data_3PS8
# 
_entry.id   3PS8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3PS8         
RCSB  RCSB062753   
WWPDB D_1000062753 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1G96 'Dimeric form of human cystatin C'                 unspecified 
PDB 1R4C 'Dimeric form of N-truncated human cystatin C'     unspecified 
PDB 1TIJ 'Dimeric form of human cystatin C'                 unspecified 
PDB 3GAX 'monomeric form of human cystatin C (stab1)'       unspecified 
PDB 3NX0 'monomeric form of human cystatin C (mutant V57N)' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3PS8 
_pdbx_database_status.recvd_initial_deposition_date   2010-12-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Orlikowska, M.' 1 
'Borek, D.'      2 
'Otwinowski, Z.' 3 
'Skowron, P.'    4 
'Szymanska, A.'  5 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of L68V mutant of human cystatin C' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Orlikowska, M.' 1 
primary 'Szymanska, A.'  2 
primary 'Borek, D.'      3 
primary 'Otwinowski, Z.' 4 
primary 'Skowron, P.'    5 
primary 'Jankowska, E.'  6 
# 
_cell.entry_id           3PS8 
_cell.length_a           139.801 
_cell.length_b           139.801 
_cell.length_c           139.801 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3PS8 
_symmetry.space_group_name_H-M             'I 4 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                211 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Cystatin-C              13351.114 1  ? L68V ? ? 
2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120   3  ? ?    ? ? 
3 non-polymer syn 'ACETATE ION'           59.044    1  ? ?    ? ? 
4 water       nat water                   18.015    80 ? ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cystatin-3, Gamma-trace, Neuroendocrine basic polypeptide, Post-gamma-globulin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNL
DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVEVGRTTCTKTQPNL
DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   SER n 
1 3   PRO n 
1 4   GLY n 
1 5   LYS n 
1 6   PRO n 
1 7   PRO n 
1 8   ARG n 
1 9   LEU n 
1 10  VAL n 
1 11  GLY n 
1 12  GLY n 
1 13  PRO n 
1 14  MET n 
1 15  ASP n 
1 16  ALA n 
1 17  SER n 
1 18  VAL n 
1 19  GLU n 
1 20  GLU n 
1 21  GLU n 
1 22  GLY n 
1 23  VAL n 
1 24  ARG n 
1 25  ARG n 
1 26  ALA n 
1 27  LEU n 
1 28  ASP n 
1 29  PHE n 
1 30  ALA n 
1 31  VAL n 
1 32  GLY n 
1 33  GLU n 
1 34  TYR n 
1 35  ASN n 
1 36  LYS n 
1 37  ALA n 
1 38  SER n 
1 39  ASN n 
1 40  ASP n 
1 41  MET n 
1 42  TYR n 
1 43  HIS n 
1 44  SER n 
1 45  ARG n 
1 46  ALA n 
1 47  LEU n 
1 48  GLN n 
1 49  VAL n 
1 50  VAL n 
1 51  ARG n 
1 52  ALA n 
1 53  ARG n 
1 54  LYS n 
1 55  GLN n 
1 56  ILE n 
1 57  VAL n 
1 58  ALA n 
1 59  GLY n 
1 60  VAL n 
1 61  ASN n 
1 62  TYR n 
1 63  PHE n 
1 64  LEU n 
1 65  ASP n 
1 66  VAL n 
1 67  GLU n 
1 68  VAL n 
1 69  GLY n 
1 70  ARG n 
1 71  THR n 
1 72  THR n 
1 73  CYS n 
1 74  THR n 
1 75  LYS n 
1 76  THR n 
1 77  GLN n 
1 78  PRO n 
1 79  ASN n 
1 80  LEU n 
1 81  ASP n 
1 82  ASN n 
1 83  CYS n 
1 84  PRO n 
1 85  PHE n 
1 86  HIS n 
1 87  ASP n 
1 88  GLN n 
1 89  PRO n 
1 90  HIS n 
1 91  LEU n 
1 92  LYS n 
1 93  ARG n 
1 94  LYS n 
1 95  ALA n 
1 96  PHE n 
1 97  CYS n 
1 98  SER n 
1 99  PHE n 
1 100 GLN n 
1 101 ILE n 
1 102 TYR n 
1 103 ALA n 
1 104 VAL n 
1 105 PRO n 
1 106 TRP n 
1 107 GLN n 
1 108 GLY n 
1 109 THR n 
1 110 MET n 
1 111 THR n 
1 112 LEU n 
1 113 SER n 
1 114 LYS n 
1 115 SER n 
1 116 THR n 
1 117 CYS n 
1 118 GLN n 
1 119 ASP n 
1 120 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CST3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               C41 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PHD313 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CYTC_HUMAN 
_struct_ref.pdbx_db_accession          P01034 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNL
DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
;
_struct_ref.pdbx_align_begin           27 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3PS8 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 120 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01034 
_struct_ref_seq.db_align_beg                  27 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  146 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       120 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3PS8 
_struct_ref_seq_dif.mon_id                       VAL 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      68 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P01034 
_struct_ref_seq_dif.db_mon_id                    LEU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          94 
_struct_ref_seq_dif.details                      'ENGINEERED MUTATION' 
_struct_ref_seq_dif.pdbx_auth_seq_num            68 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'           ? 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ? 'C5 H11 N O2 S'  149.211 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3PS8 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.26 
_exptl_crystal.density_percent_sol   71.15 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    '0.1M sodium acetate pH=4.6, 8% PEG 4000, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210r' 
_diffrn_detector.pdbx_collection_date   2010-03-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.entry_id                     3PS8 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.55 
_reflns.number_obs                   7932 
_reflns.number_all                   7932 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.115 
_reflns.pdbx_Rsym_value              0.115 
_reflns.pdbx_netI_over_sigmaI        41.57 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              42.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.23 
_reflns_shell.pdbx_redundancy        41.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3PS8 
_refine.ls_number_reflns_obs                     7087 
_refine.ls_number_reflns_all                     7932 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             33.00 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    94.01 
_refine.ls_R_factor_obs                          0.19069 
_refine.ls_R_factor_R_work                       0.18769 
_refine.ls_R_factor_R_free                       0.25055 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  356 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.935 
_refine.correlation_coeff_Fo_to_Fc_free          0.891 
_refine.B_iso_mean                               34.265 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.245 
_refine.overall_SU_ML                            0.162 
_refine.overall_SU_B                             15.921 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        859 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         25 
_refine_hist.number_atoms_solvent             80 
_refine_hist.number_atoms_total               964 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        33.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.018  0.022  ? 900  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.643  1.953  ? 1209 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.921  5.000  ? 108  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.345 23.864 ? 44   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.956 15.000 ? 146  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.817 15.000 ? 7    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.110  0.200  ? 128  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 686  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.967  1.500  ? 547  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 5.471  2.000  ? 879  'X-RAY DIFFRACTION' ? 
r_scbond_it                  12.744 3.000  ? 353  'X-RAY DIFFRACTION' ? 
r_scangle_it                 15.769 4.500  ? 330  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.55 
_refine_ls_shell.d_res_low                        2.617 
_refine_ls_shell.number_reflns_R_work             405 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.percent_reflns_obs               76.18 
_refine_ls_shell.R_factor_R_free                  0.430 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             30 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3PS8 
_struct.title                     'Crystal structure of L68V mutant of human cystatin C' 
_struct.pdbx_descriptor           Cystatin-C 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3PS8 
_struct_keywords.pdbx_keywords   'HYDROLASE INHIBITOR' 
_struct_keywords.text            
'cysteine protease inhibitor, 3D domain swapping, Hereditary Cystatin C Amyloid Angiopathy, Protease inhibitor, HYDROLASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 20 ? SER A 38 ? GLU A 20 SER A 38 1 ? 19 
HELX_P HELX_P2 2 ASN A 79 ? CYS A 83 ? ASN A 79 CYS A 83 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 73 SG ? ? ? 1_555 A CYS 83  SG ? ? A CYS 73 A CYS 83  1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf2 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 97 A CYS 117 1_555 ? ? ? ? ? ? ? 2.162 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 14  ? ASP A 15  ? MET A 14  ASP A 15  
A 2 ARG A 53  ? LYS A 54  ? ARG A 53  LYS A 54  
B 1 VAL A 60  ? GLY A 69  ? VAL A 60  GLY A 69  
B 2 LYS A 94  ? VAL A 104 ? LYS A 94  VAL A 104 
B 3 THR A 109 ? ASP A 119 ? THR A 109 ASP A 119 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET A 14  ? N MET A 14  O LYS A 54  ? O LYS A 54  
B 1 2 N VAL A 60  ? N VAL A 60  O ALA A 103 ? O ALA A 103 
B 2 3 N TYR A 102 ? N TYR A 102 O THR A 111 ? O THR A 111 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PEG A 121' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PEG A 122' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PEG A 123' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ACT A 124' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ARG A 51  ? ARG A 51  . ? 1_555  ? 
