data_3PM0
# 
_entry.id   3PM0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3PM0         
RCSB  RCSB062537   
WWPDB D_1000062537 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2HI4 
_pdbx_database_related.details        'Human Cytochrome P450 1A2 (CYP1A2)' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3PM0 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-11-15 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, A.'      1 
'Stout, C.D.'   2 
'Johnson, E.F.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Characterization of the Complex between {alpha}-Naphthoflavone and Human Cytochrome P450 1B1.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                5736 
_citation.page_last                 5743 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21147782 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.204420 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, A.'      1 
primary 'Savas, U.'     2 
primary 'Stout, C.D.'   3 
primary 'Johnson, E.F.' 4 
# 
_cell.length_a           84.170 
_cell.length_b           103.980 
_cell.length_c           62.970 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3PM0 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.entry_id                         3PM0 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                18 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cytochrome P450 1B1'               56903.949 1  1.14.14.1 A119S ? ? 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'   616.487   1  ?         ?     ? ? 
3 non-polymer syn '2-PHENYL-4H-BENZO[H]CHROMEN-4-ONE' 272.297   1  ?         ?     ? ? 
4 water       nat water                               18.015    33 ?         ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CYPIB1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAKKTSSKGKPPGPFAWPLIGNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPSF
ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVALLVRGSADGAFLDPRPLTVVA
VANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHC
ESLRPGAAPRDMMDAFILSAEKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL
DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVVFVNQWSVNHDPLKWPNPENF
DPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNV
TLRESMELLDSAVQNLQAKETCQHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAKKTSSKGKPPGPFAWPLIGNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPSF
ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVALLVRGSADGAFLDPRPLTVVA
VANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHC
ESLRPGAAPRDMMDAFILSAEKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL
DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVVFVNQWSVNHDPLKWPNPENF
DPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNV
TLRESMELLDSAVQNLQAKETCQHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LYS n 
1 4   LYS n 
1 5   THR n 
1 6   SER n 
1 7   SER n 
1 8   LYS n 
1 9   GLY n 
1 10  LYS n 
1 11  PRO n 
1 12  PRO n 
1 13  GLY n 
1 14  PRO n 
1 15  PHE n 
1 16  ALA n 
1 17  TRP n 
1 18  PRO n 
1 19  LEU n 
1 20  ILE n 
1 21  GLY n 
1 22  ASN n 
1 23  ALA n 
1 24  ALA n 
1 25  ALA n 
1 26  VAL n 
1 27  GLY n 
1 28  GLN n 
1 29  ALA n 
1 30  ALA n 
1 31  HIS n 
1 32  LEU n 
1 33  SER n 
1 34  PHE n 
1 35  ALA n 
1 36  ARG n 
1 37  LEU n 
1 38  ALA n 
1 39  ARG n 
1 40  ARG n 
1 41  TYR n 
1 42  GLY n 
1 43  ASP n 
1 44  VAL n 
1 45  PHE n 
1 46  GLN n 
1 47  ILE n 
1 48  ARG n 
1 49  LEU n 
1 50  GLY n 
1 51  SER n 
1 52  CYS n 
1 53  PRO n 
1 54  ILE n 
1 55  VAL n 
1 56  VAL n 
1 57  LEU n 
1 58  ASN n 
1 59  GLY n 
1 60  GLU n 
1 61  ARG n 
1 62  ALA n 
1 63  ILE n 
1 64  HIS n 
1 65  GLN n 
1 66  ALA n 
1 67  LEU n 
1 68  VAL n 
1 69  GLN n 
1 70  GLN n 
1 71  GLY n 
1 72  SER n 
1 73  ALA n 
1 74  PHE n 
1 75  ALA n 
1 76  ASP n 
1 77  ARG n 
1 78  PRO n 
1 79  SER n 
1 80  PHE n 
1 81  ALA n 
1 82  SER n 
1 83  PHE n 
1 84  ARG n 
1 85  VAL n 
1 86  VAL n 
1 87  SER n 
1 88  GLY n 
1 89  GLY n 
1 90  ARG n 
1 91  SER n 
1 92  MET n 
1 93  ALA n 
1 94  PHE n 
1 95  GLY n 
1 96  HIS n 
1 97  TYR n 
1 98  SER n 
1 99  GLU n 
1 100 HIS n 
1 101 TRP n 
1 102 LYS n 
1 103 VAL n 
1 104 GLN n 
1 105 ARG n 
1 106 ARG n 
1 107 ALA n 
1 108 ALA n 
1 109 HIS n 
1 110 SER n 
1 111 MET n 
1 112 MET n 
1 113 ARG n 
1 114 ASN n 
1 115 PHE n 
1 116 PHE n 
1 117 THR n 
1 118 ARG n 
1 119 GLN n 
1 120 PRO n 
1 121 ARG n 
1 122 SER n 
1 123 ARG n 
1 124 GLN n 
1 125 VAL n 
1 126 LEU n 
1 127 GLU n 
1 128 GLY n 
1 129 HIS n 
1 130 VAL n 
1 131 LEU n 
1 132 SER n 
1 133 GLU n 
1 134 ALA n 
1 135 ARG n 
1 136 GLU n 
1 137 LEU n 
1 138 VAL n 
1 139 ALA n 
1 140 LEU n 
1 141 LEU n 
1 142 VAL n 
1 143 ARG n 
1 144 GLY n 
1 145 SER n 
1 146 ALA n 
1 147 ASP n 
1 148 GLY n 
1 149 ALA n 
1 150 PHE n 
1 151 LEU n 
1 152 ASP n 
1 153 PRO n 
1 154 ARG n 
1 155 PRO n 
1 156 LEU n 
1 157 THR n 
1 158 VAL n 
1 159 VAL n 
1 160 ALA n 
1 161 VAL n 
1 162 ALA n 
1 163 ASN n 
1 164 VAL n 
1 165 MET n 
1 166 SER n 
1 167 ALA n 
1 168 VAL n 
1 169 CYS n 
1 170 PHE n 
1 171 GLY n 
1 172 CYS n 
1 173 ARG n 
1 174 TYR n 
1 175 SER n 
1 176 HIS n 
1 177 ASP n 
1 178 ASP n 
1 179 PRO n 
1 180 GLU n 
1 181 PHE n 
1 182 ARG n 
1 183 GLU n 
1 184 LEU n 
1 185 LEU n 
1 186 SER n 
1 187 HIS n 
1 188 ASN n 
1 189 GLU n 
1 190 GLU n 
1 191 PHE n 
1 192 GLY n 
1 193 ARG n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 GLY n 
1 199 SER n 
1 200 LEU n 
1 201 VAL n 
1 202 ASP n 
1 203 VAL n 
1 204 MET n 
1 205 PRO n 
1 206 TRP n 
1 207 LEU n 
1 208 GLN n 
1 209 TYR n 
1 210 PHE n 
1 211 PRO n 
1 212 ASN n 
1 213 PRO n 
1 214 VAL n 
1 215 ARG n 
1 216 THR n 
1 217 VAL n 
1 218 PHE n 
1 219 ARG n 
1 220 GLU n 
1 221 PHE n 
1 222 GLU n 
1 223 GLN n 
1 224 LEU n 
1 225 ASN n 
1 226 ARG n 
1 227 ASN n 
1 228 PHE n 
1 229 SER n 
1 230 ASN n 
1 231 PHE n 
1 232 ILE n 
1 233 LEU n 
1 234 ASP n 
1 235 LYS n 
1 236 PHE n 
1 237 LEU n 
1 238 ARG n 
1 239 HIS n 
1 240 CYS n 
1 241 GLU n 
1 242 SER n 
1 243 LEU n 
1 244 ARG n 
1 245 PRO n 
1 246 GLY n 
1 247 ALA n 
1 248 ALA n 
1 249 PRO n 
1 250 ARG n 
1 251 ASP n 
1 252 MET n 
1 253 MET n 
1 254 ASP n 
1 255 ALA n 
1 256 PHE n 
1 257 ILE n 
1 258 LEU n 
1 259 SER n 
1 260 ALA n 
1 261 GLU n 
1 262 LYS n 
1 263 LYS n 
1 264 ALA n 
1 265 ALA n 
1 266 GLY n 
1 267 ASP n 
1 268 SER n 
1 269 HIS n 
1 270 GLY n 
1 271 GLY n 
1 272 GLY n 
1 273 ALA n 
1 274 ARG n 
1 275 LEU n 
1 276 ASP n 
1 277 LEU n 
1 278 GLU n 
1 279 ASN n 
1 280 VAL n 
1 281 PRO n 
1 282 ALA n 
1 283 THR n 
1 284 ILE n 
1 285 THR n 
1 286 ASP n 
1 287 ILE n 
1 288 PHE n 
1 289 GLY n 
1 290 ALA n 
1 291 SER n 
1 292 GLN n 
1 293 ASP n 
1 294 THR n 
1 295 LEU n 
1 296 SER n 
1 297 THR n 
1 298 ALA n 
1 299 LEU n 
1 300 GLN n 
1 301 TRP n 
1 302 LEU n 
1 303 LEU n 
1 304 LEU n 
1 305 LEU n 
1 306 PHE n 
1 307 THR n 
1 308 ARG n 
1 309 TYR n 
1 310 PRO n 
1 311 ASP n 
1 312 VAL n 
1 313 GLN n 
1 314 THR n 
1 315 ARG n 
1 316 VAL n 
1 317 GLN n 
1 318 ALA n 
1 319 GLU n 
1 320 LEU n 
1 321 ASP n 
1 322 GLN n 
1 323 VAL n 
1 324 VAL n 
1 325 GLY n 
1 326 ARG n 
1 327 ASP n 
1 328 ARG n 
1 329 LEU n 
1 330 PRO n 
1 331 CYS n 
1 332 MET n 
1 333 GLY n 
1 334 ASP n 
1 335 GLN n 
1 336 PRO n 
1 337 ASN n 
1 338 LEU n 
1 339 PRO n 
1 340 TYR n 
1 341 VAL n 
1 342 LEU n 
1 343 ALA n 
1 344 PHE n 
1 345 LEU n 
1 346 TYR n 
1 347 GLU n 
1 348 ALA n 
1 349 MET n 
1 350 ARG n 
1 351 PHE n 
1 352 SER n 
1 353 SER n 
1 354 PHE n 
1 355 VAL n 
1 356 PRO n 
1 357 VAL n 
1 358 THR n 
1 359 ILE n 
1 360 PRO n 
1 361 HIS n 
1 362 ALA n 
1 363 THR n 
1 364 THR n 
1 365 ALA n 
1 366 ASN n 
1 367 THR n 
1 368 SER n 
1 369 VAL n 
1 370 LEU n 
1 371 GLY n 
1 372 TYR n 
1 373 HIS n 
1 374 ILE n 
1 375 PRO n 
1 376 LYS n 
1 377 ASP n 
1 378 THR n 
1 379 VAL n 
1 380 VAL n 
1 381 PHE n 
1 382 VAL n 
1 383 ASN n 
1 384 GLN n 
1 385 TRP n 
1 386 SER n 
1 387 VAL n 
1 388 ASN n 
1 389 HIS n 
1 390 ASP n 
1 391 PRO n 
1 392 LEU n 
1 393 LYS n 
1 394 TRP n 
1 395 PRO n 
1 396 ASN n 
1 397 PRO n 
1 398 GLU n 
1 399 ASN n 
1 400 PHE n 
1 401 ASP n 
1 402 PRO n 
1 403 ALA n 
1 404 ARG n 
1 405 PHE n 
1 406 LEU n 
1 407 ASP n 
1 408 LYS n 
1 409 ASP n 
1 410 GLY n 
1 411 LEU n 
1 412 ILE n 
1 413 ASN n 
1 414 LYS n 
1 415 ASP n 
1 416 LEU n 
1 417 THR n 
1 418 SER n 
1 419 ARG n 
1 420 VAL n 
1 421 MET n 
1 422 ILE n 
1 423 PHE n 
1 424 SER n 
1 425 VAL n 
1 426 GLY n 
1 427 LYS n 
1 428 ARG n 
1 429 ARG n 
1 430 CYS n 
1 431 ILE n 
1 432 GLY n 
1 433 GLU n 
1 434 GLU n 
1 435 LEU n 
1 436 SER n 
1 437 LYS n 
1 438 MET n 
1 439 GLN n 
1 440 LEU n 
1 441 PHE n 
1 442 LEU n 
1 443 PHE n 
1 444 ILE n 
1 445 SER n 
1 446 ILE n 
1 447 LEU n 
1 448 ALA n 
1 449 HIS n 
1 450 GLN n 
1 451 CYS n 
1 452 ASP n 
1 453 PHE n 
1 454 ARG n 
1 455 ALA n 
1 456 ASN n 
1 457 PRO n 
1 458 ASN n 
1 459 GLU n 
1 460 PRO n 
1 461 ALA n 
1 462 LYS n 
1 463 MET n 
1 464 ASN n 
1 465 PHE n 
1 466 SER n 
1 467 TYR n 
1 468 GLY n 
1 469 LEU n 
1 470 THR n 
1 471 ILE n 
1 472 LYS n 
1 473 PRO n 
1 474 LYS n 
1 475 SER n 
1 476 PHE n 
1 477 LYS n 
1 478 VAL n 
1 479 ASN n 
1 480 VAL n 
1 481 THR n 
1 482 LEU n 
1 483 ARG n 
1 484 GLU n 
1 485 SER n 
1 486 MET n 
1 487 GLU n 
1 488 LEU n 
1 489 LEU n 
1 490 ASP n 
1 491 SER n 
1 492 ALA n 
1 493 VAL n 
1 494 GLN n 
1 495 ASN n 
1 496 LEU n 
1 497 GLN n 
1 498 ALA n 
1 499 LYS n 
1 500 GLU n 
1 501 THR n 
1 502 CYS n 
1 503 GLN n 
1 504 HIS n 
1 505 HIS n 
1 506 HIS n 
1 507 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CYP1B1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PCWORI 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CP1B1_HUMAN 
_struct_ref.pdbx_db_accession          Q16678 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PPGPFAWPLIGNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAFASFRVVSGGR
SMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVALLVRGSADGAFLDPRPLTVVAVANVMSAVCF
GCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPR
DMMDAFILSAEKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAELDQVVGRDRLP
CMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVVFVNQWSVNHDPLKWPNPENFDPARFLDKDG
LINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLD
SAVQNLQAKETCQ
;
_struct_ref.pdbx_align_begin           51 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3PM0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 11 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 503 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q16678 
_struct_ref_seq.db_align_beg                  51 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  543 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       51 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3PM0 MET A 1   ? UNP Q16678 ?   ?   'EXPRESSION TAG' 41  1  
1 3PM0 ALA A 2   ? UNP Q16678 ?   ?   'EXPRESSION TAG' 42  2  
1 3PM0 LYS A 3   ? UNP Q16678 ?   ?   'EXPRESSION TAG' 43  3  
1 3PM0 LYS A 4   ? UNP Q16678 ?   ?   'EXPRESSION TAG' 44  4  
1 3PM0 THR A 5   ? UNP Q16678 ?   ?   'EXPRESSION TAG' 45  5  
1 3PM0 SER A 6   ? UNP Q16678 ?   ?   'EXPRESSION TAG' 46  6  
1 3PM0 SER A 7   ? UNP Q16678 ?   ?   'EXPRESSION TAG' 47  7  
1 3PM0 LYS A 8   ? UNP Q16678 ?   ?   'EXPRESSION TAG' 48  8  
1 3PM0 GLY A 9   ? UNP Q16678 ?   ?   'EXPRESSION TAG' 49  9  
1 3PM0 LYS A 10  ? UNP Q16678 ?   ?   'EXPRESSION TAG' 50  10 
1 3PM0 SER A 79  ? UNP Q16678 ALA 119 'SEE REMARK 999' 119 11 
1 3PM0 HIS A 504 ? UNP Q16678 ?   ?   'EXPRESSION TAG' 544 12 
1 3PM0 HIS A 505 ? UNP Q16678 ?   ?   'EXPRESSION TAG' 545 13 
1 3PM0 HIS A 506 ? UNP Q16678 ?   ?   'EXPRESSION TAG' 546 14 
1 3PM0 HIS A 507 ? UNP Q16678 ?   ?   'EXPRESSION TAG' 547 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                             ?                                        'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                            ?                                        'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ?                                        'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ?                                        'C4 H7 N O4'       133.103 
BHF non-polymer         . '2-PHENYL-4H-BENZO[H]CHROMEN-4-ONE' '7,8-BENZOFLAVONE; ALPHA-NAPHTHOFLAVONE' 'C19 H12 O2'       272.297 
CYS 'L-peptide linking' y CYSTEINE                            ?                                        'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                           ?                                        'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ?                                        'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                             ?                                        'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'   HEME                                     'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                           ?                                        'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                               ?                                        'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ?                                        'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                             ?                                        'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                              ?                                        'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                          ?                                        'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                       ?                                        'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                             ?                                        'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                              ?                                        'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                           ?                                        'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                          ?                                        'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                            ?                                        'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                              ?                                        'C5 H11 N O2'      117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3PM0 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.42 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   49.20 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.1 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
;PEG-3350, ammonium dibasic citrate, potassium phosphate, NaCl, glycerol, beta-mercaptoethanol, alpha-naphthoflavone, CHAPS, pH 5.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2009-08-02 
_diffrn_detector.details                'Rh coated flat mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Side scattering bent cube-root I-beam single crystal' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97945 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_wavelength_list        0.97945 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
# 
_reflns.entry_id                     3PM0 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.7 
_reflns.d_resolution_low             65.5 
_reflns.number_all                   15741 
_reflns.number_obs                   15741 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.110 
_reflns.pdbx_Rsym_value              0.110 
_reflns.pdbx_netI_over_sigmaI        5.7 
_reflns.B_iso_Wilson_estimate        55.387 
_reflns.pdbx_redundancy              7.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.438 
_reflns_shell.meanI_over_sigI_obs    1.7 
_reflns_shell.pdbx_Rsym_value        0.438 
_reflns_shell.pdbx_redundancy        7.8 
_reflns_shell.number_unique_all      2267 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3PM0 
_refine.ls_d_res_high                            2.7000 
_refine.ls_d_res_low                             65.5000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.3000 
_refine.ls_number_reflns_obs                     15654 
_refine.ls_number_reflns_all                     15654 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.236 
_refine.ls_R_factor_obs                          0.236 
_refine.ls_R_factor_R_work                       0.235 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.278 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  781 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               ? 
_refine.solvent_model_param_bsol                 51.99 
_refine.solvent_model_param_ksol                 0.4 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -17.145 
_refine.aniso_B[2][2]                            27.701 
_refine.aniso_B[3][3]                            -10.557 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                104.070 
_refine.B_iso_min                                20.300 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3PM0 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.43 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.42 
_refine_analyze.Luzzati_sigma_a_free            0.44 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3655 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             33 
_refine_hist.number_atoms_total               3752 
_refine_hist.d_res_high                       2.7000 
_refine_hist.d_res_low                        65.5000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
'RMSD bond lengths'    ? 0.01 1.500 ? 'X-RAY DIFFRACTION' ? 
'RMSD bond angles'     ? 1.5  2.000 ? 'X-RAY DIFFRACTION' ? 
'RMSD dihedral angles' ? 22.4 2.000 ? 'X-RAY DIFFRACTION' ? 
'RMSD improper angles' ? 1.04 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.7 
_refine_ls_shell.d_res_low                        2.80 
_refine_ls_shell.number_reflns_obs                1463 
_refine_ls_shell.number_reflns_R_free             82 
_refine_ls_shell.R_factor_R_work                  0.3187 
_refine_ls_shell.R_factor_R_free                  0.3274 
_refine_ls_shell.R_factor_R_free_error            0.06 
_refine_ls_shell.percent_reflns_obs               94.4 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param    ? 'X-RAY DIFFRACTION' 
2 xdict_heme_relax.par ? 'X-RAY DIFFRACTION' 
3 water_rep.param      ? 'X-RAY DIFFRACTION' 
4 bhf.par              ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3PM0 
_struct.title                     
'Structural Characterization of the Complex between Alpha-Naphthoflavone and Human Cytochrome P450 1B1 (CYP1B1)' 
_struct.pdbx_descriptor           'Cytochrome P450 1B1 (E.C.1.14.14.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3PM0 
_struct_keywords.text            
'CYP1B1, P450 1B1, P450, MONOOXYGENASE, ALPHA-NAPHTHOFLAVONE, HEME, 17BETA-ESTRADIOL, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 29  ? GLY A 42  ? ALA A 69  GLY A 82  1 ? 14 
HELX_P HELX_P2  2  GLY A 59  ? VAL A 68  ? GLY A 99  VAL A 108 1 ? 10 
HELX_P HELX_P3  3  PHE A 80  ? VAL A 86  ? PHE A 120 VAL A 126 1 ? 7  
HELX_P HELX_P4  4  SER A 87  ? ARG A 90  ? SER A 127 ARG A 130 5 ? 4  
HELX_P HELX_P5  5  SER A 98  ? PHE A 115 ? SER A 138 PHE A 155 1 ? 18 
HELX_P HELX_P6  6  ARG A 121 ? GLY A 144 ? ARG A 161 GLY A 184 1 ? 24 
HELX_P HELX_P7  7  SER A 145 ? ALA A 149 ? SER A 185 ALA A 189 5 ? 5  
HELX_P HELX_P8  8  PRO A 153 ? PHE A 170 ? PRO A 193 PHE A 210 1 ? 18 
HELX_P HELX_P9  9  ASP A 178 ? LEU A 185 ? ASP A 218 LEU A 225 1 ? 8  
HELX_P HELX_P10 10 HIS A 187 ? GLY A 196 ? HIS A 227 GLY A 236 1 ? 10 
HELX_P HELX_P11 11 MET A 204 ? PHE A 210 ? MET A 244 PHE A 250 5 ? 7  
HELX_P HELX_P12 12 ASN A 212 ? LEU A 243 ? ASN A 252 LEU A 283 1 ? 32 
HELX_P HELX_P13 13 ASP A 251 ? ALA A 265 ? ASP A 291 ALA A 305 1 ? 15 
HELX_P HELX_P14 14 ASP A 276 ? GLU A 278 ? ASP A 316 GLU A 318 5 ? 3  
HELX_P HELX_P15 15 ASN A 279 ? TYR A 309 ? ASN A 319 TYR A 349 1 ? 31 
HELX_P HELX_P16 16 TYR A 309 ? VAL A 324 ? TYR A 349 VAL A 364 1 ? 16 
HELX_P HELX_P17 17 CYS A 331 ? ASN A 337 ? CYS A 371 ASN A 377 5 ? 7  
HELX_P HELX_P18 18 LEU A 338 ? SER A 353 ? LEU A 378 SER A 393 1 ? 16 
HELX_P HELX_P19 19 GLN A 384 ? HIS A 389 ? GLN A 424 HIS A 429 1 ? 6  
HELX_P HELX_P20 20 ASP A 401 ? LEU A 406 ? ASP A 441 LEU A 446 5 ? 6  
HELX_P HELX_P21 21 ASN A 413 ? SER A 418 ? ASN A 453 SER A 458 1 ? 6  
HELX_P HELX_P22 22 GLY A 432 ? GLN A 450 ? GLY A 472 GLN A 490 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            metalc1 
_struct_conn.conn_type_id                  metalc 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            430 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           HEM 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           FE 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             470 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            HEM 
_struct_conn.ptnr2_auth_seq_id             900 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.354 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 44  ? LEU A 49  ? VAL A 84  LEU A 89  
A 2 CYS A 52  ? LEU A 57  ? CYS A 92  LEU A 97  
A 3 VAL A 379 ? VAL A 382 ? VAL A 419 VAL A 422 
A 4 HIS A 361 ? ALA A 362 ? HIS A 401 ALA A 402 
B 1 THR A 367 ? VAL A 369 ? THR A 407 VAL A 409 
B 2 TYR A 372 ? ILE A 374 ? TYR A 412 ILE A 414 
C 1 CYS A 451 ? ALA A 455 ? CYS A 491 ALA A 495 
C 2 VAL A 478 ? LEU A 482 ? VAL A 518 LEU A 522 
D 1 PHE A 465 ? TYR A 467 ? PHE A 505 TYR A 507 
D 2 ILE A 471 ? PRO A 473 ? ILE A 511 PRO A 513 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 47  ? N ILE A 87  O ILE A 54  ? O ILE A 94  
A 2 3 N LEU A 57  ? N LEU A 97  O PHE A 381 ? O PHE A 421 
A 3 4 O VAL A 380 ? O VAL A 420 N HIS A 361 ? N HIS A 401 
B 1 2 N THR A 367 ? N THR A 407 O ILE A 374 ? O ILE A 414 
C 1 2 N ARG A 454 ? N ARG A 494 O ASN A 479 ? O ASN A 519 
D 1 2 N SER A 466 ? N SER A 506 O LYS A 472 ? O LYS A 512 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE HEM A 900' 
AC2 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE BHF A 800' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 25 ARG A 77  ? ARG A 117 . ? 1_555 ? 
2  AC1 25 MET A 92  ? MET A 132 . ? 1_555 ? 
3  AC1 25 ALA A 93  ? ALA A 133 . ? 1_555 ? 
4  AC1 25 TRP A 101 ? TRP A 141 . ? 1_555 ? 
5  AC1 25 ARG A 105 ? ARG A 145 . ? 1_555 ? 
6  AC1 25 MET A 112 ? MET A 152 . ? 1_555 ? 
7  AC1 25 ILE A 287 ? ILE A 327 . ? 1_555 ? 
8  AC1 25 ALA A 290 ? ALA A 330 . ? 1_555 ? 
9  AC1 25 SER A 291 ? SER A 331 . ? 1_555 ? 
10 AC1 25 THR A 294 ? THR A 334 . ? 1_555 ? 
11 AC1 25 LEU A 295 ? LEU A 335 . ? 1_555 ? 
12 AC1 25 PHE A 354 ? PHE A 394 . ? 1_555 ? 
13 AC1 25 VAL A 355 ? VAL A 395 . ? 1_555 ? 
14 AC1 25 THR A 358 ? THR A 398 . ? 1_555 ? 
15 AC1 25 ILE A 359 ? ILE A 399 . ? 1_555 ? 
16 AC1 25 HIS A 361 ? HIS A 401 . ? 1_555 ? 
17 AC1 25 GLN A 384 ? GLN A 424 . ? 1_555 ? 
18 AC1 25 ILE A 422 ? ILE A 462 . ? 1_555 ? 
19 AC1 25 PHE A 423 ? PHE A 463 . ? 1_555 ? 
20 AC1 25 SER A 424 ? SER A 464 . ? 1_555 ? 
21 AC1 25 ARG A 428 ? ARG A 468 . ? 1_555 ? 
22 AC1 25 CYS A 430 ? CYS A 470 . ? 1_555 ? 
23 AC1 25 ILE A 431 ? ILE A 471 . ? 1_555 ? 
24 AC1 25 SER A 436 ? SER A 476 . ? 1_555 ? 
25 AC1 25 BHF C .   ? BHF A 800 . ? 1_555 ? 
26 AC2 9  PHE A 94  ? PHE A 134 . ? 1_555 ? 
27 AC2 9  ASN A 188 ? ASN A 228 . ? 1_555 ? 
28 AC2 9  PHE A 191 ? PHE A 231 . ? 1_555 ? 
29 AC2 9  LEU A 224 ? LEU A 264 . ? 1_555 ? 
30 AC2 9  ASP A 286 ? ASP A 326 . ? 1_555 ? 
31 AC2 9  ALA A 290 ? ALA A 330 . ? 1_555 ? 
32 AC2 9  THR A 294 ? THR A 334 . ? 1_555 ? 
33 AC2 9  LEU A 469 ? LEU A 509 . ? 1_555 ? 
34 AC2 9  HEM B .   ? HEM A 900 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3PM0 
_atom_sites.fract_transf_matrix[1][1]   0.011881 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009617 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015881 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 28  ? -42.603 23.280 -20.036 1.00 69.05  ? 68  GLN A N   1 
ATOM   2    C  CA  . GLN A 1 28  ? -42.354 22.658 -21.329 1.00 68.24  ? 68  GLN A CA  1 
ATOM   3    C  C   . GLN A 1 28  ? -40.853 22.374 -21.502 1.00 67.17  ? 68  GLN A C   1 
ATOM   4    O  O   . GLN A 1 28  ? -40.270 22.665 -22.543 1.00 67.94  ? 68  GLN A O   1 
ATOM   5    C  CB  . GLN A 1 28  ? -42.905 23.574 -22.450 1.00 68.48  ? 68  GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 28  ? -42.879 25.074 -22.069 1.00 69.90  ? 68  GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 28  ? -43.529 25.999 -23.112 1.00 70.72  ? 68  GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 28  ? -43.932 25.539 -24.214 1.00 70.18  ? 68  GLN A OE1 1 
ATOM   9    N  NE2 . GLN A 1 28  ? -43.643 27.309 -22.778 1.00 71.61  ? 68  GLN A NE2 1 
ATOM   10   N  N   . ALA A 1 29  ? -40.240 21.803 -20.465 1.00 65.69  ? 69  ALA A N   1 
ATOM   11   C  CA  . ALA A 1 29  ? -38.815 21.450 -20.479 1.00 63.28  ? 69  ALA A CA  1 
ATOM   12   C  C   . ALA A 1 29  ? -38.607 20.176 -21.299 1.00 61.69  ? 69  ALA A C   1 
ATOM   13   O  O   . ALA A 1 29  ? -39.362 19.217 -21.166 1.00 60.93  ? 69  ALA A O   1 
ATOM   14   C  CB  . ALA A 1 29  ? -38.324 21.238 -19.057 1.00 63.05  ? 69  ALA A CB  1 
ATOM   15   N  N   . ALA A 1 30  ? -37.577 20.169 -22.136 1.00 60.24  ? 70  ALA A N   1 
ATOM   16   C  CA  . ALA A 1 30  ? -37.287 19.025 -22.999 1.00 59.18  ? 70  ALA A CA  1 
ATOM   17   C  C   . ALA A 1 30  ? -37.564 17.669 -22.357 1.00 59.03  ? 70  ALA A C   1 
ATOM   18   O  O   . ALA A 1 30  ? -38.463 16.942 -22.783 1.00 58.84  ? 70  ALA A O   1 
ATOM   19   C  CB  . ALA A 1 30  ? -35.837 19.081 -23.479 1.00 58.51  ? 70  ALA A CB  1 
ATOM   20   N  N   . HIS A 1 31  ? -36.792 17.327 -21.331 1.00 58.37  ? 71  HIS A N   1 
ATOM   21   C  CA  . HIS A 1 31  ? -36.958 16.040 -20.670 1.00 57.26  ? 71  HIS A CA  1 
ATOM   22   C  C   . HIS A 1 31  ? -38.384 15.790 -20.211 1.00 57.62  ? 71  HIS A C   1 
ATOM   23   O  O   . HIS A 1 31  ? -38.754 14.648 -19.940 1.00 59.01  ? 71  HIS A O   1 
ATOM   24   C  CB  . HIS A 1 31  ? -36.029 15.931 -19.473 1.00 55.87  ? 71  HIS A CB  1 
ATOM   25   C  CG  . HIS A 1 31  ? -36.204 17.030 -18.474 1.00 57.06  ? 71  HIS A CG  1 
ATOM   26   N  ND1 . HIS A 1 31  ? -36.748 16.822 -17.225 1.00 57.25  ? 71  HIS A ND1 1 
ATOM   27   C  CD2 . HIS A 1 31  ? -35.928 18.353 -18.546 1.00 58.27  ? 71  HIS A CD2 1 
ATOM   28   C  CE1 . HIS A 1 31  ? -36.803 17.971 -16.574 1.00 57.45  ? 71  HIS A CE1 1 
ATOM   29   N  NE2 . HIS A 1 31  ? -36.312 18.916 -17.353 1.00 57.75  ? 71  HIS A NE2 1 
ATOM   30   N  N   . LEU A 1 32  ? -39.184 16.846 -20.117 1.00 56.61  ? 72  LEU A N   1 
ATOM   31   C  CA  . LEU A 1 32  ? -40.561 16.695 -19.673 1.00 55.77  ? 72  LEU A CA  1 
ATOM   32   C  C   . LEU A 1 32  ? -41.463 16.283 -20.830 1.00 55.21  ? 72  LEU A C   1 
ATOM   33   O  O   . LEU A 1 32  ? -42.310 15.408 -20.675 1.00 55.29  ? 72  LEU A O   1 
ATOM   34   C  CB  . LEU A 1 32  ? -41.072 17.997 -19.029 1.00 56.38  ? 72  LEU A CB  1 
ATOM   35   C  CG  . LEU A 1 32  ? -40.381 18.462 -17.732 1.00 56.44  ? 72  LEU A CG  1 
ATOM   36   C  CD1 . LEU A 1 32  ? -41.069 19.697 -17.171 1.00 53.70  ? 72  LEU A CD1 1 
ATOM   37   C  CD2 . LEU A 1 32  ? -40.412 17.335 -16.710 1.00 55.84  ? 72  LEU A CD2 1 
ATOM   38   N  N   . SER A 1 33  ? -41.269 16.899 -21.993 1.00 54.48  ? 73  SER A N   1 
ATOM   39   C  CA  . SER A 1 33  ? -42.076 16.568 -23.160 1.00 53.65  ? 73  SER A CA  1 
ATOM   40   C  C   . SER A 1 33  ? -41.800 15.133 -23.581 1.00 54.77  ? 73  SER A C   1 
ATOM   41   O  O   . SER A 1 33  ? -42.734 14.368 -23.843 1.00 56.16  ? 73  SER A O   1 
ATOM   42   C  CB  . SER A 1 33  ? -41.769 17.519 -24.321 1.00 51.37  ? 73  SER A CB  1 
ATOM   43   O  OG  . SER A 1 33  ? -42.070 18.854 -23.972 1.00 47.63  ? 73  SER A OG  1 
ATOM   44   N  N   . PHE A 1 34  ? -40.517 14.772 -23.635 1.00 55.06  ? 74  PHE A N   1 
ATOM   45   C  CA  . PHE A 1 34  ? -40.100 13.421 -24.025 1.00 54.36  ? 74  PHE A CA  1 
ATOM   46   C  C   . PHE A 1 34  ? -40.749 12.343 -23.167 1.00 54.55  ? 74  PHE A C   1 
ATOM   47   O  O   . PHE A 1 34  ? -41.294 11.375 -23.691 1.00 54.92  ? 74  PHE A O   1 
ATOM   48   C  CB  . PHE A 1 34  ? -38.579 13.265 -23.929 1.00 52.12  ? 74  PHE A CB  1 
ATOM   49   C  CG  . PHE A 1 34  ? -37.805 14.241 -24.772 1.00 49.91  ? 74  PHE A CG  1 
ATOM   50   C  CD1 . PHE A 1 34  ? -38.315 14.697 -25.986 1.00 49.05  ? 74  PHE A CD1 1 
ATOM   51   C  CD2 . PHE A 1 34  ? -36.540 14.665 -24.375 1.00 47.09  ? 74  PHE A CD2 1 
ATOM   52   C  CE1 . PHE A 1 34  ? -37.574 15.555 -26.790 1.00 48.58  ? 74  PHE A CE1 1 
ATOM   53   C  CE2 . PHE A 1 34  ? -35.795 15.522 -25.175 1.00 47.08  ? 74  PHE A CE2 1 
ATOM   54   C  CZ  . PHE A 1 34  ? -36.310 15.967 -26.383 1.00 46.78  ? 74  PHE A CZ  1 
ATOM   55   N  N   . ALA A 1 35  ? -40.678 12.510 -21.852 1.00 54.79  ? 75  ALA A N   1 
ATOM   56   C  CA  . ALA A 1 35  ? -41.256 11.545 -20.927 1.00 56.53  ? 75  ALA A CA  1 
ATOM   57   C  C   . ALA A 1 35  ? -42.775 11.473 -21.102 1.00 57.78  ? 75  ALA A C   1 
ATOM   58   O  O   . ALA A 1 35  ? -43.392 10.433 -20.845 1.00 58.65  ? 75  ALA A O   1 
ATOM   59   C  CB  . ALA A 1 35  ? -40.910 11.926 -19.497 1.00 55.48  ? 75  ALA A CB  1 
ATOM   60   N  N   . ARG A 1 36  ? -43.361 12.587 -21.540 1.00 58.48  ? 76  ARG A N   1 
ATOM   61   C  CA  . ARG A 1 36  ? -44.797 12.705 -21.776 1.00 58.33  ? 76  ARG A CA  1 
ATOM   62   C  C   . ARG A 1 36  ? -45.148 12.000 -23.089 1.00 58.41  ? 76  ARG A C   1 
ATOM   63   O  O   . ARG A 1 36  ? -46.128 11.264 -23.157 1.00 59.12  ? 76  ARG A O   1 
ATOM   64   C  CB  . ARG A 1 36  ? -45.181 14.183 -21.867 1.00 59.41  ? 76  ARG A CB  1 
ATOM   65   C  CG  . ARG A 1 36  ? -46.654 14.450 -22.123 1.00 63.12  ? 76  ARG A CG  1 
ATOM   66   C  CD  . ARG A 1 36  ? -46.880 15.664 -23.044 1.00 66.09  ? 76  ARG A CD  1 
ATOM   67   N  NE  . ARG A 1 36  ? -45.938 16.750 -22.763 1.00 70.01  ? 76  ARG A NE  1 
ATOM   68   C  CZ  . ARG A 1 36  ? -46.221 18.055 -22.822 1.00 70.01  ? 76  ARG A CZ  1 
ATOM   69   N  NH1 . ARG A 1 36  ? -47.441 18.474 -23.153 1.00 68.83  ? 76  ARG A NH1 1 
ATOM   70   N  NH2 . ARG A 1 36  ? -45.270 18.947 -22.549 1.00 69.64  ? 76  ARG A NH2 1 
ATOM   71   N  N   . LEU A 1 37  ? -44.350 12.231 -24.131 1.00 57.61  ? 77  LEU A N   1 
ATOM   72   C  CA  . LEU A 1 37  ? -44.586 11.605 -25.435 1.00 57.70  ? 77  LEU A CA  1 
ATOM   73   C  C   . LEU A 1 37  ? -44.404 10.087 -25.345 1.00 57.36  ? 77  LEU A C   1 
ATOM   74   O  O   . LEU A 1 37  ? -44.874 9.330  -26.198 1.00 56.88  ? 77  LEU A O   1 
ATOM   75   C  CB  . LEU A 1 37  ? -43.612 12.159 -26.486 1.00 57.16  ? 77  LEU A CB  1 
ATOM   76   C  CG  . LEU A 1 37  ? -43.630 13.661 -26.794 1.00 57.05  ? 77  LEU A CG  1 
ATOM   77   C  CD1 . LEU A 1 37  ? -42.515 14.000 -27.776 1.00 57.14  ? 77  LEU A CD1 1 
ATOM   78   C  CD2 . LEU A 1 37  ? -44.970 14.057 -27.374 1.00 56.56  ? 77  LEU A CD2 1 
ATOM   79   N  N   . ALA A 1 38  ? -43.716 9.653  -24.300 1.00 56.74  ? 78  ALA A N   1 
ATOM   80   C  CA  . ALA A 1 38  ? -43.448 8.246  -24.100 1.00 56.39  ? 78  ALA A CA  1 
ATOM   81   C  C   . ALA A 1 38  ? -44.643 7.517  -23.497 1.00 56.83  ? 78  ALA A C   1 
ATOM   82   O  O   . ALA A 1 38  ? -44.714 6.289  -23.519 1.00 56.73  ? 78  ALA A O   1 
ATOM   83   C  CB  . ALA A 1 38  ? -42.236 8.091  -23.213 1.00 56.44  ? 78  ALA A CB  1 
ATOM   84   N  N   . ARG A 1 39  ? -45.584 8.281  -22.949 1.00 57.23  ? 79  ARG A N   1 
ATOM   85   C  CA  . ARG A 1 39  ? -46.782 7.708  -22.340 1.00 57.75  ? 79  ARG A CA  1 
ATOM   86   C  C   . ARG A 1 39  ? -47.832 7.402  -23.403 1.00 57.71  ? 79  ARG A C   1 
ATOM   87   O  O   . ARG A 1 39  ? -48.968 7.043  -23.094 1.00 58.85  ? 79  ARG A O   1 
ATOM   88   C  CB  . ARG A 1 39  ? -47.358 8.659  -21.289 1.00 58.20  ? 79  ARG A CB  1 
ATOM   89   C  CG  . ARG A 1 39  ? -46.920 8.350  -19.867 1.00 60.18  ? 79  ARG A CG  1 
ATOM   90   C  CD  . ARG A 1 39  ? -47.696 9.181  -18.857 1.00 62.28  ? 79  ARG A CD  1 
ATOM   91   N  NE  . ARG A 1 39  ? -47.228 10.563 -18.812 1.00 63.93  ? 79  ARG A NE  1 
ATOM   92   C  CZ  . ARG A 1 39  ? -48.029 11.622 -18.774 1.00 63.80  ? 79  ARG A CZ  1 
ATOM   93   N  NH1 . ARG A 1 39  ? -49.345 11.461 -18.776 1.00 62.83  ? 79  ARG A NH1 1 
ATOM   94   N  NH2 . ARG A 1 39  ? -47.516 12.844 -18.734 1.00 64.62  ? 79  ARG A NH2 1 
ATOM   95   N  N   . ARG A 1 40  ? -47.435 7.554  -24.662 1.00 58.01  ? 80  ARG A N   1 
ATOM   96   C  CA  . ARG A 1 40  ? -48.328 7.305  -25.786 1.00 58.55  ? 80  ARG A CA  1 
ATOM   97   C  C   . ARG A 1 40  ? -47.617 6.564  -26.914 1.00 57.77  ? 80  ARG A C   1 
ATOM   98   O  O   . ARG A 1 40  ? -48.229 5.760  -27.618 1.00 58.00  ? 80  ARG A O   1 
ATOM   99   C  CB  . ARG A 1 40  ? -48.911 8.620  -26.308 1.00 60.56  ? 80  ARG A CB  1 
ATOM   100  C  CG  . ARG A 1 40  ? -49.900 8.451  -27.449 1.00 65.13  ? 80  ARG A CG  1 
ATOM   101  C  CD  . ARG A 1 40  ? -50.099 9.754  -28.205 1.00 68.89  ? 80  ARG A CD  1 
ATOM   102  N  NE  . ARG A 1 40  ? -51.071 10.624 -27.550 1.00 73.45  ? 80  ARG A NE  1 
ATOM   103  C  CZ  . ARG A 1 40  ? -51.778 11.559 -28.175 1.00 75.81  ? 80  ARG A CZ  1 
ATOM   104  N  NH1 . ARG A 1 40  ? -51.624 11.749 -29.479 1.00 75.49  ? 80  ARG A NH1 1 
ATOM   105  N  NH2 . ARG A 1 40  ? -52.640 12.305 -27.498 1.00 76.76  ? 80  ARG A NH2 1 
ATOM   106  N  N   . TYR A 1 41  ? -46.326 6.834  -27.087 1.00 56.75  ? 81  TYR A N   1 
ATOM   107  C  CA  . TYR A 1 41  ? -45.558 6.177  -28.146 1.00 55.82  ? 81  TYR A CA  1 
ATOM   108  C  C   . TYR A 1 41  ? -44.455 5.275  -27.622 1.00 55.68  ? 81  TYR A C   1 
ATOM   109  O  O   . TYR A 1 41  ? -43.603 4.815  -28.386 1.00 56.22  ? 81  TYR A O   1 
ATOM   110  C  CB  . TYR A 1 41  ? -44.836 7.216  -28.992 1.00 55.45  ? 81  TYR A CB  1 
ATOM   111  C  CG  . TYR A 1 41  ? -45.786 8.205  -29.598 1.00 56.14  ? 81  TYR A CG  1 
ATOM   112  C  CD1 . TYR A 1 41  ? -46.693 7.811  -30.575 1.00 56.87  ? 81  TYR A CD1 1 
ATOM   113  C  CD2 . TYR A 1 41  ? -45.831 9.521  -29.144 1.00 56.38  ? 81  TYR A CD2 1 
ATOM   114  C  CE1 . TYR A 1 41  ? -47.624 8.695  -31.083 1.00 57.74  ? 81  TYR A CE1 1 
ATOM   115  C  CE2 . TYR A 1 41  ? -46.756 10.415 -29.641 1.00 56.87  ? 81  TYR A CE2 1 
ATOM   116  C  CZ  . TYR A 1 41  ? -47.652 9.998  -30.611 1.00 58.47  ? 81  TYR A CZ  1 
ATOM   117  O  OH  . TYR A 1 41  ? -48.587 10.883 -31.105 1.00 60.26  ? 81  TYR A OH  1 
ATOM   118  N  N   . GLY A 1 42  ? -44.478 5.011  -26.323 1.00 54.85  ? 82  GLY A N   1 
ATOM   119  C  CA  . GLY A 1 42  ? -43.470 4.151  -25.735 1.00 55.48  ? 82  GLY A CA  1 
ATOM   120  C  C   . GLY A 1 42  ? -42.144 4.792  -25.374 1.00 54.95  ? 82  GLY A C   1 
ATOM   121  O  O   . GLY A 1 42  ? -41.930 5.973  -25.622 1.00 54.82  ? 82  GLY A O   1 
ATOM   122  N  N   . ASP A 1 43  ? -41.250 4.008  -24.790 1.00 55.26  ? 83  ASP A N   1 
ATOM   123  C  CA  . ASP A 1 43  ? -39.946 4.511  -24.394 1.00 55.22  ? 83  ASP A CA  1 
ATOM   124  C  C   . ASP A 1 43  ? -39.093 5.010  -25.568 1.00 54.21  ? 83  ASP A C   1 
ATOM   125  O  O   . ASP A 1 43  ? -38.428 6.036  -25.447 1.00 53.82  ? 83  ASP A O   1 
ATOM   126  C  CB  . ASP A 1 43  ? -39.205 3.431  -23.602 1.00 57.38  ? 83  ASP A CB  1 
ATOM   127  C  CG  . ASP A 1 43  ? -39.935 3.058  -22.309 1.00 60.25  ? 83  ASP A CG  1 
ATOM   128  O  OD1 . ASP A 1 43  ? -40.403 3.991  -21.611 1.00 61.30  ? 83  ASP A OD1 1 
ATOM   129  O  OD2 . ASP A 1 43  ? -40.042 1.849  -21.984 1.00 60.55  ? 83  ASP A OD2 1 
ATOM   130  N  N   . VAL A 1 44  ? -39.129 4.295  -26.696 1.00 52.78  ? 84  VAL A N   1 
ATOM   131  C  CA  . VAL A 1 44  ? -38.370 4.651  -27.905 1.00 50.11  ? 84  VAL A CA  1 
ATOM   132  C  C   . VAL A 1 44  ? -39.270 5.286  -28.964 1.00 49.08  ? 84  VAL A C   1 
ATOM   133  O  O   . VAL A 1 44  ? -40.317 4.744  -29.302 1.00 50.19  ? 84  VAL A O   1 
ATOM   134  C  CB  . VAL A 1 44  ? -37.683 3.396  -28.544 1.00 48.91  ? 84  VAL A CB  1 
ATOM   135  C  CG1 . VAL A 1 44  ? -37.215 3.709  -29.955 1.00 48.39  ? 84  VAL A CG1 1 
ATOM   136  C  CG2 . VAL A 1 44  ? -36.501 2.960  -27.702 1.00 48.64  ? 84  VAL A CG2 1 
ATOM   137  N  N   . PHE A 1 45  ? -38.852 6.431  -29.483 1.00 48.11  ? 85  PHE A N   1 
ATOM   138  C  CA  . PHE A 1 45  ? -39.593 7.157  -30.516 1.00 48.05  ? 85  PHE A CA  1 
ATOM   139  C  C   . PHE A 1 45  ? -38.674 8.258  -31.053 1.00 49.32  ? 85  PHE A C   1 
ATOM   140  O  O   . PHE A 1 45  ? -37.589 8.475  -30.526 1.00 49.77  ? 85  PHE A O   1 
ATOM   141  C  CB  . PHE A 1 45  ? -40.875 7.777  -29.945 1.00 43.95  ? 85  PHE A CB  1 
ATOM   142  C  CG  . PHE A 1 45  ? -40.628 8.836  -28.914 1.00 41.90  ? 85  PHE A CG  1 
ATOM   143  C  CD1 . PHE A 1 45  ? -40.176 10.103 -29.284 1.00 41.27  ? 85  PHE A CD1 1 
ATOM   144  C  CD2 . PHE A 1 45  ? -40.828 8.566  -27.569 1.00 39.84  ? 85  PHE A CD2 1 
ATOM   145  C  CE1 . PHE A 1 45  ? -39.926 11.090 -28.321 1.00 39.58  ? 85  PHE A CE1 1 
ATOM   146  C  CE2 . PHE A 1 45  ? -40.578 9.548  -26.597 1.00 41.38  ? 85  PHE A CE2 1 
ATOM   147  C  CZ  . PHE A 1 45  ? -40.126 10.813 -26.977 1.00 40.14  ? 85  PHE A CZ  1 
ATOM   148  N  N   . GLN A 1 46  ? -39.101 8.958  -32.095 1.00 51.20  ? 86  GLN A N   1 
ATOM   149  C  CA  . GLN A 1 46  ? -38.260 10.003 -32.653 1.00 52.62  ? 86  GLN A CA  1 
ATOM   150  C  C   . GLN A 1 46  ? -38.975 11.320 -32.826 1.00 52.76  ? 86  GLN A C   1 
ATOM   151  O  O   . GLN A 1 46  ? -40.152 11.356 -33.163 1.00 54.45  ? 86  GLN A O   1 
ATOM   152  C  CB  . GLN A 1 46  ? -37.704 9.565  -34.000 1.00 52.80  ? 86  GLN A CB  1 
ATOM   153  C  CG  . GLN A 1 46  ? -38.750 9.338  -35.040 1.00 54.29  ? 86  GLN A CG  1 
ATOM   154  C  CD  . GLN A 1 46  ? -38.143 8.891  -36.358 1.00 57.18  ? 86  GLN A CD  1 
ATOM   155  O  OE1 . GLN A 1 46  ? -36.920 8.867  -36.514 1.00 58.42  ? 86  GLN A OE1 1 
ATOM   156  N  NE2 . GLN A 1 46  ? -38.997 8.533  -37.317 1.00 56.58  ? 86  GLN A NE2 1 
ATOM   157  N  N   . ILE A 1 47  ? -38.253 12.395 -32.545 1.00 52.17  ? 87  ILE A N   1 
ATOM   158  C  CA  . ILE A 1 47  ? -38.780 13.735 -32.681 1.00 50.75  ? 87  ILE A CA  1 
ATOM   159  C  C   . ILE A 1 47  ? -37.982 14.381 -33.791 1.00 50.69  ? 87  ILE A C   1 
ATOM   160  O  O   . ILE A 1 47  ? -37.071 13.768 -34.347 1.00 50.99  ? 87  ILE A O   1 
ATOM   161  C  CB  . ILE A 1 47  ? -38.610 14.547 -31.388 1.00 49.19  ? 87  ILE A CB  1 
ATOM   162  C  CG1 . ILE A 1 47  ? -37.129 14.666 -31.023 1.00 48.93  ? 87  ILE A CG1 1 
ATOM   163  C  CG2 . ILE A 1 47  ? -39.393 13.908 -30.251 1.00 48.91  ? 87  ILE A CG2 1 
ATOM   164  C  CD1 . ILE A 1 47  ? -36.836 15.744 -30.003 1.00 48.08  ? 87  ILE A CD1 1 
ATOM   165  N  N   . ARG A 1 48  ? -38.318 15.618 -34.119 1.00 51.55  ? 88  ARG A N   1 
ATOM   166  C  CA  . ARG A 1 48  ? -37.608 16.311 -35.173 1.00 53.31  ? 88  ARG A CA  1 
ATOM   167  C  C   . ARG A 1 48  ? -37.368 17.743 -34.742 1.00 53.30  ? 88  ARG A C   1 
ATOM   168  O  O   . ARG A 1 48  ? -38.317 18.492 -34.525 1.00 54.41  ? 88  ARG A O   1 
ATOM   169  C  CB  . ARG A 1 48  ? -38.364 16.309 -36.498 1.00 54.79  ? 88  ARG A CB  1 
ATOM   170  C  CG  . ARG A 1 48  ? -37.384 16.438 -37.660 1.00 60.28  ? 88  ARG A CG  1 
ATOM   171  C  CD  . ARG A 1 48  ? -37.958 17.109 -38.882 1.00 64.55  ? 88  ARG A CD  1 
ATOM   172  N  NE  . ARG A 1 48  ? -38.997 16.328 -39.541 1.00 68.41  ? 88  ARG A NE  1 
ATOM   173  C  CZ  . ARG A 1 48  ? -39.429 16.568 -40.780 1.00 71.77  ? 88  ARG A CZ  1 
ATOM   174  N  NH1 . ARG A 1 48  ? -38.899 17.568 -41.491 1.00 71.66  ? 88  ARG A NH1 1 
ATOM   175  N  NH2 . ARG A 1 48  ? -40.398 15.818 -41.311 1.00 72.82  ? 88  ARG A NH2 1 
ATOM   176  N  N   . LEU A 1 49  ? -36.098 18.104 -34.578 1.00 52.78  ? 89  LEU A N   1 
ATOM   177  C  CA  . LEU A 1 49  ? -35.710 19.464 -34.210 1.00 52.04  ? 89  LEU A CA  1 
ATOM   178  C  C   . LEU A 1 49  ? -35.270 20.080 -35.519 1.00 51.83  ? 89  LEU A C   1 
ATOM   179  O  O   . LEU A 1 49  ? -34.188 19.786 -36.013 1.00 51.15  ? 89  LEU A O   1 
ATOM   180  C  CB  . LEU A 1 49  ? -34.529 19.451 -33.256 1.00 52.36  ? 89  LEU A CB  1 
ATOM   181  C  CG  . LEU A 1 49  ? -34.741 18.880 -31.865 1.00 52.37  ? 89  LEU A CG  1 
ATOM   182  C  CD1 . LEU A 1 49  ? -33.403 18.525 -31.283 1.00 53.16  ? 89  LEU A CD1 1 
ATOM   183  C  CD2 . LEU A 1 49  ? -35.472 19.888 -30.994 1.00 52.87  ? 89  LEU A CD2 1 
ATOM   184  N  N   . GLY A 1 50  ? -36.103 20.932 -36.091 1.00 52.82  ? 90  GLY A N   1 
ATOM   185  C  CA  . GLY A 1 50  ? -35.738 21.512 -37.365 1.00 54.26  ? 90  GLY A CA  1 
ATOM   186  C  C   . GLY A 1 50  ? -35.532 20.415 -38.406 1.00 55.44  ? 90  GLY A C   1 
ATOM   187  O  O   . GLY A 1 50  ? -36.472 19.706 -38.786 1.00 54.95  ? 90  GLY A O   1 
ATOM   188  N  N   . SER A 1 51  ? -34.289 20.254 -38.849 1.00 56.26  ? 91  SER A N   1 
ATOM   189  C  CA  . SER A 1 51  ? -33.962 19.271 -39.886 1.00 57.18  ? 91  SER A CA  1 
ATOM   190  C  C   . SER A 1 51  ? -33.513 17.918 -39.368 1.00 57.06  ? 91  SER A C   1 
ATOM   191  O  O   . SER A 1 51  ? -33.517 16.934 -40.114 1.00 57.19  ? 91  SER A O   1 
ATOM   192  C  CB  . SER A 1 51  ? -32.869 19.821 -40.821 1.00 57.51  ? 91  SER A CB  1 
ATOM   193  O  OG  . SER A 1 51  ? -31.641 20.033 -40.133 1.00 55.68  ? 91  SER A OG  1 
ATOM   194  N  N   . CYS A 1 52  ? -33.115 17.864 -38.103 1.00 56.18  ? 92  CYS A N   1 
ATOM   195  C  CA  . CYS A 1 52  ? -32.645 16.611 -37.549 1.00 55.42  ? 92  CYS A CA  1 
ATOM   196  C  C   . CYS A 1 52  ? -33.689 15.795 -36.817 1.00 54.44  ? 92  CYS A C   1 
ATOM   197  O  O   . CYS A 1 52  ? -34.434 16.287 -35.971 1.00 53.44  ? 92  CYS A O   1 
ATOM   198  C  CB  . CYS A 1 52  ? -31.424 16.836 -36.646 1.00 55.26  ? 92  CYS A CB  1 
ATOM   199  S  SG  . CYS A 1 52  ? -29.899 16.132 -37.358 1.00 58.09  ? 92  CYS A SG  1 
ATOM   200  N  N   . PRO A 1 53  ? -33.788 14.524 -37.188 1.00 53.84  ? 93  PRO A N   1 
ATOM   201  C  CA  . PRO A 1 53  ? -34.749 13.630 -36.547 1.00 53.42  ? 93  PRO A CA  1 
ATOM   202  C  C   . PRO A 1 53  ? -34.001 12.916 -35.425 1.00 52.42  ? 93  PRO A C   1 
ATOM   203  O  O   . PRO A 1 53  ? -33.135 12.075 -35.689 1.00 52.29  ? 93  PRO A O   1 
ATOM   204  C  CB  . PRO A 1 53  ? -35.135 12.689 -37.679 1.00 54.65  ? 93  PRO A CB  1 
ATOM   205  C  CG  . PRO A 1 53  ? -33.834 12.559 -38.458 1.00 53.20  ? 93  PRO A CG  1 
ATOM   206  C  CD  . PRO A 1 53  ? -33.328 13.988 -38.484 1.00 52.53  ? 93  PRO A CD  1 
ATOM   207  N  N   . ILE A 1 54  ? -34.313 13.264 -34.180 1.00 50.83  ? 94  ILE A N   1 
ATOM   208  C  CA  . ILE A 1 54  ? -33.643 12.646 -33.043 1.00 49.04  ? 94  ILE A CA  1 
ATOM   209  C  C   . ILE A 1 54  ? -34.477 11.507 -32.482 1.00 48.72  ? 94  ILE A C   1 
ATOM   210  O  O   . ILE A 1 54  ? -35.705 11.575 -32.478 1.00 49.00  ? 94  ILE A O   1 
ATOM   211  C  CB  . ILE A 1 54  ? -33.413 13.635 -31.897 1.00 47.78  ? 94  ILE A CB  1 
ATOM   212  C  CG1 . ILE A 1 54  ? -33.133 15.037 -32.438 1.00 47.50  ? 94  ILE A CG1 1 
ATOM   213  C  CG2 . ILE A 1 54  ? -32.260 13.165 -31.066 1.00 47.88  ? 94  ILE A CG2 1 
ATOM   214  C  CD1 . ILE A 1 54  ? -31.946 15.119 -33.307 1.00 48.27  ? 94  ILE A CD1 1 
ATOM   215  N  N   . VAL A 1 55  ? -33.793 10.466 -32.017 1.00 47.62  ? 95  VAL A N   1 
ATOM   216  C  CA  . VAL A 1 55  ? -34.425 9.297  -31.423 1.00 46.81  ? 95  VAL A CA  1 
ATOM   217  C  C   . VAL A 1 55  ? -34.172 9.336  -29.913 1.00 46.32  ? 95  VAL A C   1 
ATOM   218  O  O   . VAL A 1 55  ? -33.045 9.130  -29.440 1.00 47.28  ? 95  VAL A O   1 
ATOM   219  C  CB  . VAL A 1 55  ? -33.844 7.977  -32.022 1.00 48.13  ? 95  VAL A CB  1 
ATOM   220  C  CG1 . VAL A 1 55  ? -34.091 6.795  -31.071 1.00 47.01  ? 95  VAL A CG1 1 
ATOM   221  C  CG2 . VAL A 1 55  ? -34.493 7.693  -33.378 1.00 47.69  ? 95  VAL A CG2 1 
ATOM   222  N  N   . VAL A 1 56  ? -35.229 9.605  -29.163 1.00 44.40  ? 96  VAL A N   1 
ATOM   223  C  CA  . VAL A 1 56  ? -35.142 9.685  -27.718 1.00 42.91  ? 96  VAL A CA  1 
ATOM   224  C  C   . VAL A 1 56  ? -35.337 8.333  -27.017 1.00 43.07  ? 96  VAL A C   1 
ATOM   225  O  O   . VAL A 1 56  ? -36.199 7.552  -27.397 1.00 41.94  ? 96  VAL A O   1 
ATOM   226  C  CB  . VAL A 1 56  ? -36.185 10.686 -27.183 1.00 41.24  ? 96  VAL A CB  1 
ATOM   227  C  CG1 . VAL A 1 56  ? -36.020 10.873 -25.679 1.00 38.79  ? 96  VAL A CG1 1 
ATOM   228  C  CG2 . VAL A 1 56  ? -36.035 12.001 -27.910 1.00 38.46  ? 96  VAL A CG2 1 
ATOM   229  N  N   . LEU A 1 57  ? -34.509 8.073  -26.002 1.00 43.30  ? 97  LEU A N   1 
ATOM   230  C  CA  . LEU A 1 57  ? -34.567 6.854  -25.186 1.00 42.02  ? 97  LEU A CA  1 
ATOM   231  C  C   . LEU A 1 57  ? -35.098 7.340  -23.861 1.00 42.08  ? 97  LEU A C   1 
ATOM   232  O  O   . LEU A 1 57  ? -34.573 8.303  -23.318 1.00 42.51  ? 97  LEU A O   1 
ATOM   233  C  CB  . LEU A 1 57  ? -33.171 6.284  -24.959 1.00 40.50  ? 97  LEU A CB  1 
ATOM   234  C  CG  . LEU A 1 57  ? -32.394 6.043  -26.239 1.00 38.67  ? 97  LEU A CG  1 
ATOM   235  C  CD1 . LEU A 1 57  ? -31.006 5.548  -25.919 1.00 36.13  ? 97  LEU A CD1 1 
ATOM   236  C  CD2 . LEU A 1 57  ? -33.189 5.061  -27.092 1.00 37.98  ? 97  LEU A CD2 1 
ATOM   237  N  N   . ASN A 1 58  ? -36.116 6.682  -23.323 1.00 43.65  ? 98  ASN A N   1 
ATOM   238  C  CA  . ASN A 1 58  ? -36.686 7.144  -22.074 1.00 45.66  ? 98  ASN A CA  1 
ATOM   239  C  C   . ASN A 1 58  ? -36.629 6.255  -20.846 1.00 48.02  ? 98  ASN A C   1 
ATOM   240  O  O   . ASN A 1 58  ? -36.444 6.759  -19.730 1.00 49.99  ? 98  ASN A O   1 
ATOM   241  C  CB  . ASN A 1 58  ? -38.117 7.587  -22.324 1.00 45.43  ? 98  ASN A CB  1 
ATOM   242  C  CG  . ASN A 1 58  ? -38.186 8.811  -23.206 1.00 45.73  ? 98  ASN A CG  1 
ATOM   243  O  OD1 . ASN A 1 58  ? -37.695 9.875  -22.845 1.00 45.19  ? 98  ASN A OD1 1 
ATOM   244  N  ND2 . ASN A 1 58  ? -38.787 8.665  -24.377 1.00 46.63  ? 98  ASN A ND2 1 
ATOM   245  N  N   . GLY A 1 59  ? -36.768 4.945  -21.010 1.00 49.10  ? 99  GLY A N   1 
ATOM   246  C  CA  . GLY A 1 59  ? -36.737 4.103  -19.822 1.00 50.17  ? 99  GLY A CA  1 
ATOM   247  C  C   . GLY A 1 59  ? -35.378 3.539  -19.487 1.00 50.79  ? 99  GLY A C   1 
ATOM   248  O  O   . GLY A 1 59  ? -34.409 3.790  -20.188 1.00 50.37  ? 99  GLY A O   1 
ATOM   249  N  N   . GLU A 1 60  ? -35.293 2.771  -18.413 1.00 52.70  ? 100 GLU A N   1 
ATOM   250  C  CA  . GLU A 1 60  ? -34.018 2.184  -18.070 1.00 55.41  ? 100 GLU A CA  1 
ATOM   251  C  C   . GLU A 1 60  ? -33.687 1.049  -19.029 1.00 56.10  ? 100 GLU A C   1 
ATOM   252  O  O   . GLU A 1 60  ? -32.569 0.978  -19.548 1.00 56.84  ? 100 GLU A O   1 
ATOM   253  C  CB  . GLU A 1 60  ? -34.002 1.669  -16.632 1.00 57.55  ? 100 GLU A CB  1 
ATOM   254  C  CG  . GLU A 1 60  ? -32.637 1.114  -16.222 1.00 63.79  ? 100 GLU A CG  1 
ATOM   255  C  CD  . GLU A 1 60  ? -32.429 1.076  -14.705 1.00 69.02  ? 100 GLU A CD  1 
ATOM   256  O  OE1 . GLU A 1 60  ? -32.451 2.161  -14.062 1.00 70.76  ? 100 GLU A OE1 1 
ATOM   257  O  OE2 . GLU A 1 60  ? -32.238 -0.041 -14.155 1.00 71.40  ? 100 GLU A OE2 1 
ATOM   258  N  N   . ARG A 1 61  ? -34.647 0.167  -19.295 1.00 56.03  ? 101 ARG A N   1 
ATOM   259  C  CA  . ARG A 1 61  ? -34.347 -0.935 -20.201 1.00 56.12  ? 101 ARG A CA  1 
ATOM   260  C  C   . ARG A 1 61  ? -33.936 -0.503 -21.593 1.00 54.05  ? 101 ARG A C   1 
ATOM   261  O  O   . ARG A 1 61  ? -33.135 -1.170 -22.229 1.00 53.36  ? 101 ARG A O   1 
ATOM   262  C  CB  . ARG A 1 61  ? -35.512 -1.920 -20.291 1.00 58.59  ? 101 ARG A CB  1 
ATOM   263  C  CG  . ARG A 1 61  ? -35.625 -2.831 -19.062 1.00 63.33  ? 101 ARG A CG  1 
ATOM   264  C  CD  . ARG A 1 61  ? -34.242 -3.328 -18.514 1.00 65.24  ? 101 ARG A CD  1 
ATOM   265  N  NE  . ARG A 1 61  ? -33.364 -3.893 -19.545 1.00 67.27  ? 101 ARG A NE  1 
ATOM   266  C  CZ  . ARG A 1 61  ? -33.753 -4.751 -20.490 1.00 67.83  ? 101 ARG A CZ  1 
ATOM   267  N  NH1 . ARG A 1 61  ? -35.021 -5.164 -20.553 1.00 66.94  ? 101 ARG A NH1 1 
ATOM   268  N  NH2 . ARG A 1 61  ? -32.873 -5.185 -21.387 1.00 66.84  ? 101 ARG A NH2 1 
ATOM   269  N  N   . ALA A 1 62  ? -34.477 0.611  -22.066 1.00 52.90  ? 102 ALA A N   1 
ATOM   270  C  CA  . ALA A 1 62  ? -34.127 1.101  -23.392 1.00 51.93  ? 102 ALA A CA  1 
