 15  PRO C N     1 
ATOM   6054  C CA    . PRO C 2 15  ? 57.531  -62.891  11.219  1.00 129.80 ? 15  PRO C CA    1 
ATOM   6055  C C     . PRO C 2 15  ? 57.979  -63.394  9.845   1.00 129.55 ? 15  PRO C C     1 
ATOM   6056  O O     . PRO C 2 15  ? 58.384  -62.590  9.001   1.00 128.14 ? 15  PRO C O     1 
ATOM   6057  C CB    . PRO C 2 15  ? 56.095  -62.354  11.162  1.00 130.71 ? 15  PRO C CB    1 
ATOM   6058  C CG    . PRO C 2 15  ? 56.115  -61.092  11.966  1.00 129.52 ? 15  PRO C CG    1 
ATOM   6059  C CD    . PRO C 2 15  ? 57.470  -60.518  11.736  1.00 127.63 ? 15  PRO C CD    1 
ATOM   6060  N N     . GLN C 2 16  ? 57.897  -64.709  9.634   1.00 130.98 ? 16  GLN C N     1 
ATOM   6061  C CA    . GLN C 2 16  ? 58.465  -65.372  8.450   1.00 131.00 ? 16  GLN C CA    1 
ATOM   6062  C C     . GLN C 2 16  ? 57.920  -64.914  7.095   1.00 130.76 ? 16  GLN C C     1 
ATOM   6063  O O     . GLN C 2 16  ? 58.606  -65.043  6.078   1.00 130.30 ? 16  GLN C O     1 
ATOM   6064  C CB    . GLN C 2 16  ? 58.324  -66.883  8.567   1.00 133.38 ? 16  GLN C CB    1 
ATOM   6065  C CG    . GLN C 2 16  ? 59.409  -67.544  9.386   1.00 133.90 ? 16  GLN C CG    1 
ATOM   6066  C CD    . GLN C 2 16  ? 59.098  -69.000  9.691   1.00 137.82 ? 16  GLN C CD    1 
ATOM   6067  O OE1   . GLN C 2 16  ? 57.996  -69.490  9.420   1.00 139.87 ? 16  GLN C OE1   1 
ATOM   6068  N NE2   . GLN C 2 16  ? 60.069  -69.701  10.264  1.00 138.85 ? 16  GLN C NE2   1 
ATOM   6069  N N     . ASP C 2 17  ? 56.692  -64.403  7.081   1.00 131.11 ? 17  ASP C N     1 
ATOM   6070  C CA    . ASP C 2 17  ? 56.096  -63.842  5.868   1.00 131.09 ? 17  ASP C CA    1 
ATOM   6071  C C     . ASP C 2 17  ? 56.930  -62.658  5.386   1.00 128.59 ? 17  ASP C C     1 
ATOM   6072  O O     . ASP C 2 17  ? 57.216  -62.537  4.191   1.00 128.55 ? 17  ASP C O     1 
ATOM   6073  C CB    . ASP C 2 17  ? 54.672  -63.364  6.142   1.00 132.29 ? 17  ASP C CB    1 
ATOM   6074  C CG    . ASP C 2 17  ? 54.170  -63.791  7.504   1.00 133.60 ? 17  ASP C CG    1 
ATOM   6075  O OD1   . ASP C 2 17  ? 53.992  -65.010  7.716   1.00 135.77 ? 17  ASP C OD1   1 
ATOM   6076  O OD2   . ASP C 2 17  ? 53.964  -62.905  8.364   1.00 133.12 ? 17  ASP C OD2   1 
ATOM   6077  N N     . LEU C 2 18  ? 57.312  -61.800  6.338   1.00 126.54 ? 18  LEU C N     1 
ATOM   6078  C CA    . LEU C 2 18  ? 58.170  -60.643  6.094   1.00 123.81 ? 18  LEU C CA    1 
ATOM   6079  C C     . LEU C 2 18  ? 59.570  -61.078  5.676   1.00 122.59 ? 18  LEU C C     1 
ATOM   6080  O O     . LEU C 2 18  ? 60.096  -60.594  4.675   1.00 121.78 ? 18  LEU C O     1 
ATOM   6081  C CB    . LEU C 2 18  ? 58.238  -59.766  7.347   1.00 122.67 ? 18  LEU C CB    1 
ATOM   6082  C CG    . LEU C 2 18  ? 58.795  -58.350  7.209   1.00 120.61 ? 18  LEU C CG    1 
ATOM   6083  C CD1   . LEU C 2 18  ? 57.935  -57.533  6.259   1.00 120.87 ? 18  LEU C CD1   1 
ATOM   6084  C CD2   . LEU C 2 18  ? 58.879  -57.680  8.569   1.00 119.55 ? 18  LEU C CD2   1 
ATOM   6085  N N     . ALA C 2 19  ? 60.154  -62.002  6.441   1.00 122.47 ? 19  ALA C N     1 
ATOM   6086  C CA    . ALA C 2 19  ? 61.485  -62.553  6.155   1.00 121.64 ? 19  ALA C CA    1 
ATOM   6087  C C     . ALA C 2 19  ? 61.612  -63.065  4.720   1.00 122.19 ? 19  ALA C C     1 
ATOM   6088  O O     . ALA C 2 19  ? 62.669  -62.934  4.098   1.00 121.35 ? 19  ALA C O     1 
ATOM   6089  C CB    . ALA C 2 19  ? 61.838  -63.659  7.157   1.00 122.42 ? 19  ALA C CB    1 
ATOM   6090  N N     . ASP C 2 20  ? 60.528  -63.643  4.207   1.00 123.71 ? 20  ASP C N     1 
ATOM   6091  C CA    . ASP C 2 20  ? 60.473  -64.139  2.835   1.00 124.52 ? 20  ASP C CA    1 
ATOM   6092  C C     . ASP C 2 20  ? 60.342  -62.998  1.835   1.00 123.40 ? 20  ASP C C     1 
ATOM   6093  O O     . ASP C 2 20  ? 60.947  -63.038  0.760   1.00 123.44 ? 20  ASP C O     1 
ATOM   6094  C CB    . ASP C 2 20  ? 59.315  -65.128  2.668   1.00 127.09 ? 20  ASP C CB    1 
ATOM   6095  C CG    . ASP C 2 20  ? 59.606  -66.484  3.290   1.00 128.67 ? 20  ASP C CG    1 
ATOM   6096  O OD1   . ASP C 2 20  ? 60.710  -66.671  3.853   1.00 127.93 ? 20  ASP C OD1   1 
ATOM   6097  O OD2   . ASP C 2 20  ? 58.726  -67.370  3.211   1.00 131.13 ? 20  ASP C OD2   1 
ATOM   6098  N N     . LYS C 2 21  ? 59.552  -61.987  2.194   1.00 122.42 ? 21  LYS C N     1 
ATOM   6099  C CA    . LYS C 2 21  ? 59.379  -60.804  1.352   1.00 121.45 ? 21  LYS C CA    1 
ATOM   6100  C C     . LYS C 2 21  ? 60.681  -60.003  1.273   1.00 119.11 ? 21  LYS C C     1 
ATOM   6101  O O     . LYS C 2 21  ? 60.927  -59.301  0.290   1.00 118.88 ? 21  LYS C O     1 
ATOM   6102  C CB    . LYS C 2 21  ? 58.211  -59.939  1.842   1.00 121.57 ? 21  LYS C CB    1 
ATOM   6103  C CG    . LYS C 2 21  ? 56.845  -60.569  1.594   1.00 123.98 ? 21  LYS C CG    1 
ATOM   6104  C CD    . LYS C 2 21  ? 55.734  -59.822  2.320   1.00 124.61 ? 21  LYS C CD    1 
ATOM   6105  C CE    . LYS C 2 21  ? 54.597  -60.760  2.739   1.00 126.29 ? 21  LYS C CE    1 
ATOM   6106  N NZ    . LYS C 2 21  ? 53.812  -61.287  1.592   1.00 128.28 ? 21  LYS C NZ    1 
ATOM   6107  N N     . VAL C 2 22  ? 61.513  -60.132  2.305   1.00 117.34 ? 22  VAL C N     1 
ATOM   6108  C CA    . VAL C 2 22  ? 62.837  -59.519  2.318   1.00 115.08 ? 22  VAL C CA    1 
ATOM   6109  C C     . VAL C 2 22  ? 63.742  -60.222  1.310   1.00 115.16 ? 22  VAL C C     1 
ATOM   6110  O O     . VAL C 2 22  ? 64.260  -59.582  0.396   1.00 114.60 ? 22  VAL C O     1 
ATOM   6111  C CB    . VAL C 2 22  ? 63.459  -59.518  3.741   1.00 114.05 ? 22  VAL C CB    1 
ATOM   6112  C CG1   . VAL C 2 22  ? 64.927  -59.123  3.703   1.00 112.54 ? 22  VAL C CG1   1 
ATOM   6113  C CG2   . VAL C 2 22  ? 62.694  -58.573  4.648   1.00 113.41 ? 22  VAL C CG2   1 
ATOM   6114  N N     . LEU C 2 23  ? 63.903  -61.536  1.467   1.00 115.91 ? 23  LEU C N     1 
ATOM   6115  C CA    . LEU C 2 23  ? 64.715  -62.353  0.556   1.00 116.35 ? 23  LEU C CA    1 
ATOM   6116  C C     . LEU C 2 23  ? 64.317  -62.161  -0.911  1.00 117.24 ? 23  LEU C C     1 
ATOM   6117  O O     . LEU C 2 23  ? 65.183  -62.106  -1.789  1.00 117.01 ? 23  LEU C O     1 
ATOM   6118  C CB    . LEU C 2 23  ? 64.656  -63.834  0.949   1.00 117.78 ? 23  LEU C CB    1 
ATOM   6119  C CG    . LEU C 2 23  ? 65.356  -64.233  2.253   1.00 117.01 ? 23  LEU C CG    1 
ATOM   6120  C CD1   . LEU C 2 23  ? 64.842  -65.562  2.770   1.00 118.99 ? 23  LEU C CD1   1 
ATOM   6121  C CD2   . LEU C 2 23  ? 66.859  -64.293  2.068   1.00 116.37 ? 23  LEU C CD2   1 
ATOM   6122  N N     . GLU C 2 24  ? 63.011  -62.051  -1.160  1.00 118.21 ? 24  GLU C N     1 
ATOM   6123  C CA    . GLU C 2 24  ? 62.480  -61.718  -2.486  1.00 119.19 ? 24  GLU C CA    1 
ATOM   6124  C C     . GLU C 2 24  ? 62.944  -60.352  -2.993  1.00 117.69 ? 24  GLU C C     1 
ATOM   6125  O O     . GLU C 2 24  ? 63.388  -60.227  -4.140  1.00 118.14 ? 24  GLU C O     1 
ATOM   6126  C CB    . GLU C 2 24  ? 60.950  -61.765  -2.491  1.00 120.70 ? 24  GLU C CB    1 
ATOM   6127  C CG    . GLU C 2 24  ? 60.368  -62.951  -3.235  1.00 123.36 ? 24  GLU C CG    1 
ATOM   6128  C CD    . GLU C 2 24  ? 59.132  -62.591  -4.041  1.00 125.18 ? 24  GLU C CD    1 
ATOM   6129  O OE1   . GLU C 2 24  ? 59.090  -61.489  -4.631  1.00 124.49 ? 24  GLU C OE1   1 
ATOM   6130  O OE2   . GLU C 2 24  ? 58.202  -63.420  -4.097  1.00 127.78 ? 24  GLU C OE2   1 
ATOM   6131  N N     . ALA C 2 25  ? 62.830  -59.339  -2.132  1.00 115.95 ? 25  ALA C N     1 
ATOM   6132  C CA    . ALA C 2 25  ? 63.206  -57.964  -2.465  1.00 114.47 ? 25  ALA C CA    1 
ATOM   6133  C C     . ALA C 2 25  ? 64.656  -57.882  -2.890  1.00 113.37 ? 25  ALA C C     1 
ATOM   6134  O O     . ALA C 2 25  ? 64.995  -57.143  -3.812  1.00 113.32 ? 25  ALA C O     1 
ATOM   6135  C CB    . ALA C 2 25  ? 62.951  -57.042  -1.289  1.00 113.08 ? 25  ALA C CB    1 
ATOM   6136  N N     . VAL C 2 26  ? 65.498  -58.660  -2.215  1.00 112.63 ? 26  VAL C N     1 
ATOM   6137  C CA    . VAL C 2 26  ? 66.926  -58.701  -2.504  1.00 111.84 ? 26  VAL C CA    1 
ATOM   6138  C C     . VAL C 2 26  ? 67.176  -59.265  -3.903  1.00 113.26 ? 26  VAL C C     1 
ATOM   6139  O O     . VAL C 2 26  ? 67.899  -58.655  -4.685  1.00 112.86 ? 26  VAL C O     1 
ATOM   6140  C CB    . VAL C 2 26  ? 67.717  -59.509  -1.437  1.00 111.22 ? 26  VAL C CB    1 
ATOM   6141  C CG1   . VAL C 2 26  ? 69.193  -59.169  -1.496  1.00 110.29 ? 26  VAL C CG1   1 
ATOM   6142  C CG2   . VAL C 2 26  ? 67.199  -59.218  -0.041  1.00 110.34 ? 26  VAL C CG2   1 
ATOM   6143  N N     . ARG C 2 27  ? 66.561  -60.411  -4.212  1.00 115.10 ? 27  ARG C N     1 
ATOM   6144  C CA    . ARG C 2 27  ? 66.758  -61.109  -5.498  1.00 116.94 ? 27  ARG C CA    1 
ATOM   6145  C C     . ARG C 2 27  ? 66.424  -60.241  -6.703  1.00 117.54 ? 27  ARG C C     1 
ATOM   6146  O O     . ARG C 2 27  ? 67.174  -60.215  -7.687  1.00 118.04 ? 27  ARG C O     1 
ATOM   6147  C CB    . ARG C 2 27  ? 65.954  -62.413  -5.563  1.00 119.08 ? 27  ARG C CB    1 
ATOM   6148  C CG    . ARG C 2 27  ? 66.410  -63.502  -4.596  1.00 119.63 ? 27  ARG C CG    1 
ATOM   6149  C CD    . ARG C 2 27  ? 65.704  -64.832  -4.872  1.00 122.47 ? 27  ARG C CD    1 
ATOM   6150  N NE    . ARG C 2 27  ? 65.156  -65.411  -3.643  1.00 122.84 ? 27  ARG C NE    1 
ATOM   6151  C CZ    . ARG C 2 27  ? 63.871  -65.359  -3.292  1.00 123.57 ? 27  ARG C CZ    1 
ATOM   6152  N NH1   . ARG C 2 27  ? 62.977  -64.770  -4.081  1.00 124.11 ? 27  ARG C NH1   1 
ATOM   6153  N NH2   . ARG C 2 27  ? 63.474  -65.905  -2.149  1.00 123.73 ? 27  ARG C NH2   1 
ATOM   6154  N N     . LYS C 2 28  ? 65.296  -59.537  -6.613  1.00 117.54 ? 28  LYS C N     1 
ATOM   6155  C CA    . LYS C 2 28  ? 64.875  -58.598  -7.648  1.00 118.23 ? 28  LYS C CA    1 
ATOM   6156  C C     . LYS C 2 28  ? 65.855  -57.436  -7.746  1.00 116.66 ? 28  LYS C C     1 
ATOM   6157  O O     . LYS C 2 28  ? 66.050  -56.866  -8.820  1.00 117.41 ? 28  LYS C O     1 
ATOM   6158  C CB    . LYS C 2 28  ? 63.456  -58.091  -7.379  1.00 118.77 ? 28  LYS C CB    1 
ATOM   6159  C CG    . LYS C 2 28  ? 62.411  -59.201  -7.352  1.00 120.66 ? 28  LYS C CG    1 
ATOM   6160  C CD    . LYS C 2 28  ? 61.045  -58.705  -7.786  1.00 122.08 ? 28  LYS C CD    1 
ATOM   6161  C CE    . LYS C 2 28  ? 60.141  -59.872  -8.151  1.00 124.23 ? 28  LYS C CE    1 
ATOM   6162  N NZ    . LYS C 2 28  ? 58.897  -59.409  -8.815  1.00 126.12 ? 28  LYS C NZ    1 
ATOM   6163  N N     . ALA C 2 29  ? 66.482  -57.108  -6.620  1.00 114.61 ? 29  ALA C N     1 
ATOM   6164  C CA    . ALA C 2 29  ? 67.469  -56.043  -6.571  1.00 113.16 ? 29  ALA C CA    1 
ATOM   6165  C C     . ALA C 2 29  ? 68.811  -56.454  -7.182  1.00 113.19 ? 29  ALA C C     1 
ATOM   6166  O O     . ALA C 2 29  ? 69.542  -55.597  -7.661  1.00 112.96 ? 29  ALA C O     1 
ATOM   6167  C CB    . ALA C 2 29  ? 67.644  -55.541  -5.149  1.00 111.31 ? 29  ALA C CB    1 
ATOM   6168  N N     . LYS C 2 30  ? 69.137  -57.747  -7.175  1.00 113.74 ? 30  LYS C N     1 
ATOM   6169  C CA    . LYS C 2 30  ? 70.323  -58.231  -7.897  1.00 114.41 ? 30  LYS C CA    1 
ATOM   6170  C C     . LYS C 2 30  ? 70.117  -58.061  -9.381  1.00 116.23 ? 30  LYS C C     1 
ATOM   6171  O O     . LYS C 2 30  ? 71.022  -57.640  -10.097 1.00 116.59 ? 30  LYS C O     1 
ATOM   6172  C CB    . LYS C 2 30  ? 70.575  -59.710  -7.653  1.00 115.19 ? 30  LYS C CB    1 
ATOM   6173  C CG    . LYS C 2 30  ? 71.174  -60.026  -6.333  1.00 114.55 ? 30  LYS C CG    1 
ATOM   6174  C CD    . LYS C 2 30  ? 70.410  -61.174  -5.724  1.00 117.09 ? 30  LYS C CD    1 
ATOM   6175  C CE    . LYS C 2 30  ? 70.180  -60.922  -4.244  1.00 116.48 ? 30  LYS C CE    1 
ATOM   6176  N NZ    . LYS C 2 30  ? 69.170  -61.839  -3.627  1.00 117.32 ? 30  LYS C NZ    1 
ATOM   6177  N N     . GLU C 2 31  ? 68.911  -58.405  -9.826  1.00 117.61 ? 31  GLU C N     1 
ATOM   6178  C CA    . GLU C 2 31  ? 68.557  -58.408  -11.235 1.00 119.58 ? 31  GLU C CA    1 
ATOM   6179  C C     . GLU C 2 31  ? 68.462  -57.002  -11.825 1.00 119.26 ? 31  GLU C C     1 
ATOM   6180  O O     . GLU C 2 31  ? 69.132  -56.697  -12.814 1.00 120.13 ? 31  GLU C O     1 
ATOM   6181  C CB    . GLU C 2 31  ? 67.231  -59.143  -11.436 1.00 121.50 ? 31  GLU C CB    1 
ATOM   6182  C CG    . GLU C 2 31  ? 67.268  -60.622  -11.089 1.00 122.64 ? 31  GLU C CG    1 
ATOM   6183  C CD    . GLU C 2 31  ? 65.933  -61.302  -11.326 1.00 125.23 ? 31  GLU C CD    1 
ATOM   6184  O OE1   . GLU C 2 31  ? 64.981  -61.042  -10.561 1.00 124.91 ? 31  GLU C OE1   1 
ATOM   6185  O OE2   . GLU C 2 31  ? 65.838  -62.104  -12.279 1.00 128.19 ? 31  GLU C OE2   1 
ATOM   6186  N N     . SER C 2 32  ? 67.644  -56.153  -11.203 1.00 118.00 ? 32  SER C N     1 
ATOM   6187  C CA    . SER C 2 32  ? 67.269  -54.854  -11.776 1.00 118.16 ? 32  SER C CA    1 
ATOM   6188  C C     . SER C 2 32  ? 67.961  -53.620  -11.166 1.00 116.02 ? 32  SER C C     1 
ATOM   6189  O O     . SER C 2 32  ? 68.005  -52.558  -11.801 1.00 116.63 ? 32  SER C O     1 
ATOM   6190  C CB    . SER C 2 32  ? 65.751  -54.680  -11.709 1.00 119.08 ? 32  SER C CB    1 
ATOM   6191  O OG    . SER C 2 32  ? 65.300  -54.768  -10.369 1.00 117.75 ? 32  SER C OG    1 
ATOM   6192  N N     . GLY C 2 33  ? 68.486  -53.754  -9.945  1.00 113.55 ? 33  GLY C N     1 
ATOM   6193  C CA    . GLY C 2 33  ? 69.146  -52.641  -9.247  1.00 110.98 ? 33  GLY C CA    1 
ATOM   6194  C C     . GLY C 2 33  ? 70.580  -52.939  -8.845  1.00 109.17 ? 33  GLY C C     1 
ATOM   6195  O O     . GLY C 2 33  ? 71.301  -53.649  -9.551  1.00 110.07 ? 33  GLY C O     1 
ATOM   6196  N N     . LYS C 2 34  ? 70.990  -52.399  -7.703  1.00 106.65 ? 34  LYS C N     1 
ATOM   6197  C CA    . LYS C 2 34  ? 72.342  -52.593  -7.202  1.00 104.75 ? 34  LYS C CA    1 
ATOM   6198  C C     . LYS C 2 34  ? 72.294  -52.991  -5.735  1.00 102.53 ? 34  LYS C C     1 
ATOM   6199  O O     . LYS C 2 34  ? 71.695  -52.292  -4.917  1.00 101.74 ? 34  LYS C O     1 
ATOM   6200  C CB    . LYS C 2 34  ? 73.160  -51.307  -7.392  1.00 104.66 ? 34  LYS C CB    1 
ATOM   6201  C CG    . LYS C 2 34  ? 74.613  -51.399  -6.940  1.00 104.20 ? 34  LYS C CG    1 
ATOM   6202  C CD    . LYS C 2 34  ? 75.400  -50.155  -7.319  1.00 104.41 ? 34  LYS C CD    1 
ATOM   6203  C CE    . LYS C 2 34  ? 76.870  -50.332  -6.979  1.00 103.77 ? 34  LYS C CE    1 
ATOM   6204  N NZ    . LYS C 2 34  ? 77.693  -49.275  -7.612  1.00 104.15 ? 34  LYS C NZ    1 
ATOM   6205  N N     . ILE C 2 35  ? 72.913  -54.120  -5.406  1.00 101.40 ? 35  ILE C N     1 
ATOM   6206  C CA    . ILE C 2 35  ? 73.037  -54.535  -4.007  1.00 99.42  ? 35  ILE C CA    1 
ATOM   6207  C C     . ILE C 2 35  ? 74.494  -54.636  -3.563  1.00 98.08  ? 35  ILE C C     1 
ATOM   6208  O O     . ILE C 2 35  ? 75.404  -54.620  -4.394  1.00 98.65  ? 35  ILE C O     1 
ATOM   6209  C CB    . ILE C 2 35  ? 72.280  -55.865  -3.705  1.00 100.12 ? 35  ILE C CB    1 
ATOM   6210  C CG1   . ILE C 2 35  ? 72.684  -56.982  -4.674  1.00 101.47 ? 35  ILE C CG1   1 
ATOM   6211  C CG2   . ILE C 2 35  ? 70.779  -55.648  -3.726  1.00 100.35 ? 35  ILE C CG2   1 
ATOM   6212  C CD1   . ILE C 2 35  ? 73.551  -58.064  -4.053  1.00 101.46 ? 35  ILE C CD1   1 
ATOM   6213  N N     . LYS C 2 36  ? 74.704  -54.714  -2.251  1.00 96.18  ? 36  LYS C N     1 
ATOM   6214  C CA    . LYS C 2 36  ? 76.029  -54.961  -1.686  1.00 94.86  ? 36  LYS C CA    1 
ATOM   6215  C C     . LYS C 2 36  ? 75.940  -56.186  -0.794  1.00 94.50  ? 36  LYS C C     1 
ATOM   6216  O O     . LYS C 2 36  ? 74.990  -56.321  -0.015  1.00 94.25  ? 36  LYS C O     1 
ATOM   6217  C CB    . LYS C 2 36  ? 76.541  -53.752  -0.886  1.00 93.79  ? 36  LYS C CB    1 
ATOM   6218  C CG    . LYS C 2 36  ? 76.944  -52.524  -1.713  1.00 93.08  ? 36  LYS C CG    1 
ATOM   6219  C CD    . LYS C 2 36  ? 78.252  -52.721  -2.481  1.00 92.61  ? 36  LYS C CD    1 
ATOM   6220  C CE    . LYS C 2 36  ? 78.580  -51.494  -3.306  1.00 92.09  ? 36  LYS C CE    1 
ATOM   6221  N NZ    . LYS C 2 36  ? 79.417  -51.825  -4.476  1.00 92.66  ? 36  LYS C NZ    1 
ATOM   6222  N N     . LYS C 2 37  ? 76.927  -57.072  -0.911  1.00 94.36  ? 37  LYS C N     1 
ATOM   6223  C CA    . LYS C 2 37  ? 76.898  -58.354  -0.208  1.00 94.34  ? 37  LYS C CA    1 
ATOM   6224  C C     . LYS C 2 37  ? 78.154  -58.592  0.615   1.00 93.53  ? 37  LYS C C     1 
ATOM   6225  O O     . LYS C 2 37  ? 79.261  -58.465  0.100   1.00 93.90  ? 37  LYS C O     1 
ATOM   6226  C CB    . LYS C 2 37  ? 76.666  -59.502  -1.198  1.00 95.91  ? 37  LYS C CB    1 
ATOM   6227  C CG    . LYS C 2 37  ? 77.618  -59.538  -2.385  1.00 97.23  ? 37  LYS C CG    1 
ATOM   6228  C CD    . LYS C 2 37  ? 76.894  -59.961  -3.669  1.00 99.98  ? 37  LYS C CD    1 
ATOM   6229  C CE    . LYS C 2 37  ? 77.877  -60.399  -4.761  1.00 102.34 ? 37  LYS C CE    1 
ATOM   6230  N NZ    . LYS C 2 37  ? 79.173  -59.624  -4.758  1.00 103.15 ? 37  LYS C NZ    1 
ATOM   6231  N N     . GLY C 2 38  ? 77.965  -58.931  1.891   1.00 92.53  ? 38  GLY C N     1 
ATOM   6232  C CA    . GLY C 2 38  ? 79.068  -59.123  2.838   1.00 91.64  ? 38  GLY C CA    1 
ATOM   6233  C C     . GLY C 2 38  ? 79.091  -58.038  3.899   1.00 90.13  ? 38  GLY C C     1 
ATOM   6234  O O     . GLY C 2 38  ? 78.705  -56.910  3.620   1.00 89.58  ? 38  GLY C O     1 
ATOM   6235  N N     . THR C 2 39  ? 79.559  -58.370  5.106   1.00 89.78  ? 39  THR C N     1 
ATOM   6236  C CA    . THR C 2 39  ? 79.516  -57.452  6.262   1.00 88.62  ? 39  THR C CA    1 
ATOM   6237  C C     . THR C 2 39  ? 80.362  -56.192  6.082   1.00 87.67  ? 39  THR C C     1 
ATOM   6238  O O     . THR C 2 39  ? 79.933  -55.093  6.445   1.00 87.09  ? 39  THR C O     1 
ATOM   6239  C CB    . THR C 2 39  ? 79.913  -58.151  7.591   1.00 89.28  ? 39  THR C CB    1 
ATOM   6240  O OG1   . THR C 2 39  ? 79.131  -59.334  7.769   1.00 90.10  ? 39  THR C OG1   1 
ATOM   6241  C CG2   . THR C 2 39  ? 79.668  -57.238  8.786   1.00 88.83  ? 39  THR C CG2   1 
ATOM   6242  N N     . ASN C 2 40  ? 81.557  -56.348  5.530   1.00 87.51  ? 40  ASN C N     1 
ATOM   6243  C CA    . ASN C 2 40  ? 82.410  -55.200  5.289   1.00 86.81  ? 40  ASN C CA    1 
ATOM   6244  C C     . ASN C 2 40  ? 81.865  -54.254  4.226   1.00 86.08  ? 40  ASN C C     1 
ATOM   6245  O O     . ASN C 2 40  ? 81.967  -53.036  4.376   1.00 85.94  ? 40  ASN C O     1 
ATOM   6246  C CB    . ASN C 2 40  ? 83.825  -55.637  4.938   1.00 87.62  ? 40  ASN C CB    1 
ATOM   6247  C CG    . ASN C 2 40  ? 84.623  -56.071  6.152   1.00 88.26  ? 40  ASN C CG    1 
ATOM   6248  O OD1   . ASN C 2 40  ? 85.652  -56.720  6.014   1.00 88.87  ? 40  ASN C OD1   1 
ATOM   6249  N ND2   . ASN C 2 40  ? 84.155  -55.714  7.345   1.00 88.24  ? 40  ASN C ND2   1 
ATOM   6250  N N     . GLU C 2 41  ? 81.284  -54.810  3.162   1.00 85.72  ? 41  GLU C N     1 
ATOM   6251  C CA    . GLU C 2 41  ? 80.690  -53.996  2.094   1.00 84.93  ? 41  GLU C CA    1 
ATOM   6252  C C     . GLU C 2 41  ? 79.372  -53.357  2.528   1.00 83.77  ? 41  GLU C C     1 
ATOM   6253  O O     . GLU C 2 41  ? 78.994  -52.298  2.024   1.00 83.62  ? 41  GLU C O     1 
ATOM   6254  C CB    . GLU C 2 41  ? 80.466  -54.819  0.829   1.00 85.71  ? 41  GLU C CB    1 
ATOM   6255  C CG    . GLU C 2 41  ? 81.731  -55.186  0.083   1.00 87.24  ? 41  GLU C CG    1 
ATOM   6256  C CD    . GLU C 2 41  ? 81.452  -55.826  -1.271  1.00 88.90  ? 41  GLU C CD    1 
ATOM   6257  O OE1   . GLU C 2 41  ? 81.592  -57.066  -1.399  1.00 88.71  ? 41  GLU C OE1   1 
ATOM   6258  O OE2   . GLU C 2 41  ? 81.092  -55.077  -2.207  1.00 90.22  ? 41  GLU C OE2   1 
ATOM   6259  N N     . THR C 2 42  ? 78.673  -54.016  3.450   1.00 82.93  ? 42  THR C N     1 
ATOM   6260  C CA    . THR C 2 42  ? 77.436  -53.492  4.023   1.00 81.81  ? 42  THR C CA    1 
ATOM   6261  C C     . THR C 2 42  ? 77.780  -52.309  4.917   1.00 80.89  ? 42  THR C C     1 
ATOM   6262  O O     . THR C 2 42  ? 77.101  -51.282  4.883   1.00 80.70  ? 42  THR C O     1 
ATOM   6263  C CB    . THR C 2 42  ? 76.670  -54.582  4.823   1.00 82.11  ? 42  THR C CB    1 
ATOM   6264  O OG1   . THR C 2 42  ? 76.398  -55.701  3.969   1.00 82.82  ? 42  THR C OG1   1 
ATOM   6265  C CG2   . THR C 2 42  ? 75.352  -54.056  5.367   1.00 81.75  ? 42  THR C CG2   1 
ATOM   6266  N N     . THR C 2 43  ? 78.850  -52.462  5.696   1.00 80.28  ? 43  THR C N     1 
ATOM   6267  C CA    . THR C 2 43  ? 79.349  -51.413  6.577   1.00 79.47  ? 43  THR C CA    1 
ATOM   6268  C C     . THR C 2 43  ? 79.650  -50.129  5.807   1.00 79.03  ? 43  THR C C     1 
ATOM   6269  O O     . THR C 2 43  ? 79.209  -49.048  6.191   1.00 78.67  ? 43  THR C O     1 
ATOM   6270  C CB    . THR C 2 43  ? 80.607  -51.879  7.315   1.00 79.77  ? 43  THR C CB    1 
ATOM   6271  O OG1   . THR C 2 43  ? 80.293  -53.028  8.107   1.00 80.12  ? 43  THR C OG1   1 
ATOM   6272  C CG2   . THR C 2 43  ? 81.132  -50.785  8.220   1.00 80.20  ? 43  THR C CG2   1 
ATOM   6273  N N     . LYS C 2 44  ? 80.388  -50.266  4.711   1.00 79.05  ? 44  LYS C N     1 
ATOM   6274  C CA    . LYS C 2 44  ? 80.771  -49.128  3.888   1.00 79.08  ? 44  LYS C CA    1 
ATOM   6275  C C     . LYS C 2 44  ? 79.552  -48.462  3.292   1.00 79.00  ? 44  LYS C C     1 
ATOM   6276  O O     . LYS C 2 44  ? 79.539  -47.255  3.100   1.00 79.26  ? 44  LYS C O     1 
ATOM   6277  C CB    . LYS C 2 44  ? 81.719  -49.552  2.772   1.00 79.29  ? 44  LYS C CB    1 
ATOM   6278  C CG    . LYS C 2 44  ? 82.964  -50.242  3.260   1.00 80.03  ? 44  LYS C CG    1 
ATOM   6279  C CD    . LYS C 2 44  ? 83.900  -50.472  2.115   1.00 81.51  ? 44  LYS C CD    1 
ATOM   6280  C CE    . LYS C 2 44  ? 84.386  -51.900  2.086   1.00 82.19  ? 44  LYS C CE    1 
ATOM   6281  N NZ    . LYS C 2 44  ? 85.231  -52.115  0.883   1.00 82.37  ? 44  LYS C NZ    1 
ATOM   6282  N N     . ALA C 2 45  ? 78.523  -49.255  3.011   1.00 79.15  ? 45  ALA C N     1 
ATOM   6283  C CA    . ALA C 2 45  ? 77.305  -48.750  2.386   1.00 79.50  ? 45  ALA C CA    1 
ATOM   6284  C C     . ALA C 2 45  ? 76.508  -47.893  3.358   1.00 79.56  ? 45  ALA C C     1 
ATOM   6285  O O     . ALA C 2 45  ? 75.779  -46.993  2.948   1.00 79.83  ? 45  ALA C O     1 
ATOM   6286  C CB    . ALA C 2 45  ? 76.461  -49.892  1.881   1.00 79.55  ? 45  ALA C CB    1 
ATOM   6287  N N     . VAL C 2 46  ? 76.652  -48.181  4.647   1.00 79.64  ? 46  VAL C N     1 
ATOM   6288  C CA    . VAL C 2 46  ? 75.974  -47.421  5.682   1.00 79.98  ? 46  VAL C CA    1 
ATOM   6289  C C     . VAL C 2 46  ? 76.785  -46.180  5.968   1.00 80.65  ? 46  VAL C C     1 
ATOM   6290  O O     . VAL C 2 46  ? 76.256  -45.077  5.958   1.00 81.08  ? 46  VAL C O     1 
ATOM   6291  C CB    . VAL C 2 46  ? 75.791  -48.251  6.962   1.00 79.98  ? 46  VAL C CB    1 
ATOM   6292  C CG1   . VAL C 2 46  ? 75.282  -47.385  8.114   1.00 80.02  ? 46  VAL C CG1   1 
ATOM   6293  C CG2   . VAL C 2 46  ? 74.835  -49.412  6.694   1.00 80.01  ? 46  VAL C CG2   1 
ATOM   6294  N N     . GLU C 2 47  ? 78.081  -46.367  6.196   1.00 81.41  ? 47  GLU C N     1 
ATOM   6295  C CA    . GLU C 2 47  ? 79.013  -45.262  6.424   1.00 82.37  ? 47  GLU C CA    1 
ATOM   6296  C C     . GLU C 2 47  ? 78.894  -44.195  5.330   1.00 82.29  ? 47  GLU C C     1 
ATOM   6297  O O     . GLU C 2 47  ? 78.937  -42.998  5.617   1.00 82.81  ? 47  GLU C O     1 
ATOM   6298  C CB    . GLU C 2 47  ? 80.442  -45.797  6.489   1.00 82.91  ? 47  GLU C CB    1 
ATOM   6299  C CG    . GLU C 2 47  ? 81.178  -45.461  7.775   1.00 86.06  ? 47  GLU C CG    1 
ATOM   6300  C CD    . GLU C 2 47  ? 82.271  -46.480  8.096   1.00 90.44  ? 47  GLU C CD    1 
ATOM   6301  O OE1   . GLU C 2 47  ? 82.519  -46.727  9.308   1.00 91.58  ? 47  GLU C OE1   1 
ATOM   6302  O OE2   . GLU C 2 47  ? 82.869  -47.044  7.137   1.00 91.97  ? 47  GLU C OE2   1 
ATOM   6303  N N     . ARG C 2 48  ? 78.717  -44.641  4.088   1.00 81.82  ? 48  ARG C N     1 
ATOM   6304  C CA    . ARG C 2 48  ? 78.597  -43.743  2.946   1.00 82.25  ? 48  ARG C CA    1 
ATOM   6305  C C     . ARG C 2 48  ? 77.176  -43.278  2.682   1.00 82.56  ? 48  ARG C C     1 
ATOM   6306  O O     . ARG C 2 48  ? 76.953  -42.468  1.783   1.00 83.47  ? 48  ARG C O     1 
ATOM   6307  C CB    . ARG C 2 48  ? 79.131  -44.403  1.684   1.00 82.25  ? 48  ARG C CB    1 
ATOM   6308  C CG    . ARG C 2 48  ? 80.614  -44.608  1.676   1.00 81.98  ? 48  ARG C CG    1 
ATOM   6309  C CD    . ARG C 2 48  ? 80.977  -45.622  0.633   1.00 80.67  ? 48  ARG C CD    1 
ATOM   6310  N NE    . ARG C 2 48  ? 82.348  -46.067  0.805   1.00 81.48  ? 48  ARG C NE    1 
ATOM   6311  C CZ    . ARG C 2 48  ? 82.931  -46.989  0.051   1.00 81.68  ? 48  ARG C CZ    1 
ATOM   6312  N NH1   . ARG C 2 48  ? 82.241  -47.559  -0.924  1.00 82.76  ? 48  ARG C NH1   1 
ATOM   6313  N NH2   . ARG C 2 48  ? 84.194  -47.341  0.272   1.00 81.06  ? 48  ARG C NH2   1 
ATOM   6314  N N     . GLY C 2 49  ? 76.220  -43.801  3.443   1.00 82.15  ? 49  GLY C N     1 
ATOM   6315  C CA    . GLY C 2 49  ? 74.810  -43.437  3.287   1.00 82.54  ? 49  GLY C CA    1 
ATOM   6316  C C     . GLY C 2 49  ? 74.158  -43.806  1.965   1.00 82.95  ? 49  GLY C C     1 
ATOM   6317  O O     . GLY C 2 49  ? 73.188  -43.186  1.559   1.00 83.66  ? 49  GLY C O     1 
ATOM   6318  N N     . GLN C 2 50  ? 74.681  -44.820  1.293   1.00 83.19  ? 50  GLN C N     1 
ATOM   6319  C CA    . GLN C 2 50  ? 74.137  -45.256  0.000   1.00 84.15  ? 50  GLN C CA    1 
ATOM   6320  C C     . GLN C 2 50  ? 72.942  -46.218  0.130   1.00 84.51  ? 50  GLN C C     1 
ATOM   6321  O O     . GLN C 2 50  ? 72.038  -46.200  -0.701  1.00 85.35  ? 50  GLN C O     1 
ATOM   6322  C CB    . GLN C 2 50  ? 75.233  -45.908  -0.849  1.00 84.12  ? 50  GLN C CB    1 
ATOM   6323  C CG    . GLN C 2 50  ? 76.400  -44.992  -1.186  1.00 83.85  ? 50  GLN C CG    1 
ATOM   6324  C CD    . GLN C 2 50  ? 77.612  -45.736  -1.721  1.00 82.99  ? 50  GLN C CD    1 
ATOM   6325  O OE1   . GLN C 2 50  ? 77.879  -46.877  -1.347  1.00 81.94  ? 50  GLN C OE1   1 
ATOM   6326  N NE2   . GLN C 2 50  ? 78.362  -45.081  -2.593  1.00 84.34  ? 50  GLN C NE2   1 
ATOM   6327  N N     . ALA C 2 51  ? 72.951  -47.045  1.177   1.00 84.29  ? 51  ALA C N     1 
ATOM   6328  C CA    . ALA C 2 51  ? 71.948  -48.098  1.390   1.00 84.59  ? 51  ALA C CA    1 
ATOM   6329  C C     . ALA C 2 51  ? 70.558  -47.577  1.792   1.00 85.10  ? 51  ALA C C     1 
ATOM   6330  O O     . ALA C 2 51  ? 70.452  -46.634  2.579   1.00 85.16  ? 51  ALA C O     1 
ATOM   6331  C CB    . ALA C 2 51  ? 72.460  -49.095  2.428   1.00 83.98  ? 51  ALA C CB    1 
ATOM   6332  N N     . LYS C 2 52  ? 69.505  -48.195  1.248   1.00 85.73  ? 52  LYS C N     1 
ATOM   6333  C CA    . LYS C 2 52  ? 68.120  -47.851  1.600   1.00 86.25  ? 52  LYS C CA    1 
ATOM   6334  C C     . LYS C 2 52  ? 67.565  -48.855  2.599   1.00 86.14  ? 52  LYS C C     1 
ATOM   6335  O O     . LYS C 2 52  ? 66.692  -48.531  3.402   1.00 86.33  ? 52  LYS C O     1 
ATOM   6336  C CB    . LYS C 2 52  ? 67.204  -47.827  0.371   1.00 87.32  ? 52  LYS C CB    1 
ATOM   6337  C CG    . LYS C 2 52  ? 67.801  -47.253  -0.900  1.00 88.31  ? 52  LYS C CG    1 
ATOM   6338  C CD    . LYS C 2 52  ? 68.039  -45.760  -0.799  1.00 88.87  ? 52  LYS C CD    1 
ATOM   6339  C CE    . LYS C 2 52  ? 68.317  -45.175  -2.156  1.00 89.94  ? 52  LYS C CE    1 
ATOM   6340  N NZ    . LYS C 2 52  ? 69.342  -44.116  -2.045  1.00 90.44  ? 52  LYS C NZ    1 
ATOM   6341  N N     . LEU C 2 53  ? 68.066  -50.085  2.520   1.00 86.06  ? 53  LEU C N     1 
ATOM   6342  C CA    . LEU C 2 53  ? 67.679  -51.149  3.436   1.00 86.06  ? 53  LEU C CA    1 
ATOM   6343  C C     . LEU C 2 53  ? 68.863  -52.070  3.711   1.00 85.62  ? 53  LEU C C     1 
ATOM   6344  O O     . LEU C 2 53  ? 69.593  -52.464  2.799   1.00 85.71  ? 53  LEU C O     1 
ATOM   6345  C CB    . LEU C 2 53  ? 66.498  -51.943  2.870   1.00 87.19  ? 53  LEU C CB    1 
ATOM   6346  C CG    . LEU C 2 53  ? 65.943  -53.149  3.640   1.00 87.68  ? 53  LEU C CG    1 
ATOM   6347  C CD1   . LEU C 2 53  ? 65.495  -52.753  5.035   1.00 87.34  ? 53  LEU C CD1   1 
ATOM   6348  C CD2   . LEU C 2 53  ? 64.788  -53.785  2.874   1.00 88.77  ? 53  LEU C CD2   1 
ATOM   6349  N N     . VAL C 2 54  ? 69.046  -52.397  4.982   1.00 85.35  ? 54  VAL C N     1 
ATOM   6350  C CA    . VAL C 2 54  ? 70.124  -53.269  5.417   1.00 85.10  ? 54  VAL C CA    1 
ATOM   6351  C C     . VAL C 2 54  ? 69.523  -54.571  5.955   1.00 86.02  ? 54  VAL C C     1 
ATOM   6352  O O     . VAL C 2 54  ? 68.620  -54.559  6.792   1.00 86.25  ? 54  VAL C O     1 
ATOM   6353  C CB    . VAL C 2 54  ? 71.025  -52.557  6.466   1.00 84.28  ? 54  VAL C CB    1 
ATOM   6354  C CG1   . VAL C 2 54  ? 71.944  -53.532  7.175   1.00 84.25  ? 54  VAL C CG1   1 
ATOM   6355  C CG2   . VAL C 2 54  ? 71.838  -51.474  5.799   1.00 83.58  ? 54  VAL C CG2   1 
ATOM   6356  N N     . ILE C 2 55  ? 70.020  -55.693  5.448   1.00 86.64  ? 55  ILE C N     1 
ATOM   6357  C CA    . ILE C 2 55  ? 69.538  -57.000  5.859   1.00 87.82  ? 55  ILE C CA    1 
ATOM   6358  C C     . ILE C 2 55  ? 70.609  -57.715  6.678   1.00 88.01  ? 55  ILE C C     1 
ATOM   6359  O O     . ILE C 2 55  ? 71.748  -57.859  6.235   1.00 87.94  ? 55  ILE C O     1 
ATOM   6360  C CB    . ILE C 2 55  ? 69.120  -57.865  4.643   1.00 88.75  ? 55  ILE C CB    1 
ATOM   6361  C CG1   . ILE C 2 55  ? 68.163  -57.100  3.715   1.00 89.30  ? 55  ILE C CG1   1 
ATOM   6362  C CG2   . ILE C 2 55  ? 68.469  -59.158  5.109   1.00 90.09  ? 55  ILE C CG2   1 
ATOM   6363  C CD1   . ILE C 2 55  ? 68.830  -56.407  2.523   1.00 89.32  ? 55  ILE C CD1   1 
ATOM   6364  N N     . ILE C 2 56  ? 70.239  -58.154  7.875   1.00 88.57  ? 56  ILE C N     1 
ATOM   6365  C CA    . ILE C 2 56  ? 71.163  -58.846  8.764   1.00 89.10  ? 56  ILE C CA    1 
ATOM   6366  C C     . ILE C 2 56  ? 70.634  -60.251  9.091   1.00 90.87  ? 56  ILE C C     1 
ATOM   6367  O O     . ILE C 2 56  ? 69.433  -60.433  9.319   1.00 91.70  ? 56  ILE C O     1 
ATOM   6368  C CB    . ILE C 2 56  ? 71.373  -58.050  10.070  1.00 88.59  ? 56  ILE C CB    1 
ATOM   6369  C CG1   . ILE C 2 56  ? 71.599  -56.565  9.769   1.00 86.87  ? 56  ILE C CG1   1 
ATOM   6370  C CG2   . ILE C 2 56  ? 72.529  -58.632  10.865  1.00 89.14  ? 56  ILE C CG2   1 
ATOM   6371  C CD1   . ILE C 2 56  ? 71.378  -55.656  10.955  1.00 86.46  ? 56  ILE C CD1   1 
ATOM   6372  N N     . ALA C 2 57  ? 71.528  -61.239  9.112   1.00 91.67  ? 57  ALA C N     1 
ATOM   6373  C CA    . ALA C 2 57  ? 71.158  -62.617  9.462   1.00 93.31  ? 57  ALA C CA    1 
ATOM   6374  C C     . ALA C 2 57  ? 71.164  -62.853  10.982  1.00 94.04  ? 57  ALA C C     1 
ATOM   6375  O O     . ALA C 2 57  ? 71.927  -62.208  11.710  1.00 93.32  ? 57  ALA C O     1 
ATOM   6376  C CB    . ALA C 2 57  ? 72.073  -63.609  8.755   1.00 94.05  ? 57  ALA C CB    1 
ATOM   6377  N N     . GLU C 2 58  ? 70.318  -63.782  11.442  1.00 95.65  ? 58  GLU C N     1 
ATOM   6378  C CA    . GLU C 2 58  ? 70.105  -64.056  12.881  1.00 96.72  ? 58  GLU C CA    1 
ATOM   6379  C C     . GLU C 2 58  ? 70.955  -65.186  13.453  1.00 98.30  ? 58  GLU C C     1 
ATOM   6380  O O     . GLU C 2 58  ? 70.934  -65.430  14.664  1.00 99.07  ? 58  GLU C O     1 
ATOM   6381  C CB    . GLU C 2 58  ? 68.635  -64.366  13.158  1.00 97.64  ? 58  GLU C CB    1 
ATOM   6382  C CG    . GLU C 2 58  ? 67.717  -63.166  13.078  1.00 96.57  ? 58  GLU C CG    1 
ATOM   6383  C CD    . GLU C 2 58  ? 66.258  -63.555  12.976  1.00 97.68  ? 58  GLU C CD    1 
ATOM   6384  O OE1   . GLU C 2 58  ? 65.970  -64.748  12.730  1.00 98.80  ? 58  GLU C OE1   1 
ATOM   6385  O OE2   . GLU C 2 58  ? 65.397  -62.662  13.141  1.00 97.29  ? 58  GLU C OE2   1 
ATOM   6386  N N     . ASP C 2 59  ? 71.694  -65.861  12.573  1.00 98.95  ? 59  ASP C N     1 
ATOM   6387  C CA    . ASP C 2 59  ? 72.497  -67.031  12.927  1.00 100.98 ? 59  ASP C CA    1 
ATOM   6388  C C     . ASP C 2 59  ? 73.998  -66.836  12.661  1.00 100.47 ? 59  ASP C C     1 
ATOM   6389  O O     . ASP C 2 59  ? 74.691  -67.786  12.289  1.00 101.89 ? 59  ASP C O     1 
ATOM   6390  C CB    . ASP C 2 59  ? 71.973  -68.279  12.186  1.00 102.78 ? 59  ASP C CB    1 
ATOM   6391  C CG    . ASP C 2 59  ? 71.977  -68.122  10.651  1.00 102.59 ? 59  ASP C CG    1 
ATOM   6392  O OD1   . ASP C 2 59  ? 72.163  -66.994  10.143  1.00 101.23 ? 59  ASP C OD1   1 
ATOM   6393  O OD2   . ASP C 2 59  ? 71.784  -69.140  9.946   1.00 104.60 ? 59  ASP C OD2   1 
ATOM   6394  N N     . VAL C 2 60  ? 74.493  -65.611  12.857  1.00 98.89  ? 60  VAL C N     1 
ATOM   6395  C CA    . VAL C 2 60  ? 75.915  -65.292  12.649  1.00 98.19  ? 60  VAL C CA    1 
ATOM   6396  C C     . VAL C 2 60  ? 76.735  -65.854  13.813  1.00 99.63  ? 60  VAL C C     1 
ATOM   6397  O O     . VAL C 2 60  ? 76.349  -65.693  14.977  1.00 99.95  ? 60  VAL C O     1 
ATOM   6398  C CB    . VAL C 2 60  ? 76.147  -63.770  12.479  1.00 96.23  ? 60  VAL C CB    1 
ATOM   6399  C CG1   . VAL C 2 60  ? 77.590  -63.478  12.090  1.00 95.80  ? 60  VAL C CG1   1 
ATOM   6400  C CG2   . VAL C 2 60  ? 75.202  -63.202  11.426  1.00 94.96  ? 60  VAL C CG2   1 
ATOM   6401  N N     . GLN C 2 61  ? 77.856  -66.513  13.500  1.00 100.50 ? 61  GLN C N     1 
ATOM   6402  C CA    . GLN C 2 61  ? 78.521  -67.369  14.493  1.00 102.56 ? 61  GLN C CA    1 
ATOM   6403  C C     . GLN C 2 61  ? 79.898  -67.041  15.104  1.00 102.42 ? 61  GLN C C     1 
ATOM   6404  O O     . GLN C 2 61  ? 80.734  -67.944  15.320  1.00 104.41 ? 61  GLN C O     1 
ATOM   6405  C CB    . GLN C 2 61  ? 78.424  -68.855  14.119  1.00 104.93 ? 61  GLN C CB    1 
ATOM   6406  C CG    . GLN C 2 61  ? 77.477  -69.638  15.047  1.00 108.16 ? 61  GLN C CG    1 
ATOM   6407  C CD    . GLN C 2 61  ? 77.659  -69.295  16.542  1.00 110.19 ? 61  GLN C CD    1 
ATOM   6408  O OE1   . GLN C 2 61  ? 78.740  -69.483  17.122  1.00 111.21 ? 61  GLN C OE1   1 
ATOM   6409  N NE2   . GLN C 2 61  ? 76.590  -68.792  17.164  1.00 110.33 ? 61  GLN C NE2   1 
ATOM   6410  N N     . PRO C 2 62  ? 80.176  -65.738  15.243  1.00 100.23 ? 62  PRO C N     1 
ATOM   6411  C CA    . PRO C 2 62  ? 80.346  -65.045  16.506  1.00 99.87  ? 62  PRO C CA    1 
ATOM   6412  C C     . PRO C 2 62  ? 79.368  -63.871  16.403  1.00 97.76  ? 62  PRO C C     1 
ATOM   6413  O O     . PRO C 2 62  ? 79.498  -63.034  15.500  1.00 96.03  ? 62  PRO C O     1 
ATOM   6414  C CB    . PRO C 2 62  ? 81.800  -64.555  16.472  1.00 99.66  ? 62  PRO C CB    1 
ATOM   6415  C CG    . PRO C 2 62  ? 82.373  -65.025  15.162  1.00 99.62  ? 62  PRO C CG    1 
ATOM   6416  C CD    . PRO C 2 62  ? 81.192  -65.279  14.273  1.00 99.18  ? 62  PRO C CD    1 
ATOM   6417  N N     . GLU C 2 63  ? 78.368  -63.832  17.279  1.00 97.99  ? 63  GLU C N     1 
ATOM   6418  C CA    . GLU C 2 63  ? 77.289  -62.831  17.193  1.00 96.22  ? 63  GLU C CA    1 
ATOM   6419  C C     . GLU C 2 63  ? 77.771  -61.425  16.861  1.00 94.04  ? 63  GLU C C     1 
ATOM   6420  O O     . GLU C 2 63  ? 77.117  -60.688  16.124  1.00 92.59  ? 63  GLU C O     1 
ATOM   6421  C CB    . GLU C 2 63  ? 76.511  -62.764  18.506  1.00 97.35  ? 63  GLU C CB    1 
ATOM   6422  C CG    . GLU C 2 63  ? 75.588  -63.927  18.755  1.00 99.72  ? 63  GLU C CG    1 
ATOM   6423  C CD    . GLU C 2 63  ? 74.949  -63.865  20.129  1.00 102.27 ? 63  GLU C CD    1 
ATOM   6424  O OE1   . GLU C 2 63  ? 74.770  -64.942  20.738  1.00 104.82 ? 63  GLU C OE1   1 
ATOM   6425  O OE2   . GLU C 2 63  ? 74.629  -62.747  20.602  1.00 101.23 ? 63  GLU C OE2   1 
ATOM   6426  N N     . GLU C 2 64  ? 78.924  -61.070  17.415  1.00 93.88  ? 64  GLU C N     1 
ATOM   6427  C CA    . GLU C 2 64  ? 79.400  -59.698  17.433  1.00 92.05  ? 64  GLU C CA    1 
ATOM   6428  C C     . GLU C 2 64  ? 79.842  -59.190  16.064  1.00 90.07  ? 64  GLU C C     1 
ATOM   6429  O O     . GLU C 2 64  ? 80.003  -57.984  15.881  1.00 88.98  ? 64  GLU C O     1 
ATOM   6430  C CB    . GLU C 2 64  ? 80.520  -59.555  18.465  1.00 93.39  ? 64  GLU C CB    1 
ATOM   6431  C CG    . GLU C 2 64  ? 80.106  -59.906  19.903  1.00 95.17  ? 64  GLU C CG    1 
ATOM   6432  C CD    . GLU C 2 64  ? 80.294  -61.380  20.266  1.00 97.10  ? 64  GLU C CD    1 
ATOM   6433  O OE1   . GLU C 2 64  ? 80.363  -62.235  19.361  1.00 96.68  ? 64  GLU C OE1   1 
ATOM   6434  O OE2   . GLU C 2 64  ? 80.370  -61.686  21.475  1.00 99.53  ? 64  GLU C OE2   1 
ATOM   6435  N N     . ILE C 2 65  ? 80.012  -60.108  15.111  1.00 89.56  ? 65  ILE C N     1 
ATOM   6436  C CA    . ILE C 2 65  ? 80.431  -59.775  13.742  1.00 88.02  ? 65  ILE C CA    1 
ATOM   6437  C C     . ILE C 2 65  ? 79.553  -58.705  13.063  1.00 86.45  ? 65  ILE C C     1 
ATOM   6438  O O     . ILE C 2 65  ? 80.043  -57.880  12.287  1.00 85.59  ? 65  ILE C O     1 
ATOM   6439  C CB    . ILE C 2 65  ? 80.575  -61.050  12.855  1.00 88.48  ? 65  ILE C CB    1 
ATOM   6440  C CG1   . ILE C 2 65  ? 81.897  -61.750  13.177  1.00 89.14  ? 65  ILE C CG1   1 
ATOM   6441  C CG2   . ILE C 2 65  ? 80.482  -60.716  11.357  1.00 87.34  ? 65  ILE C CG2   1 
ATOM   6442  C CD1   . ILE C 2 65  ? 82.329  -62.792  12.178  1.00 88.66  ? 65  ILE C CD1   1 
ATOM   6443  N N     . VAL C 2 66  ? 78.266  -58.711  13.371  1.00 86.23  ? 66  VAL C N     1 
ATOM   6444  C CA    . VAL C 2 66  ? 77.347  -57.771  12.749  1.00 85.17  ? 66  VAL C CA    1 
ATOM   6445  C C     . VAL C 2 66  ? 76.729  -56.822  13.774  1.00 85.08  ? 66  VAL C C     1 
ATOM   6446  O O     . VAL C 2 66  ? 75.910  -55.973  13.426  1.00 84.32  ? 66  VAL C O     1 
ATOM   6447  C CB    . VAL C 2 66  ? 76.243  -58.513  11.931  1.00 85.34  ? 66  VAL C CB    1 
ATOM   6448  C CG1   . VAL C 2 66  ? 76.830  -59.132  10.662  1.00 85.27  ? 66  VAL C CG1   1 
ATOM   6449  C CG2   . VAL C 2 66  ? 75.551  -59.581  12.773  1.00 86.42  ? 66  VAL C CG2   1 
ATOM   6450  N N     . ALA C 2 67  ? 77.149  -56.960  15.031  1.00 86.26  ? 67  ALA C N     1 
ATOM   6451  C CA    . ALA C 2 67  ? 76.547  -56.240  16.159  1.00 86.83  ? 67  ALA C CA    1 
ATOM   6452  C C     . ALA C 2 67  ? 76.603  -54.723  16.019  1.00 86.13  ? 67  ALA C C     1 
ATOM   6453  O O     . ALA C 2 67  ? 75.763  -54.022  16.586  1.00 86.24  ? 67  ALA C O     1 
ATOM   6454  C CB    . ALA C 2 67  ? 77.182  -56.680  17.477  1.00 88.22  ? 67  ALA C CB    1 
ATOM   6455  N N     . HIS C 2 68  ? 77.582  -54.236  15.253  1.00 85.79  ? 68  HIS C N     1 
ATOM   6456  C CA    . HIS C 2 68  ? 77.806  -52.799  15.037  1.00 85.37  ? 68  HIS C CA    1 
ATOM   6457  C C     . HIS C 2 68  ? 76.829  -52.154  14.056  1.00 84.43  ? 68  HIS C C     1 
ATOM   6458  O O     . HIS C 2 68  ? 76.650  -50.934  14.067  1.00 84.12  ? 68  HIS C O     1 
ATOM   6459  C CB    . HIS C 2 68  ? 79.229  -52.556  14.544  1.00 85.32  ? 68  HIS C CB    1 
ATOM   6460  C CG    . HIS C 2 68  ? 79.450  -52.962  13.123  1.00 85.00  ? 68  HIS C CG    1 
ATOM   6461  N ND1   . HIS C 2 68  ? 79.542  -54.278  12.732  1.00 85.73  ? 68  HIS C ND1   1 
ATOM   6462  C CD2   . HIS C 2 68  ? 79.598  -52.223  11.997  1.00 84.99  ? 68  HIS C CD2   1 
ATOM   6463  C CE1   . HIS C 2 68  ? 79.741  -54.335  11.427  1.00 85.75  ? 68  HIS C CE1   1 
ATOM   6464  N NE2   . HIS C 2 68  ? 79.783  -53.101  10.957  1.00 85.14  ? 68  HIS C NE2   1 
ATOM   6465  N N     . LEU C 2 69  ? 76.216  -52.973  13.206  1.00 84.18  ? 69  LEU C N     1 
ATOM   6466  C CA    . LEU C 2 69  ? 75.258  -52.490  12.212  1.00 83.52  ? 69  LEU C CA    1 
ATOM   6467  C C     . LEU C 2 69  ? 73.998  -51.809  12.786  1.00 83.78  ? 69  LEU C C     1 
ATOM   6468  O O     . LEU C 2 69  ? 73.627  -50.733  12.310  1.00 83.24  ? 69  LEU C O     1 
ATOM   6469  C CB    . LEU C 2 69  ? 74.894  -53.598  11.220  1.00 83.34  ? 69  LEU C CB    1 
ATOM   6470  C CG    . LEU C 2 69  ? 76.047  -54.110  10.355  1.00 82.99  ? 69  LEU C CG    1 
ATOM   6471  C CD1   . LEU C 2 69  ? 75.625  -55.357  9.602   1.00 83.86  ? 69  LEU C CD1   1 
ATOM   6472  C CD2   . LEU C 2 69  ? 76.522  -53.045  9.388   1.00 81.67  ? 69  LEU C CD2   1 
ATOM   6473  N N     . PRO C 2 70  ? 73.336  -52.417  13.799  1.00 84.67  ? 70  PRO C N     1 
ATOM   6474  C CA    . PRO C 2 70  ? 72.209  -51.679  14.379  1.00 85.15  ? 70  PRO C CA    1 
ATOM   6475  C C     . PRO C 2 70  ? 72.601  -50.274  14.843  1.00 85.27  ? 70  PRO C C     1 
ATOM   6476  O O     . PRO C 2 70  ? 71.917  -49.312  14.496  1.00 85.21  ? 70  PRO C O     1 
ATOM   6477  C CB    . PRO C 2 70  ? 71.781  -52.555  15.563  1.00 86.27  ? 70  PRO C CB    1 
ATOM   6478  C CG    . PRO C 2 70  ? 72.145  -53.924  15.143  1.00 86.28  ? 70  PRO C CG    1 
ATOM   6479  C CD    . PRO C 2 70  ? 73.427  -53.782  14.354  1.00 85.46  ? 70  PRO C CD    1 
ATOM   6480  N N     . LEU C 2 71  ? 73.697  -50.160  15.596  1.00 85.75  ? 71  LEU C N     1 
ATOM   6481  C CA    . LEU C 2 71  ? 74.213  -48.854  16.027  1.00 86.10  ? 71  LEU C CA    1 
ATOM   6482  C C     . LEU C 2 71  ? 74.528  -47.916  14.854  1.00 85.07  ? 71  LEU C C     1 
ATOM   6483  O O     . LEU C 2 71  ? 74.155  -46.745  14.873  1.00 85.01  ? 71  LEU C O     1 
ATOM   6484  C CB    . LEU C 2 71  ? 75.465  -49.011  16.896  1.00 87.02  ? 71  LEU C CB    1 
ATOM   6485  C CG    . LEU C 2 71  ? 75.386  -49.665  18.277  1.00 89.08  ? 71  LEU C CG    1 
ATOM   6486  C CD1   . LEU C 2 71  ? 76.745  -49.535  18.952  1.00 90.78  ? 71  LEU C CD1   1 
ATOM   6487  C CD2   . LEU C 2 71  ? 74.284  -49.061  19.162  1.00 90.07  ? 71  LEU C CD2   1 
ATOM   6488  N N     . LEU C 2 72  ? 75.217  -48.436  13.841  1.00 84.27  ? 72  LEU C N     1 
ATOM   6489  C CA    . LEU C 2 72  ? 75.605  -47.630  12.686  1.00 83.64  ? 72  LEU C CA    1 
ATOM   6490  C C     . LEU C 2 72  ? 74.414  -47.153  11.878  1.00 83.10  ? 72  LEU C C     1 
ATOM   6491  O O     . LEU C 2 72  ? 74.400  -46.008  11.416  1.00 83.18  ? 72  LEU C O     1 
ATOM   6492  C CB    . LEU C 2 72  ? 76.565  -48.388  11.762  1.00 83.41  ? 72  LEU C CB    1 
ATOM   6493  C CG    . LEU C 2 72  ? 78.027  -47.904  11.682  1.00 84.00  ? 72  LEU C CG    1 
ATOM   6494  C CD1   . LEU C 2 72  ? 78.831  -48.853  10.814  1.00 83.86  ? 72  LEU C CD1   1 
ATOM   6495  C CD2   . LEU C 2 72  ? 78.133  -46.481  11.145  1.00 85.13  ? 72  LEU C CD2   1 
ATOM   6496  N N     . CYS C 2 73  ? 73.431  -48.042  11.708  1.00 82.56  ? 73  CYS C N     1 
ATOM   6497  C CA    . CYS C 2 73  ? 72.230  -47.778  10.902  1.00 81.85  ? 73  CYS C CA    1 
ATOM   6498  C C     . CYS C 2 73  ? 71.329  -46.710  11.509  1.00 81.97  ? 73  CYS C C     1 
ATOM   6499  O O     . CYS C 2 73  ? 70.634  -45.988  10.790  1.00 81.81  ? 73  CYS C O     1 
ATOM   6500  C CB    . CYS C 2 73  ? 71.420  -49.062  10.709  1.00 81.82  ? 73  CYS C CB    1 
ATOM   6501  S SG    . CYS C 2 73  ? 71.912  -50.090  9.316   1.00 81.26  ? 73  CYS C SG    1 
ATOM   6502  N N     . ASP C 2 74  ? 71.340  -46.628  12.837  1.00 82.13  ? 74  ASP C N     1 
ATOM   6503  C CA    . ASP C 2 74  ? 70.502  -45.677  13.564  1.00 82.44  ? 74  ASP C CA    1 
ATOM   6504  C C     . ASP C 2 74  ? 71.091  -44.267  13.532  1.00 82.26  ? 74  ASP C C     1 
ATOM   6505  O O     . ASP C 2 74  ? 70.346  -43.290  13.527  1.00 82.78  ? 74  ASP C O     1 
ATOM   6506  C CB    . ASP C 2 74  ? 70.265  -46.149  15.014  1.00 83.28  ? 74  ASP C CB    1 
ATOM   6507  C CG    . ASP C 2 74  ? 69.106  -47.175  15.145  1.00 83.21  ? 74  ASP C CG    1 
ATOM   6508  O OD1   . ASP C 2 74  ? 68.456  -47.557  14.137  1.00 81.38  ? 74  ASP C OD1   1 
ATOM   6509  O OD2   . ASP C 2 74  ? 68.846  -47.595  16.290  1.00 83.68  ? 74  ASP C OD2   1 
ATOM   6510  N N     . GLU C 2 75  ? 72.424  -44.182  13.511  1.00 81.73  ? 75  GLU C N     1 
ATOM   6511  C CA    . GLU C 2 75  ? 73.157  -42.918  13.394  1.00 81.48  ? 75  GLU C CA    1 
ATOM   6512  C C     . GLU C 2 75  ? 72.877  -42.278  12.046  1.00 81.01  ? 75  GLU C C     1 
ATOM   6513  O O     . GLU C 2 75  ? 72.623  -41.080  11.966  1.00 81.81  ? 75  GLU C O     1 
ATOM   6514  C CB    . GLU C 2 75  ? 74.666  -43.147  13.520  1.00 81.32  ? 75  GLU C CB    1 
ATOM   6515  C CG    . GLU C 2 75  ? 75.183  -43.457  14.912  1.00 81.75  ? 75  GLU C CG    1 
ATOM   6516  C CD    . GLU C 2 75  ? 76.652  -43.915  14.925  1.00 81.94  ? 75  GLU C CD    1 
ATOM   6517  O OE1   . GLU C 2 75  ? 77.223  -44.247  13.856  1.00 80.93  ? 75  GLU C OE1   1 
ATOM   6518  O OE2   . GLU C 2 75  ? 77.241  -43.951  16.025  1.00 82.36  ? 75  GLU C OE2   1 
ATOM   6519  N N     . LYS C 2 76  ? 72.938  -43.088  10.993  1.00 79.88  ? 76  LYS C N     1 
ATOM   6520  C CA    . LYS C 2 76  ? 72.739  -42.626  9.623   1.00 79.64  ? 76  LYS C CA    1 
ATOM   6521  C C     . LYS C 2 76  ? 71.281  -42.781  9.190   1.00 79.66  ? 76  LYS C C     1 
ATOM   6522  O O     . LYS C 2 76  ? 70.925  -42.492  8.044   1.00 79.84  ? 76  LYS C O     1 
ATOM   6523  C CB    . LYS C 2 76  ? 73.674  -43.378  8.673   1.00 78.98  ? 76  LYS C CB    1 
ATOM   6524  C CG    . LYS C 2 76  ? 75.144  -43.057  8.872   1.00 79.40  ? 76  LYS C CG    1 
ATOM   6525  C CD    . LYS C 2 76  ? 75.544  -41.844  8.044   1.00 81.67  ? 76  LYS C CD    1 
ATOM   6526  C CE    . LYS C 2 76  ? 76.824  -41.194  8.554   1.00 82.79  ? 76  LYS C CE    1 
ATOM   6527  N NZ    . LYS C 2 76  ? 78.039  -42.010  8.269   1.00 83.04  ? 76  LYS C NZ    1 
ATOM   6528  N N     . LYS C 2 77  ? 70.453  -43.241  10.125  1.00 79.63  ? 77  LYS C N     1 
ATOM   6529  C CA    . LYS C 2 77  ? 69.009  -43.393  9.939   1.00 79.87  ? 77  LYS C CA    1 
ATOM   6530  C C     . LYS C 2 77  ? 68.617  -44.225  8.708   1.00 79.61  ? 77  LYS C C     1 
ATOM   6531  O O     . LYS C 2 77  ? 67.680  -43.882  7.988   1.00 80.15  ? 77  LYS C O     1 
ATOM   6532  C CB    . LYS C 2 77  ? 68.308  -42.028  9.970   1.00 80.62  ? 77  LYS C CB    1 
ATOM   6533  C CG    . LYS C 2 77  ? 68.869  -41.098  11.036  1.00 81.06  ? 77  LYS C CG    1 
ATOM   6534  C CD    . LYS C 2 77  ? 67.795  -40.537  11.962  1.00 81.85  ? 77  LYS C CD    1 
ATOM   6535  C CE    . LYS C 2 77  ? 68.228  -40.627  13.440  1.00 81.81  ? 77  LYS C CE    1 
ATOM   6536  N NZ    . LYS C 2 77  ? 69.619  -40.119  13.722  1.00 80.48  ? 77  LYS C NZ    1 
ATOM   6537  N N     . ILE C 2 78  ? 69.337  -45.321  8.490   1.00 79.01  ? 78  ILE C N     1 
ATOM   6538  C CA    . ILE C 2 78  ? 69.001  -46.296  7.458   1.00 79.08  ? 78  ILE C CA    1 
ATOM   6539  C C     . ILE C 2 78  ? 68.328  -47.505  8.129   1.00 79.47  ? 78  ILE C C     1 
ATOM   6540  O O     . ILE C 2 78  ? 68.877  -48.065  9.077   1.00 79.20  ? 78  ILE C O     1 
ATOM   6541  C CB    . ILE C 2 78  ? 70.269  -46.751  6.688   1.00 78.65  ? 78  ILE C CB    1 
ATOM   6542  C CG1   . ILE C 2 78  ? 71.048  -45.536  6.171   1.00 78.71  ? 78  ILE C CG1   1 
ATOM   6543  C CG2   . ILE C 2 78  ? 69.920  -47.722  5.553   1.00 78.27  ? 78  ILE C CG2   1 
ATOM   6544  C CD1   . ILE C 2 78  ? 72.478  -45.843  5.757   1.00 78.27  ? 78  ILE C CD1   1 
ATOM   6545  N N     . PRO C 2 79  ? 67.128  -47.896  7.656   1.00 80.29  ? 79  PRO C N     1 
ATOM   6546  C CA    . PRO C 2 79  ? 66.407  -49.044  8.222   1.00 81.00  ? 79  PRO C CA    1 
ATOM   6547  C C     . PRO C 2 79  ? 67.046  -50.404  7.948   1.00 81.08  ? 79  PRO C C     1 
ATOM   6548  O O     . PRO C 2 79  ? 67.567  -50.642  6.860   1.00 80.52  ? 79  PRO C O     1 
ATOM   6549  C CB    . PRO C 2 79  ? 65.040  -48.972  7.538   1.00 81.88  ? 79  PRO C CB    1 
ATOM   6550  C CG    . PRO C 2 79  ? 65.274  -48.181  6.304   1.00 81.79  ? 79  PRO C CG    1 
ATOM   6551  C CD    . PRO C 2 79  ? 66.303  -47.169  6.678   1.00 80.80  ? 79  PRO C CD    1 
ATOM   6552  N N     . TYR C 2 80  ? 66.974  -51.281  8.945   1.00 81.94  ? 80  TYR C N     1 
ATOM   6553  C CA    . TYR C 2 80  ? 67.504  -52.634  8.852   1.00 82.92  ? 80  TYR C CA    1 
ATOM   6554  C C     . TYR C 2 80  ? 66.464  -53.696  9.228   1.00 84.73  ? 80  TYR C C     1 
ATOM   6555  O O     . TYR C 2 80  ? 65.486  -53.420  9.938   1.00 85.24  ? 80  TYR C O     1 
ATOM   6556  C CB    . TYR C 2 80  ? 68.770  -52.793  9.703   1.00 82.49  ? 80  TYR C CB    1 
ATOM   6557  C CG    . TYR C 2 80  ? 68.587  -52.497  11.175  1.00 82.93  ? 80  TYR C CG    1 
ATOM   6558  C CD1   . TYR C 2 80  ? 68.516  -53.523  12.112  1.00 83.88  ? 80  TYR C CD1   1 
ATOM   6559  C CD2   . TYR C 2 80  ? 68.493  -51.186  11.630  1.00 83.38  ? 80  TYR C CD2   1 
ATOM   6560  C CE1   . TYR C 2 80  ? 68.346  -53.240  13.472  1.00 85.34  ? 80  TYR C CE1   1 
ATOM   6561  C CE2   . TYR C 2 80  ? 68.326  -50.894  12.978  1.00 84.55  ? 80  TYR C CE2   1 
ATOM   6562  C CZ    . TYR C 2 80  ? 68.253  -51.917  13.892  1.00 85.20  ? 80  TYR C CZ    1 
ATOM   6563  O OH    . TYR C 2 80  ? 68.084  -51.599  15.219  1.00 86.23  ? 80  TYR C OH    1 
ATOM   6564  N N     . VAL C 2 81  ? 66.696  -54.913  8.733   1.00 86.17  ? 81  VAL C N     1 
ATOM   6565  C CA    . VAL C 2 81  ? 65.777  -56.049  8.873   1.00 88.05  ? 81  VAL C CA    1 
ATOM   6566  C C     . VAL C 2 81  ? 66.578  -57.330  9.072   1.00 88.80  ? 81  VAL C C     1 