2  AC1 2 PEG C .   ? PEG A 122 . ? 1_555  ? 
3  AC2 5 TYR A 42  ? TYR A 42  . ? 17_555 ? 
4  AC2 5 ARG A 51  ? ARG A 51  . ? 1_555  ? 
5  AC2 5 ARG A 53  ? ARG A 53  . ? 1_555  ? 
6  AC2 5 THR A 72  ? THR A 72  . ? 18_655 ? 
7  AC2 5 PEG B .   ? PEG A 121 . ? 1_555  ? 
8  AC3 5 THR A 76  ? THR A 76  . ? 20_555 ? 
9  AC3 5 GLN A 100 ? GLN A 100 . ? 1_555  ? 
10 AC3 5 HOH F .   ? HOH A 168 . ? 1_555  ? 
11 AC3 5 HOH F .   ? HOH A 189 . ? 2_655  ? 
12 AC3 5 HOH F .   ? HOH A 202 . ? 1_555  ? 
13 AC4 6 TYR A 34  ? TYR A 34  . ? 1_555  ? 
14 AC4 6 SER A 44  ? SER A 44  . ? 1_555  ? 
15 AC4 6 VAL A 68  ? VAL A 68  . ? 2_655  ? 
16 AC4 6 GLY A 69  ? GLY A 69  . ? 2_655  ? 
17 AC4 6 ARG A 70  ? ARG A 70  . ? 2_655  ? 
18 AC4 6 HOH F .   ? HOH A 165 . ? 19_655 ? 
# 
_database_PDB_matrix.entry_id          3PS8 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3PS8 
_atom_sites.fract_transf_matrix[1][1]   0.007153 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007153 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007153 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLY A 1 12  ? 83.921 5.344   31.971 1.00 51.86  ? 12  GLY A N   1 
ATOM   2   C CA  . GLY A 1 12  ? 83.182 4.382   31.127 1.00 56.30  ? 12  GLY A CA  1 
ATOM   3   C C   . GLY A 1 12  ? 83.501 2.921   31.406 1.00 54.24  ? 12  GLY A C   1 
ATOM   4   O O   . GLY A 1 12  ? 83.515 2.515   32.554 1.00 50.25  ? 12  GLY A O   1 
ATOM   5   N N   . PRO A 1 13  ? 83.756 2.126   30.356 1.00 42.48  ? 13  PRO A N   1 
ATOM   6   C CA  . PRO A 1 13  ? 83.885 0.670   30.509 1.00 35.74  ? 13  PRO A CA  1 
ATOM   7   C C   . PRO A 1 13  ? 85.155 0.214   31.186 1.00 36.85  ? 13  PRO A C   1 
ATOM   8   O O   . PRO A 1 13  ? 86.090 0.958   31.284 1.00 47.15  ? 13  PRO A O   1 
ATOM   9   C CB  . PRO A 1 13  ? 83.836 0.149   29.066 1.00 32.77  ? 13  PRO A CB  1 
ATOM   10  C CG  . PRO A 1 13  ? 84.085 1.279   28.219 1.00 30.93  ? 13  PRO A CG  1 
ATOM   11  C CD  . PRO A 1 13  ? 83.788 2.536   28.944 1.00 42.51  ? 13  PRO A CD  1 
ATOM   12  N N   . MET A 1 14  ? 85.157 -1.024  31.629 1.00 34.04  ? 14  MET A N   1 
ATOM   13  C CA  . MET A 1 14  ? 86.162 -1.555  32.487 1.00 37.26  ? 14  MET A CA  1 
ATOM   14  C C   . MET A 1 14  ? 86.543 -2.890  31.952 1.00 34.59  ? 14  MET A C   1 
ATOM   15  O O   . MET A 1 14  ? 85.702 -3.593  31.476 1.00 38.69  ? 14  MET A O   1 
ATOM   16  C CB  . MET A 1 14  ? 85.579 -1.748  33.874 1.00 42.19  ? 14  MET A CB  1 
ATOM   17  C CG  . MET A 1 14  ? 85.810 -0.608  34.819 1.00 56.43  ? 14  MET A CG  1 
ATOM   18  S SD  . MET A 1 14  ? 84.856 -0.821  36.328 1.00 101.48 ? 14  MET A SD  1 
ATOM   19  C CE  . MET A 1 14  ? 84.821 -2.610  36.518 1.00 66.46  ? 14  MET A CE  1 
ATOM   20  N N   . ASP A 1 15  ? 87.808 -3.258  32.090 1.00 37.16  ? 15  ASP A N   1 
ATOM   21  C CA  . ASP A 1 15  ? 88.317 -4.537  31.590 1.00 38.71  ? 15  ASP A CA  1 
ATOM   22  C C   . ASP A 1 15  ? 87.648 -5.756  32.182 1.00 36.40  ? 15  ASP A C   1 
ATOM   23  O O   . ASP A 1 15  ? 87.327 -5.776  33.365 1.00 57.15  ? 15  ASP A O   1 
ATOM   24  C CB  . ASP A 1 15  ? 89.814 -4.627  31.826 1.00 56.57  ? 15  ASP A CB  1 
ATOM   25  C CG  . ASP A 1 15  ? 90.567 -3.570  31.086 1.00 65.59  ? 15  ASP A CG  1 
ATOM   26  O OD1 . ASP A 1 15  ? 90.815 -3.780  29.875 1.00 44.75  ? 15  ASP A OD1 1 
ATOM   27  O OD2 . ASP A 1 15  ? 90.879 -2.537  31.720 1.00 71.70  ? 15  ASP A OD2 1 
ATOM   28  N N   . ALA A 1 16  ? 87.463 -6.779  31.360 1.00 34.19  ? 16  ALA A N   1 
ATOM   29  C CA  . ALA A 1 16  ? 86.796 -8.009  31.780 1.00 35.94  ? 16  ALA A CA  1 
ATOM   30  C C   . ALA A 1 16  ? 87.488 -9.220  31.139 1.00 48.40  ? 16  ALA A C   1 
ATOM   31  O O   . ALA A 1 16  ? 87.770 -9.222  29.965 1.00 50.37  ? 16  ALA A O   1 
ATOM   32  C CB  . ALA A 1 16  ? 85.346 -7.963  31.367 1.00 36.03  ? 16  ALA A CB  1 
ATOM   33  N N   . SER A 1 17  ? 87.770 -10.247 31.922 1.00 61.51  ? 17  SER A N   1 
ATOM   34  C CA  . SER A 1 17  ? 88.382 -11.456 31.410 1.00 50.67  ? 17  SER A CA  1 
ATOM   35  C C   . SER A 1 17  ? 87.511 -12.172 30.367 1.00 47.75  ? 17  SER A C   1 
ATOM   36  O O   . SER A 1 17  ? 86.296 -12.285 30.526 1.00 46.24  ? 17  SER A O   1 
ATOM   37  C CB  . SER A 1 17  ? 88.670 -12.395 32.581 1.00 48.39  ? 17  SER A CB  1 
ATOM   38  O OG  . SER A 1 17  ? 88.716 -13.736 32.122 1.00 50.46  ? 17  SER A OG  1 
ATOM   39  N N   . VAL A 1 18  ? 88.155 -12.692 29.328 1.00 41.95  ? 18  VAL A N   1 
ATOM   40  C CA  . VAL A 1 18  ? 87.485 -13.495 28.290 1.00 37.70  ? 18  VAL A CA  1 
ATOM   41  C C   . VAL A 1 18  ? 86.981 -14.837 28.826 1.00 50.26  ? 18  VAL A C   1 
ATOM   42  O O   . VAL A 1 18  ? 86.136 -15.512 28.197 1.00 48.94  ? 18  VAL A O   1 
ATOM   43  C CB  . VAL A 1 18  ? 88.437 -13.720 27.100 1.00 43.72  ? 18  VAL A CB  1 
ATOM   44  C CG1 . VAL A 1 18  ? 87.869 -14.736 26.101 1.00 52.57  ? 18  VAL A CG1 1 
ATOM   45  C CG2 . VAL A 1 18  ? 88.731 -12.371 26.414 1.00 31.50  ? 18  VAL A CG2 1 
ATOM   46  N N   . GLU A 1 19  ? 87.502 -15.222 29.991 1.00 61.53  ? 19  GLU A N   1 
ATOM   47  C CA  . GLU A 1 19  ? 87.092 -16.469 30.623 1.00 71.09  ? 19  GLU A CA  1 
ATOM   48  C C   . GLU A 1 19  ? 85.649 -16.353 31.110 1.00 66.97  ? 19  GLU A C   1 
ATOM   49  O O   . GLU A 1 19  ? 84.958 -17.386 31.221 1.00 63.73  ? 19  GLU A O   1 