ATOM   271  C  C   . ALA A 1 62  ? -32.753 1.761  -23.322 1.00 51.18  ? 102 ALA A C   1 
ATOM   272  O  O   . ALA A 1 62  ? -31.901 1.548  -24.186 1.00 50.33  ? 102 ALA A O   1 
ATOM   273  C  CB  . ALA A 1 62  ? -35.170 2.106  -23.874 1.00 52.53  ? 102 ALA A CB  1 
ATOM   274  N  N   . ILE A 1 63  ? -32.556 2.560  -22.274 1.00 50.26  ? 103 ILE A N   1 
ATOM   275  C  CA  . ILE A 1 63  ? -31.308 3.276  -22.048 1.00 47.85  ? 103 ILE A CA  1 
ATOM   276  C  C   . ILE A 1 63  ? -30.182 2.287  -21.825 1.00 48.65  ? 103 ILE A C   1 
ATOM   277  O  O   . ILE A 1 63  ? -29.069 2.462  -22.347 1.00 48.40  ? 103 ILE A O   1 
ATOM   278  C  CB  . ILE A 1 63  ? -31.435 4.218  -20.831 1.00 45.09  ? 103 ILE A CB  1 
ATOM   279  C  CG1 . ILE A 1 63  ? -32.073 5.536  -21.270 1.00 42.59  ? 103 ILE A CG1 1 
ATOM   280  C  CG2 . ILE A 1 63  ? -30.085 4.455  -20.200 1.00 45.62  ? 103 ILE A CG2 1 
ATOM   281  C  CD1 . ILE A 1 63  ? -32.561 6.381  -20.135 1.00 40.62  ? 103 ILE A CD1 1 
ATOM   282  N  N   . HIS A 1 64  ? -30.480 1.243  -21.058 1.00 48.25  ? 104 HIS A N   1 
ATOM   283  C  CA  . HIS A 1 64  ? -29.496 0.220  -20.762 1.00 48.86  ? 104 HIS A CA  1 
ATOM   284  C  C   . HIS A 1 64  ? -29.248 -0.705 -21.937 1.00 48.44  ? 104 HIS A C   1 
ATOM   285  O  O   . HIS A 1 64  ? -28.155 -1.243 -22.059 1.00 48.87  ? 104 HIS A O   1 
ATOM   286  C  CB  . HIS A 1 64  ? -29.932 -0.600 -19.552 1.00 50.51  ? 104 HIS A CB  1 
ATOM   287  C  CG  . HIS A 1 64  ? -29.096 -1.822 -19.307 1.00 50.84  ? 104 HIS A CG  1 
ATOM   288  N  ND1 . HIS A 1 64  ? -29.008 -2.860 -20.210 1.00 51.25  ? 104 HIS A ND1 1 
ATOM   289  C  CD2 . HIS A 1 64  ? -28.349 -2.191 -18.240 1.00 50.60  ? 104 HIS A CD2 1 
ATOM   290  C  CE1 . HIS A 1 64  ? -28.248 -3.818 -19.709 1.00 50.13  ? 104 HIS A CE1 1 
ATOM   291  N  NE2 . HIS A 1 64  ? -27.837 -3.437 -18.515 1.00 50.16  ? 104 HIS A NE2 1 
ATOM   292  N  N   . GLN A 1 65  ? -30.246 -0.888 -22.802 1.00 48.61  ? 105 GLN A N   1 
ATOM   293  C  CA  . GLN A 1 65  ? -30.101 -1.774 -23.967 1.00 47.70  ? 105 GLN A CA  1 
ATOM   294  C  C   . GLN A 1 65  ? -29.326 -1.091 -25.092 1.00 46.83  ? 105 GLN A C   1 
ATOM   295  O  O   . GLN A 1 65  ? -28.653 -1.747 -25.888 1.00 47.88  ? 105 GLN A O   1 
ATOM   296  C  CB  . GLN A 1 65  ? -31.473 -2.234 -24.483 1.00 48.64  ? 105 GLN A CB  1 
ATOM   297  C  CG  . GLN A 1 65  ? -31.391 -3.340 -25.537 1.00 52.27  ? 105 GLN A CG  1 
ATOM   298  C  CD  . GLN A 1 65  ? -32.742 -3.732 -26.127 1.00 53.69  ? 105 GLN A CD  1 
ATOM   299  O  OE1 . GLN A 1 65  ? -33.379 -2.957 -26.842 1.00 54.55  ? 105 GLN A OE1 1 
ATOM   300  N  NE2 . GLN A 1 65  ? -33.180 -4.945 -25.827 1.00 55.64  ? 105 GLN A NE2 1 
ATOM   301  N  N   . ALA A 1 66  ? -29.427 0.229  -25.168 1.00 45.02  ? 106 ALA A N   1 
ATOM   302  C  CA  . ALA A 1 66  ? -28.694 0.969  -26.175 1.00 42.54  ? 106 ALA A CA  1 
ATOM   303  C  C   . ALA A 1 66  ? -27.292 1.232  -25.633 1.00 42.72  ? 106 ALA A C   1 
ATOM   304  O  O   . ALA A 1 66  ? -26.317 0.666  -26.111 1.00 42.46  ? 106 ALA A O   1 
ATOM   305  C  CB  . ALA A 1 66  ? -29.385 2.280  -26.473 1.00 41.81  ? 106 ALA A CB  1 
ATOM   306  N  N   . LEU A 1 67  ? -27.196 2.072  -24.608 1.00 42.50  ? 107 LEU A N   1 
ATOM   307  C  CA  . LEU A 1 67  ? -25.893 2.423  -24.047 1.00 42.66  ? 107 LEU A CA  1 
ATOM   308  C  C   . LEU A 1 67  ? -25.037 1.324  -23.427 1.00 43.78  ? 107 LEU A C   1 
ATOM   309  O  O   . LEU A 1 67  ? -23.810 1.455  -23.395 1.00 43.54  ? 107 LEU A O   1 
ATOM   310  C  CB  . LEU A 1 67  ? -26.042 3.546  -23.020 1.00 40.46  ? 107 LEU A CB  1 
ATOM   311  C  CG  . LEU A 1 67  ? -26.676 4.820  -23.547 1.00 38.28  ? 107 LEU A CG  1 
ATOM   312  C  CD1 . LEU A 1 67  ? -26.324 5.986  -22.626 1.00 37.18  ? 107 LEU A CD1 1 
ATOM   313  C  CD2 . LEU A 1 67  ? -26.198 5.064  -24.941 1.00 34.55  ? 107 LEU A CD2 1 
ATOM   314  N  N   . VAL A 1 68  ? -25.661 0.275  -22.908 1.00 44.91  ? 108 VAL A N   1 
ATOM   315  C  CA  . VAL A 1 68  ? -24.906 -0.787 -22.253 1.00 47.26  ? 108 VAL A CA  1 
ATOM   316  C  C   . VAL A 1 68  ? -24.740 -2.019 -23.132 1.00 49.52  ? 108 VAL A C   1 
ATOM   317  O  O   . VAL A 1 68  ? -23.648 -2.306 -23.622 1.00 49.87  ? 108 VAL A O   1 
ATOM   318  C  CB  . VAL A 1 68  ? -25.563 -1.207 -20.924 1.00 46.97  ? 108 VAL A CB  1 
ATOM   319  C  CG1 . VAL A 1 68  ? -24.681 -2.203 -20.188 1.00 46.14  ? 108 VAL A CG1 1 
ATOM   320  C  CG2 . VAL A 1 68  ? -25.838 0.014  -20.060 1.00 47.00  ? 108 VAL A CG2 1 
ATOM   321  N  N   . GLN A 1 69  ? -25.834 -2.744 -23.319 1.00 52.07  ? 109 GLN A N   1 
ATOM   322  C  CA  . GLN A 1 69  ? -25.825 -3.959 -24.102 1.00 52.91  ? 109 GLN A CA  1 
ATOM   323  C  C   . GLN A 1 69  ? -25.317 -3.741 -25.527 1.00 53.56  ? 109 GLN A C   1 
ATOM   324  O  O   . GLN A 1 69  ? -24.540 -4.539 -26.047 1.00 53.64  ? 109 GLN A O   1 
ATOM   325  C  CB  . GLN A 1 69  ? -27.221 -4.565 -24.052 1.00 53.35  ? 109 GLN A CB  1 
ATOM   326  C  CG  . GLN A 1 69  ? -27.557 -5.014 -22.638 1.00 54.97  ? 109 GLN A CG  1 
ATOM   327  C  CD  . GLN A 1 69  ? -28.908 -5.661 -22.530 1.00 58.18  ? 109 GLN A CD  1 
ATOM   328  O  OE1 . GLN A 1 69  ? -29.937 -4.992 -22.618 1.00 61.13  ? 109 GLN A OE1 1 
ATOM   329  N  NE2 . GLN A 1 69  ? -28.922 -6.976 -22.348 1.00 59.60  ? 109 GLN A NE2 1 
ATOM   330  N  N   . GLN A 1 70  ? -25.732 -2.653 -26.156 1.00 55.01  ? 110 GLN A N   1 
ATOM   331  C  CA  . GLN A 1 70  ? -25.268 -2.337 -27.507 1.00 55.89  ? 110 GLN A CA  1 
ATOM   332  C  C   . GLN A 1 70  ? -24.343 -1.123 -27.453 1.00 56.89  ? 110 GLN A C   1 
ATOM   333  O  O   . GLN A 1 70  ? -24.190 -0.396 -28.441 1.00 56.64  ? 110 GLN A O   1 
ATOM   334  C  CB  . GLN A 1 70  ? -26.443 -2.011 -28.410 1.00 57.01  ? 110 GLN A CB  1 
ATOM   335  C  CG  . GLN A 1 70  ? -27.393 -3.147 -28.609 1.00 57.57  ? 110 GLN A CG  1 
ATOM   336  C  CD  . GLN A 1 70  ? -28.312 -2.885 -29.769 1.00 57.87  ? 110 GLN A CD  1 
ATOM   337  O  OE1 . GLN A 1 70  ? -28.180 -3.494 -30.840 1.00 57.39  ? 110 GLN A OE1 1 
ATOM   338  N  NE2 . GLN A 1 70  ? -29.273 -1.990 -29.560 1.00 57.59  ? 110 GLN A NE2 1 
ATOM   339  N  N   . GLY A 1 71  ? -23.764 -0.894 -26.272 1.00 57.81  ? 111 GLY A N   1 
ATOM   340  C  CA  . GLY A 1 71  ? -22.848 0.215  -26.070 1.00 56.84  ? 111 GLY A CA  1 
ATOM   341  C  C   . GLY A 1 71  ? -21.747 0.107  -27.101 1.00 56.94  ? 111 GLY A C   1 
ATOM   342  O  O   . GLY A 1 71  ? -21.108 -0.956 -27.242 1.00 56.22  ? 111 GLY A O   1 
ATOM   343  N  N   . SER A 1 72  ? -21.521 1.194  -27.828 1.00 55.69  ? 112 SER A N   1 
ATOM   344  C  CA  . SER A 1 72  ? -20.533 1.224  -28.894 1.00 54.76  ? 112 SER A CA  1 
ATOM   345  C  C   . SER A 1 72  ? -21.278 1.606  -30.161 1.00 53.38  ? 112 SER A C   1 
ATOM   346  O  O   . SER A 1 72  ? -20.759 2.324  -31.016 1.00 54.30  ? 112 SER A O   1 
ATOM   347  C  CB  . SER A 1 72  ? -19.871 -0.144 -29.057 1.00 55.03  ? 112 SER A CB  1 
ATOM   348  O  OG  . SER A 1 72  ? -18.837 -0.099 -30.025 1.00 57.43  ? 112 SER A OG  1 
ATOM   349  N  N   . ALA A 1 73  ? -22.511 1.121  -30.261 1.00 52.34  ? 113 ALA A N   1 
ATOM   350  C  CA  . ALA A 1 73  ? -23.382 1.437  -31.381 1.00 51.34  ? 113 ALA A CA  1 
ATOM   351  C  C   . ALA A 1 73  ? -23.886 2.824  -31.086 1.00 49.49  ? 113 ALA A C   1 
ATOM   352  O  O   . ALA A 1 73  ? -24.219 3.580  -31.990 1.00 49.57  ? 113 ALA A O   1 
ATOM   353  C  CB  . ALA A 1 73  ? -24.561 0.457  -31.448 1.00 50.92  ? 113 ALA A CB  1 
ATOM   354  N  N   . PHE A 1 74  ? -23.907 3.148  -29.797 1.00 48.18  ? 114 PHE A N   1 
ATOM   355  C  CA  . PHE A 1 74  ? -24.398 4.434  -29.324 1.00 46.73  ? 114 PHE A CA  1 
ATOM   356  C  C   . PHE A 1 74  ? -23.334 5.296  -28.631 1.00 44.75  ? 114 PHE A C   1 
ATOM   357  O  O   . PHE A 1 74  ? -23.645 6.307  -28.006 1.00 43.69  ? 114 PHE A O   1 
ATOM   358  C  CB  . PHE A 1 74  ? -25.582 4.180  -28.386 1.00 47.04  ? 114 PHE A CB  1 
ATOM   359  C  CG  . PHE A 1 74  ? -26.791 3.600  -29.081 1.00 48.50  ? 114 PHE A CG  1 
ATOM   360  C  CD1 . PHE A 1 74  ? -26.756 2.321  -29.617 1.00 49.44  ? 114 PHE A CD1 1 
ATOM   361  C  CD2 . PHE A 1 74  ? -27.965 4.338  -29.207 1.00 48.08  ? 114 PHE A CD2 1 
ATOM   362  C  CE1 . PHE A 1 74  ? -27.867 1.790  -30.262 1.00 48.24  ? 114 PHE A CE1 1 
ATOM   363  C  CE2 . PHE A 1 74  ? -29.074 3.808  -29.853 1.00 47.59  ? 114 PHE A CE2 1 
ATOM   364  C  CZ  . PHE A 1 74  ? -29.024 2.536  -30.379 1.00 47.02  ? 114 PHE A CZ  1 
ATOM   365  N  N   . ALA A 1 75  ? -22.075 4.907  -28.781 1.00 43.04  ? 115 ALA A N   1 
ATOM   366  C  CA  . ALA A 1 75  ? -20.982 5.618  -28.145 1.00 41.70  ? 115 ALA A CA  1 
ATOM   367  C  C   . ALA A 1 75  ? -20.426 6.805  -28.927 1.00 40.68  ? 115 ALA A C   1 
ATOM   368  O  O   . ALA A 1 75  ? -19.357 7.313  -28.596 1.00 42.17  ? 115 ALA A O   1 
ATOM   369  C  CB  . ALA A 1 75  ? -19.851 4.637  -27.820 1.00 39.72  ? 115 ALA A CB  1 
ATOM   370  N  N   . ASP A 1 76  ? -21.121 7.263  -29.954 1.00 38.64  ? 116 ASP A N   1 
ATOM   371  C  CA  . ASP A 1 76  ? -20.595 8.399  -30.698 1.00 38.92  ? 116 ASP A CA  1 
ATOM   372  C  C   . ASP A 1 76  ? -21.202 9.737  -30.269 1.00 37.67  ? 116 ASP A C   1 
ATOM   373  O  O   . ASP A 1 76  ? -22.006 9.802  -29.340 1.00 36.49  ? 116 ASP A O   1 
ATOM   374  C  CB  . ASP A 1 76  ? -20.799 8.195  -32.201 1.00 38.72  ? 116 ASP A CB  1 
ATOM   375  C  CG  . ASP A 1 76  ? -19.860 9.057  -33.039 1.00 40.32  ? 116 ASP A CG  1 
ATOM   376  O  OD1 . ASP A 1 76  ? -18.722 9.313  -32.594 1.00 41.16  ? 116 ASP A OD1 1 
ATOM   377  O  OD2 . ASP A 1 76  ? -20.241 9.465  -34.152 1.00 40.84  ? 116 ASP A OD2 1 
ATOM   378  N  N   . ARG A 1 77  ? -20.776 10.808 -30.931 1.00 36.94  ? 117 ARG A N   1 
ATOM   379  C  CA  . ARG A 1 77  ? -21.297 12.143 -30.651 1.00 36.04  ? 117 ARG A CA  1 
ATOM   380  C  C   . ARG A 1 77  ? -21.792 12.679 -31.975 1.00 35.31  ? 117 ARG A C   1 
ATOM   381  O  O   . ARG A 1 77  ? -21.226 12.382 -33.017 1.00 33.53  ? 117 ARG A O   1 
ATOM   382  C  CB  . ARG A 1 77  ? -20.218 13.069 -30.090 1.00 34.64  ? 117 ARG A CB  1 
ATOM   383  C  CG  . ARG A 1 77  ? -19.745 12.724 -28.687 1.00 34.59  ? 117 ARG A CG  1 
ATOM   384  C  CD  . ARG A 1 77  ? -20.878 12.806 -27.657 1.00 34.12  ? 117 ARG A CD  1 
ATOM   385  N  NE  . ARG A 1 77  ? -20.385 12.598 -26.289 1.00 33.49  ? 117 ARG A NE  1 
ATOM   386  C  CZ  . ARG A 1 77  ? -21.167 12.284 -25.258 1.00 34.25  ? 117 ARG A CZ  1 
ATOM   387  N  NH1 . ARG A 1 77  ? -22.471 12.143 -25.439 1.00 34.26  ? 117 ARG A NH1 1 
ATOM   388  N  NH2 . ARG A 1 77  ? -20.652 12.103 -24.049 1.00 34.63  ? 117 ARG A NH2 1 
ATOM   389  N  N   . PRO A 1 78  ? -22.874 13.458 -31.955 1.00 35.35  ? 118 PRO A N   1 
ATOM   390  C  CA  . PRO A 1 78  ? -23.409 14.009 -33.202 1.00 36.27  ? 118 PRO A CA  1 
ATOM   391  C  C   . PRO A 1 78  ? -22.431 14.993 -33.838 1.00 36.47  ? 118 PRO A C   1 
ATOM   392  O  O   . PRO A 1 78  ? -21.633 15.623 -33.148 1.00 36.95  ? 118 PRO A O   1 
ATOM   393  C  CB  . PRO A 1 78  ? -24.701 14.696 -32.760 1.00 36.96  ? 118 PRO A CB  1 
ATOM   394  C  CG  . PRO A 1 78  ? -25.074 13.958 -31.507 1.00 38.67  ? 118 PRO A CG  1 
ATOM   395  C  CD  . PRO A 1 78  ? -23.742 13.781 -30.818 1.00 36.15  ? 118 PRO A CD  1 
ATOM   396  N  N   . SER A 1 79  ? -22.520 15.129 -35.153 1.00 35.96  ? 119 SER A N   1 
ATOM   397  C  CA  . SER A 1 79  ? -21.660 16.023 -35.909 1.00 35.55  ? 119 SER A CA  1 
ATOM   398  C  C   . SER A 1 79  ? -22.132 17.468 -35.876 1.00 34.75  ? 119 SER A C   1 
ATOM   399  O  O   . SER A 1 79  ? -22.286 18.093 -36.914 1.00 33.73  ? 119 SER A O   1 
ATOM   400  C  CB  . SER A 1 79  ? -21.593 15.549 -37.354 1.00 36.87  ? 119 SER A CB  1 
ATOM   401  O  OG  . SER A 1 79  ? -21.109 14.217 -37.404 1.00 41.55  ? 119 SER A OG  1 
ATOM   402  N  N   . PHE A 1 80  ? -22.351 17.988 -34.674 1.00 34.06  ? 120 PHE A N   1 
ATOM   403  C  CA  . PHE A 1 80  ? -22.799 19.358 -34.482 1.00 33.76  ? 120 PHE A CA  1 
ATOM   404  C  C   . PHE A 1 80  ? -21.641 20.354 -34.520 1.00 34.31  ? 120 PHE A C   1 
ATOM   405  O  O   . PHE A 1 80  ? -20.656 20.206 -33.807 1.00 35.63  ? 120 PHE A O   1 
ATOM   406  C  CB  . PHE A 1 80  ? -23.520 19.481 -33.143 1.00 33.03  ? 120 PHE A CB  1 
ATOM   407  C  CG  . PHE A 1 80  ? -24.770 18.651 -33.046 1.00 31.19  ? 120 PHE A CG  1 
ATOM   408  C  CD1 . PHE A 1 80  ? -25.446 18.243 -34.188 1.00 31.39  ? 120 PHE A CD1 1 
ATOM   409  C  CD2 . PHE A 1 80  ? -25.318 18.345 -31.806 1.00 29.59  ? 120 PHE A CD2 1 
ATOM   410  C  CE1 . PHE A 1 80  ? -26.657 17.548 -34.086 1.00 30.99  ? 120 PHE A CE1 1 
ATOM   411  C  CE2 . PHE A 1 80  ? -26.520 17.658 -31.700 1.00 28.17  ? 120 PHE A CE2 1 
ATOM   412  C  CZ  . PHE A 1 80  ? -27.193 17.261 -32.839 1.00 28.67  ? 120 PHE A CZ  1 
ATOM   413  N  N   . ALA A 1 81  ? -21.770 21.386 -35.341 1.00 33.93  ? 121 ALA A N   1 
ATOM   414  C  CA  . ALA A 1 81  ? -20.713 22.381 -35.457 1.00 32.44  ? 121 ALA A CA  1 
ATOM   415  C  C   . ALA A 1 81  ? -20.258 22.943 -34.137 1.00 31.96  ? 121 ALA A C   1 
ATOM   416  O  O   . ALA A 1 81  ? -19.086 23.255 -33.983 1.00 33.37  ? 121 ALA A O   1 
ATOM   417  C  CB  . ALA A 1 81  ? -21.149 23.514 -36.349 1.00 33.08  ? 121 ALA A CB  1 
ATOM   418  N  N   . SER A 1 82  ? -21.171 23.078 -33.184 1.00 31.64  ? 122 SER A N   1 
ATOM   419  C  CA  . SER A 1 82  ? -20.811 23.641 -31.897 1.00 33.22  ? 122 SER A CA  1 
ATOM   420  C  C   . SER A 1 82  ? -19.908 22.706 -31.091 1.00 33.86  ? 122 SER A C   1 
ATOM   421  O  O   . SER A 1 82  ? -18.983 23.174 -30.433 1.00 35.06  ? 122 SER A O   1 
ATOM   422  C  CB  . SER A 1 82  ? -22.064 24.007 -31.085 1.00 33.66  ? 122 SER A CB  1 
ATOM   423  O  OG  . SER A 1 82  ? -22.659 22.881 -30.446 1.00 36.57  ? 122 SER A OG  1 
ATOM   424  N  N   . PHE A 1 83  ? -20.161 21.401 -31.130 1.00 33.66  ? 123 PHE A N   1 
ATOM   425  C  CA  . PHE A 1 83  ? -19.320 20.466 -30.379 1.00 34.89  ? 123 PHE A CA  1 
ATOM   426  C  C   . PHE A 1 83  ? -17.855 20.651 -30.749 1.00 37.98  ? 123 PHE A C   1 
ATOM   427  O  O   . PHE A 1 83  ? -16.964 20.598 -29.891 1.00 39.28  ? 123 PHE A O   1 
ATOM   428  C  CB  . PHE A 1 83  ? -19.679 19.013 -30.685 1.00 30.94  ? 123 PHE A CB  1 
ATOM   429  C  CG  . PHE A 1 83  ? -20.939 18.553 -30.063 1.00 28.59  ? 123 PHE A CG  1 
ATOM   430  C  CD1 . PHE A 1 83  ? -21.201 17.189 -29.964 1.00 29.17  ? 123 PHE A CD1 1 
ATOM   431  C  CD2 . PHE A 1 83  ? -21.875 19.466 -29.583 1.00 27.25  ? 123 PHE A CD2 1 
ATOM   432  C  CE1 . PHE A 1 83  ? -22.379 16.739 -29.394 1.00 28.69  ? 123 PHE A CE1 1 
ATOM   433  C  CE2 . PHE A 1 83  ? -23.049 19.035 -29.014 1.00 26.23  ? 123 PHE A CE2 1 
ATOM   434  C  CZ  . PHE A 1 83  ? -23.305 17.665 -28.917 1.00 28.13  ? 123 PHE A CZ  1 
ATOM   435  N  N   . ARG A 1 84  ? -17.653 20.854 -32.049 1.00 39.90  ? 124 ARG A N   1 
ATOM   436  C  CA  . ARG A 1 84  ? -16.369 21.043 -32.701 1.00 42.65  ? 124 ARG A CA  1 
ATOM   437  C  C   . ARG A 1 84  ? -15.593 22.217 -32.118 1.00 43.47  ? 124 ARG A C   1 
ATOM   438  O  O   . ARG A 1 84  ? -14.370 22.225 -32.148 1.00 44.98  ? 124 ARG A O   1 
ATOM   439  C  CB  . ARG A 1 84  ? -16.650 21.264 -34.193 1.00 45.52  ? 124 ARG A CB  1 
ATOM   440  C  CG  . ARG A 1 84  ? -15.474 21.212 -35.152 1.00 50.13  ? 124 ARG A CG  1 
ATOM   441  C  CD  . ARG A 1 84  ? -16.029 21.334 -36.592 1.00 55.96  ? 124 ARG A CD  1 
ATOM   442  N  NE  . ARG A 1 84  ? -15.049 21.076 -37.655 1.00 60.11  ? 124 ARG A NE  1 
ATOM   443  C  CZ  . ARG A 1 84  ? -14.155 21.956 -38.119 1.00 62.13  ? 124 ARG A CZ  1 
ATOM   444  N  NH1 . ARG A 1 84  ? -14.082 23.193 -37.628 1.00 62.15  ? 124 ARG A NH1 1 
ATOM   445  N  NH2 . ARG A 1 84  ? -13.324 21.596 -39.094 1.00 63.41  ? 124 ARG A NH2 1 
ATOM   446  N  N   . VAL A 1 85  ? -16.315 23.208 -31.598 1.00 44.43  ? 125 VAL A N   1 
ATOM   447  C  CA  . VAL A 1 85  ? -15.728 24.415 -31.012 1.00 44.38  ? 125 VAL A CA  1 
ATOM   448  C  C   . VAL A 1 85  ? -15.111 24.194 -29.632 1.00 45.63  ? 125 VAL A C   1 
ATOM   449  O  O   . VAL A 1 85  ? -14.210 24.931 -29.233 1.00 48.57  ? 125 VAL A O   1 
ATOM   450  C  CB  . VAL A 1 85  ? -16.797 25.532 -30.891 1.00 44.04  ? 125 VAL A CB  1 
ATOM   451  C  CG1 . VAL A 1 85  ? -16.262 26.730 -30.093 1.00 42.20  ? 125 VAL A CG1 1 
ATOM   452  C  CG2 . VAL A 1 85  ? -17.224 25.962 -32.261 1.00 42.87  ? 125 VAL A CG2 1 
ATOM   453  N  N   . VAL A 1 86  ? -15.592 23.191 -28.906 1.00 44.54  ? 126 VAL A N   1 
ATOM   454  C  CA  . VAL A 1 86  ? -15.088 22.905 -27.564 1.00 43.43  ? 126 VAL A CA  1 
ATOM   455  C  C   . VAL A 1 86  ? -13.653 22.351 -27.548 1.00 43.69  ? 126 VAL A C   1 
ATOM   456  O  O   . VAL A 1 86  ? -13.281 21.497 -28.352 1.00 43.19  ? 126 VAL A O   1 
ATOM   457  C  CB  . VAL A 1 86  ? -16.028 21.918 -26.847 1.00 42.31  ? 126 VAL A CB  1 
ATOM   458  C  CG1 . VAL A 1 86  ? -15.710 21.850 -25.394 1.00 40.05  ? 126 VAL A CG1 1 
ATOM   459  C  CG2 . VAL A 1 86  ? -17.478 22.353 -27.051 1.00 44.59  ? 126 VAL A CG2 1 
ATOM   460  N  N   . SER A 1 87  ? -12.849 22.870 -26.624 1.00 44.79  ? 127 SER A N   1 
ATOM   461  C  CA  . SER A 1 87  ? -11.458 22.456 -26.450 1.00 43.84  ? 127 SER A CA  1 
ATOM   462  C  C   . SER A 1 87  ? -10.650 22.510 -27.751 1.00 44.45  ? 127 SER A C   1 
ATOM   463  O  O   . SER A 1 87  ? -10.007 21.532 -28.153 1.00 44.71  ? 127 SER A O   1 
ATOM   464  C  CB  . SER A 1 87  ? -11.413 21.051 -25.850 1.00 43.62  ? 127 SER A CB  1 
ATOM   465  O  OG  . SER A 1 87  ? -12.026 21.012 -24.565 1.00 40.79  ? 127 SER A OG  1 
ATOM   466  N  N   . GLY A 1 88  ? -10.688 23.671 -28.399 1.00 42.87  ? 128 GLY A N   1 
ATOM   467  C  CA  . GLY A 1 88  ? -9.968  23.858 -29.636 1.00 40.29  ? 128 GLY A CA  1 
ATOM   468  C  C   . GLY A 1 88  ? -10.129 22.717 -30.609 1.00 39.94  ? 128 GLY A C   1 
ATOM   469  O  O   . GLY A 1 88  ? -9.219  22.438 -31.386 1.00 41.66  ? 128 GLY A O   1 
ATOM   470  N  N   . GLY A 1 89  ? -11.275 22.041 -30.568 1.00 39.07  ? 129 GLY A N   1 
ATOM   471  C  CA  . GLY A 1 89  ? -11.523 20.938 -31.489 1.00 36.12  ? 129 GLY A CA  1 
ATOM   472  C  C   . GLY A 1 89  ? -11.032 19.579 -31.044 1.00 34.07  ? 129 GLY A C   1 
ATOM   473  O  O   . GLY A 1 89  ? -11.113 18.634 -31.795 1.00 32.02  ? 129 GLY A O   1 
ATOM   474  N  N   . ARG A 1 90  ? -10.552 19.475 -29.810 1.00 34.37  ? 130 ARG A N   1 
ATOM   475  C  CA  . ARG A 1 90  ? -10.032 18.220 -29.309 1.00 34.53  ? 130 ARG A CA  1 
ATOM   476  C  C   . ARG A 1 90  ? -10.668 17.648 -28.050 1.00 34.16  ? 130 ARG A C   1 
ATOM   477  O  O   . ARG A 1 90  ? -10.051 16.839 -27.348 1.00 33.76  ? 130 ARG A O   1 
ATOM   478  C  CB  . ARG A 1 90  ? -8.529  18.342 -29.094 1.00 36.79  ? 130 ARG A CB  1 
ATOM   479  C  CG  . ARG A 1 90  ? -7.718  18.453 -30.366 1.00 36.87  ? 130 ARG A CG  1 
ATOM   480  C  CD  . ARG A 1 90  ? -6.459  17.631 -30.192 1.00 41.60  ? 130 ARG A CD  1 
ATOM   481  N  NE  . ARG A 1 90  ? -5.625  17.611 -31.384 1.00 43.09  ? 130 ARG A NE  1 
ATOM   482  C  CZ  . ARG A 1 90  ? -5.047  18.697 -31.870 1.00 44.75  ? 130 ARG A CZ  1 
ATOM   483  N  NH1 . ARG A 1 90  ? -5.232  19.860 -31.245 1.00 44.05  ? 130 ARG A NH1 1 
ATOM   484  N  NH2 . ARG A 1 90  ? -4.294  18.623 -32.961 1.00 44.39  ? 130 ARG A NH2 1 
ATOM   485  N  N   . SER A 1 91  ? -11.906 18.042 -27.789 1.00 34.38  ? 131 SER A N   1 
ATOM   486  C  CA  . SER A 1 91  ? -12.661 17.579 -26.629 1.00 34.37  ? 131 SER A CA  1 
ATOM   487  C  C   . SER A 1 91  ? -12.843 16.058 -26.605 1.00 35.63  ? 131 SER A C   1 
ATOM   488  O  O   . SER A 1 91  ? -13.019 15.432 -27.642 1.00 35.82  ? 131 SER A O   1 
ATOM   489  C  CB  . SER A 1 91  ? -14.031 18.261 -26.643 1.00 34.81  ? 131 SER A CB  1 
ATOM   490  O  OG  . SER A 1 91  ? -14.969 17.614 -25.802 1.00 35.08  ? 131 SER A OG  1 
ATOM   491  N  N   . MET A 1 92  ? -12.788 15.465 -25.420 1.00 36.62  ? 132 MET A N   1 
ATOM   492  C  CA  . MET A 1 92  ? -13.006 14.031 -25.273 1.00 37.35  ? 132 MET A CA  1 
ATOM   493  C  C   . MET A 1 92  ? -14.512 13.793 -25.034 1.00 38.34  ? 132 MET A C   1 
ATOM   494  O  O   . MET A 1 92  ? -15.064 12.756 -25.399 1.00 39.26  ? 132 MET A O   1 
ATOM   495  C  CB  . MET A 1 92  ? -12.176 13.502 -24.105 1.00 38.62  ? 132 MET A CB  1 
ATOM   496  C  CG  . MET A 1 92  ? -12.120 11.984 -23.991 1.00 39.97  ? 132 MET A CG  1 
ATOM   497  S  SD  . MET A 1 92  ? -13.423 11.305 -22.936 1.00 43.20  ? 132 MET A SD  1 
ATOM   498  C  CE  . MET A 1 92  ? -12.612 11.464 -21.302 1.00 38.67  ? 132 MET A CE  1 
ATOM   499  N  N   . ALA A 1 93  ? -15.176 14.784 -24.445 1.00 38.89  ? 133 ALA A N   1 
ATOM   500  C  CA  . ALA A 1 93  ? -16.613 14.725 -24.158 1.00 37.73  ? 133 ALA A CA  1 
ATOM   501  C  C   . ALA A 1 93  ? -17.455 14.975 -25.399 1.00 37.75  ? 133 ALA A C   1 
ATOM   502  O  O   . ALA A 1 93  ? -18.490 14.330 -25.616 1.00 37.31  ? 133 ALA A O   1 
ATOM   503  C  CB  . ALA A 1 93  ? -16.972 15.754 -23.107 1.00 36.67  ? 133 ALA A CB  1 
ATOM   504  N  N   . PHE A 1 94  ? -16.999 15.918 -26.213 1.00 37.47  ? 134 PHE A N   1 
ATOM   505  C  CA  . PHE A 1 94  ? -17.721 16.284 -27.417 1.00 36.03  ? 134 PHE A CA  1 
ATOM   506  C  C   . PHE A 1 94  ? -17.124 15.789 -28.742 1.00 34.76  ? 134 PHE A C   1 
ATOM   507  O  O   . PHE A 1 94  ? -17.624 16.121 -29.809 1.00 33.00  ? 134 PHE A O   1 
ATOM   508  C  CB  . PHE A 1 94  ? -17.888 17.792 -27.422 1.00 37.33  ? 134 PHE A CB  1 
ATOM   509  C  CG  . PHE A 1 94  ? -18.584 18.307 -26.198 1.00 38.96  ? 134 PHE A CG  1 
ATOM   510  C  CD1 . PHE A 1 94  ? -17.851 18.788 -25.109 1.00 39.37  ? 134 PHE A CD1 1 
ATOM   511  C  CD2 . PHE A 1 94  ? -19.976 18.263 -26.104 1.00 38.79  ? 134 PHE A CD2 1 
ATOM   512  C  CE1 . PHE A 1 94  ? -18.492 19.214 -23.949 1.00 37.92  ? 134 PHE A CE1 1 
ATOM   513  C  CE2 . PHE A 1 94  ? -20.632 18.684 -24.941 1.00 39.78  ? 134 PHE A CE2 1 
ATOM   514  C  CZ  . PHE A 1 94  ? -19.884 19.162 -23.859 1.00 39.08  ? 134 PHE A CZ  1 
ATOM   515  N  N   . GLY A 1 95  ? -16.069 14.978 -28.663 1.00 34.03  ? 135 GLY A N   1 
ATOM   516  C  CA  . GLY A 1 95  ? -15.448 14.449 -29.859 1.00 31.60  ? 135 GLY A CA  1 
ATOM   517  C  C   . GLY A 1 95  ? -16.129 13.157 -30.234 1.00 31.64  ? 135 GLY A C   1 
ATOM   518  O  O   . GLY A 1 95  ? -16.929 12.637 -29.473 1.00 31.04  ? 135 GLY A O   1 
ATOM   519  N  N   . HIS A 1 96  ? -15.814 12.653 -31.418 1.00 32.66  ? 136 HIS A N   1 
ATOM   520  C  CA  . HIS A 1 96  ? -16.358 11.398 -31.928 1.00 33.63  ? 136 HIS A CA  1 
ATOM   521  C  C   . HIS A 1 96  ? -15.671 10.123 -31.426 1.00 34.15  ? 136 HIS A C   1 
ATOM   522  O  O   . HIS A 1 96  ? -14.565 10.143 -30.892 1.00 33.51  ? 136 HIS A O   1 
ATOM   523  C  CB  . HIS A 1 96  ? -16.292 11.392 -33.444 1.00 33.31  ? 136 HIS A CB  1 
ATOM   524  C  CG  . HIS A 1 96  ? -17.240 12.350 -34.084 1.00 35.01  ? 136 HIS A CG  1 
ATOM   525  N  ND1 . HIS A 1 96  ? -18.559 12.463 -33.700 1.00 35.33  ? 136 HIS A ND1 1 
ATOM   526  C  CD2 . HIS A 1 96  ? -17.049 13.276 -35.049 1.00 35.33  ? 136 HIS A CD2 1 
ATOM   527  C  CE1 . HIS A 1 96  ? -19.139 13.420 -34.400 1.00 35.70  ? 136 HIS A CE1 1 
ATOM   528  N  NE2 . HIS A 1 96  ? -18.245 13.932 -35.223 1.00 35.65  ? 136 HIS A NE2 1 
ATOM   529  N  N   . TYR A 1 97  ? -16.358 9.009  -31.625 1.00 35.49  ? 137 TYR A N   1 
ATOM   530  C  CA  . TYR A 1 97  ? -15.859 7.702  -31.244 1.00 36.59  ? 137 TYR A CA  1 
ATOM   531  C  C   . TYR A 1 97  ? -14.896 7.235  -32.332 1.00 36.37  ? 137 TYR A C   1 
ATOM   532  O  O   . TYR A 1 97  ? -15.259 7.175  -33.500 1.00 36.78  ? 137 TYR A O   1 
ATOM   533  C  CB  . TYR A 1 97  ? -17.035 6.727  -31.143 1.00 38.09  ? 137 TYR A CB  1 
ATOM   534  C  CG  . TYR A 1 97  ? -16.693 5.350  -30.602 1.00 39.48  ? 137 TYR A CG  1 
ATOM   535  C  CD1 . TYR A 1 97  ? -16.289 5.181  -29.285 1.00 38.26  ? 137 TYR A CD1 1 
ATOM   536  C  CD2 . TYR A 1 97  ? -16.845 4.210  -31.394 1.00 40.25  ? 137 TYR A CD2 1 
ATOM   537  C  CE1 . TYR A 1 97  ? -16.054 3.922  -28.770 1.00 40.66  ? 137 TYR A CE1 1 
ATOM   538  C  CE2 . TYR A 1 97  ? -16.618 2.942  -30.882 1.00 40.20  ? 137 TYR A CE2 1 
ATOM   539  C  CZ  . TYR A 1 97  ? -16.227 2.807  -29.569 1.00 40.68  ? 137 TYR A CZ  1 
ATOM   540  O  OH  . TYR A 1 97  ? -16.041 1.558  -29.034 1.00 42.23  ? 137 TYR A OH  1 
ATOM   541  N  N   . SER A 1 98  ? -13.670 6.910  -31.948 1.00 38.34  ? 138 SER A N   1 
ATOM   542  C  CA  . SER A 1 98  ? -12.650 6.439  -32.891 1.00 40.37  ? 138 SER A CA  1 
ATOM   543  C  C   . SER A 1 98  ? -11.443 6.014  -32.076 1.00 42.17  ? 138 SER A C   1 
ATOM   544  O  O   . SER A 1 98  ? -11.426 6.200  -30.852 1.00 43.05  ? 138 SER A O   1 
ATOM   545  C  CB  . SER A 1 98  ? -12.245 7.553  -33.843 1.00 40.48  ? 138 SER A CB  1 
ATOM   546  O  OG  . SER A 1 98  ? -11.716 8.650  -33.117 1.00 41.37  ? 138 SER A OG  1 
ATOM   547  N  N   . GLU A 1 99  ? -10.429 5.458  -32.733 1.00 43.88  ? 139 GLU A N   1 
ATOM   548  C  CA  . GLU A 1 99  ? -9.238  5.013  -32.002 1.00 44.22  ? 139 GLU A CA  1 
ATOM   549  C  C   . GLU A 1 99  ? -8.518  6.132  -31.266 1.00 42.83  ? 139 GLU A C   1 
ATOM   550  O  O   . GLU A 1 99  ? -8.203  5.999  -30.087 1.00 42.48  ? 139 GLU A O   1 
ATOM   551  C  CB  . GLU A 1 99  ? -8.276  4.300  -32.943 1.00 46.63  ? 139 GLU A CB  1 
ATOM   552  C  CG  . GLU A 1 99  ? -8.839  3.006  -33.449 1.00 50.83  ? 139 GLU A CG  1 
ATOM   553  C  CD  . GLU A 1 99  ? -9.568  2.246  -32.355 1.00 53.64  ? 139 GLU A CD  1 
ATOM   554  O  OE1 . GLU A 1 99  ? -8.935  1.915  -31.323 1.00 55.31  ? 139 GLU A OE1 1 
ATOM   555  O  OE2 . GLU A 1 99  ? -10.783 1.991  -32.527 1.00 54.90  ? 139 GLU A OE2 1 
ATOM   556  N  N   . HIS A 1 100 ? -8.256  7.231  -31.963 1.00 42.86  ? 140 HIS A N   1 
ATOM   557  C  CA  . HIS A 1 100 ? -7.597  8.371  -31.353 1.00 42.52  ? 140 HIS A CA  1 
ATOM   558  C  C   . HIS A 1 100 ? -8.411  8.798  -30.139 1.00 41.59  ? 140 HIS A C   1 
ATOM   559  O  O   . HIS A 1 100 ? -7.861  9.106  -29.088 1.00 43.37  ? 140 HIS A O   1 
ATOM   560  C  CB  . HIS A 1 100 ? -7.500  9.517  -32.352 1.00 44.99  ? 140 HIS A CB  1 
ATOM   561  C  CG  . HIS A 1 100 ? -6.660  9.198  -33.552 1.00 48.78  ? 140 HIS A CG  1 
ATOM   562  N  ND1 . HIS A 1 100 ? -7.179  9.118  -34.830 1.00 51.48  ? 140 HIS A ND1 1 
ATOM   563  C  CD2 . HIS A 1 100 ? -5.337  8.930  -33.669 1.00 48.25  ? 140 HIS A CD2 1 
ATOM   564  C  CE1 . HIS A 1 100 ? -6.213  8.814  -35.681 1.00 49.89  ? 140 HIS A CE1 1 
ATOM   565  N  NE2 . HIS A 1 100 ? -5.087  8.693  -35.001 1.00 50.13  ? 140 HIS A NE2 1 
ATOM   566  N  N   . TRP A 1 101 ? -9.728  8.797  -30.279 1.00 39.10  ? 141 TRP A N   1 
ATOM   567  C  CA  . TRP A 1 101 ? -10.593 9.171  -29.185 1.00 37.14  ? 141 TRP A CA  1 
ATOM   568  C  C   . TRP A 1 101 ? -10.506 8.144  -28.071 1.00 37.85  ? 141 TRP A C   1 
ATOM   569  O  O   . TRP A 1 101 ? -10.537 8.487  -26.888 1.00 37.43  ? 141 TRP A O   1 
ATOM   570  C  CB  . TRP A 1 101 ? -12.043 9.244  -29.665 1.00 36.67  ? 141 TRP A CB  1 
ATOM   571  C  CG  . TRP A 1 101 ? -13.023 9.541  -28.544 1.00 34.98  ? 141 TRP A CG  1 
ATOM   572  C  CD1 . TRP A 1 101 ? -13.412 10.772 -28.099 1.00 33.92  ? 141 TRP A CD1 1 
ATOM   573  C  CD2 . TRP A 1 101 ? -13.656 8.583  -27.673 1.00 34.20  ? 141 TRP A CD2 1 
ATOM   574  N  NE1 . TRP A 1 101 ? -14.235 10.645 -27.007 1.00 33.00  ? 141 TRP A NE1 1 
ATOM   575  C  CE2 . TRP A 1 101 ? -14.403 9.316  -26.720 1.00 33.34  ? 141 TRP A CE2 1 
ATOM   576  C  CE3 . TRP A 1 101 ? -13.660 7.177  -27.604 1.00 32.97  ? 141 TRP A CE3 1 
ATOM   577  C  CZ2 . TRP A 1 101 ? -15.151 8.692  -25.703 1.00 33.55  ? 141 TRP A CZ2 1 
ATOM   578  C  CZ3 . TRP A 1 101 ? -14.402 6.558  -26.592 1.00 33.19  ? 141 TRP A CZ3 1 
ATOM   579  C  CH2 . TRP A 1 101 ? -15.137 7.320  -25.656 1.00 33.22  ? 141 TRP A CH2 1 
ATOM   580  N  N   . LYS A 1 102 ? -10.394 6.879  -28.461 1.00 38.48  ? 142 LYS A N   1 
ATOM   581  C  CA  . LYS A 1 102 ? -10.361 5.767  -27.516 1.00 39.98  ? 142 LYS A CA  1 
ATOM   582  C  C   . LYS A 1 102 ? -9.254  5.800  -26.475 1.00 39.90  ? 142 LYS A C   1 
ATOM   583  O  O   . LYS A 1 102 ? -9.451  5.348  -25.345 1.00 40.05  ? 142 LYS A O   1 
ATOM   584  C  CB  . LYS A 1 102 ? -10.295 4.448  -28.278 1.00 42.68  ? 142 LYS A CB  1 
ATOM   585  C  CG  . LYS A 1 102 ? -10.839 3.266  -27.508 1.00 44.84  ? 142 LYS A CG  1 
ATOM   586  C  CD  . LYS A 1 102 ? -12.111 2.746  -28.159 1.00 47.48  ? 142 LYS A CD  1 
ATOM   587  C  CE  . LYS A 1 102 ? -11.829 2.134  -29.518 1.00 48.08  ? 142 LYS A CE  1 
ATOM   588  N  NZ  . LYS A 1 102 ? -13.099 1.826  -30.220 1.00 49.34  ? 142 LYS A NZ  1 
ATOM   589  N  N   . VAL A 1 103 ? -8.087  6.315  -26.850 1.00 40.74  ? 143 VAL A N   1 
ATOM   590  C  CA  . VAL A 1 103 ? -6.960  6.406  -25.909 1.00 40.69  ? 143 VAL A CA  1 
ATOM   591  C  C   . VAL A 1 103 ? -7.099  7.688  -25.106 1.00 40.14  ? 143 VAL A C   1 
ATOM   592  O  O   . VAL A 1 103 ? -6.676  7.762  -23.959 1.00 40.84  ? 143 VAL A O   1 
ATOM   593  C  CB  . VAL A 1 103 ? -5.576  6.428  -26.643 1.00 42.03  ? 143 VAL A CB  1 
ATOM   594  C  CG1 . VAL A 1 103 ? -4.426  6.309  -25.623 1.00 39.58  ? 143 VAL A CG1 1 
ATOM   595  C  CG2 . VAL A 1 103 ? -5.518  5.295  -27.676 1.00 39.76  ? 143 VAL A CG2 1 
ATOM   596  N  N   . GLN A 1 104 ? -7.691  8.705  -25.720 1.00 40.22  ? 144 GLN A N   1 
ATOM   597  C  CA  . GLN A 1 104 ? -7.895  9.970  -25.040 1.00 39.61  ? 144 GLN A CA  1 
ATOM   598  C  C   . GLN A 1 104 ? -8.816  9.758  -23.837 1.00 39.10  ? 144 GLN A C   1 
ATOM   599  O  O   . GLN A 1 104 ? -8.597  10.345 -22.770 1.00 37.47  ? 144 GLN A O   1 
ATOM   600  C  CB  . GLN A 1 104 ? -8.494  10.990 -26.006 1.00 39.56  ? 144 GLN A CB  1 
ATOM   601  C  CG  . GLN A 1 104 ? -8.862  12.305 -25.349 1.00 38.48  ? 144 GLN A CG  1 
ATOM   602  C  CD  . GLN A 1 104 ? -9.314  13.326 -26.351 1.00 38.24  ? 144 GLN A CD  1 
ATOM   603  O  OE1 . GLN A 1 104 ? -9.891  12.981 -27.392 1.00 39.57  ? 144 GLN A OE1 1 
ATOM   604  N  NE2 . GLN A 1 104 ? -9.078  14.599 -26.046 1.00 38.74  ? 144 GLN A NE2 1 
ATOM   605  N  N   . ARG A 1 105 ? -9.840  8.917  -24.011 1.00 39.14  ? 145 ARG A N   1 
ATOM   606  C  CA  . ARG A 1 105 ? -10.751 8.638  -22.918 1.00 39.35  ? 145 ARG A CA  1 
ATOM   607  C  C   . ARG A 1 105 ? -10.115 7.703  -21.904 1.00 40.69  ? 145 ARG A C   1 
ATOM   608  O  O   . ARG A 1 105 ? -10.218 7.915  -20.703 1.00 41.54  ? 145 ARG A O   1 
ATOM   609  C  CB  . ARG A 1 105 ? -12.042 7.995  -23.393 1.00 38.58  ? 145 ARG A CB  1 
ATOM   610  C  CG  . ARG A 1 105 ? -13.053 8.011  -22.248 1.00 37.88  ? 145 ARG A CG  1 
ATOM   611  C  CD  . ARG A 1 105 ? -14.144 7.028  -22.399 1.00 36.63  ? 145 ARG A CD  1 
ATOM   612  N  NE  . ARG A 1 105 ? -14.732 6.706  -21.101 1.00 38.36  ? 145 ARG A NE  1 
ATOM   613  C  CZ  . ARG A 1 105 ? -15.761 7.340  -20.540 1.00 37.80  ? 145 ARG A CZ  1 
ATOM   614  N  NH1 . ARG A 1 105 ? -16.343 8.355  -21.151 1.00 36.38  ? 145 ARG A NH1 1 
ATOM   615  N  NH2 . ARG A 1 105 ? -16.215 6.946  -19.361 1.00 36.77  ? 145 ARG A NH2 1 
ATOM   616  N  N   . ARG A 1 106 ? -9.466  6.655  -22.392 1.00 42.51  ? 146 ARG A N   1 
ATOM   617  C  CA  . ARG A 1 106 ? -8.816  5.673  -21.525 1.00 43.93  ? 146 ARG A CA  1 
ATOM   618  C  C   . ARG A 1 106 ? -7.802  6.388  -20.643 1.00 44.18  ? 146 ARG A C   1 
ATOM   619  O  O   . ARG A 1 106 ? -7.736  6.155  -19.427 1.00 43.53  ? 146 ARG A O   1 
ATOM   620  C  CB  . ARG A 1 106 ? -8.114  4.625  -22.389 1.00 46.13  ? 146 ARG A CB  1 
ATOM   621  C  CG  . ARG A 1 106 ? -7.969  3.266  -21.759 1.00 49.16  ? 146 ARG A CG  1 
ATOM   622  C  CD  . ARG A 1 106 ? -7.132  2.371  -22.657 1.00 52.08  ? 146 ARG A CD  1 
ATOM   623  N  NE  . ARG A 1 106 ? -7.742  2.196  -23.974 1.00 54.37  ? 146 ARG A NE  1 
ATOM   624  C  CZ  . ARG A 1 106 ? -7.073  1.837  -25.069 1.00 56.01  ? 146 ARG A CZ  1 
ATOM   625  N  NH1 . ARG A 1 106 ? -5.760  1.618  -25.013 1.00 55.94  ? 146 ARG A NH1 1 
ATOM   626  N  NH2 . ARG A 1 106 ? -7.719  1.690  -26.220 1.00 55.82  ? 146 ARG A NH2 1 
ATOM   627  N  N   . ALA A 1 107 ? -7.028  7.274  -21.277 1.00 44.20  ? 147 ALA A N   1 
ATOM   628  C  CA  . ALA A 1 107 ? -5.998  8.073  -20.613 1.00 42.93  ? 147 ALA A CA  1 
ATOM   629  C  C   . ALA A 1 107 ? -6.628  9.055  -19.629 1.00 43.24  ? 147 ALA A C   1 
ATOM   630  O  O   . ALA A 1 107 ? -6.084  9.285  -18.540 1.00 44.71  ? 147 ALA A O   1 
ATOM   631  C  CB  . ALA A 1 107 ? -5.164  8.831  -21.653 1.00 39.83  ? 147 ALA A CB  1 
ATOM   632  N  N   . ALA A 1 108 ? -7.765  9.640  -20.015 1.00 42.30  ? 148 ALA A N   1 
ATOM   633  C  CA  . ALA A 1 108 ? -8.465  10.582 -19.152 1.00 42.55  ? 148 ALA A CA  1 
ATOM   634  C  C   . ALA A 1 108 ? -9.063  9.870  -17.931 1.00 43.43  ? 148 ALA A C   1 
ATOM   635  O  O   . ALA A 1 108 ? -9.022  10.402 -16.819 1.00 43.52  ? 148 ALA A O   1 
ATOM   636  C  CB  . ALA A 1 108 ? -9.562  11.284 -19.929 1.00 41.82  ? 148 ALA A CB  1 
ATOM   637  N  N   . HIS A 1 109 ? -9.610  8.671  -18.144 1.00 43.45  ? 149 HIS A N   1 
ATOM   638  C  CA  . HIS A 1 109 ? -10.217 7.884  -17.085 1.00 43.54  ? 149 HIS A CA  1 
ATOM   639  C  C   . HIS A 1 109 ? -9.111  7.370  -16.168 1.00 44.43  ? 149 HIS A C   1 
ATOM   640  O  O   . HIS A 1 109 ? -9.308  7.256  -14.956 1.00 44.33  ? 149 HIS A O   1 
ATOM   641  C  CB  . HIS A 1 109 ? -10.979 6.712  -17.701 1.00 47.11  ? 149 HIS A CB  1 
ATOM   642  C  CG  . HIS A 1 109 ? -12.219 6.307  -16.954 1.00 49.83  ? 149 HIS A CG  1 
ATOM   643  N  ND1 . HIS A 1 109 ? -13.127 5.401  -17.463 1.00 50.38  ? 149 HIS A ND1 1 
ATOM   644  C  CD2 . HIS A 1 109 ? -12.708 6.688  -15.749 1.00 50.84  ? 149 HIS A CD2 1 
ATOM   645  C  CE1 . HIS A 1 109 ? -14.119 5.243  -16.606 1.00 50.16  ? 149 HIS A CE1 1 
ATOM   646  N  NE2 . HIS A 1 109 ? -13.890 6.013  -15.558 1.00 49.75  ? 149 HIS A NE2 1 
ATOM   647  N  N   . SER A 1 110 ? -7.944  7.059  -16.739 1.00 44.52  ? 150 SER A N   1 
ATOM   648  C  CA  . SER A 1 110 ? -6.810  6.571  -15.932 1.00 45.32  ? 150 SER A CA  1 
ATOM   649  C  C   . SER A 1 110 ? -6.379  7.592  -14.900 1.00 44.12  ? 150 SER A C   1 
ATOM   650  O  O   . SER A 1 110 ? -6.179  7.254  -13.738 1.00 44.75  ? 150 SER A O   1 
ATOM   651  C  CB  . SER A 1 110 ? -5.595  6.258  -16.803 1.00 47.55  ? 150 SER A CB  1 
ATOM   652  O  OG  . SER A 1 110 ? -5.958  5.498  -17.944 1.00 54.79  ? 150 SER A OG  1 
ATOM   653  N  N   . MET A 1 111 ? -6.225  8.840  -15.332 1.00 43.73  ? 151 MET A N   1 
ATOM   654  C  CA  . MET A 1 111 ? -5.821  9.914  -14.434 1.00 43.47  ? 151 MET A CA  1 
ATOM   655  C  C   . MET A 1 111 ? -6.845  10.072 -13.319 1.00 43.86  ? 151 MET A C   1 
ATOM   656  O  O   . MET A 1 111 ? -6.491  10.177 -12.144 1.00 42.95  ? 151 MET A O   1 
ATOM   657  C  CB  . MET A 1 111 ? -5.670  11.228 -15.202 1.00 44.01  ? 151 MET A CB  1 
ATOM   658  C  CG  . MET A 1 111 ? -4.785  12.253 -14.511 1.00 44.67  ? 151 MET A CG  1 
ATOM   659  S  SD  . MET A 1 111 ? -3.095  11.670 -14.280 1.00 46.28  ? 151 MET A SD  1 
ATOM   660  C  CE  . MET A 1 111 ? -2.412  11.955 -15.911 1.00 45.15  ? 151 MET A CE  1 
ATOM   661  N  N   . MET A 1 112 ? -8.118  10.085 -13.698 1.00 44.86  ? 152 MET A N   1 
ATOM   662  C  CA  . MET A 1 112 ? -9.207  10.202 -12.735 1.00 46.22  ? 152 MET A CA  1 
ATOM   663  C  C   . MET A 1 112 ? -9.298  9.072  -11.711 1.00 49.17  ? 152 MET A C   1 
ATOM   664  O  O   . MET A 1 112 ? -9.804  9.269  -10.603 1.00 48.95  ? 152 MET A O   1 
ATOM   665  C  CB  . MET A 1 112 ? -10.540 10.294 -13.465 1.00 44.20  ? 152 MET A CB  1 
ATOM   666  C  CG  . MET A 1 112 ? -10.723 11.578 -14.239 1.00 44.41  ? 152 MET A CG  1 
ATOM   667  S  SD  . MET A 1 112 ? -10.431 13.019 -13.209 1.00 40.71  ? 152 MET A SD  1 
ATOM   668  C  CE  . MET A 1 112 ? -11.407 12.574 -11.783 1.00 39.37  ? 152 MET A CE  1 
ATOM   669  N  N   . ARG A 1 113 ? -8.828  7.888  -12.075 1.00 52.78  ? 153 ARG A N   1 
ATOM   670  C  CA  . ARG A 1 113 ? -8.894  6.753  -11.167 1.00 57.81  ? 153 ARG A CA  1 
ATOM   671  C  C   . ARG A 1 113 ? -7.659  6.689  -10.296 1.00 60.25  ? 153 ARG A C   1 
ATOM   672  O  O   . ARG A 1 113 ? -7.742  6.533  -9.077  1.00 60.49  ? 153 ARG A O   1 
ATOM   673  C  CB  . ARG A 1 113 ? -9.017  5.455  -11.961 1.00 60.16  ? 153 ARG A CB  1 
ATOM   674  C  CG  . ARG A 1 113 ? -10.194 4.584  -11.572 1.00 63.60  ? 153 ARG A CG  1 
ATOM   675  C  CD  . ARG A 1 113 ? -10.987 4.193  -12.810 1.00 66.55  ? 153 ARG A CD  1 
ATOM   676  N  NE  . ARG A 1 113 ? -10.096 3.914  -13.931 1.00 70.13  ? 153 ARG A NE  1 
ATOM   677  C  CZ  . ARG A 1 113 ? -10.471 3.332  -15.067 1.00 73.22  ? 153 ARG A CZ  1 
ATOM   678  N  NH1 . ARG A 1 113 ? -9.579  3.124  -16.034 1.00 74.46  ? 153 ARG A NH1 1 
ATOM   679  N  NH2 . ARG A 1 113 ? -11.731 2.944  -15.238 1.00 75.06  ? 153 ARG A NH2 1 
ATOM   680  N  N   . ASN A 1 114 ? -6.508  6.805  -10.939 1.00 63.64  ? 154 ASN A N   1 
ATOM   681  C  CA  . ASN A 1 114 ? -5.239  6.756  -10.243 1.00 67.88  ? 154 ASN A CA  1 
ATOM   682  C  C   . ASN A 1 114 ? -4.978  8.028  -9.444  1.00 70.43  ? 154 ASN A C   1 
ATOM   683  O  O   . ASN A 1 114 ? -4.738  7.961  -8.244  1.00 71.80  ? 154 ASN A O   1 
ATOM   684  C  CB  . ASN A 1 114 ? -4.107  6.543  -11.249 1.00 68.79  ? 154 ASN A CB  1 
ATOM   685  C  CG  . ASN A 1 114 ? -4.171  5.193  -11.924 1.00 68.40  ? 154 ASN A CG  1 
ATOM   686  O  OD1 . ASN A 1 114 ? -5.247  4.619  -12.078 1.00 68.46  ? 154 ASN A OD1 1 
ATOM   687  N  ND2 . ASN A 1 114 ? -3.016  4.685  -12.347 1.00 67.87  ? 154 ASN A ND2 1 
ATOM   688  N  N   . PHE A 1 115 ? -5.017  9.172  -10.120 1.00 73.11  ? 155 PHE A N   1 
ATOM   689  C  CA  . PHE A 1 115 ? -4.773  10.457 -9.475  1.00 76.50  ? 155 PHE A CA  1 
ATOM   690  C  C   . PHE A 1 115 ? -5.311  10.478 -8.049  1.00 79.83  ? 155 PHE A C   1 
ATOM   691  O  O   . PHE A 1 115 ? -4.677  11.020 -7.144  1.00 80.54  ? 155 PHE A O   1 
ATOM   692  C  CB  . PHE A 1 115 ? -5.398  11.592 -10.289 1.00 74.78  ? 155 PHE A CB  1 
ATOM   693  C  CG  . PHE A 1 115 ? -4.833  12.947 -9.973  1.00 72.58  ? 155 PHE A CG  1 
ATOM   694  C  CD1 . PHE A 1 115 ? -3.590  13.323 -10.455 1.00 72.11  ? 155 PHE A CD1 1 
ATOM   695  C  CD2 . PHE A 1 115 ? -5.544  13.845 -9.194  1.00 72.78  ? 155 PHE A CD2 1 
ATOM   696  C  CE1 . PHE A 1 115 ? -3.067  14.570 -10.166 1.00 71.90  ? 155 PHE A CE1 1 
ATOM   697  C  CE2 . PHE A 1 115 ? -5.026  15.092 -8.902  1.00 72.29  ? 155 PHE A CE2 1 
ATOM   698  C  CZ  . PHE A 1 115 ? -3.786  15.455 -9.388  1.00 71.49  ? 155 PHE A CZ  1 
ATOM   699  N  N   . PHE A 1 116 ? -6.484  9.885  -7.856  1.00 83.12  ? 156 PHE A N   1 
ATOM   700  C  CA  . PHE A 1 116 ? -7.105  9.839  -6.551  1.00 86.60  ? 156 PHE A CA  1 
ATOM   701  C  C   . PHE A 1 116 ? -6.875  8.451  -5.985  1.00 89.17  ? 156 PHE A C   1 
ATOM   702  O  O   . PHE A 1 116 ? -7.331  7.447  -6.551  1.00 89.45  ? 156 PHE A O   1 
ATOM   703  C  CB  . PHE A 1 116 ? -8.561  10.238 -6.686  1.00 86.54  ? 156 PHE A CB  1 
ATOM   704  C  CG  . PHE A 1 116 ? -8.728  11.602 -7.264  1.00 86.74  ? 156 PHE A CG  1 
ATOM   705  C  CD1 . PHE A 1 116 ? -8.230  12.713 -6.590  1.00 86.09  ? 156 PHE A CD1 1 
ATOM   706  C  CD2 . PHE A 1 116 ? -9.345  11.782 -8.496  1.00 86.91  ? 156 PHE A CD2 1 
ATOM   707  C  CE1 . PHE A 1 116 ? -8.344  13.988 -7.136  1.00 85.84  ? 156 PHE A CE1 1 
ATOM   708  C  CE2 . PHE A 1 116 ? -9.464  13.056 -9.051  1.00 86.36  ? 156 PHE A CE2 1 
ATOM   709  C  CZ  . PHE A 1 116 ? -8.962  14.162 -8.368  1.00 85.59  ? 156 PHE A CZ  1 
ATOM   710  N  N   . THR A 1 117 ? -6.154  8.398  -4.870  1.00 91.53  ? 157 THR A N   1 
ATOM   711  C  CA  . THR A 1 117 ? -5.825  7.138  -4.225  1.00 94.33  ? 157 THR A CA  1 
ATOM   712  C  C   . THR A 1 117 ? -4.549  6.566  -4.829  1.00 95.43  ? 157 THR A C   1 
ATOM   713  O  O   . THR A 1 117 ? -4.267  5.376  -4.693  1.00 95.65  ? 157 THR A O   1 
ATOM   714  C  CB  . THR A 1 117 ? -6.962  6.111  -4.376  1.00 95.14  ? 157 THR A CB  1 
ATOM   715  O  OG1 . THR A 1 117 ? -7.153  5.420  -3.136  1.00 96.43  ? 157 THR A OG1 1 
ATOM   716  C  CG2 . THR A 1 117 ? -6.627  5.104  -5.466  1.00 95.38  ? 157 THR A CG2 1 
ATOM   717  N  N   . ARG A 1 118 ? -3.778  7.420  -5.498  1.00 96.49  ? 158 ARG A N   1 
ATOM   718  C  CA  . ARG A 1 118 ? -2.538  6.978  -6.124  1.00 97.78  ? 158 ARG A CA  1 
ATOM   719  C  C   . ARG A 1 118 ? -1.449  6.809  -5.075  1.00 98.08  ? 158 ARG A C   1 
ATOM   720  O  O   . ARG A 1 118 ? -0.770  5.781  -5.029  1.00 98.37  ? 158 ARG A O   1 
ATOM   721  C  CB  . ARG A 1 118 ? -2.096  7.986  -7.192  1.00 98.71  ? 158 ARG A CB  1 
ATOM   722  C  CG  . ARG A 1 118 ? -2.012  9.416  -6.690  1.00 100.06 ? 158 ARG A CG  1 
ATOM   723  C  CD  . ARG A 1 118 ? -1.921  10.422 -7.830  1.00 100.77 ? 158 ARG A CD  1 
ATOM   724  N  NE  . ARG A 1 118 ? -2.186  11.777 -7.346  1.00 101.66 ? 158 ARG A NE  1 
ATOM   725  C  CZ  . ARG A 1 118 ? -1.278  12.569 -6.781  1.00 101.99 ? 158 ARG A CZ  1 
ATOM   726  N  NH1 . ARG A 1 118 ? -0.028  12.150 -6.635  1.00 101.98 ? 158 ARG A NH1 1 
ATOM   727  N  NH2 . ARG A 1 118 ? -1.624  13.771 -6.338  1.00 101.83 ? 158 ARG A NH2 1 
ATOM   728  N  N   . GLN A 1 119 ? -1.284  7.824  -4.232  1.00 98.22  ? 159 GLN A N   1 
ATOM   729  C  CA  . GLN A 1 119 ? -0.286  7.780  -3.167  1.00 98.02  ? 159 GLN A CA  1 
ATOM   730  C  C   . GLN A 1 119 ? -0.950  7.874  -1.796  1.00 98.34  ? 159 GLN A C   1 
ATOM   731  O  O   . GLN A 1 119 ? -2.031  8.452  -1.659  1.00 99.12  ? 159 GLN A O   1 
ATOM   732  C  CB  . GLN A 1 119 ? 0.724   8.919  -3.319  1.00 96.98  ? 159 GLN A CB  1 
ATOM   733  C  CG  . GLN A 1 119 ? 1.912   8.592  -4.198  1.00 95.62  ? 159 GLN A CG  1 
ATOM   734  C  CD  . GLN A 1 119 ? 3.030   9.599  -4.033  1.00 95.50  ? 159 GLN A CD  1 
ATOM   735  O  OE1 . GLN A 1 119 ? 3.476   9.866  -2.914  1.00 95.65  ? 159 GLN A OE1 1 
ATOM   736  N  NE2 . GLN A 1 119 ? 3.494   10.162 -5.142  1.00 94.70  ? 159 GLN A NE2 1 
ATOM   737  N  N   . PRO A 1 120 ? -0.322  7.283  -0.764  1.00 98.27  ? 160 PRO A N   1 
ATOM   738  C  CA  . PRO A 1 120 ? -0.894  7.336  0.583   1.00 97.65  ? 160 PRO A CA  1 
ATOM   739  C  C   . PRO A 1 120 ? -1.067  8.796  0.983   1.00 97.44  ? 160 PRO A C   1 
ATOM   740  O  O   . PRO A 1 120 ? -0.345  9.670  0.497   1.00 97.18  ? 160 PRO A O   1 
ATOM   741  C  CB  . PRO A 1 120 ? 0.153   6.619  1.427   1.00 97.12  ? 160 PRO A CB  1 
ATOM   742  C  CG  . PRO A 1 120 ? 0.687   5.595  0.478   1.00 97.27  ? 160 PRO A CG  1 
ATOM   743  C  CD  . PRO A 1 120 ? 0.866   6.409  -0.789  1.00 98.22  ? 160 PRO A CD  1 
ATOM   744  N  N   . ARG A 1 121 ? -2.028  9.062  1.855   1.00 97.26  ? 161 ARG A N   1 
ATOM   745  C  CA  . ARG A 1 121 ? -2.282  10.427 2.293   1.00 97.39  ? 161 ARG A CA  1 
ATOM   746  C  C   . ARG A 1 121 ? -2.771  11.318 1.142   1.00 97.05  ? 161 ARG A C   1 
ATOM   747  O  O   . ARG A 1 121 ? -2.881  12.534 1.315   1.00 98.08  ? 161 ARG A O   1 
ATOM   748  C  CB  . ARG A 1 121 ? -1.016  11.049 2.912   1.00 97.79  ? 161 ARG A CB  1 
ATOM   749  C  CG  . ARG A 1 121 ? -1.109  11.410 4.408   1.00 98.56  ? 161 ARG A CG  1 
ATOM   750  C  CD  . ARG A 1 121 ? -0.866  10.200 5.333   1.00 99.85  ? 161 ARG A CD  1 
ATOM   751  N  NE  . ARG A 1 121 ? -2.096  9.561  5.816   1.00 99.83  ? 161 ARG A NE  1 
ATOM   752  C  CZ  . ARG A 1 121 ? -2.129  8.425  6.514   1.00 99.55  ? 161 ARG A CZ  1 
ATOM   753  N  NH1 . ARG A 1 121 ? -0.999  7.794  6.813   1.00 98.88  ? 161 ARG A NH1 1 
ATOM   754  N  NH2 . ARG A 1 121 ? -3.290  7.920  6.918   1.00 98.78  ? 161 ARG A NH2 1 
ATOM   755  N  N   . SER A 1 122 ? -3.054  10.734 -0.026  1.00 95.80  ? 162 SER A N   1 
ATOM   756  C  CA  . SER A 1 122 ? -3.553  11.518 -1.173  1.00 93.50  ? 162 SER A CA  1 
ATOM   757  C  C   . SER A 1 122 ? -4.972  12.006 -0.881  1.00 92.38  ? 162 SER A C   1 
ATOM   758  O  O   . SER A 1 122 ? -5.291  13.186 -1.046  1.00 91.74  ? 162 SER A O   1 
ATOM   759  C  CB  . SER A 1 122 ? -3.555  10.684 -2.461  1.00 92.82  ? 162 SER A CB  1 
ATOM   760  O  OG  . SER A 1 122 ? -2.374  10.899 -3.217  1.00 90.71  ? 162 SER A OG  1 
ATOM   761  N  N   . ARG A 1 123 ? -5.822  11.080 -0.455  1.00 90.54  ? 163 ARG A N   1 
ATOM   762  C  CA  . ARG A 1 123 ? -7.186  11.423 -0.103  1.00 88.68  ? 163 ARG A CA  1 
ATOM   763  C  C   . ARG A 1 123 ? -7.176  12.686 0.767   1.00 85.27  ? 163 ARG A C   1 
ATOM   764  O  O   . ARG A 1 123 ? -7.998  13.578 0.584   1.00 85.03  ? 163 ARG A O   1 
ATOM   765  C  CB  . ARG A 1 123 ? -7.820  10.267 0.678   1.00 92.33  ? 163 ARG A CB  1 
ATOM   766  C  CG  . ARG A 1 123 ? -6.865  9.615  1.683   1.00 96.01  ? 163 ARG A CG  1 
ATOM   767  C  CD  . ARG A 1 123 ? -6.583  8.164  1.316   1.00 99.14  ? 163 ARG A CD  1 
ATOM   768  N  NE  . ARG A 1 123 ? -7.317  7.230  2.171   1.00 102.06 ? 163 ARG A NE  1 
ATOM   769  C  CZ  . ARG A 1 123 ? -7.227  5.906  2.069   1.00 103.44 ? 163 ARG A CZ  1 
ATOM   770  N  NH1 . ARG A 1 123 ? -7.924  5.121  2.889   1.00 104.07 ? 163 ARG A NH1 1 
ATOM   771  N  NH2 . ARG A 1 123 ? -6.441  5.367  1.140   1.00 103.56 ? 163 ARG A NH2 1 
ATOM   772  N  N   . GLN A 1 124 ? -6.230  12.760 1.700   1.00 80.63  ? 164 GLN A N   1 
ATOM   773  C  CA  . GLN A 1 124 ? -6.140  13.899 2.603   1.00 75.88  ? 164 GLN A CA  1 
ATOM   774  C  C   . GLN A 1 124 ? -5.908  15.206 1.875   1.00 72.12  ? 164 GLN A C   1 
ATOM   775  O  O   . GLN A 1 124 ? -6.512  16.222 2.218   1.00 72.29  ? 164 GLN A O   1 
ATOM   776  C  CB  . GLN A 1 124 ? -5.008  13.705 3.615   1.00 77.06  ? 164 GLN A CB  1 
ATOM   777  C  CG  . GLN A 1 124 ? -4.540  12.273 3.755   1.00 77.59  ? 164 GLN A CG  1 
ATOM   778  C  CD  . GLN A 1 124 ? -4.856  11.690 5.102   1.00 77.47  ? 164 GLN A CD  1 
ATOM   779  O  OE1 . GLN A 1 124 ? -4.351  12.157 6.127   1.00 77.75  ? 164 GLN A OE1 1 
ATOM   780  N  NE2 . GLN A 1 124 ? -5.698  10.662 5.116   1.00 76.15  ? 164 GLN A NE2 1 
ATOM   781  N  N   . VAL A 1 125 ? -5.034  15.200 0.877   1.00 67.29  ? 165 VAL A N   1 
ATOM   782  C  CA  . VAL A 1 125 ? -4.760  16.449 0.179   1.00 63.19  ? 165 VAL A CA  1 
ATOM   783  C  C   . VAL A 1 125 ? -5.999  16.914 -0.567  1.00 59.17  ? 165 VAL A C   1 
ATOM   784  O  O   . VAL A 1 125 ? -6.254  18.110 -0.676  1.00 57.86  ? 165 VAL A O   1 
ATOM   785  C  CB  . VAL A 1 125 ? -3.551  16.325 -0.783  1.00 63.35  ? 165 VAL A CB  1 
ATOM   786  C  CG1 . VAL A 1 125 ? -3.854  15.335 -1.891  1.00 64.44  ? 165 VAL A CG1 1 
ATOM   787  C  CG2 . VAL A 1 125 ? -3.206  17.695 -1.340  1.00 61.45  ? 165 VAL A CG2 1 
ATOM   788  N  N   . LEU A 1 126 ? -6.776  15.956 -1.060  1.00 54.99  ? 166 LEU A N   1 
ATOM   789  C  CA  . LEU A 1 126 ? -8.013  16.262 -1.767  1.00 50.81  ? 166 LEU A CA  1 
ATOM   790  C  C   . LEU A 1 126 ? -8.973  16.884 -0.754  1.00 48.47  ? 166 LEU A C   1 
ATOM   791  O  O   . LEU A 1 126 ? -9.442  17.999 -0.913  1.00 48.36  ? 166 LEU A O   1 
ATOM   792  C  CB  . LEU A 1 126 ? -8.635  14.981 -2.324  1.00 48.41  ? 166 LEU A CB  1 
ATOM   793  C  CG  . LEU A 1 126 ? -9.437  15.044 -3.625  1.00 47.84  ? 166 LEU A CG  1 
ATOM   794  C  CD1 . LEU A 1 126 ? -10.423 13.894 -3.601  1.00 46.70  ? 166 LEU A CD1 1 
ATOM   795  C  CD2 . LEU A 1 126 ? -10.178 16.370 -3.786  1.00 47.07  ? 166 LEU A CD2 1 
ATOM   796  N  N   . GLU A 1 127 ? -9.250  16.142 0.304   1.00 46.92  ? 167 GLU A N   1 
ATOM   797  C  CA  . GLU A 1 127 ? -10.147 16.608 1.338   1.00 44.69  ? 167 GLU A CA  1 
ATOM   798  C  C   . GLU A 1 127 ? -9.719  17.967 1.880   1.00 41.43  ? 167 GLU A C   1 
ATOM   799  O  O   . GLU A 1 127 ? -10.546 18.757 2.303   1.00 40.40  ? 167 GLU A O   1 
ATOM   800  C  CB  . GLU A 1 127 ? -10.207 15.591 2.474   1.00 47.61  ? 167 GLU A CB  1 
ATOM   801  C  CG  . GLU A 1 127 ? -11.414 15.790 3.362   1.00 56.40  ? 167 GLU A CG  1 
ATOM   802  C  CD  . GLU A 1 127 ? -11.507 14.780 4.493   1.00 62.21  ? 167 GLU A CD  1 
ATOM   803  O  OE1 . GLU A 1 127 ? -11.360 13.559 4.213   1.00 65.37  ? 167 GLU A OE1 1 
ATOM   804  O  OE2 . GLU A 1 127 ? -11.739 15.213 5.656   1.00 65.36  ? 167 GLU A OE2 1 
ATOM   805  N  N   . GLY A 1 128 ? -8.426  18.240 1.874   1.00 38.64  ? 168 GLY A N   1 
ATOM   806  C  CA  . GLY A 1 128 ? -7.970  19.518 2.376   1.00 38.11  ? 168 GLY A CA  1 
ATOM   807  C  C   . GLY A 1 128 ? -8.506  20.638 1.506   1.00 38.71  ? 168 GLY A C   1 
ATOM   808  O  O   . GLY A 1 128 ? -8.967  21.665 1.998   1.00 38.09  ? 168 GLY A O   1 
