data_3POZ
# 
_entry.id   3POZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3POZ         
RCSB  RCSB062641   
WWPDB D_1000062641 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3PP0 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.entry_id                        3POZ 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.recvd_initial_deposition_date   2010-11-23 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Aertgeerts, K.' 1 
'Skene, R.'      2 
'Sogabe, S.'     3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Analysis of the Mechanism of Inhibition and Allosteric Activation of the Kinase Domain of HER2 Protein.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                18756 
_citation.page_last                 18765 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21454582 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.206193 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Aertgeerts, K.' 1  
primary 'Skene, R.'      2  
primary 'Yano, J.'       3  
primary 'Sang, B.C.'     4  
primary 'Zou, H.'        5  
primary 'Snell, G.'      6  
primary 'Jennings, A.'   7  
primary 'Iwamoto, K.'    8  
primary 'Habuka, N.'     9  
primary 'Hirokawa, A.'   10 
primary 'Ishikawa, T.'   11 
primary 'Tanaka, T.'     12 
primary 'Miki, H.'       13 
primary 'Ohta, Y.'       14 
primary 'Sogabe, S.'     15 
# 
_cell.entry_id           3POZ 
_cell.length_a           46.806 
_cell.length_b           68.881 
_cell.length_c           104.558 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3POZ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Epidermal growth factor receptor' 37304.129 1   2.7.10.1 ? 'Residues 606-1022' ? 
2 non-polymer syn 'SULFATE ION' 96.063    3   ?        ? ?                   ? 
3 non-polymer syn 
'N-{2-[4-({3-chloro-4-[3-(trifluoromethyl)phenoxy]phenyl}amino)-5H-pyrrolo[3,2-d]pyrimidin-5-yl]ethyl}-3-hydroxy-3-methylbutanamide' 
547.957   1   ?        ? ?                   ? 
4 water       nat water 18.015    126 ?        ? ?                   ? 
# 
_entity_keywords.entity_id   1 
_entity_keywords.text        polypeptide 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Proto-oncogene c-ErbB-1, Receptor tyrosine-protein kinase erbB-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC
RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD
FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ
PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE
YLIPQQG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC
RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD
FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ
PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE
YLIPQQG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLU n 
1 3   ALA n 
1 4   PRO n 
1 5   ASN n 
1 6   GLN n 
1 7   ALA n 
1 8   LEU n 
1 9   LEU n 
1 10  ARG n 
1 11  ILE n 
1 12  LEU n 
1 13  LYS n 
1 14  GLU n 
1 15  THR n 
1 16  GLU n 
1 17  PHE n 
1 18  LYS n 
1 19  LYS n 
1 20  ILE n 
1 21  LYS n 
1 22  VAL n 
1 23  LEU n 
1 24  GLY n 
1 25  SER n 
1 26  GLY n 
1 27  ALA n 
1 28  PHE n 
1 29  GLY n 
1 30  THR n 
1 31  VAL n 
1 32  TYR n 
1 33  LYS n 
1 34  GLY n 
1 35  LEU n 
1 36  TRP n 
1 37  ILE n 
1 38  PRO n 
1 39  GLU n 
1 40  GLY n 
1 41  GLU n 
1 42  LYS n 
1 43  VAL n 
1 44  LYS n 
1 45  ILE n 
1 46  PRO n 
1 47  VAL n 
1 48  ALA n 
1 49  ILE n 
1 50  LYS n 
1 51  GLU n 
1 52  LEU n 
1 53  ARG n 
1 54  GLU n 
1 55  ALA n 
1 56  THR n 
1 57  SER n 
1 58  PRO n 
1 59  LYS n 
1 60  ALA n 
1 61  ASN n 
1 62  LYS n 
1 63  GLU n 
1 64  ILE n 
1 65  LEU n 
1 66  ASP n 
1 67  GLU n 
1 68  ALA n 
1 69  TYR n 
1 70  VAL n 
1 71  MET n 
1 72  ALA n 
1 73  SER n 
1 74  VAL n 
1 75  ASP n 
1 76  ASN n 
1 77  PRO n 
1 78  HIS n 
1 79  VAL n 
1 80  CYS n 
1 81  ARG n 
1 82  LEU n 
1 83  LEU n 
1 84  GLY n 
1 85  ILE n 
1 86  CYS n 
1 87  LEU n 
1 88  THR n 
1 89  SER n 
1 90  THR n 
1 91  VAL n 
1 92  GLN n 
1 93  LEU n 
1 94  ILE n 
1 95  THR n 
1 96  GLN n 
1 97  LEU n 
1 98  MET n 
1 99  PRO n 
1 100 PHE n 
1 101 GLY n 
1 102 CYS n 
1 103 LEU n 
1 104 LEU n 
1 105 ASP n 
1 106 TYR n 
1 107 VAL n 
1 108 ARG n 
1 109 GLU n 
1 110 HIS n 
1 111 LYS n 
1 112 ASP n 
1 113 ASN n 
1 114 ILE n 
1 115 GLY n 
1 116 SER n 
1 117 GLN n 
1 118 TYR n 
1 119 LEU n 
1 120 LEU n 
1 121 ASN n 
1 122 TRP n 
1 123 CYS n 
1 124 VAL n 
1 125 GLN n 
1 126 ILE n 
1 127 ALA n 
1 128 LYS n 
1 129 GLY n 
1 130 MET n 
1 131 ASN n 
1 132 TYR n 
1 133 LEU n 
1 134 GLU n 
1 135 ASP n 
1 136 ARG n 
1 137 ARG n 
1 138 LEU n 
1 139 VAL n 
1 140 HIS n 
1 141 ARG n 
1 142 ASP n 
1 143 LEU n 
1 144 ALA n 
1 145 ALA n 
1 146 ARG n 
1 147 ASN n 
1 148 VAL n 
1 149 LEU n 
1 150 VAL n 
1 151 LYS n 
1 152 THR n 
1 153 PRO n 
1 154 GLN n 
1 155 HIS n 
1 156 VAL n 
1 157 LYS n 
1 158 ILE n 
1 159 THR n 
1 160 ASP n 
1 161 PHE n 
1 162 GLY n 
1 163 LEU n 
1 164 ALA n 
1 165 LYS n 
1 166 LEU n 
1 167 LEU n 
1 168 GLY n 
1 169 ALA n 
1 170 GLU n 
1 171 GLU n 
1 172 LYS n 
1 173 GLU n 
1 174 TYR n 
1 175 HIS n 
1 176 ALA n 
1 177 GLU n 
1 178 GLY n 
1 179 GLY n 
1 180 LYS n 
1 181 VAL n 
1 182 PRO n 
1 183 ILE n 
1 184 LYS n 
1 185 TRP n 
1 186 MET n 
1 187 ALA n 
1 188 LEU n 
1 189 GLU n 
1 190 SER n 
1 191 ILE n 
1 192 LEU n 
1 193 HIS n 
1 194 ARG n 
1 195 ILE n 
1 196 TYR n 
1 197 THR n 
1 198 HIS n 
1 199 GLN n 
1 200 SER n 
1 201 ASP n 
1 202 VAL n 
1 203 TRP n 
1 204 SER n 
1 205 TYR n 
1 206 GLY n 
1 207 VAL n 
1 208 THR n 
1 209 VAL n 
1 210 TRP n 
1 211 GLU n 
1 212 LEU n 
1 213 MET n 
1 214 THR n 
1 215 PHE n 
1 216 GLY n 
1 217 SER n 
1 218 LYS n 
1 219 PRO n 
1 220 TYR n 
1 221 ASP n 
1 222 GLY n 
1 223 ILE n 
1 224 PRO n 
1 225 ALA n 
1 226 SER n 
1 227 GLU n 
1 228 ILE n 
1 229 SER n 
1 230 SER n 
1 231 ILE n 
1 232 LEU n 
1 233 GLU n 
1 234 LYS n 
1 235 GLY n 
1 236 GLU n 
1 237 ARG n 
1 238 LEU n 
1 239 PRO n 
1 240 GLN n 
1 241 PRO n 
1 242 PRO n 
1 243 ILE n 
1 244 CYS n 
1 245 THR n 
1 246 ILE n 
1 247 ASP n 
1 248 VAL n 
1 249 TYR n 
1 250 MET n 
1 251 ILE n 
1 252 MET n 
1 253 VAL n 
1 254 LYS n 
1 255 CYS n 
1 256 TRP n 
1 257 MET n 
1 258 ILE n 
1 259 ASP n 
1 260 ALA n 
1 261 ASP n 
1 262 SER n 
1 263 ARG n 
1 264 PRO n 
1 265 LYS n 
1 266 PHE n 
1 267 ARG n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ILE n 
1 272 GLU n 
1 273 PHE n 
1 274 SER n 
1 275 LYS n 
1 276 MET n 
1 277 ALA n 
1 278 ARG n 
1 279 ASP n 
1 280 PRO n 
1 281 GLN n 
1 282 ARG n 
1 283 TYR n 
1 284 LEU n 
1 285 VAL n 
1 286 ILE n 
1 287 GLN n 
1 288 GLY n 
1 289 ASP n 
1 290 GLU n 
1 291 ARG n 
1 292 MET n 
1 293 HIS n 
1 294 LEU n 
1 295 PRO n 
1 296 SER n 
1 297 PRO n 
1 298 THR n 
1 299 ASP n 
1 300 SER n 
1 301 ASN n 
1 302 PHE n 
1 303 TYR n 
1 304 ARG n 
1 305 ALA n 
1 306 LEU n 
1 307 MET n 
1 308 ASP n 
1 309 GLU n 
1 310 GLU n 
1 311 ASP n 
1 312 MET n 
1 313 ASP n 
1 314 ASP n 
1 315 VAL n 
1 316 VAL n 
1 317 ASP n 
1 318 ALA n 
1 319 ASP n 
1 320 GLU n 
1 321 TYR n 
1 322 LEU n 
1 323 ILE n 
1 324 PRO n 
1 325 GLN n 
1 326 GLN n 
1 327 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'EGFR, ERBB1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7118 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Sf9 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pFastBacHT 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    EGFR_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC
RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD
FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ
PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE
YLIPQQG
;
_struct_ref.pdbx_align_begin           696 
_struct_ref.pdbx_db_accession          P00533 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3POZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 327 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00533 
_struct_ref_seq.db_align_beg                  696 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1022 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       696 
_struct_ref_seq.pdbx_auth_seq_align_end       1022 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
03P non-polymer         . 
'N-{2-[4-({3-chloro-4-[3-(trifluoromethyl)phenoxy]phenyl}amino)-5H-pyrrolo[3,2-d]pyrimidin-5-yl]ethyl}-3-hydroxy-3-methylbutanamide' 
TAK-285 'C26 H25 Cl F3 N5 O3' 547.957 
ALA 'L-peptide linking' y ALANINE ?       'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE ?       'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE ?       'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?       'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE ?       'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE ?       'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?       'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE ?       'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE ?       'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER ?       'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?       'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE ?       'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE ?       'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE ?       'C5 H11 N O2 S'       149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?       'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE ?       'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE ?       'C3 H7 N O3'          105.093 
SO4 non-polymer         . 'SULFATE ION' ?       'O4 S -2'             96.063  
THR 'L-peptide linking' y THREONINE ?       'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?       'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE ?       'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE ?       'C5 H11 N O2'         117.146 
# 
_exptl.entry_id          3POZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.25 
_exptl_crystal.density_percent_sol   45.28 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.5, hanging drop vapor diffusion, temperature 20K, temperature 293K' 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'Tris pH 8.0'     '20 mM' ? ? 
1 2 1 DTT               '5 mM'  ? ? 
1 3 2 'Bis-Tris pH 6.5' '0.1 M' ? ? 
1 4 2 Li2SO4            '0.2 M' ? ? 
1 5 2 'PEG 3350'        20%     ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-07-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3POZ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.500 
_reflns.number_obs                   53697 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.8 
_reflns.pdbx_Rmerge_I_obs            0.04800 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.0000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.020 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.55 
_reflns_shell.percent_possible_all   99.2 
_reflns_shell.Rmerge_I_obs           0.58300 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.400 
_reflns_shell.pdbx_redundancy        4.58 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3POZ 
_refine.ls_number_reflns_obs                     50707 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    97.2 
_refine.ls_R_factor_obs                          0.220 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.243 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2713 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.950 
_refine.B_iso_mean                               36.52 
_refine.aniso_B[1][1]                            0.92000 
_refine.aniso_B[2][2]                            0.27000 
_refine.aniso_B[3][3]                            -1.19000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING' 
_refine.pdbx_starting_model                      'PDB ID 1XKK' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.084 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2357 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         53 
_refine_hist.number_atoms_solvent             126 
_refine_hist.number_atoms_total               2536 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.022  ? 2459 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.240  2.000  ? 3331 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.271  5.000  ? 288  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       13.842 15.000 ? 446  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.076  0.200  ? 372  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 1785 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.740  2.000  ? 1464 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.839  3.000  ? 2378 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.930  4.000  ? 995  'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.088  6.000  ? 953  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.50 
_refine_ls_shell.d_res_low                        1.54 
_refine_ls_shell.number_reflns_R_work             3745 
_refine_ls_shell.R_factor_R_work                  0.3760 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3860 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             183 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3POZ 
_struct.title                     'EGFR Kinase domain complexed with tak-285' 
_struct.pdbx_descriptor           'Epidermal growth factor receptor (E.C.2.7.10.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3POZ 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            
;KINASE DOMAIN, ANTI-ONCOGENE, ATP-BINDING, CELL CYCLE, DISEASE MUTATION, GLYCOPROTEIN, MEMBRANE, NUCLEOTIDE-BINDING, PHOSPHOPROTEIN, RECEPTOR, SECRETED, TRANSFERASE, TRANSMEMBRANE, TYROSINE-PROTEIN KINASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 13  ? THR A 15  ? LYS A 708  THR A 710  5 ? 3  
HELX_P HELX_P2  2  ALA A 60  ? VAL A 74  ? ALA A 755  VAL A 769  1 ? 15 
HELX_P HELX_P3  3  CYS A 102 ? HIS A 110 ? CYS A 797  HIS A 805  1 ? 9  
HELX_P HELX_P4  4  GLY A 115 ? ARG A 136 ? GLY A 810  ARG A 831  1 ? 22 
HELX_P HELX_P5  5  ALA A 144 ? ARG A 146 ? ALA A 839  ARG A 841  5 ? 3  
HELX_P HELX_P6  6  GLY A 162 ? GLY A 168 ? GLY A 857  GLY A 863  1 ? 7  
HELX_P HELX_P7  7  PRO A 182 ? MET A 186 ? PRO A 877  MET A 881  5 ? 5  
HELX_P HELX_P8  8  ALA A 187 ? ARG A 194 ? ALA A 882  ARG A 889  1 ? 8  
HELX_P HELX_P9  9  THR A 197 ? THR A 214 ? THR A 892  THR A 909  1 ? 18 
HELX_P HELX_P10 10 PRO A 224 ? SER A 226 ? PRO A 919  SER A 921  5 ? 3  
HELX_P HELX_P11 11 GLU A 227 ? LYS A 234 ? GLU A 922  LYS A 929  1 ? 8  
HELX_P HELX_P12 12 THR A 245 ? TRP A 256 ? THR A 940  TRP A 951  1 ? 12 
HELX_P HELX_P13 13 ASP A 259 ? ARG A 263 ? ASP A 954  ARG A 958  5 ? 5  
HELX_P HELX_P14 14 LYS A 265 ? ARG A 278 ? LYS A 960  ARG A 973  1 ? 14 
HELX_P HELX_P15 15 ASP A 279 ? LEU A 284 ? ASP A 974  LEU A 979  1 ? 6  
HELX_P HELX_P16 16 GLY A 288 ? MET A 292 ? GLY A 983  MET A 987  5 ? 5  
HELX_P HELX_P17 17 SER A 300 ? ASP A 308 ? SER A 995  ASP A 1003 1 ? 9  
HELX_P HELX_P18 18 ASP A 317 ? LEU A 322 ? ASP A 1012 LEU A 1017 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 10  ? ILE A 11  ? ARG A 705 ILE A 706 
A 2 LEU A 82  ? LEU A 87  ? LEU A 777 LEU A 782 
A 3 VAL A 91  ? GLN A 96  ? VAL A 786 GLN A 791 
A 4 ILE A 45  ? GLU A 51  ? ILE A 740 GLU A 746 
A 5 GLY A 29  ? TRP A 36  ? GLY A 724 TRP A 731 
A 6 PHE A 17  ? GLY A 26  ? PHE A 712 GLY A 721 
B 1 VAL A 148 ? THR A 152 ? VAL A 843 THR A 847 
B 2 HIS A 155 ? ILE A 158 ? HIS A 850 ILE A 853 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 10  ? N ARG A 705 O ILE A 85  ? O ILE A 780 
A 2 3 N GLY A 84  ? N GLY A 779 O ILE A 94  ? O ILE A 789 
A 3 4 O THR A 95  ? O THR A 790 N ALA A 48  ? N ALA A 743 
A 4 5 O VAL A 47  ? O VAL A 742 N GLY A 34  ? N GLY A 729 
A 5 6 O LYS A 33  ? O LYS A 728 N LYS A 21  ? N LYS A 716 
B 1 2 N LEU A 149 ? N LEU A 844 O LYS A 157 ? O LYS A 852 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 1'    
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 A 2'    
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 3'    
AC4 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE 03P A 1023' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HOH F .   ? HOH A 18  . ? 1_555 ? 
2  AC1 4  ARG A 108 ? ARG A 803 . ? 1_555 ? 
3  AC1 4  LYS A 218 ? LYS A 913 . ? 1_555 ? 
4  AC1 4  ARG A 282 ? ARG A 977 . ? 3_655 ? 
5  AC2 7  HOH F .   ? HOH A 84  . ? 1_555 ? 
6  AC2 7  HOH F .   ? HOH A 85  . ? 1_555 ? 
7  AC2 7  HIS A 110 ? HIS A 805 . ? 1_555 ? 
8  AC2 7  PRO A 295 ? PRO A 990 . ? 1_555 ? 
9  AC2 7  SER A 300 ? SER A 995 . ? 1_555 ? 
10 AC2 7  ASN A 301 ? ASN A 996 . ? 1_555 ? 
11 AC2 7  PHE A 302 ? PHE A 997 . ? 1_555 ? 
12 AC3 6  ARG A 137 ? ARG A 832 . ? 1_555 ? 
13 AC3 6  LEU A 138 ? LEU A 833 . ? 1_555 ? 
14 AC3 6  VAL A 139 ? VAL A 834 . ? 1_555 ? 
15 AC3 6  ARG A 141 ? ARG A 836 . ? 1_555 ? 
16 AC3 6  LYS A 165 ? LYS A 860 . ? 1_555 ? 
17 AC3 6  HIS A 193 ? HIS A 888 . ? 4_455 ? 
18 AC4 19 HOH F .   ? HOH A 14  . ? 1_555 ? 
19 AC4 19 HOH F .   ? HOH A 78  . ? 1_555 ? 
20 AC4 19 VAL A 31  ? VAL A 726 . ? 1_555 ? 
21 AC4 19 ALA A 48  ? ALA A 743 . ? 1_555 ? 
22 AC4 19 LYS A 50  ? LYS A 745 . ? 1_555 ? 
23 AC4 19 MET A 71  ? MET A 766 . ? 1_555 ? 
24 AC4 19 CYS A 80  ? CYS A 775 . ? 1_555 ? 
25 AC4 19 ARG A 81  ? ARG A 776 . ? 1_555 ? 
26 AC4 19 LEU A 82  ? LEU A 777 . ? 1_555 ? 
27 AC4 19 LEU A 93  ? LEU A 788 . ? 1_555 ? 
28 AC4 19 THR A 95  ? THR A 790 . ? 1_555 ? 
29 AC4 19 GLN A 96  ? GLN A 791 . ? 1_555 ? 
30 AC4 19 MET A 98  ? MET A 793 . ? 1_555 ? 
31 AC4 19 ARG A 146 ? ARG A 841 . ? 1_555 ? 
32 AC4 19 ASN A 147 ? ASN A 842 . ? 1_555 ? 
33 AC4 19 LEU A 149 ? LEU A 844 . ? 1_555 ? 
34 AC4 19 THR A 159 ? THR A 854 . ? 1_555 ? 
35 AC4 19 ASP A 160 ? ASP A 855 . ? 1_555 ? 
36 AC4 19 PHE A 161 ? PHE A 856 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3POZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3POZ 
_atom_sites.fract_transf_matrix[1][1]   0.021365 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014518 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009564 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
F  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 6   ? -0.324 32.759 -3.927  1.00 61.18  ? 701  GLN A N   1 
ATOM   2    C  CA  . GLN A 1 6   ? -0.237 31.343 -3.461  1.00 60.53  ? 701  GLN A CA  1 
ATOM   3    C  C   . GLN A 1 6   ? 1.190  30.783 -3.514  1.00 56.45  ? 701  GLN A C   1 
ATOM   4    O  O   . GLN A 1 6   ? 1.395  29.584 -3.299  1.00 58.08  ? 701  GLN A O   1 
ATOM   5    C  CB  . GLN A 1 6   ? -1.170 30.446 -4.283  1.00 63.47  ? 701  GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 6   ? -2.634 30.480 -3.860  1.00 68.38  ? 701  GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 6   ? -3.445 29.329 -4.442  1.00 70.84  ? 701  GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 6   ? -4.522 29.537 -5.002  1.00 72.26  ? 701  GLN A OE1 1 
ATOM   9    N  NE2 . GLN A 1 6   ? -2.932 28.109 -4.308  1.00 70.51  ? 701  GLN A NE2 1 
ATOM   10   N  N   . ALA A 1 7   ? 2.169  31.642 -3.797  1.00 51.63  ? 702  ALA A N   1 
ATOM   11   C  CA  . ALA A 1 7   ? 3.559  31.202 -3.934  1.00 46.19  ? 702  ALA A CA  1 
ATOM   12   C  C   . ALA A 1 7   ? 4.097  30.608 -2.644  1.00 43.23  ? 702  ALA A C   1 
ATOM   13   O  O   . ALA A 1 7   ? 3.913  31.170 -1.560  1.00 40.56  ? 702  ALA A O   1 
ATOM   14   C  CB  . ALA A 1 7   ? 4.452  32.340 -4.419  1.00 46.38  ? 702  ALA A CB  1 
ATOM   15   N  N   . LEU A 1 8   ? 4.758  29.461 -2.767  1.00 40.30  ? 703  LEU A N   1 
ATOM   16   C  CA  . LEU A 1 8   ? 5.400  28.821 -1.631  1.00 38.27  ? 703  LEU A CA  1 
ATOM   17   C  C   . LEU A 1 8   ? 6.548  29.685 -1.118  1.00 35.17  ? 703  LEU A C   1 
ATOM   18   O  O   . LEU A 1 8   ? 6.662  29.933 0.085   1.00 36.27  ? 703  LEU A O   1 
ATOM   19   C  CB  . LEU A 1 8   ? 5.885  27.424 -2.015  1.00 38.95  ? 703  LEU A CB  1 
ATOM   20   C  CG  . LEU A 1 8   ? 6.195  26.458 -0.875  1.00 42.58  ? 703  LEU A CG  1 
ATOM   21   C  CD1 . LEU A 1 8   ? 5.062  26.415 0.156   1.00 46.67  ? 703  LEU A CD1 1 
ATOM   22   C  CD2 . LEU A 1 8   ? 6.465  25.077 -1.443  1.00 40.02  ? 703  LEU A CD2 1 
ATOM   23   N  N   . LEU A 1 9   ? 7.380  30.171 -2.032  1.00 34.64  ? 704  LEU A N   1 
ATOM   24   C  CA  . LEU A 1 9   ? 8.385  31.176 -1.676  1.00 31.12  ? 704  LEU A CA  1 
ATOM   25   C  C   . LEU A 1 9   ? 7.895  32.550 -2.139  1.00 31.31  ? 704  LEU A C   1 
ATOM   26   O  O   . LEU A 1 9   ? 7.917  32.864 -3.334  1.00 30.94  ? 704  LEU A O   1 
ATOM   27   C  CB  . LEU A 1 9   ? 9.753  30.845 -2.280  1.00 34.21  ? 704  LEU A CB  1 
ATOM   28   C  CG  . LEU A 1 9   ? 10.866 31.890 -2.084  1.00 34.03  ? 704  LEU A CG  1 
ATOM   29   C  CD1 . LEU A 1 9   ? 11.353 31.960 -0.641  1.00 39.27  ? 704  LEU A CD1 1 
ATOM   30   C  CD2 . LEU A 1 9   ? 12.031 31.644 -3.054  1.00 41.05  ? 704  LEU A CD2 1 
ATOM   31   N  N   . ARG A 1 10  ? 7.434  33.362 -1.191  1.00 30.38  ? 705  ARG A N   1 
ATOM   32   C  CA  . ARG A 1 10  ? 6.920  34.693 -1.526  1.00 34.16  ? 705  ARG A CA  1 
ATOM   33   C  C   . ARG A 1 10  ? 8.049  35.663 -1.844  1.00 32.33  ? 705  ARG A C   1 
ATOM   34   O  O   . ARG A 1 10  ? 9.030  35.747 -1.105  1.00 31.84  ? 705  ARG A O   1 
ATOM   35   C  CB  . ARG A 1 10  ? 6.017  35.227 -0.410  1.00 33.10  ? 705  ARG A CB  1 
ATOM   36   C  CG  . ARG A 1 10  ? 4.675  34.511 -0.364  1.00 41.71  ? 705  ARG A CG  1 
ATOM   37   C  CD  . ARG A 1 10  ? 4.104  34.481 1.028   1.00 46.22  ? 705  ARG A CD  1 
ATOM   38   N  NE  . ARG A 1 10  ? 2.812  33.797 1.076   1.00 58.38  ? 705  ARG A NE  1 
ATOM   39   C  CZ  . ARG A 1 10  ? 1.635  34.396 0.903   1.00 59.89  ? 705  ARG A CZ  1 
ATOM   40   N  NH1 . ARG A 1 10  ? 1.570  35.702 0.669   1.00 58.26  ? 705  ARG A NH1 1 
ATOM   41   N  NH2 . ARG A 1 10  ? 0.517  33.684 0.967   1.00 63.51  ? 705  ARG A NH2 1 
ATOM   42   N  N   . ILE A 1 11  ? 7.917  36.360 -2.970  1.00 33.16  ? 706  ILE A N   1 
ATOM   43   C  CA  . ILE A 1 11  ? 8.860  37.403 -3.333  1.00 36.42  ? 706  ILE A CA  1 
ATOM   44   C  C   . ILE A 1 11  ? 8.291  38.686 -2.771  1.00 37.84  ? 706  ILE A C   1 
ATOM   45   O  O   . ILE A 1 11  ? 7.217  39.133 -3.182  1.00 41.22  ? 706  ILE A O   1 
ATOM   46   C  CB  . ILE A 1 11  ? 9.032  37.528 -4.870  1.00 37.90  ? 706  ILE A CB  1 
ATOM   47   C  CG1 . ILE A 1 11  ? 9.369  36.168 -5.501  1.00 42.91  ? 706  ILE A CG1 1 
ATOM   48   C  CG2 . ILE A 1 11  ? 10.069 38.602 -5.210  1.00 43.21  ? 706  ILE A CG2 1 
ATOM   49   C  CD1 . ILE A 1 11  ? 10.655 35.517 -5.016  1.00 37.21  ? 706  ILE A CD1 1 
ATOM   50   N  N   . LEU A 1 12  ? 8.998  39.260 -1.806  1.00 35.63  ? 707  LEU A N   1 
ATOM   51   C  CA  . LEU A 1 12  ? 8.486  40.415 -1.105  1.00 38.00  ? 707  LEU A CA  1 
ATOM   52   C  C   . LEU A 1 12  ? 9.074  41.686 -1.683  1.00 40.35  ? 707  LEU A C   1 
ATOM   53   O  O   . LEU A 1 12  ? 10.269 41.752 -1.976  1.00 42.03  ? 707  LEU A O   1 
ATOM   54   C  CB  . LEU A 1 12  ? 8.774  40.317 0.401   1.00 34.37  ? 707  LEU A CB  1 
ATOM   55   C  CG  . LEU A 1 12  ? 8.272  39.065 1.139   1.00 35.97  ? 707  LEU A CG  1 
ATOM   56   C  CD1 . LEU A 1 12  ? 8.456  39.229 2.663   1.00 37.95  ? 707  LEU A CD1 1 
ATOM   57   C  CD2 . LEU A 1 12  ? 6.833  38.713 0.832   1.00 39.35  ? 707  LEU A CD2 1 
ATOM   58   N  N   . LYS A 1 13  ? 8.217  42.681 -1.869  1.00 44.55  ? 708  LYS A N   1 
ATOM   59   C  CA  . LYS A 1 13  ? 8.676  44.030 -2.167  1.00 47.63  ? 708  LYS A CA  1 
ATOM   60   C  C   . LYS A 1 13  ? 9.180  44.624 -0.862  1.00 47.78  ? 708  LYS A C   1 
ATOM   61   O  O   . LYS A 1 13  ? 8.745  44.223 0.222   1.00 44.94  ? 708  LYS A O   1 
ATOM   62   C  CB  . LYS A 1 13  ? 7.542  44.885 -2.734  1.00 48.47  ? 708  LYS A CB  1 
ATOM   63   C  CG  . LYS A 1 13  ? 7.092  44.483 -4.136  1.00 56.78  ? 708  LYS A CG  1 
ATOM   64   C  CD  . LYS A 1 13  ? 5.875  45.283 -4.580  1.00 64.69  ? 708  LYS A CD  1 
ATOM   65   C  CE  . LYS A 1 13  ? 4.591  44.745 -3.956  1.00 67.14  ? 708  LYS A CE  1 
ATOM   66   N  NZ  . LYS A 1 13  ? 3.388  45.461 -4.470  1.00 74.12  ? 708  LYS A NZ  1 
ATOM   67   N  N   . GLU A 1 14  ? 10.097 45.579 -0.964  1.00 49.95  ? 709  GLU A N   1 
ATOM   68   C  CA  . GLU A 1 14  ? 10.642 46.239 0.215   1.00 50.03  ? 709  GLU A CA  1 
ATOM   69   C  C   . GLU A 1 14  ? 9.557  46.922 1.052   1.00 50.56  ? 709  GLU A C   1 
ATOM   70   O  O   . GLU A 1 14  ? 9.703  47.055 2.264   1.00 47.83  ? 709  GLU A O   1 
ATOM   71   C  CB  . GLU A 1 14  ? 11.730 47.235 -0.187  1.00 53.26  ? 709  GLU A CB  1 
ATOM   72   C  CG  . GLU A 1 14  ? 13.039 46.562 -0.572  1.00 55.32  ? 709  GLU A CG  1 
ATOM   73   C  CD  . GLU A 1 14  ? 14.180 47.546 -0.724  1.00 62.58  ? 709  GLU A CD  1 
ATOM   74   O  OE1 . GLU A 1 14  ? 15.105 47.516 0.118   1.00 62.30  ? 709  GLU A OE1 1 
ATOM   75   O  OE2 . GLU A 1 14  ? 14.150 48.349 -1.682  1.00 63.14  ? 709  GLU A OE2 1 
ATOM   76   N  N   . THR A 1 15  ? 8.467  47.326 0.398   1.00 52.76  ? 710  THR A N   1 
ATOM   77   C  CA  . THR A 1 15  ? 7.330  47.964 1.073   1.00 53.75  ? 710  THR A CA  1 
ATOM   78   C  C   . THR A 1 15  ? 6.442  46.981 1.847   1.00 53.16  ? 710  THR A C   1 
ATOM   79   O  O   . THR A 1 15  ? 5.543  47.402 2.584   1.00 55.23  ? 710  THR A O   1 
ATOM   80   C  CB  . THR A 1 15  ? 6.445  48.769 0.083   1.00 56.69  ? 710  THR A CB  1 
ATOM   81   O  OG1 . THR A 1 15  ? 5.994  47.911 -0.976  1.00 53.99  ? 710  THR A OG1 1 
ATOM   82   C  CG2 . THR A 1 15  ? 7.213  49.959 -0.497  1.00 56.58  ? 710  THR A CG2 1 
ATOM   83   N  N   . GLU A 1 16  ? 6.697  45.682 1.688   1.00 49.26  ? 711  GLU A N   1 
ATOM   84   C  CA  . GLU A 1 16  ? 5.854  44.655 2.296   1.00 48.10  ? 711  GLU A CA  1 
ATOM   85   C  C   . GLU A 1 16  ? 6.397  44.128 3.620   1.00 46.08  ? 711  GLU A C   1 
ATOM   86   O  O   . GLU A 1 16  ? 5.785  43.249 4.237   1.00 45.42  ? 711  GLU A O   1 
ATOM   87   C  CB  . GLU A 1 16  ? 5.651  43.489 1.334   1.00 48.28  ? 711  GLU A CB  1 
ATOM   88   C  CG  . GLU A 1 16  ? 4.671  43.784 0.224   1.00 53.95  ? 711  GLU A CG  1 
ATOM   89   C  CD  . GLU A 1 16  ? 4.511  42.603 -0.701  1.00 57.27  ? 711  GLU A CD  1 
ATOM   90   O  OE1 . GLU A 1 16  ? 5.535  42.162 -1.271  1.00 56.06  ? 711  GLU A OE1 1 
ATOM   91   O  OE2 . GLU A 1 16  ? 3.368  42.117 -0.850  1.00 55.11  ? 711  GLU A OE2 1 
ATOM   92   N  N   . PHE A 1 17  ? 7.551  44.643 4.037   1.00 41.23  ? 712  PHE A N   1 
ATOM   93   C  CA  . PHE A 1 17  ? 8.136  44.272 5.324   1.00 40.81  ? 712  PHE A CA  1 
ATOM   94   C  C   . PHE A 1 17  ? 8.916  45.422 5.929   1.00 38.75  ? 712  PHE A C   1 
ATOM   95   O  O   . PHE A 1 17  ? 9.344  46.345 5.220   1.00 40.10  ? 712  PHE A O   1 
ATOM   96   C  CB  . PHE A 1 17  ? 8.967  42.981 5.249   1.00 40.67  ? 712  PHE A CB  1 
ATOM   97   C  CG  . PHE A 1 17  ? 10.198 43.073 4.384   1.00 40.53  ? 712  PHE A CG  1 
ATOM   98   C  CD1 . PHE A 1 17  ? 11.454 43.268 4.960   1.00 41.02  ? 712  PHE A CD1 1 
ATOM   99   C  CD2 . PHE A 1 17  ? 10.112 42.916 3.004   1.00 38.70  ? 712  PHE A CD2 1 
ATOM   100  C  CE1 . PHE A 1 17  ? 12.599 43.335 4.170   1.00 40.62  ? 712  PHE A CE1 1 
ATOM   101  C  CE2 . PHE A 1 17  ? 11.255 42.990 2.200   1.00 40.04  ? 712  PHE A CE2 1 
ATOM   102  C  CZ  . PHE A 1 17  ? 12.500 43.199 2.784   1.00 41.02  ? 712  PHE A CZ  1 
ATOM   103  N  N   . LYS A 1 18  ? 9.047  45.384 7.248   1.00 35.88  ? 713  LYS A N   1 
ATOM   104  C  CA  . LYS A 1 18  ? 9.646  46.480 7.998   1.00 40.80  ? 713  LYS A CA  1 
ATOM   105  C  C   . LYS A 1 18  ? 10.564 45.902 9.055   1.00 39.58  ? 713  LYS A C   1 
ATOM   106  O  O   . LYS A 1 18  ? 10.174 44.997 9.796   1.00 39.69  ? 713  LYS A O   1 
ATOM   107  C  CB  . LYS A 1 18  ? 8.566  47.337 8.676   1.00 41.27  ? 713  LYS A CB  1 
ATOM   108  C  CG  . LYS A 1 18  ? 7.668  48.125 7.737   1.00 52.65  ? 713  LYS A CG  1 
ATOM   109  C  CD  . LYS A 1 18  ? 6.770  49.082 8.526   1.00 61.21  ? 713  LYS A CD  1 
ATOM   110  C  CE  . LYS A 1 18  ? 5.857  49.893 7.618   1.00 66.28  ? 713  LYS A CE  1 
ATOM   111  N  NZ  . LYS A 1 18  ? 5.073  50.888 8.403   1.00 68.91  ? 713  LYS A NZ  1 
ATOM   112  N  N   . LYS A 1 19  ? 11.793 46.402 9.097   1.00 39.42  ? 714  LYS A N   1 
ATOM   113  C  CA  . LYS A 1 19  ? 12.687 46.108 10.211  1.00 38.73  ? 714  LYS A CA  1 
ATOM   114  C  C   . LYS A 1 19  ? 12.355 47.049 11.367  1.00 40.49  ? 714  LYS A C   1 
ATOM   115  O  O   . LYS A 1 19  ? 12.310 48.276 11.200  1.00 40.51  ? 714  LYS A O   1 
ATOM   116  C  CB  . LYS A 1 19  ? 14.146 46.256 9.795   1.00 39.76  ? 714  LYS A CB  1 
ATOM   117  C  CG  . LYS A 1 19  ? 14.513 45.525 8.520   1.00 40.12  ? 714  LYS A CG  1 
ATOM   118  C  CD  . LYS A 1 19  ? 15.918 45.908 8.105   1.00 50.12  ? 714  LYS A CD  1 
ATOM   119  C  CE  . LYS A 1 19  ? 16.299 45.293 6.780   1.00 49.45  ? 714  LYS A CE  1 
ATOM   120  N  NZ  . LYS A 1 19  ? 15.735 46.045 5.614   1.00 44.44  ? 714  LYS A NZ  1 
ATOM   121  N  N   . ILE A 1 20  ? 12.093 46.460 12.528  1.00 37.04  ? 715  ILE A N   1 
ATOM   122  C  CA  . ILE A 1 20  ? 11.659 47.206 13.705  1.00 37.78  ? 715  ILE A CA  1 
ATOM   123  C  C   . ILE A 1 20  ? 12.822 47.358 14.676  1.00 38.31  ? 715  ILE A C   1 
ATOM   124  O  O   . ILE A 1 20  ? 13.081 48.459 15.161  1.00 39.47  ? 715  ILE A O   1 
ATOM   125  C  CB  . ILE A 1 20  ? 10.438 46.529 14.401  1.00 38.47  ? 715  ILE A CB  1 
ATOM   126  C  CG1 . ILE A 1 20  ? 9.225  46.471 13.453  1.00 37.34  ? 715  ILE A CG1 1 
ATOM   127  C  CG2 . ILE A 1 20  ? 10.085 47.222 15.736  1.00 41.43  ? 715  ILE A CG2 1 
ATOM   128  C  CD1 . ILE A 1 20  ? 8.592  47.819 13.097  1.00 47.00  ? 715  ILE A CD1 1 
ATOM   129  N  N   . LYS A 1 21  ? 13.527 46.260 14.951  1.00 36.34  ? 716  LYS A N   1 
ATOM   130  C  CA  . LYS A 1 21  ? 14.695 46.295 15.843  1.00 34.64  ? 716  LYS A CA  1 
ATOM   131  C  C   . LYS A 1 21  ? 15.740 45.263 15.426  1.00 35.86  ? 716  LYS A C   1 
ATOM   132  O  O   . LYS A 1 21  ? 15.437 44.320 14.690  1.00 30.67  ? 716  LYS A O   1 
ATOM   133  C  CB  . LYS A 1 21  ? 14.295 46.056 17.317  1.00 36.44  ? 716  LYS A CB  1 
ATOM   134  C  CG  . LYS A 1 21  ? 13.565 47.215 18.004  1.00 40.61  ? 716  LYS A CG  1 
ATOM   135  C  CD  . LYS A 1 21  ? 14.455 48.473 18.143  1.00 40.71  ? 716  LYS A CD  1 
ATOM   136  C  CE  . LYS A 1 21  ? 13.637 49.762 18.129  1.00 49.85  ? 716  LYS A CE  1 
ATOM   137  N  NZ  . LYS A 1 21  ? 12.768 49.933 19.327  1.00 49.00  ? 716  LYS A NZ  1 
ATOM   138  N  N   . VAL A 1 22  ? 16.971 45.435 15.904  1.00 34.62  ? 717  VAL A N   1 
ATOM   139  C  CA  . VAL A 1 22  ? 18.032 44.464 15.633  1.00 32.14  ? 717  VAL A CA  1 
ATOM   140  C  C   . VAL A 1 22  ? 17.951 43.298 16.624  1.00 32.62  ? 717  VAL A C   1 
ATOM   141  O  O   . VAL A 1 22  ? 17.874 43.502 17.832  1.00 32.90  ? 717  VAL A O   1 
ATOM   142  C  CB  . VAL A 1 22  ? 19.444 45.107 15.702  1.00 36.71  ? 717  VAL A CB  1 
ATOM   143  C  CG1 . VAL A 1 22  ? 20.526 44.074 15.355  1.00 35.95  ? 717  VAL A CG1 1 
ATOM   144  C  CG2 . VAL A 1 22  ? 19.546 46.309 14.772  1.00 36.52  ? 717  VAL A CG2 1 
ATOM   145  N  N   . LEU A 1 23  ? 17.951 42.070 16.120  1.00 27.96  ? 718  LEU A N   1 
ATOM   146  C  CA  . LEU A 1 23  ? 18.047 40.915 17.001  1.00 28.90  ? 718  LEU A CA  1 
ATOM   147  C  C   . LEU A 1 23  ? 19.521 40.584 17.234  1.00 28.54  ? 718  LEU A C   1 
ATOM   148  O  O   . LEU A 1 23  ? 20.008 40.600 18.373  1.00 31.42  ? 718  LEU A O   1 
ATOM   149  C  CB  . LEU A 1 23  ? 17.283 39.713 16.422  1.00 26.80  ? 718  LEU A CB  1 
ATOM   150  C  CG  . LEU A 1 23  ? 15.760 39.774 16.516  1.00 29.84  ? 718  LEU A CG  1 
ATOM   151  C  CD1 . LEU A 1 23  ? 15.152 38.606 15.757  1.00 29.38  ? 718  LEU A CD1 1 
ATOM   152  C  CD2 . LEU A 1 23  ? 15.282 39.774 17.980  1.00 35.80  ? 718  LEU A CD2 1 
ATOM   153  N  N   . GLY A 1 24  ? 20.248 40.336 16.151  1.00 30.16  ? 719  GLY A N   1 
ATOM   154  C  CA  . GLY A 1 24  ? 21.645 39.941 16.266  1.00 30.45  ? 719  GLY A CA  1 
ATOM   155  C  C   . GLY A 1 24  ? 22.492 40.403 15.107  1.00 33.43  ? 719  GLY A C   1 
ATOM   156  O  O   . GLY A 1 24  ? 21.967 40.740 14.047  1.00 36.42  ? 719  GLY A O   1 
ATOM   157  N  N   . SER A 1 25  ? 23.806 40.406 15.305  1.00 37.45  ? 720  SER A N   1 
ATOM   158  C  CA  . SER A 1 25  ? 24.734 40.802 14.253  1.00 43.68  ? 720  SER A CA  1 
ATOM   159  C  C   . SER A 1 25  ? 26.068 40.070 14.367  1.00 49.16  ? 720  SER A C   1 
ATOM   160  O  O   . SER A 1 25  ? 26.375 39.472 15.400  1.00 46.70  ? 720  SER A O   1 
ATOM   161  C  CB  . SER A 1 25  ? 24.962 42.320 14.285  1.00 45.00  ? 720  SER A CB  1 
ATOM   162  O  OG  . SER A 1 25  ? 25.499 42.773 13.055  1.00 46.29  ? 720  SER A OG  1 
ATOM   163  N  N   . GLY A 1 26  ? 26.845 40.125 13.286  1.00 56.31  ? 721  GLY A N   1 
ATOM   164  C  CA  . GLY A 1 26  ? 28.193 39.550 13.225  1.00 62.56  ? 721  GLY A CA  1 
ATOM   165  C  C   . GLY A 1 26  ? 28.551 39.154 11.802  1.00 66.46  ? 721  GLY A C   1 
ATOM   166  O  O   . GLY A 1 26  ? 28.193 39.851 10.845  1.00 67.68  ? 721  GLY A O   1 
ATOM   167  N  N   . ALA A 1 27  ? 29.253 38.032 11.664  1.00 69.16  ? 722  ALA A N   1 
ATOM   168  C  CA  . ALA A 1 27  ? 29.553 37.451 10.355  1.00 70.40  ? 722  ALA A CA  1 
ATOM   169  C  C   . ALA A 1 27  ? 28.370 36.619 9.857   1.00 69.60  ? 722  ALA A C   1 
ATOM   170  O  O   . ALA A 1 27  ? 27.788 35.840 10.618  1.00 67.33  ? 722  ALA A O   1 
ATOM   171  C  CB  . ALA A 1 27  ? 30.819 36.607 10.422  1.00 73.02  ? 722  ALA A CB  1 
ATOM   172  N  N   . PHE A 1 28  ? 28.050 36.784 8.570   1.00 70.17  ? 723  PHE A N   1 
ATOM   173  C  CA  . PHE A 1 28  ? 26.835 36.248 7.922   1.00 69.13  ? 723  PHE A CA  1 
ATOM   174  C  C   . PHE A 1 28  ? 25.740 37.320 7.827   1.00 66.08  ? 723  PHE A C   1 
ATOM   175  O  O   . PHE A 1 28  ? 24.688 37.089 7.222   1.00 65.70  ? 723  PHE A O   1 
ATOM   176  C  CB  . PHE A 1 28  ? 26.293 34.980 8.616   1.00 69.61  ? 723  PHE A CB  1 
ATOM   177  C  CG  . PHE A 1 28  ? 26.851 33.683 8.071   1.00 73.23  ? 723  PHE A CG  1 
ATOM   178  C  CD1 . PHE A 1 28  ? 25.993 32.706 7.565   1.00 74.34  ? 723  PHE A CD1 1 
ATOM   179  C  CD2 . PHE A 1 28  ? 28.223 33.429 8.080   1.00 77.42  ? 723  PHE A CD2 1 
ATOM   180  C  CE1 . PHE A 1 28  ? 26.490 31.499 7.071   1.00 75.96  ? 723  PHE A CE1 1 
ATOM   181  C  CE2 . PHE A 1 28  ? 28.732 32.226 7.580   1.00 80.45  ? 723  PHE A CE2 1 
ATOM   182  C  CZ  . PHE A 1 28  ? 27.863 31.259 7.075   1.00 78.87  ? 723  PHE A CZ  1 
ATOM   183  N  N   . GLY A 1 29  ? 25.990 38.482 8.434   1.00 62.45  ? 724  GLY A N   1 
ATOM   184  C  CA  . GLY A 1 29  ? 25.074 39.618 8.342   1.00 55.71  ? 724  GLY A CA  1 
ATOM   185  C  C   . GLY A 1 29  ? 24.426 40.055 9.646   1.00 50.52  ? 724  GLY A C   1 
ATOM   186  O  O   . GLY A 1 29  ? 25.045 40.013 10.709  1.00 50.23  ? 724  GLY A O   1 
ATOM   187  N  N   . THR A 1 30  ? 23.173 40.486 9.542   1.00 44.55  ? 725  THR A N   1 
ATOM   188  C  CA  . THR A 1 30  ? 22.411 41.033 10.658  1.00 40.58  ? 725  THR A CA  1 
ATOM   189  C  C   . THR A 1 30  ? 20.968 40.543 10.565  1.00 36.55  ? 725  THR A C   1 
ATOM   190  O  O   . THR A 1 30  ? 20.382 40.516 9.483   1.00 33.78  ? 725  THR A O   1 
ATOM   191  C  CB  . THR A 1 30  ? 22.439 42.579 10.652  1.00 42.95  ? 725  THR A CB  1 
ATOM   192  O  OG1 . THR A 1 30  ? 23.798 43.037 10.673  1.00 45.82  ? 725  THR A OG1 1 
ATOM   193  C  CG2 . THR A 1 30  ? 21.701 43.156 11.867  1.00 42.00  ? 725  THR A CG2 1 
ATOM   194  N  N   . VAL A 1 31  ? 20.406 40.127 11.699  1.00 33.07  ? 726  VAL A N   1 
ATOM   195  C  CA  . VAL A 1 31  ? 19.020 39.680 11.749  1.00 30.89  ? 726  VAL A CA  1 
ATOM   196  C  C   . VAL A 1 31  ? 18.221 40.704 12.537  1.00 30.09  ? 726  VAL A C   1 
ATOM   197  O  O   . VAL A 1 31  ? 18.643 41.138 13.611  1.00 30.54  ? 726  VAL A O   1 
ATOM   198  C  CB  . VAL A 1 31  ? 18.888 38.263 12.377  1.00 28.84  ? 726  VAL A CB  1 
ATOM   199  C  CG1 . VAL A 1 31  ? 17.419 37.803 12.443  1.00 27.16  ? 726  VAL A CG1 1 
ATOM   200  C  CG2 . VAL A 1 31  ? 19.709 37.270 11.595  1.00 35.67  ? 726  VAL A CG2 1 
ATOM   201  N  N   . TYR A 1 32  ? 17.076 41.083 11.984  1.00 28.85  ? 727  TYR A N   1 
ATOM   202  C  CA  . TYR A 1 32  ? 16.192 42.061 12.596  1.00 30.09  ? 727  TYR A CA  1 
ATOM   203  C  C   . TYR A 1 32  ? 14.895 41.384 12.974  1.00 28.16  ? 727  TYR A C   1 
ATOM   204  O  O   . TYR A 1 32  ? 14.493 40.376 12.357  1.00 28.87  ? 727  TYR A O   1 
ATOM   205  C  CB  . TYR A 1 32  ? 15.873 43.176 11.607  1.00 31.25  ? 727  TYR A CB  1 
ATOM   206  C  CG  . TYR A 1 32  ? 17.083 43.868 11.049  1.00 33.39  ? 727  TYR A CG  1 
ATOM   207  C  CD1 . TYR A 1 32  ? 17.580 45.027 11.644  1.00 34.45  ? 727  TYR A CD1 1 
ATOM   208  C  CD2 . TYR A 1 32  ? 17.736 43.368 9.920   1.00 37.62  ? 727  TYR A CD2 1 
ATOM   209  C  CE1 . TYR A 1 32  ? 18.702 45.672 11.130  1.00 38.87  ? 727  TYR A CE1 1 
ATOM   210  C  CE2 . TYR A 1 32  ? 18.865 44.010 9.394   1.00 38.37  ? 727  TYR A CE2 1 
ATOM   211  C  CZ  . TYR A 1 32  ? 19.337 45.158 10.010  1.00 41.76  ? 727  TYR A CZ  1 
ATOM   212  O  OH  . TYR A 1 32  ? 20.441 45.804 9.502   1.00 42.20  ? 727  TYR A OH  1 
ATOM   213  N  N   . LYS A 1 33  ? 14.241 41.943 13.979  1.00 27.43  ? 728  LYS A N   1 
ATOM   214  C  CA  . LYS A 1 33  ? 12.851 41.611 14.247  1.00 27.92  ? 728  LYS A CA  1 
ATOM   215  C  C   . LYS A 1 33  ? 12.019 42.602 13.464  1.00 29.98  ? 728  LYS A C   1 
ATOM   216  O  O   . LYS A 1 33  ? 12.382 43.771 13.338  1.00 32.16  ? 728  LYS A O   1 
ATOM   217  C  CB  . LYS A 1 33  ? 12.527 41.625 15.746  1.00 32.52  ? 728  LYS A CB  1 
ATOM   218  C  CG  . LYS A 1 33  ? 12.338 42.973 16.389  1.00 42.10  ? 728  LYS A CG  1 
ATOM   219  C  CD  . LYS A 1 33  ? 11.983 42.796 17.871  1.00 49.77  ? 728  LYS A CD  1 
ATOM   220  C  CE  . LYS A 1 33  ? 11.248 44.016 18.426  1.00 53.65  ? 728  LYS A CE  1 
ATOM   221  N  NZ  . LYS A 1 33  ? 9.841  44.076 17.936  1.00 55.82  ? 728  LYS A NZ  1 
ATOM   222  N  N   . GLY A 1 34  ? 10.932 42.125 12.890  1.00 30.41  ? 729  GLY A N   1 
ATOM   223  C  CA  . GLY A 1 34  ? 10.112 43.002 12.092  1.00 33.82  ? 729  GLY A CA  1 
ATOM   224  C  C   . GLY A 1 34  ? 8.711  42.519 11.891  1.00 33.49  ? 729  GLY A C   1 
ATOM   225  O  O   . GLY A 1 34  ? 8.229  41.627 12.602  1.00 30.33  ? 729  GLY A O   1 
ATOM   226  N  N   . LEU A 1 35  ? 8.059  43.143 10.915  1.00 33.30  ? 730  LEU A N   1 
ATOM   227  C  CA  . LEU A 1 35  ? 6.713  42.781 10.535  1.00 34.79  ? 730  LEU A CA  1 
ATOM   228  C  C   . LEU A 1 35  ? 6.651  42.586 9.036   1.00 35.66  ? 730  LEU A C   1 
ATOM   229  O  O   . LEU A 1 35  ? 7.253  43.344 8.265   1.00 38.98  ? 730  LEU A O   1 
ATOM   230  C  CB  . LEU A 1 35  ? 5.708  43.855 10.965  1.00 36.16  ? 730  LEU A CB  1 
ATOM   231  C  CG  . LEU A 1 35  ? 5.472  44.046 12.468  1.00 37.58  ? 730  LEU A CG  1 
ATOM   232  C  CD1 . LEU A 1 35  ? 4.793  45.396 12.739  1.00 46.47  ? 730  LEU A CD1 1 
ATOM   233  C  CD2 . LEU A 1 35  ? 4.658  42.894 13.045  1.00 36.19  ? 730  LEU A CD2 1 
ATOM   234  N  N   . TRP A 1 36  ? 5.943  41.542 8.640   1.00 37.02  ? 731  TRP A N   1 
ATOM   235  C  CA  . TRP A 1 36  ? 5.625  41.335 7.250   1.00 38.97  ? 731  TRP A CA  1 
ATOM   236  C  C   . TRP A 1 36  ? 4.181  41.805 7.095   1.00 41.44  ? 731  TRP A C   1 
ATOM   237  O  O   . TRP A 1 36  ? 3.288  41.406 7.853   1.00 38.23  ? 731  TRP A O   1 
ATOM   238  C  CB  . TRP A 1 36  ? 5.874  39.877 6.858   1.00 37.51  ? 731  TRP A CB  1 
ATOM   239  C  CG  . TRP A 1 36  ? 5.262  39.420 5.558   1.00 38.63  ? 731  TRP A CG  1 
ATOM   240  C  CD1 . TRP A 1 36  ? 5.102  40.146 4.404   1.00 48.49  ? 731  TRP A CD1 1 
ATOM   241  C  CD2 . TRP A 1 36  ? 4.741  38.123 5.289   1.00 39.68  ? 731  TRP A CD2 1 
ATOM   242  N  NE1 . TRP A 1 36  ? 4.499  39.373 3.439   1.00 45.93  ? 731  TRP A NE1 1 
ATOM   243  C  CE2 . TRP A 1 36  ? 4.266  38.127 3.956   1.00 44.17  ? 731  TRP A CE2 1 
ATOM   244  C  CE3 . TRP A 1 36  ? 4.625  36.950 6.046   1.00 35.82  ? 731  TRP A CE3 1 
ATOM   245  C  CZ2 . TRP A 1 36  ? 3.683  37.005 3.370   1.00 47.33  ? 731  TRP A CZ2 1 
ATOM   246  C  CZ3 . TRP A 1 36  ? 4.041  35.835 5.461   1.00 45.34  ? 731  TRP A CZ3 1 
ATOM   247  C  CH2 . TRP A 1 36  ? 3.581  35.871 4.137   1.00 44.84  ? 731  TRP A CH2 1 
ATOM   248  N  N   . ILE A 1 37  ? 3.988  42.724 6.159   1.00 42.56  ? 732  ILE A N   1 
ATOM   249  C  CA  . ILE A 1 37  ? 2.685  43.329 5.913   1.00 46.27  ? 732  ILE A CA  1 
ATOM   250  C  C   . ILE A 1 37  ? 2.316  43.057 4.455   1.00 44.61  ? 732  ILE A C   1 
ATOM   251  O  O   . ILE A 1 37  ? 2.581  43.892 3.582   1.00 45.94  ? 732  ILE A O   1 
ATOM   252  C  CB  . ILE A 1 37  ? 2.696  44.856 6.212   1.00 47.46  ? 732  ILE A CB  1 
ATOM   253  C  CG1 . ILE A 1 37  ? 3.412  45.143 7.539   1.00 53.07  ? 732  ILE A CG1 1 
ATOM   254  C  CG2 . ILE A 1 37  ? 1.268  45.415 6.237   1.00 53.68  ? 732  ILE A CG2 1 
ATOM   255  C  CD1 . ILE A 1 37  ? 4.130  46.476 7.589   1.00 56.26  ? 732  ILE A CD1 1 
ATOM   256  N  N   . PRO A 1 38  ? 1.723  41.877 4.184   1.00 44.92  ? 733  PRO A N   1 
ATOM   257  C  CA  . PRO A 1 38  ? 1.387  41.504 2.808   1.00 46.05  ? 733  PRO A CA  1 
ATOM   258  C  C   . PRO A 1 38  ? 0.197  42.289 2.270   1.00 47.52  ? 733  PRO A C   1 
ATOM   259  O  O   . PRO A 1 38  ? 0.394  43.197 1.471   1.00 52.14  ? 733  PRO A O   1 
ATOM   260  C  CB  . PRO A 1 38  ? 1.050  40.015 2.915   1.00 45.47  ? 733  PRO A CB  1 
ATOM   261  C  CG  . PRO A 1 38  ? 0.604  39.819 4.312   1.00 44.41  ? 733  PRO A CG  1 
ATOM   262  C  CD  . PRO A 1 38  ? 1.319  40.840 5.154   1.00 44.18  ? 733  PRO A CD  1 
ATOM   263  N  N   . VAL A 1 43  ? -2.747 42.964 7.103   1.00 59.01  ? 738  VAL A N   1 
ATOM   264  C  CA  . VAL A 1 43  ? -2.385 42.184 8.286   1.00 56.07  ? 738  VAL A CA  1 
ATOM   265  C  C   . VAL A 1 43  ? -0.882 42.302 8.592   1.00 52.56  ? 738  VAL A C   1 
ATOM   266  O  O   . VAL A 1 43  ? -0.072 42.519 7.686   1.00 49.97  ? 738  VAL A O   1 
ATOM   267  C  CB  . VAL A 1 43  ? -2.835 40.699 8.145   1.00 55.56  ? 738  VAL A CB  1 
ATOM   268  C  CG1 . VAL A 1 43  ? -1.936 39.920 7.177   1.00 52.47  ? 738  VAL A CG1 1 
ATOM   269  C  CG2 . VAL A 1 43  ? -2.894 40.021 9.499   1.00 57.53  ? 738  VAL A CG2 1 
ATOM   270  N  N   . LYS A 1 44  ? -0.533 42.171 9.872   1.00 50.30  ? 739  LYS A N   1 
ATOM   271  C  CA  . LYS A 1 44  ? 0.848  42.322 10.343  1.00 47.29  ? 739  LYS A CA  1 
ATOM   272  C  C   . LYS A 1 44  ? 1.337  41.037 10.994  1.00 44.27  ? 739  LYS A C   1 
ATOM   273  O  O   . LYS A 1 44  ? 0.765  40.571 11.982  1.00 44.06  ? 739  LYS A O   1 
ATOM   274  C  CB  . LYS A 1 44  ? 0.953  43.481 11.340  1.00 47.43  ? 739  LYS A CB  1 
ATOM   275  C  CG  . LYS A 1 44  ? 0.666  44.856 10.754  1.00 53.90  ? 739  LYS A CG  1 
ATOM   276  C  CD  . LYS A 1 44  ? 0.720  45.916 11.845  1.00 56.07  ? 739  LYS A CD  1 
ATOM   277  C  CE  . LYS A 1 44  ? 0.580  47.321 11.278  1.00 63.64  ? 739  LYS A CE  1 
ATOM   278  N  NZ  . LYS A 1 44  ? 0.955  48.353 12.290  1.00 62.83  ? 739  LYS A NZ  1 
ATOM   279  N  N   . ILE A 1 45  ? 2.408  40.473 10.441  1.00 39.49  ? 740  ILE A N   1 
ATOM   280  C  CA  . ILE A 1 45  ? 2.917  39.187 10.897  1.00 35.40  ? 740  ILE A CA  1 
ATOM   281  C  C   . ILE A 1 45  ? 4.325  39.376 11.454  1.00 31.81  ? 740  ILE A C   1 
ATOM   282  O  O   . ILE A 1 45  ? 5.204  39.881 10.750  1.00 32.69  ? 740  ILE A O   1 
ATOM   283  C  CB  . ILE A 1 45  ? 2.920  38.144 9.757   1.00 37.16  ? 740  ILE A CB  1 
ATOM   284  C  CG1 . ILE A 1 45  ? 1.511  37.992 9.171   1.00 42.93  ? 740  ILE A CG1 1 
ATOM   285  C  CG2 . ILE A 1 45  ? 3.399  36.791 10.250  1.00 33.37  ? 740  ILE A CG2 1 
ATOM   286  C  CD1 . ILE A 1 45  ? 1.478  37.538 7.733   1.00 45.44  ? 740  ILE A CD1 1 
ATOM   287  N  N   . PRO A 1 46  ? 4.544  38.974 12.721  1.00 30.95  ? 741  PRO A N   1 
ATOM   288  C  CA  . PRO A 1 46  ? 5.869  39.089 13.328  1.00 29.49  ? 741  PRO A CA  1 
ATOM   289  C  C   . PRO A 1 46  ? 6.879  38.173 12.629  1.00 27.75  ? 741  PRO A C   1 
ATOM   290  O  O   . PRO A 1 46  ? 6.633  36.964 12.498  1.00 29.03  ? 741  PRO A O   1 
ATOM   291  C  CB  . PRO A 1 46  ? 5.634  38.618 14.774  1.00 30.76  ? 741  PRO A CB  1 
ATOM   292  C  CG  . PRO A 1 46  ? 4.163  38.784 15.002  1.00 34.11  ? 741  PRO A CG  1 
ATOM   293  C  CD  . PRO A 1 46  ? 3.564  38.420 13.677  1.00 32.39  ? 741  PRO A CD  1 
ATOM   294  N  N   . VAL A 1 47  ? 7.985  38.759 12.170  1.00 26.26  ? 742  VAL A N   1 
ATOM   295  C  CA  . VAL A 1 47  ? 9.036  38.017 11.434  1.00 26.23  ? 742  VAL A CA  1 
ATOM   296  C  C   . VAL A 1 47  ? 10.459 38.357 11.893  1.00 24.85  ? 742  VAL A C   1 
ATOM   297  O  O   . VAL A 1 47  ? 10.695 39.407 12.516  1.00 26.57  ? 742  VAL A O   1 
ATOM   298  C  CB  . VAL A 1 47  ? 8.961  38.286 9.893   1.00 26.09  ? 742  VAL A CB  1 
ATOM   299  C  CG1 . VAL A 1 47  ? 7.667  37.704 9.293   1.00 26.33  ? 742  VAL A CG1 1 
ATOM   300  C  CG2 . VAL A 1 47  ? 9.115  39.800 9.572   1.00 26.42  ? 742  VAL A CG2 1 
ATOM   301  N  N   . ALA A 1 48  ? 11.394 37.452 11.595  1.00 22.39  ? 743  ALA A N   1 
ATOM   302  C  CA  . ALA A 1 48  ? 12.822 37.749 11.614  1.00 23.99  ? 743  ALA A CA  1 
ATOM   303  C  C   . ALA A 1 48  ? 13.280 37.930 10.186  1.00 25.06  ? 743  ALA A C   1 
ATOM   304  O  O   . ALA A 1 48  ? 12.814 37.235 9.276   1.00 24.46  ? 743  ALA A O   1 
ATOM   305  C  CB  . ALA A 1 48  ? 13.605 36.644 12.256  1.00 23.40  ? 743  ALA A CB  1 
ATOM   306  N  N   . ILE A 1 49  ? 14.188 38.879 9.992   1.00 23.71  ? 744  ILE A N   1 
ATOM   307  C  CA  . ILE A 1 49  ? 14.655 39.240 8.654   1.00 26.26  ? 744  ILE A CA  1 
ATOM   308  C  C   . ILE A 1 49  ? 16.170 39.168 8.690   1.00 28.94  ? 744  ILE A C   1 
ATOM   309  O  O   . ILE A 1 49  ? 16.811 39.933 9.414   1.00 29.48  ? 744  ILE A O   1 
ATOM   310  C  CB  . ILE A 1 49  ? 14.206 40.674 8.266   1.00 26.60  ? 744  ILE A CB  1 
ATOM   311  C  CG1 . ILE A 1 49  ? 12.677 40.788 8.269   1.00 27.62  ? 744  ILE A CG1 1 
ATOM   312  C  CG2 . ILE A 1 49  ? 14.762 41.093 6.884   1.00 30.85  ? 744  ILE A CG2 1 
ATOM   313  C  CD1 . ILE A 1 49  ? 12.180 42.232 8.445   1.00 34.21  ? 744  ILE A CD1 1 
ATOM   314  N  N   . LYS A 1 50  ? 16.741 38.229 7.939   1.00 27.44  ? 745  LYS A N   1 
ATOM   315  C  CA  . LYS A 1 50  ? 18.195 38.114 7.863   1.00 30.14  ? 745  LYS A CA  1 
ATOM   316  C  C   . LYS A 1 50  ? 18.707 38.758 6.587   1.00 32.38  ? 745  LYS A C   1 
ATOM   317  O  O   . LYS A 1 50  ? 18.375 38.309 5.493   1.00 33.54  ? 745  LYS A O   1 
ATOM   318  C  CB  . LYS A 1 50  ? 18.634 36.648 7.936   1.00 30.49  ? 745  LYS A CB  1 
ATOM   319  C  CG  . LYS A 1 50  ? 20.146 36.452 8.012   1.00 32.67  ? 745  LYS A CG  1 
ATOM   320  C  CD  . LYS A 1 50  ? 20.469 34.989 8.267   1.00 35.14  ? 745  LYS A CD  1 
ATOM   321  C  CE  . LYS A 1 50  ? 21.929 34.759 8.577   1.00 41.95  ? 745  LYS A CE  1 
ATOM   322  N  NZ  . LYS A 1 50  ? 22.111 33.407 9.194   1.00 39.80  ? 745  LYS A NZ  1 
ATOM   323  N  N   . GLU A 1 51  ? 19.494 39.820 6.744   1.00 34.46  ? 746  GLU A N   1 
ATOM   324  C  CA  . GLU A 1 51  ? 20.122 40.490 5.607   1.00 35.56  ? 746  GLU A CA  1 
ATOM   325  C  C   . GLU A 1 51  ? 21.575 40.052 5.533   1.00 39.54  ? 746  GLU A C   1 
ATOM   326  O  O   . GLU A 1 51  ? 22.374 40.396 6.405   1.00 40.22  ? 746  GLU A O   1 
ATOM   327  C  CB  . GLU A 1 51  ? 20.010 42.010 5.736   1.00 36.26  ? 746  GLU A CB  1 
ATOM   328  C  CG  . GLU A 1 51  ? 20.608 42.769 4.544   1.00 40.38  ? 746  GLU A CG  1 
ATOM   329  C  CD  . GLU A 1 51  ? 20.139 44.213 4.439   1.00 48.15  ? 746  GLU A CD  1 
ATOM   330  O  OE1 . GLU A 1 51  ? 20.206 44.952 5.445   1.00 47.12  ? 746  GLU A OE1 1 
ATOM   331  O  OE2 . GLU A 1 51  ? 19.719 44.613 3.331   1.00 52.07  ? 746  GLU A OE2 1 
ATOM   332  N  N   . LEU A 1 52  ? 21.907 39.303 4.480   1.00 42.54  ? 747  LEU A N   1 
ATOM   333  C  CA  . LEU A 1 52  ? 23.237 38.699 4.335   1.00 44.90  ? 747  LEU A CA  1 
ATOM   334  C  C   . LEU A 1 52  ? 24.327 39.734 4.027   1.00 47.83  ? 747  LEU A C   1 
ATOM   335  O  O   . LEU A 1 52  ? 24.060 40.757 3.398   1.00 49.37  ? 747  LEU A O   1 
ATOM   336  C  CB  . LEU A 1 52  ? 23.229 37.612 3.253   1.00 45.35  ? 747  LEU A CB  1 
ATOM   337  C  CG  . LEU A 1 52  ? 22.176 36.489 3.269   1.00 49.43  ? 747  LEU A CG  1 
ATOM   338  C  CD1 . LEU A 1 52  ? 22.488 35.476 2.179   1.00 51.28  ? 747  LEU A CD1 1 
ATOM   339  C  CD2 . LEU A 1 52  ? 22.071 35.788 4.619   1.00 49.49  ? 747  LEU A CD2 1 
ATOM   340  N  N   . ALA A 1 60  ? 23.240 35.856 -10.420 1.00 80.49  ? 755  ALA A N   1 
ATOM   341  C  CA  . ALA A 1 60  ? 23.194 34.796 -9.419  1.00 78.33  ? 755  ALA A CA  1 
ATOM   342  C  C   . ALA A 1 60  ? 21.790 34.618 -8.834  1.00 76.35  ? 755  ALA A C   1 
ATOM   343  O  O   . ALA A 1 60  ? 21.445 33.529 -8.380  1.00 74.50  ? 755  ALA A O   1 
ATOM   344  C  CB  . ALA A 1 60  ? 24.210 35.062 -8.307  1.00 77.14  ? 755  ALA A CB  1 
ATOM   345  N  N   . ASN A 1 61  ? 20.993 35.690 -8.861  1.00 76.38  ? 756  ASN A N   1 
ATOM   346  C  CA  . ASN A 1 61  ? 19.628 35.708 -8.308  1.00 73.90  ? 756  ASN A CA  1 
ATOM   347  C  C   . ASN A 1 61  ? 18.792 34.467 -8.623  1.00 72.48  ? 756  ASN A C   1 
ATOM   348  O  O   . ASN A 1 61  ? 18.101 33.938 -7.745  1.00 69.51  ? 756  ASN A O   1 
ATOM   349  C  CB  . ASN A 1 61  ? 18.871 36.956 -8.781  1.00 75.56  ? 756  ASN A CB  1 
ATOM   350  C  CG  . ASN A 1 61  ? 19.432 38.246 -8.205  1.00 76.67  ? 756  ASN A CG  1 
ATOM   351  O  OD1 . ASN A 1 61  ? 19.231 39.319 -8.774  1.00 81.77  ? 756  ASN A OD1 1 
ATOM   352  N  ND2 . ASN A 1 61  ? 20.129 38.153 -7.075  1.00 76.99  ? 756  ASN A ND2 1 
ATOM   353  N  N   . LYS A 1 62  ? 18.867 34.017 -9.876  1.00 71.62  ? 757  LYS A N   1 
ATOM   354  C  CA  . LYS A 1 62  ? 18.163 32.828 -10.356 1.00 70.57  ? 757  LYS A CA  1 
ATOM   355  C  C   . LYS A 1 62  ? 18.558 31.568 -9.574  1.00 68.26  ? 757  LYS A C   1 
ATOM   356  O  O   . LYS A 1 62  ? 17.717 30.703 -9.308  1.00 66.99  ? 757  LYS A O   1 
ATOM   357  C  CB  . LYS A 1 62  ? 18.443 32.639 -11.852 1.00 73.71  ? 757  LYS A CB  1 
ATOM   358  C  CG  . LYS A 1 62  ? 17.529 31.656 -12.565 1.00 74.00  ? 757  LYS A CG  1 
ATOM   359  C  CD  . LYS A 1 62  ? 17.872 31.573 -14.046 1.00 76.43  ? 757  LYS A CD  1 
ATOM   360  C  CE  . LYS A 1 62  ? 17.060 30.493 -14.742 1.00 77.87  ? 757  LYS A CE  1 
ATOM   361  N  NZ  . LYS A 1 62  ? 17.410 30.364 -16.187 1.00 81.86  ? 757  LYS A NZ  1 
ATOM   362  N  N   . GLU A 1 63  ? 19.837 31.479 -9.213  1.00 66.40  ? 758  GLU A N   1 
ATOM   363  C  CA  . GLU A 1 63  ? 20.368 30.346 -8.463  1.00 64.42  ? 758  GLU A CA  1 
ATOM   364  C  C   . GLU A 1 63  ? 20.004 30.459 -6.985  1.00 59.54  ? 758  GLU A C   1 
ATOM   365  O  O   . GLU A 1 63  ? 19.653 29.460 -6.357  1.00 57.96  ? 758  GLU A O   1 
ATOM   366  C  CB  . GLU A 1 63  ? 21.888 30.262 -8.637  1.00 68.09  ? 758  GLU A CB  1 
ATOM   367  C  CG  . GLU A 1 63  ? 22.528 28.942 -8.199  1.00 71.79  ? 758  GLU A CG  1 
ATOM   368  C  CD  . GLU A 1 63  ? 23.974 28.808 -8.669  1.00 79.14  ? 758  GLU A CD  1 
ATOM   369  O  OE1 . GLU A 1 63  ? 24.749 29.780 -8.524  1.00 81.01  ? 758  GLU A OE1 1 
ATOM   370  O  OE2 . GLU A 1 63  ? 24.337 27.729 -9.186  1.00 82.08  ? 758  GLU A OE2 1 
ATOM   371  N  N   . ILE A 1 64  ? 20.093 31.676 -6.443  1.00 55.69  ? 759  ILE A N   1 
ATOM   372  C  CA  . ILE A 1 64  ? 19.715 31.953 -5.053  1.00 50.88  ? 759  ILE A CA  1 
ATOM   373  C  C   . ILE A 1 64  ? 18.243 31.623 -4.802  1.00 47.19  ? 759  ILE A C   1 
ATOM   374  O  O   . ILE A 1 64  ? 17.897 31.047 -3.763  1.00 42.77  ? 759  ILE A O   1 
ATOM   375  C  CB  . ILE A 1 64  ? 20.015 33.424 -4.651  1.00 52.52  ? 759  ILE A CB  1 
ATOM   376  C  CG1 . ILE A 1 64  ? 21.527 33.676 -4.640  1.00 57.21  ? 759  ILE A CG1 1 
ATOM   377  C  CG2 . ILE A 1 64  ? 19.397 33.759 -3.287  1.00 45.28  ? 759  ILE A CG2 1 
ATOM   378  C  CD1 . ILE A 1 64  ? 21.917 35.146 -4.746  1.00 63.48  ? 759  ILE A CD1 1 
ATOM   379  N  N   . LEU A 1 65  ? 17.389 31.982 -5.757  1.00 46.25  ? 760  LEU A N   1 
ATOM   380  C  CA  . LEU A 1 65  ? 15.966 31.671 -5.681  1.00 44.03  ? 760  LEU A CA  1 
ATOM   381  C  C   . LEU A 1 65  ? 15.712 30.168 -5.697  1.00 43.37  ? 760  LEU A C   1 
ATOM   382  O  O   . LEU A 1 65  ? 14.840 29.684 -4.981  1.00 39.49  ? 760  LEU A O   1 
ATOM   383  C  CB  . LEU A 1 65  ? 15.193 32.346 -6.820  1.00 47.02  ? 760  LEU A CB  1 
ATOM   384  C  CG  . LEU A 1 65  ? 14.975 33.858 -6.727  1.00 44.87  ? 760  LEU A CG  1 
ATOM   385  C  CD1 . LEU A 1 65  ? 14.241 34.352 -7.975  1.00 52.28  ? 760  LEU A CD1 1 
ATOM   386  C  CD2 . LEU A 1 65  ? 14.217 34.251 -5.471  1.00 45.43  ? 760  LEU A CD2 1 
ATOM   387  N  N   . ASP A 1 66  ? 16.470 29.443 -6.525  1.00 45.95  ? 761  ASP A N   1 
ATOM   388  C  CA  . ASP A 1 66  ? 16.366 27.986 -6.626  1.00 47.05  ? 761  ASP A CA  1 
ATOM   389  C  C   . ASP A 1 66  ? 16.640 27.341 -5.268  1.00 45.55  ? 761  ASP A C   1 
ATOM   390  O  O   . ASP A 1 66  ? 15.875 26.487 -4.808  1.00 45.01  ? 761  ASP A O   1 
ATOM   391  C  CB  . ASP A 1 66  ? 17.341 27.465 -7.693  1.00 51.09  ? 761  ASP A CB  1 
ATOM   392  C  CG  . ASP A 1 66  ? 17.136 25.993 -8.027  1.00 56.84  ? 761  ASP A CG  1 
ATOM   393  O  OD1 . ASP A 1 66  ? 18.070 25.383 -8.597  1.00 61.30  ? 761  ASP A OD1 1 
ATOM   394  O  OD2 . ASP A 1 66  ? 16.051 25.444 -7.739  1.00 61.56  ? 761  ASP A OD2 1 
ATOM   395  N  N   . GLU A 1 67  ? 17.716 27.782 -4.618  1.00 44.56  ? 762  GLU A N   1 
ATOM   396  C  CA  . GLU A 1 67  ? 18.069 27.296 -3.279  1.00 43.82  ? 762  GLU A CA  1 
ATOM   397  C  C   . GLU A 1 67  ? 17.061 27.715 -2.213  1.00 39.77  ? 762  GLU A C   1 
ATOM   398  O  O   . GLU A 1 67  ? 16.693 26.912 -1.346  1.00 38.25  ? 762  GLU A O   1 
ATOM   399  C  CB  . GLU A 1 67  ? 19.487 27.739 -2.892  1.00 47.69  ? 762  GLU A CB  1 
ATOM   400  C  CG  . GLU A 1 67  ? 20.594 27.143 -3.770  1.00 56.04  ? 762  GLU A CG  1 
ATOM   401  C  CD  . GLU A 1 67  ? 20.631 25.620 -3.739  1.00 62.20  ? 762  GLU A CD  1 
ATOM   402  O  OE1 . GLU A 1 67  ? 20.806 25.015 -4.818  1.00 66.60  ? 762  GLU A OE1 1 
ATOM   403  O  OE2 . GLU A 1 67  ? 20.478 25.029 -2.643  1.00 64.84  ? 762  GLU A OE2 1 
ATOM   404  N  N   . ALA A 1 68  ? 16.602 28.964 -2.283  1.00 35.00  ? 763  ALA A N   1 
ATOM   405  C  CA  . ALA A 1 68  ? 15.615 29.469 -1.338  1.00 32.23  ? 763  ALA A CA  1 
ATOM   406  C  C   . ALA A 1 68  ? 14.284 28.722 -1.421  1.00 29.15  ? 763  ALA A C   1 
ATOM   407  O  O   . ALA A 1 68  ? 13.607 28.566 -0.410  1.00 29.38  ? 763  ALA A O   1 
ATOM   408  C  CB  . ALA A 1 68  ? 15.390 30.960 -1.527  1.00 31.52  ? 763  ALA A CB  1 
ATOM   409  N  N   . TYR A 1 69  ? 13.914 28.259 -2.611  1.00 29.49  ? 764  TYR A N   1 
ATOM   410  C  CA  . TYR A 1 69  ? 12.665 27.506 -2.747  1.00 28.40  ? 764  TYR A CA  1 
ATOM   411  C  C   . TYR A 1 69  ? 12.638 26.272 -1.841  1.00 28.05  ? 764  TYR A C   1 
ATOM   412  O  O   . TYR A 1 69  ? 11.625 25.993 -1.185  1.00 28.91  ? 764  TYR A O   1 
ATOM   413  C  CB  . TYR A 1 69  ? 12.411 27.083 -4.197  1.00 27.88  ? 764  TYR A CB  1 
ATOM   414  C  CG  . TYR A 1 69  ? 11.103 26.334 -4.366  1.00 28.23  ? 764  TYR A CG  1 
ATOM   415  C  CD1 . TYR A 1 69  ? 11.072 24.932 -4.370  1.00 29.74  ? 764  TYR A CD1 1 
ATOM   416  C  CD2 . TYR A 1 69  ? 9.907  27.027 -4.498  1.00 33.39  ? 764  TYR A CD2 1 
ATOM   417  C  CE1 . TYR A 1 69  ? 9.850  24.242 -4.520  1.00 28.24  ? 764  TYR A CE1 1 
ATOM   418  C  CE2 . TYR A 1 69  ? 8.686  26.353 -4.656  1.00 30.22  ? 764  TYR A CE2 1 
ATOM   419  C  CZ  . TYR A 1 69  ? 8.675  24.965 -4.652  1.00 30.79  ? 764  TYR A CZ  1 
ATOM   420  O  OH  . TYR A 1 69  ? 7.482  24.309 -4.806  1.00 30.62  ? 764  TYR A OH  1 
ATOM   421  N  N   . VAL A 1 70  ? 13.756 25.548 -1.794  1.00 29.75  ? 765  VAL A N   1 
ATOM   422  C  CA  . VAL A 1 70  ? 13.853 24.358 -0.943  1.00 31.28  ? 765  VAL A CA  1 
ATOM   423  C  C   . VAL A 1 70  ? 13.610 24.748 0.524   1.00 29.68  ? 765  VAL A C   1 
ATOM   424  O  O   . VAL A 1 70  ? 12.867 24.070 1.243   1.00 28.64  ? 765  VAL A O   1 
ATOM   425  C  CB  . VAL A 1 70  ? 15.211 23.632 -1.131  1.00 34.26  ? 765  VAL A CB  1 
ATOM   426  C  CG1 . VAL A 1 70  ? 15.283 22.378 -0.280  1.00 36.11  ? 765  VAL A CG1 1 
ATOM   427  C  CG2 . VAL A 1 70  ? 15.431 23.275 -2.598  1.00 39.10  ? 765  VAL A CG2 1 
ATOM   428  N  N   . MET A 1 71  ? 14.203 25.871 0.945   1.00 27.10  ? 766  MET A N   1 
ATOM   429  C  CA  . MET A 1 71  ? 14.027 26.388 2.310   1.00 25.16  ? 766  MET A CA  1 
ATOM   430  C  C   . MET A 1 71  ? 12.590 26.823 2.617   1.00 26.38  ? 766  MET A C   1 
ATOM   431  O  O   . MET A 1 71  ? 12.164 26.835 3.777   1.00 27.82  ? 766  MET A O   1 
ATOM   432  C  CB  . MET A 1 71  ? 14.961 27.575 2.539   1.00 26.73  ? 766  MET A CB  1 
ATOM   433  C  CG  . MET A 1 71  ? 16.436 27.236 2.460   1.00 31.84  ? 766  MET A CG  1 
ATOM   434  S  SD  . MET A 1 71  ? 17.493 28.683 2.146   1.00 38.26  ? 766  MET A SD  1 
ATOM   435  C  CE  . MET A 1 71  ? 16.676 29.967 3.065   1.00 41.11  ? 766  MET A CE  1 
ATOM   436  N  N   . ALA A 1 72  ? 11.848 27.207 1.581   1.00 26.98  ? 767  ALA A N   1 
ATOM   437  C  CA  . ALA A 1 72  ? 10.444 27.573 1.741   1.00 25.51  ? 767  ALA A CA  1 
ATOM   438  C  C   . ALA A 1 72  ? 9.483  26.383 1.708   1.00 25.47  ? 767  ALA A C   1 
ATOM   439  O  O   . ALA A 1 72  ? 8.320  26.502 2.112   1.00 28.97  ? 767  ALA A O   1 
ATOM   440  C  CB  . ALA A 1 72  ? 10.033 28.592 0.685   1.00 25.91  ? 767  ALA A CB  1 
ATOM   441  N  N   . SER A 1 73  ? 9.960  25.252 1.202   1.00 26.54  ? 768  SER A N   1 
ATOM   442  C  CA  . SER A 1 73  ? 9.115  24.091 0.971   1.00 29.36  ? 768  SER A CA  1 
ATOM   443  C  C   . SER A 1 73  ? 9.082  23.098 2.145   1.00 30.35  ? 768  SER A C   1 
ATOM   444  O  O   . SER A 1 73  ? 8.234  22.214 2.187   1.00 32.86  ? 768  SER A O   1 
ATOM   445  C  CB  . SER A 1 73  ? 9.573  23.386 -0.307  1.00 31.92  ? 768  SER A CB  1 
ATOM   446  O  OG  . SER A 1 73  ? 10.702 22.593 -0.023  1.00 38.69  ? 768  SER A OG  1 
ATOM   447  N  N   . VAL A 1 74  ? 10.003 23.237 3.092   1.00 29.09  ? 769  VAL A N   1 
ATOM   448  C  CA  . VAL A 1 74  ? 10.046 22.304 4.228   1.00 28.38  ? 769  VAL A CA  1 
ATOM   449  C  C   . VAL A 1 74  ? 8.808  22.453 5.102   1.00 30.76  ? 769  VAL A C   1 
ATOM   450  O  O   . VAL A 1 74  ? 8.341  23.558 5.368   1.00 33.90  ? 769  VAL A O   1 
ATOM   451  C  CB  . VAL A 1 74  ? 11.320 22.474 5.075   1.00 28.98  ? 769  VAL A CB  1 
ATOM   452  C  CG1 . VAL A 1 74  ? 12.540 22.016 4.283   1.00 32.76  ? 769  VAL A CG1 1 
ATOM   453  C  CG2 . VAL A 1 74  ? 11.489 23.927 5.538   1.00 31.36  ? 769  VAL A CG2 1 
ATOM   454  N  N   . ASP A 1 75  ? 8.269  21.322 5.528   1.00 29.73  ? 770  ASP A N   1 
ATOM   455  C  CA  . ASP A 1 75  ? 7.088  21.321 6.362   1.00 31.69  ? 770  ASP A CA  1 