ATOM   50  C CB  . GLU A 1 19  ? 88.010 -16.846 31.797 1.00 86.77  ? 19  GLU A CB  1 
ATOM   51  C CG  . GLU A 1 19  ? 89.491 -16.506 31.616 1.00 97.71  ? 19  GLU A CG  1 
ATOM   52  C CD  . GLU A 1 19  ? 90.267 -17.571 30.876 1.00 117.97 ? 19  GLU A CD  1 
ATOM   53  O OE1 . GLU A 1 19  ? 91.516 -17.603 31.035 1.00 127.57 ? 19  GLU A OE1 1 
ATOM   54  O OE2 . GLU A 1 19  ? 89.636 -18.376 30.146 1.00 110.58 ? 19  GLU A OE2 1 
ATOM   55  N N   . GLU A 1 20  ? 85.216 -15.101 31.370 1.00 52.49  ? 20  GLU A N   1 
ATOM   56  C CA  . GLU A 1 20  ? 83.920 -14.781 32.012 1.00 49.36  ? 20  GLU A CA  1 
ATOM   57  C C   . GLU A 1 20  ? 82.778 -15.132 31.084 1.00 45.41  ? 20  GLU A C   1 
ATOM   58  O O   . GLU A 1 20  ? 82.798 -14.772 29.923 1.00 49.02  ? 20  GLU A O   1 
ATOM   59  C CB  . GLU A 1 20  ? 83.835 -13.299 32.427 1.00 46.37  ? 20  GLU A CB  1 
ATOM   60  C CG  . GLU A 1 20  ? 84.715 -12.918 33.626 1.00 70.64  ? 20  GLU A CG  1 
ATOM   61  C CD  . GLU A 1 20  ? 84.602 -11.444 34.086 1.00 102.81 ? 20  GLU A CD  1 
ATOM   62  O OE1 . GLU A 1 20  ? 85.464 -11.064 34.929 1.00 87.11  ? 20  GLU A OE1 1 
ATOM   63  O OE2 . GLU A 1 20  ? 83.688 -10.686 33.627 1.00 68.14  ? 20  GLU A OE2 1 
ATOM   64  N N   . GLU A 1 21  ? 81.773 -15.829 31.586 1.00 53.67  ? 21  GLU A N   1 
ATOM   65  C CA  . GLU A 1 21  ? 80.749 -16.386 30.699 1.00 65.20  ? 21  GLU A CA  1 
ATOM   66  C C   . GLU A 1 21  ? 80.064 -15.357 29.796 1.00 53.09  ? 21  GLU A C   1 
ATOM   67  O O   . GLU A 1 21  ? 79.672 -15.681 28.683 1.00 55.79  ? 21  GLU A O   1 
ATOM   68  C CB  . GLU A 1 21  ? 79.701 -17.183 31.472 1.00 70.34  ? 21  GLU A CB  1 
ATOM   69  C CG  . GLU A 1 21  ? 79.223 -18.351 30.665 1.00 91.10  ? 21  GLU A CG  1 
ATOM   70  C CD  . GLU A 1 21  ? 77.761 -18.622 30.848 1.00 128.42 ? 21  GLU A CD  1 
ATOM   71  O OE1 . GLU A 1 21  ? 77.300 -18.638 32.005 1.00 120.72 ? 21  GLU A OE1 1 
ATOM   72  O OE2 . GLU A 1 21  ? 77.074 -18.830 29.827 1.00 148.10 ? 21  GLU A OE2 1 
ATOM   73  N N   . GLY A 1 22  ? 79.924 -14.130 30.295 1.00 52.06  ? 22  GLY A N   1 
ATOM   74  C CA  . GLY A 1 22  ? 79.262 -13.060 29.572 1.00 34.55  ? 22  GLY A CA  1 
ATOM   75  C C   . GLY A 1 22  ? 80.109 -12.550 28.418 1.00 35.26  ? 22  GLY A C   1 
ATOM   76  O O   . GLY A 1 22  ? 79.585 -12.265 27.322 1.00 24.95  ? 22  GLY A O   1 
ATOM   77  N N   . VAL A 1 23  ? 81.412 -12.432 28.677 1.00 30.61  ? 23  VAL A N   1 
ATOM   78  C CA  . VAL A 1 23  ? 82.370 -11.932 27.701 1.00 23.61  ? 23  VAL A CA  1 
ATOM   79  C C   . VAL A 1 23  ? 82.544 -12.972 26.587 1.00 28.52  ? 23  VAL A C   1 
ATOM   80  O O   . VAL A 1 23  ? 82.470 -12.631 25.399 1.00 29.49  ? 23  VAL A O   1 
ATOM   81  C CB  . VAL A 1 23  ? 83.698 -11.552 28.351 1.00 27.83  ? 23  VAL A CB  1 
ATOM   82  C CG1 . VAL A 1 23  ? 84.715 -11.107 27.313 1.00 31.26  ? 23  VAL A CG1 1 
ATOM   83  C CG2 . VAL A 1 23  ? 83.488 -10.446 29.357 1.00 30.79  ? 23  VAL A CG2 1 
ATOM   84  N N   . ARG A 1 24  ? 82.673 -14.236 26.967 1.00 28.13  ? 24  ARG A N   1 
ATOM   85  C CA  . ARG A 1 24  ? 82.756 -15.321 25.992 1.00 33.97  ? 24  ARG A CA  1 
ATOM   86  C C   . ARG A 1 24  ? 81.461 -15.451 25.201 1.00 33.23  ? 24  ARG A C   1 
ATOM   87  O O   . ARG A 1 24  ? 81.487 -15.724 23.997 1.00 40.92  ? 24  ARG A O   1 
ATOM   88  C CB  . ARG A 1 24  ? 83.107 -16.645 26.664 1.00 42.00  ? 24  ARG A CB  1 
ATOM   89  C CG  . ARG A 1 24  ? 83.742 -17.663 25.734 1.00 75.09  ? 24  ARG A CG  1 
ATOM   90  C CD  . ARG A 1 24  ? 83.440 -19.059 26.240 1.00 117.33 ? 24  ARG A CD  1 
ATOM   91  N NE  . ARG A 1 24  ? 82.014 -19.170 26.574 1.00 120.69 ? 24  ARG A NE  1 
ATOM   92  C CZ  . ARG A 1 24  ? 81.509 -19.889 27.580 1.00 129.97 ? 24  ARG A CZ  1 
ATOM   93  N NH1 . ARG A 1 24  ? 82.302 -20.593 28.395 1.00 85.53  ? 24  ARG A NH1 1 
ATOM   94  N NH2 . ARG A 1 24  ? 80.192 -19.894 27.773 1.00 112.95 ? 24  ARG A NH2 1 
ATOM   95  N N   . ARG A 1 25  ? 80.314 -15.264 25.848 1.00 33.14  ? 25  ARG A N   1 
ATOM   96  C CA  . ARG A 1 25  ? 79.073 -15.410 25.097 1.00 33.81  ? 25  ARG A CA  1 
ATOM   97  C C   . ARG A 1 25  ? 78.956 -14.291 24.071 1.00 26.70  ? 25  ARG A C   1 
ATOM   98  O O   . ARG A 1 25  ? 78.528 -14.528 22.942 1.00 29.50  ? 25  ARG A O   1 
ATOM   99  C CB  . ARG A 1 25  ? 77.842 -15.522 25.998 1.00 39.73  ? 25  ARG A CB  1 
ATOM   100 C CG  . ARG A 1 25  ? 77.332 -16.979 26.129 1.00 61.40  ? 25  ARG A CG  1 
ATOM   101 C CD  . ARG A 1 25  ? 76.328 -17.155 27.267 1.00 84.33  ? 25  ARG A CD  1 
ATOM   102 N NE  . ARG A 1 25  ? 74.961 -16.744 26.921 1.00 114.98 ? 25  ARG A NE  1 
ATOM   103 C CZ  . ARG A 1 25  ? 74.391 -15.584 27.270 1.00 104.60 ? 25  ARG A CZ  1 
ATOM   104 N NH1 . ARG A 1 25  ? 75.068 -14.681 27.982 1.00 82.29  ? 25  ARG A NH1 1 
ATOM   105 N NH2 . ARG A 1 25  ? 73.134 -15.321 26.900 1.00 72.27  ? 25  ARG A NH2 1 
ATOM   106 N N   . ALA A 1 26  ? 79.411 -13.096 24.439 1.00 19.27  ? 26  ALA A N   1 
ATOM   107 C CA  . ALA A 1 26  ? 79.277 -11.944 23.557 1.00 16.67  ? 26  ALA A CA  1 
ATOM   108 C C   . ALA A 1 26  ? 80.241 -12.074 22.359 1.00 22.95  ? 26  ALA A C   1 
ATOM   109 O O   . ALA A 1 26  ? 79.874 -11.771 21.227 1.00 16.39  ? 26  ALA A O   1 
ATOM   110 C CB  . ALA A 1 26  ? 79.531 -10.665 24.331 1.00 17.42  ? 26  ALA A CB  1 