ATOM   809  N  N   . HIS A 1 129 ? -8.464  20.430 0.194   1.00 37.83  ? 169 HIS A N   1 
ATOM   810  C  CA  . HIS A 1 129 ? -8.943  21.433 -0.726  1.00 36.71  ? 169 HIS A CA  1 
ATOM   811  C  C   . HIS A 1 129 ? -10.412 21.721 -0.464  1.00 37.17  ? 169 HIS A C   1 
ATOM   812  O  O   . HIS A 1 129 ? -10.828 22.879 -0.410  1.00 38.25  ? 169 HIS A O   1 
ATOM   813  C  CB  . HIS A 1 129 ? -8.733  20.988 -2.182  1.00 36.43  ? 169 HIS A CB  1 
ATOM   814  C  CG  . HIS A 1 129 ? -7.294  20.788 -2.559  1.00 37.47  ? 169 HIS A CG  1 
ATOM   815  N  ND1 . HIS A 1 129 ? -6.282  21.615 -2.115  1.00 38.80  ? 169 HIS A ND1 1 
ATOM   816  C  CD2 . HIS A 1 129 ? -6.700  19.858 -3.344  1.00 37.03  ? 169 HIS A CD2 1 
ATOM   817  C  CE1 . HIS A 1 129 ? -5.128  21.202 -2.608  1.00 36.75  ? 169 HIS A CE1 1 
ATOM   818  N  NE2 . HIS A 1 129 ? -5.354  20.138 -3.357  1.00 37.81  ? 169 HIS A NE2 1 
ATOM   819  N  N   . VAL A 1 130 ? -11.205 20.670 -0.319  1.00 37.94  ? 170 VAL A N   1 
ATOM   820  C  CA  . VAL A 1 130 ? -12.622 20.846 -0.056  1.00 38.20  ? 170 VAL A CA  1 
ATOM   821  C  C   . VAL A 1 130 ? -12.759 21.582 1.276   1.00 38.55  ? 170 VAL A C   1 
ATOM   822  O  O   . VAL A 1 130 ? -13.391 22.630 1.372   1.00 38.49  ? 170 VAL A O   1 
ATOM   823  C  CB  . VAL A 1 130 ? -13.341 19.482 0.021   1.00 37.07  ? 170 VAL A CB  1 
ATOM   824  C  CG1 . VAL A 1 130 ? -14.777 19.673 0.455   1.00 37.81  ? 170 VAL A CG1 1 
ATOM   825  C  CG2 . VAL A 1 130 ? -13.313 18.814 -1.333  1.00 35.77  ? 170 VAL A CG2 1 
ATOM   826  N  N   . LEU A 1 131 ? -12.134 21.035 2.304   1.00 39.61  ? 171 LEU A N   1 
ATOM   827  C  CA  . LEU A 1 131 ? -12.201 21.635 3.618   1.00 39.51  ? 171 LEU A CA  1 
ATOM   828  C  C   . LEU A 1 131 ? -11.810 23.094 3.534   1.00 40.09  ? 171 LEU A C   1 
ATOM   829  O  O   . LEU A 1 131 ? -12.425 23.953 4.163   1.00 41.17  ? 171 LEU A O   1 
ATOM   830  C  CB  . LEU A 1 131 ? -11.265 20.924 4.582   1.00 36.89  ? 171 LEU A CB  1 
ATOM   831  C  CG  . LEU A 1 131 ? -11.426 21.496 5.980   1.00 36.74  ? 171 LEU A CG  1 
ATOM   832  C  CD1 . LEU A 1 131 ? -12.668 20.874 6.612   1.00 39.11  ? 171 LEU A CD1 1 
ATOM   833  C  CD2 . LEU A 1 131 ? -10.215 21.223 6.813   1.00 34.03  ? 171 LEU A CD2 1 
ATOM   834  N  N   . SER A 1 132 ? -10.781 23.371 2.748   1.00 40.08  ? 172 SER A N   1 
ATOM   835  C  CA  . SER A 1 132 ? -10.304 24.730 2.585   1.00 39.69  ? 172 SER A CA  1 
ATOM   836  C  C   . SER A 1 132 ? -11.281 25.670 1.877   1.00 41.01  ? 172 SER A C   1 
ATOM   837  O  O   . SER A 1 132 ? -11.359 26.844 2.222   1.00 41.70  ? 172 SER A O   1 
ATOM   838  C  CB  . SER A 1 132 ? -8.981  24.722 1.847   1.00 38.11  ? 172 SER A CB  1 
ATOM   839  O  OG  . SER A 1 132 ? -8.574  26.046 1.612   1.00 40.70  ? 172 SER A OG  1 
ATOM   840  N  N   . GLU A 1 133 ? -12.013 25.168 0.883   1.00 42.08  ? 173 GLU A N   1 
ATOM   841  C  CA  . GLU A 1 133 ? -12.982 26.001 0.168   1.00 43.45  ? 173 GLU A CA  1 
ATOM   842  C  C   . GLU A 1 133 ? -14.286 26.068 0.968   1.00 44.54  ? 173 GLU A C   1 
ATOM   843  O  O   . GLU A 1 133 ? -15.032 27.041 0.890   1.00 45.74  ? 173 GLU A O   1 
ATOM   844  C  CB  . GLU A 1 133 ? -13.264 25.450 -1.242  1.00 43.45  ? 173 GLU A CB  1 
ATOM   845  C  CG  . GLU A 1 133 ? -12.087 25.518 -2.226  1.00 42.26  ? 173 GLU A CG  1 
ATOM   846  C  CD  . GLU A 1 133 ? -11.458 26.904 -2.318  1.00 40.37  ? 173 GLU A CD  1 
ATOM   847  O  OE1 . GLU A 1 133 ? -12.194 27.902 -2.271  1.00 41.82  ? 173 GLU A OE1 1 
ATOM   848  O  OE2 . GLU A 1 133 ? -10.225 26.995 -2.453  1.00 39.11  ? 173 GLU A OE2 1 
ATOM   849  N  N   . ALA A 1 134 ? -14.559 25.027 1.740   1.00 44.96  ? 174 ALA A N   1 
ATOM   850  C  CA  . ALA A 1 134 ? -15.752 25.014 2.564   1.00 44.75  ? 174 ALA A CA  1 
ATOM   851  C  C   . ALA A 1 134 ? -15.649 26.129 3.600   1.00 44.81  ? 174 ALA A C   1 
ATOM   852  O  O   . ALA A 1 134 ? -16.642 26.754 3.941   1.00 45.29  ? 174 ALA A O   1 
ATOM   853  C  CB  . ALA A 1 134 ? -15.890 23.678 3.258   1.00 44.22  ? 174 ALA A CB  1 
ATOM   854  N  N   . ARG A 1 135 ? -14.440 26.372 4.092   1.00 45.50  ? 175 ARG A N   1 
ATOM   855  C  CA  . ARG A 1 135 ? -14.208 27.399 5.096   1.00 46.97  ? 175 ARG A CA  1 
ATOM   856  C  C   . ARG A 1 135 ? -14.475 28.776 4.532   1.00 46.74  ? 175 ARG A C   1 
ATOM   857  O  O   . ARG A 1 135 ? -15.236 29.535 5.114   1.00 46.57  ? 175 ARG A O   1 
ATOM   858  C  CB  . ARG A 1 135 ? -12.764 27.310 5.631   1.00 51.01  ? 175 ARG A CB  1 
ATOM   859  C  CG  . ARG A 1 135 ? -12.071 28.655 6.000   1.00 56.12  ? 175 ARG A CG  1 
ATOM   860  C  CD  . ARG A 1 135 ? -12.785 29.393 7.127   1.00 59.87  ? 175 ARG A CD  1 
ATOM   861  N  NE  . ARG A 1 135 ? -12.215 30.705 7.454   1.00 63.53  ? 175 ARG A NE  1 
ATOM   862  C  CZ  . ARG A 1 135 ? -12.131 31.741 6.616   1.00 66.47  ? 175 ARG A CZ  1 
ATOM   863  N  NH1 . ARG A 1 135 ? -12.567 31.643 5.365   1.00 68.10  ? 175 ARG A NH1 1 
ATOM   864  N  NH2 . ARG A 1 135 ? -11.643 32.901 7.042   1.00 67.01  ? 175 ARG A NH2 1 
ATOM   865  N  N   . GLU A 1 136 ? -13.849 29.093 3.399   1.00 46.52  ? 176 GLU A N   1 
ATOM   866  C  CA  . GLU A 1 136 ? -14.007 30.392 2.756   1.00 45.95  ? 176 GLU A CA  1 
ATOM   867  C  C   . GLU A 1 136 ? -15.462 30.569 2.297   1.00 45.64  ? 176 GLU A C   1 
ATOM   868  O  O   . GLU A 1 136 ? -15.987 31.688 2.267   1.00 45.28  ? 176 GLU A O   1 
ATOM   869  C  CB  . GLU A 1 136 ? -13.026 30.490 1.577   1.00 48.13  ? 176 GLU A CB  1 
ATOM   870  C  CG  . GLU A 1 136 ? -13.200 31.692 0.643   1.00 54.34  ? 176 GLU A CG  1 
ATOM   871  C  CD  . GLU A 1 136 ? -12.235 32.865 0.914   1.00 58.78  ? 176 GLU A CD  1 
ATOM   872  O  OE1 . GLU A 1 136 ? -12.298 33.466 2.022   1.00 61.33  ? 176 GLU A OE1 1 
ATOM   873  O  OE2 . GLU A 1 136 ? -11.422 33.191 0.005   1.00 58.89  ? 176 GLU A OE2 1 
ATOM   874  N  N   . LEU A 1 137 ? -16.123 29.458 1.971   1.00 44.46  ? 177 LEU A N   1 
ATOM   875  C  CA  . LEU A 1 137 ? -17.518 29.495 1.511   1.00 43.25  ? 177 LEU A CA  1 
ATOM   876  C  C   . LEU A 1 137 ? -18.520 29.854 2.623   1.00 43.81  ? 177 LEU A C   1 
ATOM   877  O  O   . LEU A 1 137 ? -19.372 30.736 2.430   1.00 42.81  ? 177 LEU A O   1 
ATOM   878  C  CB  . LEU A 1 137 ? -17.905 28.151 0.869   1.00 39.71  ? 177 LEU A CB  1 
ATOM   879  C  CG  . LEU A 1 137 ? -19.349 27.998 0.383   1.00 38.56  ? 177 LEU A CG  1 
ATOM   880  C  CD1 . LEU A 1 137 ? -19.735 29.151 -0.545  1.00 36.07  ? 177 LEU A CD1 1 
ATOM   881  C  CD2 . LEU A 1 137 ? -19.511 26.660 -0.307  1.00 35.29  ? 177 LEU A CD2 1 
ATOM   882  N  N   . VAL A 1 138 ? -18.419 29.184 3.779   1.00 43.21  ? 178 VAL A N   1 
ATOM   883  C  CA  . VAL A 1 138 ? -19.331 29.463 4.886   1.00 41.66  ? 178 VAL A CA  1 
ATOM   884  C  C   . VAL A 1 138 ? -19.083 30.869 5.422   1.00 41.87  ? 178 VAL A C   1 
ATOM   885  O  O   . VAL A 1 138 ? -20.009 31.566 5.839   1.00 42.22  ? 178 VAL A O   1 
ATOM   886  C  CB  . VAL A 1 138 ? -19.182 28.433 6.038   1.00 40.69  ? 178 VAL A CB  1 
ATOM   887  C  CG1 . VAL A 1 138 ? -18.915 27.067 5.476   1.00 41.39  ? 178 VAL A CG1 1 
ATOM   888  C  CG2 . VAL A 1 138 ? -18.107 28.833 6.985   1.00 41.48  ? 178 VAL A CG2 1 
ATOM   889  N  N   . ALA A 1 139 ? -17.831 31.294 5.373   1.00 40.81  ? 179 ALA A N   1 
ATOM   890  C  CA  . ALA A 1 139 ? -17.468 32.600 5.858   1.00 41.43  ? 179 ALA A CA  1 
ATOM   891  C  C   . ALA A 1 139 ? -18.144 33.723 5.080   1.00 42.82  ? 179 ALA A C   1 
ATOM   892  O  O   . ALA A 1 139 ? -18.641 34.680 5.666   1.00 43.52  ? 179 ALA A O   1 
ATOM   893  C  CB  . ALA A 1 139 ? -15.964 32.755 5.811   1.00 40.71  ? 179 ALA A CB  1 
ATOM   894  N  N   . LEU A 1 140 ? -18.161 33.620 3.759   1.00 43.98  ? 180 LEU A N   1 
ATOM   895  C  CA  . LEU A 1 140 ? -18.785 34.668 2.954   1.00 44.69  ? 180 LEU A CA  1 
ATOM   896  C  C   . LEU A 1 140 ? -20.290 34.609 3.087   1.00 44.41  ? 180 LEU A C   1 
ATOM   897  O  O   . LEU A 1 140 ? -20.956 35.644 3.152   1.00 44.16  ? 180 LEU A O   1 
ATOM   898  C  CB  . LEU A 1 140 ? -18.428 34.508 1.479   1.00 46.22  ? 180 LEU A CB  1 
ATOM   899  C  CG  . LEU A 1 140 ? -16.955 34.309 1.138   1.00 48.09  ? 180 LEU A CG  1 
ATOM   900  C  CD1 . LEU A 1 140 ? -16.830 34.202 -0.365  1.00 48.61  ? 180 LEU A CD1 1 
ATOM   901  C  CD2 . LEU A 1 140 ? -16.105 35.458 1.688   1.00 48.91  ? 180 LEU A CD2 1 
ATOM   902  N  N   . LEU A 1 141 ? -20.822 33.389 3.106   1.00 44.30  ? 181 LEU A N   1 
ATOM   903  C  CA  . LEU A 1 141 ? -22.260 33.190 3.228   1.00 43.95  ? 181 LEU A CA  1 
ATOM   904  C  C   . LEU A 1 141 ? -22.751 33.739 4.551   1.00 45.29  ? 181 LEU A C   1 
ATOM   905  O  O   . LEU A 1 141 ? -23.791 34.389 4.598   1.00 47.29  ? 181 LEU A O   1 
ATOM   906  C  CB  . LEU A 1 141 ? -22.624 31.710 3.126   1.00 41.22  ? 181 LEU A CB  1 
ATOM   907  C  CG  . LEU A 1 141 ? -22.530 31.052 1.748   1.00 40.22  ? 181 LEU A CG  1 
ATOM   908  C  CD1 . LEU A 1 141 ? -22.808 29.569 1.896   1.00 38.24  ? 181 LEU A CD1 1 
ATOM   909  C  CD2 . LEU A 1 141 ? -23.509 31.692 0.775   1.00 36.90  ? 181 LEU A CD2 1 
ATOM   910  N  N   . VAL A 1 142 ? -21.999 33.489 5.622   1.00 45.93  ? 182 VAL A N   1 
ATOM   911  C  CA  . VAL A 1 142 ? -22.387 33.959 6.951   1.00 46.31  ? 182 VAL A CA  1 
ATOM   912  C  C   . VAL A 1 142 ? -22.188 35.466 7.080   1.00 47.53  ? 182 VAL A C   1 
ATOM   913  O  O   . VAL A 1 142 ? -23.032 36.178 7.635   1.00 46.69  ? 182 VAL A O   1 
ATOM   914  C  CB  . VAL A 1 142 ? -21.591 33.221 8.046   1.00 44.65  ? 182 VAL A CB  1 
ATOM   915  C  CG1 . VAL A 1 142 ? -21.804 33.881 9.377   1.00 44.85  ? 182 VAL A CG1 1 
ATOM   916  C  CG2 . VAL A 1 142 ? -22.040 31.776 8.117   1.00 44.42  ? 182 VAL A CG2 1 
ATOM   917  N  N   . ARG A 1 143 ? -21.066 35.942 6.554   1.00 49.58  ? 183 ARG A N   1 
ATOM   918  C  CA  . ARG A 1 143 ? -20.738 37.358 6.576   1.00 50.88  ? 183 ARG A CA  1 
ATOM   919  C  C   . ARG A 1 143 ? -21.811 38.099 5.784   1.00 50.05  ? 183 ARG A C   1 
ATOM   920  O  O   . ARG A 1 143 ? -22.393 39.053 6.268   1.00 50.44  ? 183 ARG A O   1 
ATOM   921  C  CB  . ARG A 1 143 ? -19.367 37.591 5.925   1.00 54.50  ? 183 ARG A CB  1 
ATOM   922  C  CG  . ARG A 1 143 ? -18.522 38.706 6.552   1.00 59.27  ? 183 ARG A CG  1 
ATOM   923  C  CD  . ARG A 1 143 ? -17.289 38.131 7.277   1.00 62.12  ? 183 ARG A CD  1 
ATOM   924  N  NE  . ARG A 1 143 ? -17.632 37.346 8.471   1.00 64.78  ? 183 ARG A NE  1 
ATOM   925  C  CZ  . ARG A 1 143 ? -16.816 36.472 9.067   1.00 65.32  ? 183 ARG A CZ  1 
ATOM   926  N  NH1 . ARG A 1 143 ? -15.596 36.251 8.591   1.00 64.88  ? 183 ARG A NH1 1 
ATOM   927  N  NH2 . ARG A 1 143 ? -17.213 35.819 10.152  1.00 65.56  ? 183 ARG A NH2 1 
ATOM   928  N  N   . GLY A 1 144 ? -22.087 37.636 4.571   1.00 49.78  ? 184 GLY A N   1 
ATOM   929  C  CA  . GLY A 1 144 ? -23.077 38.295 3.744   1.00 50.01  ? 184 GLY A CA  1 
ATOM   930  C  C   . GLY A 1 144 ? -24.497 37.897 4.057   1.00 50.47  ? 184 GLY A C   1 
ATOM   931  O  O   . GLY A 1 144 ? -25.357 37.922 3.191   1.00 51.75  ? 184 GLY A O   1 
ATOM   932  N  N   . SER A 1 145 ? -24.758 37.567 5.312   1.00 50.78  ? 185 SER A N   1 
ATOM   933  C  CA  . SER A 1 145 ? -26.082 37.119 5.720   1.00 49.48  ? 185 SER A CA  1 
ATOM   934  C  C   . SER A 1 145 ? -26.416 37.672 7.107   1.00 48.52  ? 185 SER A C   1 
ATOM   935  O  O   . SER A 1 145 ? -27.418 37.299 7.714   1.00 48.07  ? 185 SER A O   1 
ATOM   936  C  CB  . SER A 1 145 ? -26.079 35.588 5.730   1.00 49.59  ? 185 SER A CB  1 
ATOM   937  O  OG  . SER A 1 145 ? -27.341 35.060 6.040   1.00 53.92  ? 185 SER A OG  1 
ATOM   938  N  N   . ALA A 1 146 ? -25.556 38.567 7.590   1.00 47.72  ? 186 ALA A N   1 
ATOM   939  C  CA  . ALA A 1 146 ? -25.689 39.204 8.899   1.00 47.27  ? 186 ALA A CA  1 
ATOM   940  C  C   . ALA A 1 146 ? -26.971 40.017 9.095   1.00 47.24  ? 186 ALA A C   1 
ATOM   941  O  O   . ALA A 1 146 ? -27.538 40.565 8.145   1.00 47.40  ? 186 ALA A O   1 
ATOM   942  C  CB  . ALA A 1 146 ? -24.490 40.093 9.145   1.00 46.78  ? 186 ALA A CB  1 
ATOM   943  N  N   . ASP A 1 147 ? -27.419 40.095 10.342  1.00 46.42  ? 187 ASP A N   1 
ATOM   944  C  CA  . ASP A 1 147 ? -28.618 40.850 10.678  1.00 47.00  ? 187 ASP A CA  1 
ATOM   945  C  C   . ASP A 1 147 ? -29.870 40.461 9.906   1.00 45.05  ? 187 ASP A C   1 
ATOM   946  O  O   . ASP A 1 147 ? -30.655 41.320 9.537   1.00 45.07  ? 187 ASP A O   1 
ATOM   947  C  CB  . ASP A 1 147 ? -28.360 42.340 10.475  1.00 50.96  ? 187 ASP A CB  1 
ATOM   948  C  CG  . ASP A 1 147 ? -27.253 42.859 11.367  1.00 54.66  ? 187 ASP A CG  1 
ATOM   949  O  OD1 . ASP A 1 147 ? -26.727 43.965 11.086  1.00 56.42  ? 187 ASP A OD1 1 
ATOM   950  O  OD2 . ASP A 1 147 ? -26.920 42.153 12.354  1.00 56.74  ? 187 ASP A OD2 1 
ATOM   951  N  N   . GLY A 1 148 ? -30.056 39.172 9.671   1.00 43.46  ? 188 GLY A N   1 
ATOM   952  C  CA  . GLY A 1 148 ? -31.231 38.720 8.961   1.00 40.54  ? 188 GLY A CA  1 
ATOM   953  C  C   . GLY A 1 148 ? -31.173 38.919 7.467   1.00 39.76  ? 188 GLY A C   1 
ATOM   954  O  O   . GLY A 1 148 ? -32.194 38.822 6.801   1.00 40.15  ? 188 GLY A O   1 
ATOM   955  N  N   . ALA A 1 149 ? -29.987 39.179 6.923   1.00 39.30  ? 189 ALA A N   1 
ATOM   956  C  CA  . ALA A 1 149 ? -29.853 39.389 5.480   1.00 38.37  ? 189 ALA A CA  1 
ATOM   957  C  C   . ALA A 1 149 ? -29.859 38.110 4.636   1.00 37.57  ? 189 ALA A C   1 
ATOM   958  O  O   . ALA A 1 149 ? -29.613 37.013 5.128   1.00 37.14  ? 189 ALA A O   1 
ATOM   959  C  CB  . ALA A 1 149 ? -28.592 40.208 5.179   1.00 36.92  ? 189 ALA A CB  1 
ATOM   960  N  N   . PHE A 1 150 ? -30.171 38.281 3.354   1.00 37.63  ? 190 PHE A N   1 
ATOM   961  C  CA  . PHE A 1 150 ? -30.200 37.197 2.385   1.00 36.36  ? 190 PHE A CA  1 
ATOM   962  C  C   . PHE A 1 150 ? -29.209 37.521 1.259   1.00 36.83  ? 190 PHE A C   1 
ATOM   963  O  O   . PHE A 1 150 ? -28.921 38.696 0.952   1.00 35.15  ? 190 PHE A O   1 
ATOM   964  C  CB  . PHE A 1 150 ? -31.593 37.038 1.783   1.00 35.67  ? 190 PHE A CB  1 
ATOM   965  C  CG  . PHE A 1 150 ? -32.611 36.480 2.730   1.00 36.71  ? 190 PHE A CG  1 
ATOM   966  C  CD1 . PHE A 1 150 ? -33.251 37.299 3.649   1.00 36.91  ? 190 PHE A CD1 1 
ATOM   967  C  CD2 . PHE A 1 150 ? -32.936 35.118 2.700   1.00 37.97  ? 190 PHE A CD2 1 
ATOM   968  C  CE1 . PHE A 1 150 ? -34.199 36.769 4.524   1.00 38.32  ? 190 PHE A CE1 1 
ATOM   969  C  CE2 . PHE A 1 150 ? -33.877 34.574 3.565   1.00 35.76  ? 190 PHE A CE2 1 
ATOM   970  C  CZ  . PHE A 1 150 ? -34.512 35.393 4.480   1.00 38.32  ? 190 PHE A CZ  1 
ATOM   971  N  N   . LEU A 1 151 ? -28.688 36.467 0.645   1.00 36.96  ? 191 LEU A N   1 
ATOM   972  C  CA  . LEU A 1 151 ? -27.743 36.619 -0.436  1.00 36.98  ? 191 LEU A CA  1 
ATOM   973  C  C   . LEU A 1 151 ? -27.826 35.395 -1.299  1.00 37.19  ? 191 LEU A C   1 
ATOM   974  O  O   . LEU A 1 151 ? -28.098 34.305 -0.806  1.00 37.07  ? 191 LEU A O   1 
ATOM   975  C  CB  . LEU A 1 151 ? -26.327 36.788 0.113   1.00 38.49  ? 191 LEU A CB  1 
ATOM   976  C  CG  . LEU A 1 151 ? -25.501 35.658 0.764   1.00 41.88  ? 191 LEU A CG  1 
ATOM   977  C  CD1 . LEU A 1 151 ? -26.370 34.791 1.659   1.00 40.45  ? 191 LEU A CD1 1 
ATOM   978  C  CD2 . LEU A 1 151 ? -24.839 34.809 -0.313  1.00 43.47  ? 191 LEU A CD2 1 
ATOM   979  N  N   . ASP A 1 152 ? -27.620 35.597 -2.599  1.00 38.39  ? 192 ASP A N   1 
ATOM   980  C  CA  . ASP A 1 152 ? -27.639 34.529 -3.601  1.00 37.61  ? 192 ASP A CA  1 
ATOM   981  C  C   . ASP A 1 152 ? -26.319 33.752 -3.527  1.00 36.27  ? 192 ASP A C   1 
ATOM   982  O  O   . ASP A 1 152 ? -25.252 34.277 -3.839  1.00 32.89  ? 192 ASP A O   1 
ATOM   983  C  CB  . ASP A 1 152 ? -27.814 35.140 -4.989  1.00 40.18  ? 192 ASP A CB  1 
ATOM   984  C  CG  . ASP A 1 152 ? -27.699 34.121 -6.091  1.00 43.68  ? 192 ASP A CG  1 
ATOM   985  O  OD1 . ASP A 1 152 ? -26.794 33.270 -6.022  1.00 46.64  ? 192 ASP A OD1 1 
ATOM   986  O  OD2 . ASP A 1 152 ? -28.498 34.179 -7.043  1.00 46.73  ? 192 ASP A OD2 1 
ATOM   987  N  N   . PRO A 1 153 ? -26.389 32.475 -3.123  1.00 35.88  ? 193 PRO A N   1 
ATOM   988  C  CA  . PRO A 1 153 ? -25.246 31.574 -2.981  1.00 35.58  ? 193 PRO A CA  1 
ATOM   989  C  C   . PRO A 1 153 ? -24.486 31.151 -4.241  1.00 35.94  ? 193 PRO A C   1 
ATOM   990  O  O   . PRO A 1 153 ? -23.270 30.944 -4.188  1.00 37.06  ? 193 PRO A O   1 
ATOM   991  C  CB  . PRO A 1 153 ? -25.862 30.383 -2.268  1.00 35.20  ? 193 PRO A CB  1 
ATOM   992  C  CG  . PRO A 1 153 ? -27.186 30.323 -2.876  1.00 34.26  ? 193 PRO A CG  1 
ATOM   993  C  CD  . PRO A 1 153 ? -27.633 31.761 -2.798  1.00 33.95  ? 193 PRO A CD  1 
ATOM   994  N  N   . ARG A 1 154 ? -25.186 31.029 -5.365  1.00 35.53  ? 194 ARG A N   1 
ATOM   995  C  CA  . ARG A 1 154 ? -24.588 30.577 -6.635  1.00 35.65  ? 194 ARG A CA  1 
ATOM   996  C  C   . ARG A 1 154 ? -23.181 31.075 -7.027  1.00 34.83  ? 194 ARG A C   1 
ATOM   997  O  O   . ARG A 1 154 ? -22.241 30.293 -7.133  1.00 34.71  ? 194 ARG A O   1 
ATOM   998  C  CB  . ARG A 1 154 ? -25.566 30.858 -7.788  1.00 37.57  ? 194 ARG A CB  1 
ATOM   999  C  CG  . ARG A 1 154 ? -27.015 30.369 -7.536  1.00 40.35  ? 194 ARG A CG  1 
ATOM   1000 C  CD  . ARG A 1 154 ? -27.937 30.803 -8.669  1.00 42.61  ? 194 ARG A CD  1 
ATOM   1001 N  NE  . ARG A 1 154 ? -27.976 32.261 -8.788  1.00 44.16  ? 194 ARG A NE  1 
ATOM   1002 C  CZ  . ARG A 1 154 ? -28.226 32.916 -9.916  1.00 44.64  ? 194 ARG A CZ  1 
ATOM   1003 N  NH1 . ARG A 1 154 ? -28.457 32.245 -11.038 1.00 45.74  ? 194 ARG A NH1 1 
ATOM   1004 N  NH2 . ARG A 1 154 ? -28.248 34.245 -9.923  1.00 45.53  ? 194 ARG A NH2 1 
ATOM   1005 N  N   . PRO A 1 155 ? -23.019 32.379 -7.254  1.00 34.88  ? 195 PRO A N   1 
ATOM   1006 C  CA  . PRO A 1 155 ? -21.672 32.819 -7.630  1.00 35.02  ? 195 PRO A CA  1 
ATOM   1007 C  C   . PRO A 1 155 ? -20.631 32.248 -6.670  1.00 35.72  ? 195 PRO A C   1 
ATOM   1008 O  O   . PRO A 1 155 ? -19.540 31.834 -7.060  1.00 36.79  ? 195 PRO A O   1 
ATOM   1009 C  CB  . PRO A 1 155 ? -21.753 34.341 -7.516  1.00 34.65  ? 195 PRO A CB  1 
ATOM   1010 C  CG  . PRO A 1 155 ? -23.218 34.641 -7.594  1.00 34.43  ? 195 PRO A CG  1 
ATOM   1011 C  CD  . PRO A 1 155 ? -23.856 33.520 -6.848  1.00 33.84  ? 195 PRO A CD  1 
ATOM   1012 N  N   . LEU A 1 156 ? -20.991 32.229 -5.399  1.00 36.08  ? 196 LEU A N   1 
ATOM   1013 C  CA  . LEU A 1 156 ? -20.106 31.744 -4.379  1.00 36.41  ? 196 LEU A CA  1 
ATOM   1014 C  C   . LEU A 1 156 ? -19.804 30.267 -4.512  1.00 37.50  ? 196 LEU A C   1 
ATOM   1015 O  O   . LEU A 1 156 ? -18.666 29.857 -4.297  1.00 39.37  ? 196 LEU A O   1 
ATOM   1016 C  CB  . LEU A 1 156 ? -20.704 32.054 -3.012  1.00 36.58  ? 196 LEU A CB  1 
ATOM   1017 C  CG  . LEU A 1 156 ? -20.778 33.564 -2.758  1.00 38.84  ? 196 LEU A CG  1 
ATOM   1018 C  CD1 . LEU A 1 156 ? -21.310 33.832 -1.369  1.00 39.54  ? 196 LEU A CD1 1 
ATOM   1019 C  CD2 . LEU A 1 156 ? -19.384 34.171 -2.907  1.00 39.40  ? 196 LEU A CD2 1 
ATOM   1020 N  N   . THR A 1 157 ? -20.800 29.466 -4.885  1.00 36.28  ? 197 THR A N   1 
ATOM   1021 C  CA  . THR A 1 157 ? -20.585 28.037 -5.002  1.00 35.00  ? 197 THR A CA  1 
ATOM   1022 C  C   . THR A 1 157 ? -19.762 27.667 -6.216  1.00 35.37  ? 197 THR A C   1 
ATOM   1023 O  O   . THR A 1 157 ? -19.063 26.651 -6.202  1.00 35.99  ? 197 THR A O   1 
ATOM   1024 C  CB  . THR A 1 157 ? -21.918 27.231 -5.033  1.00 34.14  ? 197 THR A CB  1 
ATOM   1025 O  OG1 . THR A 1 157 ? -22.598 27.440 -6.272  1.00 34.35  ? 197 THR A OG1 1 
ATOM   1026 C  CG2 . THR A 1 157 ? -22.815 27.656 -3.901  1.00 33.97  ? 197 THR A CG2 1 
ATOM   1027 N  N   . VAL A 1 158 ? -19.837 28.466 -7.275  1.00 35.54  ? 198 VAL A N   1 
ATOM   1028 C  CA  . VAL A 1 158 ? -19.042 28.145 -8.459  1.00 36.14  ? 198 VAL A CA  1 
ATOM   1029 C  C   . VAL A 1 158 ? -17.572 28.307 -8.102  1.00 36.80  ? 198 VAL A C   1 
ATOM   1030 O  O   . VAL A 1 158 ? -16.769 27.387 -8.282  1.00 38.96  ? 198 VAL A O   1 
ATOM   1031 C  CB  . VAL A 1 158 ? -19.361 29.056 -9.658  1.00 35.60  ? 198 VAL A CB  1 
ATOM   1032 C  CG1 . VAL A 1 158 ? -18.690 28.497 -10.900 1.00 35.90  ? 198 VAL A CG1 1 
ATOM   1033 C  CG2 . VAL A 1 158 ? -20.869 29.135 -9.869  1.00 35.23  ? 198 VAL A CG2 1 
ATOM   1034 N  N   . VAL A 1 159 ? -17.237 29.472 -7.564  1.00 35.98  ? 199 VAL A N   1 
ATOM   1035 C  CA  . VAL A 1 159 ? -15.873 29.773 -7.166  1.00 35.42  ? 199 VAL A CA  1 
ATOM   1036 C  C   . VAL A 1 159 ? -15.290 28.748 -6.189  1.00 35.26  ? 199 VAL A C   1 
ATOM   1037 O  O   . VAL A 1 159 ? -14.113 28.411 -6.271  1.00 35.19  ? 199 VAL A O   1 
ATOM   1038 C  CB  . VAL A 1 159 ? -15.790 31.195 -6.536  1.00 33.97  ? 199 VAL A CB  1 
ATOM   1039 C  CG1 . VAL A 1 159 ? -14.361 31.530 -6.170  1.00 31.71  ? 199 VAL A CG1 1 
ATOM   1040 C  CG2 . VAL A 1 159 ? -16.328 32.212 -7.509  1.00 32.92  ? 199 VAL A CG2 1 
ATOM   1041 N  N   . ALA A 1 160 ? -16.108 28.246 -5.275  1.00 35.58  ? 200 ALA A N   1 
ATOM   1042 C  CA  . ALA A 1 160 ? -15.630 27.277 -4.284  1.00 37.16  ? 200 ALA A CA  1 
ATOM   1043 C  C   . ALA A 1 160 ? -15.276 25.922 -4.898  1.00 37.52  ? 200 ALA A C   1 
ATOM   1044 O  O   . ALA A 1 160 ? -14.345 25.248 -4.447  1.00 38.61  ? 200 ALA A O   1 
ATOM   1045 C  CB  . ALA A 1 160 ? -16.683 27.088 -3.171  1.00 35.08  ? 200 ALA A CB  1 
ATOM   1046 N  N   . VAL A 1 161 ? -16.020 25.533 -5.926  1.00 37.45  ? 201 VAL A N   1 
ATOM   1047 C  CA  . VAL A 1 161 ? -15.802 24.263 -6.595  1.00 38.02  ? 201 VAL A CA  1 
ATOM   1048 C  C   . VAL A 1 161 ? -14.709 24.354 -7.668  1.00 37.65  ? 201 VAL A C   1 
ATOM   1049 O  O   . VAL A 1 161 ? -13.951 23.399 -7.910  1.00 36.23  ? 201 VAL A O   1 
ATOM   1050 C  CB  . VAL A 1 161 ? -17.132 23.769 -7.217  1.00 39.74  ? 201 VAL A CB  1 
ATOM   1051 C  CG1 . VAL A 1 161 ? -16.887 22.536 -8.103  1.00 39.92  ? 201 VAL A CG1 1 
ATOM   1052 C  CG2 . VAL A 1 161 ? -18.122 23.445 -6.084  1.00 37.07  ? 201 VAL A CG2 1 
ATOM   1053 N  N   . ALA A 1 162 ? -14.629 25.512 -8.304  1.00 35.65  ? 202 ALA A N   1 
ATOM   1054 C  CA  . ALA A 1 162 ? -13.627 25.717 -9.327  1.00 34.66  ? 202 ALA A CA  1 
ATOM   1055 C  C   . ALA A 1 162 ? -12.270 25.767 -8.658  1.00 33.74  ? 202 ALA A C   1 
ATOM   1056 O  O   . ALA A 1 162 ? -11.252 25.422 -9.259  1.00 35.08  ? 202 ALA A O   1 
ATOM   1057 C  CB  . ALA A 1 162 ? -13.886 27.023 -10.067 1.00 35.02  ? 202 ALA A CB  1 
ATOM   1058 N  N   . ASN A 1 163 ? -12.239 26.212 -7.412  1.00 32.56  ? 203 ASN A N   1 
ATOM   1059 C  CA  . ASN A 1 163 ? -10.959 26.297 -6.726  1.00 30.69  ? 203 ASN A CA  1 
ATOM   1060 C  C   . ASN A 1 163 ? -10.527 24.935 -6.299  1.00 30.57  ? 203 ASN A C   1 
ATOM   1061 O  O   . ASN A 1 163 ? -9.347  24.642 -6.318  1.00 32.57  ? 203 ASN A O   1 
ATOM   1062 C  CB  . ASN A 1 163 ? -11.011 27.217 -5.509  1.00 28.77  ? 203 ASN A CB  1 
ATOM   1063 C  CG  . ASN A 1 163 ? -10.822 28.674 -5.864  1.00 26.00  ? 203 ASN A CG  1 
ATOM   1064 O  OD1 . ASN A 1 163 ? -10.289 29.015 -6.911  1.00 24.76  ? 203 ASN A OD1 1 
ATOM   1065 N  ND2 . ASN A 1 163 ? -11.251 29.542 -4.977  1.00 27.85  ? 203 ASN A ND2 1 
ATOM   1066 N  N   . VAL A 1 164 ? -11.464 24.089 -5.907  1.00 30.71  ? 204 VAL A N   1 
ATOM   1067 C  CA  . VAL A 1 164 ? -11.055 22.759 -5.505  1.00 30.71  ? 204 VAL A CA  1 
ATOM   1068 C  C   . VAL A 1 164 ? -10.323 22.176 -6.675  1.00 31.22  ? 204 VAL A C   1 
ATOM   1069 O  O   . VAL A 1 164 ? -9.294  21.556 -6.504  1.00 31.55  ? 204 VAL A O   1 
ATOM   1070 C  CB  . VAL A 1 164 ? -12.235 21.827 -5.221  1.00 32.64  ? 204 VAL A CB  1 
ATOM   1071 C  CG1 . VAL A 1 164 ? -11.729 20.388 -5.109  1.00 30.78  ? 204 VAL A CG1 1 
ATOM   1072 C  CG2 . VAL A 1 164 ? -12.963 22.247 -3.945  1.00 33.79  ? 204 VAL A CG2 1 
ATOM   1073 N  N   . MET A 1 165 ? -10.861 22.401 -7.876  1.00 34.05  ? 205 MET A N   1 
ATOM   1074 C  CA  . MET A 1 165 ? -10.292 21.849 -9.120  1.00 33.33  ? 205 MET A CA  1 
ATOM   1075 C  C   . MET A 1 165 ? -9.176  22.677 -9.701  1.00 33.78  ? 205 MET A C   1 
ATOM   1076 O  O   . MET A 1 165 ? -8.381  22.164 -10.493 1.00 34.97  ? 205 MET A O   1 
ATOM   1077 C  CB  . MET A 1 165 ? -11.368 21.680 -10.196 1.00 33.22  ? 205 MET A CB  1 
ATOM   1078 C  CG  . MET A 1 165 ? -12.579 20.831 -9.823  1.00 32.72  ? 205 MET A CG  1 
ATOM   1079 S  SD  . MET A 1 165 ? -12.213 19.105 -9.464  1.00 40.09  ? 205 MET A SD  1 
ATOM   1080 C  CE  . MET A 1 165 ? -11.079 18.628 -10.777 1.00 34.47  ? 205 MET A CE  1 
ATOM   1081 N  N   . SER A 1 166 ? -9.129  23.957 -9.342  1.00 33.33  ? 206 SER A N   1 
ATOM   1082 C  CA  . SER A 1 166 ? -8.069  24.821 -9.826  1.00 33.23  ? 206 SER A CA  1 
ATOM   1083 C  C   . SER A 1 166 ? -6.828  24.294 -9.130  1.00 32.50  ? 206 SER A C   1 
ATOM   1084 O  O   . SER A 1 166 ? -5.775  24.172 -9.728  1.00 34.11  ? 206 SER A O   1 
ATOM   1085 C  CB  . SER A 1 166 ? -8.330  26.294 -9.440  1.00 36.18  ? 206 SER A CB  1 
ATOM   1086 O  OG  . SER A 1 166 ? -7.546  27.218 -10.215 1.00 35.04  ? 206 SER A OG  1 
ATOM   1087 N  N   . ALA A 1 167 ? -6.953  23.950 -7.862  1.00 33.20  ? 207 ALA A N   1 
ATOM   1088 C  CA  . ALA A 1 167 ? -5.807  23.423 -7.129  1.00 35.16  ? 207 ALA A CA  1 
ATOM   1089 C  C   . ALA A 1 167 ? -5.474  21.983 -7.543  1.00 35.59  ? 207 ALA A C   1 
ATOM   1090 O  O   . ALA A 1 167 ? -4.307  21.607 -7.591  1.00 36.41  ? 207 ALA A O   1 
ATOM   1091 C  CB  . ALA A 1 167 ? -6.072  23.469 -5.630  1.00 33.63  ? 207 ALA A CB  1 
ATOM   1092 N  N   . VAL A 1 168 ? -6.487  21.173 -7.822  1.00 35.06  ? 208 VAL A N   1 
ATOM   1093 C  CA  . VAL A 1 168 ? -6.223  19.802 -8.209  1.00 36.03  ? 208 VAL A CA  1 
ATOM   1094 C  C   . VAL A 1 168 ? -5.572  19.741 -9.582  1.00 38.69  ? 208 VAL A C   1 
ATOM   1095 O  O   . VAL A 1 168 ? -4.700  18.898 -9.827  1.00 39.75  ? 208 VAL A O   1 
ATOM   1096 C  CB  . VAL A 1 168 ? -7.506  18.951 -8.262  1.00 34.29  ? 208 VAL A CB  1 
ATOM   1097 C  CG1 . VAL A 1 168 ? -7.271  17.725 -9.111  1.00 30.56  ? 208 VAL A CG1 1 
ATOM   1098 C  CG2 . VAL A 1 168 ? -7.896  18.527 -6.880  1.00 32.28  ? 208 VAL A CG2 1 
ATOM   1099 N  N   . CYS A 1 169 ? -5.993  20.647 -10.464 1.00 39.50  ? 209 CYS A N   1 
ATOM   1100 C  CA  . CYS A 1 169 ? -5.499  20.687 -11.838 1.00 39.93  ? 209 CYS A CA  1 
ATOM   1101 C  C   . CYS A 1 169 ? -4.288  21.574 -12.105 1.00 39.36  ? 209 CYS A C   1 
ATOM   1102 O  O   . CYS A 1 169 ? -3.454  21.250 -12.947 1.00 40.06  ? 209 CYS A O   1 
ATOM   1103 C  CB  . CYS A 1 169 ? -6.650  21.084 -12.775 1.00 39.98  ? 209 CYS A CB  1 
ATOM   1104 S  SG  . CYS A 1 169 ? -7.938  19.778 -12.995 1.00 43.45  ? 209 CYS A SG  1 
ATOM   1105 N  N   . PHE A 1 170 ? -4.181  22.692 -11.403 1.00 39.07  ? 210 PHE A N   1 
ATOM   1106 C  CA  . PHE A 1 170 ? -3.064  23.597 -11.637 1.00 39.64  ? 210 PHE A CA  1 
ATOM   1107 C  C   . PHE A 1 170 ? -2.246  23.850 -10.373 1.00 39.96  ? 210 PHE A C   1 
ATOM   1108 O  O   . PHE A 1 170 ? -1.130  24.344 -10.444 1.00 38.93  ? 210 PHE A O   1 
ATOM   1109 C  CB  . PHE A 1 170 ? -3.590  24.917 -12.214 1.00 39.03  ? 210 PHE A CB  1 
ATOM   1110 C  CG  . PHE A 1 170 ? -4.756  24.738 -13.136 1.00 38.31  ? 210 PHE A CG  1 
ATOM   1111 C  CD1 . PHE A 1 170 ? -4.740  23.752 -14.117 1.00 40.63  ? 210 PHE A CD1 1 
ATOM   1112 C  CD2 . PHE A 1 170 ? -5.880  25.531 -13.018 1.00 38.81  ? 210 PHE A CD2 1 
ATOM   1113 C  CE1 . PHE A 1 170 ? -5.833  23.561 -14.966 1.00 38.05  ? 210 PHE A CE1 1 
ATOM   1114 C  CE2 . PHE A 1 170 ? -6.982  25.351 -13.867 1.00 37.32  ? 210 PHE A CE2 1 
ATOM   1115 C  CZ  . PHE A 1 170 ? -6.952  24.367 -14.836 1.00 37.28  ? 210 PHE A CZ  1 
ATOM   1116 N  N   . GLY A 1 171 ? -2.796  23.493 -9.220  1.00 40.79  ? 211 GLY A N   1 
ATOM   1117 C  CA  . GLY A 1 171 ? -2.070  23.691 -7.979  1.00 43.34  ? 211 GLY A CA  1 
ATOM   1118 C  C   . GLY A 1 171 ? -2.130  25.123 -7.496  1.00 44.62  ? 211 GLY A C   1 
ATOM   1119 O  O   . GLY A 1 171 ? -1.334  25.548 -6.654  1.00 44.21  ? 211 GLY A O   1 
ATOM   1120 N  N   . CYS A 1 172 ? -3.093  25.858 -8.038  1.00 45.71  ? 212 CYS A N   1 
ATOM   1121 C  CA  . CYS A 1 172 ? -3.300  27.254 -7.705  1.00 47.19  ? 212 CYS A CA  1 
ATOM   1122 C  C   . CYS A 1 172 ? -4.800  27.531 -7.507  1.00 47.86  ? 212 CYS A C   1 
ATOM   1123 O  O   . CYS A 1 172 ? -5.619  27.121 -8.322  1.00 49.00  ? 212 CYS A O   1 
ATOM   1124 C  CB  . CYS A 1 172 ? -2.746  28.123 -8.847  1.00 46.29  ? 212 CYS A CB  1 
ATOM   1125 S  SG  . CYS A 1 172 ? -3.651  29.679 -9.200  1.00 51.49  ? 212 CYS A SG  1 
ATOM   1126 N  N   . ARG A 1 173 ? -5.166  28.194 -6.416  1.00 47.32  ? 213 ARG A N   1 
ATOM   1127 C  CA  . ARG A 1 173 ? -6.563  28.551 -6.213  1.00 48.65  ? 213 ARG A CA  1 
ATOM   1128 C  C   . ARG A 1 173 ? -6.665  30.084 -6.327  1.00 48.79  ? 213 ARG A C   1 
ATOM   1129 O  O   . ARG A 1 173 ? -5.688  30.796 -6.099  1.00 48.33  ? 213 ARG A O   1 
ATOM   1130 C  CB  . ARG A 1 173 ? -7.089  28.061 -4.856  1.00 49.76  ? 213 ARG A CB  1 
ATOM   1131 C  CG  . ARG A 1 173 ? -6.559  28.794 -3.639  1.00 51.43  ? 213 ARG A CG  1 
ATOM   1132 C  CD  . ARG A 1 173 ? -7.619  28.854 -2.538  1.00 52.44  ? 213 ARG A CD  1 
ATOM   1133 N  NE  . ARG A 1 173 ? -8.146  30.209 -2.367  1.00 53.30  ? 213 ARG A NE  1 
ATOM   1134 C  CZ  . ARG A 1 173 ? -9.339  30.499 -1.851  1.00 54.94  ? 213 ARG A CZ  1 
ATOM   1135 N  NH1 . ARG A 1 173 ? -10.151 29.526 -1.448  1.00 54.81  ? 213 ARG A NH1 1 
ATOM   1136 N  NH2 . ARG A 1 173 ? -9.727  31.768 -1.747  1.00 56.19  ? 213 ARG A NH2 1 
ATOM   1137 N  N   . TYR A 1 174 ? -7.839  30.587 -6.697  1.00 49.03  ? 214 TYR A N   1 
ATOM   1138 C  CA  . TYR A 1 174 ? -8.041  32.023 -6.880  1.00 48.86  ? 214 TYR A CA  1 
ATOM   1139 C  C   . TYR A 1 174 ? -8.830  32.666 -5.759  1.00 50.54  ? 214 TYR A C   1 
ATOM   1140 O  O   . TYR A 1 174 ? -9.594  31.992 -5.081  1.00 51.80  ? 214 TYR A O   1 
ATOM   1141 C  CB  . TYR A 1 174 ? -8.784  32.286 -8.198  1.00 46.52  ? 214 TYR A CB  1 
ATOM   1142 C  CG  . TYR A 1 174 ? -7.957  32.079 -9.443  1.00 43.18  ? 214 TYR A CG  1 
ATOM   1143 C  CD1 . TYR A 1 174 ? -7.377  33.162 -10.110 1.00 42.22  ? 214 TYR A CD1 1 
ATOM   1144 C  CD2 . TYR A 1 174 ? -7.707  30.791 -9.920  1.00 42.16  ? 214 TYR A CD2 1 
ATOM   1145 C  CE1 . TYR A 1 174 ? -6.562  32.962 -11.209 1.00 42.35  ? 214 TYR A CE1 1 
ATOM   1146 C  CE2 . TYR A 1 174 ? -6.896  30.576 -11.015 1.00 41.22  ? 214 TYR A CE2 1 
ATOM   1147 C  CZ  . TYR A 1 174 ? -6.321  31.653 -11.651 1.00 42.64  ? 214 TYR A CZ  1 
ATOM   1148 O  OH  . TYR A 1 174 ? -5.455  31.410 -12.686 1.00 43.60  ? 214 TYR A OH  1 
ATOM   1149 N  N   . SER A 1 175 ? -8.655  33.974 -5.583  1.00 51.94  ? 215 SER A N   1 
ATOM   1150 C  CA  . SER A 1 175 ? -9.388  34.708 -4.561  1.00 54.11  ? 215 SER A CA  1 
ATOM   1151 C  C   . SER A 1 175 ? -10.812 34.779 -5.044  1.00 55.55  ? 215 SER A C   1 
ATOM   1152 O  O   . SER A 1 175 ? -11.040 34.947 -6.233  1.00 55.23  ? 215 SER A O   1 
ATOM   1153 C  CB  . SER A 1 175 ? -8.852  36.132 -4.410  1.00 54.23  ? 215 SER A CB  1 
ATOM   1154 O  OG  . SER A 1 175 ? -7.472  36.122 -4.094  1.00 55.82  ? 215 SER A OG  1 
ATOM   1155 N  N   . HIS A 1 176 ? -11.766 34.642 -4.130  1.00 58.67  ? 216 HIS A N   1 
ATOM   1156 C  CA  . HIS A 1 176 ? -13.178 34.708 -4.493  1.00 61.94  ? 216 HIS A CA  1 
ATOM   1157 C  C   . HIS A 1 176 ? -13.481 36.102 -5.060  1.00 63.10  ? 216 HIS A C   1 
ATOM   1158 O  O   . HIS A 1 176 ? -14.539 36.326 -5.656  1.00 64.12  ? 216 HIS A O   1 
ATOM   1159 C  CB  . HIS A 1 176 ? -14.062 34.458 -3.267  1.00 63.48  ? 216 HIS A CB  1 
ATOM   1160 C  CG  . HIS A 1 176 ? -14.063 35.596 -2.294  1.00 67.68  ? 216 HIS A CG  1 
ATOM   1161 N  ND1 . HIS A 1 176 ? -13.028 35.823 -1.410  1.00 69.52  ? 216 HIS A ND1 1 
ATOM   1162 C  CD2 . HIS A 1 176 ? -14.932 36.623 -2.125  1.00 69.29  ? 216 HIS A CD2 1 
ATOM   1163 C  CE1 . HIS A 1 176 ? -13.256 36.941 -0.743  1.00 69.62  ? 216 HIS A CE1 1 
ATOM   1164 N  NE2 . HIS A 1 176 ? -14.405 37.447 -1.159  1.00 69.70  ? 216 HIS A NE2 1 
ATOM   1165 N  N   . ASP A 1 177 ? -12.547 37.032 -4.864  1.00 63.89  ? 217 ASP A N   1 
ATOM   1166 C  CA  . ASP A 1 177 ? -12.696 38.403 -5.338  1.00 64.36  ? 217 ASP A CA  1 
ATOM   1167 C  C   . ASP A 1 177 ? -12.156 38.547 -6.746  1.00 63.16  ? 217 ASP A C   1 
ATOM   1168 O  O   . ASP A 1 177 ? -12.578 39.429 -7.487  1.00 62.89  ? 217 ASP A O   1 
ATOM   1169 C  CB  . ASP A 1 177 ? -11.928 39.372 -4.441  1.00 68.05  ? 217 ASP A CB  1 
ATOM   1170 C  CG  . ASP A 1 177 ? -12.360 39.299 -2.986  1.00 72.37  ? 217 ASP A CG  1 
ATOM   1171 O  OD1 . ASP A 1 177 ? -13.548 39.581 -2.686  1.00 73.92  ? 217 ASP A OD1 1 
ATOM   1172 O  OD2 . ASP A 1 177 ? -11.498 38.962 -2.137  1.00 75.01  ? 217 ASP A OD2 1 
ATOM   1173 N  N   . ASP A 1 178 ? -11.248 37.651 -7.119  1.00 61.90  ? 218 ASP A N   1 
ATOM   1174 C  CA  . ASP A 1 178 ? -10.661 37.654 -8.454  1.00 60.49  ? 218 ASP A CA  1 
ATOM   1175 C  C   . ASP A 1 178 ? -11.725 37.779 -9.542  1.00 60.27  ? 218 ASP A C   1 
ATOM   1176 O  O   . ASP A 1 178 ? -12.490 36.848 -9.795  1.00 59.91  ? 218 ASP A O   1 
ATOM   1177 C  CB  . ASP A 1 178 ? -9.830  36.388 -8.675  1.00 59.60  ? 218 ASP A CB  1 
ATOM   1178 C  CG  . ASP A 1 178 ? -8.788  36.558 -9.763  1.00 58.26  ? 218 ASP A CG  1 
ATOM   1179 O  OD1 . ASP A 1 178 ? -9.136  37.074 -10.846 1.00 56.33  ? 218 ASP A OD1 1 
ATOM   1180 O  OD2 . ASP A 1 178 ? -7.621  36.176 -9.536  1.00 58.08  ? 218 ASP A OD2 1 
ATOM   1181 N  N   . PRO A 1 179 ? -11.758 38.943 -10.181 1.00 59.53  ? 219 PRO A N   1 
ATOM   1182 C  CA  . PRO A 1 179 ? -12.703 39.238 -11.262 1.00 58.14  ? 219 PRO A CA  1 
ATOM   1183 C  C   . PRO A 1 179 ? -12.479 38.398 -12.521 1.00 57.00  ? 219 PRO A C   1 
ATOM   1184 O  O   . PRO A 1 179 ? -13.406 37.764 -13.039 1.00 57.66  ? 219 PRO A O   1 
ATOM   1185 C  CB  . PRO A 1 179 ? -12.467 40.728 -11.504 1.00 58.09  ? 219 PRO A CB  1 
ATOM   1186 C  CG  . PRO A 1 179 ? -11.007 40.857 -11.281 1.00 57.11  ? 219 PRO A CG  1 
ATOM   1187 C  CD  . PRO A 1 179 ? -10.827 40.072 -9.998  1.00 58.41  ? 219 PRO A CD  1 
ATOM   1188 N  N   . GLU A 1 180 ? -11.243 38.410 -13.003 1.00 54.48  ? 220 GLU A N   1 
ATOM   1189 C  CA  . GLU A 1 180 ? -10.854 37.669 -14.191 1.00 53.14  ? 220 GLU A CA  1 
ATOM   1190 C  C   . GLU A 1 180 ? -11.194 36.165 -14.092 1.00 51.06  ? 220 GLU A C   1 
ATOM   1191 O  O   . GLU A 1 180 ? -11.382 35.493 -15.105 1.00 51.31  ? 220 GLU A O   1 
ATOM   1192 C  CB  . GLU A 1 180 ? -9.358  37.865 -14.406 1.00 55.56  ? 220 GLU A CB  1 
ATOM   1193 C  CG  . GLU A 1 180 ? -8.833  37.455 -15.753 1.00 58.92  ? 220 GLU A CG  1 
ATOM   1194 C  CD  . GLU A 1 180 ? -7.338  37.694 -15.854 1.00 61.37  ? 220 GLU A CD  1 
ATOM   1195 O  OE1 . GLU A 1 180 ? -6.902  38.837 -15.582 1.00 61.24  ? 220 GLU A OE1 1 
ATOM   1196 O  OE2 . GLU A 1 180 ? -6.601  36.742 -16.197 1.00 63.31  ? 220 GLU A OE2 1 
ATOM   1197 N  N   . PHE A 1 181 ? -11.276 35.642 -12.875 1.00 47.68  ? 221 PHE A N   1 
ATOM   1198 C  CA  . PHE A 1 181 ? -11.601 34.240 -12.683 1.00 45.26  ? 221 PHE A CA  1 
ATOM   1199 C  C   . PHE A 1 181 ? -13.108 34.054 -12.508 1.00 45.10  ? 221 PHE A C   1 
ATOM   1200 O  O   . PHE A 1 181 ? -13.679 33.062 -12.967 1.00 44.93  ? 221 PHE A O   1 
ATOM   1201 C  CB  . PHE A 1 181 ? -10.859 33.691 -11.466 1.00 43.29  ? 221 PHE A CB  1 
ATOM   1202 C  CG  . PHE A 1 181 ? -11.143 32.239 -11.178 1.00 40.48  ? 221 PHE A CG  1 
ATOM   1203 C  CD1 . PHE A 1 181 ? -10.776 31.249 -12.087 1.00 39.50  ? 221 PHE A CD1 1 
ATOM   1204 C  CD2 . PHE A 1 181 ? -11.726 31.858 -9.975  1.00 38.60  ? 221 PHE A CD2 1 
ATOM   1205 C  CE1 . PHE A 1 181 ? -10.977 29.906 -11.794 1.00 37.63  ? 221 PHE A CE1 1 
ATOM   1206 C  CE2 . PHE A 1 181 ? -11.931 30.517 -9.675  1.00 38.20  ? 221 PHE A CE2 1 
ATOM   1207 C  CZ  . PHE A 1 181 ? -11.555 29.543 -10.581 1.00 37.60  ? 221 PHE A CZ  1 
ATOM   1208 N  N   . ARG A 1 182 ? -13.753 34.994 -11.825 1.00 45.11  ? 222 ARG A N   1 
ATOM   1209 C  CA  . ARG A 1 182 ? -15.200 34.909 -11.638 1.00 45.18  ? 222 ARG A CA  1 
ATOM   1210 C  C   . ARG A 1 182 ? -15.874 35.131 -13.002 1.00 44.04  ? 222 ARG A C   1 
ATOM   1211 O  O   . ARG A 1 182 ? -16.969 34.628 -13.260 1.00 44.18  ? 222 ARG A O   1 
ATOM   1212 C  CB  . ARG A 1 182 ? -15.684 35.940 -10.605 1.00 45.62  ? 222 ARG A CB  1 
ATOM   1213 C  CG  . ARG A 1 182 ? -15.477 35.520 -9.138  1.00 48.27  ? 222 ARG A CG  1 
ATOM   1214 C  CD  . ARG A 1 182 ? -16.782 35.686 -8.320  1.00 52.17  ? 222 ARG A CD  1 
ATOM   1215 N  NE  . ARG A 1 182 ? -16.849 36.912 -7.507  1.00 56.29  ? 222 ARG A NE  1 
ATOM   1216 C  CZ  . ARG A 1 182 ? -16.710 38.174 -7.953  1.00 56.82  ? 222 ARG A CZ  1 
ATOM   1217 N  NH1 . ARG A 1 182 ? -16.484 38.433 -9.238  1.00 56.30  ? 222 ARG A NH1 1 
ATOM   1218 N  NH2 . ARG A 1 182 ? -16.803 39.196 -7.100  1.00 55.44  ? 222 ARG A NH2 1 
ATOM   1219 N  N   . GLU A 1 183 ? -15.195 35.878 -13.868 1.00 42.13  ? 223 GLU A N   1 
ATOM   1220 C  CA  . GLU A 1 183 ? -15.667 36.156 -15.221 1.00 41.42  ? 223 GLU A CA  1 
ATOM   1221 C  C   . GLU A 1 183 ? -15.606 34.866 -16.054 1.00 40.29  ? 223 GLU A C   1 
ATOM   1222 O  O   . GLU A 1 183 ? -16.591 34.438 -16.645 1.00 40.27  ? 223 GLU A O   1 
ATOM   1223 C  CB  . GLU A 1 183 ? -14.776 37.229 -15.834 1.00 43.05  ? 223 GLU A CB  1 
ATOM   1224 C  CG  . GLU A 1 183 ? -14.677 37.232 -17.344 1.00 46.90  ? 223 GLU A CG  1 
ATOM   1225 C  CD  . GLU A 1 183 ? -16.005 37.471 -18.027 1.00 49.61  ? 223 GLU A CD  1 
ATOM   1226 O  OE1 . GLU A 1 183 ? -16.879 38.129 -17.405 1.00 51.01  ? 223 GLU A OE1 1 
ATOM   1227 O  OE2 . GLU A 1 183 ? -16.162 37.011 -19.190 1.00 50.40  ? 223 GLU A OE2 1 
ATOM   1228 N  N   . LEU A 1 184 ? -14.427 34.258 -16.090 1.00 38.53  ? 224 LEU A N   1 
ATOM   1229 C  CA  . LEU A 1 184 ? -14.192 33.004 -16.796 1.00 35.19  ? 224 LEU A CA  1 
ATOM   1230 C  C   . LEU A 1 184 ? -15.256 31.965 -16.435 1.00 35.19  ? 224 LEU A C   1 
ATOM   1231 O  O   . LEU A 1 184 ? -15.616 31.127 -17.264 1.00 35.61  ? 224 LEU A O   1 
ATOM   1232 C  CB  . LEU A 1 184 ? -12.807 32.470 -16.406 1.00 32.13  ? 224 LEU A CB  1 
ATOM   1233 C  CG  . LEU A 1 184 ? -12.054 31.360 -17.161 1.00 31.19  ? 224 LEU A CG  1 
ATOM   1234 C  CD1 . LEU A 1 184 ? -12.034 30.131 -16.315 1.00 30.86  ? 224 LEU A CD1 1 
ATOM   1235 C  CD2 . LEU A 1 184 ? -12.614 31.107 -18.555 1.00 25.63  ? 224 LEU A CD2 1 
ATOM   1236 N  N   . LEU A 1 185 ? -15.759 32.023 -15.201 1.00 34.63  ? 225 LEU A N   1 
ATOM   1237 C  CA  . LEU A 1 185 ? -16.754 31.058 -14.748 1.00 35.29  ? 225 LEU A CA  1 
ATOM   1238 C  C   . LEU A 1 185 ? -18.162 31.612 -14.673 1.00 37.05  ? 225 LEU A C   1 
ATOM   1239 O  O   . LEU A 1 185 ? -19.020 31.039 -14.008 1.00 38.06  ? 225 LEU A O   1 
ATOM   1240 C  CB  . LEU A 1 185 ? -16.375 30.501 -13.367 1.00 32.99  ? 225 LEU A CB  1 
ATOM   1241 C  CG  . LEU A 1 185 ? -15.108 29.640 -13.211 1.00 31.68  ? 225 LEU A CG  1 
ATOM   1242 C  CD1 . LEU A 1 185 ? -14.968 29.216 -11.761 1.00 31.02  ? 225 LEU A CD1 1 
ATOM   1243 C  CD2 . LEU A 1 185 ? -15.168 28.408 -14.096 1.00 28.73  ? 225 LEU A CD2 1 
ATOM   1244 N  N   . SER A 1 186 ? -18.415 32.718 -15.354 1.00 38.20  ? 226 SER A N   1 
ATOM   1245 C  CA  . SER A 1 186 ? -19.734 33.324 -15.290 1.00 39.81  ? 226 SER A CA  1 
ATOM   1246 C  C   . SER A 1 186 ? -20.529 33.107 -16.562 1.00 40.31  ? 226 SER A C   1 
ATOM   1247 O  O   . SER A 1 186 ? -21.375 33.934 -16.918 1.00 41.07  ? 226 SER A O   1 
ATOM   1248 C  CB  . SER A 1 186 ? -19.604 34.827 -15.038 1.00 40.94  ? 226 SER A CB  1 
ATOM   1249 O  OG  . SER A 1 186 ? -19.147 35.504 -16.202 1.00 41.99  ? 226 SER A OG  1 
ATOM   1250 N  N   . HIS A 1 187 ? -20.269 31.993 -17.235 1.00 40.27  ? 227 HIS A N   1 
ATOM   1251 C  CA  . HIS A 1 187 ? -20.944 31.704 -18.488 1.00 40.31  ? 227 HIS A CA  1 
ATOM   1252 C  C   . HIS A 1 187 ? -21.373 30.250 -18.614 1.00 40.95  ? 227 HIS A C   1 
ATOM   1253 O  O   . HIS A 1 187 ? -21.642 29.800 -19.722 1.00 41.40  ? 227 HIS A O   1 
ATOM   1254 C  CB  . HIS A 1 187 ? -20.020 32.042 -19.655 1.00 38.93  ? 227 HIS A CB  1 
ATOM   1255 C  CG  . HIS A 1 187 ? -19.618 33.482 -19.710 1.00 40.36  ? 227 HIS A CG  1 
ATOM   1256 N  ND1 . HIS A 1 187 ? -20.515 34.497 -19.979 1.00 40.74  ? 227 HIS A ND1 1 
ATOM   1257 C  CD2 . HIS A 1 187 ? -18.419 34.081 -19.512 1.00 39.31  ? 227 HIS A CD2 1 
ATOM   1258 C  CE1 . HIS A 1 187 ? -19.882 35.657 -19.944 1.00 40.17  ? 227 HIS A CE1 1 
ATOM   1259 N  NE2 . HIS A 1 187 ? -18.609 35.432 -19.663 1.00 39.45  ? 227 HIS A NE2 1 
ATOM   1260 N  N   . ASN A 1 188 ? -21.451 29.516 -17.506 1.00 39.77  ? 228 ASN A N   1 
ATOM   1261 C  CA  . ASN A 1 188 ? -21.828 28.110 -17.611 1.00 39.86  ? 228 ASN A CA  1 
ATOM   1262 C  C   . ASN A 1 188 ? -23.222 27.867 -18.200 1.00 42.08  ? 228 ASN A C   1 
ATOM   1263 O  O   . ASN A 1 188 ? -23.482 26.786 -18.760 1.00 43.63  ? 228 ASN A O   1 
ATOM   1264 C  CB  . ASN A 1 188 ? -21.720 27.402 -16.257 1.00 35.63  ? 228 ASN A CB  1 
ATOM   1265 C  CG  . ASN A 1 188 ? -20.373 27.581 -15.619 1.00 34.06  ? 228 ASN A CG  1 
ATOM   1266 O  OD1 . ASN A 1 188 ? -19.366 27.789 -16.296 1.00 31.87  ? 228 ASN A OD1 1 
ATOM   1267 N  ND2 . ASN A 1 188 ? -20.340 27.495 -14.302 1.00 34.24  ? 228 ASN A ND2 1 
ATOM   1268 N  N   . GLU A 1 189 ? -24.118 28.846 -18.072 1.00 42.30  ? 229 GLU A N   1 
ATOM   1269 C  CA  . GLU A 1 189 ? -25.456 28.691 -18.619 1.00 43.47  ? 229 GLU A CA  1 
ATOM   1270 C  C   . GLU A 1 189 ? -25.421 28.724 -20.160 1.00 43.88  ? 229 GLU A C   1 
ATOM   1271 O  O   . GLU A 1 189 ? -26.083 27.928 -20.827 1.00 44.31  ? 229 GLU A O   1 
ATOM   1272 C  CB  . GLU A 1 189 ? -26.378 29.782 -18.089 1.00 45.44  ? 229 GLU A CB  1 
ATOM   1273 C  CG  . GLU A 1 189 ? -27.678 29.877 -18.859 1.00 50.75  ? 229 GLU A CG  1 
ATOM   1274 C  CD  . GLU A 1 189 ? -28.728 30.747 -18.185 1.00 53.81  ? 229 GLU A CD  1 
ATOM   1275 O  OE1 . GLU A 1 189 ? -29.813 30.927 -18.796 1.00 54.80  ? 229 GLU A OE1 1 
ATOM   1276 O  OE2 . GLU A 1 189 ? -28.477 31.234 -17.049 1.00 54.75  ? 229 GLU A OE2 1 
ATOM   1277 N  N   . GLU A 1 190 ? -24.648 29.642 -20.726 1.00 42.66  ? 230 GLU A N   1 
ATOM   1278 C  CA  . GLU A 1 190 ? -24.539 29.722 -22.168 1.00 41.72  ? 230 GLU A CA  1 
ATOM   1279 C  C   . GLU A 1 190 ? -23.927 28.457 -22.732 1.00 39.22  ? 230 GLU A C   1 
ATOM   1280 O  O   . GLU A 1 190 ? -24.095 28.157 -23.913 1.00 39.90  ? 230 GLU A O   1 
ATOM   1281 C  CB  . GLU A 1 190 ? -23.666 30.899 -22.593 1.00 45.28  ? 230 GLU A CB  1 
ATOM   1282 C  CG  . GLU A 1 190 ? -24.337 32.252 -22.491 1.00 51.99  ? 230 GLU A CG  1 
ATOM   1283 C  CD  . GLU A 1 190 ? -23.960 33.016 -21.231 1.00 55.43  ? 230 GLU A CD  1 
ATOM   1284 O  OE1 . GLU A 1 190 ? -24.222 32.505 -20.104 1.00 58.73  ? 230 GLU A OE1 1 
ATOM   1285 O  OE2 . GLU A 1 190 ? -23.403 34.132 -21.376 1.00 56.09  ? 230 GLU A OE2 1 
ATOM   1286 N  N   . PHE A 1 191 ? -23.214 27.707 -21.902 1.00 36.33  ? 231 PHE A N   1 
ATOM   1287 C  CA  . PHE A 1 191 ? -22.567 26.501 -22.401 1.00 33.82  ? 231 PHE A CA  1 
ATOM   1288 C  C   . PHE A 1 191 ? -23.545 25.358 -22.513 1.00 33.12  ? 231 PHE A C   1 
ATOM   1289 O  O   . PHE A 1 191 ? -23.513 24.624 -23.480 1.00 34.69  ? 231 PHE A O   1 
ATOM   1290 C  CB  . PHE A 1 191 ? -21.402 26.074 -21.510 1.00 30.77  ? 231 PHE A CB  1 
ATOM   1291 C  CG  . PHE A 1 191 ? -20.664 24.868 -22.028 1.00 27.63  ? 231 PHE A CG  1 
ATOM   1292 C  CD1 . PHE A 1 191 ? -19.508 25.018 -22.800 1.00 26.45  ? 231 PHE A CD1 1 
ATOM   1293 C  CD2 . PHE A 1 191 ? -21.164 23.586 -21.819 1.00 24.21  ? 231 PHE A CD2 1 
ATOM   1294 C  CE1 . PHE A 1 191 ? -18.875 23.900 -23.361 1.00 23.77  ? 231 PHE A CE1 1 
ATOM   1295 C  CE2 . PHE A 1 191 ? -20.539 22.486 -22.376 1.00 22.07  ? 231 PHE A CE2 1 
ATOM   1296 C  CZ  . PHE A 1 191 ? -19.399 22.645 -23.146 1.00 22.20  ? 231 PHE A CZ  1 
ATOM   1297 N  N   . GLY A 1 192 ? -24.414 25.207 -21.524 1.00 33.36  ? 232 GLY A N   1 
ATOM   1298 C  CA  . GLY A 1 192 ? -25.382 24.124 -21.555 1.00 32.04  ? 232 GLY A CA  1 
ATOM   1299 C  C   . GLY A 1 192 ? -26.531 24.410 -22.496 1.00 32.14  ? 232 GLY A C   1 
ATOM   1300 O  O   . GLY A 1 192 ? -27.124 23.492 -23.034 1.00 31.77  ? 232 GLY A O   1 
ATOM   1301 N  N   . ARG A 1 193 ? -26.860 25.680 -22.698 1.00 32.64  ? 233 ARG A N   1 
ATOM   1302 C  CA  . ARG A 1 193 ? -27.944 26.020 -23.597 1.00 32.96  ? 233 ARG A CA  1 
ATOM   1303 C  C   . ARG A 1 193 ? -27.539 25.701 -25.030 1.00 32.87  ? 233 ARG A C   1 
ATOM   1304 O  O   . ARG A 1 193 ? -28.375 25.353 -25.865 1.00 34.81  ? 233 ARG A O   1 
ATOM   1305 C  CB  . ARG A 1 193 ? -28.312 27.507 -23.488 1.00 35.46  ? 233 ARG A CB  1 
ATOM   1306 C  CG  . ARG A 1 193 ? -29.104 27.892 -22.227 1.00 40.96  ? 233 ARG A CG  1 
ATOM   1307 C  CD  . ARG A 1 193 ? -29.861 29.242 -22.402 1.00 44.39  ? 233 ARG A CD  1 
ATOM   1308 N  NE  . ARG A 1 193 ? -28.982 30.421 -22.488 1.00 47.60  ? 233 ARG A NE  1 
ATOM   1309 C  CZ  . ARG A 1 193 ? -29.161 31.444 -23.333 1.00 48.28  ? 233 ARG A CZ  1 
ATOM   1310 N  NH1 . ARG A 1 193 ? -30.186 31.453 -24.182 1.00 46.80  ? 233 ARG A NH1 1 
ATOM   1311 N  NH2 . ARG A 1 193 ? -28.307 32.465 -23.332 1.00 48.43  ? 233 ARG A NH2 1 
ATOM   1312 N  N   . THR A 1 194 ? -26.253 25.808 -25.318 1.00 31.65  ? 234 THR A N   1 
ATOM   1313 C  CA  . THR A 1 194 ? -25.763 25.558 -26.662 1.00 30.45  ? 234 THR A CA  1 
ATOM   1314 C  C   . THR A 1 194 ? -25.707 24.094 -27.053 1.00 30.92  ? 234 THR A C   1 
ATOM   1315 O  O   . THR A 1 194 ? -26.126 23.726 -28.143 1.00 32.15  ? 234 THR A O   1 
ATOM   1316 C  CB  . THR A 1 194 ? -24.360 26.163 -26.844 1.00 30.09  ? 234 THR A CB  1 
ATOM   1317 O  OG1 . THR A 1 194 ? -24.456 27.592 -26.797 1.00 30.46  ? 234 THR A OG1 1 
ATOM   1318 C  CG2 . THR A 1 194 ? -23.744 25.720 -28.171 1.00 28.74  ? 234 THR A CG2 1 
ATOM   1319 N  N   . VAL A 1 195 ? -25.167 23.264 -26.171 1.00 31.04  ? 235 VAL A N   1 
ATOM   1320 C  CA  . VAL A 1 195 ? -25.033 21.845 -26.445 1.00 31.09  ? 235 VAL A CA  1 
ATOM   1321 C  C   . VAL A 1 195 ? -26.163 20.993 -25.864 1.00 32.11  ? 235 VAL A C   1 
ATOM   1322 O  O   . VAL A 1 195 ? -26.327 19.842 -26.263 1.00 33.50  ? 235 VAL A O   1 
ATOM   1323 C  CB  . VAL A 1 195 ? -23.692 21.297 -25.891 1.00 31.25  ? 235 VAL A CB  1 
ATOM   1324 C  CG1 . VAL A 1 195 ? -22.528 21.921 -26.604 1.00 30.29  ? 235 VAL A CG1 1 
ATOM   1325 C  CG2 . VAL A 1 195 ? -23.601 21.559 -24.403 1.00 29.14  ? 235 VAL A CG2 1 
ATOM   1326 N  N   . GLY A 1 196 ? -26.924 21.550 -24.927 1.00 31.58  ? 236 GLY A N   1 
ATOM   1327 C  CA  . GLY A 1 196 ? -28.002 20.800 -24.309 1.00 33.23  ? 236 GLY A CA  1 
ATOM   1328 C  C   . GLY A 1 196 ? -28.997 20.225 -25.303 1.00 36.52  ? 236 GLY A C   1 
ATOM   1329 O  O   . GLY A 1 196 ? -29.370 20.915 -26.259 1.00 36.55  ? 236 GLY A O   1 
ATOM   1330 N  N   . ALA A 1 197 ? -29.410 18.966 -25.091 1.00 37.00  ? 237 ALA A N   1 
ATOM   1331 C  CA  . ALA A 1 197 ? -30.375 18.296 -25.964 1.00 36.81  ? 237 ALA A CA  1 
ATOM   1332 C  C   . ALA A 1 197 ? -31.647 19.119 -25.941 1.00 36.95  ? 237 ALA A C   1 
ATOM   1333 O  O   . ALA A 1 197 ? -32.256 19.316 -24.887 1.00 37.65  ? 237 ALA A O   1 
ATOM   1334 C  CB  . ALA A 1 197 ? -30.649 16.877 -25.473 1.00 36.22  ? 237 ALA A CB  1 
ATOM   1335 N  N   . GLY A 1 198 ? -32.052 19.593 -27.112 1.00 37.53  ? 238 GLY A N   1 
ATOM   1336 C  CA  . GLY A 1 198 ? -33.228 20.442 -27.206 1.00 36.62  ? 238 GLY A CA  1 
ATOM   1337 C  C   . GLY A 1 198 ? -32.805 21.731 -27.886 1.00 35.47  ? 238 GLY A C   1 
ATOM   1338 O  O   . GLY A 1 198 ? -33.564 22.358 -28.610 1.00 36.06  ? 238 GLY A O   1 
ATOM   1339 N  N   . SER A 1 199 ? -31.556 22.104 -27.651 1.00 36.11  ? 239 SER A N   1 
ATOM   1340 C  CA  . SER A 1 199 ? -30.947 23.296 -28.224 1.00 36.52  ? 239 SER A CA  1 
ATOM   1341 C  C   . SER A 1 199 ? -31.174 23.403 -29.725 1.00 36.90  ? 239 SER A C   1 
ATOM   1342 O  O   . SER A 1 199 ? -31.225 22.399 -30.420 1.00 37.95  ? 239 SER A O   1 
ATOM   1343 C  CB  . SER A 1 199 ? -29.454 23.285 -27.958 1.00 34.47  ? 239 SER A CB  1 
ATOM   1344 O  OG  . SER A 1 199 ? -28.887 24.461 -28.473 1.00 36.58  ? 239 SER A OG  1 
ATOM   1345 N  N   . LEU A 1 200 ? -31.300 24.628 -30.218 1.00 36.87  ? 240 LEU A N   1 
ATOM   1346 C  CA  . LEU A 1 200 ? -31.536 24.866 -31.637 1.00 36.60  ? 240 LEU A CA  1 
ATOM   1347 C  C   . LEU A 1 200 ? -30.308 25.401 -32.401 1.00 36.13  ? 240 LEU A C   1 