ATOM   456  C  C   . ASP A 1 75  ? 7.261  20.238 7.405   1.00 28.18  ? 770  ASP A C   1 
ATOM   457  O  O   . ASP A 1 75  ? 6.951  19.074 7.177   1.00 29.11  ? 770  ASP A O   1 
ATOM   458  C  CB  . ASP A 1 75  ? 5.845  21.082 5.501   1.00 32.57  ? 770  ASP A CB  1 
ATOM   459  C  CG  . ASP A 1 75  ? 4.555  21.064 6.310   1.00 40.47  ? 770  ASP A CG  1 
ATOM   460  O  OD1 . ASP A 1 75  ? 4.545  21.548 7.462   1.00 37.18  ? 770  ASP A OD1 1 
ATOM   461  O  OD2 . ASP A 1 75  ? 3.550  20.552 5.781   1.00 49.33  ? 770  ASP A OD2 1 
ATOM   462  N  N   . ASN A 1 76  ? 7.841  20.644 8.531   1.00 25.40  ? 771  ASN A N   1 
ATOM   463  C  CA  . ASN A 1 76  ? 8.050  19.763 9.673   1.00 27.42  ? 771  ASN A CA  1 
ATOM   464  C  C   . ASN A 1 76  ? 7.988  20.614 10.937  1.00 26.77  ? 771  ASN A C   1 
ATOM   465  O  O   . ASN A 1 76  ? 8.534  21.723 10.943  1.00 26.16  ? 771  ASN A O   1 
ATOM   466  C  CB  . ASN A 1 76  ? 9.429  19.099 9.588   1.00 25.85  ? 771  ASN A CB  1 
ATOM   467  C  CG  . ASN A 1 76  ? 9.677  18.155 10.739  1.00 23.95  ? 771  ASN A CG  1 
ATOM   468  O  OD1 . ASN A 1 76  ? 10.210 18.557 11.764  1.00 27.36  ? 771  ASN A OD1 1 
ATOM   469  N  ND2 . ASN A 1 76  ? 9.283  16.897 10.580  1.00 26.36  ? 771  ASN A ND2 1 
ATOM   470  N  N   . PRO A 1 77  ? 7.340  20.106 12.010  1.00 28.94  ? 772  PRO A N   1 
ATOM   471  C  CA  . PRO A 1 77  ? 7.233  20.934 13.233  1.00 28.83  ? 772  PRO A CA  1 
ATOM   472  C  C   . PRO A 1 77  ? 8.581  21.363 13.847  1.00 28.30  ? 772  PRO A C   1 
ATOM   473  O  O   . PRO A 1 77  ? 8.615  22.318 14.629  1.00 28.75  ? 772  PRO A O   1 
ATOM   474  C  CB  . PRO A 1 77  ? 6.455  20.043 14.216  1.00 31.91  ? 772  PRO A CB  1 
ATOM   475  C  CG  . PRO A 1 77  ? 5.842  18.960 13.401  1.00 35.59  ? 772  PRO A CG  1 
ATOM   476  C  CD  . PRO A 1 77  ? 6.644  18.812 12.144  1.00 27.83  ? 772  PRO A CD  1 
ATOM   477  N  N   . HIS A 1 78  ? 9.674  20.679 13.505  1.00 25.21  ? 773  HIS A N   1 
ATOM   478  C  CA  . HIS A 1 78  ? 10.997 20.997 14.099  1.00 23.73  ? 773  HIS A CA  1 
ATOM   479  C  C   . HIS A 1 78  ? 12.014 21.619 13.168  1.00 22.51  ? 773  HIS A C   1 
ATOM   480  O  O   . HIS A 1 78  ? 13.205 21.605 13.470  1.00 23.03  ? 773  HIS A O   1 
ATOM   481  C  CB  . HIS A 1 78  ? 11.555 19.772 14.821  1.00 24.97  ? 773  HIS A CB  1 
ATOM   482  C  CG  . HIS A 1 78  ? 10.586 19.247 15.826  1.00 30.51  ? 773  HIS A CG  1 
ATOM   483  N  ND1 . HIS A 1 78  ? 10.166 20.006 16.895  1.00 33.76  ? 773  HIS A ND1 1 
ATOM   484  C  CD2 . HIS A 1 78  ? 9.876  18.101 15.867  1.00 32.33  ? 773  HIS A CD2 1 
ATOM   485  C  CE1 . HIS A 1 78  ? 9.257  19.328 17.576  1.00 32.09  ? 773  HIS A CE1 1 
ATOM   486  N  NE2 . HIS A 1 78  ? 9.066  18.169 16.972  1.00 33.14  ? 773  HIS A NE2 1 
ATOM   487  N  N   . VAL A 1 79  ? 11.534 22.172 12.055  1.00 22.06  ? 774  VAL A N   1 
ATOM   488  C  CA  . VAL A 1 79  ? 12.356 22.824 11.070  1.00 22.22  ? 774  VAL A CA  1 
ATOM   489  C  C   . VAL A 1 79  ? 11.680 24.143 10.708  1.00 20.17  ? 774  VAL A C   1 
ATOM   490  O  O   . VAL A 1 79  ? 10.476 24.165 10.389  1.00 23.89  ? 774  VAL A O   1 
ATOM   491  C  CB  . VAL A 1 79  ? 12.529 21.959 9.804   1.00 23.59  ? 774  VAL A CB  1 
ATOM   492  C  CG1 . VAL A 1 79  ? 13.481 22.641 8.825   1.00 26.58  ? 774  VAL A CG1 1 
ATOM   493  C  CG2 . VAL A 1 79  ? 13.076 20.558 10.163  1.00 24.88  ? 774  VAL A CG2 1 
ATOM   494  N  N   . CYS A 1 80  ? 12.414 25.242 10.843  1.00 23.81  ? 775  CYS A N   1 
ATOM   495  C  CA  . CYS A 1 80  ? 11.913 26.556 10.391  1.00 22.25  ? 775  CYS A CA  1 
ATOM   496  C  C   . CYS A 1 80  ? 11.769 26.585 8.879   1.00 24.37  ? 775  CYS A C   1 
ATOM   497  O  O   . CYS A 1 80  ? 12.459 25.869 8.179   1.00 25.31  ? 775  CYS A O   1 
ATOM   498  C  CB  . CYS A 1 80  ? 12.802 27.689 10.825  1.00 23.15  ? 775  CYS A CB  1 
ATOM   499  S  SG  . CYS A 1 80  ? 12.920 27.902 12.633  1.00 27.78  ? 775  CYS A SG  1 
ATOM   500  N  N   . ARG A 1 81  ? 10.824 27.391 8.397   1.00 25.88  ? 776  ARG A N   1 
ATOM   501  C  CA  . ARG A 1 81  ? 10.556 27.503 6.973   1.00 25.82  ? 776  ARG A CA  1 
ATOM   502  C  C   . ARG A 1 81  ? 10.780 28.965 6.573   1.00 23.41  ? 776  ARG A C   1 
ATOM   503  O  O   . ARG A 1 81  ? 10.435 29.870 7.322   1.00 24.63  ? 776  ARG A O   1 
ATOM   504  C  CB  . ARG A 1 81  ? 9.083  27.118 6.710   1.00 27.15  ? 776  ARG A CB  1 
ATOM   505  C  CG  . ARG A 1 81  ? 8.713  26.920 5.242   1.00 36.24  ? 776  ARG A CG  1 
ATOM   506  C  CD  . ARG A 1 81  ? 7.196  26.635 5.039   1.00 34.99  ? 776  ARG A CD  1 
ATOM   507  N  NE  . ARG A 1 81  ? 6.370  27.842 5.056   1.00 46.30  ? 776  ARG A NE  1 
ATOM   508  C  CZ  . ARG A 1 81  ? 6.257  28.725 4.062   1.00 43.62  ? 776  ARG A CZ  1 
ATOM   509  N  NH1 . ARG A 1 81  ? 6.927  28.584 2.921   1.00 40.95  ? 776  ARG A NH1 1 
ATOM   510  N  NH2 . ARG A 1 81  ? 5.471  29.778 4.216   1.00 50.43  ? 776  ARG A NH2 1 
ATOM   511  N  N   . LEU A 1 82  ? 11.340 29.182 5.388   1.00 24.58  ? 777  LEU A N   1 
ATOM   512  C  CA  . LEU A 1 82  ? 11.434 30.522 4.824   1.00 24.27  ? 777  LEU A CA  1 
ATOM   513  C  C   . LEU A 1 82  ? 10.061 30.922 4.336   1.00 27.46  ? 777  LEU A C   1 
ATOM   514  O  O   . LEU A 1 82  ? 9.396  30.144 3.637   1.00 29.61  ? 777  LEU A O   1 
ATOM   515  C  CB  . LEU A 1 82  ? 12.454 30.569 3.679   1.00 26.64  ? 777  LEU A CB  1 
ATOM   516  C  CG  . LEU A 1 82  ? 13.063 31.890 3.258   1.00 37.50  ? 777  LEU A CG  1 
ATOM   517  C  CD1 . LEU A 1 82  ? 13.924 32.427 4.400   1.00 37.43  ? 777  LEU A CD1 1 
ATOM   518  C  CD2 . LEU A 1 82  ? 13.895 31.657 2.010   1.00 38.61  ? 777  LEU A CD2 1 
ATOM   519  N  N   . LEU A 1 83  ? 9.625  32.120 4.714   1.00 26.19  ? 778  LEU A N   1 
ATOM   520  C  CA  . LEU A 1 83  ? 8.312  32.631 4.289   1.00 28.46  ? 778  LEU A CA  1 
ATOM   521  C  C   . LEU A 1 83  ? 8.435  33.436 3.010   1.00 30.55  ? 778  LEU A C   1 
ATOM   522  O  O   . LEU A 1 83  ? 7.521  33.449 2.164   1.00 32.61  ? 778  LEU A O   1 
ATOM   523  C  CB  . LEU A 1 83  ? 7.727  33.546 5.361   1.00 28.94  ? 778  LEU A CB  1 
ATOM   524  C  CG  . LEU A 1 83  ? 7.402  32.966 6.742   1.00 35.69  ? 778  LEU A CG  1 
ATOM   525  C  CD1 . LEU A 1 83  ? 6.944  34.079 7.652   1.00 37.36  ? 778  LEU A CD1 1 
ATOM   526  C  CD2 . LEU A 1 83  ? 6.330  31.889 6.632   1.00 43.47  ? 778  LEU A CD2 1 
ATOM   527  N  N   . GLY A 1 84  ? 9.548  34.140 2.887   1.00 28.98  ? 779  GLY A N   1 
ATOM   528  C  CA  . GLY A 1 84  ? 9.731  35.051 1.771   1.00 30.39  ? 779  GLY A CA  1 
ATOM   529  C  C   . GLY A 1 84  ? 11.154 35.494 1.592   1.00 28.15  ? 779  GLY A C   1 
ATOM   530  O  O   . GLY A 1 84  ? 12.021 35.240 2.421   1.00 28.15  ? 779  GLY A O   1 
ATOM   531  N  N   . ILE A 1 85  ? 11.384 36.175 0.480   1.00 29.05  ? 780  ILE A N   1 
ATOM   532  C  CA  . ILE A 1 85  ? 12.713 36.626 0.122   1.00 29.58  ? 780  ILE A CA  1 
ATOM   533  C  C   . ILE A 1 85  ? 12.590 37.964 -0.579  1.00 33.48  ? 780  ILE A C   1 
ATOM   534  O  O   . ILE A 1 85  ? 11.603 38.236 -1.275  1.00 34.14  ? 780  ILE A O   1 
ATOM   535  C  CB  . ILE A 1 85  ? 13.436 35.572 -0.759  1.00 29.86  ? 780  ILE A CB  1 
ATOM   536  C  CG1 . ILE A 1 85  ? 14.909 35.925 -0.967  1.00 34.48  ? 780  ILE A CG1 1 
ATOM   537  C  CG2 . ILE A 1 85  ? 12.717 35.387 -2.102  1.00 33.32  ? 780  ILE A CG2 1 
ATOM   538  C  CD1 . ILE A 1 85  ? 15.766 34.744 -1.391  1.00 36.31  ? 780  ILE A CD1 1 
ATOM   539  N  N   . CYS A 1 86  ? 13.592 38.804 -0.363  1.00 33.12  ? 781  CYS A N   1 
ATOM   540  C  CA  . CYS A 1 86  ? 13.692 40.072 -1.059  1.00 38.64  ? 781  CYS A CA  1 
ATOM   541  C  C   . CYS A 1 86  ? 15.101 40.220 -1.621  1.00 39.87  ? 781  CYS A C   1 
ATOM   542  O  O   . CYS A 1 86  ? 16.079 40.281 -0.877  1.00 39.17  ? 781  CYS A O   1 
ATOM   543  C  CB  . CYS A 1 86  ? 13.356 41.227 -0.120  1.00 39.56  ? 781  CYS A CB  1 
ATOM   544  S  SG  . CYS A 1 86  ? 13.381 42.848 -0.940  1.00 44.64  ? 781  CYS A SG  1 
ATOM   545  N  N   . LEU A 1 87  ? 15.195 40.268 -2.948  1.00 43.13  ? 782  LEU A N   1 
ATOM   546  C  CA  . LEU A 1 87  ? 16.483 40.371 -3.619  1.00 48.45  ? 782  LEU A CA  1 
ATOM   547  C  C   . LEU A 1 87  ? 16.662 41.766 -4.203  1.00 51.61  ? 782  LEU A C   1 
ATOM   548  O  O   . LEU A 1 87  ? 16.013 42.124 -5.185  1.00 53.81  ? 782  LEU A O   1 
ATOM   549  C  CB  . LEU A 1 87  ? 16.610 39.312 -4.729  1.00 50.14  ? 782  LEU A CB  1 
ATOM   550  C  CG  . LEU A 1 87  ? 16.580 37.822 -4.367  1.00 51.11  ? 782  LEU A CG  1 
ATOM   551  C  CD1 . LEU A 1 87  ? 16.835 36.985 -5.609  1.00 56.83  ? 782  LEU A CD1 1 
ATOM   552  C  CD2 . LEU A 1 87  ? 17.598 37.479 -3.284  1.00 55.01  ? 782  LEU A CD2 1 
ATOM   553  N  N   . THR A 1 88  ? 17.528 42.550 -3.569  1.00 54.10  ? 783  THR A N   1 
ATOM   554  C  CA  . THR A 1 88  ? 17.919 43.868 -4.067  1.00 58.77  ? 783  THR A CA  1 
ATOM   555  C  C   . THR A 1 88  ? 19.444 43.875 -4.231  1.00 60.87  ? 783  THR A C   1 
ATOM   556  O  O   . THR A 1 88  ? 20.003 42.991 -4.885  1.00 61.10  ? 783  THR A O   1 
ATOM   557  C  CB  . THR A 1 88  ? 17.447 45.011 -3.121  1.00 58.39  ? 783  THR A CB  1 
ATOM   558  O  OG1 . THR A 1 88  ? 18.023 44.837 -1.822  1.00 56.42  ? 783  THR A OG1 1 
ATOM   559  C  CG2 . THR A 1 88  ? 15.921 45.033 -2.998  1.00 56.30  ? 783  THR A CG2 1 
ATOM   560  N  N   . SER A 1 89  ? 20.108 44.859 -3.629  1.00 61.89  ? 784  SER A N   1 
ATOM   561  C  CA  . SER A 1 89  ? 21.565 44.881 -3.535  1.00 63.70  ? 784  SER A CA  1 
ATOM   562  C  C   . SER A 1 89  ? 22.044 43.795 -2.576  1.00 60.28  ? 784  SER A C   1 
ATOM   563  O  O   . SER A 1 89  ? 23.157 43.278 -2.707  1.00 59.89  ? 784  SER A O   1 
ATOM   564  C  CB  . SER A 1 89  ? 22.038 46.246 -3.038  1.00 66.18  ? 784  SER A CB  1 
ATOM   565  O  OG  . SER A 1 89  ? 21.306 47.290 -3.658  1.00 73.25  ? 784  SER A OG  1 
ATOM   566  N  N   . THR A 1 90  ? 21.188 43.469 -1.608  1.00 56.25  ? 785  THR A N   1 
ATOM   567  C  CA  . THR A 1 90  ? 21.442 42.410 -0.641  1.00 54.13  ? 785  THR A CA  1 
ATOM   568  C  C   . THR A 1 90  ? 20.399 41.310 -0.768  1.00 50.11  ? 785  THR A C   1 
ATOM   569  O  O   . THR A 1 90  ? 19.349 41.492 -1.398  1.00 51.30  ? 785  THR A O   1 
ATOM   570  C  CB  . THR A 1 90  ? 21.347 42.931 0.804   1.00 51.99  ? 785  THR A CB  1 
ATOM   571  O  OG1 . THR A 1 90  ? 20.033 43.462 1.027   1.00 54.16  ? 785  THR A OG1 1 
ATOM   572  C  CG2 . THR A 1 90  ? 22.399 44.010 1.080   1.00 53.56  ? 785  THR A CG2 1 
ATOM   573  N  N   . VAL A 1 91  ? 20.692 40.171 -0.153  1.00 46.27  ? 786  VAL A N   1 
ATOM   574  C  CA  . VAL A 1 91  ? 19.720 39.106 -0.006  1.00 42.06  ? 786  VAL A CA  1 
ATOM   575  C  C   . VAL A 1 91  ? 19.116 39.271 1.389   1.00 37.90  ? 786  VAL A C   1 
ATOM   576  O  O   . VAL A 1 91  ? 19.850 39.337 2.379   1.00 40.99  ? 786  VAL A O   1 
ATOM   577  C  CB  . VAL A 1 91  ? 20.377 37.710 -0.141  1.00 43.34  ? 786  VAL A CB  1 
ATOM   578  C  CG1 . VAL A 1 91  ? 19.344 36.600 0.033   1.00 44.70  ? 786  VAL A CG1 1 
ATOM   579  C  CG2 . VAL A 1 91  ? 21.066 37.564 -1.500  1.00 48.82  ? 786  VAL A CG2 1 
ATOM   580  N  N   . GLN A 1 92  ? 17.793 39.379 1.452   1.00 35.43  ? 787  GLN A N   1 
ATOM   581  C  CA  . GLN A 1 92  ? 17.077 39.356 2.733   1.00 33.63  ? 787  GLN A CA  1 
ATOM   582  C  C   . GLN A 1 92  ? 16.128 38.161 2.787   1.00 32.64  ? 787  GLN A C   1 
ATOM   583  O  O   . GLN A 1 92  ? 15.336 37.942 1.863   1.00 33.78  ? 787  GLN A O   1 
ATOM   584  C  CB  . GLN A 1 92  ? 16.300 40.653 2.958   1.00 34.08  ? 787  GLN A CB  1 
ATOM   585  C  CG  . GLN A 1 92  ? 17.177 41.856 3.212   1.00 38.85  ? 787  GLN A CG  1 
ATOM   586  C  CD  . GLN A 1 92  ? 16.383 43.131 3.408   1.00 42.90  ? 787  GLN A CD  1 
ATOM   587  O  OE1 . GLN A 1 92  ? 16.084 43.521 4.539   1.00 39.70  ? 787  GLN A OE1 1 
ATOM   588  N  NE2 . GLN A 1 92  ? 16.047 43.792 2.312   1.00 41.09  ? 787  GLN A NE2 1 
ATOM   589  N  N   . LEU A 1 93  ? 16.216 37.399 3.877   1.00 27.83  ? 788  LEU A N   1 
ATOM   590  C  CA  . LEU A 1 93  ? 15.415 36.202 4.084   1.00 29.05  ? 788  LEU A CA  1 
ATOM   591  C  C   . LEU A 1 93  ? 14.410 36.499 5.192   1.00 26.95  ? 788  LEU A C   1 
ATOM   592  O  O   . LEU A 1 93  ? 14.792 37.053 6.216   1.00 27.03  ? 788  LEU A O   1 
ATOM   593  C  CB  . LEU A 1 93  ? 16.314 35.031 4.495   1.00 28.96  ? 788  LEU A CB  1 
ATOM   594  C  CG  . LEU A 1 93  ? 17.497 34.697 3.575   1.00 32.14  ? 788  LEU A CG  1 
ATOM   595  C  CD1 . LEU A 1 93  ? 18.317 33.573 4.169   1.00 36.10  ? 788  LEU A CD1 1 
ATOM   596  C  CD2 . LEU A 1 93  ? 17.028 34.337 2.158   1.00 33.49  ? 788  LEU A CD2 1 
ATOM   597  N  N   . ILE A 1 94  ? 13.142 36.158 4.972   1.00 26.38  ? 789  ILE A N   1 
ATOM   598  C  CA  . ILE A 1 94  ? 12.074 36.467 5.925   1.00 24.82  ? 789  ILE A CA  1 
ATOM   599  C  C   . ILE A 1 94  ? 11.460 35.178 6.437   1.00 22.67  ? 789  ILE A C   1 
ATOM   600  O  O   . ILE A 1 94  ? 11.146 34.284 5.653   1.00 23.07  ? 789  ILE A O   1 
ATOM   601  C  CB  . ILE A 1 94  ? 10.967 37.363 5.298   1.00 27.08  ? 789  ILE A CB  1 
ATOM   602  C  CG1 . ILE A 1 94  ? 11.517 38.746 4.924   1.00 29.94  ? 789  ILE A CG1 1 
ATOM   603  C  CG2 . ILE A 1 94  ? 9.819  37.569 6.280   1.00 27.16  ? 789  ILE A CG2 1 
ATOM   604  C  CD1 . ILE A 1 94  ? 12.047 38.835 3.512   1.00 37.30  ? 789  ILE A CD1 1 
ATOM   605  N  N   . THR A 1 95  ? 11.330 35.078 7.754   1.00 23.29  ? 790  THR A N   1 
ATOM   606  C  CA  . THR A 1 95  ? 10.838 33.853 8.375   1.00 23.84  ? 790  THR A CA  1 
ATOM   607  C  C   . THR A 1 95  ? 10.042 34.211 9.609   1.00 23.41  ? 790  THR A C   1 
ATOM   608  O  O   . THR A 1 95  ? 10.178 35.325 10.124  1.00 23.92  ? 790  THR A O   1 
ATOM   609  C  CB  . THR A 1 95  ? 12.007 32.897 8.750   1.00 26.09  ? 790  THR A CB  1 
ATOM   610  O  OG1 . THR A 1 95  ? 11.467 31.629 9.124   1.00 27.25  ? 790  THR A OG1 1 
ATOM   611  C  CG2 . THR A 1 95  ? 12.875 33.449 9.914   1.00 22.15  ? 790  THR A CG2 1 
ATOM   612  N  N   . GLN A 1 96  ? 9.257  33.262 10.114  1.00 23.32  ? 791  GLN A N   1 
ATOM   613  C  CA  . GLN A 1 96  ? 8.478  33.512 11.328  1.00 25.58  ? 791  GLN A CA  1 
ATOM   614  C  C   . GLN A 1 96  ? 9.374  33.823 12.524  1.00 23.38  ? 791  GLN A C   1 
ATOM   615  O  O   . GLN A 1 96  ? 10.386 33.161 12.758  1.00 25.63  ? 791  GLN A O   1 
ATOM   616  C  CB  . GLN A 1 96  ? 7.578  32.320 11.657  1.00 28.83  ? 791  GLN A CB  1 
ATOM   617  C  CG  . GLN A 1 96  ? 6.823  32.484 12.956  1.00 30.93  ? 791  GLN A CG  1 
ATOM   618  C  CD  . GLN A 1 96  ? 5.864  31.337 13.238  1.00 40.85  ? 791  GLN A CD  1 
ATOM   619  O  OE1 . GLN A 1 96  ? 5.878  30.306 12.557  1.00 42.28  ? 791  GLN A OE1 1 
ATOM   620  N  NE2 . GLN A 1 96  ? 5.040  31.506 14.265  1.00 38.44  ? 791  GLN A NE2 1 
ATOM   621  N  N   . LEU A 1 97  ? 9.008  34.851 13.288  1.00 22.32  ? 792  LEU A N   1 
ATOM   622  C  CA  . LEU A 1 97  ? 9.760  35.179 14.497  1.00 22.54  ? 792  LEU A CA  1 
ATOM   623  C  C   . LEU A 1 97  ? 9.561  34.123 15.579  1.00 26.72  ? 792  LEU A C   1 
ATOM   624  O  O   . LEU A 1 97  ? 8.429  33.725 15.874  1.00 28.37  ? 792  LEU A O   1 
ATOM   625  C  CB  . LEU A 1 97  ? 9.347  36.566 15.007  1.00 24.81  ? 792  LEU A CB  1 
ATOM   626  C  CG  . LEU A 1 97  ? 10.103 37.108 16.218  1.00 25.02  ? 792  LEU A CG  1 
ATOM   627  C  CD1 . LEU A 1 97  ? 11.580 37.392 15.876  1.00 25.39  ? 792  LEU A CD1 1 
ATOM   628  C  CD2 . LEU A 1 97  ? 9.411  38.378 16.756  1.00 29.92  ? 792  LEU A CD2 1 
ATOM   629  N  N   . MET A 1 98  ? 10.667 33.654 16.145  1.00 23.96  ? 793  MET A N   1 
ATOM   630  C  CA  . MET A 1 98  ? 10.619 32.683 17.233  1.00 25.50  ? 793  MET A CA  1 
ATOM   631  C  C   . MET A 1 98  ? 10.825 33.443 18.522  1.00 24.19  ? 793  MET A C   1 
ATOM   632  O  O   . MET A 1 98  ? 11.939 33.910 18.809  1.00 25.47  ? 793  MET A O   1 
ATOM   633  C  CB  . MET A 1 98  ? 11.700 31.631 17.042  1.00 24.10  ? 793  MET A CB  1 
ATOM   634  C  CG  . MET A 1 98  ? 11.582 30.834 15.739  1.00 25.93  ? 793  MET A CG  1 
ATOM   635  S  SD  . MET A 1 98  ? 10.237 29.642 15.891  1.00 32.17  ? 793  MET A SD  1 
ATOM   636  C  CE  . MET A 1 98  ? 9.053  30.271 14.709  1.00 37.85  ? 793  MET A CE  1 
ATOM   637  N  N   . PRO A 1 99  ? 9.754  33.584 19.306  1.00 33.86  ? 794  PRO A N   1 
ATOM   638  C  CA  . PRO A 1 99  ? 9.768  34.671 20.287  1.00 33.40  ? 794  PRO A CA  1 
ATOM   639  C  C   . PRO A 1 99  ? 10.594 34.414 21.551  1.00 30.27  ? 794  PRO A C   1 
ATOM   640  O  O   . PRO A 1 99  ? 10.743 35.321 22.362  1.00 32.17  ? 794  PRO A O   1 
ATOM   641  C  CB  . PRO A 1 99  ? 8.283  34.880 20.617  1.00 37.76  ? 794  PRO A CB  1 
ATOM   642  C  CG  . PRO A 1 99  ? 7.622  33.580 20.284  1.00 33.90  ? 794  PRO A CG  1 
ATOM   643  C  CD  . PRO A 1 99  ? 8.454  32.891 19.229  1.00 36.65  ? 794  PRO A CD  1 
ATOM   644  N  N   . PHE A 1 100 ? 11.121 33.205 21.715  1.00 28.20  ? 795  PHE A N   1 
ATOM   645  C  CA  . PHE A 1 100 ? 12.014 32.903 22.839  1.00 27.86  ? 795  PHE A CA  1 
ATOM   646  C  C   . PHE A 1 100 ? 13.496 32.888 22.440  1.00 28.38  ? 795  PHE A C   1 
ATOM   647  O  O   . PHE A 1 100 ? 14.368 32.625 23.275  1.00 29.19  ? 795  PHE A O   1 
ATOM   648  C  CB  . PHE A 1 100 ? 11.625 31.587 23.522  1.00 27.14  ? 795  PHE A CB  1 
ATOM   649  C  CG  . PHE A 1 100 ? 10.336 31.658 24.293  1.00 29.88  ? 795  PHE A CG  1 
ATOM   650  C  CD1 . PHE A 1 100 ? 9.115  31.419 23.661  1.00 30.19  ? 795  PHE A CD1 1 
ATOM   651  C  CD2 . PHE A 1 100 ? 10.343 31.982 25.653  1.00 32.25  ? 795  PHE A CD2 1 
ATOM   652  C  CE1 . PHE A 1 100 ? 7.913  31.494 24.375  1.00 35.17  ? 795  PHE A CE1 1 
ATOM   653  C  CE2 . PHE A 1 100 ? 9.153  32.070 26.377  1.00 36.45  ? 795  PHE A CE2 1 
ATOM   654  C  CZ  . PHE A 1 100 ? 7.932  31.838 25.738  1.00 37.76  ? 795  PHE A CZ  1 
ATOM   655  N  N   . GLY A 1 101 ? 13.782 33.182 21.176  1.00 27.34  ? 796  GLY A N   1 
ATOM   656  C  CA  . GLY A 1 101 ? 15.172 33.287 20.719  1.00 25.71  ? 796  GLY A CA  1 
ATOM   657  C  C   . GLY A 1 101 ? 15.881 31.975 20.490  1.00 27.39  ? 796  GLY A C   1 
ATOM   658  O  O   . GLY A 1 101 ? 15.242 30.923 20.328  1.00 27.07  ? 796  GLY A O   1 
ATOM   659  N  N   . CYS A 1 102 ? 17.209 32.028 20.453  1.00 25.45  ? 797  CYS A N   1 
ATOM   660  C  CA  . CYS A 1 102 ? 17.959 30.806 20.167  1.00 26.28  ? 797  CYS A CA  1 
ATOM   661  C  C   . CYS A 1 102 ? 18.176 29.952 21.404  1.00 25.75  ? 797  CYS A C   1 
ATOM   662  O  O   . CYS A 1 102 ? 18.187 30.443 22.537  1.00 24.51  ? 797  CYS A O   1 
ATOM   663  C  CB  . CYS A 1 102 ? 19.286 31.105 19.473  1.00 30.39  ? 797  CYS A CB  1 
ATOM   664  S  SG  . CYS A 1 102 ? 20.507 31.826 20.546  1.00 38.00  ? 797  CYS A SG  1 
ATOM   665  N  N   . LEU A 1 103 ? 18.329 28.649 21.164  1.00 25.54  ? 798  LEU A N   1 
ATOM   666  C  CA  . LEU A 1 103 ? 18.449 27.684 22.254  1.00 24.23  ? 798  LEU A CA  1 
ATOM   667  C  C   . LEU A 1 103 ? 19.737 27.816 23.050  1.00 22.90  ? 798  LEU A C   1 
ATOM   668  O  O   . LEU A 1 103 ? 19.730 27.569 24.263  1.00 25.28  ? 798  LEU A O   1 
ATOM   669  C  CB  . LEU A 1 103 ? 18.278 26.259 21.720  1.00 23.57  ? 798  LEU A CB  1 
ATOM   670  C  CG  . LEU A 1 103 ? 18.102 25.136 22.744  1.00 22.46  ? 798  LEU A CG  1 
ATOM   671  C  CD1 . LEU A 1 103 ? 16.980 25.365 23.749  1.00 26.39  ? 798  LEU A CD1 1 
ATOM   672  C  CD2 . LEU A 1 103 ? 17.926 23.804 21.977  1.00 26.77  ? 798  LEU A CD2 1 
ATOM   673  N  N   . LEU A 1 104 ? 20.818 28.248 22.400  1.00 25.44  ? 799  LEU A N   1 
ATOM   674  C  CA  . LEU A 1 104 ? 22.091 28.419 23.100  1.00 25.93  ? 799  LEU A CA  1 
ATOM   675  C  C   . LEU A 1 104 ? 21.927 29.463 24.210  1.00 27.02  ? 799  LEU A C   1 
ATOM   676  O  O   . LEU A 1 104 ? 22.253 29.198 25.362  1.00 28.37  ? 799  LEU A O   1 
ATOM   677  C  CB  . LEU A 1 104 ? 23.204 28.859 22.145  1.00 25.14  ? 799  LEU A CB  1 
ATOM   678  C  CG  . LEU A 1 104 ? 24.568 29.095 22.801  1.00 28.66  ? 799  LEU A CG  1 
ATOM   679  C  CD1 . LEU A 1 104 ? 25.035 27.834 23.541  1.00 26.89  ? 799  LEU A CD1 1 
ATOM   680  C  CD2 . LEU A 1 104 ? 25.567 29.526 21.750  1.00 28.31  ? 799  LEU A CD2 1 
ATOM   681  N  N   . ASP A 1 105 ? 21.418 30.639 23.846  1.00 27.04  ? 800  ASP A N   1 
ATOM   682  C  CA  . ASP A 1 105 ? 21.181 31.705 24.839  1.00 29.62  ? 800  ASP A CA  1 
ATOM   683  C  C   . ASP A 1 105 ? 20.190 31.227 25.878  1.00 28.59  ? 800  ASP A C   1 
ATOM   684  O  O   . ASP A 1 105 ? 20.344 31.490 27.077  1.00 29.60  ? 800  ASP A O   1 
ATOM   685  C  CB  . ASP A 1 105 ? 20.626 32.965 24.167  1.00 29.74  ? 800  ASP A CB  1 
ATOM   686  C  CG  . ASP A 1 105 ? 21.652 33.673 23.303  1.00 40.85  ? 800  ASP A CG  1 
ATOM   687  O  OD1 . ASP A 1 105 ? 21.231 34.494 22.453  1.00 49.45  ? 800  ASP A OD1 1 
ATOM   688  O  OD2 . ASP A 1 105 ? 22.866 33.411 23.465  1.00 49.78  ? 800  ASP A OD2 1 
ATOM   689  N  N   . TYR A 1 106 ? 19.160 30.528 25.415  1.00 28.25  ? 801  TYR A N   1 
ATOM   690  C  CA  . TYR A 1 106 ? 18.133 30.007 26.304  1.00 29.05  ? 801  TYR A CA  1 
ATOM   691  C  C   . TYR A 1 106 ? 18.702 29.096 27.411  1.00 27.56  ? 801  TYR A C   1 
ATOM   692  O  O   . TYR A 1 106 ? 18.389 29.284 28.606  1.00 28.77  ? 801  TYR A O   1 
ATOM   693  C  CB  . TYR A 1 106 ? 17.029 29.298 25.521  1.00 29.37  ? 801  TYR A CB  1 
ATOM   694  C  CG  . TYR A 1 106 ? 15.810 29.043 26.370  1.00 31.50  ? 801  TYR A CG  1 
ATOM   695  C  CD1 . TYR A 1 106 ? 15.695 27.866 27.130  1.00 32.65  ? 801  TYR A CD1 1 
ATOM   696  C  CD2 . TYR A 1 106 ? 14.781 29.981 26.440  1.00 31.89  ? 801  TYR A CD2 1 
ATOM   697  C  CE1 . TYR A 1 106 ? 14.597 27.629 27.917  1.00 32.01  ? 801  TYR A CE1 1 
ATOM   698  C  CE2 . TYR A 1 106 ? 13.673 29.757 27.224  1.00 32.81  ? 801  TYR A CE2 1 
ATOM   699  C  CZ  . TYR A 1 106 ? 13.584 28.585 27.971  1.00 34.18  ? 801  TYR A CZ  1 
ATOM   700  O  OH  . TYR A 1 106 ? 12.478 28.384 28.757  1.00 37.43  ? 801  TYR A OH  1 
ATOM   701  N  N   . VAL A 1 107 ? 19.561 28.148 27.034  1.00 28.02  ? 802  VAL A N   1 
ATOM   702  C  CA  . VAL A 1 107 ? 20.131 27.262 28.061  1.00 29.07  ? 802  VAL A CA  1 
ATOM   703  C  C   . VAL A 1 107 ? 21.117 27.970 28.995  1.00 32.00  ? 802  VAL A C   1 
ATOM   704  O  O   . VAL A 1 107 ? 21.211 27.634 30.176  1.00 33.14  ? 802  VAL A O   1 
ATOM   705  C  CB  . VAL A 1 107 ? 20.749 25.942 27.495  1.00 28.16  ? 802  VAL A CB  1 
ATOM   706  C  CG1 . VAL A 1 107 ? 19.692 25.158 26.733  1.00 29.08  ? 802  VAL A CG1 1 
ATOM   707  C  CG2 . VAL A 1 107 ? 21.966 26.213 26.630  1.00 27.34  ? 802  VAL A CG2 1 
ATOM   708  N  N   . ARG A 1 108 ? 21.819 28.971 28.473  1.00 31.40  ? 803  ARG A N   1 
ATOM   709  C  CA  . ARG A 1 108 ? 22.727 29.765 29.294  1.00 32.81  ? 803  ARG A CA  1 
ATOM   710  C  C   . ARG A 1 108 ? 21.954 30.601 30.311  1.00 35.16  ? 803  ARG A C   1 
ATOM   711  O  O   . ARG A 1 108 ? 22.388 30.760 31.465  1.00 34.83  ? 803  ARG A O   1 
ATOM   712  C  CB  . ARG A 1 108 ? 23.586 30.670 28.414  1.00 32.25  ? 803  ARG A CB  1 
ATOM   713  C  CG  . ARG A 1 108 ? 24.618 29.928 27.575  1.00 32.89  ? 803  ARG A CG  1 
ATOM   714  C  CD  . ARG A 1 108 ? 25.336 30.889 26.653  1.00 34.30  ? 803  ARG A CD  1 
ATOM   715  N  NE  . ARG A 1 108 ? 26.472 30.256 25.989  1.00 31.14  ? 803  ARG A NE  1 
ATOM   716  C  CZ  . ARG A 1 108 ? 27.187 30.810 25.018  1.00 32.07  ? 803  ARG A CZ  1 
ATOM   717  N  NH1 . ARG A 1 108 ? 26.880 32.030 24.567  1.00 35.55  ? 803  ARG A NH1 1 
ATOM   718  N  NH2 . ARG A 1 108 ? 28.217 30.149 24.497  1.00 30.29  ? 803  ARG A NH2 1 
ATOM   719  N  N   . GLU A 1 109 ? 20.794 31.106 29.894  1.00 33.55  ? 804  GLU A N   1 
ATOM   720  C  CA  . GLU A 1 109 ? 20.008 32.006 30.739  1.00 37.44  ? 804  GLU A CA  1 
ATOM   721  C  C   . GLU A 1 109 ? 19.162 31.287 31.778  1.00 35.79  ? 804  GLU A C   1 
ATOM   722  O  O   . GLU A 1 109 ? 18.917 31.819 32.868  1.00 37.86  ? 804  GLU A O   1 
ATOM   723  C  CB  . GLU A 1 109 ? 19.144 32.944 29.884  1.00 39.81  ? 804  GLU A CB  1 
ATOM   724  C  CG  . GLU A 1 109 ? 19.962 33.989 29.123  1.00 46.29  ? 804  GLU A CG  1 
ATOM   725  C  CD  . GLU A 1 109 ? 20.899 34.780 30.032  1.00 55.97  ? 804  GLU A CD  1 
ATOM   726  O  OE1 . GLU A 1 109 ? 22.091 34.927 29.680  1.00 59.29  ? 804  GLU A OE1 1 
ATOM   727  O  OE2 . GLU A 1 109 ? 20.446 35.238 31.108  1.00 51.72  ? 804  GLU A OE2 1 
ATOM   728  N  N   . HIS A 1 110 ? 18.752 30.064 31.456  1.00 32.54  ? 805  HIS A N   1 
ATOM   729  C  CA  . HIS A 1 110 ? 17.865 29.293 32.324  1.00 34.61  ? 805  HIS A CA  1 
ATOM   730  C  C   . HIS A 1 110 ? 18.507 28.051 32.926  1.00 34.07  ? 805  HIS A C   1 
ATOM   731  O  O   . HIS A 1 110 ? 17.799 27.124 33.325  1.00 35.94  ? 805  HIS A O   1 
ATOM   732  C  CB  . HIS A 1 110 ? 16.608 28.905 31.555  1.00 32.72  ? 805  HIS A CB  1 
ATOM   733  C  CG  . HIS A 1 110 ? 15.843 30.079 31.047  1.00 36.01  ? 805  HIS A CG  1 
ATOM   734  N  ND1 . HIS A 1 110 ? 16.125 30.685 29.844  1.00 39.54  ? 805  HIS A ND1 1 
ATOM   735  C  CD2 . HIS A 1 110 ? 14.831 30.786 31.602  1.00 40.85  ? 805  HIS A CD2 1 
ATOM   736  C  CE1 . HIS A 1 110 ? 15.304 31.705 29.669  1.00 41.72  ? 805  HIS A CE1 1 
ATOM   737  N  NE2 . HIS A 1 110 ? 14.508 31.784 30.719  1.00 42.03  ? 805  HIS A NE2 1 
ATOM   738  N  N   . LYS A 1 111 ? 19.835 28.052 33.022  1.00 37.29  ? 806  LYS A N   1 
ATOM   739  C  CA  . LYS A 1 111 ? 20.600 26.893 33.501  1.00 39.82  ? 806  LYS A CA  1 
ATOM   740  C  C   . LYS A 1 111 ? 20.160 26.330 34.856  1.00 43.21  ? 806  LYS A C   1 
ATOM   741  O  O   . LYS A 1 111 ? 20.393 25.150 35.133  1.00 45.07  ? 806  LYS A O   1 
ATOM   742  C  CB  . LYS A 1 111 ? 22.102 27.210 33.541  1.00 41.14  ? 806  LYS A CB  1 
ATOM   743  C  CG  . LYS A 1 111 ? 22.491 28.434 34.370  1.00 53.15  ? 806  LYS A CG  1 
ATOM   744  C  CD  . LYS A 1 111 ? 23.829 28.242 35.095  1.00 62.82  ? 806  LYS A CD  1 
ATOM   745  C  CE  . LYS A 1 111 ? 25.004 28.033 34.132  1.00 65.21  ? 806  LYS A CE  1 
ATOM   746  N  NZ  . LYS A 1 111 ? 25.294 29.237 33.297  1.00 70.09  ? 806  LYS A NZ  1 
ATOM   747  N  N   . ASP A 1 112 ? 19.539 27.168 35.690  1.00 42.31  ? 807  ASP A N   1 
ATOM   748  C  CA  . ASP A 1 112 ? 19.093 26.743 37.027  1.00 45.05  ? 807  ASP A CA  1 
ATOM   749  C  C   . ASP A 1 112 ? 17.665 26.188 37.059  1.00 43.68  ? 807  ASP A C   1 
ATOM   750  O  O   . ASP A 1 112 ? 17.215 25.672 38.090  1.00 45.33  ? 807  ASP A O   1 
ATOM   751  C  CB  . ASP A 1 112 ? 19.225 27.901 38.029  1.00 49.01  ? 807  ASP A CB  1 
ATOM   752  C  CG  . ASP A 1 112 ? 20.662 28.383 38.191  1.00 55.12  ? 807  ASP A CG  1 
ATOM   753  O  OD1 . ASP A 1 112 ? 21.600 27.555 38.101  1.00 53.47  ? 807  ASP A OD1 1 
ATOM   754  O  OD2 . ASP A 1 112 ? 20.847 29.599 38.418  1.00 59.87  ? 807  ASP A OD2 1 
ATOM   755  N  N   . ASN A 1 113 ? 16.953 26.300 35.938  1.00 42.43  ? 808  ASN A N   1 
ATOM   756  C  CA  . ASN A 1 113 ? 15.590 25.779 35.841  1.00 40.35  ? 808  ASN A CA  1 
ATOM   757  C  C   . ASN A 1 113 ? 15.311 24.827 34.682  1.00 38.19  ? 808  ASN A C   1 
ATOM   758  O  O   . ASN A 1 113 ? 14.152 24.565 34.359  1.00 39.74  ? 808  ASN A O   1 
ATOM   759  C  CB  . ASN A 1 113 ? 14.584 26.923 35.826  1.00 42.28  ? 808  ASN A CB  1 
ATOM   760  C  CG  . ASN A 1 113 ? 14.262 27.415 37.211  1.00 48.81  ? 808  ASN A CG  1 
ATOM   761  O  OD1 . ASN A 1 113 ? 13.569 26.741 37.979  1.00 51.70  ? 808  ASN A OD1 1 
ATOM   762  N  ND2 . ASN A 1 113 ? 14.779 28.585 37.552  1.00 54.10  ? 808  ASN A ND2 1 
ATOM   763  N  N   . ILE A 1 114 ? 16.365 24.297 34.069  1.00 37.05  ? 809  ILE A N   1 
ATOM   764  C  CA  . ILE A 1 114 ? 16.191 23.315 33.001  1.00 33.47  ? 809  ILE A CA  1 
ATOM   765  C  C   . ILE A 1 114 ? 16.416 21.903 33.561  1.00 35.25  ? 809  ILE A C   1 
ATOM   766  O  O   . ILE A 1 114 ? 17.512 21.566 34.028  1.00 37.28  ? 809  ILE A O   1 
ATOM   767  C  CB  . ILE A 1 114 ? 17.108 23.599 31.810  1.00 31.71  ? 809  ILE A CB  1 
ATOM   768  C  CG1 . ILE A 1 114 ? 16.697 24.896 31.098  1.00 31.26  ? 809  ILE A CG1 1 
ATOM   769  C  CG2 . ILE A 1 114 ? 17.072 22.438 30.816  1.00 32.33  ? 809  ILE A CG2 1 
ATOM   770  C  CD1 . ILE A 1 114 ? 17.750 25.431 30.153  1.00 34.22  ? 809  ILE A CD1 1 
ATOM   771  N  N   . GLY A 1 115 ? 15.360 21.099 33.527  1.00 33.64  ? 810  GLY A N   1 
ATOM   772  C  CA  . GLY A 1 115 ? 15.418 19.729 34.022  1.00 33.42  ? 810  GLY A CA  1 
ATOM   773  C  C   . GLY A 1 115 ? 15.725 18.703 32.951  1.00 32.40  ? 810  GLY A C   1 
ATOM   774  O  O   . GLY A 1 115 ? 15.835 19.041 31.768  1.00 32.36  ? 810  GLY A O   1 
ATOM   775  N  N   . SER A 1 116 ? 15.866 17.448 33.381  1.00 30.91  ? 811  SER A N   1 
ATOM   776  C  CA  . SER A 1 116 ? 16.227 16.346 32.481  1.00 28.92  ? 811  SER A CA  1 
ATOM   777  C  C   . SER A 1 116 ? 15.202 16.116 31.373  1.00 30.00  ? 811  SER A C   1 
ATOM   778  O  O   . SER A 1 116 ? 15.577 15.796 30.234  1.00 27.56  ? 811  SER A O   1 
ATOM   779  C  CB  . SER A 1 116 ? 16.465 15.055 33.265  1.00 30.85  ? 811  SER A CB  1 
ATOM   780  O  OG  . SER A 1 116 ? 15.335 14.716 34.043  1.00 33.55  ? 811  SER A OG  1 
ATOM   781  N  N   . GLN A 1 117 ? 13.919 16.270 31.707  1.00 29.98  ? 812  GLN A N   1 
ATOM   782  C  CA  . GLN A 1 117 ? 12.857 16.031 30.729  1.00 32.35  ? 812  GLN A CA  1 
ATOM   783  C  C   . GLN A 1 117 ? 12.996 16.961 29.523  1.00 29.01  ? 812  GLN A C   1 
ATOM   784  O  O   . GLN A 1 117 ? 12.902 16.516 28.363  1.00 28.52  ? 812  GLN A O   1 
ATOM   785  C  CB  . GLN A 1 117 ? 11.469 16.178 31.367  1.00 33.57  ? 812  GLN A CB  1 
ATOM   786  C  CG  . GLN A 1 117 ? 10.326 15.740 30.447  1.00 37.81  ? 812  GLN A CG  1 
ATOM   787  C  CD  . GLN A 1 117 ? 10.287 14.237 30.241  1.00 40.14  ? 812  GLN A CD  1 
ATOM   788  O  OE1 . GLN A 1 117 ? 9.970  13.487 31.159  1.00 39.21  ? 812  GLN A OE1 1 
ATOM   789  N  NE2 . GLN A 1 117 ? 10.615 13.790 29.030  1.00 38.47  ? 812  GLN A NE2 1 
ATOM   790  N  N   . TYR A 1 118 ? 13.228 18.244 29.805  1.00 27.37  ? 813  TYR A N   1 
ATOM   791  C  CA  . TYR A 1 118 ? 13.362 19.254 28.751  1.00 28.86  ? 813  TYR A CA  1 
ATOM   792  C  C   . TYR A 1 118 ? 14.575 19.009 27.863  1.00 25.82  ? 813  TYR A C   1 
ATOM   793  O  O   . TYR A 1 118 ? 14.462 19.044 26.624  1.00 27.07  ? 813  TYR A O   1 
ATOM   794  C  CB  . TYR A 1 118 ? 13.431 20.660 29.356  1.00 32.24  ? 813  TYR A CB  1 
ATOM   795  C  CG  . TYR A 1 118 ? 12.071 21.255 29.643  1.00 39.28  ? 813  TYR A CG  1 
ATOM   796  C  CD1 . TYR A 1 118 ? 11.457 22.113 28.726  1.00 41.23  ? 813  TYR A CD1 1 
ATOM   797  C  CD2 . TYR A 1 118 ? 11.390 20.949 30.824  1.00 44.80  ? 813  TYR A CD2 1 
ATOM   798  C  CE1 . TYR A 1 118 ? 10.197 22.659 28.986  1.00 47.57  ? 813  TYR A CE1 1 
ATOM   799  C  CE2 . TYR A 1 118 ? 10.132 21.490 31.091  1.00 51.31  ? 813  TYR A CE2 1 
ATOM   800  C  CZ  . TYR A 1 118 ? 9.544  22.340 30.165  1.00 50.19  ? 813  TYR A CZ  1 
ATOM   801  O  OH  . TYR A 1 118 ? 8.304  22.874 30.423  1.00 51.79  ? 813  TYR A OH  1 
ATOM   802  N  N   . LEU A 1 119 ? 15.725 18.759 28.482  1.00 26.45  ? 814  LEU A N   1 
ATOM   803  C  CA  . LEU A 1 119 ? 16.942 18.514 27.706  1.00 24.00  ? 814  LEU A CA  1 
ATOM   804  C  C   . LEU A 1 119 ? 16.776 17.331 26.770  1.00 24.29  ? 814  LEU A C   1 
ATOM   805  O  O   . LEU A 1 119 ? 17.145 17.410 25.591  1.00 23.00  ? 814  LEU A O   1 
ATOM   806  C  CB  . LEU A 1 119 ? 18.171 18.310 28.610  1.00 25.75  ? 814  LEU A CB  1 
ATOM   807  C  CG  . LEU A 1 119 ? 18.643 19.586 29.299  1.00 26.54  ? 814  LEU A CG  1 
ATOM   808  C  CD1 . LEU A 1 119 ? 19.416 19.226 30.562  1.00 29.00  ? 814  LEU A CD1 1 
ATOM   809  C  CD2 . LEU A 1 119 ? 19.470 20.463 28.347  1.00 28.37  ? 814  LEU A CD2 1 
ATOM   810  N  N   . LEU A 1 120 ? 16.216 16.236 27.279  1.00 25.07  ? 815  LEU A N   1 
ATOM   811  C  CA  . LEU A 1 120 ? 16.065 15.035 26.439  1.00 24.06  ? 815  LEU A CA  1 
ATOM   812  C  C   . LEU A 1 120 ? 15.025 15.236 25.334  1.00 23.40  ? 815  LEU A C   1 
ATOM   813  O  O   . LEU A 1 120 ? 15.227 14.794 24.203  1.00 24.34  ? 815  LEU A O   1 
ATOM   814  C  CB  . LEU A 1 120 ? 15.779 13.790 27.281  1.00 25.91  ? 815  LEU A CB  1 
ATOM   815  C  CG  . LEU A 1 120 ? 16.960 13.433 28.201  1.00 25.87  ? 815  LEU A CG  1 
ATOM   816  C  CD1 . LEU A 1 120 ? 16.536 12.447 29.264  1.00 26.89  ? 815  LEU A CD1 1 
ATOM   817  C  CD2 . LEU A 1 120 ? 18.169 12.885 27.425  1.00 24.93  ? 815  LEU A CD2 1 
ATOM   818  N  N   . ASN A 1 121 ? 13.936 15.928 25.647  1.00 24.46  ? 816  ASN A N   1 
ATOM   819  C  CA  . ASN A 1 121 ? 12.956 16.227 24.608  1.00 24.61  ? 816  ASN A CA  1 
ATOM   820  C  C   . ASN A 1 121 ? 13.528 17.110 23.506  1.00 23.09  ? 816  ASN A C   1 
ATOM   821  O  O   . ASN A 1 121 ? 13.223 16.899 22.329  1.00 24.15  ? 816  ASN A O   1 
ATOM   822  C  CB  . ASN A 1 121 ? 11.731 16.905 25.196  1.00 26.26  ? 816  ASN A CB  1 
ATOM   823  C  CG  . ASN A 1 121 ? 10.845 15.959 25.999  1.00 32.71  ? 816  ASN A CG  1 
ATOM   824  O  OD1 . ASN A 1 121 ? 11.022 14.743 25.997  1.00 37.02  ? 816  ASN A OD1 1 
ATOM   825  N  ND2 . ASN A 1 121 ? 9.875  16.542 26.699  1.00 36.75  ? 816  ASN A ND2 1 
ATOM   826  N  N   . TRP A 1 122 ? 14.338 18.102 23.881  1.00 24.16  ? 817  TRP A N   1 
ATOM   827  C  CA  . TRP A 1 122 ? 15.006 18.931 22.856  1.00 23.29  ? 817  TRP A CA  1 
ATOM   828  C  C   . TRP A 1 122 ? 15.899 18.095 21.961  1.00 21.50  ? 817  TRP A C   1 
ATOM   829  O  O   . TRP A 1 122 ? 15.936 18.291 20.730  1.00 22.15  ? 817  TRP A O   1 
ATOM   830  C  CB  . TRP A 1 122 ? 15.834 20.045 23.484  1.00 24.33  ? 817  TRP A CB  1 
ATOM   831  C  CG  . TRP A 1 122 ? 15.006 21.095 24.184  1.00 24.33  ? 817  TRP A CG  1 
ATOM   832  C  CD1 . TRP A 1 122 ? 13.717 21.466 23.918  1.00 27.91  ? 817  TRP A CD1 1 
ATOM   833  C  CD2 . TRP A 1 122 ? 15.448 21.913 25.275  1.00 23.49  ? 817  TRP A CD2 1 
ATOM   834  N  NE1 . TRP A 1 122 ? 13.325 22.469 24.794  1.00 28.16  ? 817  TRP A NE1 1 
ATOM   835  C  CE2 . TRP A 1 122 ? 14.374 22.758 25.630  1.00 26.08  ? 817  TRP A CE2 1 
ATOM   836  C  CE3 . TRP A 1 122 ? 16.659 22.013 25.976  1.00 27.45  ? 817  TRP A CE3 1 
ATOM   837  C  CZ2 . TRP A 1 122 ? 14.470 23.698 26.670  1.00 27.65  ? 817  TRP A CZ2 1 
ATOM   838  C  CZ3 . TRP A 1 122 ? 16.753 22.942 27.015  1.00 27.42  ? 817  TRP A CZ3 1 
ATOM   839  C  CH2 . TRP A 1 122 ? 15.672 23.775 27.342  1.00 27.98  ? 817  TRP A CH2 1 
ATOM   840  N  N   . CYS A 1 123 ? 16.628 17.151 22.567  1.00 22.12  ? 818  CYS A N   1 
ATOM   841  C  CA  . CYS A 1 123 ? 17.456 16.230 21.752  1.00 22.86  ? 818  CYS A CA  1 
ATOM   842  C  C   . CYS A 1 123 ? 16.634 15.435 20.747  1.00 22.34  ? 818  CYS A C   1 
ATOM   843  O  O   . CYS A 1 123 ? 17.057 15.273 19.588  1.00 22.08  ? 818  CYS A O   1 
ATOM   844  C  CB  . CYS A 1 123 ? 18.290 15.287 22.622  1.00 24.48  ? 818  CYS A CB  1 
ATOM   845  S  SG  . CYS A 1 123 ? 19.554 16.150 23.606  1.00 25.02  ? 818  CYS A SG  1 
ATOM   846  N  N   . VAL A 1 124 ? 15.473 14.934 21.183  1.00 20.70  ? 819  VAL A N   1 
ATOM   847  C  CA  . VAL A 1 124 ? 14.563 14.210 20.304  1.00 22.36  ? 819  VAL A CA  1 
ATOM   848  C  C   . VAL A 1 124 ? 14.100 15.110 19.153  1.00 21.11  ? 819  VAL A C   1 
ATOM   849  O  O   . VAL A 1 124 ? 14.159 14.719 17.989  1.00 21.76  ? 819  VAL A O   1 
ATOM   850  C  CB  . VAL A 1 124 ? 13.325 13.721 21.065  1.00 24.37  ? 819  VAL A CB  1 
ATOM   851  C  CG1 . VAL A 1 124 ? 12.302 13.114 20.102  1.00 27.83  ? 819  VAL A CG1 1 
ATOM   852  C  CG2 . VAL A 1 124 ? 13.721 12.698 22.126  1.00 25.07  ? 819  VAL A CG2 1 
ATOM   853  N  N   . GLN A 1 125 ? 13.662 16.317 19.501  1.00 20.97  ? 820  GLN A N   1 
ATOM   854  C  CA  . GLN A 1 125 ? 13.099 17.257 18.531  1.00 19.37  ? 820  GLN A CA  1 
ATOM   855  C  C   . GLN A 1 125 ? 14.114 17.660 17.469  1.00 20.40  ? 820  GLN A C   1 
ATOM   856  O  O   . GLN A 1 125 ? 13.798 17.710 16.268  1.00 20.43  ? 820  GLN A O   1 
ATOM   857  C  CB  . GLN A 1 125 ? 12.596 18.493 19.267  1.00 20.58  ? 820  GLN A CB  1 
ATOM   858  C  CG  . GLN A 1 125 ? 11.348 18.204 20.096  1.00 21.28  ? 820  GLN A CG  1 
ATOM   859  C  CD  . GLN A 1 125 ? 10.922 19.396 20.896  1.00 26.31  ? 820  GLN A CD  1 
ATOM   860  O  OE1 . GLN A 1 125 ? 11.099 20.532 20.463  1.00 31.94  ? 820  GLN A OE1 1 
ATOM   861  N  NE2 . GLN A 1 125 ? 10.294 19.148 22.042  1.00 32.08  ? 820  GLN A NE2 1 
ATOM   862  N  N   . ILE A 1 126 ? 15.340 17.916 17.917  1.00 18.98  ? 821  ILE A N   1 
ATOM   863  C  CA  . ILE A 1 126 ? 16.408 18.271 16.964  1.00 18.31  ? 821  ILE A CA  1 
ATOM   864  C  C   . ILE A 1 126 ? 16.673 17.081 16.027  1.00 19.43  ? 821  ILE A C   1 
ATOM   865  O  O   . ILE A 1 126 ? 16.836 17.253 14.801  1.00 19.68  ? 821  ILE A O   1 
ATOM   866  C  CB  . ILE A 1 126 ? 17.672 18.763 17.672  1.00 22.57  ? 821  ILE A CB  1 
ATOM   867  C  CG1 . ILE A 1 126 ? 17.327 20.029 18.485  1.00 20.78  ? 821  ILE A CG1 1 
ATOM   868  C  CG2 . ILE A 1 126 ? 18.804 19.028 16.652  1.00 20.56  ? 821  ILE A CG2 1 
ATOM   869  C  CD1 . ILE A 1 126 ? 18.396 20.359 19.526  1.00 21.42  ? 821  ILE A CD1 1 
ATOM   870  N  N   . ALA A 1 127 ? 16.692 15.879 16.596  1.00 19.55  ? 822  ALA A N   1 
ATOM   871  C  CA  . ALA A 1 127 ? 16.920 14.668 15.767  1.00 19.48  ? 822  ALA A CA  1 
ATOM   872  C  C   . ALA A 1 127 ? 15.807 14.439 14.751  1.00 21.38  ? 822  ALA A C   1 
ATOM   873  O  O   . ALA A 1 127 ? 16.094 14.010 13.625  1.00 22.14  ? 822  ALA A O   1 
ATOM   874  C  CB  . ALA A 1 127 ? 17.119 13.441 16.644  1.00 20.26  ? 822  ALA A CB  1 
ATOM   875  N  N   . LYS A 1 128 ? 14.557 14.712 15.153  1.00 21.14  ? 823  LYS A N   1 
ATOM   876  C  CA  . LYS A 1 128 ? 13.384 14.626 14.260  1.00 21.68  ? 823  LYS A CA  1 
ATOM   877  C  C   . LYS A 1 128 ? 13.540 15.625 13.109  1.00 17.93  ? 823  LYS A C   1 
ATOM   878  O  O   . LYS A 1 128 ? 13.364 15.275 11.929  1.00 20.01  ? 823  LYS A O   1 
ATOM   879  C  CB  . LYS A 1 128 ? 12.081 14.846 15.037  1.00 23.26  ? 823  LYS A CB  1 
ATOM   880  C  CG  . LYS A 1 128 ? 11.704 13.639 15.901  1.00 23.57  ? 823  LYS A CG  1 
ATOM   881  C  CD  . LYS A 1 128 ? 10.339 13.829 16.559  1.00 28.89  ? 823  LYS A CD  1 
ATOM   882  C  CE  . LYS A 1 128 ? 9.971  12.592 17.347  1.00 29.80  ? 823  LYS A CE  1 
ATOM   883  N  NZ  . LYS A 1 128 ? 8.673  12.791 18.084  1.00 36.93  ? 823  LYS A NZ  1 
ATOM   884  N  N   . GLY A 1 129 ? 13.924 16.850 13.451  1.00 20.43  ? 824  GLY A N   1 
ATOM   885  C  CA  . GLY A 1 129 ? 14.126 17.875 12.417  1.00 22.10  ? 824  GLY A CA  1 
ATOM   886  C  C   . GLY A 1 129 ? 15.198 17.489 11.410  1.00 18.16  ? 824  GLY A C   1 
ATOM   887  O  O   . GLY A 1 129 ? 15.014 17.636 10.187  1.00 19.79  ? 824  GLY A O   1 
ATOM   888  N  N   . MET A 1 130 ? 16.339 17.015 11.932  1.00 20.11  ? 825  MET A N   1 
ATOM   889  C  CA  . MET A 1 130 ? 17.428 16.587 11.090  1.00 19.31  ? 825  MET A CA  1 
ATOM   890  C  C   . MET A 1 130 ? 17.108 15.355 10.265  1.00 18.64  ? 825  MET A C   1 
ATOM   891  O  O   . MET A 1 130 ? 17.533 15.262 9.110   1.00 20.59  ? 825  MET A O   1 
ATOM   892  C  CB  . MET A 1 130 ? 18.672 16.299 11.946  1.00 19.50  ? 825  MET A CB  1 
ATOM   893  C  CG  . MET A 1 130 ? 19.289 17.560 12.612  1.00 20.28  ? 825  MET A CG  1 
ATOM   894  S  SD  . MET A 1 130 ? 19.695 18.896 11.444  1.00 22.81  ? 825  MET A SD  1 
ATOM   895  C  CE  . MET A 1 130 ? 21.191 18.239 10.712  1.00 28.98  ? 825  MET A CE  1 
ATOM   896  N  N   . ASN A 1 131 ? 16.368 14.415 10.845  1.00 19.66  ? 826  ASN A N   1 
ATOM   897  C  CA  . ASN A 1 131 ? 15.864 13.288 10.047  1.00 21.88  ? 826  ASN A CA  1 
ATOM   898  C  C   . ASN A 1 131 ? 15.006 13.753 8.871   1.00 21.64  ? 826  ASN A C   1 
ATOM   899  O  O   . ASN A 1 131 ? 15.118 13.202 7.785   1.00 22.09  ? 826  ASN A O   1 
ATOM   900  C  CB  . ASN A 1 131 ? 15.100 12.288 10.908  1.00 20.77  ? 826  ASN A CB  1 
ATOM   901  C  CG  . ASN A 1 131 ? 14.652 11.052 10.118  1.00 26.99  ? 826  ASN A CG  1 
ATOM   902  O  OD1 . ASN A 1 131 ? 15.477 10.301 9.606   1.00 30.19  ? 826  ASN A OD1 1 
ATOM   903  N  ND2 . ASN A 1 131 ? 13.333 10.854 10.013  1.00 27.69  ? 826  ASN A ND2 1 
ATOM   904  N  N   . TYR A 1 132 ? 14.159 14.772 9.108   1.00 20.35  ? 827  TYR A N   1 
ATOM   905  C  CA  . TYR A 1 132 ? 13.334 15.350 8.049   1.00 22.00  ? 827  TYR A CA  1 
ATOM   906  C  C   . TYR A 1 132 ? 14.189 15.964 6.933   1.00 21.46  ? 827  TYR A C   1 
ATOM   907  O  O   . TYR A 1 132 ? 13.920 15.762 5.723   1.00 21.46  ? 827  TYR A O   1 
ATOM   908  C  CB  . TYR A 1 132 ? 12.349 16.373 8.632   1.00 21.88  ? 827  TYR A CB  1 
ATOM   909  C  CG  . TYR A 1 132 ? 11.530 17.007 7.550   1.00 19.84  ? 827  TYR A CG  1 
ATOM   910  C  CD1 . TYR A 1 132 ? 10.336 16.427 7.109   1.00 23.33  ? 827  TYR A CD1 1 
ATOM   911  C  CD2 . TYR A 1 132 ? 11.932 18.209 6.964   1.00 20.56  ? 827  TYR A CD2 1 
ATOM   912  C  CE1 . TYR A 1 132 ? 9.605  17.027 6.104   1.00 27.97  ? 827  TYR A CE1 1 
ATOM   913  C  CE2 . TYR A 1 132 ? 11.214 18.800 5.967   1.00 24.68  ? 827  TYR A CE2 1 
ATOM   914  C  CZ  . TYR A 1 132 ? 10.043 18.216 5.543   1.00 23.40  ? 827  TYR A CZ  1 
ATOM   915  O  OH  . TYR A 1 132 ? 9.330  18.818 4.538   1.00 26.69  ? 827  TYR A OH  1 
ATOM   916  N  N   . LEU A 1 133 ? 15.229 16.700 7.338   1.00 18.81  ? 828  LEU A N   1 
ATOM   917  C  CA  . LEU A 1 133 ? 16.186 17.261 6.359   1.00 23.95  ? 828  LEU A CA  1 
ATOM   918  C  C   . LEU A 1 133 ? 16.918 16.178 5.573   1.00 24.65  ? 828  LEU A C   1 
ATOM   919  O  O   . LEU A 1 133 ? 17.108 16.315 4.353   1.00 22.24  ? 828  LEU A O   1 
ATOM   920  C  CB  . LEU A 1 133 ? 17.152 18.225 7.020   1.00 23.28  ? 828  LEU A CB  1 
ATOM   921  C  CG  . LEU A 1 133 ? 16.567 19.523 7.584   1.00 21.69  ? 828  LEU A CG  1 
ATOM   922  C  CD1 . LEU A 1 133 ? 17.687 20.332 8.217   1.00 27.11  ? 828  LEU A CD1 1 
ATOM   923  C  CD2 . LEU A 1 133 ? 15.858 20.371 6.525   1.00 23.51  ? 828  LEU A CD2 1 
ATOM   924  N  N   . GLU A 1 134 ? 17.245 15.071 6.242   1.00 20.23  ? 829  GLU A N   1 
ATOM   925  C  CA  . GLU A 1 134 ? 17.808 13.924 5.529   1.00 22.00  ? 829  GLU A CA  1 
ATOM   926  C  C   . GLU A 1 134 ? 16.816 13.342 4.497   1.00 23.95  ? 829  GLU A C   1 
ATOM   927  O  O   . GLU A 1 134 ? 17.223 12.991 3.363   1.00 25.96  ? 829  GLU A O   1 
ATOM   928  C  CB  . GLU A 1 134 ? 18.298 12.856 6.527   1.00 21.47  ? 829  GLU A CB  1 
ATOM   929  C  CG  . GLU A 1 134 ? 18.919 11.659 5.818   1.00 23.75  ? 829  GLU A CG  1 
ATOM   930  C  CD  . GLU A 1 134 ? 19.805 10.829 6.718   1.00 25.64  ? 829  GLU A CD  1 
ATOM   931  O  OE1 . GLU A 1 134 ? 19.808 11.066 7.951   1.00 25.31  ? 829  GLU A OE1 1 
ATOM   932  O  OE2 . GLU A 1 134 ? 20.480 9.926  6.166   1.00 28.07  ? 829  GLU A OE2 1 
ATOM   933  N  N   . ASP A 1 135 ? 15.541 13.239 4.864   1.00 25.28  ? 830  ASP A N   1 
ATOM   934  C  CA  . ASP A 1 135 ? 14.512 12.823 3.899   1.00 26.06  ? 830  ASP A CA  1 
ATOM   935  C  C   . ASP A 1 135 ? 14.400 13.772 2.704   1.00 26.38  ? 830  ASP A C   1 
ATOM   936  O  O   . ASP A 1 135 ? 14.028 13.360 1.593   1.00 27.18  ? 830  ASP A O   1 
ATOM   937  C  CB  . ASP A 1 135 ? 13.145 12.656 4.574   1.00 26.59  ? 830  ASP A CB  1 
ATOM   938  C  CG  . ASP A 1 135 ? 13.066 11.383 5.423   1.00 30.95  ? 830  ASP A CG  1 
ATOM   939  O  OD1 . ASP A 1 135 ? 12.190 11.320 6.314   1.00 38.16  ? 830  ASP A OD1 1 
ATOM   940  O  OD2 . ASP A 1 135 ? 13.853 10.451 5.172   1.00 36.10  ? 830  ASP A OD2 1 
ATOM   941  N  N   . ARG A 1 136 ? 14.727 15.037 2.932   1.00 25.31  ? 831  ARG A N   1 
ATOM   942  C  CA  . ARG A 1 136 ? 14.700 16.046 1.866   1.00 24.96  ? 831  ARG A CA  1 
ATOM   943  C  C   . ARG A 1 136 ? 16.030 16.097 1.131   1.00 25.85  ? 831  ARG A C   1 
ATOM   944  O  O   . ARG A 1 136 ? 16.212 16.944 0.275   1.00 29.42  ? 831  ARG A O   1 
ATOM   945  C  CB  . ARG A 1 136 ? 14.422 17.434 2.453   1.00 24.03  ? 831  ARG A CB  1 
ATOM   946  C  CG  . ARG A 1 136 ? 13.058 17.640 3.099   1.00 27.26  ? 831  ARG A CG  1 
ATOM   947  C  CD  . ARG A 1 136 ? 11.946 17.778 2.091   1.00 34.58  ? 831  ARG A CD  1 
ATOM   948  N  NE  . ARG A 1 136 ? 11.521 16.501 1.514   1.00 31.48  ? 831  ARG A NE  1 
ATOM   949  C  CZ  . ARG A 1 136 ? 10.975 15.482 2.187   1.00 38.43  ? 831  ARG A CZ  1 
ATOM   950  N  NH1 . ARG A 1 136 ? 10.602 14.400 1.522   1.00 32.67  ? 831  ARG A NH1 1 
ATOM   951  N  NH2 . ARG A 1 136 ? 10.802 15.526 3.512   1.00 35.52  ? 831  ARG A NH2 1 
ATOM   952  N  N   . ARG A 1 137 ? 16.957 15.202 1.477   1.00 24.34  ? 832  ARG A N   1 
ATOM   953  C  CA  . ARG A 1 137 ? 18.317 15.171 0.887   1.00 24.59  ? 832  ARG A CA  1 
ATOM   954  C  C   . ARG A 1 137 ? 18.997 16.533 1.019   1.00 26.62  ? 832  ARG A C   1 
ATOM   955  O  O   . ARG A 1 137 ? 19.677 16.984 0.101   1.00 34.25  ? 832  ARG A O   1 
ATOM   956  C  CB  . ARG A 1 137 ? 18.274 14.700 -0.590  1.00 28.33  ? 832  ARG A CB  1 
ATOM   957  C  CG  . ARG A 1 137 ? 17.419 13.460 -0.821  1.00 29.81  ? 832  ARG A CG  1 
ATOM   958  C  CD  . ARG A 1 137 ? 17.411 13.018 -2.291  1.00 40.75  ? 832  ARG A CD  1 
ATOM   959  N  NE  . ARG A 1 137 ? 18.760 12.750 -2.786  1.00 44.03  ? 832  ARG A NE  1 
ATOM   960  C  CZ  . ARG A 1 137 ? 19.069 12.493 -4.060  1.00 50.52  ? 832  ARG A CZ  1 
ATOM   961  N  NH1 . ARG A 1 137 ? 20.335 12.270 -4.400  1.00 45.26  ? 832  ARG A NH1 1 
ATOM   962  N  NH2 . ARG A 1 137 ? 18.125 12.456 -4.997  1.00 52.77  ? 832  ARG A NH2 1 
ATOM   963  N  N   . LEU A 1 138 ? 18.798 17.179 2.175   1.00 25.01  ? 833  LEU A N   1 
ATOM   964  C  CA  . LEU A 1 138 ? 19.351 18.490 2.447   1.00 26.12  ? 833  LEU A CA  1 
ATOM   965  C  C   . LEU A 1 138 ? 20.330 18.412 3.594   1.00 26.75  ? 833  LEU A C   1 
ATOM   966  O  O   . LEU A 1 138 ? 19.948 18.179 4.748   1.00 28.56  ? 833  LEU A O   1 
ATOM   967  C  CB  . LEU A 1 138 ? 18.216 19.449 2.813   1.00 27.45  ? 833  LEU A CB  1 
ATOM   968  C  CG  . LEU A 1 138 ? 18.404 20.973 2.779   1.00 38.10  ? 833  LEU A CG  1 
ATOM   969  C  CD1 . LEU A 1 138 ? 17.029 21.630 2.815   1.00 42.72  ? 833  LEU A CD1 1 
ATOM   970  C  CD2 . LEU A 1 138 ? 19.252 21.489 3.936   1.00 40.30  ? 833  LEU A CD2 1 
ATOM   971  N  N   . VAL A 1 139 ? 21.597 18.643 3.283   1.00 21.34  ? 834  VAL A N   1 
ATOM   972  C  CA  . VAL A 1 139 ? 22.629 18.677 4.322   1.00 20.90  ? 834  VAL A CA  1 
ATOM   973  C  C   . VAL A 1 139 ? 22.695 20.063 4.944   1.00 20.36  ? 834  VAL A C   1 
ATOM   974  O  O   . VAL A 1 139 ? 22.740 21.070 4.243   1.00 22.48  ? 834  VAL A O   1 
ATOM   975  C  CB  . VAL A 1 139 ? 23.986 18.251 3.731   1.00 20.92  ? 834  VAL A CB  1 
ATOM   976  C  CG1 . VAL A 1 139 ? 25.091 18.299 4.808   1.00 23.79  ? 834  VAL A CG1 1 
ATOM   977  C  CG2 . VAL A 1 139 ? 23.917 16.845 3.086   1.00 24.27  ? 834  VAL A CG2 1 
ATOM   978  N  N   . HIS A 1 140 ? 22.666 20.116 6.272   1.00 21.06  ? 835  HIS A N   1 
ATOM   979  C  CA  . HIS A 1 140 ? 22.552 21.408 6.979   1.00 22.53  ? 835  HIS A CA  1 
ATOM   980  C  C   . HIS A 1 140 ? 23.851 22.210 6.841   1.00 24.73  ? 835  HIS A C   1 
ATOM   981  O  O   . HIS A 1 140 ? 23.850 23.367 6.369   1.00 25.42  ? 835  HIS A O   1 
ATOM   982  C  CB  . HIS A 1 140 ? 22.202 21.162 8.458   1.00 22.17  ? 835  HIS A CB  1 
ATOM   983  C  CG  . HIS A 1 140 ? 21.853 22.409 9.210   1.00 19.15  ? 835  HIS A CG  1 
ATOM   984  N  ND1 . HIS A 1 140 ? 22.677 23.505 9.268   1.00 22.06  ? 835  HIS A ND1 1 
ATOM   985  C  CD2 . HIS A 1 140 ? 20.726 22.747 9.887   1.00 22.51  ? 835  HIS A CD2 1 
ATOM   986  C  CE1 . HIS A 1 140 ? 22.102 24.454 9.987   1.00 21.27  ? 835  HIS A CE1 1 
ATOM   987  N  NE2 . HIS A 1 140 ? 20.911 24.019 10.372  1.00 23.05  ? 835  HIS A NE2 1 
ATOM   988  N  N   . ARG A 1 141 ? 24.944 21.556 7.251   1.00 20.24  ? 836  ARG A N   1 
ATOM   989  C  CA  . ARG A 1 141 ? 26.336 22.060 7.233   1.00 22.29  ? 836  ARG A CA  1 
ATOM   990  C  C   . ARG A 1 141 ? 26.691 23.054 8.350   1.00 23.84  ? 836  ARG A C   1 
ATOM   991  O  O   . ARG A 1 141 ? 27.858 23.415 8.501   1.00 27.00  ? 836  ARG A O   1 
ATOM   992  C  CB  . ARG A 1 141 ? 26.698 22.661 5.871   1.00 25.37  ? 836  ARG A CB  1 
ATOM   993  C  CG  . ARG A 1 141 ? 26.606 21.652 4.733   1.00 26.17  ? 836  ARG A CG  1 
ATOM   994  C  CD  . ARG A 1 141 ? 27.056 22.235 3.401   1.00 34.82  ? 836  ARG A CD  1 
ATOM   995  N  NE  . ARG A 1 141 ? 26.960 21.226 2.339   1.00 34.95  ? 836  ARG A NE  1 
ATOM   996  C  CZ  . ARG A 1 141 ? 25.837 20.860 1.716   1.00 36.84  ? 836  ARG A CZ  1 
ATOM   997  N  NH1 . ARG A 1 141 ? 24.653 21.417 2.014   1.00 35.59  ? 836  ARG A NH1 1 
ATOM   998  N  NH2 . ARG A 1 141 ? 25.899 19.926 0.771   1.00 37.41  ? 836  ARG A NH2 1 
ATOM   999  N  N   . ASP A 1 142 ? 25.698 23.491 9.112   1.00 24.35  ? 837  ASP A N   1 
ATOM   1000 C  CA  . ASP A 1 142 ? 25.943 24.443 10.221  1.00 23.30  ? 837  ASP A CA  1 
ATOM   1001 C  C   . ASP A 1 142 ? 25.014 24.216 11.426  1.00 26.28  ? 837  ASP A C   1 
ATOM   1002 O  O   . ASP A 1 142 ? 24.525 25.166 12.037  1.00 24.97  ? 837  ASP A O   1 
ATOM   1003 C  CB  . ASP A 1 142 ? 25.865 25.895 9.706   1.00 25.91  ? 837  ASP A CB  1 
ATOM   1004 C  CG  . ASP A 1 142 ? 26.456 26.925 10.688  1.00 31.73  ? 837  ASP A CG  1 
ATOM   1005 O  OD1 . ASP A 1 142 ? 26.150 28.125 10.515  1.00 36.20  ? 837  ASP A OD1 1 
ATOM   1006 O  OD2 . ASP A 1 142 ? 27.221 26.561 11.609  1.00 31.16  ? 837  ASP A OD2 1 
ATOM   1007 N  N   . LEU A 1 143 ? 24.756 22.948 11.761  1.00 23.35  ? 838  LEU A N   1 
ATOM   1008 C  CA  . LEU A 1 143 ? 23.986 22.656 12.962  1.00 19.84  ? 838  LEU A CA  1 
ATOM   1009 C  C   . LEU A 1 143 ? 24.824 23.015 14.188  1.00 18.40  ? 838  LEU A C   1 
ATOM   1010 O  O   . LEU A 1 143 ? 26.022 22.699 14.282  1.00 21.25  ? 838  LEU A O   1 
ATOM   1011 C  CB  . LEU A 1 143 ? 23.515 21.189 13.032  1.00 21.43  ? 838  LEU A CB  1 
ATOM   1012 C  CG  . LEU A 1 143 ? 22.595 20.837 14.226  1.00 20.44  ? 838  LEU A CG  1 
ATOM   1013 C  CD1 . LEU A 1 143 ? 21.287 21.659 14.242  1.00 24.82  ? 838  LEU A CD1 1 
ATOM   1014 C  CD2 . LEU A 1 143 ? 22.297 19.335 14.179  1.00 22.69  ? 838  LEU A CD2 1 
ATOM   1015 N  N   . ALA A 1 144 ? 24.172 23.735 15.099  1.00 20.14  ? 839  ALA A N   1 
ATOM   1016 C  CA  . ALA A 1 144 ? 24.797 24.228 16.348  1.00 19.93  ? 839  ALA A CA  1 
ATOM   1017 C  C   . ALA A 1 144 ? 23.662 24.725 17.217  1.00 21.50  ? 839  ALA A C   1 
ATOM   1018 O  O   . ALA A 1 144 ? 22.579 25.019 16.710  1.00 22.34  ? 839  ALA A O   1 
ATOM   1019 C  CB  . ALA A 1 144 ? 25.790 25.347 16.068  1.00 23.35  ? 839  ALA A CB  1 
ATOM   1020 N  N   . ALA A 1 145 ? 23.891 24.842 18.529  1.00 21.54  ? 840  ALA A N   1 
ATOM   1021 C  CA  . ALA A 1 145 ? 22.822 25.309 19.397  1.00 21.29  ? 840  ALA A CA  1 
ATOM   1022 C  C   . ALA A 1 145 ? 22.352 26.735 19.046  1.00 21.41  ? 840  ALA A C   1 
ATOM   1023 O  O   . ALA A 1 145 ? 21.177 27.055 19.223  1.00 23.59  ? 840  ALA A O   1 
ATOM   1024 C  CB  . ALA A 1 145 ? 23.224 25.220 20.888  1.00 20.82  ? 840  ALA A CB  1 
ATOM   1025 N  N   . ARG A 1 146 ? 23.239 27.551 18.493  1.00 22.77  ? 841  ARG A N   1 
ATOM   1026 C  CA  . ARG A 1 146 ? 22.879 28.917 18.065  1.00 25.64  ? 841  ARG A CA  1 
ATOM   1027 C  C   . ARG A 1 146 ? 21.867 28.866 16.915  1.00 26.74  ? 841  ARG A C   1 
ATOM   1028 O  O   . ARG A 1 146 ? 21.116 29.830 16.687  1.00 28.04  ? 841  ARG A O   1 
ATOM   1029 C  CB  . ARG A 1 146 ? 24.137 29.696 17.637  1.00 26.22  ? 841  ARG A CB  1 
ATOM   1030 C  CG  . ARG A 1 146 ? 24.873 29.094 16.439  1.00 26.70  ? 841  ARG A CG  1 
ATOM   1031 C  CD  . ARG A 1 146 ? 26.132 29.845 15.986  1.00 37.54  ? 841  ARG A CD  1 
ATOM   1032 N  NE  . ARG A 1 146 ? 26.808 29.055 14.951  1.00 36.01  ? 841  ARG A NE  1 
ATOM   1033 C  CZ  . ARG A 1 146 ? 27.778 28.168 15.180  1.00 38.01  ? 841  ARG A CZ  1 
ATOM   1034 N  NH1 . ARG A 1 146 ? 28.250 27.968 16.405  1.00 34.57  ? 841  ARG A NH1 1 
ATOM   1035 N  NH2 . ARG A 1 146 ? 28.298 27.483 14.171  1.00 36.08  ? 841  ARG A NH2 1 
ATOM   1036 N  N   . ASN A 1 147 ? 21.866 27.744 16.196  1.00 22.80  ? 842  ASN A N   1 
ATOM   1037 C  CA  . ASN A 1 147 ? 20.986 27.554 15.034  1.00 23.96  ? 842  ASN A CA  1 
ATOM   1038 C  C   . ASN A 1 147 ? 19.765 26.685 15.333  1.00 24.70  ? 842  ASN A C   1 
ATOM   1039 O  O   . ASN A 1 147 ? 19.143 26.102 14.434  1.00 25.19  ? 842  ASN A O   1 
ATOM   1040 C  CB  . ASN A 1 147 ? 21.776 27.057 13.818  1.00 23.81  ? 842  ASN A CB  1 
ATOM   1041 C  CG  . ASN A 1 147 ? 22.702 28.118 13.258  1.00 26.72  ? 842  ASN A CG  1 
ATOM   1042 O  OD1 . ASN A 1 147 ? 22.455 29.324 13.395  1.00 27.68  ? 842  ASN A OD1 1 
ATOM   1043 N  ND2 . ASN A 1 147 ? 23.769 27.685 12.628  1.00 26.96  ? 842  ASN A ND2 1 
ATOM   1044 N  N   . VAL A 1 148 ? 19.449 26.558 16.619  1.00 22.41  ? 843  VAL A N   1 
ATOM   1045 C  CA  . VAL A 1 148 ? 18.181 25.973 17.027  1.00 18.96  ? 843  VAL A CA  1 
ATOM   1046 C  C   . VAL A 1 148 ? 17.436 27.071 17.754  1.00 22.86  ? 843  VAL A C   1 
ATOM   1047 O  O   . VAL A 1 148 ? 18.014 27.758 18.602  1.00 24.07  ? 843  VAL A O   1 
ATOM   1048 C  CB  . VAL A 1 148 ? 18.399 24.760 17.957  1.00 21.80  ? 843  VAL A CB  1 
ATOM   1049 C  CG1 . VAL A 1 148 ? 17.076 24.160 18.345  1.00 23.39  ? 843  VAL A CG1 1 
ATOM   1050 C  CG2 . VAL A 1 148 ? 19.242 23.698 17.239  1.00 22.29  ? 843  VAL A CG2 1 
ATOM   1051 N  N   . LEU A 1 149 ? 16.162 27.244 17.401  1.00 23.21  ? 844  LEU A N   1 
ATOM   1052 C  CA  . LEU A 1 149 ? 15.352 28.331 17.937  1.00 23.07  ? 844  LEU A CA  1 
ATOM   1053 C  C   . LEU A 1 149 ? 14.213 27.827 18.797  1.00 24.22  ? 844  LEU A C   1 
ATOM   1054 O  O   . LEU A 1 149 ? 13.716 26.721 18.618  1.00 24.12  ? 844  LEU A O   1 
ATOM   1055 C  CB  . LEU A 1 149 ? 14.790 29.203 16.796  1.00 25.55  ? 844  LEU A CB  1 
ATOM   1056 C  CG  . LEU A 1 149 ? 15.822 29.793 15.837  1.00 25.83  ? 844  LEU A CG  1 
ATOM   1057 C  CD1 . LEU A 1 149 ? 15.109 30.645 14.801  1.00 27.48  ? 844  LEU A CD1 1 
ATOM   1058 C  CD2 . LEU A 1 149 ? 16.924 30.621 16.555  1.00 28.40  ? 844  LEU A CD2 1 
ATOM   1059 N  N   . VAL A 1 150 ? 13.806 28.659 19.744  1.00 25.66  ? 845  VAL A N   1 
ATOM   1060 C  CA  . VAL A 1 150 ? 12.819 28.269 20.731  1.00 27.43  ? 845  VAL A CA  1 
ATOM   1061 C  C   . VAL A 1 150 ? 11.467 28.898 20.393  1.00 28.86  ? 845  VAL A C   1 
ATOM   1062 O  O   . VAL A 1 150 ? 11.292 30.113 20.517  1.00 28.80  ? 845  VAL A O   1 
ATOM   1063 C  CB  . VAL A 1 150 ? 13.315 28.683 22.148  1.00 26.35  ? 845  VAL A CB  1 
ATOM   1064 C  CG1 . VAL A 1 150 ? 12.345 28.214 23.217  1.00 26.93  ? 845  VAL A CG1 1 
ATOM   1065 C  CG2 . VAL A 1 150 ? 14.728 28.101 22.397  1.00 26.17  ? 845  VAL A CG2 1 
ATOM   1066 N  N   . LYS A 1 151 ? 10.526 28.089 19.905  1.00 26.97  ? 846  LYS A N   1 
ATOM   1067 C  CA  . LYS A 1 151 ? 9.186  28.602 19.604  1.00 31.20  ? 846  LYS A CA  1 
ATOM   1068 C  C   . LYS A 1 151 ? 8.440  28.762 20.918  1.00 32.09  ? 846  LYS A C   1 
ATOM   1069 O  O   . LYS A 1 151 ? 7.820  29.803 21.169  1.00 31.29  ? 846  LYS A O   1 
ATOM   1070 C  CB  . LYS A 1 151 ? 8.424  27.683 18.648  1.00 33.10  ? 846  LYS A CB  1 
ATOM   1071 C  CG  . LYS A 1 151 ? 7.090  28.274 18.184  1.00 38.70  ? 846  LYS A CG  1 
ATOM   1072 C  CD  . LYS A 1 151 ? 6.340  27.317 17.286  1.00 46.48  ? 846  LYS A CD  1 
ATOM   1073 C  CE  . LYS A 1 151 ? 5.048  27.948 16.783  1.00 52.70  ? 846  LYS A CE  1 
ATOM   1074 N  NZ  . LYS A 1 151 ? 4.352  27.046 15.831  1.00 59.33  ? 846  LYS A NZ  1 
ATOM   1075 N  N   . THR A 1 152 ? 8.518  27.715 21.743  1.00 31.35  ? 847  THR A N   1 
ATOM   1076 C  CA  . THR A 1 152 ? 8.147  27.762 23.157  1.00 33.15  ? 847  THR A CA  1 
ATOM   1077 C  C   . THR A 1 152 ? 9.182  26.903 23.899  1.00 31.32  ? 847  THR A C   1 
ATOM   1078 O  O   . THR A 1 152 ? 9.877  26.106 23.273  1.00 30.15  ? 847  THR A O   1 
ATOM   1079 C  CB  . THR A 1 152 ? 6.740  27.162 23.420  1.00 32.79  ? 847  THR A CB  1 
ATOM   1080 O  OG1 . THR A 1 152 ? 6.765  25.755 23.157  1.00 35.53  ? 847  THR A OG1 1 
ATOM   1081 C  CG2 . THR A 1 152 ? 5.651  27.830 22.584  1.00 40.29  ? 847  THR A CG2 1 
ATOM   1082 N  N   . PRO A 1 153 ? 9.288  27.044 25.239  1.00 33.17  ? 848  PRO A N   1 
ATOM   1083 C  CA  . PRO A 1 153 ? 10.262 26.220 25.959  1.00 33.27  ? 848  PRO A CA  1 
ATOM   1084 C  C   . PRO A 1 153 ? 10.134 24.719 25.687  1.00 33.93  ? 848  PRO A C   1 
ATOM   1085 O  O   . PRO A 1 153 ? 11.116 24.003 25.808  1.00 32.13  ? 848  PRO A O   1 
ATOM   1086 C  CB  . PRO A 1 153 ? 9.950  26.527 27.426  1.00 35.77  ? 848  PRO A CB  1 
ATOM   1087 C  CG  . PRO A 1 153 ? 9.487  27.942 27.377  1.00 35.62  ? 848  PRO A CG  1 
ATOM   1088 C  CD  . PRO A 1 153 ? 8.663  28.041 26.127  1.00 35.84  ? 848  PRO A CD  1 
ATOM   1089 N  N   . GLN A 1 154 ? 8.943  24.274 25.290  1.00 32.09  ? 849  GLN A N   1 
ATOM   1090 C  CA  . GLN A 1 154 ? 8.668  22.867 24.987  1.00 31.82  ? 849  GLN A CA  1 
ATOM   1091 C  C   . GLN A 1 154 ? 8.829  22.462 23.503  1.00 33.77  ? 849  GLN A C   1 
ATOM   1092 O  O   . GLN A 1 154 ? 8.616  21.302 23.162  1.00 35.36  ? 849  GLN A O   1 
ATOM   1093 C  CB  . GLN A 1 154 ? 7.237  22.522 25.413  1.00 36.03  ? 849  GLN A CB  1 
ATOM   1094 C  CG  . GLN A 1 154 ? 6.910  22.762 26.898  1.00 42.93  ? 849  GLN A CG  1 
ATOM   1095 C  CD  . GLN A 1 154 ? 6.543  24.212 27.236  1.00 49.54  ? 849  GLN A CD  1 
ATOM   1096 O  OE1 . GLN A 1 154 ? 5.869  24.909 26.466  1.00 47.63  ? 849  GLN A OE1 1 
ATOM   1097 N  NE2 . GLN A 1 154 ? 6.979  24.664 28.406  1.00 52.26  ? 849  GLN A NE2 1 
ATOM   1098 N  N   . HIS A 1 155 ? 9.176  23.402 22.627  1.00 31.84  ? 850  HIS A N   1 
ATOM   1099 C  CA  . HIS A 1 155 ? 9.116  23.172 21.172  1.00 30.46  ? 850  HIS A CA  1 
ATOM   1100 C  C   . HIS A 1 155 ? 10.218 23.967 20.475  1.00 29.22  ? 850  HIS A C   1 
ATOM   1101 O  O   . HIS A 1 155 ? 10.173 25.200 20.425  1.00 29.91  ? 850  HIS A O   1 
ATOM   1102 C  CB  . HIS A 1 155 ? 7.708  23.563 20.674  1.00 33.97  ? 850  HIS A CB  1 
ATOM   1103 C  CG  . HIS A 1 155 ? 7.464  23.354 19.206  1.00 37.58  ? 850  HIS A CG  1 
ATOM   1104 N  ND1 . HIS A 1 155 ? 6.265  23.687 18.607  1.00 41.50  ? 850  HIS A ND1 1 
ATOM   1105 C  CD2 . HIS A 1 155 ? 8.255  22.871 18.216  1.00 39.69  ? 850  HIS A CD2 1 
ATOM   1106 C  CE1 . HIS A 1 155 ? 6.325  23.404 17.317  1.00 45.57  ? 850  HIS A CE1 1 
ATOM   1107 N  NE2 . HIS A 1 155 ? 7.521  22.907 17.055  1.00 37.26  ? 850  HIS A NE2 1 
ATOM   1108 N  N   . VAL A 1 156 ? 11.219 23.251 19.956  1.00 26.16  ? 851  VAL A N   1 
ATOM   1109 C  CA  . VAL A 1 156 ? 12.338 23.910 19.298  1.00 25.54  ? 851  VAL A CA  1 
ATOM   1110 C  C   . VAL A 1 156 ? 12.378 23.553 17.825  1.00 25.36  ? 851  VAL A C   1 
ATOM   1111 O  O   . VAL A 1 156 ? 11.821 22.535 17.413  1.00 24.95  ? 851  VAL A O   1 