ATOM   111 N N   . LEU A 1 27  ? 81.467 -12.545 22.623 1.00 18.22  ? 27  LEU A N   1 
ATOM   112 C CA  . LEU A 1 27  ? 82.459 -12.792 21.599 1.00 18.16  ? 27  LEU A CA  1 
ATOM   113 C C   . LEU A 1 27  ? 81.944 -13.822 20.580 1.00 20.53  ? 27  LEU A C   1 
ATOM   114 O O   . LEU A 1 27  ? 81.971 -13.554 19.367 1.00 20.20  ? 27  LEU A O   1 
ATOM   115 C CB  . LEU A 1 27  ? 83.782 -13.211 22.224 1.00 22.19  ? 27  LEU A CB  1 
ATOM   116 C CG  . LEU A 1 27  ? 84.883 -13.816 21.333 1.00 31.87  ? 27  LEU A CG  1 
ATOM   117 C CD1 . LEU A 1 27  ? 85.281 -12.831 20.273 1.00 23.79  ? 27  LEU A CD1 1 
ATOM   118 C CD2 . LEU A 1 27  ? 86.123 -14.223 22.158 1.00 30.08  ? 27  LEU A CD2 1 
ATOM   119 N N   . ASP A 1 28  ? 81.458 -14.976 21.044 1.00 19.18  ? 28  ASP A N   1 
ATOM   120 C CA  . ASP A 1 28  ? 80.957 -15.996 20.117 1.00 20.80  ? 28  ASP A CA  1 
ATOM   121 C C   . ASP A 1 28  ? 79.835 -15.439 19.240 1.00 21.24  ? 28  ASP A C   1 
ATOM   122 O O   . ASP A 1 28  ? 79.720 -15.733 18.034 1.00 19.77  ? 28  ASP A O   1 
ATOM   123 C CB  . ASP A 1 28  ? 80.520 -17.278 20.857 1.00 24.52  ? 28  ASP A CB  1 
ATOM   124 C CG  . ASP A 1 28  ? 81.703 -17.991 21.549 1.00 45.27  ? 28  ASP A CG  1 
ATOM   125 O OD1 . ASP A 1 28  ? 81.467 -18.884 22.396 1.00 61.27  ? 28  ASP A OD1 1 
ATOM   126 O OD2 . ASP A 1 28  ? 82.879 -17.654 21.264 1.00 36.80  ? 28  ASP A OD2 1 
ATOM   127 N N   . PHE A 1 29  ? 79.028 -14.603 19.872 1.00 17.19  ? 29  PHE A N   1 
ATOM   128 C CA  . PHE A 1 29  ? 77.893 -14.004 19.239 1.00 18.88  ? 29  PHE A CA  1 
ATOM   129 C C   . PHE A 1 29  ? 78.356 -13.018 18.150 1.00 18.28  ? 29  PHE A C   1 
ATOM   130 O O   . PHE A 1 29  ? 77.857 -13.055 17.015 1.00 17.82  ? 29  PHE A O   1 
ATOM   131 C CB  . PHE A 1 29  ? 76.966 -13.326 20.300 1.00 15.34  ? 29  PHE A CB  1 
ATOM   132 C CG  . PHE A 1 29  ? 75.903 -12.484 19.673 1.00 15.22  ? 29  PHE A CG  1 
ATOM   133 C CD1 . PHE A 1 29  ? 74.755 -13.077 19.163 1.00 18.26  ? 29  PHE A CD1 1 
ATOM   134 C CD2 . PHE A 1 29  ? 76.101 -11.098 19.478 1.00 20.15  ? 29  PHE A CD2 1 
ATOM   135 C CE1 . PHE A 1 29  ? 73.776 -12.291 18.526 1.00 19.12  ? 29  PHE A CE1 1 
ATOM   136 C CE2 . PHE A 1 29  ? 75.131 -10.300 18.847 1.00 15.25  ? 29  PHE A CE2 1 
ATOM   137 C CZ  . PHE A 1 29  ? 73.975 -10.896 18.375 1.00 17.58  ? 29  PHE A CZ  1 
ATOM   138 N N   . ALA A 1 30  ? 79.307 -12.146 18.487 1.00 11.94  ? 30  ALA A N   1 
ATOM   139 C CA  . ALA A 1 30  ? 79.728 -11.122 17.552 1.00 11.41  ? 30  ALA A CA  1 
ATOM   140 C C   . ALA A 1 30  ? 80.356 -11.760 16.312 1.00 16.21  ? 30  ALA A C   1 
ATOM   141 O O   . ALA A 1 30  ? 80.114 -11.333 15.158 1.00 15.44  ? 30  ALA A O   1 
ATOM   142 C CB  . ALA A 1 30  ? 80.694 -10.217 18.207 1.00 12.61  ? 30  ALA A CB  1 
ATOM   143 N N   . VAL A 1 31  ? 81.190 -12.763 16.561 1.00 12.18  ? 31  VAL A N   1 
ATOM   144 C CA  . VAL A 1 31  ? 81.898 -13.492 15.511 1.00 13.73  ? 31  VAL A CA  1 
ATOM   145 C C   . VAL A 1 31  ? 80.828 -14.261 14.707 1.00 21.61  ? 31  VAL A C   1 
ATOM   146 O O   . VAL A 1 31  ? 80.902 -14.295 13.484 1.00 18.33  ? 31  VAL A O   1 
ATOM   147 C CB  . VAL A 1 31  ? 82.990 -14.450 16.122 1.00 24.87  ? 31  VAL A CB  1 
ATOM   148 C CG1 . VAL A 1 31  ? 83.524 -15.351 15.091 1.00 19.88  ? 31  VAL A CG1 1 
ATOM   149 C CG2 . VAL A 1 31  ? 84.156 -13.646 16.756 1.00 17.24  ? 31  VAL A CG2 1 
ATOM   150 N N   . GLY A 1 32  ? 79.805 -14.824 15.373 1.00 13.95  ? 32  GLY A N   1 
ATOM   151 C CA  . GLY A 1 32  ? 78.638 -15.379 14.637 1.00 15.26  ? 32  GLY A CA  1 
ATOM   152 C C   . GLY A 1 32  ? 78.003 -14.400 13.642 1.00 14.93  ? 32  GLY A C   1 
ATOM   153 O O   . GLY A 1 32  ? 77.744 -14.757 12.468 1.00 15.41  ? 32  GLY A O   1 
ATOM   154 N N   . GLU A 1 33  ? 77.777 -13.161 14.094 1.00 12.76  ? 33  GLU A N   1 
ATOM   155 C CA  . GLU A 1 33  ? 77.097 -12.131 13.289 1.00 17.82  ? 33  GLU A CA  1 
ATOM   156 C C   . GLU A 1 33  ? 78.010 -11.671 12.165 1.00 18.96  ? 33  GLU A C   1 
ATOM   157 O O   . GLU A 1 33  ? 77.556 -11.503 11.020 1.00 17.13  ? 33  GLU A O   1 
ATOM   158 C CB  . GLU A 1 33  ? 76.620 -10.913 14.127 1.00 13.43  ? 33  GLU A CB  1 
ATOM   159 C CG  . GLU A 1 33  ? 75.642 -11.239 15.216 1.00 21.97  ? 33  GLU A CG  1 
ATOM   160 C CD  . GLU A 1 33  ? 74.353 -11.879 14.681 1.00 39.28  ? 33  GLU A CD  1 
ATOM   161 O OE1 . GLU A 1 33  ? 74.056 -13.075 14.982 1.00 26.45  ? 33  GLU A OE1 1 
ATOM   162 O OE2 . GLU A 1 33  ? 73.654 -11.181 13.930 1.00 25.52  ? 33  GLU A OE2 1 
ATOM   163 N N   . TYR A 1 34  ? 79.285 -11.520 12.469 1.00 12.64  ? 34  TYR A N   1 
ATOM   164 C CA  . TYR A 1 34  ? 80.264 -11.106 11.487 1.00 12.36  ? 34  TYR A CA  1 
ATOM   165 C C   . TYR A 1 34  ? 80.302 -12.099 10.326 1.00 17.75  ? 34  TYR A C   1 
ATOM   166 O O   . TYR A 1 34  ? 80.308 -11.722 9.160  1.00 15.14  ? 34  TYR A O   1 
ATOM   167 C CB  . TYR A 1 34  ? 81.618 -10.959 12.172 1.00 12.69  ? 34  TYR A CB  1 
ATOM   168 C CG  . TYR A 1 34  ? 82.762 -10.715 11.264 1.00 18.24  ? 34  TYR A CG  1 
ATOM   169 C CD1 . TYR A 1 34  ? 83.112 -9.435  10.885 1.00 16.98  ? 34  TYR A CD1 1 
ATOM   170 C CD2 . TYR A 1 34  ? 83.497 -11.761 10.774 1.00 15.70  ? 34  TYR A CD2 1 
ATOM   171 C CE1 . TYR A 1 34  ? 84.137 -9.215  10.053 1.00 19.74  ? 34  TYR A CE1 1 
ATOM   172 C CE2 . TYR A 1 34  ? 84.521 -11.553 9.929  1.00 17.35  ? 34  TYR A CE2 1 