ATOM   1348 O  O   . LEU A 1 200 ? -30.323 25.477 -33.632 1.00 38.74  ? 240 LEU A O   1 
ATOM   1349 C  CB  . LEU A 1 200 ? -32.722 25.835 -31.810 1.00 36.84  ? 240 LEU A CB  1 
ATOM   1350 C  CG  . LEU A 1 200 ? -34.062 25.367 -31.216 1.00 35.87  ? 240 LEU A CG  1 
ATOM   1351 C  CD1 . LEU A 1 200 ? -35.122 26.437 -31.381 1.00 31.84  ? 240 LEU A CD1 1 
ATOM   1352 C  CD2 . LEU A 1 200 ? -34.494 24.089 -31.919 1.00 34.40  ? 240 LEU A CD2 1 
ATOM   1353 N  N   . VAL A 1 201 ? -29.253 25.761 -31.677 1.00 34.00  ? 241 VAL A N   1 
ATOM   1354 C  CA  . VAL A 1 201 ? -28.034 26.275 -32.285 1.00 30.87  ? 241 VAL A CA  1 
ATOM   1355 C  C   . VAL A 1 201 ? -27.583 25.418 -33.464 1.00 31.07  ? 241 VAL A C   1 
ATOM   1356 O  O   . VAL A 1 201 ? -27.467 25.898 -34.580 1.00 31.84  ? 241 VAL A O   1 
ATOM   1357 C  CB  . VAL A 1 201 ? -26.885 26.347 -31.250 1.00 29.94  ? 241 VAL A CB  1 
ATOM   1358 C  CG1 . VAL A 1 201 ? -25.611 26.879 -31.913 1.00 28.19  ? 241 VAL A CG1 1 
ATOM   1359 C  CG2 . VAL A 1 201 ? -27.291 27.242 -30.073 1.00 27.00  ? 241 VAL A CG2 1 
ATOM   1360 N  N   . ASP A 1 202 ? -27.348 24.143 -33.225 1.00 32.20  ? 242 ASP A N   1 
ATOM   1361 C  CA  . ASP A 1 202 ? -26.901 23.252 -34.287 1.00 34.20  ? 242 ASP A CA  1 
ATOM   1362 C  C   . ASP A 1 202 ? -27.945 22.839 -35.320 1.00 35.29  ? 242 ASP A C   1 
ATOM   1363 O  O   . ASP A 1 202 ? -27.712 22.969 -36.512 1.00 36.73  ? 242 ASP A O   1 
ATOM   1364 C  CB  . ASP A 1 202 ? -26.293 21.985 -33.679 1.00 35.23  ? 242 ASP A CB  1 
ATOM   1365 C  CG  . ASP A 1 202 ? -24.990 22.256 -32.973 1.00 36.21  ? 242 ASP A CG  1 
ATOM   1366 O  OD1 . ASP A 1 202 ? -24.012 22.498 -33.690 1.00 36.56  ? 242 ASP A OD1 1 
ATOM   1367 O  OD2 . ASP A 1 202 ? -24.943 22.234 -31.716 1.00 39.41  ? 242 ASP A OD2 1 
ATOM   1368 N  N   . VAL A 1 203 ? -29.094 22.346 -34.869 1.00 37.28  ? 243 VAL A N   1 
ATOM   1369 C  CA  . VAL A 1 203 ? -30.130 21.866 -35.782 1.00 37.59  ? 243 VAL A CA  1 
ATOM   1370 C  C   . VAL A 1 203 ? -30.860 22.898 -36.628 1.00 38.62  ? 243 VAL A C   1 
ATOM   1371 O  O   . VAL A 1 203 ? -31.545 22.515 -37.581 1.00 39.90  ? 243 VAL A O   1 
ATOM   1372 C  CB  . VAL A 1 203 ? -31.179 21.017 -35.028 1.00 37.12  ? 243 VAL A CB  1 
ATOM   1373 C  CG1 . VAL A 1 203 ? -30.506 19.794 -34.429 1.00 36.67  ? 243 VAL A CG1 1 
ATOM   1374 C  CG2 . VAL A 1 203 ? -31.819 21.828 -33.919 1.00 36.43  ? 243 VAL A CG2 1 
ATOM   1375 N  N   . MET A 1 204 ? -30.716 24.175 -36.281 1.00 38.08  ? 244 MET A N   1 
ATOM   1376 C  CA  . MET A 1 204 ? -31.366 25.261 -37.008 1.00 36.14  ? 244 MET A CA  1 
ATOM   1377 C  C   . MET A 1 204 ? -30.385 26.394 -37.305 1.00 35.01  ? 244 MET A C   1 
ATOM   1378 O  O   . MET A 1 204 ? -30.582 27.532 -36.879 1.00 35.45  ? 244 MET A O   1 
ATOM   1379 C  CB  . MET A 1 204 ? -32.563 25.794 -36.218 1.00 35.86  ? 244 MET A CB  1 
ATOM   1380 C  CG  . MET A 1 204 ? -33.618 24.745 -35.907 1.00 38.16  ? 244 MET A CG  1 
ATOM   1381 S  SD  . MET A 1 204 ? -35.293 25.411 -35.941 1.00 42.83  ? 244 MET A SD  1 
ATOM   1382 C  CE  . MET A 1 204 ? -35.180 26.677 -34.679 1.00 45.57  ? 244 MET A CE  1 
ATOM   1383 N  N   . PRO A 1 205 ? -29.329 26.065 -38.040 1.00 33.70  ? 245 PRO A N   1 
ATOM   1384 C  CA  . PRO A 1 205 ? -28.291 27.022 -38.419 1.00 32.73  ? 245 PRO A CA  1 
ATOM   1385 C  C   . PRO A 1 205 ? -28.767 28.325 -39.025 1.00 34.33  ? 245 PRO A C   1 
ATOM   1386 O  O   . PRO A 1 205 ? -28.105 29.362 -38.874 1.00 37.22  ? 245 PRO A O   1 
ATOM   1387 C  CB  . PRO A 1 205 ? -27.416 26.231 -39.378 1.00 29.77  ? 245 PRO A CB  1 
ATOM   1388 C  CG  . PRO A 1 205 ? -28.297 25.183 -39.885 1.00 30.30  ? 245 PRO A CG  1 
ATOM   1389 C  CD  . PRO A 1 205 ? -29.088 24.768 -38.687 1.00 31.87  ? 245 PRO A CD  1 
ATOM   1390 N  N   . TRP A 1 206 ? -29.904 28.307 -39.709 1.00 33.04  ? 246 TRP A N   1 
ATOM   1391 C  CA  . TRP A 1 206 ? -30.360 29.554 -40.310 1.00 31.45  ? 246 TRP A CA  1 
ATOM   1392 C  C   . TRP A 1 206 ? -30.567 30.591 -39.240 1.00 29.98  ? 246 TRP A C   1 
ATOM   1393 O  O   . TRP A 1 206 ? -30.643 31.773 -39.546 1.00 31.28  ? 246 TRP A O   1 
ATOM   1394 C  CB  . TRP A 1 206 ? -31.661 29.379 -41.122 1.00 29.14  ? 246 TRP A CB  1 
ATOM   1395 C  CG  . TRP A 1 206 ? -32.748 28.654 -40.397 1.00 27.93  ? 246 TRP A CG  1 
ATOM   1396 C  CD1 . TRP A 1 206 ? -32.867 27.295 -40.230 1.00 26.67  ? 246 TRP A CD1 1 
ATOM   1397 C  CD2 . TRP A 1 206 ? -33.863 29.245 -39.719 1.00 27.07  ? 246 TRP A CD2 1 
ATOM   1398 N  NE1 . TRP A 1 206 ? -33.990 27.012 -39.493 1.00 27.03  ? 246 TRP A NE1 1 
ATOM   1399 C  CE2 . TRP A 1 206 ? -34.624 28.182 -39.165 1.00 25.66  ? 246 TRP A CE2 1 
ATOM   1400 C  CE3 . TRP A 1 206 ? -34.295 30.570 -39.523 1.00 26.07  ? 246 TRP A CE3 1 
ATOM   1401 C  CZ2 . TRP A 1 206 ? -35.802 28.398 -38.430 1.00 24.57  ? 246 TRP A CZ2 1 
ATOM   1402 C  CZ3 . TRP A 1 206 ? -35.467 30.790 -38.787 1.00 27.27  ? 246 TRP A CZ3 1 
ATOM   1403 C  CH2 . TRP A 1 206 ? -36.208 29.699 -38.251 1.00 26.35  ? 246 TRP A CH2 1 
ATOM   1404 N  N   . LEU A 1 207 ? -30.638 30.159 -37.986 1.00 28.77  ? 247 LEU A N   1 
ATOM   1405 C  CA  . LEU A 1 207 ? -30.867 31.105 -36.908 1.00 30.33  ? 247 LEU A CA  1 
ATOM   1406 C  C   . LEU A 1 207 ? -29.675 31.993 -36.660 1.00 32.32  ? 247 LEU A C   1 
ATOM   1407 O  O   . LEU A 1 207 ? -29.760 33.001 -35.956 1.00 32.32  ? 247 LEU A O   1 
ATOM   1408 C  CB  . LEU A 1 207 ? -31.263 30.381 -35.637 1.00 29.84  ? 247 LEU A CB  1 
ATOM   1409 C  CG  . LEU A 1 207 ? -32.729 29.951 -35.633 1.00 30.64  ? 247 LEU A CG  1 
ATOM   1410 C  CD1 . LEU A 1 207 ? -33.004 29.057 -34.441 1.00 31.20  ? 247 LEU A CD1 1 
ATOM   1411 C  CD2 . LEU A 1 207 ? -33.617 31.183 -35.613 1.00 29.20  ? 247 LEU A CD2 1 
ATOM   1412 N  N   . GLN A 1 208 ? -28.562 31.631 -37.274 1.00 35.04  ? 248 GLN A N   1 
ATOM   1413 C  CA  . GLN A 1 208 ? -27.347 32.410 -37.134 1.00 36.68  ? 248 GLN A CA  1 
ATOM   1414 C  C   . GLN A 1 208 ? -27.369 33.592 -38.084 1.00 38.36  ? 248 GLN A C   1 
ATOM   1415 O  O   . GLN A 1 208 ? -26.603 34.548 -37.899 1.00 40.06  ? 248 GLN A O   1 
ATOM   1416 C  CB  . GLN A 1 208 ? -26.122 31.524 -37.396 1.00 34.81  ? 248 GLN A CB  1 
ATOM   1417 C  CG  . GLN A 1 208 ? -25.917 30.491 -36.303 1.00 34.39  ? 248 GLN A CG  1 
ATOM   1418 C  CD  . GLN A 1 208 ? -26.030 31.095 -34.895 1.00 33.99  ? 248 GLN A CD  1 
ATOM   1419 O  OE1 . GLN A 1 208 ? -25.363 32.081 -34.577 1.00 36.87  ? 248 GLN A OE1 1 
ATOM   1420 N  NE2 . GLN A 1 208 ? -26.868 30.501 -34.054 1.00 31.26  ? 248 GLN A NE2 1 
ATOM   1421 N  N   . TYR A 1 209 ? -28.277 33.540 -39.069 1.00 39.05  ? 249 TYR A N   1 
ATOM   1422 C  CA  . TYR A 1 209 ? -28.416 34.583 -40.095 1.00 38.78  ? 249 TYR A CA  1 
ATOM   1423 C  C   . TYR A 1 209 ? -28.947 35.928 -39.628 1.00 38.26  ? 249 TYR A C   1 
ATOM   1424 O  O   . TYR A 1 209 ? -28.869 36.908 -40.361 1.00 40.87  ? 249 TYR A O   1 
ATOM   1425 C  CB  . TYR A 1 209 ? -29.311 34.106 -41.242 1.00 40.20  ? 249 TYR A CB  1 
ATOM   1426 C  CG  . TYR A 1 209 ? -28.835 32.860 -41.951 1.00 43.37  ? 249 TYR A CG  1 
ATOM   1427 C  CD1 . TYR A 1 209 ? -27.486 32.474 -41.917 1.00 43.51  ? 249 TYR A CD1 1 
ATOM   1428 C  CD2 . TYR A 1 209 ? -29.748 32.018 -42.600 1.00 43.99  ? 249 TYR A CD2 1 
ATOM   1429 C  CE1 . TYR A 1 209 ? -27.061 31.264 -42.497 1.00 43.51  ? 249 TYR A CE1 1 
ATOM   1430 C  CE2 . TYR A 1 209 ? -29.334 30.808 -43.190 1.00 44.79  ? 249 TYR A CE2 1 
ATOM   1431 C  CZ  . TYR A 1 209 ? -27.991 30.439 -43.124 1.00 44.85  ? 249 TYR A CZ  1 
ATOM   1432 O  OH  . TYR A 1 209 ? -27.601 29.224 -43.640 1.00 46.18  ? 249 TYR A OH  1 
ATOM   1433 N  N   . PHE A 1 210 ? -29.498 35.994 -38.427 1.00 36.84  ? 250 PHE A N   1 
ATOM   1434 C  CA  . PHE A 1 210 ? -30.020 37.264 -37.938 1.00 35.51  ? 250 PHE A CA  1 
ATOM   1435 C  C   . PHE A 1 210 ? -30.124 37.241 -36.405 1.00 34.56  ? 250 PHE A C   1 
ATOM   1436 O  O   . PHE A 1 210 ? -30.050 36.182 -35.779 1.00 33.49  ? 250 PHE A O   1 
ATOM   1437 C  CB  . PHE A 1 210 ? -31.403 37.546 -38.564 1.00 34.73  ? 250 PHE A CB  1 
ATOM   1438 C  CG  . PHE A 1 210 ? -32.447 36.529 -38.193 1.00 33.52  ? 250 PHE A CG  1 
ATOM   1439 C  CD1 . PHE A 1 210 ? -32.522 35.317 -38.866 1.00 33.67  ? 250 PHE A CD1 1 
ATOM   1440 C  CD2 . PHE A 1 210 ? -33.261 36.727 -37.087 1.00 33.01  ? 250 PHE A CD2 1 
ATOM   1441 C  CE1 . PHE A 1 210 ? -33.382 34.306 -38.439 1.00 33.23  ? 250 PHE A CE1 1 
ATOM   1442 C  CE2 . PHE A 1 210 ? -34.126 35.726 -36.654 1.00 33.68  ? 250 PHE A CE2 1 
ATOM   1443 C  CZ  . PHE A 1 210 ? -34.183 34.509 -37.333 1.00 33.23  ? 250 PHE A CZ  1 
ATOM   1444 N  N   . PRO A 1 211 ? -30.310 38.420 -35.790 1.00 33.43  ? 251 PRO A N   1 
ATOM   1445 C  CA  . PRO A 1 211 ? -30.431 38.594 -34.341 1.00 32.73  ? 251 PRO A CA  1 
ATOM   1446 C  C   . PRO A 1 211 ? -31.530 37.770 -33.654 1.00 33.10  ? 251 PRO A C   1 
ATOM   1447 O  O   . PRO A 1 211 ? -32.706 37.863 -34.021 1.00 33.99  ? 251 PRO A O   1 
ATOM   1448 C  CB  . PRO A 1 211 ? -30.701 40.088 -34.199 1.00 30.39  ? 251 PRO A CB  1 
ATOM   1449 C  CG  . PRO A 1 211 ? -30.052 40.668 -35.396 1.00 30.60  ? 251 PRO A CG  1 
ATOM   1450 C  CD  . PRO A 1 211 ? -30.416 39.718 -36.475 1.00 31.61  ? 251 PRO A CD  1 
ATOM   1451 N  N   . ASN A 1 212 ? -31.148 36.971 -32.661 1.00 31.39  ? 252 ASN A N   1 
ATOM   1452 C  CA  . ASN A 1 212 ? -32.119 36.200 -31.893 1.00 33.00  ? 252 ASN A CA  1 
ATOM   1453 C  C   . ASN A 1 212 ? -31.376 35.539 -30.758 1.00 32.70  ? 252 ASN A C   1 
ATOM   1454 O  O   . ASN A 1 212 ? -30.159 35.451 -30.792 1.00 33.52  ? 252 ASN A O   1 
ATOM   1455 C  CB  . ASN A 1 212 ? -32.850 35.152 -32.751 1.00 33.26  ? 252 ASN A CB  1 
ATOM   1456 C  CG  . ASN A 1 212 ? -31.939 34.081 -33.261 1.00 34.78  ? 252 ASN A CG  1 
ATOM   1457 O  OD1 . ASN A 1 212 ? -31.384 33.298 -32.491 1.00 37.96  ? 252 ASN A OD1 1 
ATOM   1458 N  ND2 . ASN A 1 212 ? -31.765 34.038 -34.570 1.00 35.08  ? 252 ASN A ND2 1 
ATOM   1459 N  N   . PRO A 1 213 ? -32.095 35.072 -29.728 1.00 32.42  ? 253 PRO A N   1 
ATOM   1460 C  CA  . PRO A 1 213 ? -31.389 34.434 -28.618 1.00 32.30  ? 253 PRO A CA  1 
ATOM   1461 C  C   . PRO A 1 213 ? -30.417 33.320 -29.034 1.00 32.86  ? 253 PRO A C   1 
ATOM   1462 O  O   . PRO A 1 213 ? -29.351 33.170 -28.440 1.00 32.54  ? 253 PRO A O   1 
ATOM   1463 C  CB  . PRO A 1 213 ? -32.538 33.933 -27.732 1.00 30.50  ? 253 PRO A CB  1 
ATOM   1464 C  CG  . PRO A 1 213 ? -33.594 34.950 -27.948 1.00 27.84  ? 253 PRO A CG  1 
ATOM   1465 C  CD  . PRO A 1 213 ? -33.544 35.132 -29.456 1.00 30.17  ? 253 PRO A CD  1 
ATOM   1466 N  N   . VAL A 1 214 ? -30.781 32.557 -30.062 1.00 33.50  ? 254 VAL A N   1 
ATOM   1467 C  CA  . VAL A 1 214 ? -29.953 31.453 -30.526 1.00 33.97  ? 254 VAL A CA  1 
ATOM   1468 C  C   . VAL A 1 214 ? -28.681 31.940 -31.192 1.00 35.66  ? 254 VAL A C   1 
ATOM   1469 O  O   . VAL A 1 214 ? -27.642 31.278 -31.122 1.00 37.24  ? 254 VAL A O   1 
ATOM   1470 C  CB  . VAL A 1 214 ? -30.713 30.562 -31.503 1.00 32.68  ? 254 VAL A CB  1 
ATOM   1471 C  CG1 . VAL A 1 214 ? -29.902 29.307 -31.792 1.00 32.29  ? 254 VAL A CG1 1 
ATOM   1472 C  CG2 . VAL A 1 214 ? -32.058 30.192 -30.908 1.00 31.64  ? 254 VAL A CG2 1 
ATOM   1473 N  N   . ARG A 1 215 ? -28.764 33.094 -31.846 1.00 35.49  ? 255 ARG A N   1 
ATOM   1474 C  CA  . ARG A 1 215 ? -27.601 33.687 -32.498 1.00 33.90  ? 255 ARG A CA  1 
ATOM   1475 C  C   . ARG A 1 215 ? -26.721 34.200 -31.378 1.00 33.44  ? 255 ARG A C   1 
ATOM   1476 O  O   . ARG A 1 215 ? -25.493 34.034 -31.379 1.00 34.60  ? 255 ARG A O   1 
ATOM   1477 C  CB  . ARG A 1 215 ? -28.042 34.851 -33.367 1.00 34.69  ? 255 ARG A CB  1 
ATOM   1478 C  CG  . ARG A 1 215 ? -27.219 35.043 -34.605 1.00 33.48  ? 255 ARG A CG  1 
ATOM   1479 C  CD  . ARG A 1 215 ? -25.956 35.761 -34.330 1.00 33.95  ? 255 ARG A CD  1 
ATOM   1480 N  NE  . ARG A 1 215 ? -25.878 36.868 -35.266 1.00 38.37  ? 255 ARG A NE  1 
ATOM   1481 C  CZ  . ARG A 1 215 ? -26.227 38.120 -34.985 1.00 38.94  ? 255 ARG A CZ  1 
ATOM   1482 N  NH1 . ARG A 1 215 ? -26.667 38.438 -33.775 1.00 37.88  ? 255 ARG A NH1 1 
ATOM   1483 N  NH2 . ARG A 1 215 ? -26.161 39.046 -35.933 1.00 39.41  ? 255 ARG A NH2 1 
ATOM   1484 N  N   . THR A 1 216 ? -27.380 34.811 -30.405 1.00 32.42  ? 256 THR A N   1 
ATOM   1485 C  CA  . THR A 1 216 ? -26.713 35.369 -29.247 1.00 32.97  ? 256 THR A CA  1 
ATOM   1486 C  C   . THR A 1 216 ? -25.927 34.352 -28.433 1.00 32.58  ? 256 THR A C   1 
ATOM   1487 O  O   . THR A 1 216 ? -24.751 34.556 -28.185 1.00 32.58  ? 256 THR A O   1 
ATOM   1488 C  CB  . THR A 1 216 ? -27.711 36.040 -28.302 1.00 31.85  ? 256 THR A CB  1 
ATOM   1489 O  OG1 . THR A 1 216 ? -28.436 37.031 -29.018 1.00 32.89  ? 256 THR A OG1 1 
ATOM   1490 C  CG2 . THR A 1 216 ? -26.982 36.696 -27.147 1.00 30.59  ? 256 THR A CG2 1 
ATOM   1491 N  N   . VAL A 1 217 ? -26.584 33.267 -28.022 1.00 32.65  ? 257 VAL A N   1 
ATOM   1492 C  CA  . VAL A 1 217 ? -25.956 32.233 -27.194 1.00 30.86  ? 257 VAL A CA  1 
ATOM   1493 C  C   . VAL A 1 217 ? -24.760 31.578 -27.844 1.00 30.20  ? 257 VAL A C   1 
ATOM   1494 O  O   . VAL A 1 217 ? -23.738 31.394 -27.213 1.00 30.88  ? 257 VAL A O   1 
ATOM   1495 C  CB  . VAL A 1 217 ? -26.990 31.124 -26.759 1.00 30.88  ? 257 VAL A CB  1 
ATOM   1496 C  CG1 . VAL A 1 217 ? -27.290 30.180 -27.893 1.00 27.76  ? 257 VAL A CG1 1 
ATOM   1497 C  CG2 . VAL A 1 217 ? -26.468 30.369 -25.540 1.00 30.65  ? 257 VAL A CG2 1 
ATOM   1498 N  N   . PHE A 1 218 ? -24.877 31.242 -29.117 1.00 31.77  ? 258 PHE A N   1 
ATOM   1499 C  CA  . PHE A 1 218 ? -23.777 30.593 -29.817 1.00 31.77  ? 258 PHE A CA  1 
ATOM   1500 C  C   . PHE A 1 218 ? -22.530 31.496 -29.927 1.00 32.95  ? 258 PHE A C   1 
ATOM   1501 O  O   . PHE A 1 218 ? -21.391 31.022 -29.769 1.00 32.22  ? 258 PHE A O   1 
ATOM   1502 C  CB  . PHE A 1 218 ? -24.240 30.144 -31.203 1.00 29.03  ? 258 PHE A CB  1 
ATOM   1503 C  CG  . PHE A 1 218 ? -23.170 29.494 -31.997 1.00 26.87  ? 258 PHE A CG  1 
ATOM   1504 C  CD1 . PHE A 1 218 ? -22.535 28.354 -31.515 1.00 27.40  ? 258 PHE A CD1 1 
ATOM   1505 C  CD2 . PHE A 1 218 ? -22.746 30.047 -33.199 1.00 25.46  ? 258 PHE A CD2 1 
ATOM   1506 C  CE1 . PHE A 1 218 ? -21.487 27.776 -32.222 1.00 25.62  ? 258 PHE A CE1 1 
ATOM   1507 C  CE2 . PHE A 1 218 ? -21.709 29.484 -33.906 1.00 22.90  ? 258 PHE A CE2 1 
ATOM   1508 C  CZ  . PHE A 1 218 ? -21.077 28.353 -33.425 1.00 25.48  ? 258 PHE A CZ  1 
ATOM   1509 N  N   . ARG A 1 219 ? -22.739 32.783 -30.214 1.00 33.81  ? 259 ARG A N   1 
ATOM   1510 C  CA  . ARG A 1 219 ? -21.618 33.714 -30.309 1.00 33.40  ? 259 ARG A CA  1 
ATOM   1511 C  C   . ARG A 1 219 ? -20.957 33.849 -28.931 1.00 33.33  ? 259 ARG A C   1 
ATOM   1512 O  O   . ARG A 1 219 ? -19.726 33.905 -28.830 1.00 32.93  ? 259 ARG A O   1 
ATOM   1513 C  CB  . ARG A 1 219 ? -22.084 35.078 -30.827 1.00 33.40  ? 259 ARG A CB  1 
ATOM   1514 C  CG  . ARG A 1 219 ? -22.282 35.141 -32.355 1.00 32.66  ? 259 ARG A CG  1 
ATOM   1515 C  CD  . ARG A 1 219 ? -22.898 36.477 -32.822 1.00 31.69  ? 259 ARG A CD  1 
ATOM   1516 N  NE  . ARG A 1 219 ? -22.859 36.640 -34.281 1.00 32.78  ? 259 ARG A NE  1 
ATOM   1517 C  CZ  . ARG A 1 219 ? -23.228 37.751 -34.931 1.00 32.20  ? 259 ARG A CZ  1 
ATOM   1518 N  NH1 . ARG A 1 219 ? -23.673 38.811 -34.255 1.00 32.67  ? 259 ARG A NH1 1 
ATOM   1519 N  NH2 . ARG A 1 219 ? -23.138 37.816 -36.255 1.00 26.49  ? 259 ARG A NH2 1 
ATOM   1520 N  N   . GLU A 1 220 ? -21.762 33.878 -27.874 1.00 32.63  ? 260 GLU A N   1 
ATOM   1521 C  CA  . GLU A 1 220 ? -21.209 33.958 -26.521 1.00 36.28  ? 260 GLU A CA  1 
ATOM   1522 C  C   . GLU A 1 220 ? -20.471 32.647 -26.247 1.00 36.21  ? 260 GLU A C   1 
ATOM   1523 O  O   . GLU A 1 220 ? -19.415 32.633 -25.612 1.00 36.21  ? 260 GLU A O   1 
ATOM   1524 C  CB  . GLU A 1 220 ? -22.319 34.122 -25.467 1.00 39.32  ? 260 GLU A CB  1 
ATOM   1525 C  CG  . GLU A 1 220 ? -23.198 35.374 -25.643 1.00 45.62  ? 260 GLU A CG  1 
ATOM   1526 C  CD  . GLU A 1 220 ? -24.388 35.439 -24.665 1.00 49.20  ? 260 GLU A CD  1 
ATOM   1527 O  OE1 . GLU A 1 220 ? -25.160 34.444 -24.557 1.00 49.56  ? 260 GLU A OE1 1 
ATOM   1528 O  OE2 . GLU A 1 220 ? -24.551 36.504 -24.014 1.00 52.28  ? 260 GLU A OE2 1 
ATOM   1529 N  N   . PHE A 1 221 ? -21.062 31.555 -26.732 1.00 35.77  ? 261 PHE A N   1 
ATOM   1530 C  CA  . PHE A 1 221 ? -20.538 30.216 -26.583 1.00 34.96  ? 261 PHE A CA  1 
ATOM   1531 C  C   . PHE A 1 221 ? -19.147 30.138 -27.147 1.00 35.83  ? 261 PHE A C   1 
ATOM   1532 O  O   . PHE A 1 221 ? -18.237 29.653 -26.482 1.00 36.36  ? 261 PHE A O   1 
ATOM   1533 C  CB  . PHE A 1 221 ? -21.431 29.232 -27.311 1.00 36.06  ? 261 PHE A CB  1 
ATOM   1534 C  CG  . PHE A 1 221 ? -20.957 27.799 -27.242 1.00 37.24  ? 261 PHE A CG  1 
ATOM   1535 C  CD1 . PHE A 1 221 ? -21.246 27.005 -26.141 1.00 36.39  ? 261 PHE A CD1 1 
ATOM   1536 C  CD2 . PHE A 1 221 ? -20.288 27.219 -28.321 1.00 37.64  ? 261 PHE A CD2 1 
ATOM   1537 C  CE1 . PHE A 1 221 ? -20.893 25.662 -26.120 1.00 35.94  ? 261 PHE A CE1 1 
ATOM   1538 C  CE2 . PHE A 1 221 ? -19.933 25.870 -28.300 1.00 36.65  ? 261 PHE A CE2 1 
ATOM   1539 C  CZ  . PHE A 1 221 ? -20.241 25.097 -27.197 1.00 35.29  ? 261 PHE A CZ  1 
ATOM   1540 N  N   . GLU A 1 222 ? -18.970 30.591 -28.382 1.00 36.53  ? 262 GLU A N   1 
ATOM   1541 C  CA  . GLU A 1 222 ? -17.631 30.580 -28.976 1.00 38.35  ? 262 GLU A CA  1 
ATOM   1542 C  C   . GLU A 1 222 ? -16.680 31.442 -28.125 1.00 40.15  ? 262 GLU A C   1 
ATOM   1543 O  O   . GLU A 1 222 ? -15.524 31.083 -27.891 1.00 41.64  ? 262 GLU A O   1 
ATOM   1544 C  CB  . GLU A 1 222 ? -17.668 31.122 -30.401 1.00 36.56  ? 262 GLU A CB  1 
ATOM   1545 C  CG  . GLU A 1 222 ? -18.305 30.197 -31.399 1.00 38.17  ? 262 GLU A CG  1 
ATOM   1546 C  CD  . GLU A 1 222 ? -18.263 30.760 -32.792 1.00 40.19  ? 262 GLU A CD  1 
ATOM   1547 O  OE1 . GLU A 1 222 ? -18.680 31.925 -32.966 1.00 42.34  ? 262 GLU A OE1 1 
ATOM   1548 O  OE2 . GLU A 1 222 ? -17.819 30.045 -33.713 1.00 39.59  ? 262 GLU A OE2 1 
ATOM   1549 N  N   . GLN A 1 223 ? -17.191 32.575 -27.663 1.00 41.04  ? 263 GLN A N   1 
ATOM   1550 C  CA  . GLN A 1 223 ? -16.448 33.500 -26.839 1.00 41.03  ? 263 GLN A CA  1 
ATOM   1551 C  C   . GLN A 1 223 ? -15.930 32.845 -25.574 1.00 40.36  ? 263 GLN A C   1 
ATOM   1552 O  O   . GLN A 1 223 ? -14.751 32.990 -25.243 1.00 40.80  ? 263 GLN A O   1 
ATOM   1553 C  CB  . GLN A 1 223 ? -17.354 34.668 -26.455 1.00 45.78  ? 263 GLN A CB  1 
ATOM   1554 C  CG  . GLN A 1 223 ? -16.899 36.018 -26.941 1.00 49.36  ? 263 GLN A CG  1 
ATOM   1555 C  CD  . GLN A 1 223 ? -15.685 36.519 -26.189 1.00 53.00  ? 263 GLN A CD  1 
ATOM   1556 O  OE1 . GLN A 1 223 ? -14.581 35.964 -26.299 1.00 55.01  ? 263 GLN A OE1 1 
ATOM   1557 N  NE2 . GLN A 1 223 ? -15.881 37.578 -25.411 1.00 54.04  ? 263 GLN A NE2 1 
ATOM   1558 N  N   . LEU A 1 224 ? -16.804 32.132 -24.861 1.00 39.52  ? 264 LEU A N   1 
ATOM   1559 C  CA  . LEU A 1 224 ? -16.412 31.493 -23.598 1.00 39.86  ? 264 LEU A CA  1 
ATOM   1560 C  C   . LEU A 1 224 ? -15.441 30.310 -23.769 1.00 39.67  ? 264 LEU A C   1 
ATOM   1561 O  O   . LEU A 1 224 ? -14.507 30.153 -22.985 1.00 40.51  ? 264 LEU A O   1 
ATOM   1562 C  CB  . LEU A 1 224 ? -17.663 31.077 -22.792 1.00 39.02  ? 264 LEU A CB  1 
ATOM   1563 C  CG  . LEU A 1 224 ? -18.390 29.753 -23.115 1.00 41.63  ? 264 LEU A CG  1 
ATOM   1564 C  CD1 . LEU A 1 224 ? -17.743 28.610 -22.328 1.00 38.91  ? 264 LEU A CD1 1 
ATOM   1565 C  CD2 . LEU A 1 224 ? -19.893 29.850 -22.773 1.00 38.70  ? 264 LEU A CD2 1 
ATOM   1566 N  N   . ASN A 1 225 ? -15.647 29.488 -24.792 1.00 40.06  ? 265 ASN A N   1 
ATOM   1567 C  CA  . ASN A 1 225 ? -14.756 28.360 -25.047 1.00 39.86  ? 265 ASN A CA  1 
ATOM   1568 C  C   . ASN A 1 225 ? -13.397 28.908 -25.460 1.00 39.93  ? 265 ASN A C   1 
ATOM   1569 O  O   . ASN A 1 225 ? -12.349 28.337 -25.164 1.00 39.69  ? 265 ASN A O   1 
ATOM   1570 C  CB  . ASN A 1 225 ? -15.322 27.483 -26.166 1.00 40.11  ? 265 ASN A CB  1 
ATOM   1571 C  CG  . ASN A 1 225 ? -16.478 26.644 -25.704 1.00 40.37  ? 265 ASN A CG  1 
ATOM   1572 O  OD1 . ASN A 1 225 ? -16.324 25.809 -24.821 1.00 41.77  ? 265 ASN A OD1 1 
ATOM   1573 N  ND2 . ASN A 1 225 ? -17.648 26.861 -26.288 1.00 41.21  ? 265 ASN A ND2 1 
ATOM   1574 N  N   . ARG A 1 226 ? -13.425 30.026 -26.161 1.00 41.01  ? 266 ARG A N   1 
ATOM   1575 C  CA  . ARG A 1 226 ? -12.202 30.664 -26.598 1.00 42.71  ? 266 ARG A CA  1 
ATOM   1576 C  C   . ARG A 1 226 ? -11.425 31.142 -25.359 1.00 42.41  ? 266 ARG A C   1 
ATOM   1577 O  O   . ARG A 1 226 ? -10.195 31.047 -25.315 1.00 42.42  ? 266 ARG A O   1 
ATOM   1578 C  CB  . ARG A 1 226 ? -12.550 31.838 -27.518 1.00 44.38  ? 266 ARG A CB  1 
ATOM   1579 C  CG  . ARG A 1 226 ? -11.373 32.528 -28.195 1.00 48.47  ? 266 ARG A CG  1 
ATOM   1580 C  CD  . ARG A 1 226 ? -11.867 33.750 -28.995 1.00 52.17  ? 266 ARG A CD  1 
ATOM   1581 N  NE  . ARG A 1 226 ? -12.814 33.395 -30.062 1.00 53.25  ? 266 ARG A NE  1 
ATOM   1582 C  CZ  . ARG A 1 226 ? -13.999 33.981 -30.248 1.00 54.65  ? 266 ARG A CZ  1 
ATOM   1583 N  NH1 . ARG A 1 226 ? -14.402 34.961 -29.437 1.00 53.82  ? 266 ARG A NH1 1 
ATOM   1584 N  NH2 . ARG A 1 226 ? -14.784 33.594 -31.252 1.00 53.25  ? 266 ARG A NH2 1 
ATOM   1585 N  N   . ASN A 1 227 ? -12.142 31.629 -24.346 1.00 41.23  ? 267 ASN A N   1 
ATOM   1586 C  CA  . ASN A 1 227 ? -11.493 32.117 -23.122 1.00 40.57  ? 267 ASN A CA  1 
ATOM   1587 C  C   . ASN A 1 227 ? -10.971 30.999 -22.248 1.00 38.96  ? 267 ASN A C   1 
ATOM   1588 O  O   . ASN A 1 227 ? -9.926  31.130 -21.616 1.00 39.88  ? 267 ASN A O   1 
ATOM   1589 C  CB  . ASN A 1 227 ? -12.457 32.954 -22.282 1.00 41.24  ? 267 ASN A CB  1 
ATOM   1590 C  CG  . ASN A 1 227 ? -13.031 34.120 -23.041 1.00 41.61  ? 267 ASN A CG  1 
ATOM   1591 O  OD1 . ASN A 1 227 ? -12.409 34.618 -23.984 1.00 43.04  ? 267 ASN A OD1 1 
ATOM   1592 N  ND2 . ASN A 1 227 ? -14.221 34.567 -22.646 1.00 40.30  ? 267 ASN A ND2 1 
ATOM   1593 N  N   . PHE A 1 228 ? -11.720 29.907 -22.193 1.00 38.17  ? 268 PHE A N   1 
ATOM   1594 C  CA  . PHE A 1 228 ? -11.341 28.749 -21.386 1.00 36.14  ? 268 PHE A CA  1 
ATOM   1595 C  C   . PHE A 1 228 ? -10.076 28.114 -21.895 1.00 34.12  ? 268 PHE A C   1 
ATOM   1596 O  O   . PHE A 1 228 ? -9.198  27.754 -21.117 1.00 34.82  ? 268 PHE A O   1 
ATOM   1597 C  CB  . PHE A 1 228 ? -12.440 27.687 -21.412 1.00 36.43  ? 268 PHE A CB  1 
ATOM   1598 C  CG  . PHE A 1 228 ? -13.105 27.472 -20.095 1.00 35.81  ? 268 PHE A CG  1 
ATOM   1599 C  CD1 . PHE A 1 228 ? -14.031 28.390 -19.615 1.00 36.24  ? 268 PHE A CD1 1 
ATOM   1600 C  CD2 . PHE A 1 228 ? -12.806 26.350 -19.332 1.00 35.03  ? 268 PHE A CD2 1 
ATOM   1601 C  CE1 . PHE A 1 228 ? -14.659 28.197 -18.382 1.00 36.77  ? 268 PHE A CE1 1 
ATOM   1602 C  CE2 . PHE A 1 228 ? -13.424 26.148 -18.108 1.00 36.64  ? 268 PHE A CE2 1 
ATOM   1603 C  CZ  . PHE A 1 228 ? -14.356 27.077 -17.631 1.00 36.11  ? 268 PHE A CZ  1 
ATOM   1604 N  N   . SER A 1 229 ? -10.002 27.957 -23.209 1.00 32.37  ? 269 SER A N   1 
ATOM   1605 C  CA  . SER A 1 229 ? -8.854  27.342 -23.837 1.00 31.28  ? 269 SER A CA  1 
ATOM   1606 C  C   . SER A 1 229 ? -7.601  28.165 -23.625 1.00 31.79  ? 269 SER A C   1 
ATOM   1607 O  O   . SER A 1 229 ? -6.533  27.604 -23.375 1.00 31.98  ? 269 SER A O   1 
ATOM   1608 C  CB  . SER A 1 229 ? -9.106  27.163 -25.333 1.00 31.52  ? 269 SER A CB  1 
ATOM   1609 O  OG  . SER A 1 229 ? -10.201 26.310 -25.580 1.00 29.69  ? 269 SER A OG  1 
ATOM   1610 N  N   . ASN A 1 230 ? -7.717  29.491 -23.741 1.00 31.79  ? 270 ASN A N   1 
ATOM   1611 C  CA  . ASN A 1 230 ? -6.557  30.363 -23.554 1.00 31.18  ? 270 ASN A CA  1 
ATOM   1612 C  C   . ASN A 1 230 ? -6.097  30.306 -22.096 1.00 30.85  ? 270 ASN A C   1 
ATOM   1613 O  O   . ASN A 1 230 ? -4.887  30.299 -21.810 1.00 29.74  ? 270 ASN A O   1 
ATOM   1614 C  CB  . ASN A 1 230 ? -6.885  31.809 -23.958 1.00 33.90  ? 270 ASN A CB  1 
ATOM   1615 C  CG  . ASN A 1 230 ? -7.103  31.972 -25.475 1.00 35.31  ? 270 ASN A CG  1 
ATOM   1616 O  OD1 . ASN A 1 230 ? -6.400  31.368 -26.292 1.00 35.96  ? 270 ASN A OD1 1 
ATOM   1617 N  ND2 . ASN A 1 230 ? -8.064  32.808 -25.846 1.00 35.57  ? 270 ASN A ND2 1 
ATOM   1618 N  N   . PHE A 1 231 ? -7.076  30.246 -21.192 1.00 28.55  ? 271 PHE A N   1 
ATOM   1619 C  CA  . PHE A 1 231 ? -6.847  30.174 -19.759 1.00 29.85  ? 271 PHE A CA  1 
ATOM   1620 C  C   . PHE A 1 231 ? -6.019  28.929 -19.404 1.00 31.69  ? 271 PHE A C   1 
ATOM   1621 O  O   . PHE A 1 231 ? -5.086  28.982 -18.592 1.00 34.42  ? 271 PHE A O   1 
ATOM   1622 C  CB  . PHE A 1 231 ? -8.207  30.132 -19.043 1.00 30.19  ? 271 PHE A CB  1 
ATOM   1623 C  CG  . PHE A 1 231 ? -8.131  29.818 -17.562 1.00 30.27  ? 271 PHE A CG  1 
ATOM   1624 C  CD1 . PHE A 1 231 ? -7.688  30.770 -16.648 1.00 28.85  ? 271 PHE A CD1 1 
ATOM   1625 C  CD2 . PHE A 1 231 ? -8.505  28.551 -17.085 1.00 33.89  ? 271 PHE A CD2 1 
ATOM   1626 C  CE1 . PHE A 1 231 ? -7.611  30.468 -15.262 1.00 32.16  ? 271 PHE A CE1 1 
ATOM   1627 C  CE2 . PHE A 1 231 ? -8.431  28.223 -15.694 1.00 35.02  ? 271 PHE A CE2 1 
ATOM   1628 C  CZ  . PHE A 1 231 ? -7.982  29.183 -14.780 1.00 32.08  ? 271 PHE A CZ  1 
ATOM   1629 N  N   . ILE A 1 232 ? -6.363  27.809 -20.023 1.00 32.34  ? 272 ILE A N   1 
ATOM   1630 C  CA  . ILE A 1 232 ? -5.686  26.543 -19.764 1.00 32.17  ? 272 ILE A CA  1 
ATOM   1631 C  C   . ILE A 1 232 ? -4.418  26.403 -20.601 1.00 32.15  ? 272 ILE A C   1 
ATOM   1632 O  O   . ILE A 1 232 ? -3.454  25.728 -20.197 1.00 30.32  ? 272 ILE A O   1 
ATOM   1633 C  CB  . ILE A 1 232 ? -6.671  25.356 -19.989 1.00 31.65  ? 272 ILE A CB  1 
ATOM   1634 C  CG1 . ILE A 1 232 ? -7.577  25.224 -18.770 1.00 30.68  ? 272 ILE A CG1 1 
ATOM   1635 C  CG2 . ILE A 1 232 ? -5.928  24.078 -20.237 1.00 30.55  ? 272 ILE A CG2 1 
ATOM   1636 C  CD1 . ILE A 1 232 ? -8.500  24.060 -18.854 1.00 33.71  ? 272 ILE A CD1 1 
ATOM   1637 N  N   . LEU A 1 233 ? -4.417  27.057 -21.761 1.00 32.91  ? 273 LEU A N   1 
ATOM   1638 C  CA  . LEU A 1 233 ? -3.250  27.036 -22.629 1.00 34.68  ? 273 LEU A CA  1 
ATOM   1639 C  C   . LEU A 1 233 ? -2.116  27.755 -21.897 1.00 36.61  ? 273 LEU A C   1 
ATOM   1640 O  O   . LEU A 1 233 ? -0.985  27.252 -21.810 1.00 37.43  ? 273 LEU A O   1 
ATOM   1641 C  CB  . LEU A 1 233 ? -3.552  27.748 -23.944 1.00 34.46  ? 273 LEU A CB  1 
ATOM   1642 C  CG  . LEU A 1 233 ? -3.426  26.789 -25.125 1.00 35.36  ? 273 LEU A CG  1 
ATOM   1643 C  CD1 . LEU A 1 233 ? -4.217  27.279 -26.306 1.00 33.88  ? 273 LEU A CD1 1 
ATOM   1644 C  CD2 . LEU A 1 233 ? -1.971  26.618 -25.451 1.00 34.79  ? 273 LEU A CD2 1 
ATOM   1645 N  N   . ASP A 1 234 ? -2.432  28.925 -21.350 1.00 37.65  ? 274 ASP A N   1 
ATOM   1646 C  CA  . ASP A 1 234 ? -1.444  29.696 -20.640 1.00 39.06  ? 274 ASP A CA  1 
ATOM   1647 C  C   . ASP A 1 234 ? -0.845  28.874 -19.515 1.00 39.13  ? 274 ASP A C   1 
ATOM   1648 O  O   . ASP A 1 234 ? 0.375   28.797 -19.363 1.00 41.17  ? 274 ASP A O   1 
ATOM   1649 C  CB  . ASP A 1 234 ? -2.065  30.964 -20.081 1.00 42.30  ? 274 ASP A CB  1 
ATOM   1650 C  CG  . ASP A 1 234 ? -1.118  31.703 -19.162 1.00 45.98  ? 274 ASP A CG  1 
ATOM   1651 O  OD1 . ASP A 1 234 ? -1.106  31.392 -17.948 1.00 44.01  ? 274 ASP A OD1 1 
ATOM   1652 O  OD2 . ASP A 1 234 ? -0.370  32.577 -19.667 1.00 49.33  ? 274 ASP A OD2 1 
ATOM   1653 N  N   . LYS A 1 235 ? -1.701  28.262 -18.720 1.00 36.89  ? 275 LYS A N   1 
ATOM   1654 C  CA  . LYS A 1 235 ? -1.213  27.447 -17.641 1.00 36.76  ? 275 LYS A CA  1 
ATOM   1655 C  C   . LYS A 1 235 ? -0.418  26.269 -18.195 1.00 37.19  ? 275 LYS A C   1 
ATOM   1656 O  O   . LYS A 1 235 ? 0.608   25.889 -17.636 1.00 37.64  ? 275 LYS A O   1 
ATOM   1657 C  CB  . LYS A 1 235 ? -2.383  26.951 -16.791 1.00 37.16  ? 275 LYS A CB  1 
ATOM   1658 C  CG  . LYS A 1 235 ? -3.028  28.050 -15.994 1.00 37.23  ? 275 LYS A CG  1 
ATOM   1659 C  CD  . LYS A 1 235 ? -3.989  27.501 -14.976 1.00 39.60  ? 275 LYS A CD  1 
ATOM   1660 C  CE  . LYS A 1 235 ? -4.085  28.461 -13.788 1.00 40.37  ? 275 LYS A CE  1 
ATOM   1661 N  NZ  . LYS A 1 235 ? -2.718  28.701 -13.199 1.00 41.87  ? 275 LYS A NZ  1 
ATOM   1662 N  N   . PHE A 1 236 ? -0.887  25.697 -19.298 1.00 37.80  ? 276 PHE A N   1 
ATOM   1663 C  CA  . PHE A 1 236 ? -0.217  24.553 -19.914 1.00 37.06  ? 276 PHE A CA  1 
ATOM   1664 C  C   . PHE A 1 236 ? 1.242   24.853 -20.279 1.00 37.26  ? 276 PHE A C   1 
ATOM   1665 O  O   . PHE A 1 236 ? 2.176   24.096 -19.926 1.00 36.92  ? 276 PHE A O   1 
ATOM   1666 C  CB  . PHE A 1 236 ? -0.967  24.122 -21.171 1.00 35.71  ? 276 PHE A CB  1 
ATOM   1667 C  CG  . PHE A 1 236 ? -0.245  23.070 -21.966 1.00 37.16  ? 276 PHE A CG  1 
ATOM   1668 C  CD1 . PHE A 1 236 ? -0.202  21.741 -21.521 1.00 37.76  ? 276 PHE A CD1 1 
ATOM   1669 C  CD2 . PHE A 1 236 ? 0.431   23.406 -23.144 1.00 36.00  ? 276 PHE A CD2 1 
ATOM   1670 C  CE1 . PHE A 1 236 ? 0.508   20.760 -22.242 1.00 36.51  ? 276 PHE A CE1 1 
ATOM   1671 C  CE2 . PHE A 1 236 ? 1.141   22.432 -23.867 1.00 34.92  ? 276 PHE A CE2 1 
ATOM   1672 C  CZ  . PHE A 1 236 ? 1.179   21.110 -23.414 1.00 35.54  ? 276 PHE A CZ  1 
ATOM   1673 N  N   . LEU A 1 237 ? 1.432   25.953 -20.999 1.00 35.81  ? 277 LEU A N   1 
ATOM   1674 C  CA  . LEU A 1 237 ? 2.764   26.343 -21.427 1.00 35.44  ? 277 LEU A CA  1 
ATOM   1675 C  C   . LEU A 1 237 ? 3.721   26.561 -20.258 1.00 36.22  ? 277 LEU A C   1 
ATOM   1676 O  O   . LEU A 1 237 ? 4.923   26.290 -20.352 1.00 36.54  ? 277 LEU A O   1 
ATOM   1677 C  CB  . LEU A 1 237 ? 2.664   27.582 -22.315 1.00 33.72  ? 277 LEU A CB  1 
ATOM   1678 C  CG  . LEU A 1 237 ? 1.900   27.229 -23.597 1.00 33.37  ? 277 LEU A CG  1 
ATOM   1679 C  CD1 . LEU A 1 237 ? 1.728   28.444 -24.472 1.00 31.43  ? 277 LEU A CD1 1 
ATOM   1680 C  CD2 . LEU A 1 237 ? 2.646   26.128 -24.347 1.00 33.15  ? 277 LEU A CD2 1 
ATOM   1681 N  N   . ARG A 1 238 ? 3.184   27.027 -19.141 1.00 36.66  ? 278 ARG A N   1 
ATOM   1682 C  CA  . ARG A 1 238 ? 4.009   27.248 -17.976 1.00 36.57  ? 278 ARG A CA  1 
ATOM   1683 C  C   . ARG A 1 238 ? 4.382   25.974 -17.255 1.00 35.50  ? 278 ARG A C   1 
ATOM   1684 O  O   . ARG A 1 238 ? 5.520   25.817 -16.847 1.00 35.98  ? 278 ARG A O   1 
ATOM   1685 C  CB  . ARG A 1 238 ? 3.326   28.206 -17.032 1.00 38.00  ? 278 ARG A CB  1 
ATOM   1686 C  CG  . ARG A 1 238 ? 3.507   29.618 -17.475 1.00 43.61  ? 278 ARG A CG  1 
ATOM   1687 C  CD  . ARG A 1 238 ? 3.452   30.507 -16.272 1.00 51.23  ? 278 ARG A CD  1 
ATOM   1688 N  NE  . ARG A 1 238 ? 2.119   30.470 -15.686 1.00 55.67  ? 278 ARG A NE  1 
ATOM   1689 C  CZ  . ARG A 1 238 ? 1.075   31.090 -16.220 1.00 58.87  ? 278 ARG A CZ  1 
ATOM   1690 N  NH1 . ARG A 1 238 ? 1.239   31.794 -17.341 1.00 58.05  ? 278 ARG A NH1 1 
ATOM   1691 N  NH2 . ARG A 1 238 ? -0.126  30.992 -15.645 1.00 60.99  ? 278 ARG A NH2 1 
ATOM   1692 N  N   . HIS A 1 239 ? 3.441   25.059 -17.085 1.00 35.09  ? 279 HIS A N   1 
ATOM   1693 C  CA  . HIS A 1 239 ? 3.770   23.807 -16.430 1.00 33.67  ? 279 HIS A CA  1 
ATOM   1694 C  C   . HIS A 1 239 ? 4.785   23.061 -17.275 1.00 34.91  ? 279 HIS A C   1 
ATOM   1695 O  O   . HIS A 1 239 ? 5.714   22.432 -16.750 1.00 33.57  ? 279 HIS A O   1 
ATOM   1696 C  CB  . HIS A 1 239 ? 2.528   22.957 -16.248 1.00 34.98  ? 279 HIS A CB  1 
ATOM   1697 C  CG  . HIS A 1 239 ? 1.657   23.405 -15.117 1.00 35.43  ? 279 HIS A CG  1 
ATOM   1698 N  ND1 . HIS A 1 239 ? 1.090   24.663 -15.066 1.00 34.60  ? 279 HIS A ND1 1 
ATOM   1699 C  CD2 . HIS A 1 239 ? 1.257   22.760 -13.996 1.00 33.91  ? 279 HIS A CD2 1 
ATOM   1700 C  CE1 . HIS A 1 239 ? 0.376   24.771 -13.961 1.00 36.46  ? 279 HIS A CE1 1 
ATOM   1701 N  NE2 . HIS A 1 239 ? 0.461   23.629 -13.295 1.00 36.27  ? 279 HIS A NE2 1 
ATOM   1702 N  N   . CYS A 1 240 ? 4.613   23.137 -18.591 1.00 35.96  ? 280 CYS A N   1 
ATOM   1703 C  CA  . CYS A 1 240 ? 5.533   22.482 -19.502 1.00 36.73  ? 280 CYS A CA  1 
ATOM   1704 C  C   . CYS A 1 240 ? 6.940   23.042 -19.328 1.00 38.15  ? 280 CYS A C   1 
ATOM   1705 O  O   . CYS A 1 240 ? 7.910   22.284 -19.241 1.00 39.33  ? 280 CYS A O   1 
ATOM   1706 C  CB  . CYS A 1 240 ? 5.069   22.675 -20.949 1.00 37.00  ? 280 CYS A CB  1 
ATOM   1707 S  SG  . CYS A 1 240 ? 3.797   21.493 -21.495 1.00 38.41  ? 280 CYS A SG  1 
ATOM   1708 N  N   . GLU A 1 241 ? 7.041   24.373 -19.277 1.00 39.42  ? 281 GLU A N   1 
ATOM   1709 C  CA  . GLU A 1 241 ? 8.315   25.084 -19.125 1.00 39.06  ? 281 GLU A CA  1 
ATOM   1710 C  C   . GLU A 1 241 ? 9.043   24.789 -17.824 1.00 39.49  ? 281 GLU A C   1 
ATOM   1711 O  O   . GLU A 1 241 ? 10.271  24.694 -17.807 1.00 40.93  ? 281 GLU A O   1 
ATOM   1712 C  CB  . GLU A 1 241 ? 8.100   26.596 -19.181 1.00 40.33  ? 281 GLU A CB  1 
ATOM   1713 C  CG  . GLU A 1 241 ? 7.799   27.215 -20.531 1.00 43.60  ? 281 GLU A CG  1 
ATOM   1714 C  CD  . GLU A 1 241 ? 7.323   28.664 -20.385 1.00 44.50  ? 281 GLU A CD  1 
ATOM   1715 O  OE1 . GLU A 1 241 ? 7.826   29.347 -19.467 1.00 44.85  ? 281 GLU A OE1 1 
ATOM   1716 O  OE2 . GLU A 1 241 ? 6.458   29.122 -21.176 1.00 44.56  ? 281 GLU A OE2 1 
ATOM   1717 N  N   . SER A 1 242 ? 8.289   24.670 -16.732 1.00 39.83  ? 282 SER A N   1 
ATOM   1718 C  CA  . SER A 1 242 ? 8.863   24.425 -15.412 1.00 39.91  ? 282 SER A CA  1 
ATOM   1719 C  C   . SER A 1 242 ? 9.130   22.963 -15.106 1.00 40.23  ? 282 SER A C   1 
ATOM   1720 O  O   . SER A 1 242 ? 9.891   22.656 -14.199 1.00 41.93  ? 282 SER A O   1 
ATOM   1721 C  CB  . SER A 1 242 ? 7.943   24.995 -14.336 1.00 41.46  ? 282 SER A CB  1 
ATOM   1722 O  OG  . SER A 1 242 ? 7.674   26.371 -14.566 1.00 44.24  ? 282 SER A OG  1 
ATOM   1723 N  N   . LEU A 1 243 ? 8.491   22.062 -15.841 1.00 40.86  ? 283 LEU A N   1 
ATOM   1724 C  CA  . LEU A 1 243 ? 8.670   20.638 -15.622 1.00 40.99  ? 283 LEU A CA  1 
ATOM   1725 C  C   . LEU A 1 243 ? 9.948   20.179 -16.306 1.00 42.77  ? 283 LEU A C   1 
ATOM   1726 O  O   . LEU A 1 243 ? 9.904   19.692 -17.434 1.00 43.85  ? 283 LEU A O   1 
ATOM   1727 C  CB  . LEU A 1 243 ? 7.492   19.852 -16.204 1.00 39.64  ? 283 LEU A CB  1 
ATOM   1728 C  CG  . LEU A 1 243 ? 6.520   19.020 -15.357 1.00 41.53  ? 283 LEU A CG  1 
ATOM   1729 C  CD1 . LEU A 1 243 ? 6.306   17.661 -16.032 1.00 39.19  ? 283 LEU A CD1 1 
ATOM   1730 C  CD2 . LEU A 1 243 ? 7.055   18.821 -13.943 1.00 40.48  ? 283 LEU A CD2 1 
ATOM   1731 N  N   . ARG A 1 244 ? 11.081  20.338 -15.621 1.00 44.91  ? 284 ARG A N   1 
ATOM   1732 C  CA  . ARG A 1 244 ? 12.382  19.916 -16.143 1.00 45.56  ? 284 ARG A CA  1 
ATOM   1733 C  C   . ARG A 1 244 ? 12.555  18.428 -15.840 1.00 46.54  ? 284 ARG A C   1 
ATOM   1734 O  O   . ARG A 1 244 ? 11.793  17.845 -15.064 1.00 46.62  ? 284 ARG A O   1 
ATOM   1735 C  CB  . ARG A 1 244 ? 13.515  20.689 -15.469 1.00 46.81  ? 284 ARG A CB  1 
ATOM   1736 C  CG  . ARG A 1 244 ? 13.084  21.988 -14.811 1.00 50.27  ? 284 ARG A CG  1 
ATOM   1737 C  CD  . ARG A 1 244 ? 13.900  23.185 -15.292 1.00 52.61  ? 284 ARG A CD  1 
ATOM   1738 N  NE  . ARG A 1 244 ? 13.206  24.428 -14.958 1.00 54.25  ? 284 ARG A NE  1 
ATOM   1739 C  CZ  . ARG A 1 244 ? 13.625  25.643 -15.292 1.00 53.08  ? 284 ARG A CZ  1 
ATOM   1740 N  NH1 . ARG A 1 244 ? 14.752  25.786 -15.975 1.00 52.54  ? 284 ARG A NH1 1 
ATOM   1741 N  NH2 . ARG A 1 244 ? 12.908  26.712 -14.948 1.00 52.23  ? 284 ARG A NH2 1 
ATOM   1742 N  N   . PRO A 1 245 ? 13.598  17.851 -16.427 1.00 46.66  ? 285 PRO A N   1 
ATOM   1743 C  CA  . PRO A 1 245 ? 13.947  16.437 -16.252 1.00 46.48  ? 285 PRO A CA  1 
ATOM   1744 C  C   . PRO A 1 245 ? 13.549  15.834 -14.905 1.00 46.05  ? 285 PRO A C   1 
ATOM   1745 O  O   . PRO A 1 245 ? 12.517  15.167 -14.833 1.00 49.35  ? 285 PRO A O   1 
ATOM   1746 C  CB  . PRO A 1 245 ? 15.472  16.440 -16.390 1.00 47.40  ? 285 PRO A CB  1 
ATOM   1747 C  CG  . PRO A 1 245 ? 15.761  17.604 -17.268 1.00 45.99  ? 285 PRO A CG  1 
ATOM   1748 C  CD  . PRO A 1 245 ? 14.736  18.646 -16.921 1.00 46.96  ? 285 PRO A CD  1 
ATOM   1749 N  N   . GLY A 1 246 ? 14.351  16.044 -13.863 1.00 43.69  ? 286 GLY A N   1 
ATOM   1750 C  CA  . GLY A 1 246 ? 14.053  15.427 -12.581 1.00 42.35  ? 286 GLY A CA  1 
ATOM   1751 C  C   . GLY A 1 246 ? 12.913  16.006 -11.769 1.00 40.21  ? 286 GLY A C   1 
ATOM   1752 O  O   . GLY A 1 246 ? 12.684  15.567 -10.646 1.00 39.76  ? 286 GLY A O   1 
ATOM   1753 N  N   . ALA A 1 247 ? 12.196  16.974 -12.332 1.00 39.46  ? 287 ALA A N   1 
ATOM   1754 C  CA  . ALA A 1 247 ? 11.110  17.650 -11.623 1.00 39.51  ? 287 ALA A CA  1 
ATOM   1755 C  C   . ALA A 1 247 ? 9.963   16.769 -11.175 1.00 39.33  ? 287 ALA A C   1 
ATOM   1756 O  O   . ALA A 1 247 ? 9.541   15.843 -11.852 1.00 40.61  ? 287 ALA A O   1 
ATOM   1757 C  CB  . ALA A 1 247 ? 10.581  18.825 -12.449 1.00 39.36  ? 287 ALA A CB  1 
ATOM   1758 N  N   . ALA A 1 248 ? 9.462   17.074 -9.999  1.00 39.52  ? 288 ALA A N   1 
ATOM   1759 C  CA  . ALA A 1 248 ? 8.389   16.307 -9.440  1.00 39.79  ? 288 ALA A CA  1 
ATOM   1760 C  C   . ALA A 1 248 ? 7.086   16.996 -9.781  1.00 41.05  ? 288 ALA A C   1 
ATOM   1761 O  O   . ALA A 1 248 ? 6.932   18.185 -9.514  1.00 41.00  ? 288 ALA A O   1 
ATOM   1762 C  CB  . ALA A 1 248 ? 8.559   16.225 -7.941  1.00 39.92  ? 288 ALA A CB  1 
ATOM   1763 N  N   . PRO A 1 249 ? 6.140   16.265 -10.407 1.00 41.72  ? 289 PRO A N   1 
ATOM   1764 C  CA  . PRO A 1 249 ? 4.845   16.849 -10.764 1.00 41.76  ? 289 PRO A CA  1 
ATOM   1765 C  C   . PRO A 1 249 ? 4.047   17.153 -9.499  1.00 43.33  ? 289 PRO A C   1 
ATOM   1766 O  O   . PRO A 1 249 ? 4.072   16.387 -8.534  1.00 42.74  ? 289 PRO A O   1 
ATOM   1767 C  CB  . PRO A 1 249 ? 4.199   15.757 -11.624 1.00 40.00  ? 289 PRO A CB  1 
ATOM   1768 C  CG  . PRO A 1 249 ? 4.802   14.510 -11.103 1.00 39.44  ? 289 PRO A CG  1 
ATOM   1769 C  CD  . PRO A 1 249 ? 6.245   14.889 -10.927 1.00 40.56  ? 289 PRO A CD  1 
ATOM   1770 N  N   . ARG A 1 250 ? 3.348   18.278 -9.498  1.00 45.47  ? 290 ARG A N   1 
ATOM   1771 C  CA  . ARG A 1 250 ? 2.559   18.651 -8.334  1.00 48.32  ? 290 ARG A CA  1 
ATOM   1772 C  C   . ARG A 1 250 ? 1.154   19.048 -8.761  1.00 48.50  ? 290 ARG A C   1 
ATOM   1773 O  O   . ARG A 1 250 ? 0.488   19.832 -8.079  1.00 48.82  ? 290 ARG A O   1 
ATOM   1774 C  CB  . ARG A 1 250 ? 3.242   19.806 -7.594  1.00 50.92  ? 290 ARG A CB  1 
ATOM   1775 C  CG  . ARG A 1 250 ? 3.571   21.007 -8.446  1.00 53.77  ? 290 ARG A CG  1 
ATOM   1776 C  CD  . ARG A 1 250 ? 4.435   21.984 -7.668  1.00 57.94  ? 290 ARG A CD  1 
ATOM   1777 N  NE  . ARG A 1 250 ? 3.702   22.620 -6.573  1.00 63.32  ? 290 ARG A NE  1 
ATOM   1778 C  CZ  . ARG A 1 250 ? 2.674   23.455 -6.741  1.00 65.26  ? 290 ARG A CZ  1 
ATOM   1779 N  NH1 . ARG A 1 250 ? 2.248   23.761 -7.965  1.00 64.77  ? 290 ARG A NH1 1 
ATOM   1780 N  NH2 . ARG A 1 250 ? 2.069   23.993 -5.684  1.00 65.99  ? 290 ARG A NH2 1 
ATOM   1781 N  N   . ASP A 1 251 ? 0.723   18.486 -9.888  1.00 47.97  ? 291 ASP A N   1 
ATOM   1782 C  CA  . ASP A 1 251 ? -0.581  18.766 -10.466 1.00 45.88  ? 291 ASP A CA  1 
ATOM   1783 C  C   . ASP A 1 251 ? -1.102  17.592 -11.260 1.00 46.57  ? 291 ASP A C   1 
ATOM   1784 O  O   . ASP A 1 251 ? -0.509  16.513 -11.286 1.00 47.57  ? 291 ASP A O   1 
ATOM   1785 C  CB  . ASP A 1 251 ? -0.464  19.918 -11.459 1.00 44.34  ? 291 ASP A CB  1 
ATOM   1786 C  CG  . ASP A 1 251 ? -0.721  21.268 -10.818 1.00 42.97  ? 291 ASP A CG  1 
ATOM   1787 O  OD1 . ASP A 1 251 ? -1.525  21.331 -9.864  1.00 43.91  ? 291 ASP A OD1 1 
ATOM   1788 O  OD2 . ASP A 1 251 ? -0.119  22.265 -11.268 1.00 42.62  ? 291 ASP A OD2 1 
ATOM   1789 N  N   . MET A 1 252 ? -2.218  17.854 -11.932 1.00 46.29  ? 292 MET A N   1 
ATOM   1790 C  CA  . MET A 1 252 ? -2.826  16.935 -12.867 1.00 46.05  ? 292 MET A CA  1 
ATOM   1791 C  C   . MET A 1 252 ? -2.298  17.421 -14.206 1.00 44.92  ? 292 MET A C   1 
ATOM   1792 O  O   . MET A 1 252 ? -2.159  16.650 -15.156 1.00 45.74  ? 292 MET A O   1 
ATOM   1793 C  CB  . MET A 1 252 ? -4.349  17.038 -12.821 1.00 48.30  ? 292 MET A CB  1 
ATOM   1794 C  CG  . MET A 1 252 ? -5.069  15.928 -13.569 1.00 50.95  ? 292 MET A CG  1 
ATOM   1795 S  SD  . MET A 1 252 ? -6.842  15.905 -13.243 1.00 55.73  ? 292 MET A SD  1 
ATOM   1796 C  CE  . MET A 1 252 ? -7.490  16.277 -14.871 1.00 55.80  ? 292 MET A CE  1 
ATOM   1797 N  N   . MET A 1 253 ? -1.990  18.717 -14.263 1.00 43.97  ? 293 MET A N   1 
ATOM   1798 C  CA  . MET A 1 253 ? -1.397  19.315 -15.459 1.00 42.73  ? 293 MET A CA  1 
ATOM   1799 C  C   . MET A 1 253 ? -0.017  18.670 -15.553 1.00 42.92  ? 293 MET A C   1 
ATOM   1800 O  O   . MET A 1 253 ? 0.288   17.988 -16.525 1.00 42.60  ? 293 MET A O   1 
ATOM   1801 C  CB  . MET A 1 253 ? -1.251  20.822 -15.287 1.00 41.92  ? 293 MET A CB  1 
ATOM   1802 C  CG  . MET A 1 253 ? -0.693  21.507 -16.486 1.00 39.57  ? 293 MET A CG  1 
ATOM   1803 S  SD  . MET A 1 253 ? -1.827  21.352 -17.840 1.00 43.11  ? 293 MET A SD  1 
ATOM   1804 C  CE  . MET A 1 253 ? -2.646  22.932 -17.740 1.00 38.81  ? 293 MET A CE  1 
ATOM   1805 N  N   . ASP A 1 254 ? 0.803   18.871 -14.520 1.00 42.64  ? 294 ASP A N   1 
ATOM   1806 C  CA  . ASP A 1 254 ? 2.134   18.269 -14.479 1.00 41.93  ? 294 ASP A CA  1 
ATOM   1807 C  C   . ASP A 1 254 ? 2.088   16.754 -14.749 1.00 40.31  ? 294 ASP A C   1 
ATOM   1808 O  O   . ASP A 1 254 ? 2.945   16.227 -15.444 1.00 41.19  ? 294 ASP A O   1 
ATOM   1809 C  CB  . ASP A 1 254 ? 2.814   18.531 -13.116 1.00 41.78  ? 294 ASP A CB  1 
ATOM   1810 C  CG  . ASP A 1 254 ? 3.527   19.886 -13.061 1.00 42.22  ? 294 ASP A CG  1 
ATOM   1811 O  OD1 . ASP A 1 254 ? 3.805   20.430 -14.144 1.00 39.77  ? 294 ASP A OD1 1 
ATOM   1812 O  OD2 . ASP A 1 254 ? 3.820   20.397 -11.946 1.00 40.92  ? 294 ASP A OD2 1 
ATOM   1813 N  N   . ALA A 1 255 ? 1.085   16.068 -14.203 1.00 39.63  ? 295 ALA A N   1 
ATOM   1814 C  CA  . ALA A 1 255 ? 0.918   14.616 -14.351 1.00 37.91  ? 295 ALA A CA  1 
ATOM   1815 C  C   . ALA A 1 255 ? 0.655   14.156 -15.779 1.00 38.68  ? 295 ALA A C   1 
ATOM   1816 O  O   . ALA A 1 255 ? 1.178   13.123 -16.211 1.00 39.21  ? 295 ALA A O   1 
ATOM   1817 C  CB  . ALA A 1 255 ? -0.196  14.151 -13.470 1.00 37.40  ? 295 ALA A CB  1 
ATOM   1818 N  N   . PHE A 1 256 ? -0.178  14.911 -16.496 1.00 37.58  ? 296 PHE A N   1 
ATOM   1819 C  CA  . PHE A 1 256 ? -0.512  14.624 -17.892 1.00 35.48  ? 296 PHE A CA  1 
ATOM   1820 C  C   . PHE A 1 256 ? 0.684   14.912 -18.825 1.00 35.00  ? 296 PHE A C   1 
ATOM   1821 O  O   . PHE A 1 256 ? 0.967   14.153 -19.763 1.00 35.06  ? 296 PHE A O   1 
ATOM   1822 C  CB  . PHE A 1 256 ? -1.713  15.479 -18.332 1.00 33.44  ? 296 PHE A CB  1 
ATOM   1823 C  CG  . PHE A 1 256 ? -3.042  14.826 -18.102 1.00 32.71  ? 296 PHE A CG  1 
ATOM   1824 C  CD1 . PHE A 1 256 ? -3.309  13.578 -18.617 1.00 33.84  ? 296 PHE A CD1 1 
ATOM   1825 C  CD2 . PHE A 1 256 ? -4.037  15.478 -17.402 1.00 33.27  ? 296 PHE A CD2 1 
ATOM   1826 C  CE1 . PHE A 1 256 ? -4.554  12.988 -18.439 1.00 36.24  ? 296 PHE A CE1 1 
ATOM   1827 C  CE2 . PHE A 1 256 ? -5.281  14.905 -17.216 1.00 33.30  ? 296 PHE A CE2 1 
ATOM   1828 C  CZ  . PHE A 1 256 ? -5.544  13.657 -17.735 1.00 36.51  ? 296 PHE A CZ  1 
ATOM   1829 N  N   . ILE A 1 257 ? 1.370   16.023 -18.556 1.00 33.34  ? 297 ILE A N   1 
ATOM   1830 C  CA  . ILE A 1 257 ? 2.519   16.455 -19.336 1.00 30.15  ? 297 ILE A CA  1 
ATOM   1831 C  C   . ILE A 1 257 ? 3.635   15.425 -19.227 1.00 29.91  ? 297 ILE A C   1 
ATOM   1832 O  O   . ILE A 1 257 ? 4.188   15.003 -20.239 1.00 29.61  ? 297 ILE A O   1 
ATOM   1833 C  CB  . ILE A 1 257 ? 3.016   17.848 -18.853 1.00 28.55  ? 297 ILE A CB  1 
ATOM   1834 C  CG1 . ILE A 1 257 ? 1.958   18.906 -19.143 1.00 23.92  ? 297 ILE A CG1 1 
ATOM   1835 C  CG2 . ILE A 1 257 ? 4.326   18.226 -19.537 1.00 28.83  ? 297 ILE A CG2 1 
ATOM   1836 C  CD1 . ILE A 1 257 ? 2.470   20.328 -18.902 1.00 23.94  ? 297 ILE A CD1 1 
ATOM   1837 N  N   . LEU A 1 258 ? 3.956   15.019 -18.002 1.00 29.80  ? 298 LEU A N   1 
ATOM   1838 C  CA  . LEU A 1 258 ? 4.996   14.012 -17.760 1.00 32.11  ? 298 LEU A CA  1 
ATOM   1839 C  C   . LEU A 1 258 ? 4.714   12.746 -18.565 1.00 33.69  ? 298 LEU A C   1 
ATOM   1840 O  O   . LEU A 1 258 ? 5.568   12.237 -19.300 1.00 33.12  ? 298 LEU A O   1 
ATOM   1841 C  CB  . LEU A 1 258 ? 5.025   13.636 -16.287 1.00 32.31  ? 298 LEU A CB  1 
ATOM   1842 C  CG  . LEU A 1 258 ? 6.392   13.649 -15.609 1.00 35.01  ? 298 LEU A CG  1 
ATOM   1843 C  CD1 . LEU A 1 258 ? 6.278   12.998 -14.233 1.00 34.80  ? 298 LEU A CD1 1 
ATOM   1844 C  CD2 . LEU A 1 258 ? 7.398   12.910 -16.461 1.00 34.98  ? 298 LEU A CD2 1 
ATOM   1845 N  N   . SER A 1 259 ? 3.489   12.250 -18.396 1.00 35.19  ? 299 SER A N   1 
ATOM   1846 C  CA  . SER A 1 259 ? 3.002   11.067 -19.070 1.00 34.22  ? 299 SER A CA  1 
ATOM   1847 C  C   . SER A 1 259 ? 3.185   11.165 -20.558 1.00 35.18  ? 299 SER A C   1 
ATOM   1848 O  O   . SER A 1 259 ? 3.621   10.197 -21.188 1.00 36.18  ? 299 SER A O   1 
ATOM   1849 C  CB  . SER A 1 259 ? 1.526   10.884 -18.787 1.00 35.57  ? 299 SER A CB  1 
ATOM   1850 O  OG  . SER A 1 259 ? 0.949   10.032 -19.758 1.00 38.97  ? 299 SER A OG  1 
ATOM   1851 N  N   . ALA A 1 260 ? 2.840   12.326 -21.121 1.00 34.65  ? 300 ALA A N   1 
ATOM   1852 C  CA  . ALA A 1 260 ? 2.949   12.558 -22.563 1.00 34.02  ? 300 ALA A CA  1 
ATOM   1853 C  C   . ALA A 1 260 ? 4.390   12.624 -23.036 1.00 34.23  ? 300 ALA A C   1 
ATOM   1854 O  O   . ALA A 1 260 ? 4.712   12.218 -24.153 1.00 33.06  ? 300 ALA A O   1 
ATOM   1855 C  CB  . ALA A 1 260 ? 2.226   13.836 -22.943 1.00 35.72  ? 300 ALA A CB  1 
ATOM   1856 N  N   . GLU A 1 261 ? 5.267   13.140 -22.186 1.00 36.17  ? 301 GLU A N   1 
ATOM   1857 C  CA  . GLU A 1 261 ? 6.667   13.231 -22.556 1.00 36.92  ? 301 GLU A CA  1 
ATOM   1858 C  C   . GLU A 1 261 ? 7.248   11.835 -22.444 1.00 37.81  ? 301 GLU A C   1 
ATOM   1859 O  O   . GLU A 1 261 ? 8.035   11.425 -23.285 1.00 38.21  ? 301 GLU A O   1 
ATOM   1860 C  CB  . GLU A 1 261 ? 7.394   14.254 -21.667 1.00 35.71  ? 301 GLU A CB  1 
ATOM   1861 C  CG  . GLU A 1 261 ? 6.837   15.666 -21.855 1.00 34.75  ? 301 GLU A CG  1 
ATOM   1862 C  CD  . GLU A 1 261 ? 7.658   16.752 -21.190 1.00 36.55  ? 301 GLU A CD  1 
ATOM   1863 O  OE1 . GLU A 1 261 ? 7.317   17.939 -21.355 1.00 39.00  ? 301 GLU A OE1 1 
ATOM   1864 O  OE2 . GLU A 1 261 ? 8.645   16.440 -20.500 1.00 37.72  ? 301 GLU A OE2 1 
ATOM   1865 N  N   . LYS A 1 262 ? 6.843   11.097 -21.415 1.00 39.55  ? 302 LYS A N   1 
ATOM   1866 C  CA  . LYS A 1 262 ? 7.306   9.721  -21.250 1.00 41.91  ? 302 LYS A CA  1 
ATOM   1867 C  C   . LYS A 1 262 ? 6.793   8.864  -22.415 1.00 42.37  ? 302 LYS A C   1 
ATOM   1868 O  O   . LYS A 1 262 ? 7.402   7.854  -22.777 1.00 43.51  ? 302 LYS A O   1 
ATOM   1869 C  CB  . LYS A 1 262 ? 6.818   9.142  -19.912 1.00 42.09  ? 302 LYS A CB  1 
ATOM   1870 C  CG  . LYS A 1 262 ? 7.778   9.339  -18.728 1.00 44.91  ? 302 LYS A CG  1 
ATOM   1871 C  CD  . LYS A 1 262 ? 8.615   10.657 -18.825 1.00 48.80  ? 302 LYS A CD  1 
ATOM   1872 C  CE  . LYS A 1 262 ? 9.929   10.488 -19.637 1.00 48.55  ? 302 LYS A CE  1 
ATOM   1873 N  NZ  . LYS A 1 262 ? 10.672  11.744 -19.930 1.00 46.27  ? 302 LYS A NZ  1 
ATOM   1874 N  N   . LYS A 1 263 ? 5.669   9.264  -22.995 1.00 42.17  ? 303 LYS A N   1 
ATOM   1875 C  CA  . LYS A 1 263 ? 5.110   8.531  -24.121 1.00 44.13  ? 303 LYS A CA  1 
ATOM   1876 C  C   . LYS A 1 263 ? 5.914   8.816  -25.391 1.00 46.51  ? 303 LYS A C   1 
ATOM   1877 O  O   . LYS A 1 263 ? 6.303   7.905  -26.116 1.00 48.02  ? 303 LYS A O   1 
ATOM   1878 C  CB  . LYS A 1 263 ? 3.645   8.922  -24.348 1.00 41.03  ? 303 LYS A CB  1 
ATOM   1879 C  CG  . LYS A 1 263 ? 3.052   8.290  -25.587 1.00 37.67  ? 303 LYS A CG  1 
ATOM   1880 C  CD  . LYS A 1 263 ? 1.600   8.655  -25.769 1.00 34.62  ? 303 LYS A CD  1 
ATOM   1881 C  CE  . LYS A 1 263 ? 1.084   8.153  -27.116 1.00 32.40  ? 303 LYS A CE  1 
ATOM   1882 N  NZ  . LYS A 1 263 ? -0.357  8.469  -27.294 1.00 29.05  ? 303 LYS A NZ  1 
ATOM   1883 N  N   . ALA A 1 264 ? 6.156   10.092 -25.652 1.00 48.57  ? 304 ALA A N   1 
ATOM   1884 C  CA  . ALA A 1 264 ? 6.904   10.506 -26.820 1.00 50.12  ? 304 ALA A CA  1 
ATOM   1885 C  C   . ALA A 1 264 ? 8.341   10.030 -26.714 1.00 52.53  ? 304 ALA A C   1 