ATOM   1112 C  CB  . VAL A 1 156 ? 13.700 23.589 19.966  1.00 22.26  ? 851  VAL A CB  1 
ATOM   1113 C  CG1 . VAL A 1 156 ? 13.677 24.033 21.446  1.00 27.18  ? 851  VAL A CG1 1 
ATOM   1114 C  CG2 . VAL A 1 156 ? 14.049 22.091 19.862  1.00 24.39  ? 851  VAL A CG2 1 
ATOM   1115 N  N   . LYS A 1 157 ? 13.035 24.408 17.046  1.00 23.97  ? 852  LYS A N   1 
ATOM   1116 C  CA  . LYS A 1 157 ? 13.051 24.260 15.584  1.00 22.76  ? 852  LYS A CA  1 
ATOM   1117 C  C   . LYS A 1 157 ? 14.429 24.611 15.049  1.00 25.27  ? 852  LYS A C   1 
ATOM   1118 O  O   . LYS A 1 157 ? 15.053 25.570 15.487  1.00 25.98  ? 852  LYS A O   1 
ATOM   1119 C  CB  . LYS A 1 157 ? 12.000 25.173 14.933  1.00 25.90  ? 852  LYS A CB  1 
ATOM   1120 C  CG  . LYS A 1 157 ? 10.567 25.000 15.409  1.00 30.03  ? 852  LYS A CG  1 
ATOM   1121 C  CD  . LYS A 1 157 ? 9.648  25.961 14.668  1.00 31.38  ? 852  LYS A CD  1 
ATOM   1122 C  CE  . LYS A 1 157 ? 9.301  25.454 13.276  1.00 38.73  ? 852  LYS A CE  1 
ATOM   1123 N  NZ  . LYS A 1 157 ? 8.421  26.427 12.547  1.00 43.57  ? 852  LYS A NZ  1 
ATOM   1124 N  N   . ILE A 1 158 ? 14.905 23.823 14.085  1.00 22.23  ? 853  ILE A N   1 
ATOM   1125 C  CA  . ILE A 1 158 ? 16.201 24.060 13.474  1.00 21.93  ? 853  ILE A CA  1 
ATOM   1126 C  C   . ILE A 1 158 ? 16.129 25.150 12.409  1.00 22.48  ? 853  ILE A C   1 
ATOM   1127 O  O   . ILE A 1 158 ? 15.148 25.224 11.652  1.00 23.65  ? 853  ILE A O   1 
ATOM   1128 C  CB  . ILE A 1 158 ? 16.682 22.752 12.808  1.00 20.42  ? 853  ILE A CB  1 
ATOM   1129 C  CG1 . ILE A 1 158 ? 16.974 21.696 13.877  1.00 21.96  ? 853  ILE A CG1 1 
ATOM   1130 C  CG2 . ILE A 1 158 ? 17.925 23.006 11.962  1.00 24.02  ? 853  ILE A CG2 1 
ATOM   1131 C  CD1 . ILE A 1 158 ? 16.758 20.293 13.323  1.00 24.52  ? 853  ILE A CD1 1 
ATOM   1132 N  N   . THR A 1 159 ? 17.148 25.997 12.332  1.00 20.57  ? 854  THR A N   1 
ATOM   1133 C  CA  . THR A 1 159 ? 17.188 27.013 11.288  1.00 20.53  ? 854  THR A CA  1 
ATOM   1134 C  C   . THR A 1 159 ? 18.549 27.084 10.624  1.00 24.35  ? 854  THR A C   1 
ATOM   1135 O  O   . THR A 1 159 ? 19.454 26.334 10.991  1.00 22.82  ? 854  THR A O   1 
ATOM   1136 C  CB  . THR A 1 159 ? 16.744 28.402 11.840  1.00 24.63  ? 854  THR A CB  1 
ATOM   1137 O  OG1 . THR A 1 159 ? 16.508 29.301 10.750  1.00 26.97  ? 854  THR A OG1 1 
ATOM   1138 C  CG2 . THR A 1 159 ? 17.798 28.992 12.797  1.00 25.10  ? 854  THR A CG2 1 
ATOM   1139 N  N   . ASP A 1 160 ? 18.657 27.960 9.627   1.00 25.08  ? 855  ASP A N   1 
ATOM   1140 C  CA  . ASP A 1 160 ? 19.924 28.276 8.973   1.00 28.87  ? 855  ASP A CA  1 
ATOM   1141 C  C   . ASP A 1 160 ? 20.529 27.131 8.178   1.00 30.79  ? 855  ASP A C   1 
ATOM   1142 O  O   . ASP A 1 160 ? 21.735 27.114 7.960   1.00 32.23  ? 855  ASP A O   1 
ATOM   1143 C  CB  . ASP A 1 160 ? 20.951 28.786 9.991   1.00 29.95  ? 855  ASP A CB  1 
ATOM   1144 C  CG  . ASP A 1 160 ? 21.750 29.950 9.462   1.00 39.28  ? 855  ASP A CG  1 
ATOM   1145 O  OD1 . ASP A 1 160 ? 21.155 30.802 8.767   1.00 38.06  ? 855  ASP A OD1 1 
ATOM   1146 O  OD2 . ASP A 1 160 ? 22.965 30.021 9.753   1.00 45.79  ? 855  ASP A OD2 1 
ATOM   1147 N  N   . PHE A 1 161 ? 19.707 26.171 7.776   1.00 29.92  ? 856  PHE A N   1 
ATOM   1148 C  CA  . PHE A 1 161 ? 20.191 25.074 6.927   1.00 29.29  ? 856  PHE A CA  1 
ATOM   1149 C  C   . PHE A 1 161 ? 20.343 25.557 5.505   1.00 34.42  ? 856  PHE A C   1 
ATOM   1150 O  O   . PHE A 1 161 ? 19.585 26.420 5.030   1.00 31.52  ? 856  PHE A O   1 
ATOM   1151 C  CB  . PHE A 1 161 ? 19.254 23.877 6.959   1.00 29.00  ? 856  PHE A CB  1 
ATOM   1152 C  CG  . PHE A 1 161 ? 17.809 24.234 6.735   1.00 29.25  ? 856  PHE A CG  1 
ATOM   1153 C  CD1 . PHE A 1 161 ? 17.010 24.605 7.813   1.00 34.95  ? 856  PHE A CD1 1 
ATOM   1154 C  CD2 . PHE A 1 161 ? 17.251 24.200 5.464   1.00 33.17  ? 856  PHE A CD2 1 
ATOM   1155 C  CE1 . PHE A 1 161 ? 15.690 24.933 7.621   1.00 33.55  ? 856  PHE A CE1 1 
ATOM   1156 C  CE2 . PHE A 1 161 ? 15.910 24.534 5.270   1.00 38.78  ? 856  PHE A CE2 1 
ATOM   1157 C  CZ  . PHE A 1 161 ? 15.141 24.903 6.355   1.00 35.44  ? 856  PHE A CZ  1 
ATOM   1158 N  N   . GLY A 1 162 ? 21.343 24.987 4.843   1.00 36.07  ? 857  GLY A N   1 
ATOM   1159 C  CA  . GLY A 1 162 ? 21.578 25.228 3.435   1.00 38.15  ? 857  GLY A CA  1 
ATOM   1160 C  C   . GLY A 1 162 ? 22.150 26.583 3.078   1.00 36.87  ? 857  GLY A C   1 
ATOM   1161 O  O   . GLY A 1 162 ? 22.265 26.887 1.904   1.00 37.45  ? 857  GLY A O   1 
ATOM   1162 N  N   . LEU A 1 163 ? 22.486 27.407 4.075   1.00 34.72  ? 858  LEU A N   1 
ATOM   1163 C  CA  . LEU A 1 163 ? 23.160 28.668 3.809   1.00 37.10  ? 858  LEU A CA  1 
ATOM   1164 C  C   . LEU A 1 163 ? 24.610 28.384 3.449   1.00 39.79  ? 858  LEU A C   1 
ATOM   1165 O  O   . LEU A 1 163 ? 25.136 28.945 2.497   1.00 39.46  ? 858  LEU A O   1 
ATOM   1166 C  CB  . LEU A 1 163 ? 23.114 29.610 5.019   1.00 37.69  ? 858  LEU A CB  1 
ATOM   1167 C  CG  . LEU A 1 163 ? 22.084 30.736 5.093   1.00 46.64  ? 858  LEU A CG  1 
ATOM   1168 C  CD1 . LEU A 1 163 ? 22.468 31.672 6.220   1.00 47.65  ? 858  LEU A CD1 1 
ATOM   1169 C  CD2 . LEU A 1 163 ? 21.996 31.509 3.796   1.00 46.58  ? 858  LEU A CD2 1 
ATOM   1170 N  N   . ALA A 1 164 ? 25.236 27.494 4.222   1.00 40.60  ? 859  ALA A N   1 
ATOM   1171 C  CA  . ALA A 1 164 ? 26.632 27.117 4.023   1.00 42.30  ? 859  ALA A CA  1 
ATOM   1172 C  C   . ALA A 1 164 ? 26.918 26.757 2.563   1.00 43.61  ? 859  ALA A C   1 
ATOM   1173 O  O   . ALA A 1 164 ? 27.863 27.278 1.972   1.00 41.15  ? 859  ALA A O   1 
ATOM   1174 C  CB  . ALA A 1 164 ? 27.001 25.979 4.950   1.00 42.38  ? 859  ALA A CB  1 
ATOM   1175 N  N   . LYS A 1 165 ? 26.075 25.904 1.979   1.00 44.78  ? 860  LYS A N   1 
ATOM   1176 C  CA  . LYS A 1 165 ? 26.239 25.498 0.581   1.00 47.44  ? 860  LYS A CA  1 
ATOM   1177 C  C   . LYS A 1 165 ? 25.841 26.599 -0.401  1.00 50.54  ? 860  LYS A C   1 
ATOM   1178 O  O   . LYS A 1 165 ? 26.454 26.726 -1.463  1.00 52.25  ? 860  LYS A O   1 
ATOM   1179 C  CB  . LYS A 1 165 ? 25.451 24.224 0.275   1.00 49.35  ? 860  LYS A CB  1 
ATOM   1180 C  CG  . LYS A 1 165 ? 25.857 23.549 -1.038  1.00 50.44  ? 860  LYS A CG  1 
ATOM   1181 C  CD  . LYS A 1 165 ? 24.768 22.621 -1.533  1.00 52.08  ? 860  LYS A CD  1 
ATOM   1182 C  CE  . LYS A 1 165 ? 25.176 21.934 -2.822  1.00 53.62  ? 860  LYS A CE  1 
ATOM   1183 N  NZ  . LYS A 1 165 ? 24.115 20.995 -3.273  1.00 52.96  ? 860  LYS A NZ  1 
ATOM   1184 N  N   . LEU A 1 166 ? 24.812 27.378 -0.062  1.00 50.17  ? 861  LEU A N   1 
ATOM   1185 C  CA  . LEU A 1 166 ? 24.380 28.484 -0.925  1.00 54.38  ? 861  LEU A CA  1 
ATOM   1186 C  C   . LEU A 1 166 ? 25.480 29.538 -1.056  1.00 56.31  ? 861  LEU A C   1 
ATOM   1187 O  O   . LEU A 1 166 ? 25.650 30.138 -2.122  1.00 58.93  ? 861  LEU A O   1 
ATOM   1188 C  CB  . LEU A 1 166 ? 23.068 29.105 -0.418  1.00 53.97  ? 861  LEU A CB  1 
ATOM   1189 C  CG  . LEU A 1 166 ? 22.481 30.383 -1.035  1.00 56.57  ? 861  LEU A CG  1 
ATOM   1190 C  CD1 . LEU A 1 166 ? 22.329 30.293 -2.552  1.00 57.02  ? 861  LEU A CD1 1 
ATOM   1191 C  CD2 . LEU A 1 166 ? 21.139 30.701 -0.382  1.00 55.98  ? 861  LEU A CD2 1 
ATOM   1192 N  N   . LEU A 1 167 ? 26.224 29.743 0.028   1.00 57.23  ? 862  LEU A N   1 
ATOM   1193 C  CA  . LEU A 1 167 ? 27.365 30.663 0.046   1.00 59.60  ? 862  LEU A CA  1 
ATOM   1194 C  C   . LEU A 1 167 ? 28.574 30.115 -0.715  1.00 61.01  ? 862  LEU A C   1 
ATOM   1195 O  O   . LEU A 1 167 ? 29.335 30.881 -1.314  1.00 63.34  ? 862  LEU A O   1 
ATOM   1196 C  CB  . LEU A 1 167 ? 27.757 31.006 1.487   1.00 58.67  ? 862  LEU A CB  1 
ATOM   1197 C  CG  . LEU A 1 167 ? 26.901 32.076 2.169   1.00 58.72  ? 862  LEU A CG  1 
ATOM   1198 C  CD1 . LEU A 1 167 ? 26.839 31.832 3.658   1.00 54.34  ? 862  LEU A CD1 1 
ATOM   1199 C  CD2 . LEU A 1 167 ? 27.428 33.478 1.866   1.00 59.26  ? 862  LEU A CD2 1 
ATOM   1200 N  N   . GLY A 1 168 ? 28.746 28.793 -0.679  1.00 60.62  ? 863  GLY A N   1 
ATOM   1201 C  CA  . GLY A 1 168 ? 29.835 28.122 -1.397  1.00 59.23  ? 863  GLY A CA  1 
ATOM   1202 C  C   . GLY A 1 168 ? 30.930 27.565 -0.502  1.00 58.06  ? 863  GLY A C   1 
ATOM   1203 O  O   . GLY A 1 168 ? 32.108 27.602 -0.868  1.00 58.66  ? 863  GLY A O   1 
ATOM   1204 N  N   . ALA A 1 169 ? 30.542 27.035 0.661   1.00 55.46  ? 864  ALA A N   1 
ATOM   1205 C  CA  . ALA A 1 169 ? 31.491 26.468 1.628   1.00 52.94  ? 864  ALA A CA  1 
ATOM   1206 C  C   . ALA A 1 169 ? 32.049 25.092 1.225   1.00 52.43  ? 864  ALA A C   1 
ATOM   1207 O  O   . ALA A 1 169 ? 32.949 24.563 1.882   1.00 51.17  ? 864  ALA A O   1 
ATOM   1208 C  CB  . ALA A 1 169 ? 30.868 26.410 3.023   1.00 54.64  ? 864  ALA A CB  1 
ATOM   1209 N  N   . GLU A 1 170 ? 31.514 24.516 0.149   1.00 50.01  ? 865  GLU A N   1 
ATOM   1210 C  CA  . GLU A 1 170 ? 32.061 23.274 -0.405  1.00 50.39  ? 865  GLU A CA  1 
ATOM   1211 C  C   . GLU A 1 170 ? 33.163 23.536 -1.432  1.00 50.91  ? 865  GLU A C   1 
ATOM   1212 O  O   . GLU A 1 170 ? 33.741 22.600 -2.004  1.00 51.87  ? 865  GLU A O   1 
ATOM   1213 C  CB  . GLU A 1 170 ? 30.950 22.426 -1.024  1.00 49.30  ? 865  GLU A CB  1 
ATOM   1214 C  CG  . GLU A 1 170 ? 30.073 21.752 0.026   1.00 53.00  ? 865  GLU A CG  1 
ATOM   1215 C  CD  . GLU A 1 170 ? 29.123 20.728 -0.576  1.00 54.39  ? 865  GLU A CD  1 
ATOM   1216 O  OE1 . GLU A 1 170 ? 28.514 19.978 0.213   1.00 52.31  ? 865  GLU A OE1 1 
ATOM   1217 O  OE2 . GLU A 1 170 ? 28.990 20.665 -1.820  1.00 54.98  ? 865  GLU A OE2 1 
ATOM   1218 N  N   . GLU A 1 171 ? 33.452 24.812 -1.666  1.00 50.12  ? 866  GLU A N   1 
ATOM   1219 C  CA  . GLU A 1 171 ? 34.389 25.204 -2.708  1.00 51.82  ? 866  GLU A CA  1 
ATOM   1220 C  C   . GLU A 1 171 ? 35.556 26.023 -2.167  1.00 53.42  ? 866  GLU A C   1 
ATOM   1221 O  O   . GLU A 1 171 ? 35.527 26.483 -1.020  1.00 51.83  ? 866  GLU A O   1 
ATOM   1222 C  CB  . GLU A 1 171 ? 33.661 25.970 -3.821  1.00 52.90  ? 866  GLU A CB  1 
ATOM   1223 C  CG  . GLU A 1 171 ? 32.848 25.088 -4.779  1.00 56.66  ? 866  GLU A CG  1 
ATOM   1224 C  CD  . GLU A 1 171 ? 31.511 24.641 -4.203  1.00 60.25  ? 866  GLU A CD  1 
ATOM   1225 O  OE1 . GLU A 1 171 ? 31.218 23.427 -4.252  1.00 64.28  ? 866  GLU A OE1 1 
ATOM   1226 O  OE2 . GLU A 1 171 ? 30.752 25.499 -3.701  1.00 61.19  ? 866  GLU A OE2 1 
ATOM   1227 N  N   . LYS A 1 172 ? 36.571 26.185 -3.019  1.00 55.64  ? 867  LYS A N   1 
ATOM   1228 C  CA  . LYS A 1 172 ? 37.774 26.997 -2.771  1.00 61.05  ? 867  LYS A CA  1 
ATOM   1229 C  C   . LYS A 1 172 ? 38.760 26.353 -1.805  1.00 62.26  ? 867  LYS A C   1 
ATOM   1230 O  O   . LYS A 1 172 ? 39.914 26.108 -2.167  1.00 64.41  ? 867  LYS A O   1 
ATOM   1231 C  CB  . LYS A 1 172 ? 37.434 28.436 -2.344  1.00 60.96  ? 867  LYS A CB  1 
ATOM   1232 C  CG  . LYS A 1 172 ? 36.697 29.235 -3.414  1.00 61.36  ? 867  LYS A CG  1 
ATOM   1233 C  CD  . LYS A 1 172 ? 36.880 30.730 -3.224  1.00 65.16  ? 867  LYS A CD  1 
ATOM   1234 C  CE  . LYS A 1 172 ? 36.359 31.496 -4.431  1.00 66.55  ? 867  LYS A CE  1 
ATOM   1235 N  NZ  . LYS A 1 172 ? 36.828 32.911 -4.440  1.00 69.99  ? 867  LYS A NZ  1 
ATOM   1236 N  N   . LYS A 1 180 ? 34.259 32.306 6.477   1.00 57.03  ? 875  LYS A N   1 
ATOM   1237 C  CA  . LYS A 1 180 ? 34.554 31.684 7.767   1.00 55.95  ? 875  LYS A CA  1 
ATOM   1238 C  C   . LYS A 1 180 ? 33.757 30.397 7.962   1.00 53.41  ? 875  LYS A C   1 
ATOM   1239 O  O   . LYS A 1 180 ? 32.585 30.311 7.563   1.00 52.48  ? 875  LYS A O   1 
ATOM   1240 C  CB  . LYS A 1 180 ? 34.277 32.663 8.918   1.00 57.47  ? 875  LYS A CB  1 
ATOM   1241 C  CG  . LYS A 1 180 ? 34.844 32.223 10.262  1.00 60.07  ? 875  LYS A CG  1 
ATOM   1242 C  CD  . LYS A 1 180 ? 34.373 33.113 11.398  1.00 68.33  ? 875  LYS A CD  1 
ATOM   1243 C  CE  . LYS A 1 180 ? 34.805 32.553 12.747  1.00 69.63  ? 875  LYS A CE  1 
ATOM   1244 N  NZ  . LYS A 1 180 ? 34.416 33.447 13.873  1.00 73.26  ? 875  LYS A NZ  1 
ATOM   1245 N  N   . VAL A 1 181 ? 34.399 29.408 8.584   1.00 49.24  ? 876  VAL A N   1 
ATOM   1246 C  CA  . VAL A 1 181 ? 33.772 28.122 8.875   1.00 45.48  ? 876  VAL A CA  1 
ATOM   1247 C  C   . VAL A 1 181 ? 33.689 27.833 10.388  1.00 39.87  ? 876  VAL A C   1 
ATOM   1248 O  O   . VAL A 1 181 ? 34.576 28.214 11.151  1.00 39.15  ? 876  VAL A O   1 
ATOM   1249 C  CB  . VAL A 1 181 ? 34.448 26.929 8.116   1.00 43.89  ? 876  VAL A CB  1 
ATOM   1250 C  CG1 . VAL A 1 181 ? 34.095 26.961 6.633   1.00 50.84  ? 876  VAL A CG1 1 
ATOM   1251 C  CG2 . VAL A 1 181 ? 35.959 26.914 8.323   1.00 50.76  ? 876  VAL A CG2 1 
ATOM   1252 N  N   . PRO A 1 182 ? 32.603 27.174 10.820  1.00 37.20  ? 877  PRO A N   1 
ATOM   1253 C  CA  . PRO A 1 182 ? 32.440 26.802 12.236  1.00 34.72  ? 877  PRO A CA  1 
ATOM   1254 C  C   . PRO A 1 182 ? 33.242 25.550 12.586  1.00 31.04  ? 877  PRO A C   1 
ATOM   1255 O  O   . PRO A 1 182 ? 32.661 24.492 12.847  1.00 29.29  ? 877  PRO A O   1 
ATOM   1256 C  CB  . PRO A 1 182 ? 30.943 26.525 12.338  1.00 33.70  ? 877  PRO A CB  1 
ATOM   1257 C  CG  . PRO A 1 182 ? 30.585 26.003 10.966  1.00 38.14  ? 877  PRO A CG  1 
ATOM   1258 C  CD  . PRO A 1 182 ? 31.425 26.802 10.014  1.00 39.00  ? 877  PRO A CD  1 
ATOM   1259 N  N   . ILE A 1 183 ? 34.565 25.688 12.612  1.00 27.67  ? 878  ILE A N   1 
ATOM   1260 C  CA  . ILE A 1 183 ? 35.494 24.547 12.744  1.00 29.58  ? 878  ILE A CA  1 
ATOM   1261 C  C   . ILE A 1 183 ? 35.154 23.648 13.933  1.00 25.54  ? 878  ILE A C   1 
ATOM   1262 O  O   . ILE A 1 183 ? 35.170 22.420 13.828  1.00 24.87  ? 878  ILE A O   1 
ATOM   1263 C  CB  . ILE A 1 183 ? 36.975 25.015 12.861  1.00 31.68  ? 878  ILE A CB  1 
ATOM   1264 C  CG1 . ILE A 1 183 ? 37.502 25.595 11.534  1.00 35.49  ? 878  ILE A CG1 1 
ATOM   1265 C  CG2 . ILE A 1 183 ? 37.892 23.900 13.388  1.00 33.39  ? 878  ILE A CG2 1 
ATOM   1266 C  CD1 . ILE A 1 183 ? 37.865 24.565 10.451  1.00 40.17  ? 878  ILE A CD1 1 
ATOM   1267 N  N   . LYS A 1 184 ? 34.827 24.267 15.065  1.00 26.02  ? 879  LYS A N   1 
ATOM   1268 C  CA  . LYS A 1 184 ? 34.602 23.490 16.289  1.00 23.32  ? 879  LYS A CA  1 
ATOM   1269 C  C   . LYS A 1 184 ? 33.305 22.661 16.317  1.00 25.86  ? 879  LYS A C   1 
ATOM   1270 O  O   . LYS A 1 184 ? 33.090 21.874 17.259  1.00 25.36  ? 879  LYS A O   1 
ATOM   1271 C  CB  . LYS A 1 184 ? 34.738 24.409 17.514  1.00 22.58  ? 879  LYS A CB  1 
ATOM   1272 C  CG  . LYS A 1 184 ? 36.168 24.896 17.698  1.00 25.98  ? 879  LYS A CG  1 
ATOM   1273 C  CD  . LYS A 1 184 ? 36.283 26.007 18.769  1.00 30.55  ? 879  LYS A CD  1 
ATOM   1274 C  CE  . LYS A 1 184 ? 37.734 26.317 19.020  1.00 36.48  ? 879  LYS A CE  1 
ATOM   1275 N  NZ  . LYS A 1 184 ? 37.935 27.297 20.140  1.00 37.85  ? 879  LYS A NZ  1 
ATOM   1276 N  N   . TRP A 1 185 ? 32.459 22.801 15.286  1.00 22.54  ? 880  TRP A N   1 
ATOM   1277 C  CA  . TRP A 1 185 ? 31.268 21.976 15.125  1.00 22.38  ? 880  TRP A CA  1 
ATOM   1278 C  C   . TRP A 1 185 ? 31.410 20.997 13.961  1.00 22.56  ? 880  TRP A C   1 
ATOM   1279 O  O   . TRP A 1 185 ? 30.550 20.153 13.767  1.00 23.16  ? 880  TRP A O   1 
ATOM   1280 C  CB  . TRP A 1 185 ? 30.040 22.848 14.875  1.00 23.02  ? 880  TRP A CB  1 
ATOM   1281 C  CG  . TRP A 1 185 ? 29.496 23.466 16.124  1.00 22.80  ? 880  TRP A CG  1 
ATOM   1282 C  CD1 . TRP A 1 185 ? 28.402 23.056 16.818  1.00 22.18  ? 880  TRP A CD1 1 
ATOM   1283 C  CD2 . TRP A 1 185 ? 30.007 24.621 16.797  1.00 26.65  ? 880  TRP A CD2 1 
ATOM   1284 N  NE1 . TRP A 1 185 ? 28.217 23.873 17.930  1.00 21.92  ? 880  TRP A NE1 1 
ATOM   1285 C  CE2 . TRP A 1 185 ? 29.189 24.840 17.929  1.00 24.15  ? 880  TRP A CE2 1 
ATOM   1286 C  CE3 . TRP A 1 185 ? 31.096 25.483 16.563  1.00 23.91  ? 880  TRP A CE3 1 
ATOM   1287 C  CZ2 . TRP A 1 185 ? 29.403 25.907 18.820  1.00 25.24  ? 880  TRP A CZ2 1 
ATOM   1288 C  CZ3 . TRP A 1 185 ? 31.331 26.538 17.463  1.00 28.08  ? 880  TRP A CZ3 1 
ATOM   1289 C  CH2 . TRP A 1 185 ? 30.478 26.731 18.579  1.00 28.73  ? 880  TRP A CH2 1 
ATOM   1290 N  N   . MET A 1 186 ? 32.500 21.098 13.203  1.00 20.83  ? 881  MET A N   1 
ATOM   1291 C  CA  . MET A 1 186 ? 32.604 20.357 11.949  1.00 20.55  ? 881  MET A CA  1 
ATOM   1292 C  C   . MET A 1 186 ? 33.174 18.968 12.131  1.00 23.63  ? 881  MET A C   1 
ATOM   1293 O  O   . MET A 1 186 ? 34.128 18.765 12.880  1.00 22.46  ? 881  MET A O   1 
ATOM   1294 C  CB  . MET A 1 186 ? 33.474 21.130 10.954  1.00 23.74  ? 881  MET A CB  1 
ATOM   1295 C  CG  . MET A 1 186 ? 32.722 22.305 10.309  1.00 27.13  ? 881  MET A CG  1 
ATOM   1296 S  SD  . MET A 1 186 ? 33.824 23.496 9.558   1.00 30.15  ? 881  MET A SD  1 
ATOM   1297 C  CE  . MET A 1 186 ? 34.466 22.521 8.194   1.00 30.49  ? 881  MET A CE  1 
ATOM   1298 N  N   . ALA A 1 187 ? 32.663 18.013 11.363  1.00 22.70  ? 882  ALA A N   1 
ATOM   1299 C  CA  . ALA A 1 187 ? 33.246 16.699 11.321  1.00 24.15  ? 882  ALA A CA  1 
ATOM   1300 C  C   . ALA A 1 187 ? 34.655 16.782 10.711  1.00 24.25  ? 882  ALA A C   1 
ATOM   1301 O  O   . ALA A 1 187 ? 34.921 17.641 9.875   1.00 24.71  ? 882  ALA A O   1 
ATOM   1302 C  CB  . ALA A 1 187 ? 32.320 15.739 10.516  1.00 22.14  ? 882  ALA A CB  1 
ATOM   1303 N  N   . LEU A 1 188 ? 35.547 15.878 11.099  1.00 23.25  ? 883  LEU A N   1 
ATOM   1304 C  CA  . LEU A 1 188 ? 36.934 15.935 10.665  1.00 24.45  ? 883  LEU A CA  1 
ATOM   1305 C  C   . LEU A 1 188 ? 37.062 15.899 9.128   1.00 24.22  ? 883  LEU A C   1 
ATOM   1306 O  O   . LEU A 1 188 ? 37.979 16.534 8.560   1.00 25.35  ? 883  LEU A O   1 
ATOM   1307 C  CB  . LEU A 1 188 ? 37.711 14.781 11.292  1.00 25.30  ? 883  LEU A CB  1 
ATOM   1308 C  CG  . LEU A 1 188 ? 39.224 14.739 11.010  1.00 26.74  ? 883  LEU A CG  1 
ATOM   1309 C  CD1 . LEU A 1 188 ? 39.980 16.048 11.390  1.00 26.83  ? 883  LEU A CD1 1 
ATOM   1310 C  CD2 . LEU A 1 188 ? 39.939 13.528 11.628  1.00 34.55  ? 883  LEU A CD2 1 
ATOM   1311 N  N   . GLU A 1 189 ? 36.212 15.103 8.477   1.00 23.93  ? 884  GLU A N   1 
ATOM   1312 C  CA  . GLU A 1 189 ? 36.203 15.007 7.007   1.00 23.53  ? 884  GLU A CA  1 
ATOM   1313 C  C   . GLU A 1 189 ? 35.768 16.310 6.338   1.00 25.52  ? 884  GLU A C   1 
ATOM   1314 O  O   . GLU A 1 189 ? 36.179 16.588 5.201   1.00 24.94  ? 884  GLU A O   1 
ATOM   1315 C  CB  . GLU A 1 189 ? 35.375 13.802 6.481   1.00 20.87  ? 884  GLU A CB  1 
ATOM   1316 C  CG  . GLU A 1 189 ? 33.860 13.917 6.619   1.00 20.80  ? 884  GLU A CG  1 
ATOM   1317 C  CD  . GLU A 1 189 ? 33.350 13.440 7.945   1.00 22.39  ? 884  GLU A CD  1 
ATOM   1318 O  OE1 . GLU A 1 189 ? 34.119 13.217 8.906   1.00 24.54  ? 884  GLU A OE1 1 
ATOM   1319 O  OE2 . GLU A 1 189 ? 32.104 13.263 8.015   1.00 21.91  ? 884  GLU A OE2 1 
ATOM   1320 N  N   . SER A 1 190 ? 34.953 17.099 7.043   1.00 21.40  ? 885  SER A N   1 
ATOM   1321 C  CA  . SER A 1 190 ? 34.513 18.425 6.550   1.00 22.81  ? 885  SER A CA  1 
ATOM   1322 C  C   . SER A 1 190 ? 35.701 19.392 6.646   1.00 23.96  ? 885  SER A C   1 
ATOM   1323 O  O   . SER A 1 190 ? 35.971 20.176 5.721   1.00 24.68  ? 885  SER A O   1 
ATOM   1324 C  CB  . SER A 1 190 ? 33.303 18.951 7.348   1.00 23.65  ? 885  SER A CB  1 
ATOM   1325 O  OG  . SER A 1 190 ? 32.195 18.086 7.289   1.00 23.25  ? 885  SER A OG  1 
ATOM   1326 N  N   . ILE A 1 191 ? 36.411 19.351 7.777   1.00 23.24  ? 886  ILE A N   1 
ATOM   1327 C  CA  . ILE A 1 191 ? 37.632 20.154 7.940   1.00 25.46  ? 886  ILE A CA  1 
ATOM   1328 C  C   . ILE A 1 191 ? 38.707 19.829 6.896   1.00 28.29  ? 886  ILE A C   1 
ATOM   1329 O  O   . ILE A 1 191 ? 39.213 20.733 6.228   1.00 27.79  ? 886  ILE A O   1 
ATOM   1330 C  CB  . ILE A 1 191 ? 38.244 20.014 9.353   1.00 24.25  ? 886  ILE A CB  1 
ATOM   1331 C  CG1 . ILE A 1 191 ? 37.242 20.426 10.442  1.00 24.17  ? 886  ILE A CG1 1 
ATOM   1332 C  CG2 . ILE A 1 191 ? 39.547 20.813 9.451   1.00 27.96  ? 886  ILE A CG2 1 
ATOM   1333 C  CD1 . ILE A 1 191 ? 37.680 20.016 11.871  1.00 21.00  ? 886  ILE A CD1 1 
ATOM   1334 N  N   . LEU A 1 192 ? 39.027 18.544 6.746   1.00 27.39  ? 887  LEU A N   1 
ATOM   1335 C  CA  . LEU A 1 192 ? 40.174 18.133 5.929   1.00 25.12  ? 887  LEU A CA  1 
ATOM   1336 C  C   . LEU A 1 192 ? 39.869 18.161 4.442   1.00 24.23  ? 887  LEU A C   1 
ATOM   1337 O  O   . LEU A 1 192 ? 40.727 18.444 3.625   1.00 27.68  ? 887  LEU A O   1 
ATOM   1338 C  CB  . LEU A 1 192 ? 40.654 16.737 6.329   1.00 28.56  ? 887  LEU A CB  1 
ATOM   1339 C  CG  . LEU A 1 192 ? 41.139 16.549 7.779   1.00 27.97  ? 887  LEU A CG  1 
ATOM   1340 C  CD1 . LEU A 1 192 ? 41.627 15.120 7.975   1.00 32.04  ? 887  LEU A CD1 1 
ATOM   1341 C  CD2 . LEU A 1 192 ? 42.214 17.536 8.125   1.00 30.20  ? 887  LEU A CD2 1 
ATOM   1342 N  N   . HIS A 1 193 ? 38.635 17.852 4.086   1.00 23.03  ? 888  HIS A N   1 
ATOM   1343 C  CA  . HIS A 1 193 ? 38.349 17.617 2.655   1.00 23.52  ? 888  HIS A CA  1 
ATOM   1344 C  C   . HIS A 1 193 ? 37.053 18.261 2.171   1.00 25.75  ? 888  HIS A C   1 
ATOM   1345 O  O   . HIS A 1 193 ? 36.588 17.995 1.059   1.00 24.80  ? 888  HIS A O   1 
ATOM   1346 C  CB  . HIS A 1 193 ? 38.344 16.103 2.359   1.00 23.15  ? 888  HIS A CB  1 
ATOM   1347 C  CG  . HIS A 1 193 ? 39.682 15.458 2.512   1.00 25.48  ? 888  HIS A CG  1 
ATOM   1348 N  ND1 . HIS A 1 193 ? 40.733 15.732 1.672   1.00 29.06  ? 888  HIS A ND1 1 
ATOM   1349 C  CD2 . HIS A 1 193 ? 40.126 14.543 3.402   1.00 24.80  ? 888  HIS A CD2 1 
ATOM   1350 C  CE1 . HIS A 1 193 ? 41.786 15.027 2.051   1.00 28.65  ? 888  HIS A CE1 1 
ATOM   1351 N  NE2 . HIS A 1 193 ? 41.445 14.305 3.107   1.00 26.99  ? 888  HIS A NE2 1 
ATOM   1352 N  N   . ARG A 1 194 ? 36.479 19.138 2.991   1.00 25.42  ? 889  ARG A N   1 
ATOM   1353 C  CA  . ARG A 1 194 ? 35.206 19.803 2.656   1.00 25.46  ? 889  ARG A CA  1 
ATOM   1354 C  C   . ARG A 1 194 ? 34.097 18.830 2.227   1.00 24.52  ? 889  ARG A C   1 
ATOM   1355 O  O   . ARG A 1 194 ? 33.322 19.119 1.309   1.00 26.39  ? 889  ARG A O   1 
ATOM   1356 C  CB  . ARG A 1 194 ? 35.412 20.884 1.577   1.00 26.29  ? 889  ARG A CB  1 
ATOM   1357 C  CG  . ARG A 1 194 ? 36.550 21.852 1.879   1.00 29.12  ? 889  ARG A CG  1 
ATOM   1358 C  CD  . ARG A 1 194 ? 36.442 23.087 1.007   1.00 34.06  ? 889  ARG A CD  1 
ATOM   1359 N  NE  . ARG A 1 194 ? 37.491 24.040 1.352   1.00 40.27  ? 889  ARG A NE  1 
ATOM   1360 C  CZ  . ARG A 1 194 ? 38.647 24.159 0.709   1.00 44.88  ? 889  ARG A CZ  1 
ATOM   1361 N  NH1 . ARG A 1 194 ? 38.918 23.398 -0.351  1.00 43.57  ? 889  ARG A NH1 1 
ATOM   1362 N  NH2 . ARG A 1 194 ? 39.537 25.059 1.116   1.00 50.44  ? 889  ARG A NH2 1 
ATOM   1363 N  N   . ILE A 1 195 ? 34.083 17.661 2.862   1.00 23.98  ? 890  ILE A N   1 
ATOM   1364 C  CA  . ILE A 1 195 ? 33.062 16.655 2.662   1.00 25.00  ? 890  ILE A CA  1 
ATOM   1365 C  C   . ILE A 1 195 ? 31.926 16.899 3.651   1.00 23.28  ? 890  ILE A C   1 
ATOM   1366 O  O   . ILE A 1 195 ? 32.151 16.891 4.881   1.00 21.38  ? 890  ILE A O   1 
ATOM   1367 C  CB  . ILE A 1 195 ? 33.616 15.226 2.883   1.00 25.42  ? 890  ILE A CB  1 
ATOM   1368 C  CG1 . ILE A 1 195 ? 34.727 14.903 1.875   1.00 26.63  ? 890  ILE A CG1 1 
ATOM   1369 C  CG2 . ILE A 1 195 ? 32.479 14.198 2.815   1.00 28.04  ? 890  ILE A CG2 1 
ATOM   1370 C  CD1 . ILE A 1 195 ? 35.513 13.645 2.213   1.00 33.71  ? 890  ILE A CD1 1 
ATOM   1371 N  N   . TYR A 1 196 ? 30.719 17.107 3.120   1.00 22.22  ? 891  TYR A N   1 
ATOM   1372 C  CA  . TYR A 1 196 ? 29.537 17.334 3.962   1.00 24.26  ? 891  TYR A CA  1 
ATOM   1373 C  C   . TYR A 1 196 ? 28.491 16.330 3.560   1.00 23.03  ? 891  TYR A C   1 
ATOM   1374 O  O   . TYR A 1 196 ? 28.127 16.219 2.376   1.00 25.78  ? 891  TYR A O   1 
ATOM   1375 C  CB  . TYR A 1 196 ? 28.984 18.747 3.786   1.00 22.51  ? 891  TYR A CB  1 
ATOM   1376 C  CG  . TYR A 1 196 ? 29.896 19.841 4.275   1.00 23.06  ? 891  TYR A CG  1 
ATOM   1377 C  CD1 . TYR A 1 196 ? 29.824 20.314 5.586   1.00 27.59  ? 891  TYR A CD1 1 
ATOM   1378 C  CD2 . TYR A 1 196 ? 30.822 20.419 3.418   1.00 28.17  ? 891  TYR A CD2 1 
ATOM   1379 C  CE1 . TYR A 1 196 ? 30.680 21.337 6.021   1.00 31.56  ? 891  TYR A CE1 1 
ATOM   1380 C  CE2 . TYR A 1 196 ? 31.690 21.437 3.847   1.00 29.48  ? 891  TYR A CE2 1 
ATOM   1381 C  CZ  . TYR A 1 196 ? 31.605 21.884 5.149   1.00 35.39  ? 891  TYR A CZ  1 
ATOM   1382 O  OH  . TYR A 1 196 ? 32.447 22.892 5.549   1.00 34.54  ? 891  TYR A OH  1 
ATOM   1383 N  N   . THR A 1 197 ? 28.026 15.579 4.547   1.00 23.36  ? 892  THR A N   1 
ATOM   1384 C  CA  . THR A 1 197 ? 26.991 14.582 4.357   1.00 22.13  ? 892  THR A CA  1 
ATOM   1385 C  C   . THR A 1 197 ? 25.984 14.638 5.519   1.00 23.52  ? 892  THR A C   1 
ATOM   1386 O  O   . THR A 1 197 ? 26.145 15.416 6.456   1.00 23.18  ? 892  THR A O   1 
ATOM   1387 C  CB  . THR A 1 197 ? 27.595 13.140 4.289   1.00 23.36  ? 892  THR A CB  1 
ATOM   1388 O  OG1 . THR A 1 197 ? 28.198 12.820 5.554   1.00 27.28  ? 892  THR A OG1 1 
ATOM   1389 C  CG2 . THR A 1 197 ? 28.668 13.010 3.189   1.00 24.48  ? 892  THR A CG2 1 
ATOM   1390 N  N   . HIS A 1 198 ? 24.977 13.781 5.488   1.00 22.08  ? 893  HIS A N   1 
ATOM   1391 C  CA  . HIS A 1 198 ? 24.043 13.716 6.640   1.00 23.15  ? 893  HIS A CA  1 
ATOM   1392 C  C   . HIS A 1 198 ? 24.801 13.168 7.849   1.00 21.77  ? 893  HIS A C   1 
ATOM   1393 O  O   . HIS A 1 198 ? 24.500 13.493 8.996   1.00 19.97  ? 893  HIS A O   1 
ATOM   1394 C  CB  . HIS A 1 198 ? 22.805 12.881 6.314   1.00 27.35  ? 893  HIS A CB  1 
ATOM   1395 C  CG  . HIS A 1 198 ? 22.013 13.456 5.177   1.00 25.85  ? 893  HIS A CG  1 
ATOM   1396 N  ND1 . HIS A 1 198 ? 21.427 14.696 5.257   1.00 31.12  ? 893  HIS A ND1 1 
ATOM   1397 C  CD2 . HIS A 1 198 ? 21.825 13.026 3.906   1.00 36.64  ? 893  HIS A CD2 1 
ATOM   1398 C  CE1 . HIS A 1 198 ? 20.858 14.984 4.097   1.00 33.22  ? 893  HIS A CE1 1 
ATOM   1399 N  NE2 . HIS A 1 198 ? 21.084 13.987 3.262   1.00 31.29  ? 893  HIS A NE2 1 
ATOM   1400 N  N   . GLN A 1 199 ? 25.832 12.372 7.576   1.00 21.77  ? 894  GLN A N   1 
ATOM   1401 C  CA  . GLN A 1 199 ? 26.729 11.871 8.650   1.00 20.77  ? 894  GLN A CA  1 
ATOM   1402 C  C   . GLN A 1 199 ? 27.679 12.909 9.277   1.00 17.73  ? 894  GLN A C   1 
ATOM   1403 O  O   . GLN A 1 199 ? 27.985 12.820 10.465  1.00 19.63  ? 894  GLN A O   1 
ATOM   1404 C  CB  . GLN A 1 199 ? 27.466 10.587 8.230   1.00 23.65  ? 894  GLN A CB  1 
ATOM   1405 C  CG  . GLN A 1 199 ? 26.493 9.420  7.931   1.00 22.40  ? 894  GLN A CG  1 
ATOM   1406 C  CD  . GLN A 1 199 ? 25.555 9.148  9.103   1.00 27.81  ? 894  GLN A CD  1 
ATOM   1407 O  OE1 . GLN A 1 199 ? 24.369 9.478  9.035   1.00 26.17  ? 894  GLN A OE1 1 
ATOM   1408 N  NE2 . GLN A 1 199 ? 26.085 8.577  10.188  1.00 26.01  ? 894  GLN A NE2 1 
ATOM   1409 N  N   . SER A 1 200 ? 28.092 13.908 8.492   1.00 20.04  ? 895  SER A N   1 
ATOM   1410 C  CA  . SER A 1 200 ? 28.833 15.037 9.068   1.00 19.51  ? 895  SER A CA  1 
ATOM   1411 C  C   . SER A 1 200 ? 27.862 15.903 9.876   1.00 20.74  ? 895  SER A C   1 
ATOM   1412 O  O   . SER A 1 200 ? 28.266 16.454 10.909  1.00 21.76  ? 895  SER A O   1 
ATOM   1413 C  CB  . SER A 1 200 ? 29.625 15.843 8.033   1.00 23.40  ? 895  SER A CB  1 
ATOM   1414 O  OG  . SER A 1 200 ? 28.843 16.467 7.052   1.00 21.93  ? 895  SER A OG  1 
ATOM   1415 N  N   . ASP A 1 201 ? 26.585 15.956 9.455   1.00 20.11  ? 896  ASP A N   1 
ATOM   1416 C  CA  . ASP A 1 201 ? 25.563 16.637 10.266  1.00 19.26  ? 896  ASP A CA  1 
ATOM   1417 C  C   . ASP A 1 201 ? 25.351 15.922 11.606  1.00 16.09  ? 896  ASP A C   1 
ATOM   1418 O  O   . ASP A 1 201 ? 25.142 16.588 12.613  1.00 18.95  ? 896  ASP A O   1 
ATOM   1419 C  CB  . ASP A 1 201 ? 24.214 16.706 9.554   1.00 19.34  ? 896  ASP A CB  1 
ATOM   1420 C  CG  . ASP A 1 201 ? 24.108 17.868 8.555   1.00 20.51  ? 896  ASP A CG  1 
ATOM   1421 O  OD1 . ASP A 1 201 ? 23.127 17.852 7.788   1.00 24.63  ? 896  ASP A OD1 1 
ATOM   1422 O  OD2 . ASP A 1 201 ? 24.931 18.786 8.544   1.00 22.89  ? 896  ASP A OD2 1 
ATOM   1423 N  N   . VAL A 1 202 ? 25.471 14.585 11.623  1.00 17.44  ? 897  VAL A N   1 
ATOM   1424 C  CA  . VAL A 1 202 ? 25.415 13.822 12.883  1.00 16.82  ? 897  VAL A CA  1 
ATOM   1425 C  C   . VAL A 1 202 ? 26.549 14.253 13.860  1.00 18.33  ? 897  VAL A C   1 
ATOM   1426 O  O   . VAL A 1 202 ? 26.318 14.384 15.071  1.00 18.42  ? 897  VAL A O   1 
ATOM   1427 C  CB  . VAL A 1 202 ? 25.419 12.281 12.636  1.00 18.14  ? 897  VAL A CB  1 
ATOM   1428 C  CG1 . VAL A 1 202 ? 25.571 11.540 13.959  1.00 19.08  ? 897  VAL A CG1 1 
ATOM   1429 C  CG2 . VAL A 1 202 ? 24.121 11.852 11.982  1.00 20.79  ? 897  VAL A CG2 1 
ATOM   1430 N  N   . TRP A 1 203 ? 27.757 14.480 13.338  1.00 19.46  ? 898  TRP A N   1 
ATOM   1431 C  CA  . TRP A 1 203 ? 28.848 14.986 14.179  1.00 20.62  ? 898  TRP A CA  1 
ATOM   1432 C  C   . TRP A 1 203 ? 28.438 16.318 14.840  1.00 18.30  ? 898  TRP A C   1 
ATOM   1433 O  O   . TRP A 1 203 ? 28.586 16.485 16.062  1.00 18.89  ? 898  TRP A O   1 
ATOM   1434 C  CB  . TRP A 1 203 ? 30.142 15.151 13.356  1.00 17.81  ? 898  TRP A CB  1 
ATOM   1435 C  CG  . TRP A 1 203 ? 31.348 15.660 14.123  1.00 18.33  ? 898  TRP A CG  1 
ATOM   1436 C  CD1 . TRP A 1 203 ? 31.453 16.846 14.778  1.00 19.98  ? 898  TRP A CD1 1 
ATOM   1437 C  CD2 . TRP A 1 203 ? 32.615 15.009 14.252  1.00 22.26  ? 898  TRP A CD2 1 
ATOM   1438 N  NE1 . TRP A 1 203 ? 32.710 16.978 15.330  1.00 22.20  ? 898  TRP A NE1 1 
ATOM   1439 C  CE2 . TRP A 1 203 ? 33.435 15.854 15.025  1.00 20.72  ? 898  TRP A CE2 1 
ATOM   1440 C  CE3 . TRP A 1 203 ? 33.147 13.790 13.777  1.00 20.10  ? 898  TRP A CE3 1 
ATOM   1441 C  CZ2 . TRP A 1 203 ? 34.754 15.523 15.350  1.00 21.80  ? 898  TRP A CZ2 1 
ATOM   1442 C  CZ3 . TRP A 1 203 ? 34.464 13.462 14.111  1.00 24.49  ? 898  TRP A CZ3 1 
ATOM   1443 C  CH2 . TRP A 1 203 ? 35.247 14.331 14.888  1.00 28.84  ? 898  TRP A CH2 1 
ATOM   1444 N  N   . SER A 1 204 ? 27.930 17.250 14.020  1.00 19.17  ? 899  SER A N   1 
ATOM   1445 C  CA  . SER A 1 204 ? 27.537 18.557 14.524  1.00 15.78  ? 899  SER A CA  1 
ATOM   1446 C  C   . SER A 1 204 ? 26.394 18.440 15.529  1.00 20.69  ? 899  SER A C   1 
ATOM   1447 O  O   . SER A 1 204 ? 26.341 19.208 16.496  1.00 20.52  ? 899  SER A O   1 
ATOM   1448 C  CB  . SER A 1 204 ? 27.142 19.467 13.363  1.00 20.41  ? 899  SER A CB  1 
ATOM   1449 O  OG  . SER A 1 204 ? 28.222 19.588 12.452  1.00 22.46  ? 899  SER A OG  1 
ATOM   1450 N  N   . TYR A 1 205 ? 25.497 17.486 15.282  1.00 17.55  ? 900  TYR A N   1 
ATOM   1451 C  CA  . TYR A 1 205 ? 24.443 17.148 16.231  1.00 19.79  ? 900  TYR A CA  1 
ATOM   1452 C  C   . TYR A 1 205 ? 25.024 16.774 17.598  1.00 19.17  ? 900  TYR A C   1 
ATOM   1453 O  O   . TYR A 1 205 ? 24.559 17.246 18.654  1.00 19.38  ? 900  TYR A O   1 
ATOM   1454 C  CB  . TYR A 1 205 ? 23.553 16.009 15.699  1.00 19.51  ? 900  TYR A CB  1 
ATOM   1455 C  CG  . TYR A 1 205 ? 22.467 15.546 16.677  1.00 17.99  ? 900  TYR A CG  1 
ATOM   1456 C  CD1 . TYR A 1 205 ? 22.699 14.486 17.556  1.00 19.76  ? 900  TYR A CD1 1 
ATOM   1457 C  CD2 . TYR A 1 205 ? 21.228 16.170 16.719  1.00 18.82  ? 900  TYR A CD2 1 
ATOM   1458 C  CE1 . TYR A 1 205 ? 21.737 14.048 18.457  1.00 21.05  ? 900  TYR A CE1 1 
ATOM   1459 C  CE2 . TYR A 1 205 ? 20.216 15.739 17.633  1.00 20.66  ? 900  TYR A CE2 1 
ATOM   1460 C  CZ  . TYR A 1 205 ? 20.489 14.678 18.491  1.00 18.68  ? 900  TYR A CZ  1 
ATOM   1461 O  OH  . TYR A 1 205 ? 19.535 14.235 19.390  1.00 22.06  ? 900  TYR A OH  1 
ATOM   1462 N  N   . GLY A 1 206 ? 26.034 15.907 17.576  1.00 18.14  ? 901  GLY A N   1 
ATOM   1463 C  CA  . GLY A 1 206 ? 26.789 15.562 18.807  1.00 19.64  ? 901  GLY A CA  1 
ATOM   1464 C  C   . GLY A 1 206 ? 27.289 16.783 19.557  1.00 17.75  ? 901  GLY A C   1 
ATOM   1465 O  O   . GLY A 1 206 ? 27.126 16.877 20.782  1.00 20.44  ? 901  GLY A O   1 
ATOM   1466 N  N   . VAL A 1 207 ? 27.904 17.722 18.825  1.00 19.78  ? 902  VAL A N   1 
ATOM   1467 C  CA  . VAL A 1 207 ? 28.393 18.959 19.445  1.00 19.87  ? 902  VAL A CA  1 
ATOM   1468 C  C   . VAL A 1 207 ? 27.234 19.804 20.011  1.00 20.26  ? 902  VAL A C   1 
ATOM   1469 O  O   . VAL A 1 207 ? 27.330 20.340 21.128  1.00 20.32  ? 902  VAL A O   1 
ATOM   1470 C  CB  . VAL A 1 207 ? 29.289 19.790 18.477  1.00 19.17  ? 902  VAL A CB  1 
ATOM   1471 C  CG1 . VAL A 1 207 ? 29.822 21.042 19.216  1.00 21.70  ? 902  VAL A CG1 1 
ATOM   1472 C  CG2 . VAL A 1 207 ? 30.471 18.965 17.970  1.00 19.85  ? 902  VAL A CG2 1 
ATOM   1473 N  N   . THR A 1 208 ? 26.135 19.889 19.253  1.00 18.85  ? 903  THR A N   1 
ATOM   1474 C  CA  . THR A 1 208 ? 24.918 20.569 19.714  1.00 18.68  ? 903  THR A CA  1 
ATOM   1475 C  C   . THR A 1 208 ? 24.381 19.984 21.014  1.00 18.36  ? 903  THR A C   1 
ATOM   1476 O  O   . THR A 1 208 ? 24.095 20.735 21.954  1.00 21.20  ? 903  THR A O   1 
ATOM   1477 C  CB  . THR A 1 208 ? 23.855 20.542 18.610  1.00 19.94  ? 903  THR A CB  1 
ATOM   1478 O  OG1 . THR A 1 208 ? 24.402 21.156 17.437  1.00 18.87  ? 903  THR A OG1 1 
ATOM   1479 C  CG2 . THR A 1 208 ? 22.583 21.314 19.025  1.00 20.53  ? 903  THR A CG2 1 
ATOM   1480 N  N   . VAL A 1 209 ? 24.286 18.648 21.091  1.00 18.10  ? 904  VAL A N   1 
ATOM   1481 C  CA  . VAL A 1 209 ? 23.832 18.009 22.324  1.00 19.16  ? 904  VAL A CA  1 
ATOM   1482 C  C   . VAL A 1 209 ? 24.775 18.337 23.484  1.00 20.41  ? 904  VAL A C   1 
ATOM   1483 O  O   . VAL A 1 209 ? 24.315 18.619 24.603  1.00 21.83  ? 904  VAL A O   1 
ATOM   1484 C  CB  . VAL A 1 209 ? 23.640 16.488 22.122  1.00 22.39  ? 904  VAL A CB  1 
ATOM   1485 C  CG1 . VAL A 1 209 ? 23.435 15.757 23.462  1.00 23.76  ? 904  VAL A CG1 1 
ATOM   1486 C  CG2 . VAL A 1 209 ? 22.455 16.224 21.153  1.00 23.23  ? 904  VAL A CG2 1 
ATOM   1487 N  N   . TRP A 1 210 ? 26.076 18.312 23.214  1.00 20.80  ? 905  TRP A N   1 
ATOM   1488 C  CA  . TRP A 1 210 ? 27.085 18.693 24.209  1.00 21.29  ? 905  TRP A CA  1 
ATOM   1489 C  C   . TRP A 1 210 ? 26.852 20.128 24.697  1.00 19.94  ? 905  TRP A C   1 
ATOM   1490 O  O   . TRP A 1 210 ? 26.893 20.392 25.913  1.00 22.20  ? 905  TRP A O   1 
ATOM   1491 C  CB  . TRP A 1 210 ? 28.489 18.498 23.636  1.00 21.70  ? 905  TRP A CB  1 
ATOM   1492 C  CG  . TRP A 1 210 ? 29.579 18.749 24.619  1.00 21.36  ? 905  TRP A CG  1 
ATOM   1493 C  CD1 . TRP A 1 210 ? 30.159 17.829 25.438  1.00 22.65  ? 905  TRP A CD1 1 
ATOM   1494 C  CD2 . TRP A 1 210 ? 30.202 20.015 24.924  1.00 22.58  ? 905  TRP A CD2 1 
ATOM   1495 N  NE1 . TRP A 1 210 ? 31.133 18.429 26.214  1.00 26.00  ? 905  TRP A NE1 1 
ATOM   1496 C  CE2 . TRP A 1 210 ? 31.171 19.769 25.926  1.00 26.10  ? 905  TRP A CE2 1 
ATOM   1497 C  CE3 . TRP A 1 210 ? 30.043 21.325 24.437  1.00 24.96  ? 905  TRP A CE3 1 
ATOM   1498 C  CZ2 . TRP A 1 210 ? 31.971 20.782 26.458  1.00 27.63  ? 905  TRP A CZ2 1 
ATOM   1499 C  CZ3 . TRP A 1 210 ? 30.848 22.344 24.974  1.00 26.68  ? 905  TRP A CZ3 1 
ATOM   1500 C  CH2 . TRP A 1 210 ? 31.799 22.061 25.963  1.00 27.16  ? 905  TRP A CH2 1 
ATOM   1501 N  N   . GLU A 1 211 ? 26.558 21.042 23.773  1.00 20.13  ? 906  GLU A N   1 
ATOM   1502 C  CA  . GLU A 1 211 ? 26.258 22.421 24.170  1.00 21.45  ? 906  GLU A CA  1 
ATOM   1503 C  C   . GLU A 1 211 ? 25.066 22.487 25.109  1.00 24.10  ? 906  GLU A C   1 
ATOM   1504 O  O   . GLU A 1 211 ? 25.099 23.258 26.076  1.00 23.99  ? 906  GLU A O   1 
ATOM   1505 C  CB  . GLU A 1 211 ? 25.967 23.276 22.959  1.00 22.79  ? 906  GLU A CB  1 
ATOM   1506 C  CG  . GLU A 1 211 ? 27.165 23.617 22.115  1.00 23.57  ? 906  GLU A CG  1 
ATOM   1507 C  CD  . GLU A 1 211 ? 26.729 24.485 20.960  1.00 26.10  ? 906  GLU A CD  1 
ATOM   1508 O  OE1 . GLU A 1 211 ? 26.801 25.725 21.084  1.00 25.38  ? 906  GLU A OE1 1 
ATOM   1509 O  OE2 . GLU A 1 211 ? 26.216 23.940 19.961  1.00 23.11  ? 906  GLU A OE2 1 
ATOM   1510 N  N   . LEU A 1 212 ? 24.018 21.710 24.818  1.00 21.97  ? 907  LEU A N   1 
ATOM   1511 C  CA  . LEU A 1 212 ? 22.813 21.719 25.649  1.00 23.39  ? 907  LEU A CA  1 
ATOM   1512 C  C   . LEU A 1 212 ? 23.111 21.153 27.038  1.00 21.65  ? 907  LEU A C   1 
ATOM   1513 O  O   . LEU A 1 212 ? 22.720 21.748 28.042  1.00 24.72  ? 907  LEU A O   1 
ATOM   1514 C  CB  . LEU A 1 212 ? 21.669 20.928 24.996  1.00 23.11  ? 907  LEU A CB  1 
ATOM   1515 C  CG  . LEU A 1 212 ? 21.216 21.379 23.608  1.00 24.21  ? 907  LEU A CG  1 
ATOM   1516 C  CD1 . LEU A 1 212 ? 19.975 20.551 23.180  1.00 26.25  ? 907  LEU A CD1 1 
ATOM   1517 C  CD2 . LEU A 1 212 ? 20.918 22.868 23.645  1.00 25.67  ? 907  LEU A CD2 1 
ATOM   1518 N  N   . MET A 1 213 ? 23.831 20.028 27.080  1.00 23.09  ? 908  MET A N   1 
ATOM   1519 C  CA  . MET A 1 213 ? 24.079 19.317 28.340  1.00 22.52  ? 908  MET A CA  1 
ATOM   1520 C  C   . MET A 1 213 ? 25.036 20.051 29.259  1.00 23.13  ? 908  MET A C   1 
ATOM   1521 O  O   . MET A 1 213 ? 25.083 19.758 30.467  1.00 25.68  ? 908  MET A O   1 
ATOM   1522 C  CB  . MET A 1 213 ? 24.629 17.919 28.045  1.00 25.00  ? 908  MET A CB  1 
ATOM   1523 C  CG  . MET A 1 213 ? 23.666 17.070 27.244  1.00 26.10  ? 908  MET A CG  1 
ATOM   1524 S  SD  . MET A 1 213 ? 22.130 16.729 28.124  1.00 30.54  ? 908  MET A SD  1 
ATOM   1525 C  CE  . MET A 1 213 ? 21.247 15.794 26.858  1.00 33.52  ? 908  MET A CE  1 
ATOM   1526 N  N   . THR A 1 214 ? 25.819 20.975 28.698  1.00 25.91  ? 909  THR A N   1 
ATOM   1527 C  CA  . THR A 1 214 ? 26.714 21.818 29.492  1.00 26.61  ? 909  THR A CA  1 
ATOM   1528 C  C   . THR A 1 214 ? 26.103 23.192 29.766  1.00 29.52  ? 909  THR A C   1 
ATOM   1529 O  O   . THR A 1 214 ? 26.777 24.093 30.280  1.00 30.58  ? 909  THR A O   1 
ATOM   1530 C  CB  . THR A 1 214 ? 28.075 22.035 28.813  1.00 28.01  ? 909  THR A CB  1 
ATOM   1531 O  OG1 . THR A 1 214 ? 27.874 22.686 27.553  1.00 25.72  ? 909  THR A OG1 1 
ATOM   1532 C  CG2 . THR A 1 214 ? 28.808 20.692 28.618  1.00 26.85  ? 909  THR A CG2 1 
ATOM   1533 N  N   . PHE A 1 215 ? 24.829 23.340 29.419  1.00 27.61  ? 910  PHE A N   1 
ATOM   1534 C  CA  . PHE A 1 215 ? 24.104 24.616 29.565  1.00 26.99  ? 910  PHE A CA  1 
ATOM   1535 C  C   . PHE A 1 215 ? 24.793 25.758 28.839  1.00 28.00  ? 910  PHE A C   1 
ATOM   1536 O  O   . PHE A 1 215 ? 24.843 26.902 29.315  1.00 29.21  ? 910  PHE A O   1 
ATOM   1537 C  CB  . PHE A 1 215 ? 23.840 24.927 31.040  1.00 28.81  ? 910  PHE A CB  1 
ATOM   1538 C  CG  . PHE A 1 215 ? 23.095 23.853 31.725  1.00 28.89  ? 910  PHE A CG  1 
ATOM   1539 C  CD1 . PHE A 1 215 ? 21.714 23.755 31.576  1.00 29.32  ? 910  PHE A CD1 1 
ATOM   1540 C  CD2 . PHE A 1 215 ? 23.762 22.887 32.468  1.00 30.83  ? 910  PHE A CD2 1 
ATOM   1541 C  CE1 . PHE A 1 215 ? 21.002 22.737 32.191  1.00 32.13  ? 910  PHE A CE1 1 
ATOM   1542 C  CE2 . PHE A 1 215 ? 23.054 21.859 33.089  1.00 34.53  ? 910  PHE A CE2 1 
ATOM   1543 C  CZ  . PHE A 1 215 ? 21.668 21.788 32.949  1.00 33.22  ? 910  PHE A CZ  1 
ATOM   1544 N  N   . GLY A 1 216 ? 25.361 25.423 27.685  1.00 27.04  ? 911  GLY A N   1 
ATOM   1545 C  CA  . GLY A 1 216 ? 25.880 26.436 26.792  1.00 27.63  ? 911  GLY A CA  1 
ATOM   1546 C  C   . GLY A 1 216 ? 27.350 26.743 26.898  1.00 26.90  ? 911  GLY A C   1 
ATOM   1547 O  O   . GLY A 1 216 ? 27.780 27.841 26.557  1.00 28.05  ? 911  GLY A O   1 
ATOM   1548 N  N   . SER A 1 217 ? 28.144 25.769 27.317  1.00 25.29  ? 912  SER A N   1 
ATOM   1549 C  CA  . SER A 1 217 ? 29.599 25.950 27.270  1.00 28.05  ? 912  SER A CA  1 
ATOM   1550 C  C   . SER A 1 217 ? 30.087 26.067 25.820  1.00 28.02  ? 912  SER A C   1 
ATOM   1551 O  O   . SER A 1 217 ? 29.445 25.568 24.887  1.00 27.89  ? 912  SER A O   1 
ATOM   1552 C  CB  . SER A 1 217 ? 30.316 24.808 27.996  1.00 30.86  ? 912  SER A CB  1 
ATOM   1553 O  OG  . SER A 1 217 ? 30.012 24.836 29.384  1.00 32.10  ? 912  SER A OG  1 
ATOM   1554 N  N   . LYS A 1 218 ? 31.221 26.739 25.640  1.00 31.87  ? 913  LYS A N   1 
ATOM   1555 C  CA  . LYS A 1 218 ? 31.840 26.853 24.324  1.00 30.44  ? 913  LYS A CA  1 
ATOM   1556 C  C   . LYS A 1 218 ? 32.726 25.635 24.099  1.00 30.15  ? 913  LYS A C   1 
ATOM   1557 O  O   . LYS A 1 218 ? 33.561 25.322 24.957  1.00 31.95  ? 913  LYS A O   1 
ATOM   1558 C  CB  . LYS A 1 218 ? 32.678 28.127 24.261  1.00 33.86  ? 913  LYS A CB  1 
ATOM   1559 C  CG  . LYS A 1 218 ? 31.850 29.390 24.443  1.00 37.22  ? 913  LYS A CG  1 
ATOM   1560 C  CD  . LYS A 1 218 ? 32.709 30.561 24.873  1.00 47.03  ? 913  LYS A CD  1 
ATOM   1561 C  CE  . LYS A 1 218 ? 33.432 31.187 23.701  1.00 52.15  ? 913  LYS A CE  1 
ATOM   1562 N  NZ  . LYS A 1 218 ? 32.506 31.976 22.843  1.00 62.51  ? 913  LYS A NZ  1 
ATOM   1563 N  N   . PRO A 1 219 ? 32.540 24.932 22.957  1.00 29.91  ? 914  PRO A N   1 
ATOM   1564 C  CA  . PRO A 1 219 ? 33.326 23.735 22.698  1.00 29.46  ? 914  PRO A CA  1 
ATOM   1565 C  C   . PRO A 1 219 ? 34.805 24.070 22.493  1.00 30.16  ? 914  PRO A C   1 
ATOM   1566 O  O   . PRO A 1 219 ? 35.120 25.034 21.789  1.00 32.58  ? 914  PRO A O   1 
ATOM   1567 C  CB  . PRO A 1 219 ? 32.701 23.145 21.415  1.00 28.86  ? 914  PRO A CB  1 
ATOM   1568 C  CG  . PRO A 1 219 ? 32.010 24.265 20.737  1.00 27.77  ? 914  PRO A CG  1 
ATOM   1569 C  CD  . PRO A 1 219 ? 31.661 25.296 21.828  1.00 29.82  ? 914  PRO A CD  1 
ATOM   1570 N  N   . TYR A 1 220 ? 35.680 23.277 23.111  1.00 31.20  ? 915  TYR A N   1 
ATOM   1571 C  CA  . TYR A 1 220 ? 37.139 23.426 23.013  1.00 34.08  ? 915  TYR A CA  1 
ATOM   1572 C  C   . TYR A 1 220 ? 37.546 24.852 23.358  1.00 37.65  ? 915  TYR A C   1 
ATOM   1573 O  O   . TYR A 1 220 ? 38.325 25.470 22.625  1.00 41.25  ? 915  TYR A O   1 
ATOM   1574 C  CB  . TYR A 1 220 ? 37.664 23.080 21.605  1.00 32.27  ? 915  TYR A CB  1 
ATOM   1575 C  CG  . TYR A 1 220 ? 37.062 21.855 20.975  1.00 32.24  ? 915  TYR A CG  1 
ATOM   1576 C  CD1 . TYR A 1 220 ? 37.496 20.568 21.313  1.00 32.21  ? 915  TYR A CD1 1 
ATOM   1577 C  CD2 . TYR A 1 220 ? 36.074 21.988 20.015  1.00 29.69  ? 915  TYR A CD2 1 
ATOM   1578 C  CE1 . TYR A 1 220 ? 36.922 19.434 20.704  1.00 31.99  ? 915  TYR A CE1 1 
ATOM   1579 C  CE2 . TYR A 1 220 ? 35.506 20.883 19.403  1.00 31.02  ? 915  TYR A CE2 1 
ATOM   1580 C  CZ  . TYR A 1 220 ? 35.929 19.616 19.749  1.00 29.64  ? 915  TYR A CZ  1 
ATOM   1581 O  OH  . TYR A 1 220 ? 35.343 18.557 19.117  1.00 30.72  ? 915  TYR A OH  1 
ATOM   1582 N  N   . ASP A 1 221 ? 37.000 25.371 24.456  1.00 39.65  ? 916  ASP A N   1 
ATOM   1583 C  CA  . ASP A 1 221 ? 37.195 26.773 24.843  1.00 44.35  ? 916  ASP A CA  1 
ATOM   1584 C  C   . ASP A 1 221 ? 38.673 27.031 25.116  1.00 48.28  ? 916  ASP A C   1 
ATOM   1585 O  O   . ASP A 1 221 ? 39.327 26.256 25.814  1.00 51.55  ? 916  ASP A O   1 
ATOM   1586 C  CB  . ASP A 1 221 ? 36.341 27.112 26.076  1.00 46.22  ? 916  ASP A CB  1 
ATOM   1587 C  CG  . ASP A 1 221 ? 36.306 28.613 26.399  1.00 50.45  ? 916  ASP A CG  1 
ATOM   1588 O  OD1 . ASP A 1 221 ? 36.055 28.950 27.571  1.00 59.46  ? 916  ASP A OD1 1 
ATOM   1589 O  OD2 . ASP A 1 221 ? 36.512 29.454 25.498  1.00 54.51  ? 916  ASP A OD2 1 
ATOM   1590 N  N   . GLY A 1 222 ? 39.194 28.105 24.528  1.00 51.38  ? 917  GLY A N   1 
ATOM   1591 C  CA  . GLY A 1 222 ? 40.596 28.488 24.693  1.00 55.04  ? 917  GLY A CA  1 
ATOM   1592 C  C   . GLY A 1 222 ? 41.533 27.859 23.676  1.00 55.10  ? 917  GLY A C   1 
ATOM   1593 O  O   . GLY A 1 222 ? 42.707 28.225 23.612  1.00 57.77  ? 917  GLY A O   1 
ATOM   1594 N  N   . ILE A 1 223 ? 41.018 26.920 22.879  1.00 52.71  ? 918  ILE A N   1 
ATOM   1595 C  CA  . ILE A 1 223 ? 41.831 26.195 21.907  1.00 50.41  ? 918  ILE A CA  1 
ATOM   1596 C  C   . ILE A 1 223 ? 41.637 26.793 20.514  1.00 48.95  ? 918  ILE A C   1 
ATOM   1597 O  O   . ILE A 1 223 ? 40.506 26.880 20.039  1.00 46.36  ? 918  ILE A O   1 
ATOM   1598 C  CB  . ILE A 1 223 ? 41.484 24.684 21.877  1.00 51.59  ? 918  ILE A CB  1 
ATOM   1599 C  CG1 . ILE A 1 223 ? 41.604 24.074 23.280  1.00 52.08  ? 918  ILE A CG1 1 
ATOM   1600 C  CG2 . ILE A 1 223 ? 42.370 23.955 20.866  1.00 48.11  ? 918  ILE A CG2 1 
ATOM   1601 C  CD1 . ILE A 1 223 ? 41.012 22.680 23.416  1.00 54.25  ? 918  ILE A CD1 1 
ATOM   1602 N  N   . PRO A 1 224 ? 42.737 27.223 19.862  1.00 46.98  ? 919  PRO A N   1 
ATOM   1603 C  CA  . PRO A 1 224 ? 42.592 27.823 18.533  1.00 45.55  ? 919  PRO A CA  1 
ATOM   1604 C  C   . PRO A 1 224 ? 42.003 26.856 17.509  1.00 40.74  ? 919  PRO A C   1 
ATOM   1605 O  O   . PRO A 1 224 ? 42.251 25.649 17.574  1.00 40.03  ? 919  PRO A O   1 
ATOM   1606 C  CB  . PRO A 1 224 ? 44.027 28.207 18.138  1.00 48.10  ? 919  PRO A CB  1 
ATOM   1607 C  CG  . PRO A 1 224 ? 44.926 27.581 19.162  1.00 50.64  ? 919  PRO A CG  1 
ATOM   1608 C  CD  . PRO A 1 224 ? 44.106 27.355 20.389  1.00 50.96  ? 919  PRO A CD  1 
ATOM   1609 N  N   . ALA A 1 225 ? 41.240 27.410 16.573  1.00 39.19  ? 920  ALA A N   1 
ATOM   1610 C  CA  . ALA A 1 225 ? 40.576 26.635 15.525  1.00 38.01  ? 920  ALA A CA  1 
ATOM   1611 C  C   . ALA A 1 225 ? 41.572 25.856 14.671  1.00 37.72  ? 920  ALA A C   1 
ATOM   1612 O  O   . ALA A 1 225 ? 41.278 24.748 14.237  1.00 34.61  ? 920  ALA A O   1 
ATOM   1613 C  CB  . ALA A 1 225 ? 39.718 27.543 14.664  1.00 37.43  ? 920  ALA A CB  1 
ATOM   1614 N  N   . SER A 1 226 ? 42.756 26.435 14.453  1.00 39.56  ? 921  SER A N   1 
ATOM   1615 C  CA  . SER A 1 226 ? 43.816 25.811 13.651  1.00 41.09  ? 921  SER A CA  1 
ATOM   1616 C  C   . SER A 1 226 ? 44.374 24.514 14.248  1.00 39.51  ? 921  SER A C   1 
ATOM   1617 O  O   . SER A 1 226 ? 44.936 23.702 13.532  1.00 41.15  ? 921  SER A O   1 
ATOM   1618 C  CB  . SER A 1 226 ? 44.960 26.802 13.404  1.00 42.99  ? 921  SER A CB  1 
ATOM   1619 O  OG  . SER A 1 226 ? 45.530 27.232 14.632  1.00 45.45  ? 921  SER A OG  1 
ATOM   1620 N  N   . GLU A 1 227 ? 44.195 24.323 15.552  1.00 38.88  ? 922  GLU A N   1 
ATOM   1621 C  CA  . GLU A 1 227 ? 44.673 23.123 16.243  1.00 40.36  ? 922  GLU A CA  1 
ATOM   1622 C  C   . GLU A 1 227 ? 43.630 22.000 16.315  1.00 34.99  ? 922  GLU A C   1 
ATOM   1623 O  O   . GLU A 1 227 ? 43.934 20.898 16.765  1.00 37.57  ? 922  GLU A O   1 
ATOM   1624 C  CB  . GLU A 1 227 ? 45.129 23.475 17.664  1.00 40.19  ? 922  GLU A CB  1 
ATOM   1625 C  CG  . GLU A 1 227 ? 46.227 24.532 17.730  1.00 50.69  ? 922  GLU A CG  1 
ATOM   1626 C  CD  . GLU A 1 227 ? 47.630 23.963 17.630  1.00 62.51  ? 922  GLU A CD  1 
ATOM   1627 O  OE1 . GLU A 1 227 ? 48.496 24.428 18.399  1.00 67.59  ? 922  GLU A OE1 1 
ATOM   1628 O  OE2 . GLU A 1 227 ? 47.875 23.064 16.794  1.00 63.44  ? 922  GLU A OE2 1 
ATOM   1629 N  N   . ILE A 1 228 ? 42.415 22.261 15.847  1.00 34.04  ? 923  ILE A N   1 
ATOM   1630 C  CA  . ILE A 1 228 ? 41.309 21.317 16.080  1.00 32.86  ? 923  ILE A CA  1 
ATOM   1631 C  C   . ILE A 1 228 ? 41.478 20.002 15.327  1.00 31.89  ? 923  ILE A C   1 
ATOM   1632 O  O   . ILE A 1 228 ? 41.291 18.930 15.904  1.00 30.78  ? 923  ILE A O   1 
ATOM   1633 C  CB  . ILE A 1 228 ? 39.931 21.973 15.811  1.00 29.98  ? 923  ILE A CB  1 
ATOM   1634 C  CG1 . ILE A 1 228 ? 39.656 23.090 16.828  1.00 33.29  ? 923  ILE A CG1 1 
ATOM   1635 C  CG2 . ILE A 1 228 ? 38.775 20.935 15.782  1.00 33.63  ? 923  ILE A CG2 1 
ATOM   1636 C  CD1 . ILE A 1 228 ? 39.543 22.643 18.288  1.00 33.19  ? 923  ILE A CD1 1 
ATOM   1637 N  N   . SER A 1 229 ? 41.861 20.073 14.052  1.00 33.61  ? 924  SER A N   1 
ATOM   1638 C  CA  . SER A 1 229 ? 42.058 18.848 13.279  1.00 32.89  ? 924  SER A CA  1 
ATOM   1639 C  C   . SER A 1 229 ? 43.096 17.932 13.935  1.00 32.48  ? 924  SER A C   1 
ATOM   1640 O  O   . SER A 1 229 ? 42.884 16.726 14.007  1.00 31.88  ? 924  SER A O   1 
ATOM   1641 C  CB  . SER A 1 229 ? 42.409 19.137 11.808  1.00 31.78  ? 924  SER A CB  1 
ATOM   1642 O  OG  . SER A 1 229 ? 43.701 19.724 11.710  1.00 36.27  ? 924  SER A OG  1 
ATOM   1643 N  N   . SER A 1 230 ? 44.212 18.491 14.419  1.00 36.41  ? 925  SER A N   1 
ATOM   1644 C  CA  . SER A 1 230 ? 45.240 17.668 15.063  1.00 36.88  ? 925  SER A CA  1 
ATOM   1645 C  C   . SER A 1 230 ? 44.765 17.028 16.370  1.00 35.83  ? 925  SER A C   1 
ATOM   1646 O  O   . SER A 1 230 ? 45.093 15.876 16.660  1.00 38.93  ? 925  SER A O   1 
ATOM   1647 C  CB  . SER A 1 230 ? 46.546 18.452 15.272  1.00 37.45  ? 925  SER A CB  1 
ATOM   1648 O  OG  . SER A 1 230 ? 46.424 19.424 16.302  1.00 46.67  ? 925  SER A OG  1 
ATOM   1649 N  N   . ILE A 1 231 ? 44.000 17.790 17.146  1.00 36.00  ? 926  ILE A N   1 
ATOM   1650 C  CA  . ILE A 1 231 ? 43.378 17.318 18.384  1.00 36.07  ? 926  ILE A CA  1 
ATOM   1651 C  C   . ILE A 1 231 ? 42.453 16.128 18.096  1.00 34.84  ? 926  ILE A C   1 
ATOM   1652 O  O   . ILE A 1 231 ? 42.522 15.091 18.764  1.00 34.71  ? 926  ILE A O   1 
ATOM   1653 C  CB  . ILE A 1 231 ? 42.632 18.503 19.078  1.00 37.39  ? 926  ILE A CB  1 
ATOM   1654 C  CG1 . ILE A 1 231 ? 43.631 19.334 19.895  1.00 43.90  ? 926  ILE A CG1 1 
ATOM   1655 C  CG2 . ILE A 1 231 ? 41.412 18.043 19.906  1.00 43.66  ? 926  ILE A CG2 1 
ATOM   1656 C  CD1 . ILE A 1 231 ? 43.025 20.561 20.544  1.00 48.52  ? 926  ILE A CD1 1 
ATOM   1657 N  N   . LEU A 1 232 ? 41.613 16.269 17.079  1.00 32.03  ? 927  LEU A N   1 
ATOM   1658 C  CA  . LEU A 1 232 ? 40.689 15.200 16.705  1.00 29.60  ? 927  LEU A CA  1 
ATOM   1659 C  C   . LEU A 1 232 ? 41.419 13.958 16.201  1.00 32.28  ? 927  LEU A C   1 
ATOM   1660 O  O   . LEU A 1 232 ? 41.043 12.825 16.528  1.00 30.74  ? 927  LEU A O   1 
ATOM   1661 C  CB  . LEU A 1 232 ? 39.680 15.698 15.655  1.00 28.87  ? 927  LEU A CB  1 
ATOM   1662 C  CG  . LEU A 1 232 ? 38.736 16.836 16.084  1.00 28.06  ? 927  LEU A CG  1 
ATOM   1663 C  CD1 . LEU A 1 232 ? 37.942 17.360 14.920  1.00 26.90  ? 927  LEU A CD1 1 
ATOM   1664 C  CD2 . LEU A 1 232 ? 37.801 16.436 17.241  1.00 25.78  ? 927  LEU A CD2 1 
ATOM   1665 N  N   . GLU A 1 233 ? 42.458 14.174 15.396  1.00 33.05  ? 928  GLU A N   1 
ATOM   1666 C  CA  . GLU A 1 233 ? 43.293 13.076 14.914  1.00 37.59  ? 928  GLU A CA  1 
ATOM   1667 C  C   . GLU A 1 233 ? 43.989 12.325 16.045  1.00 36.21  ? 928  GLU A C   1 
ATOM   1668 O  O   . GLU A 1 233 ? 44.231 11.119 15.930  1.00 39.42  ? 928  GLU A O   1 
ATOM   1669 C  CB  . GLU A 1 233 ? 44.322 13.574 13.890  1.00 36.90  ? 928  GLU A CB  1 
ATOM   1670 C  CG  . GLU A 1 233 ? 43.690 13.905 12.531  1.00 40.20  ? 928  GLU A CG  1 
ATOM   1671 C  CD  . GLU A 1 233 ? 44.562 14.784 11.640  1.00 47.96  ? 928  GLU A CD  1 
ATOM   1672 O  OE1 . GLU A 1 233 ? 44.109 15.129 10.532  1.00 53.19  ? 928  GLU A OE1 1 
ATOM   1673 O  OE2 . GLU A 1 233 ? 45.690 15.142 12.044  1.00 48.32  ? 928  GLU A OE2 1 
ATOM   1674 N  N   . LYS A 1 234 ? 44.313 13.035 17.127  1.00 38.83  ? 929  LYS A N   1 
ATOM   1675 C  CA  . LYS A 1 234 ? 44.931 12.417 18.309  1.00 42.03  ? 929  LYS A CA  1 
ATOM   1676 C  C   . LYS A 1 234 ? 43.928 11.641 19.164  1.00 40.81  ? 929  LYS A C   1 
ATOM   1677 O  O   . LYS A 1 234 ? 44.306 10.964 20.120  1.00 42.39  ? 929  LYS A O   1 
ATOM   1678 C  CB  . LYS A 1 234 ? 45.655 13.460 19.178  1.00 43.76  ? 929  LYS A CB  1 
ATOM   1679 C  CG  . LYS A 1 234 ? 47.163 13.391 19.100  1.00 55.69  ? 929  LYS A CG  1 
ATOM   1680 C  CD  . LYS A 1 234 ? 47.773 14.658 18.521  1.00 60.44  ? 929  LYS A CD  1 
ATOM   1681 C  CE  . LYS A 1 234 ? 47.998 15.709 19.603  1.00 61.44  ? 929  LYS A CE  1 
ATOM   1682 N  NZ  . LYS A 1 234 ? 49.158 16.592 19.273  1.00 60.81  ? 929  LYS A NZ  1 
ATOM   1683 N  N   . GLY A 1 235 ? 42.648 11.762 18.829  1.00 36.50  ? 930  GLY A N   1 
ATOM   1684 C  CA  . GLY A 1 235 ? 41.592 11.039 19.534  1.00 36.83  ? 930  GLY A CA  1 
ATOM   1685 C  C   . GLY A 1 235 ? 40.931 11.829 20.647  1.00 34.64  ? 930  GLY A C   1 
ATOM   1686 O  O   . GLY A 1 235 ? 40.070 11.301 21.352  1.00 36.07  ? 930  GLY A O   1 
ATOM   1687 N  N   . GLU A 1 236 ? 41.319 13.097 20.800  1.00 35.18  ? 931  GLU A N   1 
ATOM   1688 C  CA  . GLU A 1 236 ? 40.740 13.951 21.844  1.00 31.69  ? 931  GLU A CA  1 
ATOM   1689 C  C   . GLU A 1 236 ? 39.355 14.376 21.407  1.00 29.64  ? 931  GLU A C   1 
ATOM   1690 O  O   . GLU A 1 236 ? 39.127 14.609 20.220  1.00 28.18  ? 931  GLU A O   1 
ATOM   1691 C  CB  . GLU A 1 236 ? 41.587 15.203 22.109  1.00 30.09  ? 931  GLU A CB  1 
ATOM   1692 C  CG  . GLU A 1 236 ? 43.062 14.942 22.447  1.00 34.75  ? 931  GLU A CG  1 
ATOM   1693 C  CD  . GLU A 1 236 ? 43.857 16.225 22.588  1.00 47.44  ? 931  GLU A CD  1 
ATOM   1694 O  OE1 . GLU A 1 236 ? 45.057 16.223 22.222  1.00 52.38  ? 931  GLU A OE1 1 
ATOM   1695 O  OE2 . GLU A 1 236 ? 43.290 17.234 23.067  1.00 48.55  ? 931  GLU A OE2 1 
ATOM   1696 N  N   . ARG A 1 237 ? 38.434 14.463 22.367  1.00 28.46  ? 932  ARG A N   1 
ATOM   1697 C  CA  . ARG A 1 237 ? 37.065 14.886 22.105  1.00 27.27  ? 932  ARG A CA  1 
ATOM   1698 C  C   . ARG A 1 237 ? 36.600 15.821 23.212  1.00 27.15  ? 932  ARG A C   1 
ATOM   1699 O  O   . ARG A 1 237 ? 37.275 15.982 24.238  1.00 30.35  ? 932  ARG A O   1 
ATOM   1700 C  CB  . ARG A 1 237 ? 36.113 13.679 22.010  1.00 25.76  ? 932  ARG A CB  1 
ATOM   1701 C  CG  . ARG A 1 237 ? 36.391 12.680 20.851  1.00 27.95  ? 932  ARG A CG  1 
ATOM   1702 C  CD  . ARG A 1 237 ? 36.086 13.291 19.483  1.00 26.14  ? 932  ARG A CD  1 
ATOM   1703 N  NE  . ARG A 1 237 ? 36.317 12.334 18.390  1.00 29.11  ? 932  ARG A NE  1 
ATOM   1704 C  CZ  . ARG A 1 237 ? 37.493 12.106 17.798  1.00 31.50  ? 932  ARG A CZ  1 
ATOM   1705 N  NH1 . ARG A 1 237 ? 37.565 11.222 16.804  1.00 32.96  ? 932  ARG A NH1 1 
ATOM   1706 N  NH2 . ARG A 1 237 ? 38.595 12.746 18.182  1.00 30.12  ? 932  ARG A NH2 1 
ATOM   1707 N  N   . LEU A 1 238 ? 35.426 16.415 23.008  1.00 24.31  ? 933  LEU A N   1 
ATOM   1708 C  CA  . LEU A 1 238 ? 34.788 17.214 24.057  1.00 23.89  ? 933  LEU A CA  1 
ATOM   1709 C  C   . LEU A 1 238 ? 34.539 16.321 25.301  1.00 26.68  ? 933  LEU A C   1 
ATOM   1710 O  O   . LEU A 1 238 ? 34.194 15.137 25.156  1.00 28.25  ? 933  LEU A O   1 
ATOM   1711 C  CB  . LEU A 1 238 ? 33.466 17.770 23.531  1.00 24.45  ? 933  LEU A CB  1 
ATOM   1712 C  CG  . LEU A 1 238 ? 33.620 18.838 22.438  1.00 26.43  ? 933  LEU A CG  1 
ATOM   1713 C  CD1 . LEU A 1 238 ? 32.279 19.099 21.726  1.00 26.50  ? 933  LEU A CD1 1 
ATOM   1714 C  CD2 . LEU A 1 238 ? 34.219 20.124 23.014  1.00 27.41  ? 933  LEU A CD2 1 
ATOM   1715 N  N   . PRO A 1 239 ? 34.699 16.885 26.510  1.00 26.67  ? 934  PRO A N   1 
ATOM   1716 C  CA  . PRO A 1 239 ? 34.630 16.088 27.731  1.00 27.54  ? 934  PRO A CA  1 
ATOM   1717 C  C   . PRO A 1 239 ? 33.198 15.742 28.126  1.00 28.74  ? 934  PRO A C   1 
ATOM   1718 O  O   . PRO A 1 239 ? 32.257 16.382 27.666  1.00 28.17  ? 934  PRO A O   1 
ATOM   1719 C  CB  . PRO A 1 239 ? 35.262 17.004 28.785  1.00 29.77  ? 934  PRO A CB  1 
ATOM   1720 C  CG  . PRO A 1 239 ? 34.965 18.379 28.306  1.00 30.40  ? 934  PRO A CG  1 
ATOM   1721 C  CD  . PRO A 1 239 ? 34.966 18.311 26.793  1.00 28.52  ? 934  PRO A CD  1 
ATOM   1722 N  N   . GLN A 1 240 ? 33.044 14.721 28.968  1.00 26.08  ? 935  GLN A N   1 
ATOM   1723 C  CA  . GLN A 1 240 ? 31.719 14.327 29.469  1.00 24.00  ? 935  GLN A CA  1 
ATOM   1724 C  C   . GLN A 1 240 ? 31.095 15.451 30.293  1.00 25.30  ? 935  GLN A C   1 
ATOM   1725 O  O   . GLN A 1 240 ? 31.697 15.905 31.253  1.00 28.79  ? 935  GLN A O   1 
ATOM   1726 C  CB  . GLN A 1 240 ? 31.864 13.086 30.360  1.00 26.34  ? 935  GLN A CB  1 
ATOM   1727 C  CG  . GLN A 1 240 ? 30.538 12.512 30.907  1.00 27.46  ? 935  GLN A CG  1 
ATOM   1728 C  CD  . GLN A 1 240 ? 30.747 11.176 31.631  1.00 31.17  ? 935  GLN A CD  1 
ATOM   1729 O  OE1 . GLN A 1 240 ? 31.855 10.644 31.649  1.00 34.81  ? 935  GLN A OE1 1 
ATOM   1730 N  NE2 . GLN A 1 240 ? 29.686 10.639 32.225  1.00 31.33  ? 935  GLN A NE2 1 
ATOM   1731 N  N   . PRO A 1 241 ? 29.890 15.919 29.897  1.00 24.98  ? 936  PRO A N   1 
ATOM   1732 C  CA  . PRO A 1 241 ? 29.218 16.950 30.715  1.00 27.15  ? 936  PRO A CA  1 
ATOM   1733 C  C   . PRO A 1 241 ? 28.869 16.424 32.110  1.00 29.41  ? 936  PRO A C   1 
ATOM   1734 O  O   . PRO A 1 241 ? 28.385 15.293 32.226  1.00 28.08  ? 936  PRO A O   1 
ATOM   1735 C  CB  . PRO A 1 241 ? 27.941 17.231 29.935  1.00 27.26  ? 936  PRO A CB  1 
ATOM   1736 C  CG  . PRO A 1 241 ? 28.306 16.909 28.504  1.00 25.91  ? 936  PRO A CG  1 
ATOM   1737 C  CD  . PRO A 1 241 ? 29.216 15.712 28.604  1.00 25.67  ? 936  PRO A CD  1 
ATOM   1738 N  N   . PRO A 1 242 ? 29.101 17.239 33.157  1.00 28.29  ? 937  PRO A N   1 
ATOM   1739 C  CA  . PRO A 1 242 ? 28.856 16.816 34.537  1.00 32.13  ? 937  PRO A CA  1 
ATOM   1740 C  C   . PRO A 1 242 ? 27.516 16.117 34.766  1.00 30.95  ? 937  PRO A C   1 
ATOM   1741 O  O   . PRO A 1 242 ? 27.477 15.143 35.526  1.00 32.54  ? 937  PRO A O   1 
ATOM   1742 C  CB  . PRO A 1 242 ? 28.904 18.139 35.316  1.00 32.51  ? 937  PRO A CB  1 
ATOM   1743 C  CG  . PRO A 1 242 ? 29.873 18.966 34.555  1.00 34.53  ? 937  PRO A CG  1 
ATOM   1744 C  CD  . PRO A 1 242 ? 29.719 18.581 33.099  1.00 31.17  ? 937  PRO A CD  1 
ATOM   1745 N  N   . ILE A 1 243 ? 26.444 16.583 34.117  1.00 29.04  ? 938  ILE A N   1 
ATOM   1746 C  CA  . ILE A 1 243 ? 25.107 15.997 34.314  1.00 27.48  ? 938  ILE A CA  1 
ATOM   1747 C  C   . ILE A 1 243 ? 24.878 14.655 33.598  1.00 27.07  ? 938  ILE A C   1 
ATOM   1748 O  O   . ILE A 1 243 ? 23.905 13.962 33.874  1.00 29.84  ? 938  ILE A O   1 
ATOM   1749 C  CB  . ILE A 1 243 ? 23.932 16.987 33.941  1.00 27.56  ? 938  ILE A CB  1 
ATOM   1750 C  CG1 . ILE A 1 243 ? 23.856 17.248 32.430  1.00 25.92  ? 938  ILE A CG1 1 
ATOM   1751 C  CG2 . ILE A 1 243 ? 24.047 18.300 34.724  1.00 27.10  ? 938  ILE A CG2 1 
ATOM   1752 C  CD1 . ILE A 1 243 ? 22.513 17.931 31.991  1.00 26.05  ? 938  ILE A CD1 1 
ATOM   1753 N  N   . CYS A 1 244 ? 25.748 14.319 32.647  1.00 27.31  ? 939  CYS A N   1 
ATOM   1754 C  CA  . CYS A 1 244 ? 25.510 13.160 31.795  1.00 25.73  ? 939  CYS A CA  1 
ATOM   1755 C  C   . CYS A 1 244 ? 26.002 11.874 32.417  1.00 27.22  ? 939  CYS A C   1 
ATOM   1756 O  O   . CYS A 1 244 ? 27.169 11.777 32.832  1.00 29.68  ? 939  CYS A O   1 
ATOM   1757 C  CB  . CYS A 1 244 ? 26.224 13.318 30.461  1.00 24.12  ? 939  CYS A CB  1 
ATOM   1758 S  SG  . CYS A 1 244 ? 25.532 14.619 29.425  1.00 28.55  ? 939  CYS A SG  1 
ATOM   1759 N  N   . THR A 1 245 ? 25.135 10.874 32.411  1.00 27.88  ? 940  THR A N   1 
ATOM   1760 C  CA  . THR A 1 245 ? 25.589 9.504  32.628  1.00 29.32  ? 940  THR A CA  1 
ATOM   1761 C  C   . THR A 1 245 ? 26.442 9.084  31.430  1.00 28.65  ? 940  THR A C   1 
ATOM   1762 O  O   . THR A 1 245 ? 26.434 9.738  30.381  1.00 28.99  ? 940  THR A O   1 
ATOM   1763 C  CB  . THR A 1 245 ? 24.404 8.538  32.750  1.00 30.90  ? 940  THR A CB  1 
ATOM   1764 O  OG1 . THR A 1 245 ? 23.599 8.627  31.566  1.00 31.07  ? 940  THR A OG1 1 
ATOM   1765 C  CG2 . THR A 1 245 ? 23.556 8.856  34.002  1.00 31.78  ? 940  THR A CG2 1 
ATOM   1766 N  N   . ILE A 1 246 ? 27.166 7.976  31.571  1.00 27.67  ? 941  ILE A N   1 
ATOM   1767 C  CA  . ILE A 1 246 ? 27.985 7.472  30.486  1.00 28.63  ? 941  ILE A CA  1 
ATOM   1768 C  C   . ILE A 1 246 ? 27.131 7.086  29.267  1.00 29.10  ? 941  ILE A C   1 