ATOM   6567  O O     . VAL C 2 81  ? 67.729  -57.423  8.652   1.00 88.37  ? 81  VAL C O     1 
ATOM   6568  C CB    . VAL C 2 81  ? 64.886  -56.232  7.604   1.00 88.72  ? 81  VAL C CB    1 
ATOM   6569  C CG1   . VAL C 2 81  ? 63.977  -57.443  7.745   1.00 90.47  ? 81  VAL C CG1   1 
ATOM   6570  C CG2   . VAL C 2 81  ? 64.040  -54.996  7.335   1.00 88.95  ? 81  VAL C CG2   1 
ATOM   6571  N N     . TYR C 2 82  ? 65.952  -58.321  9.695   1.00 90.60  ? 82  TYR C N     1 
ATOM   6572  C CA    . TYR C 2 82  ? 66.579  -59.620  9.909   1.00 91.95  ? 82  TYR C CA    1 
ATOM   6573  C C     . TYR C 2 82  ? 65.990  -60.748  9.048   1.00 93.58  ? 82  TYR C C     1 
ATOM   6574  O O     . TYR C 2 82  ? 64.816  -60.725  8.670   1.00 94.32  ? 82  TYR C O     1 
ATOM   6575  C CB    . TYR C 2 82  ? 66.485  -60.007  11.383  1.00 92.70  ? 82  TYR C CB    1 
ATOM   6576  C CG    . TYR C 2 82  ? 67.055  -58.988  12.336  1.00 91.78  ? 82  TYR C CG    1 
ATOM   6577  C CD1   . TYR C 2 82  ? 66.221  -58.113  13.034  1.00 91.54  ? 82  TYR C CD1   1 
ATOM   6578  C CD2   . TYR C 2 82  ? 68.428  -58.907  12.549  1.00 91.43  ? 82  TYR C CD2   1 
ATOM   6579  C CE1   . TYR C 2 82  ? 66.746  -57.180  13.921  1.00 91.40  ? 82  TYR C CE1   1 
ATOM   6580  C CE2   . TYR C 2 82  ? 68.964  -57.980  13.430  1.00 91.26  ? 82  TYR C CE2   1 
ATOM   6581  C CZ    . TYR C 2 82  ? 68.122  -57.122  14.113  1.00 91.30  ? 82  TYR C CZ    1 
ATOM   6582  O OH    . TYR C 2 82  ? 68.667  -56.211  14.986  1.00 91.42  ? 82  TYR C OH    1 
ATOM   6583  N N     . VAL C 2 83  ? 66.832  -61.722  8.726   1.00 94.57  ? 83  VAL C N     1 
ATOM   6584  C CA    . VAL C 2 83  ? 66.385  -62.997  8.170   1.00 96.62  ? 83  VAL C CA    1 
ATOM   6585  C C     . VAL C 2 83  ? 66.980  -64.100  9.047   1.00 98.20  ? 83  VAL C C     1 
ATOM   6586  O O     . VAL C 2 83  ? 67.954  -63.866  9.766   1.00 97.68  ? 83  VAL C O     1 
ATOM   6587  C CB    . VAL C 2 83  ? 66.766  -63.178  6.671   1.00 96.51  ? 83  VAL C CB    1 
ATOM   6588  C CG1   . VAL C 2 83  ? 66.029  -62.165  5.794   1.00 95.64  ? 83  VAL C CG1   1 
ATOM   6589  C CG2   . VAL C 2 83  ? 68.272  -63.087  6.461   1.00 95.64  ? 83  VAL C CG2   1 
ATOM   6590  N N     . SER C 2 84  ? 66.391  -65.288  9.012   1.00 100.61 ? 84  SER C N     1 
ATOM   6591  C CA    . SER C 2 84  ? 66.796  -66.341  9.941   1.00 102.53 ? 84  SER C CA    1 
ATOM   6592  C C     . SER C 2 84  ? 68.053  -67.085  9.506   1.00 103.14 ? 84  SER C C     1 
ATOM   6593  O O     . SER C 2 84  ? 68.875  -67.450  10.345  1.00 103.56 ? 84  SER C O     1 
ATOM   6594  C CB    . SER C 2 84  ? 65.646  -67.315  10.212  1.00 104.64 ? 84  SER C CB    1 
ATOM   6595  O OG    . SER C 2 84  ? 65.017  -67.712  9.006   1.00 106.04 ? 84  SER C OG    1 
ATOM   6596  N N     . SER C 2 85  ? 68.208  -67.311  8.206   1.00 103.54 ? 85  SER C N     1 
ATOM   6597  C CA    . SER C 2 85  ? 69.360  -68.059  7.724   1.00 104.53 ? 85  SER C CA    1 
ATOM   6598  C C     . SER C 2 85  ? 70.332  -67.223  6.914   1.00 103.23 ? 85  SER C C     1 
ATOM   6599  O O     . SER C 2 85  ? 69.934  -66.489  6.004   1.00 102.47 ? 85  SER C O     1 
ATOM   6600  C CB    . SER C 2 85  ? 68.929  -69.254  6.894   1.00 106.61 ? 85  SER C CB    1 
ATOM   6601  O OG    . SER C 2 85  ? 70.079  -69.872  6.343   1.00 107.44 ? 85  SER C OG    1 
ATOM   6602  N N     . LYS C 2 86  ? 71.614  -67.366  7.240   1.00 103.37 ? 86  LYS C N     1 
ATOM   6603  C CA    . LYS C 2 86  ? 72.680  -66.666  6.528   1.00 102.28 ? 86  LYS C CA    1 
ATOM   6604  C C     . LYS C 2 86  ? 72.952  -67.325  5.174   1.00 103.42 ? 86  LYS C C     1 
ATOM   6605  O O     . LYS C 2 86  ? 73.267  -66.650  4.184   1.00 102.34 ? 86  LYS C O     1 
ATOM   6606  C CB    . LYS C 2 86  ? 73.952  -66.572  7.390   1.00 101.91 ? 86  LYS C CB    1 
ATOM   6607  C CG    . LYS C 2 86  ? 74.638  -67.887  7.740   1.00 103.58 ? 86  LYS C CG    1 
ATOM   6608  C CD    . LYS C 2 86  ? 75.903  -67.624  8.536   1.00 103.28 ? 86  LYS C CD    1 
ATOM   6609  C CE    . LYS C 2 86  ? 76.974  -68.665  8.264   1.00 105.22 ? 86  LYS C CE    1 
ATOM   6610  N NZ    . LYS C 2 86  ? 76.766  -69.929  9.022   1.00 108.36 ? 86  LYS C NZ    1 
ATOM   6611  N N     . LYS C 2 87  ? 72.803  -68.648  5.148   1.00 105.84 ? 87  LYS C N     1 
ATOM   6612  C CA    . LYS C 2 87  ? 72.957  -69.438  3.932   1.00 107.60 ? 87  LYS C CA    1 
ATOM   6613  C C     . LYS C 2 87  ? 71.873  -69.039  2.927   1.00 107.65 ? 87  LYS C C     1 
ATOM   6614  O O     . LYS C 2 87  ? 72.139  -68.925  1.732   1.00 107.79 ? 87  LYS C O     1 
ATOM   6615  C CB    . LYS C 2 87  ? 72.886  -70.935  4.260   1.00 110.00 ? 87  LYS C CB    1 
ATOM   6616  C CG    . LYS C 2 87  ? 73.871  -71.805  3.479   1.00 111.65 ? 87  LYS C CG    1 
ATOM   6617  C CD    . LYS C 2 87  ? 73.834  -73.275  3.936   1.00 114.80 ? 87  LYS C CD    1 
ATOM   6618  C CE    . LYS C 2 87  ? 74.620  -73.525  5.232   1.00 114.93 ? 87  LYS C CE    1 
ATOM   6619  N NZ    . LYS C 2 87  ? 76.097  -73.553  5.022   1.00 114.81 ? 87  LYS C NZ    1 
ATOM   6620  N N     . ALA C 2 88  ? 70.664  -68.797  3.436   1.00 107.71 ? 88  ALA C N     1 
ATOM   6621  C CA    . ALA C 2 88  ? 69.525  -68.374  2.622   1.00 107.91 ? 88  ALA C CA    1 
ATOM   6622  C C     . ALA C 2 88  ? 69.700  -66.978  2.022   1.00 106.14 ? 88  ALA C C     1 
ATOM   6623  O O     . ALA C 2 88  ? 69.309  -66.746  0.878   1.00 106.44 ? 88  ALA C O     1 
ATOM   6624  C CB    . ALA C 2 88  ? 68.236  -68.449  3.435   1.00 108.37 ? 88  ALA C CB    1 
ATOM   6625  N N     . LEU C 2 89  ? 70.283  -66.060  2.796   1.00 104.61 ? 89  LEU C N     1 
ATOM   6626  C CA    . LEU C 2 89  ? 70.516  -64.687  2.342   1.00 102.97 ? 89  LEU C CA    1 
ATOM   6627  C C     . LEU C 2 89  ? 71.643  -64.610  1.313   1.00 103.03 ? 89  LEU C C     1 
ATOM   6628  O O     . LEU C 2 89  ? 71.531  -63.896  0.319   1.00 102.48 ? 89  LEU C O     1 
ATOM   6629  C CB    . LEU C 2 89  ? 70.790  -63.757  3.532   1.00 101.37 ? 89  LEU C CB    1 
ATOM   6630  C CG    . LEU C 2 89  ? 71.052  -62.256  3.292   1.00 99.73  ? 89  LEU C CG    1 
ATOM   6631  C CD1   . LEU C 2 89  ? 69.919  -61.557  2.547   1.00 99.44  ? 89  LEU C CD1   1 
ATOM   6632  C CD2   . LEU C 2 89  ? 71.347  -61.533  4.604   1.00 98.46  ? 89  LEU C CD2   1 
ATOM   6633  N N     . GLY C 2 90  ? 72.720  -65.351  1.553   1.00 103.86 ? 90  GLY C N     1 
ATOM   6634  C CA    . GLY C 2 90  ? 73.831  -65.413  0.611   1.00 104.68 ? 90  GLY C CA    1 
ATOM   6635  C C     . GLY C 2 90  ? 73.407  -66.032  -0.700  1.00 106.79 ? 90  GLY C C     1 
ATOM   6636  O O     . GLY C 2 90  ? 73.756  -65.535  -1.770  1.00 106.58 ? 90  GLY C O     1 
ATOM   6637  N N     . GLU C 2 91  ? 72.645  -67.122  -0.605  1.00 109.22 ? 91  GLU C N     1 
ATOM   6638  C CA    . GLU C 2 91  ? 72.143  -67.845  -1.781  1.00 111.79 ? 91  GLU C CA    1 
ATOM   6639  C C     . GLU C 2 91  ? 71.043  -67.074  -2.507  1.00 111.63 ? 91  GLU C C     1 
ATOM   6640  O O     . GLU C 2 91  ? 70.795  -67.307  -3.694  1.00 113.08 ? 91  GLU C O     1 
ATOM   6641  C CB    . GLU C 2 91  ? 71.694  -69.270  -1.422  1.00 114.15 ? 91  GLU C CB    1 
ATOM   6642  C CG    . GLU C 2 91  ? 72.871  -70.239  -1.203  1.00 116.07 ? 91  GLU C CG    1 
ATOM   6643  C CD    . GLU C 2 91  ? 72.441  -71.654  -0.832  1.00 119.35 ? 91  GLU C CD    1 
ATOM   6644  O OE1   . GLU C 2 91  ? 71.630  -72.263  -1.572  1.00 120.71 ? 91  GLU C OE1   1 
ATOM   6645  O OE2   . GLU C 2 91  ? 72.940  -72.160  0.198   1.00 120.27 ? 91  GLU C OE2   1 
ATOM   6646  N N     . ALA C 2 92  ? 70.389  -66.164  -1.790  1.00 110.18 ? 92  ALA C N     1 
ATOM   6647  C CA    . ALA C 2 92  ? 69.563  -65.159  -2.433  1.00 109.64 ? 92  ALA C CA    1 
ATOM   6648  C C     . ALA C 2 92  ? 70.489  -64.245  -3.220  1.00 108.59 ? 92  ALA C C     1 
ATOM   6649  O O     . ALA C 2 92  ? 70.279  -64.030  -4.409  1.00 109.31 ? 92  ALA C O     1 
ATOM   6650  C CB    . ALA C 2 92  ? 68.755  -64.368  -1.409  1.00 108.34 ? 92  ALA C CB    1 
ATOM   6651  N N     . CYS C 2 93  ? 71.540  -63.758  -2.559  1.00 107.23 ? 93  CYS C N     1 
ATOM   6652  C CA    . CYS C 2 93  ? 72.443  -62.726  -3.109  1.00 106.37 ? 93  CYS C CA    1 
ATOM   6653  C C     . CYS C 2 93  ? 73.100  -63.021  -4.464  1.00 107.59 ? 93  CYS C C     1 
ATOM   6654  O O     . CYS C 2 93  ? 73.714  -62.131  -5.073  1.00 107.00 ? 93  CYS C O     1 
ATOM   6655  C CB    . CYS C 2 93  ? 73.505  -62.330  -2.082  1.00 104.82 ? 93  CYS C CB    1 
ATOM   6656  S SG    . CYS C 2 93  ? 72.864  -61.260  -0.810  1.00 103.49 ? 93  CYS C SG    1 
ATOM   6657  N N     . GLY C 2 94  ? 72.946  -64.254  -4.937  1.00 109.36 ? 94  GLY C N     1 
ATOM   6658  C CA    . GLY C 2 94  ? 73.592  -64.687  -6.163  1.00 110.76 ? 94  GLY C CA    1 
ATOM   6659  C C     . GLY C 2 94  ? 74.935  -65.304  -5.847  1.00 110.86 ? 94  GLY C C     1 
ATOM   6660  O O     . GLY C 2 94  ? 75.811  -65.368  -6.705  1.00 111.62 ? 94  GLY C O     1 
ATOM   6661  N N     . LEU C 2 95  ? 75.095  -65.746  -4.604  1.00 110.32 ? 95  LEU C N     1 
ATOM   6662  C CA    . LEU C 2 95  ? 76.292  -66.460  -4.177  1.00 110.91 ? 95  LEU C CA    1 
ATOM   6663  C C     . LEU C 2 95  ? 75.944  -67.910  -3.882  1.00 112.90 ? 95  LEU C C     1 
ATOM   6664  O O     . LEU C 2 95  ? 74.791  -68.227  -3.603  1.00 113.60 ? 95  LEU C O     1 
ATOM   6665  C CB    . LEU C 2 95  ? 76.885  -65.819  -2.918  1.00 109.05 ? 95  LEU C CB    1 
ATOM   6666  C CG    . LEU C 2 95  ? 77.242  -64.332  -2.902  1.00 107.00 ? 95  LEU C CG    1 
ATOM   6667  C CD1   . LEU C 2 95  ? 77.769  -63.954  -1.533  1.00 105.45 ? 95  LEU C CD1   1 
ATOM   6668  C CD2   . LEU C 2 95  ? 78.260  -63.984  -3.974  1.00 107.28 ? 95  LEU C CD2   1 
ATOM   6669  N N     . GLN C 2 96  ? 76.934  -68.793  -3.938  1.00 114.13 ? 96  GLN C N     1 
ATOM   6670  C CA    . GLN C 2 96  ? 76.716  -70.168  -3.503  1.00 116.05 ? 96  GLN C CA    1 
ATOM   6671  C C     . GLN C 2 96  ? 77.242  -70.423  -2.087  1.00 115.47 ? 96  GLN C C     1 
ATOM   6672  O O     . GLN C 2 96  ? 77.229  -71.554  -1.603  1.00 117.10 ? 96  GLN C O     1 
ATOM   6673  C CB    . GLN C 2 96  ? 77.283  -71.160  -4.518  1.00 118.49 ? 96  GLN C CB    1 
ATOM   6674  C CG    . GLN C 2 96  ? 76.312  -71.468  -5.651  1.00 120.13 ? 96  GLN C CG    1 
ATOM   6675  C CD    . GLN C 2 96  ? 76.946  -72.265  -6.773  1.00 122.67 ? 96  GLN C CD    1 
ATOM   6676  O OE1   . GLN C 2 96  ? 77.970  -71.871  -7.333  1.00 122.32 ? 96  GLN C OE1   1 
ATOM   6677  N NE2   . GLN C 2 96  ? 76.331  -73.388  -7.118  1.00 125.44 ? 96  GLN C NE2   1 
ATOM   6678  N N     . VAL C 2 97  ? 77.689  -69.353  -1.431  1.00 113.44 ? 97  VAL C N     1 
ATOM   6679  C CA    . VAL C 2 97  ? 78.149  -69.408  -0.038  1.00 112.73 ? 97  VAL C CA    1 
ATOM   6680  C C     . VAL C 2 97  ? 77.293  -68.476  0.825   1.00 110.80 ? 97  VAL C C     1 
ATOM   6681  O O     . VAL C 2 97  ? 76.550  -67.641  0.301   1.00 109.74 ? 97  VAL C O     1 
ATOM   6682  C CB    . VAL C 2 97  ? 79.649  -69.021  0.117   1.00 112.14 ? 97  VAL C CB    1 
ATOM   6683  C CG1   . VAL C 2 97  ? 80.353  -70.016  1.031   1.00 113.53 ? 97  VAL C CG1   1 
ATOM   6684  C CG2   . VAL C 2 97  ? 80.358  -68.956  -1.233  1.00 112.60 ? 97  VAL C CG2   1 
ATOM   6685  N N     . ALA C 2 98  ? 77.404  -68.624  2.144   1.00 110.49 ? 98  ALA C N     1 
ATOM   6686  C CA    . ALA C 2 98  ? 76.637  -67.822  3.100   1.00 109.14 ? 98  ALA C CA    1 
ATOM   6687  C C     . ALA C 2 98  ? 76.978  -66.328  3.057   1.00 107.01 ? 98  ALA C C     1 
ATOM   6688  O O     . ALA C 2 98  ? 77.997  -65.932  2.491   1.00 106.69 ? 98  ALA C O     1 
ATOM   6689  C CB    . ALA C 2 98  ? 76.844  -68.367  4.512   1.00 109.74 ? 98  ALA C CB    1 
ATOM   6690  N N     . THR C 2 99  ? 76.106  -65.505  3.638   1.00 105.83 ? 99  THR C N     1 
ATOM   6691  C CA    . THR C 2 99  ? 76.421  -64.097  3.923   1.00 103.98 ? 99  THR C CA    1 
ATOM   6692  C C     . THR C 2 99  ? 75.757  -63.631  5.222   1.00 103.30 ? 99  THR C C     1 
ATOM   6693  O O     . THR C 2 99  ? 74.580  -63.909  5.461   1.00 103.64 ? 99  THR C O     1 
ATOM   6694  C CB    . THR C 2 99  ? 76.088  -63.133  2.746   1.00 103.10 ? 99  THR C CB    1 
ATOM   6695  O OG1   . THR C 2 99  ? 76.827  -61.920  2.907   1.00 101.91 ? 99  THR C OG1   1 
ATOM   6696  C CG2   . THR C 2 99  ? 74.617  -62.786  2.691   1.00 102.86 ? 99  THR C CG2   1 
ATOM   6697  N N     . ALA C 2 100 ? 76.521  -62.929  6.057   1.00 102.50 ? 100 ALA C N     1 
ATOM   6698  C CA    . ALA C 2 100 ? 76.053  -62.515  7.383   1.00 102.11 ? 100 ALA C CA    1 
ATOM   6699  C C     . ALA C 2 100 ? 75.198  -61.241  7.350   1.00 100.91 ? 100 ALA C C     1 
ATOM   6700  O O     . ALA C 2 100 ? 74.351  -61.031  8.224   1.00 101.05 ? 100 ALA C O     1 
ATOM   6701  C CB    . ALA C 2 100 ? 77.231  -62.357  8.338   1.00 102.09 ? 100 ALA C CB    1 
ATOM   6702  N N     . SER C 2 101 ? 75.427  -60.396  6.346   1.00 99.90  ? 101 SER C N     1 
ATOM   6703  C CA    . SER C 2 101 ? 74.615  -59.203  6.137   1.00 98.85  ? 101 SER C CA    1 
ATOM   6704  C C     . SER C 2 101 ? 74.733  -58.692  4.700   1.00 98.62  ? 101 SER C C     1 
ATOM   6705  O O     . SER C 2 101 ? 75.737  -58.932  4.023   1.00 98.78  ? 101 SER C O     1 
ATOM   6706  C CB    . SER C 2 101 ? 74.990  -58.105  7.141   1.00 98.04  ? 101 SER C CB    1 
ATOM   6707  O OG    . SER C 2 101 ? 76.360  -57.761  7.052   1.00 97.78  ? 101 SER C OG    1 
ATOM   6708  N N     . ALA C 2 102 ? 73.696  -57.996  4.238   1.00 98.33  ? 102 ALA C N     1 
ATOM   6709  C CA    . ALA C 2 102 ? 73.697  -57.388  2.910   1.00 98.28  ? 102 ALA C CA    1 
ATOM   6710  C C     . ALA C 2 102 ? 72.979  -56.043  2.920   1.00 97.79  ? 102 ALA C C     1 
ATOM   6711  O O     . ALA C 2 102 ? 72.335  -55.677  3.905   1.00 97.37  ? 102 ALA C O     1 
ATOM   6712  C CB    . ALA C 2 102 ? 73.069  -58.325  1.896   1.00 99.31  ? 102 ALA C CB    1 
ATOM   6713  N N     . ALA C 2 103 ? 73.093  -55.312  1.819   1.00 98.09  ? 103 ALA C N     1 
ATOM   6714  C CA    . ALA C 2 103 ? 72.456  -54.014  1.703   1.00 98.25  ? 103 ALA C CA    1 
ATOM   6715  C C     . ALA C 2 103 ? 71.863  -53.811  0.313   1.00 99.52  ? 103 ALA C C     1 
ATOM   6716  O O     . ALA C 2 103 ? 72.433  -54.267  -0.682  1.00 100.13 ? 103 ALA C O     1 
ATOM   6717  C CB    . ALA C 2 103 ? 73.458  -52.929  2.009   1.00 97.47  ? 103 ALA C CB    1 
ATOM   6718  N N     . ILE C 2 104 ? 70.715  -53.136  0.252   1.00 100.33 ? 104 ILE C N     1 
ATOM   6719  C CA    . ILE C 2 104 ? 70.143  -52.693  -1.022  1.00 101.81 ? 104 ILE C CA    1 
ATOM   6720  C C     . ILE C 2 104 ? 70.435  -51.206  -1.215  1.00 102.03 ? 104 ILE C C     1 
ATOM   6721  O O     . ILE C 2 104 ? 70.008  -50.373  -0.406  1.00 101.70 ? 104 ILE C O     1 
ATOM   6722  C CB    . ILE C 2 104 ? 68.614  -52.939  -1.115  1.00 102.53 ? 104 ILE C CB    1 
ATOM   6723  C CG1   . ILE C 2 104 ? 68.297  -54.433  -1.006  1.00 103.23 ? 104 ILE C CG1   1 
ATOM   6724  C CG2   . ILE C 2 104 ? 68.053  -52.370  -2.426  1.00 103.37 ? 104 ILE C CG2   1 
ATOM   6725  C CD1   . ILE C 2 104 ? 66.840  -54.739  -0.704  1.00 103.87 ? 104 ILE C CD1   1 
ATOM   6726  N N     . LEU C 2 105 ? 71.161  -50.883  -2.284  1.00 102.97 ? 105 LEU C N     1 
ATOM   6727  C CA    . LEU C 2 105 ? 71.517  -49.496  -2.581  1.00 103.57 ? 105 LEU C CA    1 
ATOM   6728  C C     . LEU C 2 105 ? 70.501  -48.837  -3.515  1.00 105.08 ? 105 LEU C C     1 
ATOM   6729  O O     . LEU C 2 105 ? 70.114  -47.685  -3.312  1.00 104.98 ? 105 LEU C O     1 
ATOM   6730  C CB    . LEU C 2 105 ? 72.933  -49.397  -3.174  1.00 103.71 ? 105 LEU C CB    1 
ATOM   6731  C CG    . LEU C 2 105 ? 74.169  -50.064  -2.542  1.00 103.04 ? 105 LEU C CG    1 
ATOM   6732  C CD1   . LEU C 2 105 ? 75.427  -49.399  -3.090  1.00 103.12 ? 105 LEU C CD1   1 
ATOM   6733  C CD2   . LEU C 2 105 ? 74.178  -50.028  -1.016  1.00 101.96 ? 105 LEU C CD2   1 
ATOM   6734  N N     . GLU C 2 106 ? 70.096  -49.575  -4.546  1.00 106.81 ? 106 GLU C N     1 
ATOM   6735  C CA    . GLU C 2 106 ? 69.060  -49.137  -5.478  1.00 108.87 ? 106 GLU C CA    1 
ATOM   6736  C C     . GLU C 2 106 ? 68.075  -50.281  -5.681  1.00 109.99 ? 106 GLU C C     1 
ATOM   6737  O O     . GLU C 2 106 ? 68.468  -51.362  -6.129  1.00 110.56 ? 106 GLU C O     1 
ATOM   6738  C CB    . GLU C 2 106 ? 69.665  -48.704  -6.814  1.00 109.92 ? 106 GLU C CB    1 
ATOM   6739  C CG    . GLU C 2 106 ? 70.231  -47.303  -6.800  1.00 110.27 ? 106 GLU C CG    1 
ATOM   6740  C CD    . GLU C 2 106 ? 71.343  -47.106  -7.817  1.00 112.05 ? 106 GLU C CD    1 
ATOM   6741  O OE1   . GLU C 2 106 ? 71.289  -47.712  -8.909  1.00 113.52 ? 106 GLU C OE1   1 
ATOM   6742  O OE2   . GLU C 2 106 ? 72.278  -46.332  -7.524  1.00 112.32 ? 106 GLU C OE2   1 
ATOM   6743  N N     . PRO C 2 107 ? 66.793  -50.049  -5.347  1.00 110.69 ? 107 PRO C N     1 
ATOM   6744  C CA    . PRO C 2 107 ? 65.827  -51.137  -5.337  1.00 111.78 ? 107 PRO C CA    1 
ATOM   6745  C C     . PRO C 2 107 ? 65.502  -51.634  -6.742  1.00 114.10 ? 107 PRO C C     1 
ATOM   6746  O O     . PRO C 2 107 ? 65.349  -52.843  -6.945  1.00 114.77 ? 107 PRO C O     1 
ATOM   6747  C CB    . PRO C 2 107 ? 64.589  -50.507  -4.680  1.00 111.93 ? 107 PRO C CB    1 
ATOM   6748  C CG    . PRO C 2 107 ? 65.043  -49.178  -4.131  1.00 110.80 ? 107 PRO C CG    1 
ATOM   6749  C CD    . PRO C 2 107 ? 66.166  -48.762  -5.005  1.00 110.69 ? 107 PRO C CD    1 
ATOM   6750  N N     . GLY C 2 108 ? 65.422  -50.707  -7.697  1.00 115.63 ? 108 GLY C N     1 
ATOM   6751  C CA    . GLY C 2 108 ? 65.010  -51.022  -9.065  1.00 118.28 ? 108 GLY C CA    1 
ATOM   6752  C C     . GLY C 2 108 ? 63.574  -51.509  -9.102  1.00 119.96 ? 108 GLY C C     1 
ATOM   6753  O O     . GLY C 2 108 ? 62.663  -50.812  -8.643  1.00 120.02 ? 108 GLY C O     1 
ATOM   6754  N N     . GLU C 2 109 ? 63.381  -52.717  -9.632  1.00 121.57 ? 109 GLU C N     1 
ATOM   6755  C CA    . GLU C 2 109 ? 62.060  -53.358  -9.703  1.00 123.54 ? 109 GLU C CA    1 
ATOM   6756  C C     . GLU C 2 109 ? 61.691  -54.069  -8.394  1.00 122.48 ? 109 GLU C C     1 
ATOM   6757  O O     . GLU C 2 109 ? 61.169  -55.188  -8.394  1.00 123.47 ? 109 GLU C O     1 
ATOM   6758  C CB    . GLU C 2 109 ? 61.994  -54.340  -10.878 1.00 125.76 ? 109 GLU C CB    1 
ATOM   6759  C CG    . GLU C 2 109 ? 62.026  -53.697  -12.260 1.00 128.06 ? 109 GLU C CG    1 
ATOM   6760  C CD    . GLU C 2 109 ? 62.000  -54.723  -13.387 1.00 130.99 ? 109 GLU C CD    1 
ATOM   6761  O OE1   . GLU C 2 109 ? 61.680  -55.905  -13.128 1.00 131.43 ? 109 GLU C OE1   1 
ATOM   6762  O OE2   . GLU C 2 109 ? 62.299  -54.344  -14.540 1.00 132.85 ? 109 GLU C OE2   1 
ATOM   6763  N N     . ALA C 2 110 ? 61.979  -53.402  -7.281  1.00 120.75 ? 110 ALA C N     1 
ATOM   6764  C CA    . ALA C 2 110 ? 61.625  -53.883  -5.958  1.00 119.90 ? 110 ALA C CA    1 
ATOM   6765  C C     . ALA C 2 110 ? 61.240  -52.693  -5.089  1.00 119.12 ? 110 ALA C C     1 
ATOM   6766  O O     . ALA C 2 110 ? 61.028  -52.841  -3.889  1.00 118.16 ? 110 ALA C O     1 
ATOM   6767  C CB    . ALA C 2 110 ? 62.784  -54.654  -5.341  1.00 118.34 ? 110 ALA C CB    1 
ATOM   6768  N N     . LYS C 2 111 ? 61.145  -51.518  -5.710  1.00 120.04 ? 111 LYS C N     1 
ATOM   6769  C CA    . LYS C 2 111 ? 60.782  -50.281  -5.013  1.00 119.92 ? 111 LYS C CA    1 
ATOM   6770  C C     . LYS C 2 111 ? 59.537  -50.423  -4.146  1.00 120.49 ? 111 LYS C C     1 
ATOM   6771  O O     . LYS C 2 111 ? 59.578  -50.127  -2.948  1.00 119.48 ? 111 LYS C O     1 
ATOM   6772  C CB    . LYS C 2 111 ? 60.601  -49.122  -5.994  1.00 121.11 ? 111 LYS C CB    1 
ATOM   6773  C CG    . LYS C 2 111 ? 61.706  -48.105  -5.927  1.00 120.38 ? 111 LYS C CG    1 
ATOM   6774  C CD    . LYS C 2 111 ? 61.167  -46.716  -6.168  1.00 122.12 ? 111 LYS C CD    1 
ATOM   6775  C CE    . LYS C 2 111 ? 62.229  -45.676  -5.863  1.00 121.90 ? 111 LYS C CE    1 
ATOM   6776  N NZ    . LYS C 2 111 ? 61.807  -44.321  -6.305  1.00 123.76 ? 111 LYS C NZ    1 
ATOM   6777  N N     . ASP C 2 112 ? 58.444  -50.882  -4.758  1.00 122.50 ? 112 ASP C N     1 
ATOM   6778  C CA    . ASP C 2 112 ? 57.178  -51.107  -4.059  1.00 123.29 ? 112 ASP C CA    1 
ATOM   6779  C C     . ASP C 2 112 ? 57.326  -52.167  -2.975  1.00 122.35 ? 112 ASP C C     1 
ATOM   6780  O O     . ASP C 2 112 ? 56.764  -52.042  -1.883  1.00 121.84 ? 112 ASP C O     1 
ATOM   6781  C CB    . ASP C 2 112 ? 56.090  -51.527  -5.051  1.00 125.76 ? 112 ASP C CB    1 
ATOM   6782  C CG    . ASP C 2 112 ? 55.725  -50.422  -6.024  1.00 127.27 ? 112 ASP C CG    1 
ATOM   6783  O OD1   . ASP C 2 112 ? 55.790  -49.235  -5.640  1.00 126.78 ? 112 ASP C OD1   1 
ATOM   6784  O OD2   . ASP C 2 112 ? 55.363  -50.742  -7.175  1.00 129.33 ? 112 ASP C OD2   1 
ATOM   6785  N N     . LEU C 2 113 ? 58.097  -53.204  -3.291  1.00 122.27 ? 113 LEU C N     1 
ATOM   6786  C CA    . LEU C 2 113 ? 58.337  -54.306  -2.374  1.00 121.91 ? 113 LEU C CA    1 
ATOM   6787  C C     . LEU C 2 113 ? 59.138  -53.852  -1.152  1.00 120.00 ? 113 LEU C C     1 
ATOM   6788  O O     . LEU C 2 113 ? 58.827  -54.247  -0.029  1.00 119.72 ? 113 LEU C O     1 
ATOM   6789  C CB    . LEU C 2 113 ? 59.036  -55.458  -3.109  1.00 122.38 ? 113 LEU C CB    1 
ATOM   6790  C CG    . LEU C 2 113 ? 59.182  -56.831  -2.441  1.00 122.75 ? 113 LEU C CG    1 
ATOM   6791  C CD1   . LEU C 2 113 ? 57.889  -57.306  -1.754  1.00 124.38 ? 113 LEU C CD1   1 
ATOM   6792  C CD2   . LEU C 2 113 ? 59.658  -57.852  -3.468  1.00 123.81 ? 113 LEU C CD2   1 
ATOM   6793  N N     . VAL C 2 114 ? 60.146  -53.008  -1.382  1.00 119.08 ? 114 VAL C N     1 
ATOM   6794  C CA    . VAL C 2 114 ? 60.994  -52.452  -0.319  1.00 117.45 ? 114 VAL C CA    1 
ATOM   6795  C C     . VAL C 2 114 ? 60.247  -51.448  0.560   1.00 117.44 ? 114 VAL C C     1 
ATOM   6796  O O     . VAL C 2 114 ? 60.339  -51.497  1.788   1.00 116.61 ? 114 VAL C O     1 
ATOM   6797  C CB    . VAL C 2 114 ? 62.272  -51.798  -0.901  1.00 116.56 ? 114 VAL C CB    1 
ATOM   6798  C CG1   . VAL C 2 114 ? 62.911  -50.837  0.100   1.00 115.45 ? 114 VAL C CG1   1 
ATOM   6799  C CG2   . VAL C 2 114 ? 63.271  -52.865  -1.323  1.00 116.26 ? 114 VAL C CG2   1 
ATOM   6800  N N     . ASP C 2 115 ? 59.507  -50.543  -0.071  1.00 118.71 ? 115 ASP C N     1 
ATOM   6801  C CA    . ASP C 2 115 ? 58.745  -49.530  0.658   1.00 119.28 ? 115 ASP C CA    1 
ATOM   6802  C C     . ASP C 2 115 ? 57.705  -50.113  1.612   1.00 119.98 ? 115 ASP C C     1 
ATOM   6803  O O     . ASP C 2 115 ? 57.408  -49.510  2.644   1.00 119.72 ? 115 ASP C O     1 
ATOM   6804  C CB    . ASP C 2 115 ? 58.097  -48.539  -0.311  1.00 120.67 ? 115 ASP C CB    1 
ATOM   6805  C CG    . ASP C 2 115 ? 59.112  -47.594  -0.940  1.00 120.51 ? 115 ASP C CG    1 
ATOM   6806  O OD1   . ASP C 2 115 ? 60.057  -47.169  -0.237  1.00 119.41 ? 115 ASP C OD1   1 
ATOM   6807  O OD2   . ASP C 2 115 ? 58.966  -47.269  -2.137  1.00 121.97 ? 115 ASP C OD2   1 
ATOM   6808  N N     . GLU C 2 116 ? 57.166  -51.283  1.267   1.00 121.10 ? 116 GLU C N     1 
ATOM   6809  C CA    . GLU C 2 116 ? 56.255  -51.997  2.151   1.00 121.90 ? 116 GLU C CA    1 
ATOM   6810  C C     . GLU C 2 116 ? 57.015  -52.588  3.337   1.00 120.45 ? 116 GLU C C     1 
ATOM   6811  O O     . GLU C 2 116 ? 56.504  -52.595  4.456   1.00 120.67 ? 116 GLU C O     1 
ATOM   6812  C CB    . GLU C 2 116 ? 55.505  -53.099  1.402   1.00 123.82 ? 116 GLU C CB    1 
ATOM   6813  C CG    . GLU C 2 116 ? 54.169  -53.487  2.050   1.00 126.07 ? 116 GLU C CG    1 
ATOM   6814  C CD    . GLU C 2 116 ? 53.877  -54.990  2.010   1.00 128.41 ? 116 GLU C CD    1 
ATOM   6815  O OE1   . GLU C 2 116 ? 54.368  -55.697  1.099   1.00 129.34 ? 116 GLU C OE1   1 
ATOM   6816  O OE2   . GLU C 2 116 ? 53.147  -55.467  2.906   1.00 129.53 ? 116 GLU C OE2   1 
ATOM   6817  N N     . ILE C 2 117 ? 58.233  -53.074  3.088   1.00 119.22 ? 117 ILE C N     1 
ATOM   6818  C CA    . ILE C 2 117 ? 59.078  -53.642  4.148   1.00 117.95 ? 117 ILE C CA    1 
ATOM   6819  C C     . ILE C 2 117 ? 59.537  -52.573  5.137   1.00 116.77 ? 117 ILE C C     1 
ATOM   6820  O O     . ILE C 2 117 ? 59.415  -52.763  6.347   1.00 116.67 ? 117 ILE C O     1 
ATOM   6821  C CB    . ILE C 2 117 ? 60.310  -54.412  3.594   1.00 117.27 ? 117 ILE C CB    1 
ATOM   6822  C CG1   . ILE C 2 117 ? 59.866  -55.570  2.698   1.00 118.70 ? 117 ILE C CG1   1 
ATOM   6823  C CG2   . ILE C 2 117 ? 61.182  -54.945  4.736   1.00 116.21 ? 117 ILE C CG2   1 
ATOM   6824  C CD1   . ILE C 2 117 ? 60.981  -56.167  1.859   1.00 118.88 ? 117 ILE C CD1   1 
ATOM   6825  N N     . ILE C 2 118 ? 60.048  -51.452  4.627   1.00 116.10 ? 118 ILE C N     1 
ATOM   6826  C CA    . ILE C 2 118 ? 60.519  -50.368  5.496   1.00 115.21 ? 118 ILE C CA    1 
ATOM   6827  C C     . ILE C 2 118 ? 59.369  -49.696  6.251   1.00 115.96 ? 118 ILE C C     1 
ATOM   6828  O O     . ILE C 2 118 ? 59.599  -48.855  7.119   1.00 115.63 ? 118 ILE C O     1 
ATOM   6829  C CB    . ILE C 2 118 ? 61.373  -49.296  4.752   1.00 114.54 ? 118 ILE C CB    1 
ATOM   6830  C CG1   . ILE C 2 118 ? 60.501  -48.417  3.846   1.00 115.87 ? 118 ILE C CG1   1 
ATOM   6831  C CG2   . ILE C 2 118 ? 62.519  -49.948  3.991   1.00 113.96 ? 118 ILE C CG2   1 
ATOM   6832  C CD1   . ILE C 2 118 ? 61.142  -47.084  3.473   1.00 116.02 ? 118 ILE C CD1   1 
ATOM   6833  N N     . LYS C 2 119 ? 58.137  -50.071  5.921   1.00 117.11 ? 119 LYS C N     1 
ATOM   6834  C CA    . LYS C 2 119 ? 56.982  -49.541  6.626   1.00 117.98 ? 119 LYS C CA    1 
ATOM   6835  C C     . LYS C 2 119 ? 56.371  -50.543  7.585   1.00 118.33 ? 119 LYS C C     1 
ATOM   6836  O O     . LYS C 2 119 ? 55.796  -50.150  8.590   1.00 118.62 ? 119 LYS C O     1 
ATOM   6837  C CB    . LYS C 2 119 ? 55.959  -48.963  5.650   1.00 119.46 ? 119 LYS C CB    1 
ATOM   6838  C CG    . LYS C 2 119 ? 56.346  -47.549  5.211   1.00 120.11 ? 119 LYS C CG    1 
ATOM   6839  C CD    . LYS C 2 119 ? 55.624  -47.077  3.952   1.00 122.57 ? 119 LYS C CD    1 
ATOM   6840  C CE    . LYS C 2 119 ? 56.194  -45.739  3.482   1.00 122.86 ? 119 LYS C CE    1 
ATOM   6841  N NZ    . LYS C 2 119 ? 55.683  -45.325  2.146   1.00 124.31 ? 119 LYS C NZ    1 
ATOM   6842  N N     . ARG C 2 120 ? 56.518  -51.832  7.283   1.00 118.42 ? 120 ARG C N     1 
ATOM   6843  C CA    . ARG C 2 120 ? 56.107  -52.894  8.204   1.00 119.12 ? 120 ARG C CA    1 
ATOM   6844  C C     . ARG C 2 120 ? 57.035  -53.001  9.410   1.00 117.97 ? 120 ARG C C     1 
ATOM   6845  O O     . ARG C 2 120 ? 56.579  -53.292  10.518  1.00 118.71 ? 120 ARG C O     1 
ATOM   6846  C CB    . ARG C 2 120 ? 56.025  -54.257  7.507   1.00 119.94 ? 120 ARG C CB    1 
ATOM   6847  C CG    . ARG C 2 120 ? 54.623  -54.872  7.452   1.00 122.26 ? 120 ARG C CG    1 
ATOM   6848  C CD    . ARG C 2 120 ? 54.673  -56.359  7.830   1.00 123.71 ? 120 ARG C CD    1 
ATOM   6849  N NE    . ARG C 2 120 ? 53.792  -57.192  7.006   1.00 125.73 ? 120 ARG C NE    1 
ATOM   6850  C CZ    . ARG C 2 120 ? 53.808  -58.526  6.984   1.00 126.70 ? 120 ARG C CZ    1 
ATOM   6851  N NH1   . ARG C 2 120 ? 54.659  -59.210  7.743   1.00 125.96 ? 120 ARG C NH1   1 
ATOM   6852  N NH2   . ARG C 2 120 ? 52.966  -59.181  6.196   1.00 128.37 ? 120 ARG C NH2   1 
ATOM   6853  N N     . VAL C 2 121 ? 58.331  -52.776  9.188   1.00 116.36 ? 121 VAL C N     1 
ATOM   6854  C CA    . VAL C 2 121 ? 59.321  -52.806  10.271  1.00 115.22 ? 121 VAL C CA    1 
ATOM   6855  C C     . VAL C 2 121 ? 59.208  -51.563  11.146  1.00 115.02 ? 121 VAL C C     1 
ATOM   6856  O O     . VAL C 2 121 ? 59.653  -51.558  12.292  1.00 114.77 ? 121 VAL C O     1 
ATOM   6857  C CB    . VAL C 2 121 ? 60.778  -52.995  9.761   1.00 113.85 ? 121 VAL C CB    1 
ATOM   6858  C CG1   . VAL C 2 121 ? 60.899  -54.272  8.960   1.00 114.10 ? 121 VAL C CG1   1 
ATOM   6859  C CG2   . VAL C 2 121 ? 61.238  -51.807  8.937   1.00 113.06 ? 121 VAL C CG2   1 
ATOM   6860  N N     . ASN C 2 122 ? 58.607  -50.516  10.586  1.00 115.26 ? 122 ASN C N     1 
ATOM   6861  C CA    . ASN C 2 122 ? 58.273  -49.318  11.336  1.00 115.64 ? 122 ASN C CA    1 
ATOM   6862  C C     . ASN C 2 122 ? 57.133  -49.576  12.302  1.00 116.95 ? 122 ASN C C     1 
ATOM   6863  O O     . ASN C 2 122 ? 57.184  -49.125  13.448  1.00 117.31 ? 122 ASN C O     1 
ATOM   6864  C CB    . ASN C 2 122 ? 57.896  -48.172  10.394  1.00 115.99 ? 122 ASN C CB    1 
ATOM   6865  C CG    . ASN C 2 122 ? 59.102  -47.369  9.921   1.00 115.03 ? 122 ASN C CG    1 
ATOM   6866  O OD1   . ASN C 2 122 ? 60.148  -47.340  10.573  1.00 114.00 ? 122 ASN C OD1   1 
ATOM   6867  N ND2   . ASN C 2 122 ? 58.950  -46.699  8.782   1.00 115.72 ? 122 ASN C ND2   1 
ATOM   6868  N N     . GLU C 2 123 ? 56.111  -50.300  11.831  1.00 117.85 ? 123 GLU C N     1 
ATOM   6869  C CA    . GLU C 2 123 ? 54.916  -50.599  12.631  1.00 119.22 ? 123 GLU C CA    1 
ATOM   6870  C C     . GLU C 2 123 ? 55.257  -51.524  13.790  1.00 118.98 ? 123 GLU C C     1 
ATOM   6871  O O     . GLU C 2 123 ? 54.847  -51.282  14.928  1.00 119.71 ? 123 GLU C O     1 
ATOM   6872  C CB    . GLU C 2 123 ? 53.786  -51.220  11.785  1.00 120.66 ? 123 GLU C CB    1 
ATOM   6873  C CG    . GLU C 2 123 ? 53.440  -50.508  10.464  1.00 121.77 ? 123 GLU C CG    1 
ATOM   6874  C CD    . GLU C 2 123 ? 53.237  -48.995  10.595  1.00 123.22 ? 123 GLU C CD    1 
ATOM   6875  O OE1   . GLU C 2 123 ? 52.214  -48.569  11.180  1.00 124.43 ? 123 GLU C OE1   1 
ATOM   6876  O OE2   . GLU C 2 123 ? 54.099  -48.233  10.090  1.00 122.83 ? 123 GLU C OE2   1 
ATOM   6877  N N     . ILE C 2 124 ? 56.021  -52.572  13.497  1.00 117.99 ? 124 ILE C N     1 
ATOM   6878  C CA    . ILE C 2 124 ? 56.420  -53.531  14.521  1.00 118.10 ? 124 ILE C CA    1 
ATOM   6879  C C     . ILE C 2 124 ? 57.654  -53.045  15.292  1.00 116.84 ? 124 ILE C C     1 
ATOM   6880  O O     . ILE C 2 124 ? 58.396  -53.836  15.880  1.00 116.71 ? 124 ILE C O     1 
ATOM   6881  C CB    . ILE C 2 124 ? 56.584  -54.980  13.950  1.00 118.52 ? 124 ILE C CB    1 
ATOM   6882  C CG1   . ILE C 2 124 ? 57.691  -55.045  12.889  1.00 116.80 ? 124 ILE C CG1   1 
ATOM   6883  C CG2   . ILE C 2 124 ? 55.223  -55.517  13.427  1.00 120.09 ? 124 ILE C CG2   1 
ATOM   6884  C CD1   . ILE C 2 124 ? 57.997  -56.450  12.376  1.00 116.56 ? 124 ILE C CD1   1 
ATOM   6885  N N     . LYS C 2 125 ? 57.832  -51.724  15.293  1.00 116.07 ? 125 LYS C N     1 
ATOM   6886  C CA    . LYS C 2 125 ? 58.919  -51.047  15.992  1.00 115.09 ? 125 LYS C CA    1 
ATOM   6887  C C     . LYS C 2 125 ? 58.369  -49.953  16.907  1.00 115.74 ? 125 LYS C C     1 
ATOM   6888  O O     . LYS C 2 125 ? 59.024  -49.549  17.861  1.00 115.73 ? 125 LYS C O     1 
ATOM   6889  C CB    . LYS C 2 125 ? 59.878  -50.433  14.974  1.00 113.64 ? 125 LYS C CB    1 
ATOM   6890  C CG    . LYS C 2 125 ? 61.318  -50.298  15.438  1.00 113.12 ? 125 LYS C CG    1 
ATOM   6891  C CD    . LYS C 2 125 ? 62.212  -49.773  14.314  1.00 112.36 ? 125 LYS C CD    1 
ATOM   6892  C CE    . LYS C 2 125 ? 63.690  -49.816  14.701  1.00 111.93 ? 125 LYS C CE    1 
ATOM   6893  N NZ    . LYS C 2 125 ? 64.603  -49.613  13.538  1.00 110.75 ? 125 LYS C NZ    1 
ATOM   6894  N N     . GLY C 2 126 ? 57.161  -49.485  16.607  1.00 116.59 ? 126 GLY C N     1 
ATOM   6895  C CA    . GLY C 2 126 ? 56.527  -48.375  17.322  1.00 117.52 ? 126 GLY C CA    1 
ATOM   6896  C C     . GLY C 2 126 ? 55.844  -47.475  16.311  1.00 117.75 ? 126 GLY C C     1 
ATOM   6897  O O     . GLY C 2 126 ? 54.904  -47.889  15.633  1.00 118.61 ? 126 GLY C O     1 
ATOM   6898  N N     . LYS C 2 127 ? 56.320  -46.237  16.226  1.00 117.37 ? 127 LYS C N     1 
ATOM   6899  C CA    . LYS C 2 127 ? 55.999  -45.287  15.136  1.00 117.41 ? 127 LYS C CA    1 
ATOM   6900  C C     . LYS C 2 127 ? 54.583  -44.661  15.028  1.00 119.05 ? 127 LYS C C     1 
ATOM   6901  O O     . LYS C 2 127 ? 54.023  -44.218  16.033  1.00 120.25 ? 127 LYS C O     1 
ATOM   6902  C CB    . LYS C 2 127 ? 56.549  -45.763  13.779  1.00 116.18 ? 127 LYS C CB    1 
ATOM   6903  C CG    . LYS C 2 127 ? 58.064  -45.559  13.665  1.00 115.00 ? 127 LYS C CG    1 
ATOM   6904  C CD    . LYS C 2 127 ? 58.452  -44.723  12.437  1.00 114.79 ? 127 LYS C CD    1 
ATOM   6905  C CE    . LYS C 2 127 ? 59.722  -43.900  12.694  1.00 113.67 ? 127 LYS C CE    1 
ATOM   6906  N NZ    . LYS C 2 127 ? 60.327  -43.342  11.445  1.00 112.27 ? 127 LYS C NZ    1 
ATOM   6907  N N     . THR C 2 128 ? 54.034  -44.631  13.811  1.00 119.36 ? 128 THR C N     1 
ATOM   6908  C CA    . THR C 2 128 ? 52.861  -43.799  13.423  1.00 121.10 ? 128 THR C CA    1 
ATOM   6909  C C     . THR C 2 128 ? 53.206  -42.307  13.372  1.00 121.22 ? 128 THR C C     1 
ATOM   6910  O O     . THR C 2 128 ? 52.509  -41.513  12.732  1.00 122.21 ? 128 THR C O     1 
ATOM   6911  C CB    . THR C 2 128 ? 51.560  -44.013  14.287  1.00 122.95 ? 128 THR C CB    1 
ATOM   6912  O OG1   . THR C 2 128 ? 51.735  -43.463  15.602  1.00 123.43 ? 128 THR C OG1   1 
ATOM   6913  C CG2   . THR C 2 128 ? 51.161  -45.492  14.369  1.00 123.22 ? 128 THR C CG2   1 
ATOM   6914  N N     . ALA D 2 7   ? 150.466 -3.983   8.408   1.00 87.38  ? 7   ALA D N     1 
ATOM   6915  C CA    . ALA D 2 7   ? 149.222 -4.796   8.639   1.00 86.89  ? 7   ALA D CA    1 
ATOM   6916  C C     . ALA D 2 7   ? 149.422 -6.255   8.227   1.00 86.79  ? 7   ALA D C     1 
ATOM   6917  O O     . ALA D 2 7   ? 150.267 -6.544   7.381   1.00 87.31  ? 7   ALA D O     1 
ATOM   6918  C CB    . ALA D 2 7   ? 148.021 -4.186   7.903   1.00 85.46  ? 7   ALA D CB    1 
ATOM   6919  N N     . SER D 2 8   ? 148.636 -7.165   8.807   1.00 86.43  ? 8   SER D N     1 
ATOM   6920  C CA    . SER D 2 8   ? 148.925 -8.608   8.695   1.00 86.72  ? 8   SER D CA    1 
ATOM   6921  C C     . SER D 2 8   ? 148.107 -9.358   7.643   1.00 85.19  ? 8   SER D C     1 
ATOM   6922  O O     . SER D 2 8   ? 148.534 -10.406  7.153   1.00 85.61  ? 8   SER D O     1 
ATOM   6923  C CB    . SER D 2 8   ? 148.823 -9.310   10.061  1.00 87.81  ? 8   SER D CB    1 
ATOM   6924  O OG    . SER D 2 8   ? 147.510 -9.781   10.301  1.00 86.79  ? 8   SER D OG    1 
ATOM   6925  N N     . TYR D 2 9   ? 146.938 -8.829   7.303   1.00 83.50  ? 9   TYR D N     1 
ATOM   6926  C CA    . TYR D 2 9   ? 146.134 -9.415   6.232   1.00 82.09  ? 9   TYR D CA    1 
ATOM   6927  C C     . TYR D 2 9   ? 146.635 -9.016   4.851   1.00 81.61  ? 9   TYR D C     1 
ATOM   6928  O O     . TYR D 2 9   ? 146.086 -9.461   3.843   1.00 80.95  ? 9   TYR D O     1 
ATOM   6929  C CB    . TYR D 2 9   ? 144.651 -9.057   6.377   1.00 81.12  ? 9   TYR D CB    1 
ATOM   6930  C CG    . TYR D 2 9   ? 144.329 -7.587   6.210   1.00 80.50  ? 9   TYR D CG    1 
ATOM   6931  C CD1   . TYR D 2 9   ? 144.141 -7.033   4.950   1.00 79.29  ? 9   TYR D CD1   1 
ATOM   6932  C CD2   . TYR D 2 9   ? 144.200 -6.752   7.318   1.00 81.59  ? 9   TYR D CD2   1 
ATOM   6933  C CE1   . TYR D 2 9   ? 143.848 -5.680   4.792   1.00 78.82  ? 9   TYR D CE1   1 
ATOM   6934  C CE2   . TYR D 2 9   ? 143.899 -5.397   7.171   1.00 80.98  ? 9   TYR D CE2   1 
ATOM   6935  C CZ    . TYR D 2 9   ? 143.723 -4.871   5.902   1.00 79.42  ? 9   TYR D CZ    1 
ATOM   6936  O OH    . TYR D 2 9   ? 143.426 -3.536   5.743   1.00 78.95  ? 9   TYR D OH    1 
ATOM   6937  N N     . VAL D 2 10  ? 147.655 -8.155   4.816   1.00 82.07  ? 10  VAL D N     1 
ATOM   6938  C CA    . VAL D 2 10  ? 148.306 -7.746   3.569   1.00 81.62  ? 10  VAL D CA    1 
ATOM   6939  C C     . VAL D 2 10  ? 149.382 -8.773   3.218   1.00 82.56  ? 10  VAL D C     1 
ATOM   6940  O O     . VAL D 2 10  ? 150.348 -8.954   3.954   1.00 84.07  ? 10  VAL D O     1 
ATOM   6941  C CB    . VAL D 2 10  ? 148.928 -6.338   3.686   1.00 82.03  ? 10  VAL D CB    1 
ATOM   6942  C CG1   . VAL D 2 10  ? 149.574 -5.927   2.374   1.00 81.97  ? 10  VAL D CG1   1 
ATOM   6943  C CG2   . VAL D 2 10  ? 147.879 -5.325   4.101   1.00 81.07  ? 10  VAL D CG2   1 
ATOM   6944  N N     . LYS D 2 11  ? 149.204 -9.452   2.095   1.00 81.88  ? 11  LYS D N     1 
ATOM   6945  C CA    . LYS D 2 11  ? 150.080 -10.555  1.733   1.00 82.88  ? 11  LYS D CA    1 
ATOM   6946  C C     . LYS D 2 11  ? 151.398 -10.131  1.076   1.00 84.01  ? 11  LYS D C     1 
ATOM   6947  O O     . LYS D 2 11  ? 152.436 -10.721  1.346   1.00 85.42  ? 11  LYS D O     1 
ATOM   6948  C CB    . LYS D 2 11  ? 149.323 -11.558  0.854   1.00 82.23  ? 11  LYS D CB    1 
ATOM   6949  C CG    . LYS D 2 11  ? 148.757 -12.767  1.602   1.00 82.21  ? 11  LYS D CG    1 
ATOM   6950  C CD    . LYS D 2 11  ? 147.933 -12.381  2.820   1.00 81.28  ? 11  LYS D CD    1 
ATOM   6951  C CE    . LYS D 2 11  ? 147.730 -13.565  3.738   1.00 82.12  ? 11  LYS D CE    1 
ATOM   6952  N NZ    . LYS D 2 11  ? 147.233 -13.113  5.061   1.00 82.11  ? 11  LYS D NZ    1 
ATOM   6953  N N     . PHE D 2 12  ? 151.350 -9.113   0.222   1.00 83.75  ? 12  PHE D N     1 
ATOM   6954  C CA    . PHE D 2 12  ? 152.530 -8.652   -0.510  1.00 85.14  ? 12  PHE D CA    1 
ATOM   6955  C C     . PHE D 2 12  ? 152.617 -7.125   -0.581  1.00 85.55  ? 12  PHE D C     1 
ATOM   6956  O O     . PHE D 2 12  ? 151.689 -6.430   -0.165  1.00 84.74  ? 12  PHE D O     1 
ATOM   6957  C CB    . PHE D 2 12  ? 152.564 -9.266   -1.914  1.00 85.06  ? 12  PHE D CB    1 
ATOM   6958  C CG    . PHE D 2 12  ? 151.259 -9.174   -2.656  1.00 83.38  ? 12  PHE D CG    1 
ATOM   6959  C CD1   . PHE D 2 12  ? 150.921 -8.025   -3.365  1.00 82.66  ? 12  PHE D CD1   1 
ATOM   6960  C CD2   . PHE D 2 12  ? 150.374 -10.245  -2.660  1.00 82.67  ? 12  PHE D CD2   1 
ATOM   6961  C CE1   . PHE D 2 12  ? 149.720 -7.938   -4.050  1.00 81.01  ? 12  PHE D CE1   1 
ATOM   6962  C CE2   . PHE D 2 12  ? 149.170 -10.165  -3.342  1.00 81.25  ? 12  PHE D CE2   1 
ATOM   6963  C CZ    . PHE D 2 12  ? 148.842 -9.008   -4.038  1.00 80.44  ? 12  PHE D CZ    1 
ATOM   6964  N N     . GLU D 2 13  ? 153.726 -6.613   -1.118  1.00 87.35  ? 13  GLU D N     1 
ATOM   6965  C CA    . GLU D 2 13  ? 153.976 -5.169   -1.194  1.00 88.44  ? 13  GLU D CA    1 
ATOM   6966  C C     . GLU D 2 13  ? 153.587 -4.520   -2.529  1.00 88.07  ? 13  GLU D C     1 
ATOM   6967  O O     . GLU D 2 13  ? 154.100 -4.901   -3.583  1.00 88.73  ? 13  GLU D O     1 
ATOM   6968  C CB    . GLU D 2 13  ? 155.449 -4.883   -0.912  1.00 90.74  ? 13  GLU D CB    1 
ATOM   6969  C CG    . GLU D 2 13  ? 155.739 -3.449   -0.464  1.00 93.18  ? 13  GLU D CG    1 
ATOM   6970  C CD    . GLU D 2 13  ? 155.567 -3.241   1.048   1.00 95.51  ? 13  GLU D CD    1 
ATOM   6971  O OE1   . GLU D 2 13  ? 154.730 -3.942   1.677   1.00 94.63  ? 13  GLU D OE1   1 
ATOM   6972  O OE2   . GLU D 2 13  ? 156.280 -2.368   1.606   1.00 97.13  ? 13  GLU D OE2   1 
ATOM   6973  N N     . VAL D 2 14  ? 152.708 -3.518   -2.464  1.00 87.45  ? 14  VAL D N     1 
ATOM   6974  C CA    . VAL D 2 14  ? 152.260 -2.771   -3.644  1.00 87.33  ? 14  VAL D CA    1 
ATOM   6975  C C     . VAL D 2 14  ? 152.891 -1.374   -3.710  1.00 88.87  ? 14  VAL D C     1 
ATOM   6976  O O     . VAL D 2 14  ? 152.602 -0.528   -2.865  1.00 88.78  ? 14  VAL D O     1 
ATOM   6977  C CB    . VAL D 2 14  ? 150.728 -2.604   -3.658  1.00 85.86  ? 14  VAL D CB    1 
ATOM   6978  C CG1   . VAL D 2 14  ? 150.268 -1.928   -4.955  1.00 85.44  ? 14  VAL D CG1   1 
ATOM   6979  C CG2   . VAL D 2 14  ? 150.029 -3.951   -3.457  1.00 84.99  ? 14  VAL D CG2   1 
ATOM   6980  N N     . PRO D 2 15  ? 153.755 -1.128   -4.717  1.00 90.52  ? 15  PRO D N     1 
ATOM   6981  C CA    . PRO D 2 15  ? 154.352 0.201    -4.895  1.00 92.12  ? 15  PRO D CA    1 
ATOM   6982  C C     . PRO D 2 15  ? 153.321 1.209    -5.389  1.00 91.64  ? 15  PRO D C     1 
ATOM   6983  O O     . PRO D 2 15  ? 152.428 0.849    -6.157  1.00 90.50  ? 15  PRO D O     1 
ATOM   6984  C CB    . PRO D 2 15  ? 155.429 -0.033   -5.964  1.00 93.71  ? 15  PRO D CB    1 
ATOM   6985  C CG    . PRO D 2 15  ? 155.660 -1.527   -5.983  1.00 93.22  ? 15  PRO D CG    1 
ATOM   6986  C CD    . PRO D 2 15  ? 154.320 -2.109   -5.663  1.00 91.12  ? 15  PRO D CD    1 
ATOM   6987  N N     . GLN D 2 16  ? 153.463 2.461    -4.960  1.00 92.82  ? 16  GLN D N     1 
ATOM   6988  C CA    . GLN D 2 16  ? 152.438 3.501    -5.174  1.00 92.68  ? 16  GLN D CA    1 
ATOM   6989  C C     . GLN D 2 16  ? 152.023 3.744    -6.616  1.00 92.48  ? 16  GLN D C     1 
ATOM   6990  O O     . GLN D 2 16  ? 150.919 4.212    -6.857  1.00 91.67  ? 16  GLN D O     1 
ATOM   6991  C CB    . GLN D 2 16  ? 152.858 4.828    -4.542  1.00 94.21  ? 16  GLN D CB    1 
ATOM   6992  C CG    . GLN D 2 16  ? 152.455 4.961    -3.088  1.00 94.78  ? 16  GLN D CG    1 
ATOM   6993  C CD    . GLN D 2 16  ? 153.162 6.104    -2.395  1.00 97.76  ? 16  GLN D CD    1 
ATOM   6994  O OE1   . GLN D 2 16  ? 153.948 6.826    -3.011  1.00 99.77  ? 16  GLN D OE1   1 
ATOM   6995  N NE2   . GLN D 2 16  ? 152.889 6.276    -1.102  1.00 97.97  ? 16  GLN D NE2   1 
ATOM   6996  N N     . ASP D 2 17  ? 152.911 3.445    -7.561  1.00 93.49  ? 17  ASP D N     1 
ATOM   6997  C CA    . ASP D 2 17  ? 152.612 3.574    -8.985  1.00 93.69  ? 17  ASP D CA    1 
ATOM   6998  C C     . ASP D 2 17  ? 151.485 2.609    -9.327  1.00 91.74  ? 17  ASP D C     1 
ATOM   6999  O O     . ASP D 2 17  ? 150.518 2.977    -10.004 1.00 91.51  ? 17  ASP D O     1 
ATOM   7000  C CB    . ASP D 2 17  ? 153.839 3.227    -9.831  1.00 95.32  ? 17  ASP D CB    1 
ATOM   7001  C CG    . ASP D 2 17  ? 155.094 3.043    -8.995  1.00 97.24  ? 17  ASP D CG    1 
ATOM   7002  O OD1   . ASP D 2 17  ? 155.594 4.038    -8.420  1.00 99.70  ? 17  ASP D OD1   1 
ATOM   7003  O OD2   . ASP D 2 17  ? 155.581 1.895    -8.913  1.00 97.33  ? 17  ASP D OD2   1 
ATOM   7004  N N     . LEU D 2 18  ? 151.615 1.377    -8.838  1.00 90.42  ? 18  LEU D N     1 
ATOM   7005  C CA    . LEU D 2 18  ? 150.612 0.338    -9.042  1.00 88.42  ? 18  LEU D CA    1 
ATOM   7006  C C     . LEU D 2 18  ? 149.311 0.668    -8.312  1.00 86.89  ? 18  LEU D C     1 
ATOM   7007  O O     . LEU D 2 18  ? 148.224 0.517    -8.869  1.00 85.98  ? 18  LEU D O     1 
ATOM   7008  C CB    . LEU D 2 18  ? 151.156 -1.010   -8.567  1.00 88.03  ? 18  LEU D CB    1 
ATOM   7009  C CG    . LEU D 2 18  ? 150.408 -2.273   -8.981  1.00 86.54  ? 18  LEU D CG    1 
ATOM   7010  C CD1   . LEU D 2 18  ? 150.405 -2.442   -10.491 1.00 86.73  ? 18  LEU D CD1   1 
ATOM   7011  C CD2   . LEU D 2 18  ? 151.046 -3.469   -8.314  1.00 86.60  ? 18  LEU D CD2   1 
ATOM   7012  N N     . ALA D 2 19  ? 149.435 1.121    -7.068  1.00 86.57  ? 19  ALA D N     1 
ATOM   7013  C CA    . ALA D 2 19  ? 148.288 1.544    -6.276  1.00 85.48  ? 19  ALA D CA    1 
ATOM   7014  C C     . ALA D 2 19  ? 147.444 2.603    -6.994  1.00 85.66  ? 19  ALA D C     1 
ATOM   7015  O O     . ALA D 2 19  ? 146.218 2.581    -6.909  1.00 84.72  ? 19  ALA D O     1 
ATOM   7016  C CB    . ALA D 2 19  ? 148.743 2.049    -4.917  1.00 85.97  ? 19  ALA D CB    1 
ATOM   7017  N N     . ASP D 2 20  ? 148.107 3.515    -7.703  1.00 87.05  ? 20  ASP D N     1 
ATOM   7018  C CA    . ASP D 2 20  ? 147.438 4.563    -8.469  1.00 87.60  ? 20  ASP D CA    1 
ATOM   7019  C C     . ASP D 2 20  ? 146.832 4.031    -9.754  1.00 87.20  ? 20  ASP D C     1 
ATOM   7020  O O     . ASP D 2 20  ? 145.773 4.494    -10.188 1.00 87.22  ? 20  ASP D O     1 
ATOM   7021  C CB    . ASP D 2 20  ? 148.402 5.701    -8.788  1.00 89.58  ? 20  ASP D CB    1 
ATOM   7022  C CG    . ASP D 2 20  ? 148.567 6.674    -7.629  1.00 91.17  ? 20  ASP D CG    1 
ATOM   7023  O OD1   . ASP D 2 20  ? 147.967 6.452    -6.548  1.00 91.18  ? 20  ASP D OD1   1 
ATOM   7024  O OD2   . ASP D 2 20  ? 149.306 7.669    -7.803  1.00 93.38  ? 20  ASP D OD2   1 
ATOM   7025  N N     . LYS D 2 21  ? 147.509 3.063    -10.364 1.00 87.14  ? 21  LYS D N     1 
ATOM   7026  C CA    . LYS D 2 21  ? 146.992 2.406    -11.564 1.00 86.95  ? 21  LYS D CA    1 
ATOM   7027  C C     . LYS D 2 21  ? 145.769 1.543    -11.245 1.00 85.04  ? 21  LYS D C     1 
ATOM   7028  O O     . LYS D 2 21  ? 144.924 1.309    -12.109 1.00 84.82  ? 21  LYS D O     1 
ATOM   7029  C CB    . LYS D 2 21  ? 148.090 1.597    -12.268 1.00 87.78  ? 21  LYS D CB    1 
ATOM   7030  C CG    . LYS D 2 21  ? 149.140 2.475    -12.967 1.00 90.51  ? 21  LYS D CG    1 
ATOM   7031  C CD    . LYS D 2 21  ? 150.294 1.651    -13.529 1.00 92.46  ? 21  LYS D CD    1 
ATOM   7032  C CE    . LYS D 2 21  ? 151.612 2.414    -13.477 1.00 94.45  ? 21  LYS D CE    1 
ATOM   7033  N NZ    . LYS D 2 21  ? 151.646 3.538    -14.442 1.00 96.84  ? 21  LYS D NZ    1 
ATOM   7034  N N     . VAL D 2 22  ? 145.678 1.089    -9.996  1.00 83.80  ? 22  VAL D N     1 
ATOM   7035  C CA    . VAL D 2 22  ? 144.508 0.356    -9.524  1.00 82.12  ? 22  VAL D CA    1 
ATOM   7036  C C     . VAL D 2 22  ? 143.312 1.299    -9.350  1.00 82.16  ? 22  VAL D C     1 
ATOM   7037  O O     . VAL D 2 22  ? 142.244 1.058    -9.925  1.00 81.96  ? 22  VAL D O     1 
ATOM   7038  C CB    . VAL D 2 22  ? 144.798 -0.428   -8.229  1.00 81.17  ? 22  VAL D CB    1 
ATOM   7039  C CG1   . VAL D 2 22  ? 143.527 -1.059   -7.683  1.00 79.05  ? 22  VAL D CG1   1 
ATOM   7040  C CG2   . VAL D 2 22  ? 145.838 -1.495   -8.493  1.00 81.19  ? 22  VAL D CG2   1 
ATOM   7041  N N     . LEU D 2 23  ? 143.495 2.377    -8.586  1.00 82.42  ? 23  LEU D N     1 
ATOM   7042  C CA    . LEU D 2 23  ? 142.430 3.356    -8.387  1.00 82.64  ? 23  LEU D CA    1 
ATOM   7043  C C     . LEU D 2 23  ? 141.894 3.892    -9.721  1.00 83.90  ? 23  LEU D C     1 
ATOM   7044  O O     . LEU D 2 23  ? 140.683 4.043    -9.890  1.00 83.84  ? 23  LEU D O     1 
ATOM   7045  C CB    . LEU D 2 23  ? 142.887 4.494    -7.476  1.00 83.10  ? 23  LEU D CB    1 
ATOM   7046  C CG    . LEU D 2 23  ? 143.101 4.162    -5.996  1.00 82.13  ? 23  LEU D CG    1 
ATOM   7047  C CD1   . LEU D 2 23  ? 143.928 5.244    -5.298  1.00 83.69  ? 23  LEU D CD1   1 
ATOM   7048  C CD2   . LEU D 2 23  ? 141.791 3.970    -5.277  1.00 80.08  ? 23  LEU D CD2   1 
ATOM   7049  N N     . GLU D 2 24  ? 142.794 4.160    -10.666 1.00 85.40  ? 24  GLU D N     1 
ATOM   7050  C CA    . GLU D 2 24  ? 142.402 4.516    -12.033 1.00 86.76  ? 24  GLU D CA    1 
ATOM   7051  C C     . GLU D 2 24  ? 141.534 3.440    -12.680 1.00 85.78  ? 24  GLU D C     1 
ATOM   7052  O O     . GLU D 2 24  ? 140.466 3.739    -13.228 1.00 86.25  ? 24  GLU D O     1 
ATOM   7053  C CB    . GLU D 2 24  ? 143.626 4.768    -12.907 1.00 88.18  ? 24  GLU D CB    1 
ATOM   7054  C CG    . GLU D 2 24  ? 143.826 6.217    -13.266 1.00 91.88  ? 24  GLU D CG    1 
ATOM   7055  C CD    . GLU D 2 24  ? 144.393 6.395    -14.668 1.00 96.50  ? 24  GLU D CD    1 
ATOM   7056  O OE1   . GLU D 2 24  ? 143.889 5.734    -15.612 1.00 96.86  ? 24  GLU D OE1   1 
ATOM   7057  O OE2   . GLU D 2 24  ? 145.341 7.205    -14.826 1.00 99.30  ? 24  GLU D OE2   1 
ATOM   7058  N N     . ALA D 2 25  ? 142.001 2.193    -12.607 1.00 84.58  ? 25  ALA D N     1 
ATOM   7059  C CA    . ALA D 2 25  ? 141.303 1.060    -13.202 1.00 83.62  ? 25  ALA D CA    1 
ATOM   7060  C C     . ALA D 2 25  ? 139.883 0.953    -12.682 1.00 82.60  ? 25  ALA D C     1 
ATOM   7061  O O     . ALA D 2 25  ? 138.965 0.598    -13.425 1.00 82.59  ? 25  ALA D O     1 
ATOM   7062  C CB    . ALA D 2 25  ? 142.060 -0.229   -12.942 1.00 82.96  ? 25  ALA D CB    1 
ATOM   7063  N N     . VAL D 2 26  ? 139.708 1.277    -11.406 1.00 81.80  ? 26  VAL D N     1 
ATOM   7064  C CA    . VAL D 2 26  ? 138.398 1.187    -10.782 1.00 81.12  ? 26  VAL D CA    1 
ATOM   7065  C C     . VAL D 2 26  ? 137.463 2.263    -11.331 1.00 82.05  ? 26  VAL D C     1 
ATOM   7066  O O     . VAL D 2 26  ? 136.311 1.967    -11.641 1.00 82.18  ? 26  VAL D O     1 
ATOM   7067  C CB    . VAL D 2 26  ? 138.471 1.238    -9.239  1.00 80.32  ? 26  VAL D CB    1 
ATOM   7068  C CG1   . VAL D 2 26  ? 137.169 0.779    -8.651  1.00 80.05  ? 26  VAL D CG1   1 
ATOM   7069  C CG2   . VAL D 2 26  ? 139.562 0.323    -8.722  1.00 79.47  ? 26  VAL D CG2   1 
ATOM   7070  N N     . ARG D 2 27  ? 137.971 3.492    -11.481 1.00 83.01  ? 27  ARG D N     1 
ATOM   7071  C CA    . ARG D 2 27  ? 137.166 4.642    -11.947 1.00 83.85  ? 27  ARG D CA    1 
ATOM   7072  C C     . ARG D 2 27  ? 136.636 4.439    -13.348 1.00 84.04  ? 27  ARG D C     1 
ATOM   7073  O O     . ARG D 2 27  ? 135.469 4.713    -13.615 1.00 84.82  ? 27  ARG D O     1 
ATOM   7074  C CB    . ARG D 2 27  ? 137.947 5.958    -11.882 1.00 85.22  ? 27  ARG D CB    1 
ATOM   7075  C CG    . ARG D 2 27  ? 138.297 6.412    -10.480 1.00 86.12  ? 27  ARG D CG    1 
ATOM   7076  C CD    . ARG D 2 27  ? 138.914 7.796    -10.478 1.00 89.69  ? 27  ARG D CD    1 
ATOM   7077  N NE    . ARG D 2 27  ? 140.151 7.819    -9.698  1.00 91.10  ? 27  ARG D NE    1 
ATOM   7078  C CZ    . ARG D 2 27  ? 141.372 7.872    -10.230 1.00 92.72  ? 27  ARG D CZ    1 
ATOM   7079  N NH1   . ARG D 2 27  ? 141.531 7.922    -11.547 1.00 94.37  ? 27  ARG D NH1   1 
ATOM   7080  N NH2   . ARG D 2 27  ? 142.440 7.886    -9.445  1.00 93.38  ? 27  ARG D NH2   1 