ATOM   1886 O  O   . ALA A 1 264 ? 8.988   9.738  -27.717 1.00 51.62  ? 304 ALA A O   1 
ATOM   1887 C  CB  . ALA A 1 264 ? 6.872   12.015 -26.928 1.00 49.17  ? 304 ALA A CB  1 
ATOM   1888 N  N   . ALA A 1 265 ? 8.827   9.963  -25.481 1.00 56.69  ? 305 ALA A N   1 
ATOM   1889 C  CA  . ALA A 1 265 ? 10.197  9.561  -25.191 1.00 61.36  ? 305 ALA A CA  1 
ATOM   1890 C  C   . ALA A 1 265 ? 10.361  8.056  -25.105 1.00 64.20  ? 305 ALA A C   1 
ATOM   1891 O  O   . ALA A 1 265 ? 10.636  7.498  -24.042 1.00 65.69  ? 305 ALA A O   1 
ATOM   1892 C  CB  . ALA A 1 265 ? 10.675  10.221 -23.874 1.00 61.52  ? 305 ALA A CB  1 
ATOM   1893 N  N   . GLY A 1 266 ? 10.200  7.389  -26.234 1.00 67.07  ? 306 GLY A N   1 
ATOM   1894 C  CA  . GLY A 1 266 ? 10.353  5.954  -26.224 1.00 70.12  ? 306 GLY A CA  1 
ATOM   1895 C  C   . GLY A 1 266 ? 9.195   5.305  -25.511 1.00 71.69  ? 306 GLY A C   1 
ATOM   1896 O  O   . GLY A 1 266 ? 8.043   5.618  -25.794 1.00 71.67  ? 306 GLY A O   1 
ATOM   1897 N  N   . ASP A 1 267 ? 9.495   4.424  -24.565 1.00 73.45  ? 307 ASP A N   1 
ATOM   1898 C  CA  . ASP A 1 267 ? 8.439   3.720  -23.857 1.00 75.93  ? 307 ASP A CA  1 
ATOM   1899 C  C   . ASP A 1 267 ? 8.561   3.852  -22.341 1.00 75.56  ? 307 ASP A C   1 
ATOM   1900 O  O   . ASP A 1 267 ? 7.610   3.575  -21.610 1.00 75.55  ? 307 ASP A O   1 
ATOM   1901 C  CB  . ASP A 1 267 ? 8.452   2.237  -24.272 1.00 78.30  ? 307 ASP A CB  1 
ATOM   1902 C  CG  . ASP A 1 267 ? 8.821   2.036  -25.757 1.00 80.51  ? 307 ASP A CG  1 
ATOM   1903 O  OD1 . ASP A 1 267 ? 8.207   2.687  -26.634 1.00 80.79  ? 307 ASP A OD1 1 
ATOM   1904 O  OD2 . ASP A 1 267 ? 9.726   1.218  -26.047 1.00 81.14  ? 307 ASP A OD2 1 
ATOM   1905 N  N   . GLY A 1 272 ? 0.970   2.260  -21.024 1.00 73.71  ? 312 GLY A N   1 
ATOM   1906 C  CA  . GLY A 1 272 ? -0.307  1.907  -21.626 1.00 73.08  ? 312 GLY A CA  1 
ATOM   1907 C  C   . GLY A 1 272 ? -0.914  3.052  -22.429 1.00 72.49  ? 312 GLY A C   1 
ATOM   1908 O  O   . GLY A 1 272 ? -0.270  3.606  -23.339 1.00 73.32  ? 312 GLY A O   1 
ATOM   1909 N  N   . ALA A 1 273 ? -2.158  3.406  -22.111 1.00 70.27  ? 313 ALA A N   1 
ATOM   1910 C  CA  . ALA A 1 273 ? -2.822  4.503  -22.812 1.00 67.49  ? 313 ALA A CA  1 
ATOM   1911 C  C   . ALA A 1 273 ? -2.438  5.801  -22.117 1.00 65.23  ? 313 ALA A C   1 
ATOM   1912 O  O   . ALA A 1 273 ? -2.754  6.009  -20.942 1.00 64.56  ? 313 ALA A O   1 
ATOM   1913 C  CB  . ALA A 1 273 ? -4.333  4.324  -22.792 1.00 67.07  ? 313 ALA A CB  1 
ATOM   1914 N  N   . ARG A 1 274 ? -1.725  6.650  -22.849 1.00 62.23  ? 314 ARG A N   1 
ATOM   1915 C  CA  . ARG A 1 274 ? -1.282  7.941  -22.345 1.00 59.00  ? 314 ARG A CA  1 
ATOM   1916 C  C   . ARG A 1 274 ? -1.612  8.955  -23.429 1.00 56.55  ? 314 ARG A C   1 
ATOM   1917 O  O   . ARG A 1 274 ? -1.664  8.621  -24.608 1.00 55.75  ? 314 ARG A O   1 
ATOM   1918 C  CB  . ARG A 1 274 ? 0.234   7.951  -22.113 1.00 60.82  ? 314 ARG A CB  1 
ATOM   1919 C  CG  . ARG A 1 274 ? 0.785   6.897  -21.162 1.00 62.47  ? 314 ARG A CG  1 
ATOM   1920 C  CD  . ARG A 1 274 ? 2.006   6.224  -21.788 1.00 65.09  ? 314 ARG A CD  1 
ATOM   1921 N  NE  . ARG A 1 274 ? 3.194   6.267  -20.937 1.00 66.99  ? 314 ARG A NE  1 
ATOM   1922 C  CZ  . ARG A 1 274 ? 4.407   5.879  -21.331 1.00 68.43  ? 314 ARG A CZ  1 
ATOM   1923 N  NH1 . ARG A 1 274 ? 4.605   5.413  -22.568 1.00 67.14  ? 314 ARG A NH1 1 
ATOM   1924 N  NH2 . ARG A 1 274 ? 5.431   5.969  -20.489 1.00 68.34  ? 314 ARG A NH2 1 
ATOM   1925 N  N   . LEU A 1 275 ? -1.820  10.199 -23.037 1.00 53.73  ? 315 LEU A N   1 
ATOM   1926 C  CA  . LEU A 1 275 ? -2.134  11.223 -24.010 1.00 50.87  ? 315 LEU A CA  1 
ATOM   1927 C  C   . LEU A 1 275 ? -0.908  11.713 -24.783 1.00 49.94  ? 315 LEU A C   1 
ATOM   1928 O  O   . LEU A 1 275 ? 0.245   11.467 -24.404 1.00 48.48  ? 315 LEU A O   1 
ATOM   1929 C  CB  . LEU A 1 275 ? -2.779  12.419 -23.315 1.00 50.48  ? 315 LEU A CB  1 
ATOM   1930 C  CG  . LEU A 1 275 ? -4.147  12.237 -22.663 1.00 50.23  ? 315 LEU A CG  1 
ATOM   1931 C  CD1 . LEU A 1 275 ? -4.506  13.525 -21.959 1.00 50.50  ? 315 LEU A CD1 1 
ATOM   1932 C  CD2 . LEU A 1 275 ? -5.196  11.885 -23.700 1.00 49.33  ? 315 LEU A CD2 1 
ATOM   1933 N  N   . ASP A 1 276 ? -1.184  12.397 -25.888 1.00 48.11  ? 316 ASP A N   1 
ATOM   1934 C  CA  . ASP A 1 276 ? -0.154  12.999 -26.705 1.00 45.61  ? 316 ASP A CA  1 
ATOM   1935 C  C   . ASP A 1 276 ? -0.140  14.445 -26.226 1.00 43.86  ? 316 ASP A C   1 
ATOM   1936 O  O   . ASP A 1 276 ? -1.186  14.983 -25.869 1.00 43.41  ? 316 ASP A O   1 
ATOM   1937 C  CB  . ASP A 1 276 ? -0.542  12.954 -28.178 1.00 47.38  ? 316 ASP A CB  1 
ATOM   1938 C  CG  . ASP A 1 276 ? -0.464  11.566 -28.753 1.00 49.57  ? 316 ASP A CG  1 
ATOM   1939 O  OD1 . ASP A 1 276 ? 0.617   10.943 -28.645 1.00 50.68  ? 316 ASP A OD1 1 
ATOM   1940 O  OD2 . ASP A 1 276 ? -1.479  11.099 -29.324 1.00 53.12  ? 316 ASP A OD2 1 
ATOM   1941 N  N   . LEU A 1 277 ? 1.028   15.071 -26.204 1.00 40.81  ? 317 LEU A N   1 
ATOM   1942 C  CA  . LEU A 1 277 ? 1.115   16.446 -25.760 1.00 38.34  ? 317 LEU A CA  1 
ATOM   1943 C  C   . LEU A 1 277 ? 0.096   17.365 -26.409 1.00 37.65  ? 317 LEU A C   1 
ATOM   1944 O  O   . LEU A 1 277 ? -0.442  18.247 -25.746 1.00 38.26  ? 317 LEU A O   1 
ATOM   1945 C  CB  . LEU A 1 277 ? 2.508   17.018 -26.015 1.00 37.29  ? 317 LEU A CB  1 
ATOM   1946 C  CG  . LEU A 1 277 ? 3.397   17.219 -24.793 1.00 36.26  ? 317 LEU A CG  1 
ATOM   1947 C  CD1 . LEU A 1 277 ? 4.295   18.419 -25.036 1.00 34.76  ? 317 LEU A CD1 1 
ATOM   1948 C  CD2 . LEU A 1 277 ? 2.554   17.469 -23.565 1.00 36.05  ? 317 LEU A CD2 1 
ATOM   1949 N  N   . GLU A 1 278 ? -0.161  17.178 -27.698 1.00 37.49  ? 318 GLU A N   1 
ATOM   1950 C  CA  . GLU A 1 278 ? -1.116  18.036 -28.403 1.00 38.18  ? 318 GLU A CA  1 
ATOM   1951 C  C   . GLU A 1 278 ? -2.555  17.937 -27.888 1.00 36.75  ? 318 GLU A C   1 
ATOM   1952 O  O   . GLU A 1 278 ? -3.354  18.847 -28.121 1.00 36.96  ? 318 GLU A O   1 
ATOM   1953 C  CB  . GLU A 1 278 ? -1.073  17.784 -29.934 1.00 40.35  ? 318 GLU A CB  1 
ATOM   1954 C  CG  . GLU A 1 278 ? -1.142  16.307 -30.386 1.00 46.30  ? 318 GLU A CG  1 
ATOM   1955 C  CD  . GLU A 1 278 ? -1.005  16.098 -31.919 1.00 48.54  ? 318 GLU A CD  1 
ATOM   1956 O  OE1 . GLU A 1 278 ? -2.028  16.139 -32.650 1.00 50.76  ? 318 GLU A OE1 1 
ATOM   1957 O  OE2 . GLU A 1 278 ? 0.134   15.887 -32.396 1.00 50.79  ? 318 GLU A OE2 1 
ATOM   1958 N  N   . ASN A 1 279 ? -2.875  16.859 -27.174 1.00 34.52  ? 319 ASN A N   1 
ATOM   1959 C  CA  . ASN A 1 279 ? -4.221  16.655 -26.645 1.00 33.51  ? 319 ASN A CA  1 
ATOM   1960 C  C   . ASN A 1 279 ? -4.345  16.942 -25.164 1.00 33.49  ? 319 ASN A C   1 
ATOM   1961 O  O   . ASN A 1 279 ? -5.456  16.945 -24.636 1.00 34.91  ? 319 ASN A O   1 
ATOM   1962 C  CB  . ASN A 1 279 ? -4.694  15.210 -26.857 1.00 33.93  ? 319 ASN A CB  1 
ATOM   1963 C  CG  . ASN A 1 279 ? -4.764  14.827 -28.303 1.00 34.85  ? 319 ASN A CG  1 
ATOM   1964 O  OD1 . ASN A 1 279 ? -5.456  15.471 -29.079 1.00 34.95  ? 319 ASN A OD1 1 
ATOM   1965 N  ND2 . ASN A 1 279 ? -4.046  13.768 -28.683 1.00 34.90  ? 319 ASN A ND2 1 
ATOM   1966 N  N   . VAL A 1 280 ? -3.229  17.153 -24.476 1.00 32.01  ? 320 VAL A N   1 
ATOM   1967 C  CA  . VAL A 1 280 ? -3.296  17.415 -23.044 1.00 31.18  ? 320 VAL A CA  1 
ATOM   1968 C  C   . VAL A 1 280 ? -4.087  18.691 -22.690 1.00 31.29  ? 320 VAL A C   1 
ATOM   1969 O  O   . VAL A 1 280 ? -4.955  18.657 -21.830 1.00 32.12  ? 320 VAL A O   1 
ATOM   1970 C  CB  . VAL A 1 280 ? -1.876  17.444 -22.416 1.00 30.70  ? 320 VAL A CB  1 
ATOM   1971 C  CG1 . VAL A 1 280 ? -1.927  17.975 -21.004 1.00 28.64  ? 320 VAL A CG1 1 
ATOM   1972 C  CG2 . VAL A 1 280 ? -1.306  16.039 -22.399 1.00 31.55  ? 320 VAL A CG2 1 
ATOM   1973 N  N   . PRO A 1 281 ? -3.816  19.827 -23.354 1.00 31.48  ? 321 PRO A N   1 
ATOM   1974 C  CA  . PRO A 1 281 ? -4.602  21.010 -22.983 1.00 31.19  ? 321 PRO A CA  1 
ATOM   1975 C  C   . PRO A 1 281 ? -6.109  20.786 -23.181 1.00 31.06  ? 321 PRO A C   1 
ATOM   1976 O  O   . PRO A 1 281 ? -6.921  21.128 -22.322 1.00 30.47  ? 321 PRO A O   1 
ATOM   1977 C  CB  . PRO A 1 281 ? -4.056  22.088 -23.910 1.00 31.18  ? 321 PRO A CB  1 
ATOM   1978 C  CG  . PRO A 1 281 ? -2.652  21.650 -24.137 1.00 31.60  ? 321 PRO A CG  1 
ATOM   1979 C  CD  . PRO A 1 281 ? -2.794  20.174 -24.355 1.00 31.63  ? 321 PRO A CD  1 
ATOM   1980 N  N   . ALA A 1 282 ? -6.481  20.196 -24.309 1.00 30.34  ? 322 ALA A N   1 
ATOM   1981 C  CA  . ALA A 1 282 ? -7.888  19.949 -24.579 1.00 30.47  ? 322 ALA A CA  1 
ATOM   1982 C  C   . ALA A 1 282 ? -8.529  19.046 -23.559 1.00 31.22  ? 322 ALA A C   1 
ATOM   1983 O  O   . ALA A 1 282 ? -9.650  19.305 -23.152 1.00 34.13  ? 322 ALA A O   1 
ATOM   1984 C  CB  . ALA A 1 282 ? -8.075  19.364 -25.946 1.00 30.18  ? 322 ALA A CB  1 
ATOM   1985 N  N   . THR A 1 283 ? -7.852  17.991 -23.122 1.00 31.11  ? 323 THR A N   1 
ATOM   1986 C  CA  . THR A 1 283 ? -8.515  17.127 -22.167 1.00 32.16  ? 323 THR A CA  1 
ATOM   1987 C  C   . THR A 1 283 ? -8.557  17.668 -20.733 1.00 33.90  ? 323 THR A C   1 
ATOM   1988 O  O   . THR A 1 283 ? -9.471  17.326 -19.971 1.00 36.59  ? 323 THR A O   1 
ATOM   1989 C  CB  . THR A 1 283 ? -7.980  15.644 -22.235 1.00 31.48  ? 323 THR A CB  1 
ATOM   1990 O  OG1 . THR A 1 283 ? -7.546  15.210 -20.945 1.00 33.54  ? 323 THR A OG1 1 
ATOM   1991 C  CG2 . THR A 1 283 ? -6.877  15.506 -23.229 1.00 28.68  ? 323 THR A CG2 1 
ATOM   1992 N  N   . ILE A 1 284 ? -7.609  18.516 -20.349 1.00 33.66  ? 324 ILE A N   1 
ATOM   1993 C  CA  . ILE A 1 284 ? -7.657  19.080 -19.002 1.00 33.59  ? 324 ILE A CA  1 
ATOM   1994 C  C   . ILE A 1 284 ? -8.784  20.132 -19.032 1.00 34.02  ? 324 ILE A C   1 
ATOM   1995 O  O   . ILE A 1 284 ? -9.332  20.489 -17.984 1.00 32.66  ? 324 ILE A O   1 
ATOM   1996 C  CB  . ILE A 1 284 ? -6.332  19.793 -18.604 1.00 34.51  ? 324 ILE A CB  1 
ATOM   1997 C  CG1 . ILE A 1 284 ? -6.320  20.125 -17.105 1.00 35.08  ? 324 ILE A CG1 1 
ATOM   1998 C  CG2 . ILE A 1 284 ? -6.248  21.157 -19.282 1.00 35.58  ? 324 ILE A CG2 1 
ATOM   1999 C  CD1 . ILE A 1 284 ? -5.987  18.992 -16.179 1.00 31.22  ? 324 ILE A CD1 1 
ATOM   2000 N  N   . THR A 1 285 ? -9.129  20.622 -20.234 1.00 33.18  ? 325 THR A N   1 
ATOM   2001 C  CA  . THR A 1 285 ? -10.195 21.630 -20.368 1.00 32.50  ? 325 THR A CA  1 
ATOM   2002 C  C   . THR A 1 285 ? -11.549 20.975 -20.109 1.00 33.78  ? 325 THR A C   1 
ATOM   2003 O  O   . THR A 1 285 ? -12.387 21.522 -19.383 1.00 33.36  ? 325 THR A O   1 
ATOM   2004 C  CB  . THR A 1 285 ? -10.249 22.284 -21.769 1.00 30.03  ? 325 THR A CB  1 
ATOM   2005 O  OG1 . THR A 1 285 ? -8.987  22.866 -22.096 1.00 29.22  ? 325 THR A OG1 1 
ATOM   2006 C  CG2 . THR A 1 285 ? -11.272 23.374 -21.788 1.00 27.87  ? 325 THR A CG2 1 
ATOM   2007 N  N   . ASP A 1 286 ? -11.761 19.801 -20.708 1.00 33.41  ? 326 ASP A N   1 
ATOM   2008 C  CA  . ASP A 1 286 ? -13.005 19.071 -20.504 1.00 32.64  ? 326 ASP A CA  1 
ATOM   2009 C  C   . ASP A 1 286 ? -13.100 18.726 -19.014 1.00 31.79  ? 326 ASP A C   1 
ATOM   2010 O  O   . ASP A 1 286 ? -14.128 18.922 -18.365 1.00 29.14  ? 326 ASP A O   1 
ATOM   2011 C  CB  . ASP A 1 286 ? -13.015 17.790 -21.348 1.00 35.00  ? 326 ASP A CB  1 
ATOM   2012 C  CG  . ASP A 1 286 ? -13.201 18.065 -22.848 1.00 39.56  ? 326 ASP A CG  1 
ATOM   2013 O  OD1 . ASP A 1 286 ? -13.100 17.098 -23.621 1.00 40.95  ? 326 ASP A OD1 1 
ATOM   2014 O  OD2 . ASP A 1 286 ? -13.443 19.229 -23.268 1.00 39.77  ? 326 ASP A OD2 1 
ATOM   2015 N  N   . ILE A 1 287 ? -12.001 18.232 -18.465 1.00 31.12  ? 327 ILE A N   1 
ATOM   2016 C  CA  . ILE A 1 287 ? -11.992 17.856 -17.068 1.00 30.78  ? 327 ILE A CA  1 
ATOM   2017 C  C   . ILE A 1 287 ? -12.307 19.027 -16.170 1.00 30.98  ? 327 ILE A C   1 
ATOM   2018 O  O   . ILE A 1 287 ? -13.203 18.937 -15.346 1.00 33.62  ? 327 ILE A O   1 
ATOM   2019 C  CB  . ILE A 1 287 ? -10.641 17.209 -16.690 1.00 30.19  ? 327 ILE A CB  1 
ATOM   2020 C  CG1 . ILE A 1 287 ? -10.635 15.767 -17.207 1.00 31.54  ? 327 ILE A CG1 1 
ATOM   2021 C  CG2 . ILE A 1 287 ? -10.438 17.225 -15.194 1.00 29.77  ? 327 ILE A CG2 1 
ATOM   2022 C  CD1 . ILE A 1 287 ? -9.351  15.001 -16.982 1.00 32.47  ? 327 ILE A CD1 1 
ATOM   2023 N  N   . PHE A 1 288 ? -11.599 20.134 -16.332 1.00 30.78  ? 328 PHE A N   1 
ATOM   2024 C  CA  . PHE A 1 288 ? -11.836 21.297 -15.489 1.00 29.82  ? 328 PHE A CA  1 
ATOM   2025 C  C   . PHE A 1 288 ? -13.171 21.945 -15.742 1.00 29.67  ? 328 PHE A C   1 
ATOM   2026 O  O   . PHE A 1 288 ? -13.791 22.456 -14.821 1.00 31.87  ? 328 PHE A O   1 
ATOM   2027 C  CB  . PHE A 1 288 ? -10.766 22.355 -15.708 1.00 29.52  ? 328 PHE A CB  1 
ATOM   2028 C  CG  . PHE A 1 288 ? -11.017 23.624 -14.952 1.00 28.77  ? 328 PHE A CG  1 
ATOM   2029 C  CD1 . PHE A 1 288 ? -10.978 23.636 -13.556 1.00 26.28  ? 328 PHE A CD1 1 
ATOM   2030 C  CD2 . PHE A 1 288 ? -11.264 24.818 -15.632 1.00 28.97  ? 328 PHE A CD2 1 
ATOM   2031 C  CE1 . PHE A 1 288 ? -11.171 24.813 -12.845 1.00 26.26  ? 328 PHE A CE1 1 
ATOM   2032 C  CE2 . PHE A 1 288 ? -11.459 26.016 -14.931 1.00 28.29  ? 328 PHE A CE2 1 
ATOM   2033 C  CZ  . PHE A 1 288 ? -11.409 26.014 -13.531 1.00 27.70  ? 328 PHE A CZ  1 
ATOM   2034 N  N   . GLY A 1 289 ? -13.597 21.940 -16.998 1.00 29.99  ? 329 GLY A N   1 
ATOM   2035 C  CA  . GLY A 1 289 ? -14.857 22.554 -17.367 1.00 28.94  ? 329 GLY A CA  1 
ATOM   2036 C  C   . GLY A 1 289 ? -16.081 21.839 -16.861 1.00 29.39  ? 329 GLY A C   1 
ATOM   2037 O  O   . GLY A 1 289 ? -16.989 22.472 -16.345 1.00 29.84  ? 329 GLY A O   1 
ATOM   2038 N  N   . ALA A 1 290 ? -16.121 20.521 -17.016 1.00 30.81  ? 330 ALA A N   1 
ATOM   2039 C  CA  . ALA A 1 290 ? -17.263 19.742 -16.556 1.00 31.74  ? 330 ALA A CA  1 
ATOM   2040 C  C   . ALA A 1 290 ? -17.407 19.854 -15.054 1.00 33.12  ? 330 ALA A C   1 
ATOM   2041 O  O   . ALA A 1 290 ? -18.384 20.407 -14.558 1.00 35.92  ? 330 ALA A O   1 
ATOM   2042 C  CB  . ALA A 1 290 ? -17.106 18.287 -16.946 1.00 32.57  ? 330 ALA A CB  1 
ATOM   2043 N  N   . SER A 1 291 ? -16.430 19.341 -14.324 1.00 32.87  ? 331 SER A N   1 
ATOM   2044 C  CA  . SER A 1 291 ? -16.500 19.387 -12.879 1.00 33.97  ? 331 SER A CA  1 
ATOM   2045 C  C   . SER A 1 291 ? -16.993 20.730 -12.333 1.00 34.69  ? 331 SER A C   1 
ATOM   2046 O  O   . SER A 1 291 ? -17.963 20.782 -11.580 1.00 36.78  ? 331 SER A O   1 
ATOM   2047 C  CB  . SER A 1 291 ? -15.137 19.055 -12.295 1.00 33.76  ? 331 SER A CB  1 
ATOM   2048 O  OG  . SER A 1 291 ? -14.169 19.964 -12.758 1.00 36.56  ? 331 SER A OG  1 
ATOM   2049 N  N   . GLN A 1 292 ? -16.336 21.813 -12.725 1.00 34.52  ? 332 GLN A N   1 
ATOM   2050 C  CA  . GLN A 1 292 ? -16.670 23.156 -12.251 1.00 33.72  ? 332 GLN A CA  1 
ATOM   2051 C  C   . GLN A 1 292 ? -18.115 23.576 -12.515 1.00 35.08  ? 332 GLN A C   1 
ATOM   2052 O  O   . GLN A 1 292 ? -18.696 24.384 -11.779 1.00 35.51  ? 332 GLN A O   1 
ATOM   2053 C  CB  . GLN A 1 292 ? -15.702 24.151 -12.885 1.00 32.35  ? 332 GLN A CB  1 
ATOM   2054 C  CG  . GLN A 1 292 ? -16.217 25.536 -13.004 1.00 34.82  ? 332 GLN A CG  1 
ATOM   2055 C  CD  . GLN A 1 292 ? -17.085 25.767 -14.237 1.00 38.37  ? 332 GLN A CD  1 
ATOM   2056 O  OE1 . GLN A 1 292 ? -17.915 26.666 -14.235 1.00 43.06  ? 332 GLN A OE1 1 
ATOM   2057 N  NE2 . GLN A 1 292 ? -16.890 24.978 -15.292 1.00 37.05  ? 332 GLN A NE2 1 
ATOM   2058 N  N   . ASP A 1 293 ? -18.686 23.039 -13.581 1.00 35.28  ? 333 ASP A N   1 
ATOM   2059 C  CA  . ASP A 1 293 ? -20.047 23.358 -13.951 1.00 35.69  ? 333 ASP A CA  1 
ATOM   2060 C  C   . ASP A 1 293 ? -20.977 22.442 -13.157 1.00 36.68  ? 333 ASP A C   1 
ATOM   2061 O  O   . ASP A 1 293 ? -21.744 22.914 -12.302 1.00 36.84  ? 333 ASP A O   1 
ATOM   2062 C  CB  . ASP A 1 293 ? -20.210 23.155 -15.462 1.00 37.85  ? 333 ASP A CB  1 
ATOM   2063 C  CG  . ASP A 1 293 ? -21.555 23.631 -15.990 1.00 40.79  ? 333 ASP A CG  1 
ATOM   2064 O  OD1 . ASP A 1 293 ? -22.129 24.585 -15.429 1.00 43.53  ? 333 ASP A OD1 1 
ATOM   2065 O  OD2 . ASP A 1 293 ? -22.034 23.062 -16.993 1.00 44.08  ? 333 ASP A OD2 1 
ATOM   2066 N  N   . THR A 1 294 ? -20.876 21.134 -13.414 1.00 35.13  ? 334 THR A N   1 
ATOM   2067 C  CA  . THR A 1 294 ? -21.707 20.138 -12.741 1.00 35.02  ? 334 THR A CA  1 
ATOM   2068 C  C   . THR A 1 294 ? -21.661 20.170 -11.210 1.00 34.63  ? 334 THR A C   1 
ATOM   2069 O  O   . THR A 1 294 ? -22.716 20.196 -10.549 1.00 33.49  ? 334 THR A O   1 
ATOM   2070 C  CB  . THR A 1 294 ? -21.328 18.715 -13.148 1.00 35.02  ? 334 THR A CB  1 
ATOM   2071 O  OG1 . THR A 1 294 ? -19.942 18.521 -12.874 1.00 35.83  ? 334 THR A OG1 1 
ATOM   2072 C  CG2 . THR A 1 294 ? -21.619 18.455 -14.621 1.00 34.05  ? 334 THR A CG2 1 
ATOM   2073 N  N   . LEU A 1 295 ? -20.454 20.147 -10.644 1.00 32.70  ? 335 LEU A N   1 
ATOM   2074 C  CA  . LEU A 1 295 ? -20.336 20.165 -9.196  1.00 32.50  ? 335 LEU A CA  1 
ATOM   2075 C  C   . LEU A 1 295 ? -20.919 21.450 -8.628  1.00 33.43  ? 335 LEU A C   1 
ATOM   2076 O  O   . LEU A 1 295 ? -21.458 21.484 -7.521  1.00 32.87  ? 335 LEU A O   1 
ATOM   2077 C  CB  . LEU A 1 295 ? -18.880 19.980 -8.775  1.00 31.10  ? 335 LEU A CB  1 
ATOM   2078 C  CG  . LEU A 1 295 ? -18.318 18.564 -8.963  1.00 29.24  ? 335 LEU A CG  1 
ATOM   2079 C  CD1 . LEU A 1 295 ? -17.142 18.353 -8.047  1.00 26.59  ? 335 LEU A CD1 1 
ATOM   2080 C  CD2 . LEU A 1 295 ? -19.385 17.548 -8.648  1.00 26.38  ? 335 LEU A CD2 1 
ATOM   2081 N  N   . SER A 1 296 ? -20.849 22.502 -9.420  1.00 35.35  ? 336 SER A N   1 
ATOM   2082 C  CA  . SER A 1 296 ? -21.378 23.797 -9.027  1.00 37.23  ? 336 SER A CA  1 
ATOM   2083 C  C   . SER A 1 296 ? -22.902 23.725 -9.003  1.00 38.12  ? 336 SER A C   1 
ATOM   2084 O  O   . SER A 1 296 ? -23.559 24.104 -8.037  1.00 39.82  ? 336 SER A O   1 
ATOM   2085 C  CB  . SER A 1 296 ? -20.937 24.845 -10.043 1.00 37.12  ? 336 SER A CB  1 
ATOM   2086 O  OG  . SER A 1 296 ? -20.796 26.088 -9.416  1.00 38.87  ? 336 SER A OG  1 
ATOM   2087 N  N   . THR A 1 297 ? -23.465 23.251 -10.097 1.00 37.29  ? 337 THR A N   1 
ATOM   2088 C  CA  . THR A 1 297 ? -24.898 23.118 -10.205 1.00 36.22  ? 337 THR A CA  1 
ATOM   2089 C  C   . THR A 1 297 ? -25.455 22.220 -9.098  1.00 36.74  ? 337 THR A C   1 
ATOM   2090 O  O   . THR A 1 297 ? -26.446 22.555 -8.458  1.00 36.11  ? 337 THR A O   1 
ATOM   2091 C  CB  . THR A 1 297 ? -25.228 22.509 -11.543 1.00 36.34  ? 337 THR A CB  1 
ATOM   2092 O  OG1 . THR A 1 297 ? -24.756 23.381 -12.567 1.00 36.79  ? 337 THR A OG1 1 
ATOM   2093 C  CG2 . THR A 1 297 ? -26.720 22.273 -11.689 1.00 37.52  ? 337 THR A CG2 1 
ATOM   2094 N  N   . ALA A 1 298 ? -24.810 21.069 -8.895  1.00 37.34  ? 338 ALA A N   1 
ATOM   2095 C  CA  . ALA A 1 298 ? -25.219 20.091 -7.889  1.00 36.57  ? 338 ALA A CA  1 
ATOM   2096 C  C   . ALA A 1 298 ? -25.305 20.723 -6.508  1.00 37.34  ? 338 ALA A C   1 
ATOM   2097 O  O   . ALA A 1 298 ? -26.306 20.602 -5.789  1.00 38.09  ? 338 ALA A O   1 
ATOM   2098 C  CB  . ALA A 1 298 ? -24.230 18.967 -7.857  1.00 36.28  ? 338 ALA A CB  1 
ATOM   2099 N  N   . LEU A 1 299 ? -24.221 21.394 -6.154  1.00 37.29  ? 339 LEU A N   1 
ATOM   2100 C  CA  . LEU A 1 299 ? -24.078 22.074 -4.879  1.00 36.04  ? 339 LEU A CA  1 
ATOM   2101 C  C   . LEU A 1 299 ? -25.188 23.112 -4.678  1.00 35.36  ? 339 LEU A C   1 
ATOM   2102 O  O   . LEU A 1 299 ? -25.771 23.223 -3.591  1.00 34.97  ? 339 LEU A O   1 
ATOM   2103 C  CB  . LEU A 1 299 ? -22.701 22.729 -4.840  1.00 35.04  ? 339 LEU A CB  1 
ATOM   2104 C  CG  . LEU A 1 299 ? -22.154 23.082 -3.476  1.00 36.00  ? 339 LEU A CG  1 
ATOM   2105 C  CD1 . LEU A 1 299 ? -22.160 21.855 -2.590  1.00 35.84  ? 339 LEU A CD1 1 
ATOM   2106 C  CD2 . LEU A 1 299 ? -20.746 23.635 -3.649  1.00 36.52  ? 339 LEU A CD2 1 
ATOM   2107 N  N   . GLN A 1 300 ? -25.479 23.874 -5.724  1.00 34.36  ? 340 GLN A N   1 
ATOM   2108 C  CA  . GLN A 1 300 ? -26.530 24.867 -5.623  1.00 35.30  ? 340 GLN A CA  1 
ATOM   2109 C  C   . GLN A 1 300 ? -27.861 24.217 -5.301  1.00 35.49  ? 340 GLN A C   1 
ATOM   2110 O  O   . GLN A 1 300 ? -28.686 24.823 -4.605  1.00 37.99  ? 340 GLN A O   1 
ATOM   2111 C  CB  . GLN A 1 300 ? -26.647 25.687 -6.905  1.00 35.45  ? 340 GLN A CB  1 
ATOM   2112 C  CG  . GLN A 1 300 ? -25.595 26.747 -7.006  1.00 35.36  ? 340 GLN A CG  1 
ATOM   2113 C  CD  . GLN A 1 300 ? -25.421 27.251 -8.417  1.00 36.42  ? 340 GLN A CD  1 
ATOM   2114 O  OE1 . GLN A 1 300 ? -26.380 27.358 -9.170  1.00 35.51  ? 340 GLN A OE1 1 
ATOM   2115 N  NE2 . GLN A 1 300 ? -24.188 27.587 -8.778  1.00 36.38  ? 340 GLN A NE2 1 
ATOM   2116 N  N   . TRP A 1 301 ? -28.079 22.988 -5.778  1.00 34.40  ? 341 TRP A N   1 
ATOM   2117 C  CA  . TRP A 1 301 ? -29.352 22.305 -5.490  1.00 32.44  ? 341 TRP A CA  1 
ATOM   2118 C  C   . TRP A 1 301 ? -29.426 21.840 -4.044  1.00 32.28  ? 341 TRP A C   1 
ATOM   2119 O  O   . TRP A 1 301 ? -30.476 21.914 -3.405  1.00 30.56  ? 341 TRP A O   1 
ATOM   2120 C  CB  . TRP A 1 301 ? -29.568 21.098 -6.392  1.00 28.71  ? 341 TRP A CB  1 
ATOM   2121 C  CG  . TRP A 1 301 ? -30.138 21.412 -7.719  1.00 26.31  ? 341 TRP A CG  1 
ATOM   2122 C  CD1 . TRP A 1 301 ? -29.453 21.819 -8.818  1.00 27.14  ? 341 TRP A CD1 1 
ATOM   2123 C  CD2 . TRP A 1 301 ? -31.509 21.312 -8.113  1.00 25.47  ? 341 TRP A CD2 1 
ATOM   2124 N  NE1 . TRP A 1 301 ? -30.304 21.976 -9.879  1.00 26.10  ? 341 TRP A NE1 1 
ATOM   2125 C  CE2 . TRP A 1 301 ? -31.574 21.670 -9.480  1.00 24.61  ? 341 TRP A CE2 1 
ATOM   2126 C  CE3 . TRP A 1 301 ? -32.690 20.958 -7.446  1.00 26.57  ? 341 TRP A CE3 1 
ATOM   2127 C  CZ2 . TRP A 1 301 ? -32.773 21.685 -10.204 1.00 24.20  ? 341 TRP A CZ2 1 
ATOM   2128 C  CZ3 . TRP A 1 301 ? -33.893 20.977 -8.161  1.00 27.42  ? 341 TRP A CZ3 1 
ATOM   2129 C  CH2 . TRP A 1 301 ? -33.923 21.340 -9.533  1.00 27.11  ? 341 TRP A CH2 1 
ATOM   2130 N  N   . LEU A 1 302 ? -28.304 21.345 -3.540  1.00 32.70  ? 342 LEU A N   1 
ATOM   2131 C  CA  . LEU A 1 302 ? -28.254 20.878 -2.175  1.00 33.17  ? 342 LEU A CA  1 
ATOM   2132 C  C   . LEU A 1 302 ? -28.731 21.956 -1.225  1.00 33.92  ? 342 LEU A C   1 
ATOM   2133 O  O   . LEU A 1 302 ? -29.609 21.715 -0.415  1.00 35.61  ? 342 LEU A O   1 
ATOM   2134 C  CB  . LEU A 1 302 ? -26.838 20.444 -1.839  1.00 32.23  ? 342 LEU A CB  1 
ATOM   2135 C  CG  . LEU A 1 302 ? -26.428 19.220 -2.666  1.00 32.64  ? 342 LEU A CG  1 
ATOM   2136 C  CD1 . LEU A 1 302 ? -25.091 18.738 -2.150  1.00 32.71  ? 342 LEU A CD1 1 
ATOM   2137 C  CD2 . LEU A 1 302 ? -27.482 18.091 -2.580  1.00 31.75  ? 342 LEU A CD2 1 
ATOM   2138 N  N   . LEU A 1 303 ? -28.177 23.154 -1.339  1.00 35.48  ? 343 LEU A N   1 
ATOM   2139 C  CA  . LEU A 1 303 ? -28.583 24.252 -0.465  1.00 35.43  ? 343 LEU A CA  1 
ATOM   2140 C  C   . LEU A 1 303 ? -30.022 24.629 -0.772  1.00 34.56  ? 343 LEU A C   1 
ATOM   2141 O  O   . LEU A 1 303 ? -30.805 24.943 0.128   1.00 33.31  ? 343 LEU A O   1 
ATOM   2142 C  CB  . LEU A 1 303 ? -27.670 25.461 -0.670  1.00 35.65  ? 343 LEU A CB  1 
ATOM   2143 C  CG  . LEU A 1 303 ? -26.179 25.146 -0.523  1.00 35.24  ? 343 LEU A CG  1 
ATOM   2144 C  CD1 . LEU A 1 303 ? -25.397 26.427 -0.779  1.00 33.85  ? 343 LEU A CD1 1 
ATOM   2145 C  CD2 . LEU A 1 303 ? -25.876 24.556 0.862   1.00 30.82  ? 343 LEU A CD2 1 
ATOM   2146 N  N   . LEU A 1 304 ? -30.361 24.603 -2.056  1.00 34.62  ? 344 LEU A N   1 
ATOM   2147 C  CA  . LEU A 1 304 ? -31.724 24.904 -2.481  1.00 34.67  ? 344 LEU A CA  1 
ATOM   2148 C  C   . LEU A 1 304 ? -32.672 23.933 -1.747  1.00 35.05  ? 344 LEU A C   1 
ATOM   2149 O  O   . LEU A 1 304 ? -33.608 24.372 -1.068  1.00 35.70  ? 344 LEU A O   1 
ATOM   2150 C  CB  . LEU A 1 304 ? -31.848 24.726 -3.992  1.00 35.56  ? 344 LEU A CB  1 
ATOM   2151 C  CG  . LEU A 1 304 ? -33.234 24.919 -4.619  1.00 39.33  ? 344 LEU A CG  1 
ATOM   2152 C  CD1 . LEU A 1 304 ? -33.634 26.409 -4.557  1.00 40.50  ? 344 LEU A CD1 1 
ATOM   2153 C  CD2 . LEU A 1 304 ? -33.208 24.430 -6.075  1.00 38.97  ? 344 LEU A CD2 1 
ATOM   2154 N  N   . LEU A 1 305 ? -32.417 22.621 -1.874  1.00 33.52  ? 345 LEU A N   1 
ATOM   2155 C  CA  . LEU A 1 305 ? -33.227 21.601 -1.216  1.00 31.60  ? 345 LEU A CA  1 
ATOM   2156 C  C   . LEU A 1 305 ? -33.194 21.796 0.317   1.00 33.16  ? 345 LEU A C   1 
ATOM   2157 O  O   . LEU A 1 305 ? -34.224 21.668 1.005   1.00 33.16  ? 345 LEU A O   1 
ATOM   2158 C  CB  . LEU A 1 305 ? -32.717 20.204 -1.583  1.00 30.45  ? 345 LEU A CB  1 
ATOM   2159 C  CG  . LEU A 1 305 ? -33.330 19.317 -2.683  1.00 27.50  ? 345 LEU A CG  1 
ATOM   2160 C  CD1 . LEU A 1 305 ? -34.521 19.994 -3.309  1.00 24.63  ? 345 LEU A CD1 1 
ATOM   2161 C  CD2 . LEU A 1 305 ? -32.252 18.958 -3.723  1.00 21.19  ? 345 LEU A CD2 1 
ATOM   2162 N  N   . PHE A 1 306 ? -32.024 22.107 0.860   1.00 31.81  ? 346 PHE A N   1 
ATOM   2163 C  CA  . PHE A 1 306 ? -31.935 22.336 2.296   1.00 33.66  ? 346 PHE A CA  1 
ATOM   2164 C  C   . PHE A 1 306 ? -32.923 23.448 2.731   1.00 35.59  ? 346 PHE A C   1 
ATOM   2165 O  O   . PHE A 1 306 ? -33.602 23.320 3.741   1.00 36.59  ? 346 PHE A O   1 
ATOM   2166 C  CB  . PHE A 1 306 ? -30.502 22.749 2.685   1.00 33.22  ? 346 PHE A CB  1 
ATOM   2167 C  CG  . PHE A 1 306 ? -29.647 21.624 3.213   1.00 31.87  ? 346 PHE A CG  1 
ATOM   2168 C  CD1 . PHE A 1 306 ? -30.055 20.298 3.112   1.00 34.26  ? 346 PHE A CD1 1 
ATOM   2169 C  CD2 . PHE A 1 306 ? -28.400 21.894 3.762   1.00 32.45  ? 346 PHE A CD2 1 
ATOM   2170 C  CE1 . PHE A 1 306 ? -29.226 19.261 3.544   1.00 33.51  ? 346 PHE A CE1 1 
ATOM   2171 C  CE2 . PHE A 1 306 ? -27.563 20.871 4.195   1.00 31.92  ? 346 PHE A CE2 1 
ATOM   2172 C  CZ  . PHE A 1 306 ? -27.973 19.555 4.084   1.00 31.62  ? 346 PHE A CZ  1 
ATOM   2173 N  N   . THR A 1 307 ? -32.999 24.546 1.984   1.00 37.38  ? 347 THR A N   1 
ATOM   2174 C  CA  . THR A 1 307 ? -33.906 25.629 2.370   1.00 39.39  ? 347 THR A CA  1 
ATOM   2175 C  C   . THR A 1 307 ? -35.391 25.359 2.049   1.00 39.94  ? 347 THR A C   1 
ATOM   2176 O  O   . THR A 1 307 ? -36.287 25.916 2.678   1.00 38.33  ? 347 THR A O   1 
ATOM   2177 C  CB  . THR A 1 307 ? -33.489 27.000 1.743   1.00 38.02  ? 347 THR A CB  1 
ATOM   2178 O  OG1 . THR A 1 307 ? -33.566 26.926 0.321   1.00 39.35  ? 347 THR A OG1 1 
ATOM   2179 C  CG2 . THR A 1 307 ? -32.086 27.364 2.137   1.00 36.27  ? 347 THR A CG2 1 
ATOM   2180 N  N   . ARG A 1 308 ? -35.664 24.500 1.082   1.00 41.51  ? 348 ARG A N   1 
ATOM   2181 C  CA  . ARG A 1 308 ? -37.056 24.210 0.769   1.00 43.32  ? 348 ARG A CA  1 
ATOM   2182 C  C   . ARG A 1 308 ? -37.551 22.983 1.547   1.00 42.76  ? 348 ARG A C   1 
ATOM   2183 O  O   . ARG A 1 308 ? -38.736 22.688 1.548   1.00 44.19  ? 348 ARG A O   1 
ATOM   2184 C  CB  . ARG A 1 308 ? -37.252 24.028 -0.750  1.00 45.06  ? 348 ARG A CB  1 
ATOM   2185 C  CG  . ARG A 1 308 ? -37.646 25.331 -1.519  1.00 49.51  ? 348 ARG A CG  1 
ATOM   2186 C  CD  . ARG A 1 308 ? -36.631 26.504 -1.389  1.00 53.12  ? 348 ARG A CD  1 
ATOM   2187 N  NE  . ARG A 1 308 ? -37.011 27.686 -2.180  1.00 56.43  ? 348 ARG A NE  1 
ATOM   2188 C  CZ  . ARG A 1 308 ? -36.390 28.870 -2.130  1.00 57.51  ? 348 ARG A CZ  1 
ATOM   2189 N  NH1 . ARG A 1 308 ? -35.349 29.043 -1.324  1.00 58.40  ? 348 ARG A NH1 1 
ATOM   2190 N  NH2 . ARG A 1 308 ? -36.805 29.893 -2.881  1.00 56.35  ? 348 ARG A NH2 1 
ATOM   2191 N  N   . TYR A 1 309 ? -36.643 22.268 2.207   1.00 41.78  ? 349 TYR A N   1 
ATOM   2192 C  CA  . TYR A 1 309 ? -37.020 21.102 3.013   1.00 38.33  ? 349 TYR A CA  1 
ATOM   2193 C  C   . TYR A 1 309 ? -36.266 21.150 4.346   1.00 37.03  ? 349 TYR A C   1 
ATOM   2194 O  O   . TYR A 1 309 ? -35.350 20.363 4.604   1.00 35.85  ? 349 TYR A O   1 
ATOM   2195 C  CB  . TYR A 1 309 ? -36.727 19.804 2.266   1.00 36.60  ? 349 TYR A CB  1 
ATOM   2196 C  CG  . TYR A 1 309 ? -37.504 19.682 0.988   1.00 37.71  ? 349 TYR A CG  1 
ATOM   2197 C  CD1 . TYR A 1 309 ? -36.974 20.145 -0.227  1.00 38.58  ? 349 TYR A CD1 1 
ATOM   2198 C  CD2 . TYR A 1 309 ? -38.784 19.133 0.979   1.00 38.12  ? 349 TYR A CD2 1 
ATOM   2199 C  CE1 . TYR A 1 309 ? -37.699 20.062 -1.418  1.00 38.04  ? 349 TYR A CE1 1 
ATOM   2200 C  CE2 . TYR A 1 309 ? -39.530 19.046 -0.220  1.00 39.67  ? 349 TYR A CE2 1 
ATOM   2201 C  CZ  . TYR A 1 309 ? -38.976 19.514 -1.409  1.00 40.55  ? 349 TYR A CZ  1 
ATOM   2202 O  OH  . TYR A 1 309 ? -39.690 19.418 -2.589  1.00 42.82  ? 349 TYR A OH  1 
ATOM   2203 N  N   . PRO A 1 310 ? -36.649 22.104 5.207   1.00 36.08  ? 350 PRO A N   1 
ATOM   2204 C  CA  . PRO A 1 310 ? -36.062 22.328 6.528   1.00 36.10  ? 350 PRO A CA  1 
ATOM   2205 C  C   . PRO A 1 310 ? -35.970 21.064 7.370   1.00 37.65  ? 350 PRO A C   1 
ATOM   2206 O  O   . PRO A 1 310 ? -35.050 20.896 8.169   1.00 38.31  ? 350 PRO A O   1 
ATOM   2207 C  CB  . PRO A 1 310 ? -36.996 23.361 7.145   1.00 34.35  ? 350 PRO A CB  1 
ATOM   2208 C  CG  . PRO A 1 310 ? -37.438 24.141 5.988   1.00 34.50  ? 350 PRO A CG  1 
ATOM   2209 C  CD  . PRO A 1 310 ? -37.718 23.085 4.947   1.00 35.12  ? 350 PRO A CD  1 
ATOM   2210 N  N   . ASP A 1 311 ? -36.926 20.168 7.198   1.00 39.57  ? 351 ASP A N   1 
ATOM   2211 C  CA  . ASP A 1 311 ? -36.901 18.957 7.992   1.00 41.73  ? 351 ASP A CA  1 
ATOM   2212 C  C   . ASP A 1 311 ? -35.798 18.043 7.535   1.00 40.86  ? 351 ASP A C   1 
ATOM   2213 O  O   . ASP A 1 311 ? -35.092 17.487 8.361   1.00 41.82  ? 351 ASP A O   1 
ATOM   2214 C  CB  . ASP A 1 311 ? -38.238 18.219 7.924   1.00 45.64  ? 351 ASP A CB  1 
ATOM   2215 C  CG  . ASP A 1 311 ? -38.673 17.699 9.279   1.00 47.99  ? 351 ASP A CG  1 
ATOM   2216 O  OD1 . ASP A 1 311 ? -37.899 16.929 9.894   1.00 47.81  ? 351 ASP A OD1 1 
ATOM   2217 O  OD2 . ASP A 1 311 ? -39.787 18.072 9.725   1.00 51.49  ? 351 ASP A OD2 1 
ATOM   2218 N  N   . VAL A 1 312 ? -35.647 17.867 6.227   1.00 39.62  ? 352 VAL A N   1 
ATOM   2219 C  CA  . VAL A 1 312 ? -34.573 17.010 5.777   1.00 39.14  ? 352 VAL A CA  1 
ATOM   2220 C  C   . VAL A 1 312 ? -33.287 17.697 6.248   1.00 39.35  ? 352 VAL A C   1 
ATOM   2221 O  O   . VAL A 1 312 ? -32.405 17.036 6.788   1.00 39.51  ? 352 VAL A O   1 
ATOM   2222 C  CB  . VAL A 1 312 ? -34.591 16.793 4.238   1.00 38.36  ? 352 VAL A CB  1 
ATOM   2223 C  CG1 . VAL A 1 312 ? -36.011 16.880 3.728   1.00 37.25  ? 352 VAL A CG1 1 
ATOM   2224 C  CG2 . VAL A 1 312 ? -33.694 17.760 3.547   1.00 39.27  ? 352 VAL A CG2 1 
ATOM   2225 N  N   . GLN A 1 313 ? -33.202 19.021 6.100   1.00 38.92  ? 353 GLN A N   1 
ATOM   2226 C  CA  . GLN A 1 313 ? -32.015 19.733 6.549   1.00 39.13  ? 353 GLN A CA  1 
ATOM   2227 C  C   . GLN A 1 313 ? -31.672 19.375 8.007   1.00 40.83  ? 353 GLN A C   1 
ATOM   2228 O  O   . GLN A 1 313 ? -30.503 19.117 8.324   1.00 41.57  ? 353 GLN A O   1 
ATOM   2229 C  CB  . GLN A 1 313 ? -32.192 21.258 6.415   1.00 36.09  ? 353 GLN A CB  1 
ATOM   2230 C  CG  . GLN A 1 313 ? -31.021 22.055 7.032   1.00 32.41  ? 353 GLN A CG  1 
ATOM   2231 C  CD  . GLN A 1 313 ? -31.033 23.548 6.679   1.00 33.66  ? 353 GLN A CD  1 
ATOM   2232 O  OE1 . GLN A 1 313 ? -30.099 24.291 7.022   1.00 30.85  ? 353 GLN A OE1 1 
ATOM   2233 N  NE2 . GLN A 1 313 ? -32.092 23.994 5.992   1.00 31.23  ? 353 GLN A NE2 1 
ATOM   2234 N  N   . THR A 1 314 ? -32.683 19.339 8.878   1.00 41.53  ? 354 THR A N   1 
ATOM   2235 C  CA  . THR A 1 314 ? -32.485 19.023 10.303  1.00 43.30  ? 354 THR A CA  1 
ATOM   2236 C  C   . THR A 1 314 ? -32.076 17.571 10.572  1.00 44.28  ? 354 THR A C   1 
ATOM   2237 O  O   . THR A 1 314 ? -31.226 17.292 11.425  1.00 43.15  ? 354 THR A O   1 
ATOM   2238 C  CB  . THR A 1 314 ? -33.764 19.328 11.131  1.00 43.85  ? 354 THR A CB  1 
ATOM   2239 O  OG1 . THR A 1 314 ? -34.088 20.713 10.998  1.00 46.06  ? 354 THR A OG1 1 
ATOM   2240 C  CG2 . THR A 1 314 ? -33.547 19.027 12.615  1.00 41.34  ? 354 THR A CG2 1 
ATOM   2241 N  N   . ARG A 1 315 ? -32.684 16.642 9.850   1.00 45.81  ? 355 ARG A N   1 
ATOM   2242 C  CA  . ARG A 1 315 ? -32.349 15.248 10.037  1.00 47.59  ? 355 ARG A CA  1 
ATOM   2243 C  C   . ARG A 1 315 ? -30.894 15.001 9.691   1.00 49.32  ? 355 ARG A C   1 
ATOM   2244 O  O   . ARG A 1 315 ? -30.145 14.528 10.551  1.00 50.99  ? 355 ARG A O   1 
ATOM   2245 C  CB  . ARG A 1 315 ? -33.286 14.376 9.214   1.00 49.44  ? 355 ARG A CB  1 
ATOM   2246 C  CG  . ARG A 1 315 ? -34.706 14.461 9.763   1.00 52.71  ? 355 ARG A CG  1 
ATOM   2247 C  CD  . ARG A 1 315 ? -35.766 13.830 8.893   1.00 54.88  ? 355 ARG A CD  1 
ATOM   2248 N  NE  . ARG A 1 315 ? -37.077 14.081 9.490   1.00 59.87  ? 355 ARG A NE  1 
ATOM   2249 C  CZ  . ARG A 1 315 ? -38.238 14.063 8.833   1.00 61.92  ? 355 ARG A CZ  1 
ATOM   2250 N  NH1 . ARG A 1 315 ? -38.274 13.800 7.526   1.00 62.81  ? 355 ARG A NH1 1 
ATOM   2251 N  NH2 . ARG A 1 315 ? -39.368 14.323 9.483   1.00 60.39  ? 355 ARG A NH2 1 
ATOM   2252 N  N   . VAL A 1 316 ? -30.473 15.340 8.467   1.00 49.86  ? 356 VAL A N   1 
ATOM   2253 C  CA  . VAL A 1 316 ? -29.069 15.130 8.077   1.00 48.48  ? 356 VAL A CA  1 
ATOM   2254 C  C   . VAL A 1 316 ? -28.161 15.900 9.031   1.00 49.72  ? 356 VAL A C   1 
ATOM   2255 O  O   . VAL A 1 316 ? -27.061 15.449 9.385   1.00 51.12  ? 356 VAL A O   1 
ATOM   2256 C  CB  . VAL A 1 316 ? -28.756 15.591 6.591   1.00 45.73  ? 356 VAL A CB  1 
ATOM   2257 C  CG1 . VAL A 1 316 ? -30.011 15.898 5.854   1.00 43.35  ? 356 VAL A CG1 1 
ATOM   2258 C  CG2 . VAL A 1 316 ? -27.811 16.763 6.570   1.00 42.51  ? 356 VAL A CG2 1 
ATOM   2259 N  N   . GLN A 1 317 ? -28.640 17.065 9.448   1.00 49.36  ? 357 GLN A N   1 
ATOM   2260 C  CA  . GLN A 1 317 ? -27.892 17.921 10.346  1.00 48.93  ? 357 GLN A CA  1 
ATOM   2261 C  C   . GLN A 1 317 ? -27.874 17.294 11.745  1.00 49.46  ? 357 GLN A C   1 
ATOM   2262 O  O   . GLN A 1 317 ? -27.008 17.587 12.569  1.00 48.93  ? 357 GLN A O   1 
ATOM   2263 C  CB  . GLN A 1 317 ? -28.546 19.294 10.346  1.00 46.95  ? 357 GLN A CB  1 
ATOM   2264 C  CG  . GLN A 1 317 ? -27.703 20.413 10.851  1.00 45.05  ? 357 GLN A CG  1 
ATOM   2265 C  CD  . GLN A 1 317 ? -28.407 21.736 10.665  1.00 45.01  ? 357 GLN A CD  1 
ATOM   2266 O  OE1 . GLN A 1 317 ? -29.621 21.826 10.852  1.00 42.61  ? 357 GLN A OE1 1 
ATOM   2267 N  NE2 . GLN A 1 317 ? -27.654 22.773 10.307  1.00 44.72  ? 357 GLN A NE2 1 
ATOM   2268 N  N   . ALA A 1 318 ? -28.831 16.410 11.998  1.00 50.29  ? 358 ALA A N   1 
ATOM   2269 C  CA  . ALA A 1 318 ? -28.913 15.725 13.285  1.00 50.34  ? 358 ALA A CA  1 
ATOM   2270 C  C   . ALA A 1 318 ? -27.987 14.509 13.285  1.00 49.81  ? 358 ALA A C   1 
ATOM   2271 O  O   . ALA A 1 318 ? -27.190 14.319 14.205  1.00 49.71  ? 358 ALA A O   1 
ATOM   2272 C  CB  . ALA A 1 318 ? -30.349 15.284 13.553  1.00 49.19  ? 358 ALA A CB  1 
ATOM   2273 N  N   . GLU A 1 319 ? -28.102 13.689 12.246  1.00 49.34  ? 359 GLU A N   1 
ATOM   2274 C  CA  . GLU A 1 319 ? -27.286 12.494 12.124  1.00 50.06  ? 359 GLU A CA  1 
ATOM   2275 C  C   . GLU A 1 319 ? -25.823 12.852 12.153  1.00 50.45  ? 359 GLU A C   1 
ATOM   2276 O  O   . GLU A 1 319 ? -24.989 12.081 12.619  1.00 51.24  ? 359 GLU A O   1 
ATOM   2277 C  CB  . GLU A 1 319 ? -27.572 11.786 10.816  1.00 50.37  ? 359 GLU A CB  1 
ATOM   2278 C  CG  . GLU A 1 319 ? -26.772 10.532 10.640  1.00 50.65  ? 359 GLU A CG  1 
ATOM   2279 C  CD  . GLU A 1 319 ? -26.634 10.166 9.192   1.00 52.85  ? 359 GLU A CD  1 
ATOM   2280 O  OE1 . GLU A 1 319 ? -26.034 10.965 8.449   1.00 55.53  ? 359 GLU A OE1 1 
ATOM   2281 O  OE2 . GLU A 1 319 ? -27.122 9.094  8.784   1.00 53.67  ? 359 GLU A OE2 1 
ATOM   2282 N  N   . LEU A 1 320 ? -25.514 14.025 11.631  1.00 50.31  ? 360 LEU A N   1 
ATOM   2283 C  CA  . LEU A 1 320 ? -24.144 14.505 11.594  1.00 51.70  ? 360 LEU A CA  1 
ATOM   2284 C  C   . LEU A 1 320 ? -23.648 14.794 13.025  1.00 52.23  ? 360 LEU A C   1 
ATOM   2285 O  O   . LEU A 1 320 ? -22.487 14.555 13.368  1.00 52.49  ? 360 LEU A O   1 
ATOM   2286 C  CB  . LEU A 1 320 ? -24.094 15.777 10.735  1.00 51.92  ? 360 LEU A CB  1 
ATOM   2287 C  CG  . LEU A 1 320 ? -23.019 15.974 9.664   1.00 50.44  ? 360 LEU A CG  1 
ATOM   2288 C  CD1 . LEU A 1 320 ? -22.831 14.690 8.869   1.00 48.60  ? 360 LEU A CD1 1 
ATOM   2289 C  CD2 . LEU A 1 320 ? -23.440 17.145 8.763   1.00 48.26  ? 360 LEU A CD2 1 
ATOM   2290 N  N   . ASP A 1 321 ? -24.545 15.301 13.856  1.00 52.94  ? 361 ASP A N   1 
ATOM   2291 C  CA  . ASP A 1 321 ? -24.212 15.634 15.229  1.00 54.05  ? 361 ASP A CA  1 
ATOM   2292 C  C   . ASP A 1 321 ? -24.058 14.369 16.041  1.00 54.57  ? 361 ASP A C   1 
ATOM   2293 O  O   . ASP A 1 321 ? -23.203 14.290 16.921  1.00 55.13  ? 361 ASP A O   1 
ATOM   2294 C  CB  . ASP A 1 321 ? -25.318 16.483 15.847  1.00 54.77  ? 361 ASP A CB  1 
ATOM   2295 C  CG  . ASP A 1 321 ? -25.528 17.789 15.121  1.00 56.79  ? 361 ASP A CG  1 
ATOM   2296 O  OD1 . ASP A 1 321 ? -25.088 17.928 13.953  1.00 59.81  ? 361 ASP A OD1 1 
ATOM   2297 O  OD2 . ASP A 1 321 ? -26.150 18.681 15.718  1.00 56.97  ? 361 ASP A OD2 1 
ATOM   2298 N  N   . GLN A 1 322 ? -24.899 13.384 15.751  1.00 54.16  ? 362 GLN A N   1 
ATOM   2299 C  CA  . GLN A 1 322 ? -24.864 12.121 16.470  1.00 53.78  ? 362 GLN A CA  1 
ATOM   2300 C  C   . GLN A 1 322 ? -23.648 11.290 16.125  1.00 52.92  ? 362 GLN A C   1 
ATOM   2301 O  O   . GLN A 1 322 ? -23.017 10.722 17.010  1.00 53.56  ? 362 GLN A O   1 
ATOM   2302 C  CB  . GLN A 1 322 ? -26.130 11.321 16.185  1.00 56.49  ? 362 GLN A CB  1 
ATOM   2303 C  CG  . GLN A 1 322 ? -26.081 9.876  16.621  1.00 58.87  ? 362 GLN A CG  1 
ATOM   2304 C  CD  . GLN A 1 322 ? -27.428 9.194  16.462  1.00 61.09  ? 362 GLN A CD  1 
ATOM   2305 O  OE1 . GLN A 1 322 ? -28.110 9.391  15.454  1.00 62.00  ? 362 GLN A OE1 1 
ATOM   2306 N  NE2 . GLN A 1 322 ? -27.815 8.381  17.453  1.00 61.27  ? 362 GLN A NE2 1 
ATOM   2307 N  N   . VAL A 1 323 ? -23.305 11.224 14.843  1.00 51.89  ? 363 VAL A N   1 
ATOM   2308 C  CA  . VAL A 1 323 ? -22.160 10.430 14.424  1.00 50.25  ? 363 VAL A CA  1 
ATOM   2309 C  C   . VAL A 1 323 ? -20.813 11.127 14.536  1.00 51.02  ? 363 VAL A C   1 
ATOM   2310 O  O   . VAL A 1 323 ? -19.923 10.610 15.197  1.00 51.78  ? 363 VAL A O   1 
ATOM   2311 C  CB  . VAL A 1 323 ? -22.353 9.900  12.996  1.00 49.14  ? 363 VAL A CB  1 
ATOM   2312 C  CG1 . VAL A 1 323 ? -21.164 9.062  12.578  1.00 47.11  ? 363 VAL A CG1 1 
ATOM   2313 C  CG2 . VAL A 1 323 ? -23.637 9.074  12.933  1.00 46.68  ? 363 VAL A CG2 1 
ATOM   2314 N  N   . VAL A 1 324 ? -20.637 12.296 13.926  1.00 52.62  ? 364 VAL A N   1 
ATOM   2315 C  CA  . VAL A 1 324 ? -19.326 12.945 14.023  1.00 53.34  ? 364 VAL A CA  1 
ATOM   2316 C  C   . VAL A 1 324 ? -19.177 13.769 15.303  1.00 53.72  ? 364 VAL A C   1 
ATOM   2317 O  O   . VAL A 1 324 ? -18.072 14.116 15.715  1.00 55.03  ? 364 VAL A O   1 
ATOM   2318 C  CB  . VAL A 1 324 ? -19.007 13.825 12.757  1.00 53.33  ? 364 VAL A CB  1 
ATOM   2319 C  CG1 . VAL A 1 324 ? -19.879 13.375 11.586  1.00 52.72  ? 364 VAL A CG1 1 
ATOM   2320 C  CG2 . VAL A 1 324 ? -19.165 15.327 13.057  1.00 53.77  ? 364 VAL A CG2 1 
ATOM   2321 N  N   . GLY A 1 325 ? -20.291 14.063 15.950  1.00 53.60  ? 365 GLY A N   1 
ATOM   2322 C  CA  . GLY A 1 325 ? -20.212 14.842 17.164  1.00 53.55  ? 365 GLY A CA  1 
ATOM   2323 C  C   . GLY A 1 325 ? -19.913 16.294 16.877  1.00 53.79  ? 365 GLY A C   1 
ATOM   2324 O  O   . GLY A 1 325 ? -19.319 16.634 15.875  1.00 53.61  ? 365 GLY A O   1 
ATOM   2325 N  N   . ARG A 1 326 ? -20.356 17.153 17.773  1.00 56.07  ? 366 ARG A N   1 
ATOM   2326 C  CA  . ARG A 1 326 ? -20.148 18.583 17.671  1.00 57.30  ? 366 ARG A CA  1 
ATOM   2327 C  C   . ARG A 1 326 ? -18.679 18.868 17.978  1.00 57.40  ? 366 ARG A C   1 
ATOM   2328 O  O   . ARG A 1 326 ? -18.220 20.005 17.891  1.00 56.69  ? 366 ARG A O   1 
ATOM   2329 C  CB  . ARG A 1 326 ? -21.037 19.263 18.712  1.00 59.52  ? 366 ARG A CB  1 
ATOM   2330 C  CG  . ARG A 1 326 ? -20.998 20.768 18.719  1.00 63.59  ? 366 ARG A CG  1 
ATOM   2331 C  CD  . ARG A 1 326 ? -21.521 21.295 17.400  1.00 66.62  ? 366 ARG A CD  1 
ATOM   2332 N  NE  . ARG A 1 326 ? -22.282 20.266 16.701  1.00 66.44  ? 366 ARG A NE  1 
ATOM   2333 C  CZ  . ARG A 1 326 ? -22.850 20.445 15.519  1.00 66.59  ? 366 ARG A CZ  1 
ATOM   2334 N  NH1 . ARG A 1 326 ? -22.745 21.619 14.906  1.00 66.45  ? 366 ARG A NH1 1 
ATOM   2335 N  NH2 . ARG A 1 326 ? -23.504 19.446 14.948  1.00 65.85  ? 366 ARG A NH2 1 
ATOM   2336 N  N   . ASP A 1 327 ? -17.950 17.809 18.320  1.00 58.08  ? 367 ASP A N   1 
ATOM   2337 C  CA  . ASP A 1 327 ? -16.542 17.900 18.714  1.00 59.42  ? 367 ASP A CA  1 
ATOM   2338 C  C   . ASP A 1 327 ? -15.480 18.186 17.646  1.00 59.30  ? 367 ASP A C   1 
ATOM   2339 O  O   . ASP A 1 327 ? -14.398 18.699 17.958  1.00 58.45  ? 367 ASP A O   1 
ATOM   2340 C  CB  . ASP A 1 327 ? -16.166 16.619 19.471  1.00 61.44  ? 367 ASP A CB  1 
ATOM   2341 C  CG  . ASP A 1 327 ? -16.390 16.734 20.975  1.00 62.52  ? 367 ASP A CG  1 
ATOM   2342 O  OD1 . ASP A 1 327 ? -17.487 17.161 21.405  1.00 64.04  ? 367 ASP A OD1 1 
ATOM   2343 O  OD2 . ASP A 1 327 ? -15.463 16.388 21.734  1.00 62.34  ? 367 ASP A OD2 1 
ATOM   2344 N  N   . ARG A 1 328 ? -15.782 17.834 16.401  1.00 58.93  ? 368 ARG A N   1 
ATOM   2345 C  CA  . ARG A 1 328 ? -14.868 18.041 15.274  1.00 57.54  ? 368 ARG A CA  1 
ATOM   2346 C  C   . ARG A 1 328 ? -15.748 18.199 14.036  1.00 57.41  ? 368 ARG A C   1 
ATOM   2347 O  O   . ARG A 1 328 ? -16.971 18.148 14.139  1.00 56.35  ? 368 ARG A O   1 
ATOM   2348 C  CB  . ARG A 1 328 ? -13.958 16.816 15.107  1.00 55.31  ? 368 ARG A CB  1 
ATOM   2349 C  CG  . ARG A 1 328 ? -14.733 15.554 14.764  1.00 54.26  ? 368 ARG A CG  1 
ATOM   2350 C  CD  . ARG A 1 328 ? -13.914 14.308 14.954  1.00 53.44  ? 368 ARG A CD  1 
ATOM   2351 N  NE  . ARG A 1 328 ? -14.644 13.091 14.598  1.00 52.60  ? 368 ARG A NE  1 
ATOM   2352 C  CZ  . ARG A 1 328 ? -15.047 12.784 13.366  1.00 53.16  ? 368 ARG A CZ  1 
ATOM   2353 N  NH1 . ARG A 1 328 ? -14.800 13.612 12.356  1.00 54.23  ? 368 ARG A NH1 1 
ATOM   2354 N  NH2 . ARG A 1 328 ? -15.684 11.639 13.134  1.00 51.05  ? 368 ARG A NH2 1 
ATOM   2355 N  N   . LEU A 1 329 ? -15.136 18.394 12.873  1.00 58.46  ? 369 LEU A N   1 
ATOM   2356 C  CA  . LEU A 1 329 ? -15.914 18.517 11.641  1.00 59.55  ? 369 LEU A CA  1 
ATOM   2357 C  C   . LEU A 1 329 ? -15.764 17.230 10.809  1.00 60.36  ? 369 LEU A C   1 
ATOM   2358 O  O   . LEU A 1 329 ? -14.700 16.604 10.799  1.00 60.05  ? 369 LEU A O   1 
ATOM   2359 C  CB  . LEU A 1 329 ? -15.494 19.769 10.846  1.00 57.33  ? 369 LEU A CB  1 
ATOM   2360 C  CG  . LEU A 1 329 ? -14.080 19.911 10.300  1.00 56.73  ? 369 LEU A CG  1 
ATOM   2361 C  CD1 . LEU A 1 329 ? -13.868 21.358 9.901   1.00 56.83  ? 369 LEU A CD1 1 
ATOM   2362 C  CD2 . LEU A 1 329 ? -13.061 19.512 11.344  1.00 57.17  ? 369 LEU A CD2 1 
ATOM   2363 N  N   . PRO A 1 330 ? -16.851 16.806 10.133  1.00 61.06  ? 370 PRO A N   1 
ATOM   2364 C  CA  . PRO A 1 330 ? -16.919 15.608 9.294   1.00 61.54  ? 370 PRO A CA  1 
ATOM   2365 C  C   . PRO A 1 330 ? -15.769 15.408 8.327   1.00 61.83  ? 370 PRO A C   1 
ATOM   2366 O  O   . PRO A 1 330 ? -15.182 16.359 7.813   1.00 61.88  ? 370 PRO A O   1 
ATOM   2367 C  CB  . PRO A 1 330 ? -18.249 15.775 8.569   1.00 62.00  ? 370 PRO A CB  1 
ATOM   2368 C  CG  . PRO A 1 330 ? -19.091 16.442 9.606   1.00 61.57  ? 370 PRO A CG  1 
ATOM   2369 C  CD  . PRO A 1 330 ? -18.155 17.495 10.139  1.00 61.71  ? 370 PRO A CD  1 
ATOM   2370 N  N   . CYS A 1 331 ? -15.454 14.145 8.093   1.00 62.13  ? 371 CYS A N   1 
ATOM   2371 C  CA  . CYS A 1 331 ? -14.396 13.785 7.171   1.00 61.91  ? 371 CYS A CA  1 
ATOM   2372 C  C   . CYS A 1 331 ? -14.865 12.519 6.444   1.00 60.70  ? 371 CYS A C   1 
ATOM   2373 O  O   . CYS A 1 331 ? -15.793 11.832 6.894   1.00 59.76  ? 371 CYS A O   1 
ATOM   2374 C  CB  . CYS A 1 331 ? -13.098 13.521 7.929   1.00 63.57  ? 371 CYS A CB  1 
ATOM   2375 S  SG  . CYS A 1 331 ? -13.013 11.887 8.663   1.00 67.04  ? 371 CYS A SG  1 
ATOM   2376 N  N   . MET A 1 332 ? -14.232 12.213 5.318   1.00 58.96  ? 372 MET A N   1 
ATOM   2377 C  CA  . MET A 1 332 ? -14.622 11.048 4.541   1.00 57.47  ? 372 MET A CA  1 
ATOM   2378 C  C   . MET A 1 332 ? -14.637 9.735  5.311   1.00 57.30  ? 372 MET A C   1 
ATOM   2379 O  O   . MET A 1 332 ? -15.227 8.759  4.859   1.00 58.34  ? 372 MET A O   1 
ATOM   2380 C  CB  . MET A 1 332 ? -13.740 10.939 3.301   1.00 56.75  ? 372 MET A CB  1 
ATOM   2381 C  CG  . MET A 1 332 ? -14.068 11.996 2.245   1.00 55.52  ? 372 MET A CG  1 
ATOM   2382 S  SD  . MET A 1 332 ? -15.520 11.613 1.204   1.00 55.88  ? 372 MET A SD  1 
ATOM   2383 C  CE  . MET A 1 332 ? -16.723 11.099 2.366   1.00 53.65  ? 372 MET A CE  1 
ATOM   2384 N  N   . GLY A 1 333 ? -14.002 9.706  6.474   1.00 57.05  ? 373 GLY A N   1 
ATOM   2385 C  CA  . GLY A 1 333 ? -14.005 8.489  7.256   1.00 55.86  ? 373 GLY A CA  1 
ATOM   2386 C  C   . GLY A 1 333 ? -15.410 8.197  7.757   1.00 55.81  ? 373 GLY A C   1 
ATOM   2387 O  O   . GLY A 1 333 ? -15.807 7.034  7.871   1.00 55.39  ? 373 GLY A O   1 
ATOM   2388 N  N   . ASP A 1 334 ? -16.173 9.257  8.025   1.00 54.92  ? 374 ASP A N   1 
ATOM   2389 C  CA  . ASP A 1 334 ? -17.533 9.132  8.551   1.00 54.72  ? 374 ASP A CA  1 
ATOM   2390 C  C   . ASP A 1 334 ? -18.614 8.700  7.554   1.00 55.04  ? 374 ASP A C   1 
ATOM   2391 O  O   . ASP A 1 334 ? -19.718 8.339  7.957   1.00 54.30  ? 374 ASP A O   1 
ATOM   2392 C  CB  . ASP A 1 334 ? -17.965 10.457 9.179   1.00 54.24  ? 374 ASP A CB  1 
ATOM   2393 C  CG  . ASP A 1 334 ? -16.881 11.084 10.033  1.00 55.21  ? 374 ASP A CG  1 
ATOM   2394 O  OD1 . ASP A 1 334 ? -16.483 10.466 11.046  1.00 54.38  ? 374 ASP A OD1 1 
ATOM   2395 O  OD2 . ASP A 1 334 ? -16.435 12.206 9.690   1.00 55.46  ? 374 ASP A OD2 1 
ATOM   2396 N  N   . GLN A 1 335 ? -18.299 8.725  6.263   1.00 55.14  ? 375 GLN A N   1 
ATOM   2397 C  CA  . GLN A 1 335 ? -19.277 8.376  5.237   1.00 55.34  ? 375 GLN A CA  1 
ATOM   2398 C  C   . GLN A 1 335 ? -20.121 7.110  5.451   1.00 54.99  ? 375 GLN A C   1 
ATOM   2399 O  O   . GLN A 1 335 ? -21.325 7.129  5.210   1.00 53.91  ? 375 GLN A O   1 
ATOM   2400 C  CB  . GLN A 1 335 ? -18.598 8.328  3.871   1.00 56.54  ? 375 GLN A CB  1 
ATOM   2401 C  CG  . GLN A 1 335 ? -19.551 7.991  2.740   1.00 60.08  ? 375 GLN A CG  1 
ATOM   2402 C  CD  . GLN A 1 335 ? -18.895 8.087  1.376   1.00 62.38  ? 375 GLN A CD  1 
ATOM   2403 O  OE1 . GLN A 1 335 ? -18.572 9.183  0.908   1.00 65.09  ? 375 GLN A OE1 1 
ATOM   2404 N  NE2 . GLN A 1 335 ? -18.683 6.937  0.731   1.00 62.18  ? 375 GLN A NE2 1 
ATOM   2405 N  N   . PRO A 1 336 ? -19.508 5.985  5.866   1.00 55.41  ? 376 PRO A N   1 
ATOM   2406 C  CA  . PRO A 1 336 ? -20.347 4.792  6.067   1.00 55.38  ? 376 PRO A CA  1 
ATOM   2407 C  C   . PRO A 1 336 ? -21.282 4.838  7.292   1.00 56.34  ? 376 PRO A C   1 
ATOM   2408 O  O   . PRO A 1 336 ? -22.236 4.061  7.382   1.00 55.29  ? 376 PRO A O   1 
ATOM   2409 C  CB  . PRO A 1 336 ? -19.326 3.652  6.134   1.00 54.38  ? 376 PRO A CB  1 
ATOM   2410 C  CG  . PRO A 1 336 ? -18.064 4.325  6.562   1.00 54.07  ? 376 PRO A CG  1 
ATOM   2411 C  CD  . PRO A 1 336 ? -18.085 5.613  5.793   1.00 54.44  ? 376 PRO A CD  1 
ATOM   2412 N  N   . ASN A 1 337 ? -21.007 5.747  8.230   1.00 57.16  ? 377 ASN A N   1 
ATOM   2413 C  CA  . ASN A 1 337 ? -21.846 5.902  9.428   1.00 57.15  ? 377 ASN A CA  1 
ATOM   2414 C  C   . ASN A 1 337 ? -22.801 7.080  9.210   1.00 56.25  ? 377 ASN A C   1 
ATOM   2415 O  O   . ASN A 1 337 ? -23.279 7.673  10.181  1.00 57.50  ? 377 ASN A O   1 
ATOM   2416 C  CB  . ASN A 1 337 ? -21.014 6.225  10.691  1.00 58.95  ? 377 ASN A CB  1 
ATOM   2417 C  CG  . ASN A 1 337 ? -19.939 5.178  11.005  1.00 61.63  ? 377 ASN A CG  1 
ATOM   2418 O  OD1 . ASN A 1 337 ? -20.188 3.964  10.962  1.00 61.73  ? 377 ASN A OD1 1 
ATOM   2419 N  ND2 . ASN A 1 337 ? -18.739 5.654  11.356  1.00 61.83  ? 377 ASN A ND2 1 
ATOM   2420 N  N   . LEU A 1 338 ? -23.057 7.438  7.951   1.00 52.98  ? 378 LEU A N   1 
ATOM   2421 C  CA  . LEU A 1 338 ? -23.940 8.564  7.646   1.00 49.71  ? 378 LEU A CA  1 
ATOM   2422 C  C   . LEU A 1 338 ? -24.972 8.218  6.569   1.00 48.76  ? 378 LEU A C   1 
ATOM   2423 O  O   . LEU A 1 338 ? -25.094 8.903  5.558   1.00 47.69  ? 378 LEU A O   1 
ATOM   2424 C  CB  . LEU A 1 338 ? -23.101 9.764  7.210   1.00 48.15  ? 378 LEU A CB  1 