ATOM   173 C CZ  . TYR A 1 34  ? 84.843 -10.273 9.572  1.00 35.49  ? 34  TYR A CZ  1 
ATOM   174 O OH  . TYR A 1 34  ? 85.885 -10.033 8.733  1.00 25.12  ? 34  TYR A OH  1 
ATOM   175 N N   . ASN A 1 35  ? 80.317 -13.370 10.683 1.00 12.90  ? 35  ASN A N   1 
ATOM   176 C CA  . ASN A 1 35  ? 80.222 -14.470 9.751  1.00 14.52  ? 35  ASN A CA  1 
ATOM   177 C C   . ASN A 1 35  ? 78.967 -14.533 8.896  1.00 16.12  ? 35  ASN A C   1 
ATOM   178 O O   . ASN A 1 35  ? 79.029 -14.872 7.769  1.00 17.65  ? 35  ASN A O   1 
ATOM   179 C CB  . ASN A 1 35  ? 80.452 -15.787 10.504 1.00 16.06  ? 35  ASN A CB  1 
ATOM   180 C CG  . ASN A 1 35  ? 81.887 -16.209 10.511 1.00 17.00  ? 35  ASN A CG  1 
ATOM   181 O OD1 . ASN A 1 35  ? 82.524 -16.286 9.476  1.00 17.91  ? 35  ASN A OD1 1 
ATOM   182 N ND2 . ASN A 1 35  ? 82.396 -16.494 11.655 1.00 17.64  ? 35  ASN A ND2 1 
ATOM   183 N N   . LYS A 1 36  ? 77.827 -14.198 9.465  1.00 21.82  ? 36  LYS A N   1 
ATOM   184 C CA  . LYS A 1 36  ? 76.544 -14.271 8.805  1.00 24.87  ? 36  LYS A CA  1 
ATOM   185 C C   . LYS A 1 36  ? 76.380 -13.167 7.801  1.00 27.36  ? 36  LYS A C   1 
ATOM   186 O O   . LYS A 1 36  ? 75.748 -13.328 6.772  1.00 27.04  ? 36  LYS A O   1 
ATOM   187 C CB  . LYS A 1 36  ? 75.484 -14.058 9.851  1.00 28.38  ? 36  LYS A CB  1 
ATOM   188 C CG  . LYS A 1 36  ? 74.642 -15.197 10.094 1.00 46.24  ? 36  LYS A CG  1 
ATOM   189 C CD  . LYS A 1 36  ? 73.807 -14.945 11.289 1.00 52.91  ? 36  LYS A CD  1 
ATOM   190 C CE  . LYS A 1 36  ? 72.445 -14.377 10.915 1.00 85.14  ? 36  LYS A CE  1 
ATOM   191 N NZ  . LYS A 1 36  ? 71.600 -14.106 12.115 1.00 73.59  ? 36  LYS A NZ  1 
ATOM   192 N N   . ALA A 1 37  ? 76.916 -12.017 8.171  1.00 28.08  ? 37  ALA A N   1 
ATOM   193 C CA  . ALA A 1 37  ? 76.882 -10.832 7.368  1.00 31.33  ? 37  ALA A CA  1 
ATOM   194 C C   . ALA A 1 37  ? 77.916 -10.881 6.276  1.00 30.47  ? 37  ALA A C   1 
ATOM   195 O O   . ALA A 1 37  ? 77.854 -10.095 5.367  1.00 25.47  ? 37  ALA A O   1 
ATOM   196 C CB  . ALA A 1 37  ? 77.122 -9.658  8.212  1.00 26.53  ? 37  ALA A CB  1 
ATOM   197 N N   . SER A 1 38  ? 78.897 -11.761 6.373  1.00 20.60  ? 38  SER A N   1 
ATOM   198 C CA  . SER A 1 38  ? 79.877 -11.741 5.335  1.00 19.28  ? 38  SER A CA  1 
ATOM   199 C C   . SER A 1 38  ? 79.418 -12.411 4.049  1.00 21.06  ? 38  SER A C   1 
ATOM   200 O O   . SER A 1 38  ? 78.444 -13.150 3.992  1.00 26.00  ? 38  SER A O   1 
ATOM   201 C CB  . SER A 1 38  ? 81.273 -12.130 5.796  1.00 16.68  ? 38  SER A CB  1 
ATOM   202 O OG  . SER A 1 38  ? 81.495 -13.494 5.746  1.00 25.12  ? 38  SER A OG  1 
ATOM   203 N N   . ASN A 1 39  ? 80.123 -12.081 3.003  1.00 19.82  ? 39  ASN A N   1 
ATOM   204 C CA  . ASN A 1 39  ? 79.843 -12.603 1.718  1.00 20.45  ? 39  ASN A CA  1 
ATOM   205 C C   . ASN A 1 39  ? 80.784 -13.752 1.450  1.00 18.41  ? 39  ASN A C   1 
ATOM   206 O O   . ASN A 1 39  ? 80.854 -14.234 0.366  1.00 18.10  ? 39  ASN A O   1 
ATOM   207 C CB  . ASN A 1 39  ? 80.088 -11.507 0.710  1.00 22.72  ? 39  ASN A CB  1 
ATOM   208 C CG  . ASN A 1 39  ? 78.925 -10.582 0.579  1.00 39.72  ? 39  ASN A CG  1 
ATOM   209 O OD1 . ASN A 1 39  ? 77.827 -11.024 0.349  1.00 57.10  ? 39  ASN A OD1 1 
ATOM   210 N ND2 . ASN A 1 39  ? 79.159 -9.292  0.698  1.00 28.88  ? 39  ASN A ND2 1 
ATOM   211 N N   . ASP A 1 40  ? 81.518 -14.152 2.465  1.00 16.15  ? 40  ASP A N   1 
ATOM   212 C CA  . ASP A 1 40  ? 82.567 -15.121 2.357  1.00 14.64  ? 40  ASP A CA  1 
ATOM   213 C C   . ASP A 1 40  ? 82.033 -16.518 2.533  1.00 14.49  ? 40  ASP A C   1 
ATOM   214 O O   . ASP A 1 40  ? 81.274 -16.758 3.419  1.00 16.99  ? 40  ASP A O   1 
ATOM   215 C CB  . ASP A 1 40  ? 83.627 -14.881 3.455  1.00 14.16  ? 40  ASP A CB  1 
ATOM   216 C CG  . ASP A 1 40  ? 84.966 -15.499 3.120  1.00 25.16  ? 40  ASP A CG  1 
ATOM   217 O OD1 . ASP A 1 40  ? 85.052 -16.299 2.142  1.00 16.16  ? 40  ASP A OD1 1 
ATOM   218 O OD2 . ASP A 1 40  ? 85.929 -15.175 3.835  1.00 22.79  ? 40  ASP A OD2 1 
ATOM   219 N N   . MET A 1 41  ? 82.448 -17.459 1.705  1.00 14.85  ? 41  MET A N   1 
ATOM   220 C CA  . MET A 1 41  ? 81.988 -18.828 1.871  1.00 14.91  ? 41  MET A CA  1 
ATOM   221 C C   . MET A 1 41  ? 82.846 -19.487 2.963  1.00 16.06  ? 41  MET A C   1 
ATOM   222 O O   . MET A 1 41  ? 82.502 -20.530 3.420  1.00 17.10  ? 41  MET A O   1 
ATOM   223 C CB  . MET A 1 41  ? 82.106 -19.604 0.549  1.00 15.18  ? 41  MET A CB  1 
ATOM   224 C CG  . MET A 1 41  ? 83.579 -19.923 0.112  1.00 14.61  ? 41  MET A CG  1 
ATOM   225 S SD  . MET A 1 41  ? 83.710 -20.274 -1.655 1.00 15.04  ? 41  MET A SD  1 
ATOM   226 C CE  . MET A 1 41  ? 85.397 -20.972 -1.823 1.00 15.55  ? 41  MET A CE  1 
ATOM   227 N N   . TYR A 1 42  ? 83.974 -18.891 3.356  1.00 13.95  ? 42  TYR A N   1 
ATOM   228 C CA  . TYR A 1 42  ? 84.804 -19.485 4.400  1.00 14.49  ? 42  TYR A CA  1 
ATOM   229 C C   . TYR A 1 42  ? 84.367 -18.958 5.738  1.00 14.47  ? 42  TYR A C   1 
ATOM   230 O O   . TYR A 1 42  ? 83.995 -17.793 5.887  1.00 14.69  ? 42  TYR A O   1 
ATOM   231 C CB  . TYR A 1 42  ? 86.307 -19.131 4.191  1.00 14.69  ? 42  TYR A CB  1 
ATOM   232 C CG  . TYR A 1 42  ? 86.909 -19.893 3.049  1.00 15.26  ? 42  TYR A CG  1 
ATOM   233 C CD1 . TYR A 1 42  ? 87.139 -21.263 3.172  1.00 24.16  ? 42  TYR A CD1 1 