ATOM   1769 O  O   . ILE A 1 246 ? 27.573 7.258  28.135  1.00 28.30  ? 941  ILE A O   1 
ATOM   1770 C  CB  . ILE A 1 246 ? 28.953 6.324  30.957  1.00 32.30  ? 941  ILE A CB  1 
ATOM   1771 C  CG1 . ILE A 1 246 ? 30.111 6.139  29.969  1.00 35.86  ? 941  ILE A CG1 1 
ATOM   1772 C  CG2 . ILE A 1 246 ? 28.203 5.024  31.185  1.00 34.51  ? 941  ILE A CG2 1 
ATOM   1773 C  CD1 . ILE A 1 246 ? 31.122 7.270  29.995  1.00 44.15  ? 941  ILE A CD1 1 
ATOM   1774 N  N   . ASP A 1 247 ? 25.894 6.634  29.509  1.00 28.79  ? 942  ASP A N   1 
ATOM   1775 C  CA  . ASP A 1 247 ? 24.960 6.260  28.437  1.00 29.73  ? 942  ASP A CA  1 
ATOM   1776 C  C   . ASP A 1 247 ? 24.764 7.421  27.461  1.00 28.22  ? 942  ASP A C   1 
ATOM   1777 O  O   . ASP A 1 247 ? 24.788 7.240  26.237  1.00 27.64  ? 942  ASP A O   1 
ATOM   1778 C  CB  . ASP A 1 247 ? 23.584 5.908  29.025  1.00 33.27  ? 942  ASP A CB  1 
ATOM   1779 C  CG  . ASP A 1 247 ? 23.652 4.860  30.121  1.00 46.30  ? 942  ASP A CG  1 
ATOM   1780 O  OD1 . ASP A 1 247 ? 23.088 3.774  29.902  1.00 44.71  ? 942  ASP A OD1 1 
ATOM   1781 O  OD2 . ASP A 1 247 ? 24.243 5.123  31.197  1.00 51.86  ? 942  ASP A OD2 1 
ATOM   1782 N  N   . VAL A 1 248 ? 24.567 8.611  28.018  1.00 27.08  ? 943  VAL A N   1 
ATOM   1783 C  CA  . VAL A 1 248 ? 24.322 9.799  27.193  1.00 26.24  ? 943  VAL A CA  1 
ATOM   1784 C  C   . VAL A 1 248 ? 25.616 10.250 26.536  1.00 25.51  ? 943  VAL A C   1 
ATOM   1785 O  O   . VAL A 1 248 ? 25.627 10.591 25.350  1.00 26.10  ? 943  VAL A O   1 
ATOM   1786 C  CB  . VAL A 1 248 ? 23.658 10.952 28.000  1.00 25.50  ? 943  VAL A CB  1 
ATOM   1787 C  CG1 . VAL A 1 248 ? 23.490 12.195 27.126  1.00 28.25  ? 943  VAL A CG1 1 
ATOM   1788 C  CG2 . VAL A 1 248 ? 22.300 10.510 28.546  1.00 26.90  ? 943  VAL A CG2 1 
ATOM   1789 N  N   . TYR A 1 249 ? 26.714 10.239 27.287  1.00 25.20  ? 944  TYR A N   1 
ATOM   1790 C  CA  . TYR A 1 249 ? 28.000 10.635 26.730  1.00 26.33  ? 944  TYR A CA  1 
ATOM   1791 C  C   . TYR A 1 249 ? 28.403 9.721  25.574  1.00 23.83  ? 944  TYR A C   1 
ATOM   1792 O  O   . TYR A 1 249 ? 28.917 10.191 24.571  1.00 25.75  ? 944  TYR A O   1 
ATOM   1793 C  CB  . TYR A 1 249 ? 29.077 10.696 27.816  1.00 27.81  ? 944  TYR A CB  1 
ATOM   1794 C  CG  . TYR A 1 249 ? 30.395 11.256 27.346  1.00 24.76  ? 944  TYR A CG  1 
ATOM   1795 C  CD1 . TYR A 1 249 ? 31.579 10.581 27.613  1.00 25.88  ? 944  TYR A CD1 1 
ATOM   1796 C  CD2 . TYR A 1 249 ? 30.462 12.462 26.624  1.00 26.22  ? 944  TYR A CD2 1 
ATOM   1797 C  CE1 . TYR A 1 249 ? 32.808 11.073 27.198  1.00 30.09  ? 944  TYR A CE1 1 
ATOM   1798 C  CE2 . TYR A 1 249 ? 31.709 12.968 26.200  1.00 24.65  ? 944  TYR A CE2 1 
ATOM   1799 C  CZ  . TYR A 1 249 ? 32.863 12.265 26.502  1.00 27.51  ? 944  TYR A CZ  1 
ATOM   1800 O  OH  . TYR A 1 249 ? 34.084 12.739 26.088  1.00 28.97  ? 944  TYR A OH  1 
ATOM   1801 N  N   . MET A 1 250 ? 28.111 8.428  25.685  1.00 24.04  ? 945  MET A N   1 
ATOM   1802 C  CA  . MET A 1 250 ? 28.482 7.496  24.629  1.00 26.50  ? 945  MET A CA  1 
ATOM   1803 C  C   . MET A 1 250 ? 27.771 7.821  23.323  1.00 26.19  ? 945  MET A C   1 
ATOM   1804 O  O   . MET A 1 250 ? 28.329 7.586  22.250  1.00 25.32  ? 945  MET A O   1 
ATOM   1805 C  CB  . MET A 1 250 ? 28.222 6.045  25.034  1.00 28.89  ? 945  MET A CB  1 
ATOM   1806 C  CG  . MET A 1 250 ? 29.327 5.418  25.908  1.00 31.07  ? 945  MET A CG  1 
ATOM   1807 S  SD  . MET A 1 250 ? 31.043 5.795  25.419  1.00 45.74  ? 945  MET A SD  1 
ATOM   1808 C  CE  . MET A 1 250 ? 31.359 7.169  26.504  1.00 51.37  ? 945  MET A CE  1 
ATOM   1809 N  N   . ILE A 1 251 ? 26.549 8.343  23.415  1.00 24.96  ? 946  ILE A N   1 
ATOM   1810 C  CA  . ILE A 1 251 ? 25.851 8.796  22.205  1.00 26.43  ? 946  ILE A CA  1 
ATOM   1811 C  C   . ILE A 1 251 ? 26.660 9.901  21.537  1.00 22.42  ? 946  ILE A C   1 
ATOM   1812 O  O   . ILE A 1 251 ? 26.942 9.818  20.336  1.00 24.17  ? 946  ILE A O   1 
ATOM   1813 C  CB  . ILE A 1 251 ? 24.411 9.284  22.486  1.00 26.05  ? 946  ILE A CB  1 
ATOM   1814 C  CG1 . ILE A 1 251 ? 23.556 8.132  22.995  1.00 27.54  ? 946  ILE A CG1 1 
ATOM   1815 C  CG2 . ILE A 1 251 ? 23.789 9.905  21.211  1.00 28.91  ? 946  ILE A CG2 1 
ATOM   1816 C  CD1 . ILE A 1 251 ? 22.214 8.604  23.531  1.00 34.24  ? 946  ILE A CD1 1 
ATOM   1817 N  N   . MET A 1 252 ? 27.024 10.931 22.304  1.00 22.67  ? 947  MET A N   1 
ATOM   1818 C  CA  . MET A 1 252 ? 27.890 12.012 21.793  1.00 24.40  ? 947  MET A CA  1 
ATOM   1819 C  C   . MET A 1 252 ? 29.190 11.469 21.155  1.00 23.85  ? 947  MET A C   1 
ATOM   1820 O  O   . MET A 1 252 ? 29.532 11.817 20.014  1.00 22.66  ? 947  MET A O   1 
ATOM   1821 C  CB  . MET A 1 252 ? 28.222 13.030 22.913  1.00 24.08  ? 947  MET A CB  1 
ATOM   1822 C  CG  . MET A 1 252 ? 27.164 14.068 23.157  1.00 30.72  ? 947  MET A CG  1 
ATOM   1823 S  SD  . MET A 1 252 ? 27.570 14.913 24.730  1.00 33.97  ? 947  MET A SD  1 
ATOM   1824 C  CE  . MET A 1 252 ? 26.394 14.077 25.755  1.00 31.76  ? 947  MET A CE  1 
ATOM   1825 N  N   . VAL A 1 253 ? 29.894 10.600 21.883  1.00 23.14  ? 948  VAL A N   1 
ATOM   1826 C  CA  . VAL A 1 253 ? 31.193 10.060 21.443  1.00 22.80  ? 948  VAL A CA  1 
ATOM   1827 C  C   . VAL A 1 253 ? 31.023 9.324  20.113  1.00 22.66  ? 948  VAL A C   1 
ATOM   1828 O  O   . VAL A 1 253 ? 31.860 9.429  19.217  1.00 23.66  ? 948  VAL A O   1 
ATOM   1829 C  CB  . VAL A 1 253 ? 31.790 9.167  22.554  1.00 24.57  ? 948  VAL A CB  1 
ATOM   1830 C  CG1 . VAL A 1 253 ? 33.051 8.455  22.102  1.00 30.23  ? 948  VAL A CG1 1 
ATOM   1831 C  CG2 . VAL A 1 253 ? 32.125 10.049 23.767  1.00 25.55  ? 948  VAL A CG2 1 
ATOM   1832 N  N   . LYS A 1 254 ? 29.913 8.596  19.988  1.00 23.29  ? 949  LYS A N   1 
ATOM   1833 C  CA  . LYS A 1 254 ? 29.655 7.834  18.767  1.00 23.09  ? 949  LYS A CA  1 
ATOM   1834 C  C   . LYS A 1 254 ? 29.404 8.793  17.610  1.00 21.91  ? 949  LYS A C   1 
ATOM   1835 O  O   . LYS A 1 254 ? 29.741 8.490  16.463  1.00 21.79  ? 949  LYS A O   1 
ATOM   1836 C  CB  . LYS A 1 254 ? 28.438 6.913  18.941  1.00 24.50  ? 949  LYS A CB  1 
ATOM   1837 C  CG  . LYS A 1 254 ? 28.749 5.688  19.801  1.00 33.37  ? 949  LYS A CG  1 
ATOM   1838 C  CD  . LYS A 1 254 ? 27.519 4.841  20.039  1.00 38.72  ? 949  LYS A CD  1 
ATOM   1839 C  CE  . LYS A 1 254 ? 27.843 3.714  20.995  1.00 52.05  ? 949  LYS A CE  1 
ATOM   1840 N  NZ  . LYS A 1 254 ? 26.626 3.275  21.728  1.00 59.08  ? 949  LYS A NZ  1 
ATOM   1841 N  N   . CYS A 1 255 ? 28.785 9.942  17.895  1.00 22.07  ? 950  CYS A N   1 
ATOM   1842 C  CA  . CYS A 1 255 ? 28.642 10.961 16.841  1.00 22.82  ? 950  CYS A CA  1 
ATOM   1843 C  C   . CYS A 1 255 ? 29.979 11.517 16.301  1.00 19.78  ? 950  CYS A C   1 
ATOM   1844 O  O   . CYS A 1 255 ? 30.001 12.110 15.203  1.00 21.56  ? 950  CYS A O   1 
ATOM   1845 C  CB  . CYS A 1 255 ? 27.798 12.120 17.330  1.00 18.47  ? 950  CYS A CB  1 
ATOM   1846 S  SG  . CYS A 1 255 ? 26.088 11.721 17.634  1.00 23.54  ? 950  CYS A SG  1 
ATOM   1847 N  N   . TRP A 1 256 ? 31.067 11.380 17.071  1.00 19.38  ? 951  TRP A N   1 
ATOM   1848 C  CA  . TRP A 1 256 ? 32.365 11.950 16.716  1.00 22.39  ? 951  TRP A CA  1 
ATOM   1849 C  C   . TRP A 1 256 ? 33.382 10.897 16.294  1.00 21.77  ? 951  TRP A C   1 
ATOM   1850 O  O   . TRP A 1 256 ? 34.600 11.135 16.328  1.00 24.53  ? 951  TRP A O   1 
ATOM   1851 C  CB  . TRP A 1 256 ? 32.919 12.790 17.875  1.00 25.68  ? 951  TRP A CB  1 
ATOM   1852 C  CG  . TRP A 1 256 ? 31.972 13.822 18.396  1.00 22.66  ? 951  TRP A CG  1 
ATOM   1853 C  CD1 . TRP A 1 256 ? 31.093 14.587 17.668  1.00 20.80  ? 951  TRP A CD1 1 
ATOM   1854 C  CD2 . TRP A 1 256 ? 31.806 14.189 19.761  1.00 20.91  ? 951  TRP A CD2 1 
ATOM   1855 N  NE1 . TRP A 1 256 ? 30.394 15.428 18.516  1.00 22.55  ? 951  TRP A NE1 1 
ATOM   1856 C  CE2 . TRP A 1 256 ? 30.805 15.199 19.806  1.00 22.60  ? 951  TRP A CE2 1 
ATOM   1857 C  CE3 . TRP A 1 256 ? 32.396 13.753 20.960  1.00 23.70  ? 951  TRP A CE3 1 
ATOM   1858 C  CZ2 . TRP A 1 256 ? 30.397 15.792 21.000  1.00 25.20  ? 951  TRP A CZ2 1 
ATOM   1859 C  CZ3 . TRP A 1 256 ? 31.983 14.350 22.162  1.00 26.16  ? 951  TRP A CZ3 1 
ATOM   1860 C  CH2 . TRP A 1 256 ? 30.986 15.351 22.161  1.00 25.73  ? 951  TRP A CH2 1 
ATOM   1861 N  N   . MET A 1 257 ? 32.909 9.727  15.893  1.00 22.31  ? 952  MET A N   1 
ATOM   1862 C  CA  . MET A 1 257 ? 33.812 8.703  15.380  1.00 26.27  ? 952  MET A CA  1 
ATOM   1863 C  C   . MET A 1 257 ? 34.363 9.146  14.039  1.00 26.25  ? 952  MET A C   1 
ATOM   1864 O  O   . MET A 1 257 ? 33.669 9.802  13.261  1.00 26.15  ? 952  MET A O   1 
ATOM   1865 C  CB  . MET A 1 257 ? 33.048 7.392  15.254  1.00 24.73  ? 952  MET A CB  1 
ATOM   1866 C  CG  . MET A 1 257 ? 32.660 6.876  16.611  1.00 33.06  ? 952  MET A CG  1 
ATOM   1867 S  SD  . MET A 1 257 ? 32.210 5.154  16.582  1.00 41.37  ? 952  MET A SD  1 
ATOM   1868 C  CE  . MET A 1 257 ? 30.516 5.195  16.089  1.00 33.89  ? 952  MET A CE  1 
ATOM   1869 N  N   . ILE A 1 258 ? 35.629 8.818  13.788  1.00 26.89  ? 953  ILE A N   1 
ATOM   1870 C  CA  . ILE A 1 258 ? 36.246 9.191  12.523  1.00 27.37  ? 953  ILE A CA  1 
ATOM   1871 C  C   . ILE A 1 258 ? 35.511 8.536  11.356  1.00 28.80  ? 953  ILE A C   1 
ATOM   1872 O  O   . ILE A 1 258 ? 35.305 9.164  10.312  1.00 27.76  ? 953  ILE A O   1 
ATOM   1873 C  CB  . ILE A 1 258 ? 37.767 8.872  12.522  1.00 29.37  ? 953  ILE A CB  1 
ATOM   1874 C  CG1 . ILE A 1 258 ? 38.486 9.686  13.607  1.00 32.51  ? 953  ILE A CG1 1 
ATOM   1875 C  CG2 . ILE A 1 258 ? 38.390 9.132  11.143  1.00 29.56  ? 953  ILE A CG2 1 
ATOM   1876 C  CD1 . ILE A 1 258 ? 38.211 11.186 13.567  1.00 34.41  ? 953  ILE A CD1 1 
ATOM   1877 N  N   . ASP A 1 259 ? 35.086 7.290  11.546  1.00 28.58  ? 954  ASP A N   1 
ATOM   1878 C  CA  . ASP A 1 259 ? 34.312 6.574  10.516  1.00 31.48  ? 954  ASP A CA  1 
ATOM   1879 C  C   . ASP A 1 259 ? 32.889 7.093  10.457  1.00 29.09  ? 954  ASP A C   1 
ATOM   1880 O  O   . ASP A 1 259 ? 32.035 6.710  11.264  1.00 27.42  ? 954  ASP A O   1 
ATOM   1881 C  CB  . ASP A 1 259 ? 34.362 5.046  10.755  1.00 33.71  ? 954  ASP A CB  1 
ATOM   1882 C  CG  . ASP A 1 259 ? 33.485 4.240  9.769   1.00 38.55  ? 954  ASP A CG  1 
ATOM   1883 O  OD1 . ASP A 1 259 ? 33.350 3.019  9.988   1.00 45.59  ? 954  ASP A OD1 1 
ATOM   1884 O  OD2 . ASP A 1 259 ? 32.925 4.789  8.784   1.00 34.23  ? 954  ASP A OD2 1 
ATOM   1885 N  N   . ALA A 1 260 ? 32.632 7.978  9.487   1.00 25.44  ? 955  ALA A N   1 
ATOM   1886 C  CA  . ALA A 1 260 ? 31.333 8.629  9.353   1.00 26.14  ? 955  ALA A CA  1 
ATOM   1887 C  C   . ALA A 1 260 ? 30.195 7.622  9.226   1.00 24.53  ? 955  ALA A C   1 
ATOM   1888 O  O   . ALA A 1 260 ? 29.108 7.822  9.780   1.00 24.73  ? 955  ALA A O   1 
ATOM   1889 C  CB  . ALA A 1 260 ? 31.342 9.591  8.144   1.00 25.06  ? 955  ALA A CB  1 
ATOM   1890 N  N   . ASP A 1 261 ? 30.440 6.528  8.495   1.00 27.79  ? 956  ASP A N   1 
ATOM   1891 C  CA  . ASP A 1 261 ? 29.406 5.513  8.287   1.00 30.34  ? 956  ASP A CA  1 
ATOM   1892 C  C   . ASP A 1 261 ? 29.016 4.778  9.581   1.00 30.54  ? 956  ASP A C   1 
ATOM   1893 O  O   . ASP A 1 261 ? 27.902 4.237  9.671   1.00 33.36  ? 956  ASP A O   1 
ATOM   1894 C  CB  . ASP A 1 261 ? 29.856 4.478  7.245   1.00 29.77  ? 956  ASP A CB  1 
ATOM   1895 C  CG  . ASP A 1 261 ? 29.845 5.018  5.822   1.00 35.59  ? 956  ASP A CG  1 
ATOM   1896 O  OD1 . ASP A 1 261 ? 29.003 5.886  5.488   1.00 32.81  ? 956  ASP A OD1 1 
ATOM   1897 O  OD2 . ASP A 1 261 ? 30.655 4.527  5.017   1.00 33.87  ? 956  ASP A OD2 1 
ATOM   1898 N  N   . SER A 1 262 ? 29.923 4.779  10.558  1.00 28.54  ? 957  SER A N   1 
ATOM   1899 C  CA  . SER A 1 262 ? 29.717 4.167  11.887  1.00 28.34  ? 957  SER A CA  1 
ATOM   1900 C  C   . SER A 1 262 ? 28.984 5.046  12.902  1.00 28.27  ? 957  SER A C   1 
ATOM   1901 O  O   . SER A 1 262 ? 28.522 4.543  13.939  1.00 29.60  ? 957  SER A O   1 
ATOM   1902 C  CB  . SER A 1 262 ? 31.060 3.764  12.500  1.00 32.30  ? 957  SER A CB  1 
ATOM   1903 O  OG  . SER A 1 262 ? 31.512 2.543  11.942  1.00 41.48  ? 957  SER A OG  1 
ATOM   1904 N  N   . ARG A 1 263 ? 28.885 6.346  12.627  1.00 24.61  ? 958  ARG A N   1 
ATOM   1905 C  CA  . ARG A 1 263 ? 28.097 7.240  13.484  1.00 22.20  ? 958  ARG A CA  1 
ATOM   1906 C  C   . ARG A 1 263 ? 26.638 6.834  13.476  1.00 21.45  ? 958  ARG A C   1 
ATOM   1907 O  O   . ARG A 1 263 ? 26.166 6.236  12.506  1.00 24.96  ? 958  ARG A O   1 
ATOM   1908 C  CB  . ARG A 1 263 ? 28.214 8.699  13.009  1.00 21.16  ? 958  ARG A CB  1 
ATOM   1909 C  CG  . ARG A 1 263 ? 29.674 9.175  13.056  1.00 21.65  ? 958  ARG A CG  1 
ATOM   1910 C  CD  . ARG A 1 263 ? 29.858 10.553 12.437  1.00 19.35  ? 958  ARG A CD  1 
ATOM   1911 N  NE  . ARG A 1 263 ? 31.272 10.800 12.169  1.00 20.35  ? 958  ARG A NE  1 
ATOM   1912 C  CZ  . ARG A 1 263 ? 31.756 11.572 11.193  1.00 22.11  ? 958  ARG A CZ  1 
ATOM   1913 N  NH1 . ARG A 1 263 ? 33.051 11.625 11.005  1.00 22.44  ? 958  ARG A NH1 1 
ATOM   1914 N  NH2 . ARG A 1 263 ? 30.964 12.283 10.385  1.00 20.84  ? 958  ARG A NH2 1 
ATOM   1915 N  N   . PRO A 1 264 ? 25.905 7.186  14.545  1.00 22.71  ? 959  PRO A N   1 
ATOM   1916 C  CA  . PRO A 1 264 ? 24.461 6.919  14.561  1.00 22.41  ? 959  PRO A CA  1 
ATOM   1917 C  C   . PRO A 1 264 ? 23.790 7.641  13.402  1.00 23.43  ? 959  PRO A C   1 
ATOM   1918 O  O   . PRO A 1 264 ? 24.320 8.641  12.901  1.00 23.33  ? 959  PRO A O   1 
ATOM   1919 C  CB  . PRO A 1 264 ? 23.990 7.543  15.874  1.00 26.83  ? 959  PRO A CB  1 
ATOM   1920 C  CG  . PRO A 1 264 ? 25.226 7.696  16.710  1.00 26.46  ? 959  PRO A CG  1 
ATOM   1921 C  CD  . PRO A 1 264 ? 26.347 7.922  15.747  1.00 24.34  ? 959  PRO A CD  1 
ATOM   1922 N  N   . LYS A 1 265 ? 22.654 7.116  12.976  1.00 23.53  ? 960  LYS A N   1 
ATOM   1923 C  CA  . LYS A 1 265 ? 21.785 7.822  12.027  1.00 25.17  ? 960  LYS A CA  1 
ATOM   1924 C  C   . LYS A 1 265 ? 20.776 8.620  12.816  1.00 22.50  ? 960  LYS A C   1 
ATOM   1925 O  O   . LYS A 1 265 ? 20.427 8.229  13.941  1.00 22.33  ? 960  LYS A O   1 
ATOM   1926 C  CB  . LYS A 1 265 ? 21.029 6.828  11.152  1.00 24.11  ? 960  LYS A CB  1 
ATOM   1927 C  CG  . LYS A 1 265 ? 21.946 5.806  10.468  1.00 29.79  ? 960  LYS A CG  1 
ATOM   1928 C  CD  . LYS A 1 265 ? 22.926 6.510  9.544   1.00 34.48  ? 960  LYS A CD  1 
ATOM   1929 C  CE  . LYS A 1 265 ? 24.015 5.541  9.091   1.00 46.65  ? 960  LYS A CE  1 
ATOM   1930 N  NZ  . LYS A 1 265 ? 24.150 5.544  7.614   1.00 56.33  ? 960  LYS A NZ  1 
ATOM   1931 N  N   . PHE A 1 266 ? 20.270 9.710  12.230  1.00 21.55  ? 961  PHE A N   1 
ATOM   1932 C  CA  . PHE A 1 266 ? 19.240 10.497 12.936  1.00 20.66  ? 961  PHE A CA  1 
ATOM   1933 C  C   . PHE A 1 266 ? 18.007 9.663  13.351  1.00 22.83  ? 961  PHE A C   1 
ATOM   1934 O  O   . PHE A 1 266 ? 17.487 9.864  14.446  1.00 21.55  ? 961  PHE A O   1 
ATOM   1935 C  CB  . PHE A 1 266 ? 18.833 11.764 12.164  1.00 21.94  ? 961  PHE A CB  1 
ATOM   1936 C  CG  . PHE A 1 266 ? 19.912 12.838 12.137  1.00 21.43  ? 961  PHE A CG  1 
ATOM   1937 C  CD1 . PHE A 1 266 ? 20.299 13.489 13.314  1.00 21.72  ? 961  PHE A CD1 1 
ATOM   1938 C  CD2 . PHE A 1 266 ? 20.537 13.199 10.932  1.00 20.71  ? 961  PHE A CD2 1 
ATOM   1939 C  CE1 . PHE A 1 266 ? 21.311 14.455 13.304  1.00 24.87  ? 961  PHE A CE1 1 
ATOM   1940 C  CE2 . PHE A 1 266 ? 21.554 14.181 10.921  1.00 23.08  ? 961  PHE A CE2 1 
ATOM   1941 C  CZ  . PHE A 1 266 ? 21.931 14.809 12.106  1.00 17.07  ? 961  PHE A CZ  1 
ATOM   1942 N  N   . ARG A 1 267 ? 17.573 8.708  12.508  1.00 24.31  ? 962  ARG A N   1 
ATOM   1943 C  CA  . ARG A 1 267 ? 16.474 7.815  12.896  1.00 26.99  ? 962  ARG A CA  1 
ATOM   1944 C  C   . ARG A 1 267 ? 16.754 7.056  14.199  1.00 25.97  ? 962  ARG A C   1 
ATOM   1945 O  O   . ARG A 1 267 ? 15.854 6.903  15.035  1.00 27.47  ? 962  ARG A O   1 
ATOM   1946 C  CB  . ARG A 1 267 ? 16.068 6.850  11.763  1.00 28.25  ? 962  ARG A CB  1 
ATOM   1947 C  CG  . ARG A 1 267 ? 17.214 6.331  10.934  1.00 40.31  ? 962  ARG A CG  1 
ATOM   1948 C  CD  . ARG A 1 267 ? 17.410 4.826  11.084  1.00 51.54  ? 962  ARG A CD  1 
ATOM   1949 N  NE  . ARG A 1 267 ? 18.114 4.197  9.958   1.00 52.83  ? 962  ARG A NE  1 
ATOM   1950 C  CZ  . ARG A 1 267 ? 18.492 4.800  8.828   1.00 55.24  ? 962  ARG A CZ  1 
ATOM   1951 N  NH1 . ARG A 1 267 ? 19.123 4.095  7.895   1.00 59.64  ? 962  ARG A NH1 1 
ATOM   1952 N  NH2 . ARG A 1 267 ? 18.256 6.095  8.619   1.00 46.05  ? 962  ARG A NH2 1 
ATOM   1953 N  N   . GLU A 1 268 ? 17.996 6.618  14.365  1.00 25.89  ? 963  GLU A N   1 
ATOM   1954 C  CA  . GLU A 1 268 ? 18.419 5.863  15.556  1.00 26.44  ? 963  GLU A CA  1 
ATOM   1955 C  C   . GLU A 1 268 ? 18.491 6.788  16.754  1.00 24.12  ? 963  GLU A C   1 
ATOM   1956 O  O   . GLU A 1 268 ? 18.158 6.397  17.883  1.00 25.01  ? 963  GLU A O   1 
ATOM   1957 C  CB  . GLU A 1 268 ? 19.770 5.195  15.334  1.00 28.33  ? 963  GLU A CB  1 
ATOM   1958 C  CG  . GLU A 1 268 ? 19.740 4.125  14.230  1.00 31.14  ? 963  GLU A CG  1 
ATOM   1959 C  CD  . GLU A 1 268 ? 21.120 3.655  13.818  1.00 38.53  ? 963  GLU A CD  1 
ATOM   1960 O  OE1 . GLU A 1 268 ? 21.220 2.539  13.274  1.00 42.02  ? 963  GLU A OE1 1 
ATOM   1961 O  OE2 . GLU A 1 268 ? 22.109 4.376  14.040  1.00 33.00  ? 963  GLU A OE2 1 
ATOM   1962 N  N   . LEU A 1 269 ? 18.908 8.020  16.496  1.00 22.01  ? 964  LEU A N   1 
ATOM   1963 C  CA  . LEU A 1 269 ? 19.012 9.019  17.565  1.00 21.83  ? 964  LEU A CA  1 
ATOM   1964 C  C   . LEU A 1 269 ? 17.637 9.415  18.094  1.00 24.14  ? 964  LEU A C   1 
ATOM   1965 O  O   . LEU A 1 269 ? 17.496 9.648  19.295  1.00 26.36  ? 964  LEU A O   1 
ATOM   1966 C  CB  . LEU A 1 269 ? 19.778 10.263 17.098  1.00 21.75  ? 964  LEU A CB  1 
ATOM   1967 C  CG  . LEU A 1 269 ? 21.267 10.015 16.819  1.00 22.08  ? 964  LEU A CG  1 
ATOM   1968 C  CD1 . LEU A 1 269 ? 21.859 11.138 15.988  1.00 23.36  ? 964  LEU A CD1 1 
ATOM   1969 C  CD2 . LEU A 1 269 ? 22.054 9.846  18.127  1.00 27.20  ? 964  LEU A CD2 1 
ATOM   1970 N  N   . ILE A 1 270 ? 16.626 9.476  17.215  1.00 23.07  ? 965  ILE A N   1 
ATOM   1971 C  CA  . ILE A 1 270 ? 15.247 9.739  17.644  1.00 23.38  ? 965  ILE A CA  1 
ATOM   1972 C  C   . ILE A 1 270 ? 14.811 8.635  18.605  1.00 26.75  ? 965  ILE A C   1 
ATOM   1973 O  O   . ILE A 1 270 ? 14.356 8.918  19.703  1.00 25.91  ? 965  ILE A O   1 
ATOM   1974 C  CB  . ILE A 1 270 ? 14.248 9.820  16.458  1.00 23.79  ? 965  ILE A CB  1 
ATOM   1975 C  CG1 . ILE A 1 270 ? 14.512 11.060 15.606  1.00 22.90  ? 965  ILE A CG1 1 
ATOM   1976 C  CG2 . ILE A 1 270 ? 12.808 9.870  16.975  1.00 25.16  ? 965  ILE A CG2 1 
ATOM   1977 C  CD1 . ILE A 1 270 ? 13.925 10.967 14.197  1.00 26.71  ? 965  ILE A CD1 1 
ATOM   1978 N  N   . ILE A 1 271 ? 14.983 7.387  18.185  1.00 25.74  ? 966  ILE A N   1 
ATOM   1979 C  CA  . ILE A 1 271 ? 14.649 6.217  19.009  1.00 26.57  ? 966  ILE A CA  1 
ATOM   1980 C  C   . ILE A 1 271 ? 15.368 6.209  20.367  1.00 27.16  ? 966  ILE A C   1 
ATOM   1981 O  O   . ILE A 1 271 ? 14.727 6.057  21.414  1.00 28.98  ? 966  ILE A O   1 
ATOM   1982 C  CB  . ILE A 1 271 ? 14.896 4.891  18.229  1.00 27.33  ? 966  ILE A CB  1 
ATOM   1983 C  CG1 . ILE A 1 271 ? 13.929 4.793  17.034  1.00 28.72  ? 966  ILE A CG1 1 
ATOM   1984 C  CG2 . ILE A 1 271 ? 14.755 3.654  19.172  1.00 32.29  ? 966  ILE A CG2 1 
ATOM   1985 C  CD1 . ILE A 1 271 ? 14.340 3.754  15.973  1.00 35.97  ? 966  ILE A CD1 1 
ATOM   1986 N  N   . GLU A 1 272 ? 16.683 6.407  20.365  1.00 25.54  ? 967  GLU A N   1 
ATOM   1987 C  CA  . GLU A 1 272 ? 17.437 6.333  21.623  1.00 26.95  ? 967  GLU A CA  1 
ATOM   1988 C  C   . GLU A 1 272 ? 17.072 7.453  22.589  1.00 26.05  ? 967  GLU A C   1 
ATOM   1989 O  O   . GLU A 1 272 ? 16.818 7.203  23.784  1.00 27.31  ? 967  GLU A O   1 
ATOM   1990 C  CB  . GLU A 1 272 ? 18.948 6.313  21.377  1.00 28.76  ? 967  GLU A CB  1 
ATOM   1991 C  CG  . GLU A 1 272 ? 19.738 6.221  22.690  1.00 40.75  ? 967  GLU A CG  1 
ATOM   1992 C  CD  . GLU A 1 272 ? 21.037 5.452  22.576  1.00 52.12  ? 967  GLU A CD  1 
ATOM   1993 O  OE1 . GLU A 1 272 ? 21.749 5.615  21.560  1.00 53.08  ? 967  GLU A OE1 1 
ATOM   1994 O  OE2 . GLU A 1 272 ? 21.356 4.694  23.523  1.00 57.62  ? 967  GLU A OE2 1 
ATOM   1995 N  N   . PHE A 1 273 ? 17.051 8.691  22.102  1.00 24.07  ? 968  PHE A N   1 
ATOM   1996 C  CA  . PHE A 1 273 ? 16.682 9.778  23.000  1.00 22.11  ? 968  PHE A CA  1 
ATOM   1997 C  C   . PHE A 1 273 ? 15.201 9.713  23.454  1.00 25.27  ? 968  PHE A C   1 
ATOM   1998 O  O   . PHE A 1 273 ? 14.888 10.124 24.577  1.00 24.34  ? 968  PHE A O   1 
ATOM   1999 C  CB  . PHE A 1 273 ? 17.040 11.158 22.401  1.00 23.95  ? 968  PHE A CB  1 
ATOM   2000 C  CG  . PHE A 1 273 ? 18.480 11.542 22.597  1.00 24.85  ? 968  PHE A CG  1 
ATOM   2001 C  CD1 . PHE A 1 273 ? 18.946 11.945 23.856  1.00 27.23  ? 968  PHE A CD1 1 
ATOM   2002 C  CD2 . PHE A 1 273 ? 19.351 11.564 21.527  1.00 24.84  ? 968  PHE A CD2 1 
ATOM   2003 C  CE1 . PHE A 1 273 ? 20.274 12.326 24.039  1.00 26.84  ? 968  PHE A CE1 1 
ATOM   2004 C  CE2 . PHE A 1 273 ? 20.691 11.949 21.698  1.00 25.12  ? 968  PHE A CE2 1 
ATOM   2005 C  CZ  . PHE A 1 273 ? 21.152 12.327 22.954  1.00 27.40  ? 968  PHE A CZ  1 
ATOM   2006 N  N   . SER A 1 274 ? 14.304 9.206  22.598  1.00 25.70  ? 969  SER A N   1 
ATOM   2007 C  CA  . SER A 1 274 ? 12.897 9.002  22.969  1.00 25.35  ? 969  SER A CA  1 
ATOM   2008 C  C   . SER A 1 274 ? 12.776 7.995  24.109  1.00 28.54  ? 969  SER A C   1 
ATOM   2009 O  O   . SER A 1 274 ? 11.998 8.199  25.038  1.00 30.87  ? 969  SER A O   1 
ATOM   2010 C  CB  . SER A 1 274 ? 12.051 8.550  21.774  1.00 29.89  ? 969  SER A CB  1 
ATOM   2011 O  OG  . SER A 1 274 ? 11.914 9.600  20.823  1.00 30.66  ? 969  SER A OG  1 
ATOM   2012 N  N   . LYS A 1 275 ? 13.559 6.919  24.030  1.00 28.57  ? 970  LYS A N   1 
ATOM   2013 C  CA  . LYS A 1 275 ? 13.650 5.940  25.124  1.00 27.87  ? 970  LYS A CA  1 
ATOM   2014 C  C   . LYS A 1 275 ? 14.137 6.617  26.407  1.00 27.90  ? 970  LYS A C   1 
ATOM   2015 O  O   . LYS A 1 275 ? 13.569 6.410  27.484  1.00 30.23  ? 970  LYS A O   1 
ATOM   2016 C  CB  . LYS A 1 275 ? 14.586 4.789  24.734  1.00 28.83  ? 970  LYS A CB  1 
ATOM   2017 C  CG  . LYS A 1 275 ? 14.771 3.726  25.816  1.00 39.48  ? 970  LYS A CG  1 
ATOM   2018 C  CD  . LYS A 1 275 ? 15.856 2.707  25.443  1.00 47.36  ? 970  LYS A CD  1 
ATOM   2019 C  CE  . LYS A 1 275 ? 17.261 3.320  25.492  1.00 53.08  ? 970  LYS A CE  1 
ATOM   2020 N  NZ  . LYS A 1 275 ? 18.301 2.352  25.069  1.00 55.36  ? 970  LYS A NZ  1 
ATOM   2021 N  N   . MET A 1 276 ? 15.204 7.410  26.300  1.00 28.76  ? 971  MET A N   1 
ATOM   2022 C  CA  . MET A 1 276 ? 15.732 8.111  27.477  1.00 28.15  ? 971  MET A CA  1 
ATOM   2023 C  C   . MET A 1 276 ? 14.733 9.111  28.061  1.00 30.50  ? 971  MET A C   1 
ATOM   2024 O  O   . MET A 1 276 ? 14.622 9.251  29.286  1.00 32.07  ? 971  MET A O   1 
ATOM   2025 C  CB  . MET A 1 276 ? 17.065 8.781  27.162  1.00 30.98  ? 971  MET A CB  1 
ATOM   2026 C  CG  . MET A 1 276 ? 18.193 7.771  26.917  1.00 30.64  ? 971  MET A CG  1 
ATOM   2027 S  SD  . MET A 1 276 ? 19.718 8.630  26.614  1.00 32.73  ? 971  MET A SD  1 
ATOM   2028 C  CE  . MET A 1 276 ? 20.895 7.287  26.496  1.00 33.47  ? 971  MET A CE  1 
ATOM   2029 N  N   . ALA A 1 277 ? 13.994 9.783  27.184  1.00 29.10  ? 972  ALA A N   1 
ATOM   2030 C  CA  . ALA A 1 277 ? 12.999 10.776 27.607  1.00 31.05  ? 972  ALA A CA  1 
ATOM   2031 C  C   . ALA A 1 277 ? 11.844 10.181 28.422  1.00 34.51  ? 972  ALA A C   1 
ATOM   2032 O  O   . ALA A 1 277 ? 11.160 10.909 29.137  1.00 34.30  ? 972  ALA A O   1 
ATOM   2033 C  CB  . ALA A 1 277 ? 12.482 11.572 26.396  1.00 31.47  ? 972  ALA A CB  1 
ATOM   2034 N  N   . ARG A 1 278 ? 11.646 8.867  28.329  1.00 33.95  ? 973  ARG A N   1 
ATOM   2035 C  CA  . ARG A 1 278 ? 10.633 8.172  29.126  1.00 36.66  ? 973  ARG A CA  1 
ATOM   2036 C  C   . ARG A 1 278 ? 11.060 7.886  30.576  1.00 37.42  ? 973  ARG A C   1 
ATOM   2037 O  O   . ARG A 1 278 ? 10.217 7.562  31.412  1.00 39.09  ? 973  ARG A O   1 
ATOM   2038 C  CB  . ARG A 1 278 ? 10.180 6.893  28.415  1.00 36.87  ? 973  ARG A CB  1 
ATOM   2039 C  CG  . ARG A 1 278 ? 9.343  7.185  27.170  1.00 40.76  ? 973  ARG A CG  1 
ATOM   2040 C  CD  . ARG A 1 278 ? 8.696  5.939  26.594  1.00 51.78  ? 973  ARG A CD  1 
ATOM   2041 N  NE  . ARG A 1 278 ? 9.653  5.069  25.918  1.00 55.72  ? 973  ARG A NE  1 
ATOM   2042 C  CZ  . ARG A 1 278 ? 10.008 5.182  24.640  1.00 59.15  ? 973  ARG A CZ  1 
ATOM   2043 N  NH1 . ARG A 1 278 ? 9.491  6.135  23.874  1.00 61.25  ? 973  ARG A NH1 1 
ATOM   2044 N  NH2 . ARG A 1 278 ? 10.885 4.336  24.123  1.00 61.38  ? 973  ARG A NH2 1 
ATOM   2045 N  N   . ASP A 1 279 ? 12.354 8.021  30.872  1.00 34.45  ? 974  ASP A N   1 
ATOM   2046 C  CA  . ASP A 1 279 ? 12.876 7.849  32.242  1.00 34.44  ? 974  ASP A CA  1 
ATOM   2047 C  C   . ASP A 1 279 ? 14.064 8.803  32.417  1.00 33.66  ? 974  ASP A C   1 
ATOM   2048 O  O   . ASP A 1 279 ? 15.208 8.372  32.594  1.00 33.60  ? 974  ASP A O   1 
ATOM   2049 C  CB  . ASP A 1 279 ? 13.267 6.378  32.495  1.00 35.82  ? 974  ASP A CB  1 
ATOM   2050 C  CG  . ASP A 1 279 ? 13.581 6.078  33.966  1.00 40.84  ? 974  ASP A CG  1 
ATOM   2051 O  OD1 . ASP A 1 279 ? 13.396 6.950  34.841  1.00 40.09  ? 974  ASP A OD1 1 
ATOM   2052 O  OD2 . ASP A 1 279 ? 14.024 4.939  34.243  1.00 44.49  ? 974  ASP A OD2 1 
ATOM   2053 N  N   . PRO A 1 280 ? 13.794 10.119 32.348  1.00 33.58  ? 975  PRO A N   1 
ATOM   2054 C  CA  . PRO A 1 280 ? 14.880 11.075 32.187  1.00 30.95  ? 975  PRO A CA  1 
ATOM   2055 C  C   . PRO A 1 280 ? 15.899 11.113 33.319  1.00 30.46  ? 975  PRO A C   1 
ATOM   2056 O  O   . PRO A 1 280 ? 17.078 11.323 33.061  1.00 30.12  ? 975  PRO A O   1 
ATOM   2057 C  CB  . PRO A 1 280 ? 14.151 12.418 32.045  1.00 31.11  ? 975  PRO A CB  1 
ATOM   2058 C  CG  . PRO A 1 280 ? 12.805 12.199 32.633  1.00 35.57  ? 975  PRO A CG  1 
ATOM   2059 C  CD  . PRO A 1 280 ? 12.471 10.778 32.373  1.00 32.63  ? 975  PRO A CD  1 
ATOM   2060 N  N   . GLN A 1 281 ? 15.455 10.903 34.563  1.00 31.92  ? 976  GLN A N   1 
ATOM   2061 C  CA  . GLN A 1 281 ? 16.360 10.954 35.716  1.00 33.81  ? 976  GLN A CA  1 
ATOM   2062 C  C   . GLN A 1 281 ? 17.338 9.773  35.819  1.00 35.33  ? 976  GLN A C   1 
ATOM   2063 O  O   . GLN A 1 281 ? 18.296 9.811  36.601  1.00 35.81  ? 976  GLN A O   1 
ATOM   2064 C  CB  . GLN A 1 281 ? 15.564 11.133 37.010  1.00 34.11  ? 976  GLN A CB  1 
ATOM   2065 C  CG  . GLN A 1 281 ? 14.596 12.307 36.943  1.00 36.68  ? 976  GLN A CG  1 
ATOM   2066 C  CD  . GLN A 1 281 ? 14.035 12.674 38.298  1.00 52.99  ? 976  GLN A CD  1 
ATOM   2067 O  OE1 . GLN A 1 281 ? 12.834 12.543 38.540  1.00 59.04  ? 976  GLN A OE1 1 
ATOM   2068 N  NE2 . GLN A 1 281 ? 14.902 13.135 39.192  1.00 52.74  ? 976  GLN A NE2 1 
ATOM   2069 N  N   . ARG A 1 282 ? 17.102 8.730  35.027  1.00 32.72  ? 977  ARG A N   1 
ATOM   2070 C  CA  . ARG A 1 282 ? 18.070 7.642  34.891  1.00 33.17  ? 977  ARG A CA  1 
ATOM   2071 C  C   . ARG A 1 282 ? 19.296 8.066  34.091  1.00 31.11  ? 977  ARG A C   1 
ATOM   2072 O  O   . ARG A 1 282 ? 20.400 7.567  34.314  1.00 33.00  ? 977  ARG A O   1 
ATOM   2073 C  CB  . ARG A 1 282 ? 17.407 6.406  34.264  1.00 34.26  ? 977  ARG A CB  1 
ATOM   2074 C  CG  . ARG A 1 282 ? 18.376 5.295  33.864  1.00 37.35  ? 977  ARG A CG  1 
ATOM   2075 C  CD  . ARG A 1 282 ? 17.640 4.019  33.468  1.00 37.91  ? 977  ARG A CD  1 
ATOM   2076 N  NE  . ARG A 1 282 ? 18.559 3.054  32.871  1.00 44.21  ? 977  ARG A NE  1 
ATOM   2077 C  CZ  . ARG A 1 282 ? 18.200 1.870  32.373  1.00 44.10  ? 977  ARG A CZ  1 
ATOM   2078 N  NH1 . ARG A 1 282 ? 19.118 1.072  31.849  1.00 45.44  ? 977  ARG A NH1 1 
ATOM   2079 N  NH2 . ARG A 1 282 ? 16.927 1.491  32.383  1.00 39.62  ? 977  ARG A NH2 1 
ATOM   2080 N  N   . TYR A 1 283 ? 19.101 9.012  33.169  1.00 30.04  ? 978  TYR A N   1 
ATOM   2081 C  CA  . TYR A 1 283 ? 20.096 9.309  32.151  1.00 29.52  ? 978  TYR A CA  1 
ATOM   2082 C  C   . TYR A 1 283 ? 20.825 10.623 32.359  1.00 26.99  ? 978  TYR A C   1 
ATOM   2083 O  O   . TYR A 1 283 ? 21.978 10.767 31.933  1.00 27.46  ? 978  TYR A O   1 
ATOM   2084 C  CB  . TYR A 1 283 ? 19.438 9.224  30.760  1.00 27.56  ? 978  TYR A CB  1 
ATOM   2085 C  CG  . TYR A 1 283 ? 18.989 7.810  30.480  1.00 28.05  ? 978  TYR A CG  1 
ATOM   2086 C  CD1 . TYR A 1 283 ? 17.645 7.459  30.559  1.00 26.43  ? 978  TYR A CD1 1 
ATOM   2087 C  CD2 . TYR A 1 283 ? 19.916 6.815  30.170  1.00 31.82  ? 978  TYR A CD2 1 
ATOM   2088 C  CE1 . TYR A 1 283 ? 17.230 6.162  30.336  1.00 28.54  ? 978  TYR A CE1 1 
ATOM   2089 C  CE2 . TYR A 1 283 ? 19.506 5.513  29.934  1.00 33.02  ? 978  TYR A CE2 1 
ATOM   2090 C  CZ  . TYR A 1 283 ? 18.161 5.197  30.018  1.00 36.15  ? 978  TYR A CZ  1 
ATOM   2091 O  OH  . TYR A 1 283 ? 17.746 3.910  29.791  1.00 37.21  ? 978  TYR A OH  1 
ATOM   2092 N  N   . LEU A 1 284 ? 20.167 11.567 33.032  1.00 27.26  ? 979  LEU A N   1 
ATOM   2093 C  CA  . LEU A 1 284 ? 20.808 12.821 33.410  1.00 27.57  ? 979  LEU A CA  1 
ATOM   2094 C  C   . LEU A 1 284 ? 20.629 13.051 34.895  1.00 30.19  ? 979  LEU A C   1 
ATOM   2095 O  O   . LEU A 1 284 ? 19.525 12.875 35.413  1.00 30.43  ? 979  LEU A O   1 
ATOM   2096 C  CB  . LEU A 1 284 ? 20.222 13.998 32.637  1.00 27.75  ? 979  LEU A CB  1 
ATOM   2097 C  CG  . LEU A 1 284 ? 20.303 13.959 31.103  1.00 25.78  ? 979  LEU A CG  1 
ATOM   2098 C  CD1 . LEU A 1 284 ? 19.543 15.125 30.473  1.00 28.32  ? 979  LEU A CD1 1 
ATOM   2099 C  CD2 . LEU A 1 284 ? 21.743 13.934 30.623  1.00 27.48  ? 979  LEU A CD2 1 
ATOM   2100 N  N   . VAL A 1 285 ? 21.711 13.459 35.552  1.00 29.18  ? 980  VAL A N   1 
ATOM   2101 C  CA  . VAL A 1 285 ? 21.733 13.670 37.020  1.00 28.72  ? 980  VAL A CA  1 
ATOM   2102 C  C   . VAL A 1 285 ? 21.823 15.174 37.281  1.00 30.86  ? 980  VAL A C   1 
ATOM   2103 O  O   . VAL A 1 285 ? 22.898 15.774 37.163  1.00 33.39  ? 980  VAL A O   1 
ATOM   2104 C  CB  . VAL A 1 285 ? 22.904 12.907 37.651  1.00 30.87  ? 980  VAL A CB  1 
ATOM   2105 C  CG1 . VAL A 1 285 ? 22.978 13.118 39.175  1.00 35.09  ? 980  VAL A CG1 1 
ATOM   2106 C  CG2 . VAL A 1 285 ? 22.781 11.413 37.332  1.00 36.06  ? 980  VAL A CG2 1 
ATOM   2107 N  N   . ILE A 1 286 ? 20.678 15.774 37.585  1.00 30.91  ? 981  ILE A N   1 
ATOM   2108 C  CA  . ILE A 1 286 ? 20.572 17.227 37.766  1.00 33.39  ? 981  ILE A CA  1 
ATOM   2109 C  C   . ILE A 1 286 ? 20.065 17.520 39.180  1.00 38.62  ? 981  ILE A C   1 
ATOM   2110 O  O   . ILE A 1 286 ? 18.990 17.061 39.574  1.00 37.37  ? 981  ILE A O   1 
ATOM   2111 C  CB  . ILE A 1 286 ? 19.649 17.883 36.705  1.00 34.82  ? 981  ILE A CB  1 
ATOM   2112 C  CG1 . ILE A 1 286 ? 20.233 17.684 35.300  1.00 35.69  ? 981  ILE A CG1 1 
ATOM   2113 C  CG2 . ILE A 1 286 ? 19.471 19.378 36.963  1.00 38.79  ? 981  ILE A CG2 1 
ATOM   2114 C  CD1 . ILE A 1 286 ? 19.255 18.014 34.169  1.00 31.05  ? 981  ILE A CD1 1 
ATOM   2115 N  N   . GLN A 1 287 ? 20.861 18.283 39.922  1.00 40.65  ? 982  GLN A N   1 
ATOM   2116 C  CA  . GLN A 1 287 ? 20.504 18.740 41.264  1.00 44.27  ? 982  GLN A CA  1 
ATOM   2117 C  C   . GLN A 1 287 ? 19.153 19.458 41.250  1.00 41.93  ? 982  GLN A C   1 
ATOM   2118 O  O   . GLN A 1 287 ? 18.977 20.433 40.518  1.00 44.92  ? 982  GLN A O   1 
ATOM   2119 C  CB  . GLN A 1 287 ? 21.587 19.688 41.798  1.00 47.75  ? 982  GLN A CB  1 
ATOM   2120 C  CG  . GLN A 1 287 ? 23.019 19.156 41.687  1.00 55.80  ? 982  GLN A CG  1 
ATOM   2121 C  CD  . GLN A 1 287 ? 24.064 20.130 42.222  1.00 65.79  ? 982  GLN A CD  1 
ATOM   2122 O  OE1 . GLN A 1 287 ? 25.028 20.461 41.530  1.00 69.10  ? 982  GLN A OE1 1 
ATOM   2123 N  NE2 . GLN A 1 287 ? 23.876 20.591 43.459  1.00 69.33  ? 982  GLN A NE2 1 
ATOM   2124 N  N   . GLY A 1 288 ? 18.202 18.957 42.039  1.00 63.94  ? 983  GLY A N   1 
ATOM   2125 C  CA  . GLY A 1 288 ? 16.881 19.578 42.181  1.00 61.11  ? 983  GLY A CA  1 
ATOM   2126 C  C   . GLY A 1 288 ? 16.034 19.522 40.920  1.00 57.00  ? 983  GLY A C   1 
ATOM   2127 O  O   . GLY A 1 288 ? 15.239 20.427 40.649  1.00 55.57  ? 983  GLY A O   1 
ATOM   2128 N  N   . ASP A 1 289 ? 16.202 18.444 40.160  1.00 53.19  ? 984  ASP A N   1 
ATOM   2129 C  CA  . ASP A 1 289 ? 15.492 18.237 38.900  1.00 52.21  ? 984  ASP A CA  1 
ATOM   2130 C  C   . ASP A 1 289 ? 13.986 18.470 39.044  1.00 56.54  ? 984  ASP A C   1 
ATOM   2131 O  O   . ASP A 1 289 ? 13.374 19.176 38.234  1.00 55.88  ? 984  ASP A O   1 
ATOM   2132 C  CB  . ASP A 1 289 ? 15.763 16.819 38.401  1.00 49.76  ? 984  ASP A CB  1 
ATOM   2133 C  CG  . ASP A 1 289 ? 15.577 16.671 36.904  1.00 48.13  ? 984  ASP A CG  1 
ATOM   2134 O  OD1 . ASP A 1 289 ? 14.924 17.534 36.280  1.00 42.83  ? 984  ASP A OD1 1 
ATOM   2135 O  OD2 . ASP A 1 289 ? 16.083 15.670 36.368  1.00 43.86  ? 984  ASP A OD2 1 
ATOM   2136 N  N   . GLU A 1 290 ? 13.424 17.908 40.110  1.00 62.76  ? 985  GLU A N   1 
ATOM   2137 C  CA  . GLU A 1 290 ? 11.987 17.911 40.387  1.00 68.42  ? 985  GLU A CA  1 
ATOM   2138 C  C   . GLU A 1 290 ? 11.317 19.294 40.405  1.00 68.70  ? 985  GLU A C   1 
ATOM   2139 O  O   . GLU A 1 290 ? 10.205 19.454 39.896  1.00 70.00  ? 985  GLU A O   1 
ATOM   2140 C  CB  . GLU A 1 290 ? 11.742 17.214 41.730  1.00 73.56  ? 985  GLU A CB  1 
ATOM   2141 C  CG  . GLU A 1 290 ? 10.577 16.237 41.743  1.00 82.87  ? 985  GLU A CG  1 
ATOM   2142 C  CD  . GLU A 1 290 ? 10.983 14.829 41.335  1.00 84.63  ? 985  GLU A CD  1 
ATOM   2143 O  OE1 . GLU A 1 290 ? 11.802 14.679 40.402  1.00 82.64  ? 985  GLU A OE1 1 
ATOM   2144 O  OE2 . GLU A 1 290 ? 10.478 13.866 41.950  1.00 89.38  ? 985  GLU A OE2 1 
ATOM   2145 N  N   . ARG A 1 291 ? 11.997 20.284 40.980  1.00 68.82  ? 986  ARG A N   1 
ATOM   2146 C  CA  . ARG A 1 291 ? 11.360 21.555 41.350  1.00 72.35  ? 986  ARG A CA  1 
ATOM   2147 C  C   . ARG A 1 291 ? 11.629 22.717 40.383  1.00 69.65  ? 986  ARG A C   1 
ATOM   2148 O  O   . ARG A 1 291 ? 11.726 23.873 40.806  1.00 69.98  ? 986  ARG A O   1 
ATOM   2149 C  CB  . ARG A 1 291 ? 11.786 21.953 42.770  1.00 77.44  ? 986  ARG A CB  1 
ATOM   2150 C  CG  . ARG A 1 291 ? 11.307 21.016 43.878  1.00 85.98  ? 986  ARG A CG  1 
ATOM   2151 C  CD  . ARG A 1 291 ? 12.125 21.221 45.165  1.00 92.31  ? 986  ARG A CD  1 
ATOM   2152 N  NE  . ARG A 1 291 ? 13.437 20.551 45.092  1.00 95.35  ? 986  ARG A NE  1 
ATOM   2153 C  CZ  . ARG A 1 291 ? 14.425 20.687 45.990  1.00 96.69  ? 986  ARG A CZ  1 
ATOM   2154 N  NH1 . ARG A 1 291 ? 14.274 21.485 47.056  1.00 106.51 ? 986  ARG A NH1 1 
ATOM   2155 N  NH2 . ARG A 1 291 ? 15.576 20.023 45.815  1.00 93.79  ? 986  ARG A NH2 1 
ATOM   2156 N  N   . MET A 1 292 ? 11.727 22.419 39.090  1.00 65.87  ? 987  MET A N   1 
ATOM   2157 C  CA  . MET A 1 292 ? 12.118 23.441 38.112  1.00 64.03  ? 987  MET A CA  1 
ATOM   2158 C  C   . MET A 1 292 ? 10.963 24.018 37.288  1.00 64.57  ? 987  MET A C   1 
ATOM   2159 O  O   . MET A 1 292 ? 10.007 23.313 36.956  1.00 66.75  ? 987  MET A O   1 
ATOM   2160 C  CB  . MET A 1 292 ? 13.243 22.925 37.214  1.00 59.65  ? 987  MET A CB  1 
ATOM   2161 C  CG  . MET A 1 292 ? 14.587 22.855 37.926  1.00 59.01  ? 987  MET A CG  1 
ATOM   2162 S  SD  . MET A 1 292 ? 15.844 22.013 36.958  1.00 55.74  ? 987  MET A SD  1 
ATOM   2163 C  CE  . MET A 1 292 ? 17.265 22.180 38.037  1.00 55.28  ? 987  MET A CE  1 
ATOM   2164 N  N   . HIS A 1 293 ? 11.068 25.307 36.965  1.00 63.00  ? 988  HIS A N   1 
ATOM   2165 C  CA  . HIS A 1 293 ? 10.012 26.024 36.245  1.00 63.79  ? 988  HIS A CA  1 
ATOM   2166 C  C   . HIS A 1 293 ? 10.566 27.058 35.258  1.00 58.92  ? 988  HIS A C   1 
ATOM   2167 O  O   . HIS A 1 293 ? 11.368 27.922 35.631  1.00 58.54  ? 988  HIS A O   1 
ATOM   2168 C  CB  . HIS A 1 293 ? 9.041  26.691 37.233  1.00 69.32  ? 988  HIS A CB  1 
ATOM   2169 C  CG  . HIS A 1 293 ? 9.710  27.554 38.261  1.00 75.75  ? 988  HIS A CG  1 
ATOM   2170 N  ND1 . HIS A 1 293 ? 10.254 27.046 39.422  1.00 80.36  ? 988  HIS A ND1 1 
ATOM   2171 C  CD2 . HIS A 1 293 ? 9.913  28.893 38.307  1.00 77.84  ? 988  HIS A CD2 1 
ATOM   2172 C  CE1 . HIS A 1 293 ? 10.766 28.033 40.136  1.00 84.20  ? 988  HIS A CE1 1 
ATOM   2173 N  NE2 . HIS A 1 293 ? 10.573 29.164 39.482  1.00 81.62  ? 988  HIS A NE2 1 
ATOM   2174 N  N   . LEU A 1 294 ? 10.134 26.967 34.003  1.00 55.32  ? 989  LEU A N   1 
ATOM   2175 C  CA  . LEU A 1 294 ? 10.552 27.933 32.979  1.00 50.64  ? 989  LEU A CA  1 
ATOM   2176 C  C   . LEU A 1 294 ? 9.452  28.960 32.679  1.00 51.25  ? 989  LEU A C   1 
ATOM   2177 O  O   . LEU A 1 294 ? 8.265  28.612 32.650  1.00 53.57  ? 989  LEU A O   1 
ATOM   2178 C  CB  . LEU A 1 294 ? 11.008 27.213 31.702  1.00 47.91  ? 989  LEU A CB  1 
ATOM   2179 C  CG  . LEU A 1 294 ? 12.258 26.337 31.834  1.00 42.36  ? 989  LEU A CG  1 
ATOM   2180 C  CD1 . LEU A 1 294 ? 12.313 25.306 30.712  1.00 48.30  ? 989  LEU A CD1 1 
ATOM   2181 C  CD2 . LEU A 1 294 ? 13.535 27.184 31.891  1.00 39.38  ? 989  LEU A CD2 1 
ATOM   2182 N  N   . PRO A 1 295 ? 9.841  30.235 32.468  1.00 49.05  ? 990  PRO A N   1 
ATOM   2183 C  CA  . PRO A 1 295 ? 8.872  31.311 32.226  1.00 49.95  ? 990  PRO A CA  1 
ATOM   2184 C  C   . PRO A 1 295 ? 7.966  31.056 31.017  1.00 49.78  ? 990  PRO A C   1 
ATOM   2185 O  O   . PRO A 1 295 ? 8.440  30.604 29.964  1.00 45.39  ? 990  PRO A O   1 
ATOM   2186 C  CB  . PRO A 1 295 ? 9.765  32.531 31.960  1.00 47.78  ? 990  PRO A CB  1 
ATOM   2187 C  CG  . PRO A 1 295 ? 11.024 32.240 32.675  1.00 48.55  ? 990  PRO A CG  1 
ATOM   2188 C  CD  . PRO A 1 295 ? 11.222 30.752 32.511  1.00 47.28  ? 990  PRO A CD  1 
ATOM   2189 N  N   . SER A 1 296 ? 6.674  31.341 31.194  1.00 51.31  ? 991  SER A N   1 
ATOM   2190 C  CA  . SER A 1 296 ? 5.681  31.308 30.120  1.00 52.12  ? 991  SER A CA  1 
ATOM   2191 C  C   . SER A 1 296 ? 5.778  32.589 29.273  1.00 48.61  ? 991  SER A C   1 
ATOM   2192 O  O   . SER A 1 296 ? 6.555  33.491 29.612  1.00 44.83  ? 991  SER A O   1 
ATOM   2193 C  CB  . SER A 1 296 ? 4.284  31.184 30.726  1.00 58.09  ? 991  SER A CB  1 
ATOM   2194 O  OG  . SER A 1 296 ? 4.003  32.292 31.565  1.00 63.03  ? 991  SER A OG  1 
ATOM   2195 N  N   . PRO A 1 297 ? 5.009  32.676 28.164  1.00 49.21  ? 992  PRO A N   1 
ATOM   2196 C  CA  . PRO A 1 297 ? 4.999  33.947 27.427  1.00 48.88  ? 992  PRO A CA  1 
ATOM   2197 C  C   . PRO A 1 297 ? 4.747  35.183 28.312  1.00 50.58  ? 992  PRO A C   1 
ATOM   2198 O  O   . PRO A 1 297 ? 5.455  36.188 28.175  1.00 48.32  ? 992  PRO A O   1 
ATOM   2199 C  CB  . PRO A 1 297 ? 3.869  33.754 26.416  1.00 51.49  ? 992  PRO A CB  1 
ATOM   2200 C  CG  . PRO A 1 297 ? 3.882  32.290 26.129  1.00 54.36  ? 992  PRO A CG  1 
ATOM   2201 C  CD  . PRO A 1 297 ? 4.359  31.596 27.392  1.00 53.86  ? 992  PRO A CD  1 
ATOM   2202 N  N   . THR A 1 298 ? 3.782  35.095 29.228  1.00 55.57  ? 993  THR A N   1 
ATOM   2203 C  CA  . THR A 1 298 ? 3.430  36.234 30.086  1.00 57.96  ? 993  THR A CA  1 
ATOM   2204 C  C   . THR A 1 298 ? 4.541  36.658 31.065  1.00 56.20  ? 993  THR A C   1 
ATOM   2205 O  O   . THR A 1 298 ? 4.673  37.844 31.377  1.00 57.04  ? 993  THR A O   1 
ATOM   2206 C  CB  . THR A 1 298 ? 2.089  36.015 30.854  1.00 65.63  ? 993  THR A CB  1 
ATOM   2207 O  OG1 . THR A 1 298 ? 2.180  34.854 31.690  1.00 69.79  ? 993  THR A OG1 1 
ATOM   2208 C  CG2 . THR A 1 298 ? 0.921  35.853 29.880  1.00 67.49  ? 993  THR A CG2 1 
ATOM   2209 N  N   . ASP A 1 299 ? 5.335  35.695 31.536  1.00 52.66  ? 994  ASP A N   1 
ATOM   2210 C  CA  . ASP A 1 299 ? 6.407  35.971 32.503  1.00 53.07  ? 994  ASP A CA  1 
ATOM   2211 C  C   . ASP A 1 299 ? 7.799  36.172 31.886  1.00 48.16  ? 994  ASP A C   1 
ATOM   2212 O  O   . ASP A 1 299 ? 8.716  36.654 32.562  1.00 47.39  ? 994  ASP A O   1 
ATOM   2213 C  CB  . ASP A 1 299 ? 6.478  34.864 33.564  1.00 55.01  ? 994  ASP A CB  1 
ATOM   2214 C  CG  . ASP A 1 299 ? 5.448  35.034 34.668  1.00 62.57  ? 994  ASP A CG  1 
ATOM   2215 O  OD1 . ASP A 1 299 ? 4.905  36.149 34.842  1.00 66.88  ? 994  ASP A OD1 1 
ATOM   2216 O  OD2 . ASP A 1 299 ? 5.189  34.040 35.377  1.00 67.64  ? 994  ASP A OD2 1 
ATOM   2217 N  N   . SER A 1 300 ? 7.953  35.798 30.615  1.00 44.69  ? 995  SER A N   1 
ATOM   2218 C  CA  . SER A 1 300 ? 9.246  35.868 29.929  1.00 40.74  ? 995  SER A CA  1 
ATOM   2219 C  C   . SER A 1 300 ? 9.666  37.300 29.563  1.00 41.94  ? 995  SER A C   1 
ATOM   2220 O  O   . SER A 1 300 ? 9.027  37.938 28.729  1.00 40.94  ? 995  SER A O   1 
ATOM   2221 C  CB  . SER A 1 300 ? 9.211  35.004 28.670  1.00 40.72  ? 995  SER A CB  1 
ATOM   2222 O  OG  . SER A 1 300 ? 10.419 35.118 27.924  1.00 38.52  ? 995  SER A OG  1 
ATOM   2223 N  N   . ASN A 1 301 ? 10.739 37.795 30.186  1.00 42.19  ? 996  ASN A N   1 
ATOM   2224 C  CA  . ASN A 1 301 ? 11.340 39.087 29.811  1.00 43.13  ? 996  ASN A CA  1 
ATOM   2225 C  C   . ASN A 1 301 ? 11.647 39.156 28.312  1.00 40.41  ? 996  ASN A C   1 
ATOM   2226 O  O   . ASN A 1 301 ? 11.394 40.176 27.674  1.00 36.29  ? 996  ASN A O   1 
ATOM   2227 C  CB  . ASN A 1 301 ? 12.660 39.305 30.554  1.00 47.33  ? 996  ASN A CB  1 
ATOM   2228 C  CG  . ASN A 1 301 ? 12.484 39.538 32.041  1.00 54.42  ? 996  ASN A CG  1 
ATOM   2229 O  OD1 . ASN A 1 301 ? 11.427 39.970 32.511  1.00 63.63  ? 996  ASN A OD1 1 
ATOM   2230 N  ND2 . ASN A 1 301 ? 13.543 39.274 32.792  1.00 58.50  ? 996  ASN A ND2 1 
ATOM   2231 N  N   . PHE A 1 302 ? 12.221 38.072 27.779  1.00 38.21  ? 997  PHE A N   1 
ATOM   2232 C  CA  . PHE A 1 302 ? 12.628 37.983 26.374  1.00 37.36  ? 997  PHE A CA  1 
ATOM   2233 C  C   . PHE A 1 302 ? 11.422 38.039 25.438  1.00 36.99  ? 997  PHE A C   1 
ATOM   2234 O  O   . PHE A 1 302 ? 11.405 38.829 24.498  1.00 38.07  ? 997  PHE A O   1 
ATOM   2235 C  CB  . PHE A 1 302 ? 13.438 36.699 26.129  1.00 38.60  ? 997  PHE A CB  1 
ATOM   2236 C  CG  . PHE A 1 302 ? 14.221 36.690 24.832  1.00 35.43  ? 997  PHE A CG  1 
ATOM   2237 C  CD1 . PHE A 1 302 ? 13.619 36.307 23.633  1.00 33.94  ? 997  PHE A CD1 1 
ATOM   2238 C  CD2 . PHE A 1 302 ? 15.572 37.031 24.817  1.00 41.49  ? 997  PHE A CD2 1 
ATOM   2239 C  CE1 . PHE A 1 302 ? 14.342 36.283 22.433  1.00 32.07  ? 997  PHE A CE1 1 
ATOM   2240 C  CE2 . PHE A 1 302 ? 16.305 37.004 23.623  1.00 42.20  ? 997  PHE A CE2 1 
ATOM   2241 C  CZ  . PHE A 1 302 ? 15.688 36.628 22.431  1.00 36.55  ? 997  PHE A CZ  1 
ATOM   2242 N  N   . TYR A 1 303 ? 10.420 37.197 25.690  1.00 34.91  ? 998  TYR A N   1 
ATOM   2243 C  CA  . TYR A 1 303 ? 9.186  37.220 24.913  1.00 34.64  ? 998  TYR A CA  1 
ATOM   2244 C  C   . TYR A 1 303 ? 8.570  38.631 24.919  1.00 37.57  ? 998  TYR A C   1 
ATOM   2245 O  O   . TYR A 1 303 ? 8.198  39.159 23.866  1.00 38.27  ? 998  TYR A O   1 
ATOM   2246 C  CB  . TYR A 1 303 ? 8.182  36.210 25.479  1.00 35.19  ? 998  TYR A CB  1 
ATOM   2247 C  CG  . TYR A 1 303 ? 6.912  36.053 24.661  1.00 35.62  ? 998  TYR A CG  1 
ATOM   2248 C  CD1 . TYR A 1 303 ? 6.732  34.961 23.822  1.00 34.42  ? 998  TYR A CD1 1 
ATOM   2249 C  CD2 . TYR A 1 303 ? 5.885  36.999 24.737  1.00 38.35  ? 998  TYR A CD2 1 
ATOM   2250 C  CE1 . TYR A 1 303 ? 5.580  34.820 23.066  1.00 42.43  ? 998  TYR A CE1 1 
ATOM   2251 C  CE2 . TYR A 1 303 ? 4.730  36.867 23.988  1.00 41.54  ? 998  TYR A CE2 1 
ATOM   2252 C  CZ  . TYR A 1 303 ? 4.581  35.774 23.153  1.00 44.15  ? 998  TYR A CZ  1 
ATOM   2253 O  OH  . TYR A 1 303 ? 3.430  35.635 22.412  1.00 49.03  ? 998  TYR A OH  1 
ATOM   2254 N  N   . ARG A 1 304 ? 8.449  39.216 26.108  1.00 34.57  ? 999  ARG A N   1 
ATOM   2255 C  CA  . ARG A 1 304 ? 7.933  40.574 26.266  1.00 40.26  ? 999  ARG A CA  1 
ATOM   2256 C  C   . ARG A 1 304 ? 8.786  41.599 25.508  1.00 40.71  ? 999  ARG A C   1 
ATOM   2257 O  O   . ARG A 1 304 ? 8.250  42.509 24.863  1.00 41.07  ? 999  ARG A O   1 
ATOM   2258 C  CB  . ARG A 1 304 ? 7.899  40.960 27.746  1.00 42.63  ? 999  ARG A CB  1 
ATOM   2259 C  CG  . ARG A 1 304 ? 6.848  40.268 28.601  1.00 53.73  ? 999  ARG A CG  1 
ATOM   2260 C  CD  . ARG A 1 304 ? 7.222  40.428 30.078  1.00 64.02  ? 999  ARG A CD  1 
ATOM   2261 N  NE  . ARG A 1 304 ? 6.125  40.130 30.998  1.00 74.47  ? 999  ARG A NE  1 
ATOM   2262 C  CZ  . ARG A 1 304 ? 5.339  41.043 31.569  1.00 80.09  ? 999  ARG A CZ  1 
ATOM   2263 N  NH1 . ARG A 1 304 ? 4.373  40.661 32.393  1.00 84.29  ? 999  ARG A NH1 1 
ATOM   2264 N  NH2 . ARG A 1 304 ? 5.510  42.338 31.321  1.00 82.21  ? 999  ARG A NH2 1 
ATOM   2265 N  N   . ALA A 1 305 ? 10.111 41.455 25.608  1.00 41.06  ? 1000 ALA A N   1 
ATOM   2266 C  CA  . ALA A 1 305 ? 11.048 42.360 24.944  1.00 45.17  ? 1000 ALA A CA  1 
ATOM   2267 C  C   . ALA A 1 305 ? 10.811 42.385 23.438  1.00 46.82  ? 1000 ALA A C   1 
ATOM   2268 O  O   . ALA A 1 305 ? 10.853 43.449 22.816  1.00 49.27  ? 1000 ALA A O   1 
ATOM   2269 C  CB  . ALA A 1 305 ? 12.472 41.973 25.246  1.00 42.07  ? 1000 ALA A CB  1 
ATOM   2270 N  N   . LEU A 1 306 ? 10.541 41.213 22.868  1.00 44.48  ? 1001 LEU A N   1 
ATOM   2271 C  CA  . LEU A 1 306 ? 10.182 41.115 21.462  1.00 46.96  ? 1001 LEU A CA  1 
ATOM   2272 C  C   . LEU A 1 306 ? 8.762  41.643 21.186  1.00 50.31  ? 1001 LEU A C   1 
ATOM   2273 O  O   . LEU A 1 306 ? 8.587  42.537 20.357  1.00 52.89  ? 1001 LEU A O   1 
ATOM   2274 C  CB  . LEU A 1 306 ? 10.366 39.681 20.949  1.00 44.73  ? 1001 LEU A CB  1 
ATOM   2275 C  CG  . LEU A 1 306 ? 11.755 39.295 20.400  1.00 41.97  ? 1001 LEU A CG  1 
ATOM   2276 C  CD1 . LEU A 1 306 ? 12.848 39.408 21.443  1.00 48.31  ? 1001 LEU A CD1 1 
ATOM   2277 C  CD2 . LEU A 1 306 ? 11.783 37.883 19.818  1.00 40.91  ? 1001 LEU A CD2 1 
ATOM   2278 N  N   . MET A 1 307 ? 7.763  41.114 21.898  1.00 51.06  ? 1002 MET A N   1 
ATOM   2279 C  CA  . MET A 1 307 ? 6.350  41.323 21.525  1.00 54.08  ? 1002 MET A CA  1 
ATOM   2280 C  C   . MET A 1 307 ? 5.647  42.555 22.100  1.00 56.25  ? 1002 MET A C   1 
ATOM   2281 O  O   . MET A 1 307 ? 4.771  43.126 21.446  1.00 59.05  ? 1002 MET A O   1 
ATOM   2282 C  CB  . MET A 1 307 ? 5.520  40.065 21.813  1.00 53.49  ? 1002 MET A CB  1 
ATOM   2283 C  CG  . MET A 1 307 ? 5.994  38.823 21.071  1.00 52.24  ? 1002 MET A CG  1 
ATOM   2284 S  SD  . MET A 1 307 ? 6.377  39.125 19.328  1.00 56.40  ? 1002 MET A SD  1 
ATOM   2285 C  CE  . MET A 1 307 ? 6.344  37.449 18.693  1.00 59.17  ? 1002 MET A CE  1 
ATOM   2286 N  N   . ASP A 1 308 ? 6.013  42.956 23.314  1.00 58.66  ? 1003 ASP A N   1 
ATOM   2287 C  CA  . ASP A 1 308 ? 5.395  44.119 23.953  1.00 62.87  ? 1003 ASP A CA  1 
ATOM   2288 C  C   . ASP A 1 308 ? 6.191  45.388 23.665  1.00 64.52  ? 1003 ASP A C   1 
ATOM   2289 O  O   . ASP A 1 308 ? 5.841  46.167 22.777  1.00 65.43  ? 1003 ASP A O   1 
ATOM   2290 C  CB  . ASP A 1 308 ? 5.266  43.905 25.468  1.00 65.48  ? 1003 ASP A CB  1 
ATOM   2291 C  CG  . ASP A 1 308 ? 4.418  42.685 25.829  1.00 68.31  ? 1003 ASP A CG  1 
ATOM   2292 O  OD1 . ASP A 1 308 ? 4.101  41.864 24.937  1.00 72.17  ? 1003 ASP A OD1 1 
ATOM   2293 O  OD2 . ASP A 1 308 ? 4.070  42.547 27.020  1.00 73.98  ? 1003 ASP A OD2 1 
ATOM   2294 N  N   . VAL A 1 315 ? 0.313  41.371 14.526  1.00 61.98  ? 1010 VAL A N   1 
ATOM   2295 C  CA  . VAL A 1 315 ? -0.987 41.130 15.140  1.00 63.23  ? 1010 VAL A CA  1 
ATOM   2296 C  C   . VAL A 1 315 ? -1.410 39.672 14.932  1.00 56.60  ? 1010 VAL A C   1 
ATOM   2297 O  O   . VAL A 1 315 ? -2.185 39.127 15.727  1.00 58.05  ? 1010 VAL A O   1 
ATOM   2298 C  CB  . VAL A 1 315 ? -2.095 42.089 14.595  1.00 70.74  ? 1010 VAL A CB  1 
ATOM   2299 C  CG1 . VAL A 1 315 ? -3.251 42.178 15.574  1.00 82.38  ? 1010 VAL A CG1 1 
ATOM   2300 C  CG2 . VAL A 1 315 ? -1.538 43.478 14.326  1.00 72.88  ? 1010 VAL A CG2 1 
ATOM   2301 N  N   . VAL A 1 316 ? -0.902 39.049 13.866  1.00 50.88  ? 1011 VAL A N   1 
ATOM   2302 C  CA  . VAL A 1 316 ? -1.262 37.668 13.526  1.00 48.29  ? 1011 VAL A CA  1 
ATOM   2303 C  C   . VAL A 1 316 ? -0.031 36.788 13.320  1.00 42.90  ? 1011 VAL A C   1 
ATOM   2304 O  O   . VAL A 1 316 ? 0.790  37.044 12.432  1.00 42.47  ? 1011 VAL A O   1 
ATOM   2305 C  CB  . VAL A 1 316 ? -2.184 37.597 12.274  1.00 51.45  ? 1011 VAL A CB  1 
ATOM   2306 C  CG1 . VAL A 1 316 ? -2.334 36.157 11.777  1.00 51.25  ? 1011 VAL A CG1 1 
ATOM   2307 C  CG2 . VAL A 1 316 ? -3.555 38.198 12.579  1.00 61.39  ? 1011 VAL A CG2 1 
ATOM   2308 N  N   . ASP A 1 317 ? 0.085  35.754 14.150  1.00 42.19  ? 1012 ASP A N   1 
ATOM   2309 C  CA  . ASP A 1 317 ? 1.151  34.757 14.043  1.00 43.24  ? 1012 ASP A CA  1 
ATOM   2310 C  C   . ASP A 1 317 ? 1.155  34.079 12.665  1.00 41.86  ? 1012 ASP A C   1 
ATOM   2311 O  O   . ASP A 1 317 ? 0.091  33.771 12.119  1.00 43.10  ? 1012 ASP A O   1 
ATOM   2312 C  CB  . ASP A 1 317 ? 0.992  33.714 15.157  1.00 47.95  ? 1012 ASP A CB  1 
ATOM   2313 C  CG  . ASP A 1 317 ? 2.108  32.683 15.165  1.00 54.44  ? 1012 ASP A CG  1 
ATOM   2314 O  OD1 . ASP A 1 317 ? 3.283  33.064 15.357  1.00 63.57  ? 1012 ASP A OD1 1 
ATOM   2315 O  OD2 . ASP A 1 317 ? 1.806  31.485 14.991  1.00 62.48  ? 1012 ASP A OD2 1 
ATOM   2316 N  N   . ALA A 1 318 ? 2.350  33.866 12.106  1.00 39.77  ? 1013 ALA A N   1 
ATOM   2317 C  CA  . ALA A 1 318 ? 2.501  33.229 10.787  1.00 40.41  ? 1013 ALA A CA  1 
ATOM   2318 C  C   . ALA A 1 318 ? 1.707  31.928 10.648  1.00 44.34  ? 1013 ALA A C   1 
ATOM   2319 O  O   . ALA A 1 318 ? 1.132  31.657 9.586   1.00 46.63  ? 1013 ALA A O   1 
ATOM   2320 C  CB  . ALA A 1 318 ? 3.977  32.990 10.471  1.00 43.02  ? 1013 ALA A CB  1 
ATOM   2321 N  N   . ASP A 1 319 ? 1.673  31.132 11.716  1.00 46.44  ? 1014 ASP A N   1 
ATOM   2322 C  CA  . ASP A 1 319 ? 0.911  29.881 11.730  1.00 51.57  ? 1014 ASP A CA  1 
ATOM   2323 C  C   . ASP A 1 319 ? -0.581 30.115 11.510  1.00 51.56  ? 1014 ASP A C   1 
ATOM   2324 O  O   . ASP A 1 319 ? -1.207 29.407 10.716  1.00 56.58  ? 1014 ASP A O   1 
ATOM   2325 C  CB  . ASP A 1 319 ? 1.129  29.113 13.034  1.00 56.31  ? 1014 ASP A CB  1 
ATOM   2326 C  CG  . ASP A 1 319 ? 2.556  28.643 13.204  1.00 62.95  ? 1014 ASP A CG  1 
ATOM   2327 O  OD1 . ASP A 1 319 ? 3.120  28.880 14.293  1.00 66.69  ? 1014 ASP A OD1 1 
ATOM   2328 O  OD2 . ASP A 1 319 ? 3.112  28.042 12.257  1.00 64.43  ? 1014 ASP A OD2 1 
ATOM   2329 N  N   . GLU A 1 320 ? -1.134 31.107 12.212  1.00 49.45  ? 1015 GLU A N   1 
ATOM   2330 C  CA  . GLU A 1 320 ? -2.541 31.502 12.069  1.00 53.06  ? 1015 GLU A CA  1 
ATOM   2331 C  C   . GLU A 1 320 ? -2.833 32.063 10.669  1.00 54.61  ? 1015 GLU A C   1 
ATOM   2332 O  O   . GLU A 1 320 ? -3.883 31.774 10.090  1.00 58.62  ? 1015 GLU A O   1 
ATOM   2333 C  CB  . GLU A 1 320 ? -2.926 32.515 13.159  1.00 53.98  ? 1015 GLU A CB  1 
ATOM   2334 C  CG  . GLU A 1 320 ? -4.359 33.086 13.071  1.00 65.64  ? 1015 GLU A CG  1 
ATOM   2335 C  CD  . GLU A 1 320 ? -5.444 32.133 13.567  1.00 79.87  ? 1015 GLU A CD  1 
ATOM   2336 O  OE1 . GLU A 1 320 ? -5.132 31.177 14.311  1.00 83.92  ? 1015 GLU A OE1 1 
ATOM   2337 O  OE2 . GLU A 1 320 ? -6.627 32.353 13.220  1.00 87.74  ? 1015 GLU A OE2 1 
ATOM   2338 N  N   . TYR A 1 321 ? -1.896 32.851 10.136  1.00 50.48  ? 1016 TYR A N   1 
ATOM   2339 C  CA  . TYR A 1 321 ? -2.013 33.420 8.793   1.00 55.56  ? 1016 TYR A CA  1 
ATOM   2340 C  C   . TYR A 1 321 ? -2.049 32.331 7.721   1.00 63.46  ? 1016 TYR A C   1 
ATOM   2341 O  O   . TYR A 1 321 ? -2.864 32.397 6.800   1.00 70.74  ? 1016 TYR A O   1 
ATOM   2342 C  CB  . TYR A 1 321 ? -0.880 34.420 8.510   1.00 52.47  ? 1016 TYR A CB  1 
ATOM   2343 C  CG  . TYR A 1 321 ? -0.896 34.994 7.102   1.00 58.64  ? 1016 TYR A CG  1 
ATOM   2344 C  CD1 . TYR A 1 321 ? 0.012  34.552 6.136   1.00 64.23  ? 1016 TYR A CD1 1 
ATOM   2345 C  CD2 . TYR A 1 321 ? -1.817 35.977 6.734   1.00 63.68  ? 1016 TYR A CD2 1 
ATOM   2346 C  CE1 . TYR A 1 321 ? 0.004  35.075 4.839   1.00 71.05  ? 1016 TYR A CE1 1 
ATOM   2347 C  CE2 . TYR A 1 321 ? -1.833 36.507 5.441   1.00 71.22  ? 1016 TYR A CE2 1 
ATOM   2348 C  CZ  . TYR A 1 321 ? -0.919 36.052 4.500   1.00 75.93  ? 1016 TYR A CZ  1 
ATOM   2349 O  OH  . TYR A 1 321 ? -0.931 36.570 3.219   1.00 86.72  ? 1016 TYR A OH  1 
ATOM   2350 N  N   . LEU A 1 322 ? -1.162 31.343 7.841   1.00 64.50  ? 1017 LEU A N   1 
ATOM   2351 C  CA  . LEU A 1 322 ? -1.180 30.168 6.966   1.00 74.87  ? 1017 LEU A CA  1 
ATOM   2352 C  C   . LEU A 1 322 ? -2.045 29.064 7.570   1.00 78.46  ? 1017 LEU A C   1 
ATOM   2353 O  O   . LEU A 1 322 ? -2.802 28.390 6.854   1.00 90.12  ? 1017 LEU A O   1 
ATOM   2354 C  CB  . LEU A 1 322 ? 0.239  29.643 6.714   1.00 77.33  ? 1017 LEU A CB  1 
ATOM   2355 C  CG  . LEU A 1 322 ? 1.129  30.365 5.693   1.00 81.98  ? 1017 LEU A CG  1 
ATOM   2356 C  CD1 . LEU A 1 322 ? 1.939  31.487 6.329   1.00 77.63  ? 1017 LEU A CD1 1 
ATOM   2357 C  CD2 . LEU A 1 322 ? 2.059  29.367 5.017   1.00 91.98  ? 1017 LEU A CD2 1 
HETATM 2358 S  S   . SO4 B 2 .   ? 29.376 32.715 22.033  1.00 48.24  ? 1    SO4 A S   1 
HETATM 2359 O  O1  . SO4 B 2 .   ? 30.289 33.474 22.874  1.00 54.70  ? 1    SO4 A O1  1 
HETATM 2360 O  O2  . SO4 B 2 .   ? 29.734 32.898 20.636  1.00 49.46  ? 1    SO4 A O2  1 
HETATM 2361 O  O3  . SO4 B 2 .   ? 29.479 31.298 22.404  1.00 42.85  ? 1    SO4 A O3  1 
HETATM 2362 O  O4  . SO4 B 2 .   ? 28.013 33.167 22.241  1.00 47.28  ? 1    SO4 A O4  1 
HETATM 2363 S  S   . SO4 C 2 .   ? 13.555 35.423 30.795  1.00 49.78  ? 2    SO4 A S   1 
HETATM 2364 O  O1  . SO4 C 2 .   ? 13.708 36.129 29.523  1.00 43.55  ? 2    SO4 A O1  1 
HETATM 2365 O  O2  . SO4 C 2 .   ? 13.241 34.023 30.522  1.00 50.72  ? 2    SO4 A O2  1 
HETATM 2366 O  O3  . SO4 C 2 .   ? 14.819 35.516 31.531  1.00 55.94  ? 2    SO4 A O3  1 
HETATM 2367 O  O4  . SO4 C 2 .   ? 12.465 35.968 31.608  1.00 49.26  ? 2    SO4 A O4  1 
HETATM 2368 S  S   . SO4 D 2 .   ? 22.433 19.151 -0.308  1.00 53.36  ? 3    SO4 A S   1 
HETATM 2369 O  O1  . SO4 D 2 .   ? 23.737 19.489 -0.885  1.00 56.74  ? 3    SO4 A O1  1 
HETATM 2370 O  O2  . SO4 D 2 .   ? 22.409 17.728 0.027   1.00 53.82  ? 3    SO4 A O2  1 
HETATM 2371 O  O3  . SO4 D 2 .   ? 22.202 19.915 0.910   1.00 43.27  ? 3    SO4 A O3  1 
HETATM 2372 O  O4  . SO4 D 2 .   ? 21.412 19.462 -1.317  1.00 50.61  ? 3    SO4 A O4  1 
HETATM 2373 N  N1  . 03P E 3 .   ? 14.734 33.559 13.161  1.00 17.98  ? 1023 03P A N1  1 
HETATM 2374 N  N3  . 03P E 3 .   ? 20.225 35.775 15.395  1.00 30.57  ? 1023 03P A N3  1 
HETATM 2375 C  C4  . 03P E 3 .   ? 15.890 35.034 17.235  1.00 21.42  ? 1023 03P A C4  1 
HETATM 2376 C  C5  . 03P E 3 .   ? 14.518 34.854 17.058  1.00 16.61  ? 1023 03P A C5  1 
HETATM 2377 C  C6  . 03P E 3 .   ? 18.073 34.788 16.054  1.00 24.01  ? 1023 03P A C6  1 
HETATM 2378 C  C7  . 03P E 3 .   ? 18.783 36.032 15.531  1.00 30.17  ? 1023 03P A C7  1 
HETATM 2379 C  C8  . 03P E 3 .   ? 20.715 35.001 14.407  1.00 30.73  ? 1023 03P A C8  1 
HETATM 2380 C  C10 . 03P E 3 .   ? 17.224 33.527 11.835  1.00 22.66  ? 1023 03P A C10 1 
HETATM 2381 C  C13 . 03P E 3 .   ? 17.550 32.921 9.098   1.00 24.10  ? 1023 03P A C13 1 
HETATM 2382 C  C15 . 03P E 3 .   ? 18.135 32.543 11.422  1.00 22.75  ? 1023 03P A C15 1 
HETATM 2383 C  C17 . 03P E 3 .   ? 18.404 30.743 6.486   1.00 25.76  ? 1023 03P A C17 1 
HETATM 2384 C  C20 . 03P E 3 .   ? 16.048 29.394 7.164   1.00 21.17  ? 1023 03P A C20 1 
HETATM 2385 C  C21 . 03P E 3 .   ? 16.266 30.695 7.625   1.00 22.70  ? 1023 03P A C21 1 
HETATM 2386 C  C22 . 03P E 3 .   ? 14.802 28.623 7.500   1.00 30.16  ? 1023 03P A C22 1 
HETATM 2387 C  C24 . 03P E 3 .   ? 24.121 33.228 14.043  1.00 50.94  ? 1023 03P A C24 1 
HETATM 2388 F  F2  . 03P E 3 .   ? 13.867 29.356 8.056   1.00 28.73  ? 1023 03P A F2  1 
HETATM 2389 F  F   . 03P E 3 .   ? 14.283 28.118 6.395   1.00 28.42  ? 1023 03P A F   1 
HETATM 2390 F  F1  . 03P E 3 .   ? 15.102 27.632 8.330   1.00 29.29  ? 1023 03P A F1  1 
HETATM 2391 C  C19 . 03P E 3 .   ? 17.012 28.782 6.348   1.00 24.27  ? 1023 03P A C19 1 
HETATM 2392 C  C18 . 03P E 3 .   ? 18.188 29.452 6.017   1.00 23.60  ? 1023 03P A C18 1 
HETATM 2393 C  C16 . 03P E 3 .   ? 17.456 31.366 7.300   1.00 22.06  ? 1023 03P A C16 1 
HETATM 2394 O  O1  . 03P E 3 .   ? 17.688 32.640 7.745   1.00 22.89  ? 1023 03P A O1  1 
HETATM 2395 C  C12 . 03P E 3 .   ? 16.654 33.895 9.521   1.00 20.40  ? 1023 03P A C12 1 
HETATM 2396 CL CL  . 03P E 3 .   ? 15.676 34.766 8.319   1.00 23.88  ? 1023 03P A CL  1 
HETATM 2397 C  C11 . 03P E 3 .   ? 16.476 34.203 10.862  1.00 19.04  ? 1023 03P A C11 1 
HETATM 2398 C  C14 . 03P E 3 .   ? 18.317 32.250 10.052  1.00 21.43  ? 1023 03P A C14 1 
HETATM 2399 N  N4  . 03P E 3 .   ? 17.081 33.810 13.180  1.00 21.11  ? 1023 03P A N4  1 
HETATM 2400 C  C1  . 03P E 3 .   ? 15.875 33.886 13.812  1.00 17.88  ? 1023 03P A C1  1 
HETATM 2401 C  C   . 03P E 3 .   ? 13.519 33.645 13.738  1.00 20.61  ? 1023 03P A C   1 
HETATM 2402 C  C3  . 03P E 3 .   ? 15.733 34.309 15.146  1.00 15.94  ? 1023 03P A C3  1 
HETATM 2403 C  C2  . 03P E 3 .   ? 14.475 34.412 15.705  1.00 17.43  ? 1023 03P A C2  1 
HETATM 2404 N  N   . 03P E 3 .   ? 13.371 34.064 15.005  1.00 19.18  ? 1023 03P A N   1 
HETATM 2405 N  N2  . 03P E 3 .   ? 16.593 34.740 16.100  1.00 20.76  ? 1023 03P A N2  1 
HETATM 2406 O  O   . 03P E 3 .   ? 20.014 34.442 13.583  1.00 29.30  ? 1023 03P A O   1 
HETATM 2407 C  C9  . 03P E 3 .   ? 22.220 34.825 14.324  1.00 33.39  ? 1023 03P A C9  1 
HETATM 2408 C  C23 . 03P E 3 .   ? 22.607 33.386 13.956  1.00 44.14  ? 1023 03P A C23 1 
HETATM 2409 O  O2  . 03P E 3 .   ? 22.020 32.500 14.919  1.00 48.73  ? 1023 03P A O2  1 
HETATM 2410 C  C25 . 03P E 3 .   ? 22.147 32.956 12.561  1.00 45.99  ? 1023 03P A C25 1 
HETATM 2411 O  O   . HOH F 4 .   ? 25.885 20.565 10.513  1.00 20.54  ? 4    HOH A O   1 
HETATM 2412 O  O   . HOH F 4 .   ? 27.606 18.749 7.801   1.00 21.40  ? 5    HOH A O   1 
HETATM 2413 O  O   . HOH F 4 .   ? 30.634 19.025 9.260   1.00 23.84  ? 6    HOH A O   1 
HETATM 2414 O  O   . HOH F 4 .   ? 21.597 10.148 9.745   1.00 22.17  ? 7    HOH A O   1 
HETATM 2415 O  O   . HOH F 4 .   ? 24.003 26.034 6.610   1.00 23.82  ? 8    HOH A O   1 
HETATM 2416 O  O   . HOH F 4 .   ? 34.527 27.125 15.461  1.00 25.59  ? 9    HOH A O   1 
HETATM 2417 O  O   . HOH F 4 .   ? 8.640  23.505 8.432   1.00 27.56  ? 10   HOH A O   1 
HETATM 2418 O  O   . HOH F 4 .   ? 7.086  24.220 11.090  1.00 35.25  ? 11   HOH A O   1 
HETATM 2419 O  O   . HOH F 4 .   ? 9.470  28.761 10.954  1.00 28.62  ? 12   HOH A O   1 
HETATM 2420 O  O   . HOH F 4 .   ? 11.462 30.813 11.688  1.00 24.02  ? 13   HOH A O   1 
HETATM 2421 O  O   . HOH F 4 .   ? 14.722 31.220 11.420  1.00 20.72  ? 14   HOH A O   1 
HETATM 2422 O  O   . HOH F 4 .   ? 8.422  30.631 8.964   1.00 27.25  ? 15   HOH A O   1 
HETATM 2423 O  O   . HOH F 4 .   ? 17.038 32.798 23.687  1.00 18.92  ? 16   HOH A O   1 
HETATM 2424 O  O   . HOH F 4 .   ? 28.491 27.032 22.728  1.00 18.70  ? 17   HOH A O   1 
HETATM 2425 O  O   . HOH F 4 .   ? 29.728 28.955 21.240  1.00 23.54  ? 18   HOH A O   1 