ATOM   2425 C  CG  . LEU A 1 338 ? -22.135 10.278 8.281   1.00 47.49  ? 378 LEU A CG  1 
ATOM   2426 C  CD1 . LEU A 1 338 ? -21.273 11.445 7.763   1.00 46.11  ? 378 LEU A CD1 1 
ATOM   2427 C  CD2 . LEU A 1 338 ? -22.961 10.720 9.473   1.00 47.02  ? 378 LEU A CD2 1 
ATOM   2428 N  N   . PRO A 1 339 ? -25.736 7.139  6.787   1.00 48.45  ? 379 PRO A N   1 
ATOM   2429 C  CA  . PRO A 1 339 ? -26.768 6.658  5.873   1.00 47.90  ? 379 PRO A CA  1 
ATOM   2430 C  C   . PRO A 1 339 ? -27.740 7.729  5.382   1.00 46.94  ? 379 PRO A C   1 
ATOM   2431 O  O   . PRO A 1 339 ? -28.120 7.727  4.220   1.00 46.18  ? 379 PRO A O   1 
ATOM   2432 C  CB  . PRO A 1 339 ? -27.471 5.586  6.698   1.00 48.51  ? 379 PRO A CB  1 
ATOM   2433 C  CG  . PRO A 1 339 ? -26.385 5.046  7.528   1.00 47.49  ? 379 PRO A CG  1 
ATOM   2434 C  CD  . PRO A 1 339 ? -25.691 6.288  7.990   1.00 48.28  ? 379 PRO A CD  1 
ATOM   2435 N  N   . TYR A 1 340 ? -28.151 8.637  6.263   1.00 47.09  ? 380 TYR A N   1 
ATOM   2436 C  CA  . TYR A 1 340 ? -29.095 9.689  5.867   1.00 46.97  ? 380 TYR A CA  1 
ATOM   2437 C  C   . TYR A 1 340 ? -28.474 10.734 4.947   1.00 45.97  ? 380 TYR A C   1 
ATOM   2438 O  O   . TYR A 1 340 ? -29.113 11.196 3.998   1.00 45.99  ? 380 TYR A O   1 
ATOM   2439 C  CB  . TYR A 1 340 ? -29.677 10.396 7.083   1.00 47.16  ? 380 TYR A CB  1 
ATOM   2440 C  CG  . TYR A 1 340 ? -30.904 11.188 6.737   1.00 46.79  ? 380 TYR A CG  1 
ATOM   2441 C  CD1 . TYR A 1 340 ? -32.078 10.535 6.372   1.00 46.43  ? 380 TYR A CD1 1 
ATOM   2442 C  CD2 . TYR A 1 340 ? -30.884 12.588 6.721   1.00 45.60  ? 380 TYR A CD2 1 
ATOM   2443 C  CE1 . TYR A 1 340 ? -33.212 11.250 5.989   1.00 47.11  ? 380 TYR A CE1 1 
ATOM   2444 C  CE2 . TYR A 1 340 ? -32.012 13.315 6.343   1.00 46.51  ? 380 TYR A CE2 1 
ATOM   2445 C  CZ  . TYR A 1 340 ? -33.177 12.635 5.975   1.00 47.26  ? 380 TYR A CZ  1 
ATOM   2446 O  OH  . TYR A 1 340 ? -34.309 13.322 5.575   1.00 48.26  ? 380 TYR A OH  1 
ATOM   2447 N  N   . VAL A 1 341 ? -27.241 11.123 5.252   1.00 44.83  ? 381 VAL A N   1 
ATOM   2448 C  CA  . VAL A 1 341 ? -26.514 12.074 4.428   1.00 43.49  ? 381 VAL A CA  1 
ATOM   2449 C  C   . VAL A 1 341 ? -26.363 11.480 3.025   1.00 44.51  ? 381 VAL A C   1 
ATOM   2450 O  O   . VAL A 1 341 ? -26.607 12.158 2.022   1.00 45.14  ? 381 VAL A O   1 
ATOM   2451 C  CB  . VAL A 1 341 ? -25.126 12.324 4.972   1.00 41.30  ? 381 VAL A CB  1 
ATOM   2452 C  CG1 . VAL A 1 341 ? -24.428 13.341 4.111   1.00 40.93  ? 381 VAL A CG1 1 
ATOM   2453 C  CG2 . VAL A 1 341 ? -25.217 12.786 6.405   1.00 40.04  ? 381 VAL A CG2 1 
ATOM   2454 N  N   . LEU A 1 342 ? -25.946 10.220 2.946   1.00 43.20  ? 382 LEU A N   1 
ATOM   2455 C  CA  . LEU A 1 342 ? -25.819 9.595  1.645   1.00 43.61  ? 382 LEU A CA  1 
ATOM   2456 C  C   . LEU A 1 342 ? -27.186 9.511  0.983   1.00 43.72  ? 382 LEU A C   1 
ATOM   2457 O  O   . LEU A 1 342 ? -27.299 9.667  -0.226  1.00 44.88  ? 382 LEU A O   1 
ATOM   2458 C  CB  . LEU A 1 342 ? -25.229 8.198  1.766   1.00 45.32  ? 382 LEU A CB  1 
ATOM   2459 C  CG  . LEU A 1 342 ? -23.720 8.143  1.980   1.00 46.63  ? 382 LEU A CG  1 
ATOM   2460 C  CD1 . LEU A 1 342 ? -23.283 6.678  2.134   1.00 47.40  ? 382 LEU A CD1 1 
ATOM   2461 C  CD2 . LEU A 1 342 ? -23.014 8.813  0.811   1.00 44.21  ? 382 LEU A CD2 1 
ATOM   2462 N  N   . ALA A 1 343 ? -28.225 9.264  1.772   1.00 43.25  ? 383 ALA A N   1 
ATOM   2463 C  CA  . ALA A 1 343 ? -29.581 9.169  1.238   1.00 42.31  ? 383 ALA A CA  1 
ATOM   2464 C  C   . ALA A 1 343 ? -30.053 10.509 0.681   1.00 41.49  ? 383 ALA A C   1 
ATOM   2465 O  O   . ALA A 1 343 ? -30.672 10.558 -0.384  1.00 40.52  ? 383 ALA A O   1 
ATOM   2466 C  CB  . ALA A 1 343 ? -30.541 8.685  2.323   1.00 43.31  ? 383 ALA A CB  1 
ATOM   2467 N  N   . PHE A 1 344 ? -29.777 11.589 1.409   1.00 41.08  ? 384 PHE A N   1 
ATOM   2468 C  CA  . PHE A 1 344 ? -30.157 12.926 0.959   1.00 42.05  ? 384 PHE A CA  1 
ATOM   2469 C  C   . PHE A 1 344 ? -29.421 13.186 -0.346  1.00 42.28  ? 384 PHE A C   1 
ATOM   2470 O  O   . PHE A 1 344 ? -29.938 13.803 -1.272  1.00 42.12  ? 384 PHE A O   1 
ATOM   2471 C  CB  . PHE A 1 344 ? -29.741 13.969 1.984   1.00 41.72  ? 384 PHE A CB  1 
ATOM   2472 C  CG  . PHE A 1 344 ? -29.774 15.368 1.465   1.00 42.76  ? 384 PHE A CG  1 
ATOM   2473 C  CD1 . PHE A 1 344 ? -30.943 16.111 1.496   1.00 44.59  ? 384 PHE A CD1 1 
ATOM   2474 C  CD2 . PHE A 1 344 ? -28.627 15.960 0.952   1.00 43.03  ? 384 PHE A CD2 1 
ATOM   2475 C  CE1 . PHE A 1 344 ? -30.972 17.449 1.018   1.00 44.23  ? 384 PHE A CE1 1 
ATOM   2476 C  CE2 . PHE A 1 344 ? -28.646 17.284 0.474   1.00 43.62  ? 384 PHE A CE2 1 
ATOM   2477 C  CZ  . PHE A 1 344 ? -29.822 18.027 0.510   1.00 43.57  ? 384 PHE A CZ  1 
ATOM   2478 N  N   . LEU A 1 345 ? -28.199 12.685 -0.400  1.00 43.04  ? 385 LEU A N   1 
ATOM   2479 C  CA  . LEU A 1 345 ? -27.345 12.828 -1.557  1.00 43.21  ? 385 LEU A CA  1 
ATOM   2480 C  C   . LEU A 1 345 ? -27.987 12.233 -2.807  1.00 44.03  ? 385 LEU A C   1 
ATOM   2481 O  O   . LEU A 1 345 ? -28.121 12.919 -3.817  1.00 45.77  ? 385 LEU A O   1 
ATOM   2482 C  CB  . LEU A 1 345 ? -26.009 12.149 -1.264  1.00 43.36  ? 385 LEU A CB  1 
ATOM   2483 C  CG  . LEU A 1 345 ? -24.751 12.806 -1.815  1.00 44.56  ? 385 LEU A CG  1 
ATOM   2484 C  CD1 . LEU A 1 345 ? -24.677 12.572 -3.328  1.00 43.84  ? 385 LEU A CD1 1 
ATOM   2485 C  CD2 . LEU A 1 345 ? -24.767 14.310 -1.447  1.00 43.85  ? 385 LEU A CD2 1 
ATOM   2486 N  N   . TYR A 1 346 ? -28.402 10.970 -2.746  1.00 44.51  ? 386 TYR A N   1 
ATOM   2487 C  CA  . TYR A 1 346 ? -29.012 10.314 -3.908  1.00 44.17  ? 386 TYR A CA  1 
ATOM   2488 C  C   . TYR A 1 346 ? -30.444 10.749 -4.177  1.00 43.13  ? 386 TYR A C   1 
ATOM   2489 O  O   . TYR A 1 346 ? -30.941 10.627 -5.302  1.00 42.32  ? 386 TYR A O   1 
ATOM   2490 C  CB  . TYR A 1 346 ? -28.952 8.789  -3.753  1.00 45.52  ? 386 TYR A CB  1 
ATOM   2491 C  CG  . TYR A 1 346 ? -27.540 8.255  -3.801  1.00 46.30  ? 386 TYR A CG  1 
ATOM   2492 C  CD1 . TYR A 1 346 ? -26.980 7.812  -4.995  1.00 47.25  ? 386 TYR A CD1 1 
ATOM   2493 C  CD2 . TYR A 1 346 ? -26.730 8.291  -2.669  1.00 47.85  ? 386 TYR A CD2 1 
ATOM   2494 C  CE1 . TYR A 1 346 ? -25.638 7.426  -5.065  1.00 48.34  ? 386 TYR A CE1 1 
ATOM   2495 C  CE2 . TYR A 1 346 ? -25.400 7.919  -2.721  1.00 49.26  ? 386 TYR A CE2 1 
ATOM   2496 C  CZ  . TYR A 1 346 ? -24.855 7.494  -3.924  1.00 50.04  ? 386 TYR A CZ  1 
ATOM   2497 O  OH  . TYR A 1 346 ? -23.509 7.201  -3.978  1.00 52.76  ? 386 TYR A OH  1 
ATOM   2498 N  N   . GLU A 1 347 ? -31.114 11.260 -3.152  1.00 42.89  ? 387 GLU A N   1 
ATOM   2499 C  CA  . GLU A 1 347 ? -32.486 11.710 -3.336  1.00 41.80  ? 387 GLU A CA  1 
ATOM   2500 C  C   . GLU A 1 347 ? -32.432 13.003 -4.121  1.00 41.81  ? 387 GLU A C   1 
ATOM   2501 O  O   . GLU A 1 347 ? -33.205 13.175 -5.060  1.00 42.65  ? 387 GLU A O   1 
ATOM   2502 C  CB  . GLU A 1 347 ? -33.186 11.919 -1.987  1.00 41.35  ? 387 GLU A CB  1 
ATOM   2503 C  CG  . GLU A 1 347 ? -34.647 12.373 -2.065  1.00 42.00  ? 387 GLU A CG  1 
ATOM   2504 C  CD  . GLU A 1 347 ? -35.502 11.504 -2.982  1.00 45.38  ? 387 GLU A CD  1 
ATOM   2505 O  OE1 . GLU A 1 347 ? -35.007 10.423 -3.399  1.00 46.59  ? 387 GLU A OE1 1 
ATOM   2506 O  OE2 . GLU A 1 347 ? -36.665 11.893 -3.282  1.00 42.27  ? 387 GLU A OE2 1 
ATOM   2507 N  N   . ALA A 1 348 ? -31.521 13.907 -3.747  1.00 41.21  ? 388 ALA A N   1 
ATOM   2508 C  CA  . ALA A 1 348 ? -31.372 15.188 -4.450  1.00 40.52  ? 388 ALA A CA  1 
ATOM   2509 C  C   . ALA A 1 348 ? -30.964 14.894 -5.883  1.00 40.91  ? 388 ALA A C   1 
ATOM   2510 O  O   . ALA A 1 348 ? -31.316 15.614 -6.810  1.00 41.25  ? 388 ALA A O   1 
ATOM   2511 C  CB  . ALA A 1 348 ? -30.317 16.040 -3.784  1.00 40.37  ? 388 ALA A CB  1 
ATOM   2512 N  N   . MET A 1 349 ? -30.227 13.801 -6.053  1.00 42.09  ? 389 MET A N   1 
ATOM   2513 C  CA  . MET A 1 349 ? -29.766 13.375 -7.367  1.00 42.30  ? 389 MET A CA  1 
ATOM   2514 C  C   . MET A 1 349 ? -30.920 12.888 -8.239  1.00 41.94  ? 389 MET A C   1 
ATOM   2515 O  O   . MET A 1 349 ? -31.052 13.303 -9.391  1.00 42.76  ? 389 MET A O   1 
ATOM   2516 C  CB  . MET A 1 349 ? -28.709 12.277 -7.234  1.00 44.47  ? 389 MET A CB  1 
ATOM   2517 C  CG  . MET A 1 349 ? -27.535 12.425 -8.188  1.00 48.98  ? 389 MET A CG  1 
ATOM   2518 S  SD  . MET A 1 349 ? -25.982 12.757 -7.336  1.00 54.80  ? 389 MET A SD  1 
ATOM   2519 C  CE  . MET A 1 349 ? -25.549 11.114 -6.770  1.00 49.48  ? 389 MET A CE  1 
ATOM   2520 N  N   . ARG A 1 350 ? -31.753 12.006 -7.693  1.00 42.18  ? 390 ARG A N   1 
ATOM   2521 C  CA  . ARG A 1 350 ? -32.882 11.476 -8.450  1.00 41.48  ? 390 ARG A CA  1 
ATOM   2522 C  C   . ARG A 1 350 ? -33.941 12.543 -8.650  1.00 40.87  ? 390 ARG A C   1 
ATOM   2523 O  O   . ARG A 1 350 ? -34.402 12.778 -9.769  1.00 42.05  ? 390 ARG A O   1 
ATOM   2524 C  CB  . ARG A 1 350 ? -33.499 10.266 -7.738  1.00 39.51  ? 390 ARG A CB  1 
ATOM   2525 C  CG  . ARG A 1 350 ? -34.743 9.720  -8.436  1.00 38.79  ? 390 ARG A CG  1 
ATOM   2526 C  CD  . ARG A 1 350 ? -35.689 9.034  -7.450  1.00 37.81  ? 390 ARG A CD  1 
ATOM   2527 N  NE  . ARG A 1 350 ? -36.234 9.961  -6.462  1.00 36.28  ? 390 ARG A NE  1 
ATOM   2528 C  CZ  . ARG A 1 350 ? -37.253 10.784 -6.683  1.00 36.71  ? 390 ARG A CZ  1 
ATOM   2529 N  NH1 . ARG A 1 350 ? -37.850 10.790 -7.869  1.00 35.38  ? 390 ARG A NH1 1 
ATOM   2530 N  NH2 . ARG A 1 350 ? -37.665 11.609 -5.724  1.00 35.89  ? 390 ARG A NH2 1 
ATOM   2531 N  N   . PHE A 1 351 ? -34.317 13.187 -7.554  1.00 39.93  ? 391 PHE A N   1 
ATOM   2532 C  CA  . PHE A 1 351 ? -35.340 14.220 -7.576  1.00 39.97  ? 391 PHE A CA  1 
ATOM   2533 C  C   . PHE A 1 351 ? -35.025 15.413 -8.480  1.00 39.69  ? 391 PHE A C   1 
ATOM   2534 O  O   . PHE A 1 351 ? -35.877 15.868 -9.240  1.00 39.94  ? 391 PHE A O   1 
ATOM   2535 C  CB  . PHE A 1 351 ? -35.597 14.717 -6.154  1.00 39.90  ? 391 PHE A CB  1 
ATOM   2536 C  CG  . PHE A 1 351 ? -36.596 15.835 -6.078  1.00 39.97  ? 391 PHE A CG  1 
ATOM   2537 C  CD1 . PHE A 1 351 ? -37.943 15.601 -6.332  1.00 39.88  ? 391 PHE A CD1 1 
ATOM   2538 C  CD2 . PHE A 1 351 ? -36.191 17.130 -5.768  1.00 40.17  ? 391 PHE A CD2 1 
ATOM   2539 C  CE1 . PHE A 1 351 ? -38.880 16.641 -6.278  1.00 39.07  ? 391 PHE A CE1 1 
ATOM   2540 C  CE2 . PHE A 1 351 ? -37.118 18.171 -5.715  1.00 41.08  ? 391 PHE A CE2 1 
ATOM   2541 C  CZ  . PHE A 1 351 ? -38.470 17.920 -5.971  1.00 39.19  ? 391 PHE A CZ  1 
ATOM   2542 N  N   . SER A 1 352 ? -33.802 15.923 -8.386  1.00 40.04  ? 392 SER A N   1 
ATOM   2543 C  CA  . SER A 1 352 ? -33.387 17.073 -9.170  1.00 38.56  ? 392 SER A CA  1 
ATOM   2544 C  C   . SER A 1 352 ? -33.033 16.722 -10.607 1.00 38.69  ? 392 SER A C   1 
ATOM   2545 O  O   . SER A 1 352 ? -33.362 17.482 -11.525 1.00 38.24  ? 392 SER A O   1 
ATOM   2546 C  CB  . SER A 1 352 ? -32.199 17.744 -8.489  1.00 38.48  ? 392 SER A CB  1 
ATOM   2547 O  OG  . SER A 1 352 ? -31.356 18.383 -9.430  1.00 42.98  ? 392 SER A OG  1 
ATOM   2548 N  N   . SER A 1 353 ? -32.378 15.575 -10.806 1.00 38.06  ? 393 SER A N   1 
ATOM   2549 C  CA  . SER A 1 353 ? -31.963 15.152 -12.144 1.00 37.55  ? 393 SER A CA  1 
ATOM   2550 C  C   . SER A 1 353 ? -31.370 16.360 -12.873 1.00 36.87  ? 393 SER A C   1 
ATOM   2551 O  O   . SER A 1 353 ? -31.665 16.572 -14.057 1.00 34.96  ? 393 SER A O   1 
ATOM   2552 C  CB  . SER A 1 353 ? -33.163 14.612 -12.947 1.00 38.02  ? 393 SER A CB  1 
ATOM   2553 O  OG  . SER A 1 353 ? -33.540 13.301 -12.542 1.00 38.67  ? 393 SER A OG  1 
ATOM   2554 N  N   . PHE A 1 354 ? -30.537 17.138 -12.165 1.00 37.03  ? 394 PHE A N   1 
ATOM   2555 C  CA  . PHE A 1 354 ? -29.943 18.352 -12.722 1.00 35.99  ? 394 PHE A CA  1 
ATOM   2556 C  C   . PHE A 1 354 ? -29.233 18.174 -14.065 1.00 35.76  ? 394 PHE A C   1 
ATOM   2557 O  O   . PHE A 1 354 ? -28.936 19.164 -14.738 1.00 37.02  ? 394 PHE A O   1 
ATOM   2558 C  CB  . PHE A 1 354 ? -29.060 19.083 -11.682 1.00 38.26  ? 394 PHE A CB  1 
ATOM   2559 C  CG  . PHE A 1 354 ? -27.729 18.426 -11.381 1.00 40.48  ? 394 PHE A CG  1 
ATOM   2560 C  CD1 . PHE A 1 354 ? -27.584 17.566 -10.296 1.00 40.31  ? 394 PHE A CD1 1 
ATOM   2561 C  CD2 . PHE A 1 354 ? -26.602 18.716 -12.147 1.00 40.67  ? 394 PHE A CD2 1 
ATOM   2562 C  CE1 . PHE A 1 354 ? -26.341 17.013 -9.981  1.00 38.07  ? 394 PHE A CE1 1 
ATOM   2563 C  CE2 . PHE A 1 354 ? -25.353 18.159 -11.830 1.00 40.37  ? 394 PHE A CE2 1 
ATOM   2564 C  CZ  . PHE A 1 354 ? -25.231 17.312 -10.748 1.00 38.63  ? 394 PHE A CZ  1 
ATOM   2565 N  N   . VAL A 1 355 ? -28.963 16.926 -14.457 1.00 33.11  ? 395 VAL A N   1 
ATOM   2566 C  CA  . VAL A 1 355 ? -28.406 16.639 -15.785 1.00 30.77  ? 395 VAL A CA  1 
ATOM   2567 C  C   . VAL A 1 355 ? -29.498 15.733 -16.367 1.00 30.79  ? 395 VAL A C   1 
ATOM   2568 O  O   . VAL A 1 355 ? -29.317 14.517 -16.483 1.00 30.50  ? 395 VAL A O   1 
ATOM   2569 C  CB  . VAL A 1 355 ? -27.034 15.863 -15.761 1.00 29.62  ? 395 VAL A CB  1 
ATOM   2570 C  CG1 . VAL A 1 355 ? -26.605 15.545 -17.167 1.00 26.37  ? 395 VAL A CG1 1 
ATOM   2571 C  CG2 . VAL A 1 355 ? -25.931 16.710 -15.132 1.00 29.27  ? 395 VAL A CG2 1 
ATOM   2572 N  N   . PRO A 1 356 ? -30.657 16.325 -16.727 1.00 31.06  ? 396 PRO A N   1 
ATOM   2573 C  CA  . PRO A 1 356 ? -31.835 15.649 -17.283 1.00 31.20  ? 396 PRO A CA  1 
ATOM   2574 C  C   . PRO A 1 356 ? -31.621 14.776 -18.495 1.00 31.90  ? 396 PRO A C   1 
ATOM   2575 O  O   . PRO A 1 356 ? -32.204 13.691 -18.589 1.00 32.16  ? 396 PRO A O   1 
ATOM   2576 C  CB  . PRO A 1 356 ? -32.800 16.797 -17.551 1.00 30.99  ? 396 PRO A CB  1 
ATOM   2577 C  CG  . PRO A 1 356 ? -31.902 17.900 -17.882 1.00 31.69  ? 396 PRO A CG  1 
ATOM   2578 C  CD  . PRO A 1 356 ? -30.826 17.781 -16.826 1.00 31.48  ? 396 PRO A CD  1 
ATOM   2579 N  N   . VAL A 1 357 ? -30.795 15.242 -19.425 1.00 32.14  ? 397 VAL A N   1 
ATOM   2580 C  CA  . VAL A 1 357 ? -30.500 14.473 -20.627 1.00 31.86  ? 397 VAL A CA  1 
ATOM   2581 C  C   . VAL A 1 357 ? -29.010 14.582 -20.870 1.00 32.77  ? 397 VAL A C   1 
ATOM   2582 O  O   . VAL A 1 357 ? -28.456 15.678 -20.830 1.00 34.58  ? 397 VAL A O   1 
ATOM   2583 C  CB  . VAL A 1 357 ? -31.292 15.004 -21.831 1.00 31.19  ? 397 VAL A CB  1 
ATOM   2584 C  CG1 . VAL A 1 357 ? -30.690 14.498 -23.115 1.00 32.49  ? 397 VAL A CG1 1 
ATOM   2585 C  CG2 . VAL A 1 357 ? -32.742 14.532 -21.728 1.00 32.02  ? 397 VAL A CG2 1 
ATOM   2586 N  N   . THR A 1 358 ? -28.354 13.453 -21.126 1.00 31.78  ? 398 THR A N   1 
ATOM   2587 C  CA  . THR A 1 358 ? -26.910 13.438 -21.363 1.00 31.21  ? 398 THR A CA  1 
ATOM   2588 C  C   . THR A 1 358 ? -26.507 14.209 -22.621 1.00 30.92  ? 398 THR A C   1 
ATOM   2589 O  O   . THR A 1 358 ? -27.363 14.676 -23.372 1.00 30.17  ? 398 THR A O   1 
ATOM   2590 C  CB  . THR A 1 358 ? -26.372 11.997 -21.466 1.00 30.50  ? 398 THR A CB  1 
ATOM   2591 O  OG1 . THR A 1 358 ? -26.594 11.495 -22.790 1.00 33.06  ? 398 THR A OG1 1 
ATOM   2592 C  CG2 . THR A 1 358 ? -27.073 11.094 -20.462 1.00 30.54  ? 398 THR A CG2 1 
ATOM   2593 N  N   . ILE A 1 359 ? -25.200 14.340 -22.844 1.00 28.64  ? 399 ILE A N   1 
ATOM   2594 C  CA  . ILE A 1 359 ? -24.694 15.050 -24.008 1.00 27.53  ? 399 ILE A CA  1 
ATOM   2595 C  C   . ILE A 1 359 ? -25.240 14.179 -25.131 1.00 29.62  ? 399 ILE A C   1 
ATOM   2596 O  O   . ILE A 1 359 ? -25.053 12.960 -25.115 1.00 30.23  ? 399 ILE A O   1 
ATOM   2597 C  CB  . ILE A 1 359 ? -23.160 15.049 -24.030 1.00 26.72  ? 399 ILE A CB  1 
ATOM   2598 C  CG1 . ILE A 1 359 ? -22.637 15.846 -22.840 1.00 25.07  ? 399 ILE A CG1 1 
ATOM   2599 C  CG2 . ILE A 1 359 ? -22.647 15.620 -25.328 1.00 24.35  ? 399 ILE A CG2 1 
ATOM   2600 C  CD1 . ILE A 1 359 ? -21.139 15.768 -22.677 1.00 25.14  ? 399 ILE A CD1 1 
ATOM   2601 N  N   . PRO A 1 360 ? -25.921 14.788 -26.123 1.00 30.55  ? 400 PRO A N   1 
ATOM   2602 C  CA  . PRO A 1 360 ? -26.497 14.015 -27.225 1.00 29.86  ? 400 PRO A CA  1 
ATOM   2603 C  C   . PRO A 1 360 ? -25.567 12.942 -27.729 1.00 31.27  ? 400 PRO A C   1 
ATOM   2604 O  O   . PRO A 1 360 ? -24.359 13.153 -27.806 1.00 32.05  ? 400 PRO A O   1 
ATOM   2605 C  CB  . PRO A 1 360 ? -26.795 15.079 -28.267 1.00 30.55  ? 400 PRO A CB  1 
ATOM   2606 C  CG  . PRO A 1 360 ? -27.067 16.317 -27.416 1.00 29.26  ? 400 PRO A CG  1 
ATOM   2607 C  CD  . PRO A 1 360 ? -25.961 16.234 -26.424 1.00 29.78  ? 400 PRO A CD  1 
ATOM   2608 N  N   . HIS A 1 361 ? -26.127 11.773 -28.031 1.00 32.25  ? 401 HIS A N   1 
ATOM   2609 C  CA  . HIS A 1 361 ? -25.338 10.668 -28.565 1.00 32.63  ? 401 HIS A CA  1 
ATOM   2610 C  C   . HIS A 1 361 ? -25.575 10.533 -30.070 1.00 34.19  ? 401 HIS A C   1 
ATOM   2611 O  O   . HIS A 1 361 ? -26.316 11.321 -30.681 1.00 33.17  ? 401 HIS A O   1 
ATOM   2612 C  CB  . HIS A 1 361 ? -25.698 9.347  -27.890 1.00 30.05  ? 401 HIS A CB  1 
ATOM   2613 C  CG  . HIS A 1 361 ? -25.213 9.229  -26.483 1.00 28.74  ? 401 HIS A CG  1 
ATOM   2614 N  ND1 . HIS A 1 361 ? -24.695 8.054  -25.976 1.00 25.55  ? 401 HIS A ND1 1 
ATOM   2615 C  CD2 . HIS A 1 361 ? -25.186 10.126 -25.466 1.00 28.53  ? 401 HIS A CD2 1 
ATOM   2616 C  CE1 . HIS A 1 361 ? -24.369 8.234  -24.707 1.00 26.29  ? 401 HIS A CE1 1 
ATOM   2617 N  NE2 . HIS A 1 361 ? -24.656 9.480  -24.373 1.00 27.05  ? 401 HIS A NE2 1 
ATOM   2618 N  N   . ALA A 1 362 ? -24.942 9.527  -30.659 1.00 36.90  ? 402 ALA A N   1 
ATOM   2619 C  CA  . ALA A 1 362 ? -25.057 9.258  -32.092 1.00 39.89  ? 402 ALA A CA  1 
ATOM   2620 C  C   . ALA A 1 362 ? -24.769 7.772  -32.311 1.00 41.84  ? 402 ALA A C   1 
ATOM   2621 O  O   . ALA A 1 362 ? -23.868 7.216  -31.689 1.00 42.23  ? 402 ALA A O   1 
ATOM   2622 C  CB  . ALA A 1 362 ? -24.058 10.120 -32.867 1.00 37.78  ? 402 ALA A CB  1 
ATOM   2623 N  N   . THR A 1 363 ? -25.531 7.110  -33.172 1.00 44.72  ? 403 THR A N   1 
ATOM   2624 C  CA  . THR A 1 363 ? -25.269 5.694  -33.380 1.00 47.48  ? 403 THR A CA  1 
ATOM   2625 C  C   . THR A 1 363 ? -24.137 5.519  -34.384 1.00 50.13  ? 403 THR A C   1 
ATOM   2626 O  O   . THR A 1 363 ? -23.950 6.353  -35.280 1.00 50.99  ? 403 THR A O   1 
ATOM   2627 C  CB  . THR A 1 363 ? -26.533 4.940  -33.837 1.00 46.78  ? 403 THR A CB  1 
ATOM   2628 O  OG1 . THR A 1 363 ? -27.183 5.678  -34.872 1.00 49.40  ? 403 THR A OG1 1 
ATOM   2629 C  CG2 . THR A 1 363 ? -27.498 4.765  -32.673 1.00 45.66  ? 403 THR A CG2 1 
ATOM   2630 N  N   . THR A 1 364 ? -23.365 4.448  -34.213 1.00 52.13  ? 404 THR A N   1 
ATOM   2631 C  CA  . THR A 1 364 ? -22.229 4.166  -35.089 1.00 53.67  ? 404 THR A CA  1 
ATOM   2632 C  C   . THR A 1 364 ? -22.564 3.148  -36.162 1.00 53.85  ? 404 THR A C   1 
ATOM   2633 O  O   . THR A 1 364 ? -21.800 2.940  -37.096 1.00 54.24  ? 404 THR A O   1 
ATOM   2634 C  CB  . THR A 1 364 ? -21.057 3.604  -34.296 1.00 54.61  ? 404 THR A CB  1 
ATOM   2635 O  OG1 . THR A 1 364 ? -20.859 4.391  -33.115 1.00 57.84  ? 404 THR A OG1 1 
ATOM   2636 C  CG2 . THR A 1 364 ? -19.792 3.639  -35.141 1.00 56.14  ? 404 THR A CG2 1 
ATOM   2637 N  N   . ALA A 1 365 ? -23.720 2.517  -36.024 1.00 54.86  ? 405 ALA A N   1 
ATOM   2638 C  CA  . ALA A 1 365 ? -24.142 1.494  -36.963 1.00 54.06  ? 405 ALA A CA  1 
ATOM   2639 C  C   . ALA A 1 365 ? -25.635 1.257  -36.822 1.00 54.07  ? 405 ALA A C   1 
ATOM   2640 O  O   . ALA A 1 365 ? -26.179 1.426  -35.733 1.00 54.78  ? 405 ALA A O   1 
ATOM   2641 C  CB  . ALA A 1 365 ? -23.390 0.216  -36.662 1.00 52.65  ? 405 ALA A CB  1 
ATOM   2642 N  N   . ASN A 1 366 ? -26.299 0.873  -37.912 1.00 54.12  ? 406 ASN A N   1 
ATOM   2643 C  CA  . ASN A 1 366 ? -27.735 0.583  -37.855 1.00 53.39  ? 406 ASN A CA  1 
ATOM   2644 C  C   . ASN A 1 366 ? -27.896 -0.386 -36.690 1.00 52.22  ? 406 ASN A C   1 
ATOM   2645 O  O   . ASN A 1 366 ? -27.137 -1.344 -36.561 1.00 51.04  ? 406 ASN A O   1 
ATOM   2646 C  CB  . ASN A 1 366 ? -28.215 -0.115 -39.127 1.00 54.67  ? 406 ASN A CB  1 
ATOM   2647 C  CG  . ASN A 1 366 ? -27.598 0.460  -40.382 1.00 55.96  ? 406 ASN A CG  1 
ATOM   2648 O  OD1 . ASN A 1 366 ? -27.865 1.600  -40.766 1.00 56.31  ? 406 ASN A OD1 1 
ATOM   2649 N  ND2 . ASN A 1 366 ? -26.763 -0.337 -41.035 1.00 56.89  ? 406 ASN A ND2 1 
ATOM   2650 N  N   . THR A 1 367 ? -28.876 -0.131 -35.838 1.00 51.24  ? 407 THR A N   1 
ATOM   2651 C  CA  . THR A 1 367 ? -29.107 -0.979 -34.676 1.00 50.34  ? 407 THR A CA  1 
ATOM   2652 C  C   . THR A 1 367 ? -30.556 -0.816 -34.302 1.00 50.90  ? 407 THR A C   1 
ATOM   2653 O  O   . THR A 1 367 ? -31.251 0.000  -34.897 1.00 51.50  ? 407 THR A O   1 
ATOM   2654 C  CB  . THR A 1 367 ? -28.243 -0.536 -33.486 1.00 49.86  ? 407 THR A CB  1 
ATOM   2655 O  OG1 . THR A 1 367 ? -28.732 -1.152 -32.292 1.00 48.43  ? 407 THR A OG1 1 
ATOM   2656 C  CG2 . THR A 1 367 ? -28.277 0.999  -33.334 1.00 49.28  ? 407 THR A CG2 1 
ATOM   2657 N  N   . SER A 1 368 ? -31.019 -1.590 -33.330 1.00 51.16  ? 408 SER A N   1 
ATOM   2658 C  CA  . SER A 1 368 ? -32.409 -1.478 -32.896 1.00 51.25  ? 408 SER A CA  1 
ATOM   2659 C  C   . SER A 1 368 ? -32.513 -1.572 -31.385 1.00 51.09  ? 408 SER A C   1 
ATOM   2660 O  O   . SER A 1 368 ? -31.743 -2.283 -30.740 1.00 50.92  ? 408 SER A O   1 
ATOM   2661 C  CB  . SER A 1 368 ? -33.274 -2.573 -33.541 1.00 52.00  ? 408 SER A CB  1 
ATOM   2662 O  OG  . SER A 1 368 ? -32.833 -3.873 -33.179 1.00 51.66  ? 408 SER A OG  1 
ATOM   2663 N  N   . VAL A 1 369 ? -33.456 -0.833 -30.818 1.00 50.92  ? 409 VAL A N   1 
ATOM   2664 C  CA  . VAL A 1 369 ? -33.665 -0.869 -29.383 1.00 51.60  ? 409 VAL A CA  1 
ATOM   2665 C  C   . VAL A 1 369 ? -35.147 -1.100 -29.106 1.00 52.52  ? 409 VAL A C   1 
ATOM   2666 O  O   . VAL A 1 369 ? -36.006 -0.430 -29.701 1.00 52.31  ? 409 VAL A O   1 
ATOM   2667 C  CB  . VAL A 1 369 ? -33.181 0.429  -28.734 1.00 51.64  ? 409 VAL A CB  1 
ATOM   2668 C  CG1 . VAL A 1 369 ? -33.751 0.562  -27.327 1.00 52.83  ? 409 VAL A CG1 1 
ATOM   2669 C  CG2 . VAL A 1 369 ? -31.664 0.417  -28.682 1.00 51.08  ? 409 VAL A CG2 1 
ATOM   2670 N  N   . LEU A 1 370 ? -35.432 -2.055 -28.213 1.00 52.47  ? 410 LEU A N   1 
ATOM   2671 C  CA  . LEU A 1 370 ? -36.802 -2.437 -27.853 1.00 52.70  ? 410 LEU A CA  1 
ATOM   2672 C  C   . LEU A 1 370 ? -37.606 -2.757 -29.115 1.00 53.65  ? 410 LEU A C   1 
ATOM   2673 O  O   . LEU A 1 370 ? -38.802 -2.440 -29.199 1.00 53.29  ? 410 LEU A O   1 
ATOM   2674 C  CB  . LEU A 1 370 ? -37.514 -1.328 -27.058 1.00 51.04  ? 410 LEU A CB  1 
ATOM   2675 C  CG  . LEU A 1 370 ? -36.982 -1.061 -25.643 1.00 50.49  ? 410 LEU A CG  1 
ATOM   2676 C  CD1 . LEU A 1 370 ? -37.826 0.007  -24.975 1.00 47.32  ? 410 LEU A CD1 1 
ATOM   2677 C  CD2 . LEU A 1 370 ? -36.982 -2.345 -24.828 1.00 47.34  ? 410 LEU A CD2 1 
ATOM   2678 N  N   . GLY A 1 371 ? -36.934 -3.369 -30.092 1.00 53.22  ? 411 GLY A N   1 
ATOM   2679 C  CA  . GLY A 1 371 ? -37.586 -3.737 -31.331 1.00 54.45  ? 411 GLY A CA  1 
ATOM   2680 C  C   . GLY A 1 371 ? -37.362 -2.775 -32.478 1.00 56.36  ? 411 GLY A C   1 
ATOM   2681 O  O   . GLY A 1 371 ? -37.089 -3.207 -33.602 1.00 56.23  ? 411 GLY A O   1 
ATOM   2682 N  N   . TYR A 1 372 ? -37.466 -1.476 -32.185 1.00 58.69  ? 412 TYR A N   1 
ATOM   2683 C  CA  . TYR A 1 372 ? -37.309 -0.391 -33.168 1.00 59.82  ? 412 TYR A CA  1 
ATOM   2684 C  C   . TYR A 1 372 ? -35.975 -0.240 -33.883 1.00 59.65  ? 412 TYR A C   1 
ATOM   2685 O  O   . TYR A 1 372 ? -34.923 -0.163 -33.244 1.00 60.37  ? 412 TYR A O   1 
ATOM   2686 C  CB  . TYR A 1 372 ? -37.627 0.939  -32.512 1.00 62.87  ? 412 TYR A CB  1 
ATOM   2687 C  CG  . TYR A 1 372 ? -39.093 1.158  -32.262 1.00 66.90  ? 412 TYR A CG  1 
ATOM   2688 C  CD1 . TYR A 1 372 ? -39.995 1.232  -33.326 1.00 67.61  ? 412 TYR A CD1 1 
ATOM   2689 C  CD2 . TYR A 1 372 ? -39.577 1.341  -30.962 1.00 68.87  ? 412 TYR A CD2 1 
ATOM   2690 C  CE1 . TYR A 1 372 ? -41.345 1.493  -33.109 1.00 69.71  ? 412 TYR A CE1 1 
ATOM   2691 C  CE2 . TYR A 1 372 ? -40.929 1.602  -30.727 1.00 70.94  ? 412 TYR A CE2 1 
ATOM   2692 C  CZ  . TYR A 1 372 ? -41.807 1.682  -31.808 1.00 71.29  ? 412 TYR A CZ  1 
ATOM   2693 O  OH  . TYR A 1 372 ? -43.134 1.986  -31.589 1.00 73.87  ? 412 TYR A OH  1 
ATOM   2694 N  N   . HIS A 1 373 ? -36.038 -0.158 -35.212 1.00 58.72  ? 413 HIS A N   1 
ATOM   2695 C  CA  . HIS A 1 373 ? -34.851 0.008  -36.049 1.00 57.83  ? 413 HIS A CA  1 
ATOM   2696 C  C   . HIS A 1 373 ? -34.296 1.432  -35.915 1.00 56.40  ? 413 HIS A C   1 
ATOM   2697 O  O   . HIS A 1 373 ? -35.043 2.410  -36.001 1.00 56.56  ? 413 HIS A O   1 
ATOM   2698 C  CB  . HIS A 1 373 ? -35.197 -0.268 -37.517 1.00 59.43  ? 413 HIS A CB  1 
ATOM   2699 C  CG  . HIS A 1 373 ? -34.041 -0.086 -38.459 1.00 61.55  ? 413 HIS A CG  1 
ATOM   2700 N  ND1 . HIS A 1 373 ? -32.916 -0.885 -38.425 1.00 62.71  ? 413 HIS A ND1 1 
ATOM   2701 C  CD2 . HIS A 1 373 ? -33.826 0.822  -39.443 1.00 61.41  ? 413 HIS A CD2 1 
ATOM   2702 C  CE1 . HIS A 1 373 ? -32.057 -0.477 -39.344 1.00 62.15  ? 413 HIS A CE1 1 
ATOM   2703 N  NE2 . HIS A 1 373 ? -32.584 0.558  -39.975 1.00 62.15  ? 413 HIS A NE2 1 
ATOM   2704 N  N   . ILE A 1 374 ? -32.983 1.531  -35.704 1.00 53.95  ? 414 ILE A N   1 
ATOM   2705 C  CA  . ILE A 1 374 ? -32.285 2.812  -35.552 1.00 50.40  ? 414 ILE A CA  1 
ATOM   2706 C  C   . ILE A 1 374 ? -31.082 2.855  -36.487 1.00 48.63  ? 414 ILE A C   1 
ATOM   2707 O  O   . ILE A 1 374 ? -30.017 2.323  -36.171 1.00 48.73  ? 414 ILE A O   1 
ATOM   2708 C  CB  . ILE A 1 374 ? -31.770 3.017  -34.116 1.00 48.50  ? 414 ILE A CB  1 
ATOM   2709 C  CG1 . ILE A 1 374 ? -32.898 2.782  -33.107 1.00 48.28  ? 414 ILE A CG1 1 
ATOM   2710 C  CG2 . ILE A 1 374 ? -31.247 4.429  -33.973 1.00 48.87  ? 414 ILE A CG2 1 
ATOM   2711 C  CD1 . ILE A 1 374 ? -32.511 3.050  -31.649 1.00 46.58  ? 414 ILE A CD1 1 
ATOM   2712 N  N   . PRO A 1 375 ? -31.240 3.498  -37.651 1.00 47.16  ? 415 PRO A N   1 
ATOM   2713 C  CA  . PRO A 1 375 ? -30.192 3.629  -38.667 1.00 47.09  ? 415 PRO A CA  1 
ATOM   2714 C  C   . PRO A 1 375 ? -28.912 4.373  -38.280 1.00 47.53  ? 415 PRO A C   1 
ATOM   2715 O  O   . PRO A 1 375 ? -28.949 5.427  -37.626 1.00 47.87  ? 415 PRO A O   1 
ATOM   2716 C  CB  . PRO A 1 375 ? -30.919 4.312  -39.833 1.00 46.39  ? 415 PRO A CB  1 
ATOM   2717 C  CG  . PRO A 1 375 ? -31.990 5.097  -39.168 1.00 46.54  ? 415 PRO A CG  1 
ATOM   2718 C  CD  . PRO A 1 375 ? -32.486 4.147  -38.098 1.00 46.86  ? 415 PRO A CD  1 
ATOM   2719 N  N   . LYS A 1 376 ? -27.784 3.813  -38.711 1.00 46.08  ? 416 LYS A N   1 
ATOM   2720 C  CA  . LYS A 1 376 ? -26.478 4.392  -38.467 1.00 44.88  ? 416 LYS A CA  1 
ATOM   2721 C  C   . LYS A 1 376 ? -26.436 5.915  -38.651 1.00 45.08  ? 416 LYS A C   1 
ATOM   2722 O  O   . LYS A 1 376 ? -27.117 6.474  -39.510 1.00 43.29  ? 416 LYS A O   1 
ATOM   2723 C  CB  . LYS A 1 376 ? -25.475 3.800  -39.449 1.00 44.35  ? 416 LYS A CB  1 
ATOM   2724 C  CG  . LYS A 1 376 ? -24.065 4.333  -39.306 1.00 44.87  ? 416 LYS A CG  1 
ATOM   2725 C  CD  . LYS A 1 376 ? -23.144 3.796  -40.395 1.00 46.48  ? 416 LYS A CD  1 
ATOM   2726 C  CE  . LYS A 1 376 ? -21.694 4.261  -40.166 1.00 49.11  ? 416 LYS A CE  1 
ATOM   2727 N  NZ  . LYS A 1 376 ? -20.698 3.608  -41.078 1.00 49.62  ? 416 LYS A NZ  1 
ATOM   2728 N  N   . ASP A 1 377 ? -25.628 6.566  -37.817 1.00 45.33  ? 417 ASP A N   1 
ATOM   2729 C  CA  . ASP A 1 377 ? -25.412 8.003  -37.866 1.00 46.05  ? 417 ASP A CA  1 
ATOM   2730 C  C   . ASP A 1 377 ? -26.616 8.837  -37.489 1.00 46.09  ? 417 ASP A C   1 
ATOM   2731 O  O   . ASP A 1 377 ? -26.785 9.946  -38.009 1.00 47.25  ? 417 ASP A O   1 
ATOM   2732 C  CB  . ASP A 1 377 ? -24.925 8.444  -39.250 1.00 47.47  ? 417 ASP A CB  1 
ATOM   2733 C  CG  . ASP A 1 377 ? -23.699 7.667  -39.718 1.00 49.48  ? 417 ASP A CG  1 
ATOM   2734 O  OD1 . ASP A 1 377 ? -22.780 7.446  -38.893 1.00 49.78  ? 417 ASP A OD1 1 
ATOM   2735 O  OD2 . ASP A 1 377 ? -23.651 7.287  -40.913 1.00 49.73  ? 417 ASP A OD2 1 
ATOM   2736 N  N   . THR A 1 378 ? -27.458 8.314  -36.601 1.00 45.07  ? 418 THR A N   1 
ATOM   2737 C  CA  . THR A 1 378 ? -28.641 9.053  -36.145 1.00 41.78  ? 418 THR A CA  1 
ATOM   2738 C  C   . THR A 1 378 ? -28.403 9.558  -34.719 1.00 39.99  ? 418 THR A C   1 
ATOM   2739 O  O   . THR A 1 378 ? -27.870 8.837  -33.868 1.00 38.22  ? 418 THR A O   1 
ATOM   2740 C  CB  . THR A 1 378 ? -29.959 8.178  -36.200 1.00 41.21  ? 418 THR A CB  1 
ATOM   2741 O  OG1 . THR A 1 378 ? -31.015 8.847  -35.488 1.00 39.40  ? 418 THR A OG1 1 
ATOM   2742 C  CG2 . THR A 1 378 ? -29.735 6.804  -35.604 1.00 38.49  ? 418 THR A CG2 1 
ATOM   2743 N  N   . VAL A 1 379 ? -28.782 10.815 -34.499 1.00 37.89  ? 419 VAL A N   1 
ATOM   2744 C  CA  . VAL A 1 379 ? -28.654 11.494 -33.219 1.00 35.98  ? 419 VAL A CA  1 
ATOM   2745 C  C   . VAL A 1 379 ? -29.614 10.879 -32.200 1.00 35.57  ? 419 VAL A C   1 
ATOM   2746 O  O   . VAL A 1 379 ? -30.782 10.659 -32.492 1.00 36.69  ? 419 VAL A O   1 
ATOM   2747 C  CB  . VAL A 1 379 ? -28.982 13.000 -33.380 1.00 36.21  ? 419 VAL A CB  1 
ATOM   2748 C  CG1 . VAL A 1 379 ? -28.923 13.698 -32.023 1.00 34.90  ? 419 VAL A CG1 1 
ATOM   2749 C  CG2 . VAL A 1 379 ? -28.019 13.645 -34.376 1.00 31.79  ? 419 VAL A CG2 1 
ATOM   2750 N  N   . VAL A 1 380 ? -29.118 10.626 -30.996 1.00 35.19  ? 420 VAL A N   1 
ATOM   2751 C  CA  . VAL A 1 380 ? -29.907 10.007 -29.933 1.00 33.90  ? 420 VAL A CA  1 
ATOM   2752 C  C   . VAL A 1 380 ? -29.833 10.763 -28.601 1.00 33.05  ? 420 VAL A C   1 
ATOM   2753 O  O   . VAL A 1 380 ? -28.762 11.206 -28.190 1.00 30.23  ? 420 VAL A O   1 
ATOM   2754 C  CB  . VAL A 1 380 ? -29.407 8.556  -29.676 1.00 34.15  ? 420 VAL A CB  1 
ATOM   2755 C  CG1 . VAL A 1 380 ? -30.315 7.832  -28.683 1.00 33.10  ? 420 VAL A CG1 1 
ATOM   2756 C  CG2 . VAL A 1 380 ? -29.326 7.812  -30.987 1.00 34.78  ? 420 VAL A CG2 1 
ATOM   2757 N  N   . PHE A 1 381 ? -30.981 10.894 -27.934 1.00 34.13  ? 421 PHE A N   1 
ATOM   2758 C  CA  . PHE A 1 381 ? -31.057 11.549 -26.627 1.00 34.81  ? 421 PHE A CA  1 
ATOM   2759 C  C   . PHE A 1 381 ? -31.396 10.496 -25.587 1.00 34.20  ? 421 PHE A C   1 
ATOM   2760 O  O   . PHE A 1 381 ? -32.315 9.695  -25.775 1.00 34.30  ? 421 PHE A O   1 
ATOM   2761 C  CB  . PHE A 1 381 ? -32.147 12.640 -26.573 1.00 34.84  ? 421 PHE A CB  1 
ATOM   2762 C  CG  . PHE A 1 381 ? -31.845 13.856 -27.400 1.00 36.36  ? 421 PHE A CG  1 
ATOM   2763 C  CD1 . PHE A 1 381 ? -30.677 13.939 -28.164 1.00 37.55  ? 421 PHE A CD1 1 
ATOM   2764 C  CD2 . PHE A 1 381 ? -32.748 14.910 -27.451 1.00 36.25  ? 421 PHE A CD2 1 
ATOM   2765 C  CE1 . PHE A 1 381 ? -30.425 15.062 -28.971 1.00 38.80  ? 421 PHE A CE1 1 
ATOM   2766 C  CE2 . PHE A 1 381 ? -32.504 16.035 -28.254 1.00 37.82  ? 421 PHE A CE2 1 
ATOM   2767 C  CZ  . PHE A 1 381 ? -31.346 16.112 -29.015 1.00 37.64  ? 421 PHE A CZ  1 
ATOM   2768 N  N   . VAL A 1 382 ? -30.639 10.501 -24.497 1.00 33.88  ? 422 VAL A N   1 
ATOM   2769 C  CA  . VAL A 1 382 ? -30.860 9.586  -23.387 1.00 32.83  ? 422 VAL A CA  1 
ATOM   2770 C  C   . VAL A 1 382 ? -31.547 10.448 -22.338 1.00 33.28  ? 422 VAL A C   1 
ATOM   2771 O  O   . VAL A 1 382 ? -30.985 11.451 -21.889 1.00 32.15  ? 422 VAL A O   1 
ATOM   2772 C  CB  . VAL A 1 382 ? -29.524 9.058  -22.806 1.00 32.45  ? 422 VAL A CB  1 
ATOM   2773 C  CG1 . VAL A 1 382 ? -29.772 8.273  -21.548 1.00 30.41  ? 422 VAL A CG1 1 
ATOM   2774 C  CG2 . VAL A 1 382 ? -28.814 8.207  -23.834 1.00 31.83  ? 422 VAL A CG2 1 
ATOM   2775 N  N   . ASN A 1 383 ? -32.768 10.065 -21.970 1.00 33.94  ? 423 ASN A N   1 
ATOM   2776 C  CA  . ASN A 1 383 ? -33.529 10.803 -20.980 1.00 35.07  ? 423 ASN A CA  1 
ATOM   2777 C  C   . ASN A 1 383 ? -33.280 10.195 -19.611 1.00 36.85  ? 423 ASN A C   1 
ATOM   2778 O  O   . ASN A 1 383 ? -33.919 9.217  -19.254 1.00 38.97  ? 423 ASN A O   1 
ATOM   2779 C  CB  . ASN A 1 383 ? -35.032 10.734 -21.290 1.00 33.21  ? 423 ASN A CB  1 
ATOM   2780 C  CG  . ASN A 1 383 ? -35.838 11.829 -20.578 1.00 31.68  ? 423 ASN A CG  1 
ATOM   2781 O  OD1 . ASN A 1 383 ? -35.556 12.181 -19.440 1.00 31.92  ? 423 ASN A OD1 1 
ATOM   2782 N  ND2 . ASN A 1 383 ? -36.851 12.351 -21.249 1.00 29.29  ? 423 ASN A ND2 1 
ATOM   2783 N  N   . GLN A 1 384 ? -32.356 10.757 -18.838 1.00 38.11  ? 424 GLN A N   1 
ATOM   2784 C  CA  . GLN A 1 384 ? -32.115 10.209 -17.509 1.00 39.82  ? 424 GLN A CA  1 
ATOM   2785 C  C   . GLN A 1 384 ? -33.276 10.595 -16.579 1.00 41.64  ? 424 GLN A C   1 
ATOM   2786 O  O   . GLN A 1 384 ? -33.739 9.789  -15.772 1.00 43.51  ? 424 GLN A O   1 
ATOM   2787 C  CB  . GLN A 1 384 ? -30.813 10.740 -16.934 1.00 39.76  ? 424 GLN A CB  1 
ATOM   2788 C  CG  . GLN A 1 384 ? -29.606 10.476 -17.777 1.00 39.82  ? 424 GLN A CG  1 
ATOM   2789 C  CD  . GLN A 1 384 ? -28.338 10.695 -16.994 1.00 41.33  ? 424 GLN A CD  1 
ATOM   2790 O  OE1 . GLN A 1 384 ? -27.711 9.739  -16.524 1.00 41.12  ? 424 GLN A OE1 1 
ATOM   2791 N  NE2 . GLN A 1 384 ? -27.959 11.963 -16.822 1.00 41.14  ? 424 GLN A NE2 1 
ATOM   2792 N  N   . TRP A 1 385 ? -33.740 11.832 -16.699 1.00 41.62  ? 425 TRP A N   1 
ATOM   2793 C  CA  . TRP A 1 385 ? -34.839 12.320 -15.894 1.00 41.61  ? 425 TRP A CA  1 
ATOM   2794 C  C   . TRP A 1 385 ? -36.012 11.356 -15.956 1.00 43.16  ? 425 TRP A C   1 
ATOM   2795 O  O   . TRP A 1 385 ? -36.769 11.211 -15.001 1.00 43.96  ? 425 TRP A O   1 
ATOM   2796 C  CB  . TRP A 1 385 ? -35.287 13.681 -16.409 1.00 40.90  ? 425 TRP A CB  1 
ATOM   2797 C  CG  . TRP A 1 385 ? -36.365 14.268 -15.599 1.00 40.70  ? 425 TRP A CG  1 
ATOM   2798 C  CD1 . TRP A 1 385 ? -36.229 15.115 -14.541 1.00 40.23  ? 425 TRP A CD1 1 
ATOM   2799 C  CD2 . TRP A 1 385 ? -37.761 14.018 -15.743 1.00 41.19  ? 425 TRP A CD2 1 
ATOM   2800 N  NE1 . TRP A 1 385 ? -37.462 15.410 -14.013 1.00 40.39  ? 425 TRP A NE1 1 
ATOM   2801 C  CE2 . TRP A 1 385 ? -38.422 14.749 -14.735 1.00 40.95  ? 425 TRP A CE2 1 
ATOM   2802 C  CE3 . TRP A 1 385 ? -38.525 13.242 -16.632 1.00 42.22  ? 425 TRP A CE3 1 
ATOM   2803 C  CZ2 . TRP A 1 385 ? -39.817 14.730 -14.586 1.00 42.26  ? 425 TRP A CZ2 1 
ATOM   2804 C  CZ3 . TRP A 1 385 ? -39.922 13.223 -16.482 1.00 42.35  ? 425 TRP A CZ3 1 
ATOM   2805 C  CH2 . TRP A 1 385 ? -40.547 13.963 -15.466 1.00 41.14  ? 425 TRP A CH2 1 
ATOM   2806 N  N   . SER A 1 386 ? -36.171 10.691 -17.086 1.00 45.20  ? 426 SER A N   1 
ATOM   2807 C  CA  . SER A 1 386 ? -37.280 9.761  -17.237 1.00 47.38  ? 426 SER A CA  1 
ATOM   2808 C  C   . SER A 1 386 ? -37.090 8.452  -16.483 1.00 46.78  ? 426 SER A C   1 
ATOM   2809 O  O   . SER A 1 386 ? -38.030 7.683  -16.300 1.00 47.15  ? 426 SER A O   1 
ATOM   2810 C  CB  . SER A 1 386 ? -37.524 9.492  -18.717 1.00 49.55  ? 426 SER A CB  1 
ATOM   2811 O  OG  . SER A 1 386 ? -38.142 10.625 -19.317 1.00 53.91  ? 426 SER A OG  1 
ATOM   2812 N  N   . VAL A 1 387 ? -35.869 8.197  -16.046 1.00 45.70  ? 427 VAL A N   1 
ATOM   2813 C  CA  . VAL A 1 387 ? -35.602 6.998  -15.289 1.00 44.65  ? 427 VAL A CA  1 
ATOM   2814 C  C   . VAL A 1 387 ? -35.707 7.334  -13.801 1.00 45.92  ? 427 VAL A C   1 
ATOM   2815 O  O   . VAL A 1 387 ? -36.086 6.480  -12.995 1.00 47.81  ? 427 VAL A O   1 
ATOM   2816 C  CB  . VAL A 1 387 ? -34.201 6.435  -15.612 1.00 42.58  ? 427 VAL A CB  1 
ATOM   2817 C  CG1 . VAL A 1 387 ? -33.856 5.330  -14.650 1.00 42.10  ? 427 VAL A CG1 1 
ATOM   2818 C  CG2 . VAL A 1 387 ? -34.159 5.928  -17.044 1.00 40.18  ? 427 VAL A CG2 1 
ATOM   2819 N  N   . ASN A 1 388 ? -35.390 8.576  -13.436 1.00 45.34  ? 428 ASN A N   1 
ATOM   2820 C  CA  . ASN A 1 388 ? -35.448 8.997  -12.036 1.00 45.88  ? 428 ASN A CA  1 
ATOM   2821 C  C   . ASN A 1 388 ? -36.842 9.396  -11.609 1.00 46.46  ? 428 ASN A C   1 
ATOM   2822 O  O   . ASN A 1 388 ? -37.127 9.488  -10.413 1.00 46.15  ? 428 ASN A O   1 
ATOM   2823 C  CB  . ASN A 1 388 ? -34.530 10.189 -11.770 1.00 46.59  ? 428 ASN A CB  1 
ATOM   2824 C  CG  . ASN A 1 388 ? -33.088 9.870  -12.005 1.00 48.25  ? 428 ASN A CG  1 
ATOM   2825 O  OD1 . ASN A 1 388 ? -32.682 8.705  -11.956 1.00 50.79  ? 428 ASN A OD1 1 
ATOM   2826 N  ND2 . ASN A 1 388 ? -32.292 10.901 -12.251 1.00 47.66  ? 428 ASN A ND2 1 
ATOM   2827 N  N   . HIS A 1 389 ? -37.705 9.653  -12.584 1.00 47.40  ? 429 HIS A N   1 
ATOM   2828 C  CA  . HIS A 1 389 ? -39.066 10.064 -12.287 1.00 48.52  ? 429 HIS A CA  1 
ATOM   2829 C  C   . HIS A 1 389 ? -40.137 9.067  -12.711 1.00 49.58  ? 429 HIS A C   1 
ATOM   2830 O  O   . HIS A 1 389 ? -41.320 9.379  -12.714 1.00 49.15  ? 429 HIS A O   1 
ATOM   2831 C  CB  . HIS A 1 389 ? -39.301 11.459 -12.874 1.00 48.55  ? 429 HIS A CB  1 
ATOM   2832 C  CG  . HIS A 1 389 ? -38.668 12.548 -12.061 1.00 50.07  ? 429 HIS A CG  1 
ATOM   2833 N  ND1 . HIS A 1 389 ? -39.274 13.095 -10.951 1.00 50.31  ? 429 HIS A ND1 1 
ATOM   2834 C  CD2 . HIS A 1 389 ? -37.441 13.116 -12.131 1.00 51.30  ? 429 HIS A CD2 1 
ATOM   2835 C  CE1 . HIS A 1 389 ? -38.451 13.950 -10.371 1.00 50.48  ? 429 HIS A CE1 1 
ATOM   2836 N  NE2 . HIS A 1 389 ? -37.330 13.981 -11.066 1.00 51.15  ? 429 HIS A NE2 1 
ATOM   2837 N  N   . ASP A 1 390 ? -39.702 7.854  -13.044 1.00 52.50  ? 430 ASP A N   1 
ATOM   2838 C  CA  . ASP A 1 390 ? -40.594 6.760  -13.430 1.00 54.69  ? 430 ASP A CA  1 
ATOM   2839 C  C   . ASP A 1 390 ? -41.455 6.437  -12.204 1.00 55.94  ? 430 ASP A C   1 
ATOM   2840 O  O   . ASP A 1 390 ? -40.922 6.079  -11.141 1.00 56.82  ? 430 ASP A O   1 
ATOM   2841 C  CB  . ASP A 1 390 ? -39.765 5.526  -13.804 1.00 55.84  ? 430 ASP A CB  1 
ATOM   2842 C  CG  . ASP A 1 390 ? -40.621 4.290  -14.068 1.00 58.61  ? 430 ASP A CG  1 
ATOM   2843 O  OD1 . ASP A 1 390 ? -41.149 4.138  -15.193 1.00 59.47  ? 430 ASP A OD1 1 
ATOM   2844 O  OD2 . ASP A 1 390 ? -40.776 3.462  -13.141 1.00 61.04  ? 430 ASP A OD2 1 
ATOM   2845 N  N   . PRO A 1 391 ? -42.791 6.551  -12.329 1.00 55.54  ? 431 PRO A N   1 
ATOM   2846 C  CA  . PRO A 1 391 ? -43.674 6.262  -11.192 1.00 55.71  ? 431 PRO A CA  1 
ATOM   2847 C  C   . PRO A 1 391 ? -43.410 4.905  -10.535 1.00 55.95  ? 431 PRO A C   1 
ATOM   2848 O  O   . PRO A 1 391 ? -43.164 4.832  -9.333  1.00 56.96  ? 431 PRO A O   1 
ATOM   2849 C  CB  . PRO A 1 391 ? -45.069 6.351  -11.810 1.00 55.54  ? 431 PRO A CB  1 
ATOM   2850 C  CG  . PRO A 1 391 ? -44.888 7.388  -12.887 1.00 55.27  ? 431 PRO A CG  1 
ATOM   2851 C  CD  . PRO A 1 391 ? -43.577 6.939  -13.514 1.00 55.44  ? 431 PRO A CD  1 
ATOM   2852 N  N   . LEU A 1 392 ? -43.437 3.838  -11.330 1.00 55.69  ? 432 LEU A N   1 
ATOM   2853 C  CA  . LEU A 1 392 ? -43.216 2.484  -10.823 1.00 54.96  ? 432 LEU A CA  1 
ATOM   2854 C  C   . LEU A 1 392 ? -41.912 2.265  -10.074 1.00 54.28  ? 432 LEU A C   1 
ATOM   2855 O  O   . LEU A 1 392 ? -41.897 1.560  -9.067  1.00 54.39  ? 432 LEU A O   1 
ATOM   2856 C  CB  . LEU A 1 392 ? -43.288 1.459  -11.958 1.00 54.65  ? 432 LEU A CB  1 
ATOM   2857 C  CG  . LEU A 1 392 ? -44.548 1.434  -12.821 1.00 53.51  ? 432 LEU A CG  1 
ATOM   2858 C  CD1 . LEU A 1 392 ? -44.575 0.090  -13.572 1.00 52.05  ? 432 LEU A CD1 1 
ATOM   2859 C  CD2 . LEU A 1 392 ? -45.801 1.629  -11.958 1.00 50.14  ? 432 LEU A CD2 1 
ATOM   2860 N  N   . LYS A 1 393 ? -40.811 2.830  -10.565 1.00 53.58  ? 433 LYS A N   1 
ATOM   2861 C  CA  . LYS A 1 393 ? -39.547 2.633  -9.870  1.00 52.65  ? 433 LYS A CA  1 
ATOM   2862 C  C   . LYS A 1 393 ? -39.427 3.595  -8.704  1.00 52.54  ? 433 LYS A C   1 
ATOM   2863 O  O   . LYS A 1 393 ? -38.757 3.292  -7.719  1.00 53.54  ? 433 LYS A O   1 
ATOM   2864 C  CB  . LYS A 1 393 ? -38.340 2.814  -10.790 1.00 50.77  ? 433 LYS A CB  1 
ATOM   2865 C  CG  . LYS A 1 393 ? -37.059 2.333  -10.116 1.00 50.87  ? 433 LYS A CG  1 
ATOM   2866 C  CD  . LYS A 1 393 ? -35.777 2.835  -10.755 1.00 50.64  ? 433 LYS A CD  1 
ATOM   2867 C  CE  . LYS A 1 393 ? -35.638 2.384  -12.180 1.00 50.99  ? 433 LYS A CE  1 
ATOM   2868 N  NZ  . LYS A 1 393 ? -36.621 3.102  -13.028 1.00 51.76  ? 433 LYS A NZ  1 
ATOM   2869 N  N   . TRP A 1 394 ? -40.078 4.750  -8.809  1.00 51.59  ? 434 TRP A N   1 
ATOM   2870 C  CA  . TRP A 1 394 ? -40.014 5.745  -7.742  1.00 50.59  ? 434 TRP A CA  1 
ATOM   2871 C  C   . TRP A 1 394 ? -41.401 6.281  -7.421  1.00 51.82  ? 434 TRP A C   1 
ATOM   2872 O  O   . TRP A 1 394 ? -41.869 7.251  -8.012  1.00 51.43  ? 434 TRP A O   1 
ATOM   2873 C  CB  . TRP A 1 394 ? -39.064 6.881  -8.145  1.00 47.35  ? 434 TRP A CB  1 
ATOM   2874 C  CG  . TRP A 1 394 ? -37.718 6.378  -8.566  1.00 41.73  ? 434 TRP A CG  1 
ATOM   2875 C  CD1 . TRP A 1 394 ? -37.272 6.228  -9.835  1.00 41.31  ? 434 TRP A CD1 1 
ATOM   2876 C  CD2 . TRP A 1 394 ? -36.679 5.880  -7.712  1.00 39.08  ? 434 TRP A CD2 1 
ATOM   2877 N  NE1 . TRP A 1 394 ? -36.021 5.666  -9.832  1.00 41.37  ? 434 TRP A NE1 1 
ATOM   2878 C  CE2 . TRP A 1 394 ? -35.635 5.442  -8.539  1.00 39.14  ? 434 TRP A CE2 1 
ATOM   2879 C  CE3 . TRP A 1 394 ? -36.536 5.757  -6.331  1.00 38.33  ? 434 TRP A CE3 1 
ATOM   2880 C  CZ2 . TRP A 1 394 ? -34.458 4.889  -8.031  1.00 40.18  ? 434 TRP A CZ2 1 
ATOM   2881 C  CZ3 . TRP A 1 394 ? -35.365 5.202  -5.820  1.00 38.27  ? 434 TRP A CZ3 1 
ATOM   2882 C  CH2 . TRP A 1 394 ? -34.341 4.777  -6.668  1.00 39.18  ? 434 TRP A CH2 1 
ATOM   2883 N  N   . PRO A 1 395 ? -42.095 5.602  -6.456  1.00 53.74  ? 435 PRO A N   1 
ATOM   2884 C  CA  . PRO A 1 395 ? -43.441 5.908  -5.970  1.00 55.46  ? 435 PRO A CA  1 
ATOM   2885 C  C   . PRO A 1 395 ? -43.785 7.356  -5.595  1.00 57.88  ? 435 PRO A C   1 
ATOM   2886 O  O   . PRO A 1 395 ? -44.875 7.835  -5.914  1.00 59.47  ? 435 PRO A O   1 
ATOM   2887 C  CB  . PRO A 1 395 ? -43.601 4.927  -4.818  1.00 54.48  ? 435 PRO A CB  1 
ATOM   2888 C  CG  . PRO A 1 395 ? -42.916 3.715  -5.368  1.00 52.95  ? 435 PRO A CG  1 
ATOM   2889 C  CD  . PRO A 1 395 ? -41.635 4.310  -5.912  1.00 53.78  ? 435 PRO A CD  1 
ATOM   2890 N  N   . ASN A 1 396 ? -42.879 8.006  -4.870  1.00 59.39  ? 436 ASN A N   1 
ATOM   2891 C  CA  . ASN A 1 396 ? -42.959 9.435  -4.621  1.00 61.54  ? 436 ASN A CA  1 
ATOM   2892 C  C   . ASN A 1 396 ? -42.177 10.137 -5.726  1.00 61.28  ? 436 ASN A C   1 
ATOM   2893 O  O   . ASN A 1 396 ? -41.110 10.698 -5.478  1.00 61.91  ? 436 ASN A O   1 
ATOM   2894 C  CB  . ASN A 1 396 ? -42.380 9.782  -3.251  1.00 64.51  ? 436 ASN A CB  1 
ATOM   2895 C  CG  . ASN A 1 396 ? -43.116 9.097  -2.117  1.00 67.00  ? 436 ASN A CG  1 
ATOM   2896 O  OD1 . ASN A 1 396 ? -44.071 8.352  -2.341  1.00 68.11  ? 436 ASN A OD1 1 
ATOM   2897 N  ND2 . ASN A 1 396 ? -42.675 9.345  -0.889  1.00 65.52  ? 436 ASN A ND2 1 
ATOM   2898 N  N   . PRO A 1 397 ? -42.695 10.070 -6.948  1.00 59.89  ? 437 PRO A N   1 
ATOM   2899 C  CA  . PRO A 1 397 ? -42.015 10.646 -8.115  1.00 58.56  ? 437 PRO A CA  1 
ATOM   2900 C  C   . PRO A 1 397 ? -41.764 12.148 -8.015  1.00 57.70  ? 437 PRO A C   1 
ATOM   2901 O  O   . PRO A 1 397 ? -40.670 12.608 -8.340  1.00 57.87  ? 437 PRO A O   1 
ATOM   2902 C  CB  . PRO A 1 397 ? -42.990 10.355 -9.259  1.00 58.44  ? 437 PRO A CB  1 
ATOM   2903 C  CG  . PRO A 1 397 ? -44.324 10.294 -8.603  1.00 58.57  ? 437 PRO A CG  1 
ATOM   2904 C  CD  . PRO A 1 397 ? -44.087 9.692  -7.247  1.00 58.73  ? 437 PRO A CD  1 
ATOM   2905 N  N   . GLU A 1 398 ? -42.769 12.898 -7.578  1.00 56.65  ? 438 GLU A N   1 
ATOM   2906 C  CA  . GLU A 1 398 ? -42.653 14.349 -7.483  1.00 55.72  ? 438 GLU A CA  1 
ATOM   2907 C  C   . GLU A 1 398 ? -42.332 14.834 -6.073  1.00 55.09  ? 438 GLU A C   1 
ATOM   2908 O  O   . GLU A 1 398 ? -42.289 16.038 -5.819  1.00 55.94  ? 438 GLU A O   1 
ATOM   2909 C  CB  . GLU A 1 398 ? -43.912 15.033 -8.023  1.00 57.35  ? 438 GLU A CB  1 
ATOM   2910 C  CG  . GLU A 1 398 ? -44.098 14.862 -9.522  1.00 59.07  ? 438 GLU A CG  1 
ATOM   2911 C  CD  . GLU A 1 398 ? -42.831 15.171 -10.300 1.00 60.60  ? 438 GLU A CD  1 
ATOM   2912 O  OE1 . GLU A 1 398 ? -42.829 14.988 -11.536 1.00 60.46  ? 438 GLU A OE1 1 
ATOM   2913 O  OE2 . GLU A 1 398 ? -41.837 15.595 -9.674  1.00 61.28  ? 438 GLU A OE2 1 
ATOM   2914 N  N   . ASN A 1 399 ? -42.108 13.897 -5.158  1.00 54.01  ? 439 ASN A N   1 
ATOM   2915 C  CA  . ASN A 1 399 ? -41.822 14.254 -3.774  1.00 54.28  ? 439 ASN A CA  1 
ATOM   2916 C  C   . ASN A 1 399 ? -40.407 13.895 -3.324  1.00 53.10  ? 439 ASN A C   1 
ATOM   2917 O  O   . ASN A 1 399 ? -39.942 12.769 -3.509  1.00 52.86  ? 439 ASN A O   1 
ATOM   2918 C  CB  . ASN A 1 399 ? -42.855 13.631 -2.832  1.00 56.25  ? 439 ASN A CB  1 
ATOM   2919 C  CG  . ASN A 1 399 ? -44.279 13.950 -3.240  1.00 57.21  ? 439 ASN A CG  1 
ATOM   2920 O  OD1 . ASN A 1 399 ? -44.796 15.026 -2.941  1.00 58.61  ? 439 ASN A OD1 1 
ATOM   2921 N  ND2 . ASN A 1 399 ? -44.925 13.008 -3.919  1.00 56.71  ? 439 ASN A ND2 1 
ATOM   2922 N  N   . PHE A 1 400 ? -39.733 14.874 -2.730  1.00 51.55  ? 440 PHE A N   1 
ATOM   2923 C  CA  . PHE A 1 400 ? -38.366 14.710 -2.239  1.00 50.77  ? 440 PHE A CA  1 
ATOM   2924 C  C   . PHE A 1 400 ? -38.300 13.856 -0.948  1.00 50.97  ? 440 PHE A C   1 
ATOM   2925 O  O   . PHE A 1 400 ? -38.422 14.375 0.159   1.00 51.02  ? 440 PHE A O   1 
ATOM   2926 C  CB  . PHE A 1 400 ? -37.756 16.088 -1.988  1.00 47.13  ? 440 PHE A CB  1 
ATOM   2927 C  CG  . PHE A 1 400 ? -36.322 16.038 -1.592  1.00 45.24  ? 440 PHE A CG  1 
ATOM   2928 C  CD1 . PHE A 1 400 ? -35.358 15.557 -2.482  1.00 42.99  ? 440 PHE A CD1 1 
ATOM   2929 C  CD2 . PHE A 1 400 ? -35.922 16.467 -0.329  1.00 44.41  ? 440 PHE A CD2 1 
ATOM   2930 C  CE1 . PHE A 1 400 ? -34.013 15.503 -2.123  1.00 40.26  ? 440 PHE A CE1 1 
ATOM   2931 C  CE2 . PHE A 1 400 ? -34.571 16.417 0.041   1.00 43.92  ? 440 PHE A CE2 1 
ATOM   2932 C  CZ  . PHE A 1 400 ? -33.615 15.929 -0.867  1.00 40.53  ? 440 PHE A CZ  1 
ATOM   2933 N  N   . ASP A 1 401 ? -38.079 12.553 -1.096  1.00 50.62  ? 441 ASP A N   1 
ATOM   2934 C  CA  . ASP A 1 401 ? -38.046 11.659 0.059   1.00 50.33  ? 441 ASP A CA  1 
ATOM   2935 C  C   . ASP A 1 401 ? -36.699 10.955 0.276   1.00 49.43  ? 441 ASP A C   1 
ATOM   2936 O  O   . ASP A 1 401 ? -36.485 9.842  -0.197  1.00 50.83  ? 441 ASP A O   1 
ATOM   2937 C  CB  . ASP A 1 401 ? -39.142 10.596 -0.093  1.00 51.34  ? 441 ASP A CB  1 
ATOM   2938 C  CG  . ASP A 1 401 ? -39.635 10.057 1.244   1.00 53.30  ? 441 ASP A CG  1 
ATOM   2939 O  OD1 . ASP A 1 401 ? -38.809 9.885  2.184   1.00 53.91  ? 441 ASP A OD1 1 
ATOM   2940 O  OD2 . ASP A 1 401 ? -40.858 9.791  1.344   1.00 54.01  ? 441 ASP A OD2 1 
ATOM   2941 N  N   . PRO A 1 402 ? -35.779 11.577 1.014   1.00 47.05  ? 442 PRO A N   1 
ATOM   2942 C  CA  . PRO A 1 402 ? -34.509 10.877 1.200   1.00 46.52  ? 442 PRO A CA  1 
ATOM   2943 C  C   . PRO A 1 402 ? -34.644 9.488  1.820   1.00 46.10  ? 442 PRO A C   1 
ATOM   2944 O  O   . PRO A 1 402 ? -33.828 8.608  1.565   1.00 45.18  ? 442 PRO A O   1 
ATOM   2945 C  CB  . PRO A 1 402 ? -33.725 11.831 2.080   1.00 45.66  ? 442 PRO A CB  1 
ATOM   2946 C  CG  . PRO A 1 402 ? -34.201 13.154 1.611   1.00 46.45  ? 442 PRO A CG  1 
ATOM   2947 C  CD  . PRO A 1 402 ? -35.691 12.964 1.488   1.00 46.13  ? 442 PRO A CD  1 
ATOM   2948 N  N   . ALA A 1 403 ? -35.677 9.292  2.633   1.00 47.21  ? 443 ALA A N   1 
ATOM   2949 C  CA  . ALA A 1 403 ? -35.882 8.005  3.291   1.00 46.99  ? 443 ALA A CA  1 
ATOM   2950 C  C   . ALA A 1 403 ? -36.118 6.936  2.228   1.00 47.24  ? 443 ALA A C   1 
ATOM   2951 O  O   . ALA A 1 403 ? -36.030 5.735  2.483   1.00 48.14  ? 443 ALA A O   1 
ATOM   2952 C  CB  . ALA A 1 403 ? -37.055 8.090  4.235   1.00 45.45  ? 443 ALA A CB  1 
ATOM   2953 N  N   . ARG A 1 404 ? -36.399 7.401  1.024   1.00 46.32  ? 444 ARG A N   1 
ATOM   2954 C  CA  . ARG A 1 404 ? -36.641 6.536  -0.104  1.00 46.51  ? 444 ARG A CA  1 
ATOM   2955 C  C   . ARG A 1 404 ? -35.468 5.583  -0.329  1.00 49.32  ? 444 ARG A C   1 
ATOM   2956 O  O   . ARG A 1 404 ? -35.635 4.550  -0.977  1.00 51.19  ? 444 ARG A O   1 
ATOM   2957 C  CB  . ARG A 1 404 ? -36.847 7.403  -1.334  1.00 44.39  ? 444 ARG A CB  1 
ATOM   2958 C  CG  . ARG A 1 404 ? -37.141 6.671  -2.590  1.00 44.22  ? 444 ARG A CG  1 
ATOM   2959 C  CD  . ARG A 1 404 ? -37.041 7.616  -3.755  1.00 41.82  ? 444 ARG A CD  1 
ATOM   2960 N  NE  . ARG A 1 404 ? -37.956 8.746  -3.648  1.00 40.77  ? 444 ARG A NE  1 
ATOM   2961 C  CZ  . ARG A 1 404 ? -39.264 8.700  -3.887  1.00 39.42  ? 444 ARG A CZ  1 
ATOM   2962 N  NH1 . ARG A 1 404 ? -39.849 7.567  -4.250  1.00 40.76  ? 444 ARG A NH1 1 