ATOM   7081  N N     . LYS D 2 28  ? 137.496 3.956    -14.235 1.00 83.45  ? 28  LYS D N     1 
ATOM   7082  C CA    . LYS D 2 28  ? 137.091 3.667    -15.597 1.00 83.75  ? 28  LYS D CA    1 
ATOM   7083  C C     . LYS D 2 28  ? 136.070 2.535    -15.621 1.00 82.64  ? 28  LYS D C     1 
ATOM   7084  O O     . LYS D 2 28  ? 135.207 2.483    -16.502 1.00 83.81  ? 28  LYS D O     1 
ATOM   7085  C CB    . LYS D 2 28  ? 138.303 3.339    -16.461 1.00 84.16  ? 28  LYS D CB    1 
ATOM   7086  C CG    . LYS D 2 28  ? 139.292 4.484    -16.559 1.00 85.49  ? 28  LYS D CG    1 
ATOM   7087  C CD    . LYS D 2 28  ? 140.066 4.422    -17.854 1.00 87.73  ? 28  LYS D CD    1 
ATOM   7088  C CE    . LYS D 2 28  ? 140.746 5.745    -18.155 1.00 89.95  ? 28  LYS D CE    1 
ATOM   7089  N NZ    . LYS D 2 28  ? 141.277 5.761    -19.551 1.00 91.66  ? 28  LYS D NZ    1 
ATOM   7090  N N     . ALA D 2 29  ? 136.154 1.648    -14.634 1.00 80.45  ? 29  ALA D N     1 
ATOM   7091  C CA    . ALA D 2 29  ? 135.246 0.519    -14.546 1.00 78.91  ? 29  ALA D CA    1 
ATOM   7092  C C     . ALA D 2 29  ? 133.885 0.917    -14.012 1.00 78.65  ? 29  ALA D C     1 
ATOM   7093  O O     . ALA D 2 29  ? 132.910 0.245    -14.315 1.00 78.82  ? 29  ALA D O     1 
ATOM   7094  C CB    . ALA D 2 29  ? 135.843 -0.577   -13.711 1.00 77.67  ? 29  ALA D CB    1 
ATOM   7095  N N     . LYS D 2 30  ? 133.811 1.987    -13.216 1.00 78.34  ? 30  LYS D N     1 
ATOM   7096  C CA    . LYS D 2 30  ? 132.515 2.546    -12.812 1.00 78.74  ? 30  LYS D CA    1 
ATOM   7097  C C     . LYS D 2 30  ? 131.821 3.043    -14.045 1.00 79.86  ? 30  LYS D C     1 
ATOM   7098  O O     . LYS D 2 30  ? 130.645 2.763    -14.258 1.00 80.56  ? 30  LYS D O     1 
ATOM   7099  C CB    . LYS D 2 30  ? 132.673 3.744    -11.900 1.00 79.16  ? 30  LYS D CB    1 
ATOM   7100  C CG    . LYS D 2 30  ? 132.981 3.400    -10.506 1.00 80.10  ? 30  LYS D CG    1 
ATOM   7101  C CD    . LYS D 2 30  ? 134.147 4.249    -10.040 1.00 83.27  ? 30  LYS D CD    1 
ATOM   7102  C CE    . LYS D 2 30  ? 135.097 3.401    -9.197  1.00 83.23  ? 30  LYS D CE    1 
ATOM   7103  N NZ    . LYS D 2 30  ? 136.443 4.010    -8.944  1.00 83.56  ? 30  LYS D NZ    1 
ATOM   7104  N N     . GLU D 2 31  ? 132.579 3.785    -14.848 1.00 79.98  ? 31  GLU D N     1 
ATOM   7105  C CA    . GLU D 2 31  ? 132.072 4.469    -16.007 1.00 81.00  ? 31  GLU D CA    1 
ATOM   7106  C C     . GLU D 2 31  ? 131.606 3.492    -17.077 1.00 80.42  ? 31  GLU D C     1 
ATOM   7107  O O     . GLU D 2 31  ? 130.468 3.565    -17.529 1.00 81.32  ? 31  GLU D O     1 
ATOM   7108  C CB    . GLU D 2 31  ? 133.151 5.402    -16.564 1.00 82.30  ? 31  GLU D CB    1 
ATOM   7109  C CG    . GLU D 2 31  ? 133.472 6.610    -15.677 1.00 84.59  ? 31  GLU D CG    1 
ATOM   7110  C CD    . GLU D 2 31  ? 134.538 7.535    -16.288 1.00 88.94  ? 31  GLU D CD    1 
ATOM   7111  O OE1   . GLU D 2 31  ? 135.733 7.147    -16.297 1.00 88.71  ? 31  GLU D OE1   1 
ATOM   7112  O OE2   . GLU D 2 31  ? 134.184 8.656    -16.747 1.00 91.74  ? 31  GLU D OE2   1 
ATOM   7113  N N     . SER D 2 32  ? 132.478 2.566    -17.458 1.00 78.79  ? 32  SER D N     1 
ATOM   7114  C CA    . SER D 2 32  ? 132.273 1.780    -18.672 1.00 78.78  ? 32  SER D CA    1 
ATOM   7115  C C     . SER D 2 32  ? 131.953 0.315    -18.436 1.00 77.13  ? 32  SER D C     1 
ATOM   7116  O O     . SER D 2 32  ? 131.569 -0.390   -19.362 1.00 78.05  ? 32  SER D O     1 
ATOM   7117  C CB    . SER D 2 32  ? 133.503 1.882    -19.565 1.00 79.44  ? 32  SER D CB    1 
ATOM   7118  O OG    . SER D 2 32  ? 134.652 1.442    -18.865 1.00 78.32  ? 32  SER D OG    1 
ATOM   7119  N N     . GLY D 2 33  ? 132.120 -0.153   -17.208 1.00 74.94  ? 33  GLY D N     1 
ATOM   7120  C CA    . GLY D 2 33  ? 131.823 -1.547   -16.889 1.00 72.93  ? 33  GLY D CA    1 
ATOM   7121  C C     . GLY D 2 33  ? 130.927 -1.697   -15.677 1.00 71.32  ? 33  GLY D C     1 
ATOM   7122  O O     . GLY D 2 33  ? 130.037 -0.876   -15.441 1.00 71.76  ? 33  GLY D O     1 
ATOM   7123  N N     . LYS D 2 34  ? 131.180 -2.749   -14.909 1.00 69.26  ? 34  LYS D N     1 
ATOM   7124  C CA    . LYS D 2 34  ? 130.413 -3.034   -13.710 1.00 67.80  ? 34  LYS D CA    1 
ATOM   7125  C C     . LYS D 2 34  ? 131.348 -3.328   -12.549 1.00 65.84  ? 34  LYS D C     1 
ATOM   7126  O O     . LYS D 2 34  ? 132.181 -4.247   -12.626 1.00 65.50  ? 34  LYS D O     1 
ATOM   7127  C CB    . LYS D 2 34  ? 129.485 -4.228   -13.949 1.00 68.41  ? 34  LYS D CB    1 
ATOM   7128  C CG    . LYS D 2 34  ? 128.703 -4.662   -12.731 1.00 67.99  ? 34  LYS D CG    1 
ATOM   7129  C CD    . LYS D 2 34  ? 127.639 -5.655   -13.087 1.00 69.59  ? 34  LYS D CD    1 
ATOM   7130  C CE    . LYS D 2 34  ? 126.628 -5.759   -11.961 1.00 70.53  ? 34  LYS D CE    1 
ATOM   7131  N NZ    . LYS D 2 34  ? 125.406 -6.458   -12.442 1.00 72.96  ? 34  LYS D NZ    1 
ATOM   7132  N N     . ILE D 2 35  ? 131.210 -2.552   -11.476 1.00 64.36  ? 35  ILE D N     1 
ATOM   7133  C CA    . ILE D 2 35  ? 131.938 -2.828   -10.231 1.00 62.27  ? 35  ILE D CA    1 
ATOM   7134  C C     . ILE D 2 35  ? 131.018 -3.191   -9.051  1.00 61.15  ? 35  ILE D C     1 
ATOM   7135  O O     . ILE D 2 35  ? 129.813 -2.983   -9.103  1.00 61.70  ? 35  ILE D O     1 
ATOM   7136  C CB    . ILE D 2 35  ? 132.945 -1.680   -9.855  1.00 62.11  ? 35  ILE D CB    1 
ATOM   7137  C CG1   . ILE D 2 35  ? 132.278 -0.305   -9.817  1.00 63.09  ? 35  ILE D CG1   1 
ATOM   7138  C CG2   . ILE D 2 35  ? 134.094 -1.642   -10.819 1.00 61.97  ? 35  ILE D CG2   1 
ATOM   7139  C CD1   . ILE D 2 35  ? 132.190 0.285    -8.429  1.00 62.91  ? 35  ILE D CD1   1 
ATOM   7140  N N     . LYS D 2 36  ? 131.592 -3.772   -8.004  1.00 59.66  ? 36  LYS D N     1 
ATOM   7141  C CA    . LYS D 2 36  ? 130.891 -3.941   -6.727  1.00 58.67  ? 36  LYS D CA    1 
ATOM   7142  C C     . LYS D 2 36  ? 131.677 -3.200   -5.662  1.00 57.70  ? 36  LYS D C     1 
ATOM   7143  O O     . LYS D 2 36  ? 132.907 -3.253   -5.651  1.00 57.14  ? 36  LYS D O     1 
ATOM   7144  C CB    . LYS D 2 36  ? 130.739 -5.419   -6.339  1.00 58.13  ? 36  LYS D CB    1 
ATOM   7145  C CG    . LYS D 2 36  ? 129.778 -6.231   -7.187  1.00 58.01  ? 36  LYS D CG    1 
ATOM   7146  C CD    . LYS D 2 36  ? 128.332 -5.768   -7.068  1.00 57.77  ? 36  LYS D CD    1 
ATOM   7147  C CE    . LYS D 2 36  ? 127.430 -6.620   -7.951  1.00 57.75  ? 36  LYS D CE    1 
ATOM   7148  N NZ    . LYS D 2 36  ? 126.189 -5.927   -8.313  1.00 57.83  ? 36  LYS D NZ    1 
ATOM   7149  N N     . LYS D 2 37  ? 130.970 -2.518   -4.768  1.00 57.45  ? 37  LYS D N     1 
ATOM   7150  C CA    . LYS D 2 37  ? 131.624 -1.699   -3.749  1.00 57.08  ? 37  LYS D CA    1 
ATOM   7151  C C     . LYS D 2 37  ? 131.134 -2.030   -2.340  1.00 56.57  ? 37  LYS D C     1 
ATOM   7152  O O     . LYS D 2 37  ? 129.929 -2.112   -2.101  1.00 57.40  ? 37  LYS D O     1 
ATOM   7153  C CB    . LYS D 2 37  ? 131.459 -0.209   -4.077  1.00 58.04  ? 37  LYS D CB    1 
ATOM   7154  C CG    . LYS D 2 37  ? 130.022 0.238    -4.365  1.00 59.98  ? 37  LYS D CG    1 
ATOM   7155  C CD    . LYS D 2 37  ? 129.925 1.267    -5.516  1.00 60.14  ? 37  LYS D CD    1 
ATOM   7156  C CE    . LYS D 2 37  ? 128.539 1.911    -5.538  1.00 62.50  ? 37  LYS D CE    1 
ATOM   7157  N NZ    . LYS D 2 37  ? 127.471 1.071    -4.845  1.00 63.14  ? 37  LYS D NZ    1 
ATOM   7158  N N     . GLY D 2 38  ? 132.074 -2.236   -1.417  1.00 55.45  ? 38  GLY D N     1 
ATOM   7159  C CA    . GLY D 2 38  ? 131.754 -2.717   -0.067  1.00 54.73  ? 38  GLY D CA    1 
ATOM   7160  C C     . GLY D 2 38  ? 132.154 -4.171   0.141   1.00 53.88  ? 38  GLY D C     1 
ATOM   7161  O O     . GLY D 2 38  ? 132.071 -4.987   -0.780  1.00 53.77  ? 38  GLY D O     1 
ATOM   7162  N N     . THR D 2 39  ? 132.574 -4.493   1.361   1.00 53.43  ? 39  THR D N     1 
ATOM   7163  C CA    . THR D 2 39  ? 133.133 -5.809   1.702   1.00 52.65  ? 39  THR D CA    1 
ATOM   7164  C C     . THR D 2 39  ? 132.145 -6.978   1.530   1.00 52.59  ? 39  THR D C     1 
ATOM   7165  O O     . THR D 2 39  ? 132.522 -8.057   1.060   1.00 52.45  ? 39  THR D O     1 
ATOM   7166  C CB    . THR D 2 39  ? 133.724 -5.800   3.140   1.00 52.76  ? 39  THR D CB    1 
ATOM   7167  O OG1   . THR D 2 39  ? 134.752 -4.805   3.219   1.00 52.62  ? 39  THR D OG1   1 
ATOM   7168  C CG2   . THR D 2 39  ? 134.334 -7.131   3.491   1.00 52.69  ? 39  THR D CG2   1 
ATOM   7169  N N     . ASN D 2 40  ? 130.891 -6.768   1.908   1.00 52.40  ? 40  ASN D N     1 
ATOM   7170  C CA    . ASN D 2 40  ? 129.902 -7.812   1.746   1.00 52.39  ? 40  ASN D CA    1 
ATOM   7171  C C     . ASN D 2 40  ? 129.637 -8.115   0.282   1.00 52.03  ? 40  ASN D C     1 
ATOM   7172  O O     . ASN D 2 40  ? 129.582 -9.278   -0.114  1.00 52.20  ? 40  ASN D O     1 
ATOM   7173  C CB    . ASN D 2 40  ? 128.606 -7.446   2.467   1.00 53.40  ? 40  ASN D CB    1 
ATOM   7174  C CG    . ASN D 2 40  ? 128.639 -7.787   3.949   1.00 53.52  ? 40  ASN D CG    1 
ATOM   7175  O OD1   . ASN D 2 40  ? 127.758 -7.389   4.686   1.00 54.10  ? 40  ASN D OD1   1 
ATOM   7176  N ND2   . ASN D 2 40  ? 129.643 -8.538   4.380   1.00 53.73  ? 40  ASN D ND2   1 
ATOM   7177  N N     . GLU D 2 41  ? 129.493 -7.065   -0.519  1.00 51.58  ? 41  GLU D N     1 
ATOM   7178  C CA    . GLU D 2 41  ? 129.212 -7.223   -1.944  1.00 51.25  ? 41  GLU D CA    1 
ATOM   7179  C C     . GLU D 2 41  ? 130.408 -7.796   -2.674  1.00 50.70  ? 41  GLU D C     1 
ATOM   7180  O O     . GLU D 2 41  ? 130.236 -8.574   -3.604  1.00 51.10  ? 41  GLU D O     1 
ATOM   7181  C CB    . GLU D 2 41  ? 128.772 -5.909   -2.579  1.00 51.22  ? 41  GLU D CB    1 
ATOM   7182  C CG    . GLU D 2 41  ? 127.358 -5.533   -2.273  1.00 51.12  ? 41  GLU D CG    1 
ATOM   7183  C CD    . GLU D 2 41  ? 126.919 -4.291   -3.013  1.00 51.80  ? 41  GLU D CD    1 
ATOM   7184  O OE1   . GLU D 2 41  ? 126.896 -3.207   -2.406  1.00 52.22  ? 41  GLU D OE1   1 
ATOM   7185  O OE2   . GLU D 2 41  ? 126.594 -4.393   -4.209  1.00 52.39  ? 41  GLU D OE2   1 
ATOM   7186  N N     . THR D 2 42  ? 131.606 -7.403   -2.250  1.00 50.23  ? 42  THR D N     1 
ATOM   7187  C CA    . THR D 2 42  ? 132.855 -7.964   -2.772  1.00 50.43  ? 42  THR D CA    1 
ATOM   7188  C C     . THR D 2 42  ? 132.942 -9.457   -2.456  1.00 50.97  ? 42  THR D C     1 
ATOM   7189  O O     . THR D 2 42  ? 133.336 -10.270  -3.299  1.00 51.06  ? 42  THR D O     1 
ATOM   7190  C CB    . THR D 2 42  ? 134.083 -7.245   -2.181  1.00 50.05  ? 42  THR D CB    1 
ATOM   7191  O OG1   . THR D 2 42  ? 133.978 -5.841   -2.434  1.00 50.67  ? 42  THR D OG1   1 
ATOM   7192  C CG2   . THR D 2 42  ? 135.356 -7.745   -2.804  1.00 49.70  ? 42  THR D CG2   1 
ATOM   7193  N N     . THR D 2 43  ? 132.561 -9.809   -1.237  1.00 51.51  ? 43  THR D N     1 
ATOM   7194  C CA    . THR D 2 43  ? 132.545 -11.190  -0.830  1.00 52.48  ? 43  THR D CA    1 
ATOM   7195  C C     . THR D 2 43  ? 131.673 -11.974  -1.792  1.00 53.29  ? 43  THR D C     1 
ATOM   7196  O O     . THR D 2 43  ? 132.133 -12.958  -2.368  1.00 53.97  ? 43  THR D O     1 
ATOM   7197  C CB    . THR D 2 43  ? 132.038 -11.336  0.609   1.00 53.14  ? 43  THR D CB    1 
ATOM   7198  O OG1   . THR D 2 43  ? 132.928 -10.635  1.492   1.00 53.40  ? 43  THR D OG1   1 
ATOM   7199  C CG2   . THR D 2 43  ? 131.943 -12.812  1.020   1.00 53.72  ? 43  THR D CG2   1 
ATOM   7200  N N     . LYS D 2 44  ? 130.433 -11.519  -1.993  1.00 53.80  ? 44  LYS D N     1 
ATOM   7201  C CA    . LYS D 2 44  ? 129.446 -12.268  -2.793  1.00 54.48  ? 44  LYS D CA    1 
ATOM   7202  C C     . LYS D 2 44  ? 129.937 -12.430  -4.226  1.00 54.75  ? 44  LYS D C     1 
ATOM   7203  O O     . LYS D 2 44  ? 129.651 -13.432  -4.890  1.00 55.13  ? 44  LYS D O     1 
ATOM   7204  C CB    . LYS D 2 44  ? 128.082 -11.576  -2.775  1.00 54.66  ? 44  LYS D CB    1 
ATOM   7205  C CG    . LYS D 2 44  ? 127.511 -11.341  -1.383  1.00 54.24  ? 44  LYS D CG    1 
ATOM   7206  C CD    . LYS D 2 44  ? 126.112 -10.788  -1.460  1.00 53.89  ? 44  LYS D CD    1 
ATOM   7207  C CE    . LYS D 2 44  ? 125.968 -9.539   -0.620  1.00 53.19  ? 44  LYS D CE    1 
ATOM   7208  N NZ    . LYS D 2 44  ? 124.697 -8.824   -0.942  1.00 53.72  ? 44  LYS D NZ    1 
ATOM   7209  N N     . ALA D 2 45  ? 130.699 -11.434  -4.675  1.00 54.53  ? 45  ALA D N     1 
ATOM   7210  C CA    . ALA D 2 45  ? 131.258 -11.396  -6.013  1.00 54.98  ? 45  ALA D CA    1 
ATOM   7211  C C     . ALA D 2 45  ? 132.343 -12.461  -6.175  1.00 55.80  ? 45  ALA D C     1 
ATOM   7212  O O     . ALA D 2 45  ? 132.546 -12.990  -7.280  1.00 56.58  ? 45  ALA D O     1 
ATOM   7213  C CB    . ALA D 2 45  ? 131.811 -10.022  -6.294  1.00 54.04  ? 45  ALA D CB    1 
ATOM   7214  N N     . VAL D 2 46  ? 133.036 -12.778  -5.078  1.00 55.89  ? 46  VAL D N     1 
ATOM   7215  C CA    . VAL D 2 46  ? 134.070 -13.808  -5.107  1.00 56.52  ? 46  VAL D CA    1 
ATOM   7216  C C     . VAL D 2 46  ? 133.411 -15.177  -4.978  1.00 58.23  ? 46  VAL D C     1 
ATOM   7217  O O     . VAL D 2 46  ? 133.668 -16.087  -5.767  1.00 59.02  ? 46  VAL D O     1 
ATOM   7218  C CB    . VAL D 2 46  ? 135.117 -13.580  -4.007  1.00 55.93  ? 46  VAL D CB    1 
ATOM   7219  C CG1   . VAL D 2 46  ? 136.088 -14.752  -3.919  1.00 56.21  ? 46  VAL D CG1   1 
ATOM   7220  C CG2   . VAL D 2 46  ? 135.856 -12.261  -4.241  1.00 54.35  ? 46  VAL D CG2   1 
ATOM   7221  N N     . GLU D 2 47  ? 132.534 -15.302  -3.991  1.00 59.42  ? 47  GLU D N     1 
ATOM   7222  C CA    . GLU D 2 47  ? 131.788 -16.533  -3.759  1.00 61.66  ? 47  GLU D CA    1 
ATOM   7223  C C     . GLU D 2 47  ? 131.066 -16.983  -5.045  1.00 62.05  ? 47  GLU D C     1 
ATOM   7224  O O     . GLU D 2 47  ? 130.985 -18.174  -5.333  1.00 62.93  ? 47  GLU D O     1 
ATOM   7225  C CB    . GLU D 2 47  ? 130.801 -16.321  -2.600  1.00 62.34  ? 47  GLU D CB    1 
ATOM   7226  C CG    . GLU D 2 47  ? 130.907 -17.331  -1.443  1.00 66.24  ? 47  GLU D CG    1 
ATOM   7227  C CD    . GLU D 2 47  ? 130.134 -16.874  -0.171  1.00 72.12  ? 47  GLU D CD    1 
ATOM   7228  O OE1   . GLU D 2 47  ? 130.610 -17.157  0.964   1.00 72.31  ? 47  GLU D OE1   1 
ATOM   7229  O OE2   . GLU D 2 47  ? 129.051 -16.228  -0.298  1.00 74.51  ? 47  GLU D OE2   1 
ATOM   7230  N N     . ARG D 2 48  ? 130.571 -16.017  -5.818  1.00 61.79  ? 48  ARG D N     1 
ATOM   7231  C CA    . ARG D 2 48  ? 129.880 -16.288  -7.091  1.00 62.48  ? 48  ARG D CA    1 
ATOM   7232  C C     . ARG D 2 48  ? 130.812 -16.383  -8.308  1.00 62.83  ? 48  ARG D C     1 
ATOM   7233  O O     . ARG D 2 48  ? 130.382 -16.768  -9.388  1.00 63.64  ? 48  ARG D O     1 
ATOM   7234  C CB    . ARG D 2 48  ? 128.812 -15.227  -7.352  1.00 61.94  ? 48  ARG D CB    1 
ATOM   7235  C CG    . ARG D 2 48  ? 127.676 -15.259  -6.388  1.00 60.25  ? 48  ARG D CG    1 
ATOM   7236  C CD    . ARG D 2 48  ? 126.892 -13.981  -6.477  1.00 56.89  ? 48  ARG D CD    1 
ATOM   7237  N NE    . ARG D 2 48  ? 125.925 -13.892  -5.390  1.00 55.17  ? 48  ARG D NE    1 
ATOM   7238  C CZ    . ARG D 2 48  ? 125.315 -12.777  -5.025  1.00 53.00  ? 48  ARG D CZ    1 
ATOM   7239  N NH1   . ARG D 2 48  ? 125.580 -11.652  -5.652  1.00 52.97  ? 48  ARG D NH1   1 
ATOM   7240  N NH2   . ARG D 2 48  ? 124.452 -12.782  -4.026  1.00 52.94  ? 48  ARG D NH2   1 
ATOM   7241  N N     . GLY D 2 49  ? 132.076 -16.017  -8.135  1.00 62.44  ? 49  GLY D N     1 
ATOM   7242  C CA    . GLY D 2 49  ? 133.066 -16.164  -9.203  1.00 63.68  ? 49  GLY D CA    1 
ATOM   7243  C C     . GLY D 2 49  ? 132.985 -15.110  -10.296 1.00 64.02  ? 49  GLY D C     1 
ATOM   7244  O O     . GLY D 2 49  ? 133.602 -15.238  -11.367 1.00 64.36  ? 49  GLY D O     1 
ATOM   7245  N N     . GLN D 2 50  ? 132.234 -14.054  -10.011 1.00 63.94  ? 50  GLN D N     1 
ATOM   7246  C CA    . GLN D 2 50  ? 132.033 -12.980  -10.967 1.00 64.24  ? 50  GLN D CA    1 
ATOM   7247  C C     . GLN D 2 50  ? 133.227 -12.037  -11.064 1.00 63.65  ? 50  GLN D C     1 
ATOM   7248  O O     . GLN D 2 50  ? 133.488 -11.500  -12.136 1.00 64.65  ? 50  GLN D O     1 
ATOM   7249  C CB    . GLN D 2 50  ? 130.768 -12.198  -10.617 1.00 64.11  ? 50  GLN D CB    1 
ATOM   7250  C CG    . GLN D 2 50  ? 129.515 -13.034  -10.687 1.00 65.20  ? 50  GLN D CG    1 
ATOM   7251  C CD    . GLN D 2 50  ? 128.324 -12.345  -10.076 1.00 65.63  ? 50  GLN D CD    1 
ATOM   7252  O OE1   . GLN D 2 50  ? 128.465 -11.384  -9.315  1.00 64.97  ? 50  GLN D OE1   1 
ATOM   7253  N NE2   . GLN D 2 50  ? 127.133 -12.834  -10.403 1.00 66.83  ? 50  GLN D NE2   1 
ATOM   7254  N N     . ALA D 2 51  ? 133.938 -11.836  -9.956  1.00 62.73  ? 51  ALA D N     1 
ATOM   7255  C CA    . ALA D 2 51  ? 134.985 -10.819  -9.878  1.00 62.19  ? 51  ALA D CA    1 
ATOM   7256  C C     . ALA D 2 51  ? 136.243 -11.215  -10.654 1.00 62.71  ? 51  ALA D C     1 
ATOM   7257  O O     . ALA D 2 51  ? 136.673 -12.370  -10.574 1.00 63.17  ? 51  ALA D O     1 
ATOM   7258  C CB    . ALA D 2 51  ? 135.324 -10.534  -8.428  1.00 61.31  ? 51  ALA D CB    1 
ATOM   7259  N N     . LYS D 2 52  ? 136.811 -10.259  -11.404 1.00 62.76  ? 52  LYS D N     1 
ATOM   7260  C CA    . LYS D 2 52  ? 138.062 -10.466  -12.147 1.00 63.17  ? 52  LYS D CA    1 
ATOM   7261  C C     . LYS D 2 52  ? 139.253 -9.976   -11.340 1.00 62.64  ? 52  LYS D C     1 
ATOM   7262  O O     . LYS D 2 52  ? 140.334 -10.565  -11.404 1.00 63.22  ? 52  LYS D O     1 
ATOM   7263  C CB    . LYS D 2 52  ? 138.041 -9.734   -13.484 1.00 63.84  ? 52  LYS D CB    1 
ATOM   7264  C CG    . LYS D 2 52  ? 136.728 -9.817   -14.240 1.00 65.04  ? 52  LYS D CG    1 
ATOM   7265  C CD    . LYS D 2 52  ? 136.401 -11.231  -14.700 1.00 66.69  ? 52  LYS D CD    1 
ATOM   7266  C CE    . LYS D 2 52  ? 135.449 -11.185  -15.879 1.00 68.56  ? 52  LYS D CE    1 
ATOM   7267  N NZ    . LYS D 2 52  ? 134.405 -12.230  -15.760 1.00 70.17  ? 52  LYS D NZ    1 
ATOM   7268  N N     . LEU D 2 53  ? 139.042 -8.895   -10.593 1.00 61.71  ? 53  LEU D N     1 
ATOM   7269  C CA    . LEU D 2 53  ? 140.056 -8.325   -9.719  1.00 61.13  ? 53  LEU D CA    1 
ATOM   7270  C C     . LEU D 2 53  ? 139.418 -7.824   -8.436  1.00 60.49  ? 53  LEU D C     1 
ATOM   7271  O O     . LEU D 2 53  ? 138.384 -7.145   -8.479  1.00 60.50  ? 53  LEU D O     1 
ATOM   7272  C CB    . LEU D 2 53  ? 140.765 -7.164   -10.417 1.00 61.45  ? 53  LEU D CB    1 
ATOM   7273  C CG    . LEU D 2 53  ? 141.741 -6.297   -9.622  1.00 60.93  ? 53  LEU D CG    1 
ATOM   7274  C CD1   . LEU D 2 53  ? 142.929 -7.096   -9.149  1.00 60.79  ? 53  LEU D CD1   1 
ATOM   7275  C CD2   . LEU D 2 53  ? 142.204 -5.170   -10.498 1.00 62.30  ? 53  LEU D CD2   1 
ATOM   7276  N N     . VAL D 2 54  ? 140.047 -8.148   -7.304  1.00 59.92  ? 54  VAL D N     1 
ATOM   7277  C CA    . VAL D 2 54  ? 139.591 -7.689   -5.992  1.00 59.00  ? 54  VAL D CA    1 
ATOM   7278  C C     . VAL D 2 54  ? 140.586 -6.694   -5.393  1.00 58.97  ? 54  VAL D C     1 
ATOM   7279  O O     . VAL D 2 54  ? 141.787 -6.951   -5.377  1.00 59.25  ? 54  VAL D O     1 
ATOM   7280  C CB    . VAL D 2 54  ? 139.353 -8.879   -5.053  1.00 58.80  ? 54  VAL D CB    1 
ATOM   7281  C CG1   . VAL D 2 54  ? 139.144 -8.422   -3.628  1.00 58.42  ? 54  VAL D CG1   1 
ATOM   7282  C CG2   . VAL D 2 54  ? 138.150 -9.661   -5.521  1.00 59.21  ? 54  VAL D CG2   1 
ATOM   7283  N N     . ILE D 2 55  ? 140.071 -5.559   -4.920  1.00 58.75  ? 55  ILE D N     1 
ATOM   7284  C CA    . ILE D 2 55  ? 140.886 -4.473   -4.371  1.00 59.16  ? 55  ILE D CA    1 
ATOM   7285  C C     . ILE D 2 55  ? 140.621 -4.276   -2.879  1.00 59.52  ? 55  ILE D C     1 
ATOM   7286  O O     . ILE D 2 55  ? 139.496 -3.949   -2.472  1.00 59.63  ? 55  ILE D O     1 
ATOM   7287  C CB    . ILE D 2 55  ? 140.602 -3.133   -5.073  1.00 59.27  ? 55  ILE D CB    1 
ATOM   7288  C CG1   . ILE D 2 55  ? 140.709 -3.275   -6.587  1.00 59.73  ? 55  ILE D CG1   1 
ATOM   7289  C CG2   . ILE D 2 55  ? 141.525 -2.039   -4.556  1.00 59.31  ? 55  ILE D CG2   1 
ATOM   7290  C CD1   . ILE D 2 55  ? 139.371 -3.485   -7.278  1.00 60.02  ? 55  ILE D CD1   1 
ATOM   7291  N N     . ILE D 2 56  ? 141.665 -4.446   -2.072  1.00 59.92  ? 56  ILE D N     1 
ATOM   7292  C CA    . ILE D 2 56  ? 141.545 -4.362   -0.619  1.00 59.85  ? 56  ILE D CA    1 
ATOM   7293  C C     . ILE D 2 56  ? 142.353 -3.181   -0.065  1.00 61.08  ? 56  ILE D C     1 
ATOM   7294  O O     . ILE D 2 56  ? 143.519 -3.002   -0.414  1.00 61.87  ? 56  ILE D O     1 
ATOM   7295  C CB    . ILE D 2 56  ? 141.993 -5.677   0.048   1.00 59.51  ? 56  ILE D CB    1 
ATOM   7296  C CG1   . ILE D 2 56  ? 141.403 -6.883   -0.700  1.00 58.69  ? 56  ILE D CG1   1 
ATOM   7297  C CG2   . ILE D 2 56  ? 141.589 -5.692   1.514   1.00 59.54  ? 56  ILE D CG2   1 
ATOM   7298  C CD1   . ILE D 2 56  ? 142.089 -8.207   -0.420  1.00 57.58  ? 56  ILE D CD1   1 
ATOM   7299  N N     . ALA D 2 57  ? 141.724 -2.370   0.784   1.00 61.66  ? 57  ALA D N     1 
ATOM   7300  C CA    . ALA D 2 57  ? 142.399 -1.257   1.451   1.00 62.61  ? 57  ALA D CA    1 
ATOM   7301  C C     . ALA D 2 57  ? 143.276 -1.755   2.586   1.00 63.58  ? 57  ALA D C     1 
ATOM   7302  O O     . ALA D 2 57  ? 142.990 -2.788   3.190   1.00 63.38  ? 57  ALA D O     1 
ATOM   7303  C CB    . ALA D 2 57  ? 141.391 -0.258   1.965   1.00 62.64  ? 57  ALA D CB    1 
ATOM   7304  N N     . GLU D 2 58  ? 144.336 -1.002   2.878   1.00 65.31  ? 58  GLU D N     1 
ATOM   7305  C CA    . GLU D 2 58  ? 145.348 -1.389   3.873   1.00 66.70  ? 58  GLU D CA    1 
ATOM   7306  C C     . GLU D 2 58  ? 145.102 -0.836   5.280   1.00 67.46  ? 58  GLU D C     1 
ATOM   7307  O O     . GLU D 2 58  ? 145.768 -1.244   6.243   1.00 68.43  ? 58  GLU D O     1 
ATOM   7308  C CB    . GLU D 2 58  ? 146.747 -0.980   3.388   1.00 67.79  ? 58  GLU D CB    1 
ATOM   7309  C CG    . GLU D 2 58  ? 147.385 -1.959   2.398   1.00 68.49  ? 58  GLU D CG    1 
ATOM   7310  C CD    . GLU D 2 58  ? 148.592 -1.375   1.677   1.00 71.04  ? 58  GLU D CD    1 
ATOM   7311  O OE1   . GLU D 2 58  ? 148.957 -0.204   1.944   1.00 73.25  ? 58  GLU D OE1   1 
ATOM   7312  O OE2   . GLU D 2 58  ? 149.176 -2.091   0.835   1.00 71.24  ? 58  GLU D OE2   1 
ATOM   7313  N N     . ASP D 2 59  ? 144.150 0.086    5.393   1.00 67.50  ? 59  ASP D N     1 
ATOM   7314  C CA    . ASP D 2 59  ? 143.902 0.789    6.644   1.00 68.75  ? 59  ASP D CA    1 
ATOM   7315  C C     . ASP D 2 59  ? 142.507 0.501    7.217   1.00 68.31  ? 59  ASP D C     1 
ATOM   7316  O O     . ASP D 2 59  ? 141.849 1.404    7.763   1.00 68.84  ? 59  ASP D O     1 
ATOM   7317  C CB    . ASP D 2 59  ? 144.096 2.291    6.437   1.00 69.80  ? 59  ASP D CB    1 
ATOM   7318  C CG    . ASP D 2 59  ? 143.196 2.847    5.354   1.00 70.12  ? 59  ASP D CG    1 
ATOM   7319  O OD1   . ASP D 2 59  ? 142.753 2.043    4.501   1.00 70.60  ? 59  ASP D OD1   1 
ATOM   7320  O OD2   . ASP D 2 59  ? 142.928 4.076    5.352   1.00 71.51  ? 59  ASP D OD2   1 
ATOM   7321  N N     . VAL D 2 60  ? 142.072 -0.759   7.095   1.00 67.39  ? 60  VAL D N     1 
ATOM   7322  C CA    . VAL D 2 60  ? 140.778 -1.221   7.632   1.00 66.72  ? 60  VAL D CA    1 
ATOM   7323  C C     . VAL D 2 60  ? 140.851 -1.353   9.158   1.00 67.67  ? 60  VAL D C     1 
ATOM   7324  O O     . VAL D 2 60  ? 141.805 -1.941   9.685   1.00 68.03  ? 60  VAL D O     1 
ATOM   7325  C CB    . VAL D 2 60  ? 140.320 -2.565   6.986   1.00 65.62  ? 60  VAL D CB    1 
ATOM   7326  C CG1   . VAL D 2 60  ? 138.869 -2.867   7.340   1.00 64.96  ? 60  VAL D CG1   1 
ATOM   7327  C CG2   . VAL D 2 60  ? 140.477 -2.518   5.483   1.00 64.57  ? 60  VAL D CG2   1 
ATOM   7328  N N     . GLN D 2 61  ? 139.841 -0.827   9.857   1.00 68.31  ? 61  GLN D N     1 
ATOM   7329  C CA    . GLN D 2 61  ? 139.973 -0.602   11.295  1.00 69.77  ? 61  GLN D CA    1 
ATOM   7330  C C     . GLN D 2 61  ? 139.083 -1.338   12.290  1.00 69.61  ? 61  GLN D C     1 
ATOM   7331  O O     . GLN D 2 61  ? 138.571 -0.752   13.244  1.00 71.30  ? 61  GLN D O     1 
ATOM   7332  C CB    . GLN D 2 61  ? 140.094 0.892    11.641  1.00 71.19  ? 61  GLN D CB    1 
ATOM   7333  C CG    . GLN D 2 61  ? 141.545 1.333    11.943  1.00 73.53  ? 61  GLN D CG    1 
ATOM   7334  C CD    . GLN D 2 61  ? 142.269 0.392    12.900  1.00 75.33  ? 61  GLN D CD    1 
ATOM   7335  O OE1   . GLN D 2 61  ? 141.794 0.125    14.007  1.00 78.21  ? 61  GLN D OE1   1 
ATOM   7336  N NE2   . GLN D 2 61  ? 143.424 -0.113   12.475  1.00 75.06  ? 61  GLN D NE2   1 
ATOM   7337  N N     . PRO D 2 62  ? 138.772 -2.586   11.969  1.00 68.11  ? 62  PRO D N     1 
ATOM   7338  C CA    . PRO D 2 62  ? 139.304 -3.757   12.631  1.00 67.64  ? 62  PRO D CA    1 
ATOM   7339  C C     . PRO D 2 62  ? 139.865 -4.574   11.457  1.00 66.01  ? 62  PRO D C     1 
ATOM   7340  O O     . PRO D 2 62  ? 139.128 -4.886   10.520  1.00 65.07  ? 62  PRO D O     1 
ATOM   7341  C CB    . PRO D 2 62  ? 138.071 -4.418   13.271  1.00 67.67  ? 62  PRO D CB    1 
ATOM   7342  C CG    . PRO D 2 62  ? 136.990 -3.416   13.192  1.00 67.96  ? 62  PRO D CG    1 
ATOM   7343  C CD    . PRO D 2 62  ? 137.304 -2.650   11.935  1.00 67.80  ? 62  PRO D CD    1 
ATOM   7344  N N     . GLU D 2 63  ? 141.169 -4.863   11.464  1.00 65.32  ? 63  GLU D N     1 
ATOM   7345  C CA    . GLU D 2 63  ? 141.837 -5.578   10.366  1.00 63.60  ? 63  GLU D CA    1 
ATOM   7346  C C     . GLU D 2 63  ? 141.072 -6.784   9.841   1.00 61.90  ? 63  GLU D C     1 
ATOM   7347  O O     . GLU D 2 63  ? 141.097 -7.084   8.641   1.00 61.16  ? 63  GLU D O     1 
ATOM   7348  C CB    . GLU D 2 63  ? 143.186 -6.087   10.827  1.00 64.69  ? 63  GLU D CB    1 
ATOM   7349  C CG    . GLU D 2 63  ? 144.179 -5.021   11.105  1.00 67.50  ? 63  GLU D CG    1 
ATOM   7350  C CD    . GLU D 2 63  ? 145.491 -5.598   11.568  1.00 71.27  ? 63  GLU D CD    1 
ATOM   7351  O OE1   . GLU D 2 63  ? 146.193 -4.897   12.334  1.00 73.80  ? 63  GLU D OE1   1 
ATOM   7352  O OE2   . GLU D 2 63  ? 145.808 -6.749   11.170  1.00 71.01  ? 63  GLU D OE2   1 
ATOM   7353  N N     . GLU D 2 64  ? 140.403 -7.476   10.754  1.00 60.89  ? 64  GLU D N     1 
ATOM   7354  C CA    . GLU D 2 64  ? 139.793 -8.767   10.475  1.00 59.42  ? 64  GLU D CA    1 
ATOM   7355  C C     . GLU D 2 64  ? 138.579 -8.694   9.554   1.00 57.52  ? 64  GLU D C     1 
ATOM   7356  O O     . GLU D 2 64  ? 138.188 -9.688   8.964   1.00 56.97  ? 64  GLU D O     1 
ATOM   7357  C CB    . GLU D 2 64  ? 139.457 -9.473   11.787  1.00 60.39  ? 64  GLU D CB    1 
ATOM   7358  C CG    . GLU D 2 64  ? 140.688 -9.738   12.672  1.00 61.66  ? 64  GLU D CG    1 
ATOM   7359  C CD    . GLU D 2 64  ? 141.000 -8.615   13.687  1.00 61.88  ? 64  GLU D CD    1 
ATOM   7360  O OE1   . GLU D 2 64  ? 140.592 -7.457   13.468  1.00 59.40  ? 64  GLU D OE1   1 
ATOM   7361  O OE2   . GLU D 2 64  ? 141.661 -8.899   14.718  1.00 62.98  ? 64  GLU D OE2   1 
ATOM   7362  N N     . ILE D 2 65  ? 138.014 -7.502   9.420   1.00 56.47  ? 65  ILE D N     1 
ATOM   7363  C CA    . ILE D 2 65  ? 136.876 -7.249   8.530   1.00 54.98  ? 65  ILE D CA    1 
ATOM   7364  C C     . ILE D 2 65  ? 137.090 -7.732   7.095   1.00 54.39  ? 65  ILE D C     1 
ATOM   7365  O O     . ILE D 2 65  ? 136.160 -8.217   6.473   1.00 54.10  ? 65  ILE D O     1 
ATOM   7366  C CB    . ILE D 2 65  ? 136.483 -5.762   8.533   1.00 54.42  ? 65  ILE D CB    1 
ATOM   7367  C CG1   . ILE D 2 65  ? 135.784 -5.429   9.838   1.00 53.49  ? 65  ILE D CG1   1 
ATOM   7368  C CG2   . ILE D 2 65  ? 135.595 -5.434   7.350   1.00 53.12  ? 65  ILE D CG2   1 
ATOM   7369  C CD1   . ILE D 2 65  ? 135.213 -4.059   9.871   1.00 53.30  ? 65  ILE D CD1   1 
ATOM   7370  N N     . VAL D 2 66  ? 138.306 -7.609   6.579   1.00 54.48  ? 66  VAL D N     1 
ATOM   7371  C CA    . VAL D 2 66  ? 138.594 -8.049   5.209   1.00 54.59  ? 66  VAL D CA    1 
ATOM   7372  C C     . VAL D 2 66  ? 139.545 -9.251   5.148   1.00 55.33  ? 66  VAL D C     1 
ATOM   7373  O O     . VAL D 2 66  ? 139.979 -9.664   4.061   1.00 54.85  ? 66  VAL D O     1 
ATOM   7374  C CB    . VAL D 2 66  ? 139.170 -6.898   4.360   1.00 54.20  ? 66  VAL D CB    1 
ATOM   7375  C CG1   . VAL D 2 66  ? 138.097 -5.850   4.099   1.00 54.78  ? 66  VAL D CG1   1 
ATOM   7376  C CG2   . VAL D 2 66  ? 140.353 -6.272   5.052   1.00 54.86  ? 66  VAL D CG2   1 
ATOM   7377  N N     . ALA D 2 67  ? 139.854 -9.812   6.320   1.00 56.53  ? 67  ALA D N     1 
ATOM   7378  C CA    . ALA D 2 67  ? 140.893 -10.828  6.442   1.00 57.60  ? 67  ALA D CA    1 
ATOM   7379  C C     . ALA D 2 67  ? 140.553 -12.106  5.701   1.00 58.16  ? 67  ALA D C     1 
ATOM   7380  O O     . ALA D 2 67  ? 141.449 -12.875  5.341   1.00 59.12  ? 67  ALA D O     1 
ATOM   7381  C CB    . ALA D 2 67  ? 141.148 -11.121  7.876   1.00 58.55  ? 67  ALA D CB    1 
ATOM   7382  N N     . HIS D 2 68  ? 139.258 -12.318  5.470   1.00 58.08  ? 68  HIS D N     1 
ATOM   7383  C CA    . HIS D 2 68  ? 138.758 -13.525  4.829   1.00 58.58  ? 68  HIS D CA    1 
ATOM   7384  C C     . HIS D 2 68  ? 138.940 -13.523  3.330   1.00 58.42  ? 68  HIS D C     1 
ATOM   7385  O O     . HIS D 2 68  ? 138.956 -14.588  2.708   1.00 58.98  ? 68  HIS D O     1 
ATOM   7386  C CB    . HIS D 2 68  ? 137.290 -13.754  5.180   1.00 58.74  ? 68  HIS D CB    1 
ATOM   7387  C CG    . HIS D 2 68  ? 136.348 -12.768  4.564   1.00 58.49  ? 68  HIS D CG    1 
ATOM   7388  N ND1   . HIS D 2 68  ? 136.232 -11.468  5.003   1.00 58.64  ? 68  HIS D ND1   1 
ATOM   7389  C CD2   . HIS D 2 68  ? 135.446 -12.907  3.564   1.00 58.81  ? 68  HIS D CD2   1 
ATOM   7390  C CE1   . HIS D 2 68  ? 135.314 -10.843  4.288   1.00 58.03  ? 68  HIS D CE1   1 
ATOM   7391  N NE2   . HIS D 2 68  ? 134.819 -11.695  3.409   1.00 57.72  ? 68  HIS D NE2   1 
ATOM   7392  N N     . LEU D 2 69  ? 139.089 -12.327  2.760   1.00 58.27  ? 69  LEU D N     1 
ATOM   7393  C CA    . LEU D 2 69  ? 139.233 -12.145  1.305   1.00 58.31  ? 69  LEU D CA    1 
ATOM   7394  C C     . LEU D 2 69  ? 140.473 -12.804  0.667   1.00 59.35  ? 69  LEU D C     1 
ATOM   7395  O O     . LEU D 2 69  ? 140.347 -13.472  -0.360  1.00 59.60  ? 69  LEU D O     1 
ATOM   7396  C CB    . LEU D 2 69  ? 139.145 -10.669  0.916   1.00 57.35  ? 69  LEU D CB    1 
ATOM   7397  C CG    . LEU D 2 69  ? 137.810 -9.977   1.137   1.00 56.27  ? 69  LEU D CG    1 
ATOM   7398  C CD1   . LEU D 2 69  ? 137.958 -8.511   0.817   1.00 55.09  ? 69  LEU D CD1   1 
ATOM   7399  C CD2   . LEU D 2 69  ? 136.779 -10.606  0.253   1.00 56.87  ? 69  LEU D CD2   1 
ATOM   7400  N N     . PRO D 2 70  ? 141.670 -12.619  1.254   1.00 60.31  ? 70  PRO D N     1 
ATOM   7401  C CA    . PRO D 2 70  ? 142.773 -13.345  0.624   1.00 61.56  ? 70  PRO D CA    1 
ATOM   7402  C C     . PRO D 2 70  ? 142.501 -14.854  0.541   1.00 62.70  ? 70  PRO D C     1 
ATOM   7403  O O     . PRO D 2 70  ? 142.712 -15.459  -0.515  1.00 62.98  ? 70  PRO D O     1 
ATOM   7404  C CB    . PRO D 2 70  ? 143.967 -13.028  1.535   1.00 62.09  ? 70  PRO D CB    1 
ATOM   7405  C CG    . PRO D 2 70  ? 143.654 -11.687  2.081   1.00 61.09  ? 70  PRO D CG    1 
ATOM   7406  C CD    . PRO D 2 70  ? 142.153 -11.721  2.320   1.00 60.37  ? 70  PRO D CD    1 
ATOM   7407  N N     . LEU D 2 71  ? 141.999 -15.434  1.628   1.00 63.63  ? 71  LEU D N     1 
ATOM   7408  C CA    . LEU D 2 71  ? 141.723 -16.864  1.679   1.00 65.31  ? 71  LEU D CA    1 
ATOM   7409  C C     . LEU D 2 71  ? 140.688 -17.248  0.642   1.00 65.17  ? 71  LEU D C     1 
ATOM   7410  O O     . LEU D 2 71  ? 140.797 -18.307  0.011   1.00 66.08  ? 71  LEU D O     1 
ATOM   7411  C CB    . LEU D 2 71  ? 141.218 -17.287  3.068   1.00 66.19  ? 71  LEU D CB    1 
ATOM   7412  C CG    . LEU D 2 71  ? 142.094 -17.189  4.325   1.00 67.58  ? 71  LEU D CG    1 
ATOM   7413  C CD1   . LEU D 2 71  ? 141.365 -17.863  5.483   1.00 69.25  ? 71  LEU D CD1   1 
ATOM   7414  C CD2   . LEU D 2 71  ? 143.494 -17.802  4.139   1.00 69.31  ? 71  LEU D CD2   1 
ATOM   7415  N N     . LEU D 2 72  ? 139.688 -16.384  0.470   1.00 64.35  ? 72  LEU D N     1 
ATOM   7416  C CA    . LEU D 2 72  ? 138.523 -16.703  -0.369  1.00 64.63  ? 72  LEU D CA    1 
ATOM   7417  C C     . LEU D 2 72  ? 138.852 -16.596  -1.855  1.00 64.86  ? 72  LEU D C     1 
ATOM   7418  O O     . LEU D 2 72  ? 138.426 -17.433  -2.658  1.00 65.36  ? 72  LEU D O     1 
ATOM   7419  C CB    . LEU D 2 72  ? 137.342 -15.787  -0.024  1.00 63.63  ? 72  LEU D CB    1 
ATOM   7420  C CG    . LEU D 2 72  ? 136.009 -16.415  0.371   1.00 63.25  ? 72  LEU D CG    1 
ATOM   7421  C CD1   . LEU D 2 72  ? 135.022 -15.303  0.629   1.00 62.49  ? 72  LEU D CD1   1 
ATOM   7422  C CD2   . LEU D 2 72  ? 135.489 -17.368  -0.687  1.00 64.34  ? 72  LEU D CD2   1 
ATOM   7423  N N     . CYS D 2 73  ? 139.615 -15.556  -2.190  1.00 64.68  ? 73  CYS D N     1 
ATOM   7424  C CA    . CYS D 2 73  ? 140.081 -15.294  -3.529  1.00 65.22  ? 73  CYS D CA    1 
ATOM   7425  C C     . CYS D 2 73  ? 141.000 -16.378  -4.054  1.00 66.67  ? 73  CYS D C     1 
ATOM   7426  O O     . CYS D 2 73  ? 140.960 -16.687  -5.244  1.00 66.85  ? 73  CYS D O     1 
ATOM   7427  C CB    . CYS D 2 73  ? 140.817 -13.971  -3.549  1.00 64.73  ? 73  CYS D CB    1 
ATOM   7428  S SG    . CYS D 2 73  ? 139.718 -12.559  -3.680  1.00 65.64  ? 73  CYS D SG    1 
ATOM   7429  N N     . ASP D 2 74  ? 141.828 -16.944  -3.174  1.00 67.95  ? 74  ASP D N     1 
ATOM   7430  C CA    . ASP D 2 74  ? 142.724 -18.045  -3.554  1.00 69.94  ? 74  ASP D CA    1 
ATOM   7431  C C     . ASP D 2 74  ? 141.984 -19.342  -3.894  1.00 70.91  ? 74  ASP D C     1 
ATOM   7432  O O     . ASP D 2 74  ? 142.374 -20.059  -4.816  1.00 71.98  ? 74  ASP D O     1 
ATOM   7433  C CB    . ASP D 2 74  ? 143.806 -18.287  -2.494  1.00 70.86  ? 74  ASP D CB    1 
ATOM   7434  C CG    . ASP D 2 74  ? 144.986 -17.302  -2.610  1.00 72.26  ? 74  ASP D CG    1 
ATOM   7435  O OD1   . ASP D 2 74  ? 144.994 -16.456  -3.539  1.00 73.04  ? 74  ASP D OD1   1 
ATOM   7436  O OD2   . ASP D 2 74  ? 145.913 -17.369  -1.765  1.00 74.15  ? 74  ASP D OD2   1 
ATOM   7437  N N     . GLU D 2 75  ? 140.915 -19.629  -3.157  1.00 70.96  ? 75  GLU D N     1 
ATOM   7438  C CA    . GLU D 2 75  ? 140.062 -20.783  -3.439  1.00 72.05  ? 75  GLU D CA    1 
ATOM   7439  C C     . GLU D 2 75  ? 139.403 -20.662  -4.808  1.00 71.75  ? 75  GLU D C     1 
ATOM   7440  O O     . GLU D 2 75  ? 139.333 -21.627  -5.568  1.00 72.81  ? 75  GLU D O     1 
ATOM   7441  C CB    . GLU D 2 75  ? 138.969 -20.907  -2.379  1.00 72.24  ? 75  GLU D CB    1 
ATOM   7442  C CG    . GLU D 2 75  ? 139.447 -21.259  -0.984  1.00 73.59  ? 75  GLU D CG    1 
ATOM   7443  C CD    . GLU D 2 75  ? 138.347 -21.127  0.054   1.00 74.53  ? 75  GLU D CD    1 
ATOM   7444  O OE1   . GLU D 2 75  ? 137.359 -20.398  -0.200  1.00 74.48  ? 75  GLU D OE1   1 
ATOM   7445  O OE2   . GLU D 2 75  ? 138.473 -21.752  1.127   1.00 75.91  ? 75  GLU D OE2   1 
ATOM   7446  N N     . LYS D 2 76  ? 138.910 -19.463  -5.102  1.00 70.60  ? 76  LYS D N     1 
ATOM   7447  C CA    . LYS D 2 76  ? 138.214 -19.177  -6.362  1.00 70.53  ? 76  LYS D CA    1 
ATOM   7448  C C     . LYS D 2 76  ? 139.169 -18.697  -7.481  1.00 70.29  ? 76  LYS D C     1 
ATOM   7449  O O     . LYS D 2 76  ? 138.756 -18.473  -8.625  1.00 70.09  ? 76  LYS D O     1 
ATOM   7450  C CB    . LYS D 2 76  ? 137.065 -18.182  -6.114  1.00 69.49  ? 76  LYS D CB    1 
ATOM   7451  C CG    . LYS D 2 76  ? 135.893 -18.768  -5.321  1.00 70.27  ? 76  LYS D CG    1 
ATOM   7452  C CD    . LYS D 2 76  ? 134.957 -19.577  -6.237  1.00 73.39  ? 76  LYS D CD    1 
ATOM   7453  C CE    . LYS D 2 76  ? 134.259 -20.726  -5.504  1.00 75.21  ? 76  LYS D CE    1 
ATOM   7454  N NZ    . LYS D 2 76  ? 133.236 -20.232  -4.534  1.00 76.15  ? 76  LYS D NZ    1 
ATOM   7455  N N     . LYS D 2 77  ? 140.449 -18.563  -7.124  1.00 70.12  ? 77  LYS D N     1 
ATOM   7456  C CA    . LYS D 2 77  ? 141.523 -18.154  -8.040  1.00 69.77  ? 77  LYS D CA    1 
ATOM   7457  C C     . LYS D 2 77  ? 141.251 -16.795  -8.714  1.00 68.08  ? 77  LYS D C     1 
ATOM   7458  O O     . LYS D 2 77  ? 141.462 -16.606  -9.904  1.00 68.08  ? 77  LYS D O     1 
ATOM   7459  C CB    . LYS D 2 77  ? 141.871 -19.283  -9.021  1.00 71.30  ? 77  LYS D CB    1 
ATOM   7460  C CG    . LYS D 2 77  ? 141.855 -20.653  -8.353  1.00 73.60  ? 77  LYS D CG    1 
ATOM   7461  C CD    . LYS D 2 77  ? 143.140 -21.444  -8.582  1.00 77.97  ? 77  LYS D CD    1 
ATOM   7462  C CE    . LYS D 2 77  ? 143.640 -22.103  -7.263  1.00 80.25  ? 77  LYS D CE    1 
ATOM   7463  N NZ    . LYS D 2 77  ? 142.613 -22.920  -6.524  1.00 79.39  ? 77  LYS D NZ    1 
ATOM   7464  N N     . ILE D 2 78  ? 140.785 -15.853  -7.909  1.00 66.48  ? 78  ILE D N     1 
ATOM   7465  C CA    . ILE D 2 78  ? 140.579 -14.482  -8.339  1.00 65.40  ? 78  ILE D CA    1 
ATOM   7466  C C     . ILE D 2 78  ? 141.703 -13.609  -7.752  1.00 64.88  ? 78  ILE D C     1 
ATOM   7467  O O     . ILE D 2 78  ? 141.924 -13.610  -6.540  1.00 64.62  ? 78  ILE D O     1 
ATOM   7468  C CB    . ILE D 2 78  ? 139.182 -13.959  -7.877  1.00 64.72  ? 78  ILE D CB    1 
ATOM   7469  C CG1   . ILE D 2 78  ? 138.068 -14.882  -8.374  1.00 64.87  ? 78  ILE D CG1   1 
ATOM   7470  C CG2   . ILE D 2 78  ? 138.938 -12.531  -8.360  1.00 64.40  ? 78  ILE D CG2   1 
ATOM   7471  C CD1   . ILE D 2 78  ? 136.732 -14.648  -7.726  1.00 63.62  ? 78  ILE D CD1   1 
ATOM   7472  N N     . PRO D 2 79  ? 142.433 -12.878  -8.611  1.00 64.76  ? 79  PRO D N     1 
ATOM   7473  C CA    . PRO D 2 79  ? 143.513 -12.037  -8.104  1.00 64.53  ? 79  PRO D CA    1 
ATOM   7474  C C     . PRO D 2 79  ? 143.011 -10.853  -7.291  1.00 63.60  ? 79  PRO D C     1 
ATOM   7475  O O     . PRO D 2 79  ? 141.930 -10.323  -7.562  1.00 62.88  ? 79  PRO D O     1 
ATOM   7476  C CB    . PRO D 2 79  ? 144.222 -11.555  -9.371  1.00 64.95  ? 79  PRO D CB    1 
ATOM   7477  C CG    . PRO D 2 79  ? 143.248 -11.748  -10.454 1.00 65.48  ? 79  PRO D CG    1 
ATOM   7478  C CD    . PRO D 2 79  ? 142.423 -12.930  -10.080 1.00 65.41  ? 79  PRO D CD    1 
ATOM   7479  N N     . TYR D 2 80  ? 143.806 -10.469  -6.292  1.00 63.65  ? 80  TYR D N     1 
ATOM   7480  C CA    . TYR D 2 80  ? 143.500 -9.347   -5.418  1.00 62.89  ? 80  TYR D CA    1 
ATOM   7481  C C     . TYR D 2 80  ? 144.717 -8.449   -5.252  1.00 63.63  ? 80  TYR D C     1 
ATOM   7482  O O     . TYR D 2 80  ? 145.857 -8.901   -5.397  1.00 64.44  ? 80  TYR D O     1 
ATOM   7483  C CB    . TYR D 2 80  ? 143.016 -9.832   -4.049  1.00 62.57  ? 80  TYR D CB    1 
ATOM   7484  C CG    . TYR D 2 80  ? 143.995 -10.714  -3.293  1.00 62.75  ? 80  TYR D CG    1 
ATOM   7485  C CD1   . TYR D 2 80  ? 144.924 -10.170  -2.394  1.00 62.35  ? 80  TYR D CD1   1 
ATOM   7486  C CD2   . TYR D 2 80  ? 143.977 -12.094  -3.460  1.00 62.98  ? 80  TYR D CD2   1 
ATOM   7487  C CE1   . TYR D 2 80  ? 145.810 -10.979  -1.700  1.00 62.08  ? 80  TYR D CE1   1 
ATOM   7488  C CE2   . TYR D 2 80  ? 144.856 -12.910  -2.772  1.00 63.69  ? 80  TYR D CE2   1 
ATOM   7489  C CZ    . TYR D 2 80  ? 145.763 -12.348  -1.899  1.00 63.67  ? 80  TYR D CZ    1 
ATOM   7490  O OH    . TYR D 2 80  ? 146.620 -13.188  -1.243  1.00 66.11  ? 80  TYR D OH    1 
ATOM   7491  N N     . VAL D 2 81  ? 144.454 -7.184   -4.932  1.00 63.47  ? 81  VAL D N     1 
ATOM   7492  C CA    . VAL D 2 81  ? 145.461 -6.131   -4.871  1.00 64.15  ? 81  VAL D CA    1 
ATOM   7493  C C     . VAL D 2 81  ? 145.121 -5.208   -3.720  1.00 64.04  ? 81  VAL D C     1 
ATOM   7494  O O     . VAL D 2 81  ? 143.960 -5.136   -3.304  1.00 63.42  ? 81  VAL D O     1 
ATOM   7495  C CB    . VAL D 2 81  ? 145.434 -5.271   -6.150  1.00 64.41  ? 81  VAL D CB    1 
ATOM   7496  C CG1   . VAL D 2 81  ? 146.357 -4.074   -6.024  1.00 65.33  ? 81  VAL D CG1   1 
ATOM   7497  C CG2   . VAL D 2 81  ? 145.839 -6.086   -7.334  1.00 65.71  ? 81  VAL D CG2   1 
ATOM   7498  N N     . TYR D 2 82  ? 146.126 -4.474   -3.238  1.00 64.77  ? 82  TYR D N     1 
ATOM   7499  C CA    . TYR D 2 82  ? 145.949 -3.533   -2.140  1.00 64.65  ? 82  TYR D CA    1 
ATOM   7500  C C     . TYR D 2 82  ? 146.041 -2.073   -2.556  1.00 65.17  ? 82  TYR D C     1 
ATOM   7501  O O     . TYR D 2 82  ? 146.716 -1.744   -3.526  1.00 66.16  ? 82  TYR D O     1 
ATOM   7502  C CB    . TYR D 2 82  ? 146.970 -3.830   -1.063  1.00 65.13  ? 82  TYR D CB    1 
ATOM   7503  C CG    . TYR D 2 82  ? 146.867 -5.239   -0.548  1.00 65.12  ? 82  TYR D CG    1 
ATOM   7504  C CD1   . TYR D 2 82  ? 147.764 -6.216   -0.965  1.00 66.29  ? 82  TYR D CD1   1 
ATOM   7505  C CD2   . TYR D 2 82  ? 145.865 -5.600   0.350   1.00 64.52  ? 82  TYR D CD2   1 
ATOM   7506  C CE1   . TYR D 2 82  ? 147.674 -7.516   -0.493  1.00 66.96  ? 82  TYR D CE1   1 
ATOM   7507  C CE2   . TYR D 2 82  ? 145.762 -6.893   0.825   1.00 65.31  ? 82  TYR D CE2   1 
ATOM   7508  C CZ    . TYR D 2 82  ? 146.670 -7.847   0.400   1.00 66.87  ? 82  TYR D CZ    1 
ATOM   7509  O OH    . TYR D 2 82  ? 146.576 -9.136   0.875   1.00 68.99  ? 82  TYR D OH    1 
ATOM   7510  N N     . VAL D 2 83  ? 145.327 -1.210   -1.838  1.00 64.74  ? 83  VAL D N     1 
ATOM   7511  C CA    . VAL D 2 83  ? 145.542 0.234    -1.915  1.00 65.44  ? 83  VAL D CA    1 
ATOM   7512  C C     . VAL D 2 83  ? 145.745 0.712    -0.486  1.00 66.29  ? 83  VAL D C     1 
ATOM   7513  O O     . VAL D 2 83  ? 145.406 -0.004   0.447   1.00 66.03  ? 83  VAL D O     1 
ATOM   7514  C CB    . VAL D 2 83  ? 144.389 1.004    -2.631  1.00 65.02  ? 83  VAL D CB    1 
ATOM   7515  C CG1   . VAL D 2 83  ? 144.279 0.577    -4.087  1.00 64.21  ? 83  VAL D CG1   1 
ATOM   7516  C CG2   . VAL D 2 83  ? 143.064 0.837    -1.919  1.00 63.77  ? 83  VAL D CG2   1 
ATOM   7517  N N     . SER D 2 84  ? 146.311 1.899    -0.299  1.00 67.81  ? 84  SER D N     1 
ATOM   7518  C CA    . SER D 2 84  ? 146.675 2.344    1.050   1.00 68.85  ? 84  SER D CA    1 
ATOM   7519  C C     . SER D 2 84  ? 145.551 3.059    1.794   1.00 69.10  ? 84  SER D C     1 
ATOM   7520  O O     . SER D 2 84  ? 145.487 2.994    3.020   1.00 69.69  ? 84  SER D O     1 
ATOM   7521  C CB    . SER D 2 84  ? 147.935 3.202    1.028   1.00 70.11  ? 84  SER D CB    1 
ATOM   7522  O OG    . SER D 2 84  ? 147.927 4.056    -0.093  1.00 71.11  ? 84  SER D OG    1 
ATOM   7523  N N     . SER D 2 85  ? 144.670 3.741    1.069   1.00 69.20  ? 85  SER D N     1 
ATOM   7524  C CA    . SER D 2 85  ? 143.560 4.435    1.720   1.00 69.40  ? 85  SER D CA    1 
ATOM   7525  C C     . SER D 2 85  ? 142.179 3.921    1.323   1.00 68.26  ? 85  SER D C     1 
ATOM   7526  O O     . SER D 2 85  ? 141.856 3.776    0.136   1.00 67.73  ? 85  SER D O     1 
ATOM   7527  C CB    . SER D 2 85  ? 143.630 5.946    1.497   1.00 71.06  ? 85  SER D CB    1 
ATOM   7528  O OG    . SER D 2 85  ? 142.563 6.588    2.187   1.00 71.39  ? 85  SER D OG    1 
ATOM   7529  N N     . LYS D 2 86  ? 141.367 3.666    2.344   1.00 67.84  ? 86  LYS D N     1 
ATOM   7530  C CA    . LYS D 2 86  ? 140.009 3.180    2.166   1.00 66.83  ? 86  LYS D CA    1 
ATOM   7531  C C     . LYS D 2 86  ? 139.097 4.328    1.744   1.00 67.81  ? 86  LYS D C     1 
ATOM   7532  O O     . LYS D 2 86  ? 138.116 4.121    1.018   1.00 67.31  ? 86  LYS D O     1 
ATOM   7533  C CB    . LYS D 2 86  ? 139.504 2.518    3.453   1.00 66.23  ? 86  LYS D CB    1 
ATOM   7534  C CG    . LYS D 2 86  ? 139.407 3.434    4.678   1.00 66.90  ? 86  LYS D CG    1 
ATOM   7535  C CD    . LYS D 2 86  ? 138.887 2.671    5.887   1.00 66.11  ? 86  LYS D CD    1 
ATOM   7536  C CE    . LYS D 2 86  ? 138.016 3.541    6.791   1.00 66.92  ? 86  LYS D CE    1 
ATOM   7537  N NZ    . LYS D 2 86  ? 138.806 4.436    7.658   1.00 66.92  ? 86  LYS D NZ    1 
ATOM   7538  N N     . LYS D 2 87  ? 139.433 5.536    2.205   1.00 69.21  ? 87  LYS D N     1 
ATOM   7539  C CA    . LYS D 2 87  ? 138.700 6.742    1.843   1.00 70.43  ? 87  LYS D CA    1 
ATOM   7540  C C     . LYS D 2 87  ? 138.914 7.001    0.357   1.00 70.57  ? 87  LYS D C     1 
ATOM   7541  O O     . LYS D 2 87  ? 137.986 7.377    -0.359  1.00 70.64  ? 87  LYS D O     1 
ATOM   7542  C CB    . LYS D 2 87  ? 139.183 7.930    2.679   1.00 71.95  ? 87  LYS D CB    1 
ATOM   7543  C CG    . LYS D 2 87  ? 138.105 8.963    3.004   1.00 74.39  ? 87  LYS D CG    1 
ATOM   7544  C CD    . LYS D 2 87  ? 138.637 10.085   3.912   1.00 78.51  ? 87  LYS D CD    1 
ATOM   7545  C CE    . LYS D 2 87  ? 138.678 9.690    5.394   1.00 79.69  ? 87  LYS D CE    1 
ATOM   7546  N NZ    . LYS D 2 87  ? 137.313 9.631    6.013   1.00 80.10  ? 87  LYS D NZ    1 
ATOM   7547  N N     . ALA D 2 88  ? 140.146 6.757    -0.089  1.00 70.84  ? 88  ALA D N     1 
ATOM   7548  C CA    . ALA D 2 88  ? 140.564 6.967    -1.475  1.00 71.16  ? 88  ALA D CA    1 
ATOM   7549  C C     . ALA D 2 88  ? 139.933 5.964    -2.438  1.00 69.98  ? 88  ALA D C     1 
ATOM   7550  O O     . ALA D 2 88  ? 139.640 6.317    -3.582  1.00 70.47  ? 88  ALA D O     1 
ATOM   7551  C CB    . ALA D 2 88  ? 142.091 6.927    -1.582  1.00 71.67  ? 88  ALA D CB    1 
ATOM   7552  N N     . LEU D 2 89  ? 139.736 4.726    -1.975  1.00 68.55  ? 89  LEU D N     1 
ATOM   7553  C CA    . LEU D 2 89  ? 139.107 3.682    -2.786  1.00 67.28  ? 89  LEU D CA    1 
ATOM   7554  C C     . LEU D 2 89  ? 137.614 3.924    -2.922  1.00 67.57  ? 89  LEU D C     1 
ATOM   7555  O O     . LEU D 2 89  ? 137.053 3.774    -4.000  1.00 67.34  ? 89  LEU D O     1 
ATOM   7556  C CB    . LEU D 2 89  ? 139.384 2.282    -2.214  1.00 66.09  ? 89  LEU D CB    1 
ATOM   7557  C CG    . LEU D 2 89  ? 138.801 1.030    -2.892  1.00 63.90  ? 89  LEU D CG    1 
ATOM   7558  C CD1   . LEU D 2 89  ? 139.218 0.894    -4.335  1.00 63.69  ? 89  LEU D CD1   1 
ATOM   7559  C CD2   . LEU D 2 89  ? 139.231 -0.196   -2.146  1.00 63.99  ? 89  LEU D CD2   1 
ATOM   7560  N N     . GLY D 2 90  ? 136.977 4.305    -1.824  1.00 68.35  ? 90  GLY D N     1 
ATOM   7561  C CA    . GLY D 2 90  ? 135.557 4.631    -1.848  1.00 69.71  ? 90  GLY D CA    1 
ATOM   7562  C C     . GLY D 2 90  ? 135.268 5.848    -2.704  1.00 71.51  ? 90  GLY D C     1 
ATOM   7563  O O     . GLY D 2 90  ? 134.317 5.862    -3.494  1.00 71.59  ? 90  GLY D O     1 
ATOM   7564  N N     . GLU D 2 91  ? 136.103 6.872    -2.547  1.00 73.20  ? 91  GLU D N     1 
ATOM   7565  C CA    . GLU D 2 91  ? 135.971 8.093    -3.328  1.00 75.32  ? 91  GLU D CA    1 
ATOM   7566  C C     . GLU D 2 91  ? 136.293 7.874    -4.801  1.00 74.91  ? 91  GLU D C     1 
ATOM   7567  O O     . GLU D 2 91  ? 135.742 8.562    -5.648  1.00 76.28  ? 91  GLU D O     1 
ATOM   7568  C CB    . GLU D 2 91  ? 136.767 9.252    -2.710  1.00 77.12  ? 91  GLU D CB    1 
ATOM   7569  C CG    . GLU D 2 91  ? 136.039 9.911    -1.506  1.00 80.14  ? 91  GLU D CG    1 
ATOM   7570  C CD    . GLU D 2 91  ? 136.873 10.983   -0.783  1.00 84.50  ? 91  GLU D CD    1 
ATOM   7571  O OE1   . GLU D 2 91  ? 137.303 11.969   -1.439  1.00 85.77  ? 91  GLU D OE1   1 
ATOM   7572  O OE2   . GLU D 2 91  ? 137.079 10.836   0.452   1.00 85.60  ? 91  GLU D OE2   1 
ATOM   7573  N N     . ALA D 2 92  ? 137.155 6.908    -5.106  1.00 73.63  ? 92  ALA D N     1 
ATOM   7574  C CA    . ALA D 2 92  ? 137.283 6.425    -6.480  1.00 73.42  ? 92  ALA D CA    1 
ATOM   7575  C C     . ALA D 2 92  ? 135.965 5.816    -6.913  1.00 73.19  ? 92  ALA D C     1 
ATOM   7576  O O     . ALA D 2 92  ? 135.421 6.206    -7.947  1.00 74.29  ? 92  ALA D O     1 
ATOM   7577  C CB    . ALA D 2 92  ? 138.382 5.406    -6.613  1.00 72.32  ? 92  ALA D CB    1 
ATOM   7578  N N     . CYS D 2 93  ? 135.450 4.884    -6.101  1.00 72.20  ? 93  CYS D N     1 
ATOM   7579  C CA    . CYS D 2 93  ? 134.230 4.095    -6.397  1.00 71.37  ? 93  CYS D CA    1 
ATOM   7580  C C     . CYS D 2 93  ? 132.972 4.897    -6.770  1.00 72.46  ? 93  CYS D C     1 
ATOM   7581  O O     . CYS D 2 93  ? 131.994 4.329    -7.242  1.00 72.66  ? 93  CYS D O     1 
ATOM   7582  C CB    . CYS D 2 93  ? 133.926 3.115    -5.249  1.00 70.49  ? 93  CYS D CB    1 
ATOM   7583  S SG    . CYS D 2 93  ? 134.995 1.643    -5.160  1.00 67.83  ? 93  CYS D SG    1 
ATOM   7584  N N     . GLY D 2 94  ? 133.007 6.208    -6.569  1.00 73.62  ? 94  GLY D N     1 
ATOM   7585  C CA    . GLY D 2 94  ? 131.878 7.073    -6.895  1.00 74.84  ? 94  GLY D CA    1 
ATOM   7586  C C     . GLY D 2 94  ? 131.071 7.347    -5.652  1.00 74.90  ? 94  GLY D C     1 
ATOM   7587  O O     . GLY D 2 94  ? 129.922 7.772    -5.733  1.00 76.05  ? 94  GLY D O     1 
ATOM   7588  N N     . LEU D 2 95  ? 131.680 7.087    -4.497  1.00 73.91  ? 95  LEU D N     1 
ATOM   7589  C CA    . LEU D 2 95  ? 131.046 7.328    -3.202  1.00 73.93  ? 95  LEU D CA    1 
ATOM   7590  C C     . LEU D 2 95  ? 131.680 8.526    -2.526  1.00 74.98  ? 95  LEU D C     1 
ATOM   7591  O O     . LEU D 2 95  ? 132.785 8.937    -2.875  1.00 75.23  ? 95  LEU D O     1 
ATOM   7592  C CB    . LEU D 2 95  ? 131.183 6.109    -2.293  1.00 72.15  ? 95  LEU D CB    1 
ATOM   7593  C CG    . LEU D 2 95  ? 130.635 4.785    -2.802  1.00 70.67  ? 95  LEU D CG    1 