HETATM 2426 O  O   . HOH F 4 .   ? 20.661 15.785 7.693   1.00 38.84  ? 19   HOH A O   1 
HETATM 2427 O  O   . HOH F 4 .   ? 18.327 10.912 2.099   1.00 40.43  ? 20   HOH A O   1 
HETATM 2428 O  O   . HOH F 4 .   ? 35.425 19.931 14.921  1.00 16.39  ? 21   HOH A O   1 
HETATM 2429 O  O   . HOH F 4 .   ? 30.580 12.650 5.846   1.00 21.42  ? 22   HOH A O   1 
HETATM 2430 O  O   . HOH F 4 .   ? 26.115 27.233 18.983  1.00 18.72  ? 23   HOH A O   1 
HETATM 2431 O  O   . HOH F 4 .   ? 39.220 13.369 25.074  1.00 33.56  ? 24   HOH A O   1 
HETATM 2432 O  O   . HOH F 4 .   ? 35.404 13.287 29.927  1.00 25.82  ? 25   HOH A O   1 
HETATM 2433 O  O   . HOH F 4 .   ? 12.846 9.613  35.538  1.00 27.92  ? 26   HOH A O   1 
HETATM 2434 O  O   . HOH F 4 .   ? 6.886  43.826 16.066  1.00 21.50  ? 27   HOH A O   1 
HETATM 2435 O  O   . HOH F 4 .   ? 24.447 39.941 18.285  1.00 28.61  ? 28   HOH A O   1 
HETATM 2436 O  O   . HOH F 4 .   ? 7.400  17.476 3.453   1.00 25.67  ? 29   HOH A O   1 
HETATM 2437 O  O   . HOH F 4 .   ? 36.246 11.586 9.620   1.00 22.95  ? 30   HOH A O   1 
HETATM 2438 O  O   . HOH F 4 .   ? 38.916 12.807 6.175   1.00 30.19  ? 31   HOH A O   1 
HETATM 2439 O  O   . HOH F 4 .   ? 37.009 7.135  15.874  1.00 26.95  ? 32   HOH A O   1 
HETATM 2440 O  O   . HOH F 4 .   ? 24.771 34.000 25.193  1.00 38.91  ? 33   HOH A O   1 
HETATM 2441 O  O   . HOH F 4 .   ? 19.571 22.772 35.550  1.00 32.86  ? 34   HOH A O   1 
HETATM 2442 O  O   . HOH F 4 .   ? 18.275 14.177 37.324  1.00 25.91  ? 35   HOH A O   1 
HETATM 2443 O  O   . HOH F 4 .   ? 28.016 24.340 12.885  1.00 26.34  ? 36   HOH A O   1 
HETATM 2444 O  O   . HOH F 4 .   ? 27.971 29.375 18.940  1.00 21.01  ? 37   HOH A O   1 
HETATM 2445 O  O   . HOH F 4 .   ? 24.968 32.265 10.677  1.00 41.39  ? 38   HOH A O   1 
HETATM 2446 O  O   . HOH F 4 .   ? 41.701 22.616 12.573  1.00 29.94  ? 39   HOH A O   1 
HETATM 2447 O  O   . HOH F 4 .   ? 44.894 21.233 13.299  1.00 25.84  ? 40   HOH A O   1 
HETATM 2448 O  O   . HOH F 4 .   ? 26.589 19.365 32.649  1.00 21.11  ? 41   HOH A O   1 
HETATM 2449 O  O   . HOH F 4 .   ? 32.393 28.005 27.896  1.00 27.31  ? 42   HOH A O   1 
HETATM 2450 O  O   . HOH F 4 .   ? 34.701 8.341  7.501   1.00 39.42  ? 43   HOH A O   1 
HETATM 2451 O  O   . HOH F 4 .   ? 34.667 10.850 30.900  1.00 30.45  ? 44   HOH A O   1 
HETATM 2452 O  O   . HOH F 4 .   ? 18.140 9.178  9.632   1.00 21.76  ? 45   HOH A O   1 
HETATM 2453 O  O   . HOH F 4 .   ? 8.745  15.085 13.031  1.00 30.92  ? 46   HOH A O   1 
HETATM 2454 O  O   . HOH F 4 .   ? 9.791  15.673 22.345  1.00 36.36  ? 47   HOH A O   1 
HETATM 2455 O  O   . HOH F 4 .   ? 17.261 33.321 26.472  1.00 24.78  ? 48   HOH A O   1 
HETATM 2456 O  O   . HOH F 4 .   ? 32.527 29.087 20.541  1.00 27.63  ? 49   HOH A O   1 
HETATM 2457 O  O   . HOH F 4 .   ? 35.849 21.764 25.717  1.00 29.94  ? 50   HOH A O   1 
HETATM 2458 O  O   . HOH F 4 .   ? 38.588 8.773  20.009  1.00 39.40  ? 51   HOH A O   1 
HETATM 2459 O  O   . HOH F 4 .   ? 27.060 21.465 34.368  1.00 30.45  ? 52   HOH A O   1 
HETATM 2460 O  O   . HOH F 4 .   ? 36.071 5.506  13.650  1.00 25.95  ? 53   HOH A O   1 
HETATM 2461 O  O   . HOH F 4 .   ? 38.570 12.119 8.500   1.00 28.33  ? 54   HOH A O   1 
HETATM 2462 O  O   . HOH F 4 .   ? 26.424 28.069 31.014  1.00 39.19  ? 55   HOH A O   1 
HETATM 2463 O  O   . HOH F 4 .   ? 24.876 13.146 2.164   1.00 27.97  ? 56   HOH A O   1 
HETATM 2464 O  O   . HOH F 4 .   ? 36.074 22.973 5.332   1.00 35.94  ? 57   HOH A O   1 
HETATM 2465 O  O   . HOH F 4 .   ? 28.474 20.141 9.981   1.00 32.92  ? 58   HOH A O   1 
HETATM 2466 O  O   . HOH F 4 .   ? 34.135 24.970 27.505  1.00 40.47  ? 59   HOH A O   1 
HETATM 2467 O  O   . HOH F 4 .   ? 12.202 4.692  21.606  1.00 24.96  ? 60   HOH A O   1 
HETATM 2468 O  O   . HOH F 4 .   ? 11.634 13.161 11.214  1.00 21.34  ? 61   HOH A O   1 
HETATM 2469 O  O   . HOH F 4 .   ? 9.126  15.064 19.959  1.00 33.10  ? 62   HOH A O   1 
HETATM 2470 O  O   . HOH F 4 .   ? 40.026 9.778  16.756  1.00 33.97  ? 63   HOH A O   1 
HETATM 2471 O  O   . HOH F 4 .   ? 4.885  20.742 10.069  1.00 31.27  ? 64   HOH A O   1 
HETATM 2472 O  O   . HOH F 4 .   ? 24.645 10.799 4.596   1.00 28.93  ? 65   HOH A O   1 
HETATM 2473 O  O   . HOH F 4 .   ? 15.057 8.876  7.266   1.00 35.94  ? 66   HOH A O   1 
HETATM 2474 O  O   . HOH F 4 .   ? 9.177  13.565 4.846   1.00 30.32  ? 67   HOH A O   1 
HETATM 2475 O  O   . HOH F 4 .   ? 42.977 22.122 9.673   1.00 42.47  ? 68   HOH A O   1 
HETATM 2476 O  O   . HOH F 4 .   ? 23.108 9.229  6.562   1.00 25.61  ? 69   HOH A O   1 
HETATM 2477 O  O   . HOH F 4 .   ? 9.907  10.710 13.868  1.00 40.06  ? 70   HOH A O   1 
HETATM 2478 O  O   . HOH F 4 .   ? 7.159  16.545 8.530   1.00 25.07  ? 71   HOH A O   1 
HETATM 2479 O  O   . HOH F 4 .   ? 5.476  35.891 -4.769  1.00 26.06  ? 72   HOH A O   1 
HETATM 2480 O  O   . HOH F 4 .   ? 20.324 9.442  3.431   1.00 31.97  ? 73   HOH A O   1 
HETATM 2481 O  O   . HOH F 4 .   ? 11.065 30.676 29.211  1.00 28.35  ? 74   HOH A O   1 
HETATM 2482 O  O   . HOH F 4 .   ? 24.334 5.002  24.888  1.00 31.36  ? 75   HOH A O   1 
HETATM 2483 O  O   . HOH F 4 .   ? 26.332 29.958 12.270  1.00 35.80  ? 76   HOH A O   1 
HETATM 2484 O  O   . HOH F 4 .   ? 24.691 28.863 8.385   1.00 31.87  ? 77   HOH A O   1 
HETATM 2485 O  O   . HOH F 4 .   ? 19.815 31.378 14.425  1.00 40.71  ? 78   HOH A O   1 
HETATM 2486 O  O   . HOH F 4 .   ? 28.729 8.776  5.454   1.00 25.64  ? 79   HOH A O   1 
HETATM 2487 O  O   . HOH F 4 .   ? 26.409 6.029  6.710   1.00 33.89  ? 80   HOH A O   1 
HETATM 2488 O  O   . HOH F 4 .   ? 26.318 15.183 0.566   1.00 36.32  ? 81   HOH A O   1 
HETATM 2489 O  O   . HOH F 4 .   ? 26.635 9.435  3.713   1.00 35.95  ? 82   HOH A O   1 
HETATM 2490 O  O   . HOH F 4 .   ? 41.546 18.070 24.410  1.00 33.43  ? 83   HOH A O   1 
HETATM 2491 O  O   . HOH F 4 .   ? 15.405 34.257 27.882  1.00 30.18  ? 84   HOH A O   1 
HETATM 2492 O  O   . HOH F 4 .   ? 12.068 33.312 28.295  1.00 24.17  ? 85   HOH A O   1 
HETATM 2493 O  O   . HOH F 4 .   ? 4.653  35.177 13.305  1.00 26.09  ? 86   HOH A O   1 
HETATM 2494 O  O   . HOH F 4 .   ? 5.394  31.773 2.335   1.00 31.84  ? 87   HOH A O   1 
HETATM 2495 O  O   . HOH F 4 .   ? 6.199  29.481 9.911   1.00 43.10  ? 88   HOH A O   1 
HETATM 2496 O  O   . HOH F 4 .   ? 44.408 7.918  18.480  1.00 41.88  ? 89   HOH A O   1 
HETATM 2497 O  O   . HOH F 4 .   ? 14.231 2.766  32.628  1.00 33.66  ? 90   HOH A O   1 
HETATM 2498 O  O   . HOH F 4 .   ? -2.261 34.884 15.873  1.00 27.20  ? 91   HOH A O   1 
HETATM 2499 O  O   . HOH F 4 .   ? 30.390 17.734 0.351   1.00 34.92  ? 92   HOH A O   1 
HETATM 2500 O  O   . HOH F 4 .   ? 17.638 47.529 17.740  1.00 26.63  ? 93   HOH A O   1 
HETATM 2501 O  O   . HOH F 4 .   ? 29.149 22.497 10.996  1.00 37.97  ? 94   HOH A O   1 
HETATM 2502 O  O   . HOH F 4 .   ? 29.142 27.348 30.560  1.00 35.27  ? 95   HOH A O   1 
HETATM 2503 O  O   . HOH F 4 .   ? 10.907 6.756  15.697  1.00 40.18  ? 96   HOH A O   1 
HETATM 2504 O  O   . HOH F 4 .   ? 9.414  10.287 19.777  1.00 36.82  ? 97   HOH A O   1 
HETATM 2505 O  O   . HOH F 4 .   ? 9.668  9.810  24.632  1.00 32.50  ? 98   HOH A O   1 
HETATM 2506 O  O   . HOH F 4 .   ? 12.111 8.449  11.759  1.00 44.36  ? 99   HOH A O   1 
HETATM 2507 O  O   . HOH F 4 .   ? 13.687 33.216 26.181  1.00 30.04  ? 100  HOH A O   1 
HETATM 2508 O  O   . HOH F 4 .   ? 26.847 19.074 -2.493  1.00 49.46  ? 101  HOH A O   1 
HETATM 2509 O  O   . HOH F 4 .   ? 13.031 6.882  14.075  1.00 36.73  ? 102  HOH A O   1 
HETATM 2510 O  O   . HOH F 4 .   ? 34.785 27.610 21.539  1.00 35.69  ? 103  HOH A O   1 
HETATM 2511 O  O   . HOH F 4 .   ? 37.514 29.846 18.287  1.00 52.05  ? 104  HOH A O   1 
HETATM 2512 O  O   . HOH F 4 .   ? 11.619 41.824 -4.165  1.00 36.66  ? 105  HOH A O   1 
HETATM 2513 O  O   . HOH F 4 .   ? 11.804 2.204  27.266  1.00 36.60  ? 106  HOH A O   1 
HETATM 2514 O  O   . HOH F 4 .   ? 24.236 4.456  21.996  1.00 50.00  ? 107  HOH A O   1 
HETATM 2515 O  O   . HOH F 4 .   ? 31.716 15.405 -0.964  1.00 51.35  ? 108  HOH A O   1 
HETATM 2516 O  O   . HOH F 4 .   ? 20.923 33.969 34.353  1.00 45.63  ? 109  HOH A O   1 
HETATM 2517 O  O   . HOH F 4 .   ? 20.948 3.189  34.239  1.00 39.22  ? 110  HOH A O   1 
HETATM 2518 O  O   . HOH F 4 .   ? 20.942 12.104 0.008   1.00 50.83  ? 111  HOH A O   1 
HETATM 2519 O  O   . HOH F 4 .   ? 6.235  21.429 0.443   1.00 43.29  ? 112  HOH A O   1 
HETATM 2520 O  O   . HOH F 4 .   ? 27.093 32.089 19.162  1.00 36.70  ? 113  HOH A O   1 
HETATM 2521 O  O   . HOH F 4 .   ? 32.715 20.709 30.317  1.00 60.89  ? 114  HOH A O   1 
HETATM 2522 O  O   . HOH F 4 .   ? 43.421 29.335 14.616  1.00 37.20  ? 115  HOH A O   1 
HETATM 2523 O  O   . HOH F 4 .   ? 2.041  18.390 8.088   1.00 51.57  ? 116  HOH A O   1 
HETATM 2524 O  O   . HOH F 4 .   ? 35.389 26.496 2.516   1.00 44.47  ? 117  HOH A O   1 
HETATM 2525 O  O   . HOH F 4 .   ? 34.132 24.077 4.295   1.00 38.52  ? 118  HOH A O   1 
HETATM 2526 O  O   . HOH F 4 .   ? 38.126 20.347 25.485  1.00 38.43  ? 119  HOH A O   1 
HETATM 2527 O  O   . HOH F 4 .   ? 18.318 3.643  18.427  1.00 33.61  ? 120  HOH A O   1 
HETATM 2528 O  O   . HOH F 4 .   ? 14.994 0.203  17.664  1.00 41.45  ? 121  HOH A O   1 
HETATM 2529 O  O   . HOH F 4 .   ? 7.181  12.337 27.216  1.00 49.74  ? 122  HOH A O   1 
HETATM 2530 O  O   . HOH F 4 .   ? 8.047  7.698  22.289  1.00 48.29  ? 123  HOH A O   1 
HETATM 2531 O  O   . HOH F 4 .   ? 11.088 14.173 35.219  1.00 60.82  ? 124  HOH A O   1 
HETATM 2532 O  O   . HOH F 4 .   ? 21.911 14.353 0.689   1.00 35.58  ? 125  HOH A O   1 
HETATM 2533 O  O   . HOH F 4 .   ? 38.915 18.257 24.365  1.00 47.53  ? 126  HOH A O   1 
HETATM 2534 O  O   . HOH F 4 .   ? 34.611 9.874  19.346  1.00 22.80  ? 1024 HOH A O   1 
HETATM 2535 O  O   . HOH F 4 .   ? 34.394 16.159 20.330  1.00 20.64  ? 1025 HOH A O   1 
HETATM 2536 O  O   . HOH F 4 .   ? 33.827 19.204 16.899  1.00 19.13  ? 1026 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLN A 6   ? 0.7962 0.7186 0.8098 0.0383  -0.2169 -0.0174 701  GLN A N   
2    C CA  . GLN A 6   ? 0.7691 0.7196 0.8112 0.0335  -0.1991 -0.0231 701  GLN A CA  
3    C C   . GLN A 6   ? 0.7293 0.6764 0.7390 0.0219  -0.1788 -0.0204 701  GLN A C   
4    O O   . GLN A 6   ? 0.7395 0.7030 0.7641 0.0178  -0.1666 -0.0249 701  GLN A O   
5    C CB  . GLN A 6   ? 0.7982 0.7547 0.8586 0.0337  -0.2165 -0.0305 701  GLN A CB  
6    C CG  . GLN A 6   ? 0.8347 0.8126 0.9507 0.0441  -0.2285 -0.0372 701  GLN A CG  
7    C CD  . GLN A 6   ? 0.8527 0.8436 0.9951 0.0412  -0.2400 -0.0458 701  GLN A CD  
8    O OE1 . GLN A 6   ? 0.8636 0.8556 1.0264 0.0479  -0.2650 -0.0512 701  GLN A OE1 
9    N NE2 . GLN A 6   ? 0.8454 0.8454 0.9883 0.0317  -0.2235 -0.0478 701  GLN A NE2 
10   N N   . ALA A 7   ? 0.6896 0.6156 0.6565 0.0166  -0.1756 -0.0136 702  ALA A N   
11   C CA  . ALA A 7   ? 0.6307 0.5558 0.5685 0.0057  -0.1570 -0.0126 702  ALA A CA  
12   C C   . ALA A 7   ? 0.5758 0.5257 0.5409 0.0064  -0.1338 -0.0143 702  ALA A C   
13   O O   . ALA A 7   ? 0.5326 0.4904 0.5180 0.0123  -0.1275 -0.0119 702  ALA A O   
14   C CB  . ALA A 7   ? 0.6575 0.5568 0.5478 -0.0018 -0.1572 -0.0051 702  ALA A CB  
15   N N   . LEU A 8   ? 0.5358 0.4959 0.4993 0.0011  -0.1219 -0.0189 703  LEU A N   
16   C CA  . LEU A 8   ? 0.4973 0.4764 0.4803 0.0018  -0.1018 -0.0202 703  LEU A CA  
17   C C   . LEU A 8   ? 0.4656 0.4417 0.4291 -0.0017 -0.0898 -0.0155 703  LEU A C   
18   O O   . LEU A 8   ? 0.4705 0.4562 0.4514 0.0025  -0.0801 -0.0135 703  LEU A O   
19   C CB  . LEU A 8   ? 0.5037 0.4901 0.4862 -0.0019 -0.0951 -0.0270 703  LEU A CB  
20   C CG  . LEU A 8   ? 0.5354 0.5387 0.5437 0.0009  -0.0797 -0.0292 703  LEU A CG  
21   C CD1 . LEU A 8   ? 0.5716 0.5850 0.6167 0.0068  -0.0799 -0.0272 703  LEU A CD1 
22   C CD2 . LEU A 8   ? 0.5028 0.5077 0.5100 -0.0014 -0.0784 -0.0369 703  LEU A CD2 
23   N N   . LEU A 9   ? 0.4760 0.4381 0.4022 -0.0103 -0.0904 -0.0140 704  LEU A N   
24   C CA  . LEU A 9   ? 0.4397 0.3965 0.3464 -0.0158 -0.0814 -0.0093 704  LEU A CA  
25   C C   . LEU A 9   ? 0.4579 0.3894 0.3425 -0.0169 -0.0963 -0.0021 704  LEU A C   
26   O O   . LEU A 9   ? 0.4712 0.3823 0.3223 -0.0238 -0.1061 -0.0001 704  LEU A O   
27   C CB  . LEU A 9   ? 0.4859 0.4460 0.3678 -0.0266 -0.0689 -0.0128 704  LEU A CB  
28   C CG  . LEU A 9   ? 0.4921 0.4477 0.3531 -0.0359 -0.0596 -0.0087 704  LEU A CG  
29   C CD1 . LEU A 9   ? 0.5444 0.5169 0.4307 -0.0311 -0.0487 -0.0089 704  LEU A CD1 
30   C CD2 . LEU A 9   ? 0.5898 0.5472 0.4228 -0.0487 -0.0491 -0.0132 704  LEU A CD2 
31   N N   . ARG A 10  ? 0.4411 0.3712 0.3419 -0.0096 -0.0987 0.0014  705  ARG A N   
32   C CA  . ARG A 10  ? 0.5041 0.4077 0.3863 -0.0081 -0.1146 0.0076  705  ARG A CA  
33   C C   . ARG A 10  ? 0.5005 0.3846 0.3432 -0.0209 -0.1098 0.0135  705  ARG A C   
34   O O   . ARG A 10  ? 0.4896 0.3852 0.3350 -0.0258 -0.0939 0.0131  705  ARG A O   
35   C CB  . ARG A 10  ? 0.4782 0.3871 0.3924 0.0052  -0.1185 0.0074  705  ARG A CB  
36   C CG  . ARG A 10  ? 0.5703 0.4937 0.5209 0.0162  -0.1274 0.0021  705  ARG A CG  
37   C CD  . ARG A 10  ? 0.6077 0.5509 0.5976 0.0265  -0.1185 -0.0011 705  ARG A CD  
38   N NE  . ARG A 10  ? 0.7433 0.7035 0.7714 0.0348  -0.1250 -0.0068 705  ARG A NE  
39   C CZ  . ARG A 10  ? 0.7577 0.7142 0.8037 0.0449  -0.1420 -0.0091 705  ARG A CZ  
40   N NH1 . ARG A 10  ? 0.7517 0.6841 0.7778 0.0492  -0.1554 -0.0055 705  ARG A NH1 
41   N NH2 . ARG A 10  ? 0.7837 0.7604 0.8691 0.0506  -0.1461 -0.0155 705  ARG A NH2 
42   N N   . ILE A 11  ? 0.5338 0.3875 0.3387 -0.0273 -0.1240 0.0189  706  ILE A N   
43   C CA  . ILE A 11  ? 0.5966 0.4264 0.3608 -0.0415 -0.1208 0.0259  706  ILE A CA  
44   C C   . ILE A 11  ? 0.6219 0.4294 0.3863 -0.0340 -0.1339 0.0314  706  ILE A C   
45   O O   . ILE A 11  ? 0.6727 0.4595 0.4339 -0.0245 -0.1553 0.0337  706  ILE A O   
46   C CB  . ILE A 11  ? 0.6408 0.4431 0.3561 -0.0540 -0.1292 0.0299  706  ILE A CB  
47   C CG1 . ILE A 11  ? 0.6966 0.5201 0.4136 -0.0580 -0.1190 0.0220  706  ILE A CG1 
48   C CG2 . ILE A 11  ? 0.7308 0.5081 0.4027 -0.0720 -0.1227 0.0377  706  ILE A CG2 
49   C CD1 . ILE A 11  ? 0.6102 0.4640 0.3395 -0.0658 -0.0932 0.0158  706  ILE A CD1 
50   N N   . LEU A 12  ? 0.5906 0.4025 0.3605 -0.0370 -0.1221 0.0324  707  LEU A N   
51   C CA  . LEU A 12  ? 0.6256 0.4185 0.3996 -0.0282 -0.1327 0.0356  707  LEU A CA  
52   C C   . LEU A 12  ? 0.6844 0.4374 0.4115 -0.0421 -0.1394 0.0447  707  LEU A C   
53   O O   . LEU A 12  ? 0.7138 0.4662 0.4170 -0.0606 -0.1255 0.0471  707  LEU A O   
54   C CB  . LEU A 12  ? 0.5599 0.3783 0.3676 -0.0215 -0.1181 0.0305  707  LEU A CB  
55   C CG  . LEU A 12  ? 0.5532 0.4088 0.4047 -0.0096 -0.1089 0.0226  707  LEU A CG  
56   C CD1 . LEU A 12  ? 0.5652 0.4360 0.4409 -0.0025 -0.0975 0.0191  707  LEU A CD1 
57   C CD2 . LEU A 12  ? 0.5881 0.4458 0.4613 0.0043  -0.1236 0.0198  707  LEU A CD2 
58   N N   . LYS A 13  ? 0.7530 0.4721 0.4675 -0.0335 -0.1611 0.0493  708  LYS A N   
59   C CA  . LYS A 13  ? 0.8207 0.4965 0.4926 -0.0448 -0.1691 0.0585  708  LYS A CA  
60   C C   . LYS A 13  ? 0.8144 0.4974 0.5037 -0.0435 -0.1586 0.0561  708  LYS A C   
61   O O   . LYS A 13  ? 0.7547 0.4664 0.4863 -0.0281 -0.1530 0.0481  708  LYS A O   
62   C CB  . LYS A 13  ? 0.8509 0.4856 0.5053 -0.0328 -0.1987 0.0634  708  LYS A CB  
63   C CG  . LYS A 13  ? 0.9712 0.5888 0.5975 -0.0357 -0.2135 0.0672  708  LYS A CG  
64   C CD  . LYS A 13  ? 1.0875 0.6671 0.7033 -0.0198 -0.2463 0.0705  708  LYS A CD  
65   C CE  . LYS A 13  ? 1.0883 0.6996 0.7631 0.0058  -0.2555 0.0594  708  LYS A CE  
66   N NZ  . LYS A 13  ? 1.1897 0.7677 0.8589 0.0227  -0.2894 0.0607  708  LYS A NZ  
67   N N   . GLU A 14  ? 0.8624 0.5182 0.5173 -0.0609 -0.1557 0.0628  709  GLU A N   
68   C CA  . GLU A 14  ? 0.8590 0.5167 0.5253 -0.0616 -0.1479 0.0604  709  GLU A CA  
69   C C   . GLU A 14  ? 0.8634 0.5079 0.5500 -0.0388 -0.1635 0.0568  709  GLU A C   
70   O O   . GLU A 14  ? 0.8153 0.4755 0.5263 -0.0317 -0.1552 0.0505  709  GLU A O   
71   C CB  . GLU A 14  ? 0.9252 0.5504 0.5482 -0.0862 -0.1451 0.0688  709  GLU A CB  
72   C CG  . GLU A 14  ? 0.9445 0.5964 0.5610 -0.1088 -0.1223 0.0680  709  GLU A CG  
73   C CD  . GLU A 14  ? 1.0557 0.6833 0.6389 -0.1344 -0.1158 0.0742  709  GLU A CD  
74   O OE1 . GLU A 14  ? 1.0370 0.6897 0.6403 -0.1418 -0.1009 0.0686  709  GLU A OE1 
75   O OE2 . GLU A 14  ? 1.0934 0.6756 0.6298 -0.1477 -0.1263 0.0848  709  GLU A OE2 
76   N N   . THR A 15  ? 0.9038 0.5202 0.5805 -0.0267 -0.1863 0.0598  710  THR A N   
77   C CA  . THR A 15  ? 0.9127 0.5179 0.6117 -0.0027 -0.2026 0.0545  710  THR A CA  
78   C C   . THR A 15  ? 0.8714 0.5230 0.6256 0.0177  -0.1957 0.0430  710  THR A C   
79   O O   . THR A 15  ? 0.8888 0.5408 0.6691 0.0377  -0.2036 0.0359  710  THR A O   
80   C CB  . THR A 15  ? 0.9748 0.5330 0.6460 0.0050  -0.2325 0.0608  710  THR A CB  
81   O OG1 . THR A 15  ? 0.9385 0.5057 0.6071 0.0048  -0.2390 0.0625  710  THR A OG1 
82   C CG2 . THR A 15  ? 1.0110 0.5141 0.6247 -0.0140 -0.2411 0.0729  710  THR A CG2 
83   N N   . GLU A 16  ? 0.8036 0.4931 0.5750 0.0121  -0.1802 0.0406  711  GLU A N   
84   C CA  . GLU A 16  ? 0.7588 0.4896 0.5790 0.0281  -0.1735 0.0310  711  GLU A CA  
85   C C   . GLU A 16  ? 0.7135 0.4777 0.5598 0.0284  -0.1503 0.0248  711  GLU A C   
86   O O   . GLU A 16  ? 0.6816 0.4789 0.5655 0.0393  -0.1416 0.0176  711  GLU A O   
87   C CB  . GLU A 16  ? 0.7539 0.5026 0.5780 0.0238  -0.1734 0.0315  711  GLU A CB  
88   C CG  . GLU A 16  ? 0.8379 0.5618 0.6503 0.0311  -0.1993 0.0341  711  GLU A CG  
89   C CD  . GLU A 16  ? 0.8734 0.6145 0.6881 0.0262  -0.1993 0.0334  711  GLU A CD  
90   O OE1 . GLU A 16  ? 0.8672 0.6084 0.6543 0.0082  -0.1875 0.0377  711  GLU A OE1 
91   O OE2 . GLU A 16  ? 0.8310 0.5864 0.6764 0.0401  -0.2108 0.0276  711  GLU A OE2 
92   N N   . PHE A 17  ? 0.6623 0.4169 0.4873 0.0154  -0.1408 0.0277  712  PHE A N   
93   C CA  . PHE A 17  ? 0.6418 0.4226 0.4862 0.0159  -0.1221 0.0220  712  PHE A CA  
94   C C   . PHE A 17  ? 0.6308 0.3876 0.4537 0.0091  -0.1221 0.0233  712  PHE A C   
95   O O   . PHE A 17  ? 0.6708 0.3932 0.4598 -0.0027 -0.1323 0.0304  712  PHE A O   
96   C CB  . PHE A 17  ? 0.6264 0.4401 0.4789 0.0052  -0.1047 0.0213  712  PHE A CB  
97   C CG  . PHE A 17  ? 0.6379 0.4427 0.4594 -0.0163 -0.1009 0.0272  712  PHE A CG  
98   C CD1 . PHE A 17  ? 0.6444 0.4553 0.4590 -0.0286 -0.0890 0.0264  712  PHE A CD1 
99   C CD2 . PHE A 17  ? 0.6260 0.4183 0.4260 -0.0247 -0.1084 0.0324  712  PHE A CD2 
100  C CE1 . PHE A 17  ? 0.6484 0.4560 0.4390 -0.0494 -0.0832 0.0302  712  PHE A CE1 
101  C CE2 . PHE A 17  ? 0.6551 0.4407 0.4255 -0.0458 -0.1017 0.0370  712  PHE A CE2 
102  C CZ  . PHE A 17  ? 0.6652 0.4604 0.4330 -0.0585 -0.0882 0.0356  712  PHE A CZ  
103  N N   . LYS A 18  ? 0.5835 0.3556 0.4243 0.0164  -0.1116 0.0166  713  LYS A N   
104  C CA  . LYS A 18  ? 0.6588 0.4085 0.4830 0.0128  -0.1130 0.0156  713  LYS A CA  
105  C C   . LYS A 18  ? 0.6309 0.4073 0.4657 0.0081  -0.0960 0.0110  713  LYS A C   
106  O O   . LYS A 18  ? 0.6142 0.4192 0.4746 0.0189  -0.0857 0.0055  713  LYS A O   
107  C CB  . LYS A 18  ? 0.6677 0.3994 0.5008 0.0329  -0.1233 0.0095  713  LYS A CB  
108  C CG  . LYS A 18  ? 0.8265 0.5256 0.6482 0.0403  -0.1447 0.0131  713  LYS A CG  
109  C CD  . LYS A 18  ? 0.9379 0.6187 0.7690 0.0608  -0.1544 0.0048  713  LYS A CD  
110  C CE  . LYS A 18  ? 1.0169 0.6633 0.8381 0.0709  -0.1789 0.0074  713  LYS A CE  
111  N NZ  . LYS A 18  ? 1.0535 0.6808 0.8841 0.0916  -0.1887 -0.0022 713  LYS A NZ  
112  N N   . LYS A 19  ? 0.6389 0.4054 0.4535 -0.0090 -0.0938 0.0133  714  LYS A N   
113  C CA  . LYS A 19  ? 0.6211 0.4069 0.4436 -0.0121 -0.0824 0.0079  714  LYS A CA  
114  C C   . LYS A 19  ? 0.6510 0.4172 0.4702 -0.0008 -0.0871 0.0019  714  LYS A C   
115  O O   . LYS A 19  ? 0.6699 0.4005 0.4686 -0.0035 -0.0991 0.0036  714  LYS A O   
116  C CB  . LYS A 19  ? 0.6388 0.4260 0.4461 -0.0352 -0.0784 0.0109  714  LYS A CB  
117  C CG  . LYS A 19  ? 0.6396 0.4407 0.4442 -0.0478 -0.0737 0.0160  714  LYS A CG  
118  C CD  . LYS A 19  ? 0.7718 0.5719 0.5608 -0.0719 -0.0691 0.0180  714  LYS A CD  
119  C CE  . LYS A 19  ? 0.7619 0.5732 0.5438 -0.0855 -0.0630 0.0221  714  LYS A CE  
120  N NZ  . LYS A 19  ? 0.7209 0.4953 0.4722 -0.0919 -0.0740 0.0312  714  LYS A NZ  
121  N N   . ILE A 20  ? 0.5945 0.3814 0.4316 0.0120  -0.0779 -0.0052 715  ILE A N   
122  C CA  . ILE A 20  ? 0.6097 0.3814 0.4444 0.0252  -0.0799 -0.0127 715  ILE A CA  
123  C C   . ILE A 20  ? 0.6192 0.3925 0.4439 0.0168  -0.0758 -0.0166 715  ILE A C   
124  O O   . ILE A 20  ? 0.6486 0.3948 0.4562 0.0154  -0.0835 -0.0200 715  ILE A O   
125  C CB  . ILE A 20  ? 0.6042 0.3949 0.4626 0.0455  -0.0715 -0.0188 715  ILE A CB  
126  C CG1 . ILE A 20  ? 0.5856 0.3752 0.4580 0.0547  -0.0783 -0.0167 715  ILE A CG1 
127  C CG2 . ILE A 20  ? 0.6474 0.4253 0.5013 0.0588  -0.0699 -0.0284 715  ILE A CG2 
128  C CD1 . ILE A 20  ? 0.7237 0.4774 0.5847 0.0622  -0.0950 -0.0178 715  ILE A CD1 
129  N N   . LYS A 21  ? 0.5807 0.3842 0.4160 0.0117  -0.0656 -0.0168 716  LYS A N   
130  C CA  . LYS A 21  ? 0.5599 0.3681 0.3883 0.0042  -0.0639 -0.0210 716  LYS A CA  
131  C C   . LYS A 21  ? 0.5618 0.3998 0.4009 -0.0081 -0.0578 -0.0186 716  LYS A C   
132  O O   . LYS A 21  ? 0.4853 0.3423 0.3377 -0.0072 -0.0522 -0.0148 716  LYS A O   
133  C CB  . LYS A 21  ? 0.5813 0.3926 0.4106 0.0199  -0.0584 -0.0286 716  LYS A CB  
134  C CG  . LYS A 21  ? 0.6484 0.4299 0.4646 0.0314  -0.0639 -0.0348 716  LYS A CG  
135  C CD  . LYS A 21  ? 0.6663 0.4194 0.4610 0.0195  -0.0758 -0.0370 716  LYS A CD  
136  C CE  . LYS A 21  ? 0.7984 0.5152 0.5805 0.0283  -0.0854 -0.0402 716  LYS A CE  
137  N NZ  . LYS A 21  ? 0.7901 0.5008 0.5708 0.0486  -0.0808 -0.0503 716  LYS A NZ  
138  N N   . VAL A 22  ? 0.5460 0.3885 0.3809 -0.0188 -0.0597 -0.0222 717  VAL A N   
139  C CA  . VAL A 22  ? 0.4995 0.3730 0.3485 -0.0283 -0.0545 -0.0226 717  VAL A CA  
140  C C   . VAL A 22  ? 0.4955 0.3889 0.3552 -0.0144 -0.0489 -0.0263 717  VAL A C   
141  O O   . VAL A 22  ? 0.5051 0.3892 0.3560 -0.0056 -0.0510 -0.0309 717  VAL A O   
142  C CB  . VAL A 22  ? 0.5584 0.4326 0.4036 -0.0464 -0.0596 -0.0261 717  VAL A CB  
143  C CG1 . VAL A 22  ? 0.5301 0.4406 0.3952 -0.0547 -0.0540 -0.0285 717  VAL A CG1 
144  C CG2 . VAL A 22  ? 0.5697 0.4187 0.3993 -0.0627 -0.0648 -0.0214 717  VAL A CG2 
145  N N   . LEU A 23  ? 0.4230 0.3409 0.2986 -0.0126 -0.0421 -0.0241 718  LEU A N   
146  C CA  . LEU A 23  ? 0.4270 0.3610 0.3102 -0.0018 -0.0381 -0.0267 718  LEU A CA  
147  C C   . LEU A 23  ? 0.4138 0.3663 0.3044 -0.0098 -0.0420 -0.0318 718  LEU A C   
148  O O   . LEU A 23  ? 0.4533 0.4030 0.3375 -0.0051 -0.0472 -0.0366 718  LEU A O   
149  C CB  . LEU A 23  ? 0.3911 0.3395 0.2878 0.0051  -0.0301 -0.0226 718  LEU A CB  
150  C CG  . LEU A 23  ? 0.4339 0.3702 0.3295 0.0163  -0.0258 -0.0196 718  LEU A CG  
151  C CD1 . LEU A 23  ? 0.4177 0.3697 0.3291 0.0192  -0.0196 -0.0160 718  LEU A CD1 
152  C CD2 . LEU A 23  ? 0.5161 0.4423 0.4017 0.0285  -0.0228 -0.0227 718  LEU A CD2 
153  N N   . GLY A 24  ? 0.4237 0.3948 0.3276 -0.0219 -0.0401 -0.0318 719  GLY A N   
154  C CA  . GLY A 24  ? 0.4146 0.4095 0.3327 -0.0289 -0.0430 -0.0385 719  GLY A CA  
155  C C   . GLY A 24  ? 0.4454 0.4530 0.3718 -0.0483 -0.0406 -0.0398 719  GLY A C   
156  O O   . GLY A 24  ? 0.4883 0.4873 0.4081 -0.0555 -0.0358 -0.0340 719  GLY A O   
157  N N   . SER A 25  ? 0.4845 0.5129 0.4255 -0.0570 -0.0440 -0.0478 720  SER A N   
158  C CA  . SER A 25  ? 0.5543 0.5995 0.5059 -0.0777 -0.0391 -0.0505 720  SER A CA  
159  C C   . SER A 25  ? 0.6011 0.6846 0.5820 -0.0802 -0.0395 -0.0616 720  SER A C   
160  O O   . SER A 25  ? 0.5644 0.6561 0.5541 -0.0666 -0.0478 -0.0671 720  SER A O   
161  C CB  . SER A 25  ? 0.5840 0.6062 0.5197 -0.0942 -0.0439 -0.0491 720  SER A CB  
162  O OG  . SER A 25  ? 0.5975 0.6268 0.5346 -0.1161 -0.0360 -0.0478 720  SER A OG  
163  N N   . GLY A 26  ? 0.6794 0.7856 0.6744 -0.0974 -0.0306 -0.0653 721  GLY A N   
164  C CA  . GLY A 26  ? 0.7337 0.8814 0.7620 -0.1022 -0.0294 -0.0781 721  GLY A CA  
165  C C   . GLY A 26  ? 0.7712 0.9428 0.8110 -0.1145 -0.0139 -0.0805 721  GLY A C   
166  O O   . GLY A 26  ? 0.7986 0.9540 0.8187 -0.1302 -0.0053 -0.0730 721  GLY A O   
167  N N   . ALA A 27  ? 0.7836 0.9914 0.8529 -0.1066 -0.0110 -0.0912 722  ALA A N   
168  C CA  . ALA A 27  ? 0.7874 1.0196 0.8678 -0.1144 0.0046  -0.0956 722  ALA A CA  
169  C C   . ALA A 27  ? 0.7890 1.0037 0.8519 -0.0999 0.0081  -0.0872 722  ALA A C   
170  O O   . ALA A 27  ? 0.7634 0.9690 0.8260 -0.0789 -0.0006 -0.0852 722  ALA A O   
171  C CB  . ALA A 27  ? 0.7909 1.0703 0.9131 -0.1104 0.0057  -0.1129 722  ALA A CB  
172  N N   . PHE A 28  ? 0.8031 1.0126 0.8505 -0.1127 0.0208  -0.0827 723  PHE A N   
173  C CA  . PHE A 28  ? 0.8040 0.9923 0.8305 -0.1036 0.0234  -0.0737 723  PHE A CA  
174  C C   . PHE A 28  ? 0.7909 0.9371 0.7829 -0.1092 0.0190  -0.0590 723  PHE A C   
175  O O   . PHE A 28  ? 0.7987 0.9252 0.7723 -0.1041 0.0197  -0.0511 723  PHE A O   
176  C CB  . PHE A 28  ? 0.8063 0.9956 0.8432 -0.0781 0.0159  -0.0750 723  PHE A CB  
177  C CG  . PHE A 28  ? 0.8343 1.0540 0.8941 -0.0705 0.0223  -0.0864 723  PHE A CG  
178  C CD1 . PHE A 28  ? 0.8538 1.0645 0.9063 -0.0589 0.0240  -0.0835 723  PHE A CD1 
179  C CD2 . PHE A 28  ? 0.8645 1.1220 0.9550 -0.0742 0.0257  -0.1014 723  PHE A CD2 
180  C CE1 . PHE A 28  ? 0.8596 1.0949 0.9316 -0.0508 0.0289  -0.0950 723  PHE A CE1 
181  C CE2 . PHE A 28  ? 0.8862 1.1715 0.9991 -0.0651 0.0311  -0.1138 723  PHE A CE2 
182  C CZ  . PHE A 28  ? 0.8741 1.1465 0.9761 -0.0531 0.0326  -0.1104 723  PHE A CZ  
183  N N   . GLY A 29  ? 0.7520 0.8841 0.7365 -0.1190 0.0131  -0.0563 724  GLY A N   
184  C CA  . GLY A 29  ? 0.6910 0.7820 0.6437 -0.1247 0.0079  -0.0440 724  GLY A CA  
185  C C   . GLY A 29  ? 0.6351 0.7029 0.5815 -0.1107 -0.0050 -0.0402 724  GLY A C   
186  O O   . GLY A 29  ? 0.6226 0.7020 0.5840 -0.1057 -0.0109 -0.0469 724  GLY A O   
187  N N   . THR A 30  ? 0.5781 0.6130 0.5017 -0.1043 -0.0096 -0.0303 725  THR A N   
188  C CA  . THR A 30  ? 0.5395 0.5491 0.4535 -0.0917 -0.0198 -0.0269 725  THR A CA  
189  C C   . THR A 30  ? 0.4955 0.4904 0.4028 -0.0748 -0.0210 -0.0206 725  THR A C   
190  O O   . THR A 30  ? 0.4666 0.4529 0.3638 -0.0784 -0.0187 -0.0152 725  THR A O   
191  C CB  . THR A 30  ? 0.5871 0.5658 0.4791 -0.1056 -0.0257 -0.0225 725  THR A CB  
192  O OG1 . THR A 30  ? 0.6155 0.6095 0.5160 -0.1244 -0.0237 -0.0286 725  THR A OG1 
193  C CG2 . THR A 30  ? 0.5866 0.5400 0.4691 -0.0913 -0.0357 -0.0215 725  THR A CG2 
194  N N   . VAL A 31  ? 0.4503 0.4431 0.3632 -0.0571 -0.0246 -0.0218 726  VAL A N   
195  C CA  . VAL A 31  ? 0.4271 0.4089 0.3378 -0.0418 -0.0248 -0.0170 726  VAL A CA  
196  C C   . VAL A 31  ? 0.4309 0.3846 0.3277 -0.0349 -0.0313 -0.0146 726  VAL A C   
197  O O   . VAL A 31  ? 0.4394 0.3882 0.3329 -0.0328 -0.0348 -0.0185 726  VAL A O   
198  C CB  . VAL A 31  ? 0.3892 0.3902 0.3165 -0.0274 -0.0211 -0.0201 726  VAL A CB  
199  C CG1 . VAL A 31  ? 0.3710 0.3622 0.2986 -0.0140 -0.0198 -0.0155 726  VAL A CG1 
200  C CG2 . VAL A 31  ? 0.4621 0.4896 0.4038 -0.0326 -0.0158 -0.0242 726  VAL A CG2 
201  N N   . TYR A 32  ? 0.4240 0.3593 0.3128 -0.0306 -0.0337 -0.0093 727  TYR A N   
202  C CA  . TYR A 32  ? 0.4522 0.3610 0.3302 -0.0221 -0.0399 -0.0083 727  TYR A CA  
203  C C   . TYR A 32  ? 0.4228 0.3352 0.3122 -0.0046 -0.0368 -0.0082 727  TYR A C   
204  O O   . TYR A 32  ? 0.4225 0.3504 0.3242 -0.0020 -0.0325 -0.0064 727  TYR A O   
205  C CB  . TYR A 32  ? 0.4816 0.3637 0.3420 -0.0307 -0.0476 -0.0030 727  TYR A CB  
206  C CG  . TYR A 32  ? 0.5151 0.3915 0.3622 -0.0518 -0.0489 -0.0018 727  TYR A CG  
207  C CD1 . TYR A 32  ? 0.5399 0.3955 0.3734 -0.0586 -0.0551 -0.0035 727  TYR A CD1 
208  C CD2 . TYR A 32  ? 0.5633 0.4552 0.4110 -0.0659 -0.0431 0.0003  727  TYR A CD2 
209  C CE1 . TYR A 32  ? 0.6010 0.4521 0.4239 -0.0807 -0.0554 -0.0024 727  TYR A CE1 
210  C CE2 . TYR A 32  ? 0.5775 0.4666 0.4139 -0.0876 -0.0416 0.0009  727  TYR A CE2 
211  C CZ  . TYR A 32  ? 0.6308 0.4999 0.4559 -0.0956 -0.0477 -0.0002 727  TYR A CZ  
212  O OH  . TYR A 32  ? 0.6404 0.5070 0.4559 -0.1193 -0.0454 0.0004  727  TYR A OH  
213  N N   . LYS A 33  ? 0.4194 0.3177 0.3050 0.0066  -0.0383 -0.0109 728  LYS A N   
214  C CA  . LYS A 33  ? 0.4218 0.3206 0.3184 0.0218  -0.0350 -0.0115 728  LYS A CA  
215  C C   . LYS A 33  ? 0.4567 0.3341 0.3482 0.0236  -0.0444 -0.0092 728  LYS A C   
216  O O   . LYS A 33  ? 0.4980 0.3518 0.3721 0.0176  -0.0529 -0.0087 728  LYS A O   
217  C CB  . LYS A 33  ? 0.4813 0.3779 0.3765 0.0335  -0.0295 -0.0168 728  LYS A CB  
218  C CG  . LYS A 33  ? 0.6161 0.4872 0.4962 0.0379  -0.0355 -0.0211 728  LYS A CG  
219  C CD  . LYS A 33  ? 0.7144 0.5856 0.5911 0.0498  -0.0274 -0.0272 728  LYS A CD  
220  C CE  . LYS A 33  ? 0.7744 0.6221 0.6420 0.0599  -0.0309 -0.0334 728  LYS A CE  
221  N NZ  . LYS A 33  ? 0.7951 0.6451 0.6809 0.0709  -0.0294 -0.0342 728  LYS A NZ  
222  N N   . GLY A 34  ? 0.4550 0.3391 0.3614 0.0312  -0.0444 -0.0079 729  GLY A N   
223  C CA  . GLY A 34  ? 0.5062 0.3698 0.4089 0.0346  -0.0562 -0.0060 729  GLY A CA  
224  C C   . GLY A 34  ? 0.4908 0.3649 0.4167 0.0479  -0.0562 -0.0079 729  GLY A C   
225  O O   . GLY A 34  ? 0.4371 0.3327 0.3825 0.0554  -0.0448 -0.0115 729  GLY A O   
226  N N   . LEU A 35  ? 0.4950 0.3523 0.4181 0.0501  -0.0699 -0.0056 730  LEU A N   
227  C CA  . LEU A 35  ? 0.5024 0.3695 0.4500 0.0622  -0.0739 -0.0080 730  LEU A CA  
228  C C   . LEU A 35  ? 0.5180 0.3788 0.4583 0.0547  -0.0856 -0.0017 730  LEU A C   
229  O O   . LEU A 35  ? 0.5779 0.4132 0.4899 0.0446  -0.0960 0.0041  730  LEU A O   
230  C CB  . LEU A 35  ? 0.5228 0.3736 0.4776 0.0782  -0.0825 -0.0143 730  LEU A CB  
231  C CG  . LEU A 35  ? 0.5354 0.3931 0.4995 0.0889  -0.0701 -0.0230 730  LEU A CG  
232  C CD1 . LEU A 35  ? 0.6569 0.4897 0.6188 0.1028  -0.0815 -0.0295 730  LEU A CD1 
233  C CD2 . LEU A 35  ? 0.4959 0.3874 0.4919 0.0961  -0.0546 -0.0278 730  LEU A CD2 
234  N N   . TRP A 36  ? 0.5200 0.4031 0.4837 0.0582  -0.0834 -0.0029 731  TRP A N   
235  C CA  . TRP A 36  ? 0.5483 0.4252 0.5071 0.0543  -0.0964 0.0013  731  TRP A CA  
236  C C   . TRP A 36  ? 0.5739 0.4465 0.5542 0.0705  -0.1104 -0.0034 731  TRP A C   
237  O O   . TRP A 36  ? 0.5145 0.4094 0.5286 0.0823  -0.1030 -0.0109 731  TRP A O   
238  C CB  . TRP A 36  ? 0.5178 0.4202 0.4871 0.0469  -0.0868 0.0021  731  TRP A CB  
239  C CG  . TRP A 36  ? 0.5315 0.4332 0.5031 0.0458  -0.0993 0.0037  731  TRP A CG  
240  C CD1 . TRP A 36  ? 0.6731 0.5479 0.6213 0.0432  -0.1178 0.0082  731  TRP A CD1 
241  C CD2 . TRP A 36  ? 0.5287 0.4546 0.5244 0.0467  -0.0952 0.0009  731  TRP A CD2 
242  N NE1 . TRP A 36  ? 0.6356 0.5177 0.5919 0.0433  -0.1261 0.0078  731  TRP A NE1 
243  C CE2 . TRP A 36  ? 0.5925 0.5065 0.5794 0.0453  -0.1125 0.0029  731  TRP A CE2 
244  C CE3 . TRP A 36  ? 0.4621 0.4155 0.4835 0.0480  -0.0795 -0.0029 731  TRP A CE3 
245  C CZ2 . TRP A 36  ? 0.6207 0.5515 0.6263 0.0453  -0.1146 0.0001  731  TRP A CZ2 
246  C CZ3 . TRP A 36  ? 0.5713 0.5401 0.6113 0.0473  -0.0811 -0.0049 731  TRP A CZ3 
247  C CH2 . TRP A 36  ? 0.5706 0.5292 0.6039 0.0460  -0.0986 -0.0040 731  TRP A CH2 
248  N N   . ILE A 37  ? 0.6051 0.4473 0.5646 0.0710  -0.1306 0.0005  732  ILE A N   
249  C CA  . ILE A 37  ? 0.6490 0.4823 0.6266 0.0878  -0.1487 -0.0043 732  ILE A CA  
250  C C   . ILE A 37  ? 0.6346 0.4578 0.6026 0.0844  -0.1670 0.0004  732  ILE A C   
251  O O   . ILE A 37  ? 0.6756 0.4621 0.6078 0.0796  -0.1844 0.0075  732  ILE A O   
252  C CB  . ILE A 37  ? 0.6827 0.4801 0.6405 0.0951  -0.1610 -0.0046 732  ILE A CB  
253  C CG1 . ILE A 37  ? 0.7537 0.5548 0.7079 0.0934  -0.1430 -0.0078 732  ILE A CG1 
254  C CG2 . ILE A 37  ? 0.7526 0.5477 0.7394 0.1172  -0.1776 -0.0133 732  ILE A CG2 
255  C CD1 . ILE A 37  ? 0.8201 0.5802 0.7371 0.0883  -0.1523 -0.0036 732  ILE A CD1 
256  N N   . PRO A 38  ? 0.6189 0.4721 0.6160 0.0858  -0.1635 -0.0032 733  PRO A N   
257  C CA  . PRO A 38  ? 0.6393 0.4840 0.6265 0.0821  -0.1810 0.0003  733  PRO A CA  
258  C C   . PRO A 38  ? 0.6604 0.4876 0.6576 0.0980  -0.2083 -0.0030 733  PRO A C   
259  O O   . PRO A 38  ? 0.7448 0.5324 0.7041 0.0960  -0.2277 0.0039  733  PRO A O   
260  C CB  . PRO A 38  ? 0.6077 0.4913 0.6286 0.0801  -0.1680 -0.0046 733  PRO A CB  
261  C CG  . PRO A 38  ? 0.5722 0.4836 0.6315 0.0895  -0.1506 -0.0125 733  PRO A CG  
262  C CD  . PRO A 38  ? 0.5823 0.4759 0.6204 0.0899  -0.1436 -0.0106 733  PRO A CD  
263  N N   . VAL A 43  ? 0.7206 0.6421 0.8794 0.1567  -0.1635 -0.0480 738  VAL A N   
264  C CA  . VAL A 43  ? 0.6706 0.6196 0.8403 0.1499  -0.1327 -0.0501 738  VAL A CA  
265  C C   . VAL A 43  ? 0.6488 0.5766 0.7715 0.1351  -0.1219 -0.0400 738  VAL A C   
266  O O   . VAL A 43  ? 0.6367 0.5387 0.7231 0.1243  -0.1338 -0.0301 738  VAL A O   
267  C CB  . VAL A 43  ? 0.6412 0.6271 0.8428 0.1425  -0.1212 -0.0514 738  VAL A CB  
268  C CG1 . VAL A 43  ? 0.6153 0.5916 0.7868 0.1250  -0.1249 -0.0398 738  VAL A CG1 
269  C CG2 . VAL A 43  ? 0.6498 0.6643 0.8716 0.1405  -0.0913 -0.0564 738  VAL A CG2 
270  N N   . LYS A 44  ? 0.6159 0.5552 0.7400 0.1345  -0.0996 -0.0433 739  LYS A N   
271  C CA  . LYS A 44  ? 0.5963 0.5189 0.6816 0.1224  -0.0898 -0.0361 739  LYS A CA  
272  C C   . LYS A 44  ? 0.5480 0.4960 0.6381 0.1121  -0.0672 -0.0341 739  LYS A C   
273  O O   . LYS A 44  ? 0.5299 0.5002 0.6438 0.1176  -0.0503 -0.0407 739  LYS A O   
274  C CB  . LYS A 44  ? 0.6077 0.5126 0.6818 0.1319  -0.0875 -0.0420 739  LYS A CB  
275  C CG  . LYS A 44  ? 0.7053 0.5762 0.7665 0.1415  -0.1114 -0.0431 739  LYS A CG  
276  C CD  . LYS A 44  ? 0.7413 0.5956 0.7937 0.1519  -0.1076 -0.0509 739  LYS A CD  
277  C CE  . LYS A 44  ? 0.8570 0.6703 0.8906 0.1604  -0.1327 -0.0510 739  LYS A CE  
278  N NZ  . LYS A 44  ? 0.8608 0.6510 0.8755 0.1662  -0.1296 -0.0570 739  LYS A NZ  
279  N N   . ILE A 45  ? 0.4971 0.4401 0.5631 0.0971  -0.0667 -0.0251 740  ILE A N   
280  C CA  . ILE A 45  ? 0.4373 0.4009 0.5066 0.0880  -0.0491 -0.0227 740  ILE A CA  
281  C C   . ILE A 45  ? 0.4067 0.3581 0.4440 0.0791  -0.0422 -0.0184 740  ILE A C   
282  O O   . ILE A 45  ? 0.4325 0.3656 0.4441 0.0706  -0.0519 -0.0131 740  ILE A O   
283  C CB  . ILE A 45  ? 0.4544 0.4280 0.5294 0.0794  -0.0543 -0.0183 740  ILE A CB  
284  C CG1 . ILE A 45  ? 0.5123 0.4981 0.6207 0.0879  -0.0641 -0.0235 740  ILE A CG1 
285  C CG2 . ILE A 45  ? 0.3990 0.3910 0.4780 0.0715  -0.0375 -0.0165 740  ILE A CG2 
286  C CD1 . ILE A 45  ? 0.5468 0.5289 0.6507 0.0815  -0.0793 -0.0195 740  ILE A CD1 
287  N N   . PRO A 46  ? 0.3922 0.3533 0.4306 0.0803  -0.0256 -0.0209 741  PRO A N   
288  C CA  . PRO A 46  ? 0.3859 0.3375 0.3969 0.0729  -0.0207 -0.0180 741  PRO A CA  
289  C C   . PRO A 46  ? 0.3648 0.3228 0.3667 0.0603  -0.0208 -0.0120 741  PRO A C   
290  O O   . PRO A 46  ? 0.3704 0.3455 0.3871 0.0585  -0.0142 -0.0110 741  PRO A O   
291  C CB  . PRO A 46  ? 0.3968 0.3588 0.4130 0.0783  -0.0035 -0.0221 741  PRO A CB  
292  C CG  . PRO A 46  ? 0.4267 0.3988 0.4705 0.0898  0.0004  -0.0289 741  PRO A CG  
293  C CD  . PRO A 46  ? 0.3955 0.3760 0.4593 0.0882  -0.0106 -0.0269 741  PRO A CD  
294  N N   . VAL A 47  ? 0.3582 0.3024 0.3369 0.0513  -0.0280 -0.0087 742  VAL A N   
295  C CA  . VAL A 47  ? 0.3582 0.3097 0.3287 0.0393  -0.0276 -0.0048 742  VAL A CA  
296  C C   . VAL A 47  ? 0.3487 0.2955 0.2999 0.0311  -0.0258 -0.0046 742  VAL A C   
297  O O   . VAL A 47  ? 0.3798 0.3114 0.3185 0.0322  -0.0286 -0.0062 742  VAL A O   
298  C CB  . VAL A 47  ? 0.3616 0.3046 0.3251 0.0325  -0.0394 -0.0012 742  VAL A CB  
299  C CG1 . VAL A 47  ? 0.3546 0.3060 0.3396 0.0394  -0.0433 -0.0021 742  VAL A CG1 
300  C CG2 . VAL A 47  ? 0.3819 0.2977 0.3242 0.0300  -0.0509 0.0008  742  VAL A CG2 
301  N N   . ALA A 48  ? 0.3129 0.2737 0.2639 0.0235  -0.0217 -0.0039 743  ALA A N   
302  C CA  . ALA A 48  ? 0.3377 0.2985 0.2751 0.0131  -0.0222 -0.0045 743  ALA A CA  
303  C C   . ALA A 48  ? 0.3548 0.3138 0.2837 0.0010  -0.0265 -0.0020 743  ALA A C   
304  O O   . ALA A 48  ? 0.3429 0.3083 0.2781 0.0008  -0.0269 -0.0007 743  ALA A O   
305  C CB  . ALA A 48  ? 0.3221 0.3006 0.2665 0.0140  -0.0153 -0.0071 743  ALA A CB  
306  N N   . ILE A 49  ? 0.3463 0.2952 0.2592 -0.0102 -0.0296 -0.0014 744  ILE A N   
307  C CA  . ILE A 49  ? 0.3855 0.3281 0.2839 -0.0244 -0.0324 0.0017  744  ILE A CA  
308  C C   . ILE A 49  ? 0.4151 0.3724 0.3120 -0.0374 -0.0264 -0.0018 744  ILE A C   
309  O O   . ILE A 49  ? 0.4256 0.3770 0.3173 -0.0417 -0.0278 -0.0035 744  ILE A O   
310  C CB  . ILE A 49  ? 0.4075 0.3181 0.2851 -0.0283 -0.0428 0.0066  744  ILE A CB  
311  C CG1 . ILE A 49  ? 0.4221 0.3210 0.3065 -0.0132 -0.0504 0.0080  744  ILE A CG1 
312  C CG2 . ILE A 49  ? 0.4726 0.3718 0.3278 -0.0458 -0.0450 0.0112  744  ILE A CG2 
313  C CD1 . ILE A 49  ? 0.5212 0.3881 0.3904 -0.0102 -0.0616 0.0101  744  ILE A CD1 
314  N N   . LYS A 50  ? 0.3873 0.3648 0.2906 -0.0429 -0.0200 -0.0044 745  LYS A N   
315  C CA  . LYS A 50  ? 0.4138 0.4104 0.3208 -0.0550 -0.0135 -0.0098 745  LYS A CA  
316  C C   . LYS A 50  ? 0.4512 0.4402 0.3390 -0.0740 -0.0113 -0.0072 745  LYS A C   
317  O O   . LYS A 50  ? 0.4685 0.4571 0.3488 -0.0767 -0.0094 -0.0056 745  LYS A O   
318  C CB  . LYS A 50  ? 0.4016 0.4271 0.3296 -0.0483 -0.0070 -0.0165 745  LYS A CB  
319  C CG  . LYS A 50  ? 0.4172 0.4675 0.3565 -0.0572 -0.0012 -0.0247 745  LYS A CG  
320  C CD  . LYS A 50  ? 0.4333 0.5079 0.3941 -0.0459 0.0021  -0.0318 745  LYS A CD  
321  C CE  . LYS A 50  ? 0.5048 0.6062 0.4829 -0.0503 0.0051  -0.0418 745  LYS A CE  
322  N NZ  . LYS A 50  ? 0.4660 0.5832 0.4633 -0.0344 0.0036  -0.0478 745  LYS A NZ  
323  N N   . GLU A 51  ? 0.4836 0.4644 0.3611 -0.0879 -0.0116 -0.0068 746  GLU A N   
324  C CA  . GLU A 51  ? 0.5072 0.4799 0.3640 -0.1097 -0.0073 -0.0041 746  GLU A CA  
325  C C   . GLU A 51  ? 0.5405 0.5474 0.4143 -0.1217 0.0045  -0.0134 746  GLU A C   
326  O O   . GLU A 51  ? 0.5412 0.5589 0.4282 -0.1250 0.0041  -0.0184 746  GLU A O   
327  C CB  . GLU A 51  ? 0.5358 0.4733 0.3686 -0.1197 -0.0156 0.0028  746  GLU A CB  
328  C CG  . GLU A 51  ? 0.6023 0.5246 0.4073 -0.1447 -0.0111 0.0077  746  GLU A CG  
329  C CD  . GLU A 51  ? 0.7266 0.6026 0.5002 -0.1521 -0.0228 0.0174  746  GLU A CD  
330  O OE1 . GLU A 51  ? 0.7163 0.5806 0.4934 -0.1492 -0.0296 0.0164  746  GLU A OE1 
331  O OE2 . GLU A 51  ? 0.7957 0.6442 0.5387 -0.1608 -0.0262 0.0257  746  GLU A OE2 
332  N N   . LEU A 52  ? 0.5725 0.5969 0.4467 -0.1279 0.0144  -0.0169 747  LEU A N   
333  C CA  . LEU A 52  ? 0.5823 0.6452 0.4784 -0.1364 0.0269  -0.0284 747  LEU A CA  
334  C C   . LEU A 52  ? 0.6214 0.6863 0.5096 -0.1619 0.0342  -0.0295 747  LEU A C   
335  O O   . LEU A 52  ? 0.6621 0.6956 0.5183 -0.1772 0.0329  -0.0200 747  LEU A O   
336  C CB  . LEU A 52  ? 0.5822 0.6617 0.4792 -0.1350 0.0362  -0.0332 747  LEU A CB  
337  C CG  . LEU A 52  ? 0.6326 0.7099 0.5356 -0.1137 0.0306  -0.0326 747  LEU A CG  
338  C CD1 . LEU A 52  ? 0.6492 0.7456 0.5536 -0.1158 0.0410  -0.0403 747  LEU A CD1 
339  C CD2 . LEU A 52  ? 0.6195 0.7100 0.5507 -0.0939 0.0243  -0.0367 747  LEU A CD2 
340  N N   . ALA A 60  ? 1.1742 1.1556 0.7283 -0.2551 0.1245  -0.0371 755  ALA A N   
341  C CA  . ALA A 60  ? 1.1140 1.1333 0.7289 -0.2294 0.1200  -0.0491 755  ALA A CA  
342  C C   . ALA A 60  ? 1.0938 1.0892 0.7180 -0.2060 0.0918  -0.0396 755  ALA A C   
343  O O   . ALA A 60  ? 1.0522 1.0675 0.7110 -0.1847 0.0860  -0.0484 755  ALA A O   
344  C CB  . ALA A 60  ? 1.0706 1.1272 0.7332 -0.2319 0.1303  -0.0551 755  ALA A CB  
345  N N   . ASN A 61  ? 1.1188 1.0712 0.7120 -0.2105 0.0746  -0.0223 756  ASN A N   
346  C CA  . ASN A 61  ? 1.0918 1.0216 0.6945 -0.1899 0.0481  -0.0133 756  ASN A CA  
347  C C   . ASN A 61  ? 1.0690 1.0031 0.6817 -0.1709 0.0384  -0.0204 756  ASN A C   
348  O O   . ASN A 61  ? 1.0155 0.9596 0.6658 -0.1507 0.0264  -0.0215 756  ASN A O   
349  C CB  . ASN A 61  ? 1.1463 1.0235 0.7013 -0.1988 0.0309  0.0042  756  ASN A CB  
350  C CG  . ASN A 61  ? 1.1655 1.0318 0.7160 -0.2135 0.0341  0.0130  756  ASN A CG  
351  O OD1 . ASN A 61  ? 1.2597 1.0834 0.7636 -0.2280 0.0267  0.0260  756  ASN A OD1 
352  N ND2 . ASN A 61  ? 1.1423 1.0439 0.7391 -0.2098 0.0435  0.0061  756  ASN A ND2 
353  N N   . LYS A 62  ? 1.0729 0.9983 0.6499 -0.1788 0.0442  -0.0253 757  LYS A N   
354  C CA  . LYS A 62  ? 1.0581 0.9850 0.6383 -0.1639 0.0356  -0.0334 757  LYS A CA  
355  C C   . LYS A 62  ? 0.9962 0.9663 0.6312 -0.1477 0.0443  -0.0486 757  LYS A C   
356  O O   . LYS A 62  ? 0.9722 0.9438 0.6293 -0.1298 0.0309  -0.0516 757  LYS A O   
357  C CB  . LYS A 62  ? 1.1207 1.0319 0.6482 -0.1784 0.0446  -0.0379 757  LYS A CB  
358  C CG  . LYS A 62  ? 1.1323 1.0311 0.6483 -0.1658 0.0302  -0.0435 757  LYS A CG  
359  C CD  . LYS A 62  ? 1.1890 1.0690 0.6459 -0.1817 0.0400  -0.0479 757  LYS A CD  
360  C CE  . LYS A 62  ? 1.2137 1.0839 0.6610 -0.1690 0.0262  -0.0564 757  LYS A CE  
361  N NZ  . LYS A 62  ? 1.2912 1.1421 0.6772 -0.1839 0.0362  -0.0621 757  LYS A NZ  
362  N N   . GLU A 63  ? 0.9541 0.9581 0.6109 -0.1544 0.0657  -0.0581 758  GLU A N   
363  C CA  . GLU A 63  ? 0.8991 0.9427 0.6060 -0.1392 0.0734  -0.0729 758  GLU A CA  
364  C C   . GLU A 63  ? 0.8209 0.8720 0.5694 -0.1248 0.0619  -0.0668 758  GLU A C   
365  O O   . GLU A 63  ? 0.7858 0.8496 0.5669 -0.1066 0.0555  -0.0725 758  GLU A O   
366  C CB  . GLU A 63  ? 0.9305 1.0092 0.6475 -0.1512 0.0992  -0.0866 758  GLU A CB  
367  C CG  . GLU A 63  ? 0.9493 1.0673 0.7112 -0.1350 0.1074  -0.1054 758  GLU A CG  
368  C CD  . GLU A 63  ? 1.0284 1.1816 0.7970 -0.1470 0.1335  -0.1220 758  GLU A CD  
369  O OE1 . GLU A 63  ? 1.0491 1.2123 0.8166 -0.1645 0.1453  -0.1188 758  GLU A OE1 
370  O OE2 . GLU A 63  ? 1.0570 1.2285 0.8332 -0.1391 0.1424  -0.1392 758  GLU A OE2 
371  N N   . ILE A 64  ? 0.7769 0.8177 0.5211 -0.1338 0.0596  -0.0553 759  ILE A N   
372  C CA  . ILE A 64  ? 0.7044 0.7478 0.4810 -0.1216 0.0488  -0.0488 759  ILE A CA  
373  C C   . ILE A 64  ? 0.6631 0.6858 0.4441 -0.1053 0.0287  -0.0418 759  ILE A C   
374  O O   . ILE A 64  ? 0.5916 0.6263 0.4072 -0.0895 0.0233  -0.0433 759  ILE A O   
375  C CB  . ILE A 64  ? 0.7339 0.7636 0.4982 -0.1355 0.0487  -0.0379 759  ILE A CB  
376  C CG1 . ILE A 64  ? 0.7810 0.8391 0.5537 -0.1511 0.0691  -0.0465 759  ILE A CG1 
377  C CG2 . ILE A 64  ? 0.6347 0.6602 0.4254 -0.1215 0.0353  -0.0309 759  ILE A CG2 
378  C CD1 . ILE A 64  ? 0.8756 0.9144 0.6221 -0.1726 0.0720  -0.0362 759  ILE A CD1 
379  N N   . LEU A 65  ? 0.6734 0.6649 0.4188 -0.1097 0.0176  -0.0345 760  LEU A N   
380  C CA  . LEU A 65  ? 0.6493 0.6233 0.4002 -0.0955 -0.0020 -0.0294 760  LEU A CA  
381  C C   . LEU A 65  ? 0.6272 0.6186 0.4020 -0.0825 -0.0020 -0.0405 760  LEU A C   
382  O O   . LEU A 65  ? 0.5684 0.5614 0.3706 -0.0685 -0.0124 -0.0390 760  LEU A O   
383  C CB  . LEU A 65  ? 0.7145 0.6514 0.4206 -0.1031 -0.0158 -0.0207 760  LEU A CB  
384  C CG  . LEU A 65  ? 0.7049 0.6129 0.3870 -0.1115 -0.0245 -0.0070 760  LEU A CG  
385  C CD1 . LEU A 65  ? 0.8280 0.6966 0.4619 -0.1177 -0.0401 0.0005  760  LEU A CD1 
386  C CD2 . LEU A 65  ? 0.7008 0.6091 0.4161 -0.0973 -0.0360 -0.0014 760  LEU A CD2 
387  N N   . ASP A 66  ? 0.6598 0.6630 0.4232 -0.0877 0.0103  -0.0519 761  ASP A N   
388  C CA  . ASP A 66  ? 0.6624 0.6798 0.4454 -0.0760 0.0109  -0.0641 761  ASP A CA  
389  C C   . ASP A 66  ? 0.6200 0.6616 0.4491 -0.0626 0.0141  -0.0680 761  ASP A C   
390  O O   . ASP A 66  ? 0.6060 0.6469 0.4572 -0.0498 0.0048  -0.0690 761  ASP A O   
391  C CB  . ASP A 66  ? 0.7170 0.7449 0.4793 -0.0844 0.0267  -0.0774 761  ASP A CB  
392  C CG  . ASP A 66  ? 0.7836 0.8184 0.5577 -0.0726 0.0248  -0.0907 761  ASP A CG  
393  O OD1 . ASP A 66  ? 0.8360 0.8873 0.6058 -0.0750 0.0398  -0.1052 761  ASP A OD1 
394  O OD2 . ASP A 66  ? 0.8423 0.8661 0.6305 -0.0615 0.0088  -0.0877 761  ASP A OD2 
395  N N   . GLU A 67  ? 0.5966 0.6577 0.4388 -0.0667 0.0263  -0.0697 762  GLU A N   
396  C CA  . GLU A 67  ? 0.5674 0.6487 0.4487 -0.0545 0.0278  -0.0726 762  GLU A CA  
397  C C   . GLU A 67  ? 0.5160 0.5843 0.4108 -0.0467 0.0152  -0.0603 762  GLU A C   
398  O O   . GLU A 67  ? 0.4865 0.5598 0.4069 -0.0338 0.0109  -0.0614 762  GLU A O   
399  C CB  . GLU A 67  ? 0.6048 0.7107 0.4966 -0.0615 0.0421  -0.0783 762  GLU A CB  
400  C CG  . GLU A 67  ? 0.7042 0.8318 0.5934 -0.0667 0.0575  -0.0942 762  GLU A CG  
401  C CD  . GLU A 67  ? 0.7712 0.9104 0.6815 -0.0506 0.0564  -0.1072 762  GLU A CD  
402  O OE1 . GLU A 67  ? 0.8315 0.9721 0.7269 -0.0527 0.0626  -0.1178 762  GLU A OE1 
403  O OE2 . GLU A 67  ? 0.7937 0.9375 0.7325 -0.0362 0.0491  -0.1068 762  GLU A OE2 
404  N N   . ALA A 68  ? 0.4679 0.5178 0.3440 -0.0546 0.0095  -0.0490 763  ALA A N   
405  C CA  . ALA A 68  ? 0.4329 0.4707 0.3210 -0.0471 -0.0016 -0.0389 763  ALA A CA  
406  C C   . ALA A 68  ? 0.3940 0.4220 0.2916 -0.0368 -0.0134 -0.0375 763  ALA A C   
407  O O   . ALA A 68  ? 0.3891 0.4180 0.3092 -0.0273 -0.0179 -0.0338 763  ALA A O   
408  C CB  . ALA A 68  ? 0.4387 0.4559 0.3030 -0.0568 -0.0067 -0.0285 763  ALA A CB  
409  N N   . TYR A 69  ? 0.4071 0.4260 0.2873 -0.0397 -0.0180 -0.0410 764  TYR A N   
410  C CA  . TYR A 69  ? 0.3920 0.4031 0.2838 -0.0313 -0.0303 -0.0411 764  TYR A CA  
411  C C   . TYR A 69  ? 0.3718 0.3979 0.2961 -0.0206 -0.0265 -0.0464 764  TYR A C   
412  O O   . TYR A 69  ? 0.3766 0.4001 0.3217 -0.0136 -0.0335 -0.0425 764  TYR A O   
413  C CB  . TYR A 69  ? 0.3980 0.3970 0.2642 -0.0362 -0.0362 -0.0462 764  TYR A CB  
414  C CG  . TYR A 69  ? 0.4003 0.3917 0.2805 -0.0287 -0.0507 -0.0470 764  TYR A CG  
415  C CD1 . TYR A 69  ? 0.4111 0.4108 0.3080 -0.0230 -0.0491 -0.0563 764  TYR A CD1 
416  C CD2 . TYR A 69  ? 0.4712 0.4471 0.3502 -0.0273 -0.0668 -0.0392 764  TYR A CD2 
417  C CE1 . TYR A 69  ? 0.3895 0.3823 0.3012 -0.0183 -0.0626 -0.0572 764  TYR A CE1 
418  C CE2 . TYR A 69  ? 0.4262 0.3988 0.3231 -0.0214 -0.0806 -0.0412 764  TYR A CE2 
419  C CZ  . TYR A 69  ? 0.4251 0.4065 0.3384 -0.0180 -0.0778 -0.0499 764  TYR A CZ  
420  O OH  . TYR A 69  ? 0.4176 0.3959 0.3498 -0.0142 -0.0912 -0.0520 764  TYR A OH  
421  N N   . VAL A 70  ? 0.3868 0.4280 0.3154 -0.0197 -0.0155 -0.0556 765  VAL A N   
422  C CA  . VAL A 70  ? 0.3942 0.4451 0.3492 -0.0093 -0.0132 -0.0604 765  VAL A CA  
423  C C   . VAL A 70  ? 0.3668 0.4201 0.3409 -0.0038 -0.0130 -0.0521 765  VAL A C   
424  O O   . VAL A 70  ? 0.3488 0.3987 0.3407 0.0030  -0.0165 -0.0497 765  VAL A O   
425  C CB  . VAL A 70  ? 0.4258 0.4931 0.3829 -0.0075 -0.0027 -0.0729 765  VAL A CB  
426  C CG1 . VAL A 70  ? 0.4399 0.5113 0.4209 0.0045  -0.0034 -0.0774 765  VAL A CG1 
427  C CG2 . VAL A 70  ? 0.4952 0.5598 0.4305 -0.0131 -0.0010 -0.0824 765  VAL A CG2 
428  N N   . MET A 71  ? 0.3348 0.3921 0.3029 -0.0082 -0.0086 -0.0477 766  MET A N   
429  C CA  . MET A 71  ? 0.3058 0.3633 0.2867 -0.0036 -0.0083 -0.0406 766  MET A CA  
430  C C   . MET A 71  ? 0.3238 0.3685 0.3099 -0.0012 -0.0163 -0.0321 766  MET A C   
431  O O   . MET A 71  ? 0.3375 0.3821 0.3376 0.0047  -0.0153 -0.0279 766  MET A O   
432  C CB  . MET A 71  ? 0.3275 0.3898 0.2984 -0.0104 -0.0034 -0.0387 766  MET A CB  
433  C CG  . MET A 71  ? 0.3851 0.4660 0.3586 -0.0125 0.0055  -0.0482 766  MET A CG  
434  S SD  . MET A 71  ? 0.4701 0.5563 0.4274 -0.0271 0.0119  -0.0474 766  MET A SD  
435  C CE  . MET A 71  ? 0.5137 0.5815 0.4666 -0.0269 0.0046  -0.0348 766  MET A CE  
436  N N   . ALA A 72  ? 0.3391 0.3730 0.3132 -0.0056 -0.0243 -0.0304 767  ALA A N   
437  C CA  . ALA A 72  ? 0.3203 0.3451 0.3039 -0.0022 -0.0336 -0.0247 767  ALA A CA  
438  C C   . ALA A 72  ? 0.3127 0.3390 0.3160 0.0023  -0.0377 -0.0275 767  ALA A C   
439  O O   . ALA A 72  ? 0.3516 0.3766 0.3724 0.0059  -0.0428 -0.0242 767  ALA A O   
440  C CB  . ALA A 72  ? 0.3375 0.3475 0.2995 -0.0079 -0.0439 -0.0214 767  ALA A CB  
441  N N   . SER A 73  ? 0.3257 0.3552 0.3275 0.0018  -0.0355 -0.0345 768  SER A N   
442  C CA  . SER A 73  ? 0.3571 0.3847 0.3739 0.0039  -0.0408 -0.0380 768  SER A CA  
443  C C   . SER A 73  ? 0.3612 0.3930 0.3988 0.0090  -0.0339 -0.0377 768  SER A C   
444  O O   . SER A 73  ? 0.3889 0.4177 0.4420 0.0094  -0.0374 -0.0388 768  SER A O   
445  C CB  . SER A 73  ? 0.3962 0.4201 0.3964 0.0007  -0.0438 -0.0467 768  SER A CB  
446  O OG  . SER A 73  ? 0.4795 0.5106 0.4799 0.0035  -0.0343 -0.0530 768  SER A OG  
447  N N   . VAL A 74  ? 0.3441 0.3809 0.3803 0.0121  -0.0249 -0.0361 769  VAL A N   
448  C CA  . VAL A 74  ? 0.3311 0.3669 0.3804 0.0171  -0.0196 -0.0349 769  VAL A CA  
449  C C   . VAL A 74  ? 0.3565 0.3901 0.4222 0.0171  -0.0184 -0.0278 769  VAL A C   
450  O O   . VAL A 74  ? 0.3949 0.4311 0.4620 0.0168  -0.0184 -0.0233 769  VAL A O   
451  C CB  . VAL A 74  ? 0.3392 0.3799 0.3821 0.0212  -0.0129 -0.0351 769  VAL A CB  
452  C CG1 . VAL A 74  ? 0.3879 0.4348 0.4221 0.0221  -0.0123 -0.0447 769  VAL A CG1 
453  C CG2 . VAL A 74  ? 0.3703 0.4148 0.4066 0.0196  -0.0105 -0.0297 769  VAL A CG2 
454  N N   . ASP A 75  ? 0.3411 0.3692 0.4192 0.0172  -0.0170 -0.0274 770  ASP A N   
455  C CA  . ASP A 75  ? 0.3603 0.3883 0.4557 0.0154  -0.0130 -0.0217 770  ASP A CA  
456  C C   . ASP A 75  ? 0.3189 0.3370 0.4149 0.0163  -0.0060 -0.0188 770  ASP A C   
457  O O   . ASP A 75  ? 0.3314 0.3411 0.4336 0.0135  -0.0082 -0.0208 770  ASP A O   
458  C CB  . ASP A 75  ? 0.3647 0.3951 0.4775 0.0105  -0.0209 -0.0244 770  ASP A CB  
459  C CG  . ASP A 75  ? 0.4549 0.4905 0.5921 0.0076  -0.0154 -0.0204 770  ASP A CG  
460  O OD1 . ASP A 75  ? 0.4127 0.4502 0.5498 0.0097  -0.0051 -0.0153 770  ASP A OD1 
461  O OD2 . ASP A 75  ? 0.5597 0.5981 0.7165 0.0027  -0.0212 -0.0234 770  ASP A OD2 
462  N N   . ASN A 76  ? 0.2877 0.3038 0.3736 0.0203  0.0011  -0.0141 771  ASN A N   
463  C CA  . ASN A 76  ? 0.3199 0.3223 0.3997 0.0217  0.0071  -0.0096 771  ASN A CA  
464  C C   . ASN A 76  ? 0.3138 0.3165 0.3868 0.0235  0.0158  -0.0033 771  ASN A C   
465  O O   . ASN A 76  ? 0.3058 0.3166 0.3717 0.0270  0.0148  -0.0043 771  ASN A O   
466  C CB  . ASN A 76  ? 0.3072 0.3023 0.3727 0.0282  0.0022  -0.0138 771  ASN A CB  
467  C CG  . ASN A 76  ? 0.2930 0.2687 0.3483 0.0309  0.0049  -0.0087 771  ASN A CG  
468  O OD1 . ASN A 76  ? 0.3419 0.3135 0.3843 0.0352  0.0080  -0.0046 771  ASN A OD1 
469  N ND2 . ASN A 76  ? 0.3275 0.2880 0.3862 0.0280  0.0027  -0.0088 771  ASN A ND2 
470  N N   . PRO A 77  ? 0.3448 0.3370 0.4176 0.0204  0.0248  0.0029  772  PRO A N   
471  C CA  . PRO A 77  ? 0.3470 0.3384 0.4101 0.0222  0.0343  0.0079  772  PRO A CA  
472  C C   . PRO A 77  ? 0.3500 0.3355 0.3898 0.0300  0.0310  0.0082  772  PRO A C   
473  O O   . PRO A 77  ? 0.3581 0.3450 0.3891 0.0323  0.0359  0.0102  772  PRO A O   
474  C CB  . PRO A 77  ? 0.3913 0.3684 0.4526 0.0159  0.0453  0.0145  772  PRO A CB  
475  C CG  . PRO A 77  ? 0.4329 0.4080 0.5113 0.0090  0.0418  0.0127  772  PRO A CG  
476  C CD  . PRO A 77  ? 0.3328 0.3122 0.4123 0.0137  0.0277  0.0055  772  PRO A CD  
477  N N   . HIS A 78  ? 0.3155 0.2951 0.3471 0.0345  0.0223  0.0051  773  HIS A N   
478  C CA  . HIS A 78  ? 0.3037 0.2801 0.3178 0.0421  0.0175  0.0039  773  HIS A CA  
479  C C   . HIS A 78  ? 0.2813 0.2745 0.2996 0.0450  0.0100  -0.0040 773  HIS A C   
480  O O   . HIS A 78  ? 0.2905 0.2841 0.3004 0.0511  0.0044  -0.0073 773  HIS A O   
481  C CB  . HIS A 78  ? 0.3316 0.2863 0.3307 0.0467  0.0138  0.0067  773  HIS A CB  
482  C CG  . HIS A 78  ? 0.4116 0.3468 0.4009 0.0413  0.0233  0.0159  773  HIS A CG  
483  N ND1 . HIS A 78  ? 0.4580 0.3899 0.4350 0.0398  0.0328  0.0212  773  HIS A ND1 
484  C CD2 . HIS A 78  ? 0.4396 0.3587 0.4302 0.0355  0.0264  0.0201  773  HIS A CD2 
485  C CE1 . HIS A 78  ? 0.4444 0.3599 0.4149 0.0328  0.0429  0.0285  773  HIS A CE1 
486  N NE2 . HIS A 78  ? 0.4577 0.3649 0.4366 0.0294  0.0390  0.0285  773  HIS A NE2 
487  N N   . VAL A 79  ? 0.2669 0.2736 0.2977 0.0402  0.0096  -0.0072 774  VAL A N   
488  C CA  . VAL A 79  ? 0.2638 0.2848 0.2958 0.0398  0.0048  -0.0138 774  VAL A CA  
489  C C   . VAL A 79  ? 0.2346 0.2626 0.2691 0.0350  0.0064  -0.0120 774  VAL A C   
490  O O   . VAL A 79  ? 0.2785 0.3060 0.3233 0.0318  0.0077  -0.0098 774  VAL A O   
491  C CB  . VAL A 79  ? 0.2774 0.3023 0.3165 0.0388  0.0002  -0.0207 774  VAL A CB  
492  C CG1 . VAL A 79  ? 0.3112 0.3510 0.3477 0.0370  -0.0021 -0.0278 774  VAL A CG1 
493  C CG2 . VAL A 79  ? 0.2979 0.3119 0.3354 0.0450  -0.0028 -0.0231 774  VAL A CG2 
494  N N   . CYS A 80  ? 0.2817 0.3150 0.3080 0.0349  0.0055  -0.0130 775  CYS A N   
495  C CA  . CYS A 80  ? 0.2612 0.2972 0.2868 0.0308  0.0047  -0.0116 775  CYS A CA  
496  C C   . CYS A 80  ? 0.2856 0.3266 0.3138 0.0256  -0.0001 -0.0149 775  CYS A C   
497  O O   . CYS A 80  ? 0.2962 0.3420 0.3236 0.0246  -0.0016 -0.0201 775  CYS A O   
498  C CB  . CYS A 80  ? 0.2760 0.3133 0.2902 0.0302  0.0039  -0.0121 775  CYS A CB  
499  S SG  . CYS A 80  ? 0.3408 0.3689 0.3459 0.0363  0.0078  -0.0086 775  CYS A SG  
500  N N   . ARG A 81  ? 0.3049 0.3432 0.3353 0.0231  -0.0031 -0.0126 776  ARG A N   
501  C CA  . ARG A 81  ? 0.3048 0.3433 0.3329 0.0182  -0.0097 -0.0147 776  ARG A CA  
502  C C   . ARG A 81  ? 0.2807 0.3143 0.2945 0.0142  -0.0137 -0.0128 776  ARG A C   
503  O O   . ARG A 81  ? 0.2978 0.3265 0.3115 0.0168  -0.0133 -0.0094 776  ARG A O   
504  C CB  . ARG A 81  ? 0.3169 0.3536 0.3612 0.0194  -0.0134 -0.0136 776  ARG A CB  
505  C CG  . ARG A 81  ? 0.4333 0.4683 0.4752 0.0153  -0.0226 -0.0166 776  ARG A CG  
506  C CD  . ARG A 81  ? 0.4104 0.4459 0.4730 0.0167  -0.0285 -0.0164 776  ARG A CD  
507  N NE  . ARG A 81  ? 0.5530 0.5860 0.6200 0.0191  -0.0345 -0.0138 776  ARG A NE  
508  C CZ  . ARG A 81  ? 0.5265 0.5510 0.5799 0.0174  -0.0460 -0.0134 776  ARG A CZ  
509  N NH1 . ARG A 81  ? 0.5020 0.5202 0.5337 0.0116  -0.0510 -0.0151 776  ARG A NH1 
510  N NH2 . ARG A 81  ? 0.6120 0.6325 0.6715 0.0218  -0.0526 -0.0115 776  ARG A NH2 
511  N N   . LEU A 82  ? 0.3005 0.3332 0.3002 0.0073  -0.0171 -0.0150 777  LEU A N   
512  C CA  . LEU A 82  ? 0.3059 0.3284 0.2879 0.0013  -0.0221 -0.0119 777  LEU A CA  
513  C C   . LEU A 82  ? 0.3486 0.3604 0.3341 0.0040  -0.0323 -0.0089 777  LEU A C   
514  O O   . LEU A 82  ? 0.3732 0.3863 0.3657 0.0048  -0.0372 -0.0110 777  LEU A O   
515  C CB  . LEU A 82  ? 0.3419 0.3657 0.3046 -0.0087 -0.0208 -0.0152 777  LEU A CB  
516  C CG  . LEU A 82  ? 0.4905 0.5040 0.4303 -0.0187 -0.0219 -0.0120 777  LEU A CG  
517  C CD1 . LEU A 82  ? 0.4862 0.5059 0.4300 -0.0189 -0.0158 -0.0120 777  LEU A CD1 
518  C CD2 . LEU A 82  ? 0.5096 0.5262 0.4313 -0.0295 -0.0181 -0.0161 777  LEU A CD2 
519  N N   . LEU A 83  ? 0.3374 0.3385 0.3192 0.0061  -0.0369 -0.0049 778  LEU A N   
520  C CA  . LEU A 83  ? 0.3674 0.3586 0.3552 0.0108  -0.0489 -0.0031 778  LEU A CA  
521  C C   . LEU A 83  ? 0.4091 0.3818 0.3698 0.0038  -0.0604 -0.0003 778  LEU A C   
522  O O   . LEU A 83  ? 0.4380 0.4025 0.3987 0.0059  -0.0732 -0.0001 778  LEU A O   
523  C CB  . LEU A 83  ? 0.3715 0.3587 0.3694 0.0188  -0.0488 -0.0016 778  LEU A CB  
524  C CG  . LEU A 83  ? 0.4448 0.4460 0.4654 0.0259  -0.0372 -0.0036 778  LEU A CG  
525  C CD1 . LEU A 83  ? 0.4673 0.4614 0.4907 0.0330  -0.0373 -0.0033 778  LEU A CD1 
526  C CD2 . LEU A 83  ? 0.5306 0.5440 0.5773 0.0294  -0.0370 -0.0061 778  LEU A CD2 
527  N N   . GLY A 84  ? 0.3999 0.3646 0.3365 -0.0050 -0.0565 0.0019  779  GLY A N   
528  C CA  . GLY A 84  ? 0.4360 0.3780 0.3406 -0.0139 -0.0659 0.0062  779  GLY A CA  
529  C C   . GLY A 84  ? 0.4161 0.3561 0.2972 -0.0276 -0.0566 0.0073  779  GLY A C   
530  O O   . GLY A 84  ? 0.4070 0.3636 0.2988 -0.0287 -0.0447 0.0042  779  GLY A O   
531  N N   . ILE A 85  ? 0.4457 0.3643 0.2937 -0.0386 -0.0628 0.0115  780  ILE A N   
532  C CA  . ILE A 85  ? 0.4612 0.3776 0.2850 -0.0550 -0.0528 0.0124  780  ILE A CA  
533  C C   . ILE A 85  ? 0.5348 0.4154 0.3220 -0.0645 -0.0637 0.0210  780  ILE A C   
534  O O   . ILE A 85  ? 0.5552 0.4132 0.3286 -0.0600 -0.0796 0.0252  780  ILE A O   
535  C CB  . ILE A 85  ? 0.4613 0.3945 0.2789 -0.0630 -0.0423 0.0062  780  ILE A CB  
536  C CG1 . ILE A 85  ? 0.5225 0.4631 0.3246 -0.0799 -0.0279 0.0044  780  ILE A CG1 
537  C CG2 . ILE A 85  ? 0.5194 0.4338 0.3128 -0.0650 -0.0534 0.0082  780  ILE A CG2 
538  C CD1 . ILE A 85  ? 0.5337 0.5019 0.3441 -0.0833 -0.0138 -0.0057 780  ILE A CD1 
539  N N   . CYS A 86  ? 0.5374 0.4117 0.3092 -0.0776 -0.0565 0.0235  781  CYS A N   
540  C CA  . CYS A 86  ? 0.6331 0.4702 0.3648 -0.0906 -0.0647 0.0324  781  CYS A CA  
541  C C   . CYS A 86  ? 0.6545 0.4965 0.3638 -0.1135 -0.0488 0.0319  781  CYS A C   
542  O O   . CYS A 86  ? 0.6334 0.4962 0.3588 -0.1195 -0.0361 0.0276  781  CYS A O   
543  C CB  . CYS A 86  ? 0.6502 0.4676 0.3851 -0.0846 -0.0740 0.0365  781  CYS A CB  
544  S SG  . CYS A 86  ? 0.7502 0.5130 0.4328 -0.0996 -0.0878 0.0485  781  CYS A SG  
545  N N   . LEU A 87  ? 0.7143 0.5380 0.3864 -0.1265 -0.0494 0.0357  782  LEU A N   
546  C CA  . LEU A 87  ? 0.7875 0.6170 0.4364 -0.1499 -0.0317 0.0345  782  LEU A CA  
547  C C   . LEU A 87  ? 0.8580 0.6433 0.4596 -0.1687 -0.0377 0.0463  782  LEU A C   
548  O O   . LEU A 87  ? 0.9112 0.6598 0.4734 -0.1715 -0.0508 0.0545  782  LEU A O   
549  C CB  . LEU A 87  ? 0.8086 0.6508 0.4457 -0.1536 -0.0237 0.0287  782  LEU A CB  
550  C CG  . LEU A 87  ? 0.7937 0.6766 0.4716 -0.1382 -0.0165 0.0164  782  LEU A CG  
551  C CD1 . LEU A 87  ? 0.8714 0.7598 0.5282 -0.1454 -0.0082 0.0105  782  LEU A CD1 
552  C CD2 . LEU A 87  ? 0.8173 0.7386 0.5340 -0.1373 -0.0011 0.0076  782  LEU A CD2 
553  N N   . THR A 88  ? 0.8880 0.6746 0.4927 -0.1812 -0.0295 0.0473  783  THR A N   
554  C CA  . THR A 88  ? 0.9757 0.7214 0.5358 -0.2034 -0.0318 0.0582  783  THR A CA  
555  C C   . THR A 88  ? 0.9941 0.7650 0.5537 -0.2290 -0.0068 0.0530  783  THR A C   
556  O O   . THR A 88  ? 0.9871 0.7861 0.5486 -0.2359 0.0097  0.0454  783  THR A O   
557  C CB  . THR A 88  ? 0.9795 0.6964 0.5426 -0.1957 -0.0483 0.0644  783  THR A CB  
558  O OG1 . THR A 88  ? 0.9282 0.6803 0.5352 -0.1900 -0.0393 0.0555  783  THR A OG1 
559  C CG2 . THR A 88  ? 0.9590 0.6540 0.5260 -0.1700 -0.0722 0.0677  783  THR A CG2 
560  N N   . SER A 89  ? 1.0100 0.7723 0.5693 -0.2427 -0.0042 0.0557  784  SER A N   
561  C CA  . SER A 89  ? 1.0182 0.8121 0.5901 -0.2655 0.0187  0.0485  784  SER A CA  
562  C C   . SER A 89  ? 0.9358 0.7879 0.5667 -0.2499 0.0284  0.0330  784  SER A C   
563  O O   . SER A 89  ? 0.9112 0.8031 0.5614 -0.2620 0.0484  0.0225  784  SER A O   
564  C CB  . SER A 89  ? 1.0630 0.8298 0.6219 -0.2828 0.0152  0.0553  784  SER A CB  
565  O OG  . SER A 89  ? 1.1906 0.8950 0.6975 -0.2890 -0.0016 0.0708  784  SER A OG  