ATOM   234 C CD2 . TYR A 1 42  ? 87.157 -19.282 1.818  1.00 14.98  ? 42  TYR A CD2 1 
ATOM   235 C CE1 . TYR A 1 42  ? 87.644 -21.999 2.135  1.00 18.06  ? 42  TYR A CE1 1 
ATOM   236 C CE2 . TYR A 1 42  ? 87.648 -20.011 0.757  1.00 15.98  ? 42  TYR A CE2 1 
ATOM   237 C CZ  . TYR A 1 42  ? 87.900 -21.383 0.930  1.00 19.16  ? 42  TYR A CZ  1 
ATOM   238 O OH  . TYR A 1 42  ? 88.404 -22.164 -0.088 1.00 18.77  ? 42  TYR A OH  1 
ATOM   239 N N   . HIS A 1 43  ? 84.396 -19.835 6.715  1.00 15.94  ? 43  HIS A N   1 
ATOM   240 C CA  . HIS A 1 43  ? 84.271 -19.447 8.095  1.00 17.43  ? 43  HIS A CA  1 
ATOM   241 C C   . HIS A 1 43  ? 85.507 -18.606 8.572  1.00 15.34  ? 43  HIS A C   1 
ATOM   242 O O   . HIS A 1 43  ? 86.637 -18.980 8.343  1.00 15.94  ? 43  HIS A O   1 
ATOM   243 C CB  . HIS A 1 43  ? 84.117 -20.725 8.913  1.00 19.12  ? 43  HIS A CB  1 
ATOM   244 C CG  . HIS A 1 43  ? 84.003 -20.480 10.377 1.00 31.92  ? 43  HIS A CG  1 
ATOM   245 N ND1 . HIS A 1 43  ? 82.872 -19.935 10.952 1.00 36.05  ? 43  HIS A ND1 1 
ATOM   246 C CD2 . HIS A 1 43  ? 84.878 -20.691 11.387 1.00 33.16  ? 43  HIS A CD2 1 
ATOM   247 C CE1 . HIS A 1 43  ? 83.057 -19.827 12.255 1.00 21.61  ? 43  HIS A CE1 1 
ATOM   248 N NE2 . HIS A 1 43  ? 84.265 -20.281 12.545 1.00 38.52  ? 43  HIS A NE2 1 
ATOM   249 N N   . SER A 1 44  ? 85.275 -17.469 9.236  1.00 17.88  ? 44  SER A N   1 
ATOM   250 C CA  . SER A 1 44  ? 86.342 -16.725 9.948  1.00 14.20  ? 44  SER A CA  1 
ATOM   251 C C   . SER A 1 44  ? 86.205 -16.954 11.457 1.00 18.48  ? 44  SER A C   1 
ATOM   252 O O   . SER A 1 44  ? 85.087 -17.244 11.923 1.00 21.47  ? 44  SER A O   1 
ATOM   253 C CB  . SER A 1 44  ? 86.206 -15.227 9.687  1.00 13.07  ? 44  SER A CB  1 
ATOM   254 O OG  . SER A 1 44  ? 86.913 -14.859 8.519  1.00 13.01  ? 44  SER A OG  1 
ATOM   255 N N   . ARG A 1 45  ? 87.301 -16.824 12.227 1.00 15.98  ? 45  ARG A N   1 
ATOM   256 C CA  . ARG A 1 45  ? 87.228 -16.953 13.719 1.00 17.30  ? 45  ARG A CA  1 
ATOM   257 C C   . ARG A 1 45  ? 88.330 -16.129 14.360 1.00 17.33  ? 45  ARG A C   1 
ATOM   258 O O   . ARG A 1 45  ? 89.266 -15.709 13.672 1.00 19.77  ? 45  ARG A O   1 
ATOM   259 C CB  . ARG A 1 45  ? 87.288 -18.414 14.185 1.00 20.25  ? 45  ARG A CB  1 
ATOM   260 C CG  . ARG A 1 45  ? 88.686 -19.062 14.072 1.00 22.32  ? 45  ARG A CG  1 
ATOM   261 C CD  . ARG A 1 45  ? 88.656 -20.567 14.340 1.00 30.80  ? 45  ARG A CD  1 
ATOM   262 N NE  . ARG A 1 45  ? 89.934 -21.207 14.022 1.00 28.72  ? 45  ARG A NE  1 
ATOM   263 C CZ  . ARG A 1 45  ? 91.014 -21.193 14.803 1.00 51.34  ? 45  ARG A CZ  1 
ATOM   264 N NH1 . ARG A 1 45  ? 91.003 -20.597 16.007 1.00 31.55  ? 45  ARG A NH1 1 
ATOM   265 N NH2 . ARG A 1 45  ? 92.110 -21.799 14.372 1.00 34.33  ? 45  ARG A NH2 1 
ATOM   266 N N   . ALA A 1 46  ? 88.221 -15.907 15.662 1.00 18.09  ? 46  ALA A N   1 
ATOM   267 C CA  . ALA A 1 46  ? 89.144 -15.057 16.409 1.00 18.33  ? 46  ALA A CA  1 
ATOM   268 C C   . ALA A 1 46  ? 90.578 -15.560 16.364 1.00 23.33  ? 46  ALA A C   1 
ATOM   269 O O   . ALA A 1 46  ? 90.864 -16.748 16.598 1.00 25.57  ? 46  ALA A O   1 
ATOM   270 C CB  . ALA A 1 46  ? 88.679 -14.946 17.848 1.00 19.16  ? 46  ALA A CB  1 
ATOM   271 N N   . LEU A 1 47  ? 91.489 -14.665 16.019 1.00 27.38  ? 47  LEU A N   1 
ATOM   272 C CA  . LEU A 1 47  ? 92.896 -14.985 16.119 1.00 23.57  ? 47  LEU A CA  1 
ATOM   273 C C   . LEU A 1 47  ? 93.359 -14.621 17.500 1.00 25.57  ? 47  LEU A C   1 
ATOM   274 O O   . LEU A 1 47  ? 94.134 -15.351 18.123 1.00 33.77  ? 47  LEU A O   1 
ATOM   275 C CB  . LEU A 1 47  ? 93.725 -14.216 15.105 1.00 27.53  ? 47  LEU A CB  1 
ATOM   276 C CG  . LEU A 1 47  ? 93.991 -14.867 13.749 1.00 35.71  ? 47  LEU A CG  1 
ATOM   277 C CD1 . LEU A 1 47  ? 94.326 -13.839 12.684 1.00 31.14  ? 47  LEU A CD1 1 
ATOM   278 C CD2 . LEU A 1 47  ? 95.119 -15.842 13.875 1.00 28.68  ? 47  LEU A CD2 1 
ATOM   279 N N   . GLN A 1 48  ? 92.863 -13.499 18.003 1.00 30.20  ? 48  GLN A N   1 
ATOM   280 C CA  . GLN A 1 48  ? 93.372 -12.934 19.247 1.00 29.64  ? 48  GLN A CA  1 
ATOM   281 C C   . GLN A 1 48  ? 92.323 -11.961 19.718 1.00 29.81  ? 48  GLN A C   1 
ATOM   282 O O   . GLN A 1 48  ? 91.738 -11.254 18.899 1.00 32.45  ? 48  GLN A O   1 
ATOM   283 C CB  . GLN A 1 48  ? 94.682 -12.203 18.937 1.00 26.61  ? 48  GLN A CB  1 
ATOM   284 C CG  . GLN A 1 48  ? 95.374 -11.513 20.083 1.00 34.13  ? 48  GLN A CG  1 
ATOM   285 C CD  . GLN A 1 48  ? 96.347 -10.436 19.598 1.00 54.37  ? 48  GLN A CD  1 
ATOM   286 O OE1 . GLN A 1 48  ? 96.467 -10.145 18.387 1.00 48.94  ? 48  GLN A OE1 1 
ATOM   287 N NE2 . GLN A 1 48  ? 97.036 -9.827  20.545 1.00 56.95  ? 48  GLN A NE2 1 
ATOM   288 N N   . VAL A 1 49  ? 92.067 -11.927 21.023 1.00 26.07  ? 49  VAL A N   1 
ATOM   289 C CA  . VAL A 1 49  ? 91.225 -10.901 21.580 1.00 20.77  ? 49  VAL A CA  1 
ATOM   290 C C   . VAL A 1 49  ? 92.146 -9.846  22.111 1.00 26.74  ? 49  VAL A C   1 
ATOM   291 O O   . VAL A 1 49  ? 92.867 -10.108 23.066 1.00 26.96  ? 49  VAL A O   1 
ATOM   292 C CB  . VAL A 1 49  ? 90.360 -11.423 22.720 1.00 23.04  ? 49  VAL A CB  1 
ATOM   293 C CG1 . VAL A 1 49  ? 89.566 -10.262 23.368 1.00 20.10  ? 49  VAL A CG1 1 
ATOM   294 C CG2 . VAL A 1 49  ? 89.424 -12.508 22.191 1.00 21.13  ? 49  VAL A CG2 1 
ATOM   295 N N   . VAL A 1 50  ? 92.124 -8.653  21.504 1.00 23.66  ? 50  VAL A N   1 