ATOM   7594  C CD1   . LEU D 2 95  ? 130.974 3.672    -1.825  1.00 68.42  ? 95  LEU D CD1   1 
ATOM   7595  C CD2   . LEU D 2 95  ? 129.125 4.880    -3.057  1.00 71.41  ? 95  LEU D CD2   1 
ATOM   7596  N N     . GLN D 2 96  ? 130.980 9.092    -1.556  1.00 75.86  ? 96  GLN D N     1 
ATOM   7597  C CA    . GLN D 2 96  ? 131.558 10.175   -0.802  1.00 77.24  ? 96  GLN D CA    1 
ATOM   7598  C C     . GLN D 2 96  ? 131.996 9.714    0.577   1.00 76.35  ? 96  GLN D C     1 
ATOM   7599  O O     . GLN D 2 96  ? 132.483 10.507   1.389   1.00 77.30  ? 96  GLN D O     1 
ATOM   7600  C CB    . GLN D 2 96  ? 130.611 11.366   -0.759  1.00 79.43  ? 96  GLN D CB    1 
ATOM   7601  C CG    . GLN D 2 96  ? 130.829 12.306   -1.940  1.00 82.40  ? 96  GLN D CG    1 
ATOM   7602  C CD    . GLN D 2 96  ? 129.821 13.421   -1.986  1.00 86.77  ? 96  GLN D CD    1 
ATOM   7603  O OE1   . GLN D 2 96  ? 128.613 13.176   -1.963  1.00 88.36  ? 96  GLN D OE1   1 
ATOM   7604  N NE2   . GLN D 2 96  ? 130.305 14.658   -2.059  1.00 89.18  ? 96  GLN D NE2   1 
ATOM   7605  N N     . VAL D 2 97  ? 131.836 8.414    0.815   1.00 74.75  ? 97  VAL D N     1 
ATOM   7606  C CA    . VAL D 2 97  ? 132.311 7.777    2.036   1.00 73.85  ? 97  VAL D CA    1 
ATOM   7607  C C     . VAL D 2 97  ? 133.383 6.736    1.697   1.00 72.39  ? 97  VAL D C     1 
ATOM   7608  O O     . VAL D 2 97  ? 133.597 6.403    0.523   1.00 71.61  ? 97  VAL D O     1 
ATOM   7609  C CB    . VAL D 2 97  ? 131.171 7.101    2.845   1.00 73.80  ? 97  VAL D CB    1 
ATOM   7610  C CG1   . VAL D 2 97  ? 131.233 7.551    4.323   1.00 74.97  ? 97  VAL D CG1   1 
ATOM   7611  C CG2   . VAL D 2 97  ? 129.801 7.391    2.245   1.00 74.05  ? 97  VAL D CG2   1 
ATOM   7612  N N     . ALA D 2 98  ? 134.051 6.233    2.735   1.00 71.79  ? 98  ALA D N     1 
ATOM   7613  C CA    . ALA D 2 98  ? 135.131 5.265    2.589   1.00 70.52  ? 98  ALA D CA    1 
ATOM   7614  C C     . ALA D 2 98  ? 134.606 3.910    2.138   1.00 69.38  ? 98  ALA D C     1 
ATOM   7615  O O     . ALA D 2 98  ? 133.415 3.638    2.266   1.00 69.41  ? 98  ALA D O     1 
ATOM   7616  C CB    . ALA D 2 98  ? 135.861 5.127    3.901   1.00 70.57  ? 98  ALA D CB    1 
ATOM   7617  N N     . THR D 2 99  ? 135.491 3.073    1.594   1.00 68.56  ? 99  THR D N     1 
ATOM   7618  C CA    . THR D 2 99  ? 135.173 1.657    1.375   1.00 67.76  ? 99  THR D CA    1 
ATOM   7619  C C     . THR D 2 99  ? 136.378 0.764    1.680   1.00 67.15  ? 99  THR D C     1 
ATOM   7620  O O     . THR D 2 99  ? 137.514 1.118    1.363   1.00 67.43  ? 99  THR D O     1 
ATOM   7621  C CB    . THR D 2 99  ? 134.590 1.377    -0.038  1.00 67.58  ? 99  THR D CB    1 
ATOM   7622  O OG1   . THR D 2 99  ? 133.830 0.163    -0.007  1.00 67.57  ? 99  THR D OG1   1 
ATOM   7623  C CG2   . THR D 2 99  ? 135.681 1.249    -1.091  1.00 67.70  ? 99  THR D CG2   1 
ATOM   7624  N N     . ALA D 2 100 ? 136.120 -0.383   2.305   1.00 66.64  ? 100 ALA D N     1 
ATOM   7625  C CA    . ALA D 2 100 ? 137.187 -1.263   2.779   1.00 66.31  ? 100 ALA D CA    1 
ATOM   7626  C C     . ALA D 2 100 ? 137.713 -2.204   1.704   1.00 65.87  ? 100 ALA D C     1 
ATOM   7627  O O     . ALA D 2 100 ? 138.871 -2.596   1.742   1.00 65.97  ? 100 ALA D O     1 
ATOM   7628  C CB    . ALA D 2 100 ? 136.713 -2.053   3.973   1.00 66.52  ? 100 ALA D CB    1 
ATOM   7629  N N     . SER D 2 101 ? 136.853 -2.575   0.762   1.00 65.71  ? 101 SER D N     1 
ATOM   7630  C CA    . SER D 2 101 ? 137.216 -3.475   -0.321  1.00 65.50  ? 101 SER D CA    1 
ATOM   7631  C C     . SER D 2 101 ? 136.234 -3.315   -1.467  1.00 66.08  ? 101 SER D C     1 
ATOM   7632  O O     . SER D 2 101 ? 135.072 -2.969   -1.250  1.00 66.37  ? 101 SER D O     1 
ATOM   7633  C CB    . SER D 2 101 ? 137.177 -4.917   0.158   1.00 65.16  ? 101 SER D CB    1 
ATOM   7634  O OG    . SER D 2 101 ? 135.872 -5.260   0.590   1.00 64.56  ? 101 SER D OG    1 
ATOM   7635  N N     . ALA D 2 102 ? 136.701 -3.570   -2.685  1.00 66.56  ? 102 ALA D N     1 
ATOM   7636  C CA    . ALA D 2 102 ? 135.854 -3.483   -3.863  1.00 67.30  ? 102 ALA D CA    1 
ATOM   7637  C C     . ALA D 2 102 ? 136.239 -4.556   -4.869  1.00 67.89  ? 102 ALA D C     1 
ATOM   7638  O O     . ALA D 2 102 ? 137.265 -5.218   -4.720  1.00 67.99  ? 102 ALA D O     1 
ATOM   7639  C CB    . ALA D 2 102 ? 135.951 -2.106   -4.482  1.00 67.63  ? 102 ALA D CB    1 
ATOM   7640  N N     . ALA D 2 103 ? 135.411 -4.724   -5.894  1.00 68.91  ? 103 ALA D N     1 
ATOM   7641  C CA    . ALA D 2 103 ? 135.640 -5.741   -6.914  1.00 69.69  ? 103 ALA D CA    1 
ATOM   7642  C C     . ALA D 2 103 ? 135.285 -5.211   -8.303  1.00 70.68  ? 103 ALA D C     1 
ATOM   7643  O O     . ALA D 2 103 ? 134.331 -4.448   -8.448  1.00 71.21  ? 103 ALA D O     1 
ATOM   7644  C CB    . ALA D 2 103 ? 134.823 -6.995   -6.593  1.00 69.58  ? 103 ALA D CB    1 
ATOM   7645  N N     . ILE D 2 104 ? 136.060 -5.608   -9.315  1.00 71.36  ? 104 ILE D N     1 
ATOM   7646  C CA    . ILE D 2 104 ? 135.736 -5.309   -10.716 1.00 72.28  ? 104 ILE D CA    1 
ATOM   7647  C C     . ILE D 2 104 ? 135.148 -6.557   -11.346 1.00 72.98  ? 104 ILE D C     1 
ATOM   7648  O O     . ILE D 2 104 ? 135.817 -7.595   -11.413 1.00 73.00  ? 104 ILE D O     1 
ATOM   7649  C CB    . ILE D 2 104 ? 136.974 -4.858   -11.535 1.00 72.51  ? 104 ILE D CB    1 
ATOM   7650  C CG1   . ILE D 2 104 ? 137.494 -3.509   -11.033 1.00 72.32  ? 104 ILE D CG1   1 
ATOM   7651  C CG2   . ILE D 2 104 ? 136.623 -4.752   -13.012 1.00 73.19  ? 104 ILE D CG2   1 
ATOM   7652  C CD1   . ILE D 2 104 ? 138.859 -3.130   -11.568 1.00 72.77  ? 104 ILE D CD1   1 
ATOM   7653  N N     . LEU D 2 105 ? 133.899 -6.457   -11.799 1.00 73.97  ? 105 LEU D N     1 
ATOM   7654  C CA    . LEU D 2 105 ? 133.208 -7.606   -12.397 1.00 74.92  ? 105 LEU D CA    1 
ATOM   7655  C C     . LEU D 2 105 ? 133.402 -7.639   -13.904 1.00 76.27  ? 105 LEU D C     1 
ATOM   7656  O O     . LEU D 2 105 ? 133.688 -8.690   -14.474 1.00 76.82  ? 105 LEU D O     1 
ATOM   7657  C CB    . LEU D 2 105 ? 131.712 -7.621   -12.046 1.00 75.10  ? 105 LEU D CB    1 
ATOM   7658  C CG    . LEU D 2 105 ? 131.229 -7.660   -10.587 1.00 73.90  ? 105 LEU D CG    1 
ATOM   7659  C CD1   . LEU D 2 105 ? 129.833 -8.264   -10.510 1.00 73.65  ? 105 LEU D CD1   1 
ATOM   7660  C CD2   . LEU D 2 105 ? 132.167 -8.428   -9.686  1.00 72.21  ? 105 LEU D CD2   1 
ATOM   7661  N N     . GLU D 2 106 ? 133.233 -6.484   -14.540 1.00 77.29  ? 106 GLU D N     1 
ATOM   7662  C CA    . GLU D 2 106 ? 133.533 -6.323   -15.958 1.00 78.87  ? 106 GLU D CA    1 
ATOM   7663  C C     . GLU D 2 106 ? 134.340 -5.037   -16.162 1.00 78.94  ? 106 GLU D C     1 
ATOM   7664  O O     . GLU D 2 106 ? 133.891 -3.950   -15.774 1.00 78.70  ? 106 GLU D O     1 
ATOM   7665  C CB    . GLU D 2 106 ? 132.255 -6.289   -16.784 1.00 80.23  ? 106 GLU D CB    1 
ATOM   7666  C CG    . GLU D 2 106 ? 131.605 -7.639   -17.001 1.00 82.24  ? 106 GLU D CG    1 
ATOM   7667  C CD    . GLU D 2 106 ? 130.082 -7.532   -17.069 1.00 86.67  ? 106 GLU D CD    1 
ATOM   7668  O OE1   . GLU D 2 106 ? 129.562 -6.469   -17.512 1.00 88.64  ? 106 GLU D OE1   1 
ATOM   7669  O OE2   . GLU D 2 106 ? 129.399 -8.508   -16.668 1.00 87.50  ? 106 GLU D OE2   1 
ATOM   7670  N N     . PRO D 2 107 ? 135.535 -5.163   -16.771 1.00 79.20  ? 107 PRO D N     1 
ATOM   7671  C CA    . PRO D 2 107 ? 136.470 -4.045   -16.807 1.00 79.36  ? 107 PRO D CA    1 
ATOM   7672  C C     . PRO D 2 107 ? 136.064 -2.969   -17.816 1.00 80.79  ? 107 PRO D C     1 
ATOM   7673  O O     . PRO D 2 107 ? 136.405 -1.798   -17.629 1.00 81.04  ? 107 PRO D O     1 
ATOM   7674  C CB    . PRO D 2 107 ? 137.802 -4.704   -17.214 1.00 79.50  ? 107 PRO D CB    1 
ATOM   7675  C CG    . PRO D 2 107 ? 137.521 -6.199   -17.368 1.00 79.28  ? 107 PRO D CG    1 
ATOM   7676  C CD    . PRO D 2 107 ? 136.043 -6.328   -17.520 1.00 79.70  ? 107 PRO D CD    1 
ATOM   7677  N N     . GLY D 2 108 ? 135.340 -3.363   -18.864 1.00 81.81  ? 108 GLY D N     1 
ATOM   7678  C CA    . GLY D 2 108 ? 134.993 -2.456   -19.946 1.00 83.48  ? 108 GLY D CA    1 
ATOM   7679  C C     . GLY D 2 108 ? 136.220 -1.792   -20.545 1.00 84.46  ? 108 GLY D C     1 
ATOM   7680  O O     . GLY D 2 108 ? 137.093 -2.466   -21.098 1.00 84.72  ? 108 GLY D O     1 
ATOM   7681  N N     . GLU D 2 109 ? 136.287 -0.467   -20.413 1.00 85.31  ? 109 GLU D N     1 
ATOM   7682  C CA    . GLU D 2 109 ? 137.366 0.346    -20.986 1.00 86.66  ? 109 GLU D CA    1 
ATOM   7683  C C     . GLU D 2 109 ? 138.539 0.456    -20.031 1.00 85.74  ? 109 GLU D C     1 
ATOM   7684  O O     . GLU D 2 109 ? 139.096 1.536    -19.825 1.00 86.29  ? 109 GLU D O     1 
ATOM   7685  C CB    . GLU D 2 109 ? 136.859 1.748    -21.326 1.00 88.04  ? 109 GLU D CB    1 
ATOM   7686  C CG    . GLU D 2 109 ? 135.887 1.809    -22.494 1.00 90.63  ? 109 GLU D CG    1 
ATOM   7687  C CD    . GLU D 2 109 ? 135.334 3.208    -22.710 1.00 93.40  ? 109 GLU D CD    1 
ATOM   7688  O OE1   . GLU D 2 109 ? 135.849 4.156    -22.070 1.00 94.03  ? 109 GLU D OE1   1 
ATOM   7689  O OE2   . GLU D 2 109 ? 134.385 3.360    -23.516 1.00 94.93  ? 109 GLU D OE2   1 
ATOM   7690  N N     . ALA D 2 110 ? 138.900 -0.675   -19.442 1.00 84.78  ? 110 ALA D N     1 
ATOM   7691  C CA    . ALA D 2 110 ? 139.988 -0.754   -18.489 1.00 84.07  ? 110 ALA D CA    1 
ATOM   7692  C C     . ALA D 2 110 ? 140.603 -2.126   -18.615 1.00 83.88  ? 110 ALA D C     1 
ATOM   7693  O O     . ALA D 2 110 ? 141.487 -2.484   -17.844 1.00 83.34  ? 110 ALA D O     1 
ATOM   7694  C CB    . ALA D 2 110 ? 139.472 -0.530   -17.074 1.00 82.69  ? 110 ALA D CB    1 
ATOM   7695  N N     . LYS D 2 111 ? 140.126 -2.896   -19.590 1.00 84.76  ? 111 LYS D N     1 
ATOM   7696  C CA    . LYS D 2 111 ? 140.625 -4.246   -19.813 1.00 85.10  ? 111 LYS D CA    1 
ATOM   7697  C C     . LYS D 2 111 ? 142.134 -4.272   -19.883 1.00 85.68  ? 111 LYS D C     1 
ATOM   7698  O O     . LYS D 2 111 ? 142.767 -5.046   -19.175 1.00 85.03  ? 111 LYS D O     1 
ATOM   7699  C CB    . LYS D 2 111 ? 140.052 -4.850   -21.088 1.00 86.38  ? 111 LYS D CB    1 
ATOM   7700  C CG    . LYS D 2 111 ? 139.134 -6.017   -20.845 1.00 86.62  ? 111 LYS D CG    1 
ATOM   7701  C CD    . LYS D 2 111 ? 139.294 -7.068   -21.933 1.00 88.47  ? 111 LYS D CD    1 
ATOM   7702  C CE    . LYS D 2 111 ? 138.335 -8.222   -21.686 1.00 89.05  ? 111 LYS D CE    1 
ATOM   7703  N NZ    . LYS D 2 111 ? 138.202 -9.120   -22.864 1.00 91.01  ? 111 LYS D NZ    1 
ATOM   7704  N N     . ASP D 2 112 ? 142.695 -3.410   -20.729 1.00 87.29  ? 112 ASP D N     1 
ATOM   7705  C CA    . ASP D 2 112 ? 144.138 -3.305   -20.899 1.00 88.38  ? 112 ASP D CA    1 
ATOM   7706  C C     . ASP D 2 112 ? 144.810 -2.907   -19.591 1.00 87.32  ? 112 ASP D C     1 
ATOM   7707  O O     . ASP D 2 112 ? 145.846 -3.465   -19.221 1.00 87.19  ? 112 ASP D O     1 
ATOM   7708  C CB    . ASP D 2 112 ? 144.474 -2.302   -22.008 1.00 90.38  ? 112 ASP D CB    1 
ATOM   7709  C CG    . ASP D 2 112 ? 144.125 -2.823   -23.397 1.00 92.60  ? 112 ASP D CG    1 
ATOM   7710  O OD1   . ASP D 2 112 ? 144.136 -4.059   -23.601 1.00 93.32  ? 112 ASP D OD1   1 
ATOM   7711  O OD2   . ASP D 2 112 ? 143.843 -1.996   -24.292 1.00 95.11  ? 112 ASP D OD2   1 
ATOM   7712  N N     . LEU D 2 113 ? 144.193 -1.958   -18.893 1.00 86.64  ? 113 LEU D N     1 
ATOM   7713  C CA    . LEU D 2 113 ? 144.709 -1.451   -17.622 1.00 85.95  ? 113 LEU D CA    1 
ATOM   7714  C C     . LEU D 2 113 ? 144.683 -2.504   -16.505 1.00 84.72  ? 113 LEU D C     1 
ATOM   7715  O O     . LEU D 2 113 ? 145.642 -2.619   -15.740 1.00 84.87  ? 113 LEU D O     1 
ATOM   7716  C CB    . LEU D 2 113 ? 143.962 -0.170   -17.212 1.00 85.68  ? 113 LEU D CB    1 
ATOM   7717  C CG    . LEU D 2 113 ? 144.405 0.641    -15.986 1.00 84.59  ? 113 LEU D CG    1 
ATOM   7718  C CD1   . LEU D 2 113 ? 145.903 0.894    -15.954 1.00 84.83  ? 113 LEU D CD1   1 
ATOM   7719  C CD2   . LEU D 2 113 ? 143.641 1.953    -15.918 1.00 84.82  ? 113 LEU D CD2   1 
ATOM   7720  N N     . VAL D 2 114 ? 143.598 -3.273   -16.429 1.00 83.92  ? 114 VAL D N     1 
ATOM   7721  C CA    . VAL D 2 114 ? 143.482 -4.383   -15.472 1.00 82.75  ? 114 VAL D CA    1 
ATOM   7722  C C     . VAL D 2 114 ? 144.472 -5.506   -15.781 1.00 83.39  ? 114 VAL D C     1 
ATOM   7723  O O     . VAL D 2 114 ? 145.123 -6.013   -14.877 1.00 83.08  ? 114 VAL D O     1 
ATOM   7724  C CB    . VAL D 2 114 ? 142.038 -4.957   -15.417 1.00 81.90  ? 114 VAL D CB    1 
ATOM   7725  C CG1   . VAL D 2 114 ? 142.014 -6.332   -14.774 1.00 80.46  ? 114 VAL D CG1   1 
ATOM   7726  C CG2   . VAL D 2 114 ? 141.121 -4.010   -14.669 1.00 81.30  ? 114 VAL D CG2   1 
ATOM   7727  N N     . ASP D 2 115 ? 144.587 -5.882   -17.055 1.00 84.56  ? 115 ASP D N     1 
ATOM   7728  C CA    . ASP D 2 115 ? 145.444 -6.995   -17.456 1.00 85.28  ? 115 ASP D CA    1 
ATOM   7729  C C     . ASP D 2 115 ? 146.892 -6.748   -17.084 1.00 85.91  ? 115 ASP D C     1 
ATOM   7730  O O     . ASP D 2 115 ? 147.627 -7.690   -16.786 1.00 86.09  ? 115 ASP D O     1 
ATOM   7731  C CB    . ASP D 2 115 ? 145.299 -7.295   -18.946 1.00 86.53  ? 115 ASP D CB    1 
ATOM   7732  C CG    . ASP D 2 115 ? 144.054 -8.106   -19.255 1.00 86.93  ? 115 ASP D CG    1 
ATOM   7733  O OD1   . ASP D 2 115 ? 143.619 -8.895   -18.386 1.00 87.17  ? 115 ASP D OD1   1 
ATOM   7734  O OD2   . ASP D 2 115 ? 143.510 -7.962   -20.370 1.00 88.66  ? 115 ASP D OD2   1 
ATOM   7735  N N     . GLU D 2 116 ? 147.286 -5.476   -17.076 1.00 86.45  ? 116 GLU D N     1 
ATOM   7736  C CA    . GLU D 2 116 ? 148.630 -5.092   -16.662 1.00 87.37  ? 116 GLU D CA    1 
ATOM   7737  C C     . GLU D 2 116 ? 148.793 -5.228   -15.158 1.00 85.93  ? 116 GLU D C     1 
ATOM   7738  O O     . GLU D 2 116 ? 149.851 -5.633   -14.689 1.00 86.75  ? 116 GLU D O     1 
ATOM   7739  C CB    . GLU D 2 116 ? 148.974 -3.669   -17.096 1.00 88.47  ? 116 GLU D CB    1 
ATOM   7740  C CG    . GLU D 2 116 ? 150.476 -3.458   -17.275 1.00 92.02  ? 116 GLU D CG    1 
ATOM   7741  C CD    . GLU D 2 116 ? 150.963 -2.083   -16.809 1.00 95.57  ? 116 GLU D CD    1 
ATOM   7742  O OE1   . GLU D 2 116 ? 150.175 -1.105   -16.861 1.00 96.42  ? 116 GLU D OE1   1 
ATOM   7743  O OE2   . GLU D 2 116 ? 152.147 -1.984   -16.397 1.00 96.93  ? 116 GLU D OE2   1 
ATOM   7744  N N     . ILE D 2 117 ? 147.747 -4.891   -14.411 1.00 84.21  ? 117 ILE D N     1 
ATOM   7745  C CA    . ILE D 2 117 ? 147.754 -5.043   -12.960 1.00 82.87  ? 117 ILE D CA    1 
ATOM   7746  C C     . ILE D 2 117 ? 147.794 -6.515   -12.547 1.00 82.65  ? 117 ILE D C     1 
ATOM   7747  O O     . ILE D 2 117 ? 148.640 -6.909   -11.757 1.00 82.82  ? 117 ILE D O     1 
ATOM   7748  C CB    . ILE D 2 117 ? 146.549 -4.337   -12.300 1.00 81.61  ? 117 ILE D CB    1 
ATOM   7749  C CG1   . ILE D 2 117 ? 146.530 -2.854   -12.672 1.00 81.91  ? 117 ILE D CG1   1 
ATOM   7750  C CG2   . ILE D 2 117 ? 146.588 -4.504   -10.786 1.00 80.52  ? 117 ILE D CG2   1 
ATOM   7751  C CD1   . ILE D 2 117 ? 145.229 -2.146   -12.358 1.00 80.09  ? 117 ILE D CD1   1 
ATOM   7752  N N     . ILE D 2 118 ? 146.899 -7.333   -13.090 1.00 82.69  ? 118 ILE D N     1 
ATOM   7753  C CA    . ILE D 2 118 ? 146.861 -8.744   -12.710 1.00 83.24  ? 118 ILE D CA    1 
ATOM   7754  C C     . ILE D 2 118 ? 148.138 -9.451   -13.123 1.00 84.72  ? 118 ILE D C     1 
ATOM   7755  O O     . ILE D 2 118 ? 148.358 -10.593  -12.734 1.00 85.30  ? 118 ILE D O     1 
ATOM   7756  C CB    . ILE D 2 118 ? 145.612 -9.535   -13.254 1.00 83.02  ? 118 ILE D CB    1 
ATOM   7757  C CG1   . ILE D 2 118 ? 145.735 -9.821   -14.758 1.00 85.53  ? 118 ILE D CG1   1 
ATOM   7758  C CG2   . ILE D 2 118 ? 144.295 -8.832   -12.900 1.00 81.84  ? 118 ILE D CG2   1 
ATOM   7759  C CD1   . ILE D 2 118 ? 144.733 -10.867  -15.313 1.00 87.40  ? 118 ILE D CD1   1 
ATOM   7760  N N     . LYS D 2 119 ? 148.975 -8.776   -13.907 1.00 86.02  ? 119 LYS D N     1 
ATOM   7761  C CA    . LYS D 2 119 ? 150.240 -9.369   -14.339 1.00 87.73  ? 119 LYS D CA    1 
ATOM   7762  C C     . LYS D 2 119 ? 151.452 -8.804   -13.630 1.00 88.07  ? 119 LYS D C     1 
ATOM   7763  O O     . LYS D 2 119 ? 152.457 -9.491   -13.520 1.00 89.22  ? 119 LYS D O     1 
ATOM   7764  C CB    . LYS D 2 119 ? 150.394 -9.338   -15.860 1.00 89.19  ? 119 LYS D CB    1 
ATOM   7765  C CG    . LYS D 2 119 ? 149.630 -10.493  -16.528 1.00 90.82  ? 119 LYS D CG    1 
ATOM   7766  C CD    . LYS D 2 119 ? 149.451 -10.320  -18.036 1.00 93.67  ? 119 LYS D CD    1 
ATOM   7767  C CE    . LYS D 2 119 ? 148.541 -11.408  -18.604 1.00 93.84  ? 119 LYS D CE    1 
ATOM   7768  N NZ    . LYS D 2 119 ? 148.070 -11.081  -19.980 1.00 94.99  ? 119 LYS D NZ    1 
ATOM   7769  N N     . ARG D 2 120 ? 151.350 -7.573   -13.136 1.00 87.40  ? 120 ARG D N     1 
ATOM   7770  C CA    . ARG D 2 120 ? 152.363 -7.022   -12.234 1.00 87.98  ? 120 ARG D CA    1 
ATOM   7771  C C     . ARG D 2 120 ? 152.318 -7.643   -10.840 1.00 87.33  ? 120 ARG D C     1 
ATOM   7772  O O     . ARG D 2 120 ? 153.366 -7.836   -10.218 1.00 88.22  ? 120 ARG D O     1 
ATOM   7773  C CB    . ARG D 2 120 ? 152.254 -5.504   -12.112 1.00 87.83  ? 120 ARG D CB    1 
ATOM   7774  C CG    . ARG D 2 120 ? 153.439 -4.751   -12.688 1.00 90.16  ? 120 ARG D CG    1 
ATOM   7775  C CD    . ARG D 2 120 ? 153.909 -3.649   -11.746 1.00 91.19  ? 120 ARG D CD    1 
ATOM   7776  N NE    . ARG D 2 120 ? 154.175 -2.407   -12.470 1.00 93.68  ? 120 ARG D NE    1 
ATOM   7777  C CZ    . ARG D 2 120 ? 154.347 -1.213   -11.903 1.00 95.08  ? 120 ARG D CZ    1 
ATOM   7778  N NH1   . ARG D 2 120 ? 154.294 -1.077   -10.583 1.00 95.00  ? 120 ARG D NH1   1 
ATOM   7779  N NH2   . ARG D 2 120 ? 154.574 -0.145   -12.662 1.00 96.41  ? 120 ARG D NH2   1 
ATOM   7780  N N     . VAL D 2 121 ? 151.111 -7.946   -10.350 1.00 86.06  ? 121 VAL D N     1 
ATOM   7781  C CA    . VAL D 2 121 ? 150.941 -8.582   -9.024  1.00 85.41  ? 121 VAL D CA    1 
ATOM   7782  C C     . VAL D 2 121 ? 151.324 -10.055  -9.055  1.00 86.20  ? 121 VAL D C     1 
ATOM   7783  O O     . VAL D 2 121 ? 151.565 -10.656  -8.016  1.00 86.50  ? 121 VAL D O     1 
ATOM   7784  C CB    . VAL D 2 121 ? 149.515 -8.409   -8.414  1.00 83.57  ? 121 VAL D CB    1 
ATOM   7785  C CG1   . VAL D 2 121 ? 149.104 -6.945   -8.404  1.00 82.53  ? 121 VAL D CG1   1 
ATOM   7786  C CG2   . VAL D 2 121 ? 148.500 -9.246   -9.155  1.00 83.37  ? 121 VAL D CG2   1 
ATOM   7787  N N     . ASN D 2 122 ? 151.363 -10.625  -10.253 1.00 86.91  ? 122 ASN D N     1 
ATOM   7788  C CA    . ASN D 2 122 ? 151.907 -11.950  -10.458 1.00 88.10  ? 122 ASN D CA    1 
ATOM   7789  C C     . ASN D 2 122 ? 153.416 -11.952  -10.317 1.00 90.00  ? 122 ASN D C     1 
ATOM   7790  O O     . ASN D 2 122 ? 153.975 -12.849  -9.695  1.00 90.68  ? 122 ASN D O     1 
ATOM   7791  C CB    . ASN D 2 122 ? 151.536 -12.458  -11.844 1.00 88.55  ? 122 ASN D CB    1 
ATOM   7792  C CG    . ASN D 2 122 ? 150.213 -13.161  -11.867 1.00 87.10  ? 122 ASN D CG    1 
ATOM   7793  O OD1   . ASN D 2 122 ? 149.726 -13.628  -10.841 1.00 86.44  ? 122 ASN D OD1   1 
ATOM   7794  N ND2   . ASN D 2 122 ? 149.623 -13.256  -13.048 1.00 87.08  ? 122 ASN D ND2   1 
ATOM   7795  N N     . GLU D 2 123 ? 154.064 -10.947  -10.906 1.00 91.15  ? 123 GLU D N     1 
ATOM   7796  C CA    . GLU D 2 123 ? 155.524 -10.850  -10.902 1.00 93.74  ? 123 GLU D CA    1 
ATOM   7797  C C     . GLU D 2 123 ? 156.040 -10.603  -9.497  1.00 93.71  ? 123 GLU D C     1 
ATOM   7798  O O     . GLU D 2 123 ? 156.978 -11.259  -9.056  1.00 95.22  ? 123 GLU D O     1 
ATOM   7799  C CB    . GLU D 2 123 ? 156.047 -9.756   -11.855 1.00 94.89  ? 123 GLU D CB    1 
ATOM   7800  C CG    . GLU D 2 123 ? 155.472 -9.766   -13.288 1.00 97.16  ? 123 GLU D CG    1 
ATOM   7801  C CD    . GLU D 2 123 ? 155.455 -11.154  -13.953 1.00 101.12 ? 123 GLU D CD    1 
ATOM   7802  O OE1   . GLU D 2 123 ? 156.548 -11.658  -14.328 1.00 104.54 ? 123 GLU D OE1   1 
ATOM   7803  O OE2   . GLU D 2 123 ? 154.345 -11.730  -14.113 1.00 100.30 ? 123 GLU D OE2   1 
ATOM   7804  N N     . ILE D 2 124 ? 155.415 -9.671   -8.788  1.00 92.44  ? 124 ILE D N     1 
ATOM   7805  C CA    . ILE D 2 124 ? 155.853 -9.346   -7.438  1.00 92.59  ? 124 ILE D CA    1 
ATOM   7806  C C     . ILE D 2 124 ? 155.246 -10.302  -6.425  1.00 91.94  ? 124 ILE D C     1 
ATOM   7807  O O     . ILE D 2 124 ? 155.177 -10.012  -5.238  1.00 91.78  ? 124 ILE D O     1 
ATOM   7808  C CB    . ILE D 2 124 ? 155.612 -7.858   -7.081  1.00 91.90  ? 124 ILE D CB    1 
ATOM   7809  C CG1   . ILE D 2 124 ? 154.126 -7.503   -7.150  1.00 89.33  ? 124 ILE D CG1   1 
ATOM   7810  C CG2   . ILE D 2 124 ? 156.471 -6.954   -7.990  1.00 93.64  ? 124 ILE D CG2   1 
ATOM   7811  C CD1   . ILE D 2 124 ? 153.815 -6.072   -6.770  1.00 88.32  ? 124 ILE D CD1   1 
ATOM   7812  N N     . LYS D 2 125 ? 154.841 -11.463  -6.919  1.00 92.16  ? 125 LYS D N     1 
ATOM   7813  C CA    . LYS D 2 125 ? 154.280 -12.524  -6.106  1.00 92.23  ? 125 LYS D CA    1 
ATOM   7814  C C     . LYS D 2 125 ? 155.115 -13.796  -6.279  1.00 94.48  ? 125 LYS D C     1 
ATOM   7815  O O     . LYS D 2 125 ? 155.121 -14.665  -5.413  1.00 94.86  ? 125 LYS D O     1 
ATOM   7816  C CB    . LYS D 2 125 ? 152.849 -12.784  -6.560  1.00 90.53  ? 125 LYS D CB    1 
ATOM   7817  C CG    . LYS D 2 125 ? 151.929 -13.353  -5.524  1.00 89.67  ? 125 LYS D CG    1 
ATOM   7818  C CD    . LYS D 2 125 ? 150.516 -13.449  -6.080  1.00 88.76  ? 125 LYS D CD    1 
ATOM   7819  C CE    . LYS D 2 125 ? 149.514 -13.662  -4.957  1.00 88.58  ? 125 LYS D CE    1 
ATOM   7820  N NZ    . LYS D 2 125 ? 148.107 -13.562  -5.421  1.00 87.33  ? 125 LYS D NZ    1 
ATOM   7821  N N     . GLY D 2 126 ? 155.819 -13.883  -7.408  1.00 96.32  ? 126 GLY D N     1 
ATOM   7822  C CA    . GLY D 2 126 ? 156.560 -15.081  -7.815  1.00 98.99  ? 126 GLY D CA    1 
ATOM   7823  C C     . GLY D 2 126 ? 156.375 -15.326  -9.306  1.00 99.97  ? 126 GLY D C     1 
ATOM   7824  O O     . GLY D 2 126 ? 156.749 -14.492  -10.131 1.00 100.50 ? 126 GLY D O     1 
ATOM   7825  N N     . LYS D 2 127 ? 155.815 -16.485  -9.642  1.00 100.62 ? 127 LYS D N     1 
ATOM   7826  C CA    . LYS D 2 127 ? 155.304 -16.820  -10.993 1.00 101.24 ? 127 LYS D CA    1 
ATOM   7827  C C     . LYS D 2 127 ? 156.266 -17.147  -12.172 1.00 103.63 ? 127 LYS D C     1 
ATOM   7828  O O     . LYS D 2 127 ? 157.186 -17.958  -12.033 1.00 105.82 ? 127 LYS D O     1 
ATOM   7829  C CB    . LYS D 2 127 ? 154.131 -15.922  -11.412 1.00 99.33  ? 127 LYS D CB    1 
ATOM   7830  C CG    . LYS D 2 127 ? 152.839 -16.355  -10.745 1.00 98.14  ? 127 LYS D CG    1 
ATOM   7831  C CD    . LYS D 2 127 ? 151.728 -16.606  -11.752 1.00 97.74  ? 127 LYS D CD    1 
ATOM   7832  C CE    . LYS D 2 127 ? 150.772 -17.661  -11.214 1.00 97.33  ? 127 LYS D CE    1 
ATOM   7833  N NZ    . LYS D 2 127 ? 149.437 -17.590  -11.863 1.00 96.57  ? 127 LYS D NZ    1 
ATOM   7834  N N     . THR D 2 128 ? 156.031 -16.503  -13.317 1.00 103.59 ? 128 THR D N     1 
ATOM   7835  C CA    . THR D 2 128 ? 156.626 -16.868  -14.622 1.00 105.57 ? 128 THR D CA    1 
ATOM   7836  C C     . THR D 2 128 ? 156.116 -18.214  -15.128 1.00 106.18 ? 128 THR D C     1 
ATOM   7837  O O     . THR D 2 128 ? 156.235 -18.524  -16.316 1.00 107.45 ? 128 THR D O     1 
ATOM   7838  C CB    . THR D 2 128 ? 158.186 -16.848  -14.653 1.00 107.92 ? 128 THR D CB    1 
ATOM   7839  O OG1   . THR D 2 128 ? 158.706 -17.893  -13.818 1.00 109.11 ? 128 THR D OG1   1 
ATOM   7840  C CG2   . THR D 2 128 ? 158.743 -15.482  -14.220 1.00 107.53 ? 128 THR D CG2   1 
ATOM   7841  N N     . ILE E 3 5   ? 91.233  5.729    17.671  1.00 95.82  ? 5   ILE E N     1 
ATOM   7842  C CA    . ILE E 3 5   ? 90.176  4.717    17.950  1.00 94.55  ? 5   ILE E CA    1 
ATOM   7843  C C     . ILE E 3 5   ? 88.781  5.367    17.893  1.00 95.09  ? 5   ILE E C     1 
ATOM   7844  O O     . ILE E 3 5   ? 88.604  6.521    18.294  1.00 96.34  ? 5   ILE E O     1 
ATOM   7845  C CB    . ILE E 3 5   ? 90.409  3.981    19.315  1.00 94.06  ? 5   ILE E CB    1 
ATOM   7846  C CG1   . ILE E 3 5   ? 91.855  3.492    19.442  1.00 93.79  ? 5   ILE E CG1   1 
ATOM   7847  C CG2   . ILE E 3 5   ? 89.451  2.792    19.485  1.00 92.42  ? 5   ILE E CG2   1 
ATOM   7848  C CD1   . ILE E 3 5   ? 92.188  2.853    20.796  1.00 93.84  ? 5   ILE E CD1   1 
ATOM   7849  N N     . THR E 3 6   ? 87.816  4.622    17.349  1.00 94.30  ? 6   THR E N     1 
ATOM   7850  C CA    . THR E 3 6   ? 86.378  4.956    17.374  1.00 94.49  ? 6   THR E CA    1 
ATOM   7851  C C     . THR E 3 6   ? 85.573  3.660    17.203  1.00 93.03  ? 6   THR E C     1 
ATOM   7852  O O     . THR E 3 6   ? 85.953  2.787    16.412  1.00 92.38  ? 6   THR E O     1 
ATOM   7853  C CB    . THR E 3 6   ? 85.981  5.942    16.247  1.00 95.41  ? 6   THR E CB    1 
ATOM   7854  O OG1   . THR E 3 6   ? 86.920  7.023    16.201  1.00 97.59  ? 6   THR E OG1   1 
ATOM   7855  C CG2   . THR E 3 6   ? 84.567  6.502    16.468  1.00 95.53  ? 6   THR E CG2   1 
ATOM   7856  N N     . VAL E 3 7   ? 84.476  3.525    17.947  1.00 92.50  ? 7   VAL E N     1 
ATOM   7857  C CA    . VAL E 3 7   ? 83.596  2.364    17.812  1.00 90.85  ? 7   VAL E CA    1 
ATOM   7858  C C     . VAL E 3 7   ? 82.195  2.850    17.474  1.00 91.28  ? 7   VAL E C     1 
ATOM   7859  O O     . VAL E 3 7   ? 81.701  3.792    18.094  1.00 92.40  ? 7   VAL E O     1 
ATOM   7860  C CB    . VAL E 3 7   ? 83.551  1.518    19.104  1.00 90.18  ? 7   VAL E CB    1 
ATOM   7861  C CG1   . VAL E 3 7   ? 82.632  0.337    18.933  1.00 88.95  ? 7   VAL E CG1   1 
ATOM   7862  C CG2   . VAL E 3 7   ? 84.931  1.036    19.489  1.00 89.43  ? 7   VAL E CG2   1 
ATOM   7863  N N     . LYS E 3 8   ? 81.560  2.215    16.493  1.00 90.47  ? 8   LYS E N     1 
ATOM   7864  C CA    . LYS E 3 8   ? 80.204  2.598    16.100  1.00 90.92  ? 8   LYS E CA    1 
ATOM   7865  C C     . LYS E 3 8   ? 79.359  1.418    15.619  1.00 89.55  ? 8   LYS E C     1 
ATOM   7866  O O     . LYS E 3 8   ? 79.892  0.445    15.087  1.00 88.63  ? 8   LYS E O     1 
ATOM   7867  C CB    . LYS E 3 8   ? 80.231  3.719    15.049  1.00 92.12  ? 8   LYS E CB    1 
ATOM   7868  C CG    . LYS E 3 8   ? 80.959  3.378    13.748  1.00 92.60  ? 8   LYS E CG    1 
ATOM   7869  C CD    . LYS E 3 8   ? 81.005  4.586    12.799  1.00 95.62  ? 8   LYS E CD    1 
ATOM   7870  C CE    . LYS E 3 8   ? 82.202  5.509    13.072  1.00 96.94  ? 8   LYS E CE    1 
ATOM   7871  N NZ    . LYS E 3 8   ? 83.500  4.914    12.603  1.00 97.13  ? 8   LYS E NZ    1 
ATOM   7872  N N     . GLN E 3 9   ? 78.044  1.531    15.812  1.00 89.34  ? 9   GLN E N     1 
ATOM   7873  C CA    . GLN E 3 9   ? 77.060  0.524    15.403  1.00 88.23  ? 9   GLN E CA    1 
ATOM   7874  C C     . GLN E 3 9   ? 77.118  0.221    13.899  1.00 87.35  ? 9   GLN E C     1 
ATOM   7875  O O     . GLN E 3 9   ? 77.540  1.062    13.107  1.00 88.10  ? 9   GLN E O     1 
ATOM   7876  C CB    . GLN E 3 9   ? 75.654  1.013    15.774  1.00 89.29  ? 9   GLN E CB    1 
ATOM   7877  C CG    . GLN E 3 9   ? 74.543  -0.047   15.707  1.00 89.81  ? 9   GLN E CG    1 
ATOM   7878  C CD    . GLN E 3 9   ? 74.130  -0.574   17.075  1.00 91.08  ? 9   GLN E CD    1 
ATOM   7879  O OE1   . GLN E 3 9   ? 74.146  0.161    18.061  1.00 92.98  ? 9   GLN E OE1   1 
ATOM   7880  N NE2   . GLN E 3 9   ? 73.739  -1.847   17.136  1.00 89.99  ? 9   GLN E NE2   1 
ATOM   7881  N N     . THR E 3 10  ? 76.703  -0.986   13.518  1.00 85.77  ? 10  THR E N     1 
ATOM   7882  C CA    . THR E 3 10  ? 76.555  -1.359   12.107  1.00 84.72  ? 10  THR E CA    1 
ATOM   7883  C C     . THR E 3 10  ? 75.077  -1.614   11.793  1.00 84.94  ? 10  THR E C     1 
ATOM   7884  O O     . THR E 3 10  ? 74.220  -1.409   12.653  1.00 85.26  ? 10  THR E O     1 
ATOM   7885  C CB    . THR E 3 10  ? 77.416  -2.594   11.723  1.00 83.26  ? 10  THR E CB    1 
ATOM   7886  O OG1   . THR E 3 10  ? 76.909  -3.762   12.365  1.00 81.63  ? 10  THR E OG1   1 
ATOM   7887  C CG2   . THR E 3 10  ? 78.858  -2.399   12.131  1.00 82.72  ? 10  THR E CG2   1 
ATOM   7888  N N     . ASN E 3 11  ? 74.785  -2.053   10.567  1.00 84.71  ? 11  ASN E N     1 
ATOM   7889  C CA    . ASN E 3 11  ? 73.417  -2.383   10.141  1.00 85.02  ? 11  ASN E CA    1 
ATOM   7890  C C     . ASN E 3 11  ? 72.745  -3.442   11.009  1.00 84.01  ? 11  ASN E C     1 
ATOM   7891  O O     . ASN E 3 11  ? 71.518  -3.553   11.031  1.00 84.54  ? 11  ASN E O     1 
ATOM   7892  C CB    . ASN E 3 11  ? 73.411  -2.889   8.699   1.00 85.22  ? 11  ASN E CB    1 
ATOM   7893  C CG    . ASN E 3 11  ? 74.308  -2.079   7.788   1.00 87.21  ? 11  ASN E CG    1 
ATOM   7894  O OD1   . ASN E 3 11  ? 74.282  -0.844   7.796   1.00 89.45  ? 11  ASN E OD1   1 
ATOM   7895  N ND2   . ASN E 3 11  ? 75.110  -2.778   6.985   1.00 88.42  ? 11  ASN E ND2   1 
ATOM   7896  N N     . MET E 3 12  ? 73.564  -4.218   11.709  1.00 82.54  ? 12  MET E N     1 
ATOM   7897  C CA    . MET E 3 12  ? 73.112  -5.342   12.496  1.00 81.26  ? 12  MET E CA    1 
ATOM   7898  C C     . MET E 3 12  ? 73.249  -5.058   13.982  1.00 81.59  ? 12  MET E C     1 
ATOM   7899  O O     . MET E 3 12  ? 74.291  -4.581   14.426  1.00 81.54  ? 12  MET E O     1 
ATOM   7900  C CB    . MET E 3 12  ? 73.948  -6.550   12.120  1.00 79.95  ? 12  MET E CB    1 
ATOM   7901  C CG    . MET E 3 12  ? 73.609  -7.122   10.759  1.00 78.89  ? 12  MET E CG    1 
ATOM   7902  S SD    . MET E 3 12  ? 74.934  -8.016   9.915   1.00 75.04  ? 12  MET E SD    1 
ATOM   7903  C CE    . MET E 3 12  ? 76.004  -8.480   11.263  1.00 74.42  ? 12  MET E CE    1 
ATOM   7904  N N     . GLU E 3 13  ? 72.198  -5.366   14.743  1.00 82.10  ? 13  GLU E N     1 
ATOM   7905  C CA    . GLU E 3 13  ? 72.166  -5.168   16.199  1.00 82.61  ? 13  GLU E CA    1 
ATOM   7906  C C     . GLU E 3 13  ? 73.383  -5.711   16.926  1.00 82.12  ? 13  GLU E C     1 
ATOM   7907  O O     . GLU E 3 13  ? 73.907  -6.760   16.562  1.00 81.30  ? 13  GLU E O     1 
ATOM   7908  C CB    . GLU E 3 13  ? 70.940  -5.838   16.796  1.00 82.80  ? 13  GLU E CB    1 
ATOM   7909  C CG    . GLU E 3 13  ? 69.738  -4.947   16.912  1.00 84.45  ? 13  GLU E CG    1 
ATOM   7910  C CD    . GLU E 3 13  ? 68.777  -5.422   17.981  1.00 85.06  ? 13  GLU E CD    1 
ATOM   7911  O OE1   . GLU E 3 13  ? 68.245  -6.558   17.870  1.00 84.40  ? 13  GLU E OE1   1 
ATOM   7912  O OE2   . GLU E 3 13  ? 68.559  -4.643   18.934  1.00 85.47  ? 13  GLU E OE2   1 
ATOM   7913  N N     . ASN E 3 14  ? 73.811  -4.987   17.960  1.00 83.02  ? 14  ASN E N     1 
ATOM   7914  C CA    . ASN E 3 14  ? 74.940  -5.372   18.825  1.00 82.94  ? 14  ASN E CA    1 
ATOM   7915  C C     . ASN E 3 14  ? 76.204  -5.885   18.115  1.00 82.10  ? 14  ASN E C     1 
ATOM   7916  O O     . ASN E 3 14  ? 76.933  -6.728   18.652  1.00 81.48  ? 14  ASN E O     1 
ATOM   7917  C CB    . ASN E 3 14  ? 74.486  -6.360   19.911  1.00 82.95  ? 14  ASN E CB    1 
ATOM   7918  C CG    . ASN E 3 14  ? 73.714  -5.684   21.034  1.00 84.19  ? 14  ASN E CG    1 
ATOM   7919  O OD1   . ASN E 3 14  ? 74.248  -4.851   21.774  1.00 85.48  ? 14  ASN E OD1   1 
ATOM   7920  N ND2   . ASN E 3 14  ? 72.455  -6.056   21.174  1.00 84.12  ? 14  ASN E ND2   1 
ATOM   7921  N N     . ILE E 3 15  ? 76.446  -5.364   16.915  1.00 82.22  ? 15  ILE E N     1 
ATOM   7922  C CA    . ILE E 3 15  ? 77.656  -5.646   16.155  1.00 81.79  ? 15  ILE E CA    1 
ATOM   7923  C C     . ILE E 3 15  ? 78.247  -4.302   15.726  1.00 82.86  ? 15  ILE E C     1 
ATOM   7924  O O     . ILE E 3 15  ? 77.542  -3.458   15.178  1.00 83.64  ? 15  ILE E O     1 
ATOM   7925  C CB    . ILE E 3 15  ? 77.360  -6.578   14.958  1.00 81.00  ? 15  ILE E CB    1 
ATOM   7926  C CG1   . ILE E 3 15  ? 76.911  -7.950   15.465  1.00 80.27  ? 15  ILE E CG1   1 
ATOM   7927  C CG2   . ILE E 3 15  ? 78.589  -6.756   14.095  1.00 80.52  ? 15  ILE E CG2   1 
ATOM   7928  C CD1   . ILE E 3 15  ? 75.971  -8.694   14.543  1.00 79.08  ? 15  ILE E CD1   1 
ATOM   7929  N N     . TYR E 3 16  ? 79.535  -4.105   16.002  1.00 83.25  ? 16  TYR E N     1 
ATOM   7930  C CA    . TYR E 3 16  ? 80.180  -2.805   15.848  1.00 84.59  ? 16  TYR E CA    1 
ATOM   7931  C C     . TYR E 3 16  ? 81.488  -2.908   15.072  1.00 85.12  ? 16  TYR E C     1 
ATOM   7932  O O     . TYR E 3 16  ? 82.073  -3.985   14.995  1.00 84.37  ? 16  TYR E O     1 
ATOM   7933  C CB    . TYR E 3 16  ? 80.476  -2.208   17.224  1.00 84.95  ? 16  TYR E CB    1 
ATOM   7934  C CG    . TYR E 3 16  ? 79.326  -2.226   18.217  1.00 84.92  ? 16  TYR E CG    1 
ATOM   7935  C CD1   . TYR E 3 16  ? 78.564  -1.083   18.448  1.00 86.15  ? 16  TYR E CD1   1 
ATOM   7936  C CD2   . TYR E 3 16  ? 79.021  -3.374   18.951  1.00 83.59  ? 16  TYR E CD2   1 
ATOM   7937  C CE1   . TYR E 3 16  ? 77.514  -1.088   19.366  1.00 85.91  ? 16  TYR E CE1   1 
ATOM   7938  C CE2   . TYR E 3 16  ? 77.979  -3.388   19.866  1.00 83.54  ? 16  TYR E CE2   1 
ATOM   7939  C CZ    . TYR E 3 16  ? 77.229  -2.243   20.069  1.00 84.92  ? 16  TYR E CZ    1 
ATOM   7940  O OH    . TYR E 3 16  ? 76.193  -2.251   20.974  1.00 85.16  ? 16  TYR E OH    1 
ATOM   7941  N N     . GLU E 3 17  ? 81.939  -1.784   14.508  1.00 87.04  ? 17  GLU E N     1 
ATOM   7942  C CA    . GLU E 3 17  ? 83.248  -1.679   13.848  1.00 88.41  ? 17  GLU E CA    1 
ATOM   7943  C C     . GLU E 3 17  ? 84.151  -0.670   14.536  1.00 89.85  ? 17  GLU E C     1 
ATOM   7944  O O     . GLU E 3 17  ? 83.677  0.316    15.092  1.00 90.75  ? 17  GLU E O     1 
ATOM   7945  C CB    . GLU E 3 17  ? 83.096  -1.261   12.387  1.00 88.97  ? 17  GLU E CB    1 
ATOM   7946  C CG    . GLU E 3 17  ? 83.057  -2.415   11.397  1.00 90.30  ? 17  GLU E CG    1 
ATOM   7947  C CD    . GLU E 3 17  ? 83.214  -1.972   9.939   1.00 93.24  ? 17  GLU E CD    1 
ATOM   7948  O OE1   . GLU E 3 17  ? 83.526  -2.849   9.091   1.00 93.96  ? 17  GLU E OE1   1 
ATOM   7949  O OE2   . GLU E 3 17  ? 83.025  -0.763   9.644   1.00 94.23  ? 17  GLU E OE2   1 
ATOM   7950  N N     . CYS E 3 18  ? 85.458  -0.906   14.467  1.00 90.82  ? 18  CYS E N     1 
ATOM   7951  C CA    . CYS E 3 18  ? 86.438  0.030    15.014  1.00 92.94  ? 18  CYS E CA    1 
ATOM   7952  C C     . CYS E 3 18  ? 87.310  0.704    13.977  1.00 94.21  ? 18  CYS E C     1 
ATOM   7953  O O     . CYS E 3 18  ? 87.877  0.048    13.103  1.00 94.03  ? 18  CYS E O     1 
ATOM   7954  C CB    . CYS E 3 18  ? 87.361  -0.670   15.992  1.00 92.48  ? 18  CYS E CB    1 
ATOM   7955  S SG    . CYS E 3 18  ? 86.477  -1.403   17.311  1.00 94.00  ? 18  CYS E SG    1 
ATOM   7956  N N     . GLU E 3 19  ? 87.417  2.023    14.098  1.00 96.10  ? 19  GLU E N     1 
ATOM   7957  C CA    . GLU E 3 19  ? 88.467  2.783    13.448  1.00 97.62  ? 19  GLU E CA    1 
ATOM   7958  C C     . GLU E 3 19  ? 89.641  2.651    14.411  1.00 97.88  ? 19  GLU E C     1 
ATOM   7959  O O     . GLU E 3 19  ? 89.462  2.791    15.620  1.00 97.97  ? 19  GLU E O     1 
ATOM   7960  C CB    . GLU E 3 19  ? 88.040  4.250    13.318  1.00 99.25  ? 19  GLU E CB    1 
ATOM   7961  C CG    . GLU E 3 19  ? 88.005  4.807    11.885  1.00 100.80 ? 19  GLU E CG    1 
ATOM   7962  C CD    . GLU E 3 19  ? 89.344  5.363    11.393  1.00 102.93 ? 19  GLU E CD    1 
ATOM   7963  O OE1   . GLU E 3 19  ? 90.268  5.566    12.213  1.00 103.48 ? 19  GLU E OE1   1 
ATOM   7964  O OE2   . GLU E 3 19  ? 89.471  5.613    10.173  1.00 104.29 ? 19  GLU E OE2   1 
ATOM   7965  N N     . PHE E 3 20  ? 90.828  2.356    13.893  1.00 98.24  ? 20  PHE E N     1 
ATOM   7966  C CA    . PHE E 3 20  ? 91.977  2.091    14.762  1.00 98.67  ? 20  PHE E CA    1 
ATOM   7967  C C     . PHE E 3 20  ? 93.086  3.149    14.749  1.00 100.11 ? 20  PHE E C     1 
ATOM   7968  O O     . PHE E 3 20  ? 93.179  3.951    13.810  1.00 100.89 ? 20  PHE E O     1 
ATOM   7969  C CB    . PHE E 3 20  ? 92.553  0.700    14.472  1.00 97.77  ? 20  PHE E CB    1 
ATOM   7970  C CG    . PHE E 3 20  ? 92.000  -0.373   15.360  1.00 96.98  ? 20  PHE E CG    1 
ATOM   7971  C CD1   . PHE E 3 20  ? 91.089  -1.297   14.870  1.00 96.47  ? 20  PHE E CD1   1 
ATOM   7972  C CD2   . PHE E 3 20  ? 92.379  -0.449   16.697  1.00 97.37  ? 20  PHE E CD2   1 
ATOM   7973  C CE1   . PHE E 3 20  ? 90.571  -2.290   15.696  1.00 95.95  ? 20  PHE E CE1   1 
ATOM   7974  C CE2   . PHE E 3 20  ? 91.862  -1.429   17.529  1.00 96.45  ? 20  PHE E CE2   1 
ATOM   7975  C CZ    . PHE E 3 20  ? 90.958  -2.352   17.029  1.00 95.85  ? 20  PHE E CZ    1 
ATOM   7976  N N     . ASN E 3 21  ? 93.918  3.132    15.802  1.00 100.50 ? 21  ASN E N     1 
ATOM   7977  C CA    . ASN E 3 21  ? 95.082  4.028    15.948  1.00 101.66 ? 21  ASN E CA    1 
ATOM   7978  C C     . ASN E 3 21  ? 95.840  4.189    14.631  1.00 101.98 ? 21  ASN E C     1 
ATOM   7979  O O     . ASN E 3 21  ? 96.450  5.224    14.388  1.00 103.33 ? 21  ASN E O     1 
ATOM   7980  C CB    . ASN E 3 21  ? 96.067  3.533    17.034  1.00 101.84 ? 21  ASN E CB    1 
ATOM   7981  C CG    . ASN E 3 21  ? 95.409  2.636    18.103  1.00 100.74 ? 21  ASN E CG    1 
ATOM   7982  O OD1   . ASN E 3 21  ? 94.507  3.059    18.828  1.00 99.89  ? 21  ASN E OD1   1 
ATOM   7983  N ND2   . ASN E 3 21  ? 95.894  1.398    18.213  1.00 99.09  ? 21  ASN E ND2   1 
ATOM   7984  N N     . ASP E 3 22  ? 95.780  3.151    13.793  1.00 100.85 ? 22  ASP E N     1 
ATOM   7985  C CA    . ASP E 3 22  ? 96.479  3.110    12.506  1.00 101.00 ? 22  ASP E CA    1 
ATOM   7986  C C     . ASP E 3 22  ? 95.562  3.331    11.297  1.00 100.60 ? 22  ASP E C     1 
ATOM   7987  O O     . ASP E 3 22  ? 96.011  3.837    10.267  1.00 101.66 ? 22  ASP E O     1 
ATOM   7988  C CB    . ASP E 3 22  ? 97.266  1.793    12.353  1.00 100.31 ? 22  ASP E CB    1 
ATOM   7989  C CG    . ASP E 3 22  ? 96.384  0.610    11.955  1.00 99.09  ? 22  ASP E CG    1 
ATOM   7990  O OD1   . ASP E 3 22  ? 96.365  -0.397   12.691  1.00 98.58  ? 22  ASP E OD1   1 
ATOM   7991  O OD2   . ASP E 3 22  ? 95.718  0.675    10.900  1.00 99.26  ? 22  ASP E OD2   1 
ATOM   7992  N N     . GLY E 3 23  ? 94.298  2.925    11.412  1.00 99.11  ? 23  GLY E N     1 
ATOM   7993  C CA    . GLY E 3 23  ? 93.349  3.050    10.302  1.00 98.44  ? 23  GLY E CA    1 
ATOM   7994  C C     . GLY E 3 23  ? 92.899  1.729    9.696   1.00 96.71  ? 23  GLY E C     1 
ATOM   7995  O O     . GLY E 3 23  ? 92.639  1.637    8.494   1.00 96.81  ? 23  GLY E O     1 
ATOM   7996  N N     . SER E 3 24  ? 92.814  0.700    10.530  1.00 95.06  ? 24  SER E N     1 
ATOM   7997  C CA    . SER E 3 24  ? 92.237  -0.574   10.121  1.00 93.08  ? 24  SER E CA    1 
ATOM   7998  C C     . SER E 3 24  ? 90.825  -0.656   10.678  1.00 91.85  ? 24  SER E C     1 
ATOM   7999  O O     . SER E 3 24  ? 90.474  0.090    11.599  1.00 92.45  ? 24  SER E O     1 
ATOM   8000  C CB    . SER E 3 24  ? 93.087  -1.742   10.629  1.00 92.53  ? 24  SER E CB    1 
ATOM   8001  O OG    . SER E 3 24  ? 93.294  -1.666   12.031  1.00 92.75  ? 24  SER E OG    1 
ATOM   8002  N N     . PHE E 3 25  ? 90.020  -1.552   10.118  1.00 90.00  ? 25  PHE E N     1 
ATOM   8003  C CA    . PHE E 3 25  ? 88.638  -1.726   10.550  1.00 88.48  ? 25  PHE E CA    1 
ATOM   8004  C C     . PHE E 3 25  ? 88.377  -3.160   10.982  1.00 86.42  ? 25  PHE E C     1 
ATOM   8005  O O     . PHE E 3 25  ? 88.422  -4.078   10.154  1.00 85.89  ? 25  PHE E O     1 
ATOM   8006  C CB    . PHE E 3 25  ? 87.688  -1.341   9.413   1.00 89.13  ? 25  PHE E CB    1 
ATOM   8007  C CG    . PHE E 3 25  ? 87.362  0.128    9.352   1.00 90.68  ? 25  PHE E CG    1 
ATOM   8008  C CD1   . PHE E 3 25  ? 88.329  1.063    8.991   1.00 92.12  ? 25  PHE E CD1   1 
ATOM   8009  C CD2   . PHE E 3 25  ? 86.073  0.573    9.636   1.00 91.13  ? 25  PHE E CD2   1 
ATOM   8010  C CE1   . PHE E 3 25  ? 88.018  2.422    8.932   1.00 93.71  ? 25  PHE E CE1   1 
ATOM   8011  C CE2   . PHE E 3 25  ? 85.756  1.925    9.579   1.00 92.83  ? 25  PHE E CE2   1 
ATOM   8012  C CZ    . PHE E 3 25  ? 86.728  2.852    9.224   1.00 93.61  ? 25  PHE E CZ    1 
ATOM   8013  N N     . ARG E 3 26  ? 88.109  -3.364   12.270  1.00 84.93  ? 26  ARG E N     1 
ATOM   8014  C CA    . ARG E 3 26  ? 87.799  -4.714   12.759  1.00 83.05  ? 26  ARG E CA    1 
ATOM   8015  C C     . ARG E 3 26  ? 86.460  -4.832   13.475  1.00 81.35  ? 26  ARG E C     1 
ATOM   8016  O O     . ARG E 3 26  ? 86.059  -3.926   14.201  1.00 81.85  ? 26  ARG E O     1 
ATOM   8017  C CB    . ARG E 3 26  ? 88.944  -5.286   13.602  1.00 83.19  ? 26  ARG E CB    1 
ATOM   8018  C CG    . ARG E 3 26  ? 89.934  -6.079   12.754  1.00 85.41  ? 26  ARG E CG    1 
ATOM   8019  C CD    . ARG E 3 26  ? 91.206  -6.444   13.492  1.00 89.14  ? 26  ARG E CD    1 
ATOM   8020  N NE    . ARG E 3 26  ? 92.253  -6.895   12.569  1.00 92.84  ? 26  ARG E NE    1 
ATOM   8021  C CZ    . ARG E 3 26  ? 93.481  -7.280   12.934  1.00 95.35  ? 26  ARG E CZ    1 
ATOM   8022  N NH1   . ARG E 3 26  ? 93.844  -7.282   14.220  1.00 96.03  ? 26  ARG E NH1   1 
ATOM   8023  N NH2   . ARG E 3 26  ? 94.357  -7.669   12.006  1.00 95.77  ? 26  ARG E NH2   1 
ATOM   8024  N N     . LEU E 3 27  ? 85.770  -5.946   13.243  1.00 78.98  ? 27  LEU E N     1 
ATOM   8025  C CA    . LEU E 3 27  ? 84.498  -6.233   13.908  1.00 77.20  ? 27  LEU E CA    1 
ATOM   8026  C C     . LEU E 3 27  ? 84.668  -6.523   15.396  1.00 76.30  ? 27  LEU E C     1 
ATOM   8027  O O     . LEU E 3 27  ? 85.700  -7.048   15.836  1.00 76.27  ? 27  LEU E O     1 
ATOM   8028  C CB    . LEU E 3 27  ? 83.818  -7.437   13.269  1.00 76.37  ? 27  LEU E CB    1 
ATOM   8029  C CG    . LEU E 3 27  ? 83.089  -7.273   11.949  1.00 75.62  ? 27  LEU E CG    1 
ATOM   8030  C CD1   . LEU E 3 27  ? 82.904  -8.656   11.356  1.00 74.72  ? 27  LEU E CD1   1 
ATOM   8031  C CD2   . LEU E 3 27  ? 81.763  -6.566   12.155  1.00 74.35  ? 27  LEU E CD2   1 
ATOM   8032  N N     . CYS E 3 28  ? 83.638  -6.197   16.165  1.00 75.10  ? 28  CYS E N     1 
ATOM   8033  C CA    . CYS E 3 28  ? 83.632  -6.483   17.587  1.00 73.92  ? 28  CYS E CA    1 
ATOM   8034  C C     . CYS E 3 28  ? 82.208  -6.571   18.124  1.00 73.26  ? 28  CYS E C     1 
ATOM   8035  O O     . CYS E 3 28  ? 81.256  -6.171   17.457  1.00 73.29  ? 28  CYS E O     1 
ATOM   8036  C CB    . CYS E 3 28  ? 84.437  -5.435   18.354  1.00 74.70  ? 28  CYS E CB    1 
ATOM   8037  S SG    . CYS E 3 28  ? 83.871  -3.750   18.118  1.00 75.41  ? 28  CYS E SG    1 
ATOM   8038  N N     . THR E 3 29  ? 82.073  -7.120   19.325  1.00 72.29  ? 29  THR E N     1 
ATOM   8039  C CA    . THR E 3 29  ? 80.783  -7.264   19.971  1.00 71.46  ? 29  THR E CA    1 
ATOM   8040  C C     . THR E 3 29  ? 80.873  -6.681   21.366  1.00 71.93  ? 29  THR E C     1 
ATOM   8041  O O     . THR E 3 29  ? 81.961  -6.538   21.919  1.00 71.87  ? 29  THR E O     1 
ATOM   8042  C CB    . THR E 3 29  ? 80.332  -8.737   20.048  1.00 70.70  ? 29  THR E CB    1 
ATOM   8043  O OG1   . THR E 3 29  ? 81.433  -9.572   20.430  1.00 69.64  ? 29  THR E OG1   1 
ATOM   8044  C CG2   . THR E 3 29  ? 79.814  -9.200   18.710  1.00 70.39  ? 29  THR E CG2   1 
ATOM   8045  N N     . ARG E 3 30  ? 79.718  -6.344   21.924  1.00 72.15  ? 30  ARG E N     1 
ATOM   8046  C CA    . ARG E 3 30  ? 79.624  -5.738   23.242  1.00 72.60  ? 30  ARG E CA    1 
ATOM   8047  C C     . ARG E 3 30  ? 79.833  -6.816   24.298  1.00 71.73  ? 30  ARG E C     1 
ATOM   8048  O O     . ARG E 3 30  ? 79.111  -7.818   24.323  1.00 71.20  ? 30  ARG E O     1 
ATOM   8049  C CB    . ARG E 3 30  ? 78.247  -5.108   23.389  1.00 73.75  ? 30  ARG E CB    1 
ATOM   8050  C CG    . ARG E 3 30  ? 78.158  -4.007   24.395  1.00 76.25  ? 30  ARG E CG    1 
ATOM   8051  C CD    . ARG E 3 30  ? 76.845  -3.269   24.230  1.00 79.53  ? 30  ARG E CD    1 
ATOM   8052  N NE    . ARG E 3 30  ? 76.699  -2.262   25.270  1.00 83.49  ? 30  ARG E NE    1 
ATOM   8053  C CZ    . ARG E 3 30  ? 76.177  -2.498   26.467  1.00 85.80  ? 30  ARG E CZ    1 
ATOM   8054  N NH1   . ARG E 3 30  ? 75.735  -3.714   26.776  1.00 86.28  ? 30  ARG E NH1   1 
ATOM   8055  N NH2   . ARG E 3 30  ? 76.094  -1.512   27.354  1.00 88.06  ? 30  ARG E NH2   1 
ATOM   8056  N N     . ASN E 3 31  ? 80.823  -6.609   25.163  1.00 71.44  ? 31  ASN E N     1 
ATOM   8057  C CA    . ASN E 3 31  ? 81.248  -7.660   26.089  1.00 70.66  ? 31  ASN E CA    1 
ATOM   8058  C C     . ASN E 3 31  ? 80.294  -7.842   27.251  1.00 71.17  ? 31  ASN E C     1 
ATOM   8059  O O     . ASN E 3 31  ? 80.189  -6.976   28.129  1.00 72.24  ? 31  ASN E O     1 
ATOM   8060  C CB    . ASN E 3 31  ? 82.671  -7.434   26.606  1.00 70.83  ? 31  ASN E CB    1 
ATOM   8061  C CG    . ASN E 3 31  ? 83.274  -8.685   27.241  1.00 69.62  ? 31  ASN E CG    1 
ATOM   8062  O OD1   . ASN E 3 31  ? 84.375  -8.650   27.795  1.00 68.82  ? 31  ASN E OD1   1 
ATOM   8063  N ND2   . ASN E 3 31  ? 82.557  -9.795   27.155  1.00 68.77  ? 31  ASN E ND2   1 
ATOM   8064  N N     . LEU E 3 32  ? 79.613  -8.987   27.233  1.00 70.23  ? 32  LEU E N     1 
ATOM   8065  C CA    . LEU E 3 32  ? 78.642  -9.379   28.249  1.00 70.09  ? 32  LEU E CA    1 
ATOM   8066  C C     . LEU E 3 32  ? 79.297  -9.652   29.615  1.00 70.53  ? 32  LEU E C     1 
ATOM   8067  O O     . LEU E 3 32  ? 78.652  -9.527   30.648  1.00 71.44  ? 32  LEU E O     1 
ATOM   8068  C CB    . LEU E 3 32  ? 77.895  -10.615  27.757  1.00 69.20  ? 32  LEU E CB    1 
ATOM   8069  C CG    . LEU E 3 32  ? 76.712  -11.140  28.548  1.00 69.13  ? 32  LEU E CG    1 
ATOM   8070  C CD1   . LEU E 3 32  ? 75.422  -10.502  28.069  1.00 69.30  ? 32  LEU E CD1   1 
ATOM   8071  C CD2   . LEU E 3 32  ? 76.668  -12.632  28.368  1.00 68.66  ? 32  LEU E CD2   1 
ATOM   8072  N N     . VAL E 3 33  ? 80.571  -10.034  29.611  1.00 69.79  ? 33  VAL E N     1 
ATOM   8073  C CA    . VAL E 3 33  ? 81.323  -10.264  30.836  1.00 70.36  ? 33  VAL E CA    1 
ATOM   8074  C C     . VAL E 3 33  ? 82.618  -9.444   30.799  1.00 70.58  ? 33  VAL E C     1 
ATOM   8075  O O     . VAL E 3 33  ? 83.685  -9.996   30.524  1.00 70.27  ? 33  VAL E O     1 
ATOM   8076  C CB    . VAL E 3 33  ? 81.680  -11.755  31.011  1.00 69.94  ? 33  VAL E CB    1 
ATOM   8077  C CG1   . VAL E 3 33  ? 82.102  -12.050  32.445  1.00 71.17  ? 33  VAL E CG1   1 
ATOM   8078  C CG2   . VAL E 3 33  ? 80.512  -12.643  30.610  1.00 69.97  ? 33  VAL E CG2   1 
ATOM   8079  N N     . PRO E 3 34  ? 82.532  -8.124   31.077  1.00 71.24  ? 34  PRO E N     1 
ATOM   8080  C CA    . PRO E 3 34  ? 83.666  -7.204   30.960  1.00 71.46  ? 34  PRO E CA    1 
ATOM   8081  C C     . PRO E 3 34  ? 84.890  -7.617   31.763  1.00 72.08  ? 34  PRO E C     1 
ATOM   8082  O O     . PRO E 3 34  ? 84.754  -8.171   32.853  1.00 72.72  ? 34  PRO E O     1 
ATOM   8083  C CB    . PRO E 3 34  ? 83.103  -5.897   31.501  1.00 72.43  ? 34  PRO E CB    1 
ATOM   8084  C CG    . PRO E 3 34  ? 81.662  -5.989   31.207  1.00 72.44  ? 34  PRO E CG    1 
ATOM   8085  C CD    . PRO E 3 34  ? 81.315  -7.409   31.489  1.00 71.98  ? 34  PRO E CD    1 
ATOM   8086  N N     . ASN E 3 35  ? 86.065  -7.318   31.203  1.00 72.23  ? 35  ASN E N     1 
ATOM   8087  C CA    . ASN E 3 35  ? 87.399  -7.736   31.692  1.00 72.94  ? 35  ASN E CA    1 
ATOM   8088  C C     . ASN E 3 35  ? 87.822  -9.167   31.334  1.00 72.18  ? 35  ASN E C     1 
ATOM   8089  O O     . ASN E 3 35  ? 88.928  -9.587   31.686  1.00 72.50  ? 35  ASN E O     1 
ATOM   8090  C CB    . ASN E 3 35  ? 87.573  -7.506   33.197  1.00 74.25  ? 35  ASN E CB    1 
ATOM   8091  C CG    . ASN E 3 35  ? 87.235  -6.100   33.612  1.00 76.11  ? 35  ASN E CG    1 
ATOM   8092  O OD1   . ASN E 3 35  ? 87.816  -5.128   33.118  1.00 77.05  ? 35  ASN E OD1   1 
ATOM   8093  N ND2   . ASN E 3 35  ? 86.287  -5.978   34.536  1.00 78.10  ? 35  ASN E ND2   1 
ATOM   8094  N N     . PHE E 3 36  ? 86.956  -9.898   30.631  1.00 71.36  ? 36  PHE E N     1 
ATOM   8095  C CA    . PHE E 3 36  ? 87.183  -11.317  30.359  1.00 71.04  ? 36  PHE E CA    1 
ATOM   8096  C C     . PHE E 3 36  ? 86.983  -11.726  28.893  1.00 70.30  ? 36  PHE E C     1 
ATOM   8097  O O     . PHE E 3 36  ? 85.937  -11.445  28.287  1.00 69.74  ? 36  PHE E O     1 
ATOM   8098  C CB    . PHE E 3 36  ? 86.332  -12.182  31.297  1.00 71.30  ? 36  PHE E CB    1 
ATOM   8099  C CG    . PHE E 3 36  ? 86.835  -12.208  32.713  1.00 72.23  ? 36  PHE E CG    1 
ATOM   8100  C CD1   . PHE E 3 36  ? 86.416  -11.254  33.630  1.00 72.97  ? 36  PHE E CD1   1 
ATOM   8101  C CD2   . PHE E 3 36  ? 87.741  -13.184  33.128  1.00 72.44  ? 36  PHE E CD2   1 
ATOM   8102  C CE1   . PHE E 3 36  ? 86.891  -11.268  34.934  1.00 74.50  ? 36  PHE E CE1   1 
ATOM   8103  C CE2   . PHE E 3 36  ? 88.223  -13.206  34.436  1.00 73.36  ? 36  PHE E CE2   1 
ATOM   8104  C CZ    . PHE E 3 36  ? 87.796  -12.248  35.338  1.00 74.70  ? 36  PHE E CZ    1 
ATOM   8105  N N     . ASN E 3 37  ? 88.005  -12.403  28.357  1.00 70.26  ? 37  ASN E N     1 
ATOM   8106  C CA    . ASN E 3 37  ? 88.091  -12.839  26.954  1.00 69.83  ? 37  ASN E CA    1 
ATOM   8107  C C     . ASN E 3 37  ? 88.116  -14.372  26.812  1.00 69.58  ? 37  ASN E C     1 