566  N N   . THR A 90  ? 0.8742 0.7300 0.5329 -0.2228 0.0139  0.0314  785  THR A N   
567  C CA  . THR A 90  ? 0.8150 0.7175 0.5242 -0.2050 0.0192  0.0188  785  THR A CA  
568  C C   . THR A 90  ? 0.7579 0.6673 0.4786 -0.1814 0.0121  0.0168  785  THR A C   
569  O O   . THR A 90  ? 0.7923 0.6699 0.4871 -0.1757 -0.0006 0.0250  785  THR A O   
570  C CB  . THR A 90  ? 0.7803 0.6817 0.5132 -0.1938 0.0094  0.0181  785  THR A CB  
571  O OG1 . THR A 90  ? 0.8252 0.6890 0.5435 -0.1784 -0.0096 0.0270  785  THR A OG1 
572  C CG2 . THR A 90  ? 0.8043 0.7001 0.5308 -0.2167 0.0146  0.0187  785  THR A CG2 
573  N N   . VAL A 91  ? 0.6828 0.6325 0.4428 -0.1677 0.0189  0.0056  786  VAL A N   
574  C CA  . VAL A 91  ? 0.6212 0.5786 0.3981 -0.1450 0.0118  0.0031  786  VAL A CA  
575  C C   . VAL A 91  ? 0.5613 0.5167 0.3620 -0.1269 0.0010  0.0042  786  VAL A C   
576  O O   . VAL A 91  ? 0.5869 0.5609 0.4095 -0.1263 0.0052  -0.0011 786  VAL A O   
577  C CB  . VAL A 91  ? 0.6150 0.6135 0.4182 -0.1402 0.0250  -0.0097 786  VAL A CB  
578  C CG1 . VAL A 91  ? 0.6253 0.6281 0.4450 -0.1183 0.0172  -0.0116 786  VAL A CG1 
579  C CG2 . VAL A 91  ? 0.6906 0.6939 0.4703 -0.1588 0.0388  -0.0130 786  VAL A CG2 
580  N N   . GLN A 92  ? 0.5394 0.4719 0.3348 -0.1126 -0.0129 0.0104  787  GLN A N   
581  C CA  . GLN A 92  ? 0.5084 0.4419 0.3274 -0.0938 -0.0207 0.0099  787  GLN A CA  
582  C C   . GLN A 92  ? 0.4851 0.4312 0.3241 -0.0760 -0.0233 0.0071  787  GLN A C   
583  O O   . GLN A 92  ? 0.5077 0.4414 0.3345 -0.0741 -0.0299 0.0101  787  GLN A O   
584  C CB  . GLN A 92  ? 0.5325 0.4291 0.3334 -0.0917 -0.0346 0.0181  787  GLN A CB  
585  C CG  . GLN A 92  ? 0.6032 0.4848 0.3880 -0.1076 -0.0335 0.0207  787  GLN A CG  
586  C CD  . GLN A 92  ? 0.6745 0.5156 0.4399 -0.1040 -0.0489 0.0281  787  GLN A CD  
587  O OE1 . GLN A 92  ? 0.6306 0.4684 0.4095 -0.0925 -0.0536 0.0259  787  GLN A OE1 
588  N NE2 . GLN A 92  ? 0.6740 0.4819 0.4054 -0.1133 -0.0572 0.0364  787  GLN A NE2 
589  N N   . LEU A 93  ? 0.4069 0.3757 0.2749 -0.0639 -0.0191 0.0014  788  LEU A N   
590  C CA  . LEU A 93  ? 0.4112 0.3927 0.3000 -0.0489 -0.0198 -0.0015 788  LEU A CA  
591  C C   . LEU A 93  ? 0.3833 0.3561 0.2847 -0.0346 -0.0262 0.0010  788  LEU A C   
592  O O   . LEU A 93  ? 0.3834 0.3555 0.2880 -0.0332 -0.0250 0.0004  788  LEU A O   
593  C CB  . LEU A 93  ? 0.3932 0.4045 0.3025 -0.0463 -0.0095 -0.0098 788  LEU A CB  
594  C CG  . LEU A 93  ? 0.4303 0.4575 0.3336 -0.0593 -0.0001 -0.0158 788  LEU A CG  
595  C CD1 . LEU A 93  ? 0.4624 0.5184 0.3908 -0.0525 0.0071  -0.0252 788  LEU A CD1 
596  C CD2 . LEU A 93  ? 0.4558 0.4749 0.3419 -0.0639 -0.0011 -0.0150 788  LEU A CD2 
597  N N   . ILE A 94  ? 0.3755 0.3425 0.2842 -0.0247 -0.0329 0.0028  789  ILE A N   
598  C CA  . ILE A 94  ? 0.3533 0.3141 0.2758 -0.0115 -0.0374 0.0039  789  ILE A CA  
599  C C   . ILE A 94  ? 0.3116 0.2905 0.2593 -0.0011 -0.0324 0.0006  789  ILE A C   
600  O O   . ILE A 94  ? 0.3126 0.2984 0.2656 -0.0014 -0.0333 -0.0007 789  ILE A O   
601  C CB  . ILE A 94  ? 0.3929 0.3301 0.3058 -0.0082 -0.0511 0.0082  789  ILE A CB  
602  C CG1 . ILE A 94  ? 0.4472 0.3591 0.3312 -0.0186 -0.0573 0.0129  789  ILE A CG1 
603  C CG2 . ILE A 94  ? 0.3872 0.3241 0.3207 0.0068  -0.0538 0.0067  789  ILE A CG2 
604  C CD1 . ILE A 94  ? 0.5528 0.4542 0.4101 -0.0333 -0.0596 0.0163  789  ILE A CD1 
605  N N   . THR A 95  ? 0.3132 0.2979 0.2736 0.0070  -0.0270 -0.0008 790  THR A N   
606  C CA  . THR A 95  ? 0.3087 0.3076 0.2894 0.0148  -0.0206 -0.0029 790  THR A CA  
607  C C   . THR A 95  ? 0.3012 0.2970 0.2914 0.0244  -0.0176 -0.0029 790  THR A C   
608  O O   . THR A 95  ? 0.3147 0.2992 0.2948 0.0255  -0.0196 -0.0026 790  THR A O   
609  C CB  . THR A 95  ? 0.3324 0.3450 0.3141 0.0125  -0.0130 -0.0059 790  THR A CB  
610  O OG1 . THR A 95  ? 0.3389 0.3600 0.3365 0.0186  -0.0086 -0.0068 790  THR A OG1 
611  C CG2 . THR A 95  ? 0.2851 0.2965 0.2600 0.0131  -0.0099 -0.0068 790  THR A CG2 
612  N N   . GLN A 96  ? 0.2909 0.2961 0.2991 0.0304  -0.0117 -0.0038 791  GLN A N   
613  C CA  . GLN A 96  ? 0.3170 0.3213 0.3338 0.0386  -0.0054 -0.0046 791  GLN A CA  
614  C C   . GLN A 96  ? 0.2957 0.2952 0.2975 0.0395  0.0002  -0.0050 791  GLN A C   
615  O O   . GLN A 96  ? 0.3252 0.3289 0.3200 0.0363  0.0026  -0.0048 791  GLN A O   
616  C CB  . GLN A 96  ? 0.3475 0.3631 0.3848 0.0415  0.0024  -0.0050 791  GLN A CB  
617  C CG  . GLN A 96  ? 0.3715 0.3877 0.4158 0.0481  0.0126  -0.0063 791  GLN A CG  
618  C CD  . GLN A 96  ? 0.4865 0.5138 0.5518 0.0482  0.0218  -0.0064 791  GLN A CD  
619  O OE1 . GLN A 96  ? 0.5004 0.5329 0.5733 0.0435  0.0198  -0.0052 791  GLN A OE1 
620  N NE2 . GLN A 96  ? 0.4523 0.4823 0.5259 0.0527  0.0329  -0.0083 791  GLN A NE2 
621  N N   . LEU A 97  ? 0.2870 0.2771 0.2839 0.0448  0.0008  -0.0065 792  LEU A N   
622  C CA  . LEU A 97  ? 0.2974 0.2808 0.2782 0.0464  0.0050  -0.0077 792  LEU A CA  
623  C C   . LEU A 97  ? 0.3479 0.3364 0.3307 0.0502  0.0162  -0.0073 792  LEU A C   
624  O O   . LEU A 97  ? 0.3627 0.3560 0.3593 0.0544  0.0241  -0.0076 792  LEU A O   
625  C CB  . LEU A 97  ? 0.3334 0.3025 0.3067 0.0517  0.0024  -0.0106 792  LEU A CB  
626  C CG  . LEU A 97  ? 0.3463 0.3048 0.2997 0.0531  0.0044  -0.0129 792  LEU A CG  
627  C CD1 . LEU A 97  ? 0.3565 0.3122 0.2959 0.0435  -0.0035 -0.0121 792  LEU A CD1 
628  C CD2 . LEU A 97  ? 0.4149 0.3586 0.3633 0.0608  0.0032  -0.0174 792  LEU A CD2 
629  N N   . MET A 98  ? 0.3181 0.3052 0.2872 0.0483  0.0164  -0.0067 793  MET A N   
630  C CA  . MET A 98  ? 0.3401 0.3255 0.3033 0.0517  0.0248  -0.0051 793  MET A CA  
631  C C   . MET A 98  ? 0.3347 0.3070 0.2775 0.0560  0.0272  -0.0072 793  MET A C   
632  O O   . MET A 98  ? 0.3577 0.3245 0.2858 0.0546  0.0196  -0.0090 793  MET A O   
633  C CB  . MET A 98  ? 0.3219 0.3117 0.2822 0.0489  0.0207  -0.0038 793  MET A CB  
634  C CG  . MET A 98  ? 0.3353 0.3367 0.3131 0.0448  0.0183  -0.0032 793  MET A CG  
635  S SD  . MET A 98  ? 0.4092 0.4119 0.4011 0.0460  0.0281  0.0001  793  MET A SD  
636  C CE  . MET A 98  ? 0.4711 0.4825 0.4845 0.0442  0.0258  -0.0015 793  MET A CE  
637  N N   . PRO A 99  ? 0.5263 0.3776 0.3826 0.1684  0.0480  -0.0083 794  PRO A N   
638  C CA  . PRO A 99  ? 0.5414 0.3568 0.3709 0.1765  0.0538  -0.0113 794  PRO A CA  
639  C C   . PRO A 99  ? 0.5124 0.3104 0.3274 0.1643  0.0556  -0.0170 794  PRO A C   
640  O O   . PRO A 99  ? 0.5559 0.3210 0.3455 0.1688  0.0595  -0.0205 794  PRO A O   
641  C CB  . PRO A 99  ? 0.5887 0.4194 0.4267 0.1969  0.0621  -0.0108 794  PRO A CB  
642  C CG  . PRO A 99  ? 0.5134 0.3906 0.3842 0.1938  0.0618  -0.0094 794  PRO A CG  
643  C CD  . PRO A 99  ? 0.5407 0.4296 0.4223 0.1780  0.0519  -0.0072 794  PRO A CD  
644  N N   . PHE A 100 ? 0.4746 0.2930 0.3038 0.1498  0.0527  -0.0181 795  PHE A N   
645  C CA  . PHE A 100 ? 0.4799 0.2833 0.2954 0.1377  0.0526  -0.0227 795  PHE A CA  
646  C C   . PHE A 100 ? 0.4928 0.2836 0.3018 0.1205  0.0435  -0.0229 795  PHE A C   
647  O O   . PHE A 100 ? 0.5099 0.2905 0.3088 0.1094  0.0414  -0.0264 795  PHE A O   
648  C CB  . PHE A 100 ? 0.4559 0.2868 0.2884 0.1340  0.0564  -0.0238 795  PHE A CB  
649  C CG  . PHE A 100 ? 0.4875 0.3264 0.3215 0.1486  0.0671  -0.0247 795  PHE A CG  
650  C CD1 . PHE A 100 ? 0.4740 0.3423 0.3308 0.1597  0.0707  -0.0215 795  PHE A CD1 
651  C CD2 . PHE A 100 ? 0.5316 0.3497 0.3440 0.1512  0.0736  -0.0291 795  PHE A CD2 
652  C CE1 . PHE A 100 ? 0.5323 0.4115 0.3926 0.1733  0.0814  -0.0223 795  PHE A CE1 
653  C CE2 . PHE A 100 ? 0.5819 0.4080 0.3951 0.1652  0.0848  -0.0301 795  PHE A CE2 
654  C CZ  . PHE A 100 ? 0.5797 0.4372 0.4178 0.1765  0.0891  -0.0265 795  PHE A CZ  
655  N N   . GLY A 101 ? 0.4772 0.2700 0.2917 0.1185  0.0381  -0.0190 796  GLY A N   
656  C CA  . GLY A 101 ? 0.4623 0.2439 0.2707 0.1027  0.0305  -0.0188 796  GLY A CA  
657  C C   . GLY A 101 ? 0.4684 0.2761 0.2962 0.0894  0.0257  -0.0188 796  GLY A C   
658  O O   . GLY A 101 ? 0.4477 0.2843 0.2964 0.0919  0.0273  -0.0178 796  GLY A O   
659  N N   . CYS A 102 ? 0.4492 0.2471 0.2705 0.0750  0.0200  -0.0198 797  CYS A N   
660  C CA  . CYS A 102 ? 0.4456 0.2677 0.2852 0.0637  0.0153  -0.0196 797  CYS A CA  
661  C C   . CYS A 102 ? 0.4369 0.2642 0.2772 0.0596  0.0159  -0.0230 797  CYS A C   
662  O O   . CYS A 102 ? 0.4338 0.2414 0.2559 0.0609  0.0181  -0.0262 797  CYS A O   
663  C CB  . CYS A 102 ? 0.5006 0.3167 0.3374 0.0506  0.0091  -0.0187 797  CYS A CB  
664  S SG  . CYS A 102 ? 0.6136 0.4020 0.4282 0.0387  0.0057  -0.0228 797  CYS A SG  
665  N N   . LEU A 103 ? 0.4190 0.2720 0.2792 0.0551  0.0142  -0.0223 798  LEU A N   
666  C CA  . LEU A 103 ? 0.3996 0.2591 0.2618 0.0523  0.0149  -0.0242 798  LEU A CA  
667  C C   . LEU A 103 ? 0.3918 0.2376 0.2407 0.0420  0.0095  -0.0267 798  LEU A C   
668  O O   . LEU A 103 ? 0.4276 0.2667 0.2663 0.0421  0.0108  -0.0287 798  LEU A O   
669  C CB  . LEU A 103 ? 0.3742 0.2617 0.2599 0.0503  0.0144  -0.0225 798  LEU A CB  
670  C CG  . LEU A 103 ? 0.3563 0.2515 0.2456 0.0493  0.0168  -0.0231 798  LEU A CG  
671  C CD1 . LEU A 103 ? 0.4112 0.3001 0.2916 0.0581  0.0248  -0.0238 798  LEU A CD1 
672  C CD2 . LEU A 103 ? 0.3950 0.3148 0.3071 0.0469  0.0161  -0.0216 798  LEU A CD2 
673  N N   . LEU A 104 ? 0.4256 0.2675 0.2735 0.0330  0.0035  -0.0264 799  LEU A N   
674  C CA  . LEU A 104 ? 0.4386 0.2706 0.2759 0.0221  -0.0027 -0.0289 799  LEU A CA  
675  C C   . LEU A 104 ? 0.4708 0.2741 0.2818 0.0238  -0.0011 -0.0325 799  LEU A C   
676  O O   . LEU A 104 ? 0.4930 0.2909 0.2938 0.0211  -0.0029 -0.0351 799  LEU A O   
677  C CB  . LEU A 104 ? 0.4269 0.2602 0.2682 0.0118  -0.0082 -0.0279 799  LEU A CB  
678  C CG  . LEU A 104 ? 0.4765 0.3032 0.3093 -0.0008 -0.0153 -0.0305 799  LEU A CG  
679  C CD1 . LEU A 104 ? 0.4450 0.2893 0.2874 -0.0025 -0.0189 -0.0310 799  LEU A CD1 
680  C CD2 . LEU A 104 ? 0.4683 0.2995 0.3076 -0.0111 -0.0191 -0.0289 799  LEU A CD2 
681  N N   . ASP A 105 ? 0.4818 0.2653 0.2804 0.0288  0.0023  -0.0326 800  ASP A N   
682  C CA  . ASP A 105 ? 0.5340 0.2864 0.3052 0.0319  0.0047  -0.0367 800  ASP A CA  
683  C C   . ASP A 105 ? 0.5217 0.2760 0.2887 0.0424  0.0113  -0.0382 800  ASP A C   
684  O O   . ASP A 105 ? 0.5469 0.2840 0.2939 0.0413  0.0114  -0.0424 800  ASP A O   
685  C CB  . ASP A 105 ? 0.5464 0.2774 0.3063 0.0387  0.0085  -0.0356 800  ASP A CB  
686  C CG  . ASP A 105 ? 0.6914 0.4125 0.4484 0.0268  0.0029  -0.0342 800  ASP A CG  
687  O OD1 . ASP A 105 ? 0.8059 0.5147 0.5583 0.0322  0.0055  -0.0313 800  ASP A OD1 
688  O OD2 . ASP A 105 ? 0.8019 0.5284 0.5613 0.0124  -0.0039 -0.0356 800  ASP A OD2 
689  N N   . TYR A 106 ? 0.5041 0.2798 0.2896 0.0520  0.0168  -0.0349 801  TYR A N   
690  C CA  . TYR A 106 ? 0.5125 0.2940 0.2974 0.0615  0.0244  -0.0355 801  TYR A CA  
691  C C   . TYR A 106 ? 0.4934 0.2792 0.2745 0.0547  0.0219  -0.0370 801  TYR A C   
692  O O   . TYR A 106 ? 0.5197 0.2915 0.2820 0.0585  0.0261  -0.0399 801  TYR A O   
693  C CB  . TYR A 106 ? 0.4995 0.3076 0.3086 0.0700  0.0296  -0.0316 801  TYR A CB  
694  C CG  . TYR A 106 ? 0.5256 0.3382 0.3332 0.0808  0.0393  -0.0321 801  TYR A CG  
695  C CD1 . TYR A 106 ? 0.5333 0.3600 0.3473 0.0779  0.0416  -0.0315 801  TYR A CD1 
696  C CD2 . TYR A 106 ? 0.5368 0.3390 0.3359 0.0942  0.0467  -0.0329 801  TYR A CD2 
697  C CE1 . TYR A 106 ? 0.5241 0.3556 0.3366 0.0866  0.0514  -0.0315 801  TYR A CE1 
698  C CE2 . TYR A 106 ? 0.5463 0.3550 0.3451 0.1043  0.0565  -0.0334 801  TYR A CE2 
699  C CZ  . TYR A 106 ? 0.5565 0.3802 0.3619 0.0998  0.0592  -0.0327 801  TYR A CZ  
700  O OH  . TYR A 106 ? 0.5955 0.4262 0.4003 0.1089  0.0700  -0.0328 801  TYR A OH  
701  N N   . VAL A 107 ? 0.4880 0.2918 0.2848 0.0454  0.0152  -0.0349 802  VAL A N   
702  C CA  . VAL A 107 ? 0.5014 0.3089 0.2942 0.0401  0.0120  -0.0354 802  VAL A CA  
703  C C   . VAL A 107 ? 0.5540 0.3396 0.3224 0.0328  0.0057  -0.0396 802  VAL A C   
704  O O   . VAL A 107 ? 0.5752 0.3547 0.3295 0.0325  0.0055  -0.0411 802  VAL A O   
705  C CB  . VAL A 107 ? 0.4739 0.3064 0.2898 0.0341  0.0069  -0.0319 802  VAL A CB  
706  C CG1 . VAL A 107 ? 0.4716 0.3242 0.3090 0.0405  0.0133  -0.0287 802  VAL A CG1 
707  C CG2 . VAL A 107 ? 0.4598 0.2960 0.2830 0.0247  -0.0017 -0.0320 802  VAL A CG2 
708  N N   . ARG A 108 ? 0.5527 0.3255 0.3149 0.0264  0.0005  -0.0416 803  ARG A N   
709  C CA  . ARG A 108 ? 0.5859 0.3365 0.3244 0.0178  -0.0059 -0.0465 803  ARG A CA  
710  C C   . ARG A 108 ? 0.6340 0.3573 0.3445 0.0255  0.0006  -0.0510 803  ARG A C   
711  O O   . ARG A 108 ? 0.6419 0.3506 0.3308 0.0214  -0.0028 -0.0552 803  ARG A O   
712  C CB  . ARG A 108 ? 0.5811 0.3240 0.3202 0.0080  -0.0117 -0.0472 803  ARG A CB  
713  C CG  . ARG A 108 ? 0.5726 0.3414 0.3357 -0.0014 -0.0190 -0.0439 803  ARG A CG  
714  C CD  . ARG A 108 ? 0.5931 0.3539 0.3562 -0.0108 -0.0226 -0.0440 803  ARG A CD  
715  N NE  . ARG A 108 ? 0.5379 0.3233 0.3219 -0.0209 -0.0294 -0.0417 803  ARG A NE  
716  C CZ  . ARG A 108 ? 0.5470 0.3342 0.3374 -0.0300 -0.0320 -0.0404 803  ARG A CZ  
717  N NH1 . ARG A 108 ? 0.6037 0.3668 0.3801 -0.0307 -0.0287 -0.0408 803  ARG A NH1 
718  N NH2 . ARG A 108 ? 0.5094 0.3217 0.3196 -0.0381 -0.0374 -0.0385 803  ARG A NH2 
719  N N   . GLU A 109 ? 0.6156 0.3327 0.3262 0.0373  0.0099  -0.0503 804  GLU A N   
720  C CA  . GLU A 109 ? 0.6828 0.3729 0.3671 0.0467  0.0174  -0.0548 804  GLU A CA  
721  C C   . GLU A 109 ? 0.6610 0.3578 0.3408 0.0555  0.0253  -0.0549 804  GLU A C   
722  O O   . GLU A 109 ? 0.7037 0.3781 0.3566 0.0594  0.0292  -0.0598 804  GLU A O   
723  C CB  . GLU A 109 ? 0.7160 0.3956 0.4010 0.0572  0.0241  -0.0539 804  GLU A CB  
724  C CG  . GLU A 109 ? 0.8069 0.4673 0.4845 0.0485  0.0177  -0.0549 804  GLU A CG  
725  C CD  . GLU A 109 ? 0.9492 0.5795 0.5977 0.0375  0.0116  -0.0616 804  GLU A CD  
726  O OE1 . GLU A 109 ? 0.9906 0.6207 0.6413 0.0222  0.0022  -0.0619 804  GLU A OE1 
727  O OE2 . GLU A 109 ? 0.9113 0.5192 0.5346 0.0438  0.0164  -0.0669 804  GLU A OE2 
728  N N   . HIS A 110 ? 0.6017 0.3281 0.3064 0.0577  0.0278  -0.0495 805  HIS A N   
729  C CA  . HIS A 110 ? 0.6253 0.3607 0.3289 0.0654  0.0366  -0.0482 805  HIS A CA  
730  C C   . HIS A 110 ? 0.6126 0.3616 0.3204 0.0576  0.0315  -0.0456 805  HIS A C   
731  O O   . HIS A 110 ? 0.6292 0.3921 0.3442 0.0620  0.0385  -0.0422 805  HIS A O   
732  C CB  . HIS A 110 ? 0.5861 0.3432 0.3137 0.0756  0.0458  -0.0440 805  HIS A CB  
733  C CG  . HIS A 110 ? 0.6335 0.3784 0.3565 0.0863  0.0515  -0.0457 805  HIS A CG  
734  N ND1 . HIS A 110 ? 0.6755 0.4190 0.4077 0.0849  0.0465  -0.0445 805  HIS A ND1 
735  C CD2 . HIS A 110 ? 0.7038 0.4359 0.4124 0.0994  0.0620  -0.0483 805  HIS A CD2 
736  C CE1 . HIS A 110 ? 0.7108 0.4403 0.4342 0.0970  0.0531  -0.0459 805  HIS A CE1 
737  N NE2 . HIS A 110 ? 0.7212 0.4444 0.4312 0.1065  0.0626  -0.0485 805  HIS A NE2 
738  N N   . LYS A 111 ? 0.6566 0.4011 0.3590 0.0461  0.0196  -0.0469 806  LYS A N   
739  C CA  . LYS A 111 ? 0.6827 0.4405 0.3900 0.0394  0.0129  -0.0440 806  LYS A CA  
740  C C   . LYS A 111 ? 0.7334 0.4859 0.4226 0.0435  0.0182  -0.0434 806  LYS A C   
741  O O   . LYS A 111 ? 0.7495 0.5159 0.4469 0.0414  0.0162  -0.0388 806  LYS A O   
742  C CB  . LYS A 111 ? 0.7032 0.4557 0.4043 0.0273  -0.0010 -0.0465 806  LYS A CB  
743  C CG  . LYS A 111 ? 0.8756 0.5990 0.5449 0.0237  -0.0043 -0.0536 806  LYS A CG  
744  C CD  . LYS A 111 ? 1.0021 0.7245 0.6604 0.0126  -0.0176 -0.0554 806  LYS A CD  
745  C CE  . LYS A 111 ? 1.0186 0.7594 0.6999 0.0021  -0.0283 -0.0534 806  LYS A CE  
746  N NZ  . LYS A 111 ? 1.0843 0.8134 0.7656 -0.0039 -0.0300 -0.0568 806  LYS A NZ  
747  N N   . ASP A 112 ? 0.7377 0.4688 0.4012 0.0497  0.0253  -0.0480 807  ASP A N   
748  C CA  . ASP A 112 ? 0.7818 0.5058 0.4243 0.0539  0.0316  -0.0478 807  ASP A CA  
749  C C   . ASP A 112 ? 0.7566 0.4933 0.4099 0.0641  0.0468  -0.0439 807  ASP A C   
750  O O   . ASP A 112 ? 0.7830 0.5174 0.4221 0.0672  0.0537  -0.0422 807  ASP A O   
751  C CB  . ASP A 112 ? 0.8545 0.5476 0.4599 0.0549  0.0317  -0.0556 807  ASP A CB  
752  C CG  . ASP A 112 ? 0.9402 0.6213 0.5327 0.0427  0.0160  -0.0599 807  ASP A CG  
753  O OD1 . ASP A 112 ? 0.9102 0.6069 0.5146 0.0346  0.0055  -0.0561 807  ASP A OD1 
754  O OD2 . ASP A 112 ? 1.0162 0.6721 0.5864 0.0413  0.0144  -0.0671 807  ASP A OD2 
755  N N   . ASN A 113 ? 0.7276 0.4786 0.4058 0.0688  0.0519  -0.0421 808  ASN A N   
756  C CA  . ASN A 113 ? 0.6907 0.4585 0.3839 0.0773  0.0655  -0.0385 808  ASN A CA  
757  C C   . ASN A 113 ? 0.6420 0.4381 0.3709 0.0750  0.0650  -0.0328 808  ASN A C   
758  O O   . ASN A 113 ? 0.6508 0.4631 0.3960 0.0814  0.0752  -0.0305 808  ASN A O   
759  C CB  . ASN A 113 ? 0.7212 0.4790 0.4063 0.0892  0.0757  -0.0426 808  ASN A CB  
760  C CG  . ASN A 113 ? 0.8221 0.5584 0.4741 0.0950  0.0835  -0.0468 808  ASN A CG  
761  O OD1 . ASN A 113 ? 0.8572 0.6013 0.5059 0.0984  0.0935  -0.0441 808  ASN A OD1 
762  N ND2 . ASN A 113 ? 0.9073 0.6153 0.5329 0.0954  0.0792  -0.0537 808  ASN A ND2 
763  N N   . ILE A 114 ? 0.6213 0.4242 0.3623 0.0658  0.0533  -0.0310 809  ILE A N   
764  C CA  . ILE A 114 ? 0.5573 0.3849 0.3296 0.0630  0.0524  -0.0264 809  ILE A CA  
765  C C   . ILE A 114 ? 0.5764 0.4116 0.3514 0.0581  0.0520  -0.0215 809  ILE A C   
766  O O   . ILE A 114 ? 0.6081 0.4358 0.3726 0.0524  0.0429  -0.0210 809  ILE A O   
767  C CB  . ILE A 114 ? 0.5291 0.3608 0.3149 0.0575  0.0415  -0.0274 809  ILE A CB  
768  C CG1 . ILE A 114 ? 0.5257 0.3507 0.3112 0.0630  0.0433  -0.0306 809  ILE A CG1 
769  C CG2 . ILE A 114 ? 0.5196 0.3748 0.3341 0.0538  0.0397  -0.0232 809  ILE A CG2 
770  C CD1 . ILE A 114 ? 0.5626 0.3847 0.3529 0.0565  0.0328  -0.0320 809  ILE A CD1 
771  N N   . GLY A 115 ? 0.5465 0.3965 0.3353 0.0603  0.0619  -0.0178 810  GLY A N   
772  C CA  . GLY A 115 ? 0.5412 0.3963 0.3323 0.0557  0.0633  -0.0124 810  GLY A CA  
773  C C   . GLY A 115 ? 0.5142 0.3855 0.3314 0.0501  0.0579  -0.0094 810  GLY A C   
774  O O   . GLY A 115 ? 0.5046 0.3857 0.3392 0.0497  0.0535  -0.0116 810  GLY A O   
775  N N   . SER A 116 ? 0.4949 0.3671 0.3125 0.0460  0.0585  -0.0045 811  SER A N   
776  C CA  . SER A 116 ? 0.4587 0.3423 0.2976 0.0408  0.0536  -0.0019 811  SER A CA  
777  C C   . SER A 116 ? 0.4574 0.3603 0.3224 0.0402  0.0593  -0.0024 811  SER A C   
778  O O   . SER A 116 ? 0.4171 0.3298 0.3002 0.0373  0.0531  -0.0035 811  SER A O   
779  C CB  . SER A 116 ? 0.4882 0.3649 0.3191 0.0376  0.0544  0.0040  811  SER A CB  
780  O OG  . SER A 116 ? 0.5246 0.4007 0.3493 0.0381  0.0673  0.0073  811  SER A OG  
781  N N   . GLN A 117 ? 0.4542 0.3638 0.3210 0.0431  0.0711  -0.0018 812  GLN A N   
782  C CA  . GLN A 117 ? 0.4686 0.3996 0.3610 0.0423  0.0764  -0.0022 812  GLN A CA  
783  C C   . GLN A 117 ? 0.4195 0.3587 0.3240 0.0456  0.0700  -0.0065 812  GLN A C   
784  O O   . GLN A 117 ? 0.4016 0.3551 0.3268 0.0422  0.0665  -0.0072 812  GLN A O   
785  C CB  . GLN A 117 ? 0.4811 0.4205 0.3738 0.0457  0.0904  -0.0009 812  GLN A CB  
786  C CG  . GLN A 117 ? 0.5168 0.4818 0.4378 0.0433  0.0957  -0.0006 812  GLN A CG  
787  C CD  . GLN A 117 ? 0.5409 0.5107 0.4737 0.0328  0.0960  0.0029  812  GLN A CD  
788  O OE1 . GLN A 117 ? 0.5336 0.4978 0.4582 0.0288  0.1038  0.0072  812  GLN A OE1 
789  N NE2 . GLN A 117 ? 0.5111 0.4892 0.4613 0.0284  0.0879  0.0010  812  GLN A NE2 
790  N N   . TYR A 118 ? 0.4075 0.3356 0.2970 0.0519  0.0687  -0.0096 813  TYR A N   
791  C CA  . TYR A 118 ? 0.4227 0.3543 0.3195 0.0556  0.0633  -0.0130 813  TYR A CA  
792  C C   . TYR A 118 ? 0.3824 0.3133 0.2855 0.0498  0.0516  -0.0137 813  TYR A C   
793  O O   . TYR A 118 ? 0.3881 0.3319 0.3085 0.0492  0.0484  -0.0147 813  TYR A O   
794  C CB  . TYR A 118 ? 0.4783 0.3927 0.3538 0.0628  0.0646  -0.0160 813  TYR A CB  
795  C CG  . TYR A 118 ? 0.5651 0.4859 0.4414 0.0721  0.0760  -0.0165 813  TYR A CG  
796  C CD1 . TYR A 118 ? 0.5833 0.5129 0.4705 0.0793  0.0766  -0.0181 813  TYR A CD1 
797  C CD2 . TYR A 118 ? 0.6391 0.5581 0.5052 0.0743  0.0865  -0.0150 813  TYR A CD2 
798  C CE1 . TYR A 118 ? 0.6601 0.5977 0.5495 0.0896  0.0871  -0.0184 813  TYR A CE1 
799  C CE2 . TYR A 118 ? 0.7178 0.6454 0.5862 0.0837  0.0980  -0.0156 813  TYR A CE2 
800  C CZ  . TYR A 118 ? 0.6961 0.6337 0.5771 0.0918  0.0980  -0.0174 813  TYR A CZ  
801  O OH  . TYR A 118 ? 0.7117 0.6598 0.5963 0.1027  0.1093  -0.0178 813  TYR A OH  
802  N N   . LEU A 119 ? 0.3995 0.3167 0.2887 0.0459  0.0454  -0.0133 814  LEU A N   
803  C CA  . LEU A 119 ? 0.3659 0.2843 0.2618 0.0409  0.0349  -0.0140 814  LEU A CA  
804  C C   . LEU A 119 ? 0.3571 0.2913 0.2746 0.0370  0.0343  -0.0126 814  LEU A C   
805  O O   . LEU A 119 ? 0.3336 0.2764 0.2639 0.0355  0.0292  -0.0142 814  LEU A O   
806  C CB  . LEU A 119 ? 0.3981 0.3028 0.2774 0.0379  0.0281  -0.0132 814  LEU A CB  
807  C CG  . LEU A 119 ? 0.4208 0.3091 0.2786 0.0395  0.0252  -0.0162 814  LEU A CG  
808  C CD1 . LEU A 119 ? 0.4625 0.3383 0.3009 0.0375  0.0213  -0.0148 814  LEU A CD1 
809  C CD2 . LEU A 119 ? 0.4424 0.3310 0.3045 0.0369  0.0174  -0.0191 814  LEU A CD2 
810  N N   . LEU A 120 ? 0.3652 0.3018 0.2856 0.0350  0.0400  -0.0096 815  LEU A N   
811  C CA  . LEU A 120 ? 0.3424 0.2905 0.2813 0.0303  0.0395  -0.0088 815  LEU A CA  
812  C C   . LEU A 120 ? 0.3217 0.2878 0.2794 0.0307  0.0426  -0.0109 815  LEU A C   
813  O O   . LEU A 120 ? 0.3258 0.3013 0.2976 0.0278  0.0383  -0.0126 815  LEU A O   
814  C CB  . LEU A 120 ? 0.3688 0.3115 0.3041 0.0269  0.0447  -0.0047 815  LEU A CB  
815  C CG  . LEU A 120 ? 0.3796 0.3058 0.2975 0.0270  0.0392  -0.0021 815  LEU A CG  
816  C CD1 . LEU A 120 ? 0.3989 0.3159 0.3071 0.0250  0.0458  0.0030  815  LEU A CD1 
817  C CD2 . LEU A 120 ? 0.3648 0.2919 0.2904 0.0254  0.0296  -0.0031 815  LEU A CD2 
818  N N   . ASN A 121 ? 0.3336 0.3051 0.2909 0.0352  0.0499  -0.0109 816  ASN A N   
819  C CA  . ASN A 121 ? 0.3232 0.3137 0.2983 0.0370  0.0517  -0.0126 816  ASN A CA  
820  C C   . ASN A 121 ? 0.3025 0.2945 0.2801 0.0397  0.0439  -0.0152 816  ASN A C   
821  O O   . ASN A 121 ? 0.3060 0.3126 0.2991 0.0382  0.0412  -0.0166 816  ASN A O   
822  C CB  . ASN A 121 ? 0.3422 0.3391 0.3163 0.0434  0.0609  -0.0120 816  ASN A CB  
823  C CG  . ASN A 121 ? 0.4205 0.4237 0.3986 0.0394  0.0705  -0.0092 816  ASN A CG  
824  O OD1 . ASN A 121 ? 0.4735 0.4765 0.4567 0.0312  0.0701  -0.0076 816  ASN A OD1 
825  N ND2 . ASN A 121 ? 0.4711 0.4792 0.4462 0.0455  0.0798  -0.0084 816  ASN A ND2 
826  N N   . TRP A 122 ? 0.3269 0.3032 0.2880 0.0431  0.0404  -0.0159 817  TRP A N   
827  C CA  . TRP A 122 ? 0.3161 0.2913 0.2777 0.0441  0.0333  -0.0177 817  TRP A CA  
828  C C   . TRP A 122 ? 0.2883 0.2690 0.2597 0.0377  0.0266  -0.0184 817  TRP A C   
829  O O   . TRP A 122 ? 0.2902 0.2803 0.2712 0.0375  0.0230  -0.0197 817  TRP A O   
830  C CB  . TRP A 122 ? 0.3425 0.2980 0.2840 0.0462  0.0305  -0.0184 817  TRP A CB  
831  C CG  . TRP A 122 ? 0.3492 0.2964 0.2788 0.0541  0.0369  -0.0188 817  TRP A CG  
832  C CD1 . TRP A 122 ? 0.3883 0.3464 0.3259 0.0614  0.0431  -0.0184 817  TRP A CD1 
833  C CD2 . TRP A 122 ? 0.3534 0.2792 0.2601 0.0561  0.0374  -0.0199 817  TRP A CD2 
834  N NE1 . TRP A 122 ? 0.4017 0.3458 0.3226 0.0690  0.0484  -0.0193 817  TRP A NE1 
835  C CE2 . TRP A 122 ? 0.3891 0.3120 0.2898 0.0654  0.0450  -0.0205 817  TRP A CE2 
836  C CE3 . TRP A 122 ? 0.4142 0.3240 0.3049 0.0511  0.0317  -0.0209 817  TRP A CE3 
837  C CZ2 . TRP A 122 ? 0.4241 0.3253 0.3011 0.0697  0.0477  -0.0225 817  TRP A CZ2 
838  C CZ3 . TRP A 122 ? 0.4282 0.3178 0.2958 0.0541  0.0334  -0.0228 817  TRP A CZ3 
839  C CH2 . TRP A 122 ? 0.4396 0.3237 0.2997 0.0633  0.0416  -0.0239 817  TRP A CH2 
840  N N   . CYS A 123 ? 0.2994 0.2737 0.2673 0.0333  0.0250  -0.0175 818  CYS A N   
841  C CA  . CYS A 123 ? 0.3038 0.2833 0.2814 0.0285  0.0196  -0.0185 818  CYS A CA  
842  C C   . CYS A 123 ? 0.2864 0.2812 0.2812 0.0262  0.0214  -0.0198 818  CYS A C   
843  O O   . CYS A 123 ? 0.2779 0.2800 0.2808 0.0245  0.0169  -0.0220 818  CYS A O   
844  C CB  . CYS A 123 ? 0.3299 0.2996 0.3008 0.0260  0.0179  -0.0168 818  CYS A CB  
845  S SG  . CYS A 123 ? 0.3479 0.3027 0.2999 0.0271  0.0124  -0.0161 818  CYS A SG  
846  N N   . VAL A 124 ? 0.2622 0.2624 0.2620 0.0256  0.0279  -0.0187 819  VAL A N   
847  C CA  . VAL A 124 ? 0.2723 0.2885 0.2888 0.0220  0.0295  -0.0204 819  VAL A CA  
848  C C   . VAL A 124 ? 0.2494 0.2791 0.2735 0.0255  0.0268  -0.0224 819  VAL A C   
849  O O   . VAL A 124 ? 0.2513 0.2904 0.2849 0.0227  0.0228  -0.0250 819  VAL A O   
850  C CB  . VAL A 124 ? 0.2944 0.3162 0.3154 0.0202  0.0377  -0.0185 819  VAL A CB  
851  C CG1 . VAL A 124 ? 0.3255 0.3667 0.3651 0.0155  0.0386  -0.0208 819  VAL A CG1 
852  C CG2 . VAL A 124 ? 0.3110 0.3182 0.3234 0.0160  0.0406  -0.0158 819  VAL A CG2 
853  N N   . GLN A 125 ? 0.2500 0.2787 0.2680 0.0323  0.0291  -0.0210 820  GLN A N   
854  C CA  . GLN A 125 ? 0.2243 0.2642 0.2477 0.0377  0.0271  -0.0217 820  GLN A CA  
855  C C   . GLN A 125 ? 0.2395 0.2758 0.2597 0.0370  0.0199  -0.0229 820  GLN A C   
856  O O   . GLN A 125 ? 0.2328 0.2819 0.2617 0.0373  0.0166  -0.0242 820  GLN A O   
857  C CB  . GLN A 125 ? 0.2449 0.2785 0.2585 0.0463  0.0314  -0.0198 820  GLN A CB  
858  C CG  . GLN A 125 ? 0.2484 0.2918 0.2682 0.0484  0.0399  -0.0186 820  GLN A CG  
859  C CD  . GLN A 125 ? 0.3189 0.3540 0.3269 0.0581  0.0450  -0.0174 820  GLN A CD  
860  O OE1 . GLN A 125 ? 0.3948 0.4232 0.3954 0.0649  0.0421  -0.0175 820  GLN A OE1 
861  N NE2 . GLN A 125 ? 0.3929 0.4278 0.3983 0.0592  0.0534  -0.0163 820  GLN A NE2 
862  N N   . ILE A 126 ? 0.2310 0.2512 0.2389 0.0357  0.0174  -0.0225 821  ILE A N   
863  C CA  . ILE A 126 ? 0.2242 0.2419 0.2296 0.0340  0.0114  -0.0234 821  ILE A CA  
864  C C   . ILE A 126 ? 0.2310 0.2594 0.2479 0.0287  0.0088  -0.0260 821  ILE A C   
865  O O   . ILE A 126 ? 0.2304 0.2663 0.2510 0.0283  0.0054  -0.0273 821  ILE A O   
866  C CB  . ILE A 126 ? 0.2880 0.2894 0.2799 0.0325  0.0092  -0.0227 821  ILE A CB  
867  C CG1 . ILE A 126 ? 0.2742 0.2629 0.2525 0.0377  0.0117  -0.0211 821  ILE A CG1 
868  C CG2 . ILE A 126 ? 0.2625 0.2646 0.2543 0.0294  0.0039  -0.0234 821  ILE A CG2 
869  C CD1 . ILE A 126 ? 0.2926 0.2647 0.2565 0.0352  0.0098  -0.0210 821  ILE A CD1 
870  N N   . ALA A 127 ? 0.2315 0.2588 0.2524 0.0248  0.0106  -0.0267 822  ALA A N   
871  C CA  . ALA A 127 ? 0.2254 0.2592 0.2554 0.0200  0.0087  -0.0299 822  ALA A CA  
872  C C   . ALA A 127 ? 0.2404 0.2902 0.2817 0.0188  0.0085  -0.0322 822  ALA A C   
873  O O   . ALA A 127 ? 0.2465 0.3024 0.2921 0.0164  0.0051  -0.0355 822  ALA A O   
874  C CB  . ALA A 127 ? 0.2380 0.2637 0.2680 0.0166  0.0110  -0.0296 822  ALA A CB  
875  N N   . LYS A 128 ? 0.2332 0.2909 0.2792 0.0206  0.0122  -0.0308 823  LYS A N   
876  C CA  . LYS A 128 ? 0.2295 0.3063 0.2878 0.0200  0.0113  -0.0326 823  LYS A CA  
877  C C   . LYS A 128 ? 0.1810 0.2635 0.2366 0.0247  0.0064  -0.0327 823  LYS A C   
878  O O   . LYS A 128 ? 0.2017 0.2954 0.2632 0.0223  0.0023  -0.0357 823  LYS A O   
879  C CB  . LYS A 128 ? 0.2443 0.3304 0.3089 0.0222  0.0168  -0.0304 823  LYS A CB  
880  C CG  . LYS A 128 ? 0.2473 0.3315 0.3168 0.0151  0.0221  -0.0305 823  LYS A CG  
881  C CD  . LYS A 128 ? 0.3072 0.4052 0.3854 0.0166  0.0285  -0.0285 823  LYS A CD  
882  C CE  . LYS A 128 ? 0.3182 0.4137 0.4006 0.0078  0.0342  -0.0281 823  LYS A CE  
883  N NZ  . LYS A 128 ? 0.4008 0.5109 0.4917 0.0089  0.0420  -0.0256 823  LYS A NZ  
884  N N   . GLY A 129 ? 0.2195 0.2923 0.2644 0.0310  0.0066  -0.0294 824  GLY A N   
885  C CA  . GLY A 129 ? 0.2419 0.3163 0.2816 0.0355  0.0025  -0.0283 824  GLY A CA  
886  C C   . GLY A 129 ? 0.1934 0.2661 0.2305 0.0309  -0.0016 -0.0307 824  GLY A C   
887  O O   . GLY A 129 ? 0.2104 0.2927 0.2489 0.0316  -0.0053 -0.0316 824  GLY A O   
888  N N   . MET A 130 ? 0.2234 0.2845 0.2562 0.0270  -0.0009 -0.0314 825  MET A N   
889  C CA  . MET A 130 ? 0.2139 0.2745 0.2454 0.0234  -0.0036 -0.0339 825  MET A CA  
890  C C   . MET A 130 ? 0.1991 0.2700 0.2393 0.0193  -0.0049 -0.0388 825  MET A C   
891  O O   . MET A 130 ? 0.2226 0.2983 0.2614 0.0183  -0.0075 -0.0412 825  MET A O   
892  C CB  . MET A 130 ? 0.2218 0.2703 0.2487 0.0213  -0.0028 -0.0335 825  MET A CB  
893  C CG  . MET A 130 ? 0.2391 0.2761 0.2553 0.0233  -0.0028 -0.0296 825  MET A CG  
894  S SD  . MET A 130 ? 0.2739 0.3107 0.2822 0.0245  -0.0051 -0.0275 825  MET A SD  
895  C CE  . MET A 130 ? 0.3498 0.3907 0.3605 0.0194  -0.0066 -0.0300 825  MET A CE  
896  N N   . ASN A 131 ? 0.2086 0.2818 0.2565 0.0164  -0.0028 -0.0405 826  ASN A N   
897  C CA  . ASN A 131 ? 0.2311 0.3133 0.2868 0.0114  -0.0042 -0.0457 826  ASN A CA  
898  C C   . ASN A 131 ? 0.2218 0.3199 0.2806 0.0125  -0.0080 -0.0470 826  ASN A C   
899  O O   . ASN A 131 ? 0.2256 0.3291 0.2847 0.0094  -0.0111 -0.0516 826  ASN A O   
900  C CB  . ASN A 131 ? 0.2148 0.2962 0.2780 0.0067  -0.0008 -0.0466 826  ASN A CB  
901  C CG  . ASN A 131 ? 0.2895 0.3767 0.3594 -0.0004 -0.0024 -0.0528 826  ASN A CG  
902  O OD1 . ASN A 131 ? 0.3337 0.4133 0.4000 -0.0025 -0.0035 -0.0568 826  ASN A OD1 
903  N ND2 . ASN A 131 ? 0.2903 0.3917 0.3702 -0.0041 -0.0024 -0.0539 826  ASN A ND2 
904  N N   . TYR A 132 ? 0.2027 0.3078 0.2628 0.0178  -0.0079 -0.0429 827  TYR A N   
905  C CA  . TYR A 132 ? 0.2175 0.3382 0.2800 0.0210  -0.0123 -0.0428 827  TYR A CA  
906  C C   . TYR A 132 ? 0.2156 0.3328 0.2668 0.0233  -0.0158 -0.0423 827  TYR A C   
907  O O   . TYR A 132 ? 0.2120 0.3401 0.2632 0.0221  -0.0203 -0.0452 827  TYR A O   
908  C CB  . TYR A 132 ? 0.2130 0.3399 0.2782 0.0284  -0.0107 -0.0378 827  TYR A CB  
909  C CG  . TYR A 132 ? 0.1812 0.3244 0.2484 0.0335  -0.0160 -0.0368 827  TYR A CG  
910  C CD1 . TYR A 132 ? 0.2133 0.3787 0.2943 0.0309  -0.0189 -0.0397 827  TYR A CD1 
911  C CD2 . TYR A 132 ? 0.1966 0.3333 0.2515 0.0408  -0.0183 -0.0326 827  TYR A CD2 
912  C CE1 . TYR A 132 ? 0.2661 0.4480 0.3486 0.0365  -0.0249 -0.0385 827  TYR A CE1 
913  C CE2 . TYR A 132 ? 0.2443 0.3944 0.2989 0.0466  -0.0235 -0.0308 827  TYR A CE2 
914  C CZ  . TYR A 132 ? 0.2155 0.3892 0.2842 0.0450  -0.0272 -0.0337 827  TYR A CZ  
915  O OH  . TYR A 132 ? 0.2523 0.4410 0.3205 0.0516  -0.0336 -0.0316 827  TYR A OH  
916  N N   . LEU A 133 ? 0.1904 0.2928 0.2316 0.0258  -0.0137 -0.0387 828  LEU A N   
917  C CA  . LEU A 133 ? 0.2606 0.3586 0.2910 0.0265  -0.0156 -0.0378 828  LEU A CA  
918  C C   . LEU A 133 ? 0.2685 0.3686 0.2993 0.0209  -0.0163 -0.0436 828  LEU A C   
919  O O   . LEU A 133 ? 0.2383 0.3437 0.2632 0.0210  -0.0189 -0.0448 828  LEU A O   
920  C CB  . LEU A 133 ? 0.2604 0.3428 0.2813 0.0283  -0.0131 -0.0331 828  LEU A CB  
921  C CG  . LEU A 133 ? 0.2442 0.3202 0.2596 0.0349  -0.0123 -0.0275 828  LEU A CG  
922  C CD1 . LEU A 133 ? 0.3222 0.3807 0.3270 0.0340  -0.0102 -0.0243 828  LEU A CD1 
923  C CD2 . LEU A 133 ? 0.2667 0.3493 0.2771 0.0407  -0.0157 -0.0244 828  LEU A CD2 
924  N N   . GLU A 134 ? 0.2121 0.3077 0.2489 0.0168  -0.0139 -0.0473 829  GLU A N   
925  C CA  . GLU A 134 ? 0.2341 0.3304 0.2715 0.0126  -0.0142 -0.0536 829  GLU A CA  
926  C C   . GLU A 134 ? 0.2536 0.3622 0.2940 0.0098  -0.0180 -0.0589 829  GLU A C   
927  O O   . GLU A 134 ? 0.2801 0.3914 0.3148 0.0085  -0.0197 -0.0633 829  GLU A O   
928  C CB  . GLU A 134 ? 0.2291 0.3154 0.2711 0.0100  -0.0110 -0.0558 829  GLU A CB  
929  C CG  . GLU A 134 ? 0.2589 0.3430 0.3003 0.0072  -0.0107 -0.0626 829  GLU A CG  
930  C CD  . GLU A 134 ? 0.2865 0.3584 0.3294 0.0074  -0.0076 -0.0631 829  GLU A CD  
931  O OE1 . GLU A 134 ? 0.2838 0.3494 0.3285 0.0085  -0.0061 -0.0585 829  GLU A OE1 
932  O OE2 . GLU A 134 ? 0.3189 0.3872 0.3603 0.0072  -0.0067 -0.0684 829  GLU A OE2 
933  N N   . ASP A 135 ? 0.2647 0.3820 0.3138 0.0087  -0.0194 -0.0586 830  ASP A N   
934  C CA  . ASP A 135 ? 0.2683 0.4007 0.3213 0.0055  -0.0243 -0.0632 830  ASP A CA  
935  C C   . ASP A 135 ? 0.2721 0.4136 0.3167 0.0102  -0.0290 -0.0612 830  ASP A C   
936  O O   . ASP A 135 ? 0.2797 0.4309 0.3220 0.0074  -0.0338 -0.0662 830  ASP A O   
937  C CB  . ASP A 135 ? 0.2668 0.4105 0.3331 0.0035  -0.0247 -0.0625 830  ASP A CB  
938  C CG  . ASP A 135 ? 0.3220 0.4581 0.3957 -0.0040 -0.0208 -0.0661 830  ASP A CG  
939  O OD1 . ASP A 135 ? 0.4083 0.5498 0.4919 -0.0056 -0.0184 -0.0638 830  ASP A OD1 
940  O OD2 . ASP A 135 ? 0.3927 0.5172 0.4617 -0.0080 -0.0198 -0.0712 830  ASP A OD2 
941  N N   . ARG A 136 ? 0.2623 0.3989 0.3004 0.0169  -0.0279 -0.0539 831  ARG A N   
942  C CA  . ARG A 136 ? 0.2599 0.4012 0.2872 0.0221  -0.0316 -0.0503 831  ARG A CA  
943  C C   . ARG A 136 ? 0.2785 0.4106 0.2931 0.0208  -0.0297 -0.0511 831  ARG A C   
944  O O   . ARG A 136 ? 0.3274 0.4600 0.3305 0.0243  -0.0315 -0.0473 831  ARG A O   
945  C CB  . ARG A 136 ? 0.2505 0.3875 0.2749 0.0299  -0.0307 -0.0417 831  ARG A CB  
946  C CG  . ARG A 136 ? 0.2837 0.4321 0.3199 0.0339  -0.0319 -0.0397 831  ARG A CG  
947  C CD  . ARG A 136 ? 0.3689 0.5371 0.4078 0.0370  -0.0390 -0.0401 831  ARG A CD  
948  N NE  . ARG A 136 ? 0.3224 0.5042 0.3694 0.0286  -0.0426 -0.0482 831  ARG A NE  
949  C CZ  . ARG A 136 ? 0.4035 0.5916 0.4650 0.0217  -0.0410 -0.0530 831  ARG A CZ  
950  N NH1 . ARG A 136 ? 0.3256 0.5240 0.3919 0.0134  -0.0450 -0.0606 831  ARG A NH1 
951  N NH2 . ARG A 136 ? 0.3657 0.5486 0.4354 0.0225  -0.0353 -0.0503 831  ARG A NH2 
952  N N   . ARG A 137 ? 0.2615 0.3854 0.2780 0.0164  -0.0257 -0.0555 832  ARG A N   
953  C CA  . ARG A 137 ? 0.2699 0.3873 0.2771 0.0155  -0.0225 -0.0566 832  ARG A CA  
954  C C   . ARG A 137 ? 0.3008 0.4111 0.2996 0.0189  -0.0204 -0.0484 832  ARG A C   
955  O O   . ARG A 137 ? 0.4011 0.5112 0.3891 0.0190  -0.0194 -0.0469 832  ARG A O   
956  C CB  . ARG A 137 ? 0.3175 0.4426 0.3163 0.0139  -0.0253 -0.0622 832  ARG A CB  
957  C CG  . ARG A 137 ? 0.3320 0.4635 0.3373 0.0094  -0.0288 -0.0707 832  ARG A CG  
958  C CD  . ARG A 137 ? 0.4721 0.6098 0.4664 0.0076  -0.0319 -0.0772 832  ARG A CD  
959  N NE  . ARG A 137 ? 0.5192 0.6493 0.5043 0.0079  -0.0265 -0.0798 832  ARG A NE  
960  C CZ  . ARG A 137 ? 0.6048 0.7378 0.5769 0.0074  -0.0270 -0.0848 832  ARG A CZ  
961  N NH1 . ARG A 137 ? 0.5422 0.6697 0.5079 0.0085  -0.0206 -0.0868 832  ARG A NH1 
962  N NH2 . ARG A 137 ? 0.6323 0.7748 0.5977 0.0062  -0.0338 -0.0879 832  ARG A NH2 
963  N N   . LEU A 138 ? 0.2812 0.3849 0.2840 0.0210  -0.0192 -0.0433 833  LEU A N   
964  C CA  . LEU A 138 ? 0.3014 0.3952 0.2957 0.0232  -0.0174 -0.0360 833  LEU A CA  
965  C C   . LEU A 138 ? 0.3114 0.3955 0.3096 0.0206  -0.0136 -0.0354 833  LEU A C   
966  O O   . LEU A 138 ? 0.3331 0.4136 0.3384 0.0212  -0.0131 -0.0355 833  LEU A O   
967  C CB  . LEU A 138 ? 0.3191 0.4118 0.3122 0.0290  -0.0198 -0.0307 833  LEU A CB  
968  C CG  . LEU A 138 ? 0.4621 0.5430 0.4425 0.0330  -0.0192 -0.0228 833  LEU A CG  
969  C CD1 . LEU A 138 ? 0.5195 0.6039 0.4998 0.0410  -0.0225 -0.0191 833  LEU A CD1 
970  C CD2 . LEU A 138 ? 0.4957 0.5613 0.4744 0.0307  -0.0154 -0.0202 833  LEU A CD2 
971  N N   . VAL A 139 ? 0.2455 0.3266 0.2387 0.0177  -0.0109 -0.0345 834  VAL A N   
972  C CA  . VAL A 139 ? 0.2410 0.3151 0.2378 0.0150  -0.0083 -0.0335 834  VAL A CA  
973  C C   . VAL A 139 ? 0.2408 0.3030 0.2299 0.0152  -0.0081 -0.0269 834  VAL A C   
974  O O   . VAL A 139 ? 0.2725 0.3308 0.2509 0.0153  -0.0080 -0.0225 834  VAL A O   
975  C CB  . VAL A 139 ? 0.2393 0.3188 0.2367 0.0116  -0.0053 -0.0358 834  VAL A CB  
976  C CG1 . VAL A 139 ? 0.2752 0.3509 0.2779 0.0089  -0.0037 -0.0346 834  VAL A CG1 
977  C CG2 . VAL A 139 ? 0.2771 0.3652 0.2798 0.0123  -0.0050 -0.0433 834  VAL A CG2 
978  N N   . HIS A 140 ? 0.2510 0.3057 0.2436 0.0154  -0.0080 -0.0263 835  HIS A N   
979  C CA  . HIS A 140 ? 0.2773 0.3178 0.2610 0.0162  -0.0080 -0.0211 835  HIS A CA  
980  C C   . HIS A 140 ? 0.3095 0.3437 0.2862 0.0101  -0.0066 -0.0182 835  HIS A C   
981  O O   . HIS A 140 ? 0.3254 0.3502 0.2902 0.0095  -0.0062 -0.0135 835  HIS A O   
982  C CB  . HIS A 140 ? 0.2735 0.3076 0.2614 0.0176  -0.0080 -0.0220 835  HIS A CB  
983  C CG  . HIS A 140 ? 0.2440 0.2624 0.2214 0.0199  -0.0077 -0.0180 835  HIS A CG  
984  N ND1 . HIS A 140 ? 0.2886 0.2944 0.2551 0.0160  -0.0074 -0.0148 835  HIS A ND1 
985  C CD2 . HIS A 140 ? 0.2890 0.3018 0.2646 0.0260  -0.0072 -0.0170 835  HIS A CD2 
986  C CE1 . HIS A 140 ? 0.2869 0.2772 0.2439 0.0196  -0.0070 -0.0123 835  HIS A CE1 
987  N NE2 . HIS A 140 ? 0.3062 0.3012 0.2686 0.0266  -0.0066 -0.0136 835  HIS A NE2 
988  N N   . ARG A 141 ? 0.2483 0.2881 0.2327 0.0056  -0.0060 -0.0208 836  ARG A N   
989  C CA  . ARG A 141 ? 0.2747 0.3145 0.2577 -0.0016 -0.0047 -0.0191 836  ARG A CA  
990  C C   . ARG A 141 ? 0.3015 0.3265 0.2777 -0.0057 -0.0059 -0.0163 836  ARG A C   
991  O O   . ARG A 141 ? 0.3408 0.3673 0.3177 -0.0130 -0.0057 -0.0153 836  ARG A O   
992  C CB  . ARG A 141 ? 0.3152 0.3579 0.2907 -0.0046 -0.0023 -0.0162 836  ARG A CB  
993  C CG  . ARG A 141 ? 0.3186 0.3764 0.2992 -0.0019 -0.0010 -0.0200 836  ARG A CG  
994  C CD  . ARG A 141 ? 0.4302 0.4911 0.4016 -0.0051 0.0020  -0.0170 836  ARG A CD  
995  N NE  . ARG A 141 ? 0.4263 0.5009 0.4007 -0.0021 0.0033  -0.0216 836  ARG A NE  
996  C CZ  . ARG A 141 ? 0.4509 0.5271 0.4217 0.0032  0.0009  -0.0235 836  ARG A CZ  
997  N NH1 . ARG A 141 ? 0.4396 0.5071 0.4055 0.0074  -0.0027 -0.0207 836  ARG A NH1 
998  N NH2 . ARG A 141 ? 0.4539 0.5414 0.4261 0.0046  0.0021  -0.0287 836  ARG A NH2 
999  N N   . ASP A 142 ? 0.3145 0.3263 0.2844 -0.0011 -0.0071 -0.0153 837  ASP A N   
1000 C CA  . ASP A 142 ? 0.3100 0.3048 0.2706 -0.0043 -0.0082 -0.0136 837  ASP A CA  
1001 C C   . ASP A 142 ? 0.3506 0.3375 0.3103 0.0018  -0.0090 -0.0151 837  ASP A C   
1002 O O   . ASP A 142 ? 0.3438 0.3134 0.2916 0.0037  -0.0088 -0.0135 837  ASP A O   
1003 C CB  . ASP A 142 ? 0.3538 0.3320 0.2987 -0.0065 -0.0071 -0.0089 837  ASP A CB  
1004 C CG  . ASP A 142 ? 0.4374 0.3968 0.3713 -0.0132 -0.0082 -0.0078 837  ASP A CG  
1005 O OD1 . ASP A 142 ? 0.5058 0.4454 0.4241 -0.0132 -0.0072 -0.0043 837  ASP A OD1 
1006 O OD2 . ASP A 142 ? 0.4272 0.3902 0.3665 -0.0182 -0.0104 -0.0105 837  ASP A OD2 
1007 N N   . LEU A 143 ? 0.3057 0.3044 0.2770 0.0050  -0.0092 -0.0183 838  LEU A N   
1008 C CA  . LEU A 143 ? 0.2637 0.2559 0.2341 0.0095  -0.0091 -0.0194 838  LEU A CA  
1009 C C   . LEU A 143 ? 0.2510 0.2330 0.2151 0.0048  -0.0111 -0.0196 838  LEU A C   
1010 O O   . LEU A 143 ? 0.2831 0.2721 0.2522 -0.0009 -0.0135 -0.0204 838  LEU A O   
1011 C CB  . LEU A 143 ? 0.2755 0.2804 0.2585 0.0127  -0.0085 -0.0223 838  LEU A CB  
1012 C CG  . LEU A 143 ? 0.2651 0.2642 0.2472 0.0170  -0.0071 -0.0227 838  LEU A CG  
1013 C CD1 . LEU A 143 ? 0.3248 0.3176 0.3007 0.0229  -0.0047 -0.0210 838  LEU A CD1 
1014 C CD2 . LEU A 143 ? 0.2858 0.2962 0.2800 0.0180  -0.0063 -0.0252 838  LEU A CD2 
1015 N N   . ALA A 144 ? 0.2823 0.2483 0.2348 0.0078  -0.0104 -0.0190 839  ALA A N   
1016 C CA  . ALA A 144 ? 0.2874 0.2401 0.2296 0.0036  -0.0126 -0.0198 839  ALA A CA  
1017 C C   . ALA A 144 ? 0.3162 0.2537 0.2470 0.0104  -0.0098 -0.0198 839  ALA A C   
1018 O O   . ALA A 144 ? 0.3274 0.2637 0.2576 0.0173  -0.0065 -0.0186 839  ALA A O   
1019 C CB  . ALA A 144 ? 0.3366 0.2803 0.2702 -0.0049 -0.0147 -0.0187 839  ALA A CB  
1020 N N   . ALA A 145 ? 0.3236 0.2500 0.2448 0.0091  -0.0110 -0.0213 840  ALA A N   
1021 C CA  . ALA A 145 ? 0.3293 0.2411 0.2384 0.0162  -0.0072 -0.0218 840  ALA A CA  
1022 C C   . ALA A 145 ? 0.3416 0.2352 0.2367 0.0192  -0.0051 -0.0207 840  ALA A C   
1023 O O   . ALA A 145 ? 0.3726 0.2604 0.2633 0.0285  -0.0005 -0.0203 840  ALA A O   
1024 C CB  . ALA A 145 ? 0.3305 0.2320 0.2284 0.0139  -0.0091 -0.0238 840  ALA A CB  
1025 N N   . ARG A 146 ? 0.3635 0.2491 0.2527 0.0117  -0.0080 -0.0200 841  ARG A N   
1026 C CA  . ARG A 146 ? 0.4117 0.2767 0.2859 0.0141  -0.0061 -0.0183 841  ARG A CA  
1027 C C   . ARG A 146 ? 0.4197 0.2943 0.3019 0.0231  -0.0030 -0.0151 841  ARG A C   
1028 O O   . ARG A 146 ? 0.4450 0.3043 0.3160 0.0306  -0.0004 -0.0131 841  ARG A O   
1029 C CB  . ARG A 146 ? 0.4244 0.2801 0.2917 0.0018  -0.0096 -0.0175 841  ARG A CB  
1030 C CG  . ARG A 146 ? 0.4177 0.2955 0.3014 -0.0043 -0.0113 -0.0154 841  ARG A CG  
1031 C CD  . ARG A 146 ? 0.5586 0.4305 0.4374 -0.0175 -0.0137 -0.0142 841  ARG A CD  
1032 N NE  . ARG A 146 ? 0.5249 0.4221 0.4213 -0.0218 -0.0142 -0.0128 841  ARG A NE  
1033 C CZ  . ARG A 146 ? 0.5389 0.4559 0.4494 -0.0277 -0.0172 -0.0149 841  ARG A CZ  
1034 N NH1 . ARG A 146 ? 0.4965 0.4117 0.4054 -0.0311 -0.0210 -0.0179 841  ARG A NH1 
1035 N NH2 . ARG A 146 ? 0.5023 0.4411 0.4277 -0.0297 -0.0165 -0.0139 841  ARG A NH2 
1036 N N   . ASN A 147 ? 0.3552 0.2548 0.2562 0.0228  -0.0038 -0.0147 842  ASN A N   
1037 C CA  . ASN A 147 ? 0.3627 0.2751 0.2725 0.0298  -0.0023 -0.0122 842  ASN A CA  
1038 C C   . ASN A 147 ? 0.3634 0.2904 0.2847 0.0384  0.0004  -0.0134 842  ASN A C   
1039 O O   . ASN A 147 ? 0.3596 0.3044 0.2933 0.0419  0.0004  -0.0127 842  ASN A O   
1040 C CB  . ASN A 147 ? 0.3522 0.2803 0.2722 0.0231  -0.0046 -0.0112 842  ASN A CB  
1041 C CG  . ASN A 147 ? 0.3976 0.3119 0.3058 0.0157  -0.0057 -0.0086 842  ASN A CG  
1042 O OD1 . ASN A 147 ? 0.4226 0.3146 0.3144 0.0179  -0.0046 -0.0065 842  ASN A OD1 
1043 N ND2 . ASN A 147 ? 0.3939 0.3206 0.3099 0.0070  -0.0073 -0.0087 842  ASN A ND2 
1044 N N   . VAL A 148 ? 0.3380 0.2582 0.2551 0.0408  0.0026  -0.0154 843  VAL A N   
1045 C CA  . VAL A 148 ? 0.2880 0.2191 0.2134 0.0490  0.0067  -0.0160 843  VAL A CA  
1046 C C   . VAL A 148 ? 0.3485 0.2613 0.2589 0.0578  0.0107  -0.0156 843  VAL A C   
1047 O O   . VAL A 148 ? 0.3764 0.2679 0.2702 0.0552  0.0107  -0.0170 843  VAL A O   
1048 C CB  . VAL A 148 ? 0.3188 0.2581 0.2515 0.0448  0.0072  -0.0182 843  VAL A CB  
1049 C CG1 . VAL A 148 ? 0.3320 0.2831 0.2737 0.0516  0.0123  -0.0183 843  VAL A CG1 
1050 C CG2 . VAL A 148 ? 0.3155 0.2700 0.2614 0.0371  0.0033  -0.0189 843  VAL A CG2 
1051 N N   . LEU A 149 ? 0.3481 0.2696 0.2643 0.0684  0.0141  -0.0141 844  LEU A N   
1052 C CA  . LEU A 149 ? 0.3562 0.2615 0.2591 0.0796  0.0186  -0.0135 844  LEU A CA  
1053 C C   . LEU A 149 ? 0.3643 0.2813 0.2747 0.0872  0.0249  -0.0148 844  LEU A C   
1054 O O   . LEU A 149 ? 0.3486 0.2900 0.2777 0.0856  0.0256  -0.0149 844  LEU A O   
1055 C CB  . LEU A 149 ? 0.3885 0.2926 0.2898 0.0884  0.0176  -0.0098 844  LEU A CB  
1056 C CG  . LEU A 149 ? 0.3989 0.2909 0.2915 0.0812  0.0125  -0.0075 844  LEU A CG  
1057 C CD1 . LEU A 149 ? 0.4220 0.3115 0.3108 0.0918  0.0120  -0.0029 844  LEU A CD1 
1058 C CD2 . LEU A 149 ? 0.4485 0.3104 0.3201 0.0734  0.0118  -0.0090 844  LEU A CD2 
1059 N N   . VAL A 150 ? 0.3939 0.2923 0.2886 0.0951  0.0300  -0.0159 845  VAL A N   
1060 C CA  . VAL A 150 ? 0.4122 0.3193 0.3109 0.1019  0.0374  -0.0172 845  VAL A CA  
1061 C C   . VAL A 150 ? 0.4257 0.3411 0.3296 0.1176  0.0422  -0.0153 845  VAL A C   
1062 O O   . VAL A 150 ? 0.4379 0.3316 0.3249 0.1273  0.0443  -0.0151 845  VAL A O   
1063 C CB  . VAL A 150 ? 0.4145 0.2960 0.2909 0.1003  0.0405  -0.0205 845  VAL A CB  
1064 C CG1 . VAL A 150 ? 0.4179 0.3083 0.2969 0.1066  0.0492  -0.0216 845  VAL A CG1 
1065 C CG2 . VAL A 150 ? 0.4154 0.2910 0.2879 0.0851  0.0340  -0.0219 845  VAL A CG2 
1066 N N   . LYS A 151 ? 0.3835 0.3303 0.3108 0.1203  0.0435  -0.0138 846  LYS A N   
1067 C CA  . LYS A 151 ? 0.4296 0.3904 0.3655 0.1357  0.0477  -0.0118 846  LYS A CA  
1068 C C   . LYS A 151 ? 0.4437 0.4015 0.3741 0.1441  0.0579  -0.0137 846  LYS A C   
1069 O O   . LYS A 151 ? 0.4407 0.3873 0.3609 0.1587  0.0627  -0.0135 846  LYS A O   
1070 C CB  . LYS A 151 ? 0.4321 0.4298 0.3956 0.1345  0.0450  -0.0101 846  LYS A CB  
1071 C CG  . LYS A 151 ? 0.4937 0.5091 0.4677 0.1509  0.0474  -0.0076 846  LYS A CG  
1072 C CD  . LYS A 151 ? 0.5702 0.6239 0.5718 0.1478  0.0438  -0.0066 846  LYS A CD  
1073 C CE  . LYS A 151 ? 0.6385 0.7125 0.6514 0.1648  0.0447  -0.0037 846  LYS A CE  
1074 N NZ  . LYS A 151 ? 0.7008 0.8131 0.7403 0.1605  0.0395  -0.0032 846  LYS A NZ  
1075 N N   . THR A 152 ? 0.4294 0.3962 0.3655 0.1350  0.0614  -0.0155 847  THR A N   
1076 C CA  . THR A 152 ? 0.4586 0.4171 0.3839 0.1391  0.0710  -0.0176 847  THR A CA  
1077 C C   . THR A 152 ? 0.4414 0.3899 0.3588 0.1241  0.0690  -0.0193 847  THR A C   
1078 O O   . THR A 152 ? 0.4206 0.3769 0.3479 0.1125  0.0618  -0.0185 847  THR A O   
1079 C CB  . THR A 152 ? 0.4362 0.4268 0.3830 0.1455  0.0798  -0.0165 847  THR A CB  
1080 O OG1 . THR A 152 ? 0.4564 0.4704 0.4233 0.1321  0.0776  -0.0157 847  THR A OG1 
1081 C CG2 . THR A 152 ? 0.5205 0.5293 0.4809 0.1604  0.0806  -0.0143 847  THR A CG2 
1082 N N   . PRO A 153 ? 0.4768 0.4080 0.3757 0.1250  0.0753  -0.0215 848  PRO A N   
1083 C CA  . PRO A 153 ? 0.4836 0.4061 0.3743 0.1119  0.0725  -0.0224 848  PRO A CA  
1084 C C   . PRO A 153 ? 0.4760 0.4241 0.3892 0.1020  0.0717  -0.0201 848  PRO A C   
1085 O O   . PRO A 153 ? 0.4559 0.3985 0.3664 0.0910  0.0660  -0.0200 848  PRO A O   
1086 C CB  . PRO A 153 ? 0.5272 0.4343 0.3976 0.1173  0.0818  -0.0246 848  PRO A CB  
1087 C CG  . PRO A 153 ? 0.5348 0.4263 0.3921 0.1313  0.0852  -0.0265 848  PRO A CG  
1088 C CD  . PRO A 153 ? 0.5217 0.4372 0.4029 0.1384  0.0843  -0.0236 848  PRO A CD  
1089 N N   . GLN A 154 ? 0.4363 0.4118 0.3714 0.1061  0.0770  -0.0183 849  GLN A N   
1090 C CA  . GLN A 154 ? 0.4176 0.4169 0.3743 0.0964  0.0769  -0.0166 849  GLN A CA  
1091 C C   . GLN A 154 ? 0.4305 0.4462 0.4065 0.0913  0.0679  -0.0161 849  GLN A C   
1092 O O   . GLN A 154 ? 0.4389 0.4725 0.4320 0.0827  0.0672  -0.0154 849  GLN A O   
1093 C CB  . GLN A 154 ? 0.4582 0.4810 0.4296 0.1014  0.0879  -0.0153 849  GLN A CB  
1094 C CG  . GLN A 154 ? 0.5555 0.5663 0.5094 0.1064  0.0990  -0.0156 849  GLN A CG  
1095 C CD  . GLN A 154 ? 0.6490 0.6461 0.5872 0.1219  0.1037  -0.0176 849  GLN A CD  
1096 O OE1 . GLN A 154 ? 0.6172 0.6261 0.5663 0.1323  0.1034  -0.0174 849  GLN A OE1 
1097 N NE2 . GLN A 154 ? 0.7011 0.6721 0.6124 0.1241  0.1078  -0.0196 849  GLN A NE2 
1098 N N   . HIS A 155 ? 0.4098 0.4183 0.3816 0.0963  0.0616  -0.0164 850  HIS A N   
1099 C CA  . HIS A 155 ? 0.3809 0.4066 0.3696 0.0940  0.0542  -0.0157 850  HIS A CA  
1100 C C   . HIS A 155 ? 0.3762 0.3824 0.3515 0.0932  0.0460  -0.0159 850  HIS A C   
1101 O O   . HIS A 155 ? 0.3941 0.3856 0.3565 0.1025  0.0463  -0.0155 850  HIS A O   
1102 C CB  . HIS A 155 ? 0.4122 0.4616 0.4168 0.1050  0.0577  -0.0145 850  HIS A CB  
1103 C CG  . HIS A 155 ? 0.4456 0.5153 0.4671 0.1038  0.0501  -0.0138 850  HIS A CG  
1104 N ND1 . HIS A 155 ? 0.4821 0.5758 0.5190 0.1135  0.0509  -0.0124 850  HIS A ND1 
1105 C CD2 . HIS A 155 ? 0.4712 0.5413 0.4957 0.0947  0.0416  -0.0144 850  HIS A CD2 
1106 C CE1 . HIS A 155 ? 0.5255 0.6329 0.5730 0.1098  0.0425  -0.0122 850  HIS A CE1 
1107 N NE2 . HIS A 155 ? 0.4277 0.5205 0.4675 0.0984  0.0373  -0.0136 850  HIS A NE2 
1108 N N   . VAL A 156 ? 0.3368 0.3422 0.3148 0.0822  0.0394  -0.0166 851  VAL A N   
1109 C CA  . VAL A 156 ? 0.3380 0.3274 0.3048 0.0796  0.0323  -0.0166 851  VAL A CA  
1110 C C   . VAL A 156 ? 0.3258 0.3316 0.3063 0.0766  0.0262  -0.0160 851  VAL A C   
1111 O O   . VAL A 156 ? 0.3075 0.3348 0.3055 0.0731  0.0261  -0.0166 851  VAL A O   
1112 C CB  . VAL A 156 ? 0.3063 0.2784 0.2610 0.0700  0.0294  -0.0179 851  VAL A CB  
1113 C CG1 . VAL A 156 ? 0.3805 0.3345 0.3179 0.0731  0.0347  -0.0188 851  VAL A CG1 
1114 C CG2 . VAL A 156 ? 0.3244 0.3100 0.2925 0.0606  0.0276  -0.0186 851  VAL A CG2 
1115 N N   . LYS A 157 ? 0.3151 0.3094 0.2862 0.0774  0.0214  -0.0149 852  LYS A N   
1116 C CA  . LYS A 157 ? 0.2922 0.3001 0.2726 0.0760  0.0159  -0.0139 852  LYS A CA  
1117 C C   . LYS A 157 ? 0.3325 0.3257 0.3020 0.0691  0.0110  -0.0136 852  LYS A C   
1118 O O   . LYS A 157 ? 0.3544 0.3255 0.3073 0.0695  0.0112  -0.0128 852  LYS A O   
1119 C CB  . LYS A 157 ? 0.3295 0.3436 0.3109 0.0881  0.0160  -0.0111 852  LYS A CB  
1120 C CG  . LYS A 157 ? 0.3718 0.4038 0.3656 0.0966  0.0212  -0.0110 852  LYS A CG  
1121 C CD  . LYS A 157 ? 0.3863 0.4250 0.3809 0.1100  0.0200  -0.0078 852  LYS A CD  
1122 C CE  . LYS A 157 ? 0.4666 0.5293 0.4758 0.1082  0.0133  -0.0071 852  LYS A CE  
1123 N NZ  . LYS A 157 ? 0.5258 0.5951 0.5347 0.1225  0.0112  -0.0032 852  LYS A NZ  
1124 N N   . ILE A 158 ? 0.2867 0.2925 0.2655 0.0621  0.0068  -0.0146 853  ILE A N   
1125 C CA  . ILE A 158 ? 0.2885 0.2850 0.2597 0.0553  0.0030  -0.0142 853  ILE A CA  
1126 C C   . ILE A 158 ? 0.3002 0.2912 0.2628 0.0599  0.0008  -0.0107 853  ILE A C   
1127 O O   . ILE A 158 ? 0.3087 0.3126 0.2773 0.0667  -0.0002 -0.0092 853  ILE A O   
1128 C CB  . ILE A 158 ? 0.2598 0.2723 0.2438 0.0476  0.0004  -0.0170 853  ILE A CB  
1129 C CG1 . ILE A 158 ? 0.2774 0.2904 0.2667 0.0427  0.0024  -0.0196 853  ILE A CG1 
1130 C CG2 . ILE A 158 ? 0.3089 0.3166 0.2870 0.0416  -0.0027 -0.0164 853  ILE A CG2 
1131 C CD1 . ILE A 158 ? 0.2991 0.3294 0.3033 0.0386  0.0014  -0.0226 853  ILE A CD1 
1132 N N   . THR A 159 ? 0.2870 0.2593 0.2353 0.0559  -0.0003 -0.0090 854  THR A N   
1133 C CA  . THR A 159 ? 0.2927 0.2569 0.2306 0.0590  -0.0020 -0.0048 854  THR A CA  
1134 C C   . THR A 159 ? 0.3442 0.3039 0.2772 0.0486  -0.0040 -0.0042 854  THR A C   
1135 O O   . THR A 159 ? 0.3212 0.2857 0.2602 0.0399  -0.0044 -0.0073 854  THR A O   
1136 C CB  . THR A 159 ? 0.3581 0.2986 0.2792 0.0675  0.0004  -0.0019 854  THR A CB  
1137 O OG1 . THR A 159 ? 0.3929 0.3269 0.3048 0.0730  -0.0013 0.0031  854  THR A OG1 
1138 C CG2 . THR A 159 ? 0.3769 0.2932 0.2837 0.0600  0.0015  -0.0031 854  THR A CG2 
1139 N N   . ASP A 160 ? 0.3597 0.3113 0.2819 0.0500  -0.0051 0.0003  855  ASP A N   
1140 C CA  . ASP A 160 ? 0.4123 0.3573 0.3272 0.0401  -0.0058 0.0020  855  ASP A CA  
1141 C C   . ASP A 160 ? 0.4251 0.3920 0.3529 0.0334  -0.0070 -0.0007 855  ASP A C   
1142 O O   . ASP A 160 ? 0.4441 0.4100 0.3706 0.0239  -0.0066 -0.0008 855  ASP A O   
1143 C CB  . ASP A 160 ? 0.4350 0.3616 0.3414 0.0317  -0.0047 0.0009  855  ASP A CB  
1144 C CG  . ASP A 160 ? 0.5651 0.4722 0.4551 0.0254  -0.0043 0.0054  855  ASP A CG  
1145 O OD1 . ASP A 160 ? 0.5574 0.4531 0.4357 0.0322  -0.0039 0.0103  855  ASP A OD1 
1146 O OD2 . ASP A 160 ? 0.6493 0.5524 0.5380 0.0137  -0.0044 0.0042  855  ASP A OD2 
1147 N N   . PHE A 161 ? 0.4033 0.3900 0.3437 0.0380  -0.0083 -0.0032 856  PHE A N   
1148 C CA  . PHE A 161 ? 0.3857 0.3910 0.3362 0.0327  -0.0093 -0.0064 856  PHE A CA  
1149 C C   . PHE A 161 ? 0.4532 0.4599 0.3947 0.0327  -0.0103 -0.0028 856  PHE A C   
1150 O O   . PHE A 161 ? 0.4220 0.4220 0.3537 0.0399  -0.0115 0.0019  856  PHE A O   
1151 C CB  . PHE A 161 ? 0.3708 0.3946 0.3362 0.0362  -0.0106 -0.0109 856  PHE A CB  
1152 C CG  . PHE A 161 ? 0.3722 0.4010 0.3382 0.0458  -0.0123 -0.0089 856  PHE A CG  
1153 C CD1 . PHE A 161 ? 0.4460 0.4689 0.4131 0.0519  -0.0105 -0.0081 856  PHE A CD1 
1154 C CD2 . PHE A 161 ? 0.4181 0.4587 0.3835 0.0491  -0.0155 -0.0078 856  PHE A CD2 
1155 C CE1 . PHE A 161 ? 0.4249 0.4554 0.3946 0.0617  -0.0117 -0.0062 856  PHE A CE1 
1156 C CE2 . PHE A 161 ? 0.4859 0.5342 0.4535 0.0587  -0.0179 -0.0057 856  PHE A CE2 
1157 C CZ  . PHE A 161 ? 0.4439 0.4880 0.4147 0.0652  -0.0158 -0.0048 856  PHE A CZ  
1158 N N   . GLY A 162 ? 0.4704 0.4856 0.4146 0.0254  -0.0094 -0.0048 857  GLY A N   
1159 C CA  . GLY A 162 ? 0.4982 0.5174 0.4339 0.0244  -0.0095 -0.0021 857  GLY A CA  
1160 C C   . GLY A 162 ? 0.4939 0.4949 0.4122 0.0216  -0.0076 0.0050  857  GLY A C   
1161 O O   . GLY A 162 ? 0.5041 0.5063 0.4127 0.0213  -0.0074 0.0085  857  GLY A O   
1162 N N   . LEU A 163 ? 0.4746 0.4572 0.3874 0.0191  -0.0063 0.0072  858  LEU A N   
1163 C CA  . LEU A 163 ? 0.5171 0.4797 0.4129 0.0139  -0.0040 0.0134  858  LEU A CA  
1164 C C   . LEU A 163 ? 0.5473 0.5179 0.4467 0.0016  -0.0009 0.0124  858  LEU A C   
1165 O O   . LEU A 163 ? 0.5481 0.5147 0.4366 -0.0032 0.0016  0.0172  858  LEU A O   
1166 C CB  . LEU A 163 ? 0.5351 0.4741 0.4229 0.0138  -0.0037 0.0149  858  LEU A CB  
1167 C CG  . LEU A 163 ? 0.6608 0.5782 0.5329 0.0241  -0.0044 0.0200  858  LEU A CG  
1168 C CD1 . LEU A 163 ? 0.6859 0.5772 0.5473 0.0201  -0.0029 0.0204  858  LEU A CD1 
1169 C CD2 . LEU A 163 ? 0.6683 0.5772 0.5245 0.0261  -0.0040 0.0275  858  LEU A CD2 
1170 N N   . ALA A 164 ? 0.5484 0.5311 0.4632 -0.0030 -0.0009 0.0065  859  ALA A N   
1171 C CA  . ALA A 164 ? 0.5636 0.5580 0.4857 -0.0134 0.0019  0.0049  859  ALA A CA  
1172 C C   . ALA A 164 ? 0.5760 0.5843 0.4966 -0.0142 0.0047  0.0057  859  ALA A C   
1173 O O   . ALA A 164 ? 0.5470 0.5547 0.4617 -0.0226 0.0086  0.0093  859  ALA A O   
1174 C CB  . ALA A 164 ? 0.5539 0.5623 0.4938 -0.0139 0.0006  -0.0017 859  ALA A CB  
1175 N N   . LYS A 165 ? 0.5855 0.6057 0.5102 -0.0062 0.0028  0.0025  860  LYS A N   
1176 C CA  . LYS A 165 ? 0.6162 0.6490 0.5372 -0.0061 0.0050  0.0023  860  LYS A CA  
1177 C C   . LYS A 165 ? 0.6666 0.6867 0.5672 -0.0046 0.0054  0.0101  860  LYS A C   
1178 O O   . LYS A 165 ? 0.6893 0.7139 0.5818 -0.0089 0.0093  0.0126  860  LYS A O   
1179 C CB  . LYS A 165 ? 0.6323 0.6804 0.5626 0.0009  0.0021  -0.0045 860  LYS A CB  
1180 C CG  . LYS A 165 ? 0.6420 0.7046 0.5701 -0.0001 0.0048  -0.0073 860  LYS A CG  
1181 C CD  . LYS A 165 ? 0.6586 0.7307 0.5893 0.0069  0.0005  -0.0127 860  LYS A CD  
1182 C CE  . LYS A 165 ? 0.6756 0.7602 0.6015 0.0059  0.0031  -0.0166 860  LYS A CE  
1183 N NZ  . LYS A 165 ? 0.6638 0.7568 0.5918 0.0112  -0.0019 -0.0230 860  LYS A NZ  
1184 N N   . LEU A 166 ? 0.6700 0.6743 0.5618 0.0023  0.0018  0.0142  861  LEU A N   
1185 C CA  . LEU A 166 ? 0.7354 0.7246 0.6064 0.0056  0.0016  0.0226  861  LEU A CA  
1186 C C   . LEU A 166 ? 0.7695 0.7424 0.6277 -0.0051 0.0069  0.0291  861  LEU A C   
1187 O O   . LEU A 166 ? 0.8103 0.7768 0.6519 -0.0067 0.0094  0.0356  861  LEU A O   
1188 C CB  . LEU A 166 ? 0.7365 0.7122 0.6021 0.0167  -0.0031 0.0256  861  LEU A CB  
1189 C CG  . LEU A 166 ? 0.7836 0.7388 0.6270 0.0231  -0.0041 0.0351  861  LEU A CG  
1190 C CD1 . LEU A 166 ? 0.7902 0.7540 0.6221 0.0255  -0.0049 0.0387  861  LEU A CD1 
1191 C CD2 . LEU A 166 ? 0.7779 0.7266 0.6225 0.0363  -0.0087 0.0357  861  LEU A CD2 
1192 N N   . LEU A 167 ? 0.7808 0.7474 0.6462 -0.0129 0.0085  0.0273  862  LEU A N   
1193 C CA  . LEU A 167 ? 0.8182 0.7716 0.6747 -0.0258 0.0133  0.0322  862  LEU A CA  
1194 C C   . LEU A 167 ? 0.8269 0.8007 0.6905 -0.0356 0.0188  0.0309  862  LEU A C   
1195 O O   . LEU A 167 ? 0.8628 0.8291 0.7149 -0.0452 0.0239  0.0370  862  LEU A O   
1196 C CB  . LEU A 167 ? 0.8082 0.7502 0.6707 -0.0315 0.0121  0.0297  862  LEU A CB  
1197 C CG  . LEU A 167 ? 0.8237 0.7360 0.6712 -0.0256 0.0094  0.0334  862  LEU A CG  
1198 C CD1 . LEU A 167 ? 0.7655 0.6754 0.6236 -0.0253 0.0065  0.0273  862  LEU A CD1 
1199 C CD2 . LEU A 167 ? 0.8469 0.7315 0.6730 -0.0346 0.0129  0.0414  862  LEU A CD2 
1200 N N   . GLY A 168 ? 0.8074 0.8065 0.6896 -0.0331 0.0183  0.0231  863  GLY A N   
1201 C CA  . GLY A 168 ? 0.7796 0.8007 0.6702 -0.0396 0.0239  0.0206  863  GLY A CA  
1202 C C   . GLY A 168 ? 0.7531 0.7890 0.6639 -0.0468 0.0252  0.0154  863  GLY A C   
1203 O O   . GLY A 168 ? 0.7549 0.8032 0.6706 -0.0563 0.0310  0.0163  863  GLY A O   
1204 N N   . ALA A 169 ? 0.7160 0.7522 0.6389 -0.0420 0.0199  0.0102  864  ALA A N   
1205 C CA  . ALA A 169 ? 0.6734 0.7230 0.6149 -0.0470 0.0195  0.0054  864  ALA A CA  
1206 C C   . ALA A 169 ? 0.6526 0.7288 0.6105 -0.0437 0.0220  -0.0009 864  ALA A C   
1207 O O   . ALA A 169 ? 0.6266 0.7169 0.6006 -0.0467 0.0220  -0.0044 864  ALA A O   
1208 C CB  . ALA A 169 ? 0.6974 0.7358 0.6430 -0.0427 0.0133  0.0028  864  ALA A CB  
1209 N N   . GLU A 170 ? 0.6216 0.7039 0.5746 -0.0369 0.0237  -0.0027 865  GLU A N   
1210 C CA  . GLU A 170 ? 0.6152 0.7196 0.5799 -0.0335 0.0272  -0.0090 865  GLU A CA  
1211 C C   . GLU A 170 ? 0.6182 0.7356 0.5806 -0.0406 0.0355  -0.0065 865  GLU A C   
1212 O O   . GLU A 170 ? 0.6213 0.7575 0.5920 -0.0378 0.0400  -0.0115 865  GLU A O   
1213 C CB  . GLU A 170 ? 0.6028 0.7073 0.5629 -0.0234 0.0247  -0.0136 865  GLU A CB  
1214 C CG  . GLU A 170 ? 0.6485 0.7479 0.6173 -0.0168 0.0182  -0.0180 865  GLU A CG  
1215 C CD  . GLU A 170 ? 0.6652 0.7684 0.6329 -0.0088 0.0161  -0.0239 865  GLU A CD  
1216 O OE1 . GLU A 170 ? 0.6365 0.7381 0.6130 -0.0043 0.0120  -0.0282 865  GLU A OE1 
1217 O OE2 . GLU A 170 ? 0.6747 0.7822 0.6322 -0.0077 0.0184  -0.0243 865  GLU A OE2 
1218 N N   . GLU A 171 ? 0.6159 0.7223 0.5662 -0.0498 0.0381  0.0014  866  GLU A N   
1219 C CA  . GLU A 171 ? 0.6357 0.7523 0.5808 -0.0577 0.0468  0.0053  866  GLU A CA  
1220 C C   . GLU A 171 ? 0.6525 0.7724 0.6048 -0.0717 0.0499  0.0096  866  GLU A C   
1221 O O   . GLU A 171 ? 0.6346 0.7436 0.5912 -0.0755 0.0444  0.0103  866  GLU A O   
1222 C CB  . GLU A 171 ? 0.6632 0.7637 0.5832 -0.0569 0.0485  0.0117  866  GLU A CB  
1223 C CG  . GLU A 171 ? 0.7114 0.8173 0.6242 -0.0457 0.0476  0.0071  866  GLU A CG  
1224 C CD  . GLU A 171 ? 0.7598 0.8558 0.6736 -0.0353 0.0383  0.0032  866  GLU A CD  
1225 O OE1 . GLU A 171 ? 0.8039 0.9115 0.7270 -0.0279 0.0364  -0.0050 866  GLU A OE1 
1226 O OE2 . GLU A 171 ? 0.7811 0.8576 0.6863 -0.0345 0.0332  0.0082  866  GLU A OE2 
1227 N N   . LYS A 172 ? 0.6751 0.8107 0.6283 -0.0796 0.0590  0.0121  867  LYS A N   
1228 C CA  . LYS A 172 ? 0.7391 0.8817 0.6988 -0.0954 0.0636  0.0168  867  LYS A CA  
1229 C C   . LYS A 172 ? 0.7371 0.9041 0.7243 -0.0977 0.0619  0.0113  867  LYS A C   
1230 O O   . LYS A 172 ? 0.7506 0.9444 0.7521 -0.1034 0.0691  0.0107  867  LYS A O   
1231 C CB  . LYS A 172 ? 0.7537 0.8660 0.6965 -0.1052 0.0605  0.0245  867  LYS A CB  
1232 C CG  . LYS A 172 ? 0.7758 0.8652 0.6904 -0.1045 0.0636  0.0321  867  LYS A CG  
1233 C CD  . LYS A 172 ? 0.8379 0.9013 0.7366 -0.1183 0.0647  0.0410  867  LYS A CD  
1234 C CE  . LYS A 172 ? 0.8717 0.9148 0.7420 -0.1180 0.0693  0.0498  867  LYS A CE  
1235 N NZ  . LYS A 172 ? 0.9283 0.9481 0.7829 -0.1341 0.0732  0.0592  867  LYS A NZ  
1236 N N   . LYS A 180 ? 0.7693 0.7222 0.6752 -0.1094 0.0098  0.0172  875  LYS A N   
1237 C CA  . LYS A 180 ? 0.7474 0.7113 0.6672 -0.1089 0.0037  0.0106  875  LYS A CA  
1238 C C   . LYS A 180 ? 0.7066 0.6850 0.6378 -0.0920 0.0014  0.0063  875  LYS A C   
1239 O O   . LYS A 180 ? 0.7013 0.6689 0.6237 -0.0798 0.0023  0.0075  875  LYS A O   
1240 C CB  . LYS A 180 ? 0.7825 0.7151 0.6859 -0.1133 -0.0009 0.0096  875  LYS A CB  
1241 C CG  . LYS A 180 ? 0.8081 0.7514 0.7230 -0.1171 -0.0076 0.0035  875  LYS A CG  
1242 C CD  . LYS A 180 ? 0.9303 0.8403 0.8257 -0.1187 -0.0119 0.0015  875  LYS A CD  
1243 C CE  . LYS A 180 ? 0.9398 0.8609 0.8449 -0.1201 -0.0191 -0.0047 875  LYS A CE  
1244 N NZ  . LYS A 180 ? 1.0038 0.8918 0.8878 -0.1226 -0.0230 -0.0074 875  LYS A NZ  
1245 N N   . VAL A 181 ? 0.6392 0.6420 0.5899 -0.0917 -0.0017 0.0014  876  VAL A N   