ATOM   296 C CA  . VAL A 1 50  ? 93.058 -7.586  21.884 1.00 22.75  ? 50  VAL A CA  1 
ATOM   297 C C   . VAL A 1 50  ? 92.617 -6.925  23.182 1.00 24.06  ? 50  VAL A C   1 
ATOM   298 O O   . VAL A 1 50  ? 93.435 -6.576  24.026 1.00 25.09  ? 50  VAL A O   1 
ATOM   299 C CB  . VAL A 1 50  ? 93.234 -6.517  20.770 1.00 24.20  ? 50  VAL A CB  1 
ATOM   300 C CG1 . VAL A 1 50  ? 94.062 -5.310  21.301 1.00 28.82  ? 50  VAL A CG1 1 
ATOM   301 C CG2 . VAL A 1 50  ? 93.914 -7.113  19.540 1.00 24.16  ? 50  VAL A CG2 1 
ATOM   302 N N   . ARG A 1 51  ? 91.317 -6.725  23.328 1.00 23.38  ? 51  ARG A N   1 
ATOM   303 C CA  . ARG A 1 51  ? 90.778 -6.137  24.545 1.00 20.77  ? 51  ARG A CA  1 
ATOM   304 C C   . ARG A 1 51  ? 89.324 -6.539  24.708 1.00 21.24  ? 51  ARG A C   1 
ATOM   305 O O   . ARG A 1 51  ? 88.619 -6.741  23.720 1.00 22.37  ? 51  ARG A O   1 
ATOM   306 C CB  . ARG A 1 51  ? 90.896 -4.615  24.559 1.00 21.49  ? 51  ARG A CB  1 
ATOM   307 C CG  . ARG A 1 51  ? 90.854 -4.096  25.976 1.00 22.30  ? 51  ARG A CG  1 
ATOM   308 C CD  . ARG A 1 51  ? 91.863 -3.004  26.195 1.00 27.23  ? 51  ARG A CD  1 
ATOM   309 N NE  . ARG A 1 51  ? 91.725 -2.447  27.542 1.00 27.74  ? 51  ARG A NE  1 
ATOM   310 C CZ  . ARG A 1 51  ? 92.205 -1.260  27.924 1.00 31.04  ? 51  ARG A CZ  1 
ATOM   311 N NH1 . ARG A 1 51  ? 92.883 -0.489  27.078 1.00 33.46  ? 51  ARG A NH1 1 
ATOM   312 N NH2 . ARG A 1 51  ? 92.005 -0.846  29.160 1.00 27.47  ? 51  ARG A NH2 1 
ATOM   313 N N   . ALA A 1 52  ? 88.895 -6.656  25.959 1.00 20.27  ? 52  ALA A N   1 
ATOM   314 C CA  . ALA A 1 52  ? 87.515 -6.915  26.291 1.00 20.26  ? 52  ALA A CA  1 
ATOM   315 C C   . ALA A 1 52  ? 87.179 -6.049  27.488 1.00 21.23  ? 52  ALA A C   1 
ATOM   316 O O   . ALA A 1 52  ? 87.820 -6.141  28.537 1.00 25.02  ? 52  ALA A O   1 
ATOM   317 C CB  . ALA A 1 52  ? 87.302 -8.400  26.580 1.00 21.28  ? 52  ALA A CB  1 
ATOM   318 N N   . ARG A 1 53  ? 86.200 -5.167  27.313 1.00 33.75  ? 53  ARG A N   1 
ATOM   319 C CA  . ARG A 1 53  ? 85.724 -4.281  28.380 1.00 27.55  ? 53  ARG A CA  1 
ATOM   320 C C   . ARG A 1 53  ? 84.209 -4.379  28.409 1.00 24.91  ? 53  ARG A C   1 
ATOM   321 O O   . ARG A 1 53  ? 83.590 -4.854  27.477 1.00 25.14  ? 53  ARG A O   1 
ATOM   322 C CB  . ARG A 1 53  ? 86.200 -2.832  28.179 1.00 29.32  ? 53  ARG A CB  1 
ATOM   323 C CG  . ARG A 1 53  ? 87.700 -2.656  27.917 1.00 33.21  ? 53  ARG A CG  1 
ATOM   324 C CD  . ARG A 1 53  ? 88.090 -1.217  28.000 1.00 35.90  ? 53  ARG A CD  1 
ATOM   325 N NE  . ARG A 1 53  ? 87.363 -0.417  27.016 1.00 54.74  ? 53  ARG A NE  1 
ATOM   326 C CZ  . ARG A 1 53  ? 87.461 0.909   26.904 1.00 75.92  ? 53  ARG A CZ  1 
ATOM   327 N NH1 . ARG A 1 53  ? 88.264 1.581   27.717 1.00 86.39  ? 53  ARG A NH1 1 
ATOM   328 N NH2 . ARG A 1 53  ? 86.755 1.573   25.987 1.00 43.46  ? 53  ARG A NH2 1 
ATOM   329 N N   . LYS A 1 54  ? 83.611 -3.925  29.492 1.00 23.10  ? 54  LYS A N   1 
ATOM   330 C CA  . LYS A 1 54  ? 82.181 -4.075  29.701 1.00 26.05  ? 54  LYS A CA  1 
ATOM   331 C C   . LYS A 1 54  ? 81.672 -2.921  30.568 1.00 27.54  ? 54  LYS A C   1 
ATOM   332 O O   . LYS A 1 54  ? 82.446 -2.309  31.322 1.00 21.67  ? 54  LYS A O   1 
ATOM   333 C CB  . LYS A 1 54  ? 81.865 -5.429  30.354 1.00 31.41  ? 54  LYS A CB  1 
ATOM   334 C CG  . LYS A 1 54  ? 82.015 -5.457  31.861 1.00 23.02  ? 54  LYS A CG  1 
ATOM   335 C CD  . LYS A 1 54  ? 81.513 -6.808  32.413 1.00 46.95  ? 54  LYS A CD  1 
ATOM   336 C CE  . LYS A 1 54  ? 82.152 -7.109  33.788 1.00 38.32  ? 54  LYS A CE  1 
ATOM   337 N NZ  . LYS A 1 54  ? 81.599 -8.374  34.340 1.00 39.15  ? 54  LYS A NZ  1 
ATOM   338 N N   . GLN A 1 55  ? 80.383 -2.611  30.428 1.00 18.88  ? 55  GLN A N   1 
ATOM   339 C CA  . GLN A 1 55  ? 79.797 -1.439  31.074 1.00 18.96  ? 55  GLN A CA  1 
ATOM   340 C C   . GLN A 1 55  ? 78.314 -1.687  31.238 1.00 24.25  ? 55  GLN A C   1 
ATOM   341 O O   . GLN A 1 55  ? 77.627 -2.013  30.259 1.00 26.00  ? 55  GLN A O   1 
ATOM   342 C CB  . GLN A 1 55  ? 80.021 -0.217  30.193 1.00 23.70  ? 55  GLN A CB  1 
ATOM   343 C CG  . GLN A 1 55  ? 79.476 1.035   30.742 1.00 23.14  ? 55  GLN A CG  1 
ATOM   344 C CD  . GLN A 1 55  ? 79.537 2.152   29.720 1.00 58.13  ? 55  GLN A CD  1 
ATOM   345 O OE1 . GLN A 1 55  ? 80.214 3.162   29.954 1.00 45.40  ? 55  GLN A OE1 1 
ATOM   346 N NE2 . GLN A 1 55  ? 78.832 1.984   28.570 1.00 26.41  ? 55  GLN A NE2 1 
ATOM   347 N N   . ILE A 1 56  ? 77.826 -1.574  32.468 1.00 18.30  ? 56  ILE A N   1 
ATOM   348 C CA  . ILE A 1 56  ? 76.382 -1.624  32.705 1.00 17.85  ? 56  ILE A CA  1 
ATOM   349 C C   . ILE A 1 56  ? 75.779 -0.282  32.279 1.00 17.36  ? 56  ILE A C   1 
ATOM   350 O O   . ILE A 1 56  ? 76.358 0.757   32.555 1.00 18.93  ? 56  ILE A O   1 
ATOM   351 C CB  . ILE A 1 56  ? 76.095 -1.844  34.165 1.00 20.29  ? 56  ILE A CB  1 
ATOM   352 C CG1 . ILE A 1 56  ? 76.649 -3.198  34.585 1.00 31.29  ? 56  ILE A CG1 1 
ATOM   353 C CG2 . ILE A 1 56  ? 74.595 -1.805  34.432 1.00 22.47  ? 56  ILE A CG2 1 
ATOM   354 C CD1 . ILE A 1 56  ? 76.868 -3.273  36.096 1.00 44.60  ? 56  ILE A CD1 1 
ATOM   355 N N   . VAL A 1 57  ? 74.622 -0.305  31.622 1.00 15.91  ? 57  VAL A N   1 
ATOM   356 C CA  . VAL A 1 57  ? 73.967 0.920   31.175 1.00 15.96  ? 57  VAL A CA  1 