ATOM   8108  O O     . ASN E 3 37  ? 88.730  -15.060  27.635  1.00 70.47  ? 37  ASN E O     1 
ATOM   8109  C CB    . ASN E 3 37  ? 89.363  -12.272  26.328  1.00 69.93  ? 37  ASN E CB    1 
ATOM   8110  C CG    . ASN E 3 37  ? 90.625  -12.776  27.021  1.00 71.38  ? 37  ASN E CG    1 
ATOM   8111  O OD1   . ASN E 3 37  ? 90.684  -12.849  28.248  1.00 73.11  ? 37  ASN E OD1   1 
ATOM   8112  N ND2   . ASN E 3 37  ? 91.629  -13.139  26.239  1.00 72.13  ? 37  ASN E ND2   1 
ATOM   8113  N N     . VAL E 3 38  ? 87.491  -14.906  25.764  1.00 68.65  ? 38  VAL E N     1 
ATOM   8114  C CA    . VAL E 3 38  ? 87.365  -16.359  25.640  1.00 68.61  ? 38  VAL E CA    1 
ATOM   8115  C C     . VAL E 3 38  ? 88.525  -17.058  24.929  1.00 68.22  ? 38  VAL E C     1 
ATOM   8116  O O     . VAL E 3 38  ? 89.092  -17.994  25.465  1.00 68.89  ? 38  VAL E O     1 
ATOM   8117  C CB    . VAL E 3 38  ? 86.001  -16.794  25.081  1.00 68.23  ? 38  VAL E CB    1 
ATOM   8118  C CG1   . VAL E 3 38  ? 84.886  -16.309  26.003  1.00 69.68  ? 38  VAL E CG1   1 
ATOM   8119  C CG2   . VAL E 3 38  ? 85.787  -16.263  23.700  1.00 68.28  ? 38  VAL E CG2   1 
ATOM   8120  N N     . TYR E 3 39  ? 88.875  -16.627  23.729  1.00 67.83  ? 39  TYR E N     1 
ATOM   8121  C CA    . TYR E 3 39  ? 90.175  -16.995  23.160  1.00 67.87  ? 39  TYR E CA    1 
ATOM   8122  C C     . TYR E 3 39  ? 91.133  -15.831  23.485  1.00 68.57  ? 39  TYR E C     1 
ATOM   8123  O O     . TYR E 3 39  ? 90.953  -15.173  24.521  1.00 69.59  ? 39  TYR E O     1 
ATOM   8124  C CB    . TYR E 3 39  ? 90.074  -17.347  21.664  1.00 67.16  ? 39  TYR E CB    1 
ATOM   8125  C CG    . TYR E 3 39  ? 89.229  -16.408  20.838  1.00 65.87  ? 39  TYR E CG    1 
ATOM   8126  C CD1   . TYR E 3 39  ? 89.793  -15.677  19.801  1.00 65.86  ? 39  TYR E CD1   1 
ATOM   8127  C CD2   . TYR E 3 39  ? 87.868  -16.254  21.089  1.00 65.11  ? 39  TYR E CD2   1 
ATOM   8128  C CE1   . TYR E 3 39  ? 89.024  -14.799  19.039  1.00 66.13  ? 39  TYR E CE1   1 
ATOM   8129  C CE2   . TYR E 3 39  ? 87.088  -15.373  20.345  1.00 64.99  ? 39  TYR E CE2   1 
ATOM   8130  C CZ    . TYR E 3 39  ? 87.672  -14.654  19.321  1.00 65.42  ? 39  TYR E CZ    1 
ATOM   8131  O OH    . TYR E 3 39  ? 86.916  -13.789  18.575  1.00 65.05  ? 39  TYR E OH    1 
ATOM   8132  N N     . GLY E 3 40  ? 92.129  -15.552  22.650  1.00 68.05  ? 40  GLY E N     1 
ATOM   8133  C CA    . GLY E 3 40  ? 93.084  -14.488  22.993  1.00 68.32  ? 40  GLY E CA    1 
ATOM   8134  C C     . GLY E 3 40  ? 92.696  -13.057  22.646  1.00 68.17  ? 40  GLY E C     1 
ATOM   8135  O O     . GLY E 3 40  ? 93.514  -12.149  22.781  1.00 68.70  ? 40  GLY E O     1 
ATOM   8136  N N     . GLU E 3 41  ? 91.447  -12.855  22.230  1.00 67.69  ? 41  GLU E N     1 
ATOM   8137  C CA    . GLU E 3 41  ? 90.995  -11.607  21.587  1.00 67.79  ? 41  GLU E CA    1 
ATOM   8138  C C     . GLU E 3 41  ? 91.208  -10.329  22.380  1.00 69.08  ? 41  GLU E C     1 
ATOM   8139  O O     . GLU E 3 41  ? 91.235  -10.343  23.611  1.00 70.00  ? 41  GLU E O     1 
ATOM   8140  C CB    . GLU E 3 41  ? 89.524  -11.703  21.183  1.00 67.01  ? 41  GLU E CB    1 
ATOM   8141  C CG    . GLU E 3 41  ? 88.528  -11.501  22.314  1.00 66.49  ? 41  GLU E CG    1 
ATOM   8142  C CD    . GLU E 3 41  ? 88.214  -12.775  23.096  1.00 65.52  ? 41  GLU E CD    1 
ATOM   8143  O OE1   . GLU E 3 41  ? 88.995  -13.750  23.034  1.00 63.22  ? 41  GLU E OE1   1 
ATOM   8144  O OE2   . GLU E 3 41  ? 87.169  -12.787  23.785  1.00 65.63  ? 41  GLU E OE2   1 
ATOM   8145  N N     . ARG E 3 42  ? 91.335  -9.223   21.648  1.00 69.74  ? 42  ARG E N     1 
ATOM   8146  C CA    . ARG E 3 42  ? 91.624  -7.911   22.217  1.00 70.93  ? 42  ARG E CA    1 
ATOM   8147  C C     . ARG E 3 42  ? 90.384  -7.389   22.894  1.00 71.21  ? 42  ARG E C     1 
ATOM   8148  O O     . ARG E 3 42  ? 89.299  -7.497   22.348  1.00 70.94  ? 42  ARG E O     1 
ATOM   8149  C CB    . ARG E 3 42  ? 92.027  -6.947   21.102  1.00 71.21  ? 42  ARG E CB    1 
ATOM   8150  C CG    . ARG E 3 42  ? 93.225  -6.058   21.407  1.00 72.98  ? 42  ARG E CG    1 
ATOM   8151  C CD    . ARG E 3 42  ? 92.819  -4.654   21.835  1.00 75.22  ? 42  ARG E CD    1 
ATOM   8152  N NE    . ARG E 3 42  ? 93.942  -3.720   21.796  1.00 77.43  ? 42  ARG E NE    1 
ATOM   8153  C CZ    . ARG E 3 42  ? 94.313  -3.039   20.713  1.00 78.91  ? 42  ARG E CZ    1 
ATOM   8154  N NH1   . ARG E 3 42  ? 93.644  -3.182   19.578  1.00 78.88  ? 42  ARG E NH1   1 
ATOM   8155  N NH2   . ARG E 3 42  ? 95.357  -2.220   20.756  1.00 80.19  ? 42  ARG E NH2   1 
ATOM   8156  N N     . LEU E 3 43  ? 90.538  -6.838   24.090  1.00 72.45  ? 43  LEU E N     1 
ATOM   8157  C CA    . LEU E 3 43  ? 89.446  -6.123   24.739  1.00 73.35  ? 43  LEU E CA    1 
ATOM   8158  C C     . LEU E 3 43  ? 89.616  -4.626   24.512  1.00 74.64  ? 43  LEU E C     1 
ATOM   8159  O O     . LEU E 3 43  ? 90.699  -4.081   24.749  1.00 75.23  ? 43  LEU E O     1 
ATOM   8160  C CB    . LEU E 3 43  ? 89.419  -6.425   26.232  1.00 73.85  ? 43  LEU E CB    1 
ATOM   8161  C CG    . LEU E 3 43  ? 89.184  -7.880   26.641  1.00 73.23  ? 43  LEU E CG    1 
ATOM   8162  C CD1   . LEU E 3 43  ? 89.624  -8.118   28.085  1.00 74.08  ? 43  LEU E CD1   1 
ATOM   8163  C CD2   . LEU E 3 43  ? 87.737  -8.261   26.451  1.00 72.07  ? 43  LEU E CD2   1 
ATOM   8164  N N     . ILE E 3 44  ? 88.556  -3.964   24.047  1.00 75.39  ? 44  ILE E N     1 
ATOM   8165  C CA    . ILE E 3 44  ? 88.617  -2.516   23.771  1.00 77.28  ? 44  ILE E CA    1 
ATOM   8166  C C     . ILE E 3 44  ? 87.551  -1.664   24.461  1.00 78.52  ? 44  ILE E C     1 
ATOM   8167  O O     . ILE E 3 44  ? 86.352  -1.870   24.263  1.00 78.11  ? 44  ILE E O     1 
ATOM   8168  C CB    . ILE E 3 44  ? 88.642  -2.186   22.253  1.00 76.88  ? 44  ILE E CB    1 
ATOM   8169  C CG1   . ILE E 3 44  ? 87.548  -2.948   21.505  1.00 76.35  ? 44  ILE E CG1   1 
ATOM   8170  C CG2   . ILE E 3 44  ? 90.021  -2.473   21.677  1.00 77.10  ? 44  ILE E CG2   1 
ATOM   8171  C CD1   . ILE E 3 44  ? 87.710  -2.946   20.008  1.00 75.63  ? 44  ILE E CD1   1 
ATOM   8172  N N     . LYS E 3 45  ? 88.020  -0.710   25.272  1.00 80.49  ? 45  LYS E N     1 
ATOM   8173  C CA    . LYS E 3 45  ? 87.165  0.272    25.937  1.00 82.21  ? 45  LYS E CA    1 
ATOM   8174  C C     . LYS E 3 45  ? 87.023  1.501    25.062  1.00 83.05  ? 45  LYS E C     1 
ATOM   8175  O O     . LYS E 3 45  ? 88.004  1.989    24.511  1.00 83.26  ? 45  LYS E O     1 
ATOM   8176  C CB    . LYS E 3 45  ? 87.728  0.678    27.309  1.00 83.46  ? 45  LYS E CB    1 
ATOM   8177  C CG    . LYS E 3 45  ? 87.469  -0.327   28.420  1.00 83.98  ? 45  LYS E CG    1 
ATOM   8178  C CD    . LYS E 3 45  ? 87.158  0.376    29.728  1.00 86.63  ? 45  LYS E CD    1 
ATOM   8179  C CE    . LYS E 3 45  ? 86.501  -0.583   30.710  1.00 87.68  ? 45  LYS E CE    1 
ATOM   8180  N NZ    . LYS E 3 45  ? 86.288  0.032    32.054  1.00 90.60  ? 45  LYS E NZ    1 
ATOM   8181  N N     . TYR E 3 46  ? 85.790  1.977    24.922  1.00 83.89  ? 46  TYR E N     1 
ATOM   8182  C CA    . TYR E 3 46  ? 85.501  3.227    24.222  1.00 85.34  ? 46  TYR E CA    1 
ATOM   8183  C C     . TYR E 3 46  ? 84.260  3.859    24.832  1.00 86.25  ? 46  TYR E C     1 
ATOM   8184  O O     . TYR E 3 46  ? 83.222  3.203    24.953  1.00 85.79  ? 46  TYR E O     1 
ATOM   8185  C CB    . TYR E 3 46  ? 85.306  2.998    22.719  1.00 84.69  ? 46  TYR E CB    1 
ATOM   8186  C CG    . TYR E 3 46  ? 84.877  4.240    21.970  1.00 86.55  ? 46  TYR E CG    1 
ATOM   8187  C CD1   . TYR E 3 46  ? 85.799  5.237    21.659  1.00 88.76  ? 46  TYR E CD1   1 
ATOM   8188  C CD2   . TYR E 3 46  ? 83.549  4.422    21.578  1.00 87.29  ? 46  TYR E CD2   1 
ATOM   8189  C CE1   . TYR E 3 46  ? 85.416  6.389    20.974  1.00 90.87  ? 46  TYR E CE1   1 
ATOM   8190  C CE2   . TYR E 3 46  ? 83.151  5.568    20.893  1.00 89.67  ? 46  TYR E CE2   1 
ATOM   8191  C CZ    . TYR E 3 46  ? 84.091  6.552    20.593  1.00 91.19  ? 46  TYR E CZ    1 
ATOM   8192  O OH    . TYR E 3 46  ? 83.718  7.694    19.912  1.00 92.22  ? 46  TYR E OH    1 
ATOM   8193  N N     . GLU E 3 47  ? 84.372  5.132    25.204  1.00 87.77  ? 47  GLU E N     1 
ATOM   8194  C CA    . GLU E 3 47  ? 83.334  5.807    25.984  1.00 89.07  ? 47  GLU E CA    1 
ATOM   8195  C C     . GLU E 3 47  ? 82.832  4.918    27.127  1.00 88.47  ? 47  GLU E C     1 
ATOM   8196  O O     . GLU E 3 47  ? 81.630  4.704    27.283  1.00 88.47  ? 47  GLU E O     1 
ATOM   8197  C CB    . GLU E 3 47  ? 82.180  6.267    25.090  1.00 89.31  ? 47  GLU E CB    1 
ATOM   8198  C CG    . GLU E 3 47  ? 82.424  7.601    24.399  1.00 91.72  ? 47  GLU E CG    1 
ATOM   8199  C CD    . GLU E 3 47  ? 81.404  7.894    23.303  1.00 93.43  ? 47  GLU E CD    1 
ATOM   8200  O OE1   . GLU E 3 47  ? 81.792  8.505    22.287  1.00 93.76  ? 47  GLU E OE1   1 
ATOM   8201  O OE2   . GLU E 3 47  ? 80.219  7.510    23.445  1.00 94.36  ? 47  GLU E OE2   1 
ATOM   8202  N N     . GLY E 3 48  ? 83.775  4.382    27.899  1.00 88.02  ? 48  GLY E N     1 
ATOM   8203  C CA    . GLY E 3 48  ? 83.474  3.593    29.088  1.00 87.60  ? 48  GLY E CA    1 
ATOM   8204  C C     . GLY E 3 48  ? 82.629  2.350    28.885  1.00 86.10  ? 48  GLY E C     1 
ATOM   8205  O O     . GLY E 3 48  ? 81.958  1.909    29.821  1.00 86.71  ? 48  GLY E O     1 
ATOM   8206  N N     . VAL E 3 49  ? 82.655  1.790    27.672  1.00 84.36  ? 49  VAL E N     1 
ATOM   8207  C CA    . VAL E 3 49  ? 81.981  0.514    27.351  1.00 82.36  ? 49  VAL E CA    1 
ATOM   8208  C C     . VAL E 3 49  ? 82.971  -0.447   26.677  1.00 80.50  ? 49  VAL E C     1 
ATOM   8209  O O     . VAL E 3 49  ? 83.758  -0.034   25.828  1.00 80.27  ? 49  VAL E O     1 
ATOM   8210  C CB    . VAL E 3 49  ? 80.709  0.740    26.479  1.00 82.28  ? 49  VAL E CB    1 
ATOM   8211  C CG1   . VAL E 3 49  ? 80.293  -0.535   25.747  1.00 81.06  ? 49  VAL E CG1   1 
ATOM   8212  C CG2   . VAL E 3 49  ? 79.562  1.259    27.342  1.00 83.04  ? 49  VAL E CG2   1 
ATOM   8213  N N     . GLU E 3 50  ? 82.937  -1.720   27.063  1.00 78.99  ? 50  GLU E N     1 
ATOM   8214  C CA    . GLU E 3 50  ? 83.946  -2.678   26.597  1.00 77.33  ? 50  GLU E CA    1 
ATOM   8215  C C     . GLU E 3 50  ? 83.467  -3.617   25.483  1.00 75.53  ? 50  GLU E C     1 
ATOM   8216  O O     . GLU E 3 50  ? 82.424  -4.268   25.608  1.00 75.19  ? 50  GLU E O     1 
ATOM   8217  C CB    . GLU E 3 50  ? 84.513  -3.483   27.771  1.00 77.49  ? 50  GLU E CB    1 
ATOM   8218  C CG    . GLU E 3 50  ? 85.693  -4.355   27.396  1.00 76.90  ? 50  GLU E CG    1 
ATOM   8219  C CD    . GLU E 3 50  ? 86.368  -4.998   28.585  1.00 77.86  ? 50  GLU E CD    1 
ATOM   8220  O OE1   . GLU E 3 50  ? 86.194  -6.216   28.761  1.00 77.73  ? 50  GLU E OE1   1 
ATOM   8221  O OE2   . GLU E 3 50  ? 87.075  -4.296   29.341  1.00 79.70  ? 50  GLU E OE2   1 
ATOM   8222  N N     . TYR E 3 51  ? 84.262  -3.685   24.411  1.00 74.20  ? 51  TYR E N     1 
ATOM   8223  C CA    . TYR E 3 51  ? 83.986  -4.527   23.243  1.00 72.21  ? 51  TYR E CA    1 
ATOM   8224  C C     . TYR E 3 51  ? 85.049  -5.615   23.036  1.00 71.01  ? 51  TYR E C     1 
ATOM   8225  O O     . TYR E 3 51  ? 86.240  -5.395   23.308  1.00 71.29  ? 51  TYR E O     1 
ATOM   8226  C CB    . TYR E 3 51  ? 83.874  -3.676   21.974  1.00 72.08  ? 51  TYR E CB    1 
ATOM   8227  C CG    . TYR E 3 51  ? 82.870  -2.555   22.069  1.00 72.75  ? 51  TYR E CG    1 
ATOM   8228  C CD1   . TYR E 3 51  ? 83.240  -1.308   22.572  1.00 73.97  ? 51  TYR E CD1   1 
ATOM   8229  C CD2   . TYR E 3 51  ? 81.552  -2.735   21.653  1.00 72.69  ? 51  TYR E CD2   1 
ATOM   8230  C CE1   . TYR E 3 51  ? 82.329  -0.272   22.667  1.00 75.20  ? 51  TYR E CE1   1 
ATOM   8231  C CE2   . TYR E 3 51  ? 80.624  -1.699   21.745  1.00 73.90  ? 51  TYR E CE2   1 
ATOM   8232  C CZ    . TYR E 3 51  ? 81.026  -0.472   22.254  1.00 75.22  ? 51  TYR E CZ    1 
ATOM   8233  O OH    . TYR E 3 51  ? 80.133  0.562    22.359  1.00 76.97  ? 51  TYR E OH    1 
ATOM   8234  N N     . ARG E 3 52  ? 84.600  -6.777   22.551  1.00 69.18  ? 52  ARG E N     1 
ATOM   8235  C CA    . ARG E 3 52  ? 85.473  -7.911   22.213  1.00 67.44  ? 52  ARG E CA    1 
ATOM   8236  C C     . ARG E 3 52  ? 85.722  -8.023   20.714  1.00 66.25  ? 52  ARG E C     1 
ATOM   8237  O O     . ARG E 3 52  ? 84.787  -8.184   19.938  1.00 65.67  ? 52  ARG E O     1 
ATOM   8238  C CB    . ARG E 3 52  ? 84.838  -9.217   22.668  1.00 67.03  ? 52  ARG E CB    1 
ATOM   8239  C CG    . ARG E 3 52  ? 85.039  -9.551   24.093  1.00 66.32  ? 52  ARG E CG    1 
ATOM   8240  C CD    . ARG E 3 52  ? 84.176  -10.708  24.444  1.00 65.20  ? 52  ARG E CD    1 
ATOM   8241  N NE    . ARG E 3 52  ? 84.589  -11.949  23.797  1.00 63.72  ? 52  ARG E NE    1 
ATOM   8242  C CZ    . ARG E 3 52  ? 83.801  -12.687  23.018  1.00 63.24  ? 52  ARG E CZ    1 
ATOM   8243  N NH1   . ARG E 3 52  ? 84.267  -13.811  22.493  1.00 62.44  ? 52  ARG E NH1   1 
ATOM   8244  N NH2   . ARG E 3 52  ? 82.551  -12.308  22.762  1.00 62.18  ? 52  ARG E NH2   1 
ATOM   8245  N N     . GLU E 3 53  ? 86.987  -7.983   20.320  1.00 65.49  ? 53  GLU E N     1 
ATOM   8246  C CA    . GLU E 3 53  ? 87.354  -7.978   18.913  1.00 64.62  ? 53  GLU E CA    1 
ATOM   8247  C C     . GLU E 3 53  ? 87.044  -9.314   18.248  1.00 62.92  ? 53  GLU E C     1 
ATOM   8248  O O     . GLU E 3 53  ? 87.513  -10.363  18.684  1.00 62.78  ? 53  GLU E O     1 
ATOM   8249  C CB    . GLU E 3 53  ? 88.828  -7.633   18.764  1.00 65.26  ? 53  GLU E CB    1 
ATOM   8250  C CG    . GLU E 3 53  ? 89.203  -7.191   17.379  1.00 66.93  ? 53  GLU E CG    1 
ATOM   8251  C CD    . GLU E 3 53  ? 90.650  -7.486   17.053  1.00 69.07  ? 53  GLU E CD    1 
ATOM   8252  O OE1   . GLU E 3 53  ? 90.910  -8.081   15.975  1.00 69.30  ? 53  GLU E OE1   1 
ATOM   8253  O OE2   . GLU E 3 53  ? 91.518  -7.125   17.877  1.00 70.20  ? 53  GLU E OE2   1 
ATOM   8254  N N     . TRP E 3 54  ? 86.264  -9.262   17.176  1.00 61.56  ? 54  TRP E N     1 
ATOM   8255  C CA    . TRP E 3 54  ? 85.728  -10.466  16.551  1.00 59.80  ? 54  TRP E CA    1 
ATOM   8256  C C     . TRP E 3 54  ? 86.532  -10.895  15.328  1.00 59.88  ? 54  TRP E C     1 
ATOM   8257  O O     . TRP E 3 54  ? 86.235  -10.480  14.203  1.00 60.41  ? 54  TRP E O     1 
ATOM   8258  C CB    . TRP E 3 54  ? 84.275  -10.222  16.158  1.00 59.07  ? 54  TRP E CB    1 
ATOM   8259  C CG    . TRP E 3 54  ? 83.455  -11.464  15.902  1.00 55.67  ? 54  TRP E CG    1 
ATOM   8260  C CD1   . TRP E 3 54  ? 83.879  -12.764  15.919  1.00 52.66  ? 54  TRP E CD1   1 
ATOM   8261  C CD2   . TRP E 3 54  ? 82.069  -11.501  15.554  1.00 52.66  ? 54  TRP E CD2   1 
ATOM   8262  N NE1   . TRP E 3 54  ? 82.842  -13.601  15.620  1.00 50.10  ? 54  TRP E NE1   1 
ATOM   8263  C CE2   . TRP E 3 54  ? 81.721  -12.857  15.384  1.00 50.31  ? 54  TRP E CE2   1 
ATOM   8264  C CE3   . TRP E 3 54  ? 81.090  -10.512  15.361  1.00 52.28  ? 54  TRP E CE3   1 
ATOM   8265  C CZ2   . TRP E 3 54  ? 80.439  -13.259  15.045  1.00 50.50  ? 54  TRP E CZ2   1 
ATOM   8266  C CZ3   . TRP E 3 54  ? 79.822  -10.903  15.013  1.00 52.38  ? 54  TRP E CZ3   1 
ATOM   8267  C CH2   . TRP E 3 54  ? 79.501  -12.275  14.864  1.00 52.59  ? 54  TRP E CH2   1 
ATOM   8268  N N     . ASN E 3 55  ? 87.546  -11.725  15.554  1.00 59.59  ? 55  ASN E N     1 
ATOM   8269  C CA    . ASN E 3 55  ? 88.428  -12.202  14.493  1.00 59.45  ? 55  ASN E CA    1 
ATOM   8270  C C     . ASN E 3 55  ? 87.688  -13.043  13.446  1.00 58.86  ? 55  ASN E C     1 
ATOM   8271  O O     . ASN E 3 55  ? 87.133  -14.094  13.767  1.00 58.63  ? 55  ASN E O     1 
ATOM   8272  C CB    . ASN E 3 55  ? 89.564  -13.012  15.125  1.00 59.85  ? 55  ASN E CB    1 
ATOM   8273  C CG    . ASN E 3 55  ? 90.655  -13.387  14.141  1.00 60.25  ? 55  ASN E CG    1 
ATOM   8274  O OD1   . ASN E 3 55  ? 90.771  -12.812  13.055  1.00 62.19  ? 55  ASN E OD1   1 
ATOM   8275  N ND2   . ASN E 3 55  ? 91.478  -14.349  14.530  1.00 59.64  ? 55  ASN E ND2   1 
ATOM   8276  N N     . ALA E 3 56  ? 87.691  -12.577  12.196  1.00 58.91  ? 56  ALA E N     1 
ATOM   8277  C CA    . ALA E 3 56  ? 87.006  -13.260  11.081  1.00 58.33  ? 56  ALA E CA    1 
ATOM   8278  C C     . ALA E 3 56  ? 87.661  -14.585  10.688  1.00 58.09  ? 56  ALA E C     1 
ATOM   8279  O O     . ALA E 3 56  ? 86.979  -15.517  10.226  1.00 57.87  ? 56  ALA E O     1 
ATOM   8280  C CB    . ALA E 3 56  ? 86.921  -12.350  9.872   1.00 58.73  ? 56  ALA E CB    1 
ATOM   8281  N N     . PHE E 3 57  ? 88.977  -14.668  10.887  1.00 57.83  ? 57  PHE E N     1 
ATOM   8282  C CA    . PHE E 3 57  ? 89.728  -15.874  10.565  1.00 57.56  ? 57  PHE E CA    1 
ATOM   8283  C C     . PHE E 3 57  ? 89.375  -17.068  11.452  1.00 57.20  ? 57  PHE E C     1 
ATOM   8284  O O     . PHE E 3 57  ? 89.612  -18.218  11.070  1.00 57.50  ? 57  PHE E O     1 
ATOM   8285  C CB    . PHE E 3 57  ? 91.229  -15.583  10.557  1.00 57.95  ? 57  PHE E CB    1 
ATOM   8286  C CG    . PHE E 3 57  ? 91.660  -14.718  9.395   1.00 59.08  ? 57  PHE E CG    1 
ATOM   8287  C CD1   . PHE E 3 57  ? 91.633  -13.325  9.494   1.00 59.06  ? 57  PHE E CD1   1 
ATOM   8288  C CD2   . PHE E 3 57  ? 92.052  -15.294  8.183   1.00 59.41  ? 57  PHE E CD2   1 
ATOM   8289  C CE1   . PHE E 3 57  ? 91.999  -12.530  8.419   1.00 58.44  ? 57  PHE E CE1   1 
ATOM   8290  C CE2   . PHE E 3 57  ? 92.410  -14.501  7.104   1.00 58.84  ? 57  PHE E CE2   1 
ATOM   8291  C CZ    . PHE E 3 57  ? 92.385  -13.120  7.226   1.00 59.26  ? 57  PHE E CZ    1 
ATOM   8292  N N     . ARG E 3 58  ? 88.778  -16.800  12.614  1.00 56.71  ? 58  ARG E N     1 
ATOM   8293  C CA    . ARG E 3 58  ? 88.376  -17.864  13.537  1.00 56.01  ? 58  ARG E CA    1 
ATOM   8294  C C     . ARG E 3 58  ? 86.877  -18.131  13.528  1.00 55.70  ? 58  ARG E C     1 
ATOM   8295  O O     . ARG E 3 58  ? 86.424  -19.303  13.592  1.00 55.60  ? 58  ARG E O     1 
ATOM   8296  C CB    . ARG E 3 58  ? 88.783  -17.513  14.947  1.00 56.13  ? 58  ARG E CB    1 
ATOM   8297  C CG    . ARG E 3 58  ? 90.268  -17.428  15.168  1.00 55.97  ? 58  ARG E CG    1 
ATOM   8298  C CD    . ARG E 3 58  ? 90.495  -17.643  16.619  1.00 54.28  ? 58  ARG E CD    1 
ATOM   8299  N NE    . ARG E 3 58  ? 91.822  -17.296  17.049  1.00 54.13  ? 58  ARG E NE    1 
ATOM   8300  C CZ    . ARG E 3 58  ? 92.379  -17.773  18.150  1.00 55.45  ? 58  ARG E CZ    1 
ATOM   8301  N NH1   . ARG E 3 58  ? 93.608  -17.386  18.478  1.00 57.66  ? 58  ARG E NH1   1 
ATOM   8302  N NH2   . ARG E 3 58  ? 91.716  -18.639  18.914  1.00 53.59  ? 58  ARG E NH2   1 
ATOM   8303  N N     . SER E 3 59  ? 86.103  -17.051  13.448  1.00 55.14  ? 59  SER E N     1 
ATOM   8304  C CA    . SER E 3 59  ? 84.655  -17.179  13.517  1.00 54.54  ? 59  SER E CA    1 
ATOM   8305  C C     . SER E 3 59  ? 83.957  -17.064  12.161  1.00 54.35  ? 59  SER E C     1 
ATOM   8306  O O     . SER E 3 59  ? 83.940  -15.988  11.549  1.00 54.79  ? 59  SER E O     1 
ATOM   8307  C CB    . SER E 3 59  ? 84.093  -16.165  14.486  1.00 54.32  ? 59  SER E CB    1 
ATOM   8308  O OG    . SER E 3 59  ? 82.714  -16.388  14.595  1.00 54.73  ? 59  SER E OG    1 
ATOM   8309  N N     . LYS E 3 60  ? 83.368  -18.168  11.709  1.00 53.57  ? 60  LYS E N     1 
ATOM   8310  C CA    . LYS E 3 60  ? 82.729  -18.197  10.404  1.00 53.53  ? 60  LYS E CA    1 
ATOM   8311  C C     . LYS E 3 60  ? 81.594  -17.218  10.318  1.00 53.18  ? 60  LYS E C     1 
ATOM   8312  O O     . LYS E 3 60  ? 81.272  -16.771  9.233   1.00 53.93  ? 60  LYS E O     1 
ATOM   8313  C CB    . LYS E 3 60  ? 82.204  -19.583  10.036  1.00 54.03  ? 60  LYS E CB    1 
ATOM   8314  C CG    . LYS E 3 60  ? 83.258  -20.633  9.706   1.00 56.09  ? 60  LYS E CG    1 
ATOM   8315  C CD    . LYS E 3 60  ? 83.793  -21.269  10.986  1.00 60.44  ? 60  LYS E CD    1 
ATOM   8316  C CE    . LYS E 3 60  ? 84.743  -22.400  10.689  1.00 61.88  ? 60  LYS E CE    1 
ATOM   8317  N NZ    . LYS E 3 60  ? 84.099  -23.387  9.797   1.00 62.82  ? 60  LYS E NZ    1 
ATOM   8318  N N     . LEU E 3 61  ? 80.973  -16.885  11.443  1.00 52.76  ? 61  LEU E N     1 
ATOM   8319  C CA    . LEU E 3 61  ? 79.904  -15.883  11.425  1.00 52.72  ? 61  LEU E CA    1 
ATOM   8320  C C     . LEU E 3 61  ? 80.446  -14.486  11.081  1.00 52.64  ? 61  LEU E C     1 
ATOM   8321  O O     . LEU E 3 61  ? 79.852  -13.783  10.271  1.00 53.06  ? 61  LEU E O     1 
ATOM   8322  C CB    . LEU E 3 61  ? 79.126  -15.849  12.744  1.00 52.77  ? 61  LEU E CB    1 
ATOM   8323  C CG    . LEU E 3 61  ? 77.625  -15.516  12.760  1.00 53.05  ? 61  LEU E CG    1 
ATOM   8324  C CD1   . LEU E 3 61  ? 77.313  -14.581  13.912  1.00 54.01  ? 61  LEU E CD1   1 
ATOM   8325  C CD2   . LEU E 3 61  ? 77.104  -14.895  11.495  1.00 53.71  ? 61  LEU E CD2   1 
ATOM   8326  N N     . ALA E 3 62  ? 81.571  -14.096  11.681  1.00 52.03  ? 62  ALA E N     1 
ATOM   8327  C CA    . ALA E 3 62  ? 82.201  -12.809  11.361  1.00 51.98  ? 62  ALA E CA    1 
ATOM   8328  C C     . ALA E 3 62  ? 82.651  -12.789  9.901   1.00 51.54  ? 62  ALA E C     1 
ATOM   8329  O O     . ALA E 3 62  ? 82.551  -11.774  9.215   1.00 51.13  ? 62  ALA E O     1 
ATOM   8330  C CB    . ALA E 3 62  ? 83.389  -12.553  12.285  1.00 52.40  ? 62  ALA E CB    1 
ATOM   8331  N N     . GLY E 3 63  ? 83.150  -13.938  9.456   1.00 50.71  ? 63  GLY E N     1 
ATOM   8332  C CA    . GLY E 3 63  ? 83.568  -14.132  8.093   1.00 50.28  ? 63  GLY E CA    1 
ATOM   8333  C C     . GLY E 3 63  ? 82.414  -13.862  7.169   1.00 50.36  ? 63  GLY E C     1 
ATOM   8334  O O     . GLY E 3 63  ? 82.556  -13.118  6.202   1.00 51.30  ? 63  GLY E O     1 
ATOM   8335  N N     . ALA E 3 64  ? 81.267  -14.460  7.470   1.00 49.74  ? 64  ALA E N     1 
ATOM   8336  C CA    . ALA E 3 64  ? 80.083  -14.302  6.645   1.00 49.79  ? 64  ALA E CA    1 
ATOM   8337  C C     . ALA E 3 64  ? 79.666  -12.841  6.596   1.00 50.36  ? 64  ALA E C     1 
ATOM   8338  O O     . ALA E 3 64  ? 79.235  -12.348  5.559   1.00 51.34  ? 64  ALA E O     1 
ATOM   8339  C CB    . ALA E 3 64  ? 78.969  -15.145  7.174   1.00 49.45  ? 64  ALA E CB    1 
ATOM   8340  N N     . ILE E 3 65  ? 79.813  -12.145  7.718   1.00 50.14  ? 65  ILE E N     1 
ATOM   8341  C CA    . ILE E 3 65  ? 79.413  -10.750  7.809   1.00 50.32  ? 65  ILE E CA    1 
ATOM   8342  C C     . ILE E 3 65  ? 80.269  -9.950   6.853   1.00 51.06  ? 65  ILE E C     1 
ATOM   8343  O O     . ILE E 3 65  ? 79.739  -9.258   5.994   1.00 51.73  ? 65  ILE E O     1 
ATOM   8344  C CB    . ILE E 3 65  ? 79.484  -10.232  9.270   1.00 50.11  ? 65  ILE E CB    1 
ATOM   8345  C CG1   . ILE E 3 65  ? 78.277  -10.746  10.055  1.00 48.95  ? 65  ILE E CG1   1 
ATOM   8346  C CG2   . ILE E 3 65  ? 79.552  -8.706   9.343   1.00 49.71  ? 65  ILE E CG2   1 
ATOM   8347  C CD1   . ILE E 3 65  ? 78.592  -11.046  11.503  1.00 49.24  ? 65  ILE E CD1   1 
ATOM   8348  N N     . LEU E 3 66  ? 81.587  -10.096  6.978   1.00 51.36  ? 66  LEU E N     1 
ATOM   8349  C CA    . LEU E 3 66  ? 82.550  -9.372   6.145   1.00 52.28  ? 66  LEU E CA    1 
ATOM   8350  C C     . LEU E 3 66  ? 82.472  -9.749   4.666   1.00 53.48  ? 66  LEU E C     1 
ATOM   8351  O O     . LEU E 3 66  ? 83.054  -9.058   3.821   1.00 54.60  ? 66  LEU E O     1 
ATOM   8352  C CB    . LEU E 3 66  ? 83.986  -9.543   6.657   1.00 51.56  ? 66  LEU E CB    1 
ATOM   8353  C CG    . LEU E 3 66  ? 84.439  -8.821   7.926   1.00 50.69  ? 66  LEU E CG    1 
ATOM   8354  C CD1   . LEU E 3 66  ? 85.840  -9.294   8.269   1.00 50.02  ? 66  LEU E CD1   1 
ATOM   8355  C CD2   . LEU E 3 66  ? 84.378  -7.300   7.824   1.00 49.71  ? 66  LEU E CD2   1 
ATOM   8356  N N     . LYS E 3 67  ? 81.747  -10.823  4.354   1.00 53.87  ? 67  LYS E N     1 
ATOM   8357  C CA    . LYS E 3 67  ? 81.509  -11.207  2.968   1.00 55.13  ? 67  LYS E CA    1 
ATOM   8358  C C     . LYS E 3 67  ? 80.118  -10.802  2.513   1.00 56.50  ? 67  LYS E C     1 
ATOM   8359  O O     . LYS E 3 67  ? 79.584  -11.322  1.533   1.00 56.39  ? 67  LYS E O     1 
ATOM   8360  C CB    . LYS E 3 67  ? 81.756  -12.691  2.782   1.00 54.41  ? 67  LYS E CB    1 
ATOM   8361  C CG    . LYS E 3 67  ? 83.208  -13.020  2.620   1.00 54.19  ? 67  LYS E CG    1 
ATOM   8362  C CD    . LYS E 3 67  ? 83.637  -12.720  1.214   1.00 53.67  ? 67  LYS E CD    1 
ATOM   8363  C CE    . LYS E 3 67  ? 84.833  -13.529  0.849   1.00 53.72  ? 67  LYS E CE    1 
ATOM   8364  N NZ    . LYS E 3 67  ? 84.707  -13.941  -0.568  1.00 55.32  ? 67  LYS E NZ    1 
ATOM   8365  N N     . GLY E 3 68  ? 79.543  -9.869   3.262   1.00 58.34  ? 68  GLY E N     1 
ATOM   8366  C CA    . GLY E 3 68  ? 78.306  -9.184   2.900   1.00 61.28  ? 68  GLY E CA    1 
ATOM   8367  C C     . GLY E 3 68  ? 77.035  -9.976   3.131   1.00 62.48  ? 68  GLY E C     1 
ATOM   8368  O O     . GLY E 3 68  ? 76.231  -10.119  2.210   1.00 63.44  ? 68  GLY E O     1 
ATOM   8369  N N     . LEU E 3 69  ? 76.850  -10.486  4.352   1.00 62.88  ? 69  LEU E N     1 
ATOM   8370  C CA    . LEU E 3 69  ? 75.635  -11.208  4.710   1.00 63.80  ? 69  LEU E CA    1 
ATOM   8371  C C     . LEU E 3 69  ? 74.482  -10.204  4.838   1.00 65.66  ? 69  LEU E C     1 
ATOM   8372  O O     . LEU E 3 69  ? 74.459  -9.391   5.774   1.00 65.92  ? 69  LEU E O     1 
ATOM   8373  C CB    . LEU E 3 69  ? 75.847  -12.012  6.011   1.00 62.85  ? 69  LEU E CB    1 
ATOM   8374  C CG    . LEU E 3 69  ? 74.672  -12.672  6.761   1.00 62.17  ? 69  LEU E CG    1 
ATOM   8375  C CD1   . LEU E 3 69  ? 74.174  -13.915  6.059   1.00 61.82  ? 69  LEU E CD1   1 
ATOM   8376  C CD2   . LEU E 3 69  ? 75.050  -13.009  8.189   1.00 60.81  ? 69  LEU E CD2   1 
ATOM   8377  N N     . LYS E 3 70  ? 73.554  -10.263  3.876   1.00 67.41  ? 70  LYS E N     1 
ATOM   8378  C CA    . LYS E 3 70  ? 72.368  -9.385   3.795   1.00 69.72  ? 70  LYS E CA    1 
ATOM   8379  C C     . LYS E 3 70  ? 71.829  -8.906   5.141   1.00 70.27  ? 70  LYS E C     1 
ATOM   8380  O O     . LYS E 3 70  ? 72.016  -7.743   5.531   1.00 71.04  ? 70  LYS E O     1 
ATOM   8381  C CB    . LYS E 3 70  ? 71.229  -10.097  3.046   1.00 70.40  ? 70  LYS E CB    1 
ATOM   8382  C CG    . LYS E 3 70  ? 70.963  -9.587   1.654   1.00 72.74  ? 70  LYS E CG    1 
ATOM   8383  C CD    . LYS E 3 70  ? 69.746  -10.275  1.046   1.00 75.36  ? 70  LYS E CD    1 
ATOM   8384  C CE    . LYS E 3 70  ? 69.463  -9.765   -0.386  1.00 78.82  ? 70  LYS E CE    1 
ATOM   8385  N NZ    . LYS E 3 70  ? 70.453  -10.218  -1.423  1.00 78.77  ? 70  LYS E NZ    1 
ATOM   8386  N N     . THR E 3 71  ? 71.142  -9.819   5.827   1.00 70.29  ? 71  THR E N     1 
ATOM   8387  C CA    . THR E 3 71  ? 70.506  -9.547   7.107   1.00 70.68  ? 71  THR E CA    1 
ATOM   8388  C C     . THR E 3 71  ? 70.869  -10.668  8.058   1.00 69.80  ? 71  THR E C     1 
ATOM   8389  O O     . THR E 3 71  ? 70.824  -11.838  7.685   1.00 69.71  ? 71  THR E O     1 
ATOM   8390  C CB    . THR E 3 71  ? 68.982  -9.502   6.973   1.00 71.52  ? 71  THR E CB    1 
ATOM   8391  O OG1   . THR E 3 71  ? 68.550  -10.652  6.240   1.00 71.41  ? 71  THR E OG1   1 
ATOM   8392  C CG2   . THR E 3 71  ? 68.537  -8.236   6.231   1.00 73.16  ? 71  THR E CG2   1 
ATOM   8393  N N     . ASN E 3 72  ? 71.238  -10.299  9.280   1.00 69.55  ? 72  ASN E N     1 
ATOM   8394  C CA    . ASN E 3 72  ? 71.642  -11.259  10.298  1.00 68.52  ? 72  ASN E CA    1 
ATOM   8395  C C     . ASN E 3 72  ? 70.494  -11.556  11.261  1.00 68.69  ? 72  ASN E C     1 
ATOM   8396  O O     . ASN E 3 72  ? 70.064  -10.669  11.997  1.00 69.50  ? 72  ASN E O     1 
ATOM   8397  C CB    . ASN E 3 72  ? 72.846  -10.708  11.056  1.00 68.27  ? 72  ASN E CB    1 
ATOM   8398  C CG    . ASN E 3 72  ? 73.448  -11.708  11.995  1.00 67.59  ? 72  ASN E CG    1 
ATOM   8399  O OD1   . ASN E 3 72  ? 72.899  -12.777  12.202  1.00 68.89  ? 72  ASN E OD1   1 
ATOM   8400  N ND2   . ASN E 3 72  ? 74.582  -11.363  12.582  1.00 67.48  ? 72  ASN E ND2   1 
ATOM   8401  N N     . PRO E 3 73  ? 69.997  -12.804  11.265  1.00 68.26  ? 73  PRO E N     1 
ATOM   8402  C CA    . PRO E 3 73  ? 68.843  -13.201  12.072  1.00 68.63  ? 73  PRO E CA    1 
ATOM   8403  C C     . PRO E 3 73  ? 69.181  -13.442  13.547  1.00 68.21  ? 73  PRO E C     1 
ATOM   8404  O O     . PRO E 3 73  ? 68.297  -13.762  14.342  1.00 68.58  ? 73  PRO E O     1 
ATOM   8405  C CB    . PRO E 3 73  ? 68.391  -14.502  11.407  1.00 68.64  ? 73  PRO E CB    1 
ATOM   8406  C CG    . PRO E 3 73  ? 69.658  -15.097  10.891  1.00 68.11  ? 73  PRO E CG    1 
ATOM   8407  C CD    . PRO E 3 73  ? 70.519  -13.932  10.473  1.00 67.98  ? 73  PRO E CD    1 
ATOM   8408  N N     . ILE E 3 74  ? 70.451  -13.286  13.894  1.00 67.56  ? 74  ILE E N     1 
ATOM   8409  C CA    . ILE E 3 74  ? 70.899  -13.324  15.277  1.00 67.38  ? 74  ILE E CA    1 
ATOM   8410  C C     . ILE E 3 74  ? 70.996  -11.888  15.820  1.00 68.39  ? 74  ILE E C     1 
ATOM   8411  O O     . ILE E 3 74  ? 71.809  -11.079  15.362  1.00 68.34  ? 74  ILE E O     1 
ATOM   8412  C CB    . ILE E 3 74  ? 72.244  -14.080  15.394  1.00 66.29  ? 74  ILE E CB    1 
ATOM   8413  C CG1   . ILE E 3 74  ? 72.048  -15.552  15.019  1.00 65.39  ? 74  ILE E CG1   1 
ATOM   8414  C CG2   . ILE E 3 74  ? 72.823  -13.955  16.790  1.00 66.42  ? 74  ILE E CG2   1 
ATOM   8415  C CD1   . ILE E 3 74  ? 73.319  -16.358  14.905  1.00 64.07  ? 74  ILE E CD1   1 
ATOM   8416  N N     . ARG E 3 75  ? 70.149  -11.571  16.792  1.00 69.71  ? 75  ARG E N     1 
ATOM   8417  C CA    . ARG E 3 75  ? 70.107  -10.225  17.362  1.00 71.15  ? 75  ARG E CA    1 
ATOM   8418  C C     . ARG E 3 75  ? 69.795  -10.231  18.857  1.00 71.72  ? 75  ARG E C     1 
ATOM   8419  O O     . ARG E 3 75  ? 69.816  -11.288  19.480  1.00 71.33  ? 75  ARG E O     1 
ATOM   8420  C CB    . ARG E 3 75  ? 69.098  -9.369   16.594  1.00 72.29  ? 75  ARG E CB    1 
ATOM   8421  C CG    . ARG E 3 75  ? 67.689  -9.924   16.547  1.00 74.41  ? 75  ARG E CG    1 
ATOM   8422  C CD    . ARG E 3 75  ? 66.870  -9.191   15.506  1.00 77.87  ? 75  ARG E CD    1 
ATOM   8423  N NE    . ARG E 3 75  ? 67.096  -9.721   14.159  1.00 78.54  ? 75  ARG E NE    1 
ATOM   8424  C CZ    . ARG E 3 75  ? 67.082  -8.990   13.043  1.00 79.53  ? 75  ARG E CZ    1 
ATOM   8425  N NH1   . ARG E 3 75  ? 66.873  -7.678   13.091  1.00 80.21  ? 75  ARG E NH1   1 
ATOM   8426  N NH2   . ARG E 3 75  ? 67.291  -9.573   11.871  1.00 79.76  ? 75  ARG E NH2   1 
ATOM   8427  N N     . LYS E 3 76  ? 69.522  -9.051   19.424  1.00 73.08  ? 76  LYS E N     1 
ATOM   8428  C CA    . LYS E 3 76  ? 69.063  -8.916   20.822  1.00 74.28  ? 76  LYS E CA    1 
ATOM   8429  C C     . LYS E 3 76  ? 67.898  -9.839   21.150  1.00 74.36  ? 76  LYS E C     1 
ATOM   8430  O O     . LYS E 3 76  ? 66.838  -9.774   20.514  1.00 75.01  ? 76  LYS E O     1 
ATOM   8431  C CB    . LYS E 3 76  ? 68.644  -7.480   21.138  1.00 75.59  ? 76  LYS E CB    1 
ATOM   8432  C CG    . LYS E 3 76  ? 69.490  -6.785   22.191  1.00 77.99  ? 76  LYS E CG    1 
ATOM   8433  C CD    . LYS E 3 76  ? 69.107  -5.290   22.331  1.00 83.13  ? 76  LYS E CD    1 
ATOM   8434  C CE    . LYS E 3 76  ? 70.308  -4.417   22.796  1.00 84.88  ? 76  LYS E CE    1 
ATOM   8435  N NZ    . LYS E 3 76  ? 70.340  -3.008   22.263  1.00 85.85  ? 76  LYS E NZ    1 
ATOM   8436  N N     . GLY E 3 77  ? 68.111  -10.697  22.142  1.00 73.85  ? 77  GLY E N     1 
ATOM   8437  C CA    . GLY E 3 77  ? 67.079  -11.604  22.629  1.00 73.85  ? 77  GLY E CA    1 
ATOM   8438  C C     . GLY E 3 77  ? 66.623  -12.675  21.655  1.00 72.81  ? 77  GLY E C     1 
ATOM   8439  O O     . GLY E 3 77  ? 65.453  -13.049  21.642  1.00 73.76  ? 77  GLY E O     1 
ATOM   8440  N N     . THR E 3 78  ? 67.539  -13.173  20.838  1.00 71.11  ? 78  THR E N     1 
ATOM   8441  C CA    . THR E 3 78  ? 67.214  -14.256  19.924  1.00 70.22  ? 78  THR E CA    1 
ATOM   8442  C C     . THR E 3 78  ? 67.488  -15.605  20.600  1.00 69.18  ? 78  THR E C     1 
ATOM   8443  O O     . THR E 3 78  ? 68.386  -15.726  21.423  1.00 68.69  ? 78  THR E O     1 
ATOM   8444  C CB    . THR E 3 78  ? 67.991  -14.111  18.583  1.00 69.75  ? 78  THR E CB    1 
ATOM   8445  O OG1   . THR E 3 78  ? 67.950  -12.743  18.152  1.00 70.53  ? 78  THR E OG1   1 
ATOM   8446  C CG2   . THR E 3 78  ? 67.384  -14.982  17.491  1.00 69.77  ? 78  THR E CG2   1 
ATOM   8447  N N     . LYS E 3 79  ? 66.683  -16.607  20.271  1.00 68.76  ? 79  LYS E N     1 
ATOM   8448  C CA    . LYS E 3 79  ? 66.902  -17.962  20.762  1.00 68.01  ? 79  LYS E CA    1 
ATOM   8449  C C     . LYS E 3 79  ? 67.580  -18.777  19.674  1.00 66.68  ? 79  LYS E C     1 
ATOM   8450  O O     . LYS E 3 79  ? 67.005  -18.976  18.607  1.00 66.84  ? 79  LYS E O     1 
ATOM   8451  C CB    . LYS E 3 79  ? 65.567  -18.601  21.170  1.00 69.06  ? 79  LYS E CB    1 
ATOM   8452  C CG    . LYS E 3 79  ? 64.976  -17.991  22.436  1.00 70.42  ? 79  LYS E CG    1 
ATOM   8453  C CD    . LYS E 3 79  ? 63.552  -18.432  22.743  1.00 70.80  ? 79  LYS E CD    1 
ATOM   8454  C CE    . LYS E 3 79  ? 63.191  -17.968  24.160  1.00 71.65  ? 79  LYS E CE    1 
ATOM   8455  N NZ    . LYS E 3 79  ? 61.764  -18.150  24.486  1.00 71.99  ? 79  LYS E NZ    1 
ATOM   8456  N N     . VAL E 3 80  ? 68.806  -19.230  19.928  1.00 65.46  ? 80  VAL E N     1 
ATOM   8457  C CA    . VAL E 3 80  ? 69.559  -19.997  18.917  1.00 64.26  ? 80  VAL E CA    1 
ATOM   8458  C C     . VAL E 3 80  ? 69.977  -21.410  19.370  1.00 63.85  ? 80  VAL E C     1 
ATOM   8459  O O     . VAL E 3 80  ? 70.464  -21.600  20.487  1.00 63.88  ? 80  VAL E O     1 
ATOM   8460  C CB    . VAL E 3 80  ? 70.792  -19.206  18.349  1.00 63.43  ? 80  VAL E CB    1 
ATOM   8461  C CG1   . VAL E 3 80  ? 70.376  -17.829  17.888  1.00 63.33  ? 80  VAL E CG1   1 
ATOM   8462  C CG2   . VAL E 3 80  ? 71.887  -19.072  19.371  1.00 63.02  ? 80  VAL E CG2   1 
ATOM   8463  N N     . LEU E 3 81  ? 69.760  -22.396  18.502  1.00 63.27  ? 81  LEU E N     1 
ATOM   8464  C CA    . LEU E 3 81  ? 70.307  -23.731  18.705  1.00 62.67  ? 81  LEU E CA    1 
ATOM   8465  C C     . LEU E 3 81  ? 71.570  -23.794  17.865  1.00 61.95  ? 81  LEU E C     1 
ATOM   8466  O O     . LEU E 3 81  ? 71.539  -23.538  16.645  1.00 62.10  ? 81  LEU E O     1 
ATOM   8467  C CB    . LEU E 3 81  ? 69.329  -24.805  18.233  1.00 63.13  ? 81  LEU E CB    1 
ATOM   8468  C CG    . LEU E 3 81  ? 69.258  -26.191  18.904  1.00 63.42  ? 81  LEU E CG    1 
ATOM   8469  C CD1   . LEU E 3 81  ? 68.709  -27.210  17.915  1.00 63.53  ? 81  LEU E CD1   1 
ATOM   8470  C CD2   . LEU E 3 81  ? 70.571  -26.700  19.489  1.00 61.95  ? 81  LEU E CD2   1 
ATOM   8471  N N     . TYR E 3 82  ? 72.679  -24.132  18.511  1.00 60.92  ? 82  TYR E N     1 
ATOM   8472  C CA    . TYR E 3 82  ? 73.977  -24.005  17.890  1.00 59.47  ? 82  TYR E CA    1 
ATOM   8473  C C     . TYR E 3 82  ? 74.612  -25.365  17.810  1.00 58.72  ? 82  TYR E C     1 
ATOM   8474  O O     . TYR E 3 82  ? 75.189  -25.840  18.777  1.00 58.77  ? 82  TYR E O     1 
ATOM   8475  C CB    . TYR E 3 82  ? 74.836  -23.071  18.734  1.00 59.61  ? 82  TYR E CB    1 
ATOM   8476  C CG    . TYR E 3 82  ? 76.094  -22.569  18.072  1.00 60.24  ? 82  TYR E CG    1 
ATOM   8477  C CD1   . TYR E 3 82  ? 76.354  -21.210  17.989  1.00 60.61  ? 82  TYR E CD1   1 
ATOM   8478  C CD2   . TYR E 3 82  ? 77.038  -23.451  17.552  1.00 61.50  ? 82  TYR E CD2   1 
ATOM   8479  C CE1   . TYR E 3 82  ? 77.503  -20.741  17.403  1.00 60.84  ? 82  TYR E CE1   1 
ATOM   8480  C CE2   . TYR E 3 82  ? 78.189  -22.989  16.960  1.00 61.55  ? 82  TYR E CE2   1 
ATOM   8481  C CZ    . TYR E 3 82  ? 78.411  -21.633  16.891  1.00 61.67  ? 82  TYR E CZ    1 
ATOM   8482  O OH    . TYR E 3 82  ? 79.557  -21.161  16.306  1.00 64.33  ? 82  TYR E OH    1 
ATOM   8483  N N     . LEU E 3 83  ? 74.511  -26.003  16.657  1.00 58.08  ? 83  LEU E N     1 
ATOM   8484  C CA    . LEU E 3 83  ? 75.113  -27.326  16.506  1.00 57.84  ? 83  LEU E CA    1 
ATOM   8485  C C     . LEU E 3 83  ? 76.602  -27.215  16.167  1.00 57.14  ? 83  LEU E C     1 
ATOM   8486  O O     . LEU E 3 83  ? 76.971  -26.547  15.203  1.00 56.69  ? 83  LEU E O     1 
ATOM   8487  C CB    . LEU E 3 83  ? 74.362  -28.165  15.464  1.00 57.78  ? 83  LEU E CB    1 
ATOM   8488  C CG    . LEU E 3 83  ? 72.838  -28.243  15.578  1.00 57.94  ? 83  LEU E CG    1 
ATOM   8489  C CD1   . LEU E 3 83  ? 72.304  -29.132  14.496  1.00 58.68  ? 83  LEU E CD1   1 
ATOM   8490  C CD2   . LEU E 3 83  ? 72.364  -28.748  16.933  1.00 58.59  ? 83  LEU E CD2   1 
ATOM   8491  N N     . GLY E 3 84  ? 77.442  -27.871  16.969  1.00 57.11  ? 84  GLY E N     1 
ATOM   8492  C CA    . GLY E 3 84  ? 78.905  -27.834  16.820  1.00 56.25  ? 84  GLY E CA    1 
ATOM   8493  C C     . GLY E 3 84  ? 79.498  -26.637  17.532  1.00 55.96  ? 84  GLY E C     1 
ATOM   8494  O O     . GLY E 3 84  ? 80.166  -25.814  16.921  1.00 55.66  ? 84  GLY E O     1 
ATOM   8495  N N     . ALA E 3 85  ? 79.241  -26.525  18.829  1.00 56.22  ? 85  ALA E N     1 
ATOM   8496  C CA    . ALA E 3 85  ? 79.673  -25.361  19.592  1.00 56.09  ? 85  ALA E CA    1 
ATOM   8497  C C     . ALA E 3 85  ? 81.191  -25.342  19.787  1.00 56.03  ? 85  ALA E C     1 
ATOM   8498  O O     . ALA E 3 85  ? 81.791  -24.285  20.012  1.00 55.82  ? 85  ALA E O     1 
ATOM   8499  C CB    . ALA E 3 85  ? 78.953  -25.311  20.932  1.00 56.49  ? 85  ALA E CB    1 
ATOM   8500  N N     . ALA E 3 86  ? 81.798  -26.519  19.686  1.00 56.25  ? 86  ALA E N     1 
ATOM   8501  C CA    . ALA E 3 86  ? 83.236  -26.687  19.846  1.00 56.69  ? 86  ALA E CA    1 
ATOM   8502  C C     . ALA E 3 86  ? 83.760  -25.996  21.123  1.00 57.16  ? 86  ALA E C     1 
ATOM   8503  O O     . ALA E 3 86  ? 83.103  -26.076  22.156  1.00 57.65  ? 86  ALA E O     1 
ATOM   8504  C CB    . ALA E 3 86  ? 83.975  -26.232  18.585  1.00 56.05  ? 86  ALA E CB    1 
ATOM   8505  N N     . SER E 3 87  ? 84.924  -25.337  21.041  1.00 57.29  ? 87  SER E N     1 
ATOM   8506  C CA    . SER E 3 87  ? 85.577  -24.643  22.173  1.00 57.54  ? 87  SER E CA    1 
ATOM   8507  C C     . SER E 3 87  ? 84.865  -23.376  22.662  1.00 57.22  ? 87  SER E C     1 
ATOM   8508  O O     . SER E 3 87  ? 85.187  -22.867  23.730  1.00 57.50  ? 87  SER E O     1 
ATOM   8509  C CB    . SER E 3 87  ? 87.024  -24.262  21.816  1.00 57.80  ? 87  SER E CB    1 
ATOM   8510  O OG    . SER E 3 87  ? 87.821  -25.391  21.525  1.00 58.84  ? 87  SER E OG    1 
ATOM   8511  N N     . GLY E 3 88  ? 83.934  -22.847  21.873  1.00 56.74  ? 88  GLY E N     1 
ATOM   8512  C CA    . GLY E 3 88  ? 83.182  -21.654  22.272  1.00 56.78  ? 88  GLY E CA    1 
ATOM   8513  C C     . GLY E 3 88  ? 83.592  -20.324  21.651  1.00 56.51  ? 88  GLY E C     1 
ATOM   8514  O O     . GLY E 3 88  ? 83.155  -19.268  22.094  1.00 56.78  ? 88  GLY E O     1 
ATOM   8515  N N     . THR E 3 89  ? 84.420  -20.367  20.614  1.00 56.13  ? 89  THR E N     1 
ATOM   8516  C CA    . THR E 3 89  ? 84.875  -19.151  19.940  1.00 55.55  ? 89  THR E CA    1 
ATOM   8517  C C     . THR E 3 89  ? 83.726  -18.334  19.350  1.00 55.24  ? 89  THR E C     1 
ATOM   8518  O O     . THR E 3 89  ? 83.496  -17.205  19.771  1.00 55.26  ? 89  THR E O     1 
ATOM   8519  C CB    . THR E 3 89  ? 85.916  -19.491  18.867  1.00 55.43  ? 89  THR E CB    1 
ATOM   8520  O OG1   . THR E 3 89  ? 87.091  -19.993  19.516  1.00 55.33  ? 89  THR E OG1   1 
ATOM   8521  C CG2   . THR E 3 89  ? 86.274  -18.273  18.040  1.00 54.67  ? 89  THR E CG2   1 
ATOM   8522  N N     . THR E 3 90  ? 83.007  -18.909  18.391  1.00 54.83  ? 90  THR E N     1 
ATOM   8523  C CA    . THR E 3 90  ? 81.891  -18.209  17.762  1.00 54.66  ? 90  THR E CA    1 
ATOM   8524  C C     . THR E 3 90  ? 80.711  -18.055  18.712  1.00 54.94  ? 90  THR E C     1 
ATOM   8525  O O     . THR E 3 90  ? 80.143  -16.971  18.809  1.00 55.30  ? 90  THR E O     1 
ATOM   8526  C CB    . THR E 3 90  ? 81.450  -18.904  16.465  1.00 54.30  ? 90  THR E CB    1 
ATOM   8527  O OG1   . THR E 3 90  ? 82.556  -18.933  15.560  1.00 55.29  ? 90  THR E OG1   1 
ATOM   8528  C CG2   . THR E 3 90  ? 80.293  -18.172  15.805  1.00 53.64  ? 90  THR E CG2   1 
ATOM   8529  N N     . ILE E 3 91  ? 80.356  -19.120  19.431  1.00 54.87  ? 91  ILE E N     1 
ATOM   8530  C CA    . ILE E 3 91  ? 79.166  -19.073  20.284  1.00 54.87  ? 91  ILE E CA    1 
ATOM   8531  C C     . ILE E 3 91  ? 79.276  -17.999  21.362  1.00 55.27  ? 91  ILE E C     1 
ATOM   8532  O O     . ILE E 3 91  ? 78.267  -17.470  21.819  1.00 55.71  ? 91  ILE E O     1 
ATOM   8533  C CB    . ILE E 3 91  ? 78.816  -20.452  20.895  1.00 55.06  ? 91  ILE E CB    1 
ATOM   8534  C CG1   . ILE E 3 91  ? 77.359  -20.479  21.350  1.00 54.37  ? 91  ILE E CG1   1 
ATOM   8535  C CG2   . ILE E 3 91  ? 79.769  -20.825  22.031  1.00 55.47  ? 91  ILE E CG2   1 
ATOM   8536  C CD1   . ILE E 3 91  ? 76.849  -21.852  21.625  1.00 53.85  ? 91  ILE E CD1   1 
ATOM   8537  N N     . SER E 3 92  ? 80.495  -17.656  21.751  1.00 55.20  ? 92  SER E N     1 
ATOM   8538  C CA    . SER E 3 92  ? 80.667  -16.592  22.716  1.00 56.37  ? 92  SER E CA    1 
ATOM   8539  C C     . SER E 3 92  ? 80.251  -15.274  22.095  1.00 56.84  ? 92  SER E C     1 
ATOM   8540  O O     . SER E 3 92  ? 79.705  -14.403  22.778  1.00 58.18  ? 92  SER E O     1 
ATOM   8541  C CB    . SER E 3 92  ? 82.108  -16.488  23.167  1.00 56.36  ? 92  SER E CB    1 
ATOM   8542  O OG    . SER E 3 92  ? 82.892  -15.981  22.112  1.00 56.73  ? 92  SER E OG    1 
ATOM   8543  N N     . HIS E 3 93  ? 80.513  -15.120  20.804  1.00 56.19  ? 93  HIS E N     1 
ATOM   8544  C CA    . HIS E 3 93  ? 80.134  -13.904  20.140  1.00 56.17  ? 93  HIS E CA    1 
ATOM   8545  C C     . HIS E 3 93  ? 78.634  -13.816  19.935  1.00 56.90  ? 93  HIS E C     1 
ATOM   8546  O O     . HIS E 3 93  ? 78.082  -12.724  19.999  1.00 57.75  ? 93  HIS E O     1 
ATOM   8547  C CB    . HIS E 3 93  ? 80.902  -13.725  18.842  1.00 55.52  ? 93  HIS E CB    1 
ATOM   8548  C CG    . HIS E 3 93  ? 82.294  -13.238  19.049  1.00 54.57  ? 93  HIS E CG    1 
ATOM   8549  N ND1   . HIS E 3 93  ? 82.579  -11.936  19.409  1.00 54.32  ? 93  HIS E ND1   1 
ATOM   8550  C CD2   . HIS E 3 93  ? 83.482  -13.879  18.980  1.00 53.93  ? 93  HIS E CD2   1 
ATOM   8551  C CE1   . HIS E 3 93  ? 83.886  -11.795  19.542  1.00 53.69  ? 93  HIS E CE1   1 
ATOM   8552  N NE2   . HIS E 3 93  ? 84.457  -12.960  19.291  1.00 53.91  ? 93  HIS E NE2   1 
ATOM   8553  N N     . VAL E 3 94  ? 77.962  -14.944  19.725  1.00 57.17  ? 94  VAL E N     1 
ATOM   8554  C CA    . VAL E 3 94  ? 76.515  -14.879  19.576  1.00 58.40  ? 94  VAL E CA    1 
ATOM   8555  C C     . VAL E 3 94  ? 75.886  -14.713  20.950  1.00 59.96  ? 94  VAL E C     1 
ATOM   8556  O O     . VAL E 3 94  ? 74.764  -14.231  21.069  1.00 60.88  ? 94  VAL E O     1 
ATOM   8557  C CB    . VAL E 3 94  ? 75.892  -16.056  18.777  1.00 58.01  ? 94  VAL E CB    1 
ATOM   8558  C CG1   . VAL E 3 94  ? 76.927  -16.738  17.885  1.00 57.71  ? 94  VAL E CG1   1 
ATOM   8559  C CG2   . VAL E 3 94  ? 75.245  -17.059  19.689  1.00 58.70  ? 94  VAL E CG2   1 
ATOM   8560  N N     . SER E 3 95  ? 76.624  -15.084  21.993  1.00 61.18  ? 95  SER E N     1 
ATOM   8561  C CA    . SER E 3 95  ? 76.207  -14.788  23.363  1.00 63.08  ? 95  SER E CA    1 
ATOM   8562  C C     . SER E 3 95  ? 76.134  -13.270  23.580  1.00 64.07  ? 95  SER E C     1 
ATOM   8563  O O     . SER E 3 95  ? 75.112  -12.754  24.018  1.00 64.57  ? 95  SER E O     1 
ATOM   8564  C CB    . SER E 3 95  ? 77.163  -15.439  24.369  1.00 63.21  ? 95  SER E CB    1 
ATOM   8565  O OG    . SER E 3 95  ? 76.768  -15.169  25.710  1.00 65.25  ? 95  SER E OG    1 
ATOM   8566  N N     . ASP E 3 96  ? 77.226  -12.579  23.254  1.00 64.73  ? 96  ASP E N     1 
ATOM   8567  C CA    . ASP E 3 96  ? 77.313  -11.121  23.277  1.00 66.05  ? 96  ASP E CA    1 
ATOM   8568  C C     . ASP E 3 96  ? 76.178  -10.440  22.501  1.00 66.53  ? 96  ASP E C     1 
ATOM   8569  O O     . ASP E 3 96  ? 75.591  -9.448   22.972  1.00 67.43  ? 96  ASP E O     1 
ATOM   8570  C CB    . ASP E 3 96  ? 78.655  -10.676  22.677  1.00 66.00  ? 96  ASP E CB    1 
ATOM   8571  C CG    . ASP E 3 96  ? 79.819  -10.806  23.649  1.00 67.49  ? 96  ASP E CG    1 
ATOM   8572  O OD1   . ASP E 3 96  ? 80.979  -10.602  23.215  1.00 67.13  ? 96  ASP E OD1   1 
ATOM   8573  O OD2   . ASP E 3 96  ? 79.581  -11.099  24.844  1.00 70.86  ? 96  ASP E OD2   1 
ATOM   8574  N N     . ILE E 3 97  ? 75.890  -10.965  21.308  1.00 65.90  ? 97  ILE E N     1 
ATOM   8575  C CA    . ILE E 3 97  ? 74.931  -10.335  20.398  1.00 66.38  ? 97  ILE E CA    1 
ATOM   8576  C C     . ILE E 3 97  ? 73.528  -10.466  20.971  1.00 67.35  ? 97  ILE E C     1 
ATOM   8577  O O     . ILE E 3 97  ? 72.759  -9.508   21.015  1.00 68.06  ? 97  ILE E O     1 
ATOM   8578  C CB    . ILE E 3 97  ? 75.031  -10.926  18.954  1.00 65.48  ? 97  ILE E CB    1 
ATOM   8579  C CG1   . ILE E 3 97  ? 76.308  -10.441  18.269  1.00 64.75  ? 97  ILE E CG1   1 
ATOM   8580  C CG2   . ILE E 3 97  ? 73.835  -10.529  18.096  1.00 65.41  ? 97  ILE E CG2   1 
ATOM   8581  C CD1   . ILE E 3 97  ? 76.846  -11.389  17.237  1.00 63.61  ? 97  ILE E CD1   1 
ATOM   8582  N N     . ILE E 3 98  ? 73.240  -11.665  21.446  1.00 67.70  ? 98  ILE E N     1 
ATOM   8583  C CA    . ILE E 3 98  ? 71.930  -12.050  21.931  1.00 68.89  ? 98  ILE E CA    1 
ATOM   8584  C C     . ILE E 3 98  ? 71.528  -11.409  23.277  1.00 70.22  ? 98  ILE E C     1 
ATOM   8585  O O     . ILE E 3 98  ? 70.346  -11.157  23.527  1.00 70.74  ? 98  ILE E O     1 
ATOM   8586  C CB    . ILE E 3 98  ? 71.875  -13.590  21.926  1.00 68.52  ? 98  ILE E CB    1 
ATOM   8587  C CG1   . ILE E 3 98  ? 71.141  -14.046  20.674  1.00 68.86  ? 98  ILE E CG1   1 
ATOM   8588  C CG2   . ILE E 3 98  ? 71.309  -14.180  23.205  1.00 68.78  ? 98  ILE E CG2   1 
ATOM   8589  C CD1   . ILE E 3 98  ? 71.578  -15.388  20.190  1.00 70.98  ? 98  ILE E CD1   1 
ATOM   8590  N N     . GLU E 3 99  ? 72.529  -11.120  24.110  1.00 70.94  ? 99  GLU E N     1 
ATOM   8591  C CA    . GLU E 3 99  ? 72.357  -10.564  25.459  1.00 72.47  ? 99  GLU E CA    1 
ATOM   8592  C C     . GLU E 3 99  ? 71.508  -11.436  26.400  1.00 73.27  ? 99  GLU E C     1 
ATOM   8593  O O     . GLU E 3 99  ? 70.930  -12.448  25.977  1.00 72.89  ? 99  GLU E O     1 
ATOM   8594  C CB    . GLU E 3 99  ? 71.876  -9.100   25.414  1.00 73.41  ? 99  GLU E CB    1 
ATOM   8595  C CG    . GLU E 3 99  ? 72.962  -8.116   24.934  1.00 74.36  ? 99  GLU E CG    1 
ATOM   8596  C CD    . GLU E 3 99  ? 72.557  -6.634   24.999  1.00 76.41  ? 99  GLU E CD    1 
ATOM   8597  O OE1   . GLU E 3 99  ? 71.367  -6.322   24.785  1.00 77.65  ? 99  GLU E OE1   1 
ATOM   8598  O OE2   . GLU E 3 99  ? 73.438  -5.776   25.250  1.00 76.67  ? 99  GLU E OE2   1 
ATOM   8599  N N     . LEU E 3 100 ? 71.454  -11.040  27.675  1.00 74.29  ? 100 LEU E N     1 
ATOM   8600  C CA    . LEU E 3 100 ? 70.846  -11.829  28.754  1.00 74.67  ? 100 LEU E CA    1 
ATOM   8601  C C     . LEU E 3 100 ? 69.431  -12.316  28.451  1.00 74.80  ? 100 LEU E C     1 
ATOM   8602  O O     . LEU E 3 100 ? 69.023  -13.377  28.934  1.00 74.72  ? 100 LEU E O     1 
ATOM   8603  C CB    . LEU E 3 100 ? 70.883  -11.027  30.055  1.00 76.10  ? 100 LEU E CB    1 
ATOM   8604  C CG    . LEU E 3 100 ? 72.297  -10.764  30.601  1.00 76.76  ? 100 LEU E CG    1 
ATOM   8605  C CD1   . LEU E 3 100 ? 72.585  -9.263   30.818  1.00 78.37  ? 100 LEU E CD1   1 
ATOM   8606  C CD2   . LEU E 3 100 ? 72.575  -11.575  31.862  1.00 77.59  ? 100 LEU E CD2   1 
ATOM   8607  N N     . ASN E 3 101 ? 68.705  -11.542  27.641  1.00 74.90  ? 101 ASN E N     1 
ATOM   8608  C CA    . ASN E 3 101 ? 67.343  -11.880  27.198  1.00 75.29  ? 101 ASN E CA    1 
ATOM   8609  C C     . ASN E 3 101 ? 67.267  -13.194  26.439  1.00 73.92  ? 101 ASN E C     1 
ATOM   8610  O O     . ASN E 3 101 ? 66.505  -14.092  26.816  1.00 74.65  ? 101 ASN E O     1 
ATOM   8611  C CB    . ASN E 3 101 ? 66.747  -10.793  26.291  1.00 75.82  ? 101 ASN E CB    1 
ATOM   8612  C CG    . ASN E 3 101 ? 67.058  -9.397   26.760  1.00 77.46  ? 101 ASN E CG    1 
ATOM   8613  O OD1   . ASN E 3 101 ? 68.164  -8.885   26.540  1.00 78.37  ? 101 ASN E OD1   1 
ATOM   8614  N ND2   . ASN E 3 101 ? 66.079  -8.758   27.393  1.00 78.97  ? 101 ASN E ND2   1 
ATOM   8615  N N     . GLY E 3 102 ? 68.038  -13.279  25.357  1.00 71.92  ? 102 GLY E N     1 
ATOM   8616  C CA    . GLY E 3 102 ? 68.034  -14.448  24.486  1.00 70.34  ? 102 GLY E CA    1 
ATOM   8617  C C     . GLY E 3 102 ? 68.885  -15.593  25.007  1.00 69.28  ? 102 GLY E C     1 
ATOM   8618  O O     . GLY E 3 102 ? 69.596  -15.452  26.004  1.00 69.64  ? 102 GLY E O     1 
ATOM   8619  N N     . LYS E 3 103 ? 68.825  -16.731  24.323  1.00 67.89  ? 103 LYS E N     1 
ATOM   8620  C CA    . LYS E 3 103 ? 69.448  -17.944  24.825  1.00 66.77  ? 103 LYS E CA    1 