1246 C CA  . VAL A 181 ? 0.5836 0.5991 0.5454 -0.0774 -0.0038 -0.0028 876  VAL A CA  
1247 C C   . VAL A 181 ? 0.5132 0.5242 0.4774 -0.0752 -0.0104 -0.0069 876  VAL A C   
1248 O O   . VAL A 181 ? 0.5028 0.5155 0.4693 -0.0855 -0.0141 -0.0079 876  VAL A O   
1249 C CB  . VAL A 181 ? 0.5460 0.5940 0.5276 -0.0745 -0.0008 -0.0048 876  VAL A CB  
1250 C CG1 . VAL A 181 ? 0.6353 0.6853 0.6112 -0.0716 0.0055  -0.0018 876  VAL A CG1 
1251 C CG2 . VAL A 181 ? 0.6208 0.6907 0.6172 -0.0861 -0.0012 -0.0054 876  VAL A CG2 
1252 N N   . PRO A 182 ? 0.4816 0.4872 0.4447 -0.0623 -0.0118 -0.0091 877  PRO A N   
1253 C CA  . PRO A 182 ? 0.4514 0.4525 0.4152 -0.0591 -0.0172 -0.0125 877  PRO A CA  
1254 C C   . PRO A 182 ? 0.3896 0.4169 0.3729 -0.0572 -0.0198 -0.0155 877  PRO A C   
1255 O O   . PRO A 182 ? 0.3637 0.3962 0.3530 -0.0467 -0.0203 -0.0175 877  PRO A O   
1256 C CB  . PRO A 182 ? 0.4452 0.4334 0.4017 -0.0461 -0.0159 -0.0129 877  PRO A CB  
1257 C CG  . PRO A 182 ? 0.4953 0.4958 0.4579 -0.0408 -0.0115 -0.0116 877  PRO A CG  
1258 C CD  . PRO A 182 ? 0.5066 0.5092 0.4662 -0.0509 -0.0086 -0.0082 877  PRO A CD  
1259 N N   . ILE A 183 ? 0.3382 0.3817 0.3313 -0.0673 -0.0216 -0.0155 878  ILE A N   
1260 C CA  . ILE A 183 ? 0.3462 0.4182 0.3597 -0.0649 -0.0236 -0.0176 878  ILE A CA  
1261 C C   . ILE A 183 ? 0.2948 0.3654 0.3104 -0.0559 -0.0288 -0.0201 878  ILE A C   
1262 O O   . ILE A 183 ? 0.2776 0.3624 0.3051 -0.0465 -0.0283 -0.0216 878  ILE A O   
1263 C CB  . ILE A 183 ? 0.3634 0.4533 0.3871 -0.0784 -0.0261 -0.0171 878  ILE A CB  
1264 C CG1 . ILE A 183 ? 0.4078 0.5065 0.4340 -0.0870 -0.0192 -0.0142 878  ILE A CG1 
1265 C CG2 . ILE A 183 ? 0.3692 0.4867 0.4128 -0.0741 -0.0304 -0.0194 878  ILE A CG2 
1266 C CD1 . ILE A 183 ? 0.4530 0.5778 0.4955 -0.0798 -0.0134 -0.0148 878  ILE A CD1 
1267 N N   . LYS A 184 ? 0.3118 0.3632 0.3138 -0.0586 -0.0334 -0.0206 879  LYS A N   
1268 C CA  . LYS A 184 ? 0.2783 0.3278 0.2800 -0.0513 -0.0385 -0.0224 879  LYS A CA  
1269 C C   . LYS A 184 ? 0.3148 0.3548 0.3131 -0.0384 -0.0352 -0.0228 879  LYS A C   
1270 O O   . LYS A 184 ? 0.3088 0.3477 0.3071 -0.0319 -0.0382 -0.0236 879  LYS A O   
1271 C CB  . LYS A 184 ? 0.2795 0.3121 0.2663 -0.0589 -0.0444 -0.0234 879  LYS A CB  
1272 C CG  . LYS A 184 ? 0.3148 0.3629 0.3093 -0.0720 -0.0498 -0.0238 879  LYS A CG  
1273 C CD  . LYS A 184 ? 0.3856 0.4131 0.3620 -0.0821 -0.0556 -0.0255 879  LYS A CD  
1274 C CE  . LYS A 184 ? 0.4506 0.4980 0.4374 -0.0956 -0.0623 -0.0263 879  LYS A CE  
1275 N NZ  . LYS A 184 ? 0.4803 0.5087 0.4493 -0.1065 -0.0694 -0.0291 879  LYS A NZ  
1276 N N   . TRP A 185 ? 0.2755 0.3099 0.2710 -0.0350 -0.0291 -0.0219 880  TRP A N   
1277 C CA  . TRP A 185 ? 0.2750 0.3050 0.2705 -0.0243 -0.0259 -0.0226 880  TRP A CA  
1278 C C   . TRP A 185 ? 0.2667 0.3145 0.2759 -0.0198 -0.0223 -0.0235 880  TRP A C   
1279 O O   . TRP A 185 ? 0.2740 0.3207 0.2853 -0.0122 -0.0201 -0.0247 880  TRP A O   
1280 C CB  . TRP A 185 ? 0.2942 0.3049 0.2756 -0.0225 -0.0226 -0.0213 880  TRP A CB  
1281 C CG  . TRP A 185 ? 0.3030 0.2937 0.2698 -0.0221 -0.0246 -0.0215 880  TRP A CG  
1282 C CD1 . TRP A 185 ? 0.2998 0.2815 0.2616 -0.0142 -0.0233 -0.0221 880  TRP A CD1 
1283 C CD2 . TRP A 185 ? 0.3605 0.3372 0.3146 -0.0303 -0.0277 -0.0215 880  TRP A CD2 
1284 N NE1 . TRP A 185 ? 0.3078 0.2709 0.2540 -0.0159 -0.0250 -0.0225 880  TRP A NE1 
1285 C CE2 . TRP A 185 ? 0.3394 0.2980 0.2800 -0.0257 -0.0281 -0.0225 880  TRP A CE2 
1286 C CE3 . TRP A 185 ? 0.3260 0.3037 0.2787 -0.0419 -0.0299 -0.0209 880  TRP A CE3 
1287 C CZ2 . TRP A 185 ? 0.3653 0.3046 0.2890 -0.0317 -0.0309 -0.0236 880  TRP A CZ2 
1288 C CZ3 . TRP A 185 ? 0.3904 0.3492 0.3274 -0.0492 -0.0333 -0.0219 880  TRP A CZ3 
1289 C CH2 . TRP A 185 ? 0.4103 0.3492 0.3322 -0.0436 -0.0340 -0.0235 880  TRP A CH2 
1290 N N   . MET A 186 ? 0.2363 0.3003 0.2546 -0.0251 -0.0214 -0.0232 881  MET A N   
1291 C CA  . MET A 186 ? 0.2247 0.3033 0.2527 -0.0212 -0.0168 -0.0245 881  MET A CA  
1292 C C   . MET A 186 ? 0.2540 0.3479 0.2958 -0.0144 -0.0177 -0.0270 881  MET A C   
1293 O O   . MET A 186 ? 0.2335 0.3371 0.2828 -0.0156 -0.0218 -0.0269 881  MET A O   
1294 C CB  . MET A 186 ? 0.2609 0.3500 0.2910 -0.0296 -0.0137 -0.0228 881  MET A CB  
1295 C CG  . MET A 186 ? 0.3145 0.3869 0.3294 -0.0336 -0.0109 -0.0199 881  MET A CG  
1296 S SD  . MET A 186 ? 0.3515 0.4294 0.3646 -0.0470 -0.0081 -0.0163 881  MET A SD  
1297 C CE  . MET A 186 ? 0.3424 0.4466 0.3694 -0.0436 -0.0021 -0.0180 881  MET A CE  
1298 N N   . ALA A 187 ? 0.2400 0.3369 0.2855 -0.0073 -0.0141 -0.0294 882  ALA A N   
1299 C CA  . ALA A 187 ? 0.2503 0.3597 0.3078 -0.0002 -0.0138 -0.0321 882  ALA A CA  
1300 C C   . ALA A 187 ? 0.2401 0.3719 0.3095 -0.0031 -0.0121 -0.0323 882  ALA A C   
1301 O O   . ALA A 187 ? 0.2448 0.3817 0.3123 -0.0100 -0.0088 -0.0310 882  ALA A O   
1302 C CB  . ALA A 187 ? 0.2267 0.3316 0.2830 0.0066  -0.0098 -0.0355 882  ALA A CB  
1303 N N   . LEU A 188 ? 0.2188 0.3643 0.3005 0.0027  -0.0138 -0.0335 883  LEU A N   
1304 C CA  . LEU A 188 ? 0.2209 0.3914 0.3166 0.0007  -0.0124 -0.0335 883  LEU A CA  
1305 C C   . LEU A 188 ? 0.2141 0.3946 0.3118 0.0006  -0.0042 -0.0356 883  LEU A C   
1306 O O   . LEU A 188 ? 0.2202 0.4183 0.3246 -0.0063 -0.0012 -0.0342 883  LEU A O   
1307 C CB  . LEU A 188 ? 0.2233 0.4061 0.3319 0.0106  -0.0155 -0.0347 883  LEU A CB  
1308 C CG  . LEU A 188 ? 0.2254 0.4387 0.3521 0.0104  -0.0147 -0.0346 883  LEU A CG  
1309 C CD1 . LEU A 188 ? 0.2214 0.4465 0.3515 -0.0036 -0.0184 -0.0313 883  LEU A CD1 
1310 C CD2 . LEU A 188 ? 0.3163 0.5412 0.4554 0.0231  -0.0181 -0.0354 883  LEU A CD2 
1311 N N   . GLU A 189 ? 0.2155 0.3861 0.3076 0.0078  -0.0007 -0.0390 884  GLU A N   
1312 C CA  . GLU A 189 ? 0.2088 0.3861 0.2990 0.0083  0.0067  -0.0416 884  GLU A CA  
1313 C C   . GLU A 189 ? 0.2400 0.4112 0.3186 -0.0017 0.0088  -0.0383 884  GLU A C   
1314 O O   . GLU A 189 ? 0.2292 0.4111 0.3072 -0.0045 0.0149  -0.0385 884  GLU A O   
1315 C CB  . GLU A 189 ? 0.1801 0.3471 0.2657 0.0177  0.0090  -0.0469 884  GLU A CB  
1316 C CG  . GLU A 189 ? 0.1910 0.3360 0.2633 0.0165  0.0066  -0.0469 884  GLU A CG  
1317 C CD  . GLU A 189 ? 0.2156 0.3473 0.2878 0.0197  0.0012  -0.0460 884  GLU A CD  
1318 O OE1 . GLU A 189 ? 0.2385 0.3754 0.3185 0.0219  -0.0022 -0.0443 884  GLU A OE1 
1319 O OE2 . GLU A 189 ? 0.2175 0.3337 0.2813 0.0201  0.0002  -0.0469 884  GLU A OE2 
1320 N N   . SER A 190 ? 0.1971 0.3505 0.2655 -0.0064 0.0043  -0.0351 885  SER A N   
1321 C CA  . SER A 190 ? 0.2224 0.3661 0.2781 -0.0149 0.0056  -0.0312 885  SER A CA  
1322 C C   . SER A 190 ? 0.2314 0.3868 0.2920 -0.0254 0.0063  -0.0275 885  SER A C   
1323 O O   . SER A 190 ? 0.2413 0.3998 0.2967 -0.0324 0.0110  -0.0249 885  SER A O   
1324 C CB  . SER A 190 ? 0.2445 0.3656 0.2884 -0.0152 0.0010  -0.0293 885  SER A CB  
1325 O OG  . SER A 190 ? 0.2433 0.3559 0.2844 -0.0071 0.0005  -0.0324 885  SER A OG  
1326 N N   . ILE A 191 ? 0.2171 0.3789 0.2871 -0.0273 0.0012  -0.0272 886  ILE A N   
1327 C CA  . ILE A 191 ? 0.2378 0.4143 0.3154 -0.0383 0.0010  -0.0245 886  ILE A CA  
1328 C C   . ILE A 191 ? 0.2602 0.4637 0.3510 -0.0390 0.0080  -0.0253 886  ILE A C   
1329 O O   . ILE A 191 ? 0.2525 0.4621 0.3414 -0.0496 0.0125  -0.0222 886  ILE A O   
1330 C CB  . ILE A 191 ? 0.2176 0.3997 0.3042 -0.0393 -0.0069 -0.0246 886  ILE A CB  
1331 C CG1 . ILE A 191 ? 0.2304 0.3857 0.3022 -0.0393 -0.0130 -0.0239 886  ILE A CG1 
1332 C CG2 . ILE A 191 ? 0.2549 0.4560 0.3515 -0.0520 -0.0076 -0.0224 886  ILE A CG2 
1333 C CD1 . ILE A 191 ? 0.1870 0.3458 0.2649 -0.0372 -0.0211 -0.0246 886  ILE A CD1 
1334 N N   . LEU A 192 ? 0.2399 0.4579 0.3428 -0.0275 0.0095  -0.0293 887  LEU A N   
1335 C CA  . LEU A 192 ? 0.1967 0.4433 0.3146 -0.0262 0.0162  -0.0307 887  LEU A CA  
1336 C C   . LEU A 192 ? 0.1886 0.4347 0.2974 -0.0256 0.0254  -0.0316 887  LEU A C   
1337 O O   . LEU A 192 ? 0.2236 0.4893 0.3387 -0.0306 0.0325  -0.0306 887  LEU A O   
1338 C CB  . LEU A 192 ? 0.2305 0.4911 0.3634 -0.0123 0.0147  -0.0349 887  LEU A CB  
1339 C CG  . LEU A 192 ? 0.2180 0.4836 0.3612 -0.0109 0.0054  -0.0338 887  LEU A CG  
1340 C CD1 . LEU A 192 ? 0.2608 0.5393 0.4174 0.0047  0.0052  -0.0373 887  LEU A CD1 
1341 C CD2 . LEU A 192 ? 0.2361 0.5215 0.3899 -0.0240 0.0032  -0.0303 887  LEU A CD2 
1342 N N   . HIS A 193 ? 0.1854 0.4101 0.2793 -0.0198 0.0252  -0.0336 888  HIS A N   
1343 C CA  . HIS A 193 ? 0.1943 0.4200 0.2794 -0.0169 0.0330  -0.0358 888  HIS A CA  
1344 C C   . HIS A 193 ? 0.2375 0.4393 0.3017 -0.0196 0.0320  -0.0337 888  HIS A C   
1345 O O   . HIS A 193 ? 0.2295 0.4290 0.2837 -0.0162 0.0365  -0.0359 888  HIS A O   
1346 C CB  . HIS A 193 ? 0.1858 0.4171 0.2769 -0.0029 0.0353  -0.0429 888  HIS A CB  
1347 C CG  . HIS A 193 ? 0.1999 0.4574 0.3109 0.0021  0.0383  -0.0449 888  HIS A CG  
1348 N ND1 . HIS A 193 ? 0.2346 0.5162 0.3534 -0.0015 0.0467  -0.0442 888  HIS A ND1 
1349 C CD2 . HIS A 193 ? 0.1845 0.4487 0.3092 0.0112  0.0342  -0.0472 888  HIS A CD2 
1350 C CE1 . HIS A 193 ? 0.2153 0.5196 0.3537 0.0055  0.0475  -0.0463 888  HIS A CE1 
1351 N NE2 . HIS A 193 ? 0.1967 0.4901 0.3385 0.0136  0.0396  -0.0479 888  HIS A NE2 
1352 N N   . ARG A 194 ? 0.2413 0.4260 0.2983 -0.0254 0.0260  -0.0295 889  ARG A N   
1353 C CA  . ARG A 194 ? 0.2556 0.4179 0.2938 -0.0265 0.0243  -0.0270 889  ARG A CA  
1354 C C   . ARG A 194 ? 0.2482 0.4027 0.2808 -0.0163 0.0234  -0.0320 889  ARG A C   
1355 O O   . ARG A 194 ? 0.2790 0.4257 0.2980 -0.0158 0.0248  -0.0312 889  ARG A O   
1356 C CB  . ARG A 194 ? 0.2704 0.4320 0.2966 -0.0349 0.0300  -0.0218 889  ARG A CB  
1357 C CG  . ARG A 194 ? 0.3017 0.4714 0.3334 -0.0473 0.0318  -0.0170 889  ARG A CG  
1358 C CD  . ARG A 194 ? 0.3735 0.5324 0.3880 -0.0564 0.0362  -0.0104 889  ARG A CD  
1359 N NE  . ARG A 194 ? 0.4489 0.6133 0.4681 -0.0703 0.0379  -0.0058 889  ARG A NE  
1360 C CZ  . ARG A 194 ? 0.4972 0.6832 0.5247 -0.0779 0.0453  -0.0043 889  ARG A CZ  
1361 N NH1 . ARG A 194 ? 0.4739 0.6772 0.5043 -0.0719 0.0526  -0.0070 889  ARG A NH1 
1362 N NH2 . ARG A 194 ? 0.5646 0.7549 0.5969 -0.0923 0.0459  -0.0002 889  ARG A NH2 
1363 N N   . ILE A 195 ? 0.2369 0.3943 0.2800 -0.0086 0.0209  -0.0370 890  ILE A N   
1364 C CA  . ILE A 195 ? 0.2539 0.4027 0.2931 -0.0006 0.0193  -0.0422 890  ILE A CA  
1365 C C   . ILE A 195 ? 0.2395 0.3707 0.2742 -0.0003 0.0129  -0.0404 890  ILE A C   
1366 O O   . ILE A 195 ? 0.2144 0.3425 0.2556 -0.0005 0.0092  -0.0390 890  ILE A O   
1367 C CB  . ILE A 195 ? 0.2524 0.4099 0.3038 0.0077  0.0205  -0.0483 890  ILE A CB  
1368 C CG1 . ILE A 195 ? 0.2597 0.4361 0.3162 0.0093  0.0279  -0.0510 890  ILE A CG1 
1369 C CG2 . ILE A 195 ? 0.2914 0.4361 0.3379 0.0141  0.0183  -0.0537 890  ILE A CG2 
1370 C CD1 . ILE A 195 ? 0.3414 0.5278 0.4115 0.0184  0.0293  -0.0559 890  ILE A CD1 
1371 N N   . TYR A 196 ? 0.2333 0.3542 0.2568 0.0007  0.0117  -0.0404 891  TYR A N   
1372 C CA  . TYR A 196 ? 0.2652 0.3716 0.2849 0.0018  0.0066  -0.0388 891  TYR A CA  
1373 C C   . TYR A 196 ? 0.2509 0.3547 0.2694 0.0070  0.0055  -0.0441 891  TYR A C   
1374 O O   . TYR A 196 ? 0.2869 0.3941 0.2986 0.0077  0.0070  -0.0463 891  TYR A O   
1375 C CB  . TYR A 196 ? 0.2503 0.3470 0.2579 -0.0021 0.0056  -0.0328 891  TYR A CB  
1376 C CG  . TYR A 196 ? 0.2584 0.3531 0.2649 -0.0091 0.0062  -0.0276 891  TYR A CG  
1377 C CD1 . TYR A 196 ? 0.3188 0.4033 0.3260 -0.0109 0.0025  -0.0254 891  TYR A CD1 
1378 C CD2 . TYR A 196 ? 0.3214 0.4240 0.3252 -0.0148 0.0106  -0.0250 891  TYR A CD2 
1379 C CE1 . TYR A 196 ? 0.3707 0.4524 0.3759 -0.0188 0.0025  -0.0214 891  TYR A CE1 
1380 C CE2 . TYR A 196 ? 0.3387 0.4397 0.3419 -0.0234 0.0111  -0.0204 891  TYR A CE2 
1381 C CZ  . TYR A 196 ? 0.4169 0.5071 0.4208 -0.0255 0.0066  -0.0190 891  TYR A CZ  
1382 O OH  . TYR A 196 ? 0.4076 0.4951 0.4098 -0.0352 0.0067  -0.0152 891  TYR A OH  
1383 N N   . THR A 197 ? 0.2551 0.3530 0.2797 0.0098  0.0029  -0.0461 892  THR A N   
1384 C CA  . THR A 197 ? 0.2406 0.3348 0.2653 0.0129  0.0016  -0.0511 892  THR A CA  
1385 C C   . THR A 197 ? 0.2610 0.3454 0.2872 0.0132  -0.0017 -0.0490 892  THR A C   
1386 O O   . THR A 197 ? 0.2586 0.3380 0.2843 0.0119  -0.0029 -0.0442 892  THR A O   
1387 C CB  . THR A 197 ? 0.2531 0.3499 0.2846 0.0167  0.0037  -0.0574 892  THR A CB  
1388 O OG1 . THR A 197 ? 0.3012 0.3949 0.3404 0.0184  0.0027  -0.0556 892  THR A OG1 
1389 C CG2 . THR A 197 ? 0.2637 0.3717 0.2946 0.0177  0.0082  -0.0601 892  THR A CG2 
1390 N N   . HIS A 198 ? 0.2432 0.3247 0.2709 0.0144  -0.0028 -0.0529 893  HIS A N   
1391 C CA  . HIS A 198 ? 0.2586 0.3323 0.2887 0.0145  -0.0047 -0.0509 893  HIS A CA  
1392 C C   . HIS A 198 ? 0.2415 0.3093 0.2764 0.0157  -0.0042 -0.0500 893  HIS A C   
1393 O O   . HIS A 198 ? 0.2210 0.2821 0.2556 0.0157  -0.0051 -0.0464 893  HIS A O   
1394 C CB  . HIS A 198 ? 0.3111 0.3849 0.3431 0.0138  -0.0057 -0.0552 893  HIS A CB  
1395 C CG  . HIS A 198 ? 0.2911 0.3726 0.3183 0.0132  -0.0075 -0.0557 893  HIS A CG  
1396 N ND1 . HIS A 198 ? 0.3589 0.4412 0.3822 0.0142  -0.0091 -0.0502 893  HIS A ND1 
1397 C CD2 . HIS A 198 ? 0.4269 0.5146 0.4507 0.0124  -0.0083 -0.0607 893  HIS A CD2 
1398 C CE1 . HIS A 198 ? 0.3846 0.4744 0.4031 0.0145  -0.0112 -0.0512 893  HIS A CE1 
1399 N NE2 . HIS A 198 ? 0.3590 0.4526 0.3775 0.0129  -0.0110 -0.0577 893  HIS A NE2 
1400 N N   . GLN A 199 ? 0.2393 0.3102 0.2778 0.0177  -0.0027 -0.0531 894  GLN A N   
1401 C CA  . GLN A 199 ? 0.2262 0.2936 0.2694 0.0204  -0.0030 -0.0517 894  GLN A CA  
1402 C C   . GLN A 199 ? 0.1863 0.2576 0.2298 0.0189  -0.0044 -0.0467 894  GLN A C   
1403 O O   . GLN A 199 ? 0.2116 0.2779 0.2563 0.0199  -0.0065 -0.0440 894  GLN A O   
1404 C CB  . GLN A 199 ? 0.2608 0.3295 0.3083 0.0248  -0.0010 -0.0567 894  GLN A CB  
1405 C CG  . GLN A 199 ? 0.2486 0.3080 0.2945 0.0250  -0.0002 -0.0620 894  GLN A CG  
1406 C CD  . GLN A 199 ? 0.3212 0.3690 0.3666 0.0233  -0.0015 -0.0592 894  GLN A CD  
1407 O OE1 . GLN A 199 ? 0.3011 0.3482 0.3448 0.0193  -0.0021 -0.0589 894  GLN A OE1 
1408 N NE2 . GLN A 199 ? 0.3005 0.3403 0.3473 0.0267  -0.0019 -0.0568 894  GLN A NE2 
1409 N N   . SER A 200 ? 0.2138 0.2929 0.2549 0.0158  -0.0036 -0.0452 895  SER A N   
1410 C CA  . SER A 200 ? 0.2069 0.2876 0.2468 0.0120  -0.0051 -0.0405 895  SER A CA  
1411 C C   . SER A 200 ? 0.2291 0.2975 0.2612 0.0101  -0.0072 -0.0370 895  SER A C   
1412 O O   . SER A 200 ? 0.2442 0.3080 0.2744 0.0081  -0.0095 -0.0341 895  SER A O   
1413 C CB  . SER A 200 ? 0.2529 0.3442 0.2920 0.0081  -0.0028 -0.0395 895  SER A CB  
1414 O OG  . SER A 200 ? 0.2378 0.3267 0.2686 0.0064  -0.0014 -0.0389 895  SER A OG  
1415 N N   . ASP A 201 ? 0.2241 0.2880 0.2520 0.0111  -0.0065 -0.0377 896  ASP A N   
1416 C CA  . ASP A 201 ? 0.2189 0.2722 0.2408 0.0113  -0.0076 -0.0348 896  ASP A CA  
1417 C C   . ASP A 201 ? 0.1804 0.2266 0.2042 0.0132  -0.0084 -0.0347 896  ASP A C   
1418 O O   . ASP A 201 ? 0.2215 0.2591 0.2395 0.0128  -0.0093 -0.0319 896  ASP A O   
1419 C CB  . ASP A 201 ? 0.2204 0.2742 0.2401 0.0130  -0.0070 -0.0356 896  ASP A CB  
1420 C CG  . ASP A 201 ? 0.2372 0.2925 0.2496 0.0121  -0.0069 -0.0331 896  ASP A CG  
1421 O OD1 . ASP A 201 ? 0.2885 0.3474 0.2998 0.0141  -0.0073 -0.0339 896  ASP A OD1 
1422 O OD2 . ASP A 201 ? 0.2700 0.3224 0.2773 0.0091  -0.0068 -0.0301 896  ASP A OD2 
1423 N N   . VAL A 202 ? 0.1947 0.2429 0.2249 0.0153  -0.0078 -0.0378 897  VAL A N   
1424 C CA  . VAL A 202 ? 0.1895 0.2296 0.2202 0.0172  -0.0083 -0.0369 897  VAL A CA  
1425 C C   . VAL A 202 ? 0.2098 0.2484 0.2384 0.0169  -0.0113 -0.0340 897  VAL A C   
1426 O O   . VAL A 202 ? 0.2158 0.2454 0.2389 0.0172  -0.0124 -0.0315 897  VAL A O   
1427 C CB  . VAL A 202 ? 0.2044 0.2440 0.2408 0.0197  -0.0070 -0.0406 897  VAL A CB  
1428 C CG1 . VAL A 202 ? 0.2201 0.2497 0.2551 0.0220  -0.0078 -0.0383 897  VAL A CG1 
1429 C CG2 . VAL A 202 ? 0.2378 0.2770 0.2752 0.0183  -0.0050 -0.0435 897  VAL A CG2 
1430 N N   . TRP A 203 ? 0.2193 0.2680 0.2522 0.0159  -0.0125 -0.0344 898  TRP A N   
1431 C CA  . TRP A 203 ? 0.2334 0.2841 0.2658 0.0141  -0.0162 -0.0319 898  TRP A CA  
1432 C C   . TRP A 203 ? 0.2109 0.2518 0.2325 0.0098  -0.0175 -0.0292 898  TRP A C   
1433 O O   . TRP A 203 ? 0.2228 0.2563 0.2387 0.0095  -0.0205 -0.0274 898  TRP A O   
1434 C CB  . TRP A 203 ? 0.1898 0.2565 0.2303 0.0123  -0.0163 -0.0328 898  TRP A CB  
1435 C CG  . TRP A 203 ? 0.1935 0.2668 0.2362 0.0092  -0.0208 -0.0306 898  TRP A CG  
1436 C CD1 . TRP A 203 ? 0.2190 0.2863 0.2538 0.0029  -0.0237 -0.0283 898  TRP A CD1 
1437 C CD2 . TRP A 203 ? 0.2347 0.3227 0.2885 0.0121  -0.0230 -0.0310 898  TRP A CD2 
1438 N NE1 . TRP A 203 ? 0.2417 0.3198 0.2821 0.0002  -0.0283 -0.0274 898  TRP A NE1 
1439 C CE2 . TRP A 203 ? 0.2139 0.3065 0.2670 0.0063  -0.0280 -0.0287 898  TRP A CE2 
1440 C CE3 . TRP A 203 ? 0.2006 0.2985 0.2647 0.0195  -0.0213 -0.0334 898  TRP A CE3 
1441 C CZ2 . TRP A 203 ? 0.2180 0.3279 0.2823 0.0076  -0.0320 -0.0283 898  TRP A CZ2 
1442 C CZ3 . TRP A 203 ? 0.2473 0.3611 0.3220 0.0223  -0.0246 -0.0327 898  TRP A CZ3 
1443 C CH2 . TRP A 203 ? 0.2995 0.4209 0.3752 0.0163  -0.0301 -0.0300 898  TRP A CH2 
1444 N N   . SER A 204 ? 0.2237 0.2635 0.2412 0.0070  -0.0154 -0.0289 899  SER A N   
1445 C CA  . SER A 204 ? 0.1885 0.2165 0.1945 0.0039  -0.0161 -0.0266 899  SER A CA  
1446 C C   . SER A 204 ? 0.2572 0.2728 0.2563 0.0077  -0.0152 -0.0260 899  SER A C   
1447 O O   . SER A 204 ? 0.2622 0.2664 0.2511 0.0063  -0.0165 -0.0246 899  SER A O   
1448 C CB  . SER A 204 ? 0.2484 0.2763 0.2507 0.0021  -0.0138 -0.0258 899  SER A CB  
1449 O OG  . SER A 204 ? 0.2687 0.3082 0.2764 -0.0020 -0.0136 -0.0260 899  SER A OG  
1450 N N   . TYR A 205 ? 0.2149 0.2328 0.2193 0.0117  -0.0125 -0.0273 900  TYR A N   
1451 C CA  . TYR A 205 ? 0.2475 0.2567 0.2479 0.0147  -0.0106 -0.0266 900  TYR A CA  
1452 C C   . TYR A 205 ? 0.2435 0.2459 0.2391 0.0149  -0.0129 -0.0253 900  TYR A C   
1453 O O   . TYR A 205 ? 0.2532 0.2447 0.2386 0.0156  -0.0123 -0.0238 900  TYR A O   
1454 C CB  . TYR A 205 ? 0.2393 0.2540 0.2482 0.0169  -0.0077 -0.0285 900  TYR A CB  
1455 C CG  . TYR A 205 ? 0.2232 0.2310 0.2296 0.0187  -0.0047 -0.0275 900  TYR A CG  
1456 C CD1 . TYR A 205 ? 0.2473 0.2499 0.2536 0.0193  -0.0045 -0.0267 900  TYR A CD1 
1457 C CD2 . TYR A 205 ? 0.2347 0.2416 0.2389 0.0202  -0.0016 -0.0267 900  TYR A CD2 
1458 C CE1 . TYR A 205 ? 0.2669 0.2628 0.2700 0.0200  -0.0008 -0.0251 900  TYR A CE1 
1459 C CE2 . TYR A 205 ? 0.2597 0.2627 0.2627 0.0215  0.0024  -0.0256 900  TYR A CE2 
1460 C CZ  . TYR A 205 ? 0.2368 0.2340 0.2390 0.0206  0.0031  -0.0247 900  TYR A CZ  
1461 O OH  . TYR A 205 ? 0.2818 0.2746 0.2818 0.0209  0.0079  -0.0230 900  TYR A OH  
1462 N N   . GLY A 206 ? 0.2260 0.2350 0.2284 0.0153  -0.0155 -0.0258 901  GLY A N   
1463 C CA  . GLY A 206 ? 0.2479 0.2524 0.2458 0.0161  -0.0193 -0.0240 901  GLY A CA  
1464 C C   . GLY A 206 ? 0.2294 0.2283 0.2168 0.0123  -0.0230 -0.0230 901  GLY A C   
1465 O O   . GLY A 206 ? 0.2707 0.2590 0.2471 0.0130  -0.0243 -0.0215 901  GLY A O   
1466 N N   . VAL A 207 ? 0.2526 0.2573 0.2419 0.0076  -0.0245 -0.0238 902  VAL A N   
1467 C CA  . VAL A 207 ? 0.2598 0.2570 0.2382 0.0021  -0.0280 -0.0234 902  VAL A CA  
1468 C C   . VAL A 207 ? 0.2756 0.2552 0.2391 0.0032  -0.0248 -0.0231 902  VAL A C   
1469 O O   . VAL A 207 ? 0.2847 0.2524 0.2349 0.0017  -0.0272 -0.0231 902  VAL A O   
1470 C CB  . VAL A 207 ? 0.2462 0.2524 0.2296 -0.0046 -0.0294 -0.0238 902  VAL A CB  
1471 C CG1 . VAL A 207 ? 0.2859 0.2819 0.2567 -0.0119 -0.0335 -0.0238 902  VAL A CG1 
1472 C CG2 . VAL A 207 ? 0.2431 0.2692 0.2420 -0.0047 -0.0317 -0.0243 902  VAL A CG2 
1473 N N   . THR A 208 ? 0.2573 0.2359 0.2229 0.0065  -0.0195 -0.0232 903  THR A N   
1474 C CA  . THR A 208 ? 0.2635 0.2285 0.2178 0.0099  -0.0154 -0.0228 903  THR A CA  
1475 C C   . THR A 208 ? 0.2642 0.2217 0.2117 0.0135  -0.0139 -0.0223 903  THR A C   
1476 O O   . THR A 208 ? 0.3099 0.2533 0.2424 0.0141  -0.0132 -0.0224 903  THR A O   
1477 C CB  . THR A 208 ? 0.2751 0.2460 0.2366 0.0136  -0.0109 -0.0227 903  THR A CB  
1478 O OG1 . THR A 208 ? 0.2588 0.2346 0.2234 0.0102  -0.0122 -0.0226 903  THR A OG1 
1479 C CG2 . THR A 208 ? 0.2896 0.2492 0.2413 0.0187  -0.0065 -0.0222 903  THR A CG2 
1480 N N   . VAL A 209 ? 0.2553 0.2205 0.2119 0.0157  -0.0131 -0.0217 904  VAL A N   
1481 C CA  . VAL A 209 ? 0.2738 0.2313 0.2230 0.0184  -0.0112 -0.0202 904  VAL A CA  
1482 C C   . VAL A 209 ? 0.2968 0.2458 0.2328 0.0163  -0.0167 -0.0197 904  VAL A C   
1483 O O   . VAL A 209 ? 0.3240 0.2604 0.2450 0.0179  -0.0149 -0.0191 904  VAL A O   
1484 C CB  . VAL A 209 ? 0.3086 0.2733 0.2690 0.0203  -0.0094 -0.0192 904  VAL A CB  
1485 C CG1 . VAL A 209 ? 0.3323 0.2873 0.2831 0.0223  -0.0081 -0.0166 904  VAL A CG1 
1486 C CG2 . VAL A 209 ? 0.3133 0.2852 0.2842 0.0214  -0.0038 -0.0203 904  VAL A CG2 
1487 N N   . TRP A 210 ? 0.2974 0.2543 0.2388 0.0128  -0.0233 -0.0201 905  TRP A N   
1488 C CA  . TRP A 210 ? 0.3086 0.2610 0.2393 0.0096  -0.0303 -0.0201 905  TRP A CA  
1489 C C   . TRP A 210 ? 0.3022 0.2395 0.2158 0.0061  -0.0303 -0.0221 905  TRP A C   
1490 O O   . TRP A 210 ? 0.3405 0.2657 0.2374 0.0059  -0.0325 -0.0223 905  TRP A O   
1491 C CB  . TRP A 210 ? 0.3043 0.2726 0.2477 0.0060  -0.0369 -0.0205 905  TRP A CB  
1492 C CG  . TRP A 210 ? 0.3025 0.2709 0.2382 0.0024  -0.0454 -0.0204 905  TRP A CG  
1493 C CD1 . TRP A 210 ? 0.3178 0.2900 0.2530 0.0060  -0.0505 -0.0182 905  TRP A CD1 
1494 C CD2 . TRP A 210 ? 0.3226 0.2864 0.2488 -0.0057 -0.0504 -0.0226 905  TRP A CD2 
1495 N NE1 . TRP A 210 ? 0.3624 0.3358 0.2897 0.0008  -0.0592 -0.0190 905  TRP A NE1 
1496 C CE2 . TRP A 210 ? 0.3674 0.3352 0.2889 -0.0072 -0.0592 -0.0221 905  TRP A CE2 
1497 C CE3 . TRP A 210 ? 0.3575 0.3130 0.2777 -0.0119 -0.0486 -0.0248 905  TRP A CE3 
1498 C CZ2 . TRP A 210 ? 0.3908 0.3561 0.3028 -0.0161 -0.0664 -0.0244 905  TRP A CZ2 
1499 C CZ3 . TRP A 210 ? 0.3848 0.3346 0.2944 -0.0209 -0.0551 -0.0270 905  TRP A CZ3 
1500 C CH2 . TRP A 210 ? 0.3900 0.3456 0.2962 -0.0235 -0.0641 -0.0272 905  TRP A CH2 
1501 N N   . GLU A 211 ? 0.3044 0.2404 0.2201 0.0041  -0.0276 -0.0234 906  GLU A N   
1502 C CA  . GLU A 211 ? 0.3330 0.2510 0.2311 0.0019  -0.0268 -0.0253 906  GLU A CA  
1503 C C   . GLU A 211 ? 0.3760 0.2797 0.2601 0.0084  -0.0208 -0.0254 906  GLU A C   
1504 O O   . GLU A 211 ? 0.3866 0.2736 0.2512 0.0072  -0.0220 -0.0273 906  GLU A O   
1505 C CB  . GLU A 211 ? 0.3487 0.2661 0.2510 0.0007  -0.0238 -0.0256 906  GLU A CB  
1506 C CG  . GLU A 211 ? 0.3525 0.2796 0.2633 -0.0075 -0.0286 -0.0257 906  GLU A CG  
1507 C CD  . GLU A 211 ? 0.3858 0.3088 0.2970 -0.0079 -0.0247 -0.0250 906  GLU A CD  
1508 O OE1 . GLU A 211 ? 0.3873 0.2930 0.2840 -0.0119 -0.0251 -0.0259 906  GLU A OE1 
1509 O OE2 . GLU A 211 ? 0.3398 0.2746 0.2637 -0.0035 -0.0212 -0.0237 906  GLU A OE2 
1510 N N   . LEU A 212 ? 0.3437 0.2541 0.2371 0.0147  -0.0143 -0.0236 907  LEU A N   
1511 C CA  . LEU A 212 ? 0.3685 0.2691 0.2513 0.0209  -0.0072 -0.0233 907  LEU A CA  
1512 C C   . LEU A 212 ? 0.3531 0.2467 0.2229 0.0209  -0.0090 -0.0225 907  LEU A C   
1513 O O   . LEU A 212 ? 0.4034 0.2817 0.2541 0.0229  -0.0065 -0.0238 907  LEU A O   
1514 C CB  . LEU A 212 ? 0.3556 0.2685 0.2539 0.0258  -0.0002 -0.0215 907  LEU A CB  
1515 C CG  . LEU A 212 ? 0.3626 0.2839 0.2732 0.0270  0.0015  -0.0220 907  LEU A CG  
1516 C CD1 . LEU A 212 ? 0.3796 0.3137 0.3041 0.0314  0.0079  -0.0207 907  LEU A CD1 
1517 C CD2 . LEU A 212 ? 0.3906 0.2972 0.2873 0.0293  0.0029  -0.0234 907  LEU A CD2 
1518 N N   . MET A 213 ? 0.3648 0.2687 0.2438 0.0192  -0.0135 -0.0203 908  MET A N   
1519 C CA  . MET A 213 ? 0.3634 0.2615 0.2307 0.0203  -0.0154 -0.0182 908  MET A CA  
1520 C C   . MET A 213 ? 0.3806 0.2685 0.2297 0.0163  -0.0234 -0.0202 908  MET A C   
1521 O O   . MET A 213 ? 0.4214 0.3002 0.2540 0.0178  -0.0246 -0.0189 908  MET A O   
1522 C CB  . MET A 213 ? 0.3858 0.2965 0.2678 0.0209  -0.0185 -0.0150 908  MET A CB  
1523 C CG  . MET A 213 ? 0.3918 0.3105 0.2896 0.0236  -0.0110 -0.0136 908  MET A CG  
1524 S SD  . MET A 213 ? 0.4543 0.3637 0.3422 0.0274  -0.0001 -0.0113 908  MET A SD  
1525 C CE  . MET A 213 ? 0.4794 0.4031 0.3910 0.0275  0.0059  -0.0108 908  MET A CE  
1526 N N   . THR A 214 ? 0.4146 0.3041 0.2659 0.0106  -0.0290 -0.0231 909  THR A N   
1527 C CA  . THR A 214 ? 0.4325 0.3120 0.2667 0.0046  -0.0370 -0.0260 909  THR A CA  
1528 C C   . THR A 214 ? 0.4825 0.3415 0.2977 0.0039  -0.0330 -0.0301 909  THR A C   
1529 O O   . THR A 214 ? 0.5049 0.3524 0.3046 -0.0025 -0.0392 -0.0337 909  THR A O   
1530 C CB  . THR A 214 ? 0.4412 0.3346 0.2884 -0.0033 -0.0462 -0.0270 909  THR A CB  
1531 O OG1 . THR A 214 ? 0.4075 0.3040 0.2659 -0.0056 -0.0424 -0.0281 909  THR A OG1 
1532 C CG2 . THR A 214 ? 0.4139 0.3274 0.2787 -0.0011 -0.0507 -0.0234 909  THR A CG2 
1533 N N   . PHE A 215 ? 0.4594 0.3137 0.2758 0.0106  -0.0228 -0.0297 910  PHE A N   
1534 C CA  . PHE A 215 ? 0.4637 0.2984 0.2636 0.0128  -0.0175 -0.0331 910  PHE A CA  
1535 C C   . PHE A 215 ? 0.4789 0.3072 0.2778 0.0056  -0.0222 -0.0359 910  PHE A C   
1536 O O   . PHE A 215 ? 0.5084 0.3150 0.2865 0.0032  -0.0229 -0.0399 910  PHE A O   
1537 C CB  . PHE A 215 ? 0.5022 0.3176 0.2748 0.0150  -0.0161 -0.0356 910  PHE A CB  
1538 C CG  . PHE A 215 ? 0.5016 0.3221 0.2739 0.0216  -0.0099 -0.0321 910  PHE A CG  
1539 C CD1 . PHE A 215 ? 0.5055 0.3269 0.2818 0.0299  0.0019  -0.0308 910  PHE A CD1 
1540 C CD2 . PHE A 215 ? 0.5253 0.3512 0.2949 0.0196  -0.0157 -0.0295 910  PHE A CD2 
1541 C CE1 . PHE A 215 ? 0.5390 0.3658 0.3159 0.0345  0.0085  -0.0272 910  PHE A CE1 
1542 C CE2 . PHE A 215 ? 0.5718 0.4002 0.3399 0.0251  -0.0092 -0.0253 910  PHE A CE2 
1543 C CZ  . PHE A 215 ? 0.5539 0.3826 0.3257 0.0318  0.0033  -0.0243 910  PHE A CZ  
1544 N N   . GLY A 216 ? 0.4535 0.2997 0.2740 0.0017  -0.0253 -0.0338 911  GLY A N   
1545 C CA  . GLY A 216 ? 0.4619 0.3039 0.2840 -0.0050 -0.0278 -0.0351 911  GLY A CA  
1546 C C   . GLY A 216 ? 0.4519 0.2971 0.2732 -0.0172 -0.0378 -0.0368 911  GLY A C   
1547 O O   . GLY A 216 ? 0.4728 0.3062 0.2866 -0.0248 -0.0398 -0.0389 911  GLY A O   
1548 N N   . SER A 217 ? 0.4229 0.2849 0.2532 -0.0194 -0.0441 -0.0356 912  SER A N   
1549 C CA  . SER A 217 ? 0.4525 0.3251 0.2882 -0.0308 -0.0539 -0.0367 912  SER A CA  
1550 C C   . SER A 217 ? 0.4401 0.3283 0.2961 -0.0355 -0.0532 -0.0349 912  SER A C   
1551 O O   . SER A 217 ? 0.4310 0.3280 0.3007 -0.0288 -0.0468 -0.0323 912  SER A O   
1552 C CB  . SER A 217 ? 0.4803 0.3698 0.3225 -0.0296 -0.0609 -0.0351 912  SER A CB  
1553 O OG  . SER A 217 ? 0.5088 0.3823 0.3285 -0.0270 -0.0626 -0.0367 912  SER A OG  
1554 N N   . LYS A 218 ? 0.4873 0.3792 0.3446 -0.0478 -0.0597 -0.0365 913  LYS A N   
1555 C CA  . LYS A 218 ? 0.4575 0.3657 0.3334 -0.0537 -0.0589 -0.0346 913  LYS A CA  
1556 C C   . LYS A 218 ? 0.4357 0.3752 0.3348 -0.0527 -0.0632 -0.0325 913  LYS A C   
1557 O O   . LYS A 218 ? 0.4553 0.4039 0.3546 -0.0561 -0.0715 -0.0335 913  LYS A O   
1558 C CB  . LYS A 218 ? 0.5070 0.4054 0.3740 -0.0688 -0.0632 -0.0370 913  LYS A CB  
1559 C CG  . LYS A 218 ? 0.5694 0.4331 0.4116 -0.0693 -0.0587 -0.0393 913  LYS A CG  
1560 C CD  . LYS A 218 ? 0.7038 0.5522 0.5310 -0.0851 -0.0649 -0.0431 913  LYS A CD  
1561 C CE  . LYS A 218 ? 0.7630 0.6178 0.6005 -0.0969 -0.0641 -0.0410 913  LYS A CE  
1562 N NZ  . LYS A 218 ? 0.9052 0.7373 0.7327 -0.0924 -0.0552 -0.0388 913  LYS A NZ  
1563 N N   . PRO A 219 ? 0.4210 0.3767 0.3387 -0.0472 -0.0579 -0.0298 914  PRO A N   
1564 C CA  . PRO A 219 ? 0.3991 0.3824 0.3380 -0.0442 -0.0609 -0.0282 914  PRO A CA  
1565 C C   . PRO A 219 ? 0.3976 0.4003 0.3480 -0.0556 -0.0675 -0.0288 914  PRO A C   
1566 O O   . PRO A 219 ? 0.4291 0.4296 0.3793 -0.0654 -0.0658 -0.0291 914  PRO A O   
1567 C CB  . PRO A 219 ? 0.3843 0.3757 0.3365 -0.0370 -0.0528 -0.0263 914  PRO A CB  
1568 C CG  . PRO A 219 ? 0.3795 0.3541 0.3217 -0.0402 -0.0473 -0.0264 914  PRO A CG  
1569 C CD  . PRO A 219 ? 0.4219 0.3705 0.3406 -0.0438 -0.0495 -0.0284 914  PRO A CD  
1570 N N   . TYR A 220 ? 0.4012 0.4228 0.3614 -0.0541 -0.0749 -0.0285 915  TYR A N   
1571 C CA  . TYR A 220 ? 0.4246 0.4710 0.3995 -0.0638 -0.0820 -0.0289 915  TYR A CA  
1572 C C   . TYR A 220 ? 0.4784 0.5123 0.4398 -0.0796 -0.0862 -0.0316 915  TYR A C   
1573 O O   . TYR A 220 ? 0.5166 0.5627 0.4881 -0.0911 -0.0860 -0.0317 915  TYR A O   
1574 C CB  . TYR A 220 ? 0.3860 0.4563 0.3840 -0.0639 -0.0767 -0.0273 915  TYR A CB  
1575 C CG  . TYR A 220 ? 0.3802 0.4563 0.3882 -0.0496 -0.0702 -0.0255 915  TYR A CG  
1576 C CD1 . TYR A 220 ? 0.3701 0.4632 0.3904 -0.0394 -0.0736 -0.0244 915  TYR A CD1 
1577 C CD2 . TYR A 220 ? 0.3531 0.4172 0.3578 -0.0463 -0.0610 -0.0251 915  TYR A CD2 
1578 C CE1 . TYR A 220 ? 0.3642 0.4591 0.3921 -0.0271 -0.0673 -0.0234 915  TYR A CE1 
1579 C CE2 . TYR A 220 ? 0.3656 0.4343 0.3787 -0.0347 -0.0555 -0.0243 915  TYR A CE2 
1580 C CZ  . TYR A 220 ? 0.3397 0.4227 0.3639 -0.0257 -0.0584 -0.0238 915  TYR A CZ  
1581 O OH  . TYR A 220 ? 0.3509 0.4349 0.3815 -0.0155 -0.0527 -0.0236 915  TYR A OH  
1582 N N   . ASP A 221 ? 0.5202 0.5285 0.4578 -0.0805 -0.0893 -0.0340 916  ASP A N   
1583 C CA  . ASP A 221 ? 0.5925 0.5808 0.5118 -0.0949 -0.0925 -0.0375 916  ASP A CA  
1584 C C   . ASP A 221 ? 0.6310 0.6422 0.5612 -0.1090 -0.1030 -0.0391 916  ASP A C   
1585 O O   . ASP A 221 ? 0.6627 0.6943 0.6015 -0.1057 -0.1114 -0.0388 916  ASP A O   
1586 C CB  . ASP A 221 ? 0.6359 0.5935 0.5267 -0.0909 -0.0939 -0.0404 916  ASP A CB  
1587 C CG  . ASP A 221 ? 0.7068 0.6357 0.5743 -0.1039 -0.0951 -0.0447 916  ASP A CG  
1588 O OD1 . ASP A 221 ? 0.8353 0.7441 0.6799 -0.1043 -0.0994 -0.0485 916  ASP A OD1 
1589 O OD2 . ASP A 221 ? 0.7589 0.6833 0.6289 -0.1135 -0.0914 -0.0445 916  ASP A OD2 
1590 N N   . GLY A 222 ? 0.6709 0.6797 0.6015 -0.1246 -0.1023 -0.0403 917  GLY A N   
1591 C CA  . GLY A 222 ? 0.7057 0.7376 0.6481 -0.1411 -0.1115 -0.0419 917  GLY A CA  
1592 C C   . GLY A 222 ? 0.6821 0.7542 0.6572 -0.1419 -0.1098 -0.0385 917  GLY A C   
1593 O O   . GLY A 222 ? 0.7036 0.7989 0.6924 -0.1565 -0.1157 -0.0394 917  GLY A O   
1594 N N   . ILE A 223 ? 0.6447 0.7257 0.6323 -0.1267 -0.1015 -0.0350 918  ILE A N   
1595 C CA  . ILE A 223 ? 0.5934 0.7115 0.6106 -0.1245 -0.0986 -0.0322 918  ILE A CA  
1596 C C   . ILE A 223 ? 0.5752 0.6890 0.5955 -0.1303 -0.0875 -0.0302 918  ILE A C   
1597 O O   . ILE A 223 ? 0.5549 0.6443 0.5622 -0.1225 -0.0794 -0.0291 918  ILE A O   
1598 C CB  . ILE A 223 ? 0.6002 0.7312 0.6289 -0.1040 -0.0967 -0.0300 918  ILE A CB  
1599 C CG1 . ILE A 223 ? 0.6082 0.7400 0.6306 -0.0971 -0.1073 -0.0309 918  ILE A CG1 
1600 C CG2 . ILE A 223 ? 0.5338 0.7022 0.5920 -0.1009 -0.0933 -0.0279 918  ILE A CG2 
1601 C CD1 . ILE A 223 ? 0.6343 0.7671 0.6600 -0.0772 -0.1048 -0.0284 918  ILE A CD1 
1602 N N   . PRO A 224 ? 0.5366 0.6748 0.5737 -0.1443 -0.0872 -0.0294 919  PRO A N   
1603 C CA  . PRO A 224 ? 0.5199 0.6530 0.5577 -0.1506 -0.0763 -0.0268 919  PRO A CA  
1604 C C   . PRO A 224 ? 0.4534 0.5940 0.5006 -0.1340 -0.0669 -0.0243 919  PRO A C   
1605 O O   . PRO A 224 ? 0.4310 0.5951 0.4948 -0.1212 -0.0683 -0.0243 919  PRO A O   
1606 C CB  . PRO A 224 ? 0.5343 0.7002 0.5929 -0.1677 -0.0781 -0.0263 919  PRO A CB  
1607 C CG  . PRO A 224 ? 0.5519 0.7465 0.6257 -0.1668 -0.0900 -0.0285 919  PRO A CG  
1608 C CD  . PRO A 224 ? 0.5717 0.7399 0.6246 -0.1571 -0.0970 -0.0309 919  PRO A CD  
1609 N N   . ALA A 225 ? 0.4447 0.5643 0.4799 -0.1344 -0.0577 -0.0222 920  ALA A N   
1610 C CA  . ALA A 225 ? 0.4270 0.5499 0.4673 -0.1203 -0.0488 -0.0202 920  ALA A CA  
1611 C C   . ALA A 225 ? 0.4015 0.5634 0.4682 -0.1187 -0.0452 -0.0193 920  ALA A C   
1612 O O   . ALA A 225 ? 0.3555 0.5281 0.4313 -0.1039 -0.0416 -0.0195 920  ALA A O   
1613 C CB  . ALA A 225 ? 0.4350 0.5301 0.4571 -0.1232 -0.0410 -0.0177 920  ALA A CB  
1614 N N   . SER A 226 ? 0.4138 0.5969 0.4926 -0.1343 -0.0458 -0.0185 921  SER A N   
1615 C CA  . SER A 226 ? 0.4109 0.6342 0.5162 -0.1340 -0.0415 -0.0176 921  SER A CA  
1616 C C   . SER A 226 ? 0.3744 0.6267 0.5001 -0.1208 -0.0475 -0.0196 921  SER A C   
1617 O O   . SER A 226 ? 0.3791 0.6601 0.5245 -0.1132 -0.0424 -0.0194 921  SER A O   
1618 C CB  . SER A 226 ? 0.4263 0.6667 0.5404 -0.1556 -0.0411 -0.0161 921  SER A CB  
1619 O OG  . SER A 226 ? 0.4564 0.6995 0.5711 -0.1663 -0.0527 -0.0184 921  SER A OG  
1620 N N   . GLU A 227 ? 0.3717 0.6146 0.4908 -0.1172 -0.0578 -0.0215 922  GLU A N   
1621 C CA  . GLU A 227 ? 0.3776 0.6435 0.5125 -0.1038 -0.0646 -0.0226 922  GLU A CA  
1622 C C   . GLU A 227 ? 0.3176 0.5670 0.4450 -0.0836 -0.0623 -0.0229 922  GLU A C   
1623 O O   . GLU A 227 ? 0.3414 0.6060 0.4800 -0.0705 -0.0664 -0.0232 922  GLU A O   
1624 C CB  . GLU A 227 ? 0.3764 0.6429 0.5076 -0.1112 -0.0780 -0.0240 922  GLU A CB  
1625 C CG  . GLU A 227 ? 0.5004 0.7851 0.6403 -0.1329 -0.0822 -0.0243 922  GLU A CG  
1626 C CD  . GLU A 227 ? 0.6230 0.9574 0.7949 -0.1330 -0.0856 -0.0239 922  GLU A CD  
1627 O OE1 . GLU A 227 ? 0.6791 1.0308 0.8582 -0.1456 -0.0960 -0.0250 922  GLU A OE1 
1628 O OE2 . GLU A 227 ? 0.6212 0.9782 0.8111 -0.1205 -0.0783 -0.0227 922  GLU A OE2 
1629 N N   . ILE A 228 ? 0.3219 0.5408 0.4306 -0.0810 -0.0556 -0.0227 923  ILE A N   
1630 C CA  . ILE A 228 ? 0.3163 0.5165 0.4158 -0.0646 -0.0543 -0.0233 923  ILE A CA  
1631 C C   . ILE A 228 ? 0.2925 0.5114 0.4079 -0.0501 -0.0490 -0.0237 923  ILE A C   
1632 O O   . ILE A 228 ? 0.2780 0.4962 0.3954 -0.0370 -0.0522 -0.0242 923  ILE A O   
1633 C CB  . ILE A 228 ? 0.2991 0.4642 0.3758 -0.0656 -0.0492 -0.0230 923  ILE A CB  
1634 C CG1 . ILE A 228 ? 0.3551 0.4968 0.4129 -0.0759 -0.0553 -0.0233 923  ILE A CG1 
1635 C CG2 . ILE A 228 ? 0.3521 0.5028 0.4229 -0.0497 -0.0460 -0.0236 923  ILE A CG2 
1636 C CD1 . ILE A 228 ? 0.3583 0.4933 0.4096 -0.0704 -0.0642 -0.0245 923  ILE A CD1 
1637 N N   . SER A 229 ? 0.3058 0.5401 0.4313 -0.0525 -0.0407 -0.0236 924  SER A N   
1638 C CA  . SER A 229 ? 0.2866 0.5375 0.4257 -0.0387 -0.0350 -0.0250 924  SER A CA  
1639 C C   . SER A 229 ? 0.2661 0.5437 0.4242 -0.0301 -0.0411 -0.0253 924  SER A C   
1640 O O   . SER A 229 ? 0.2578 0.5344 0.4191 -0.0146 -0.0406 -0.0264 924  SER A O   
1641 C CB  . SER A 229 ? 0.2655 0.5306 0.4113 -0.0434 -0.0247 -0.0250 924  SER A CB  
1642 O OG  . SER A 229 ? 0.3074 0.6014 0.4693 -0.0548 -0.0252 -0.0237 924  SER A OG  
1643 N N   . SER A 230 ? 0.3039 0.6049 0.4746 -0.0400 -0.0471 -0.0243 925  SER A N   
1644 C CA  . SER A 230 ? 0.2939 0.6234 0.4839 -0.0312 -0.0541 -0.0241 925  SER A CA  
1645 C C   . SER A 230 ? 0.2900 0.6020 0.4694 -0.0211 -0.0635 -0.0235 925  SER A C   
1646 O O   . SER A 230 ? 0.3225 0.6452 0.5114 -0.0056 -0.0660 -0.0232 925  SER A O   
1647 C CB  . SER A 230 ? 0.2845 0.6465 0.4918 -0.0455 -0.0591 -0.0232 925  SER A CB  
1648 O OG  . SER A 230 ? 0.4106 0.7580 0.6046 -0.0592 -0.0686 -0.0227 925  SER A OG  
1649 N N   . ILE A 231 ? 0.3084 0.5925 0.4668 -0.0296 -0.0682 -0.0231 926  ILE A N   
1650 C CA  . ILE A 231 ? 0.3214 0.5840 0.4649 -0.0217 -0.0757 -0.0223 926  ILE A CA  
1651 C C   . ILE A 231 ? 0.3138 0.5586 0.4513 -0.0053 -0.0697 -0.0224 926  ILE A C   
1652 O O   . ILE A 231 ? 0.3119 0.5564 0.4506 0.0077  -0.0741 -0.0211 926  ILE A O   
1653 C CB  . ILE A 231 ? 0.3555 0.5895 0.4757 -0.0347 -0.0791 -0.0226 926  ILE A CB  
1654 C CG1 . ILE A 231 ? 0.4315 0.6810 0.5554 -0.0480 -0.0896 -0.0228 926  ILE A CG1 
1655 C CG2 . ILE A 231 ? 0.4528 0.6544 0.5519 -0.0257 -0.0802 -0.0221 926  ILE A CG2 
1656 C CD1 . ILE A 231 ? 0.5074 0.7284 0.6078 -0.0615 -0.0928 -0.0241 926  ILE A CD1 
1657 N N   . LEU A 232 ? 0.2852 0.5154 0.4161 -0.0063 -0.0598 -0.0239 927  LEU A N   
1658 C CA  . LEU A 232 ? 0.2621 0.4753 0.3872 0.0067  -0.0539 -0.0248 927  LEU A CA  
1659 C C   . LEU A 232 ? 0.2835 0.5171 0.4260 0.0204  -0.0514 -0.0257 927  LEU A C   
1660 O O   . LEU A 232 ? 0.2690 0.4910 0.4081 0.0335  -0.0517 -0.0255 927  LEU A O   
1661 C CB  . LEU A 232 ? 0.2617 0.4584 0.3768 0.0017  -0.0449 -0.0264 927  LEU A CB  
1662 C CG  . LEU A 232 ? 0.2661 0.4380 0.3619 -0.0086 -0.0460 -0.0256 927  LEU A CG  
1663 C CD1 . LEU A 232 ? 0.2573 0.4186 0.3463 -0.0126 -0.0377 -0.0265 927  LEU A CD1 
1664 C CD2 . LEU A 232 ? 0.2503 0.3982 0.3311 -0.0028 -0.0499 -0.0247 927  LEU A CD2 
1665 N N   . GLU A 233 ? 0.2776 0.5403 0.4380 0.0176  -0.0483 -0.0266 928  GLU A N   
1666 C CA  . GLU A 233 ? 0.3215 0.6069 0.4999 0.0313  -0.0454 -0.0277 928  GLU A CA  
1667 C C   . GLU A 233 ? 0.2979 0.5940 0.4841 0.0421  -0.0551 -0.0252 928  GLU A C   
1668 O O   . GLU A 233 ? 0.3351 0.6347 0.5280 0.0584  -0.0535 -0.0257 928  GLU A O   
1669 C CB  . GLU A 233 ? 0.2957 0.6137 0.4926 0.0250  -0.0397 -0.0288 928  GLU A CB  
1670 C CG  . GLU A 233 ? 0.3432 0.6515 0.5327 0.0200  -0.0283 -0.0313 928  GLU A CG  
1671 C CD  . GLU A 233 ? 0.4284 0.7636 0.6304 0.0082  -0.0227 -0.0310 928  GLU A CD  
1672 O OE1 . GLU A 233 ? 0.4995 0.8275 0.6941 0.0036  -0.0137 -0.0323 928  GLU A OE1 
1673 O OE2 . GLU A 233 ? 0.4177 0.7816 0.6367 0.0029  -0.0273 -0.0293 928  GLU A OE2 
1674 N N   . LYS A 234 ? 0.3305 0.6306 0.5143 0.0335  -0.0653 -0.0227 929  LYS A N   
1675 C CA  . LYS A 234 ? 0.3666 0.6757 0.5548 0.0431  -0.0762 -0.0197 929  LYS A CA  
1676 C C   . LYS A 234 ? 0.3692 0.6443 0.5370 0.0528  -0.0788 -0.0178 929  LYS A C   
1677 O O   . LYS A 234 ? 0.3885 0.6658 0.5562 0.0631  -0.0870 -0.0146 929  LYS A O   
1678 C CB  . LYS A 234 ? 0.3816 0.7077 0.5732 0.0293  -0.0871 -0.0182 929  LYS A CB  
1679 C CG  . LYS A 234 ? 0.5087 0.8797 0.7277 0.0309  -0.0918 -0.0176 929  LYS A CG  
1680 C CD  . LYS A 234 ? 0.5577 0.9508 0.7879 0.0112  -0.0898 -0.0191 929  LYS A CD  
1681 C CE  . LYS A 234 ? 0.5732 0.9658 0.7956 -0.0050 -0.1017 -0.0184 929  LYS A CE  
1682 N NZ  . LYS A 234 ? 0.5458 0.9755 0.7892 -0.0208 -0.1036 -0.0191 929  LYS A NZ  
1683 N N   . GLY A 235 ? 0.3307 0.5752 0.4810 0.0492  -0.0718 -0.0193 930  GLY A N   
1684 C CA  . GLY A 235 ? 0.3519 0.5641 0.4833 0.0567  -0.0722 -0.0176 930  GLY A CA  
1685 C C   . GLY A 235 ? 0.3373 0.5296 0.4493 0.0472  -0.0781 -0.0157 930  GLY A C   
1686 O O   . GLY A 235 ? 0.3694 0.5361 0.4650 0.0523  -0.0784 -0.0137 930  GLY A O   
1687 N N   . GLU A 236 ? 0.3404 0.5431 0.4531 0.0329  -0.0821 -0.0165 931  GLU A N   
1688 C CA  . GLU A 236 ? 0.3094 0.4924 0.4021 0.0235  -0.0875 -0.0156 931  GLU A CA  
1689 C C   . GLU A 236 ? 0.2978 0.4533 0.3752 0.0187  -0.0787 -0.0173 931  GLU A C   
1690 O O   . GLU A 236 ? 0.2761 0.4346 0.3599 0.0156  -0.0706 -0.0196 931  GLU A O   
1691 C CB  . GLU A 236 ? 0.2821 0.4823 0.3790 0.0088  -0.0944 -0.0167 931  GLU A CB  
1692 C CG  . GLU A 236 ? 0.3230 0.5579 0.4394 0.0113  -0.1038 -0.0154 931  GLU A CG  
1693 C CD  . GLU A 236 ? 0.4761 0.7286 0.5977 -0.0062 -0.1099 -0.0171 931  GLU A CD  
1694 O OE1 . GLU A 236 ? 0.5193 0.8070 0.6640 -0.0080 -0.1128 -0.0171 931  GLU A OE1 
1695 O OE2 . GLU A 236 ? 0.5037 0.7347 0.6063 -0.0184 -0.1116 -0.0185 931  GLU A OE2 
1696 N N   . ARG A 237 ? 0.2981 0.4280 0.3551 0.0186  -0.0802 -0.0160 932  ARG A N   
1697 C CA  . ARG A 237 ? 0.2962 0.4012 0.3387 0.0149  -0.0725 -0.0173 932  ARG A CA  
1698 C C   . ARG A 237 ? 0.3074 0.3945 0.3297 0.0075  -0.0767 -0.0171 932  ARG A C   
1699 O O   . ARG A 237 ? 0.3480 0.4396 0.3655 0.0059  -0.0859 -0.0159 932  ARG A O   
1700 C CB  . ARG A 237 ? 0.2838 0.3729 0.3221 0.0257  -0.0664 -0.0162 932  ARG A CB  
1701 C CG  . ARG A 237 ? 0.3021 0.4031 0.3569 0.0337  -0.0610 -0.0176 932  ARG A CG  
1702 C CD  . ARG A 237 ? 0.2755 0.3812 0.3364 0.0274  -0.0536 -0.0210 932  ARG A CD  
1703 N NE  . ARG A 237 ? 0.3057 0.4210 0.3794 0.0350  -0.0481 -0.0232 932  ARG A NE  
1704 C CZ  . ARG A 237 ? 0.3223 0.4619 0.4126 0.0380  -0.0486 -0.0241 932  ARG A CZ  
1705 N NH1 . ARG A 237 ? 0.3364 0.4807 0.4352 0.0457  -0.0425 -0.0268 932  ARG A NH1 
1706 N NH2 . ARG A 237 ? 0.2953 0.4550 0.3940 0.0332  -0.0548 -0.0229 932  ARG A NH2 
1707 N N   . LEU A 238 ? 0.2823 0.3493 0.2922 0.0038  -0.0701 -0.0183 933  LEU A N   
1708 C CA  . LEU A 238 ? 0.2911 0.3371 0.2794 -0.0009 -0.0720 -0.0185 933  LEU A CA  
1709 C C   . LEU A 238 ? 0.3338 0.3694 0.3106 0.0073  -0.0755 -0.0155 933  LEU A C   
1710 O O   . LEU A 238 ? 0.3526 0.3866 0.3340 0.0167  -0.0719 -0.0132 933  LEU A O   
1711 C CB  . LEU A 238 ? 0.3072 0.3352 0.2867 -0.0026 -0.0630 -0.0199 933  LEU A CB  
1712 C CG  . LEU A 238 ? 0.3288 0.3616 0.3138 -0.0112 -0.0599 -0.0221 933  LEU A CG  
1713 C CD1 . LEU A 238 ? 0.3362 0.3548 0.3160 -0.0092 -0.0509 -0.0226 933  LEU A CD1 
1714 C CD2 . LEU A 238 ? 0.3460 0.3746 0.3208 -0.0223 -0.0659 -0.0236 933  LEU A CD2 
1715 N N   . PRO A 239 ? 0.3423 0.3690 0.3022 0.0035  -0.0822 -0.0154 934  PRO A N   
1716 C CA  . PRO A 239 ? 0.3604 0.3785 0.3076 0.0109  -0.0865 -0.0118 934  PRO A CA  
1717 C C   . PRO A 239 ? 0.3888 0.3829 0.3205 0.0155  -0.0778 -0.0103 934  PRO A C   
1718 O O   . PRO A 239 ? 0.3863 0.3699 0.3141 0.0120  -0.0701 -0.0127 934  PRO A O   
1719 C CB  . PRO A 239 ? 0.3938 0.4106 0.3267 0.0033  -0.0965 -0.0134 934  PRO A CB  
1720 C CG  . PRO A 239 ? 0.4057 0.4152 0.3343 -0.0078 -0.0931 -0.0180 934  PRO A CG  
1721 C CD  . PRO A 239 ? 0.3704 0.3928 0.3203 -0.0083 -0.0862 -0.0187 934  PRO A CD  
1722 N N   . GLN A 240 ? 0.3605 0.3469 0.2836 0.0236  -0.0790 -0.0059 935  GLN A N   
1723 C CA  . GLN A 240 ? 0.3463 0.3112 0.2543 0.0272  -0.0705 -0.0037 935  GLN A CA  
1724 C C   . GLN A 240 ? 0.3755 0.3241 0.2616 0.0215  -0.0693 -0.0061 935  GLN A C   
1725 O O   . GLN A 240 ? 0.4252 0.3716 0.2973 0.0190  -0.0776 -0.0063 935  GLN A O   
1726 C CB  . GLN A 240 ? 0.3808 0.3393 0.2807 0.0359  -0.0733 0.0022  935  GLN A CB  
1727 C CG  . GLN A 240 ? 0.4071 0.3441 0.2921 0.0390  -0.0637 0.0055  935  GLN A CG  
1728 C CD  . GLN A 240 ? 0.4589 0.3885 0.3369 0.0477  -0.0659 0.0124  935  GLN A CD  
1729 O OE1 . GLN A 240 ? 0.4988 0.4397 0.3843 0.0529  -0.0745 0.0146  935  GLN A OE1 
1730 N NE2 . GLN A 240 ? 0.4721 0.3827 0.3356 0.0494  -0.0577 0.0161  935  GLN A NE2 
1731 N N   . PRO A 241 ? 0.3760 0.3139 0.2592 0.0199  -0.0591 -0.0081 936  PRO A N   
1732 C CA  . PRO A 241 ? 0.4166 0.3372 0.2777 0.0166  -0.0566 -0.0104 936  PRO A CA  
1733 C C   . PRO A 241 ? 0.4573 0.3635 0.2966 0.0210  -0.0564 -0.0067 936  PRO A C   
1734 O O   . PRO A 241 ? 0.4406 0.3441 0.2820 0.0267  -0.0515 -0.0021 936  PRO A O   
1735 C CB  . PRO A 241 ? 0.4179 0.3336 0.2844 0.0171  -0.0450 -0.0120 936  PRO A CB  
1736 C CG  . PRO A 241 ? 0.3868 0.3196 0.2782 0.0165  -0.0448 -0.0127 936  PRO A CG  
1737 C CD  . PRO A 241 ? 0.3772 0.3205 0.2776 0.0205  -0.0507 -0.0093 936  PRO A CD  
1738 N N   . PRO A 242 ? 0.4542 0.3496 0.2712 0.0178  -0.0615 -0.0089 937  PRO A N   
1739 C CA  . PRO A 242 ? 0.5155 0.3968 0.3084 0.0217  -0.0620 -0.0054 937  PRO A CA  
1740 C C   . PRO A 242 ? 0.5063 0.3760 0.2936 0.0271  -0.0490 -0.0016 937  PRO A C   
1741 O O   . PRO A 242 ? 0.5317 0.3956 0.3092 0.0318  -0.0490 0.0042  937  PRO A O   
1742 C CB  . PRO A 242 ? 0.5326 0.4007 0.3021 0.0161  -0.0652 -0.0109 937  PRO A CB  
1743 C CG  . PRO A 242 ? 0.5494 0.4301 0.3326 0.0084  -0.0733 -0.0156 937  PRO A CG  
1744 C CD  . PRO A 242 ? 0.4922 0.3877 0.3044 0.0095  -0.0678 -0.0147 937  PRO A CD  
1745 N N   . ILE A 243 ? 0.4808 0.3480 0.2746 0.0263  -0.0382 -0.0042 938  ILE A N   
1746 C CA  . ILE A 243 ? 0.4647 0.3241 0.2554 0.0302  -0.0253 -0.0010 938  ILE A CA  
1747 C C   . ILE A 243 ? 0.4499 0.3179 0.2606 0.0327  -0.0215 0.0036  938  ILE A C   
1748 O O   . ILE A 243 ? 0.4881 0.3499 0.2960 0.0346  -0.0120 0.0073  938  ILE A O   
1749 C CB  . ILE A 243 ? 0.4671 0.3223 0.2577 0.0297  -0.0149 -0.0054 938  ILE A CB  
1750 C CG1 . ILE A 243 ? 0.4331 0.3023 0.2493 0.0278  -0.0139 -0.0082 938  ILE A CG1 
1751 C CG2 . ILE A 243 ? 0.4737 0.3152 0.2408 0.0280  -0.0171 -0.0104 938  ILE A CG2 
1752 C CD1 . ILE A 243 ? 0.4344 0.3018 0.2536 0.0296  -0.0027 -0.0107 938  ILE A CD1 
1753 N N   . CYS A 244 ? 0.4417 0.3237 0.2724 0.0321  -0.0283 0.0029  939  CYS A N   
1754 C CA  . CYS A 244 ? 0.4130 0.3018 0.2628 0.0342  -0.0243 0.0055  939  CYS A CA  
1755 C C   . CYS A 244 ? 0.4355 0.3189 0.2799 0.0388  -0.0277 0.0119  939  CYS A C   
1756 O O   . CYS A 244 ? 0.4670 0.3536 0.3073 0.0411  -0.0383 0.0133  939  CYS A O   
1757 C CB  . CYS A 244 ? 0.3794 0.2849 0.2520 0.0325  -0.0290 0.0019  939  CYS A CB  
1758 S SG  . CYS A 244 ? 0.4305 0.3418 0.3123 0.0280  -0.0238 -0.0043 939  CYS A SG  
1759 N N   . THR A 245 ? 0.4459 0.3218 0.2916 0.0401  -0.0190 0.0158  940  THR A N   
1760 C CA  . THR A 245 ? 0.4664 0.3362 0.3115 0.0448  -0.0214 0.0217  940  THR A CA  
1761 C C   . THR A 245 ? 0.4457 0.3295 0.3134 0.0468  -0.0269 0.0192  940  THR A C   
1762 O O   . THR A 245 ? 0.4402 0.3373 0.3240 0.0434  -0.0265 0.0134  940  THR A O   
1763 C CB  . THR A 245 ? 0.4912 0.3488 0.3339 0.0436  -0.0097 0.0259  940  THR A CB  
1764 O OG1 . THR A 245 ? 0.4837 0.3507 0.3462 0.0393  -0.0027 0.0212  940  THR A OG1 
1765 C CG2 . THR A 245 ? 0.5146 0.3589 0.3341 0.0422  -0.0028 0.0292  940  THR A CG2 
1766 N N   . ILE A 246 ? 0.4343 0.3144 0.3025 0.0530  -0.0315 0.0238  941  ILE A N   
1767 C CA  . ILE A 246 ? 0.4356 0.3280 0.3241 0.0566  -0.0357 0.0215  941  ILE A CA  
1768 C C   . ILE A 246 ? 0.4357 0.3297 0.3402 0.0529  -0.0267 0.0177  941  ILE A C   
1769 O O   . ILE A 246 ? 0.4149 0.3234 0.3371 0.0527  -0.0285 0.0127  941  ILE A O   
1770 C CB  . ILE A 246 ? 0.4855 0.3722 0.3697 0.0663  -0.0426 0.0276  941  ILE A CB  
1771 C CG1 . ILE A 246 ? 0.5175 0.4227 0.4224 0.0713  -0.0492 0.0243  941  ILE A CG1 
1772 C CG2 . ILE A 246 ? 0.5234 0.3884 0.3997 0.0685  -0.0348 0.0331  941  ILE A CG2 
1773 C CD1 . ILE A 246 ? 0.6136 0.5398 0.5242 0.0694  -0.0588 0.0209  941  ILE A CD1 
1774 N N   . ASP A 247 ? 0.4385 0.3189 0.3365 0.0493  -0.0170 0.0198  942  ASP A N   
1775 C CA  . ASP A 247 ? 0.4451 0.3273 0.3572 0.0445  -0.0089 0.0160  942  ASP A CA  
1776 C C   . ASP A 247 ? 0.4154 0.3155 0.3412 0.0401  -0.0087 0.0090  942  ASP A C   
1777 O O   . ASP A 247 ? 0.3997 0.3091 0.3414 0.0391  -0.0080 0.0044  942  ASP A O   
1778 C CB  . ASP A 247 ? 0.4975 0.3664 0.4001 0.0393  0.0015  0.0193  942  ASP A CB  
1779 C CG  . ASP A 247 ? 0.6754 0.5234 0.5604 0.0426  0.0026  0.0275  942  ASP A CG  
1780 O OD1 . ASP A 247 ? 0.6588 0.4948 0.5453 0.0402  0.0088  0.0296  942  ASP A OD1 
1781 O OD2 . ASP A 247 ? 0.7531 0.5957 0.6215 0.0469  -0.0027 0.0319  942  ASP A OD2 
1782 N N   . VAL A 248 ? 0.4028 0.3058 0.3202 0.0379  -0.0092 0.0082  943  VAL A N   
1783 C CA  . VAL A 248 ? 0.3846 0.3010 0.3116 0.0341  -0.0088 0.0025  943  VAL A CA  
1784 C C   . VAL A 248 ? 0.3677 0.2972 0.3041 0.0356  -0.0174 -0.0005 943  VAL A C   
1785 O O   . VAL A 248 ? 0.3667 0.3079 0.3172 0.0336  -0.0168 -0.0049 943  VAL A O   
1786 C CB  . VAL A 248 ? 0.3811 0.2933 0.2945 0.0320  -0.0057 0.0023  943  VAL A CB  
1787 C CG1 . VAL A 248 ? 0.4094 0.3327 0.3313 0.0293  -0.0058 -0.0030 943  VAL A CG1 
1788 C CG2 . VAL A 248 ? 0.4040 0.3072 0.3110 0.0303  0.0045  0.0051  943  VAL A CG2 
1789 N N   . TYR A 249 ? 0.3665 0.2955 0.2954 0.0390  -0.0254 0.0020  944  TYR A N   
1790 C CA  . TYR A 249 ? 0.3723 0.3166 0.3117 0.0397  -0.0335 -0.0005 944  TYR A CA  
1791 C C   . TYR A 249 ? 0.3318 0.2848 0.2888 0.0431  -0.0328 -0.0022 944  TYR A C   
1792 O O   . TYR A 249 ? 0.3469 0.3147 0.3170 0.0413  -0.0344 -0.0061 944  TYR A O   
1793 C CB  . TYR A 249 ? 0.3944 0.3388 0.3234 0.0428  -0.0429 0.0027  944  TYR A CB  
1794 C CG  . TYR A 249 ? 0.3456 0.3091 0.2862 0.0419  -0.0515 0.0001  944  TYR A CG  
1795 C CD1 . TYR A 249 ? 0.3553 0.3275 0.3006 0.0482  -0.0595 0.0028  944  TYR A CD1 
1796 C CD2 . TYR A 249 ? 0.3585 0.3319 0.3059 0.0348  -0.0513 -0.0047 944  TYR A CD2 
1797 C CE1 . TYR A 249 ? 0.3972 0.3906 0.3554 0.0470  -0.0670 0.0005  944  TYR A CE1 
1798 C CE2 . TYR A 249 ? 0.3288 0.3206 0.2874 0.0325  -0.0585 -0.0068 944  TYR A CE2 
1799 C CZ  . TYR A 249 ? 0.3591 0.3623 0.3240 0.0383  -0.0662 -0.0043 944  TYR A CZ  
1800 O OH  . TYR A 249 ? 0.3659 0.3908 0.3441 0.0356  -0.0728 -0.0062 944  TYR A OH  
1801 N N   . MET A 250 ? 0.3385 0.2806 0.2943 0.0474  -0.0296 0.0007  945  MET A N   
1802 C CA  . MET A 250 ? 0.3635 0.3102 0.3333 0.0513  -0.0285 -0.0016 945  MET A CA  
1803 C C   . MET A 250 ? 0.3531 0.3073 0.3346 0.0459  -0.0228 -0.0073 945  MET A C   
1804 O O   . MET A 250 ? 0.3344 0.2993 0.3284 0.0478  -0.0234 -0.0111 945  MET A O   
1805 C CB  . MET A 250 ? 0.4019 0.3305 0.3654 0.0564  -0.0257 0.0025  945  MET A CB  
1806 C CG  . MET A 250 ? 0.4331 0.3578 0.3898 0.0657  -0.0331 0.0080  945  MET A CG  
1807 S SD  . MET A 250 ? 0.6053 0.5554 0.5771 0.0720  -0.0428 0.0057  945  MET A SD  
1808 C CE  . MET A 250 ? 0.6776 0.6352 0.6389 0.0667  -0.0500 0.0074  945  MET A CE  
1809 N N   . ILE A 251 ? 0.3407 0.2901 0.3175 0.0399  -0.0173 -0.0080 946  ILE A N   
1810 C CA  . ILE A 251 ? 0.3529 0.3114 0.3401 0.0352  -0.0131 -0.0130 946  ILE A CA  
1811 C C   . ILE A 251 ? 0.2946 0.2687 0.2884 0.0340  -0.0174 -0.0159 946  ILE A C   
1812 O O   . ILE A 251 ? 0.3097 0.2941 0.3147 0.0339  -0.0170 -0.0198 946  ILE A O   
1813 C CB  . ILE A 251 ? 0.3514 0.3050 0.3335 0.0301  -0.0069 -0.0127 946  ILE A CB  
1814 C CG1 . ILE A 251 ? 0.3763 0.3162 0.3540 0.0293  -0.0014 -0.0099 946  ILE A CG1 
1815 C CG2 . ILE A 251 ? 0.3801 0.3456 0.3728 0.0264  -0.0044 -0.0175 946  ILE A CG2 
1816 C CD1 . ILE A 251 ? 0.4638 0.4010 0.4363 0.0250  0.0051  -0.0086 946  ILE A CD1 
1817 N N   . MET A 252 ? 0.3002 0.2751 0.2860 0.0324  -0.0213 -0.0143 947  MET A N   
1818 C CA  . MET A 252 ? 0.3161 0.3041 0.3068 0.0298  -0.0257 -0.0165 947  MET A CA  
1819 C C   . MET A 252 ? 0.3005 0.3021 0.3035 0.0332  -0.0297 -0.0176 947  MET A C   
1820 O O   . MET A 252 ? 0.2779 0.2920 0.2912 0.0313  -0.0288 -0.0208 947  MET A O   
1821 C CB  . MET A 252 ? 0.3177 0.3013 0.2957 0.0272  -0.0303 -0.0147 947  MET A CB  
1822 C CG  . MET A 252 ? 0.4082 0.3830 0.3761 0.0235  -0.0262 -0.0154 947  MET A CG  
1823 S SD  . MET A 252 ? 0.4593 0.4236 0.4077 0.0218  -0.0316 -0.0137 947  MET A SD  
1824 C CE  . MET A 252 ? 0.4405 0.3892 0.3769 0.0257  -0.0253 -0.0102 947  MET A CE  
1825 N N   . VAL A 253 ? 0.2927 0.2922 0.2944 0.0391  -0.0337 -0.0147 948  VAL A N   
1826 C CA  . VAL A 253 ? 0.2796 0.2934 0.2933 0.0445  -0.0378 -0.0153 948  VAL A CA  
1827 C C   . VAL A 253 ? 0.2728 0.2904 0.2976 0.0469  -0.0323 -0.0192 948  VAL A C   
1828 O O   . VAL A 253 ? 0.2762 0.3101 0.3128 0.0480  -0.0328 -0.0219 948  VAL A O   
1829 C CB  . VAL A 253 ? 0.3060 0.3137 0.3139 0.0523  -0.0429 -0.0106 948  VAL A CB  
1830 C CG1 . VAL A 253 ? 0.3683 0.3908 0.3896 0.0604  -0.0465 -0.0109 948  VAL A CG1 
1831 C CG2 . VAL A 253 ? 0.3222 0.3296 0.3189 0.0489  -0.0497 -0.0077 948  VAL A CG2 
1832 N N   . LYS A 254 ? 0.2873 0.2899 0.3076 0.0470  -0.0267 -0.0197 949  LYS A N   
1833 C CA  . LYS A 254 ? 0.2819 0.2852 0.3101 0.0486  -0.0219 -0.0242 949  LYS A CA  
1834 C C   . LYS A 254 ? 0.2608 0.2766 0.2950 0.0424  -0.0195 -0.0284 949  LYS A C   
1835 O O   . LYS A 254 ? 0.2537 0.2781 0.2960 0.0440  -0.0174 -0.0325 949  LYS A O   
1836 C CB  . LYS A 254 ? 0.3082 0.2927 0.3298 0.0476  -0.0168 -0.0240 949  LYS A CB  
1837 C CG  . LYS A 254 ? 0.4278 0.3970 0.4432 0.0547  -0.0179 -0.0201 949  LYS A CG  
1838 C CD  . LYS A 254 ? 0.5046 0.4539 0.5126 0.0515  -0.0123 -0.0193 949  LYS A CD  
1839 C CE  . LYS A 254 ? 0.6826 0.6137 0.6815 0.0583  -0.0133 -0.0140 949  LYS A CE  
1840 N NZ  . LYS A 254 ? 0.7815 0.6937 0.7695 0.0527  -0.0082 -0.0106 949  LYS A NZ  
1841 N N   . CYS A 255 ? 0.2648 0.2802 0.2934 0.0361  -0.0196 -0.0272 950  CYS A N   
1842 C CA  . CYS A 255 ? 0.2695 0.2955 0.3020 0.0310  -0.0181 -0.0300 950  CYS A CA  
1843 C C   . CYS A 255 ? 0.2228 0.2657 0.2631 0.0306  -0.0209 -0.0307 950  CYS A C   
1844 O O   . CYS A 255 ? 0.2411 0.2930 0.2852 0.0272  -0.0187 -0.0331 950  CYS A O   
1845 C CB  . CYS A 255 ? 0.2193 0.2395 0.2431 0.0259  -0.0177 -0.0281 950  CYS A CB  
1846 S SG  . CYS A 255 ? 0.2895 0.2968 0.3079 0.0249  -0.0126 -0.0279 950  CYS A SG  
1847 N N   . TRP A 256 ? 0.2152 0.2634 0.2577 0.0336  -0.0258 -0.0284 951  TRP A N   
1848 C CA  . TRP A 256 ? 0.2441 0.3112 0.2955 0.0321  -0.0287 -0.0286 951  TRP A CA  
1849 C C   . TRP A 256 ? 0.2282 0.3075 0.2914 0.0402  -0.0288 -0.0300 951  TRP A C   
1850 O O   . TRP A 256 ? 0.2540 0.3513 0.3266 0.0409  -0.0323 -0.0293 951  TRP A O   
1851 C CB  . TRP A 256 ? 0.2871 0.3554 0.3334 0.0281  -0.0353 -0.0254 951  TRP A CB  
1852 C CG  . TRP A 256 ? 0.2581 0.3121 0.2909 0.0215  -0.0349 -0.0244 951  TRP A CG  
1853 C CD1 . TRP A 256 ? 0.2375 0.2864 0.2664 0.0168  -0.0304 -0.0258 951  TRP A CD1 
1854 C CD2 . TRP A 256 ? 0.2438 0.2864 0.2643 0.0202  -0.0391 -0.0218 951  TRP A CD2 
1855 N NE1 . TRP A 256 ? 0.2688 0.3037 0.2844 0.0133  -0.0311 -0.0243 951  TRP A NE1 
1856 C CE2 . TRP A 256 ? 0.2729 0.3033 0.2825 0.0150  -0.0361 -0.0222 951  TRP A CE2 
1857 C CE3 . TRP A 256 ? 0.2809 0.3222 0.2972 0.0237  -0.0453 -0.0191 951  TRP A CE3 
1858 C CZ2 . TRP A 256 ? 0.3155 0.3319 0.3100 0.0130  -0.0383 -0.0206 951  TRP A CZ2 
1859 C CZ3 . TRP A 256 ? 0.3222 0.3495 0.3224 0.0208  -0.0480 -0.0174 951  TRP A CZ3 
1860 C CH2 . TRP A 256 ? 0.3244 0.3392 0.3139 0.0155  -0.0440 -0.0185 951  TRP A CH2 
1861 N N   . MET A 257 ? 0.2381 0.3083 0.3014 0.0465  -0.0249 -0.0322 952  MET A N   
1862 C CA  . MET A 257 ? 0.2819 0.3611 0.3550 0.0557  -0.0238 -0.0344 952  MET A CA  
1863 C C   . MET A 257 ? 0.2723 0.3701 0.3548 0.0534  -0.0199 -0.0382 952  MET A C   
1864 O O   . MET A 257 ? 0.2728 0.3691 0.3515 0.0464  -0.0165 -0.0402 952  MET A O   
1865 C CB  . MET A 257 ? 0.2706 0.3306 0.3384 0.0616  -0.0201 -0.0364 952  MET A CB  
1866 C CG  . MET A 257 ? 0.3852 0.4274 0.4436 0.0643  -0.0234 -0.0316 952  MET A CG  
1867 S SD  . MET A 257 ? 0.4996 0.5195 0.5529 0.0726  -0.0196 -0.0330 952  MET A SD  
1868 C CE  . MET A 257 ? 0.4123 0.4172 0.4581 0.0627  -0.0140 -0.0362 952  MET A CE  
1869 N N   . ILE A 258 ? 0.2702 0.3865 0.3648 0.0598  -0.0204 -0.0388 953  ILE A N   
1870 C CA  . ILE A 258 ? 0.2668 0.4025 0.3705 0.0579  -0.0156 -0.0422 953  ILE A CA  
1871 C C   . ILE A 258 ? 0.2899 0.4157 0.3888 0.0602  -0.0087 -0.0478 953  ILE A C   
1872 O O   . ILE A 258 ? 0.2751 0.4071 0.3727 0.0541  -0.0046 -0.0502 953  ILE A O   
1873 C CB  . ILE A 258 ? 0.2787 0.4391 0.3983 0.0655  -0.0169 -0.0418 953  ILE A CB  
1874 C CG1 . ILE A 258 ? 0.3126 0.4857 0.4370 0.0605  -0.0248 -0.0368 953  ILE A CG1 
1875 C CG2 . ILE A 258 ? 0.2712 0.4519 0.3999 0.0643  -0.0099 -0.0456 953  ILE A CG2 
1876 C CD1 . ILE A 258 ? 0.3376 0.5125 0.4572 0.0454  -0.0258 -0.0352 953  ILE A CD1 
1877 N N   . ASP A 259 ? 0.2943 0.4029 0.3887 0.0682  -0.0078 -0.0498 954  ASP A N   
1878 C CA  . ASP A 259 ? 0.3371 0.4335 0.4253 0.0694  -0.0021 -0.0560 954  ASP A CA  
1879 C C   . ASP A 259 ? 0.3150 0.3975 0.3927 0.0595  -0.0022 -0.0559 954  ASP A C   
1880 O O   . ASP A 259 ? 0.3021 0.3667 0.3730 0.0585  -0.0041 -0.0540 954  ASP A O   
1881 C CB  . ASP A 259 ? 0.3716 0.4517 0.4576 0.0806  -0.0011 -0.0583 954  ASP A CB  
1882 C CG  . ASP A 259 ? 0.4411 0.5049 0.5187 0.0802  0.0041  -0.0655 954  ASP A CG  
1883 O OD1 . ASP A 259 ? 0.5379 0.5831 0.6110 0.0874  0.0051  -0.0676 954  ASP A OD1 
1884 O OD2 . ASP A 259 ? 0.3860 0.4541 0.4604 0.0728  0.0068  -0.0692 954  ASP A OD2 
1885 N N   . ALA A 260 ? 0.2662 0.3578 0.3426 0.0525  0.0002  -0.0576 955  ALA A N   
1886 C CA  . ALA A 260 ? 0.2809 0.3634 0.3488 0.0441  -0.0003 -0.0571 955  ALA A CA  
1887 C C   . ALA A 260 ? 0.2686 0.3332 0.3300 0.0446  0.0010  -0.0610 955  ALA A C   
1888 O O   . ALA A 260 ? 0.2762 0.3305 0.3328 0.0398  -0.0007 -0.0589 955  ALA A O   
1889 C CB  . ALA A 260 ? 0.2637 0.3584 0.3301 0.0386  0.0024  -0.0584 955  ALA A CB  
1890 N N   . ASP A 261 ? 0.3111 0.3722 0.3726 0.0503  0.0043  -0.0670 956  ASP A N   
1891 C CA  . ASP A 261 ? 0.3517 0.3948 0.4065 0.0493  0.0055  -0.0717 956  ASP A CA  
1892 C C   . ASP A 261 ? 0.3608 0.3860 0.4136 0.0508  0.0036  -0.0682 956  ASP A C   
1893 O O   . ASP A 261 ? 0.4032 0.4138 0.4506 0.0462  0.0040  -0.0700 956  ASP A O   
1894 C CB  . ASP A 261 ? 0.3459 0.3862 0.3991 0.0554  0.0096  -0.0797 956  ASP A CB  
1895 C CG  . ASP A 261 ? 0.4161 0.4693 0.4668 0.0522  0.0123  -0.0845 956  ASP A CG  
1896 O OD1 . ASP A 261 ? 0.3806 0.4382 0.4279 0.0441  0.0106  -0.0831 956  ASP A OD1 
1897 O OD2 . ASP A 261 ? 0.3926 0.4508 0.4436 0.0586  0.0163  -0.0896 956  ASP A OD2 
1898 N N   . SER A 262 ? 0.3335 0.3608 0.3901 0.0568  0.0013  -0.0630 957  SER A N   
1899 C CA  . SER A 262 ? 0.3377 0.3485 0.3906 0.0592  -0.0009 -0.0581 957  SER A CA  
1900 C C   . SER A 262 ? 0.3385 0.3477 0.3881 0.0522  -0.0036 -0.0520 957  SER A C   
1901 O O   . SER A 262 ? 0.3622 0.3560 0.4063 0.0523  -0.0043 -0.0482 957  SER A O   
1902 C CB  . SER A 262 ? 0.3848 0.3998 0.4426 0.0700  -0.0030 -0.0549 957  SER A CB  
1903 O OG  . SER A 262 ? 0.5040 0.5105 0.5616 0.0790  0.0001  -0.0598 957  SER A OG  
1904 N N   . ARG A 263 ? 0.2866 0.3102 0.3384 0.0464  -0.0047 -0.0509 958  ARG A N   
1905 C CA  . ARG A 263 ? 0.2586 0.2793 0.3058 0.0403  -0.0065 -0.0461 958  ARG A CA  
1906 C C   . ARG A 263 ? 0.2545 0.2632 0.2972 0.0352  -0.0039 -0.0475 958  ARG A C   
1907 O O   . ARG A 263 ? 0.2992 0.3062 0.3428 0.0336  -0.0015 -0.0530 958  ARG A O   
1908 C CB  . ARG A 263 ? 0.2399 0.2754 0.2888 0.0355  -0.0075 -0.0453 958  ARG A CB  
1909 C CG  . ARG A 263 ? 0.2395 0.2891 0.2941 0.0383  -0.0099 -0.0437 958  ARG A CG  
1910 C CD  . ARG A 263 ? 0.2059 0.2680 0.2612 0.0324  -0.0100 -0.0431 958  ARG A CD  
1911 N NE  . ARG A 263 ? 0.2105 0.2889 0.2737 0.0341  -0.0109 -0.0429 958  ARG A NE  
1912 C CZ  . ARG A 263 ? 0.2274 0.3193 0.2936 0.0303  -0.0090 -0.0438 958  ARG A CZ  
1913 N NH1 . ARG A 263 ? 0.2229 0.3314 0.2982 0.0320  -0.0090 -0.0437 958  ARG A NH1 
1914 N NH2 . ARG A 263 ? 0.2138 0.3039 0.2741 0.0251  -0.0067 -0.0446 958  ARG A NH2 
1915 N N   . PRO A 264 ? 0.2745 0.2761 0.3124 0.0320  -0.0043 -0.0429 959  PRO A N   
1916 C CA  . PRO A 264 ? 0.2737 0.2682 0.3096 0.0262  -0.0014 -0.0438 959  PRO A CA  
1917 C C   . PRO A 264 ? 0.2812 0.2881 0.3208 0.0217  -0.0009 -0.0476 959  PRO A C   
1918 O O   . PRO A 264 ? 0.2758 0.2941 0.3165 0.0224  -0.0026 -0.0474 959  PRO A O   
1919 C CB  . PRO A 264 ? 0.3330 0.3229 0.3634 0.0247  -0.0015 -0.0378 959  PRO A CB  
1920 C CG  . PRO A 264 ? 0.3298 0.3185 0.3572 0.0301  -0.0051 -0.0339 959  PRO A CG  
1921 C CD  . PRO A 264 ? 0.2964 0.2980 0.3304 0.0331  -0.0073 -0.0370 959  PRO A CD  
1922 N N   . LYS A 265 ? 0.2830 0.2873 0.3238 0.0169  0.0011  -0.0507 960  LYS A N   
1923 C CA  . LYS A 265 ? 0.2987 0.3154 0.3423 0.0128  0.0008  -0.0534 960  LYS A CA  
1924 C C   . LYS A 265 ? 0.2642 0.2832 0.3076 0.0104  0.0016  -0.0488 960  LYS A C   
1925 O O   . LYS A 265 ? 0.2658 0.2754 0.3072 0.0095  0.0037  -0.0454 960  LYS A O   