ATOM   2963 N  NH2 . ARG A 1 404 ? -39.988 9.805  -3.779  1.00 38.61  ? 444 ARG A NH2 1 
ATOM   2964 N  N   . PHE A 1 405 ? -34.292 5.921  0.211   1.00 50.81  ? 445 PHE A N   1 
ATOM   2965 C  CA  . PHE A 1 405 ? -33.069 5.113  0.045   1.00 51.80  ? 445 PHE A CA  1 
ATOM   2966 C  C   . PHE A 1 405 ? -32.609 4.430  1.317   1.00 53.75  ? 445 PHE A C   1 
ATOM   2967 O  O   . PHE A 1 405 ? -31.598 3.723  1.328   1.00 53.67  ? 445 PHE A O   1 
ATOM   2968 C  CB  . PHE A 1 405 ? -31.920 5.992  -0.454  1.00 50.17  ? 445 PHE A CB  1 
ATOM   2969 C  CG  . PHE A 1 405 ? -32.126 6.516  -1.831  1.00 48.00  ? 445 PHE A CG  1 
ATOM   2970 C  CD1 . PHE A 1 405 ? -31.929 5.700  -2.928  1.00 48.21  ? 445 PHE A CD1 1 
ATOM   2971 C  CD2 . PHE A 1 405 ? -32.562 7.809  -2.033  1.00 46.76  ? 445 PHE A CD2 1 
ATOM   2972 C  CE1 . PHE A 1 405 ? -32.168 6.175  -4.202  1.00 47.39  ? 445 PHE A CE1 1 
ATOM   2973 C  CE2 . PHE A 1 405 ? -32.803 8.281  -3.307  1.00 45.52  ? 445 PHE A CE2 1 
ATOM   2974 C  CZ  . PHE A 1 405 ? -32.607 7.471  -4.384  1.00 44.66  ? 445 PHE A CZ  1 
ATOM   2975 N  N   . LEU A 1 406 ? -33.344 4.664  2.397   1.00 56.57  ? 446 LEU A N   1 
ATOM   2976 C  CA  . LEU A 1 406 ? -32.998 4.086  3.679   1.00 57.44  ? 446 LEU A CA  1 
ATOM   2977 C  C   . LEU A 1 406 ? -33.592 2.706  3.877   1.00 59.84  ? 446 LEU A C   1 
ATOM   2978 O  O   . LEU A 1 406 ? -34.783 2.471  3.652   1.00 59.94  ? 446 LEU A O   1 
ATOM   2979 C  CB  . LEU A 1 406 ? -33.406 5.027  4.810   1.00 54.11  ? 446 LEU A CB  1 
ATOM   2980 C  CG  . LEU A 1 406 ? -32.364 6.136  4.987   1.00 53.96  ? 446 LEU A CG  1 
ATOM   2981 C  CD1 . LEU A 1 406 ? -32.730 7.022  6.169   1.00 53.47  ? 446 LEU A CD1 1 
ATOM   2982 C  CD2 . LEU A 1 406 ? -30.985 5.507  5.199   1.00 51.47  ? 446 LEU A CD2 1 
ATOM   2983 N  N   . ASP A 1 407 ? -32.705 1.803  4.276   1.00 62.69  ? 447 ASP A N   1 
ATOM   2984 C  CA  . ASP A 1 407 ? -32.983 0.403  4.535   1.00 65.56  ? 447 ASP A CA  1 
ATOM   2985 C  C   . ASP A 1 407 ? -33.821 0.296  5.810   1.00 67.56  ? 447 ASP A C   1 
ATOM   2986 O  O   . ASP A 1 407 ? -33.763 1.176  6.671   1.00 67.40  ? 447 ASP A O   1 
ATOM   2987 C  CB  . ASP A 1 407 ? -31.639 -0.300 4.700   1.00 66.71  ? 447 ASP A CB  1 
ATOM   2988 C  CG  . ASP A 1 407 ? -31.764 -1.771 4.865   1.00 69.16  ? 447 ASP A CG  1 
ATOM   2989 O  OD1 . ASP A 1 407 ? -31.989 -2.471 3.855   1.00 70.06  ? 447 ASP A OD1 1 
ATOM   2990 O  OD2 . ASP A 1 407 ? -31.628 -2.225 6.019   1.00 71.51  ? 447 ASP A OD2 1 
ATOM   2991 N  N   . LYS A 1 408 ? -34.595 -0.779 5.933   1.00 69.47  ? 448 LYS A N   1 
ATOM   2992 C  CA  . LYS A 1 408 ? -35.449 -0.979 7.109   1.00 71.83  ? 448 LYS A CA  1 
ATOM   2993 C  C   . LYS A 1 408 ? -34.792 -0.689 8.461   1.00 72.67  ? 448 LYS A C   1 
ATOM   2994 O  O   . LYS A 1 408 ? -35.482 -0.313 9.413   1.00 73.41  ? 448 LYS A O   1 
ATOM   2995 C  CB  . LYS A 1 408 ? -36.024 -2.402 7.129   1.00 72.74  ? 448 LYS A CB  1 
ATOM   2996 C  CG  . LYS A 1 408 ? -37.152 -2.649 6.117   1.00 74.51  ? 448 LYS A CG  1 
ATOM   2997 C  CD  . LYS A 1 408 ? -36.696 -2.429 4.671   1.00 75.49  ? 448 LYS A CD  1 
ATOM   2998 C  CE  . LYS A 1 408 ? -35.530 -3.350 4.313   1.00 75.96  ? 448 LYS A CE  1 
ATOM   2999 N  NZ  . LYS A 1 408 ? -35.893 -4.795 4.496   1.00 75.97  ? 448 LYS A NZ  1 
ATOM   3000 N  N   . ASP A 1 409 ? -33.474 -0.858 8.560   1.00 72.83  ? 449 ASP A N   1 
ATOM   3001 C  CA  . ASP A 1 409 ? -32.800 -0.590 9.826   1.00 72.40  ? 449 ASP A CA  1 
ATOM   3002 C  C   . ASP A 1 409 ? -31.937 0.663  9.790   1.00 72.00  ? 449 ASP A C   1 
ATOM   3003 O  O   . ASP A 1 409 ? -30.967 0.772  10.541  1.00 71.13  ? 449 ASP A O   1 
ATOM   3004 C  CB  . ASP A 1 409 ? -31.959 -1.793 10.262  1.00 73.63  ? 449 ASP A CB  1 
ATOM   3005 C  CG  . ASP A 1 409 ? -31.923 -2.892 9.218   1.00 75.74  ? 449 ASP A CG  1 
ATOM   3006 O  OD1 . ASP A 1 409 ? -33.014 -3.380 8.839   1.00 75.62  ? 449 ASP A OD1 1 
ATOM   3007 O  OD2 . ASP A 1 409 ? -30.804 -3.265 8.781   1.00 76.52  ? 449 ASP A OD2 1 
ATOM   3008 N  N   . GLY A 1 410 ? -32.289 1.594  8.900   1.00 71.68  ? 450 GLY A N   1 
ATOM   3009 C  CA  . GLY A 1 410 ? -31.575 2.861  8.797   1.00 70.65  ? 450 GLY A CA  1 
ATOM   3010 C  C   . GLY A 1 410 ? -30.320 3.011  7.950   1.00 69.31  ? 450 GLY A C   1 
ATOM   3011 O  O   . GLY A 1 410 ? -29.737 4.091  7.917   1.00 68.35  ? 450 GLY A O   1 
ATOM   3012 N  N   . LEU A 1 411 ? -29.894 1.957  7.268   1.00 69.49  ? 451 LEU A N   1 
ATOM   3013 C  CA  . LEU A 1 411 ? -28.697 2.034  6.432   1.00 70.25  ? 451 LEU A CA  1 
ATOM   3014 C  C   . LEU A 1 411 ? -29.093 2.141  4.946   1.00 71.07  ? 451 LEU A C   1 
ATOM   3015 O  O   . LEU A 1 411 ? -30.248 1.899  4.594   1.00 71.20  ? 451 LEU A O   1 
ATOM   3016 C  CB  . LEU A 1 411 ? -27.842 0.797  6.685   1.00 69.36  ? 451 LEU A CB  1 
ATOM   3017 C  CG  . LEU A 1 411 ? -27.644 0.559  8.189   1.00 69.01  ? 451 LEU A CG  1 
ATOM   3018 C  CD1 . LEU A 1 411 ? -27.177 -0.861 8.434   1.00 67.42  ? 451 LEU A CD1 1 
ATOM   3019 C  CD2 . LEU A 1 411 ? -26.650 1.572  8.751   1.00 68.14  ? 451 LEU A CD2 1 
ATOM   3020 N  N   . ILE A 1 412 ? -28.165 2.522  4.070   1.00 70.81  ? 452 ILE A N   1 
ATOM   3021 C  CA  . ILE A 1 412 ? -28.523 2.628  2.655   1.00 70.54  ? 452 ILE A CA  1 
ATOM   3022 C  C   . ILE A 1 412 ? -28.351 1.301  1.958   1.00 70.41  ? 452 ILE A C   1 
ATOM   3023 O  O   . ILE A 1 412 ? -27.495 0.500  2.328   1.00 70.58  ? 452 ILE A O   1 
ATOM   3024 C  CB  . ILE A 1 412 ? -27.659 3.637  1.888   1.00 70.95  ? 452 ILE A CB  1 
ATOM   3025 C  CG1 . ILE A 1 412 ? -26.178 3.347  2.155   1.00 70.25  ? 452 ILE A CG1 1 
ATOM   3026 C  CG2 . ILE A 1 412 ? -28.089 5.062  2.225   1.00 70.56  ? 452 ILE A CG2 1 
ATOM   3027 C  CD1 . ILE A 1 412 ? -25.244 4.035  1.194   1.00 70.26  ? 452 ILE A CD1 1 
ATOM   3028 N  N   . ASN A 1 413 ? -29.156 1.083  0.929   1.00 69.98  ? 453 ASN A N   1 
ATOM   3029 C  CA  . ASN A 1 413 ? -29.094 -0.152 0.163   1.00 70.05  ? 453 ASN A CA  1 
ATOM   3030 C  C   . ASN A 1 413 ? -28.691 0.139  -1.275  1.00 69.34  ? 453 ASN A C   1 
ATOM   3031 O  O   . ASN A 1 413 ? -29.520 0.543  -2.086  1.00 68.98  ? 453 ASN A O   1 
ATOM   3032 C  CB  . ASN A 1 413 ? -30.450 -0.836 0.176   1.00 70.27  ? 453 ASN A CB  1 
ATOM   3033 C  CG  . ASN A 1 413 ? -31.551 0.082  -0.262  1.00 70.37  ? 453 ASN A CG  1 
ATOM   3034 O  OD1 . ASN A 1 413 ? -31.593 1.245  0.132   1.00 71.74  ? 453 ASN A OD1 1 
ATOM   3035 N  ND2 . ASN A 1 413 ? -32.458 -0.431 -1.089  1.00 70.31  ? 453 ASN A ND2 1 
ATOM   3036 N  N   . LYS A 1 414 ? -27.416 -0.074 -1.582  1.00 68.68  ? 454 LYS A N   1 
ATOM   3037 C  CA  . LYS A 1 414 ? -26.892 0.168  -2.921  1.00 67.87  ? 454 LYS A CA  1 
ATOM   3038 C  C   . LYS A 1 414 ? -27.904 -0.175 -4.011  1.00 67.23  ? 454 LYS A C   1 
ATOM   3039 O  O   . LYS A 1 414 ? -27.976 0.506  -5.034  1.00 67.26  ? 454 LYS A O   1 
ATOM   3040 C  CB  . LYS A 1 414 ? -25.599 -0.622 -3.139  1.00 68.42  ? 454 LYS A CB  1 
ATOM   3041 C  CG  . LYS A 1 414 ? -24.490 -0.279 -2.158  1.00 68.82  ? 454 LYS A CG  1 
ATOM   3042 C  CD  . LYS A 1 414 ? -23.141 -0.774 -2.656  1.00 69.93  ? 454 LYS A CD  1 
ATOM   3043 C  CE  . LYS A 1 414 ? -22.589 0.132  -3.745  1.00 69.47  ? 454 LYS A CE  1 
ATOM   3044 N  NZ  . LYS A 1 414 ? -22.038 1.398  -3.189  1.00 67.86  ? 454 LYS A NZ  1 
ATOM   3045 N  N   . ASP A 1 415 ? -28.680 -1.232 -3.793  1.00 67.70  ? 455 ASP A N   1 
ATOM   3046 C  CA  . ASP A 1 415 ? -29.672 -1.658 -4.778  1.00 68.81  ? 455 ASP A CA  1 
ATOM   3047 C  C   . ASP A 1 415 ? -30.642 -0.583 -5.262  1.00 67.34  ? 455 ASP A C   1 
ATOM   3048 O  O   . ASP A 1 415 ? -31.227 -0.708 -6.340  1.00 67.83  ? 455 ASP A O   1 
ATOM   3049 C  CB  . ASP A 1 415 ? -30.431 -2.880 -4.249  1.00 71.26  ? 455 ASP A CB  1 
ATOM   3050 C  CG  . ASP A 1 415 ? -29.516 -4.088 -4.074  1.00 74.55  ? 455 ASP A CG  1 
ATOM   3051 O  OD1 . ASP A 1 415 ? -28.811 -4.421 -5.056  1.00 76.04  ? 455 ASP A OD1 1 
ATOM   3052 O  OD2 . ASP A 1 415 ? -29.484 -4.695 -2.972  1.00 75.82  ? 455 ASP A OD2 1 
ATOM   3053 N  N   . LEU A 1 416 ? -30.817 0.467  -4.468  1.00 65.65  ? 456 LEU A N   1 
ATOM   3054 C  CA  . LEU A 1 416 ? -31.695 1.571  -4.846  1.00 63.60  ? 456 LEU A CA  1 
ATOM   3055 C  C   . LEU A 1 416 ? -30.802 2.762  -5.138  1.00 61.86  ? 456 LEU A C   1 
ATOM   3056 O  O   . LEU A 1 416 ? -30.979 3.456  -6.136  1.00 60.92  ? 456 LEU A O   1 
ATOM   3057 C  CB  . LEU A 1 416 ? -32.675 1.918  -3.714  1.00 63.51  ? 456 LEU A CB  1 
ATOM   3058 C  CG  . LEU A 1 416 ? -33.989 1.131  -3.609  1.00 63.77  ? 456 LEU A CG  1 
ATOM   3059 C  CD1 . LEU A 1 416 ? -34.869 1.379  -4.841  1.00 63.19  ? 456 LEU A CD1 1 
ATOM   3060 C  CD2 . LEU A 1 416 ? -33.677 -0.348 -3.477  1.00 65.05  ? 456 LEU A CD2 1 
ATOM   3061 N  N   . THR A 1 417 ? -29.831 2.975  -4.260  1.00 60.50  ? 457 THR A N   1 
ATOM   3062 C  CA  . THR A 1 417 ? -28.901 4.070  -4.412  1.00 60.21  ? 457 THR A CA  1 
ATOM   3063 C  C   . THR A 1 417 ? -28.213 3.973  -5.764  1.00 59.92  ? 457 THR A C   1 
ATOM   3064 O  O   . THR A 1 417 ? -27.796 4.980  -6.328  1.00 61.05  ? 457 THR A O   1 
ATOM   3065 C  CB  . THR A 1 417 ? -27.829 4.050  -3.319  1.00 60.38  ? 457 THR A CB  1 
ATOM   3066 O  OG1 . THR A 1 417 ? -27.241 5.353  -3.205  1.00 62.65  ? 457 THR A OG1 1 
ATOM   3067 C  CG2 . THR A 1 417 ? -26.733 3.059  -3.666  1.00 60.68  ? 457 THR A CG2 1 
ATOM   3068 N  N   . SER A 1 418 ? -28.097 2.760  -6.289  1.00 58.84  ? 458 SER A N   1 
ATOM   3069 C  CA  . SER A 1 418 ? -27.444 2.565  -7.573  1.00 57.11  ? 458 SER A CA  1 
ATOM   3070 C  C   . SER A 1 418 ? -28.471 2.384  -8.664  1.00 55.70  ? 458 SER A C   1 
ATOM   3071 O  O   . SER A 1 418 ? -28.159 1.873  -9.726  1.00 54.86  ? 458 SER A O   1 
ATOM   3072 C  CB  . SER A 1 418 ? -26.563 1.331  -7.551  1.00 57.96  ? 458 SER A CB  1 
ATOM   3073 O  OG  . SER A 1 418 ? -27.310 0.204  -7.984  1.00 59.30  ? 458 SER A OG  1 
ATOM   3074 N  N   . ARG A 1 419 ? -29.705 2.779  -8.400  1.00 55.35  ? 459 ARG A N   1 
ATOM   3075 C  CA  . ARG A 1 419 ? -30.737 2.648  -9.417  1.00 55.51  ? 459 ARG A CA  1 
ATOM   3076 C  C   . ARG A 1 419 ? -30.966 4.029  -10.028 1.00 52.58  ? 459 ARG A C   1 
ATOM   3077 O  O   . ARG A 1 419 ? -31.659 4.180  -11.035 1.00 51.46  ? 459 ARG A O   1 
ATOM   3078 C  CB  . ARG A 1 419 ? -32.030 2.112  -8.796  1.00 59.41  ? 459 ARG A CB  1 
ATOM   3079 C  CG  . ARG A 1 419 ? -32.792 1.115  -9.685  1.00 64.56  ? 459 ARG A CG  1 
ATOM   3080 C  CD  . ARG A 1 419 ? -32.702 -0.326 -9.152  1.00 68.83  ? 459 ARG A CD  1 
ATOM   3081 N  NE  . ARG A 1 419 ? -31.399 -0.951 -9.394  1.00 72.50  ? 459 ARG A NE  1 
ATOM   3082 C  CZ  . ARG A 1 419 ? -31.028 -2.135 -8.901  1.00 73.88  ? 459 ARG A CZ  1 
ATOM   3083 N  NH1 . ARG A 1 419 ? -31.860 -2.828 -8.129  1.00 73.70  ? 459 ARG A NH1 1 
ATOM   3084 N  NH2 . ARG A 1 419 ? -29.824 -2.628 -9.181  1.00 73.50  ? 459 ARG A NH2 1 
ATOM   3085 N  N   . VAL A 1 420 ? -30.354 5.029  -9.402  1.00 50.58  ? 460 VAL A N   1 
ATOM   3086 C  CA  . VAL A 1 420 ? -30.448 6.411  -9.841  1.00 48.04  ? 460 VAL A CA  1 
ATOM   3087 C  C   . VAL A 1 420 ? -29.509 6.660  -11.031 1.00 46.51  ? 460 VAL A C   1 
ATOM   3088 O  O   . VAL A 1 420 ? -28.357 6.242  -11.028 1.00 45.92  ? 460 VAL A O   1 
ATOM   3089 C  CB  . VAL A 1 420 ? -30.091 7.362  -8.677  1.00 48.21  ? 460 VAL A CB  1 
ATOM   3090 C  CG1 . VAL A 1 420 ? -30.206 8.820  -9.110  1.00 48.91  ? 460 VAL A CG1 1 
ATOM   3091 C  CG2 . VAL A 1 420 ? -31.020 7.106  -7.522  1.00 47.07  ? 460 VAL A CG2 1 
ATOM   3092 N  N   . MET A 1 421 ? -30.008 7.348  -12.051 1.00 44.76  ? 461 MET A N   1 
ATOM   3093 C  CA  . MET A 1 421 ? -29.195 7.613  -13.234 1.00 43.71  ? 461 MET A CA  1 
ATOM   3094 C  C   . MET A 1 421 ? -28.931 9.098  -13.465 1.00 42.64  ? 461 MET A C   1 
ATOM   3095 O  O   . MET A 1 421 ? -29.828 9.839  -13.868 1.00 42.34  ? 461 MET A O   1 
ATOM   3096 C  CB  . MET A 1 421 ? -29.848 7.001  -14.476 1.00 46.02  ? 461 MET A CB  1 
ATOM   3097 C  CG  . MET A 1 421 ? -28.949 6.976  -15.701 1.00 48.78  ? 461 MET A CG  1 
ATOM   3098 S  SD  . MET A 1 421 ? -29.681 6.080  -17.084 1.00 54.24  ? 461 MET A SD  1 
ATOM   3099 C  CE  . MET A 1 421 ? -29.398 4.386  -16.579 1.00 53.68  ? 461 MET A CE  1 
ATOM   3100 N  N   . ILE A 1 422 ? -27.697 9.528  -13.216 1.00 41.12  ? 462 ILE A N   1 
ATOM   3101 C  CA  . ILE A 1 422 ? -27.328 10.918 -13.444 1.00 39.39  ? 462 ILE A CA  1 
ATOM   3102 C  C   . ILE A 1 422 ? -25.957 11.012 -14.155 1.00 38.55  ? 462 ILE A C   1 
ATOM   3103 O  O   . ILE A 1 422 ? -25.678 11.991 -14.865 1.00 37.84  ? 462 ILE A O   1 
ATOM   3104 C  CB  . ILE A 1 422 ? -27.331 11.715 -12.100 1.00 38.65  ? 462 ILE A CB  1 
ATOM   3105 C  CG1 . ILE A 1 422 ? -27.342 13.212 -12.398 1.00 38.39  ? 462 ILE A CG1 1 
ATOM   3106 C  CG2 . ILE A 1 422 ? -26.132 11.324 -11.223 1.00 37.33  ? 462 ILE A CG2 1 
ATOM   3107 C  CD1 . ILE A 1 422 ? -27.787 14.060 -11.234 1.00 38.29  ? 462 ILE A CD1 1 
ATOM   3108 N  N   . PHE A 1 423 ? -25.125 9.977  -13.986 1.00 35.88  ? 463 PHE A N   1 
ATOM   3109 C  CA  . PHE A 1 423 ? -23.803 9.933  -14.606 1.00 32.88  ? 463 PHE A CA  1 
ATOM   3110 C  C   . PHE A 1 423 ? -23.811 9.151  -15.894 1.00 32.38  ? 463 PHE A C   1 
ATOM   3111 O  O   . PHE A 1 423 ? -22.762 8.865  -16.449 1.00 32.58  ? 463 PHE A O   1 
ATOM   3112 C  CB  . PHE A 1 423 ? -22.788 9.296  -13.673 1.00 32.25  ? 463 PHE A CB  1 
ATOM   3113 C  CG  . PHE A 1 423 ? -22.452 10.134 -12.482 1.00 32.92  ? 463 PHE A CG  1 
ATOM   3114 C  CD1 . PHE A 1 423 ? -22.937 9.800  -11.228 1.00 32.59  ? 463 PHE A CD1 1 
ATOM   3115 C  CD2 . PHE A 1 423 ? -21.653 11.271 -12.621 1.00 32.50  ? 463 PHE A CD2 1 
ATOM   3116 C  CE1 . PHE A 1 423 ? -22.634 10.588 -10.124 1.00 34.74  ? 463 PHE A CE1 1 
ATOM   3117 C  CE2 . PHE A 1 423 ? -21.340 12.065 -11.526 1.00 32.97  ? 463 PHE A CE2 1 
ATOM   3118 C  CZ  . PHE A 1 423 ? -21.827 11.733 -10.274 1.00 34.57  ? 463 PHE A CZ  1 
ATOM   3119 N  N   . SER A 1 424 ? -25.010 8.820  -16.360 1.00 32.62  ? 464 SER A N   1 
ATOM   3120 C  CA  . SER A 1 424 ? -25.172 8.058  -17.584 1.00 31.16  ? 464 SER A CA  1 
ATOM   3121 C  C   . SER A 1 424 ? -24.620 6.655  -17.392 1.00 29.92  ? 464 SER A C   1 
ATOM   3122 O  O   . SER A 1 424 ? -24.310 6.242  -16.275 1.00 29.13  ? 464 SER A O   1 
ATOM   3123 C  CB  . SER A 1 424 ? -24.458 8.751  -18.746 1.00 33.17  ? 464 SER A CB  1 
ATOM   3124 O  OG  . SER A 1 424 ? -24.694 8.072  -19.967 1.00 34.12  ? 464 SER A OG  1 
ATOM   3125 N  N   . VAL A 1 425 ? -24.500 5.929  -18.494 1.00 29.26  ? 465 VAL A N   1 
ATOM   3126 C  CA  . VAL A 1 425 ? -23.980 4.564  -18.473 1.00 27.74  ? 465 VAL A CA  1 
ATOM   3127 C  C   . VAL A 1 425 ? -23.393 4.262  -19.845 1.00 28.77  ? 465 VAL A C   1 
ATOM   3128 O  O   . VAL A 1 425 ? -23.817 4.835  -20.841 1.00 29.19  ? 465 VAL A O   1 
ATOM   3129 C  CB  . VAL A 1 425 ? -25.115 3.542  -18.260 1.00 26.55  ? 465 VAL A CB  1 
ATOM   3130 C  CG1 . VAL A 1 425 ? -25.957 3.880  -17.008 1.00 24.10  ? 465 VAL A CG1 1 
ATOM   3131 C  CG2 . VAL A 1 425 ? -25.997 3.527  -19.515 1.00 26.55  ? 465 VAL A CG2 1 
ATOM   3132 N  N   . GLY A 1 426 ? -22.436 3.346  -19.913 1.00 29.97  ? 466 GLY A N   1 
ATOM   3133 C  CA  . GLY A 1 426 ? -21.891 3.003  -21.212 1.00 31.30  ? 466 GLY A CA  1 
ATOM   3134 C  C   . GLY A 1 426 ? -20.546 3.614  -21.507 1.00 33.38  ? 466 GLY A C   1 
ATOM   3135 O  O   . GLY A 1 426 ? -19.891 4.123  -20.590 1.00 30.23  ? 466 GLY A O   1 
ATOM   3136 N  N   . LYS A 1 427 ? -20.146 3.572  -22.787 1.00 35.36  ? 467 LYS A N   1 
ATOM   3137 C  CA  . LYS A 1 427 ? -18.844 4.095  -23.208 1.00 37.64  ? 467 LYS A CA  1 
ATOM   3138 C  C   . LYS A 1 427 ? -18.634 5.553  -22.835 1.00 37.78  ? 467 LYS A C   1 
ATOM   3139 O  O   . LYS A 1 427 ? -17.531 5.945  -22.453 1.00 38.27  ? 467 LYS A O   1 
ATOM   3140 C  CB  . LYS A 1 427 ? -18.664 3.985  -24.716 1.00 40.28  ? 467 LYS A CB  1 
ATOM   3141 C  CG  . LYS A 1 427 ? -18.780 2.608  -25.310 1.00 44.14  ? 467 LYS A CG  1 
ATOM   3142 C  CD  . LYS A 1 427 ? -17.659 1.715  -24.882 1.00 46.58  ? 467 LYS A CD  1 
ATOM   3143 C  CE  . LYS A 1 427 ? -18.136 0.826  -23.765 1.00 50.18  ? 467 LYS A CE  1 
ATOM   3144 N  NZ  . LYS A 1 427 ? -19.328 0.013  -24.197 1.00 52.22  ? 467 LYS A NZ  1 
ATOM   3145 N  N   . ARG A 1 428 ? -19.698 6.343  -22.946 1.00 37.20  ? 468 ARG A N   1 
ATOM   3146 C  CA  . ARG A 1 428 ? -19.639 7.769  -22.666 1.00 37.41  ? 468 ARG A CA  1 
ATOM   3147 C  C   . ARG A 1 428 ? -20.024 8.194  -21.267 1.00 38.12  ? 468 ARG A C   1 
ATOM   3148 O  O   . ARG A 1 428 ? -20.292 9.378  -21.050 1.00 39.58  ? 468 ARG A O   1 
ATOM   3149 C  CB  . ARG A 1 428 ? -20.521 8.525  -23.659 1.00 36.62  ? 468 ARG A CB  1 
ATOM   3150 C  CG  . ARG A 1 428 ? -20.080 8.397  -25.093 1.00 34.65  ? 468 ARG A CG  1 
ATOM   3151 C  CD  . ARG A 1 428 ? -18.618 8.765  -25.193 1.00 37.16  ? 468 ARG A CD  1 
ATOM   3152 N  NE  . ARG A 1 428 ? -18.264 9.159  -26.546 1.00 38.51  ? 468 ARG A NE  1 
ATOM   3153 C  CZ  . ARG A 1 428 ? -17.740 10.338 -26.870 1.00 39.00  ? 468 ARG A CZ  1 
ATOM   3154 N  NH1 . ARG A 1 428 ? -17.493 11.253 -25.936 1.00 36.68  ? 468 ARG A NH1 1 
ATOM   3155 N  NH2 . ARG A 1 428 ? -17.490 10.606 -28.147 1.00 41.44  ? 468 ARG A NH2 1 
ATOM   3156 N  N   . ARG A 1 429 ? -20.052 7.257  -20.319 1.00 38.00  ? 469 ARG A N   1 
ATOM   3157 C  CA  . ARG A 1 429 ? -20.438 7.594  -18.950 1.00 37.09  ? 469 ARG A CA  1 
ATOM   3158 C  C   . ARG A 1 429 ? -19.394 8.449  -18.257 1.00 35.66  ? 469 ARG A C   1 
ATOM   3159 O  O   . ARG A 1 429 ? -18.205 8.324  -18.510 1.00 35.80  ? 469 ARG A O   1 
ATOM   3160 C  CB  . ARG A 1 429 ? -20.720 6.333  -18.122 1.00 39.24  ? 469 ARG A CB  1 
ATOM   3161 C  CG  . ARG A 1 429 ? -19.529 5.485  -17.720 1.00 41.89  ? 469 ARG A CG  1 
ATOM   3162 C  CD  . ARG A 1 429 ? -19.941 4.584  -16.566 1.00 48.95  ? 469 ARG A CD  1 
ATOM   3163 N  NE  . ARG A 1 429 ? -20.523 5.356  -15.449 1.00 55.85  ? 469 ARG A NE  1 
ATOM   3164 C  CZ  . ARG A 1 429 ? -21.437 4.891  -14.583 1.00 58.23  ? 469 ARG A CZ  1 
ATOM   3165 N  NH1 . ARG A 1 429 ? -21.894 3.642  -14.687 1.00 58.35  ? 469 ARG A NH1 1 
ATOM   3166 N  NH2 . ARG A 1 429 ? -21.910 5.677  -13.611 1.00 57.32  ? 469 ARG A NH2 1 
ATOM   3167 N  N   . CYS A 1 430 ? -19.853 9.356  -17.401 1.00 34.71  ? 470 CYS A N   1 
ATOM   3168 C  CA  . CYS A 1 430 ? -18.963 10.288 -16.712 1.00 34.03  ? 470 CYS A CA  1 
ATOM   3169 C  C   . CYS A 1 430 ? -17.686 9.623  -16.204 1.00 33.93  ? 470 CYS A C   1 
ATOM   3170 O  O   . CYS A 1 430 ? -17.723 8.505  -15.690 1.00 34.72  ? 470 CYS A O   1 
ATOM   3171 C  CB  . CYS A 1 430 ? -19.696 10.967 -15.552 1.00 31.61  ? 470 CYS A CB  1 
ATOM   3172 S  SG  . CYS A 1 430 ? -18.751 12.273 -14.733 1.00 31.53  ? 470 CYS A SG  1 
ATOM   3173 N  N   . ILE A 1 431 ? -16.559 10.317 -16.345 1.00 33.59  ? 471 ILE A N   1 
ATOM   3174 C  CA  . ILE A 1 431 ? -15.275 9.786  -15.861 1.00 34.80  ? 471 ILE A CA  1 
ATOM   3175 C  C   . ILE A 1 431 ? -14.915 10.322 -14.470 1.00 35.53  ? 471 ILE A C   1 
ATOM   3176 O  O   . ILE A 1 431 ? -13.944 9.875  -13.855 1.00 36.65  ? 471 ILE A O   1 
ATOM   3177 C  CB  . ILE A 1 431 ? -14.055 10.090 -16.818 1.00 33.76  ? 471 ILE A CB  1 
ATOM   3178 C  CG1 . ILE A 1 431 ? -13.781 11.606 -16.875 1.00 34.03  ? 471 ILE A CG1 1 
ATOM   3179 C  CG2 . ILE A 1 431 ? -14.291 9.514  -18.190 1.00 30.41  ? 471 ILE A CG2 1 
ATOM   3180 C  CD1 . ILE A 1 431 ? -12.502 11.975 -17.633 1.00 31.44  ? 471 ILE A CD1 1 
ATOM   3181 N  N   . GLY A 1 432 ? -15.681 11.282 -13.973 1.00 34.76  ? 472 GLY A N   1 
ATOM   3182 C  CA  . GLY A 1 432 ? -15.363 11.805 -12.664 1.00 34.65  ? 472 GLY A CA  1 
ATOM   3183 C  C   . GLY A 1 432 ? -16.473 11.581 -11.672 1.00 34.70  ? 472 GLY A C   1 
ATOM   3184 O  O   . GLY A 1 432 ? -16.776 12.465 -10.893 1.00 33.21  ? 472 GLY A O   1 
ATOM   3185 N  N   . GLU A 1 433 ? -17.064 10.390 -11.682 1.00 36.38  ? 473 GLU A N   1 
ATOM   3186 C  CA  . GLU A 1 433 ? -18.161 10.089 -10.788 1.00 36.96  ? 473 GLU A CA  1 
ATOM   3187 C  C   . GLU A 1 433 ? -17.795 9.973  -9.315  1.00 38.44  ? 473 GLU A C   1 
ATOM   3188 O  O   . GLU A 1 433 ? -18.402 10.620 -8.459  1.00 38.44  ? 473 GLU A O   1 
ATOM   3189 C  CB  . GLU A 1 433 ? -18.858 8.828  -11.240 1.00 38.30  ? 473 GLU A CB  1 
ATOM   3190 C  CG  . GLU A 1 433 ? -20.018 8.497  -10.352 1.00 44.18  ? 473 GLU A CG  1 
ATOM   3191 C  CD  . GLU A 1 433 ? -20.733 7.235  -10.764 1.00 48.16  ? 473 GLU A CD  1 
ATOM   3192 O  OE1 . GLU A 1 433 ? -21.721 6.875  -10.080 1.00 51.50  ? 473 GLU A OE1 1 
ATOM   3193 O  OE2 . GLU A 1 433 ? -20.318 6.604  -11.763 1.00 49.38  ? 473 GLU A OE2 1 
ATOM   3194 N  N   . GLU A 1 434 ? -16.816 9.143  -8.994  1.00 40.94  ? 474 GLU A N   1 
ATOM   3195 C  CA  . GLU A 1 434 ? -16.422 9.015  -7.599  1.00 42.82  ? 474 GLU A CA  1 
ATOM   3196 C  C   . GLU A 1 434 ? -15.910 10.341 -7.024  1.00 41.42  ? 474 GLU A C   1 
ATOM   3197 O  O   . GLU A 1 434 ? -16.150 10.661 -5.870  1.00 42.17  ? 474 GLU A O   1 
ATOM   3198 C  CB  . GLU A 1 434 ? -15.356 7.946  -7.441  1.00 45.70  ? 474 GLU A CB  1 
ATOM   3199 C  CG  . GLU A 1 434 ? -15.109 7.639  -5.981  1.00 54.40  ? 474 GLU A CG  1 
ATOM   3200 C  CD  . GLU A 1 434 ? -14.435 6.297  -5.776  1.00 59.31  ? 474 GLU A CD  1 
ATOM   3201 O  OE1 . GLU A 1 434 ? -14.995 5.276  -6.256  1.00 61.53  ? 474 GLU A OE1 1 
ATOM   3202 O  OE2 . GLU A 1 434 ? -13.356 6.268  -5.129  1.00 60.94  ? 474 GLU A OE2 1 
ATOM   3203 N  N   . LEU A 1 435 ? -15.192 11.107 -7.832  1.00 40.36  ? 475 LEU A N   1 
ATOM   3204 C  CA  . LEU A 1 435 ? -14.684 12.392 -7.391  1.00 38.18  ? 475 LEU A CA  1 
ATOM   3205 C  C   . LEU A 1 435 ? -15.851 13.303 -7.065  1.00 38.82  ? 475 LEU A C   1 
ATOM   3206 O  O   . LEU A 1 435 ? -15.826 14.011 -6.058  1.00 40.10  ? 475 LEU A O   1 
ATOM   3207 C  CB  . LEU A 1 435 ? -13.851 13.049 -8.474  1.00 35.41  ? 475 LEU A CB  1 
ATOM   3208 C  CG  . LEU A 1 435 ? -13.472 14.418 -7.961  1.00 33.54  ? 475 LEU A CG  1 
ATOM   3209 C  CD1 . LEU A 1 435 ? -12.726 14.228 -6.675  1.00 32.17  ? 475 LEU A CD1 1 
ATOM   3210 C  CD2 . LEU A 1 435 ? -12.643 15.170 -8.975  1.00 36.36  ? 475 LEU A CD2 1 
ATOM   3211 N  N   . SER A 1 436 ? -16.863 13.290 -7.932  1.00 38.72  ? 476 SER A N   1 
ATOM   3212 C  CA  . SER A 1 436 ? -18.062 14.099 -7.746  1.00 38.30  ? 476 SER A CA  1 
ATOM   3213 C  C   . SER A 1 436 ? -18.723 13.762 -6.438  1.00 41.27  ? 476 SER A C   1 
ATOM   3214 O  O   . SER A 1 436 ? -19.130 14.655 -5.699  1.00 42.91  ? 476 SER A O   1 
ATOM   3215 C  CB  . SER A 1 436 ? -19.065 13.828 -8.848  1.00 36.70  ? 476 SER A CB  1 
ATOM   3216 O  OG  . SER A 1 436 ? -18.566 14.276 -10.077 1.00 34.93  ? 476 SER A OG  1 
ATOM   3217 N  N   . LYS A 1 437 ? -18.832 12.462 -6.160  1.00 43.77  ? 477 LYS A N   1 
ATOM   3218 C  CA  . LYS A 1 437 ? -19.464 11.982 -4.940  1.00 44.35  ? 477 LYS A CA  1 
ATOM   3219 C  C   . LYS A 1 437 ? -18.698 12.227 -3.652  1.00 44.86  ? 477 LYS A C   1 
ATOM   3220 O  O   . LYS A 1 437 ? -19.278 12.724 -2.686  1.00 45.66  ? 477 LYS A O   1 
ATOM   3221 C  CB  . LYS A 1 437 ? -19.816 10.500 -5.088  1.00 45.17  ? 477 LYS A CB  1 
ATOM   3222 C  CG  . LYS A 1 437 ? -20.974 10.296 -6.070  1.00 45.98  ? 477 LYS A CG  1 
ATOM   3223 C  CD  . LYS A 1 437 ? -21.613 8.924  -5.973  1.00 46.61  ? 477 LYS A CD  1 
ATOM   3224 C  CE  . LYS A 1 437 ? -20.666 7.816  -6.402  1.00 48.36  ? 477 LYS A CE  1 
ATOM   3225 N  NZ  . LYS A 1 437 ? -21.378 6.512  -6.586  1.00 48.61  ? 477 LYS A NZ  1 
ATOM   3226 N  N   . MET A 1 438 ? -17.415 11.883 -3.639  1.00 45.65  ? 478 MET A N   1 
ATOM   3227 C  CA  . MET A 1 438 ? -16.583 12.078 -2.458  1.00 48.45  ? 478 MET A CA  1 
ATOM   3228 C  C   . MET A 1 438 ? -16.280 13.557 -2.249  1.00 48.29  ? 478 MET A C   1 
ATOM   3229 O  O   . MET A 1 438 ? -15.394 13.917 -1.475  1.00 50.41  ? 478 MET A O   1 
ATOM   3230 C  CB  . MET A 1 438 ? -15.280 11.286 -2.583  1.00 52.78  ? 478 MET A CB  1 
ATOM   3231 C  CG  . MET A 1 438 ? -14.218 11.968 -3.431  1.00 58.63  ? 478 MET A CG  1 
ATOM   3232 S  SD  . MET A 1 438 ? -12.649 11.081 -3.426  1.00 65.25  ? 478 MET A SD  1 
ATOM   3233 C  CE  . MET A 1 438 ? -12.621 10.433 -5.096  1.00 61.13  ? 478 MET A CE  1 
ATOM   3234 N  N   . GLN A 1 439 ? -17.024 14.410 -2.946  1.00 45.54  ? 479 GLN A N   1 
ATOM   3235 C  CA  . GLN A 1 439 ? -16.838 15.852 -2.842  1.00 42.41  ? 479 GLN A CA  1 
ATOM   3236 C  C   . GLN A 1 439 ? -18.135 16.552 -2.451  1.00 41.21  ? 479 GLN A C   1 
ATOM   3237 O  O   . GLN A 1 439 ? -18.123 17.523 -1.695  1.00 40.02  ? 479 GLN A O   1 
ATOM   3238 C  CB  . GLN A 1 439 ? -16.311 16.421 -4.162  1.00 41.35  ? 479 GLN A CB  1 
ATOM   3239 C  CG  . GLN A 1 439 ? -15.482 17.685 -4.006  1.00 41.97  ? 479 GLN A CG  1 
ATOM   3240 C  CD  . GLN A 1 439 ? -14.837 18.122 -5.306  1.00 40.89  ? 479 GLN A CD  1 
ATOM   3241 O  OE1 . GLN A 1 439 ? -14.946 19.281 -5.708  1.00 39.92  ? 479 GLN A OE1 1 
ATOM   3242 N  NE2 . GLN A 1 439 ? -14.160 17.194 -5.973  1.00 42.18  ? 479 GLN A NE2 1 
ATOM   3243 N  N   . LEU A 1 440 ? -19.253 16.054 -2.970  1.00 39.54  ? 480 LEU A N   1 
ATOM   3244 C  CA  . LEU A 1 440 ? -20.554 16.635 -2.674  1.00 38.21  ? 480 LEU A CA  1 
ATOM   3245 C  C   . LEU A 1 440 ? -20.944 16.136 -1.279  1.00 38.25  ? 480 LEU A C   1 
ATOM   3246 O  O   . LEU A 1 440 ? -21.771 16.732 -0.589  1.00 37.96  ? 480 LEU A O   1 
ATOM   3247 C  CB  . LEU A 1 440 ? -21.584 16.202 -3.717  1.00 36.22  ? 480 LEU A CB  1 
ATOM   3248 C  CG  . LEU A 1 440 ? -21.427 16.920 -5.053  1.00 34.67  ? 480 LEU A CG  1 
ATOM   3249 C  CD1 . LEU A 1 440 ? -22.478 16.451 -6.027  1.00 32.04  ? 480 LEU A CD1 1 
ATOM   3250 C  CD2 . LEU A 1 440 ? -21.550 18.429 -4.808  1.00 35.44  ? 480 LEU A CD2 1 
ATOM   3251 N  N   . PHE A 1 441 ? -20.336 15.027 -0.878  1.00 37.58  ? 481 PHE A N   1 
ATOM   3252 C  CA  . PHE A 1 441 ? -20.581 14.477 0.427   1.00 38.09  ? 481 PHE A CA  1 
ATOM   3253 C  C   . PHE A 1 441 ? -19.900 15.414 1.401   1.00 39.20  ? 481 PHE A C   1 
ATOM   3254 O  O   . PHE A 1 441 ? -20.505 15.858 2.377   1.00 40.98  ? 481 PHE A O   1 
ATOM   3255 C  CB  . PHE A 1 441 ? -19.951 13.104 0.564   1.00 39.11  ? 481 PHE A CB  1 
ATOM   3256 C  CG  . PHE A 1 441 ? -20.077 12.529 1.944   1.00 39.72  ? 481 PHE A CG  1 
ATOM   3257 C  CD1 . PHE A 1 441 ? -21.224 11.848 2.326   1.00 39.74  ? 481 PHE A CD1 1 
ATOM   3258 C  CD2 . PHE A 1 441 ? -19.067 12.704 2.872   1.00 39.98  ? 481 PHE A CD2 1 
ATOM   3259 C  CE1 . PHE A 1 441 ? -21.357 11.352 3.610   1.00 40.13  ? 481 PHE A CE1 1 
ATOM   3260 C  CE2 . PHE A 1 441 ? -19.189 12.214 4.158   1.00 40.69  ? 481 PHE A CE2 1 
ATOM   3261 C  CZ  . PHE A 1 441 ? -20.340 11.534 4.529   1.00 40.40  ? 481 PHE A CZ  1 
ATOM   3262 N  N   . LEU A 1 442 ? -18.628 15.703 1.135   1.00 39.76  ? 482 LEU A N   1 
ATOM   3263 C  CA  . LEU A 1 442 ? -17.846 16.592 1.984   1.00 39.64  ? 482 LEU A CA  1 
ATOM   3264 C  C   . LEU A 1 442 ? -18.367 18.023 2.058   1.00 39.18  ? 482 LEU A C   1 
ATOM   3265 O  O   . LEU A 1 442 ? -18.584 18.544 3.140   1.00 39.64  ? 482 LEU A O   1 
ATOM   3266 C  CB  . LEU A 1 442 ? -16.388 16.612 1.533   1.00 40.65  ? 482 LEU A CB  1 
ATOM   3267 C  CG  . LEU A 1 442 ? -15.498 15.548 2.187   1.00 41.99  ? 482 LEU A CG  1 
ATOM   3268 C  CD1 . LEU A 1 442 ? -14.182 15.394 1.399   1.00 40.75  ? 482 LEU A CD1 1 
ATOM   3269 C  CD2 . LEU A 1 442 ? -15.244 15.938 3.645   1.00 39.51  ? 482 LEU A CD2 1 
ATOM   3270 N  N   . PHE A 1 443 ? -18.571 18.672 0.924   1.00 38.97  ? 483 PHE A N   1 
ATOM   3271 C  CA  . PHE A 1 443 ? -19.061 20.045 0.986   1.00 39.50  ? 483 PHE A CA  1 
ATOM   3272 C  C   . PHE A 1 443 ? -20.308 20.153 1.840   1.00 40.35  ? 483 PHE A C   1 
ATOM   3273 O  O   . PHE A 1 443 ? -20.462 21.072 2.666   1.00 40.76  ? 483 PHE A O   1 
ATOM   3274 C  CB  . PHE A 1 443 ? -19.369 20.604 -0.413  1.00 35.91  ? 483 PHE A CB  1 
ATOM   3275 C  CG  . PHE A 1 443 ? -18.224 21.347 -1.020  1.00 33.74  ? 483 PHE A CG  1 
ATOM   3276 C  CD1 . PHE A 1 443 ? -17.773 22.532 -0.438  1.00 33.74  ? 483 PHE A CD1 1 
ATOM   3277 C  CD2 . PHE A 1 443 ? -17.561 20.844 -2.136  1.00 31.96  ? 483 PHE A CD2 1 
ATOM   3278 C  CE1 . PHE A 1 443 ? -16.681 23.206 -0.951  1.00 33.52  ? 483 PHE A CE1 1 
ATOM   3279 C  CE2 . PHE A 1 443 ? -16.464 21.504 -2.666  1.00 33.48  ? 483 PHE A CE2 1 
ATOM   3280 C  CZ  . PHE A 1 443 ? -16.016 22.694 -2.070  1.00 34.34  ? 483 PHE A CZ  1 
ATOM   3281 N  N   . ILE A 1 444 ? -21.200 19.197 1.654   1.00 39.68  ? 484 ILE A N   1 
ATOM   3282 C  CA  . ILE A 1 444 ? -22.431 19.260 2.374   1.00 39.21  ? 484 ILE A CA  1 
ATOM   3283 C  C   . ILE A 1 444 ? -22.258 18.870 3.826   1.00 39.19  ? 484 ILE A C   1 
ATOM   3284 O  O   . ILE A 1 444 ? -22.862 19.478 4.704   1.00 40.03  ? 484 ILE A O   1 
ATOM   3285 C  CB  . ILE A 1 444 ? -23.478 18.414 1.663   1.00 39.51  ? 484 ILE A CB  1 
ATOM   3286 C  CG1 . ILE A 1 444 ? -24.826 19.088 1.810   1.00 39.04  ? 484 ILE A CG1 1 
ATOM   3287 C  CG2 . ILE A 1 444 ? -23.486 16.992 2.203   1.00 42.36  ? 484 ILE A CG2 1 
ATOM   3288 C  CD1 . ILE A 1 444 ? -25.931 18.250 1.307   1.00 41.92  ? 484 ILE A CD1 1 
ATOM   3289 N  N   . SER A 1 445 ? -21.414 17.878 4.091   1.00 39.63  ? 485 SER A N   1 
ATOM   3290 C  CA  . SER A 1 445 ? -21.187 17.442 5.466   1.00 38.40  ? 485 SER A CA  1 
ATOM   3291 C  C   . SER A 1 445 ? -20.648 18.554 6.332   1.00 37.58  ? 485 SER A C   1 
ATOM   3292 O  O   . SER A 1 445 ? -21.045 18.674 7.475   1.00 39.15  ? 485 SER A O   1 
ATOM   3293 C  CB  . SER A 1 445 ? -20.225 16.249 5.521   1.00 37.41  ? 485 SER A CB  1 
ATOM   3294 O  OG  . SER A 1 445 ? -20.910 15.059 5.183   1.00 38.56  ? 485 SER A OG  1 
ATOM   3295 N  N   . ILE A 1 446 ? -19.740 19.360 5.788   1.00 37.42  ? 486 ILE A N   1 
ATOM   3296 C  CA  . ILE A 1 446 ? -19.138 20.467 6.531   1.00 35.63  ? 486 ILE A CA  1 
ATOM   3297 C  C   . ILE A 1 446 ? -20.157 21.556 6.717   1.00 34.52  ? 486 ILE A C   1 
ATOM   3298 O  O   . ILE A 1 446 ? -20.407 21.982 7.832   1.00 35.24  ? 486 ILE A O   1 
ATOM   3299 C  CB  . ILE A 1 446 ? -17.924 21.058 5.788   1.00 36.17  ? 486 ILE A CB  1 
ATOM   3300 C  CG1 . ILE A 1 446 ? -16.909 19.951 5.507   1.00 37.95  ? 486 ILE A CG1 1 
ATOM   3301 C  CG2 . ILE A 1 446 ? -17.276 22.160 6.600   1.00 34.44  ? 486 ILE A CG2 1 
ATOM   3302 C  CD1 . ILE A 1 446 ? -16.637 19.079 6.705   1.00 41.55  ? 486 ILE A CD1 1 
ATOM   3303 N  N   . LEU A 1 447 ? -20.745 21.990 5.611   1.00 34.87  ? 487 LEU A N   1 
ATOM   3304 C  CA  . LEU A 1 447 ? -21.763 23.045 5.590   1.00 35.58  ? 487 LEU A CA  1 
ATOM   3305 C  C   . LEU A 1 447 ? -22.967 22.787 6.495   1.00 36.34  ? 487 LEU A C   1 
ATOM   3306 O  O   . LEU A 1 447 ? -23.397 23.682 7.240   1.00 36.54  ? 487 LEU A O   1 
ATOM   3307 C  CB  . LEU A 1 447 ? -22.269 23.249 4.152   1.00 33.38  ? 487 LEU A CB  1 
ATOM   3308 C  CG  . LEU A 1 447 ? -21.575 24.235 3.207   1.00 32.13  ? 487 LEU A CG  1 
ATOM   3309 C  CD1 . LEU A 1 447 ? -20.168 24.543 3.629   1.00 32.98  ? 487 LEU A CD1 1 
ATOM   3310 C  CD2 . LEU A 1 447 ? -21.577 23.629 1.838   1.00 33.26  ? 487 LEU A CD2 1 
ATOM   3311 N  N   . ALA A 1 448 ? -23.510 21.572 6.416   1.00 36.05  ? 488 ALA A N   1 
ATOM   3312 C  CA  . ALA A 1 448 ? -24.671 21.206 7.209   1.00 37.45  ? 488 ALA A CA  1 
ATOM   3313 C  C   . ALA A 1 448 ? -24.294 21.068 8.671   1.00 38.35  ? 488 ALA A C   1 
ATOM   3314 O  O   . ALA A 1 448 ? -25.068 21.385 9.573   1.00 40.41  ? 488 ALA A O   1 
ATOM   3315 C  CB  . ALA A 1 448 ? -25.277 19.908 6.690   1.00 36.90  ? 488 ALA A CB  1 
ATOM   3316 N  N   . HIS A 1 449 ? -23.088 20.594 8.907   1.00 38.49  ? 489 HIS A N   1 
ATOM   3317 C  CA  . HIS A 1 449 ? -22.604 20.432 10.262  1.00 39.41  ? 489 HIS A CA  1 
ATOM   3318 C  C   . HIS A 1 449 ? -22.220 21.799 10.890  1.00 40.11  ? 489 HIS A C   1 
ATOM   3319 O  O   . HIS A 1 449 ? -22.271 21.967 12.106  1.00 40.03  ? 489 HIS A O   1 
ATOM   3320 C  CB  . HIS A 1 449 ? -21.414 19.468 10.219  1.00 38.78  ? 489 HIS A CB  1 
ATOM   3321 C  CG  . HIS A 1 449 ? -20.517 19.549 11.407  1.00 39.90  ? 489 HIS A CG  1 
ATOM   3322 N  ND1 . HIS A 1 449 ? -20.766 18.865 12.577  1.00 39.75  ? 489 HIS A ND1 1 
ATOM   3323 C  CD2 . HIS A 1 449 ? -19.362 20.230 11.603  1.00 40.78  ? 489 HIS A CD2 1 
ATOM   3324 C  CE1 . HIS A 1 449 ? -19.803 19.118 13.444  1.00 40.55  ? 489 HIS A CE1 1 
ATOM   3325 N  NE2 . HIS A 1 449 ? -18.938 19.943 12.878  1.00 41.76  ? 489 HIS A NE2 1 
ATOM   3326 N  N   . GLN A 1 450 ? -21.884 22.778 10.055  1.00 40.36  ? 490 GLN A N   1 
ATOM   3327 C  CA  . GLN A 1 450 ? -21.459 24.093 10.528  1.00 41.47  ? 490 GLN A CA  1 
ATOM   3328 C  C   . GLN A 1 450 ? -22.445 25.248 10.366  1.00 41.51  ? 490 GLN A C   1 
ATOM   3329 O  O   . GLN A 1 450 ? -22.311 26.289 11.037  1.00 39.79  ? 490 GLN A O   1 
ATOM   3330 C  CB  . GLN A 1 450 ? -20.149 24.488 9.822   1.00 43.29  ? 490 GLN A CB  1 
ATOM   3331 C  CG  . GLN A 1 450 ? -18.864 24.108 10.544  1.00 45.95  ? 490 GLN A CG  1 
ATOM   3332 C  CD  . GLN A 1 450 ? -18.396 25.190 11.498  1.00 46.70  ? 490 GLN A CD  1 
ATOM   3333 O  OE1 . GLN A 1 450 ? -19.142 26.126 11.821  1.00 48.42  ? 490 GLN A OE1 1 
ATOM   3334 N  NE2 . GLN A 1 450 ? -17.153 25.069 11.959  1.00 48.05  ? 490 GLN A NE2 1 
ATOM   3335 N  N   . CYS A 1 451 ? -23.423 25.075 9.475   1.00 41.51  ? 491 CYS A N   1 
ATOM   3336 C  CA  . CYS A 1 451 ? -24.382 26.145 9.204   1.00 39.92  ? 491 CYS A CA  1 
ATOM   3337 C  C   . CYS A 1 451 ? -25.831 25.774 9.226   1.00 39.71  ? 491 CYS A C   1 
ATOM   3338 O  O   . CYS A 1 451 ? -26.205 24.600 9.242   1.00 37.39  ? 491 CYS A O   1 
ATOM   3339 C  CB  . CYS A 1 451 ? -24.122 26.773 7.833   1.00 38.99  ? 491 CYS A CB  1 
ATOM   3340 S  SG  . CYS A 1 451 ? -22.562 27.612 7.656   1.00 38.64  ? 491 CYS A SG  1 
ATOM   3341 N  N   . ASP A 1 452 ? -26.631 26.834 9.183   1.00 41.11  ? 492 ASP A N   1 
ATOM   3342 C  CA  . ASP A 1 452 ? -28.084 26.759 9.152   1.00 42.33  ? 492 ASP A CA  1 
ATOM   3343 C  C   . ASP A 1 452 ? -28.512 27.563 7.927   1.00 40.77  ? 492 ASP A C   1 
ATOM   3344 O  O   . ASP A 1 452 ? -28.083 28.694 7.753   1.00 39.43  ? 492 ASP A O   1 
ATOM   3345 C  CB  . ASP A 1 452 ? -28.679 27.381 10.423  1.00 44.94  ? 492 ASP A CB  1 
ATOM   3346 C  CG  . ASP A 1 452 ? -29.299 26.341 11.360  1.00 47.84  ? 492 ASP A CG  1 
ATOM   3347 O  OD1 . ASP A 1 452 ? -29.934 26.753 12.370  1.00 49.92  ? 492 ASP A OD1 1 
ATOM   3348 O  OD2 . ASP A 1 452 ? -29.158 25.124 11.088  1.00 46.49  ? 492 ASP A OD2 1 
ATOM   3349 N  N   . PHE A 1 453 ? -29.347 26.968 7.079   1.00 41.36  ? 493 PHE A N   1 
ATOM   3350 C  CA  . PHE A 1 453 ? -29.824 27.638 5.867   1.00 41.68  ? 493 PHE A CA  1 
ATOM   3351 C  C   . PHE A 1 453 ? -31.320 27.919 5.853   1.00 39.74  ? 493 PHE A C   1 
ATOM   3352 O  O   . PHE A 1 453 ? -32.120 27.007 5.951   1.00 39.76  ? 493 PHE A O   1 
ATOM   3353 C  CB  . PHE A 1 453 ? -29.455 26.810 4.627   1.00 42.52  ? 493 PHE A CB  1 
ATOM   3354 C  CG  . PHE A 1 453 ? -27.977 26.540 4.500   1.00 42.33  ? 493 PHE A CG  1 
ATOM   3355 C  CD1 . PHE A 1 453 ? -27.431 25.342 4.964   1.00 42.28  ? 493 PHE A CD1 1 
ATOM   3356 C  CD2 . PHE A 1 453 ? -27.132 27.498 3.952   1.00 42.03  ? 493 PHE A CD2 1 
ATOM   3357 C  CE1 . PHE A 1 453 ? -26.067 25.101 4.886   1.00 42.91  ? 493 PHE A CE1 1 
ATOM   3358 C  CE2 . PHE A 1 453 ? -25.758 27.275 3.865   1.00 42.52  ? 493 PHE A CE2 1 
ATOM   3359 C  CZ  . PHE A 1 453 ? -25.222 26.077 4.333   1.00 43.29  ? 493 PHE A CZ  1 
ATOM   3360 N  N   . ARG A 1 454 ? -31.683 29.188 5.718   1.00 39.68  ? 494 ARG A N   1 
ATOM   3361 C  CA  . ARG A 1 454 ? -33.086 29.602 5.682   1.00 41.79  ? 494 ARG A CA  1 
ATOM   3362 C  C   . ARG A 1 454 ? -33.453 30.281 4.365   1.00 42.75  ? 494 ARG A C   1 
ATOM   3363 O  O   . ARG A 1 454 ? -32.694 31.094 3.839   1.00 44.34  ? 494 ARG A O   1 
ATOM   3364 C  CB  . ARG A 1 454 ? -33.389 30.587 6.815   1.00 41.19  ? 494 ARG A CB  1 
ATOM   3365 C  CG  . ARG A 1 454 ? -33.287 30.019 8.210   1.00 39.21  ? 494 ARG A CG  1 
ATOM   3366 C  CD  . ARG A 1 454 ? -33.253 31.146 9.232   1.00 38.22  ? 494 ARG A CD  1 
ATOM   3367 N  NE  . ARG A 1 454 ? -33.576 30.641 10.555  1.00 38.07  ? 494 ARG A NE  1 
ATOM   3368 C  CZ  . ARG A 1 454 ? -34.729 30.848 11.182  1.00 36.67  ? 494 ARG A CZ  1 
ATOM   3369 N  NH1 . ARG A 1 454 ? -35.885 30.746 10.538  1.00 35.27  ? 494 ARG A NH1 1 
ATOM   3370 N  NH2 . ARG A 1 454 ? -34.726 31.138 12.472  1.00 37.64  ? 494 ARG A NH2 1 
ATOM   3371 N  N   . ALA A 1 455 ? -34.631 29.960 3.848   1.00 43.96  ? 495 ALA A N   1 
ATOM   3372 C  CA  . ALA A 1 455 ? -35.111 30.551 2.602   1.00 44.84  ? 495 ALA A CA  1 
ATOM   3373 C  C   . ALA A 1 455 ? -35.677 31.951 2.849   1.00 46.02  ? 495 ALA A C   1 
ATOM   3374 O  O   . ALA A 1 455 ? -35.990 32.323 3.977   1.00 46.19  ? 495 ALA A O   1 
ATOM   3375 C  CB  . ALA A 1 455 ? -36.179 29.663 1.979   1.00 40.86  ? 495 ALA A CB  1 
ATOM   3376 N  N   . ASN A 1 456 ? -35.792 32.723 1.777   1.00 48.00  ? 496 ASN A N   1 
ATOM   3377 C  CA  . ASN A 1 456 ? -36.327 34.066 1.848   1.00 48.58  ? 496 ASN A CA  1 
ATOM   3378 C  C   . ASN A 1 456 ? -37.836 33.920 1.862   1.00 48.93  ? 496 ASN A C   1 
ATOM   3379 O  O   . ASN A 1 456 ? -38.448 33.627 0.845   1.00 49.03  ? 496 ASN A O   1 
ATOM   3380 C  CB  . ASN A 1 456 ? -35.881 34.872 0.631   1.00 48.50  ? 496 ASN A CB  1 
ATOM   3381 C  CG  . ASN A 1 456 ? -36.353 36.294 0.687   1.00 50.02  ? 496 ASN A CG  1 
ATOM   3382 O  OD1 . ASN A 1 456 ? -36.856 36.746 1.718   1.00 49.77  ? 496 ASN A OD1 1 
ATOM   3383 N  ND2 . ASN A 1 456 ? -36.196 37.021 -0.418  1.00 51.13  ? 496 ASN A ND2 1 
ATOM   3384 N  N   . PRO A 1 457 ? -38.458 34.136 3.020   1.00 49.72  ? 497 PRO A N   1 
ATOM   3385 C  CA  . PRO A 1 457 ? -39.908 34.008 3.140   1.00 50.76  ? 497 PRO A CA  1 
ATOM   3386 C  C   . PRO A 1 457 ? -40.712 34.967 2.268   1.00 54.16  ? 497 PRO A C   1 
ATOM   3387 O  O   . PRO A 1 457 ? -41.771 34.598 1.760   1.00 55.10  ? 497 PRO A O   1 
ATOM   3388 C  CB  . PRO A 1 457 ? -40.136 34.235 4.629   1.00 48.30  ? 497 PRO A CB  1 
ATOM   3389 C  CG  . PRO A 1 457 ? -39.132 35.245 4.952   1.00 47.23  ? 497 PRO A CG  1 
ATOM   3390 C  CD  . PRO A 1 457 ? -37.890 34.727 4.242   1.00 48.33  ? 497 PRO A CD  1 
ATOM   3391 N  N   . ASN A 1 458 ? -40.205 36.188 2.089   1.00 56.81  ? 498 ASN A N   1 
ATOM   3392 C  CA  . ASN A 1 458 ? -40.887 37.212 1.296   1.00 58.44  ? 498 ASN A CA  1 
ATOM   3393 C  C   . ASN A 1 458 ? -40.977 36.928 -0.205  1.00 59.82  ? 498 ASN A C   1 
ATOM   3394 O  O   . ASN A 1 458 ? -41.561 37.718 -0.952  1.00 60.74  ? 498 ASN A O   1 
ATOM   3395 C  CB  . ASN A 1 458 ? -40.202 38.567 1.516   1.00 59.26  ? 498 ASN A CB  1 
ATOM   3396 C  CG  . ASN A 1 458 ? -40.360 39.078 2.936   1.00 59.81  ? 498 ASN A CG  1 
ATOM   3397 O  OD1 . ASN A 1 458 ? -41.378 39.680 3.293   1.00 60.39  ? 498 ASN A OD1 1 
ATOM   3398 N  ND2 . ASN A 1 458 ? -39.357 38.826 3.761   1.00 60.58  ? 498 ASN A ND2 1 
ATOM   3399 N  N   . GLU A 1 459 ? -40.418 35.799 -0.638  1.00 60.81  ? 499 GLU A N   1 
ATOM   3400 C  CA  . GLU A 1 459 ? -40.404 35.401 -2.050  1.00 61.44  ? 499 GLU A CA  1 
ATOM   3401 C  C   . GLU A 1 459 ? -41.585 34.512 -2.461  1.00 62.02  ? 499 GLU A C   1 
ATOM   3402 O  O   . GLU A 1 459 ? -41.479 33.276 -2.420  1.00 61.58  ? 499 GLU A O   1 
ATOM   3403 C  CB  . GLU A 1 459 ? -39.088 34.673 -2.355  1.00 61.89  ? 499 GLU A CB  1 
ATOM   3404 C  CG  . GLU A 1 459 ? -38.992 34.111 -3.759  1.00 62.16  ? 499 GLU A CG  1 
ATOM   3405 C  CD  . GLU A 1 459 ? -39.285 35.152 -4.818  1.00 61.76  ? 499 GLU A CD  1 
ATOM   3406 O  OE1 . GLU A 1 459 ? -38.569 36.175 -4.850  1.00 62.54  ? 499 GLU A OE1 1 
ATOM   3407 O  OE2 . GLU A 1 459 ? -40.232 34.950 -5.612  1.00 60.49  ? 499 GLU A OE2 1 
ATOM   3408 N  N   . PRO A 1 460 ? -42.681 35.135 -2.879  1.00 62.98  ? 500 PRO A N   1 
ATOM   3409 C  CA  . PRO A 1 460 ? -43.879 34.400 -3.301  1.00 62.76  ? 500 PRO A CA  1 
ATOM   3410 C  C   . PRO A 1 460 ? -43.641 33.454 -4.480  1.00 62.88  ? 500 PRO A C   1 
ATOM   3411 O  O   . PRO A 1 460 ? -43.602 32.239 -4.289  1.00 60.42  ? 500 PRO A O   1 
ATOM   3412 C  CB  . PRO A 1 460 ? -44.841 35.517 -3.712  1.00 61.33  ? 500 PRO A CB  1 
ATOM   3413 C  CG  . PRO A 1 460 ? -43.953 36.629 -4.142  1.00 61.52  ? 500 PRO A CG  1 
ATOM   3414 C  CD  . PRO A 1 460 ? -42.745 36.559 -3.252  1.00 62.34  ? 500 PRO A CD  1 
ATOM   3415 N  N   . ALA A 1 461 ? -43.493 34.008 -5.681  1.00 64.33  ? 501 ALA A N   1 
ATOM   3416 C  CA  . ALA A 1 461 ? -43.306 33.202 -6.884  1.00 65.82  ? 501 ALA A CA  1 
ATOM   3417 C  C   . ALA A 1 461 ? -42.222 32.148 -6.505  1.00 66.18  ? 501 ALA A C   1 
ATOM   3418 O  O   . ALA A 1 461 ? -41.447 32.343 -5.563  1.00 67.39  ? 501 ALA A O   1 
ATOM   3419 C  CB  . ALA A 1 461 ? -42.714 34.055 -8.013  1.00 65.02  ? 501 ALA A CB  1 
ATOM   3420 N  N   . LYS A 1 462 ? -42.179 31.039 -7.231  1.00 65.87  ? 502 LYS A N   1 
ATOM   3421 C  CA  . LYS A 1 462 ? -41.219 30.039 -6.909  1.00 65.42  ? 502 LYS A CA  1 
ATOM   3422 C  C   . LYS A 1 462 ? -39.881 30.059 -7.700  1.00 65.52  ? 502 LYS A C   1 
ATOM   3423 O  O   . LYS A 1 462 ? -39.684 30.883 -8.598  1.00 64.57  ? 502 LYS A O   1 
ATOM   3424 C  CB  . LYS A 1 462 ? -41.855 28.633 -6.973  1.00 63.32  ? 502 LYS A CB  1 
ATOM   3425 C  CG  . LYS A 1 462 ? -43.147 28.461 -6.108  1.00 60.13  ? 502 LYS A CG  1 
ATOM   3426 C  CD  . LYS A 1 462 ? -43.046 29.107 -4.709  1.00 55.58  ? 502 LYS A CD  1 
ATOM   3427 C  CE  . LYS A 1 462 ? -41.934 28.505 -3.864  1.00 53.34  ? 502 LYS A CE  1 
ATOM   3428 N  NZ  . LYS A 1 462 ? -41.577 29.416 -2.755  1.00 49.76  ? 502 LYS A NZ  1 
ATOM   3429 N  N   . MET A 1 463 ? -38.976 29.164 -7.342  1.00 65.84  ? 503 MET A N   1 
ATOM   3430 C  CA  . MET A 1 463 ? -37.701 29.067 -8.017  1.00 65.92  ? 503 MET A CA  1 
ATOM   3431 C  C   . MET A 1 463 ? -37.887 28.705 -9.489  1.00 64.67  ? 503 MET A C   1 
ATOM   3432 O  O   . MET A 1 463 ? -38.595 27.747 -9.808  1.00 64.60  ? 503 MET A O   1 
ATOM   3433 C  CB  . MET A 1 463 ? -36.851 27.990 -7.341  1.00 67.90  ? 503 MET A CB  1 
ATOM   3434 C  CG  . MET A 1 463 ? -35.659 28.517 -6.590  1.00 71.47  ? 503 MET A CG  1 
ATOM   3435 S  SD  . MET A 1 463 ? -34.230 28.764 -7.662  1.00 76.46  ? 503 MET A SD  1 
ATOM   3436 C  CE  . MET A 1 463 ? -34.678 30.343 -8.435  1.00 75.78  ? 503 MET A CE  1 
ATOM   3437 N  N   . ASN A 1 464 ? -37.266 29.483 -10.376 1.00 62.33  ? 504 ASN A N   1 
ATOM   3438 C  CA  . ASN A 1 464 ? -37.300 29.203 -11.808 1.00 59.97  ? 504 ASN A CA  1 
ATOM   3439 C  C   . ASN A 1 464 ? -35.896 28.693 -12.184 1.00 57.55  ? 504 ASN A C   1 
ATOM   3440 O  O   . ASN A 1 464 ? -34.914 29.010 -11.515 1.00 56.61  ? 504 ASN A O   1 
ATOM   3441 C  CB  . ASN A 1 464 ? -37.719 30.452 -12.610 1.00 62.11  ? 504 ASN A CB  1 
ATOM   3442 C  CG  . ASN A 1 464 ? -36.970 31.707 -12.193 1.00 65.28  ? 504 ASN A CG  1 
ATOM   3443 O  OD1 . ASN A 1 464 ? -36.699 31.926 -11.004 1.00 68.46  ? 504 ASN A OD1 1 
ATOM   3444 N  ND2 . ASN A 1 464 ? -36.649 32.554 -13.170 1.00 65.12  ? 504 ASN A ND2 1 
ATOM   3445 N  N   . PHE A 1 465 ? -35.804 27.873 -13.226 1.00 54.93  ? 505 PHE A N   1 
ATOM   3446 C  CA  . PHE A 1 465 ? -34.520 27.293 -13.623 1.00 51.57  ? 505 PHE A CA  1 
ATOM   3447 C  C   . PHE A 1 465 ? -34.146 27.620 -15.051 1.00 50.92  ? 505 PHE A C   1 
ATOM   3448 O  O   . PHE A 1 465 ? -34.934 28.218 -15.792 1.00 51.40  ? 505 PHE A O   1 
ATOM   3449 C  CB  . PHE A 1 465 ? -34.567 25.768 -13.454 1.00 49.41  ? 505 PHE A CB  1 
ATOM   3450 C  CG  . PHE A 1 465 ? -34.895 25.342 -12.067 1.00 48.42  ? 505 PHE A CG  1 
ATOM   3451 C  CD1 . PHE A 1 465 ? -33.905 24.868 -11.219 1.00 49.76  ? 505 PHE A CD1 1 
ATOM   3452 C  CD2 . PHE A 1 465 ? -36.173 25.526 -11.560 1.00 48.31  ? 505 PHE A CD2 1 
ATOM   3453 C  CE1 . PHE A 1 465 ? -34.185 24.593 -9.872  1.00 49.61  ? 505 PHE A CE1 1 
ATOM   3454 C  CE2 . PHE A 1 465 ? -36.461 25.256 -10.224 1.00 48.90  ? 505 PHE A CE2 1 
ATOM   3455 C  CZ  . PHE A 1 465 ? -35.465 24.790 -9.376  1.00 48.59  ? 505 PHE A CZ  1 
ATOM   3456 N  N   . SER A 1 466 ? -32.925 27.227 -15.412 1.00 49.15  ? 506 SER A N   1 
ATOM   3457 C  CA  . SER A 1 466 ? -32.370 27.418 -16.743 1.00 46.97  ? 506 SER A CA  1 
ATOM   3458 C  C   . SER A 1 466 ? -32.063 26.007 -17.194 1.00 45.55  ? 506 SER A C   1 
ATOM   3459 O  O   . SER A 1 466 ? -31.232 25.334 -16.599 1.00 46.21  ? 506 SER A O   1 
ATOM   3460 C  CB  . SER A 1 466 ? -31.082 28.245 -16.674 1.00 46.96  ? 506 SER A CB  1 
ATOM   3461 O  OG  . SER A 1 466 ? -30.183 27.909 -17.726 1.00 47.67  ? 506 SER A OG  1 
ATOM   3462 N  N   . TYR A 1 467 ? -32.736 25.562 -18.242 1.00 43.12  ? 507 TYR A N   1 
ATOM   3463 C  CA  . TYR A 1 467 ? -32.558 24.207 -18.749 1.00 42.33  ? 507 TYR A CA  1 
ATOM   3464 C  C   . TYR A 1 467 ? -31.511 24.111 -19.841 1.00 41.59  ? 507 TYR A C   1 
ATOM   3465 O  O   . TYR A 1 467 ? -31.540 24.909 -20.770 1.00 43.38  ? 507 TYR A O   1 
ATOM   3466 C  CB  . TYR A 1 467 ? -33.902 23.708 -19.273 1.00 42.58  ? 507 TYR A CB  1 
ATOM   3467 C  CG  . TYR A 1 467 ? -34.961 23.671 -18.197 1.00 42.23  ? 507 TYR A CG  1 
ATOM   3468 C  CD1 . TYR A 1 467 ? -35.193 22.502 -17.471 1.00 43.35  ? 507 TYR A CD1 1 
ATOM   3469 C  CD2 . TYR A 1 467 ? -35.673 24.818 -17.844 1.00 42.16  ? 507 TYR A CD2 1 
ATOM   3470 C  CE1 . TYR A 1 467 ? -36.107 22.464 -16.416 1.00 42.85  ? 507 TYR A CE1 1 
ATOM   3471 C  CE2 . TYR A 1 467 ? -36.596 24.796 -16.775 1.00 42.65  ? 507 TYR A CE2 1 
ATOM   3472 C  CZ  . TYR A 1 467 ? -36.801 23.607 -16.074 1.00 42.62  ? 507 TYR A CZ  1 
ATOM   3473 O  OH  . TYR A 1 467 ? -37.698 23.532 -15.044 1.00 41.87  ? 507 TYR A OH  1 
ATOM   3474 N  N   . GLY A 1 468 ? -30.590 23.150 -19.742 1.00 39.60  ? 508 GLY A N   1 
ATOM   3475 C  CA  . GLY A 1 468 ? -29.585 23.016 -20.777 1.00 38.69  ? 508 GLY A CA  1 
ATOM   3476 C  C   . GLY A 1 468 ? -28.422 22.170 -20.347 1.00 40.43  ? 508 GLY A C   1 
ATOM   3477 O  O   . GLY A 1 468 ? -27.449 22.691 -19.822 1.00 44.24  ? 508 GLY A O   1 
ATOM   3478 N  N   . LEU A 1 469 ? -28.487 20.869 -20.605 1.00 40.45  ? 509 LEU A N   1 
ATOM   3479 C  CA  . LEU A 1 469 ? -27.435 19.944 -20.178 1.00 39.19  ? 509 LEU A CA  1 
ATOM   3480 C  C   . LEU A 1 469 ? -27.660 19.901 -18.671 1.00 40.10  ? 509 LEU A C   1 
ATOM   3481 O  O   . LEU A 1 469 ? -28.278 18.956 -18.196 1.00 41.89  ? 509 LEU A O   1 
ATOM   3482 C  CB  . LEU A 1 469 ? -26.042 20.459 -20.525 1.00 36.41  ? 509 LEU A CB  1 
ATOM   3483 C  CG  . LEU A 1 469 ? -24.985 19.356 -20.491 1.00 35.10  ? 509 LEU A CG  1 
ATOM   3484 C  CD1 . LEU A 1 469 ? -25.360 18.300 -21.504 1.00 36.34  ? 509 LEU A CD1 1 
ATOM   3485 C  CD2 . LEU A 1 469 ? -23.621 19.910 -20.823 1.00 32.78  ? 509 LEU A CD2 1 
ATOM   3486 N  N   . THR A 1 470 ? -27.198 20.906 -17.916 1.00 39.41  ? 510 THR A N   1 
ATOM   3487 C  CA  . THR A 1 470 ? -27.507 20.928 -16.478 1.00 39.52  ? 510 THR A CA  1 
ATOM   3488 C  C   . THR A 1 470 ? -28.749 21.828 -16.230 1.00 39.42  ? 510 THR A C   1 
ATOM   3489 O  O   . THR A 1 470 ? -29.038 22.762 -17.001 1.00 38.52  ? 510 THR A O   1 
ATOM   3490 C  CB  . THR A 1 470 ? -26.339 21.469 -15.574 1.00 39.96  ? 510 THR A CB  1 
ATOM   3491 O  OG1 . THR A 1 470 ? -26.026 22.821 -15.920 1.00 41.97  ? 510 THR A OG1 1 
ATOM   3492 C  CG2 . THR A 1 470 ? -25.105 20.613 -15.699 1.00 39.99  ? 510 THR A CG2 1 
ATOM   3493 N  N   . ILE A 1 471 ? -29.493 21.523 -15.169 1.00 38.27  ? 511 ILE A N   1 
ATOM   3494 C  CA  . ILE A 1 471 ? -30.657 22.312 -14.796 1.00 36.86  ? 511 ILE A CA  1 
ATOM   3495 C  C   . ILE A 1 471 ? -30.202 23.262 -13.688 1.00 35.42  ? 511 ILE A C   1 
ATOM   3496 O  O   . ILE A 1 471 ? -30.225 22.916 -12.525 1.00 35.26  ? 511 ILE A O   1 
ATOM   3497 C  CB  . ILE A 1 471 ? -31.783 21.418 -14.255 1.00 37.67  ? 511 ILE A CB  1 
ATOM   3498 C  CG1 . ILE A 1 471 ? -32.225 20.433 -15.337 1.00 38.81  ? 511 ILE A CG1 1 
ATOM   3499 C  CG2 . ILE A 1 471 ? -32.966 22.268 -13.837 1.00 38.07  ? 511 ILE A CG2 1 
ATOM   3500 C  CD1 . ILE A 1 471 ? -33.441 19.601 -14.949 1.00 35.37  ? 511 ILE A CD1 1 
ATOM   3501 N  N   . LYS A 1 472 ? -29.777 24.458 -14.056 1.00 35.23  ? 512 LYS A N   1 