ATOM   8621  C C     . LYS E 3 103 ? 70.116  -18.752  23.719  1.00 65.30  ? 103 LYS E C     1 
ATOM   8622  O O     . LYS E 3 103 ? 69.674  -18.723  22.567  1.00 65.02  ? 103 LYS E O     1 
ATOM   8623  C CB    . LYS E 3 103 ? 68.402  -18.792  25.556  1.00 67.91  ? 103 LYS E CB    1 
ATOM   8624  C CG    . LYS E 3 103 ? 68.184  -18.397  27.015  1.00 68.37  ? 103 LYS E CG    1 
ATOM   8625  C CD    . LYS E 3 103 ? 67.074  -17.378  27.212  1.00 68.28  ? 103 LYS E CD    1 
ATOM   8626  C CE    . LYS E 3 103 ? 67.410  -16.421  28.352  1.00 69.51  ? 103 LYS E CE    1 
ATOM   8627  N NZ    . LYS E 3 103 ? 68.104  -17.055  29.516  1.00 71.45  ? 103 LYS E NZ    1 
ATOM   8628  N N     . ALA E 3 104 ? 71.178  -19.471  24.077  1.00 64.14  ? 104 ALA E N     1 
ATOM   8629  C CA    . ALA E 3 104 ? 71.976  -20.223  23.107  1.00 62.59  ? 104 ALA E CA    1 
ATOM   8630  C C     . ALA E 3 104 ? 72.296  -21.599  23.634  1.00 62.14  ? 104 ALA E C     1 
ATOM   8631  O O     . ALA E 3 104 ? 72.979  -21.737  24.647  1.00 62.47  ? 104 ALA E O     1 
ATOM   8632  C CB    . ALA E 3 104 ? 73.266  -19.481  22.770  1.00 62.10  ? 104 ALA E CB    1 
ATOM   8633  N N     . TYR E 3 105 ? 71.808  -22.611  22.928  1.00 61.22  ? 105 TYR E N     1 
ATOM   8634  C CA    . TYR E 3 105 ? 71.981  -24.000  23.320  1.00 60.68  ? 105 TYR E CA    1 
ATOM   8635  C C     . TYR E 3 105 ? 73.092  -24.646  22.492  1.00 59.81  ? 105 TYR E C     1 
ATOM   8636  O O     . TYR E 3 105 ? 72.921  -24.902  21.301  1.00 59.41  ? 105 TYR E O     1 
ATOM   8637  C CB    . TYR E 3 105 ? 70.662  -24.763  23.141  1.00 61.22  ? 105 TYR E CB    1 
ATOM   8638  C CG    . TYR E 3 105 ? 69.518  -24.264  23.996  1.00 60.76  ? 105 TYR E CG    1 
ATOM   8639  C CD1   . TYR E 3 105 ? 68.600  -23.359  23.489  1.00 59.74  ? 105 TYR E CD1   1 
ATOM   8640  C CD2   . TYR E 3 105 ? 69.355  -24.708  25.311  1.00 61.09  ? 105 TYR E CD2   1 
ATOM   8641  C CE1   . TYR E 3 105 ? 67.555  -22.896  24.263  1.00 61.34  ? 105 TYR E CE1   1 
ATOM   8642  C CE2   . TYR E 3 105 ? 68.306  -24.254  26.098  1.00 61.59  ? 105 TYR E CE2   1 
ATOM   8643  C CZ    . TYR E 3 105 ? 67.408  -23.349  25.563  1.00 62.06  ? 105 TYR E CZ    1 
ATOM   8644  O OH    . TYR E 3 105 ? 66.362  -22.876  26.316  1.00 63.30  ? 105 TYR E OH    1 
ATOM   8645  N N     . GLY E 3 106 ? 74.228  -24.906  23.128  1.00 59.48  ? 106 GLY E N     1 
ATOM   8646  C CA    . GLY E 3 106 ? 75.422  -25.316  22.412  1.00 59.01  ? 106 GLY E CA    1 
ATOM   8647  C C     . GLY E 3 106 ? 75.654  -26.800  22.403  1.00 59.58  ? 106 GLY E C     1 
ATOM   8648  O O     . GLY E 3 106 ? 76.162  -27.354  23.366  1.00 60.36  ? 106 GLY E O     1 
ATOM   8649  N N     . VAL E 3 107 ? 75.300  -27.445  21.302  1.00 59.87  ? 107 VAL E N     1 
ATOM   8650  C CA    . VAL E 3 107 ? 75.460  -28.891  21.155  1.00 60.75  ? 107 VAL E CA    1 
ATOM   8651  C C     . VAL E 3 107 ? 76.857  -29.237  20.639  1.00 60.93  ? 107 VAL E C     1 
ATOM   8652  O O     . VAL E 3 107 ? 77.313  -28.674  19.650  1.00 60.49  ? 107 VAL E O     1 
ATOM   8653  C CB    . VAL E 3 107 ? 74.358  -29.469  20.226  1.00 60.84  ? 107 VAL E CB    1 
ATOM   8654  C CG1   . VAL E 3 107 ? 74.682  -30.897  19.773  1.00 60.83  ? 107 VAL E CG1   1 
ATOM   8655  C CG2   . VAL E 3 107 ? 72.993  -29.404  20.918  1.00 61.32  ? 107 VAL E CG2   1 
ATOM   8656  N N     . GLU E 3 108 ? 77.528  -30.167  21.312  1.00 61.98  ? 108 GLU E N     1 
ATOM   8657  C CA    . GLU E 3 108 ? 78.895  -30.539  20.969  1.00 62.54  ? 108 GLU E CA    1 
ATOM   8658  C C     . GLU E 3 108 ? 79.187  -31.908  21.550  1.00 63.34  ? 108 GLU E C     1 
ATOM   8659  O O     . GLU E 3 108 ? 78.950  -32.127  22.736  1.00 64.25  ? 108 GLU E O     1 
ATOM   8660  C CB    . GLU E 3 108 ? 79.869  -29.503  21.544  1.00 62.60  ? 108 GLU E CB    1 
ATOM   8661  C CG    . GLU E 3 108 ? 81.350  -29.788  21.318  1.00 64.44  ? 108 GLU E CG    1 
ATOM   8662  C CD    . GLU E 3 108 ? 81.702  -30.050  19.857  1.00 67.00  ? 108 GLU E CD    1 
ATOM   8663  O OE1   . GLU E 3 108 ? 81.340  -29.231  18.972  1.00 68.00  ? 108 GLU E OE1   1 
ATOM   8664  O OE2   . GLU E 3 108 ? 82.350  -31.085  19.597  1.00 68.37  ? 108 GLU E OE2   1 
ATOM   8665  N N     . PHE E 3 109 ? 79.704  -32.823  20.728  1.00 63.42  ? 109 PHE E N     1 
ATOM   8666  C CA    . PHE E 3 109 ? 79.880  -34.227  21.149  1.00 64.23  ? 109 PHE E CA    1 
ATOM   8667  C C     . PHE E 3 109 ? 81.322  -34.669  21.394  1.00 64.33  ? 109 PHE E C     1 
ATOM   8668  O O     . PHE E 3 109 ? 81.575  -35.846  21.625  1.00 65.36  ? 109 PHE E O     1 
ATOM   8669  C CB    . PHE E 3 109 ? 79.146  -35.194  20.192  1.00 64.75  ? 109 PHE E CB    1 
ATOM   8670  C CG    . PHE E 3 109 ? 79.979  -35.700  19.021  1.00 65.00  ? 109 PHE E CG    1 
ATOM   8671  C CD1   . PHE E 3 109 ? 79.823  -37.007  18.579  1.00 66.68  ? 109 PHE E CD1   1 
ATOM   8672  C CD2   . PHE E 3 109 ? 80.885  -34.876  18.346  1.00 65.42  ? 109 PHE E CD2   1 
ATOM   8673  C CE1   . PHE E 3 109 ? 80.570  -37.507  17.494  1.00 68.01  ? 109 PHE E CE1   1 
ATOM   8674  C CE2   . PHE E 3 109 ? 81.645  -35.366  17.258  1.00 66.51  ? 109 PHE E CE2   1 
ATOM   8675  C CZ    . PHE E 3 109 ? 81.486  -36.687  16.835  1.00 67.29  ? 109 PHE E CZ    1 
ATOM   8676  N N     . SER E 3 110 ? 82.265  -33.734  21.345  1.00 63.41  ? 110 SER E N     1 
ATOM   8677  C CA    . SER E 3 110 ? 83.654  -34.065  21.630  1.00 63.59  ? 110 SER E CA    1 
ATOM   8678  C C     . SER E 3 110 ? 84.075  -33.586  23.035  1.00 63.56  ? 110 SER E C     1 
ATOM   8679  O O     . SER E 3 110 ? 84.202  -32.380  23.264  1.00 63.20  ? 110 SER E O     1 
ATOM   8680  C CB    . SER E 3 110 ? 84.575  -33.491  20.560  1.00 62.96  ? 110 SER E CB    1 
ATOM   8681  O OG    . SER E 3 110 ? 85.886  -34.013  20.717  1.00 65.06  ? 110 SER E OG    1 
ATOM   8682  N N     . PRO E 3 111 ? 84.305  -34.533  23.976  1.00 63.85  ? 111 PRO E N     1 
ATOM   8683  C CA    . PRO E 3 111 ? 84.553  -34.188  25.380  1.00 63.64  ? 111 PRO E CA    1 
ATOM   8684  C C     . PRO E 3 111 ? 85.826  -33.378  25.573  1.00 62.88  ? 111 PRO E C     1 
ATOM   8685  O O     . PRO E 3 111 ? 85.848  -32.443  26.370  1.00 62.68  ? 111 PRO E O     1 
ATOM   8686  C CB    . PRO E 3 111 ? 84.676  -35.555  26.062  1.00 64.93  ? 111 PRO E CB    1 
ATOM   8687  C CG    . PRO E 3 111 ? 83.994  -36.519  25.127  1.00 65.40  ? 111 PRO E CG    1 
ATOM   8688  C CD    . PRO E 3 111 ? 84.315  -35.992  23.767  1.00 64.60  ? 111 PRO E CD    1 
ATOM   8689  N N     . ARG E 3 112 ? 86.874  -33.729  24.832  1.00 62.41  ? 112 ARG E N     1 
ATOM   8690  C CA    . ARG E 3 112 ? 88.161  -33.032  24.885  1.00 61.62  ? 112 ARG E CA    1 
ATOM   8691  C C     . ARG E 3 112 ? 87.996  -31.525  24.670  1.00 60.14  ? 112 ARG E C     1 
ATOM   8692  O O     . ARG E 3 112 ? 88.851  -30.732  25.056  1.00 59.69  ? 112 ARG E O     1 
ATOM   8693  C CB    . ARG E 3 112 ? 89.096  -33.654  23.842  1.00 61.80  ? 112 ARG E CB    1 
ATOM   8694  C CG    . ARG E 3 112 ? 90.450  -32.973  23.585  1.00 62.35  ? 112 ARG E CG    1 
ATOM   8695  C CD    . ARG E 3 112 ? 91.437  -32.980  24.751  1.00 64.23  ? 112 ARG E CD    1 
ATOM   8696  N NE    . ARG E 3 112 ? 91.374  -31.739  25.500  1.00 65.05  ? 112 ARG E NE    1 
ATOM   8697  C CZ    . ARG E 3 112 ? 92.222  -30.722  25.404  1.00 66.17  ? 112 ARG E CZ    1 
ATOM   8698  N NH1   . ARG E 3 112 ? 92.017  -29.648  26.144  1.00 65.99  ? 112 ARG E NH1   1 
ATOM   8699  N NH2   . ARG E 3 112 ? 93.258  -30.756  24.583  1.00 68.05  ? 112 ARG E NH2   1 
ATOM   8700  N N     . VAL E 3 113 ? 86.856  -31.153  24.093  1.00 59.20  ? 113 VAL E N     1 
ATOM   8701  C CA    . VAL E 3 113 ? 86.596  -29.804  23.606  1.00 57.98  ? 113 VAL E CA    1 
ATOM   8702  C C     . VAL E 3 113 ? 85.507  -29.105  24.415  1.00 58.02  ? 113 VAL E C     1 
ATOM   8703  O O     . VAL E 3 113 ? 85.626  -27.917  24.716  1.00 57.79  ? 113 VAL E O     1 
ATOM   8704  C CB    . VAL E 3 113 ? 86.287  -29.836  22.089  1.00 57.02  ? 113 VAL E CB    1 
ATOM   8705  C CG1   . VAL E 3 113 ? 85.331  -28.736  21.682  1.00 55.61  ? 113 VAL E CG1   1 
ATOM   8706  C CG2   . VAL E 3 113 ? 87.594  -29.756  21.301  1.00 56.77  ? 113 VAL E CG2   1 
ATOM   8707  N N     . VAL E 3 114 ? 84.465  -29.856  24.774  1.00 58.63  ? 114 VAL E N     1 
ATOM   8708  C CA    . VAL E 3 114 ? 83.425  -29.411  25.719  1.00 59.01  ? 114 VAL E CA    1 
ATOM   8709  C C     . VAL E 3 114 ? 84.073  -29.072  27.073  1.00 60.24  ? 114 VAL E C     1 
ATOM   8710  O O     . VAL E 3 114 ? 83.527  -28.305  27.876  1.00 60.32  ? 114 VAL E O     1 
ATOM   8711  C CB    . VAL E 3 114 ? 82.329  -30.500  25.933  1.00 59.31  ? 114 VAL E CB    1 
ATOM   8712  C CG1   . VAL E 3 114 ? 81.199  -29.963  26.786  1.00 59.71  ? 114 VAL E CG1   1 
ATOM   8713  C CG2   . VAL E 3 114 ? 81.780  -31.021  24.608  1.00 57.93  ? 114 VAL E CG2   1 
ATOM   8714  N N     . ARG E 3 115 ? 85.245  -29.653  27.314  1.00 61.17  ? 115 ARG E N     1 
ATOM   8715  C CA    . ARG E 3 115 ? 86.048  -29.292  28.453  1.00 62.72  ? 115 ARG E CA    1 
ATOM   8716  C C     . ARG E 3 115 ? 86.204  -27.788  28.510  1.00 63.40  ? 115 ARG E C     1 
ATOM   8717  O O     . ARG E 3 115 ? 85.946  -27.174  29.531  1.00 64.20  ? 115 ARG E O     1 
ATOM   8718  C CB    . ARG E 3 115 ? 87.414  -29.944  28.354  1.00 62.93  ? 115 ARG E CB    1 
ATOM   8719  C CG    . ARG E 3 115 ? 88.273  -29.778  29.583  1.00 62.86  ? 115 ARG E CG    1 
ATOM   8720  C CD    . ARG E 3 115 ? 89.216  -30.934  29.650  1.00 63.58  ? 115 ARG E CD    1 
ATOM   8721  N NE    . ARG E 3 115 ? 90.600  -30.561  29.407  1.00 64.24  ? 115 ARG E NE    1 
ATOM   8722  C CZ    . ARG E 3 115 ? 91.532  -31.403  28.964  1.00 65.79  ? 115 ARG E CZ    1 
ATOM   8723  N NH1   . ARG E 3 115 ? 92.785  -30.983  28.797  1.00 67.21  ? 115 ARG E NH1   1 
ATOM   8724  N NH2   . ARG E 3 115 ? 91.219  -32.663  28.680  1.00 64.69  ? 115 ARG E NH2   1 
ATOM   8725  N N     . GLU E 3 116 ? 86.610  -27.191  27.402  1.00 64.04  ? 116 GLU E N     1 
ATOM   8726  C CA    . GLU E 3 116 ? 86.882  -25.771  27.391  1.00 65.07  ? 116 GLU E CA    1 
ATOM   8727  C C     . GLU E 3 116 ? 85.633  -24.943  27.150  1.00 64.56  ? 116 GLU E C     1 
ATOM   8728  O O     . GLU E 3 116 ? 85.600  -23.753  27.489  1.00 64.88  ? 116 GLU E O     1 
ATOM   8729  C CB    . GLU E 3 116 ? 87.979  -25.453  26.390  1.00 65.20  ? 116 GLU E CB    1 
ATOM   8730  C CG    . GLU E 3 116 ? 89.362  -25.781  26.946  1.00 68.96  ? 116 GLU E CG    1 
ATOM   8731  C CD    . GLU E 3 116 ? 90.189  -26.659  25.999  1.00 73.90  ? 116 GLU E CD    1 
ATOM   8732  O OE1   . GLU E 3 116 ? 89.977  -26.605  24.751  1.00 76.18  ? 116 GLU E OE1   1 
ATOM   8733  O OE2   . GLU E 3 116 ? 91.063  -27.401  26.509  1.00 74.78  ? 116 GLU E OE2   1 
ATOM   8734  N N     . LEU E 3 117 ? 84.605  -25.575  26.589  1.00 64.28  ? 117 LEU E N     1 
ATOM   8735  C CA    . LEU E 3 117 ? 83.312  -24.918  26.411  1.00 64.12  ? 117 LEU E CA    1 
ATOM   8736  C C     . LEU E 3 117 ? 82.686  -24.607  27.792  1.00 65.57  ? 117 LEU E C     1 
ATOM   8737  O O     . LEU E 3 117 ? 82.189  -23.495  28.016  1.00 65.89  ? 117 LEU E O     1 
ATOM   8738  C CB    . LEU E 3 117 ? 82.396  -25.765  25.517  1.00 63.26  ? 117 LEU E CB    1 
ATOM   8739  C CG    . LEU E 3 117 ? 80.973  -25.303  25.199  1.00 62.50  ? 117 LEU E CG    1 
ATOM   8740  C CD1   . LEU E 3 117 ? 80.963  -24.095  24.295  1.00 60.52  ? 117 LEU E CD1   1 
ATOM   8741  C CD2   . LEU E 3 117 ? 80.170  -26.449  24.586  1.00 61.62  ? 117 LEU E CD2   1 
ATOM   8742  N N     . LEU E 3 118 ? 82.749  -25.572  28.717  1.00 66.61  ? 118 LEU E N     1 
ATOM   8743  C CA    . LEU E 3 118 ? 82.347  -25.366  30.114  1.00 67.63  ? 118 LEU E CA    1 
ATOM   8744  C C     . LEU E 3 118 ? 82.777  -24.012  30.690  1.00 68.10  ? 118 LEU E C     1 
ATOM   8745  O O     . LEU E 3 118 ? 81.940  -23.261  31.203  1.00 68.34  ? 118 LEU E O     1 
ATOM   8746  C CB    . LEU E 3 118 ? 82.923  -26.469  31.000  1.00 68.54  ? 118 LEU E CB    1 
ATOM   8747  C CG    . LEU E 3 118 ? 82.053  -27.587  31.571  1.00 69.08  ? 118 LEU E CG    1 
ATOM   8748  C CD1   . LEU E 3 118 ? 82.900  -28.390  32.540  1.00 69.66  ? 118 LEU E CD1   1 
ATOM   8749  C CD2   . LEU E 3 118 ? 80.819  -27.043  32.272  1.00 68.61  ? 118 LEU E CD2   1 
ATOM   8750  N N     . LEU E 3 119 ? 84.079  -23.717  30.603  1.00 68.20  ? 119 LEU E N     1 
ATOM   8751  C CA    . LEU E 3 119 ? 84.646  -22.471  31.116  1.00 68.61  ? 119 LEU E CA    1 
ATOM   8752  C C     . LEU E 3 119 ? 83.980  -21.235  30.520  1.00 67.94  ? 119 LEU E C     1 
ATOM   8753  O O     . LEU E 3 119 ? 83.773  -20.239  31.220  1.00 68.49  ? 119 LEU E O     1 
ATOM   8754  C CB    . LEU E 3 119 ? 86.149  -22.421  30.872  1.00 68.66  ? 119 LEU E CB    1 
ATOM   8755  C CG    . LEU E 3 119 ? 87.051  -23.151  31.876  1.00 70.72  ? 119 LEU E CG    1 
ATOM   8756  C CD1   . LEU E 3 119 ? 88.421  -23.395  31.256  1.00 71.23  ? 119 LEU E CD1   1 
ATOM   8757  C CD2   . LEU E 3 119 ? 87.194  -22.392  33.209  1.00 72.63  ? 119 LEU E CD2   1 
ATOM   8758  N N     . VAL E 3 120 ? 83.640  -21.310  29.236  1.00 66.87  ? 120 VAL E N     1 
ATOM   8759  C CA    . VAL E 3 120 ? 82.982  -20.202  28.546  1.00 66.28  ? 120 VAL E CA    1 
ATOM   8760  C C     . VAL E 3 120 ? 81.566  -20.062  29.081  1.00 67.10  ? 120 VAL E C     1 
ATOM   8761  O O     . VAL E 3 120 ? 81.101  -18.952  29.369  1.00 67.42  ? 120 VAL E O     1 
ATOM   8762  C CB    . VAL E 3 120 ? 82.947  -20.410  27.000  1.00 65.03  ? 120 VAL E CB    1 
ATOM   8763  C CG1   . VAL E 3 120 ? 82.259  -19.256  26.307  1.00 63.56  ? 120 VAL E CG1   1 
ATOM   8764  C CG2   . VAL E 3 120 ? 84.346  -20.587  26.446  1.00 64.64  ? 120 VAL E CG2   1 
ATOM   8765  N N     . ALA E 3 121 ? 80.894  -21.201  29.230  1.00 67.67  ? 121 ALA E N     1 
ATOM   8766  C CA    . ALA E 3 121 ? 79.480  -21.215  29.569  1.00 68.45  ? 121 ALA E CA    1 
ATOM   8767  C C     . ALA E 3 121 ? 79.236  -20.998  31.053  1.00 70.09  ? 121 ALA E C     1 
ATOM   8768  O O     . ALA E 3 121 ? 78.138  -20.623  31.446  1.00 70.64  ? 121 ALA E O     1 
ATOM   8769  C CB    . ALA E 3 121 ? 78.836  -22.491  29.098  1.00 68.23  ? 121 ALA E CB    1 
ATOM   8770  N N     . GLN E 3 122 ? 80.252  -21.228  31.878  1.00 71.39  ? 122 GLN E N     1 
ATOM   8771  C CA    . GLN E 3 122 ? 80.150  -20.896  33.294  1.00 73.50  ? 122 GLN E CA    1 
ATOM   8772  C C     . GLN E 3 122 ? 79.967  -19.395  33.472  1.00 74.13  ? 122 GLN E C     1 
ATOM   8773  O O     . GLN E 3 122 ? 79.001  -18.949  34.091  1.00 75.09  ? 122 GLN E O     1 
ATOM   8774  C CB    . GLN E 3 122 ? 81.376  -21.382  34.056  1.00 74.19  ? 122 GLN E CB    1 
ATOM   8775  C CG    . GLN E 3 122 ? 81.306  -22.859  34.414  1.00 75.90  ? 122 GLN E CG    1 
ATOM   8776  C CD    . GLN E 3 122 ? 82.496  -23.337  35.225  1.00 78.27  ? 122 GLN E CD    1 
ATOM   8777  O OE1   . GLN E 3 122 ? 83.599  -22.782  35.142  1.00 78.82  ? 122 GLN E OE1   1 
ATOM   8778  N NE2   . GLN E 3 122 ? 82.278  -24.382  36.012  1.00 79.47  ? 122 GLN E NE2   1 
ATOM   8779  N N     . ARG E 3 123 ? 80.889  -18.632  32.889  1.00 74.14  ? 123 ARG E N     1 
ATOM   8780  C CA    . ARG E 3 123 ? 80.875  -17.179  32.928  1.00 74.75  ? 123 ARG E CA    1 
ATOM   8781  C C     . ARG E 3 123 ? 79.675  -16.550  32.201  1.00 74.04  ? 123 ARG E C     1 
ATOM   8782  O O     . ARG E 3 123 ? 79.441  -15.348  32.329  1.00 74.32  ? 123 ARG E O     1 
ATOM   8783  C CB    . ARG E 3 123 ? 82.198  -16.634  32.348  1.00 74.86  ? 123 ARG E CB    1 
ATOM   8784  C CG    . ARG E 3 123 ? 83.366  -16.436  33.356  1.00 78.13  ? 123 ARG E CG    1 
ATOM   8785  C CD    . ARG E 3 123 ? 83.075  -15.259  34.333  1.00 83.97  ? 123 ARG E CD    1 
ATOM   8786  N NE    . ARG E 3 123 ? 84.184  -14.893  35.232  1.00 87.32  ? 123 ARG E NE    1 
ATOM   8787  C CZ    . ARG E 3 123 ? 84.132  -13.917  36.152  1.00 88.98  ? 123 ARG E CZ    1 
ATOM   8788  N NH1   . ARG E 3 123 ? 83.026  -13.197  36.311  1.00 88.70  ? 123 ARG E NH1   1 
ATOM   8789  N NH2   . ARG E 3 123 ? 85.187  -13.656  36.926  1.00 90.12  ? 123 ARG E NH2   1 
ATOM   8790  N N     . ARG E 3 124 ? 78.908  -17.353  31.462  1.00 73.29  ? 124 ARG E N     1 
ATOM   8791  C CA    . ARG E 3 124 ? 77.869  -16.816  30.565  1.00 72.80  ? 124 ARG E CA    1 
ATOM   8792  C C     . ARG E 3 124 ? 76.466  -17.439  30.701  1.00 73.06  ? 124 ARG E C     1 
ATOM   8793  O O     . ARG E 3 124 ? 76.197  -18.501  30.127  1.00 72.75  ? 124 ARG E O     1 
ATOM   8794  C CB    . ARG E 3 124 ? 78.341  -16.905  29.102  1.00 71.73  ? 124 ARG E CB    1 
ATOM   8795  C CG    . ARG E 3 124 ? 79.465  -15.944  28.768  1.00 71.40  ? 124 ARG E CG    1 
ATOM   8796  C CD    . ARG E 3 124 ? 79.945  -16.069  27.350  1.00 69.51  ? 124 ARG E CD    1 
ATOM   8797  N NE    . ARG E 3 124 ? 80.864  -14.976  27.052  1.00 69.37  ? 124 ARG E NE    1 
ATOM   8798  C CZ    . ARG E 3 124 ? 80.530  -13.878  26.383  1.00 68.38  ? 124 ARG E CZ    1 
ATOM   8799  N NH1   . ARG E 3 124 ? 81.431  -12.923  26.174  1.00 67.00  ? 124 ARG E NH1   1 
ATOM   8800  N NH2   . ARG E 3 124 ? 79.297  -13.738  25.920  1.00 67.79  ? 124 ARG E NH2   1 
ATOM   8801  N N     . PRO E 3 125 ? 75.554  -16.757  31.419  1.00 73.77  ? 125 PRO E N     1 
ATOM   8802  C CA    . PRO E 3 125 ? 74.158  -17.195  31.631  1.00 74.27  ? 125 PRO E CA    1 
ATOM   8803  C C     . PRO E 3 125 ? 73.339  -17.461  30.350  1.00 73.45  ? 125 PRO E C     1 
ATOM   8804  O O     . PRO E 3 125 ? 72.351  -18.201  30.390  1.00 73.86  ? 125 PRO E O     1 
ATOM   8805  C CB    . PRO E 3 125 ? 73.542  -16.027  32.407  1.00 75.30  ? 125 PRO E CB    1 
ATOM   8806  C CG    . PRO E 3 125 ? 74.705  -15.366  33.081  1.00 75.67  ? 125 PRO E CG    1 
ATOM   8807  C CD    . PRO E 3 125 ? 75.835  -15.481  32.101  1.00 74.44  ? 125 PRO E CD    1 
ATOM   8808  N N     . ASN E 3 126 ? 73.749  -16.835  29.248  1.00 72.50  ? 126 ASN E N     1 
ATOM   8809  C CA    . ASN E 3 126 ? 73.203  -17.045  27.901  1.00 71.65  ? 126 ASN E CA    1 
ATOM   8810  C C     . ASN E 3 126 ? 73.334  -18.452  27.352  1.00 70.83  ? 126 ASN E C     1 
ATOM   8811  O O     . ASN E 3 126 ? 72.524  -18.867  26.515  1.00 70.68  ? 126 ASN E O     1 
ATOM   8812  C CB    . ASN E 3 126 ? 73.982  -16.184  26.915  1.00 71.24  ? 126 ASN E CB    1 
ATOM   8813  C CG    . ASN E 3 126 ? 73.443  -14.800  26.798  1.00 73.21  ? 126 ASN E CG    1 
ATOM   8814  O OD1   . ASN E 3 126 ? 74.200  -13.848  26.599  1.00 74.45  ? 126 ASN E OD1   1 
ATOM   8815  N ND2   . ASN E 3 126 ? 72.122  -14.665  26.900  1.00 75.75  ? 126 ASN E ND2   1 
ATOM   8816  N N     . ILE E 3 127 ? 74.385  -19.157  27.777  1.00 69.95  ? 127 ILE E N     1 
ATOM   8817  C CA    . ILE E 3 127 ? 74.830  -20.363  27.087  1.00 68.70  ? 127 ILE E CA    1 
ATOM   8818  C C     . ILE E 3 127 ? 74.537  -21.638  27.880  1.00 68.80  ? 127 ILE E C     1 
ATOM   8819  O O     . ILE E 3 127 ? 74.895  -21.756  29.050  1.00 69.72  ? 127 ILE E O     1 
ATOM   8820  C CB    . ILE E 3 127 ? 76.333  -20.288  26.731  1.00 68.10  ? 127 ILE E CB    1 
ATOM   8821  C CG1   . ILE E 3 127 ? 76.656  -18.973  26.029  1.00 67.28  ? 127 ILE E CG1   1 
ATOM   8822  C CG2   . ILE E 3 127 ? 76.745  -21.462  25.850  1.00 67.68  ? 127 ILE E CG2   1 
ATOM   8823  C CD1   . ILE E 3 127 ? 78.124  -18.774  25.804  1.00 67.35  ? 127 ILE E CD1   1 
ATOM   8824  N N     . PHE E 3 128 ? 73.887  -22.587  27.217  1.00 67.60  ? 128 PHE E N     1 
ATOM   8825  C CA    . PHE E 3 128 ? 73.500  -23.838  27.827  1.00 67.31  ? 128 PHE E CA    1 
ATOM   8826  C C     . PHE E 3 128 ? 74.226  -24.977  27.120  1.00 66.07  ? 128 PHE E C     1 
ATOM   8827  O O     . PHE E 3 128 ? 73.722  -25.537  26.141  1.00 66.05  ? 128 PHE E O     1 
ATOM   8828  C CB    . PHE E 3 128 ? 71.980  -24.029  27.736  1.00 68.13  ? 128 PHE E CB    1 
ATOM   8829  C CG    . PHE E 3 128 ? 71.184  -22.918  28.368  1.00 69.02  ? 128 PHE E CG    1 
ATOM   8830  C CD1   . PHE E 3 128 ? 70.875  -21.766  27.642  1.00 68.61  ? 128 PHE E CD1   1 
ATOM   8831  C CD2   . PHE E 3 128 ? 70.736  -23.023  29.678  1.00 69.33  ? 128 PHE E CD2   1 
ATOM   8832  C CE1   . PHE E 3 128 ? 70.146  -20.732  28.218  1.00 69.12  ? 128 PHE E CE1   1 
ATOM   8833  C CE2   . PHE E 3 128 ? 70.003  -21.994  30.252  1.00 70.73  ? 128 PHE E CE2   1 
ATOM   8834  C CZ    . PHE E 3 128 ? 69.713  -20.840  29.521  1.00 70.19  ? 128 PHE E CZ    1 
ATOM   8835  N N     . PRO E 3 129 ? 75.414  -25.337  27.620  1.00 65.09  ? 129 PRO E N     1 
ATOM   8836  C CA    . PRO E 3 129 ? 76.253  -26.355  26.989  1.00 63.93  ? 129 PRO E CA    1 
ATOM   8837  C C     . PRO E 3 129 ? 75.561  -27.703  26.942  1.00 63.75  ? 129 PRO E C     1 
ATOM   8838  O O     . PRO E 3 129 ? 74.779  -28.005  27.835  1.00 65.01  ? 129 PRO E O     1 
ATOM   8839  C CB    . PRO E 3 129 ? 77.453  -26.440  27.935  1.00 64.53  ? 129 PRO E CB    1 
ATOM   8840  C CG    . PRO E 3 129 ? 76.936  -25.969  29.261  1.00 65.43  ? 129 PRO E CG    1 
ATOM   8841  C CD    . PRO E 3 129 ? 75.941  -24.906  28.929  1.00 65.61  ? 129 PRO E CD    1 
ATOM   8842  N N     . LEU E 3 130 ? 75.838  -28.509  25.920  1.00 62.57  ? 130 LEU E N     1 
ATOM   8843  C CA    . LEU E 3 130 ? 75.314  -29.886  25.863  1.00 62.63  ? 130 LEU E CA    1 
ATOM   8844  C C     . LEU E 3 130 ? 76.296  -30.878  25.236  1.00 62.15  ? 130 LEU E C     1 
ATOM   8845  O O     . LEU E 3 130 ? 76.581  -30.809  24.040  1.00 61.65  ? 130 LEU E O     1 
ATOM   8846  C CB    . LEU E 3 130 ? 73.958  -29.944  25.134  1.00 62.51  ? 130 LEU E CB    1 
ATOM   8847  C CG    . LEU E 3 130 ? 72.741  -29.220  25.731  1.00 62.73  ? 130 LEU E CG    1 
ATOM   8848  C CD1   . LEU E 3 130 ? 71.642  -29.050  24.692  1.00 62.05  ? 130 LEU E CD1   1 
ATOM   8849  C CD2   . LEU E 3 130 ? 72.217  -29.916  26.992  1.00 63.13  ? 130 LEU E CD2   1 
ATOM   8850  N N     . LEU E 3 131 ? 76.819  -31.796  26.040  1.00 62.37  ? 131 LEU E N     1 
ATOM   8851  C CA    . LEU E 3 131 ? 77.649  -32.851  25.499  1.00 62.10  ? 131 LEU E CA    1 
ATOM   8852  C C     . LEU E 3 131 ? 76.752  -33.944  24.910  1.00 62.23  ? 131 LEU E C     1 
ATOM   8853  O O     . LEU E 3 131 ? 76.434  -34.940  25.574  1.00 63.29  ? 131 LEU E O     1 
ATOM   8854  C CB    . LEU E 3 131 ? 78.595  -33.410  26.564  1.00 63.08  ? 131 LEU E CB    1 
ATOM   8855  C CG    . LEU E 3 131 ? 79.791  -34.240  26.058  1.00 64.29  ? 131 LEU E CG    1 
ATOM   8856  C CD1   . LEU E 3 131 ? 80.954  -34.129  27.011  1.00 65.68  ? 131 LEU E CD1   1 
ATOM   8857  C CD2   . LEU E 3 131 ? 79.480  -35.724  25.807  1.00 66.23  ? 131 LEU E CD2   1 
ATOM   8858  N N     . ALA E 3 132 ? 76.341  -33.746  23.662  1.00 61.07  ? 132 ALA E N     1 
ATOM   8859  C CA    . ALA E 3 132 ? 75.455  -34.687  22.987  1.00 61.20  ? 132 ALA E CA    1 
ATOM   8860  C C     . ALA E 3 132 ? 75.728  -34.747  21.491  1.00 60.38  ? 132 ALA E C     1 
ATOM   8861  O O     . ALA E 3 132 ? 76.272  -33.813  20.925  1.00 59.47  ? 132 ALA E O     1 
ATOM   8862  C CB    . ALA E 3 132 ? 74.023  -34.314  23.239  1.00 61.43  ? 132 ALA E CB    1 
ATOM   8863  N N     . ASP E 3 133 ? 75.339  -35.851  20.862  1.00 60.95  ? 133 ASP E N     1 
ATOM   8864  C CA    . ASP E 3 133 ? 75.524  -36.057  19.429  1.00 60.56  ? 133 ASP E CA    1 
ATOM   8865  C C     . ASP E 3 133 ? 74.312  -35.490  18.664  1.00 60.54  ? 133 ASP E C     1 
ATOM   8866  O O     . ASP E 3 133 ? 73.190  -35.963  18.820  1.00 61.21  ? 133 ASP E O     1 
ATOM   8867  C CB    . ASP E 3 133 ? 75.744  -37.554  19.151  1.00 61.21  ? 133 ASP E CB    1 
ATOM   8868  C CG    . ASP E 3 133 ? 75.980  -37.869  17.682  1.00 61.15  ? 133 ASP E CG    1 
ATOM   8869  O OD1   . ASP E 3 133 ? 75.519  -37.125  16.806  1.00 61.90  ? 133 ASP E OD1   1 
ATOM   8870  O OD2   . ASP E 3 133 ? 76.608  -38.896  17.379  1.00 62.61  ? 133 ASP E OD2   1 
ATOM   8871  N N     . ALA E 3 134 ? 74.560  -34.477  17.837  1.00 59.98  ? 134 ALA E N     1 
ATOM   8872  C CA    . ALA E 3 134 ? 73.523  -33.757  17.105  1.00 60.13  ? 134 ALA E CA    1 
ATOM   8873  C C     . ALA E 3 134 ? 72.704  -34.625  16.164  1.00 61.16  ? 134 ALA E C     1 
ATOM   8874  O O     . ALA E 3 134 ? 71.683  -34.183  15.650  1.00 61.38  ? 134 ALA E O     1 
ATOM   8875  C CB    . ALA E 3 134 ? 74.134  -32.606  16.334  1.00 59.45  ? 134 ALA E CB    1 
ATOM   8876  N N     . ARG E 3 135 ? 73.154  -35.847  15.920  1.00 62.37  ? 135 ARG E N     1 
ATOM   8877  C CA    . ARG E 3 135 ? 72.382  -36.801  15.121  1.00 63.85  ? 135 ARG E CA    1 
ATOM   8878  C C     . ARG E 3 135 ? 71.167  -37.371  15.886  1.00 65.27  ? 135 ARG E C     1 
ATOM   8879  O O     . ARG E 3 135 ? 70.206  -37.855  15.276  1.00 66.02  ? 135 ARG E O     1 
ATOM   8880  C CB    . ARG E 3 135 ? 73.284  -37.936  14.636  1.00 64.29  ? 135 ARG E CB    1 
ATOM   8881  C CG    . ARG E 3 135 ? 74.197  -37.548  13.499  1.00 63.76  ? 135 ARG E CG    1 
ATOM   8882  C CD    . ARG E 3 135 ? 75.079  -38.701  13.094  1.00 65.32  ? 135 ARG E CD    1 
ATOM   8883  N NE    . ARG E 3 135 ? 75.951  -39.082  14.201  1.00 66.44  ? 135 ARG E NE    1 
ATOM   8884  C CZ    . ARG E 3 135 ? 77.116  -39.703  14.060  1.00 66.92  ? 135 ARG E CZ    1 
ATOM   8885  N NH1   . ARG E 3 135 ? 77.560  -40.019  12.842  1.00 66.73  ? 135 ARG E NH1   1 
ATOM   8886  N NH2   . ARG E 3 135 ? 77.832  -40.003  15.139  1.00 66.65  ? 135 ARG E NH2   1 
ATOM   8887  N N     . PHE E 3 136 ? 71.219  -37.317  17.217  1.00 65.90  ? 136 PHE E N     1 
ATOM   8888  C CA    . PHE E 3 136 ? 70.107  -37.739  18.059  1.00 66.92  ? 136 PHE E CA    1 
ATOM   8889  C C     . PHE E 3 136 ? 69.590  -36.563  18.877  1.00 67.04  ? 136 PHE E C     1 
ATOM   8890  O O     . PHE E 3 136 ? 69.971  -36.421  20.032  1.00 67.43  ? 136 PHE E O     1 
ATOM   8891  C CB    . PHE E 3 136 ? 70.559  -38.851  19.006  1.00 67.61  ? 136 PHE E CB    1 
ATOM   8892  C CG    . PHE E 3 136 ? 71.175  -40.031  18.312  1.00 67.79  ? 136 PHE E CG    1 
ATOM   8893  C CD1   . PHE E 3 136 ? 72.514  -40.322  18.485  1.00 67.45  ? 136 PHE E CD1   1 
ATOM   8894  C CD2   . PHE E 3 136 ? 70.413  -40.856  17.490  1.00 68.42  ? 136 PHE E CD2   1 
ATOM   8895  C CE1   . PHE E 3 136 ? 73.091  -41.412  17.853  1.00 67.70  ? 136 PHE E CE1   1 
ATOM   8896  C CE2   . PHE E 3 136 ? 70.981  -41.945  16.853  1.00 68.25  ? 136 PHE E CE2   1 
ATOM   8897  C CZ    . PHE E 3 136 ? 72.323  -42.223  17.035  1.00 68.14  ? 136 PHE E CZ    1 
ATOM   8898  N N     . PRO E 3 137 ? 68.731  -35.705  18.289  1.00 67.11  ? 137 PRO E N     1 
ATOM   8899  C CA    . PRO E 3 137 ? 68.125  -34.608  19.063  1.00 67.43  ? 137 PRO E CA    1 
ATOM   8900  C C     . PRO E 3 137 ? 67.252  -35.082  20.245  1.00 69.05  ? 137 PRO E C     1 
ATOM   8901  O O     . PRO E 3 137 ? 66.965  -34.295  21.162  1.00 68.95  ? 137 PRO E O     1 
ATOM   8902  C CB    . PRO E 3 137 ? 67.281  -33.858  18.029  1.00 67.04  ? 137 PRO E CB    1 
ATOM   8903  C CG    . PRO E 3 137 ? 67.163  -34.770  16.870  1.00 67.12  ? 137 PRO E CG    1 
ATOM   8904  C CD    . PRO E 3 137 ? 68.373  -35.629  16.865  1.00 66.85  ? 137 PRO E CD    1 
ATOM   8905  N N     . GLN E 3 138 ? 66.864  -36.360  20.217  1.00 70.40  ? 138 GLN E N     1 
ATOM   8906  C CA    . GLN E 3 138 ? 66.159  -37.025  21.321  1.00 72.35  ? 138 GLN E CA    1 
ATOM   8907  C C     . GLN E 3 138 ? 66.914  -36.927  22.647  1.00 72.23  ? 138 GLN E C     1 
ATOM   8908  O O     . GLN E 3 138 ? 66.306  -36.809  23.720  1.00 72.83  ? 138 GLN E O     1 
ATOM   8909  C CB    . GLN E 3 138 ? 65.929  -38.508  20.997  1.00 73.75  ? 138 GLN E CB    1 
ATOM   8910  C CG    . GLN E 3 138 ? 64.983  -38.792  19.827  1.00 75.82  ? 138 GLN E CG    1 
ATOM   8911  C CD    . GLN E 3 138 ? 65.689  -38.756  18.472  1.00 76.68  ? 138 GLN E CD    1 
ATOM   8912  O OE1   . GLN E 3 138 ? 66.350  -39.716  18.071  1.00 77.35  ? 138 GLN E OE1   1 
ATOM   8913  N NE2   . GLN E 3 138 ? 65.541  -37.646  17.762  1.00 76.54  ? 138 GLN E NE2   1 
ATOM   8914  N N     . SER E 3 139 ? 68.240  -36.979  22.553  1.00 71.39  ? 139 SER E N     1 
ATOM   8915  C CA    . SER E 3 139 ? 69.119  -36.914  23.711  1.00 71.53  ? 139 SER E CA    1 
ATOM   8916  C C     . SER E 3 139 ? 69.396  -35.502  24.244  1.00 70.54  ? 139 SER E C     1 
ATOM   8917  O O     . SER E 3 139 ? 70.223  -35.338  25.149  1.00 70.44  ? 139 SER E O     1 
ATOM   8918  C CB    . SER E 3 139 ? 70.431  -37.605  23.386  1.00 71.42  ? 139 SER E CB    1 
ATOM   8919  O OG    . SER E 3 139 ? 71.052  -36.969  22.290  1.00 71.21  ? 139 SER E OG    1 
ATOM   8920  N N     . TYR E 3 140 ? 68.727  -34.494  23.676  1.00 69.73  ? 140 TYR E N     1 
ATOM   8921  C CA    . TYR E 3 140 ? 68.685  -33.154  24.284  1.00 69.05  ? 140 TYR E CA    1 
ATOM   8922  C C     . TYR E 3 140 ? 67.332  -32.459  24.141  1.00 69.34  ? 140 TYR E C     1 
ATOM   8923  O O     . TYR E 3 140 ? 67.136  -31.343  24.617  1.00 69.14  ? 140 TYR E O     1 
ATOM   8924  C CB    . TYR E 3 140 ? 69.858  -32.257  23.833  1.00 67.94  ? 140 TYR E CB    1 
ATOM   8925  C CG    . TYR E 3 140 ? 70.090  -32.163  22.337  1.00 65.78  ? 140 TYR E CG    1 
ATOM   8926  C CD1   . TYR E 3 140 ? 69.454  -31.190  21.576  1.00 63.19  ? 140 TYR E CD1   1 
ATOM   8927  C CD2   . TYR E 3 140 ? 70.960  -33.035  21.697  1.00 63.84  ? 140 TYR E CD2   1 
ATOM   8928  C CE1   . TYR E 3 140 ? 69.655  -31.108  20.228  1.00 61.55  ? 140 TYR E CE1   1 
ATOM   8929  C CE2   . TYR E 3 140 ? 71.169  -32.952  20.349  1.00 62.60  ? 140 TYR E CE2   1 
ATOM   8930  C CZ    . TYR E 3 140 ? 70.512  -31.985  19.617  1.00 61.72  ? 140 TYR E CZ    1 
ATOM   8931  O OH    . TYR E 3 140 ? 70.714  -31.896  18.260  1.00 61.08  ? 140 TYR E OH    1 
ATOM   8932  N N     . LYS E 3 141 ? 66.405  -33.144  23.487  1.00 70.12  ? 141 LYS E N     1 
ATOM   8933  C CA    . LYS E 3 141 ? 64.970  -32.825  23.509  1.00 71.28  ? 141 LYS E CA    1 
ATOM   8934  C C     . LYS E 3 141 ? 64.480  -32.260  24.848  1.00 71.94  ? 141 LYS E C     1 
ATOM   8935  O O     . LYS E 3 141 ? 63.683  -31.321  24.877  1.00 72.44  ? 141 LYS E O     1 
ATOM   8936  C CB    . LYS E 3 141 ? 64.189  -34.116  23.228  1.00 72.61  ? 141 LYS E CB    1 
ATOM   8937  C CG    . LYS E 3 141 ? 62.758  -33.945  22.771  1.00 74.05  ? 141 LYS E CG    1 
ATOM   8938  C CD    . LYS E 3 141 ? 62.169  -35.300  22.377  1.00 76.44  ? 141 LYS E CD    1 
ATOM   8939  C CE    . LYS E 3 141 ? 61.405  -35.255  21.024  1.00 76.48  ? 141 LYS E CE    1 
ATOM   8940  N NZ    . LYS E 3 141 ? 60.075  -34.551  21.011  1.00 75.46  ? 141 LYS E NZ    1 
ATOM   8941  N N     . SER E 3 142 ? 64.965  -32.846  25.945  1.00 72.19  ? 142 SER E N     1 
ATOM   8942  C CA    . SER E 3 142 ? 64.461  -32.582  27.294  1.00 72.74  ? 142 SER E CA    1 
ATOM   8943  C C     . SER E 3 142 ? 65.069  -31.364  28.009  1.00 71.61  ? 142 SER E C     1 
ATOM   8944  O O     . SER E 3 142 ? 64.784  -31.121  29.179  1.00 72.29  ? 142 SER E O     1 
ATOM   8945  C CB    . SER E 3 142 ? 64.673  -33.830  28.159  1.00 74.16  ? 142 SER E CB    1 
ATOM   8946  O OG    . SER E 3 142 ? 64.070  -34.982  27.593  1.00 75.72  ? 142 SER E OG    1 
ATOM   8947  N N     . VAL E 3 143 ? 65.912  -30.606  27.319  1.00 69.70  ? 143 VAL E N     1 
ATOM   8948  C CA    . VAL E 3 143 ? 66.571  -29.456  27.934  1.00 68.57  ? 143 VAL E CA    1 
ATOM   8949  C C     . VAL E 3 143 ? 66.290  -28.186  27.147  1.00 67.46  ? 143 VAL E C     1 
ATOM   8950  O O     . VAL E 3 143 ? 66.233  -27.094  27.718  1.00 67.48  ? 143 VAL E O     1 
ATOM   8951  C CB    . VAL E 3 143 ? 68.113  -29.646  28.042  1.00 67.79  ? 143 VAL E CB    1 
ATOM   8952  C CG1   . VAL E 3 143 ? 68.733  -28.534  28.881  1.00 67.37  ? 143 VAL E CG1   1 
ATOM   8953  C CG2   . VAL E 3 143 ? 68.474  -31.005  28.627  1.00 68.40  ? 143 VAL E CG2   1 
ATOM   8954  N N     . VAL E 3 144 ? 66.117  -28.340  25.837  1.00 66.41  ? 144 VAL E N     1 
ATOM   8955  C CA    . VAL E 3 144 ? 65.998  -27.199  24.931  1.00 65.52  ? 144 VAL E CA    1 
ATOM   8956  C C     . VAL E 3 144 ? 64.540  -26.799  24.702  1.00 66.06  ? 144 VAL E C     1 
ATOM   8957  O O     . VAL E 3 144 ? 63.631  -27.498  25.141  1.00 67.41  ? 144 VAL E O     1 
ATOM   8958  C CB    . VAL E 3 144 ? 66.751  -27.447  23.587  1.00 64.59  ? 144 VAL E CB    1 
ATOM   8959  C CG1   . VAL E 3 144 ? 68.203  -27.924  23.855  1.00 63.79  ? 144 VAL E CG1   1 
ATOM   8960  C CG2   . VAL E 3 144 ? 66.021  -28.450  22.715  1.00 64.67  ? 144 VAL E CG2   1 
ATOM   8961  N N     . GLU E 3 145 ? 64.327  -25.659  24.050  1.00 65.17  ? 145 GLU E N     1 
ATOM   8962  C CA    . GLU E 3 145 ? 62.988  -25.213  23.635  1.00 65.40  ? 145 GLU E CA    1 
ATOM   8963  C C     . GLU E 3 145 ? 63.000  -25.096  22.127  1.00 64.63  ? 145 GLU E C     1 
ATOM   8964  O O     . GLU E 3 145 ? 63.958  -25.532  21.505  1.00 64.16  ? 145 GLU E O     1 
ATOM   8965  C CB    . GLU E 3 145 ? 62.654  -23.863  24.255  1.00 65.70  ? 145 GLU E CB    1 
ATOM   8966  C CG    . GLU E 3 145 ? 63.788  -22.851  24.209  1.00 64.00  ? 145 GLU E CG    1 
ATOM   8967  C CD    . GLU E 3 145 ? 63.429  -21.545  24.877  1.00 64.48  ? 145 GLU E CD    1 
ATOM   8968  O OE1   . GLU E 3 145 ? 62.383  -20.965  24.509  1.00 65.70  ? 145 GLU E OE1   1 
ATOM   8969  O OE2   . GLU E 3 145 ? 64.191  -21.097  25.764  1.00 63.59  ? 145 GLU E OE2   1 
ATOM   8970  N N     . ASN E 3 146 ? 61.963  -24.527  21.522  1.00 64.85  ? 146 ASN E N     1 
ATOM   8971  C CA    . ASN E 3 146 ? 62.067  -24.162  20.105  1.00 64.16  ? 146 ASN E CA    1 
ATOM   8972  C C     . ASN E 3 146 ? 62.849  -22.849  19.922  1.00 63.47  ? 146 ASN E C     1 
ATOM   8973  O O     . ASN E 3 146 ? 63.046  -22.101  20.888  1.00 64.11  ? 146 ASN E O     1 
ATOM   8974  C CB    . ASN E 3 146 ? 60.709  -24.182  19.390  1.00 64.82  ? 146 ASN E CB    1 
ATOM   8975  C CG    . ASN E 3 146 ? 60.362  -25.575  18.836  1.00 65.69  ? 146 ASN E CG    1 
ATOM   8976  O OD1   . ASN E 3 146 ? 61.021  -26.569  19.175  1.00 66.01  ? 146 ASN E OD1   1 
ATOM   8977  N ND2   . ASN E 3 146 ? 59.336  -25.650  17.972  1.00 64.44  ? 146 ASN E ND2   1 
ATOM   8978  N N     . VAL E 3 147 ? 63.335  -22.585  18.710  1.00 62.40  ? 147 VAL E N     1 
ATOM   8979  C CA    . VAL E 3 147 ? 64.349  -21.540  18.509  1.00 60.99  ? 147 VAL E CA    1 
ATOM   8980  C C     . VAL E 3 147 ? 64.103  -20.732  17.247  1.00 60.78  ? 147 VAL E C     1 
ATOM   8981  O O     . VAL E 3 147 ? 63.404  -21.192  16.346  1.00 61.66  ? 147 VAL E O     1 
ATOM   8982  C CB    . VAL E 3 147 ? 65.773  -22.144  18.408  1.00 60.06  ? 147 VAL E CB    1 
ATOM   8983  C CG1   . VAL E 3 147 ? 66.261  -22.655  19.764  1.00 59.89  ? 147 VAL E CG1   1 
ATOM   8984  C CG2   . VAL E 3 147 ? 65.819  -23.246  17.358  1.00 59.56  ? 147 VAL E CG2   1 
ATOM   8985  N N     . ASP E 3 148 ? 64.696  -19.539  17.180  1.00 59.85  ? 148 ASP E N     1 
ATOM   8986  C CA    . ASP E 3 148 ? 64.609  -18.670  16.003  1.00 59.12  ? 148 ASP E CA    1 
ATOM   8987  C C     . ASP E 3 148 ? 65.691  -18.992  14.967  1.00 58.09  ? 148 ASP E C     1 
ATOM   8988  O O     . ASP E 3 148 ? 65.444  -18.999  13.758  1.00 58.22  ? 148 ASP E O     1 
ATOM   8989  C CB    . ASP E 3 148 ? 64.760  -17.222  16.430  1.00 59.23  ? 148 ASP E CB    1 
ATOM   8990  C CG    . ASP E 3 148 ? 63.839  -16.851  17.561  1.00 60.39  ? 148 ASP E CG    1 
ATOM   8991  O OD1   . ASP E 3 148 ? 62.604  -17.002  17.400  1.00 61.88  ? 148 ASP E OD1   1 
ATOM   8992  O OD2   . ASP E 3 148 ? 64.356  -16.396  18.608  1.00 60.40  ? 148 ASP E OD2   1 
ATOM   8993  N N     . VAL E 3 149 ? 66.896  -19.261  15.455  1.00 57.01  ? 149 VAL E N     1 
ATOM   8994  C CA    . VAL E 3 149 ? 68.021  -19.580  14.593  1.00 55.76  ? 149 VAL E CA    1 
ATOM   8995  C C     . VAL E 3 149 ? 68.624  -20.959  14.893  1.00 55.35  ? 149 VAL E C     1 
ATOM   8996  O O     . VAL E 3 149 ? 68.872  -21.319  16.053  1.00 54.91  ? 149 VAL E O     1 
ATOM   8997  C CB    . VAL E 3 149 ? 69.114  -18.481  14.673  1.00 55.14  ? 149 VAL E CB    1 
ATOM   8998  C CG1   . VAL E 3 149 ? 70.347  -18.870  13.869  1.00 53.66  ? 149 VAL E CG1   1 
ATOM   8999  C CG2   . VAL E 3 149 ? 68.559  -17.146  14.210  1.00 55.43  ? 149 VAL E CG2   1 
ATOM   9000  N N     . LEU E 3 150 ? 68.849  -21.713  13.822  1.00 55.15  ? 150 LEU E N     1 
ATOM   9001  C CA    . LEU E 3 150 ? 69.577  -22.969  13.871  1.00 54.95  ? 150 LEU E CA    1 
ATOM   9002  C C     . LEU E 3 150 ? 70.951  -22.721  13.244  1.00 54.87  ? 150 LEU E C     1 
ATOM   9003  O O     . LEU E 3 150 ? 71.101  -22.735  12.025  1.00 54.99  ? 150 LEU E O     1 
ATOM   9004  C CB    . LEU E 3 150 ? 68.823  -24.030  13.070  1.00 54.81  ? 150 LEU E CB    1 
ATOM   9005  C CG    . LEU E 3 150 ? 68.783  -25.482  13.528  1.00 54.10  ? 150 LEU E CG    1 
ATOM   9006  C CD1   . LEU E 3 150 ? 68.776  -26.360  12.313  1.00 53.05  ? 150 LEU E CD1   1 
ATOM   9007  C CD2   . LEU E 3 150 ? 69.939  -25.850  14.423  1.00 52.71  ? 150 LEU E CD2   1 
ATOM   9008  N N     . TYR E 3 151 ? 71.954  -22.459  14.067  1.00 55.05  ? 151 TYR E N     1 
ATOM   9009  C CA    . TYR E 3 151 ? 73.276  -22.201  13.538  1.00 55.15  ? 151 TYR E CA    1 
ATOM   9010  C C     . TYR E 3 151 ? 74.040  -23.504  13.547  1.00 55.39  ? 151 TYR E C     1 
ATOM   9011  O O     . TYR E 3 151 ? 74.289  -24.081  14.609  1.00 56.18  ? 151 TYR E O     1 
ATOM   9012  C CB    . TYR E 3 151 ? 73.990  -21.130  14.357  1.00 55.14  ? 151 TYR E CB    1 
ATOM   9013  C CG    . TYR E 3 151 ? 75.334  -20.754  13.794  1.00 56.35  ? 151 TYR E CG    1 
ATOM   9014  C CD1   . TYR E 3 151 ? 75.478  -19.674  12.921  1.00 57.53  ? 151 TYR E CD1   1 
ATOM   9015  C CD2   . TYR E 3 151 ? 76.468  -21.494  14.118  1.00 58.12  ? 151 TYR E CD2   1 
ATOM   9016  C CE1   . TYR E 3 151 ? 76.725  -19.339  12.389  1.00 57.77  ? 151 TYR E CE1   1 
ATOM   9017  C CE2   . TYR E 3 151 ? 77.710  -21.172  13.589  1.00 58.61  ? 151 TYR E CE2   1 
ATOM   9018  C CZ    . TYR E 3 151 ? 77.832  -20.098  12.736  1.00 58.05  ? 151 TYR E CZ    1 
ATOM   9019  O OH    . TYR E 3 151 ? 79.079  -19.821  12.245  1.00 58.84  ? 151 TYR E OH    1 
ATOM   9020  N N     . VAL E 3 152 ? 74.410  -23.975  12.363  1.00 55.55  ? 152 VAL E N     1 
ATOM   9021  C CA    . VAL E 3 152 ? 74.969  -25.318  12.216  1.00 55.66  ? 152 VAL E CA    1 
ATOM   9022  C C     . VAL E 3 152 ? 76.367  -25.302  11.597  1.00 55.37  ? 152 VAL E C     1 
ATOM   9023  O O     . VAL E 3 152 ? 76.527  -25.036  10.409  1.00 55.37  ? 152 VAL E O     1 
ATOM   9024  C CB    . VAL E 3 152 ? 74.022  -26.228  11.395  1.00 55.95  ? 152 VAL E CB    1 
ATOM   9025  C CG1   . VAL E 3 152 ? 74.625  -27.600  11.205  1.00 56.85  ? 152 VAL E CG1   1 
ATOM   9026  C CG2   . VAL E 3 152 ? 72.692  -26.361  12.090  1.00 56.35  ? 152 VAL E CG2   1 
ATOM   9027  N N     . ASP E 3 153 ? 77.370  -25.581  12.423  1.00 55.50  ? 153 ASP E N     1 
ATOM   9028  C CA    . ASP E 3 153 ? 78.748  -25.750  11.967  1.00 55.56  ? 153 ASP E CA    1 
ATOM   9029  C C     . ASP E 3 153 ? 79.309  -27.080  12.466  1.00 55.86  ? 153 ASP E C     1 
ATOM   9030  O O     . ASP E 3 153 ? 80.105  -27.104  13.409  1.00 55.98  ? 153 ASP E O     1 
ATOM   9031  C CB    . ASP E 3 153 ? 79.644  -24.589  12.446  1.00 55.30  ? 153 ASP E CB    1 
ATOM   9032  C CG    . ASP E 3 153 ? 81.016  -24.546  11.725  1.00 55.74  ? 153 ASP E CG    1 
ATOM   9033  O OD1   . ASP E 3 153 ? 81.214  -25.292  10.745  1.00 54.92  ? 153 ASP E OD1   1 
ATOM   9034  O OD2   . ASP E 3 153 ? 81.898  -23.747  12.127  1.00 56.46  ? 153 ASP E OD2   1 
ATOM   9035  N N     . ILE E 3 154 ? 78.906  -28.178  11.830  1.00 56.15  ? 154 ILE E N     1 
ATOM   9036  C CA    . ILE E 3 154 ? 79.381  -29.495  12.242  1.00 56.69  ? 154 ILE E CA    1 
ATOM   9037  C C     . ILE E 3 154 ? 80.136  -30.259  11.162  1.00 57.18  ? 154 ILE E C     1 
ATOM   9038  O O     . ILE E 3 154 ? 79.686  -30.375  10.010  1.00 57.31  ? 154 ILE E O     1 
ATOM   9039  C CB    . ILE E 3 154 ? 78.238  -30.392  12.798  1.00 57.31  ? 154 ILE E CB    1 
ATOM   9040  C CG1   . ILE E 3 154 ? 76.957  -30.245  11.978  1.00 56.93  ? 154 ILE E CG1   1 
ATOM   9041  C CG2   . ILE E 3 154 ? 77.967  -30.083  14.261  1.00 57.30  ? 154 ILE E CG2   1 
ATOM   9042  C CD1   . ILE E 3 154 ? 76.130  -31.499  11.979  1.00 58.03  ? 154 ILE E CD1   1 
ATOM   9043  N N     . ALA E 3 155 ? 81.282  -30.796  11.557  1.00 57.60  ? 155 ALA E N     1 
ATOM   9044  C CA    . ALA E 3 155 ? 82.106  -31.560  10.648  1.00 58.36  ? 155 ALA E CA    1 
ATOM   9045  C C     . ALA E 3 155 ? 81.555  -32.973  10.554  1.00 59.25  ? 155 ALA E C     1 
ATOM   9046  O O     . ALA E 3 155 ? 81.783  -33.791  11.447  1.00 59.63  ? 155 ALA E O     1 
ATOM   9047  C CB    . ALA E 3 155 ? 83.554  -31.551  11.121  1.00 58.46  ? 155 ALA E CB    1 
ATOM   9048  N N     . GLN E 3 156 ? 80.805  -33.230  9.478   1.00 60.09  ? 156 GLN E N     1 
ATOM   9049  C CA    . GLN E 3 156 ? 80.108  -34.519  9.216   1.00 61.09  ? 156 GLN E CA    1 
ATOM   9050  C C     . GLN E 3 156 ? 79.735  -34.656  7.742   1.00 61.19  ? 156 GLN E C     1 
ATOM   9051  O O     . GLN E 3 156 ? 79.241  -33.707  7.145   1.00 60.80  ? 156 GLN E O     1 
ATOM   9052  C CB    . GLN E 3 156 ? 78.814  -34.625  10.031  1.00 61.21  ? 156 GLN E CB    1 
ATOM   9053  C CG    . GLN E 3 156 ? 78.995  -34.909  11.504  1.00 62.41  ? 156 GLN E CG    1 
ATOM   9054  C CD    . GLN E 3 156 ? 79.327  -36.348  11.777  1.00 65.04  ? 156 GLN E CD    1 
ATOM   9055  O OE1   . GLN E 3 156 ? 78.723  -37.250  11.207  1.00 68.16  ? 156 GLN E OE1   1 
ATOM   9056  N NE2   . GLN E 3 156 ? 80.281  -36.576  12.659  1.00 66.38  ? 156 GLN E NE2   1 
ATOM   9057  N N     . PRO E 3 157 ? 79.943  -35.841  7.147   1.00 62.09  ? 157 PRO E N     1 
ATOM   9058  C CA    . PRO E 3 157 ? 79.558  -35.997  5.741   1.00 62.81  ? 157 PRO E CA    1 
ATOM   9059  C C     . PRO E 3 157 ? 78.071  -35.743  5.508   1.00 63.19  ? 157 PRO E C     1 
ATOM   9060  O O     . PRO E 3 157 ? 77.695  -35.136  4.511   1.00 63.40  ? 157 PRO E O     1 
ATOM   9061  C CB    . PRO E 3 157 ? 79.913  -37.454  5.423   1.00 63.37  ? 157 PRO E CB    1 
ATOM   9062  C CG    . PRO E 3 157 ? 80.159  -38.099  6.721   1.00 63.36  ? 157 PRO E CG    1 
ATOM   9063  C CD    . PRO E 3 157 ? 80.599  -37.048  7.670   1.00 62.81  ? 157 PRO E CD    1 
ATOM   9064  N N     . ASP E 3 158 ? 77.239  -36.189  6.437   1.00 63.80  ? 158 ASP E N     1 
ATOM   9065  C CA    . ASP E 3 158 ? 75.800  -36.012  6.325   1.00 64.25  ? 158 ASP E CA    1 
ATOM   9066  C C     . ASP E 3 158 ? 75.332  -34.830  7.165   1.00 63.16  ? 158 ASP E C     1 
ATOM   9067  O O     . ASP E 3 158 ? 74.220  -34.853  7.695   1.00 63.23  ? 158 ASP E O     1 
ATOM   9068  C CB    . ASP E 3 158 ? 75.078  -37.295  6.745   1.00 65.53  ? 158 ASP E CB    1 
ATOM   9069  C CG    . ASP E 3 158 ? 75.429  -37.742  8.181   1.00 67.92  ? 158 ASP E CG    1 
ATOM   9070  O OD1   . ASP E 3 158 ? 76.526  -37.389  8.696   1.00 68.23  ? 158 ASP E OD1   1 
ATOM   9071  O OD2   . ASP E 3 158 ? 74.594  -38.460  8.801   1.00 71.43  ? 158 ASP E OD2   1 
ATOM   9072  N N     . GLN E 3 159 ? 76.188  -33.806  7.266   1.00 62.12  ? 159 GLN E N     1 
ATOM   9073  C CA    . GLN E 3 159 ? 75.935  -32.589  8.056   1.00 61.08  ? 159 GLN E CA    1 
ATOM   9074  C C     . GLN E 3 159 ? 74.651  -31.877  7.690   1.00 60.75  ? 159 GLN E C     1 
ATOM   9075  O O     . GLN E 3 159 ? 73.992  -31.324  8.569   1.00 60.43  ? 159 GLN E O     1 
ATOM   9076  C CB    . GLN E 3 159 ? 77.085  -31.593  7.901   1.00 60.84  ? 159 GLN E CB    1 
ATOM   9077  C CG    . GLN E 3 159 ? 77.368  -31.217  6.439   1.00 62.26  ? 159 GLN E CG    1 
ATOM   9078  C CD    . GLN E 3 159 ? 78.188  -29.965  6.284   1.00 62.15  ? 159 GLN E CD    1 
ATOM   9079  O OE1   . GLN E 3 159 ? 77.665  -28.920  5.895   1.00 62.45  ? 159 GLN E OE1   1 
ATOM   9080  N NE2   . GLN E 3 159 ? 79.480  -30.061  6.574   1.00 62.19  ? 159 GLN E NE2   1 
ATOM   9081  N N     . THR E 3 160 ? 74.310  -31.872  6.397   1.00 60.92  ? 160 THR E N     1 
ATOM   9082  C CA    . THR E 3 160 ? 73.096  -31.197  5.927   1.00 60.96  ? 160 THR E CA    1 
ATOM   9083  C C     . THR E 3 160 ? 71.851  -31.918  6.419   1.00 61.57  ? 160 THR E C     1 
ATOM   9084  O O     . THR E 3 160 ? 70.946  -31.273  6.953   1.00 61.72  ? 160 THR E O     1 
ATOM   9085  C CB    . THR E 3 160 ? 73.061  -31.017  4.392   1.00 61.20  ? 160 THR E CB    1 
ATOM   9086  O OG1   . THR E 3 160 ? 74.224  -30.300  3.976   1.00 60.92  ? 160 THR E OG1   1 
ATOM   9087  C CG2   . THR E 3 160 ? 71.833  -30.227  3.963   1.00 60.59  ? 160 THR E CG2   1 
ATOM   9088  N N     . ASP E 3 161 ? 71.823  -33.244  6.251   1.00 62.11  ? 161 ASP E N     1 
ATOM   9089  C CA    . ASP E 3 161 ? 70.734  -34.089  6.764   1.00 62.79  ? 161 ASP E CA    1 
ATOM   9090  C C     . ASP E 3 161 ? 70.541  -33.907  8.281   1.00 61.90  ? 161 ASP E C     1 
ATOM   9091  O O     . ASP E 3 161 ? 69.427  -33.623  8.727   1.00 62.28  ? 161 ASP E O     1 
ATOM   9092  C CB    . ASP E 3 161 ? 70.960  -35.569  6.408   1.00 63.97  ? 161 ASP E CB    1 
ATOM   9093  C CG    . ASP E 3 161 ? 71.100  -35.804  4.895   1.00 66.29  ? 161 ASP E CG    1 
ATOM   9094  O OD1   . ASP E 3 161 ? 70.099  -36.196  4.253   1.00 68.41  ? 161 ASP E OD1   1 
ATOM   9095  O OD2   . ASP E 3 161 ? 72.209  -35.592  4.340   1.00 67.71  ? 161 ASP E OD2   1 
ATOM   9096  N N     . ILE E 3 162 ? 71.625  -34.040  9.050   1.00 60.43  ? 162 ILE E N     1 
ATOM   9097  C CA    . ILE E 3 162 ? 71.614  -33.763  10.482  1.00 59.61  ? 162 ILE E CA    1 
ATOM   9098  C C     . ILE E 3 162 ? 70.943  -32.433  10.782  1.00 59.40  ? 162 ILE E C     1 
ATOM   9099  O O     . ILE E 3 162 ? 70.074  -32.348  11.644  1.00 59.96  ? 162 ILE E O     1 
ATOM   9100  C CB    . ILE E 3 162 ? 73.037  -33.760  11.080  1.00 58.94  ? 162 ILE E CB    1 
ATOM   9101  C CG1   . ILE E 3 162 ? 73.706  -35.117  10.851  1.00 59.73  ? 162 ILE E CG1   1 
ATOM   9102  C CG2   . ILE E 3 162 ? 73.008  -33.401  12.578  1.00 58.38  ? 162 ILE E CG2   1 
ATOM   9103  C CD1   . ILE E 3 162 ? 75.227  -35.137  11.009  1.00 59.02  ? 162 ILE E CD1   1 
ATOM   9104  N N     . ALA E 3 163 ? 71.349  -31.388  10.074  1.00 59.20  ? 163 ALA E N     1 
ATOM   9105  C CA    . ALA E 3 163 ? 70.793  -30.060  10.304  1.00 59.23  ? 163 ALA E CA    1 
ATOM   9106  C C     . ALA E 3 163 ? 69.268  -30.043  10.114  1.00 60.01  ? 163 ALA E C     1 
ATOM   9107  O O     . ALA E 3 163 ? 68.545  -29.524  10.961  1.00 60.11  ? 163 ALA E O     1 
ATOM   9108  C CB    . ALA E 3 163 ? 71.482  -29.027  9.409   1.00 58.62  ? 163 ALA E CB    1 
ATOM   9109  N N     . ILE E 3 164 ? 68.796  -30.639  9.017   1.00 60.78  ? 164 ILE E N     1 
ATOM   9110  C CA    . ILE E 3 164 ? 67.372  -30.667  8.674   1.00 61.85  ? 164 ILE E CA    1 
ATOM   9111  C C     . ILE E 3 164 ? 66.586  -31.371  9.781   1.00 62.55  ? 164 ILE E C     1 
ATOM   9112  O O     . ILE E 3 164 ? 65.513  -30.917  10.192  1.00 62.75  ? 164 ILE E O     1 
ATOM   9113  C CB    . ILE E 3 164 ? 67.125  -31.357  7.290   1.00 62.51  ? 164 ILE E CB    1 
ATOM   9114  C CG1   . ILE E 3 164 ? 67.822  -30.590  6.166   1.00 62.04  ? 164 ILE E CG1   1 
ATOM   9115  C CG2   . ILE E 3 164 ? 65.629  -31.450  6.971   1.00 63.42  ? 164 ILE E CG2   1 
ATOM   9116  C CD1   . ILE E 3 164 ? 67.945  -31.363  4.882   1.00 62.25  ? 164 ILE E CD1   1 
ATOM   9117  N N     . TYR E 3 165 ? 67.155  -32.474  10.260  1.00 62.92  ? 165 TYR E N     1 
ATOM   9118  C CA    . TYR E 3 165 ? 66.567  -33.298  11.308  1.00 63.74  ? 165 TYR E CA    1 
ATOM   9119  C C     . TYR E 3 165 ? 66.357  -32.469  12.571  1.00 63.23  ? 165 TYR E C     1 
ATOM   9120  O O     . TYR E 3 165 ? 65.256  -32.452  13.124  1.00 64.18  ? 165 TYR E O     1 
ATOM   9121  C CB    . TYR E 3 165 ? 67.456  -34.523  11.570  1.00 63.99  ? 165 TYR E CB    1 
ATOM   9122  C CG    . TYR E 3 165 ? 66.761  -35.697  12.223  1.00 66.92  ? 165 TYR E CG    1 
ATOM   9123  C CD1   . TYR E 3 165 ? 65.579  -36.228  11.696  1.00 69.89  ? 165 TYR E CD1   1 
ATOM   9124  C CD2   . TYR E 3 165 ? 67.297  -36.296  13.356  1.00 68.76  ? 165 TYR E CD2   1 
ATOM   9125  C CE1   . TYR E 3 165 ? 64.945  -37.310  12.299  1.00 71.88  ? 165 TYR E CE1   1 
ATOM   9126  C CE2   . TYR E 3 165 ? 66.675  -37.373  13.965  1.00 70.47  ? 165 TYR E CE2   1 
ATOM   9127  C CZ    . TYR E 3 165 ? 65.505  -37.876  13.437  1.00 72.54  ? 165 TYR E CZ    1 
ATOM   9128  O OH    . TYR E 3 165 ? 64.903  -38.955  14.053  1.00 76.29  ? 165 TYR E OH    1 
ATOM   9129  N N     . ASN E 3 166 ? 67.397  -31.763  13.007  1.00 61.80  ? 166 ASN E N     1 
ATOM   9130  C CA    . ASN E 3 166 ? 67.266  -30.844  14.118  1.00 61.18  ? 166 ASN E CA    1 
ATOM   9131  C C     . ASN E 3 166 ? 66.252  -29.760  13.846  1.00 61.24  ? 166 ASN E C     1 
ATOM   9132  O O     . ASN E 3 166 ? 65.570  -29.290  14.758  1.00 61.84  ? 166 ASN E O     1 
ATOM   9133  C CB    . ASN E 3 166 ? 68.595  -30.187  14.424  1.00 60.35  ? 166 ASN E CB    1 
ATOM   9134  C CG    . ASN E 3 166 ? 69.424  -30.999  15.349  1.00 60.51  ? 166 ASN E CG    1 