1926 C CB  . LYS A 265 ? 0.2850 0.3002 0.3310 0.0082  0.0017  -0.0597 960  LYS A CB  
1927 C CG  . LYS A 265 ? 0.3598 0.3680 0.4040 0.0113  0.0020  -0.0651 960  LYS A CG  
1928 C CD  . LYS A 265 ? 0.4152 0.4354 0.4593 0.0156  0.0007  -0.0667 960  LYS A CD  
1929 C CE  . LYS A 265 ? 0.5719 0.5858 0.6147 0.0211  0.0021  -0.0712 960  LYS A CE  
1930 N NZ  . LYS A 265 ? 0.6922 0.7146 0.7334 0.0208  0.0024  -0.0779 960  LYS A NZ  
1931 N N   . PHE A 266 ? 0.2478 0.2787 0.2925 0.0098  0.0004  -0.0486 961  PHE A N   
1932 C CA  . PHE A 266 ? 0.2355 0.2692 0.2802 0.0091  0.0018  -0.0447 961  PHE A CA  
1933 C C   . PHE A 266 ? 0.2618 0.2944 0.3113 0.0043  0.0049  -0.0453 961  PHE A C   
1934 O O   . PHE A 266 ? 0.2474 0.2763 0.2953 0.0043  0.0079  -0.0412 961  PHE A O   
1935 C CB  . PHE A 266 ? 0.2479 0.2933 0.2927 0.0106  0.0000  -0.0442 961  PHE A CB  
1936 C CG  . PHE A 266 ? 0.2441 0.2878 0.2824 0.0140  -0.0019 -0.0415 961  PHE A CG  
1937 C CD1 . PHE A 266 ? 0.2525 0.2879 0.2848 0.0159  -0.0013 -0.0372 961  PHE A CD1 
1938 C CD2 . PHE A 266 ? 0.2331 0.2834 0.2705 0.0143  -0.0039 -0.0435 961  PHE A CD2 
1939 C CE1 . PHE A 266 ? 0.2949 0.3284 0.3215 0.0170  -0.0033 -0.0352 961  PHE A CE1 
1940 C CE2 . PHE A 266 ? 0.2654 0.3143 0.2973 0.0157  -0.0050 -0.0407 961  PHE A CE2 
1941 C CZ  . PHE A 266 ? 0.1936 0.2342 0.2207 0.0165  -0.0050 -0.0368 961  PHE A CZ  
1942 N N   . ARG A 267 ? 0.2780 0.3131 0.3325 -0.0005 0.0046  -0.0506 962  ARG A N   
1943 C CA  . ARG A 267 ? 0.3107 0.3443 0.3704 -0.0072 0.0077  -0.0514 962  ARG A CA  
1944 C C   . ARG A 267 ? 0.3054 0.3214 0.3599 -0.0076 0.0115  -0.0476 962  ARG A C   
1945 O O   . ARG A 267 ? 0.3240 0.3394 0.3804 -0.0114 0.0157  -0.0445 962  ARG A O   
1946 C CB  . ARG A 267 ? 0.3242 0.3607 0.3883 -0.0135 0.0060  -0.0587 962  ARG A CB  
1947 C CG  . ARG A 267 ? 0.4813 0.5100 0.5401 -0.0108 0.0037  -0.0634 962  ARG A CG  
1948 C CD  . ARG A 267 ? 0.6305 0.6411 0.6865 -0.0146 0.0058  -0.0669 962  ARG A CD  
1949 N NE  . ARG A 267 ? 0.6497 0.6558 0.7019 -0.0134 0.0039  -0.0741 962  ARG A NE  
1950 C CZ  . ARG A 267 ? 0.6764 0.6945 0.7278 -0.0104 0.0009  -0.0776 962  ARG A CZ  
1951 N NH1 . ARG A 267 ? 0.7358 0.7479 0.7824 -0.0091 0.0004  -0.0845 962  ARG A NH1 
1952 N NH2 . ARG A 267 ? 0.5538 0.5883 0.6076 -0.0083 -0.0012 -0.0742 962  ARG A NH2 
1953 N N   . GLU A 268 ? 0.3109 0.3140 0.3588 -0.0033 0.0103  -0.0473 963  GLU A N   
1954 C CA  . GLU A 268 ? 0.3261 0.3112 0.3672 -0.0021 0.0128  -0.0431 963  GLU A CA  
1955 C C   . GLU A 268 ? 0.2987 0.2834 0.3342 0.0016  0.0139  -0.0366 963  GLU A C   
1956 O O   . GLU A 268 ? 0.3153 0.2895 0.3455 0.0003  0.0176  -0.0321 963  GLU A O   
1957 C CB  . GLU A 268 ? 0.3552 0.3294 0.3918 0.0034  0.0105  -0.0446 963  GLU A CB  
1958 C CG  . GLU A 268 ? 0.3915 0.3611 0.4304 0.0004  0.0103  -0.0518 963  GLU A CG  
1959 C CD  . GLU A 268 ? 0.4884 0.4514 0.5242 0.0080  0.0083  -0.0542 963  GLU A CD  
1960 O OE1 . GLU A 268 ? 0.5370 0.4884 0.5711 0.0072  0.0093  -0.0592 963  GLU A OE1 
1961 O OE2 . GLU A 268 ? 0.4164 0.3858 0.4516 0.0147  0.0059  -0.0513 963  GLU A OE2 
1962 N N   . LEU A 269 ? 0.2687 0.2637 0.3040 0.0058  0.0108  -0.0362 964  LEU A N   
1963 C CA  . LEU A 269 ? 0.2694 0.2626 0.2976 0.0092  0.0113  -0.0311 964  LEU A CA  
1964 C C   . LEU A 269 ? 0.2964 0.2945 0.3262 0.0065  0.0162  -0.0291 964  LEU A C   
1965 O O   . LEU A 269 ? 0.3296 0.3204 0.3515 0.0079  0.0191  -0.0247 964  LEU A O   
1966 C CB  . LEU A 269 ? 0.2662 0.2671 0.2929 0.0131  0.0071  -0.0315 964  LEU A CB  
1967 C CG  . LEU A 269 ? 0.2717 0.2701 0.2971 0.0162  0.0029  -0.0324 964  LEU A CG  
1968 C CD1 . LEU A 269 ? 0.2840 0.2927 0.3107 0.0174  -0.0002 -0.0338 964  LEU A CD1 
1969 C CD2 . LEU A 269 ? 0.3431 0.3304 0.3600 0.0192  0.0016  -0.0281 964  LEU A CD2 
1970 N N   . ILE A 270 ? 0.2750 0.2867 0.3149 0.0030  0.0171  -0.0322 965  ILE A N   
1971 C CA  . ILE A 270 ? 0.2743 0.2948 0.3192 0.0007  0.0221  -0.0306 965  ILE A CA  
1972 C C   . ILE A 270 ? 0.3212 0.3311 0.3641 -0.0046 0.0277  -0.0280 965  ILE A C   
1973 O O   . ILE A 270 ? 0.3131 0.3201 0.3510 -0.0036 0.0327  -0.0237 965  ILE A O   
1974 C CB  . ILE A 270 ? 0.2688 0.3083 0.3267 -0.0027 0.0209  -0.0347 965  ILE A CB  
1975 C CG1 . ILE A 270 ? 0.2544 0.3035 0.3120 0.0033  0.0162  -0.0357 965  ILE A CG1 
1976 C CG2 . ILE A 270 ? 0.2796 0.3308 0.3456 -0.0057 0.0266  -0.0328 965  ILE A CG2 
1977 C CD1 . ILE A 270 ? 0.2940 0.3594 0.3616 0.0006  0.0125  -0.0403 965  ILE A CD1 
1978 N N   . ILE A 271 ? 0.3100 0.3126 0.3554 -0.0100 0.0271  -0.0306 966  ILE A N   
1979 C CA  . ILE A 271 ? 0.3264 0.3149 0.3683 -0.0158 0.0324  -0.0278 966  ILE A CA  
1980 C C   . ILE A 271 ? 0.3446 0.3156 0.3716 -0.0109 0.0342  -0.0216 966  ILE A C   
1981 O O   . ILE A 271 ? 0.3709 0.3371 0.3931 -0.0134 0.0405  -0.0169 966  ILE A O   
1982 C CB  . ILE A 271 ? 0.3385 0.3173 0.3827 -0.0215 0.0307  -0.0324 966  ILE A CB  
1983 C CG1 . ILE A 271 ? 0.3457 0.3421 0.4037 -0.0287 0.0295  -0.0386 966  ILE A CG1 
1984 C CG2 . ILE A 271 ? 0.4108 0.3685 0.4475 -0.0268 0.0361  -0.0284 966  ILE A CG2 
1985 C CD1 . ILE A 271 ? 0.4400 0.4281 0.4986 -0.0327 0.0260  -0.0454 966  ILE A CD1 
1986 N N   . GLU A 272 ? 0.3292 0.2923 0.3487 -0.0040 0.0286  -0.0213 967  GLU A N   
1987 C CA  . GLU A 272 ? 0.3572 0.3046 0.3622 0.0008  0.0286  -0.0156 967  GLU A CA  
1988 C C   . GLU A 272 ? 0.3471 0.2981 0.3448 0.0036  0.0312  -0.0120 967  GLU A C   
1989 O O   . GLU A 272 ? 0.3702 0.3103 0.3570 0.0032  0.0358  -0.0068 967  GLU A O   
1990 C CB  . GLU A 272 ? 0.3832 0.3254 0.3842 0.0076  0.0214  -0.0164 967  GLU A CB  
1991 C CG  . GLU A 272 ? 0.5448 0.4726 0.5309 0.0127  0.0199  -0.0103 967  GLU A CG  
1992 C CD  . GLU A 272 ? 0.6928 0.6114 0.6762 0.0183  0.0145  -0.0100 967  GLU A CD  
1993 O OE1 . GLU A 272 ? 0.6990 0.6270 0.6908 0.0209  0.0101  -0.0146 967  GLU A OE1 
1994 O OE2 . GLU A 272 ? 0.7717 0.6739 0.7439 0.0209  0.0149  -0.0047 967  GLU A OE2 
1995 N N   . PHE A 273 ? 0.3162 0.2805 0.3179 0.0066  0.0286  -0.0145 968  PHE A N   
1996 C CA  . PHE A 273 ? 0.2939 0.2591 0.2872 0.0099  0.0315  -0.0119 968  PHE A CA  
1997 C C   . PHE A 273 ? 0.3305 0.3021 0.3276 0.0063  0.0405  -0.0102 968  PHE A C   
1998 O O   . PHE A 273 ? 0.3242 0.2903 0.3103 0.0085  0.0453  -0.0067 968  PHE A O   
1999 C CB  . PHE A 273 ? 0.3138 0.2879 0.3082 0.0144  0.0268  -0.0147 968  PHE A CB  
2000 C CG  . PHE A 273 ? 0.3309 0.2973 0.3162 0.0179  0.0198  -0.0144 968  PHE A CG  
2001 C CD1 . PHE A 273 ? 0.3702 0.3249 0.3396 0.0206  0.0193  -0.0112 968  PHE A CD1 
2002 C CD2 . PHE A 273 ? 0.3264 0.2986 0.3189 0.0182  0.0139  -0.0175 968  PHE A CD2 
2003 C CE1 . PHE A 273 ? 0.3690 0.3194 0.3315 0.0228  0.0119  -0.0112 968  PHE A CE1 
2004 C CE2 . PHE A 273 ? 0.3331 0.3017 0.3195 0.0207  0.0076  -0.0172 968  PHE A CE2 
2005 C CZ  . PHE A 273 ? 0.3701 0.3285 0.3423 0.0226  0.0062  -0.0141 968  PHE A CZ  
2006 N N   . SER A 274 ? 0.3265 0.3108 0.3391 0.0007  0.0427  -0.0130 969  SER A N   
2007 C CA  . SER A 274 ? 0.3165 0.3105 0.3363 -0.0042 0.0514  -0.0114 969  SER A CA  
2008 C C   . SER A 274 ? 0.3654 0.3436 0.3752 -0.0088 0.0578  -0.0063 969  SER A C   
2009 O O   . SER A 274 ? 0.3957 0.3757 0.4015 -0.0093 0.0659  -0.0027 969  SER A O   
2010 C CB  . SER A 274 ? 0.3617 0.3734 0.4006 -0.0109 0.0509  -0.0158 969  SER A CB  
2011 O OG  . SER A 274 ? 0.3632 0.3914 0.4103 -0.0059 0.0463  -0.0194 969  SER A OG  
2012 N N   . LYS A 275 ? 0.3729 0.3349 0.3778 -0.0115 0.0545  -0.0057 970  LYS A N   
2013 C CA  . LYS A 275 ? 0.3751 0.3171 0.3669 -0.0146 0.0595  0.0003  970  LYS A CA  
2014 C C   . LYS A 275 ? 0.3853 0.3169 0.3580 -0.0073 0.0603  0.0052  970  LYS A C   
2015 O O   . LYS A 275 ? 0.4203 0.3451 0.3830 -0.0094 0.0683  0.0104  970  LYS A O   
2016 C CB  . LYS A 275 ? 0.3941 0.3189 0.3825 -0.0155 0.0543  -0.0002 970  LYS A CB  
2017 C CG  . LYS A 275 ? 0.5423 0.4429 0.5150 -0.0175 0.0586  0.0068  970  LYS A CG  
2018 C CD  . LYS A 275 ? 0.6499 0.5320 0.6178 -0.0150 0.0525  0.0064  970  LYS A CD  
2019 C CE  . LYS A 275 ? 0.7250 0.6059 0.6861 -0.0035 0.0433  0.0061  970  LYS A CE  
2020 N NZ  . LYS A 275 ? 0.7594 0.6258 0.7183 0.0006  0.0378  0.0054  970  LYS A NZ  
2021 N N   . MET A 276 ? 0.3986 0.3288 0.3653 0.0005  0.0522  0.0034  971  MET A N   
2022 C CA  . MET A 276 ? 0.4005 0.3208 0.3481 0.0067  0.0514  0.0070  971  MET A CA  
2023 C C   . MET A 276 ? 0.4283 0.3574 0.3731 0.0081  0.0589  0.0072  971  MET A C   
2024 O O   . MET A 276 ? 0.4574 0.3761 0.3850 0.0099  0.0637  0.0114  971  MET A O   
2025 C CB  . MET A 276 ? 0.4380 0.3573 0.3820 0.0129  0.0408  0.0044  971  MET A CB  
2026 C CG  . MET A 276 ? 0.4373 0.3464 0.3804 0.0140  0.0341  0.0054  971  MET A CG  
2027 S SD  . MET A 276 ? 0.4632 0.3760 0.4042 0.0204  0.0226  0.0026  971  MET A SD  
2028 C CE  . MET A 276 ? 0.4764 0.3785 0.4169 0.0234  0.0166  0.0048  971  MET A CE  
2029 N N   . ALA A 277 ? 0.3991 0.3469 0.3598 0.0079  0.0602  0.0028  972  ALA A N   
2030 C CA  . ALA A 277 ? 0.4205 0.3785 0.3808 0.0111  0.0674  0.0026  972  ALA A CA  
2031 C C   . ALA A 277 ? 0.4637 0.4239 0.4237 0.0064  0.0795  0.0067  972  ALA A C   
2032 O O   . ALA A 277 ? 0.4616 0.4260 0.4156 0.0103  0.0870  0.0077  972  ALA A O   
2033 C CB  . ALA A 277 ? 0.4131 0.3912 0.3913 0.0131  0.0651  -0.0024 972  ALA A CB  
2034 N N   . ARG A 278 ? 0.4560 0.4125 0.4215 -0.0022 0.0820  0.0092  973  ARG A N   
2035 C CA  . ARG A 278 ? 0.4906 0.4473 0.4550 -0.0088 0.0940  0.0140  973  ARG A CA  
2036 C C   . ARG A 278 ? 0.5165 0.4505 0.4548 -0.0071 0.0981  0.0205  973  ARG A C   
2037 O O   . ARG A 278 ? 0.5394 0.4732 0.4727 -0.0111 0.1094  0.0251  973  ARG A O   
2038 C CB  . ARG A 278 ? 0.4869 0.4470 0.4670 -0.0203 0.0953  0.0138  973  ARG A CB  
2039 C CG  . ARG A 278 ? 0.5185 0.5057 0.5244 -0.0235 0.0941  0.0079  973  ARG A CG  
2040 C CD  . ARG A 278 ? 0.6516 0.6434 0.6723 -0.0368 0.0968  0.0072  973  ARG A CD  
2041 N NE  . ARG A 278 ? 0.7081 0.6829 0.7262 -0.0395 0.0883  0.0051  973  ARG A NE  
2042 C CZ  . ARG A 278 ? 0.7449 0.7280 0.7744 -0.0385 0.0793  -0.0014 973  ARG A CZ  
2043 N NH1 . ARG A 278 ? 0.7585 0.7662 0.8025 -0.0352 0.0768  -0.0058 973  ARG A NH1 
2044 N NH2 . ARG A 278 ? 0.7802 0.7464 0.8057 -0.0402 0.0731  -0.0032 973  ARG A NH2 
2045 N N   . ASP A 279 ? 0.4902 0.4068 0.4120 -0.0011 0.0889  0.0211  974  ASP A N   
2046 C CA  . ASP A 279 ? 0.5062 0.4015 0.4009 0.0019  0.0904  0.0272  974  ASP A CA  
2047 C C   . ASP A 279 ? 0.5028 0.3914 0.3845 0.0107  0.0796  0.0245  974  ASP A C   
2048 O O   . ASP A 279 ? 0.5102 0.3849 0.3816 0.0129  0.0708  0.0265  974  ASP A O   
2049 C CB  . ASP A 279 ? 0.5321 0.4088 0.4200 -0.0035 0.0901  0.0331  974  ASP A CB  
2050 C CG  . ASP A 279 ? 0.6126 0.4676 0.4716 -0.0012 0.0935  0.0409  974  ASP A CG  
2051 O OD1 . ASP A 279 ? 0.6080 0.4631 0.4520 0.0035  0.0973  0.0414  974  ASP A OD1 
2052 O OD2 . ASP A 279 ? 0.6680 0.5045 0.5179 -0.0036 0.0922  0.0465  974  ASP A OD2 
2053 N N   . PRO A 280 ? 0.4982 0.3971 0.3806 0.0158  0.0801  0.0199  975  PRO A N   
2054 C CA  . PRO A 280 ? 0.4686 0.3637 0.3438 0.0218  0.0691  0.0159  975  PRO A CA  
2055 C C   . PRO A 280 ? 0.4775 0.3535 0.3265 0.0252  0.0635  0.0190  975  PRO A C   
2056 O O   . PRO A 280 ? 0.4750 0.3475 0.3218 0.0274  0.0520  0.0171  975  PRO A O   
2057 C CB  . PRO A 280 ? 0.4658 0.3720 0.3441 0.0262  0.0735  0.0112  975  PRO A CB  
2058 C CG  . PRO A 280 ? 0.5200 0.4323 0.3990 0.0247  0.0875  0.0140  975  PRO A CG  
2059 C CD  . PRO A 280 ? 0.4782 0.3927 0.3689 0.0164  0.0909  0.0181  975  PRO A CD  
2060 N N   . GLN A 281 ? 0.5062 0.3711 0.3354 0.0255  0.0715  0.0238  976  GLN A N   
2061 C CA  . GLN A 281 ? 0.5455 0.3921 0.3469 0.0289  0.0659  0.0269  976  GLN A CA  
2062 C C   . GLN A 281 ? 0.5698 0.4054 0.3671 0.0281  0.0579  0.0323  976  GLN A C   
2063 O O   . GLN A 281 ? 0.5866 0.4100 0.3639 0.0317  0.0498  0.0347  976  GLN A O   
2064 C CB  . GLN A 281 ? 0.5597 0.3975 0.3387 0.0300  0.0775  0.0304  976  GLN A CB  
2065 C CG  . GLN A 281 ? 0.5875 0.4360 0.3702 0.0329  0.0861  0.0249  976  GLN A CG  
2066 C CD  . GLN A 281 ? 0.8064 0.6444 0.5625 0.0360  0.0963  0.0270  976  GLN A CD  
2067 O OE1 . GLN A 281 ? 0.8790 0.7250 0.6394 0.0349  0.1106  0.0288  976  GLN A OE1 
2068 N NE2 . GLN A 281 ? 0.8180 0.6393 0.5466 0.0396  0.0892  0.0265  976  GLN A NE2 
2069 N N   . ARG A 282 ? 0.5293 0.3688 0.3449 0.0237  0.0597  0.0341  977  ARG A N   
2070 C CA  . ARG A 282 ? 0.5388 0.3680 0.3537 0.0245  0.0516  0.0381  977  ARG A CA  
2071 C C   . ARG A 282 ? 0.5066 0.3436 0.3318 0.0284  0.0380  0.0330  977  ARG A C   
2072 O O   . ARG A 282 ? 0.5355 0.3647 0.3538 0.0324  0.0287  0.0359  977  ARG A O   
2073 C CB  . ARG A 282 ? 0.5478 0.3761 0.3778 0.0182  0.0584  0.0406  977  ARG A CB  
2074 C CG  . ARG A 282 ? 0.5896 0.4074 0.4222 0.0200  0.0503  0.0432  977  ARG A CG  
2075 C CD  . ARG A 282 ? 0.5962 0.4067 0.4375 0.0128  0.0583  0.0462  977  ARG A CD  
2076 N NE  . ARG A 282 ? 0.6776 0.4786 0.5237 0.0157  0.0505  0.0468  977  ARG A NE  
2077 C CZ  . ARG A 282 ? 0.6772 0.4680 0.5302 0.0103  0.0548  0.0482  977  ARG A CZ  
2078 N NH1 . ARG A 282 ? 0.6966 0.4776 0.5522 0.0150  0.0475  0.0481  977  ARG A NH1 
2079 N NH2 . ARG A 282 ? 0.6189 0.4098 0.4765 0.0000  0.0664  0.0494  977  ARG A NH2 
2080 N N   . TYR A 283 ? 0.4821 0.3353 0.3238 0.0276  0.0369  0.0258  978  TYR A N   
2081 C CA  . TYR A 283 ? 0.4674 0.3306 0.3235 0.0293  0.0264  0.0210  978  TYR A CA  
2082 C C   . TYR A 283 ? 0.4369 0.3035 0.2853 0.0320  0.0187  0.0169  978  TYR A C   
2083 O O   . TYR A 283 ? 0.4394 0.3109 0.2930 0.0337  0.0083  0.0149  978  TYR A O   
2084 C CB  . TYR A 283 ? 0.4294 0.3072 0.3105 0.0255  0.0300  0.0164  978  TYR A CB  
2085 C CG  . TYR A 283 ? 0.4349 0.3075 0.3235 0.0218  0.0350  0.0196  978  TYR A CG  
2086 C CD1 . TYR A 283 ? 0.4124 0.2866 0.3052 0.0161  0.0463  0.0210  978  TYR A CD1 
2087 C CD2 . TYR A 283 ? 0.4843 0.3496 0.3751 0.0239  0.0286  0.0213  978  TYR A CD2 
2088 C CE1 . TYR A 283 ? 0.4396 0.3068 0.3379 0.0108  0.0509  0.0239  978  TYR A CE1 
2089 C CE2 . TYR A 283 ? 0.5012 0.3573 0.3962 0.0202  0.0334  0.0240  978  TYR A CE2 
2090 C CZ  . TYR A 283 ? 0.5396 0.3959 0.4379 0.0128  0.0444  0.0252  978  TYR A CZ  
2091 O OH  . TYR A 283 ? 0.5555 0.4011 0.4572 0.0073  0.0492  0.0276  978  TYR A OH  
2092 N N   . LEU A 284 ? 0.4455 0.3091 0.2810 0.0323  0.0241  0.0155  979  LEU A N   
2093 C CA  . LEU A 284 ? 0.4542 0.3159 0.2773 0.0340  0.0174  0.0115  979  LEU A CA  
2094 C C   . LEU A 284 ? 0.5019 0.3485 0.2967 0.0359  0.0203  0.0143  979  LEU A C   
2095 O O   . LEU A 284 ? 0.5087 0.3509 0.2967 0.0358  0.0319  0.0166  979  LEU A O   
2096 C CB  . LEU A 284 ? 0.4501 0.3209 0.2835 0.0334  0.0207  0.0054  979  LEU A CB  
2097 C CG  . LEU A 284 ? 0.4114 0.2975 0.2708 0.0316  0.0183  0.0022  979  LEU A CG  
2098 C CD1 . LEU A 284 ? 0.4391 0.3319 0.3050 0.0323  0.0227  -0.0025 979  LEU A CD1 
2099 C CD2 . LEU A 284 ? 0.4297 0.3198 0.2946 0.0310  0.0062  0.0009  979  LEU A CD2 
2100 N N   . VAL A 285 ? 0.4967 0.3367 0.2753 0.0371  0.0098  0.0137  980  VAL A N   
2101 C CA  . VAL A 285 ? 0.5063 0.3307 0.2541 0.0389  0.0102  0.0160  980  VAL A CA  
2102 C C   . VAL A 285 ? 0.5391 0.3595 0.2741 0.0385  0.0079  0.0088  980  VAL A C   
2103 O O   . VAL A 285 ? 0.5710 0.3933 0.3046 0.0367  -0.0040 0.0051  980  VAL A O   
2104 C CB  . VAL A 285 ? 0.5392 0.3581 0.2758 0.0408  -0.0011 0.0211  980  VAL A CB  
2105 C CG1 . VAL A 285 ? 0.6095 0.4121 0.3117 0.0427  -0.0020 0.0235  980  VAL A CG1 
2106 C CG2 . VAL A 285 ? 0.6008 0.4200 0.3492 0.0419  0.0019  0.0281  980  VAL A CG2 
2107 N N   . ILE A 286 ? 0.5440 0.3595 0.2709 0.0400  0.0198  0.0067  981  ILE A N   
2108 C CA  . ILE A 286 ? 0.5818 0.3905 0.2962 0.0407  0.0200  -0.0006 981  ILE A CA  
2109 C C   . ILE A 286 ? 0.6644 0.4563 0.3466 0.0436  0.0268  -0.0003 981  ILE A C   
2110 O O   . ILE A 286 ? 0.6499 0.4409 0.3291 0.0461  0.0400  0.0034  981  ILE A O   
2111 C CB  . ILE A 286 ? 0.5901 0.4085 0.3245 0.0418  0.0281  -0.0046 981  ILE A CB  
2112 C CG1 . ILE A 286 ? 0.5864 0.4203 0.3493 0.0387  0.0206  -0.0054 981  ILE A CG1 
2113 C CG2 . ILE A 286 ? 0.6495 0.4566 0.3679 0.0440  0.0294  -0.0116 981  ILE A CG2 
2114 C CD1 . ILE A 286 ? 0.5163 0.3624 0.3012 0.0401  0.0284  -0.0075 981  ILE A CD1 
2115 N N   . GLN A 287 ? 0.7024 0.4815 0.3606 0.0427  0.0179  -0.0044 982  GLN A N   
2116 C CA  . GLN A 287 ? 0.7658 0.5267 0.3894 0.0455  0.0230  -0.0058 982  GLN A CA  
2117 C C   . GLN A 287 ? 0.7379 0.4957 0.3594 0.0503  0.0390  -0.0095 982  GLN A C   
2118 O O   . GLN A 287 ? 0.7719 0.5314 0.4034 0.0510  0.0394  -0.0156 982  GLN A O   
2119 C CB  . GLN A 287 ? 0.8214 0.5701 0.4227 0.0423  0.0095  -0.0122 982  GLN A CB  
2120 C CG  . GLN A 287 ? 0.9186 0.6752 0.5262 0.0377  -0.0078 -0.0097 982  GLN A CG  
2121 C CD  . GLN A 287 ? 1.0552 0.8022 0.6421 0.0329  -0.0215 -0.0165 982  GLN A CD  
2122 O OE1 . GLN A 287 ? 1.0887 0.8456 0.6912 0.0274  -0.0332 -0.0194 982  GLN A OE1 
2123 N NE2 . GLN A 287 ? 1.1184 0.8463 0.6697 0.0343  -0.0199 -0.0193 982  GLN A NE2 
2124 N N   . GLY A 288 ? 1.3145 0.6135 0.5013 0.1949  0.0136  -0.1764 983  GLY A N   
2125 C CA  . GLY A 288 ? 1.2733 0.5926 0.4559 0.2055  0.0634  -0.1509 983  GLY A CA  
2126 C C   . GLY A 288 ? 1.1461 0.5641 0.4557 0.1404  0.0963  -0.1262 983  GLY A C   
2127 O O   . GLY A 288 ? 1.1007 0.5601 0.4507 0.1365  0.1121  -0.1168 983  GLY A O   
2128 N N   . ASP A 289 ? 1.0722 0.5157 0.4333 0.0946  0.1013  -0.1167 984  ASP A N   
2129 C CA  . ASP A 289 ? 1.0025 0.5144 0.4668 0.0354  0.1149  -0.0984 984  ASP A CA  
2130 C C   . ASP A 289 ? 1.0311 0.5804 0.5368 0.0308  0.1643  -0.0565 984  ASP A C   
2131 O O   . ASP A 289 ? 0.9767 0.5853 0.5613 0.0029  0.1616  -0.0527 984  ASP A O   
2132 C CB  . ASP A 289 ? 0.9767 0.4693 0.4447 0.0045  0.1138  -0.0900 984  ASP A CB  
2133 C CG  . ASP A 289 ? 0.9178 0.4490 0.4620 -0.0467 0.0959  -0.0912 984  ASP A CG  
2134 O OD1 . ASP A 289 ? 0.8124 0.3948 0.4200 -0.0650 0.0950  -0.0884 984  ASP A OD1 
2135 O OD2 . ASP A 289 ? 0.8809 0.3791 0.4065 -0.0616 0.0816  -0.0952 984  ASP A OD2 
2136 N N   . GLU A 290 ? 1.1391 0.6526 0.5928 0.0647  0.2125  -0.0206 985  GLU A N   
2137 C CA  . GLU A 290 ? 1.1797 0.7315 0.6883 0.0672  0.2743  0.0384  985  GLU A CA  
2138 C C   . GLU A 290 ? 1.1615 0.7556 0.6930 0.0908  0.2890  0.0428  985  GLU A C   
2139 O O   . GLU A 290 ? 1.1182 0.7825 0.7588 0.0618  0.3158  0.0825  985  GLU A O   
2140 C CB  . GLU A 290 ? 1.2945 0.7844 0.7159 0.1232  0.3324  0.0784  985  GLU A CB  
2141 C CG  . GLU A 290 ? 1.3684 0.8930 0.8873 0.0947  0.3907  0.1536  985  GLU A CG  
2142 C CD  . GLU A 290 ? 1.3934 0.8897 0.9327 0.0453  0.3657  0.1536  985  GLU A CD  
2143 O OE1 . GLU A 290 ? 1.3684 0.8605 0.9111 0.0047  0.3006  0.1023  985  GLU A OE1 
2144 O OE2 . GLU A 290 ? 1.4583 0.9310 1.0068 0.0521  0.4153  0.2096  985  GLU A OE2 
2145 N N   . ARG A 291 ? 1.2126 0.7580 0.6443 0.1435  0.2640  0.0027  986  ARG A N   
2146 C CA  . ARG A 291 ? 1.2635 0.8152 0.6704 0.1892  0.2849  0.0097  986  ARG A CA  
2147 C C   . ARG A 291 ? 1.1950 0.7909 0.6604 0.1577  0.2326  -0.0303 986  ARG A C   
2148 O O   . ARG A 291 ? 1.2327 0.7933 0.6328 0.2036  0.2170  -0.0517 986  ARG A O   
2149 C CB  . ARG A 291 ? 1.4245 0.8631 0.6547 0.2833  0.2886  -0.0046 986  ARG A CB  
2150 C CG  . ARG A 291 ? 1.5778 0.9625 0.7267 0.3383  0.3609  0.0471  986  ARG A CG  
2151 C CD  . ARG A 291 ? 1.7738 1.0158 0.7176 0.4304  0.3361  0.0137  986  ARG A CD  
2152 N NE  . ARG A 291 ? 1.8345 1.0352 0.7530 0.4038  0.2663  -0.0342 986  ARG A NE  
2153 C CZ  . ARG A 291 ? 1.9419 1.0226 0.7091 0.4650  0.2108  -0.0771 986  ARG A CZ  
2154 N NH1 . ARG A 291 ? 2.1592 1.1278 0.7601 0.5622  0.2102  -0.0846 986  ARG A NH1 
2155 N NH2 . ARG A 291 ? 1.9074 0.9715 0.6845 0.4341  0.1508  -0.1122 986  ARG A NH2 
2156 N N   . MET A 292 ? 1.0882 0.7488 0.6656 0.0857  0.2055  -0.0386 987  MET A N   
2157 C CA  . MET A 292 ? 1.0364 0.7320 0.6643 0.0589  0.1595  -0.0739 987  MET A CA  
2158 C C   . MET A 292 ? 0.9850 0.7580 0.7102 0.0314  0.1792  -0.0495 987  MET A C   
2159 O O   . MET A 292 ? 0.9722 0.7903 0.7738 0.0014  0.2084  -0.0084 987  MET A O   
2160 C CB  . MET A 292 ? 0.9705 0.6667 0.6293 0.0166  0.1127  -0.1041 987  MET A CB  
2161 C CG  . MET A 292 ? 1.0099 0.6395 0.5929 0.0474  0.0752  -0.1362 987  MET A CG  
2162 S SD  . MET A 292 ? 0.9520 0.5883 0.5776 0.0091  0.0409  -0.1532 987  MET A SD  
2163 C CE  . MET A 292 ? 0.9919 0.5584 0.5501 0.0532  -0.0078 -0.1828 987  MET A CE  
2164 N N   . HIS A 293 ? 0.9602 0.7446 0.6889 0.0409  0.1564  -0.0735 988  HIS A N   
2165 C CA  . HIS A 293 ? 0.9210 0.7730 0.7299 0.0242  0.1718  -0.0541 988  HIS A CA  
2166 C C   . HIS A 293 ? 0.8445 0.7117 0.6824 0.0042  0.1271  -0.0909 988  HIS A C   
2167 O O   . HIS A 293 ? 0.8725 0.6955 0.6564 0.0315  0.0974  -0.1221 988  HIS A O   
2168 C CB  . HIS A 293 ? 1.0057 0.8540 0.7742 0.0836  0.2224  -0.0219 988  HIS A CB  
2169 C CG  . HIS A 293 ? 1.1617 0.9211 0.7954 0.1502  0.2057  -0.0534 988  HIS A CG  
2170 N ND1 . HIS A 293 ? 1.2872 0.9611 0.8052 0.1983  0.2095  -0.0585 988  HIS A ND1 
2171 C CD2 . HIS A 293 ? 1.2136 0.9418 0.8022 0.1793  0.1759  -0.0827 988  HIS A CD2 
2172 C CE1 . HIS A 293 ? 1.4031 0.9901 0.8060 0.2555  0.1750  -0.0922 988  HIS A CE1 
2173 N NE2 . HIS A 293 ? 1.3455 0.9634 0.7923 0.2430  0.1533  -0.1068 988  HIS A NE2 
2174 N N   . LEU A 294 ? 0.7529 0.6736 0.6754 -0.0411 0.1180  -0.0846 989  LEU A N   
2175 C CA  . LEU A 294 ? 0.6797 0.6148 0.6296 -0.0552 0.0868  -0.1106 989  LEU A CA  
2176 C C   . LEU A 294 ? 0.6589 0.6394 0.6487 -0.0478 0.1012  -0.0965 989  LEU A C   
2177 O O   . LEU A 294 ? 0.6560 0.6806 0.6987 -0.0559 0.1272  -0.0610 989  LEU A O   
2178 C CB  . LEU A 294 ? 0.6324 0.5716 0.6164 -0.0955 0.0633  -0.1183 989  LEU A CB  
2179 C CG  . LEU A 294 ? 0.5895 0.4848 0.5351 -0.0971 0.0492  -0.1327 989  LEU A CG  
2180 C CD1 . LEU A 294 ? 0.6648 0.5497 0.6208 -0.1263 0.0373  -0.1291 989  LEU A CD1 
2181 C CD2 . LEU A 294 ? 0.5609 0.4373 0.4980 -0.0798 0.0269  -0.1560 989  LEU A CD2 
2182 N N   . PRO A 295 ? 0.6390 0.6098 0.6148 -0.0323 0.0827  -0.1197 990  PRO A N   
2183 C CA  . PRO A 295 ? 0.6305 0.6363 0.6312 -0.0184 0.0955  -0.1094 990  PRO A CA  
2184 C C   . PRO A 295 ? 0.5805 0.6460 0.6651 -0.0551 0.0950  -0.0910 990  PRO A C   
2185 O O   . PRO A 295 ? 0.5203 0.5806 0.6239 -0.0871 0.0685  -0.1038 990  PRO A O   
2186 C CB  . PRO A 295 ? 0.6214 0.5941 0.5999 -0.0086 0.0623  -0.1417 990  PRO A CB  
2187 C CG  . PRO A 295 ? 0.6667 0.5801 0.5978 0.0008  0.0365  -0.1625 990  PRO A CG  
2188 C CD  . PRO A 295 ? 0.6417 0.5666 0.5881 -0.0260 0.0466  -0.1519 990  PRO A CD  
2189 N N   . SER A 296 ? 0.5689 0.6828 0.6979 -0.0431 0.1224  -0.0582 991  SER A N   
2190 C CA  . SER A 296 ? 0.5310 0.7004 0.7490 -0.0726 0.1104  -0.0393 991  SER A CA  
2191 C C   . SER A 296 ? 0.4892 0.6594 0.6984 -0.0653 0.0910  -0.0637 991  SER A C   
2192 O O   . SER A 296 ? 0.4747 0.6067 0.6218 -0.0399 0.0897  -0.0893 991  SER A O   
2193 C CB  . SER A 296 ? 0.5615 0.7923 0.8533 -0.0585 0.1508  0.0153  991  SER A CB  
2194 O OG  . SER A 296 ? 0.6406 0.8703 0.8841 -0.0017 0.1893  0.0228  991  SER A OG  
2195 N N   . PRO A 297 ? 0.4644 0.6694 0.7358 -0.0871 0.0691  -0.0552 992  PRO A N   
2196 C CA  . PRO A 297 ? 0.4650 0.6694 0.7228 -0.0730 0.0580  -0.0735 992  PRO A CA  
2197 C C   . PRO A 297 ? 0.4948 0.7051 0.7220 -0.0280 0.0892  -0.0701 992  PRO A C   
2198 O O   . PRO A 297 ? 0.4960 0.6676 0.6723 -0.0121 0.0795  -0.0973 992  PRO A O   
2199 C CB  . PRO A 297 ? 0.4588 0.7040 0.7934 -0.0943 0.0316  -0.0548 992  PRO A CB  
2200 C CG  . PRO A 297 ? 0.4916 0.7211 0.8527 -0.1310 0.0035  -0.0473 992  PRO A CG  
2201 C CD  . PRO A 297 ? 0.4947 0.7167 0.8351 -0.1265 0.0379  -0.0373 992  PRO A CD  
2202 N N   . THR A 298 ? 0.5357 0.7850 0.7907 -0.0030 0.1272  -0.0327 993  THR A N   
2203 C CA  . THR A 298 ? 0.5866 0.8261 0.7896 0.0545  0.1604  -0.0256 993  THR A CA  
2204 C C   . THR A 298 ? 0.6336 0.7846 0.7170 0.0884  0.1569  -0.0581 993  THR A C   
2205 O O   . THR A 298 ? 0.6818 0.7879 0.6975 0.1279  0.1528  -0.0751 993  THR A O   
2206 C CB  . THR A 298 ? 0.6441 0.9457 0.9040 0.0875  0.2160  0.0352  993  THR A CB  
2207 O OG1 . THR A 298 ? 0.6969 0.9946 0.9600 0.0858  0.2423  0.0603  993  THR A OG1 
2208 C CG2 . THR A 298 ? 0.5914 0.9822 0.9906 0.0562  0.2056  0.0700  993  THR A CG2 
2209 N N   . ASP A 299 ? 0.6086 0.7265 0.6656 0.0737  0.1499  -0.0672 994  ASP A N   
2210 C CA  . ASP A 299 ? 0.6790 0.7073 0.6303 0.1046  0.1331  -0.0973 994  ASP A CA  
2211 C C   . ASP A 299 ? 0.6303 0.6186 0.5811 0.0706  0.0802  -0.1375 994  ASP A C   
2212 O O   . ASP A 299 ? 0.6673 0.5806 0.5526 0.0922  0.0490  -0.1633 994  ASP A O   
2213 C CB  . ASP A 299 ? 0.7233 0.7304 0.6365 0.1210  0.1589  -0.0797 994  ASP A CB  
2214 C CG  . ASP A 299 ? 0.8372 0.8398 0.7003 0.1884  0.2178  -0.0395 994  ASP A CG  
2215 O OD1 . ASP A 299 ? 0.9095 0.8991 0.7324 0.2348  0.2312  -0.0355 994  ASP A OD1 
2216 O OD2 . ASP A 299 ? 0.9013 0.9085 0.7604 0.2010  0.2560  -0.0074 994  ASP A OD2 
2217 N N   . SER A 300 ? 0.5473 0.5791 0.5717 0.0230  0.0685  -0.1383 995  SER A N   
2218 C CA  . SER A 300 ? 0.5013 0.5063 0.5403 -0.0033 0.0353  -0.1608 995  SER A CA  
2219 C C   . SER A 300 ? 0.5255 0.5036 0.5646 0.0070  0.0130  -0.1756 995  SER A C   
2220 O O   . SER A 300 ? 0.4948 0.5022 0.5586 0.0055  0.0210  -0.1697 995  SER A O   
2221 C CB  . SER A 300 ? 0.4720 0.5131 0.5619 -0.0409 0.0365  -0.1524 995  SER A CB  
2222 O OG  . SER A 300 ? 0.4478 0.4652 0.5506 -0.0538 0.0199  -0.1629 995  SER A OG  
2223 N N   . ASN A 301 ? 0.5562 0.4739 0.5730 0.0167  -0.0212 -0.1932 996  ASN A N   
2224 C CA  . ASN A 301 ? 0.5712 0.4565 0.6110 0.0175  -0.0519 -0.2024 996  ASN A CA  
2225 C C   . ASN A 301 ? 0.4977 0.4253 0.6124 -0.0117 -0.0382 -0.1881 996  ASN A C   
2226 O O   . ASN A 301 ? 0.4401 0.3686 0.5700 -0.0070 -0.0373 -0.1852 996  ASN A O   
2227 C CB  . ASN A 301 ? 0.6456 0.4641 0.6885 0.0180  -0.1044 -0.2168 996  ASN A CB  
2228 C CG  . ASN A 301 ? 0.7974 0.5355 0.7349 0.0618  -0.1334 -0.2370 996  ASN A CG  
2229 O OD1 . ASN A 301 ? 0.9455 0.6674 0.8047 0.1011  -0.1124 -0.2382 996  ASN A OD1 
2230 N ND2 . ASN A 301 ? 0.8714 0.5506 0.8007 0.0627  -0.1830 -0.2506 996  ASN A ND2 
2231 N N   . PHE A 302 ? 0.4516 0.4020 0.5983 -0.0338 -0.0258 -0.1780 997  PHE A N   
2232 C CA  . PHE A 302 ? 0.4193 0.3900 0.6104 -0.0465 -0.0068 -0.1605 997  PHE A CA  
2233 C C   . PHE A 302 ? 0.4129 0.4110 0.5815 -0.0425 0.0137  -0.1571 997  PHE A C   
2234 O O   . PHE A 302 ? 0.4231 0.4187 0.6048 -0.0353 0.0217  -0.1490 997  PHE A O   
2235 C CB  . PHE A 302 ? 0.4300 0.4037 0.6328 -0.0583 0.0033  -0.1507 997  PHE A CB  
2236 C CG  . PHE A 302 ? 0.3780 0.3517 0.6167 -0.0549 0.0271  -0.1256 997  PHE A CG  
2237 C CD1 . PHE A 302 ? 0.3738 0.3463 0.5694 -0.0453 0.0500  -0.1193 997  PHE A CD1 
2238 C CD2 . PHE A 302 ? 0.4310 0.3990 0.7465 -0.0553 0.0257  -0.1031 997  PHE A CD2 
2239 C CE1 . PHE A 302 ? 0.3547 0.3089 0.5547 -0.0253 0.0803  -0.0923 997  PHE A CE1 
2240 C CE2 . PHE A 302 ? 0.4277 0.3973 0.7785 -0.0407 0.0637  -0.0669 997  PHE A CE2 
2241 C CZ  . PHE A 302 ? 0.3844 0.3414 0.6630 -0.0203 0.0957  -0.0621 997  PHE A CZ  
2242 N N   . TYR A 303 ? 0.3873 0.4091 0.5300 -0.0465 0.0189  -0.1595 998  TYR A N   
2243 C CA  . TYR A 303 ? 0.3758 0.4250 0.5153 -0.0454 0.0236  -0.1544 998  TYR A CA  
2244 C C   . TYR A 303 ? 0.4102 0.4667 0.5507 -0.0257 0.0247  -0.1562 998  TYR A C   
2245 O O   . TYR A 303 ? 0.4179 0.4767 0.5595 -0.0196 0.0252  -0.1530 998  TYR A O   
2246 C CB  . TYR A 303 ? 0.3706 0.4513 0.5154 -0.0555 0.0247  -0.1470 998  TYR A CB  
2247 C CG  . TYR A 303 ? 0.3575 0.4693 0.5267 -0.0614 0.0150  -0.1363 998  TYR A CG  
2248 C CD1 . TYR A 303 ? 0.3474 0.4447 0.5156 -0.0803 -0.0075 -0.1339 998  TYR A CD1 
2249 C CD2 . TYR A 303 ? 0.3729 0.5200 0.5643 -0.0450 0.0207  -0.1280 998  TYR A CD2 
2250 C CE1 . TYR A 303 ? 0.4338 0.5476 0.6305 -0.0871 -0.0349 -0.1254 998  TYR A CE1 
2251 C CE2 . TYR A 303 ? 0.3895 0.5686 0.6205 -0.0513 0.0030  -0.1153 998  TYR A CE2 
2252 C CZ  . TYR A 303 ? 0.4262 0.5874 0.6641 -0.0746 -0.0302 -0.1147 998  TYR A CZ  
2253 O OH  . TYR A 303 ? 0.4657 0.6478 0.7493 -0.0823 -0.0656 -0.1032 998  TYR A OH  
2254 N N   . ARG A 304 ? 0.3805 0.4282 0.5046 -0.0089 0.0235  -0.1620 999  ARG A N   
2255 C CA  . ARG A 304 ? 0.4614 0.4995 0.5687 0.0173  0.0226  -0.1653 999  ARG A CA  
2256 C C   . ARG A 304 ? 0.4734 0.4771 0.5963 0.0155  0.0106  -0.1690 999  ARG A C   
2257 O O   . ARG A 304 ? 0.4777 0.4846 0.5982 0.0285  0.0149  -0.1664 999  ARG A O   
2258 C CB  . ARG A 304 ? 0.5209 0.5220 0.5767 0.0470  0.0175  -0.1736 999  ARG A CB  
2259 C CG  . ARG A 304 ? 0.6572 0.6909 0.6935 0.0668  0.0457  -0.1575 999  ARG A CG  
2260 C CD  . ARG A 304 ? 0.8371 0.8030 0.7924 0.1043  0.0389  -0.1681 999  ARG A CD  
2261 N NE  . ARG A 304 ? 0.9757 0.9597 0.8940 0.1460  0.0804  -0.1433 999  ARG A NE  
2262 C CZ  . ARG A 304 ? 1.0744 1.0361 0.9324 0.2027  0.1006  -0.1342 999  ARG A CZ  
2263 N NH1 . ARG A 304 ? 1.1279 1.1123 0.9624 0.2470  0.1520  -0.0989 999  ARG A NH1 
2264 N NH2 . ARG A 304 ? 1.1295 1.0431 0.9510 0.2200  0.0741  -0.1545 999  ARG A NH2 
2265 N N   . ALA A 305 ? 0.4793 0.4525 0.6284 0.0008  -0.0029 -0.1692 1000 ALA A N   
2266 C CA  . ALA A 305 ? 0.5254 0.4714 0.7195 -0.0032 -0.0096 -0.1587 1000 ALA A CA  
2267 C C   . ALA A 305 ? 0.5373 0.5026 0.7390 -0.0003 0.0201  -0.1417 1000 ALA A C   
2268 O O   . ALA A 305 ? 0.5697 0.5185 0.7840 0.0104  0.0252  -0.1322 1000 ALA A O   
2269 C CB  . ALA A 305 ? 0.4741 0.4013 0.7232 -0.0208 -0.0250 -0.1497 1000 ALA A CB  
2270 N N   . LEU A 306 ? 0.5071 0.4937 0.6891 -0.0052 0.0351  -0.1386 1001 LEU A N   
2271 C CA  . LEU A 306 ? 0.5491 0.5308 0.7043 0.0083  0.0526  -0.1282 1001 LEU A CA  
2272 C C   . LEU A 306 ? 0.5952 0.5947 0.7218 0.0206  0.0436  -0.1382 1001 LEU A C   
2273 O O   . LEU A 306 ? 0.6379 0.6204 0.7514 0.0398  0.0515  -0.1320 1001 LEU A O   
2274 C CB  . LEU A 306 ? 0.5333 0.5071 0.6591 0.0046  0.0575  -0.1250 1001 LEU A CB  
2275 C CG  . LEU A 306 ? 0.5039 0.4490 0.6416 0.0140  0.0842  -0.1009 1001 LEU A CG  
2276 C CD1 . LEU A 306 ? 0.5557 0.5135 0.7664 -0.0043 0.0804  -0.0937 1001 LEU A CD1 
2277 C CD2 . LEU A 306 ? 0.5199 0.4378 0.5966 0.0216  0.0862  -0.1013 1001 LEU A CD2 
2278 N N   . MET A 307 ? 0.5926 0.6288 0.7187 0.0124  0.0304  -0.1476 1002 MET A N   
2279 C CA  . MET A 307 ? 0.6218 0.6885 0.7446 0.0223  0.0205  -0.1475 1002 MET A CA  
2280 C C   . MET A 307 ? 0.6421 0.7265 0.7687 0.0431  0.0255  -0.1482 1002 MET A C   
2281 O O   . MET A 307 ? 0.6739 0.7717 0.7979 0.0591  0.0209  -0.1450 1002 MET A O   
2282 C CB  . MET A 307 ? 0.5940 0.6983 0.7402 0.0038  0.0056  -0.1431 1002 MET A CB  
2283 C CG  . MET A 307 ? 0.5970 0.6676 0.7203 -0.0109 -0.0098 -0.1451 1002 MET A CG  
2284 S SD  . MET A 307 ? 0.6959 0.6970 0.7501 0.0162  -0.0159 -0.1476 1002 MET A SD  
2285 C CE  . MET A 307 ? 0.7618 0.7150 0.7715 0.0066  -0.0511 -0.1521 1002 MET A CE  
2286 N N   . ASP A 308 ? 0.6781 0.7516 0.7991 0.0489  0.0305  -0.1532 1003 ASP A N   
2287 C CA  . ASP A 308 ? 0.7409 0.8090 0.8389 0.0799  0.0343  -0.1551 1003 ASP A CA  
2288 C C   . ASP A 308 ? 0.7869 0.7964 0.8679 0.0890  0.0251  -0.1629 1003 ASP A C   
2289 O O   . ASP A 308 ? 0.8012 0.8069 0.8779 0.1013  0.0287  -0.1592 1003 ASP A O   
2290 C CB  . ASP A 308 ? 0.7846 0.8469 0.8564 0.0963  0.0402  -0.1562 1003 ASP A CB  
2291 C CG  . ASP A 308 ? 0.7886 0.9133 0.8936 0.0890  0.0577  -0.1369 1003 ASP A CG  
2292 O OD1 . ASP A 308 ? 0.8084 0.9725 0.9614 0.0613  0.0511  -0.1283 1003 ASP A OD1 
2293 O OD2 . ASP A 308 ? 0.8693 0.9937 0.9479 0.1152  0.0761  -0.1277 1003 ASP A OD2 
2294 N N   . VAL A 315 ? 0.7190 0.6410 0.9948 0.1515  -0.0704 -0.1047 1010 VAL A N   
2295 C CA  . VAL A 315 ? 0.6996 0.7046 0.9981 0.2153  -0.0296 -0.1287 1010 VAL A CA  
2296 C C   . VAL A 315 ? 0.5851 0.7162 0.8491 0.1793  0.0008  -0.0849 1010 VAL A C   
2297 O O   . VAL A 315 ? 0.5810 0.7924 0.8322 0.1985  0.0570  -0.1075 1010 VAL A O   
2298 C CB  . VAL A 315 ? 0.7499 0.7450 1.1929 0.2807  -0.0495 -0.1039 1010 VAL A CB  
2299 C CG1 . VAL A 315 ? 0.8410 0.9292 1.3598 0.3623  0.0162  -0.1785 1010 VAL A CG1 
2300 C CG2 . VAL A 315 ? 0.8258 0.6350 1.3085 0.2928  -0.1004 -0.1056 1010 VAL A CG2 
2301 N N   . VAL A 316 ? 0.5166 0.6550 0.7615 0.1184  -0.0249 -0.0293 1011 VAL A N   
2302 C CA  . VAL A 316 ? 0.4647 0.6841 0.6860 0.0765  -0.0058 -0.0018 1011 VAL A CA  
2303 C C   . VAL A 316 ? 0.4318 0.6131 0.5850 0.0316  -0.0072 -0.0076 1011 VAL A C   
2304 O O   . VAL A 316 ? 0.4356 0.5896 0.5885 -0.0010 -0.0207 -0.0003 1011 VAL A O   
2305 C CB  . VAL A 316 ? 0.4616 0.7491 0.7441 0.0542  -0.0400 0.0492  1011 VAL A CB  
2306 C CG1 . VAL A 316 ? 0.4546 0.7912 0.7016 -0.0108 -0.0308 0.0549  1011 VAL A CG1 
2307 C CG2 . VAL A 316 ? 0.5115 0.8878 0.9334 0.1144  -0.0428 0.0496  1011 VAL A CG2 
2308 N N   . ASP A 317 ? 0.4405 0.6189 0.5437 0.0320  0.0128  -0.0170 1012 ASP A N   
2309 C CA  . ASP A 317 ? 0.4740 0.6141 0.5548 0.0141  0.0020  -0.0244 1012 ASP A CA  
2310 C C   . ASP A 317 ? 0.4431 0.5992 0.5481 -0.0338 0.0128  -0.0228 1012 ASP A C   
2311 O O   . ASP A 317 ? 0.4459 0.6389 0.5530 -0.0649 0.0183  -0.0047 1012 ASP A O   
2312 C CB  . ASP A 317 ? 0.5721 0.6713 0.5785 0.0254  0.0090  -0.0047 1012 ASP A CB  
2313 C CG  . ASP A 317 ? 0.6726 0.7090 0.6867 0.0345  -0.0240 -0.0073 1012 ASP A CG  
2314 O OD1 . ASP A 317 ? 0.7734 0.8129 0.8292 0.0646  -0.0683 -0.0386 1012 ASP A OD1 
2315 O OD2 . ASP A 317 ? 0.7944 0.7780 0.8015 0.0128  -0.0102 0.0167  1012 ASP A OD2 
2316 N N   . ALA A 318 ? 0.4114 0.5563 0.5433 -0.0427 0.0171  -0.0554 1013 ALA A N   
2317 C CA  . ALA A 318 ? 0.4201 0.5752 0.5400 -0.0887 0.0470  -0.0825 1013 ALA A CA  
2318 C C   . ALA A 318 ? 0.4899 0.6100 0.5848 -0.1115 0.0495  -0.0909 1013 ALA A C   
2319 O O   . ALA A 318 ? 0.5291 0.6663 0.5765 -0.1645 0.0526  -0.1079 1013 ALA A O   
2320 C CB  . ALA A 318 ? 0.4244 0.5934 0.6167 -0.0812 0.0781  -0.1389 1013 ALA A CB  
2321 N N   . ASP A 319 ? 0.5321 0.5896 0.6430 -0.0823 0.0397  -0.0748 1014 ASP A N   
2322 C CA  . ASP A 319 ? 0.6226 0.6129 0.7239 -0.1199 0.0453  -0.0693 1014 ASP A CA  
2323 C C   . ASP A 319 ? 0.5970 0.6646 0.6975 -0.1764 0.0448  -0.0398 1014 ASP A C   
2324 O O   . ASP A 319 ? 0.6587 0.7232 0.7680 -0.2406 0.0385  -0.0687 1014 ASP A O   
2325 C CB  . ASP A 319 ? 0.7233 0.6058 0.8103 -0.0851 0.0324  -0.0213 1014 ASP A CB  
2326 C CG  . ASP A 319 ? 0.8137 0.6253 0.9529 -0.0175 0.0037  -0.0512 1014 ASP A CG  
2327 O OD1 . ASP A 319 ? 0.8747 0.6670 0.9920 0.0376  -0.0409 -0.0102 1014 ASP A OD1 
2328 O OD2 . ASP A 319 ? 0.8178 0.6042 1.0262 -0.0159 0.0222  -0.1254 1014 ASP A OD2 
2329 N N   . GLU A 320 ? 0.5407 0.6857 0.6524 -0.1496 0.0469  0.0025  1015 GLU A N   
2330 C CA  . GLU A 320 ? 0.5245 0.7879 0.7036 -0.1792 0.0456  0.0241  1015 GLU A CA  
2331 C C   . GLU A 320 ? 0.5173 0.8502 0.7074 -0.2017 -0.0073 0.0092  1015 GLU A C   
2332 O O   . GLU A 320 ? 0.5194 0.9366 0.7715 -0.2527 -0.0414 0.0085  1015 GLU A O   
2333 C CB  . GLU A 320 ? 0.5089 0.8318 0.7102 -0.1220 0.0733  0.0475  1015 GLU A CB  
2334 C CG  . GLU A 320 ? 0.5582 1.0385 0.8974 -0.1232 0.0793  0.0563  1015 GLU A CG  
2335 C CD  . GLU A 320 ? 0.6845 1.2425 1.1078 -0.1894 0.1358  0.0725  1015 GLU A CD  
2336 O OE1 . GLU A 320 ? 0.8009 1.2555 1.1322 -0.2262 0.1840  0.0959  1015 GLU A OE1 
2337 O OE2 . GLU A 320 ? 0.6698 1.3955 1.2684 -0.2079 0.1276  0.0693  1015 GLU A OE2 
2338 N N   . TYR A 321 ? 0.4982 0.7968 0.6228 -0.1740 -0.0199 0.0036  1016 TYR A N   
2339 C CA  . TYR A 321 ? 0.5728 0.9011 0.6373 -0.2033 -0.0675 0.0129  1016 TYR A CA  
2340 C C   . TYR A 321 ? 0.7059 1.0180 0.6873 -0.2784 -0.0784 -0.0409 1016 TYR A C   
2341 O O   . TYR A 321 ? 0.7910 1.1630 0.7340 -0.3233 -0.1466 -0.0333 1016 TYR A O   
2342 C CB  . TYR A 321 ? 0.5731 0.8478 0.5729 -0.1820 -0.0514 0.0274  1016 TYR A CB  
2343 C CG  . TYR A 321 ? 0.6933 0.9661 0.5685 -0.2280 -0.0883 0.0616  1016 TYR A CG  
2344 C CD1 . TYR A 321 ? 0.8197 1.0613 0.5593 -0.2854 -0.0393 0.0187  1016 TYR A CD1 
2345 C CD2 . TYR A 321 ? 0.7455 1.0444 0.6296 -0.2102 -0.1707 0.1389  1016 TYR A CD2 
2346 C CE1 . TYR A 321 ? 0.9709 1.2003 0.5285 -0.3427 -0.0625 0.0607  1016 TYR A CE1 
2347 C CE2 . TYR A 321 ? 0.9051 1.1751 0.6257 -0.2555 -0.2236 0.1979  1016 TYR A CE2 
2348 C CZ  . TYR A 321 ? 1.0416 1.2732 0.5702 -0.3310 -0.1646 0.1630  1016 TYR A CZ  
2349 O OH  . TYR A 321 ? 1.2663 1.4598 0.5689 -0.3904 -0.2062 0.2310  1016 TYR A OH  
2350 N N   . LEU A 322 ? 0.7555 0.9818 0.7134 -0.2857 -0.0231 -0.1035 1017 LEU A N   
2351 C CA  . LEU A 322 ? 0.9250 1.1021 0.8178 -0.3497 -0.0202 -0.1870 1017 LEU A CA  
2352 C C   . LEU A 322 ? 0.9488 1.0930 0.9395 -0.3858 -0.0328 -0.1965 1017 LEU A C   
2353 O O   . LEU A 322 ? 1.0989 1.2503 1.0749 -0.4646 -0.0745 -0.2454 1017 LEU A O   
2354 C CB  . LEU A 322 ? 0.9952 1.0892 0.8539 -0.3269 0.0538  -0.2664 1017 LEU A CB  
2355 C CG  . LEU A 322 ? 1.0816 1.2119 0.8215 -0.3398 0.0997  -0.2916 1017 LEU A CG  
2356 C CD1 . LEU A 322 ? 0.9905 1.1568 0.8022 -0.2875 0.1248  -0.2275 1017 LEU A CD1 
2357 C CD2 . LEU A 322 ? 1.2371 1.3129 0.9450 -0.3489 0.1810  -0.4240 1017 LEU A CD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   696  ?    ?   ?   A . n 
A 1 2   GLU 2   697  ?    ?   ?   A . n 
A 1 3   ALA 3   698  ?    ?   ?   A . n 
A 1 4   PRO 4   699  ?    ?   ?   A . n 
A 1 5   ASN 5   700  ?    ?   ?   A . n 
A 1 6   GLN 6   701  701  GLN GLN A . n 
A 1 7   ALA 7   702  702  ALA ALA A . n 
A 1 8   LEU 8   703  703  LEU LEU A . n 
A 1 9   LEU 9   704  704  LEU LEU A . n 
A 1 10  ARG 10  705  705  ARG ARG A . n 
A 1 11  ILE 11  706  706  ILE ILE A . n 
A 1 12  LEU 12  707  707  LEU LEU A . n 
A 1 13  LYS 13  708  708  LYS LYS A . n 
A 1 14  GLU 14  709  709  GLU GLU A . n 
A 1 15  THR 15  710  710  THR THR A . n 
A 1 16  GLU 16  711  711  GLU GLU A . n 
A 1 17  PHE 17  712  712  PHE PHE A . n 
A 1 18  LYS 18  713  713  LYS LYS A . n 
A 1 19  LYS 19  714  714  LYS LYS A . n 
A 1 20  ILE 20  715  715  ILE ILE A . n 
A 1 21  LYS 21  716  716  LYS LYS A . n 
A 1 22  VAL 22  717  717  VAL VAL A . n 
A 1 23  LEU 23  718  718  LEU LEU A . n 
A 1 24  GLY 24  719  719  GLY GLY A . n 
A 1 25  SER 25  720  720  SER SER A . n 
A 1 26  GLY 26  721  721  GLY GLY A . n 
A 1 27  ALA 27  722  722  ALA ALA A . n 
A 1 28  PHE 28  723  723  PHE PHE A . n 
A 1 29  GLY 29  724  724  GLY GLY A . n 
A 1 30  THR 30  725  725  THR THR A . n 
A 1 31  VAL 31  726  726  VAL VAL A . n 
A 1 32  TYR 32  727  727  TYR TYR A . n 
A 1 33  LYS 33  728  728  LYS LYS A . n 
A 1 34  GLY 34  729  729  GLY GLY A . n 
A 1 35  LEU 35  730  730  LEU LEU A . n 
A 1 36  TRP 36  731  731  TRP TRP A . n 
A 1 37  ILE 37  732  732  ILE ILE A . n 
A 1 38  PRO 38  733  733  PRO PRO A . n 
A 1 39  GLU 39  734  ?    ?   ?   A . n 
A 1 40  GLY 40  735  ?    ?   ?   A . n 
A 1 41  GLU 41  736  ?    ?   ?   A . n 
A 1 42  LYS 42  737  ?    ?   ?   A . n 
A 1 43  VAL 43  738  738  VAL VAL A . n 
A 1 44  LYS 44  739  739  LYS LYS A . n 
A 1 45  ILE 45  740  740  ILE ILE A . n 
A 1 46  PRO 46  741  741  PRO PRO A . n 
A 1 47  VAL 47  742  742  VAL VAL A . n 
A 1 48  ALA 48  743  743  ALA ALA A . n 
A 1 49  ILE 49  744  744  ILE ILE A . n 
A 1 50  LYS 50  745  745  LYS LYS A . n 
A 1 51  GLU 51  746  746  GLU GLU A . n 
A 1 52  LEU 52  747  747  LEU LEU A . n 
A 1 53  ARG 53  748  ?    ?   ?   A . n 
A 1 54  GLU 54  749  ?    ?   ?   A . n 
A 1 55  ALA 55  750  ?    ?   ?   A . n 
A 1 56  THR 56  751  ?    ?   ?   A . n 
A 1 57  SER 57  752  ?    ?   ?   A . n 
A 1 58  PRO 58  753  ?    ?   ?   A . n 
A 1 59  LYS 59  754  ?    ?   ?   A . n 
A 1 60  ALA 60  755  755  ALA ALA A . n 
A 1 61  ASN 61  756  756  ASN ASN A . n 
A 1 62  LYS 62  757  757  LYS LYS A . n 
A 1 63  GLU 63  758  758  GLU GLU A . n 
A 1 64  ILE 64  759  759  ILE ILE A . n 
A 1 65  LEU 65  760  760  LEU LEU A . n 
A 1 66  ASP 66  761  761  ASP ASP A . n 
A 1 67  GLU 67  762  762  GLU GLU A . n 
A 1 68  ALA 68  763  763  ALA ALA A . n 
A 1 69  TYR 69  764  764  TYR TYR A . n 
A 1 70  VAL 70  765  765  VAL VAL A . n 
A 1 71  MET 71  766  766  MET MET A . n 
A 1 72  ALA 72  767  767  ALA ALA A . n 
A 1 73  SER 73  768  768  SER SER A . n 
A 1 74  VAL 74  769  769  VAL VAL A . n 
A 1 75  ASP 75  770  770  ASP ASP A . n 
A 1 76  ASN 76  771  771  ASN ASN A . n 
A 1 77  PRO 77  772  772  PRO PRO A . n 
A 1 78  HIS 78  773  773  HIS HIS A . n 
A 1 79  VAL 79  774  774  VAL VAL A . n 
A 1 80  CYS 80  775  775  CYS CYS A . n 
A 1 81  ARG 81  776  776  ARG ARG A . n 
A 1 82  LEU 82  777  777  LEU LEU A . n 
A 1 83  LEU 83  778  778  LEU LEU A . n 
A 1 84  GLY 84  779  779  GLY GLY A . n 
A 1 85  ILE 85  780  780  ILE ILE A . n 
A 1 86  CYS 86  781  781  CYS CYS A . n 
A 1 87  LEU 87  782  782  LEU LEU A . n 
A 1 88  THR 88  783  783  THR THR A . n 
A 1 89  SER 89  784  784  SER SER A . n 
A 1 90  THR 90  785  785  THR THR A . n 
A 1 91  VAL 91  786  786  VAL VAL A . n 
A 1 92  GLN 92  787  787  GLN GLN A . n 
A 1 93  LEU 93  788  788  LEU LEU A . n 
A 1 94  ILE 94  789  789  ILE ILE A . n 
A 1 95  THR 95  790  790  THR THR A . n 
A 1 96  GLN 96  791  791  GLN GLN A . n 
A 1 97  LEU 97  792  792  LEU LEU A . n 
A 1 98  MET 98  793  793  MET MET A . n 
A 1 99  PRO 99  794  794  PRO PRO A . n 
A 1 100 PHE 100 795  795  PHE PHE A . n 
A 1 101 GLY 101 796  796  GLY GLY A . n 
A 1 102 CYS 102 797  797  CYS CYS A . n 
A 1 103 LEU 103 798  798  LEU LEU A . n 
A 1 104 LEU 104 799  799  LEU LEU A . n 
A 1 105 ASP 105 800  800  ASP ASP A . n 
A 1 106 TYR 106 801  801  TYR TYR A . n 
A 1 107 VAL 107 802  802  VAL VAL A . n 
A 1 108 ARG 108 803  803  ARG ARG A . n 
A 1 109 GLU 109 804  804  GLU GLU A . n 
A 1 110 HIS 110 805  805  HIS HIS A . n 
A 1 111 LYS 111 806  806  LYS LYS A . n 
A 1 112 ASP 112 807  807  ASP ASP A . n 
A 1 113 ASN 113 808  808  ASN ASN A . n 
A 1 114 ILE 114 809  809  ILE ILE A . n 
A 1 115 GLY 115 810  810  GLY GLY A . n 
A 1 116 SER 116 811  811  SER SER A . n 
A 1 117 GLN 117 812  812  GLN GLN A . n 
A 1 118 TYR 118 813  813  TYR TYR A . n 
A 1 119 LEU 119 814  814  LEU LEU A . n 
A 1 120 LEU 120 815  815  LEU LEU A . n 
A 1 121 ASN 121 816  816  ASN ASN A . n 
A 1 122 TRP 122 817  817  TRP TRP A . n 
A 1 123 CYS 123 818  818  CYS CYS A . n 
A 1 124 VAL 124 819  819  VAL VAL A . n 
A 1 125 GLN 125 820  820  GLN GLN A . n 
A 1 126 ILE 126 821  821  ILE ILE A . n 
A 1 127 ALA 127 822  822  ALA ALA A . n 
A 1 128 LYS 128 823  823  LYS LYS A . n 
A 1 129 GLY 129 824  824  GLY GLY A . n 
A 1 130 MET 130 825  825  MET MET A . n 
A 1 131 ASN 131 826  826  ASN ASN A . n 
A 1 132 TYR 132 827  827  TYR TYR A . n 
A 1 133 LEU 133 828  828  LEU LEU A . n 
A 1 134 GLU 134 829  829  GLU GLU A . n 
A 1 135 ASP 135 830  830  ASP ASP A . n 
A 1 136 ARG 136 831  831  ARG ARG A . n 
A 1 137 ARG 137 832  832  ARG ARG A . n 
A 1 138 LEU 138 833  833  LEU LEU A . n 
A 1 139 VAL 139 834  834  VAL VAL A . n 
A 1 140 HIS 140 835  835  HIS HIS A . n 
A 1 141 ARG 141 836  836  ARG ARG A . n 
A 1 142 ASP 142 837  837  ASP ASP A . n 
A 1 143 LEU 143 838  838  LEU LEU A . n 
A 1 144 ALA 144 839  839  ALA ALA A . n 
A 1 145 ALA 145 840  840  ALA ALA A . n 
A 1 146 ARG 146 841  841  ARG ARG A . n 
A 1 147 ASN 147 842  842  ASN ASN A . n 
A 1 148 VAL 148 843  843  VAL VAL A . n 
A 1 149 LEU 149 844  844  LEU LEU A . n 
A 1 150 VAL 150 845  845  VAL VAL A . n 
A 1 151 LYS 151 846  846  LYS LYS A . n 
A 1 152 THR 152 847  847  THR THR A . n 
A 1 153 PRO 153 848  848  PRO PRO A . n 
A 1 154 GLN 154 849  849  GLN GLN A . n 
A 1 155 HIS 155 850  850  HIS HIS A . n 
A 1 156 VAL 156 851  851  VAL VAL A . n 
A 1 157 LYS 157 852  852  LYS LYS A . n 
A 1 158 ILE 158 853  853  ILE ILE A . n 
A 1 159 THR 159 854  854  THR THR A . n 
A 1 160 ASP 160 855  855  ASP ASP A . n 
A 1 161 PHE 161 856  856  PHE PHE A . n 
A 1 162 GLY 162 857  857  GLY GLY A . n 
A 1 163 LEU 163 858  858  LEU LEU A . n 
A 1 164 ALA 164 859  859  ALA ALA A . n 
A 1 165 LYS 165 860  860  LYS LYS A . n 
A 1 166 LEU 166 861  861  LEU LEU A . n 
A 1 167 LEU 167 862  862  LEU LEU A . n 
A 1 168 GLY 168 863  863  GLY GLY A . n 
A 1 169 ALA 169 864  864  ALA ALA A . n 
A 1 170 GLU 170 865  865  GLU GLU A . n 
A 1 171 GLU 171 866  866  GLU GLU A . n 
A 1 172 LYS 172 867  867  LYS LYS A . n 
A 1 173 GLU 173 868  ?    ?   ?   A . n 
A 1 174 TYR 174 869  ?    ?   ?   A . n 
A 1 175 HIS 175 870  ?    ?   ?   A . n 
A 1 176 ALA 176 871  ?    ?   ?   A . n 
A 1 177 GLU 177 872  ?    ?   ?   A . n 
A 1 178 GLY 178 873  ?    ?   ?   A . n 
A 1 179 GLY 179 874  ?    ?   ?   A . n 
A 1 180 LYS 180 875  875  LYS LYS A . n 
A 1 181 VAL 181 876  876  VAL VAL A . n 
A 1 182 PRO 182 877  877  PRO PRO A . n 
A 1 183 ILE 183 878  878  ILE ILE A . n 
A 1 184 LYS 184 879  879  LYS LYS A . n 
A 1 185 TRP 185 880  880  TRP TRP A . n 
A 1 186 MET 186 881  881  MET MET A . n 
A 1 187 ALA 187 882  882  ALA ALA A . n 
A 1 188 LEU 188 883  883  LEU LEU A . n 
A 1 189 GLU 189 884  884  GLU GLU A . n 
A 1 190 SER 190 885  885  SER SER A . n 
A 1 191 ILE 191 886  886  ILE ILE A . n 
A 1 192 LEU 192 887  887  LEU LEU A . n 
A 1 193 HIS 193 888  888  HIS HIS A . n 
A 1 194 ARG 194 889  889  ARG ARG A . n 
A 1 195 ILE 195 890  890  ILE ILE A . n 
A 1 196 TYR 196 891  891  TYR TYR A . n 
A 1 197 THR 197 892  892  THR THR A . n 
A 1 198 HIS 198 893  893  HIS HIS A . n 
A 1 199 GLN 199 894  894  GLN GLN A . n 
A 1 200 SER 200 895  895  SER SER A . n 
A 1 201 ASP 201 896  896  ASP ASP A . n 
A 1 202 VAL 202 897  897  VAL VAL A . n 
A 1 203 TRP 203 898  898  TRP TRP A . n 
A 1 204 SER 204 899  899  SER SER A . n 
A 1 205 TYR 205 900  900  TYR TYR A . n 
A 1 206 GLY 206 901  901  GLY GLY A . n 
A 1 207 VAL 207 902  902  VAL VAL A . n 
A 1 208 THR 208 903  903  THR THR A . n 
A 1 209 VAL 209 904  904  VAL VAL A . n 
A 1 210 TRP 210 905  905  TRP TRP A . n 
A 1 211 GLU 211 906  906  GLU GLU A . n 
A 1 212 LEU 212 907  907  LEU LEU A . n 
A 1 213 MET 213 908  908  MET MET A . n 
A 1 214 THR 214 909  909  THR THR A . n 
A 1 215 PHE 215 910  910  PHE PHE A . n 
A 1 216 GLY 216 911  911  GLY GLY A . n 
A 1 217 SER 217 912  912  SER SER A . n 
A 1 218 LYS 218 913  913  LYS LYS A . n 
A 1 219 PRO 219 914  914  PRO PRO A . n 
A 1 220 TYR 220 915  915  TYR TYR A . n 
A 1 221 ASP 221 916  916  ASP ASP A . n 
A 1 222 GLY 222 917  917  GLY GLY A . n 
A 1 223 ILE 223 918  918  ILE ILE A . n 
A 1 224 PRO 224 919  919  PRO PRO A . n 
A 1 225 ALA 225 920  920  ALA ALA A . n 
A 1 226 SER 226 921  921  SER SER A . n 
A 1 227 GLU 227 922  922  GLU GLU A . n 
A 1 228 ILE 228 923  923  ILE ILE A . n 
A 1 229 SER 229 924  924  SER SER A . n 
A 1 230 SER 230 925  925  SER SER A . n 
A 1 231 ILE 231 926  926  ILE ILE A . n 
A 1 232 LEU 232 927  927  LEU LEU A . n 
A 1 233 GLU 233 928  928  GLU GLU A . n 
A 1 234 LYS 234 929  929  LYS LYS A . n 
A 1 235 GLY 235 930  930  GLY GLY A . n 
A 1 236 GLU 236 931  931  GLU GLU A . n 
A 1 237 ARG 237 932  932  ARG ARG A . n 
A 1 238 LEU 238 933  933  LEU LEU A . n 
A 1 239 PRO 239 934  934  PRO PRO A . n 
A 1 240 GLN 240 935  935  GLN GLN A . n 
A 1 241 PRO 241 936  936  PRO PRO A . n 
A 1 242 PRO 242 937  937  PRO PRO A . n 
A 1 243 ILE 243 938  938  ILE ILE A . n 
A 1 244 CYS 244 939  939  CYS CYS A . n 
A 1 245 THR 245 940  940  THR THR A . n 
A 1 246 ILE 246 941  941  ILE ILE A . n 
A 1 247 ASP 247 942  942  ASP ASP A . n 
A 1 248 VAL 248 943  943  VAL VAL A . n 
A 1 249 TYR 249 944  944  TYR TYR A . n 
A 1 250 MET 250 945  945  MET MET A . n 
A 1 251 ILE 251 946  946  ILE ILE A . n 
A 1 252 MET 252 947  947  MET MET A . n 
A 1 253 VAL 253 948  948  VAL VAL A . n 
A 1 254 LYS 254 949  949  LYS LYS A . n 
A 1 255 CYS 255 950  950  CYS CYS A . n 
A 1 256 TRP 256 951  951  TRP TRP A . n 
A 1 257 MET 257 952  952  MET MET A . n 
A 1 258 ILE 258 953  953  ILE ILE A . n 
A 1 259 ASP 259 954  954  ASP ASP A . n 
A 1 260 ALA 260 955  955  ALA ALA A . n 
A 1 261 ASP 261 956  956  ASP ASP A . n 
A 1 262 SER 262 957  957  SER SER A . n 
A 1 263 ARG 263 958  958  ARG ARG A . n 
A 1 264 PRO 264 959  959  PRO PRO A . n 
A 1 265 LYS 265 960  960  LYS LYS A . n 
A 1 266 PHE 266 961  961  PHE PHE A . n 
A 1 267 ARG 267 962  962  ARG ARG A . n 
A 1 268 GLU 268 963  963  GLU GLU A . n 
A 1 269 LEU 269 964  964  LEU LEU A . n 
A 1 270 ILE 270 965  965  ILE ILE A . n 
A 1 271 ILE 271 966  966  ILE ILE A . n 
A 1 272 GLU 272 967  967  GLU GLU A . n 
A 1 273 PHE 273 968  968  PHE PHE A . n 
A 1 274 SER 274 969  969  SER SER A . n 
A 1 275 LYS 275 970  970  LYS LYS A . n 
A 1 276 MET 276 971  971  MET MET A . n 
A 1 277 ALA 277 972  972  ALA ALA A . n 
A 1 278 ARG 278 973  973  ARG ARG A . n 
A 1 279 ASP 279 974  974  ASP ASP A . n 
A 1 280 PRO 280 975  975  PRO PRO A . n 
A 1 281 GLN 281 976  976  GLN GLN A . n 
A 1 282 ARG 282 977  977  ARG ARG A . n 
A 1 283 TYR 283 978  978  TYR TYR A . n 
A 1 284 LEU 284 979  979  LEU LEU A . n 
A 1 285 VAL 285 980  980  VAL VAL A . n 
A 1 286 ILE 286 981  981  ILE ILE A . n 
A 1 287 GLN 287 982  982  GLN GLN A . n 
A 1 288 GLY 288 983  983  GLY GLY A . n 
A 1 289 ASP 289 984  984  ASP ASP A . n 
A 1 290 GLU 290 985  985  GLU GLU A . n 
A 1 291 ARG 291 986  986  ARG ARG A . n 
A 1 292 MET 292 987  987  MET MET A . n 
A 1 293 HIS 293 988  988  HIS HIS A . n 
A 1 294 LEU 294 989  989  LEU LEU A . n 
A 1 295 PRO 295 990  990  PRO PRO A . n 
A 1 296 SER 296 991  991  SER SER A . n 
A 1 297 PRO 297 992  992  PRO PRO A . n 
A 1 298 THR 298 993  993  THR THR A . n 
A 1 299 ASP 299 994  994  ASP ASP A . n 
A 1 300 SER 300 995  995  SER SER A . n 
A 1 301 ASN 301 996  996  ASN ASN A . n 
A 1 302 PHE 302 997  997  PHE PHE A . n 
A 1 303 TYR 303 998  998  TYR TYR A . n 
A 1 304 ARG 304 999  999  ARG ARG A . n 
A 1 305 ALA 305 1000 1000 ALA ALA A . n 
A 1 306 LEU 306 1001 1001 LEU LEU A . n 
A 1 307 MET 307 1002 1002 MET MET A . n 
A 1 308 ASP 308 1003 1003 ASP ASP A . n 
A 1 309 GLU 309 1004 ?    ?   ?   A . n 
A 1 310 GLU 310 1005 ?    ?   ?   A . n 
A 1 311 ASP 311 1006 ?    ?   ?   A . n 
A 1 312 MET 312 1007 ?    ?   ?   A . n 
A 1 313 ASP 313 1008 ?    ?   ?   A . n 
A 1 314 ASP 314 1009 ?    ?   ?   A . n 
A 1 315 VAL 315 1010 1010 VAL VAL A . n 
A 1 316 VAL 316 1011 1011 VAL VAL A . n 
A 1 317 ASP 317 1012 1012 ASP ASP A . n 
A 1 318 ALA 318 1013 1013 ALA ALA A . n 
A 1 319 ASP 319 1014 1014 ASP ASP A . n 
A 1 320 GLU 320 1015 1015 GLU GLU A . n 
A 1 321 TYR 321 1016 1016 TYR TYR A . n 
A 1 322 LEU 322 1017 1017 LEU LEU A . n 
A 1 323 ILE 323 1018 ?    ?   ?   A . n 
A 1 324 PRO 324 1019 ?    ?   ?   A . n 
A 1 325 GLN 325 1020 ?    ?   ?   A . n 
A 1 326 GLN 326 1021 ?    ?   ?   A . n 
A 1 327 GLY 327 1022 ?    ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-03-30 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 12.7724 35.7633 5.2480  0.1133 0.0853 0.0324 -0.0188 -0.0325 0.0018  1.3227  2.8811  2.2657  
0.2198  0.6671  0.8984  -0.2017 0.1806  0.0668  -0.3304 0.1481 0.1720  -0.4274 0.1856  0.0536  
'X-RAY DIFFRACTION' 2 ? refined 24.6906 18.4830 18.0931 0.0498 0.0402 0.0311 0.0132  -0.0129 -0.0239 0.9727  1.2554  2.0024  
-0.0545 -0.1333 -0.0317 -0.0160 0.0250  -0.0429 0.1878  0.0117 -0.0364 -0.1533 0.0851  0.0044  
'X-RAY DIFFRACTION' 3 ? refined 9.5266  32.3619 31.0977 0.2981 0.3025 0.3208 -0.0331 0.0616  -0.1365 3.5904  14.7433 5.8061  
-7.1627 2.4755  -5.3241 -0.5846 -0.5077 -0.0773 1.1615  0.8243 0.5252  -0.1778 -0.9251 -0.2397 
'X-RAY DIFFRACTION' 4 ? refined -0.5626 33.7221 11.1088 0.0533 0.2871 0.1625 -0.1035 0.0060  0.0032  29.7079 33.7928 23.8057 
4.7355  2.6590  4.6178  -0.8586 0.9224  -0.2297 -0.5752 0.9822 0.7381  0.5049  -1.3298 -0.1236 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 701  ? ? A 793  ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 A 1023 ? ? A 1023 ? ? ? ? 
'X-RAY DIFFRACTION' 3 2 A 794  ? ? A 982  ? ? ? ? 
'X-RAY DIFFRACTION' 4 3 A 983  ? ? A 1003 ? ? ? ? 
'X-RAY DIFFRACTION' 5 4 A 1010 ? ? A 1017 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.dependencies 
_software.description 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.os 
_software.os_version 
_software.type 
_software.pdbx_ordinal 
d*TREK 'data scaling'   .        ? ? ? ? ? ? ? ? ? ? ? ? ? ? program 1 
d*TREK 'data reduction' .        ? ? ? ? ? ? ? ? ? ? ? ? ? ? program 2 
MOLREP phasing          .        ? ? ? ? ? ? ? ? ? ? ? ? ? ? program 3 
REFMAC refinement       5.5.0109 ? ? ? ? ? ? ? ? ? ? ? ? ? ? program 4 
Coot   'model building' .        ? ? ? ? ? ? ? ? ? ? ? ? ? ? program 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 723 ? ? 98.25   -6.13   
2 1 THR A 783 ? ? -122.81 -126.68 
3 1 ARG A 836 ? ? 77.16   -8.09   
4 1 ASP A 837 ? ? -145.81 39.72   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 696  ? A GLY 1   
2  1 Y 1 A GLU 697  ? A GLU 2   
3  1 Y 1 A ALA 698  ? A ALA 3   
4  1 Y 1 A PRO 699  ? A PRO 4   
5  1 Y 1 A ASN 700  ? A ASN 5   
6  1 Y 1 A GLU 734  ? A GLU 39  
7  1 Y 1 A GLY 735  ? A GLY 40  
8  1 Y 1 A GLU 736  ? A GLU 41  
9  1 Y 1 A LYS 737  ? A LYS 42  
10 1 Y 1 A ARG 748  ? A ARG 53  
11 1 Y 1 A GLU 749  ? A GLU 54  
12 1 Y 1 A ALA 750  ? A ALA 55  
13 1 Y 1 A THR 751  ? A THR 56  
14 1 Y 1 A SER 752  ? A SER 57  
15 1 Y 1 A PRO 753  ? A PRO 58  
16 1 Y 1 A LYS 754  ? A LYS 59  
17 1 Y 1 A GLU 868  ? A GLU 173 
18 1 Y 1 A TYR 869  ? A TYR 174 
19 1 Y 1 A HIS 870  ? A HIS 175 
20 1 Y 1 A ALA 871  ? A ALA 176 
21 1 Y 1 A GLU 872  ? A GLU 177 
22 1 Y 1 A GLY 873  ? A GLY 178 
23 1 Y 1 A GLY 874  ? A GLY 179 
24 1 Y 1 A GLU 1004 ? A GLU 309 
25 1 Y 1 A GLU 1005 ? A GLU 310 
26 1 Y 1 A ASP 1006 ? A ASP 311 
27 1 Y 1 A MET 1007 ? A MET 312 
28 1 Y 1 A ASP 1008 ? A ASP 313 
29 1 Y 1 A ASP 1009 ? A ASP 314 
30 1 Y 1 A ILE 1018 ? A ILE 323 
31 1 Y 1 A PRO 1019 ? A PRO 324 
32 1 Y 1 A GLN 1020 ? A GLN 325 
33 1 Y 1 A GLN 1021 ? A GLN 326 
34 1 Y 1 A GLY 1022 ? A GLY 327 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 
'N-{2-[4-({3-chloro-4-[3-(trifluoromethyl)phenoxy]phenyl}amino)-5H-pyrrolo[3,2-d]pyrimidin-5-yl]ethyl}-3-hydroxy-3-methylbutanamide' 
03P 
4 water HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   1    1   SO4 SO4 A . 
C 2 SO4 1   2    2   SO4 SO4 A . 
D 2 SO4 1   3    3   SO4 SO4 A . 
E 3 03P 1   1023 1   03P 03P A . 
F 4 HOH 1   4    4   HOH HOH A . 
F 4 HOH 2   5    5   HOH HOH A . 
F 4 HOH 3   6    6   HOH HOH A . 
F 4 HOH 4   7    7   HOH HOH A . 
F 4 HOH 5   8    8   HOH HOH A . 
F 4 HOH 6   9    9   HOH HOH A . 
F 4 HOH 7   10   10  HOH HOH A . 
F 4 HOH 8   11   11  HOH HOH A . 
F 4 HOH 9   12   12  HOH HOH A . 
F 4 HOH 10  13   13  HOH HOH A . 
F 4 HOH 11  14   14  HOH HOH A . 
F 4 HOH 12  15   15  HOH HOH A . 
F 4 HOH 13  16   16  HOH HOH A . 
F 4 HOH 14  17   17  HOH HOH A . 
F 4 HOH 15  18   18  HOH HOH A . 
F 4 HOH 16  19   19  HOH HOH A . 
F 4 HOH 17  20   20  HOH HOH A . 
F 4 HOH 18  21   21  HOH HOH A . 
F 4 HOH 19  22   22  HOH HOH A . 
F 4 HOH 20  23   23  HOH HOH A . 
F 4 HOH 21  24   24  HOH HOH A . 
F 4 HOH 22  25   25  HOH HOH A . 
F 4 HOH 23  26   26  HOH HOH A . 
F 4 HOH 24  27   27  HOH HOH A . 
F 4 HOH 25  28   28  HOH HOH A . 
F 4 HOH 26  29   29  HOH HOH A . 
F 4 HOH 27  30   30  HOH HOH A . 
F 4 HOH 28  31   31  HOH HOH A . 
F 4 HOH 29  32   32  HOH HOH A . 
F 4 HOH 30  33   33  HOH HOH A . 
F 4 HOH 31  34   34  HOH HOH A . 
F 4 HOH 32  35   35  HOH HOH A . 
F 4 HOH 33  36   36  HOH HOH A . 
F 4 HOH 34  37   37  HOH HOH A . 
F 4 HOH 35  38   38  HOH HOH A . 
F 4 HOH 36  39   39  HOH HOH A . 
F 4 HOH 37  40   40  HOH HOH A . 
F 4 HOH 38  41   41  HOH HOH A . 
F 4 HOH 39  42   42  HOH HOH A . 
F 4 HOH 40  43   43  HOH HOH A . 
F 4 HOH 41  44   44  HOH HOH A . 
F 4 HOH 42  45   45  HOH HOH A . 
F 4 HOH 43  46   46  HOH HOH A . 
F 4 HOH 44  47   47  HOH HOH A . 
F 4 HOH 45  48   48  HOH HOH A . 
F 4 HOH 46  49   49  HOH HOH A . 
F 4 HOH 47  50   50  HOH HOH A . 
F 4 HOH 48  51   51  HOH HOH A . 
F 4 HOH 49  52   52  HOH HOH A . 
F 4 HOH 50  53   53  HOH HOH A . 
F 4 HOH 51  54   54  HOH HOH A . 
F 4 HOH 52  55   55  HOH HOH A . 
F 4 HOH 53  56   56  HOH HOH A . 
F 4 HOH 54  57   57  HOH HOH A . 
F 4 HOH 55  58   58  HOH HOH A . 
F 4 HOH 56  59   59  HOH HOH A . 
F 4 HOH 57  60   60  HOH HOH A . 
F 4 HOH 58  61   61  HOH HOH A . 
F 4 HOH 59  62   62  HOH HOH A . 
F 4 HOH 60  63   63  HOH HOH A . 
F 4 HOH 61  64   64  HOH HOH A . 
F 4 HOH 62  65   65  HOH HOH A . 
F 4 HOH 63  66   66  HOH HOH A . 
F 4 HOH 64  67   67  HOH HOH A . 
F 4 HOH 65  68   68  HOH HOH A . 
F 4 HOH 66  69   69  HOH HOH A . 
F 4 HOH 67  70   70  HOH HOH A . 
F 4 HOH 68  71   71  HOH HOH A . 
F 4 HOH 69  72   72  HOH HOH A . 
F 4 HOH 70  73   73  HOH HOH A . 
F 4 HOH 71  74   74  HOH HOH A . 
F 4 HOH 72  75   75  HOH HOH A . 
F 4 HOH 73  76   76  HOH HOH A . 
F 4 HOH 74  77   77  HOH HOH A . 
F 4 HOH 75  78   78  HOH HOH A . 
F 4 HOH 76  79   79  HOH HOH A . 
F 4 HOH 77  80   80  HOH HOH A . 
F 4 HOH 78  81   81  HOH HOH A . 
F 4 HOH 79  82   82  HOH HOH A . 
F 4 HOH 80  83   83  HOH HOH A . 
F 4 HOH 81  84   84  HOH HOH A . 
F 4 HOH 82  85   85  HOH HOH A . 
F 4 HOH 83  86   86  HOH HOH A . 
F 4 HOH 84  87   87  HOH HOH A . 
F 4 HOH 85  88   88  HOH HOH A . 
F 4 HOH 86  89   89  HOH HOH A . 
F 4 HOH 87  90   90  HOH HOH A . 
F 4 HOH 88  91   91  HOH HOH A . 
F 4 HOH 89  92   92  HOH HOH A . 
F 4 HOH 90  93   93  HOH HOH A . 
F 4 HOH 91  94   94  HOH HOH A . 
F 4 HOH 92  95   95  HOH HOH A . 
F 4 HOH 93  96   96  HOH HOH A . 
F 4 HOH 94  97   97  HOH HOH A . 
F 4 HOH 95  98   98  HOH HOH A . 
F 4 HOH 96  99   99  HOH HOH A . 
F 4 HOH 97  100  100 HOH HOH A . 
F 4 HOH 98  101  101 HOH HOH A . 
F 4 HOH 99  102  102 HOH HOH A . 
F 4 HOH 100 103  103 HOH HOH A . 
F 4 HOH 101 104  104 HOH HOH A . 
F 4 HOH 102 105  105 HOH HOH A . 
F 4 HOH 103 106  106 HOH HOH A . 
F 4 HOH 104 107  107 HOH HOH A . 
F 4 HOH 105 108  108 HOH HOH A . 
F 4 HOH 106 109  109 HOH HOH A . 
F 4 HOH 107 110  110 HOH HOH A . 
F 4 HOH 108 111  111 HOH HOH A . 
F 4 HOH 109 112  112 HOH HOH A . 
F 4 HOH 110 113  113 HOH HOH A . 
F 4 HOH 111 114  114 HOH HOH A . 
F 4 HOH 112 115  115 HOH HOH A . 
F 4 HOH 113 116  116 HOH HOH A . 
F 4 HOH 114 117  117 HOH HOH A . 
F 4 HOH 115 118  118 HOH HOH A . 
F 4 HOH 116 119  119 HOH HOH A . 
F 4 HOH 117 120  120 HOH HOH A . 
F 4 HOH 118 121  121 HOH HOH A . 
F 4 HOH 119 122  122 HOH HOH A . 
F 4 HOH 120 123  123 HOH HOH A . 
F 4 HOH 121 124  124 HOH HOH A . 
F 4 HOH 122 125  125 HOH HOH A . 
F 4 HOH 123 126  126 HOH HOH A . 
F 4 HOH 124 1024 1   HOH HOH A . 
F 4 HOH 125 1025 2   HOH HOH A . 
F 4 HOH 126 1026 3   HOH HOH A . 
#