ATOM   3502 C  CA  . LYS A 1 472 ? -29.295 25.438 -13.084 1.00 35.97  ? 512 LYS A CA  1 
ATOM   3503 C  C   . LYS A 1 472 ? -30.384 26.304 -12.483 1.00 37.69  ? 512 LYS A C   1 
ATOM   3504 O  O   . LYS A 1 472 ? -31.259 26.814 -13.184 1.00 39.42  ? 512 LYS A O   1 
ATOM   3505 C  CB  . LYS A 1 472 ? -28.244 26.355 -13.729 1.00 34.87  ? 512 LYS A CB  1 
ATOM   3506 C  CG  . LYS A 1 472 ? -26.913 25.692 -13.952 1.00 33.07  ? 512 LYS A CG  1 
ATOM   3507 C  CD  . LYS A 1 472 ? -26.108 26.404 -14.986 1.00 30.38  ? 512 LYS A CD  1 
ATOM   3508 C  CE  . LYS A 1 472 ? -24.725 25.816 -15.011 1.00 34.06  ? 512 LYS A CE  1 
ATOM   3509 N  NZ  . LYS A 1 472 ? -23.987 26.042 -13.703 1.00 34.91  ? 512 LYS A NZ  1 
ATOM   3510 N  N   . PRO A 1 473 ? -30.350 26.477 -11.163 1.00 38.83  ? 513 PRO A N   1 
ATOM   3511 C  CA  . PRO A 1 473 ? -31.352 27.301 -10.491 1.00 40.15  ? 513 PRO A CA  1 
ATOM   3512 C  C   . PRO A 1 473 ? -31.147 28.762 -10.869 1.00 42.38  ? 513 PRO A C   1 
ATOM   3513 O  O   . PRO A 1 473 ? -30.014 29.235 -10.948 1.00 41.87  ? 513 PRO A O   1 
ATOM   3514 C  CB  . PRO A 1 473 ? -31.060 27.060 -9.015  1.00 40.38  ? 513 PRO A CB  1 
ATOM   3515 C  CG  . PRO A 1 473 ? -30.474 25.665 -9.002  1.00 41.10  ? 513 PRO A CG  1 
ATOM   3516 C  CD  . PRO A 1 473 ? -29.562 25.694 -10.194 1.00 39.58  ? 513 PRO A CD  1 
ATOM   3517 N  N   . LYS A 1 474 ? -32.236 29.476 -11.125 1.00 45.91  ? 514 LYS A N   1 
ATOM   3518 C  CA  . LYS A 1 474 ? -32.137 30.906 -11.443 1.00 47.60  ? 514 LYS A CA  1 
ATOM   3519 C  C   . LYS A 1 474 ? -31.968 31.577 -10.092 1.00 47.87  ? 514 LYS A C   1 
ATOM   3520 O  O   . LYS A 1 474 ? -32.056 30.921 -9.054  1.00 50.22  ? 514 LYS A O   1 
ATOM   3521 C  CB  . LYS A 1 474 ? -33.421 31.427 -12.089 1.00 47.67  ? 514 LYS A CB  1 
ATOM   3522 C  CG  . LYS A 1 474 ? -33.755 30.835 -13.446 1.00 49.92  ? 514 LYS A CG  1 
ATOM   3523 C  CD  . LYS A 1 474 ? -32.940 31.452 -14.576 1.00 51.30  ? 514 LYS A CD  1 
ATOM   3524 C  CE  . LYS A 1 474 ? -33.633 31.194 -15.923 1.00 53.48  ? 514 LYS A CE  1 
ATOM   3525 N  NZ  . LYS A 1 474 ? -33.029 31.958 -17.065 1.00 57.13  ? 514 LYS A NZ  1 
ATOM   3526 N  N   . SER A 1 475 ? -31.735 32.885 -10.103 1.00 46.92  ? 515 SER A N   1 
ATOM   3527 C  CA  . SER A 1 475 ? -31.546 33.645 -8.872  1.00 45.24  ? 515 SER A CA  1 
ATOM   3528 C  C   . SER A 1 475 ? -32.464 33.196 -7.733  1.00 44.70  ? 515 SER A C   1 
ATOM   3529 O  O   . SER A 1 475 ? -33.647 32.925 -7.940  1.00 44.97  ? 515 SER A O   1 
ATOM   3530 C  CB  . SER A 1 475 ? -31.737 35.141 -9.135  1.00 44.76  ? 515 SER A CB  1 
ATOM   3531 O  OG  . SER A 1 475 ? -31.402 35.908 -7.991  1.00 44.95  ? 515 SER A OG  1 
ATOM   3532 N  N   . PHE A 1 476 ? -31.899 33.126 -6.531  1.00 43.99  ? 516 PHE A N   1 
ATOM   3533 C  CA  . PHE A 1 476 ? -32.632 32.746 -5.329  1.00 43.33  ? 516 PHE A CA  1 
ATOM   3534 C  C   . PHE A 1 476 ? -31.725 33.103 -4.164  1.00 43.46  ? 516 PHE A C   1 
ATOM   3535 O  O   . PHE A 1 476 ? -30.507 32.937 -4.261  1.00 44.47  ? 516 PHE A O   1 
ATOM   3536 C  CB  . PHE A 1 476 ? -33.003 31.252 -5.345  1.00 42.25  ? 516 PHE A CB  1 
ATOM   3537 C  CG  . PHE A 1 476 ? -31.914 30.318 -4.881  1.00 39.26  ? 516 PHE A CG  1 
ATOM   3538 C  CD1 . PHE A 1 476 ? -31.868 29.889 -3.564  1.00 39.57  ? 516 PHE A CD1 1 
ATOM   3539 C  CD2 . PHE A 1 476 ? -31.004 29.798 -5.772  1.00 38.46  ? 516 PHE A CD2 1 
ATOM   3540 C  CE1 . PHE A 1 476 ? -30.945 28.946 -3.139  1.00 37.31  ? 516 PHE A CE1 1 
ATOM   3541 C  CE2 . PHE A 1 476 ? -30.076 28.854 -5.355  1.00 40.32  ? 516 PHE A CE2 1 
ATOM   3542 C  CZ  . PHE A 1 476 ? -30.054 28.426 -4.027  1.00 38.24  ? 516 PHE A CZ  1 
ATOM   3543 N  N   . LYS A 1 477 ? -32.311 33.614 -3.085  1.00 42.79  ? 517 LYS A N   1 
ATOM   3544 C  CA  . LYS A 1 477 ? -31.535 34.040 -1.932  1.00 43.86  ? 517 LYS A CA  1 
ATOM   3545 C  C   . LYS A 1 477 ? -31.735 33.236 -0.643  1.00 43.71  ? 517 LYS A C   1 
ATOM   3546 O  O   . LYS A 1 477 ? -32.857 32.894 -0.256  1.00 43.96  ? 517 LYS A O   1 
ATOM   3547 C  CB  . LYS A 1 477 ? -31.796 35.527 -1.659  1.00 44.68  ? 517 LYS A CB  1 
ATOM   3548 C  CG  . LYS A 1 477 ? -31.575 36.412 -2.872  1.00 47.14  ? 517 LYS A CG  1 
ATOM   3549 C  CD  . LYS A 1 477 ? -31.614 37.896 -2.500  1.00 49.09  ? 517 LYS A CD  1 
ATOM   3550 C  CE  . LYS A 1 477 ? -31.483 38.788 -3.740  1.00 50.09  ? 517 LYS A CE  1 
ATOM   3551 N  NZ  . LYS A 1 477 ? -31.415 40.250 -3.420  1.00 50.92  ? 517 LYS A NZ  1 
ATOM   3552 N  N   . VAL A 1 478 ? -30.621 32.970 0.031   1.00 42.99  ? 518 VAL A N   1 
ATOM   3553 C  CA  . VAL A 1 478 ? -30.615 32.193 1.258   1.00 40.40  ? 518 VAL A CA  1 
ATOM   3554 C  C   . VAL A 1 478 ? -30.015 33.059 2.352   1.00 39.59  ? 518 VAL A C   1 
ATOM   3555 O  O   . VAL A 1 478 ? -29.373 34.067 2.054   1.00 38.65  ? 518 VAL A O   1 
ATOM   3556 C  CB  . VAL A 1 478 ? -29.760 30.904 1.060   1.00 39.05  ? 518 VAL A CB  1 
ATOM   3557 C  CG1 . VAL A 1 478 ? -28.322 31.253 1.005   1.00 38.18  ? 518 VAL A CG1 1 
ATOM   3558 C  CG2 . VAL A 1 478 ? -30.008 29.927 2.162   1.00 40.75  ? 518 VAL A CG2 1 
ATOM   3559 N  N   . ASN A 1 479 ? -30.266 32.686 3.609   1.00 38.98  ? 519 ASN A N   1 
ATOM   3560 C  CA  . ASN A 1 479 ? -29.726 33.399 4.774   1.00 38.99  ? 519 ASN A CA  1 
ATOM   3561 C  C   . ASN A 1 479 ? -28.977 32.374 5.615   1.00 38.90  ? 519 ASN A C   1 
ATOM   3562 O  O   . ASN A 1 479 ? -29.545 31.383 6.058   1.00 39.31  ? 519 ASN A O   1 
ATOM   3563 C  CB  . ASN A 1 479 ? -30.841 34.048 5.588   1.00 38.70  ? 519 ASN A CB  1 
ATOM   3564 C  CG  . ASN A 1 479 ? -30.367 34.523 6.960   1.00 39.25  ? 519 ASN A CG  1 
ATOM   3565 O  OD1 . ASN A 1 479 ? -30.346 33.756 7.931   1.00 38.97  ? 519 ASN A OD1 1 
ATOM   3566 N  ND2 . ASN A 1 479 ? -29.979 35.784 7.044   1.00 36.65  ? 519 ASN A ND2 1 
ATOM   3567 N  N   . VAL A 1 480 ? -27.698 32.613 5.841   1.00 39.56  ? 520 VAL A N   1 
ATOM   3568 C  CA  . VAL A 1 480 ? -26.900 31.642 6.570   1.00 41.51  ? 520 VAL A CA  1 
ATOM   3569 C  C   . VAL A 1 480 ? -26.272 32.119 7.883   1.00 42.19  ? 520 VAL A C   1 
ATOM   3570 O  O   . VAL A 1 480 ? -25.665 33.192 7.958   1.00 43.72  ? 520 VAL A O   1 
ATOM   3571 C  CB  . VAL A 1 480 ? -25.785 31.061 5.633   1.00 40.26  ? 520 VAL A CB  1 
ATOM   3572 C  CG1 . VAL A 1 480 ? -25.078 29.935 6.311   1.00 38.94  ? 520 VAL A CG1 1 
ATOM   3573 C  CG2 . VAL A 1 480 ? -26.402 30.579 4.323   1.00 38.88  ? 520 VAL A CG2 1 
ATOM   3574 N  N   . THR A 1 481 ? -26.432 31.300 8.918   1.00 41.86  ? 521 THR A N   1 
ATOM   3575 C  CA  . THR A 1 481 ? -25.880 31.596 10.228  1.00 40.81  ? 521 THR A CA  1 
ATOM   3576 C  C   . THR A 1 481 ? -25.069 30.408 10.712  1.00 38.81  ? 521 THR A C   1 
ATOM   3577 O  O   . THR A 1 481 ? -25.313 29.273 10.323  1.00 37.60  ? 521 THR A O   1 
ATOM   3578 C  CB  . THR A 1 481 ? -26.998 31.921 11.255  1.00 41.46  ? 521 THR A CB  1 
ATOM   3579 O  OG1 . THR A 1 481 ? -28.015 30.921 11.191  1.00 44.63  ? 521 THR A OG1 1 
ATOM   3580 C  CG2 . THR A 1 481 ? -27.624 33.261 10.959  1.00 40.73  ? 521 THR A CG2 1 
ATOM   3581 N  N   . LEU A 1 482 ? -24.081 30.703 11.543  1.00 39.37  ? 522 LEU A N   1 
ATOM   3582 C  CA  . LEU A 1 482 ? -23.194 29.706 12.130  1.00 40.79  ? 522 LEU A CA  1 
ATOM   3583 C  C   . LEU A 1 482 ? -23.821 29.057 13.371  1.00 42.27  ? 522 LEU A C   1 
ATOM   3584 O  O   . LEU A 1 482 ? -24.337 29.745 14.259  1.00 41.68  ? 522 LEU A O   1 
ATOM   3585 C  CB  . LEU A 1 482 ? -21.862 30.363 12.532  1.00 39.01  ? 522 LEU A CB  1 
ATOM   3586 C  CG  . LEU A 1 482 ? -20.723 30.466 11.520  1.00 37.38  ? 522 LEU A CG  1 
ATOM   3587 C  CD1 . LEU A 1 482 ? -19.615 31.334 12.058  1.00 36.91  ? 522 LEU A CD1 1 
ATOM   3588 C  CD2 . LEU A 1 482 ? -20.169 29.087 11.258  1.00 39.26  ? 522 LEU A CD2 1 
ATOM   3589 N  N   . ARG A 1 483 ? -23.787 27.730 13.430  1.00 44.52  ? 523 ARG A N   1 
ATOM   3590 C  CA  . ARG A 1 483 ? -24.325 27.027 14.588  1.00 48.19  ? 523 ARG A CA  1 
ATOM   3591 C  C   . ARG A 1 483 ? -23.399 27.263 15.774  1.00 50.92  ? 523 ARG A C   1 
ATOM   3592 O  O   . ARG A 1 483 ? -23.853 27.373 16.902  1.00 50.92  ? 523 ARG A O   1 
ATOM   3593 C  CB  . ARG A 1 483 ? -24.442 25.540 14.290  1.00 46.47  ? 523 ARG A CB  1 
ATOM   3594 C  CG  . ARG A 1 483 ? -25.382 25.282 13.153  1.00 46.41  ? 523 ARG A CG  1 
ATOM   3595 C  CD  . ARG A 1 483 ? -25.182 23.910 12.614  1.00 46.47  ? 523 ARG A CD  1 
ATOM   3596 N  NE  . ARG A 1 483 ? -25.851 22.894 13.402  1.00 45.84  ? 523 ARG A NE  1 
ATOM   3597 C  CZ  . ARG A 1 483 ? -25.614 21.599 13.257  1.00 46.83  ? 523 ARG A CZ  1 
ATOM   3598 N  NH1 . ARG A 1 483 ? -24.721 21.199 12.364  1.00 46.81  ? 523 ARG A NH1 1 
ATOM   3599 N  NH2 . ARG A 1 483 ? -26.284 20.705 13.973  1.00 45.52  ? 523 ARG A NH2 1 
ATOM   3600 N  N   . GLU A 1 484 ? -22.100 27.358 15.501  1.00 56.11  ? 524 GLU A N   1 
ATOM   3601 C  CA  . GLU A 1 484 ? -21.097 27.611 16.536  1.00 60.08  ? 524 GLU A CA  1 
ATOM   3602 C  C   . GLU A 1 484 ? -19.806 28.225 16.007  1.00 61.78  ? 524 GLU A C   1 
ATOM   3603 O  O   . GLU A 1 484 ? -19.588 28.330 14.793  1.00 63.00  ? 524 GLU A O   1 
ATOM   3604 C  CB  . GLU A 1 484 ? -20.751 26.328 17.292  1.00 61.25  ? 524 GLU A CB  1 
ATOM   3605 C  CG  . GLU A 1 484 ? -21.857 25.837 18.188  1.00 64.83  ? 524 GLU A CG  1 
ATOM   3606 C  CD  . GLU A 1 484 ? -21.407 24.728 19.104  1.00 66.91  ? 524 GLU A CD  1 
ATOM   3607 O  OE1 . GLU A 1 484 ? -20.505 24.993 19.932  1.00 69.16  ? 524 GLU A OE1 1 
ATOM   3608 O  OE2 . GLU A 1 484 ? -21.951 23.602 18.998  1.00 66.12  ? 524 GLU A OE2 1 
ATOM   3609 N  N   . SER A 1 485 ? -18.951 28.610 16.948  1.00 63.23  ? 525 SER A N   1 
ATOM   3610 C  CA  . SER A 1 485 ? -17.660 29.216 16.658  1.00 64.09  ? 525 SER A CA  1 
ATOM   3611 C  C   . SER A 1 485 ? -16.863 28.424 15.626  1.00 64.44  ? 525 SER A C   1 
ATOM   3612 O  O   . SER A 1 485 ? -16.883 27.188 15.604  1.00 63.76  ? 525 SER A O   1 
ATOM   3613 C  CB  . SER A 1 485 ? -16.856 29.342 17.951  1.00 64.45  ? 525 SER A CB  1 
ATOM   3614 O  OG  . SER A 1 485 ? -15.641 30.023 17.731  1.00 66.64  ? 525 SER A OG  1 
ATOM   3615 N  N   . MET A 1 486 ? -16.152 29.160 14.778  1.00 65.51  ? 526 MET A N   1 
ATOM   3616 C  CA  . MET A 1 486 ? -15.345 28.573 13.716  1.00 64.94  ? 526 MET A CA  1 
ATOM   3617 C  C   . MET A 1 486 ? -14.143 27.738 14.168  1.00 64.30  ? 526 MET A C   1 
ATOM   3618 O  O   . MET A 1 486 ? -13.164 28.263 14.686  1.00 63.15  ? 526 MET A O   1 
ATOM   3619 C  CB  . MET A 1 486 ? -14.883 29.682 12.774  1.00 63.67  ? 526 MET A CB  1 
ATOM   3620 C  CG  . MET A 1 486 ? -16.023 30.605 12.383  1.00 63.06  ? 526 MET A CG  1 
ATOM   3621 S  SD  . MET A 1 486 ? -16.094 31.060 10.616  1.00 65.30  ? 526 MET A SD  1 
ATOM   3622 C  CE  . MET A 1 486 ? -16.631 29.524 9.871   1.00 63.62  ? 526 MET A CE  1 
ATOM   3623 N  N   . GLU A 1 487 ? -14.259 26.423 13.987  1.00 65.13  ? 527 GLU A N   1 
ATOM   3624 C  CA  . GLU A 1 487 ? -13.188 25.468 14.296  1.00 63.51  ? 527 GLU A CA  1 
ATOM   3625 C  C   . GLU A 1 487 ? -12.727 25.083 12.901  1.00 63.29  ? 527 GLU A C   1 
ATOM   3626 O  O   . GLU A 1 487 ? -11.919 24.190 12.707  1.00 62.34  ? 527 GLU A O   1 
ATOM   3627 C  CB  . GLU A 1 487 ? -13.729 24.227 14.999  1.00 62.91  ? 527 GLU A CB  1 
ATOM   3628 C  CG  . GLU A 1 487 ? -14.358 23.206 14.066  1.00 63.55  ? 527 GLU A CG  1 
ATOM   3629 C  CD  . GLU A 1 487 ? -14.884 21.974 14.801  1.00 64.76  ? 527 GLU A CD  1 
ATOM   3630 O  OE1 . GLU A 1 487 ? -16.081 21.959 15.178  1.00 63.91  ? 527 GLU A OE1 1 
ATOM   3631 O  OE2 . GLU A 1 487 ? -14.095 21.021 15.009  1.00 64.94  ? 527 GLU A OE2 1 
ATOM   3632 N  N   . LEU A 1 488 ? -13.314 25.759 11.922  1.00 63.88  ? 528 LEU A N   1 
ATOM   3633 C  CA  . LEU A 1 488 ? -12.971 25.554 10.531  1.00 63.44  ? 528 LEU A CA  1 
ATOM   3634 C  C   . LEU A 1 488 ? -11.692 26.341 10.353  1.00 62.86  ? 528 LEU A C   1 
ATOM   3635 O  O   . LEU A 1 488 ? -10.924 26.071 9.440   1.00 63.17  ? 528 LEU A O   1 
ATOM   3636 C  CB  . LEU A 1 488 ? -14.055 26.114 9.600   1.00 62.70  ? 528 LEU A CB  1 
ATOM   3637 C  CG  . LEU A 1 488 ? -15.395 25.386 9.541   1.00 61.66  ? 528 LEU A CG  1 
ATOM   3638 C  CD1 . LEU A 1 488 ? -16.402 26.256 8.828   1.00 62.02  ? 528 LEU A CD1 1 
ATOM   3639 C  CD2 . LEU A 1 488 ? -15.239 24.062 8.831   1.00 61.69  ? 528 LEU A CD2 1 
ATOM   3640 N  N   . LEU A 1 489 ? -11.479 27.313 11.239  1.00 62.12  ? 529 LEU A N   1 
ATOM   3641 C  CA  . LEU A 1 489 ? -10.263 28.116 11.240  1.00 61.98  ? 529 LEU A CA  1 
ATOM   3642 C  C   . LEU A 1 489 ? -9.144  27.169 11.633  1.00 62.58  ? 529 LEU A C   1 
ATOM   3643 O  O   . LEU A 1 489 ? -8.791  27.045 12.806  1.00 62.46  ? 529 LEU A O   1 
ATOM   3644 C  CB  . LEU A 1 489 ? -10.371 29.262 12.244  1.00 59.63  ? 529 LEU A CB  1 
ATOM   3645 C  CG  . LEU A 1 489 ? -11.502 30.265 12.008  1.00 58.22  ? 529 LEU A CG  1 
ATOM   3646 C  CD1 . LEU A 1 489 ? -11.287 31.523 12.834  1.00 57.17  ? 529 LEU A CD1 1 
ATOM   3647 C  CD2 . LEU A 1 489 ? -11.621 30.603 10.530  1.00 56.00  ? 529 LEU A CD2 1 
ATOM   3648 N  N   . ASP A 1 490 ? -8.606  26.490 10.631  1.00 63.74  ? 530 ASP A N   1 
ATOM   3649 C  CA  . ASP A 1 490 ? -7.610  25.460 10.821  1.00 64.89  ? 530 ASP A CA  1 
ATOM   3650 C  C   . ASP A 1 490 ? -8.108  24.474 11.856  1.00 65.14  ? 530 ASP A C   1 
ATOM   3651 O  O   . ASP A 1 490 ? -8.556  23.388 11.416  1.00 65.38  ? 530 ASP A O   1 
ATOM   3652 C  CB  . ASP A 1 490 ? -6.258  26.052 11.217  1.00 66.56  ? 530 ASP A CB  1 
ATOM   3653 C  CG  . ASP A 1 490 ? -5.203  25.834 10.138  1.00 68.33  ? 530 ASP A CG  1 
ATOM   3654 O  OD1 . ASP A 1 490 ? -5.330  26.439 9.045   1.00 68.74  ? 530 ASP A OD1 1 
ATOM   3655 O  OD2 . ASP A 1 490 ? -4.265  25.034 10.371  1.00 69.14  ? 530 ASP A OD2 1 
HETATM 3656 C  CHA . HEM B 2 .   ? -19.699 13.474 -19.012 1.00 27.96  ? 900 HEM A CHA 1 
HETATM 3657 C  CHB . HEM B 2 .   ? -22.509 13.782 -15.294 1.00 26.63  ? 900 HEM A CHB 1 
HETATM 3658 C  CHC . HEM B 2 .   ? -18.985 15.553 -12.796 1.00 27.56  ? 900 HEM A CHC 1 
HETATM 3659 C  CHD . HEM B 2 .   ? -16.081 14.986 -16.481 1.00 27.51  ? 900 HEM A CHD 1 
HETATM 3660 C  C1A . HEM B 2 .   ? -20.835 13.252 -18.259 1.00 29.16  ? 900 HEM A C1A 1 
HETATM 3661 C  C2A . HEM B 2 .   ? -22.155 12.996 -18.724 1.00 29.99  ? 900 HEM A C2A 1 
HETATM 3662 C  C3A . HEM B 2 .   ? -22.971 13.205 -17.632 1.00 28.40  ? 900 HEM A C3A 1 
HETATM 3663 C  C4A . HEM B 2 .   ? -22.124 13.570 -16.579 1.00 28.90  ? 900 HEM A C4A 1 
HETATM 3664 C  CMA . HEM B 2 .   ? -24.534 13.070 -17.552 1.00 25.71  ? 900 HEM A CMA 1 
HETATM 3665 C  CAA . HEM B 2 .   ? -22.599 12.577 -20.140 1.00 33.72  ? 900 HEM A CAA 1 
HETATM 3666 C  CBA . HEM B 2 .   ? -22.684 11.114 -20.429 1.00 37.27  ? 900 HEM A CBA 1 
HETATM 3667 C  CGA . HEM B 2 .   ? -23.195 10.782 -21.834 1.00 40.75  ? 900 HEM A CGA 1 
HETATM 3668 O  O1A . HEM B 2 .   ? -23.621 9.641  -22.066 1.00 41.44  ? 900 HEM A O1A 1 
HETATM 3669 O  O2A . HEM B 2 .   ? -23.229 11.634 -22.733 1.00 41.88  ? 900 HEM A O2A 1 
HETATM 3670 C  C1B . HEM B 2 .   ? -21.901 14.462 -14.284 1.00 26.75  ? 900 HEM A C1B 1 
HETATM 3671 C  C2B . HEM B 2 .   ? -22.498 14.845 -13.048 1.00 28.76  ? 900 HEM A C2B 1 
HETATM 3672 C  C3B . HEM B 2 .   ? -21.453 15.451 -12.331 1.00 28.58  ? 900 HEM A C3B 1 
HETATM 3673 C  C4B . HEM B 2 .   ? -20.310 15.374 -13.200 1.00 28.15  ? 900 HEM A C4B 1 
HETATM 3674 C  CMB . HEM B 2 .   ? -23.949 14.618 -12.659 1.00 27.78  ? 900 HEM A CMB 1 
HETATM 3675 C  CAB . HEM B 2 .   ? -21.473 16.027 -11.038 1.00 30.32  ? 900 HEM A CAB 1 
HETATM 3676 C  CBB . HEM B 2 .   ? -22.285 15.708 -9.847  1.00 31.06  ? 900 HEM A CBB 1 
HETATM 3677 C  C1C . HEM B 2 .   ? -17.777 15.379 -13.461 1.00 27.29  ? 900 HEM A C1C 1 
HETATM 3678 C  C2C . HEM B 2 .   ? -16.519 15.728 -12.958 1.00 26.08  ? 900 HEM A C2C 1 
HETATM 3679 C  C3C . HEM B 2 .   ? -15.640 15.670 -14.052 1.00 25.94  ? 900 HEM A C3C 1 
HETATM 3680 C  C4C . HEM B 2 .   ? -16.455 15.279 -15.167 1.00 26.89  ? 900 HEM A C4C 1 
HETATM 3681 C  CMC . HEM B 2 .   ? -16.165 16.102 -11.489 1.00 22.14  ? 900 HEM A CMC 1 
HETATM 3682 C  CAC . HEM B 2 .   ? -14.310 15.911 -14.145 1.00 26.09  ? 900 HEM A CAC 1 
HETATM 3683 C  CBC . HEM B 2 .   ? -13.229 15.044 -13.907 1.00 28.37  ? 900 HEM A CBC 1 
HETATM 3684 C  C1D . HEM B 2 .   ? -16.715 14.212 -17.419 1.00 28.80  ? 900 HEM A C1D 1 
HETATM 3685 C  C2D . HEM B 2 .   ? -16.236 13.997 -18.727 1.00 27.46  ? 900 HEM A C2D 1 
HETATM 3686 C  C3D . HEM B 2 .   ? -17.301 13.566 -19.472 1.00 25.88  ? 900 HEM A C3D 1 
HETATM 3687 C  C4D . HEM B 2 .   ? -18.374 13.540 -18.592 1.00 26.98  ? 900 HEM A C4D 1 
HETATM 3688 C  CMD . HEM B 2 .   ? -14.796 14.210 -19.237 1.00 26.83  ? 900 HEM A CMD 1 
HETATM 3689 C  CAD . HEM B 2 .   ? -17.396 13.174 -20.951 1.00 26.30  ? 900 HEM A CAD 1 
HETATM 3690 C  CBD . HEM B 2 .   ? -17.141 11.663 -21.133 1.00 27.33  ? 900 HEM A CBD 1 
HETATM 3691 C  CGD . HEM B 2 .   ? -17.264 11.125 -22.546 1.00 29.23  ? 900 HEM A CGD 1 
HETATM 3692 O  O1D . HEM B 2 .   ? -17.696 11.812 -23.431 1.00 28.77  ? 900 HEM A O1D 1 
HETATM 3693 O  O2D . HEM B 2 .   ? -16.950 9.961  -22.770 1.00 32.98  ? 900 HEM A O2D 1 
HETATM 3694 N  NA  . HEM B 2 .   ? -20.869 13.599 -16.944 1.00 28.49  ? 900 HEM A NA  1 
HETATM 3695 N  NB  . HEM B 2 .   ? -20.621 14.788 -14.339 1.00 26.30  ? 900 HEM A NB  1 
HETATM 3696 N  NC  . HEM B 2 .   ? -17.729 15.113 -14.764 1.00 27.85  ? 900 HEM A NC  1 
HETATM 3697 N  ND  . HEM B 2 .   ? -17.989 13.923 -17.385 1.00 26.90  ? 900 HEM A ND  1 
HETATM 3698 FE FE  . HEM B 2 .   ? -19.272 14.286 -15.837 1.00 28.24  ? 900 HEM A FE  1 
HETATM 3699 C  C8  . BHF C 3 .   ? -17.501 19.509 -20.574 1.00 41.57  ? 800 BHF A C8  1 
HETATM 3700 C  C9  . BHF C 3 .   ? -16.556 20.406 -21.068 1.00 42.74  ? 800 BHF A C9  1 
HETATM 3701 O  O2  . BHF C 3 .   ? -15.602 19.990 -21.727 1.00 43.44  ? 800 BHF A O2  1 
HETATM 3702 C  C10 . BHF C 3 .   ? -16.704 21.772 -20.846 1.00 42.42  ? 800 BHF A C10 1 
HETATM 3703 C  C11 . BHF C 3 .   ? -15.746 22.683 -21.286 1.00 42.03  ? 800 BHF A C11 1 
HETATM 3704 C  C12 . BHF C 3 .   ? -15.894 24.035 -20.989 1.00 41.82  ? 800 BHF A C12 1 
HETATM 3705 C  C13 . BHF C 3 .   ? -16.994 24.476 -20.258 1.00 40.37  ? 800 BHF A C13 1 
HETATM 3706 C  C14 . BHF C 3 .   ? -17.158 25.832 -19.988 1.00 38.34  ? 800 BHF A C14 1 
HETATM 3707 C  C15 . BHF C 3 .   ? -18.276 26.269 -19.284 1.00 39.28  ? 800 BHF A C15 1 
HETATM 3708 C  C16 . BHF C 3 .   ? -19.234 25.359 -18.848 1.00 40.19  ? 800 BHF A C16 1 
HETATM 3709 C  C17 . BHF C 3 .   ? -19.072 24.002 -19.115 1.00 41.29  ? 800 BHF A C17 1 
HETATM 3710 C  C18 . BHF C 3 .   ? -17.953 23.565 -19.819 1.00 41.21  ? 800 BHF A C18 1 
HETATM 3711 C  C19 . BHF C 3 .   ? -17.803 22.216 -20.117 1.00 40.95  ? 800 BHF A C19 1 
HETATM 3712 O  O1  . BHF C 3 .   ? -18.800 21.340 -19.814 1.00 42.63  ? 800 BHF A O1  1 
HETATM 3713 C  C7  . BHF C 3 .   ? -18.603 19.993 -19.877 1.00 41.63  ? 800 BHF A C7  1 
HETATM 3714 C  C1  . BHF C 3 .   ? -19.576 19.159 -19.333 1.00 39.26  ? 800 BHF A C1  1 
HETATM 3715 C  C2  . BHF C 3 .   ? -19.540 17.780 -19.521 1.00 39.26  ? 800 BHF A C2  1 
HETATM 3716 C  C3  . BHF C 3 .   ? -20.518 16.972 -18.951 1.00 39.57  ? 800 BHF A C3  1 
HETATM 3717 C  C4  . BHF C 3 .   ? -21.536 17.538 -18.188 1.00 39.46  ? 800 BHF A C4  1 
HETATM 3718 C  C5  . BHF C 3 .   ? -21.574 18.917 -18.002 1.00 41.21  ? 800 BHF A C5  1 
HETATM 3719 C  C6  . BHF C 3 .   ? -20.596 19.725 -18.575 1.00 38.93  ? 800 BHF A C6  1 
HETATM 3720 O  O   . HOH D 4 .   ? -23.783 12.781 -36.735 1.00 27.50  ? 1   HOH A O   1 
HETATM 3721 O  O   . HOH D 4 .   ? -30.172 31.048 9.058   1.00 27.59  ? 2   HOH A O   1 
HETATM 3722 O  O   . HOH D 4 .   ? -4.070  11.445 -27.201 1.00 20.30  ? 3   HOH A O   1 
HETATM 3723 O  O   . HOH D 4 .   ? -27.740 19.279 -28.451 1.00 24.60  ? 4   HOH A O   1 
HETATM 3724 O  O   . HOH D 4 .   ? 5.104   22.697 -13.951 1.00 23.38  ? 5   HOH A O   1 
HETATM 3725 O  O   . HOH D 4 .   ? -5.383  19.964 -27.011 1.00 25.50  ? 6   HOH A O   1 
HETATM 3726 O  O   . HOH D 4 .   ? -18.542 29.903 -17.833 1.00 40.57  ? 7   HOH A O   1 
HETATM 3727 O  O   . HOH D 4 .   ? -35.587 33.051 -2.964  1.00 37.77  ? 8   HOH A O   1 
HETATM 3728 O  O   . HOH D 4 .   ? -9.082  33.576 -20.913 1.00 39.20  ? 9   HOH A O   1 
HETATM 3729 O  O   . HOH D 4 .   ? -28.423 17.636 -23.043 1.00 21.56  ? 10  HOH A O   1 
HETATM 3730 O  O   . HOH D 4 .   ? -13.976 2.807  -19.463 1.00 51.14  ? 11  HOH A O   1 
HETATM 3731 O  O   . HOH D 4 .   ? -23.549 -5.083 -28.588 1.00 50.68  ? 12  HOH A O   1 
HETATM 3732 O  O   . HOH D 4 .   ? -8.949  13.439 -30.409 1.00 40.70  ? 13  HOH A O   1 
HETATM 3733 O  O   . HOH D 4 .   ? -42.984 17.899 -3.119  1.00 53.62  ? 15  HOH A O   1 
HETATM 3734 O  O   . HOH D 4 .   ? -28.044 26.094 -18.640 1.00 39.42  ? 16  HOH A O   1 
HETATM 3735 O  O   . HOH D 4 .   ? -28.304 28.455 -35.267 1.00 21.15  ? 17  HOH A O   1 
HETATM 3736 O  O   . HOH D 4 .   ? -23.209 28.970 -11.504 1.00 29.70  ? 18  HOH A O   1 
HETATM 3737 O  O   . HOH D 4 .   ? -15.161 7.640  -12.239 1.00 47.22  ? 19  HOH A O   1 
HETATM 3738 O  O   . HOH D 4 .   ? -6.501  22.481 -27.640 1.00 29.55  ? 20  HOH A O   1 
HETATM 3739 O  O   . HOH D 4 .   ? -8.685  23.582 -24.934 1.00 33.66  ? 21  HOH A O   1 
HETATM 3740 O  O   . HOH D 4 .   ? -11.941 26.282 -28.070 1.00 27.94  ? 22  HOH A O   1 
HETATM 3741 O  O   . HOH D 4 .   ? -21.933 30.728 -14.348 1.00 44.51  ? 23  HOH A O   1 
HETATM 3742 O  O   . HOH D 4 .   ? -19.147 33.763 -10.924 1.00 47.64  ? 24  HOH A O   1 
HETATM 3743 O  O   . HOH D 4 .   ? -26.081 24.297 -18.245 1.00 38.20  ? 25  HOH A O   1 
HETATM 3744 O  O   . HOH D 4 .   ? 4.174   25.262 -12.510 1.00 27.43  ? 26  HOH A O   1 
HETATM 3745 O  O   . HOH D 4 .   ? -19.596 34.541 -23.604 1.00 34.82  ? 27  HOH A O   1 
HETATM 3746 O  O   . HOH D 4 .   ? -20.877 16.826 21.130  1.00 36.83  ? 28  HOH A O   1 
HETATM 3747 O  O   . HOH D 4 .   ? -25.435 6.410  -13.809 1.00 27.71  ? 29  HOH A O   1 
HETATM 3748 O  O   . HOH D 4 .   ? -37.737 31.520 -5.421  1.00 45.75  ? 30  HOH A O   1 
HETATM 3749 O  O   . HOH D 4 .   ? -24.470 15.448 19.535  1.00 34.34  ? 31  HOH A O   1 
HETATM 3750 O  O   . HOH D 4 .   ? -9.207  7.093  -35.561 1.00 33.13  ? 32  HOH A O   1 
HETATM 3751 O  O   . HOH D 4 .   ? 10.801  14.685 -19.257 1.00 51.88  ? 33  HOH A O   1 
HETATM 3752 O  O   . HOH D 4 .   ? 10.802  12.625 -13.207 1.00 36.49  ? 34  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   41  ?   ?   ?   A . n 
A 1 2   ALA 2   42  ?   ?   ?   A . n 
A 1 3   LYS 3   43  ?   ?   ?   A . n 
A 1 4   LYS 4   44  ?   ?   ?   A . n 
A 1 5   THR 5   45  ?   ?   ?   A . n 
A 1 6   SER 6   46  ?   ?   ?   A . n 
A 1 7   SER 7   47  ?   ?   ?   A . n 
A 1 8   LYS 8   48  ?   ?   ?   A . n 
A 1 9   GLY 9   49  ?   ?   ?   A . n 
A 1 10  LYS 10  50  ?   ?   ?   A . n 
A 1 11  PRO 11  51  ?   ?   ?   A . n 
A 1 12  PRO 12  52  ?   ?   ?   A . n 
A 1 13  GLY 13  53  ?   ?   ?   A . n 
A 1 14  PRO 14  54  ?   ?   ?   A . n 
A 1 15  PHE 15  55  ?   ?   ?   A . n 
A 1 16  ALA 16  56  ?   ?   ?   A . n 
A 1 17  TRP 17  57  ?   ?   ?   A . n 
A 1 18  PRO 18  58  ?   ?   ?   A . n 
A 1 19  LEU 19  59  ?   ?   ?   A . n 
A 1 20  ILE 20  60  ?   ?   ?   A . n 
A 1 21  GLY 21  61  ?   ?   ?   A . n 
A 1 22  ASN 22  62  ?   ?   ?   A . n 
A 1 23  ALA 23  63  ?   ?   ?   A . n 
A 1 24  ALA 24  64  ?   ?   ?   A . n 
A 1 25  ALA 25  65  ?   ?   ?   A . n 
A 1 26  VAL 26  66  ?   ?   ?   A . n 
A 1 27  GLY 27  67  ?   ?   ?   A . n 
A 1 28  GLN 28  68  68  GLN GLN A . n 
A 1 29  ALA 29  69  69  ALA ALA A . n 
A 1 30  ALA 30  70  70  ALA ALA A . n 
A 1 31  HIS 31  71  71  HIS HIS A . n 
A 1 32  LEU 32  72  72  LEU LEU A . n 
A 1 33  SER 33  73  73  SER SER A . n 
A 1 34  PHE 34  74  74  PHE PHE A . n 
A 1 35  ALA 35  75  75  ALA ALA A . n 
A 1 36  ARG 36  76  76  ARG ARG A . n 
A 1 37  LEU 37  77  77  LEU LEU A . n 
A 1 38  ALA 38  78  78  ALA ALA A . n 
A 1 39  ARG 39  79  79  ARG ARG A . n 
A 1 40  ARG 40  80  80  ARG ARG A . n 
A 1 41  TYR 41  81  81  TYR TYR A . n 
A 1 42  GLY 42  82  82  GLY GLY A . n 
A 1 43  ASP 43  83  83  ASP ASP A . n 
A 1 44  VAL 44  84  84  VAL VAL A . n 
A 1 45  PHE 45  85  85  PHE PHE A . n 
A 1 46  GLN 46  86  86  GLN GLN A . n 
A 1 47  ILE 47  87  87  ILE ILE A . n 
A 1 48  ARG 48  88  88  ARG ARG A . n 
A 1 49  LEU 49  89  89  LEU LEU A . n 
A 1 50  GLY 50  90  90  GLY GLY A . n 
A 1 51  SER 51  91  91  SER SER A . n 
A 1 52  CYS 52  92  92  CYS CYS A . n 
A 1 53  PRO 53  93  93  PRO PRO A . n 
A 1 54  ILE 54  94  94  ILE ILE A . n 
A 1 55  VAL 55  95  95  VAL VAL A . n 
A 1 56  VAL 56  96  96  VAL VAL A . n 
A 1 57  LEU 57  97  97  LEU LEU A . n 
A 1 58  ASN 58  98  98  ASN ASN A . n 
A 1 59  GLY 59  99  99  GLY GLY A . n 
A 1 60  GLU 60  100 100 GLU GLU A . n 
A 1 61  ARG 61  101 101 ARG ARG A . n 
A 1 62  ALA 62  102 102 ALA ALA A . n 
A 1 63  ILE 63  103 103 ILE ILE A . n 
A 1 64  HIS 64  104 104 HIS HIS A . n 
A 1 65  GLN 65  105 105 GLN GLN A . n 
A 1 66  ALA 66  106 106 ALA ALA A . n 
A 1 67  LEU 67  107 107 LEU LEU A . n 
A 1 68  VAL 68  108 108 VAL VAL A . n 
A 1 69  GLN 69  109 109 GLN GLN A . n 
A 1 70  GLN 70  110 110 GLN GLN A . n 
A 1 71  GLY 71  111 111 GLY GLY A . n 
A 1 72  SER 72  112 112 SER SER A . n 
A 1 73  ALA 73  113 113 ALA ALA A . n 
A 1 74  PHE 74  114 114 PHE PHE A . n 
A 1 75  ALA 75  115 115 ALA ALA A . n 
A 1 76  ASP 76  116 116 ASP ASP A . n 
A 1 77  ARG 77  117 117 ARG ARG A . n 
A 1 78  PRO 78  118 118 PRO PRO A . n 
A 1 79  SER 79  119 119 SER SER A . n 
A 1 80  PHE 80  120 120 PHE PHE A . n 
A 1 81  ALA 81  121 121 ALA ALA A . n 
A 1 82  SER 82  122 122 SER SER A . n 
A 1 83  PHE 83  123 123 PHE PHE A . n 
A 1 84  ARG 84  124 124 ARG ARG A . n 
A 1 85  VAL 85  125 125 VAL VAL A . n 
A 1 86  VAL 86  126 126 VAL VAL A . n 
A 1 87  SER 87  127 127 SER SER A . n 
A 1 88  GLY 88  128 128 GLY GLY A . n 
A 1 89  GLY 89  129 129 GLY GLY A . n 
A 1 90  ARG 90  130 130 ARG ARG A . n 
A 1 91  SER 91  131 131 SER SER A . n 
A 1 92  MET 92  132 132 MET MET A . n 
A 1 93  ALA 93  133 133 ALA ALA A . n 
A 1 94  PHE 94  134 134 PHE PHE A . n 
A 1 95  GLY 95  135 135 GLY GLY A . n 
A 1 96  HIS 96  136 136 HIS HIS A . n 
A 1 97  TYR 97  137 137 TYR TYR A . n 
A 1 98  SER 98  138 138 SER SER A . n 
A 1 99  GLU 99  139 139 GLU GLU A . n 
A 1 100 HIS 100 140 140 HIS HIS A . n 
A 1 101 TRP 101 141 141 TRP TRP A . n 
A 1 102 LYS 102 142 142 LYS LYS A . n 
A 1 103 VAL 103 143 143 VAL VAL A . n 
A 1 104 GLN 104 144 144 GLN GLN A . n 
A 1 105 ARG 105 145 145 ARG ARG A . n 
A 1 106 ARG 106 146 146 ARG ARG A . n 
A 1 107 ALA 107 147 147 ALA ALA A . n 
A 1 108 ALA 108 148 148 ALA ALA A . n 
A 1 109 HIS 109 149 149 HIS HIS A . n 
A 1 110 SER 110 150 150 SER SER A . n 
A 1 111 MET 111 151 151 MET MET A . n 
A 1 112 MET 112 152 152 MET MET A . n 
A 1 113 ARG 113 153 153 ARG ARG A . n 
A 1 114 ASN 114 154 154 ASN ASN A . n 
A 1 115 PHE 115 155 155 PHE PHE A . n 
A 1 116 PHE 116 156 156 PHE PHE A . n 
A 1 117 THR 117 157 157 THR THR A . n 
A 1 118 ARG 118 158 158 ARG ARG A . n 
A 1 119 GLN 119 159 159 GLN GLN A . n 
A 1 120 PRO 120 160 160 PRO PRO A . n 
A 1 121 ARG 121 161 161 ARG ARG A . n 
A 1 122 SER 122 162 162 SER SER A . n 
A 1 123 ARG 123 163 163 ARG ARG A . n 
A 1 124 GLN 124 164 164 GLN GLN A . n 
A 1 125 VAL 125 165 165 VAL VAL A . n 
A 1 126 LEU 126 166 166 LEU LEU A . n 
A 1 127 GLU 127 167 167 GLU GLU A . n 
A 1 128 GLY 128 168 168 GLY GLY A . n 
A 1 129 HIS 129 169 169 HIS HIS A . n 
A 1 130 VAL 130 170 170 VAL VAL A . n 
A 1 131 LEU 131 171 171 LEU LEU A . n 
A 1 132 SER 132 172 172 SER SER A . n 
A 1 133 GLU 133 173 173 GLU GLU A . n 
A 1 134 ALA 134 174 174 ALA ALA A . n 
A 1 135 ARG 135 175 175 ARG ARG A . n 
A 1 136 GLU 136 176 176 GLU GLU A . n 
A 1 137 LEU 137 177 177 LEU LEU A . n 
A 1 138 VAL 138 178 178 VAL VAL A . n 
A 1 139 ALA 139 179 179 ALA ALA A . n 
A 1 140 LEU 140 180 180 LEU LEU A . n 
A 1 141 LEU 141 181 181 LEU LEU A . n 
A 1 142 VAL 142 182 182 VAL VAL A . n 
A 1 143 ARG 143 183 183 ARG ARG A . n 
A 1 144 GLY 144 184 184 GLY GLY A . n 
A 1 145 SER 145 185 185 SER SER A . n 
A 1 146 ALA 146 186 186 ALA ALA A . n 
A 1 147 ASP 147 187 187 ASP ASP A . n 
A 1 148 GLY 148 188 188 GLY GLY A . n 
A 1 149 ALA 149 189 189 ALA ALA A . n 
A 1 150 PHE 150 190 190 PHE PHE A . n 
A 1 151 LEU 151 191 191 LEU LEU A . n 
A 1 152 ASP 152 192 192 ASP ASP A . n 
A 1 153 PRO 153 193 193 PRO PRO A . n 
A 1 154 ARG 154 194 194 ARG ARG A . n 
A 1 155 PRO 155 195 195 PRO PRO A . n 
A 1 156 LEU 156 196 196 LEU LEU A . n 
A 1 157 THR 157 197 197 THR THR A . n 
A 1 158 VAL 158 198 198 VAL VAL A . n 
A 1 159 VAL 159 199 199 VAL VAL A . n 
A 1 160 ALA 160 200 200 ALA ALA A . n 
A 1 161 VAL 161 201 201 VAL VAL A . n 
A 1 162 ALA 162 202 202 ALA ALA A . n 
A 1 163 ASN 163 203 203 ASN ASN A . n 
A 1 164 VAL 164 204 204 VAL VAL A . n 
A 1 165 MET 165 205 205 MET MET A . n 
A 1 166 SER 166 206 206 SER SER A . n 
A 1 167 ALA 167 207 207 ALA ALA A . n 
A 1 168 VAL 168 208 208 VAL VAL A . n 
A 1 169 CYS 169 209 209 CYS CYS A . n 
A 1 170 PHE 170 210 210 PHE PHE A . n 
A 1 171 GLY 171 211 211 GLY GLY A . n 
A 1 172 CYS 172 212 212 CYS CYS A . n 
A 1 173 ARG 173 213 213 ARG ARG A . n 
A 1 174 TYR 174 214 214 TYR TYR A . n 
A 1 175 SER 175 215 215 SER SER A . n 
A 1 176 HIS 176 216 216 HIS HIS A . n 
A 1 177 ASP 177 217 217 ASP ASP A . n 
A 1 178 ASP 178 218 218 ASP ASP A . n 
A 1 179 PRO 179 219 219 PRO PRO A . n 
A 1 180 GLU 180 220 220 GLU GLU A . n 
A 1 181 PHE 181 221 221 PHE PHE A . n 
A 1 182 ARG 182 222 222 ARG ARG A . n 
A 1 183 GLU 183 223 223 GLU GLU A . n 
A 1 184 LEU 184 224 224 LEU LEU A . n 
A 1 185 LEU 185 225 225 LEU LEU A . n 
A 1 186 SER 186 226 226 SER SER A . n 
A 1 187 HIS 187 227 227 HIS HIS A . n 
A 1 188 ASN 188 228 228 ASN ASN A . n 
A 1 189 GLU 189 229 229 GLU GLU A . n 
A 1 190 GLU 190 230 230 GLU GLU A . n 
A 1 191 PHE 191 231 231 PHE PHE A . n 
A 1 192 GLY 192 232 232 GLY GLY A . n 
A 1 193 ARG 193 233 233 ARG ARG A . n 
A 1 194 THR 194 234 234 THR THR A . n 
A 1 195 VAL 195 235 235 VAL VAL A . n 
A 1 196 GLY 196 236 236 GLY GLY A . n 
A 1 197 ALA 197 237 237 ALA ALA A . n 
A 1 198 GLY 198 238 238 GLY GLY A . n 
A 1 199 SER 199 239 239 SER SER A . n 
A 1 200 LEU 200 240 240 LEU LEU A . n 
A 1 201 VAL 201 241 241 VAL VAL A . n 
A 1 202 ASP 202 242 242 ASP ASP A . n 
A 1 203 VAL 203 243 243 VAL VAL A . n 
A 1 204 MET 204 244 244 MET MET A . n 
A 1 205 PRO 205 245 245 PRO PRO A . n 
A 1 206 TRP 206 246 246 TRP TRP A . n 
A 1 207 LEU 207 247 247 LEU LEU A . n 
A 1 208 GLN 208 248 248 GLN GLN A . n 
A 1 209 TYR 209 249 249 TYR TYR A . n 
A 1 210 PHE 210 250 250 PHE PHE A . n 
A 1 211 PRO 211 251 251 PRO PRO A . n 
A 1 212 ASN 212 252 252 ASN ASN A . n 
A 1 213 PRO 213 253 253 PRO PRO A . n 
A 1 214 VAL 214 254 254 VAL VAL A . n 
A 1 215 ARG 215 255 255 ARG ARG A . n 
A 1 216 THR 216 256 256 THR THR A . n 
A 1 217 VAL 217 257 257 VAL VAL A . n 
A 1 218 PHE 218 258 258 PHE PHE A . n 
A 1 219 ARG 219 259 259 ARG ARG A . n 
A 1 220 GLU 220 260 260 GLU GLU A . n 
A 1 221 PHE 221 261 261 PHE PHE A . n 
A 1 222 GLU 222 262 262 GLU GLU A . n 
A 1 223 GLN 223 263 263 GLN GLN A . n 
A 1 224 LEU 224 264 264 LEU LEU A . n 
A 1 225 ASN 225 265 265 ASN ASN A . n 
A 1 226 ARG 226 266 266 ARG ARG A . n 
A 1 227 ASN 227 267 267 ASN ASN A . n 
A 1 228 PHE 228 268 268 PHE PHE A . n 
A 1 229 SER 229 269 269 SER SER A . n 
A 1 230 ASN 230 270 270 ASN ASN A . n 
A 1 231 PHE 231 271 271 PHE PHE A . n 
A 1 232 ILE 232 272 272 ILE ILE A . n 
A 1 233 LEU 233 273 273 LEU LEU A . n 
A 1 234 ASP 234 274 274 ASP ASP A . n 
A 1 235 LYS 235 275 275 LYS LYS A . n 
A 1 236 PHE 236 276 276 PHE PHE A . n 
A 1 237 LEU 237 277 277 LEU LEU A . n 
A 1 238 ARG 238 278 278 ARG ARG A . n 
A 1 239 HIS 239 279 279 HIS HIS A . n 
A 1 240 CYS 240 280 280 CYS CYS A . n 
A 1 241 GLU 241 281 281 GLU GLU A . n 
A 1 242 SER 242 282 282 SER SER A . n 
A 1 243 LEU 243 283 283 LEU LEU A . n 
A 1 244 ARG 244 284 284 ARG ARG A . n 
A 1 245 PRO 245 285 285 PRO PRO A . n 
A 1 246 GLY 246 286 286 GLY GLY A . n 
A 1 247 ALA 247 287 287 ALA ALA A . n 
A 1 248 ALA 248 288 288 ALA ALA A . n 
A 1 249 PRO 249 289 289 PRO PRO A . n 
A 1 250 ARG 250 290 290 ARG ARG A . n 
A 1 251 ASP 251 291 291 ASP ASP A . n 
A 1 252 MET 252 292 292 MET MET A . n 
A 1 253 MET 253 293 293 MET MET A . n 
A 1 254 ASP 254 294 294 ASP ASP A . n 
A 1 255 ALA 255 295 295 ALA ALA A . n 
A 1 256 PHE 256 296 296 PHE PHE A . n 
A 1 257 ILE 257 297 297 ILE ILE A . n 
A 1 258 LEU 258 298 298 LEU LEU A . n 
A 1 259 SER 259 299 299 SER SER A . n 
A 1 260 ALA 260 300 300 ALA ALA A . n 
A 1 261 GLU 261 301 301 GLU GLU A . n 
A 1 262 LYS 262 302 302 LYS LYS A . n 
A 1 263 LYS 263 303 303 LYS LYS A . n 
A 1 264 ALA 264 304 304 ALA ALA A . n 
A 1 265 ALA 265 305 305 ALA ALA A . n 
A 1 266 GLY 266 306 306 GLY GLY A . n 
A 1 267 ASP 267 307 307 ASP ASP A . n 
A 1 268 SER 268 308 ?   ?   ?   A . n 
A 1 269 HIS 269 309 ?   ?   ?   A . n 
A 1 270 GLY 270 310 ?   ?   ?   A . n 
A 1 271 GLY 271 311 ?   ?   ?   A . n 
A 1 272 GLY 272 312 312 GLY GLY A . n 
A 1 273 ALA 273 313 313 ALA ALA A . n 
A 1 274 ARG 274 314 314 ARG ARG A . n 
A 1 275 LEU 275 315 315 LEU LEU A . n 
A 1 276 ASP 276 316 316 ASP ASP A . n 
A 1 277 LEU 277 317 317 LEU LEU A . n 
A 1 278 GLU 278 318 318 GLU GLU A . n 
A 1 279 ASN 279 319 319 ASN ASN A . n 
A 1 280 VAL 280 320 320 VAL VAL A . n 
A 1 281 PRO 281 321 321 PRO PRO A . n 
A 1 282 ALA 282 322 322 ALA ALA A . n 
A 1 283 THR 283 323 323 THR THR A . n 
A 1 284 ILE 284 324 324 ILE ILE A . n 
A 1 285 THR 285 325 325 THR THR A . n 
A 1 286 ASP 286 326 326 ASP ASP A . n 
A 1 287 ILE 287 327 327 ILE ILE A . n 
A 1 288 PHE 288 328 328 PHE PHE A . n 
A 1 289 GLY 289 329 329 GLY GLY A . n 
A 1 290 ALA 290 330 330 ALA ALA A . n 
A 1 291 SER 291 331 331 SER SER A . n 
A 1 292 GLN 292 332 332 GLN GLN A . n 
A 1 293 ASP 293 333 333 ASP ASP A . n 
A 1 294 THR 294 334 334 THR THR A . n 
A 1 295 LEU 295 335 335 LEU LEU A . n 
A 1 296 SER 296 336 336 SER SER A . n 
A 1 297 THR 297 337 337 THR THR A . n 
A 1 298 ALA 298 338 338 ALA ALA A . n 
A 1 299 LEU 299 339 339 LEU LEU A . n 
A 1 300 GLN 300 340 340 GLN GLN A . n 
A 1 301 TRP 301 341 341 TRP TRP A . n 
A 1 302 LEU 302 342 342 LEU LEU A . n 
A 1 303 LEU 303 343 343 LEU LEU A . n 
A 1 304 LEU 304 344 344 LEU LEU A . n 
A 1 305 LEU 305 345 345 LEU LEU A . n 
A 1 306 PHE 306 346 346 PHE PHE A . n 
A 1 307 THR 307 347 347 THR THR A . n 
A 1 308 ARG 308 348 348 ARG ARG A . n 
A 1 309 TYR 309 349 349 TYR TYR A . n 
A 1 310 PRO 310 350 350 PRO PRO A . n 
A 1 311 ASP 311 351 351 ASP ASP A . n 
A 1 312 VAL 312 352 352 VAL VAL A . n 
A 1 313 GLN 313 353 353 GLN GLN A . n 
A 1 314 THR 314 354 354 THR THR A . n 
A 1 315 ARG 315 355 355 ARG ARG A . n 
A 1 316 VAL 316 356 356 VAL VAL A . n 
A 1 317 GLN 317 357 357 GLN GLN A . n 
A 1 318 ALA 318 358 358 ALA ALA A . n 
A 1 319 GLU 319 359 359 GLU GLU A . n 
A 1 320 LEU 320 360 360 LEU LEU A . n 
A 1 321 ASP 321 361 361 ASP ASP A . n 
A 1 322 GLN 322 362 362 GLN GLN A . n 
A 1 323 VAL 323 363 363 VAL VAL A . n 
A 1 324 VAL 324 364 364 VAL VAL A . n 
A 1 325 GLY 325 365 365 GLY GLY A . n 
A 1 326 ARG 326 366 366 ARG ARG A . n 
A 1 327 ASP 327 367 367 ASP ASP A . n 
A 1 328 ARG 328 368 368 ARG ARG A . n 
A 1 329 LEU 329 369 369 LEU LEU A . n 
A 1 330 PRO 330 370 370 PRO PRO A . n 
A 1 331 CYS 331 371 371 CYS CYS A . n 
A 1 332 MET 332 372 372 MET MET A . n 
A 1 333 GLY 333 373 373 GLY GLY A . n 
A 1 334 ASP 334 374 374 ASP ASP A . n 
A 1 335 GLN 335 375 375 GLN GLN A . n 
A 1 336 PRO 336 376 376 PRO PRO A . n 
A 1 337 ASN 337 377 377 ASN ASN A . n 
A 1 338 LEU 338 378 378 LEU LEU A . n 
A 1 339 PRO 339 379 379 PRO PRO A . n 
A 1 340 TYR 340 380 380 TYR TYR A . n 
A 1 341 VAL 341 381 381 VAL VAL A . n 
A 1 342 LEU 342 382 382 LEU LEU A . n 
A 1 343 ALA 343 383 383 ALA ALA A . n 
A 1 344 PHE 344 384 384 PHE PHE A . n 
A 1 345 LEU 345 385 385 LEU LEU A . n 
A 1 346 TYR 346 386 386 TYR TYR A . n 
A 1 347 GLU 347 387 387 GLU GLU A . n 
A 1 348 ALA 348 388 388 ALA ALA A . n 
A 1 349 MET 349 389 389 MET MET A . n 
A 1 350 ARG 350 390 390 ARG ARG A . n 
A 1 351 PHE 351 391 391 PHE PHE A . n 
A 1 352 SER 352 392 392 SER SER A . n 
A 1 353 SER 353 393 393 SER SER A . n 
A 1 354 PHE 354 394 394 PHE PHE A . n 
A 1 355 VAL 355 395 395 VAL VAL A . n 
A 1 356 PRO 356 396 396 PRO PRO A . n 
A 1 357 VAL 357 397 397 VAL VAL A . n 
A 1 358 THR 358 398 398 THR THR A . n 
A 1 359 ILE 359 399 399 ILE ILE A . n 
A 1 360 PRO 360 400 400 PRO PRO A . n 
A 1 361 HIS 361 401 401 HIS HIS A . n 
A 1 362 ALA 362 402 402 ALA ALA A . n 
A 1 363 THR 363 403 403 THR THR A . n 
A 1 364 THR 364 404 404 THR THR A . n 
A 1 365 ALA 365 405 405 ALA ALA A . n 
A 1 366 ASN 366 406 406 ASN ASN A . n 
A 1 367 THR 367 407 407 THR THR A . n 
A 1 368 SER 368 408 408 SER SER A . n 
A 1 369 VAL 369 409 409 VAL VAL A . n 
A 1 370 LEU 370 410 410 LEU LEU A . n 
A 1 371 GLY 371 411 411 GLY GLY A . n 
A 1 372 TYR 372 412 412 TYR TYR A . n 
A 1 373 HIS 373 413 413 HIS HIS A . n 
A 1 374 ILE 374 414 414 ILE ILE A . n 
A 1 375 PRO 375 415 415 PRO PRO A . n 
A 1 376 LYS 376 416 416 LYS LYS A . n 
A 1 377 ASP 377 417 417 ASP ASP A . n 
A 1 378 THR 378 418 418 THR THR A . n 
A 1 379 VAL 379 419 419 VAL VAL A . n 
A 1 380 VAL 380 420 420 VAL VAL A . n 
A 1 381 PHE 381 421 421 PHE PHE A . n 
A 1 382 VAL 382 422 422 VAL VAL A . n 
A 1 383 ASN 383 423 423 ASN ASN A . n 
A 1 384 GLN 384 424 424 GLN GLN A . n 
A 1 385 TRP 385 425 425 TRP TRP A . n 
A 1 386 SER 386 426 426 SER SER A . n 
A 1 387 VAL 387 427 427 VAL VAL A . n 
A 1 388 ASN 388 428 428 ASN ASN A . n 
A 1 389 HIS 389 429 429 HIS HIS A . n 
A 1 390 ASP 390 430 430 ASP ASP A . n 
A 1 391 PRO 391 431 431 PRO PRO A . n 
A 1 392 LEU 392 432 432 LEU LEU A . n 
A 1 393 LYS 393 433 433 LYS LYS A . n 
A 1 394 TRP 394 434 434 TRP TRP A . n 
A 1 395 PRO 395 435 435 PRO PRO A . n 
A 1 396 ASN 396 436 436 ASN ASN A . n 
A 1 397 PRO 397 437 437 PRO PRO A . n 
A 1 398 GLU 398 438 438 GLU GLU A . n 
A 1 399 ASN 399 439 439 ASN ASN A . n 
A 1 400 PHE 400 440 440 PHE PHE A . n 
A 1 401 ASP 401 441 441 ASP ASP A . n 
A 1 402 PRO 402 442 442 PRO PRO A . n 
A 1 403 ALA 403 443 443 ALA ALA A . n 
A 1 404 ARG 404 444 444 ARG ARG A . n 
A 1 405 PHE 405 445 445 PHE PHE A . n 
A 1 406 LEU 406 446 446 LEU LEU A . n 
A 1 407 ASP 407 447 447 ASP ASP A . n 
A 1 408 LYS 408 448 448 LYS LYS A . n 
A 1 409 ASP 409 449 449 ASP ASP A . n 
A 1 410 GLY 410 450 450 GLY GLY A . n 
A 1 411 LEU 411 451 451 LEU LEU A . n 
A 1 412 ILE 412 452 452 ILE ILE A . n 
A 1 413 ASN 413 453 453 ASN ASN A . n 
A 1 414 LYS 414 454 454 LYS LYS A . n 
A 1 415 ASP 415 455 455 ASP ASP A . n 
A 1 416 LEU 416 456 456 LEU LEU A . n 
A 1 417 THR 417 457 457 THR THR A . n 
A 1 418 SER 418 458 458 SER SER A . n 
A 1 419 ARG 419 459 459 ARG ARG A . n 
A 1 420 VAL 420 460 460 VAL VAL A . n 
A 1 421 MET 421 461 461 MET MET A . n 
A 1 422 ILE 422 462 462 ILE ILE A . n 
A 1 423 PHE 423 463 463 PHE PHE A . n 
A 1 424 SER 424 464 464 SER SER A . n 
A 1 425 VAL 425 465 465 VAL VAL A . n 
A 1 426 GLY 426 466 466 GLY GLY A . n 
A 1 427 LYS 427 467 467 LYS LYS A . n 
A 1 428 ARG 428 468 468 ARG ARG A . n 
A 1 429 ARG 429 469 469 ARG ARG A . n 
A 1 430 CYS 430 470 470 CYS CYS A . n 
A 1 431 ILE 431 471 471 ILE ILE A . n 
A 1 432 GLY 432 472 472 GLY GLY A . n 
A 1 433 GLU 433 473 473 GLU GLU A . n 
A 1 434 GLU 434 474 474 GLU GLU A . n 
A 1 435 LEU 435 475 475 LEU LEU A . n 
A 1 436 SER 436 476 476 SER SER A . n 
A 1 437 LYS 437 477 477 LYS LYS A . n 
A 1 438 MET 438 478 478 MET MET A . n 
A 1 439 GLN 439 479 479 GLN GLN A . n 
A 1 440 LEU 440 480 480 LEU LEU A . n 
A 1 441 PHE 441 481 481 PHE PHE A . n 
A 1 442 LEU 442 482 482 LEU LEU A . n 
A 1 443 PHE 443 483 483 PHE PHE A . n 
A 1 444 ILE 444 484 484 ILE ILE A . n 
A 1 445 SER 445 485 485 SER SER A . n 
A 1 446 ILE 446 486 486 ILE ILE A . n 
A 1 447 LEU 447 487 487 LEU LEU A . n 
A 1 448 ALA 448 488 488 ALA ALA A . n 
A 1 449 HIS 449 489 489 HIS HIS A . n 
A 1 450 GLN 450 490 490 GLN GLN A . n 
A 1 451 CYS 451 491 491 CYS CYS A . n 
A 1 452 ASP 452 492 492 ASP ASP A . n 
A 1 453 PHE 453 493 493 PHE PHE A . n 
A 1 454 ARG 454 494 494 ARG ARG A . n 
A 1 455 ALA 455 495 495 ALA ALA A . n 
A 1 456 ASN 456 496 496 ASN ASN A . n 
A 1 457 PRO 457 497 497 PRO PRO A . n 
A 1 458 ASN 458 498 498 ASN ASN A . n 
A 1 459 GLU 459 499 499 GLU GLU A . n 
A 1 460 PRO 460 500 500 PRO PRO A . n 
A 1 461 ALA 461 501 501 ALA ALA A . n 
A 1 462 LYS 462 502 502 LYS LYS A . n 
A 1 463 MET 463 503 503 MET MET A . n 
A 1 464 ASN 464 504 504 ASN ASN A . n 
A 1 465 PHE 465 505 505 PHE PHE A . n 
A 1 466 SER 466 506 506 SER SER A . n 
A 1 467 TYR 467 507 507 TYR TYR A . n 
A 1 468 GLY 468 508 508 GLY GLY A . n 
A 1 469 LEU 469 509 509 LEU LEU A . n 
A 1 470 THR 470 510 510 THR THR A . n 
A 1 471 ILE 471 511 511 ILE ILE A . n 
A 1 472 LYS 472 512 512 LYS LYS A . n 
A 1 473 PRO 473 513 513 PRO PRO A . n 
A 1 474 LYS 474 514 514 LYS LYS A . n 
A 1 475 SER 475 515 515 SER SER A . n 
A 1 476 PHE 476 516 516 PHE PHE A . n 
A 1 477 LYS 477 517 517 LYS LYS A . n 
A 1 478 VAL 478 518 518 VAL VAL A . n 
A 1 479 ASN 479 519 519 ASN ASN A . n 
A 1 480 VAL 480 520 520 VAL VAL A . n 
A 1 481 THR 481 521 521 THR THR A . n 
A 1 482 LEU 482 522 522 LEU LEU A . n 
A 1 483 ARG 483 523 523 ARG ARG A . n 
A 1 484 GLU 484 524 524 GLU GLU A . n 
A 1 485 SER 485 525 525 SER SER A . n 
A 1 486 MET 486 526 526 MET MET A . n 
A 1 487 GLU 487 527 527 GLU GLU A . n 
A 1 488 LEU 488 528 528 LEU LEU A . n 
A 1 489 LEU 489 529 529 LEU LEU A . n 
A 1 490 ASP 490 530 530 ASP ASP A . n 
A 1 491 SER 491 531 ?   ?   ?   A . n 
A 1 492 ALA 492 532 ?   ?   ?   A . n 
A 1 493 VAL 493 533 ?   ?   ?   A . n 
A 1 494 GLN 494 534 ?   ?   ?   A . n 
A 1 495 ASN 495 535 ?   ?   ?   A . n 
A 1 496 LEU 496 536 ?   ?   ?   A . n 
A 1 497 GLN 497 537 ?   ?   ?   A . n 
A 1 498 ALA 498 538 ?   ?   ?   A . n 
A 1 499 LYS 499 539 ?   ?   ?   A . n 
A 1 500 GLU 500 540 ?   ?   ?   A . n 
A 1 501 THR 501 541 ?   ?   ?   A . n 
A 1 502 CYS 502 542 ?   ?   ?   A . n 
A 1 503 GLN 503 543 ?   ?   ?   A . n 
A 1 504 HIS 504 544 ?   ?   ?   A . n 
A 1 505 HIS 505 545 ?   ?   ?   A . n 
A 1 506 HIS 506 546 ?   ?   ?   A . n 
A 1 507 HIS 507 547 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HEM 1  900 900 HEM HEM A . 
C 3 BHF 1  800 800 BHF BHF A . 
D 4 HOH 1  1   1   HOH HOH A . 
D 4 HOH 2  2   2   HOH HOH A . 
D 4 HOH 3  3   3   HOH HOH A . 
D 4 HOH 4  4   4   HOH HOH A . 
D 4 HOH 5  5   5   HOH HOH A . 
D 4 HOH 6  6   6   HOH HOH A . 
D 4 HOH 7  7   7   HOH HOH A . 
D 4 HOH 8  8   8   HOH HOH A . 
D 4 HOH 9  9   9   HOH HOH A . 
D 4 HOH 10 10  10  HOH HOH A . 
D 4 HOH 11 11  11  HOH HOH A . 
D 4 HOH 12 12  12  HOH HOH A . 
D 4 HOH 13 13  13  HOH HOH A . 
D 4 HOH 14 15  15  HOH HOH A . 
D 4 HOH 15 16  16  HOH HOH A . 
D 4 HOH 16 17  17  HOH HOH A . 
D 4 HOH 17 18  18  HOH HOH A . 
D 4 HOH 18 19  19  HOH HOH A . 
D 4 HOH 19 20  20  HOH HOH A . 
D 4 HOH 20 21  21  HOH HOH A . 
D 4 HOH 21 22  22  HOH HOH A . 
D 4 HOH 22 23  23  HOH HOH A . 
D 4 HOH 23 24  24  HOH HOH A . 
D 4 HOH 24 25  25  HOH HOH A . 
D 4 HOH 25 26  26  HOH HOH A . 
D 4 HOH 26 27  27  HOH HOH A . 
D 4 HOH 27 28  28  HOH HOH A . 
D 4 HOH 28 29  29  HOH HOH A . 
D 4 HOH 29 30  30  HOH HOH A . 
D 4 HOH 30 31  31  HOH HOH A . 
D 4 HOH 31 32  32  HOH HOH A . 
D 4 HOH 32 33  33  HOH HOH A . 
D 4 HOH 33 34  34  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 430 ? A CYS 470 ? 1_555 FE ? B HEM . ? A HEM 900 ? 1_555 NA ? B HEM . ? A HEM 900 ? 1_555 98.0  ? 
2  SG ? A CYS 430 ? A CYS 470 ? 1_555 FE ? B HEM . ? A HEM 900 ? 1_555 NB ? B HEM . ? A HEM 900 ? 1_555 90.7  ? 
3  NA ? B HEM .   ? A HEM 900 ? 1_555 FE ? B HEM . ? A HEM 900 ? 1_555 NB ? B HEM . ? A HEM 900 ? 1_555 88.0  ? 
4  SG ? A CYS 430 ? A CYS 470 ? 1_555 FE ? B HEM . ? A HEM 900 ? 1_555 NC ? B HEM . ? A HEM 900 ? 1_555 86.2  ? 
5  NA ? B HEM .   ? A HEM 900 ? 1_555 FE ? B HEM . ? A HEM 900 ? 1_555 NC ? B HEM . ? A HEM 900 ? 1_555 175.7 ? 
6  NB ? B HEM .   ? A HEM 900 ? 1_555 FE ? B HEM . ? A HEM 900 ? 1_555 NC ? B HEM . ? A HEM 900 ? 1_555 90.8  ? 
7  SG ? A CYS 430 ? A CYS 470 ? 1_555 FE ? B HEM . ? A HEM 900 ? 1_555 ND ? B HEM . ? A HEM 900 ? 1_555 93.7  ? 
8  NA ? B HEM .   ? A HEM 900 ? 1_555 FE ? B HEM . ? A HEM 900 ? 1_555 ND ? B HEM . ? A HEM 900 ? 1_555 91.2  ? 
9  NB ? B HEM .   ? A HEM 900 ? 1_555 FE ? B HEM . ? A HEM 900 ? 1_555 ND ? B HEM . ? A HEM 900 ? 1_555 175.6 ? 
10 NC ? B HEM .   ? A HEM 900 ? 1_555 FE ? B HEM . ? A HEM 900 ? 1_555 ND ? B HEM . ? A HEM 900 ? 1_555 89.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-12-08 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 CNS         1.21 ?               package 'Axel T. Brunger' axel.brunger@yale.edu    refinement        http://cns-online.org/ 
Fortran_77 ? 
2 PDB_EXTRACT 3.10 'June 10, 2010' package PDB               deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++        ? 
3 MOSFLM      .    ?               ?       ?                 ?                        'data reduction'  ? ?          ? 
4 SCALA       .    ?               ?       ?                 ?                        'data scaling'    ? ?          ? 
5 PHASER      .    ?               ?       ?                 ?                        phasing           ? ?          ? 
# 
_pdbx_entry_details.entry_id             3PM0 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THIS AMINO ACID SUBSTITUTION IS A NATURALLY OCCURRING ALLELIC VARIANT FOR THE ENZYME. IT ARISES FROM A SINGLE NUCLEOTIDE POLYMORPHISM (SNP) WHICH IS DESCRIBED IN THE SNP DATABASE WITH ACCESSION NUMBER RS1056827 WITH AN ALLELE FREQUENCY OF ABOUT 35%.
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 80  ? ? -138.35 -33.23  
2  1 VAL A 108 ? ? -102.09 -71.76  
3  1 SER A 112 ? ? 121.87  -35.77  
4  1 THR A 157 ? ? 86.91   18.65   
5  1 ASP A 218 ? ? -47.79  108.93  
6  1 PRO A 285 ? ? -29.61  -81.76  
7  1 LYS A 454 ? ? -35.68  -36.68  
8  1 SER A 464 ? ? 66.38   -169.08 
9  1 PRO A 500 ? ? -59.85  -74.05  
10 1 ALA A 501 ? ? -46.72  158.14  
11 1 LEU A 509 ? ? 71.61   -79.31  
12 1 SER A 515 ? ? -38.42  138.35  
13 1 LEU A 529 ? ? -67.52  86.12   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     494 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.192 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 41  ? A MET 1   
2  1 Y 1 A ALA 42  ? A ALA 2   
3  1 Y 1 A LYS 43  ? A LYS 3   
4  1 Y 1 A LYS 44  ? A LYS 4   
5  1 Y 1 A THR 45  ? A THR 5   
6  1 Y 1 A SER 46  ? A SER 6   
7  1 Y 1 A SER 47  ? A SER 7   
8  1 Y 1 A LYS 48  ? A LYS 8   
9  1 Y 1 A GLY 49  ? A GLY 9   
10 1 Y 1 A LYS 50  ? A LYS 10  
11 1 Y 1 A PRO 51  ? A PRO 11  
12 1 Y 1 A PRO 52  ? A PRO 12  
13 1 Y 1 A GLY 53  ? A GLY 13  
14 1 Y 1 A PRO 54  ? A PRO 14  
15 1 Y 1 A PHE 55  ? A PHE 15  
16 1 Y 1 A ALA 56  ? A ALA 16  
17 1 Y 1 A TRP 57  ? A TRP 17  
18 1 Y 1 A PRO 58  ? A PRO 18  
19 1 Y 1 A LEU 59  ? A LEU 19  
20 1 Y 1 A ILE 60  ? A ILE 20  
21 1 Y 1 A GLY 61  ? A GLY 21  
22 1 Y 1 A ASN 62  ? A ASN 22  
23 1 Y 1 A ALA 63  ? A ALA 23  
24 1 Y 1 A ALA 64  ? A ALA 24  
25 1 Y 1 A ALA 65  ? A ALA 25  
26 1 Y 1 A VAL 66  ? A VAL 26  
27 1 Y 1 A GLY 67  ? A GLY 27  
28 1 Y 1 A SER 308 ? A SER 268 
29 1 Y 1 A HIS 309 ? A HIS 269 
30 1 Y 1 A GLY 310 ? A GLY 270 
31 1 Y 1 A GLY 311 ? A GLY 271 
32 1 Y 1 A SER 531 ? A SER 491 
33 1 Y 1 A ALA 532 ? A ALA 492 
34 1 Y 1 A VAL 533 ? A VAL 493 
35 1 Y 1 A GLN 534 ? A GLN 494 
36 1 Y 1 A ASN 535 ? A ASN 495 
37 1 Y 1 A LEU 536 ? A LEU 496 
38 1 Y 1 A GLN 537 ? A GLN 497 
39 1 Y 1 A ALA 538 ? A ALA 498 
40 1 Y 1 A LYS 539 ? A LYS 499 
41 1 Y 1 A GLU 540 ? A GLU 500 
42 1 Y 1 A THR 541 ? A THR 501 
43 1 Y 1 A CYS 542 ? A CYS 502 
44 1 Y 1 A GLN 543 ? A GLN 503 
45 1 Y 1 A HIS 544 ? A HIS 504 
46 1 Y 1 A HIS 545 ? A HIS 505 
47 1 Y 1 A HIS 546 ? A HIS 506 
48 1 Y 1 A HIS 547 ? A HIS 507 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PROTOPORPHYRIN IX CONTAINING FE'   HEM 
3 '2-PHENYL-4H-BENZO[H]CHROMEN-4-ONE' BHF 
4 water                               HOH 
#