ATOM   9135  O OD1   . ASN E 3 166 ? 69.342  -30.837  16.572  1.00 59.80  ? 166 ASN E OD1   1 
ATOM   9136  N ND2   . ASN E 3 166 ? 70.230  -31.900  14.785  1.00 60.34  ? 166 ASN E ND2   1 
ATOM   9137  N N     . ALA E 3 167 ? 66.161  -29.352  12.588  1.00 61.00  ? 167 ALA E N     1 
ATOM   9138  C CA    . ALA E 3 167 ? 65.303  -28.236  12.221  1.00 61.18  ? 167 ALA E CA    1 
ATOM   9139  C C     . ALA E 3 167 ? 63.846  -28.566  12.518  1.00 62.05  ? 167 ALA E C     1 
ATOM   9140  O O     . ALA E 3 167 ? 63.193  -27.835  13.262  1.00 62.07  ? 167 ALA E O     1 
ATOM   9141  C CB    . ALA E 3 167 ? 65.506  -27.852  10.759  1.00 60.96  ? 167 ALA E CB    1 
ATOM   9142  N N     . LYS E 3 168 ? 63.366  -29.688  11.974  1.00 62.62  ? 168 LYS E N     1 
ATOM   9143  C CA    . LYS E 3 168 ? 61.989  -30.152  12.208  1.00 63.58  ? 168 LYS E CA    1 
ATOM   9144  C C     . LYS E 3 168 ? 61.696  -30.528  13.662  1.00 64.18  ? 168 LYS E C     1 
ATOM   9145  O O     . LYS E 3 168 ? 60.540  -30.652  14.046  1.00 65.17  ? 168 LYS E O     1 
ATOM   9146  C CB    . LYS E 3 168 ? 61.582  -31.275  11.240  1.00 63.94  ? 168 LYS E CB    1 
ATOM   9147  C CG    . LYS E 3 168 ? 62.565  -32.411  11.122  1.00 62.66  ? 168 LYS E CG    1 
ATOM   9148  C CD    . LYS E 3 168 ? 62.112  -33.417  10.087  1.00 61.66  ? 168 LYS E CD    1 
ATOM   9149  C CE    . LYS E 3 168 ? 62.343  -32.954  8.675   1.00 60.65  ? 168 LYS E CE    1 
ATOM   9150  N NZ    . LYS E 3 168 ? 61.965  -34.019  7.728   1.00 61.58  ? 168 LYS E NZ    1 
ATOM   9151  N N     . PHE E 3 169 ? 62.740  -30.688  14.465  1.00 64.00  ? 169 PHE E N     1 
ATOM   9152  C CA    . PHE E 3 169 ? 62.573  -30.750  15.913  1.00 64.95  ? 169 PHE E CA    1 
ATOM   9153  C C     . PHE E 3 169 ? 62.422  -29.371  16.538  1.00 65.11  ? 169 PHE E C     1 
ATOM   9154  O O     . PHE E 3 169 ? 61.384  -29.077  17.146  1.00 66.48  ? 169 PHE E O     1 
ATOM   9155  C CB    . PHE E 3 169 ? 63.734  -31.481  16.580  1.00 64.42  ? 169 PHE E CB    1 
ATOM   9156  C CG    . PHE E 3 169 ? 63.534  -32.951  16.683  1.00 65.35  ? 169 PHE E CG    1 
ATOM   9157  C CD1   . PHE E 3 169 ? 63.973  -33.800  15.669  1.00 65.82  ? 169 PHE E CD1   1 
ATOM   9158  C CD2   . PHE E 3 169 ? 62.897  -33.495  17.785  1.00 66.17  ? 169 PHE E CD2   1 
ATOM   9159  C CE1   . PHE E 3 169 ? 63.782  -35.178  15.760  1.00 66.86  ? 169 PHE E CE1   1 
ATOM   9160  C CE2   . PHE E 3 169 ? 62.699  -34.867  17.882  1.00 67.48  ? 169 PHE E CE2   1 
ATOM   9161  C CZ    . PHE E 3 169 ? 63.141  -35.708  16.872  1.00 67.45  ? 169 PHE E CZ    1 
ATOM   9162  N N     . PHE E 3 170 ? 63.435  -28.523  16.360  1.00 64.13  ? 170 PHE E N     1 
ATOM   9163  C CA    . PHE E 3 170 ? 63.575  -27.313  17.173  1.00 64.27  ? 170 PHE E CA    1 
ATOM   9164  C C     . PHE E 3 170 ? 63.421  -25.942  16.482  1.00 63.82  ? 170 PHE E C     1 
ATOM   9165  O O     . PHE E 3 170 ? 63.312  -24.916  17.147  1.00 63.36  ? 170 PHE E O     1 
ATOM   9166  C CB    . PHE E 3 170 ? 64.907  -27.371  17.916  1.00 63.81  ? 170 PHE E CB    1 
ATOM   9167  C CG    . PHE E 3 170 ? 65.152  -28.673  18.611  1.00 65.16  ? 170 PHE E CG    1 
ATOM   9168  C CD1   . PHE E 3 170 ? 66.155  -29.520  18.188  1.00 66.71  ? 170 PHE E CD1   1 
ATOM   9169  C CD2   . PHE E 3 170 ? 64.382  -29.055  19.691  1.00 67.56  ? 170 PHE E CD2   1 
ATOM   9170  C CE1   . PHE E 3 170 ? 66.392  -30.739  18.846  1.00 67.80  ? 170 PHE E CE1   1 
ATOM   9171  C CE2   . PHE E 3 170 ? 64.610  -30.274  20.347  1.00 68.71  ? 170 PHE E CE2   1 
ATOM   9172  C CZ    . PHE E 3 170 ? 65.613  -31.111  19.920  1.00 68.05  ? 170 PHE E CZ    1 
ATOM   9173  N N     . LEU E 3 171 ? 63.407  -25.917  15.159  1.00 63.89  ? 171 LEU E N     1 
ATOM   9174  C CA    . LEU E 3 171 ? 63.359  -24.643  14.445  1.00 64.08  ? 171 LEU E CA    1 
ATOM   9175  C C     . LEU E 3 171 ? 61.925  -24.138  14.188  1.00 65.23  ? 171 LEU E C     1 
ATOM   9176  O O     . LEU E 3 171 ? 61.162  -24.760  13.449  1.00 65.67  ? 171 LEU E O     1 
ATOM   9177  C CB    . LEU E 3 171 ? 64.160  -24.749  13.136  1.00 63.53  ? 171 LEU E CB    1 
ATOM   9178  C CG    . LEU E 3 171 ? 64.921  -23.545  12.564  1.00 62.71  ? 171 LEU E CG    1 
ATOM   9179  C CD1   . LEU E 3 171 ? 64.211  -22.972  11.373  1.00 62.65  ? 171 LEU E CD1   1 
ATOM   9180  C CD2   . LEU E 3 171 ? 65.203  -22.456  13.611  1.00 63.09  ? 171 LEU E CD2   1 
ATOM   9181  N N     . LYS E 3 172 ? 61.572  -23.008  14.805  1.00 65.76  ? 172 LYS E N     1 
ATOM   9182  C CA    . LYS E 3 172 ? 60.281  -22.363  14.595  1.00 67.16  ? 172 LYS E CA    1 
ATOM   9183  C C     . LYS E 3 172 ? 59.990  -22.252  13.111  1.00 68.04  ? 172 LYS E C     1 
ATOM   9184  O O     . LYS E 3 172 ? 60.908  -22.109  12.304  1.00 67.51  ? 172 LYS E O     1 
ATOM   9185  C CB    . LYS E 3 172 ? 60.281  -20.963  15.198  1.00 66.95  ? 172 LYS E CB    1 
ATOM   9186  C CG    . LYS E 3 172 ? 60.142  -20.922  16.702  1.00 67.91  ? 172 LYS E CG    1 
ATOM   9187  C CD    . LYS E 3 172 ? 60.166  -19.487  17.250  1.00 68.66  ? 172 LYS E CD    1 
ATOM   9188  C CE    . LYS E 3 172 ? 59.871  -19.463  18.751  1.00 69.99  ? 172 LYS E CE    1 
ATOM   9189  N NZ    . LYS E 3 172 ? 60.561  -18.356  19.462  1.00 69.76  ? 172 LYS E NZ    1 
ATOM   9190  N N     . VAL E 3 173 ? 58.718  -22.334  12.736  1.00 70.06  ? 173 VAL E N     1 
ATOM   9191  C CA    . VAL E 3 173 ? 58.337  -22.060  11.348  1.00 71.02  ? 173 VAL E CA    1 
ATOM   9192  C C     . VAL E 3 173 ? 58.577  -20.580  11.088  1.00 71.24  ? 173 VAL E C     1 
ATOM   9193  O O     . VAL E 3 173 ? 58.262  -19.744  11.928  1.00 71.66  ? 173 VAL E O     1 
ATOM   9194  C CB    . VAL E 3 173 ? 56.887  -22.444  11.039  1.00 72.33  ? 173 VAL E CB    1 
ATOM   9195  C CG1   . VAL E 3 173 ? 56.514  -22.006  9.637   1.00 72.79  ? 173 VAL E CG1   1 
ATOM   9196  C CG2   . VAL E 3 173 ? 56.703  -23.947  11.179  1.00 72.93  ? 173 VAL E CG2   1 
ATOM   9197  N N     . ASN E 3 174 ? 59.155  -20.281  9.928   1.00 71.48  ? 174 ASN E N     1 
ATOM   9198  C CA    . ASN E 3 174 ? 59.691  -18.949  9.600   1.00 71.72  ? 174 ASN E CA    1 
ATOM   9199  C C     . ASN E 3 174 ? 60.956  -18.563  10.364  1.00 70.65  ? 174 ASN E C     1 
ATOM   9200  O O     . ASN E 3 174 ? 61.375  -17.402  10.349  1.00 71.07  ? 174 ASN E O     1 
ATOM   9201  C CB    . ASN E 3 174 ? 58.630  -17.851  9.696   1.00 72.88  ? 174 ASN E CB    1 
ATOM   9202  C CG    . ASN E 3 174 ? 58.017  -17.537  8.358   1.00 74.86  ? 174 ASN E CG    1 
ATOM   9203  O OD1   . ASN E 3 174 ? 57.930  -16.373  7.965   1.00 76.85  ? 174 ASN E OD1   1 
ATOM   9204  N ND2   . ASN E 3 174 ? 57.607  -18.579  7.631   1.00 76.00  ? 174 ASN E ND2   1 
ATOM   9205  N N     . GLY E 3 175 ? 61.567  -19.539  11.024  1.00 69.67  ? 175 GLY E N     1 
ATOM   9206  C CA    . GLY E 3 175 ? 62.847  -19.323  11.668  1.00 68.18  ? 175 GLY E CA    1 
ATOM   9207  C C     . GLY E 3 175 ? 63.921  -19.447  10.616  1.00 67.36  ? 175 GLY E C     1 
ATOM   9208  O O     . GLY E 3 175 ? 63.651  -19.889  9.486   1.00 67.53  ? 175 GLY E O     1 
ATOM   9209  N N     . ASP E 3 176 ? 65.141  -19.071  10.991  1.00 66.34  ? 176 ASP E N     1 
ATOM   9210  C CA    . ASP E 3 176 ? 66.263  -19.056  10.059  1.00 65.26  ? 176 ASP E CA    1 
ATOM   9211  C C     . ASP E 3 176 ? 67.326  -20.083  10.412  1.00 63.49  ? 176 ASP E C     1 
ATOM   9212  O O     . ASP E 3 176 ? 67.535  -20.388  11.583  1.00 63.16  ? 176 ASP E O     1 
ATOM   9213  C CB    . ASP E 3 176 ? 66.860  -17.653  9.985   1.00 65.60  ? 176 ASP E CB    1 
ATOM   9214  C CG    . ASP E 3 176 ? 65.876  -16.639  9.436   1.00 68.65  ? 176 ASP E CG    1 
ATOM   9215  O OD1   . ASP E 3 176 ? 66.148  -16.056  8.358   1.00 72.00  ? 176 ASP E OD1   1 
ATOM   9216  O OD2   . ASP E 3 176 ? 64.815  -16.445  10.074  1.00 71.52  ? 176 ASP E OD2   1 
ATOM   9217  N N     . MET E 3 177 ? 67.976  -20.619  9.381   1.00 62.26  ? 177 MET E N     1 
ATOM   9218  C CA    . MET E 3 177 ? 69.086  -21.558  9.543   1.00 60.77  ? 177 MET E CA    1 
ATOM   9219  C C     . MET E 3 177 ? 70.359  -21.061  8.840   1.00 59.66  ? 177 MET E C     1 
ATOM   9220  O O     . MET E 3 177 ? 70.382  -20.839  7.618   1.00 59.93  ? 177 MET E O     1 
ATOM   9221  C CB    . MET E 3 177 ? 68.702  -22.952  9.036   1.00 61.03  ? 177 MET E CB    1 
ATOM   9222  C CG    . MET E 3 177 ? 69.784  -24.003  9.237   1.00 61.13  ? 177 MET E CG    1 
ATOM   9223  S SD    . MET E 3 177 ? 69.390  -25.703  8.727   1.00 63.08  ? 177 MET E SD    1 
ATOM   9224  C CE    . MET E 3 177 ? 69.431  -25.570  6.957   1.00 64.27  ? 177 MET E CE    1 
ATOM   9225  N N     . LEU E 3 178 ? 71.408  -20.869  9.630   1.00 57.97  ? 178 LEU E N     1 
ATOM   9226  C CA    . LEU E 3 178 ? 72.718  -20.596  9.092   1.00 56.57  ? 178 LEU E CA    1 
ATOM   9227  C C     . LEU E 3 178 ? 73.487  -21.920  9.079   1.00 55.61  ? 178 LEU E C     1 
ATOM   9228  O O     . LEU E 3 178 ? 73.824  -22.459  10.128  1.00 55.59  ? 178 LEU E O     1 
ATOM   9229  C CB    . LEU E 3 178 ? 73.416  -19.513  9.920   1.00 56.28  ? 178 LEU E CB    1 
ATOM   9230  C CG    . LEU E 3 178 ? 72.885  -18.083  9.735   1.00 57.18  ? 178 LEU E CG    1 
ATOM   9231  C CD1   . LEU E 3 178 ? 73.270  -17.176  10.899  1.00 56.76  ? 178 LEU E CD1   1 
ATOM   9232  C CD2   . LEU E 3 178 ? 73.370  -17.479  8.410   1.00 58.39  ? 178 LEU E CD2   1 
ATOM   9233  N N     . LEU E 3 179 ? 73.727  -22.459  7.887   1.00 54.80  ? 179 LEU E N     1 
ATOM   9234  C CA    . LEU E 3 179 ? 74.338  -23.777  7.730   1.00 53.74  ? 179 LEU E CA    1 
ATOM   9235  C C     . LEU E 3 179 ? 75.699  -23.642  7.093   1.00 53.10  ? 179 LEU E C     1 
ATOM   9236  O O     . LEU E 3 179 ? 75.791  -23.218  5.937   1.00 54.15  ? 179 LEU E O     1 
ATOM   9237  C CB    . LEU E 3 179 ? 73.485  -24.653  6.813   1.00 53.91  ? 179 LEU E CB    1 
ATOM   9238  C CG    . LEU E 3 179 ? 73.657  -26.179  6.831   1.00 53.67  ? 179 LEU E CG    1 
ATOM   9239  C CD1   . LEU E 3 179 ? 73.139  -26.748  5.518   1.00 52.86  ? 179 LEU E CD1   1 
ATOM   9240  C CD2   . LEU E 3 179 ? 75.074  -26.685  7.100   1.00 51.52  ? 179 LEU E CD2   1 
ATOM   9241  N N     . VAL E 3 180 ? 76.745  -24.022  7.820   1.00 51.58  ? 180 VAL E N     1 
ATOM   9242  C CA    . VAL E 3 180 ? 78.098  -23.999  7.286   1.00 50.55  ? 180 VAL E CA    1 
ATOM   9243  C C     . VAL E 3 180 ? 78.350  -25.256  6.465   1.00 50.69  ? 180 VAL E C     1 
ATOM   9244  O O     . VAL E 3 180 ? 78.264  -26.354  6.983   1.00 51.01  ? 180 VAL E O     1 
ATOM   9245  C CB    . VAL E 3 180 ? 79.137  -23.873  8.413   1.00 49.75  ? 180 VAL E CB    1 
ATOM   9246  C CG1   . VAL E 3 180 ? 80.533  -23.992  7.870   1.00 49.61  ? 180 VAL E CG1   1 
ATOM   9247  C CG2   . VAL E 3 180 ? 78.983  -22.559  9.108   1.00 49.48  ? 180 VAL E CG2   1 
ATOM   9248  N N     . ILE E 3 181 ? 78.653  -25.098  5.185   1.00 50.92  ? 181 ILE E N     1 
ATOM   9249  C CA    . ILE E 3 181 ? 78.939  -26.243  4.328   1.00 51.51  ? 181 ILE E CA    1 
ATOM   9250  C C     . ILE E 3 181 ? 80.448  -26.470  4.247   1.00 52.03  ? 181 ILE E C     1 
ATOM   9251  O O     . ILE E 3 181 ? 81.162  -25.693  3.620   1.00 52.50  ? 181 ILE E O     1 
ATOM   9252  C CB    . ILE E 3 181 ? 78.368  -26.069  2.899   1.00 51.74  ? 181 ILE E CB    1 
ATOM   9253  C CG1   . ILE E 3 181 ? 76.852  -25.878  2.918   1.00 51.23  ? 181 ILE E CG1   1 
ATOM   9254  C CG2   . ILE E 3 181 ? 78.739  -27.248  2.018   1.00 52.43  ? 181 ILE E CG2   1 
ATOM   9255  C CD1   . ILE E 3 181 ? 76.238  -25.671  1.539   1.00 50.66  ? 181 ILE E CD1   1 
ATOM   9256  N N     . LYS E 3 182 ? 80.923  -27.541  4.869   1.00 52.38  ? 182 LYS E N     1 
ATOM   9257  C CA    . LYS E 3 182 ? 82.336  -27.876  4.854   1.00 53.02  ? 182 LYS E CA    1 
ATOM   9258  C C     . LYS E 3 182 ? 82.662  -28.881  3.745   1.00 54.27  ? 182 LYS E C     1 
ATOM   9259  O O     . LYS E 3 182 ? 82.591  -30.095  3.959   1.00 55.04  ? 182 LYS E O     1 
ATOM   9260  C CB    . LYS E 3 182 ? 82.734  -28.473  6.199   1.00 53.02  ? 182 LYS E CB    1 
ATOM   9261  C CG    . LYS E 3 182 ? 82.147  -27.775  7.417   1.00 52.72  ? 182 LYS E CG    1 
ATOM   9262  C CD    . LYS E 3 182 ? 82.905  -28.186  8.669   1.00 51.93  ? 182 LYS E CD    1 
ATOM   9263  C CE    . LYS E 3 182 ? 82.779  -27.136  9.728   1.00 51.00  ? 182 LYS E CE    1 
ATOM   9264  N NZ    . LYS E 3 182 ? 84.116  -26.695  10.217  1.00 52.84  ? 182 LYS E NZ    1 
ATOM   9265  N N     . ALA E 3 183 ? 83.036  -28.387  2.566   1.00 54.86  ? 183 ALA E N     1 
ATOM   9266  C CA    . ALA E 3 183 ? 83.275  -29.263  1.416   1.00 55.65  ? 183 ALA E CA    1 
ATOM   9267  C C     . ALA E 3 183 ? 84.217  -30.430  1.727   1.00 56.25  ? 183 ALA E C     1 
ATOM   9268  O O     . ALA E 3 183 ? 83.905  -31.579  1.450   1.00 56.83  ? 183 ALA E O     1 
ATOM   9269  C CB    . ALA E 3 183 ? 83.795  -28.469  0.252   1.00 55.71  ? 183 ALA E CB    1 
ATOM   9270  N N     . ARG E 3 184 ? 85.357  -30.137  2.336   1.00 56.59  ? 184 ARG E N     1 
ATOM   9271  C CA    . ARG E 3 184 ? 86.438  -31.126  2.443   1.00 57.21  ? 184 ARG E CA    1 
ATOM   9272  C C     . ARG E 3 184 ? 86.177  -32.216  3.478   1.00 57.37  ? 184 ARG E C     1 
ATOM   9273  O O     . ARG E 3 184 ? 86.928  -33.201  3.547   1.00 57.49  ? 184 ARG E O     1 
ATOM   9274  C CB    . ARG E 3 184 ? 87.769  -30.427  2.732   1.00 57.21  ? 184 ARG E CB    1 
ATOM   9275  C CG    . ARG E 3 184 ? 88.278  -29.546  1.600   1.00 56.67  ? 184 ARG E CG    1 
ATOM   9276  C CD    . ARG E 3 184 ? 89.192  -30.311  0.669   1.00 57.41  ? 184 ARG E CD    1 
ATOM   9277  N NE    . ARG E 3 184 ? 88.647  -30.617  -0.655  1.00 58.46  ? 184 ARG E NE    1 
ATOM   9278  C CZ    . ARG E 3 184 ? 88.862  -29.888  -1.753  1.00 59.17  ? 184 ARG E CZ    1 
ATOM   9279  N NH1   . ARG E 3 184 ? 89.580  -28.775  -1.693  1.00 59.77  ? 184 ARG E NH1   1 
ATOM   9280  N NH2   . ARG E 3 184 ? 88.340  -30.257  -2.916  1.00 59.60  ? 184 ARG E NH2   1 
ATOM   9281  N N     . SER E 3 185 ? 85.122  -32.023  4.280   1.00 57.03  ? 185 SER E N     1 
ATOM   9282  C CA    . SER E 3 185 ? 84.675  -33.028  5.253   1.00 57.23  ? 185 SER E CA    1 
ATOM   9283  C C     . SER E 3 185 ? 83.323  -33.653  4.863   1.00 57.61  ? 185 SER E C     1 
ATOM   9284  O O     . SER E 3 185 ? 82.778  -34.489  5.571   1.00 58.09  ? 185 SER E O     1 
ATOM   9285  C CB    . SER E 3 185 ? 84.702  -32.477  6.687   1.00 56.36  ? 185 SER E CB    1 
ATOM   9286  O OG    . SER E 3 185 ? 84.859  -31.074  6.691   1.00 56.14  ? 185 SER E OG    1 
ATOM   9287  N N     . ILE E 3 186 ? 82.794  -33.250  3.719   1.00 57.97  ? 186 ILE E N     1 
ATOM   9288  C CA    . ILE E 3 186 ? 81.716  -33.990  3.082   1.00 58.65  ? 186 ILE E CA    1 
ATOM   9289  C C     . ILE E 3 186 ? 82.352  -34.939  2.070   1.00 60.31  ? 186 ILE E C     1 
ATOM   9290  O O     . ILE E 3 186 ? 81.976  -36.107  1.985   1.00 61.41  ? 186 ILE E O     1 
ATOM   9291  C CB    . ILE E 3 186 ? 80.727  -33.049  2.399   1.00 58.09  ? 186 ILE E CB    1 
ATOM   9292  C CG1   . ILE E 3 186 ? 79.837  -32.405  3.448   1.00 57.22  ? 186 ILE E CG1   1 
ATOM   9293  C CG2   . ILE E 3 186 ? 79.885  -33.781  1.378   1.00 58.44  ? 186 ILE E CG2   1 
ATOM   9294  C CD1   . ILE E 3 186 ? 79.371  -31.044  3.069   1.00 56.70  ? 186 ILE E CD1   1 
ATOM   9295  N N     . ASP E 3 187 ? 83.325  -34.434  1.316   1.00 60.88  ? 187 ASP E N     1 
ATOM   9296  C CA    . ASP E 3 187 ? 84.085  -35.243  0.382   1.00 62.47  ? 187 ASP E CA    1 
ATOM   9297  C C     . ASP E 3 187 ? 85.322  -34.487  -0.089  1.00 63.14  ? 187 ASP E C     1 
ATOM   9298  O O     . ASP E 3 187 ? 85.205  -33.444  -0.754  1.00 63.03  ? 187 ASP E O     1 
ATOM   9299  C CB    . ASP E 3 187 ? 83.216  -35.612  -0.816  1.00 63.19  ? 187 ASP E CB    1 
ATOM   9300  C CG    . ASP E 3 187 ? 83.774  -36.772  -1.609  1.00 64.52  ? 187 ASP E CG    1 
ATOM   9301  O OD1   . ASP E 3 187 ? 85.015  -36.919  -1.675  1.00 63.70  ? 187 ASP E OD1   1 
ATOM   9302  O OD2   . ASP E 3 187 ? 82.954  -37.538  -2.166  1.00 66.03  ? 187 ASP E OD2   1 
ATOM   9303  N N     . VAL E 3 188 ? 86.506  -35.004  0.252   1.00 63.99  ? 188 VAL E N     1 
ATOM   9304  C CA    . VAL E 3 188 ? 87.752  -34.370  -0.191  1.00 64.58  ? 188 VAL E CA    1 
ATOM   9305  C C     . VAL E 3 188 ? 88.009  -34.526  -1.685  1.00 65.83  ? 188 VAL E C     1 
ATOM   9306  O O     . VAL E 3 188 ? 88.812  -33.791  -2.254  1.00 66.35  ? 188 VAL E O     1 
ATOM   9307  C CB    . VAL E 3 188 ? 89.005  -34.843  0.582   1.00 64.70  ? 188 VAL E CB    1 
ATOM   9308  C CG1   . VAL E 3 188 ? 89.096  -34.138  1.897   1.00 64.47  ? 188 VAL E CG1   1 
ATOM   9309  C CG2   . VAL E 3 188 ? 89.040  -36.354  0.741   1.00 65.46  ? 188 VAL E CG2   1 
ATOM   9310  N N     . THR E 3 189 ? 87.332  -35.479  -2.313  1.00 66.96  ? 189 THR E N     1 
ATOM   9311  C CA    . THR E 3 189 ? 87.557  -35.782  -3.719  1.00 68.53  ? 189 THR E CA    1 
ATOM   9312  C C     . THR E 3 189 ? 86.771  -34.855  -4.631  1.00 68.71  ? 189 THR E C     1 
ATOM   9313  O O     . THR E 3 189 ? 87.312  -34.322  -5.587  1.00 69.05  ? 189 THR E O     1 
ATOM   9314  C CB    . THR E 3 189 ? 87.225  -37.244  -4.011  1.00 69.64  ? 189 THR E CB    1 
ATOM   9315  O OG1   . THR E 3 189 ? 88.156  -38.071  -3.300  1.00 69.64  ? 189 THR E OG1   1 
ATOM   9316  C CG2   . THR E 3 189 ? 87.295  -37.540  -5.511  1.00 71.31  ? 189 THR E CG2   1 
ATOM   9317  N N     . LYS E 3 190 ? 85.495  -34.662  -4.320  1.00 68.92  ? 190 LYS E N     1 
ATOM   9318  C CA    . LYS E 3 190 ? 84.641  -33.749  -5.080  1.00 69.51  ? 190 LYS E CA    1 
ATOM   9319  C C     . LYS E 3 190 ? 85.114  -32.286  -5.054  1.00 68.99  ? 190 LYS E C     1 
ATOM   9320  O O     . LYS E 3 190 ? 85.901  -31.879  -4.188  1.00 68.08  ? 190 LYS E O     1 
ATOM   9321  C CB    . LYS E 3 190 ? 83.175  -33.876  -4.634  1.00 69.04  ? 190 LYS E CB    1 
ATOM   9322  C CG    . LYS E 3 190 ? 82.447  -35.047  -5.288  1.00 71.21  ? 190 LYS E CG    1 
ATOM   9323  C CD    . LYS E 3 190 ? 81.163  -35.392  -4.563  1.00 73.19  ? 190 LYS E CD    1 
ATOM   9324  C CE    . LYS E 3 190 ? 80.563  -36.693  -5.081  1.00 75.52  ? 190 LYS E CE    1 
ATOM   9325  N NZ    . LYS E 3 190 ? 79.800  -37.368  -3.978  1.00 76.65  ? 190 LYS E NZ    1 
ATOM   9326  N N     . ASP E 3 191 ? 84.641  -31.523  -6.042  1.00 69.68  ? 191 ASP E N     1 
ATOM   9327  C CA    . ASP E 3 191 ? 84.888  -30.093  -6.149  1.00 69.49  ? 191 ASP E CA    1 
ATOM   9328  C C     . ASP E 3 191 ? 84.009  -29.356  -5.142  1.00 68.34  ? 191 ASP E C     1 
ATOM   9329  O O     . ASP E 3 191 ? 82.794  -29.576  -5.104  1.00 68.21  ? 191 ASP E O     1 
ATOM   9330  C CB    . ASP E 3 191 ? 84.560  -29.621  -7.560  1.00 70.52  ? 191 ASP E CB    1 
ATOM   9331  C CG    . ASP E 3 191 ? 85.219  -28.302  -7.907  1.00 71.92  ? 191 ASP E CG    1 
ATOM   9332  O OD1   . ASP E 3 191 ? 85.989  -28.300  -8.887  1.00 75.39  ? 191 ASP E OD1   1 
ATOM   9333  O OD2   . ASP E 3 191 ? 84.984  -27.274  -7.225  1.00 71.55  ? 191 ASP E OD2   1 
ATOM   9334  N N     . PRO E 3 192 ? 84.617  -28.482  -4.315  1.00 67.52  ? 192 PRO E N     1 
ATOM   9335  C CA    . PRO E 3 192 ? 83.845  -27.763  -3.308  1.00 66.53  ? 192 PRO E CA    1 
ATOM   9336  C C     . PRO E 3 192 ? 82.593  -27.140  -3.889  1.00 66.89  ? 192 PRO E C     1 
ATOM   9337  O O     . PRO E 3 192 ? 81.576  -27.092  -3.221  1.00 66.31  ? 192 PRO E O     1 
ATOM   9338  C CB    . PRO E 3 192 ? 84.811  -26.678  -2.837  1.00 65.99  ? 192 PRO E CB    1 
ATOM   9339  C CG    . PRO E 3 192 ? 86.149  -27.298  -2.994  1.00 66.54  ? 192 PRO E CG    1 
ATOM   9340  C CD    . PRO E 3 192 ? 86.058  -28.184  -4.215  1.00 67.52  ? 192 PRO E CD    1 
ATOM   9341  N N     . LYS E 3 193 ? 82.669  -26.698  -5.138  1.00 68.36  ? 193 LYS E N     1 
ATOM   9342  C CA    . LYS E 3 193 ? 81.585  -25.954  -5.764  1.00 69.50  ? 193 LYS E CA    1 
ATOM   9343  C C     . LYS E 3 193 ? 80.424  -26.852  -6.198  1.00 70.24  ? 193 LYS E C     1 
ATOM   9344  O O     . LYS E 3 193 ? 79.284  -26.390  -6.261  1.00 70.38  ? 193 LYS E O     1 
ATOM   9345  C CB    . LYS E 3 193 ? 82.120  -25.100  -6.922  1.00 70.47  ? 193 LYS E CB    1 
ATOM   9346  C CG    . LYS E 3 193 ? 81.550  -23.683  -6.953  1.00 71.95  ? 193 LYS E CG    1 
ATOM   9347  C CD    . LYS E 3 193 ? 82.643  -22.604  -6.988  1.00 74.04  ? 193 LYS E CD    1 
ATOM   9348  C CE    . LYS E 3 193 ? 83.543  -22.711  -8.230  1.00 77.01  ? 193 LYS E CE    1 
ATOM   9349  N NZ    . LYS E 3 193 ? 82.805  -22.795  -9.525  1.00 79.54  ? 193 LYS E NZ    1 
ATOM   9350  N N     . GLU E 3 194 ? 80.708  -28.128  -6.477  1.00 71.14  ? 194 GLU E N     1 
ATOM   9351  C CA    . GLU E 3 194 ? 79.655  -29.113  -6.771  1.00 72.20  ? 194 GLU E CA    1 
ATOM   9352  C C     . GLU E 3 194 ? 78.878  -29.395  -5.496  1.00 71.12  ? 194 GLU E C     1 
ATOM   9353  O O     . GLU E 3 194 ? 77.651  -29.452  -5.499  1.00 71.45  ? 194 GLU E O     1 
ATOM   9354  C CB    . GLU E 3 194 ? 80.220  -30.437  -7.315  1.00 73.09  ? 194 GLU E CB    1 
ATOM   9355  C CG    . GLU E 3 194 ? 81.286  -30.327  -8.400  1.00 76.74  ? 194 GLU E CG    1 
ATOM   9356  C CD    . GLU E 3 194 ? 80.746  -30.027  -9.805  1.00 81.43  ? 194 GLU E CD    1 
ATOM   9357  O OE1   . GLU E 3 194 ? 79.966  -29.049  -9.981  1.00 82.41  ? 194 GLU E OE1   1 
ATOM   9358  O OE2   . GLU E 3 194 ? 81.138  -30.765  -10.745 1.00 83.69  ? 194 GLU E OE2   1 
ATOM   9359  N N     . ILE E 3 195 ? 79.615  -29.560  -4.405  1.00 70.19  ? 195 ILE E N     1 
ATOM   9360  C CA    . ILE E 3 195 ? 79.047  -29.858  -3.109  1.00 69.27  ? 195 ILE E CA    1 
ATOM   9361  C C     . ILE E 3 195 ? 78.073  -28.781  -2.672  1.00 68.88  ? 195 ILE E C     1 
ATOM   9362  O O     . ILE E 3 195 ? 76.983  -29.113  -2.248  1.00 69.31  ? 195 ILE E O     1 
ATOM   9363  C CB    . ILE E 3 195 ? 80.141  -30.080  -2.045  1.00 68.58  ? 195 ILE E CB    1 
ATOM   9364  C CG1   . ILE E 3 195 ? 80.881  -31.387  -2.320  1.00 69.23  ? 195 ILE E CG1   1 
ATOM   9365  C CG2   . ILE E 3 195 ? 79.536  -30.167  -0.672  1.00 68.27  ? 195 ILE E CG2   1 
ATOM   9366  C CD1   . ILE E 3 195 ? 82.210  -31.505  -1.632  1.00 68.56  ? 195 ILE E CD1   1 
ATOM   9367  N N     . TYR E 3 196 ? 78.447  -27.504  -2.792  1.00 68.76  ? 196 TYR E N     1 
ATOM   9368  C CA    . TYR E 3 196 ? 77.575  -26.382  -2.381  1.00 68.35  ? 196 TYR E CA    1 
ATOM   9369  C C     . TYR E 3 196 ? 76.229  -26.428  -3.088  1.00 69.26  ? 196 TYR E C     1 
ATOM   9370  O O     . TYR E 3 196 ? 75.198  -26.113  -2.512  1.00 68.77  ? 196 TYR E O     1 
ATOM   9371  C CB    . TYR E 3 196 ? 78.215  -25.014  -2.667  1.00 68.09  ? 196 TYR E CB    1 
ATOM   9372  C CG    . TYR E 3 196 ? 79.601  -24.792  -2.103  1.00 66.99  ? 196 TYR E CG    1 
ATOM   9373  C CD1   . TYR E 3 196 ? 79.979  -25.331  -0.877  1.00 65.68  ? 196 TYR E CD1   1 
ATOM   9374  C CD2   . TYR E 3 196 ? 80.521  -24.013  -2.788  1.00 66.90  ? 196 TYR E CD2   1 
ATOM   9375  C CE1   . TYR E 3 196 ? 81.247  -25.125  -0.364  1.00 65.04  ? 196 TYR E CE1   1 
ATOM   9376  C CE2   . TYR E 3 196 ? 81.790  -23.795  -2.278  1.00 66.64  ? 196 TYR E CE2   1 
ATOM   9377  C CZ    . TYR E 3 196 ? 82.147  -24.357  -1.067  1.00 65.57  ? 196 TYR E CZ    1 
ATOM   9378  O OH    . TYR E 3 196 ? 83.407  -24.147  -0.553  1.00 65.91  ? 196 TYR E OH    1 
ATOM   9379  N N     . LYS E 3 197 ? 76.255  -26.823  -4.350  1.00 70.82  ? 197 LYS E N     1 
ATOM   9380  C CA    . LYS E 3 197 ? 75.050  -26.877  -5.144  1.00 72.45  ? 197 LYS E CA    1 
ATOM   9381  C C     . LYS E 3 197 ? 74.159  -28.017  -4.679  1.00 72.61  ? 197 LYS E C     1 
ATOM   9382  O O     . LYS E 3 197 ? 72.948  -27.839  -4.553  1.00 73.11  ? 197 LYS E O     1 
ATOM   9383  C CB    . LYS E 3 197 ? 75.391  -27.001  -6.636  1.00 73.77  ? 197 LYS E CB    1 
ATOM   9384  C CG    . LYS E 3 197 ? 74.200  -26.809  -7.557  1.00 76.38  ? 197 LYS E CG    1 
ATOM   9385  C CD    . LYS E 3 197 ? 74.564  -25.981  -8.784  1.00 80.50  ? 197 LYS E CD    1 
ATOM   9386  C CE    . LYS E 3 197 ? 73.458  -26.044  -9.845  1.00 83.52  ? 197 LYS E CE    1 
ATOM   9387  N NZ    . LYS E 3 197 ? 73.360  -27.411  -10.469 1.00 84.94  ? 197 LYS E NZ    1 
ATOM   9388  N N     . THR E 3 198 ? 74.754  -29.176  -4.408  1.00 72.67  ? 198 THR E N     1 
ATOM   9389  C CA    . THR E 3 198 ? 73.962  -30.363  -4.085  1.00 73.21  ? 198 THR E CA    1 
ATOM   9390  C C     . THR E 3 198 ? 73.386  -30.321  -2.668  1.00 72.62  ? 198 THR E C     1 
ATOM   9391  O O     . THR E 3 198 ? 72.266  -30.773  -2.445  1.00 73.29  ? 198 THR E O     1 
ATOM   9392  C CB    . THR E 3 198 ? 74.722  -31.691  -4.323  1.00 73.50  ? 198 THR E CB    1 
ATOM   9393  O OG1   . THR E 3 198 ? 75.751  -31.838  -3.347  1.00 72.70  ? 198 THR E OG1   1 
ATOM   9394  C CG2   . THR E 3 198 ? 75.320  -31.751  -5.736  1.00 74.28  ? 198 THR E CG2   1 
ATOM   9395  N N     . GLU E 3 199 ? 74.134  -29.759  -1.725  1.00 71.83  ? 199 GLU E N     1 
ATOM   9396  C CA    . GLU E 3 199 ? 73.651  -29.609  -0.350  1.00 71.39  ? 199 GLU E CA    1 
ATOM   9397  C C     . GLU E 3 199 ? 72.549  -28.556  -0.241  1.00 71.21  ? 199 GLU E C     1 
ATOM   9398  O O     . GLU E 3 199 ? 71.644  -28.702  0.568   1.00 71.22  ? 199 GLU E O     1 
ATOM   9399  C CB    . GLU E 3 199 ? 74.789  -29.285  0.634   1.00 70.74  ? 199 GLU E CB    1 
ATOM   9400  C CG    . GLU E 3 199 ? 75.971  -30.275  0.649   1.00 72.14  ? 199 GLU E CG    1 
ATOM   9401  C CD    . GLU E 3 199 ? 75.569  -31.728  0.922   1.00 74.70  ? 199 GLU E CD    1 
ATOM   9402  O OE1   . GLU E 3 199 ? 74.978  -32.004  1.990   1.00 75.45  ? 199 GLU E OE1   1 
ATOM   9403  O OE2   . GLU E 3 199 ? 75.871  -32.601  0.073   1.00 75.59  ? 199 GLU E OE2   1 
ATOM   9404  N N     . VAL E 3 200 ? 72.624  -27.493  -1.040  1.00 71.47  ? 200 VAL E N     1 
ATOM   9405  C CA    . VAL E 3 200 ? 71.549  -26.484  -1.058  1.00 71.65  ? 200 VAL E CA    1 
ATOM   9406  C C     . VAL E 3 200 ? 70.270  -27.091  -1.630  1.00 72.92  ? 200 VAL E C     1 
ATOM   9407  O O     . VAL E 3 200 ? 69.174  -26.789  -1.169  1.00 73.09  ? 200 VAL E O     1 
ATOM   9408  C CB    . VAL E 3 200 ? 71.935  -25.194  -1.821  1.00 71.52  ? 200 VAL E CB    1 
ATOM   9409  C CG1   . VAL E 3 200 ? 70.747  -24.274  -1.964  1.00 71.63  ? 200 VAL E CG1   1 
ATOM   9410  C CG2   . VAL E 3 200 ? 73.032  -24.463  -1.101  1.00 70.40  ? 200 VAL E CG2   1 
ATOM   9411  N N     . GLU E 3 201 ? 70.415  -27.972  -2.612  1.00 74.10  ? 201 GLU E N     1 
ATOM   9412  C CA    . GLU E 3 201 ? 69.269  -28.695  -3.146  1.00 75.77  ? 201 GLU E CA    1 
ATOM   9413  C C     . GLU E 3 201 ? 68.552  -29.547  -2.094  1.00 75.58  ? 201 GLU E C     1 
ATOM   9414  O O     . GLU E 3 201 ? 67.324  -29.639  -2.122  1.00 76.37  ? 201 GLU E O     1 
ATOM   9415  C CB    . GLU E 3 201 ? 69.662  -29.531  -4.359  1.00 76.83  ? 201 GLU E CB    1 
ATOM   9416  C CG    . GLU E 3 201 ? 69.801  -28.700  -5.624  1.00 79.24  ? 201 GLU E CG    1 
ATOM   9417  C CD    . GLU E 3 201 ? 70.380  -29.488  -6.789  1.00 82.92  ? 201 GLU E CD    1 
ATOM   9418  O OE1   . GLU E 3 201 ? 70.190  -30.728  -6.836  1.00 85.22  ? 201 GLU E OE1   1 
ATOM   9419  O OE2   . GLU E 3 201 ? 71.023  -28.865  -7.665  1.00 83.70  ? 201 GLU E OE2   1 
ATOM   9420  N N     . LYS E 3 202 ? 69.304  -30.150  -1.168  1.00 74.58  ? 202 LYS E N     1 
ATOM   9421  C CA    . LYS E 3 202 ? 68.696  -30.910  -0.075  1.00 74.42  ? 202 LYS E CA    1 
ATOM   9422  C C     . LYS E 3 202 ? 67.798  -30.032  0.766   1.00 74.37  ? 202 LYS E C     1 
ATOM   9423  O O     . LYS E 3 202 ? 66.739  -30.462  1.209   1.00 75.13  ? 202 LYS E O     1 
ATOM   9424  C CB    . LYS E 3 202 ? 69.747  -31.549  0.824   1.00 73.52  ? 202 LYS E CB    1 
ATOM   9425  C CG    . LYS E 3 202 ? 70.369  -32.807  0.267   1.00 74.12  ? 202 LYS E CG    1 
ATOM   9426  C CD    . LYS E 3 202 ? 71.278  -33.435  1.299   1.00 73.71  ? 202 LYS E CD    1 
ATOM   9427  C CE    . LYS E 3 202 ? 72.298  -34.352  0.667   1.00 74.33  ? 202 LYS E CE    1 
ATOM   9428  N NZ    . LYS E 3 202 ? 73.463  -34.545  1.585   1.00 74.90  ? 202 LYS E NZ    1 
ATOM   9429  N N     . LEU E 3 203 ? 68.229  -28.797  0.983   1.00 74.11  ? 203 LEU E N     1 
ATOM   9430  C CA    . LEU E 3 203 ? 67.483  -27.860  1.803   1.00 74.43  ? 203 LEU E CA    1 
ATOM   9431  C C     . LEU E 3 203 ? 66.235  -27.413  1.087   1.00 75.85  ? 203 LEU E C     1 
ATOM   9432  O O     . LEU E 3 203 ? 65.202  -27.199  1.706   1.00 76.28  ? 203 LEU E O     1 
ATOM   9433  C CB    . LEU E 3 203 ? 68.332  -26.633  2.131   1.00 73.63  ? 203 LEU E CB    1 
ATOM   9434  C CG    . LEU E 3 203 ? 69.562  -26.751  3.028   1.00 72.32  ? 203 LEU E CG    1 
ATOM   9435  C CD1   . LEU E 3 203 ? 70.026  -25.351  3.340   1.00 72.02  ? 203 LEU E CD1   1 
ATOM   9436  C CD2   . LEU E 3 203 ? 69.267  -27.512  4.313   1.00 71.77  ? 203 LEU E CD2   1 
ATOM   9437  N N     . GLU E 3 204 ? 66.352  -27.255  -0.226  1.00 77.11  ? 204 GLU E N     1 
ATOM   9438  C CA    . GLU E 3 204 ? 65.234  -26.831  -1.048  1.00 78.62  ? 204 GLU E CA    1 
ATOM   9439  C C     . GLU E 3 204 ? 64.272  -27.992  -1.215  1.00 79.83  ? 204 GLU E C     1 
ATOM   9440  O O     . GLU E 3 204 ? 63.065  -27.790  -1.193  1.00 80.91  ? 204 GLU E O     1 
ATOM   9441  C CB    . GLU E 3 204 ? 65.721  -26.281  -2.394  1.00 78.97  ? 204 GLU E CB    1 
ATOM   9442  C CG    . GLU E 3 204 ? 66.544  -24.990  -2.232  1.00 78.63  ? 204 GLU E CG    1 
ATOM   9443  C CD    . GLU E 3 204 ? 66.876  -24.298  -3.550  1.00 79.75  ? 204 GLU E CD    1 
ATOM   9444  O OE1   . GLU E 3 204 ? 66.469  -24.803  -4.626  1.00 81.63  ? 204 GLU E OE1   1 
ATOM   9445  O OE2   . GLU E 3 204 ? 67.553  -23.242  -3.503  1.00 78.86  ? 204 GLU E OE2   1 
ATOM   9446  N N     . ASN E 3 205 ? 64.806  -29.207  -1.338  1.00 80.17  ? 205 ASN E N     1 
ATOM   9447  C CA    . ASN E 3 205 ? 63.967  -30.399  -1.492  1.00 81.49  ? 205 ASN E CA    1 
ATOM   9448  C C     . ASN E 3 205 ? 63.263  -30.857  -0.218  1.00 81.28  ? 205 ASN E C     1 
ATOM   9449  O O     . ASN E 3 205 ? 62.245  -31.552  -0.291  1.00 82.44  ? 205 ASN E O     1 
ATOM   9450  C CB    . ASN E 3 205 ? 64.710  -31.530  -2.199  1.00 81.93  ? 205 ASN E CB    1 
ATOM   9451  C CG    . ASN E 3 205 ? 64.772  -31.309  -3.704  1.00 84.29  ? 205 ASN E CG    1 
ATOM   9452  O OD1   . ASN E 3 205 ? 63.740  -31.332  -4.393  1.00 86.37  ? 205 ASN E OD1   1 
ATOM   9453  N ND2   . ASN E 3 205 ? 65.979  -31.061  -4.222  1.00 84.86  ? 205 ASN E ND2   1 
ATOM   9454  N N     . SER E 3 206 ? 63.800  -30.464  0.940   1.00 79.88  ? 206 SER E N     1 
ATOM   9455  C CA    . SER E 3 206 ? 62.985  -30.333  2.136   1.00 79.27  ? 206 SER E CA    1 
ATOM   9456  C C     . SER E 3 206 ? 62.095  -29.111  1.828   1.00 79.96  ? 206 SER E C     1 
ATOM   9457  O O     . SER E 3 206 ? 61.554  -29.025  0.717   1.00 80.95  ? 206 SER E O     1 
ATOM   9458  C CB    . SER E 3 206 ? 63.856  -30.134  3.365   1.00 77.81  ? 206 SER E CB    1 
ATOM   9459  O OG    . SER E 3 206 ? 63.081  -29.629  4.432   1.00 77.03  ? 206 SER E OG    1 
ATOM   9460  N N     . ASN E 3 207 ? 61.912  -28.177  2.764   1.00 79.41  ? 207 ASN E N     1 
ATOM   9461  C CA    . ASN E 3 207 ? 61.376  -26.859  2.380   1.00 79.71  ? 207 ASN E CA    1 
ATOM   9462  C C     . ASN E 3 207 ? 62.023  -25.726  3.137   1.00 78.41  ? 207 ASN E C     1 
ATOM   9463  O O     . ASN E 3 207 ? 61.434  -25.125  4.036   1.00 78.66  ? 207 ASN E O     1 
ATOM   9464  C CB    . ASN E 3 207 ? 59.839  -26.766  2.365   1.00 81.23  ? 207 ASN E CB    1 
ATOM   9465  C CG    . ASN E 3 207 ? 59.198  -27.241  3.654   1.00 83.56  ? 207 ASN E CG    1 
ATOM   9466  O OD1   . ASN E 3 207 ? 59.669  -28.187  4.296   1.00 86.38  ? 207 ASN E OD1   1 
ATOM   9467  N ND2   . ASN E 3 207 ? 58.096  -26.598  4.031   1.00 85.85  ? 207 ASN E ND2   1 
ATOM   9468  N N     . PHE E 3 208 ? 63.271  -25.474  2.754   1.00 77.11  ? 208 PHE E N     1 
ATOM   9469  C CA    . PHE E 3 208 ? 64.013  -24.309  3.162   1.00 75.73  ? 208 PHE E CA    1 
ATOM   9470  C C     . PHE E 3 208 ? 64.140  -23.414  1.941   1.00 75.63  ? 208 PHE E C     1 
ATOM   9471  O O     . PHE E 3 208 ? 64.315  -23.889  0.816   1.00 75.93  ? 208 PHE E O     1 
ATOM   9472  C CB    . PHE E 3 208 ? 65.382  -24.711  3.678   1.00 74.73  ? 208 PHE E CB    1 
ATOM   9473  C CG    . PHE E 3 208 ? 65.345  -25.386  5.013   1.00 75.53  ? 208 PHE E CG    1 
ATOM   9474  C CD1   . PHE E 3 208 ? 65.679  -24.683  6.173   1.00 76.13  ? 208 PHE E CD1   1 
ATOM   9475  C CD2   . PHE E 3 208 ? 64.984  -26.727  5.123   1.00 76.80  ? 208 PHE E CD2   1 
ATOM   9476  C CE1   . PHE E 3 208 ? 65.656  -25.304  7.420   1.00 75.88  ? 208 PHE E CE1   1 
ATOM   9477  C CE2   . PHE E 3 208 ? 64.951  -27.358  6.364   1.00 76.84  ? 208 PHE E CE2   1 
ATOM   9478  C CZ    . PHE E 3 208 ? 65.295  -26.643  7.513   1.00 76.79  ? 208 PHE E CZ    1 
ATOM   9479  N N     . GLU E 3 209 ? 64.034  -22.116  2.181   1.00 74.87  ? 209 GLU E N     1 
ATOM   9480  C CA    . GLU E 3 209 ? 63.956  -21.131  1.135   1.00 74.61  ? 209 GLU E CA    1 
ATOM   9481  C C     . GLU E 3 209 ? 65.257  -20.370  1.169   1.00 72.82  ? 209 GLU E C     1 
ATOM   9482  O O     . GLU E 3 209 ? 65.414  -19.437  1.959   1.00 72.65  ? 209 GLU E O     1 
ATOM   9483  C CB    . GLU E 3 209 ? 62.787  -20.190  1.429   1.00 75.94  ? 209 GLU E CB    1 
ATOM   9484  C CG    . GLU E 3 209 ? 62.234  -19.412  0.241   1.00 78.81  ? 209 GLU E CG    1 
ATOM   9485  C CD    . GLU E 3 209 ? 60.887  -18.725  0.540   1.00 82.31  ? 209 GLU E CD    1 
ATOM   9486  O OE1   . GLU E 3 209 ? 60.750  -18.085  1.619   1.00 82.12  ? 209 GLU E OE1   1 
ATOM   9487  O OE2   . GLU E 3 209 ? 59.968  -18.831  -0.316  1.00 84.20  ? 209 GLU E OE2   1 
ATOM   9488  N N     . THR E 3 210 ? 66.197  -20.790  0.323   1.00 71.37  ? 210 THR E N     1 
ATOM   9489  C CA    . THR E 3 210 ? 67.523  -20.163  0.220   1.00 68.96  ? 210 THR E CA    1 
ATOM   9490  C C     . THR E 3 210 ? 67.414  -18.645  0.081   1.00 67.95  ? 210 THR E C     1 
ATOM   9491  O O     . THR E 3 210 ? 66.764  -18.133  -0.831  1.00 68.52  ? 210 THR E O     1 
ATOM   9492  C CB    . THR E 3 210 ? 68.335  -20.749  -0.946  1.00 69.05  ? 210 THR E CB    1 
ATOM   9493  O OG1   . THR E 3 210 ? 68.056  -22.147  -1.072  1.00 69.58  ? 210 THR E OG1   1 
ATOM   9494  C CG2   . THR E 3 210 ? 69.806  -20.560  -0.707  1.00 67.96  ? 210 THR E CG2   1 
ATOM   9495  N N     . ILE E 3 211 ? 68.025  -17.942  1.020   1.00 65.88  ? 211 ILE E N     1 
ATOM   9496  C CA    . ILE E 3 211 ? 67.986  -16.493  1.043   1.00 65.21  ? 211 ILE E CA    1 
ATOM   9497  C C     . ILE E 3 211 ? 69.289  -15.937  0.487   1.00 64.39  ? 211 ILE E C     1 
ATOM   9498  O O     . ILE E 3 211 ? 69.274  -15.045  -0.381  1.00 65.30  ? 211 ILE E O     1 
ATOM   9499  C CB    . ILE E 3 211 ? 67.708  -15.955  2.463   1.00 64.75  ? 211 ILE E CB    1 
ATOM   9500  C CG1   . ILE E 3 211 ? 66.250  -16.240  2.839   1.00 65.15  ? 211 ILE E CG1   1 
ATOM   9501  C CG2   . ILE E 3 211 ? 67.984  -14.465  2.551   1.00 64.73  ? 211 ILE E CG2   1 
ATOM   9502  C CD1   . ILE E 3 211 ? 65.899  -15.943  4.291   1.00 65.54  ? 211 ILE E CD1   1 
ATOM   9503  N N     . GLN E 3 212 ? 70.404  -16.482  0.976   1.00 62.16  ? 212 GLN E N     1 
ATOM   9504  C CA    . GLN E 3 212 ? 71.724  -16.031  0.578   1.00 60.71  ? 212 GLN E CA    1 
ATOM   9505  C C     . GLN E 3 212 ? 72.741  -17.164  0.709   1.00 59.34  ? 212 GLN E C     1 
ATOM   9506  O O     . GLN E 3 212 ? 72.703  -17.920  1.664   1.00 58.41  ? 212 GLN E O     1 
ATOM   9507  C CB    . GLN E 3 212 ? 72.119  -14.838  1.439   1.00 60.16  ? 212 GLN E CB    1 
ATOM   9508  C CG    . GLN E 3 212 ? 73.213  -13.974  0.865   1.00 60.48  ? 212 GLN E CG    1 
ATOM   9509  C CD    . GLN E 3 212 ? 73.669  -12.895  1.829   1.00 59.74  ? 212 GLN E CD    1 
ATOM   9510  O OE1   . GLN E 3 212 ? 74.455  -12.031  1.479   1.00 59.61  ? 212 GLN E OE1   1 
ATOM   9511  N NE2   . GLN E 3 212 ? 73.171  -12.944  3.045   1.00 59.27  ? 212 GLN E NE2   1 
ATOM   9512  N N     . ILE E 3 213 ? 73.628  -17.285  -0.276  1.00 59.23  ? 213 ILE E N     1 
ATOM   9513  C CA    . ILE E 3 213 ? 74.746  -18.239  -0.242  1.00 58.39  ? 213 ILE E CA    1 
ATOM   9514  C C     . ILE E 3 213 ? 76.095  -17.505  -0.324  1.00 57.98  ? 213 ILE E C     1 
ATOM   9515  O O     . ILE E 3 213 ? 76.396  -16.851  -1.317  1.00 58.95  ? 213 ILE E O     1 
ATOM   9516  C CB    . ILE E 3 213 ? 74.687  -19.248  -1.408  1.00 58.80  ? 213 ILE E CB    1 
ATOM   9517  C CG1   . ILE E 3 213 ? 73.290  -19.845  -1.563  1.00 59.24  ? 213 ILE E CG1   1 
ATOM   9518  C CG2   . ILE E 3 213 ? 75.718  -20.345  -1.198  1.00 59.03  ? 213 ILE E CG2   1 
ATOM   9519  C CD1   . ILE E 3 213 ? 73.121  -20.743  -2.795  1.00 59.93  ? 213 ILE E CD1   1 
ATOM   9520  N N     . ILE E 3 214 ? 76.909  -17.624  0.714   1.00 57.00  ? 214 ILE E N     1 
ATOM   9521  C CA    . ILE E 3 214 ? 78.196  -16.939  0.762   1.00 56.65  ? 214 ILE E CA    1 
ATOM   9522  C C     . ILE E 3 214 ? 79.384  -17.915  0.685   1.00 56.94  ? 214 ILE E C     1 
ATOM   9523  O O     . ILE E 3 214 ? 79.320  -19.033  1.211   1.00 56.93  ? 214 ILE E O     1 
ATOM   9524  C CB    . ILE E 3 214 ? 78.314  -16.089  2.031   1.00 55.74  ? 214 ILE E CB    1 
ATOM   9525  C CG1   . ILE E 3 214 ? 77.244  -15.000  2.037   1.00 55.47  ? 214 ILE E CG1   1 
ATOM   9526  C CG2   . ILE E 3 214 ? 79.704  -15.501  2.137   1.00 55.36  ? 214 ILE E CG2   1 
ATOM   9527  C CD1   . ILE E 3 214 ? 77.215  -14.177  3.305   1.00 55.07  ? 214 ILE E CD1   1 
ATOM   9528  N N     . ASN E 3 215 ? 80.462  -17.498  0.019   1.00 57.41  ? 215 ASN E N     1 
ATOM   9529  C CA    . ASN E 3 215 ? 81.696  -18.280  0.018   1.00 57.35  ? 215 ASN E CA    1 
ATOM   9530  C C     . ASN E 3 215 ? 82.679  -17.673  0.994   1.00 56.87  ? 215 ASN E C     1 
ATOM   9531  O O     . ASN E 3 215 ? 83.071  -16.521  0.836   1.00 57.70  ? 215 ASN E O     1 
ATOM   9532  C CB    . ASN E 3 215 ? 82.315  -18.341  -1.376  1.00 58.17  ? 215 ASN E CB    1 
ATOM   9533  C CG    . ASN E 3 215 ? 83.593  -19.192  -1.418  1.00 58.33  ? 215 ASN E CG    1 
ATOM   9534  O OD1   . ASN E 3 215 ? 83.794  -19.974  -2.341  1.00 60.00  ? 215 ASN E OD1   1 
ATOM   9535  N ND2   . ASN E 3 215 ? 84.454  -19.034  -0.426  1.00 56.74  ? 215 ASN E ND2   1 
ATOM   9536  N N     . LEU E 3 216 ? 83.098  -18.440  1.992   1.00 56.00  ? 216 LEU E N     1 
ATOM   9537  C CA    . LEU E 3 216 ? 83.878  -17.861  3.082   1.00 55.31  ? 216 LEU E CA    1 
ATOM   9538  C C     . LEU E 3 216 ? 85.361  -17.623  2.767   1.00 55.69  ? 216 LEU E C     1 
ATOM   9539  O O     . LEU E 3 216 ? 86.156  -17.448  3.693   1.00 55.41  ? 216 LEU E O     1 
ATOM   9540  C CB    . LEU E 3 216 ? 83.734  -18.701  4.368   1.00 54.70  ? 216 LEU E CB    1 
ATOM   9541  C CG    . LEU E 3 216 ? 82.588  -18.626  5.402   1.00 53.54  ? 216 LEU E CG    1 
ATOM   9542  C CD1   . LEU E 3 216 ? 82.111  -17.215  5.695   1.00 51.58  ? 216 LEU E CD1   1 
ATOM   9543  C CD2   . LEU E 3 216 ? 81.421  -19.495  4.994   1.00 53.89  ? 216 LEU E CD2   1 
ATOM   9544  N N     . ASP E 3 217 ? 85.744  -17.588  1.487   1.00 56.66  ? 217 ASP E N     1 
ATOM   9545  C CA    . ASP E 3 217 ? 87.170  -17.383  1.120   1.00 57.18  ? 217 ASP E CA    1 
ATOM   9546  C C     . ASP E 3 217 ? 87.746  -16.027  1.578   1.00 57.41  ? 217 ASP E C     1 
ATOM   9547  O O     . ASP E 3 217 ? 86.996  -15.125  1.955   1.00 57.31  ? 217 ASP E O     1 
ATOM   9548  C CB    . ASP E 3 217 ? 87.457  -17.663  -0.353  1.00 57.99  ? 217 ASP E CB    1 
ATOM   9549  C CG    . ASP E 3 217 ? 88.870  -18.210  -0.580  1.00 59.11  ? 217 ASP E CG    1 
ATOM   9550  O OD1   . ASP E 3 217 ? 89.125  -19.404  -0.306  1.00 60.48  ? 217 ASP E OD1   1 
ATOM   9551  O OD2   . ASP E 3 217 ? 89.739  -17.450  -1.051  1.00 60.63  ? 217 ASP E OD2   1 
ATOM   9552  N N     . PRO E 3 218 ? 89.065  -15.836  1.409   1.00 57.90  ? 218 PRO E N     1 
ATOM   9553  C CA    . PRO E 3 218 ? 90.097  -15.530  2.377   1.00 57.27  ? 218 PRO E CA    1 
ATOM   9554  C C     . PRO E 3 218 ? 89.963  -16.315  3.678   1.00 56.49  ? 218 PRO E C     1 
ATOM   9555  O O     . PRO E 3 218 ? 90.807  -17.174  3.943   1.00 56.91  ? 218 PRO E O     1 
ATOM   9556  C CB    . PRO E 3 218 ? 89.932  -14.033  2.571   1.00 57.09  ? 218 PRO E CB    1 
ATOM   9557  C CG    . PRO E 3 218 ? 89.587  -13.559  1.175   1.00 59.10  ? 218 PRO E CG    1 
ATOM   9558  C CD    . PRO E 3 218 ? 89.140  -14.805  0.362   1.00 59.30  ? 218 PRO E CD    1 
ATOM   9559  N N     . TYR E 3 219 ? 88.885  -16.077  4.431   1.00 55.54  ? 219 TYR E N     1 
ATOM   9560  C CA    . TYR E 3 219 ? 88.776  -16.475  5.831   1.00 54.15  ? 219 TYR E CA    1 
ATOM   9561  C C     . TYR E 3 219 ? 88.720  -17.954  6.086   1.00 54.09  ? 219 TYR E C     1 
ATOM   9562  O O     . TYR E 3 219 ? 89.356  -18.417  7.027   1.00 54.37  ? 219 TYR E O     1 
ATOM   9563  C CB    . TYR E 3 219 ? 87.591  -15.783  6.482   1.00 53.44  ? 219 TYR E CB    1 
ATOM   9564  C CG    . TYR E 3 219 ? 87.559  -14.305  6.200   1.00 52.99  ? 219 TYR E CG    1 
ATOM   9565  C CD1   . TYR E 3 219 ? 88.616  -13.478  6.593   1.00 53.28  ? 219 TYR E CD1   1 
ATOM   9566  C CD2   . TYR E 3 219 ? 86.490  -13.731  5.524   1.00 51.56  ? 219 TYR E CD2   1 
ATOM   9567  C CE1   . TYR E 3 219 ? 88.601  -12.118  6.322   1.00 52.53  ? 219 TYR E CE1   1 
ATOM   9568  C CE2   . TYR E 3 219 ? 86.463  -12.371  5.253   1.00 51.68  ? 219 TYR E CE2   1 
ATOM   9569  C CZ    . TYR E 3 219 ? 87.520  -11.575  5.656   1.00 52.03  ? 219 TYR E CZ    1 
ATOM   9570  O OH    . TYR E 3 219 ? 87.501  -10.233  5.397   1.00 52.90  ? 219 TYR E OH    1 
ATOM   9571  N N     . ASP E 3 220 ? 87.964  -18.699  5.280   1.00 54.13  ? 220 ASP E N     1 
ATOM   9572  C CA    . ASP E 3 220 ? 87.917  -20.180  5.391   1.00 54.12  ? 220 ASP E CA    1 
ATOM   9573  C C     . ASP E 3 220 ? 88.001  -20.860  4.015   1.00 54.56  ? 220 ASP E C     1 
ATOM   9574  O O     . ASP E 3 220 ? 87.214  -20.565  3.104   1.00 54.96  ? 220 ASP E O     1 
ATOM   9575  C CB    . ASP E 3 220 ? 86.671  -20.648  6.151   1.00 53.35  ? 220 ASP E CB    1 
ATOM   9576  C CG    . ASP E 3 220 ? 86.594  -20.081  7.563   1.00 54.29  ? 220 ASP E CG    1 
ATOM   9577  O OD1   . ASP E 3 220 ? 86.234  -18.901  7.721   1.00 54.52  ? 220 ASP E OD1   1 
ATOM   9578  O OD2   . ASP E 3 220 ? 86.878  -20.813  8.536   1.00 57.10  ? 220 ASP E OD2   1 
ATOM   9579  N N     . LYS E 3 221 ? 88.959  -21.760  3.848   1.00 54.64  ? 221 LYS E N     1 
ATOM   9580  C CA    . LYS E 3 221 ? 89.114  -22.411  2.555   1.00 55.57  ? 221 LYS E CA    1 
ATOM   9581  C C     . LYS E 3 221 ? 88.111  -23.549  2.385   1.00 55.13  ? 221 LYS E C     1 
ATOM   9582  O O     . LYS E 3 221 ? 87.846  -24.288  3.325   1.00 54.87  ? 221 LYS E O     1 
ATOM   9583  C CB    . LYS E 3 221 ? 90.545  -22.913  2.357   1.00 56.51  ? 221 LYS E CB    1 
ATOM   9584  C CG    . LYS E 3 221 ? 91.574  -21.823  2.116   1.00 57.97  ? 221 LYS E CG    1 
ATOM   9585  C CD    . LYS E 3 221 ? 92.993  -22.388  2.214   1.00 62.00  ? 221 LYS E CD    1 
ATOM   9586  C CE    . LYS E 3 221 ? 94.019  -21.316  2.653   1.00 64.81  ? 221 LYS E CE    1 
ATOM   9587  N NZ    . LYS E 3 221 ? 95.447  -21.817  2.669   1.00 66.98  ? 221 LYS E NZ    1 
ATOM   9588  N N     . ASP E 3 222 ? 87.557  -23.676  1.181   1.00 55.28  ? 222 ASP E N     1 
ATOM   9589  C CA    . ASP E 3 222 ? 86.611  -24.745  0.834   1.00 55.02  ? 222 ASP E CA    1 
ATOM   9590  C C     . ASP E 3 222 ? 85.402  -24.791  1.773   1.00 53.98  ? 222 ASP E C     1 
ATOM   9591  O O     . ASP E 3 222 ? 84.956  -25.868  2.173   1.00 54.19  ? 222 ASP E O     1 
ATOM   9592  C CB    . ASP E 3 222 ? 87.301  -26.121  0.814   1.00 55.68  ? 222 ASP E CB    1 
ATOM   9593  C CG    . ASP E 3 222 ? 88.621  -26.128  0.057   1.00 56.93  ? 222 ASP E CG    1 
ATOM   9594  O OD1   . ASP E 3 222 ? 88.660  -25.613  -1.076  1.00 59.89  ? 222 ASP E OD1   1 
ATOM   9595  O OD2   . ASP E 3 222 ? 89.616  -26.679  0.585   1.00 56.64  ? 222 ASP E OD2   1 
ATOM   9596  N N     . HIS E 3 223 ? 84.887  -23.622  2.132   1.00 52.99  ? 223 HIS E N     1 
ATOM   9597  C CA    . HIS E 3 223 ? 83.701  -23.513  2.974   1.00 52.00  ? 223 HIS E CA    1 
ATOM   9598  C C     . HIS E 3 223 ? 82.684  -22.583  2.316   1.00 52.00  ? 223 HIS E C     1 
ATOM   9599  O O     . HIS E 3 223 ? 83.050  -21.682  1.555   1.00 52.47  ? 223 HIS E O     1 
ATOM   9600  C CB    . HIS E 3 223 ? 84.070  -22.964  4.356   1.00 51.33  ? 223 HIS E CB    1 
ATOM   9601  C CG    . HIS E 3 223 ? 84.566  -23.998  5.321   1.00 51.28  ? 223 HIS E CG    1 
ATOM   9602  N ND1   . HIS E 3 223 ? 83.873  -24.340  6.464   1.00 51.22  ? 223 HIS E ND1   1 
ATOM   9603  C CD2   . HIS E 3 223 ? 85.697  -24.743  5.334   1.00 52.09  ? 223 HIS E CD2   1 
ATOM   9604  C CE1   . HIS E 3 223 ? 84.549  -25.258  7.134   1.00 50.67  ? 223 HIS E CE1   1 
ATOM   9605  N NE2   . HIS E 3 223 ? 85.661  -25.519  6.472   1.00 52.06  ? 223 HIS E NE2   1 
ATOM   9606  N N     . ALA E 3 224 ? 81.407  -22.809  2.596   1.00 51.60  ? 224 ALA E N     1 
ATOM   9607  C CA    . ALA E 3 224 ? 80.365  -21.857  2.239   1.00 51.76  ? 224 ALA E CA    1 
ATOM   9608  C C     . ALA E 3 224 ? 79.341  -21.848  3.355   1.00 51.79  ? 224 ALA E C     1 
ATOM   9609  O O     . ALA E 3 224 ? 79.221  -22.817  4.105   1.00 51.66  ? 224 ALA E O     1 
ATOM   9610  C CB    . ALA E 3 224 ? 79.723  -22.222  0.931   1.00 52.00  ? 224 ALA E CB    1 
ATOM   9611  N N     . ILE E 3 225 ? 78.619  -20.745  3.488   1.00 52.21  ? 225 ILE E N     1 
ATOM   9612  C CA    . ILE E 3 225 ? 77.541  -20.676  4.465   1.00 52.34  ? 225 ILE E CA    1 
ATOM   9613  C C     . ILE E 3 225 ? 76.217  -20.359  3.750   1.00 53.23  ? 225 ILE E C     1 
ATOM   9614  O O     . ILE E 3 225 ? 76.174  -19.497  2.871   1.00 53.34  ? 225 ILE E O     1 
ATOM   9615  C CB    . ILE E 3 225 ? 77.862  -19.657  5.616   1.00 51.96  ? 225 ILE E CB    1 
ATOM   9616  C CG1   . ILE E 3 225 ? 76.945  -19.891  6.835   1.00 50.82  ? 225 ILE E CG1   1 
ATOM   9617  C CG2   . ILE E 3 225 ? 77.836  -18.195  5.083   1.00 51.81  ? 225 ILE E CG2   1 
ATOM   9618  C CD1   . ILE E 3 225 ? 77.362  -19.157  8.093   1.00 49.01  ? 225 ILE E CD1   1 
ATOM   9619  N N     . VAL E 3 226 ? 75.155  -21.070  4.122   1.00 53.81  ? 226 VAL E N     1 
ATOM   9620  C CA    . VAL E 3 226 ? 73.827  -20.823  3.560   1.00 55.24  ? 226 VAL E CA    1 
ATOM   9621  C C     . VAL E 3 226 ? 72.901  -20.201  4.594   1.00 55.91  ? 226 VAL E C     1 
ATOM   9622  O O     . VAL E 3 226 ? 72.816  -20.678  5.717   1.00 56.10  ? 226 VAL E O     1 
ATOM   9623  C CB    . VAL E 3 226 ? 73.182  -22.122  3.034   1.00 55.47  ? 226 VAL E CB    1 
ATOM   9624  C CG1   . VAL E 3 226 ? 71.872  -21.829  2.343   1.00 55.81  ? 226 VAL E CG1   1 
ATOM   9625  C CG2   . VAL E 3 226 ? 74.117  -22.830  2.082   1.00 56.04  ? 226 VAL E CG2   1 
ATOM   9626  N N     . LEU E 3 227 ? 72.226  -19.124  4.219   1.00 57.11  ? 227 LEU E N     1 
ATOM   9627  C CA    . LEU E 3 227 ? 71.151  -18.584  5.029   1.00 58.33  ? 227 LEU E CA    1 
ATOM   9628  C C     . LEU E 3 227 ? 69.843  -18.884  4.296   1.00 60.05  ? 227 LEU E C     1 
ATOM   9629  O O     . LEU E 3 227 ? 69.689  -18.525  3.129   1.00 60.86  ? 227 LEU E O     1 
ATOM   9630  C CB    . LEU E 3 227 ? 71.337  -17.080  5.254   1.00 58.11  ? 227 LEU E CB    1 
ATOM   9631  C CG    . LEU E 3 227 ? 70.135  -16.227  5.693   1.00 58.87  ? 227 LEU E CG    1 
ATOM   9632  C CD1   . LEU E 3 227 ? 69.888  -16.305  7.182   1.00 59.33  ? 227 LEU E CD1   1 
ATOM   9633  C CD2   . LEU E 3 227 ? 70.339  -14.791  5.319   1.00 59.60  ? 227 LEU E CD2   1 
ATOM   9634  N N     . SER E 3 228 ? 68.914  -19.552  4.975   1.00 61.10  ? 228 SER E N     1 
ATOM   9635  C CA    . SER E 3 228 ? 67.620  -19.889  4.393   1.00 62.87  ? 228 SER E CA    1 
ATOM   9636  C C     . SER E 3 228 ? 66.550  -19.925  5.467   1.00 63.76  ? 228 SER E C     1 
ATOM   9637  O O     . SER E 3 228 ? 66.876  -19.955  6.656   1.00 63.26  ? 228 SER E O     1 
ATOM   9638  C CB    . SER E 3 228 ? 67.686  -21.232  3.674   1.00 63.18  ? 228 SER E CB    1 
ATOM   9639  O OG    . SER E 3 228 ? 68.243  -22.223  4.516   1.00 64.12  ? 228 SER E OG    1 
ATOM   9640  N N     . LYS E 3 229 ? 65.280  -19.919  5.037   1.00 65.48  ? 229 LYS E N     1 
ATOM   9641  C CA    . LYS E 3 229 ? 64.128  -19.885  5.947   1.00 66.85  ? 229 LYS E CA    1 
ATOM   9642  C C     . LYS E 3 229 ? 63.287  -21.148  5.918   1.00 67.79  ? 229 LYS E C     1 
ATOM   9643  O O     . LYS E 3 229 ? 62.868  -21.606  4.854   1.00 68.41  ? 229 LYS E O     1 
ATOM   9644  C CB    . LYS E 3 229 ? 63.241  -18.661  5.692   1.00 67.84  ? 229 LYS E CB    1 
ATOM   9645  C CG    . LYS E 3 229 ? 63.610  -17.461  6.569   1.00 69.05  ? 229 LYS E CG    1 
ATOM   9646  C CD    . LYS E 3 229 ? 62.437  -16.503  6.794   1.00 71.56  ? 229 LYS E CD    1 
ATOM   9647  C CE    . LYS E 3 229 ? 62.854  -15.369  7.739   1.00 71.95  ? 229 LYS E CE    1 
ATOM   9648  N NZ    . LYS E 3 229 ? 61.802  -14.322  7.923   1.00 75.07  ? 229 LYS E NZ    1 
ATOM   9649  N N     . TYR E 3 230 ? 63.045  -21.704  7.103   1.00 68.26  ? 230 TYR E N     1 
ATOM   9650  C CA    . TYR E 3 230 ? 62.241  -22.908  7.243   1.00 69.56  ? 230 TYR E CA    1 
ATOM   9651  C C     . TYR E 3 230 ? 60.748  -22.559  7.101   1.00 71.13  ? 230 TYR E C     1 
ATOM   9652  O O     . TYR E 3 230 ? 60.315  -21.507  7.557   1.00 71.40  ? 230 TYR E O     1 
ATOM   9653  C CB    . TYR E 3 230 ? 62.565  -23.583  8.583   1.00 69.11  ? 230 TYR E CB    1 
ATOM   9654  C CG    . TYR E 3 230 ? 61.917  -24.926  8.794   1.00 70.23  ? 230 TYR E CG    1 
ATOM   9655  C CD1   . TYR E 3 230 ? 62.052  -25.939  7.846   1.00 71.82  ? 230 TYR E CD1   1 
ATOM   9656  C CD2   . TYR E 3 230 ? 61.176  -25.193  9.943   1.00 71.03  ? 230 TYR E CD2   1 
ATOM   9657  C CE1   . TYR E 3 230 ? 61.446  -27.191  8.020   1.00 73.53  ? 230 TYR E CE1   1 
ATOM   9658  C CE2   . TYR E 3 230 ? 60.563  -26.441  10.130  1.00 73.00  ? 230 TYR E CE2   1 
ATOM   9659  C CZ    . TYR E 3 230 ? 60.706  -27.436  9.162   1.00 73.60  ? 230 TYR E CZ    1 
ATOM   9660  O OH    . TYR E 3 230 ? 60.117  -28.670  9.314   1.00 74.11  ? 230 TYR E OH    1 
ATOM   9661  N N     . LYS E 3 231 ? 59.973  -23.425  6.451   1.00 72.61  ? 231 LYS E N     1 
ATOM   9662  C CA    . LYS E 3 231 ? 58.535  -23.174  6.235   1.00 74.83  ? 231 LYS E CA    1 
ATOM   9663  C C     . LYS E 3 231 ? 57.582  -24.100  7.028   1.00 75.65  ? 231 LYS E C     1 
ATOM   9664  O O     . LYS E 3 231 ? 57.594  -25.331  6.888   1.00 75.88  ? 231 LYS E O     1 
ATOM   9665  C CB    . LYS E 3 231 ? 58.198  -23.231  4.744   1.00 75.80  ? 231 LYS E CB    1 
ATOM   9666  C CG    . LYS E 3 231 ? 58.964  -22.238  3.880   1.00 76.63  ? 231 LYS E CG    1 
ATOM   9667  C CD    . LYS E 3 231 ? 58.781  -22.597  2.397   1.00 79.99  ? 231 LYS E CD    1 
ATOM   9668  C CE    . LYS E 3 231 ? 59.370  -21.525  1.479   1.00 80.46  ? 231 LYS E CE    1 
ATOM   9669  N NZ    . LYS E 3 231 ? 59.206  -21.807  0.010   1.00 80.89  ? 231 LYS E NZ    1 
ATOM   9670  N N     . ILE F 3 5   ? 120.491 -68.146  -11.693 1.00 100.90 ? 5   ILE F N     1 
ATOM   9671  C CA    . ILE F 3 5   ? 121.613 -67.170  -11.691 1.00 99.57  ? 5   ILE F CA    1 
ATOM   9672  C C     . ILE F 3 5   ? 122.574 -67.494  -12.844 1.00 100.02 ? 5   ILE F C     1 
ATOM   9673  O O     . ILE F 3 5   ? 122.732 -68.657  -13.214 1.00 101.28 ? 5   ILE F O     1 
ATOM   9674  C CB    . ILE F 3 5   ? 122.351 -67.133  -10.312 1.00 98.94  ? 5   ILE F CB    1 
ATOM   9675  C CG1   . ILE F 3 5   ? 121.347 -66.970  -9.163  1.00 98.90  ? 5   ILE F CG1   1 
ATOM   9676  C CG2   . ILE F 3 5   ? 123.378 -65.994  -10.256 1.00 97.44  ? 5   ILE F CG2   1 
ATOM   9677  C CD1   . ILE F 3 5   ? 121.943 -67.112  -7.754  1.00 98.29  ? 5   ILE F CD1   1 
ATOM   9678  N N     . THR F 3 6   ? 123.167 -66.447  -13.425 1.00 99.15  ? 6   THR F N     1 
ATOM   9679  C CA    . THR F 3 6   ? 124.236 -66.535  -14.435 1.00 99.31  ? 6   THR F CA    1 
ATOM   9680  C C     . THR F 3 6   ? 124.980 -65.200  -14.476 1.00 98.10  ? 6   THR F C     1 
ATOM   9681  O O     . THR F 3 6   ? 124.353 -64.145  -14.513 1.00 97.70  ? 6   THR F O     1 
ATOM   9682  C CB    . THR F 3 6   ? 123.688 -66.803  -15.853 1.00 100.16 ? 6   THR F CB    1 
ATOM   9683  O OG1   . THR F 3 6   ? 122.777 -67.904  -15.819 1.00 101.78 ? 6   THR F OG1   1 
ATOM   9684  C CG2   . THR F 3 6   ? 124.819 -67.114  -16.823 1.00 100.30 ? 6   THR F CG2   1 
ATOM   9685  N N     . VAL F 3 7   ? 126.308 -65.243  -14.477 1.00 97.84  ? 7   VAL F N     1 
ATOM   9686  C CA    . VAL F 3 7   ? 127.127 -64.036  -14.576 1.00 96.57  ? 7   VAL F CA    1 
ATOM   9687  C C     . VAL F 3 7   ? 127.955 -64.128  -15.849 1.00 97.49  ? 7   VAL F C     1 
ATOM   9688  O O     . VAL F 3 7   ? 128.537 -65.177  -16.133 1.00 98.61  ? 7   VAL F O     1 
ATOM   9689  C CB    . VAL F 3 7   ? 128.062 -63.882  -13.344 1.00 95.83  ? 7   VAL F CB    1 
ATOM   9690  C CG1   . VAL F 3 7   ? 128.958 -62.651  -13.466 1.00 94.32  ? 7   VAL F CG1   1 
ATOM   9691  C CG2   . VAL F 3 7   ? 127.254 -63.835  -12.056 1.00 95.11  ? 7   VAL F CG2   1 
ATOM   9692  N N     . LYS F 3 8   ? 128.002 -63.042  -16.618 1.00 97.29  ? 8   LYS F N     1 
ATOM   9693  C CA    . LYS F 3 8   ? 128.837 -62.991  -17.826 1.00 98.26  ? 8   LYS F CA    1 
ATOM   9694  C C     . LYS F 3 8   ? 129.425 -61.606  -18.109 1.00 97.17  ? 8   LYS F C     1 
ATOM   9695  O O     . LYS F 3 8   ? 128.814 -60.594  -17.793 1.00 96.28  ? 8   LYS F O     1 
ATOM   9696  C CB    . LYS F 3 8   ? 128.084 -63.544  -19.052 1.00 99.64  ? 8   LYS F CB    1 
ATOM   9697  C CG    . LYS F 3 8   ? 126.829 -62.781  -19.449 1.00 100.54 ? 8   LYS F CG    1 
ATOM   9698  C CD    . LYS F 3 8   ? 126.080 -63.483  -20.586 1.00 103.69 ? 8   LYS F CD    1 
ATOM   9699  C CE    . LYS F 3 8   ? 125.080 -64.522  -20.068 1.00 105.26 ? 8   LYS F CE    1 
ATOM   9700  N NZ    . LYS F 3 8   ? 123.895 -63.908  -19.385 1.00 105.40 ? 8   LYS F NZ    1 
ATOM   9701  N N     . GLN F 3 9   ? 130.618 -61.591  -18.703 1.00 97.62  ? 9   GLN F N     1 
ATOM   9702  C CA    . GLN F 3 9   ? 131.321 -60.374  -19.127 1.00 97.11  ? 9   GLN F CA    1 
ATOM   9703  C C     . GLN F 3 9   ? 130.442 -59.450  -19.981 1.00 96.72  ? 9   GLN F C     1 
ATOM   9704  O O     . GLN F 3 9   ? 129.484 -59.892  -20.605 1.00 97.57  ? 9   GLN F O     1 
ATOM   9705  C CB    . GLN F 3 9   ? 132.571 -60.775  -19.923 1.00 98.35  ? 9   GLN F CB    1 
ATOM   9706  C CG    . GLN F 3 9   ? 133.605 -59.663  -20.142 1.00 99.02  ? 9   GLN F CG    1 
ATOM   9707  C CD    . GLN F 3 9   ? 134.828 -59.766  -19.231 1.00 99.88  ? 9   GLN F CD    1 
ATOM   9708  O OE1   . GLN F 3 9   ? 135.262 -60.860  -18.859 1.00 101.49 ? 9   GLN F OE1   1 
ATOM   9709  N NE2   . GLN F 3 9   ? 135.405 -58.618  -18.893 1.00 99.03  ? 9   GLN F NE2   1 
ATOM   9710  N N     . THR F 3 10  ? 130.767 -58.164  -19.995 1.00 95.65  ? 10  THR F N     1 
ATOM   9711  C CA    . THR F 3 10  ? 130.102 -57.206  -20.874 1.00 95.41  ? 10  THR F CA    1 
ATOM   9712  C C     . THR F 3 10  ? 131.139 -56.611  -21.827 1.00 95.81  ? 10  THR F C     1 
ATOM   9713  O O     . THR F 3 10  ? 132.308 -57.004  -21.788 1.00 96.14  ? 10  THR F O     1 
ATOM   9714  C CB    . THR F 3 10  ? 129.435 -56.072  -20.070 1.00 94.12  ? 10  THR F CB    1 
ATOM   9715  O OG1   . THR F 3 10  ? 130.440 -55.313  -19.389 1.00 93.10  ? 10  THR F OG1   1 
ATOM   9716  C CG2   . THR F 3 10  ? 128.443 -56.627  -19.052 1.00 93.61  ? 10  THR F CG2   1 
ATOM   9717  N N     . ASN F 3 11  ? 130.723 -55.662  -22.666 1.00 95.84  ? 11  ASN F N     1 
ATOM   9718  C CA    . ASN F 3 11  ? 131.644 -54.960  -23.579 1.00 96.24  ? 11  ASN F CA    1 
ATOM   9719  C C     . ASN F 3 11  ? 132.854 -54.337  -22.880 1.00 95.17  ? 11  ASN F C     1 
ATOM   9720  O O     . ASN F 3 11  ? 133.883 -54.103  -23.515 1.00 95.95  ? 11  ASN F O     1 
ATOM   9721  C CB    . ASN F 3 11  ? 130.927 -53.853  -24.363 1.00 96.47  ? 11  ASN F CB    1 
ATOM   9722  C CG    . ASN F 3 11  ? 129.531 -54.242  -24.798 1.00 97.38  ? 11  ASN F CG    1 
ATOM   9723  O OD1   . ASN F 3 11  ? 129.322 -55.270  -25.441 1.00 98.97  ? 11  ASN F OD1   1 
ATOM   9724  N ND2   . ASN F 3 11  ? 128.563 -53.402  -24.458 1.00 97.40  ? 11  ASN F ND2   1 
ATOM   9725  N N     . MET F 3 12  ? 132.718 -54.069  -21.581 1.00 93.50  ? 12  MET F N     1 
ATOM   9726  C CA    . MET F 3 12  ? 133.745 -53.384  -20.793 1.00 92.11  ? 12  MET F CA    1 
ATOM   9727  C C     . MET F 3 12  ? 134.465 -54.333  -19.835 1.00 91.86  ? 12  MET F C     1 
ATOM   9728  O O     . MET F 3 12  ? 133.841 -55.190  -19.211 1.00 91.63  ? 12  MET F O     1 
ATOM   9729  C CB    . MET F 3 12  ? 133.112 -52.232  -20.015 1.00 90.76  ? 12  MET F CB    1 
ATOM   9730  C CG    . MET F 3 12  ? 132.700 -51.034  -20.875 1.00 89.97  ? 12  MET F CG    1 
ATOM   9731  S SD    . MET F 3 12  ? 131.149 -50.207  -20.420 1.00 85.78  ? 12  MET F SD    1 
ATOM   9732  C CE    . MET F 3 12  ? 131.009 -50.553  -18.680 1.00 85.68  ? 12  MET F CE    1 
ATOM   9733  N N     . GLU F 3 13  ? 135.779 -54.164  -19.727 1.00 91.84  ? 13  GLU F N     1 
ATOM   9734  C CA    . GLU F 3 13  ? 136.618 -55.010  -18.880 1.00 91.94  ? 13  GLU F CA    1 
ATOM   9735  C C     . GLU F 3 13  ? 136.157 -55.044  -17.435 1.00 90.99  ? 13  GLU F C     1 
ATOM   9736  O O     . GLU F 3 13  ? 135.739 -54.032  -16.892 1.00 90.03  ? 13  GLU F O     1 
ATOM   9737  C CB    . GLU F 3 13  ? 138.060 -54.519  -18.911 1.00 92.13  ? 13  GLU F CB    1 
ATOM   9738  C CG    . GLU F 3 13  ? 138.920 -55.140  -19.979 1.00 93.58  ? 13  GLU F CG    1 
ATOM   9739  C CD    . GLU F 3 13  ? 140.397 -55.058  -19.633 1.00 94.44  ? 13  GLU F CD    1 
ATOM   9740  O OE1   . GLU F 3 13  ? 140.933 -53.932  -19.551 1.00 93.98  ? 13  GLU F OE1   1 
ATOM   9741  O OE2   . GLU F 3 13  ? 141.027 -56.122  -19.443 1.00 95.66  ? 13  GLU F OE2   1 
ATOM   9742  N N     . ASN F 3 14  ? 136.254 -56.219  -16.820 1.00 91.64  ? 14  ASN F N     1 
ATOM   9743  C CA    . ASN F 3 14  ? 135.906 -56.431  -15.405 1.00 91.27  ? 14  ASN F CA    1 
ATOM   9744  C C     . ASN F 3 14  ? 134.550 -55.877  -14.942 1.00 90.38  ? 14  ASN F C     1 
ATOM   9745  O O     . ASN F 3 14  ? 134.381 -55.532  -13.766 1.00 89.76  ? 14  ASN F O     1 
ATOM   9746  C CB    . ASN F 3 14  ? 137.032 -55.937  -14.483 1.00 91.09  ? 14  ASN F CB    1 
ATOM   9747  C CG    . ASN F 3 14  ? 138.194 -56.911  -14.397 1.00 92.41  ? 14  ASN F CG    1 
ATOM   9748  O OD1   . ASN F 3 14  ? 138.028 -58.087  -14.047 1.00 94.02  ? 14  ASN F OD1   1 
ATOM   9749  N ND2   . ASN F 3 14  ? 139.385 -56.418  -14.697 1.00 92.26  ? 14  ASN F ND2   1 
ATOM   9750  N N     . ILE F 3 15  ? 133.598 -55.799  -15.871 1.00 90.53  ? 15  ILE F N     1 
ATOM   9751  C CA    . ILE F 3 15  ? 132.233 -55.351  -15.586 1.00 89.81  ? 15  ILE F CA    1 
ATOM   9752  C C     . ILE F 3 15  ? 131.264 -56.410  -16.109 1.00 90.97  ? 15  ILE F C     1 
ATOM   9753  O O     . ILE F 3 15  ? 131.290 -56.746  -17.293 1.00 91.91  ? 15  ILE F O     1 
ATOM   9754  C CB    . ILE F 3 15  ? 131.944 -53.940  -16.191 1.00 89.00  ? 15  ILE F CB    1 
ATOM   9755  C CG1   . ILE F 3 15  ? 132.817 -52.883  -15.509 1.00 87.69  ? 15  ILE F CG1   1 
ATOM   9756  C CG2   . ILE F 3 15  ? 130.490 -53.557  -16.011 1.00 88.18  ? 15  ILE F CG2   1 
ATOM   9757  C CD1   . ILE F 3 15  ? 133.108 -51.651  -16.332 1.00 86.06  ? 15  ILE F CD1   1 
ATOM   9758  N N     . TYR F 3 16  ? 130.421 -56.932  -15.221 1.00 91.23  ? 16  TYR F N     1 
ATOM   9759  C CA    . TYR F 3 16  ? 129.595 -58.102  -15.518 1.00 92.68  ? 16  TYR F CA    1 
ATOM   9760  C C     . TYR F 3 16  ? 128.109 -57.847  -15.290 1.00 92.90  ? 16  TYR F C     1 
ATOM   9761  O O     . TYR F 3 16  ? 127.749 -56.971  -14.513 1.00 91.86  ? 16  TYR F O     1 
ATOM   9762  C CB    . TYR F 3 16  ? 130.043 -59.289  -14.655 1.00 92.99  ? 16  TYR F CB    1 
ATOM   9763  C CG    . TYR F 3 16  ? 131.530 -59.560  -14.679 1.00 93.37  ? 16  TYR F CG    1 
ATOM   9764  C CD1   . TYR F 3 16  ? 132.070 -60.529  -15.528 1.00 94.94  ? 16  TYR F CD1   1 
ATOM   9765  C CD2   . TYR F 3 16  ? 132.399 -58.850  -13.851 1.00 92.62  ? 16  TYR F CD2   1 
ATOM   9766  C CE1   . TYR F 3 16  ? 133.443 -60.780  -15.553 1.00 95.19  ? 16  TYR F CE1   1 
ATOM   9767  C CE2   . TYR F 3 16  ? 133.769 -59.091  -13.869 1.00 93.22  ? 16  TYR F CE2   1 
ATOM   9768  C CZ    . TYR F 3 16  ? 134.283 -60.056  -14.720 1.00 94.39  ? 16  TYR F CZ    1 
ATOM   9769  O OH    . TYR F 3 16  ? 135.635 -60.293  -14.738 1.00 95.06  ? 16  TYR F OH    1 
ATOM   9770  N N     . GLU F 3 17  ? 127.262 -58.625  -15.972 1.00 94.69  ? 17  GLU F N     1 
ATOM   9771  C CA    . GLU F 3 17  ? 125.801 -58.627  -15.769 1.00 95.84  ? 17  GLU F CA    1 
ATOM   9772  C C     . GLU F 3 17  ? 125.298 -59.956  -15.204 1.00 96.84  ? 17  GLU F C     1 
ATOM   9773  O O     . GLU F 3 17  ? 125.840 -61.013  -15.530 1.00 97.79  ? 17  GLU F O     1 
ATOM   9774  C CB    . GLU F 3 17  ? 125.046 -58.330  -17.080 1.00 96.64  ? 17  GLU F CB    1 
ATOM   9775  C CG    . GLU F 3 17  ? 124.729 -56.846  -17.334 1.00 97.44  ? 17  GLU F CG    1 
ATOM   9776  C CD    . GLU F 3 17  ? 123.608 -56.614  -18.353 1.00 99.90  ? 17  GLU F CD    1 
ATOM   9777  O OE1   . GLU F 3 17  ? 122.916 -55.570  -18.244 1.00 100.23 ? 17  GLU F OE1   1 
ATOM   9778  O OE2   . GLU F 3 17  ? 123.420 -57.461  -19.259 1.00 101.45 ? 17  GLU F OE2   1 
ATOM   9779  N N     . CYS F 3 18  ? 124.245 -59.897  -14.387 1.00 97.08  ? 18  CYS F N     1 
ATOM   9780  C CA    . CYS F 3 18  ? 123.630 -61.099  -13.825 1.00 98.37  ? 18  CYS F CA    1 
ATOM   9781  C C     . CYS F 3 18  ? 122.240 -61.397  -14.342 1.00 99.82  ? 18  CYS F C     1 
ATOM   9782  O O     . CYS F 3 18  ? 121.371 -60.526  -14.322 1.00 99.71  ? 18  CYS F O     1 
ATOM   9783  C CB    . CYS F 3 18  ? 123.518 -60.985  -12.316 1.00 97.59  ? 18  CYS F CB    1 
ATOM   9784  S SG    . CYS F 3 18  ? 125.056 -61.090  -11.503 1.00 96.61  ? 18  CYS F SG    1 
ATOM   9785  N N     . GLU F 3 19  ? 122.036 -62.633  -14.787 1.00 101.60 ? 19  GLU F N     1 
ATOM   9786  C CA    . GLU F 3 19  ? 120.698 -63.207  -14.870 1.00 103.23 ? 19  GLU F CA    1 
ATOM   9787  C C     . GLU F 3 19  ? 120.340 -63.659  -13.453 1.00 103.16 ? 19  GLU F C     1 
ATOM   9788  O O     . GLU F 3 19  ? 121.187 -64.204  -12.746 1.00 102.96 ? 19  GLU F O     1 
ATOM   9789  C CB    . GLU F 3 19  ? 120.676 -64.388  -15.847 1.00 105.02 ? 19  GLU F CB    1 
ATOM   9790  C CG    . GLU F 3 19  ? 119.919 -64.142  -17.163 1.00 107.19 ? 19  GLU F CG    1 
ATOM   9791  C CD    . GLU F 3 19  ? 118.443 -64.537  -17.086 1.00 110.43 ? 19  GLU F CD    1 
ATOM   9792  O OE1   . GLU F 3 19  ? 118.018 -65.094  -16.048 1.00 111.74 ? 19  GLU F OE1   1 
ATOM   9793  O OE2   . GLU F 3 19  ? 117.702 -64.295  -18.067 1.00 111.99 ? 19  GLU F OE2   1 
ATOM   9794  N N     . PHE F 3 20  ? 119.105 -63.415  -13.026 1.00 103.52 ? 20  PHE F N     1 
ATOM   9795  C CA    . PHE F 3 20  ? 118.713 -63.732  -11.647 1.00 103.84 ? 20  PHE F CA    1 
ATOM   9796  C C     . PHE F 3 20  ? 117.629 -64.792  -11.513 1.00 105.35 ? 20  PHE F C     1 
ATOM   9797  O O     . PHE F 3 20  ? 116.892 -65.074  -12.464 1.00 106.08 ? 20  PHE F O     1 
ATOM   9798  C CB    . PHE F 3 20  ? 118.303 -62.467  -10.878 1.00 102.85 ? 20  PHE F CB    1 
ATOM   9799  C CG    . PHE F 3 20  ? 119.428 -61.831  -10.116 1.00 101.90 ? 20  PHE F CG    1 
ATOM   9800  C CD1   . PHE F 3 20  ? 120.037 -60.670  -10.585 1.00 101.26 ? 20  PHE F CD1   1 
ATOM   9801  C CD2   . PHE F 3 20  ? 119.890 -62.400  -8.934  1.00 102.10 ? 20  PHE F CD2   1 
ATOM   9802  C CE1   . PHE F 3 20  ? 121.087 -60.082  -9.885  1.00 100.48 ? 20  PHE F CE1   1 
ATOM   9803  C CE2   . PHE F 3 20  ? 120.943 -61.824  -8.231  1.00 101.28 ? 20  PHE F CE2   1 
ATOM   9804  C CZ    . PHE F 3 20  ? 121.542 -60.662  -8.706  1.00 100.39 ? 20  PHE F CZ    1 
ATOM   9805  N N     . ASN F 3 21  ? 117.551 -65.364  -10.308 1.00 105.88 ? 21  ASN F N     1 
ATOM   9806  C CA    . ASN F 3 21  ? 116.541 -66.368  -9.932  1.00 107.31 ? 21  ASN F CA    1 
ATOM   9807  C C     . ASN F 3 21  ? 115.139 -66.041  -10.477 1.00 107.78 ? 21  ASN F C     1 
ATOM   9808  O O     . ASN F 3 21  ? 114.339 -66.940  -10.743 1.00 108.95 ? 21  ASN F O     1 
ATOM   9809  C CB    . ASN F 3 21  ? 116.480 -66.536  -8.392  1.00 107.40 ? 21  ASN F CB    1 
ATOM   9810  C CG    . ASN F 3 21  ? 117.787 -66.124  -7.674  1.00 106.24 ? 21  ASN F CG    1 
ATOM   9811  O OD1   . ASN F 3 21  ? 118.848 -66.710  -7.889  1.00 105.67 ? 21  ASN F OD1   1 
ATOM   9812  N ND2   . ASN F 3 21  ? 117.690 -65.123  -6.800  1.00 104.77 ? 21  ASN F ND2   1 
ATOM   9813  N N     . ASP F 3 22  ? 114.868 -64.745  -10.645 1.00 106.87 ? 22  ASP F N     1 
ATOM   9814  C CA    . ASP F 3 22  ? 113.561 -64.229  -11.069 1.00 107.32 ? 22  ASP F CA    1 
ATOM   9815  C C     . ASP F 3 22  ? 113.544 -63.670  -12.501 1.00 107.27 ? 22  ASP F C     1 
ATOM   9816  O O     . ASP F 3 22  ? 112.474 -63.493  -13.084 1.00 108.11 ? 22  ASP F O     1 
ATOM   9817  C CB    . ASP F 3 22  ? 113.062 -63.154  -10.081 1.00 106.41 ? 22  ASP F CB    1 
ATOM   9818  C CG    . ASP F 3 22  ? 113.740 -61.796  -10.280 1.00 104.53 ? 22  ASP F CG    1 
ATOM   9819  O OD1   . ASP F 3 22  ? 114.368 -61.285  -9.331  1.00 102.69 ? 22  ASP F OD1   1 
ATOM   9820  O OD2   . ASP F 3 22  ? 113.639 -61.228  -11.386 1.00 104.61 ? 22  ASP F OD2   1 
ATOM   9821  N N     . GLY F 3 23  ? 114.723 -63.361  -13.044 1.00 106.48 ? 23  GLY F N     1 
ATOM   9822  C CA    . GLY F 3 23  ? 114.845 -62.799  -14.396 1.00 106.18 ? 23  GLY F CA    1 
ATOM   9823  C C     . GLY F 3 23  ? 115.155 -61.308  -14.463 1.00 104.67 ? 23  GLY F C     1 
ATOM   9824  O O     . GLY F 3 23  ? 114.718 -60.623  -15.393 1.00 104.77 ? 23  GLY F O     1 
ATOM   9825  N N     . SER F 3 24  ? 115.907 -60.807  -13.481 1.00 103.26 ? 24  SER F N     1 
ATOM   9826  C CA    . SER F 3 24  ? 116.367 -59.416  -13.474 1.00 101.79 ? 24  SER F CA    1 
ATOM   9827  C C     . SER F 3 24  ? 117.845 -59.323  -13.856 1.00 101.04 ? 24  SER F C     1 
ATOM   9828  O O     . SER F 3 24  ? 118.596 -60.282  -13.684 1.00 101.38 ? 24  SER F O     1 
ATOM   9829  C CB    . SER F 3 24  ? 116.119 -58.763  -12.109 1.00 101.02 ? 24  SER F CB    1 
ATOM   9830  O OG    . SER F 3 24  ? 116.770 -59.463  -11.065 1.00 100.77 ? 24  SER F OG    1 
ATOM   9831  N N     . PHE F 3 25  ? 118.248 -58.168  -14.379 1.00 100.06 ? 25  PHE F N     1 
ATOM   9832  C CA    . PHE F 3 25  ? 119.623 -57.938  -14.817 1.00 99.38  ? 25  PHE F CA    1 
ATOM   9833  C C     . PHE F 3 25  ? 120.286 -56.801  -14.032 1.00 97.65  ? 25  PHE F C     1 
ATOM   9834  O O     . PHE F 3 25  ? 119.871 -55.644  -14.127 1.00 97.19  ? 25  PHE F O     1 
ATOM   9835  C CB    . PHE F 3 25  ? 119.655 -57.632  -16.322 1.00 100.11 ? 25  PHE F CB    1 
ATOM   9836  C CG    . PHE F 3 25  ? 119.668 -58.853  -17.201 1.00 102.07 ? 25  PHE F CG    1 
ATOM   9837  C CD1   . PHE F 3 25  ? 118.516 -59.617  -17.378 1.00 103.93 ? 25  PHE F CD1   1 
ATOM   9838  C CD2   . PHE F 3 25  ? 120.832 -59.226  -17.873 1.00 103.11 ? 25  PHE F CD2   1 
ATOM   9839  C CE1   . PHE F 3 25  ? 118.527 -60.749  -18.200 1.00 106.11 ? 25  PHE F CE1   1 
ATOM   9840  C CE2   . PHE F 3 25  ? 120.858 -60.355  -18.699 1.00 105.20 ? 25  PHE F CE2   1 
ATOM   9841  C CZ    . PHE F 3 25  ? 119.702 -61.118  -18.865 1.00 106.66 ? 25  PHE F CZ    1 
ATOM   9842  N N     . ARG F 3 26  ? 121.315 -57.121  -13.255 1.00 96.66  ? 26  ARG F N     1 
ATOM   9843  C CA    . ARG F 3 26  ? 122.018 -56.082  -12.505 1.00 94.95  ? 26  ARG F CA    1 
ATOM   9844  C C     . ARG F 3 26  ? 123.522 -56.122  -12.680 1.00 93.65  ? 26  ARG F C     1 
ATOM   9845  O O     . ARG F 3 26  ? 124.120 -57.191  -12.742 1.00 94.01  ? 26  ARG F O     1 
ATOM   9846  C CB    . ARG F 3 26  ? 121.637 -56.108  -11.025 1.00 94.99  ? 26  ARG F CB    1 
ATOM   9847  C CG    . ARG F 3 26  ? 120.390 -55.299  -10.735 1.00 96.33  ? 26  ARG F CG    1 
ATOM   9848  C CD    . ARG F 3 26  ? 119.851 -55.578  -9.356  1.00 99.52  ? 26  ARG F CD    1 
ATOM   9849  N NE    . ARG F 3 26  ? 118.547 -54.948  -9.168  1.00 102.08 ? 26  ARG F NE    1 
ATOM   9850  C CZ    . ARG F 3 26  ? 117.894 -54.887  -8.009  1.00 103.69 ? 26  ARG F CZ    1 
ATOM   9851  N NH1   . ARG F 3 26  ? 118.417 -55.414  -6.905  1.00 104.30 ? 26  ARG F NH1   1 
ATOM   9852  N NH2   . ARG F 3 26  ? 116.711 -54.286  -7.953  1.00 104.62 ? 26  ARG F NH2   1 
ATOM   9853  N N     . LEU F 3 27  ? 124.115 -54.937  -12.769 1.00 91.85  ? 27  LEU F N     1 
ATOM   9854  C CA    . LEU F 3 27  ? 125.554 -54.795  -12.894 1.00 90.61  ? 27  LEU F CA    1 
ATOM   9855  C C     . LEU F 3 27  ? 126.255 -55.261  -11.633 1.00 89.76  ? 27  LEU F C     1 
ATOM   9856  O O     . LEU F 3 27  ? 125.696 -55.183  -10.536 1.00 89.50  ? 27  LEU F O     1 
ATOM   9857  C CB    . LEU F 3 27  ? 125.930 -53.340  -13.167 1.00 89.87  ? 27  LEU F CB    1 
ATOM   9858  C CG    . LEU F 3 27  ? 125.754 -52.787  -14.581 1.00 90.48  ? 27  LEU F CG    1 
ATOM   9859  C CD1   . LEU F 3 27  ? 125.888 -51.287  -14.561 1.00 90.60  ? 27  LEU F CD1   1 
ATOM   9860  C CD2   . LEU F 3 27  ? 126.771 -53.368  -15.528 1.00 91.43  ? 27  LEU F CD2   1 
ATOM   9861  N N     . CYS F 3 28  ? 127.480 -55.753  -11.809 1.00 89.16  ? 28  CYS F N     1 
ATOM   9862  C CA    . CYS F 3 28  ? 128.355 -56.144  -10.707 1.00 88.06  ? 28  CYS F CA    1 
ATOM   9863  C C     . CYS F 3 28  ? 129.818 -56.072  -11.132 1.00 87.50  ? 28  CYS F C     1 
ATOM   9864  O O     . CYS F 3 28  ? 130.117 -55.990  -12.318 1.00 87.71  ? 28  CYS F O     1 
ATOM   9865  C CB    . CYS F 3 28  ? 128.002 -57.542  -10.194 1.00 88.76  ? 28  CYS F CB    1 
ATOM   9866  S SG    . CYS F 3 28  ? 127.960 -58.797  -11.459 1.00 89.68  ? 28  CYS F SG    1 
ATOM   9867  N N     . THR F 3 29  ? 130.720 -56.079  -10.160 1.00 86.74  ? 29  THR F N     1 
ATOM   9868  C CA    . THR F 3 29  ? 132.151 -56.065  -10.436 1.00 86.51  ? 29  THR F CA    1 
ATOM   9869  C C     . THR F 3 29  ? 132.830 -57.215  -9.718  1.00 86.77  ? 29  THR F C     1 
ATOM   9870  O O     . THR F 3 29  ? 132.275 -57.778  -8.783  1.00 86.80  ? 29  THR F O     1 
ATOM   9871  C CB    . THR F 3 29  ? 132.812 -54.735  -10.011 1.00 85.87  ? 29  THR F CB    1 
ATOM   9872  O OG1   . THR F 3 29  ? 132.391 -54.377  -8.686  1.00 85.39  ? 29  THR F OG1   1 
ATOM   9873  C CG2   . THR F 3 29  ? 132.443 -53.621  -10.972 1.00 85.46  ? 29  THR F CG2   1 
ATOM   9874  N N     . ARG F 3 30  ? 134.035 -57.556  -10.157 1.00 87.03  ? 30  ARG F N     1 
ATOM   9875  C CA    . ARG F 3 30  ? 134.770 -58.672  -9.577  1.00 87.64  ? 30  ARG F CA    1 
ATOM   9876  C C     . ARG F 3 30  ? 135.393 -58.265  -8.239  1.00 86.67  ? 30  ARG F C     1 
ATOM   9877  O O     . ARG F 3 30  ? 136.257 -57.379  -8.193  1.00 86.11  ? 30  ARG F O     1 
ATOM   9878  C CB    . ARG F 3 30  ? 135.840 -59.141  -10.561 1.00 88.73  ? 30  ARG F CB    1 
ATOM   9879  C CG    . ARG F 3 30  ? 136.257 -60.591  -10.409 1.00 90.96  ? 30  ARG F CG    1 
ATOM   9880  C CD    . ARG F 3 30  ? 137.185 -60.978  -11.554 1.00 94.17  ? 30  ARG F CD    1 
ATOM   9881  N NE    . ARG F 3 30  ? 137.755 -62.312  -11.381 1.00 97.43  ? 30  ARG F NE    1 
ATOM   9882  C CZ    . ARG F 3 30  ? 138.871 -62.575  -10.703 1.00 98.92  ? 30  ARG F CZ    1 
ATOM   9883  N NH1   . ARG F 3 30  ? 139.552 -61.592  -10.117 1.00 99.03  ? 30  ARG F NH1   1 
ATOM   9884  N NH2   . ARG F 3 30  ? 139.309 -63.827  -10.609 1.00 99.95  ? 30  ARG F NH2   1 
ATOM   9885  N N     . ASN F 3 31  ? 134.953 -58.922  -7.164  1.00 86.29  ? 31  ASN F N     1 
ATOM   9886  C CA    . ASN F 3 31  ? 135.351 -58.560  -5.797  1.00 85.56  ? 31  ASN F CA    1 
ATOM   9887  C C     . ASN F 3 31  ? 136.838 -58.731  -5.510  1.00 85.86  ? 31  ASN F C     1 
ATOM   9888  O O     . ASN F 3 31  ? 137.328 -59.865  -5.400  1.00 86.76  ? 31  ASN F O     1 
ATOM   9889  C CB    . ASN F 3 31  ? 134.531 -59.339  -4.760  1.00 85.84  ? 31  ASN F CB    1 
ATOM   9890  C CG    . ASN F 3 31  ? 134.572 -58.710  -3.362  1.00 85.49  ? 31  ASN F CG    1 
ATOM   9891  O OD1   . ASN F 3 31  ? 133.960 -59.230  -2.433  1.00 85.46  ? 31  ASN F OD1   1 
ATOM   9892  N ND2   . ASN F 3 31  ? 135.280 -57.589  -3.213  1.00 84.83  ? 31  ASN F ND2   1 
ATOM   9893  N N     . LEU F 3 32  ? 137.531 -57.593  -5.376  1.00 85.01  ? 32  LEU F N     1 
ATOM   9894  C CA    . LEU F 3 32  ? 138.963 -57.537  -5.057  1.00 85.09  ? 32  LEU F CA    1 
ATOM   9895  C C     . LEU F 3 32  ? 139.264 -58.026  -3.644  1.00 85.68  ? 32  LEU F C     1 
ATOM   9896  O O     . LEU F 3 32  ? 140.330 -58.589  -3.390  1.00 86.42  ? 32  LEU F O     1 
ATOM   9897  C CB    . LEU F 3 32  ? 139.494 -56.115  -5.224  1.00 84.25  ? 32  LEU F CB    1 
ATOM   9898  C CG    . LEU F 3 32  ? 141.007 -55.873  -5.221  1.00 84.06  ? 32  LEU F CG    1 
ATOM   9899  C CD1   . LEU F 3 32  ? 141.578 -55.970  -6.617  1.00 84.94  ? 32  LEU F CD1   1 
ATOM   9900  C CD2   . LEU F 3 32  ? 141.311 -54.516  -4.662  1.00 83.05  ? 32  LEU F CD2   1 
ATOM   9901  N N     . VAL F 3 33  ? 138.333 -57.799  -2.723  1.00 85.44  ? 33  VAL F N     1 
ATOM   9902  C CA    . VAL F 3 33  ? 138.455 -58.338  -1.376  1.00 86.28  ? 33  VAL F CA    1 
ATOM   9903  C C     . VAL F 3 33  ? 137.255 -59.237  -1.083  1.00 86.88  ? 33  VAL F C     1 
ATOM   9904  O O     . VAL F 3 33  ? 136.260 -58.772  -0.533  1.00 86.51  ? 33  VAL F O     1 
ATOM   9905  C CB    . VAL F 3 33  ? 138.555 -57.225  -0.310  1.00 85.83  ? 33  VAL F CB    1 
ATOM   9906  C CG1   . VAL F 3 33  ? 139.156 -57.782  0.973   1.00 86.73  ? 33  VAL F CG1   1 
ATOM   9907  C CG2   . VAL F 3 33  ? 139.380 -56.044  -0.818  1.00 85.12  ? 33  VAL F CG2   1 
ATOM   9908  N N     . PRO F 3 34  ? 137.342 -60.529  -1.460  1.00 88.06  ? 34  PRO F N     1 
ATOM   9909  C CA    . PRO F 3 34  ? 136.226 -61.456  -1.292  1.00 88.77  ? 34  PRO F CA    1 
ATOM   9910  C C     . PRO F 3 34  ? 135.765 -61.588  0.154   1.00 89.46  ? 34  PRO F C     1 
ATOM   9911  O O     . PRO F 3 34  ? 136.584 -61.542  1.075   1.00 89.82  ? 34  PRO F O     1 
ATOM   9912  C CB    . PRO F 3 34  ? 136.802 -62.782  -1.788  1.00 89.89  ? 34  PRO F CB    1 
ATOM   9913  C CG    . PRO F 3 34  ? 137.837 -62.380  -2.767  1.00 89.66  ? 34  PRO F CG    1 
ATOM   9914  C CD    . PRO F 3 34  ? 138.473 -61.177  -2.147  1.00 88.72  ? 34  PRO F CD    1 
ATOM   9915  N N     . ASN F 3 35  ? 134.453 -61.752  0.321   1.00 89.93  ? 35  ASN F N     1 
ATOM   9916  C CA    . ASN F 3 35  ? 133.768 -61.853  1.625   1.00 90.71  ? 35  ASN F CA    1 
ATOM   9917  C C     . ASN F 3 35  ? 133.440 -60.508  2.276   1.00 89.84  ? 35  ASN F C     1 
ATOM   9918  O O     . ASN F 3 35  ? 132.811 -60.474  3.333   1.00 90.26  ? 35  ASN F O     1 
ATOM   9919  C CB    . ASN F 3 35  ? 134.529 -62.758  2.609   1.00 92.02  ? 35  ASN F CB    1 
ATOM   9920  C CG    . ASN F 3 35  ? 134.829 -64.134  2.032   1.00 93.96  ? 35  ASN F CG    1 
ATOM   9921  O OD1   . ASN F 3 35  ? 133.942 -64.814  1.508   1.00 95.47  ? 35  ASN F OD1   1 
ATOM   9922  N ND2   . ASN F 3 35  ? 136.089 -64.551  2.129   1.00 95.09  ? 35  ASN F ND2   1 
ATOM   9923  N N     . PHE F 3 36  ? 133.840 -59.410  1.629   1.00 88.87  ? 36  PHE F N     1 
ATOM   9924  C CA    . PHE F 3 36  ? 133.715 -58.059  2.199   1.00 87.98  ? 36  PHE F CA    1 
ATOM   9925  C C     . PHE F 3 36  ? 133.059 -57.021  1.278   1.00 86.63  ? 36  PHE F C     1 
ATOM   9926  O O     . PHE F 3 36  ? 133.479 -56.827  0.135   1.00 86.26  ? 36  PHE F O     1 
ATOM   9927  C CB    . PHE F 3 36  ? 135.086 -57.573  2.690   1.00 88.15  ? 36  PHE F CB    1 
ATOM   9928  C CG    . PHE F 3 36  ? 135.551 -58.266  3.944   1.00 90.14  ? 36  PHE F CG    1 
ATOM   9929  C CD1   . PHE F 3 36  ? 136.295 -59.443  3.878   1.00 91.21  ? 36  PHE F CD1   1 
ATOM   9930  C CD2   . PHE F 3 36  ? 135.217 -57.756  5.198   1.00 91.21  ? 36  PHE F CD2   1 
ATOM   9931  C CE1   . PHE F 3 36  ? 136.707 -60.091  5.033   1.00 91.99  ? 36  PHE F CE1   1 
ATOM   9932  C CE2   . PHE F 3 36  ? 135.625 -58.402  6.360   1.00 92.45  ? 36  PHE F CE2   1 
ATOM   9933  C CZ    . PHE F 3 36  ? 136.372 -59.573  6.274   1.00 92.77  ? 36  PHE F CZ    1 
ATOM   9934  N N     . ASN F 3 37  ? 132.030 -56.358  1.803   1.00 85.99  ? 37  ASN F N     1 
ATOM   9935  C CA    . ASN F 3 37  ? 131.251 -55.347  1.074   1.00 84.86  ? 37  ASN F CA    1 
ATOM   9936  C C     . ASN F 3 37  ? 131.422 -53.952  1.686   1.00 84.10  ? 37  ASN F C     1 
ATOM   9937  O O     . ASN F 3 37  ? 131.504 -53.829  2.909   1.00 84.71  ? 37  ASN F O     1 
ATOM   9938  C CB    . ASN F 3 37  ? 129.765 -55.722  1.092   1.00 85.01  ? 37  ASN F CB    1 
ATOM   9939  C CG    . ASN F 3 37  ? 129.212 -55.861  2.507   1.00 85.65  ? 37  ASN F CG    1 
ATOM   9940  O OD1   . ASN F 3 37  ? 129.855 -56.440  3.384   1.00 86.45  ? 37  ASN F OD1   1 
ATOM   9941  N ND2   . ASN F 3 37  ? 128.016 -55.332  2.731   1.00 85.72  ? 37  ASN F ND2   1 
ATOM   9942  N N     . VAL F 3 38  ? 131.449 -52.905  0.854   1.00 82.84  ? 38  VAL F N     1 
ATOM   9943  C CA    . VAL F 3 38  ? 131.676 -51.530  1.359   1.00 81.71  ? 38  VAL F CA    1 
ATOM   9944  C C     . VAL F 3 38  ? 130.414 -50.812  1.856   1.00 81.05  ? 38  VAL F C     1 
ATOM   9945  O O     . VAL F 3 38  ? 130.401 -50.297  2.974   1.00 81.30  ? 38  VAL F O     1 
ATOM   9946  C CB    . VAL F 3 38  ? 132.507 -50.636  0.391   1.00 80.92  ? 38  VAL F CB    1 
ATOM   9947  C CG1   . VAL F 3 38  ? 133.845 -51.277  0.095   1.00 81.43  ? 38  VAL F CG1   1 
ATOM   9948  C CG2   . VAL F 3 38  ? 131.766 -50.369  -0.886  1.00 81.08  ? 38  VAL F CG2   1 
ATOM   9949  N N     . TYR F 3 39  ? 129.370 -50.766  1.034   1.00 80.32  ? 39  TYR F N     1 
ATOM   9950  C CA    . TYR F 3 39  ? 128.043 -50.387  1.515   1.00 80.02  ? 39  TYR F CA    1 
ATOM   9951  C C     . TYR F 3 39  ? 127.239 -51.665  1.799   1.00 81.11  ? 39  TYR F C     1 
ATOM   9952  O O     . TYR F 3 39  ? 127.819 -52.671  2.211   1.00 81.97  ? 39  TYR F O     1 
ATOM   9953  C CB    . TYR F 3 39  ? 127.336 -49.414  0.560   1.00 79.10  ? 39  TYR F CB    1 
ATOM   9954  C CG    . TYR F 3 39  ? 127.367 -49.762  -0.916  1.00 77.41  ? 39  TYR F CG    1 
ATOM   9955  C CD1   . TYR F 3 39  ? 126.215 -50.220  -1.562  1.00 76.65  ? 39  TYR F CD1   1 
ATOM   9956  C CD2   . TYR F 3 39  ? 128.527 -49.595  -1.675  1.00 75.18  ? 39  TYR F CD2   1 
ATOM   9957  C CE1   . TYR F 3 39  ? 126.222 -50.530  -2.924  1.00 75.28  ? 39  TYR F CE1   1 
ATOM   9958  C CE2   . TYR F 3 39  ? 128.551 -49.911  -3.034  1.00 74.21  ? 39  TYR F CE2   1 
ATOM   9959  C CZ    . TYR F 3 39  ? 127.391 -50.377  -3.653  1.00 74.35  ? 39  TYR F CZ    1 
ATOM   9960  O OH    . TYR F 3 39  ? 127.385 -50.687  -4.996  1.00 72.55  ? 39  TYR F OH    1 
ATOM   9961  N N     . GLY F 3 40  ? 125.931 -51.662  1.587   1.00 81.32  ? 40  GLY F N     1 
ATOM   9962  C CA    . GLY F 3 40  ? 125.154 -52.858  1.915   1.00 82.45  ? 40  GLY F CA    1 
ATOM   9963  C C     . GLY F 3 40  ? 125.063 -53.915  0.828   1.00 82.88  ? 40  GLY F C     1 
ATOM   9964  O O     . GLY F 3 40  ? 124.355 -54.908  0.995   1.00 83.83  ? 40  GLY F O     1 
ATOM   9965  N N     . GLU F 3 41  ? 125.792 -53.715  -0.271  1.00 82.57  ? 41  GLU F N     1 
ATOM   9966  C CA    . GLU F 3 41  ? 125.592 -54.468  -1.521  1.00 82.98  ? 41  GLU F CA    1 
ATOM   9967  C C     . GLU F 3 41  ? 125.641 -55.995  -1.402  1.00 84.25  ? 41  GLU F C     1 
ATOM   9968  O O     . GLU F 3 41  ? 126.272 -56.553  -0.494  1.00 84.55  ? 41  GLU F O     1 
ATOM   9969  C CB    . GLU F 3 41  ? 126.545 -53.977  -2.625  1.00 82.20  ? 41  GLU F CB    1 
ATOM   9970  C CG    . GLU F 3 41  ? 127.984 -54.503  -2.549  1.00 82.35  ? 41  GLU F CG    1 
ATOM   9971  C CD    . GLU F 3 41  ? 128.888 -53.725  -1.589  1.00 81.60  ? 41  GLU F CD    1 
ATOM   9972  O OE1   . GLU F 3 41  ? 128.382 -53.088  -0.646  1.00 81.04  ? 41  GLU F OE1   1 
ATOM   9973  O OE2   . GLU F 3 41  ? 130.123 -53.759  -1.777  1.00 81.33  ? 41  GLU F OE2   1 
ATOM   9974  N N     . ARG F 3 42  ? 124.957 -56.649  -2.339  1.00 85.12  ? 42  ARG F N     1 
ATOM   9975  C CA    . ARG F 3 42  ? 124.849 -58.095  -2.380  1.00 86.61  ? 42  ARG F CA    1 
ATOM   9976  C C     . ARG F 3 42  ? 126.147 -58.694  -2.895  1.00 86.67  ? 42  ARG F C     1 
ATOM   9977  O O     . ARG F 3 42  ? 126.710 -58.223  -3.889  1.00 86.25  ? 42  ARG F O     1 
ATOM   9978  C CB    . ARG F 3 42  ? 123.697 -58.488  -3.299  1.00 87.26  ? 42  ARG F CB    1 
ATOM   9979  C CG    . ARG F 3 42  ? 122.746 -59.537  -2.732  1.00 90.49  ? 42  ARG F CG    1 
ATOM   9980  C CD    . ARG F 3 42  ? 123.013 -60.955  -3.278  1.00 94.80  ? 42  ARG F CD    1 
ATOM   9981  N NE    . ARG F 3 42  ? 121.883 -61.862  -3.023  1.00 97.41  ? 42  ARG F NE    1 
ATOM   9982  C CZ    . ARG F 3 42  ? 120.868 -62.072  -3.866  1.00 98.13  ? 42  ARG F CZ    1 
ATOM   9983  N NH1   . ARG F 3 42  ? 120.824 -61.453  -5.040  1.00 97.75  ? 42  ARG F NH1   1 
ATOM   9984  N NH2   . ARG F 3 42  ? 119.891 -62.905  -3.536  1.00 99.12  ? 42  ARG F NH2   1 
ATOM   9985  N N     . LEU F 3 43  ? 126.631 -59.719  -2.204  1.00 87.44  ? 43  LEU F N     1 
ATOM   9986  C CA    . LEU F 3 43  ? 127.777 -60.477  -2.679  1.00 87.79  ? 43  LEU F CA    1 
ATOM   9987  C C     . LEU F 3 43  ? 127.256 -61.715  -3.397  1.00 88.99  ? 43  LEU F C     1 
ATOM   9988  O O     . LEU F 3 43  ? 126.331 -62.362  -2.911  1.00 89.75  ? 43  LEU F O     1 
ATOM   9989  C CB    . LEU F 3 43  ? 128.671 -60.876  -1.509  1.00 88.13  ? 43  LEU F CB    1 
ATOM   9990  C CG    . LEU F 3 43  ? 129.342 -59.765  -0.703  1.00 86.92  ? 43  LEU F CG    1 
ATOM   9991  C CD1   . LEU F 3 43  ? 129.891 -60.326  0.591   1.00 87.49  ? 43  LEU F CD1   1 
ATOM   9992  C CD2   . LEU F 3 43  ? 130.440 -59.089  -1.503  1.00 86.19  ? 43  LEU F CD2   1 
ATOM   9993  N N     . ILE F 3 44  ? 127.827 -62.033  -4.559  1.00 89.38  ? 44  ILE F N     1 
ATOM   9994  C CA    . ILE F 3 44  ? 127.343 -63.167  -5.367  1.00 90.65  ? 44  ILE F CA    1 
ATOM   9995  C C     . ILE F 3 44  ? 128.447 -64.087  -5.907  1.00 91.62  ? 44  ILE F C     1 
ATOM   9996  O O     . ILE F 3 44  ? 129.343 -63.641  -6.637  1.00 91.40  ? 44  ILE F O     1 
ATOM   9997  C CB    . ILE F 3 44  ? 126.403 -62.717  -6.522  1.00 90.27  ? 44  ILE F CB    1 
ATOM   9998  C CG1   . ILE F 3 44  ? 126.994 -61.516  -7.273  1.00 89.18  ? 44  ILE F CG1   1 
ATOM   9999  C CG2   . ILE F 3 44  ? 125.012 -62.417  -5.977  1.00 90.54  ? 44  ILE F CG2   1 
ATOM   10000 C CD1   . ILE F 3 44  ? 126.049 -60.809  -8.223  1.00 88.03  ? 44  ILE F CD1   1 
ATOM   10001 N N     . LYS F 3 45  ? 128.369 -65.365  -5.525  1.00 92.91  ? 45  LYS F N     1 
ATOM   10002 C CA    . LYS F 3 45  ? 129.279 -66.405  -6.014  1.00 93.90  ? 45  LYS F CA    1 
ATOM   10003 C C     . LYS F 3 45  ? 128.720 -67.092  -7.254  1.00 94.56  ? 45  LYS F C     1 
ATOM   10004 O O     . LYS F 3 45  ? 127.565 -67.523  -7.282  1.00 95.11  ? 45  LYS F O     1 
ATOM   10005 C CB    . LYS F 3 45  ? 129.578 -67.455  -4.932  1.00 94.91  ? 45  LYS F CB    1 
ATOM   10006 C CG    . LYS F 3 45  ? 130.679 -67.047  -3.964  1.00 95.16  ? 45  LYS F CG    1 
ATOM   10007 C CD    . LYS F 3 45  ? 131.518 -68.242  -3.507  1.00 96.65  ? 45  LYS F CD    1 
ATOM   10008 C CE    . LYS F 3 45  ? 132.790 -67.781  -2.796  1.00 95.93  ? 45  LYS F CE    1 
ATOM   10009 N NZ    . LYS F 3 45  ? 133.491 -68.902  -2.120  1.00 96.66  ? 45  LYS F NZ    1 
ATOM   10010 N N     . TYR F 3 46  ? 129.550 -67.182  -8.283  1.00 94.61  ? 46  TYR F N     1 
ATOM   10011 C CA    . TYR F 3 46  ? 129.207 -67.925  -9.485  1.00 95.36  ? 46  TYR F CA    1 
ATOM   10012 C C     . TYR F 3 46  ? 130.473 -68.596  -10.022 1.00 96.27  ? 46  TYR F C     1 
ATOM   10013 O O     . TYR F 3 46  ? 131.491 -67.928  -10.244 1.00 95.71  ? 46  TYR F O     1 
ATOM   10014 C CB    . TYR F 3 46  ? 128.547 -67.010  -10.530 1.00 94.32  ? 46  TYR F CB    1 
ATOM   10015 C CG    . TYR F 3 46  ? 128.240 -67.699  -11.838 1.00 94.37  ? 46  TYR F CG    1 
ATOM   10016 C CD1   . TYR F 3 46  ? 127.171 -68.590  -11.946 1.00 94.98  ? 46  TYR F CD1   1 
ATOM   10017 C CD2   . TYR F 3 46  ? 129.026 -67.471  -12.965 1.00 93.26  ? 46  TYR F CD2   1 
ATOM   10018 C CE1   . TYR F 3 46  ? 126.894 -69.232  -13.139 1.00 95.72  ? 46  TYR F CE1   1 
ATOM   10019 C CE2   . TYR F 3 46  ? 128.759 -68.106  -14.164 1.00 94.13  ? 46  TYR F CE2   1 
ATOM   10020 C CZ    . TYR F 3 46  ? 127.694 -68.986  -14.245 1.00 95.77  ? 46  TYR F CZ    1 
ATOM   10021 O OH    . TYR F 3 46  ? 127.429 -69.619  -15.439 1.00 97.57  ? 46  TYR F OH    1 
ATOM   10022 N N     . GLU F 3 47  ? 130.406 -69.913  -10.220 1.00 97.70  ? 47  GLU F N     1 
ATOM   10023 C CA    . GLU F 3 47  ? 131.579 -70.702  -10.616 1.00 98.95  ? 47  GLU F CA    1 
ATOM   10024 C C     . GLU F 3 47  ? 132.792 -70.360  -9.750  1.00 98.39  ? 47  GLU F C     1 
ATOM   10025 O O     . GLU F 3 47  ? 133.882 -70.099  -10.265 1.00 98.38  ? 47  GLU F O     1 
ATOM   10026 C CB    . GLU F 3 47  ? 131.903 -70.546  -12.111 1.00 99.26  ? 47  GLU F CB    1 
ATOM   10027 C CG    . GLU F 3 47  ? 131.151 -71.512  -13.020 1.00 101.34 ? 47  GLU F CG    1 
ATOM   10028 C CD    . GLU F 3 47  ? 131.392 -71.251  -14.500 1.00 102.47 ? 47  GLU F CD    1 
ATOM   10029 O OE1   . GLU F 3 47  ? 130.484 -71.542  -15.306 1.00 104.17 ? 47  GLU F OE1   1 
ATOM   10030 O OE2   . GLU F 3 47  ? 132.480 -70.758  -14.864 1.00 102.29 ? 47  GLU F OE2   1 
ATOM   10031 N N     . GLY F 3 48  ? 132.574 -70.338  -8.434  1.00 98.05  ? 48  GLY F N     1 
ATOM   10032 C CA    . GLY F 3 48  ? 133.637 -70.120  -7.451  1.00 97.46  ? 48  GLY F CA    1 
ATOM   10033 C C     . GLY F 3 48  ? 134.390 -68.801  -7.536  1.00 95.95  ? 48  GLY F C     1 
ATOM   10034 O O     . GLY F 3 48  ? 135.530 -68.715  -7.092  1.00 96.06  ? 48  GLY F O     1 
ATOM   10035 N N     . VAL F 3 49  ? 133.760 -67.778  -8.113  1.00 94.72  ? 49  VAL F N     1 
ATOM   10036 C CA    . VAL F 3 49  ? 134.318 -66.417  -8.144  1.00 93.16  ? 49  VAL F CA    1 
ATOM   10037 C C     . VAL F 3 49  ? 133.259 -65.441  -7.626  1.00 91.92  ? 49  VAL F C     1 
ATOM   10038 O O     . VAL F 3 49  ? 132.083 -65.552  -7.983  1.00 91.96  ? 49  VAL F O     1 
ATOM   10039 C CB    . VAL F 3 49  ? 134.829 -66.020  -9.565  1.00 93.11  ? 49  VAL F CB    1 
ATOM   10040 C CG1   . VAL F 3 49  ? 134.971 -64.513  -9.713  1.00 91.50  ? 49  VAL F CG1   1 
ATOM   10041 C CG2   . VAL F 3 49  ? 136.163 -66.702  -9.865  1.00 93.83  ? 49  VAL F CG2   1 
ATOM   10042 N N     . GLU F 3 50  ? 133.672 -64.500  -6.778  1.00 90.74  ? 50  GLU F N     1 
ATOM   10043 C CA    . GLU F 3 50  ? 132.720 -63.600  -6.126  1.00 89.55  ? 50  GLU F CA    1 
ATOM   10044 C C     . GLU F 3 50  ? 132.620 -62.212  -6.776  1.00 87.99  ? 50  GLU F C     1 
ATOM   10045 O O     . GLU F 3 50  ? 133.633 -61.583  -7.120  1.00 87.66  ? 50  GLU F O     1 
ATOM   10046 C CB    . GLU F 3 50  ? 133.023 -63.487  -4.633  1.00 89.70  ? 50  GLU F CB    1 
ATOM   10047 C CG    . GLU F 3 50  ? 131.903 -62.848  -3.815  1.00 90.28  ? 50  GLU F CG    1 
ATOM   10048 C CD    . GLU F 3 50  ? 132.209 -62.810  -2.326  1.00 92.17  ? 50  GLU F CD    1 
ATOM   10049 O OE1   . GLU F 3 50  ? 132.684 -61.759  -1.837  1.00 91.79  ? 50  GLU F OE1   1 
ATOM   10050 O OE2   . GLU F 3 50  ? 131.986 -63.838  -1.646  1.00 94.04  ? 50  GLU F OE2   1 
ATOM   10051 N N     . TYR F 3 51  ? 131.381 -61.750  -6.927  1.00 86.82  ? 51  TYR F N     1 
ATOM   10052 C CA    . TYR F 3 51  ? 131.086 -60.470  -7.557  1.00 85.24  ? 51  TYR F CA    1 
ATOM   10053 C C     . TYR F 3 51  ? 130.273 -59.558  -6.636  1.00 84.00  ? 51  TYR F C     1 
ATOM   10054 O O     . TYR F 3 51  ? 129.443 -60.027  -5.856  1.00 84.34  ? 51  TYR F O     1 
ATOM   10055 C CB    . TYR F 3 51  ? 130.331 -60.689  -8.872  1.00 85.68  ? 51  TYR F CB    1 
ATOM   10056 C CG    . TYR F 3 51  ? 131.049 -61.568  -9.876  1.00 86.49  ? 51  TYR F CG    1 
ATOM   10057 C CD1   . TYR F 3 51  ? 130.841 -62.945  -9.898  1.00 87.40  ? 51  TYR F CD1   1 
ATOM   10058 C CD2   . TYR F 3 51  ? 131.928 -61.018  -10.814 1.00 86.36  ? 51  TYR F CD2   1 
ATOM   10059 C CE1   . TYR F 3 51  ? 131.491 -63.753  -10.818 1.00 88.57  ? 51  TYR F CE1   1 
ATOM   10060 C CE2   . TYR F 3 51  ? 132.584 -61.817  -11.741 1.00 87.36  ? 51  TYR F CE2   1 
ATOM   10061 C CZ    . TYR F 3 51  ? 132.359 -63.183  -11.737 1.00 88.70  ? 51  TYR F CZ    1 
ATOM   10062 O OH    . TYR F 3 51  ? 133.007 -63.983  -12.647 1.00 90.12  ? 51  TYR F OH    1 
ATOM   10063 N N     . ARG F 3 52  ? 130.518 -58.253  -6.738  1.00 82.44  ? 52  ARG F N     1 
ATOM   10064 C CA    . ARG F 3 52  ? 129.825 -57.251  -5.927  1.00 81.17  ? 52  ARG F CA    1 
ATOM   10065 C C     . ARG F 3 52  ? 128.764 -56.525  -6.744  1.00 80.22  ? 52  ARG F C     1 
ATOM   10066 O O     . ARG F 3 52  ? 129.091 -55.856  -7.723  1.00 79.78  ? 52  ARG F O     1 
ATOM   10067 C CB    . ARG F 3 52  ? 130.819 -56.219  -5.397  1.00 80.44  ? 52  ARG F CB    1 
ATOM   10068 C CG    . ARG F 3 52  ? 131.547 -56.617  -4.149  1.00 81.01  ? 52  ARG F CG    1 
ATOM   10069 C CD    . ARG F 3 52  ? 132.619 -55.587  -3.808  1.00 82.57  ? 52  ARG F CD    1 
ATOM   10070 N NE    . ARG F 3 52  ? 132.053 -54.271  -3.496  1.00 83.24  ? 52  ARG F NE    1 
ATOM   10071 C CZ    . ARG F 3 52  ? 132.263 -53.162  -4.203  1.00 83.38  ? 52  ARG F CZ    1 
ATOM   10072 N NH1   . ARG F 3 52  ? 131.688 -52.031  -3.821  1.00 82.21  ? 52  ARG F NH1   1 
ATOM   10073 N NH2   . ARG F 3 52  ? 133.043 -53.172  -5.283  1.00 84.01  ? 52  ARG F NH2   1 
ATOM   10074 N N     . GLU F 3 53  ? 127.506 -56.632  -6.325  1.00 79.57  ? 53  GLU F N     1 
ATOM   10075 C CA    . GLU F 3 53  ? 126.409 -55.989  -7.033  1.00 78.77  ? 53  GLU F CA    1 
ATOM   10076 C C     . GLU F 3 53  ? 126.600 -54.485  -7.083  1.00 77.22  ? 53  GLU F C     1 
ATOM   10077 O O     . GLU F 3 53  ? 126.873 -53.867  -6.060  1.00 77.01  ? 53  GLU F O     1 
ATOM   10078 C CB    . GLU F 3 53  ? 125.085 -56.316  -6.372  1.00 79.12  ? 53  GLU F CB    1 
ATOM   10079 C CG    . GLU F 3 53  ? 123.928 -56.097  -7.295  1.00 81.07  ? 53  GLU F CG    1 
ATOM   10080 C CD    . GLU F 3 53  ? 122.623 -55.940  -6.560  1.00 84.52  ? 53  GLU F CD    1 
ATOM   10081 O OE1   . GLU F 3 53  ? 121.877 -54.987  -6.872  1.00 85.62  ? 53  GLU F OE1   1 
ATOM   10082 O OE2   . GLU F 3 53  ? 122.338 -56.758  -5.664  1.00 86.85  ? 53  GLU F OE2   1 
ATOM   10083 N N     . TRP F 3 54  ? 126.456 -53.908  -8.273  1.00 76.30  ? 54  TRP F N     1 
ATOM   10084 C CA    . TRP F 3 54  ? 126.721 -52.492  -8.503  1.00 74.81  ? 54  TRP F CA    1 
ATOM   10085 C C     . TRP F 3 54  ? 125.425 -51.733  -8.691  1.00 75.00  ? 54  TRP F C     1 
ATOM   10086 O O     . TRP F 3 54  ? 124.964 -51.556  -9.813  1.00 75.34  ? 54  TRP F O     1 
ATOM   10087 C CB    . TRP F 3 54  ? 127.574 -52.312  -9.756  1.00 74.43  ? 54  TRP F CB    1 
ATOM   10088 C CG    . TRP F 3 54  ? 128.293 -50.993  -9.856  1.00 72.19  ? 54  TRP F CG    1 
ATOM   10089 C CD1   . TRP F 3 54  ? 128.181 -49.929  -9.014  1.00 71.09  ? 54  TRP F CD1   1 
ATOM   10090 C CD2   . TRP F 3 54  ? 129.219 -50.597  -10.875 1.00 70.90  ? 54  TRP F CD2   1 
ATOM   10091 N NE1   . TRP F 3 54  ? 128.992 -48.900  -9.430  1.00 69.48  ? 54  TRP F NE1   1 
ATOM   10092 C CE2   . TRP F 3 54  ? 129.638 -49.281  -10.572 1.00 70.04  ? 54  TRP F CE2   1 
ATOM   10093 C CE3   . TRP F 3 54  ? 129.742 -51.228  -12.011 1.00 70.83  ? 54  TRP F CE3   1 
ATOM   10094 C CZ2   . TRP F 3 54  ? 130.556 -48.583  -11.362 1.00 70.17  ? 54  TRP F CZ2   1 
ATOM   10095 C CZ3   . TRP F 3 54  ? 130.654 -50.539  -12.793 1.00 70.59  ? 54  TRP F CZ3   1 
ATOM   10096 C CH2   . TRP F 3 54  ? 131.053 -49.228  -12.465 1.00 70.43  ? 54  TRP F CH2   1 
ATOM   10097 N N     . ASN F 3 55  ? 124.844 -51.277  -7.590  1.00 75.25  ? 55  ASN F N     1 
ATOM   10098 C CA    . ASN F 3 55  ? 123.601 -50.505  -7.613  1.00 75.61  ? 55  ASN F CA    1 
ATOM   10099 C C     . ASN F 3 55  ? 123.718 -49.161  -8.345  1.00 75.23  ? 55  ASN F C     1 
ATOM   10100 O O     . ASN F 3 55  ? 124.480 -48.285  -7.935  1.00 74.87  ? 55  ASN F O     1 
ATOM   10101 C CB    . ASN F 3 55  ? 123.131 -50.277  -6.179  1.00 75.76  ? 55  ASN F CB    1 
ATOM   10102 C CG    . ASN F 3 55  ? 121.796 -49.571  -6.104  1.00 76.49  ? 55  ASN F CG    1 
ATOM   10103 O OD1   . ASN F 3 55  ? 121.116 -49.374  -7.116  1.00 76.71  ? 55  ASN F OD1   1 
ATOM   10104 N ND2   . ASN F 3 55  ? 121.403 -49.194  -4.890  1.00 77.48  ? 55  ASN F ND2   1 
ATOM   10105 N N     . ALA F 3 56  ? 122.950 -49.000  -9.420  1.00 75.79  ? 56  ALA F N     1 
ATOM   10106 C CA    . ALA F 3 56  ? 123.033 -47.797  -10.265 1.00 75.46  ? 56  ALA F CA    1 
ATOM   10107 C C     . ALA F 3 56  ? 122.511 -46.544  -9.577  1.00 75.12  ? 56  ALA F C     1 
ATOM   10108 O O     . ALA F 3 56  ? 122.958 -45.439  -9.880  1.00 75.12  ? 56  ALA F O     1 
ATOM   10109 C CB    . ALA F 3 56  ? 122.308 -48.013  -11.582 1.00 75.98  ? 56  ALA F CB    1 
ATOM   10110 N N     . PHE F 3 57  ? 121.577 -46.717  -8.647  1.00 75.24  ? 57  PHE F N     1 
ATOM   10111 C CA    . PHE F 3 57  ? 120.975 -45.590  -7.939  1.00 75.05  ? 57  PHE F CA    1 
ATOM   10112 C C     . PHE F 3 57  ? 121.937 -44.864  -6.995  1.00 74.17  ? 57  PHE F C     1 
ATOM   10113 O O     . PHE F 3 57  ? 121.701 -43.706  -6.633  1.00 73.97  ? 57  PHE F O     1 
ATOM   10114 C CB    . PHE F 3 57  ? 119.728 -46.052  -7.194  1.00 75.82  ? 57  PHE F CB    1 
ATOM   10115 C CG    . PHE F 3 57  ? 118.601 -46.401  -8.102  1.00 77.69  ? 57  PHE F CG    1 
ATOM   10116 C CD1   . PHE F 3 57  ? 118.494 -47.687  -8.642  1.00 79.46  ? 57  PHE F CD1   1 
ATOM   10117 C CD2   . PHE F 3 57  ? 117.661 -45.439  -8.453  1.00 78.67  ? 57  PHE F CD2   1 
ATOM   10118 C CE1   . PHE F 3 57  ? 117.451 -48.017  -9.512  1.00 80.91  ? 57  PHE F CE1   1 
ATOM   10119 C CE2   . PHE F 3 57  ? 116.613 -45.751  -9.319  1.00 80.69  ? 57  PHE F CE2   1 
ATOM   10120 C CZ    . PHE F 3 57  ? 116.504 -47.046  -9.852  1.00 81.40  ? 57  PHE F CZ    1 
ATOM   10121 N N     . ARG F 3 58  ? 123.018 -45.551  -6.619  1.00 73.60  ? 58  ARG F N     1 
ATOM   10122 C CA    . ARG F 3 58  ? 124.056 -45.008  -5.734  1.00 72.65  ? 58  ARG F CA    1 
ATOM   10123 C C     . ARG F 3 58  ? 125.290 -44.541  -6.486  1.00 72.29  ? 58  ARG F C     1 
ATOM   10124 O O     . ARG F 3 58  ? 125.881 -43.499  -6.157  1.00 71.89  ? 58  ARG F O     1 
ATOM   10125 C CB    . ARG F 3 58  ? 124.507 -46.057  -4.726  1.00 72.54  ? 58  ARG F CB    1 
ATOM   10126 C CG    . ARG F 3 58  ? 123.436 -46.565  -3.816  1.00 72.24  ? 58  ARG F CG    1 
ATOM   10127 C CD    . ARG F 3 58  ? 124.094 -47.114  -2.601  1.00 71.19  ? 58  ARG F CD    1 
ATOM   10128 N NE    . ARG F 3 58  ? 123.157 -47.753  -1.701  1.00 71.64  ? 58  ARG F NE    1 
ATOM   10129 C CZ    . ARG F 3 58  ? 123.343 -47.867  -0.392  1.00 72.51  ? 58  ARG F CZ    1 
ATOM   10130 N NH1   . ARG F 3 58  ? 122.431 -48.489  0.341   1.00 74.76  ? 58  ARG F NH1   1 
ATOM   10131 N NH2   . ARG F 3 58  ? 124.426 -47.355  0.185   1.00 71.53  ? 58  ARG F NH2   1 
ATOM   10132 N N     . SER F 3 59  ? 125.693 -45.333  -7.477  1.00 72.39  ? 59  SER F N     1 
ATOM   10133 C CA    . SER F 3 59  ? 126.908 -45.059  -8.215  1.00 72.21  ? 59  SER F CA    1 
ATOM   10134 C C     . SER F 3 59  ? 126.597 -44.442  -9.567  1.00 72.31  ? 59  SER F C     1 
ATOM   10135 O O     . SER F 3 59  ? 125.887 -45.032  -10.383 1.00 72.78  ? 59  SER F O     1 
ATOM   10136 C CB    . SER F 3 59  ? 127.717 -46.332  -8.374  1.00 72.52  ? 59  SER F CB    1 
ATOM   10137 O OG    . SER F 3 59  ? 128.928 -46.061  -9.046  1.00 73.19  ? 59  SER F OG    1 
ATOM   10138 N N     . LYS F 3 60  ? 127.133 -43.247  -9.792  1.00 72.03  ? 60  LYS F N     1 
ATOM   10139 C CA    . LYS F 3 60  ? 126.870 -42.519  -11.027 1.00 72.51  ? 60  LYS F CA    1 
ATOM   10140 C C     . LYS F 3 60  ? 127.492 -43.237  -12.212 1.00 72.67  ? 60  LYS F C     1 
ATOM   10141 O O     . LYS F 3 60  ? 126.935 -43.209  -13.303 1.00 73.65  ? 60  LYS F O     1 
ATOM   10142 C CB    . LYS F 3 60  ? 127.362 -41.064  -10.965 1.00 72.40  ? 60  LYS F CB    1 
ATOM   10143 C CG    . LYS F 3 60  ? 126.517 -40.132  -10.105 1.00 73.76  ? 60  LYS F CG    1 
ATOM   10144 C CD    . LYS F 3 60  ? 126.866 -40.312  -8.619  1.00 77.20  ? 60  LYS F CD    1 
ATOM   10145 C CE    . LYS F 3 60  ? 126.204 -39.276  -7.744  1.00 78.64  ? 60  LYS F CE    1 
ATOM   10146 N NZ    . LYS F 3 60  ? 126.616 -37.891  -8.130  1.00 80.03  ? 60  LYS F NZ    1 
ATOM   10147 N N     . LEU F 3 61  ? 128.631 -43.889  -12.000 1.00 72.05  ? 61  LEU F N     1 
ATOM   10148 C CA    . LEU F 3 61  ? 129.280 -44.620  -13.079 1.00 71.96  ? 61  LEU F CA    1 
ATOM   10149 C C     . LEU F 3 61  ? 128.391 -45.767  -13.543 1.00 72.38  ? 61  LEU F C     1 
ATOM   10150 O O     . LEU F 3 61  ? 128.174 -45.931  -14.742 1.00 72.89  ? 61  LEU F O     1 
ATOM   10151 C CB    . LEU F 3 61  ? 130.652 -45.140  -12.652 1.00 71.95  ? 61  LEU F CB    1 
ATOM   10152 C CG    . LEU F 3 61  ? 131.846 -45.057  -13.609 1.00 71.50  ? 61  LEU F CG    1 
ATOM   10153 C CD1   . LEU F 3 61  ? 132.748 -46.238  -13.335 1.00 71.99  ? 61  LEU F CD1   1 
ATOM   10154 C CD2   . LEU F 3 61  ? 131.460 -45.031  -15.082 1.00 71.22  ? 61  LEU F CD2   1 
ATOM   10155 N N     . ALA F 3 62  ? 127.857 -46.541  -12.599 1.00 72.12  ? 62  ALA F N     1 
ATOM   10156 C CA    . ALA F 3 62  ? 126.929 -47.618  -12.942 1.00 72.76  ? 62  ALA F CA    1 
ATOM   10157 C C     . ALA F 3 62  ? 125.742 -47.057  -13.691 1.00 73.22  ? 62  ALA F C     1 
ATOM   10158 O O     . ALA F 3 62  ? 125.260 -47.680  -14.630 1.00 73.84  ? 62  ALA F O     1 
ATOM   10159 C CB    . ALA F 3 62  ? 126.460 -48.349  -11.716 1.00 72.49  ? 62  ALA F CB    1 
ATOM   10160 N N     . GLY F 3 63  ? 125.278 -45.879  -13.268 1.00 73.10  ? 63  GLY F N     1 
ATOM   10161 C CA    . GLY F 3 63  ? 124.187 -45.177  -13.944 1.00 73.65  ? 63  G