ATOM   357 C C   . VAL A 1 57  ? 72.500 0.830   31.569 1.00 17.38  ? 57  VAL A C   1 
ATOM   358 O O   . VAL A 1 57  ? 71.938 -0.242  31.510 1.00 25.17  ? 57  VAL A O   1 
ATOM   359 C CB  . VAL A 1 57  ? 74.072 1.135   29.627 1.00 14.51  ? 57  VAL A CB  1 
ATOM   360 C CG1 . VAL A 1 57  ? 75.531 1.340   29.221 1.00 15.79  ? 57  VAL A CG1 1 
ATOM   361 C CG2 . VAL A 1 57  ? 73.481 -0.094  28.888 1.00 13.11  ? 57  VAL A CG2 1 
ATOM   362 N N   . ALA A 1 58  ? 71.918 1.931   32.044 1.00 16.97  ? 58  ALA A N   1 
ATOM   363 C CA  . ALA A 1 58  ? 70.486 2.023   32.214 1.00 17.10  ? 58  ALA A CA  1 
ATOM   364 C C   . ALA A 1 58  ? 69.953 3.151   31.318 1.00 18.69  ? 58  ALA A C   1 
ATOM   365 O O   . ALA A 1 58  ? 70.675 4.092   30.950 1.00 17.34  ? 58  ALA A O   1 
ATOM   366 C CB  . ALA A 1 58  ? 70.143 2.283   33.659 1.00 22.89  ? 58  ALA A CB  1 
ATOM   367 N N   . GLY A 1 59  ? 68.685 3.042   30.989 1.00 15.51  ? 59  GLY A N   1 
ATOM   368 C CA  . GLY A 1 59  ? 68.040 3.877   30.031 1.00 14.73  ? 59  GLY A CA  1 
ATOM   369 C C   . GLY A 1 59  ? 66.547 3.756   30.255 1.00 16.99  ? 59  GLY A C   1 
ATOM   370 O O   . GLY A 1 59  ? 66.071 3.005   31.142 1.00 16.06  ? 59  GLY A O   1 
ATOM   371 N N   . VAL A 1 60  ? 65.800 4.529   29.468 1.00 14.35  ? 60  VAL A N   1 
ATOM   372 C CA  . VAL A 1 60  ? 64.347 4.581   29.612 1.00 16.60  ? 60  VAL A CA  1 
ATOM   373 C C   . VAL A 1 60  ? 63.865 4.443   28.200 1.00 16.71  ? 60  VAL A C   1 
ATOM   374 O O   . VAL A 1 60  ? 64.304 5.218   27.297 1.00 12.37  ? 60  VAL A O   1 
ATOM   375 C CB  . VAL A 1 60  ? 63.845 5.939   30.174 1.00 17.51  ? 60  VAL A CB  1 
ATOM   376 C CG1 . VAL A 1 60  ? 62.364 5.879   30.467 1.00 18.47  ? 60  VAL A CG1 1 
ATOM   377 C CG2 . VAL A 1 60  ? 64.573 6.310   31.433 1.00 20.80  ? 60  VAL A CG2 1 
ATOM   378 N N   . ASN A 1 61  ? 63.012 3.442   27.993 1.00 12.02  ? 61  ASN A N   1 
ATOM   379 C CA  . ASN A 1 61  ? 62.275 3.337   26.742 1.00 10.94  ? 61  ASN A CA  1 
ATOM   380 C C   . ASN A 1 61  ? 60.950 4.071   26.896 1.00 19.40  ? 61  ASN A C   1 
ATOM   381 O O   . ASN A 1 61  ? 60.186 3.812   27.858 1.00 18.07  ? 61  ASN A O   1 
ATOM   382 C CB  . ASN A 1 61  ? 61.992 1.863   26.398 1.00 20.34  ? 61  ASN A CB  1 
ATOM   383 C CG  . ASN A 1 61  ? 63.201 1.131   25.823 1.00 12.59  ? 61  ASN A CG  1 
ATOM   384 O OD1 . ASN A 1 61  ? 63.916 1.647   24.943 1.00 15.22  ? 61  ASN A OD1 1 
ATOM   385 N ND2 . ASN A 1 61  ? 63.422 -0.093  26.303 1.00 11.88  ? 61  ASN A ND2 1 
ATOM   386 N N   . TYR A 1 62  ? 60.651 4.976   25.963 1.00 15.51  ? 62  TYR A N   1 
ATOM   387 C CA  . TYR A 1 62  ? 59.267 5.468   25.830 1.00 11.95  ? 62  TYR A CA  1 
ATOM   388 C C   . TYR A 1 62  ? 58.532 4.769   24.674 1.00 11.20  ? 62  TYR A C   1 
ATOM   389 O O   . TYR A 1 62  ? 59.097 4.596   23.600 1.00 11.59  ? 62  TYR A O   1 
ATOM   390 C CB  . TYR A 1 62  ? 59.313 6.956   25.587 1.00 12.98  ? 62  TYR A CB  1 
ATOM   391 C CG  . TYR A 1 62  ? 59.910 7.711   26.718 1.00 16.25  ? 62  TYR A CG  1 
ATOM   392 C CD1 . TYR A 1 62  ? 61.265 8.027   26.735 1.00 23.71  ? 62  TYR A CD1 1 
ATOM   393 C CD2 . TYR A 1 62  ? 59.120 8.094   27.815 1.00 29.99  ? 62  TYR A CD2 1 
ATOM   394 C CE1 . TYR A 1 62  ? 61.808 8.743   27.797 1.00 24.53  ? 62  TYR A CE1 1 
ATOM   395 C CE2 . TYR A 1 62  ? 59.643 8.798   28.865 1.00 20.56  ? 62  TYR A CE2 1 
ATOM   396 C CZ  . TYR A 1 62  ? 60.993 9.120   28.869 1.00 22.29  ? 62  TYR A CZ  1 
ATOM   397 O OH  . TYR A 1 62  ? 61.506 9.857   29.941 1.00 33.49  ? 62  TYR A OH  1 
ATOM   398 N N   . PHE A 1 63  ? 57.299 4.342   24.904 1.00 12.98  ? 63  PHE A N   1 
ATOM   399 C CA  . PHE A 1 63  ? 56.461 3.703   23.879 1.00 13.72  ? 63  PHE A CA  1 
ATOM   400 C C   . PHE A 1 63  ? 55.225 4.577   23.634 1.00 21.24  ? 63  PHE A C   1 
ATOM   401 O O   . PHE A 1 63  ? 54.282 4.599   24.456 1.00 14.36  ? 63  PHE A O   1 
ATOM   402 C CB  . PHE A 1 63  ? 56.021 2.314   24.328 1.00 14.23  ? 63  PHE A CB  1 
ATOM   403 C CG  . PHE A 1 63  ? 57.166 1.407   24.670 1.00 24.94  ? 63  PHE A CG  1 
ATOM   404 C CD1 . PHE A 1 63  ? 57.594 1.265   25.996 1.00 35.71  ? 63  PHE A CD1 1 
ATOM   405 C CD2 . PHE A 1 63  ? 57.823 0.687   23.677 1.00 31.48  ? 63  PHE A CD2 1 
ATOM   406 C CE1 . PHE A 1 63  ? 58.655 0.404   26.336 1.00 15.42  ? 63  PHE A CE1 1 
ATOM   407 C CE2 . PHE A 1 63  ? 58.871 -0.148  23.995 1.00 20.54  ? 63  PHE A CE2 1 
ATOM   408 C CZ  . PHE A 1 63  ? 59.275 -0.304  25.349 1.00 18.72  ? 63  PHE A CZ  1 
ATOM   409 N N   . LEU A 1 64  ? 55.244 5.249   22.479 1.00 12.38  ? 64  LEU A N   1 
ATOM   410 C CA  . LEU A 1 64  ? 54.292 6.263   22.081 1.00 12.95  ? 64  LEU A CA  1 
ATOM   411 C C   . LEU A 1 64  ? 53.421 5.806   20.923 1.00 13.69  ? 64  LEU A C   1 
ATOM   412 O O   . LEU A 1 64  ? 53.908 5.488   19.833 1.00 16.61  ? 64  LEU A O   1 
ATOM   413 C CB  . LEU A 1 64  ? 55.029 7.539   21.689 1.00 13.84  ? 64  LEU A CB  1 
ATOM   414 C CG  . LEU A 1 64  ? 56.026 8.108   22.713 1.00 18.94  ? 64  LEU A CG  1 
ATOM   415 C CD1 . LEU A 1 64  ? 56.666 9.357   22.193 1.00 15.14  ? 64  LEU A CD1 1 
ATOM   416 C CD2 . LEU A 1 64  ? 55.326 8.408   24.025 1.00 24.96  ? 64  LEU A CD2 1 
ATOM   417 N N   . ASP A 1 65  ? 52.133 5.716   21.191 1.00 14.65  ? 65  ASP A N   1 
ATOM   418 C CA  . ASP A 1 65  ? 51.157 5.587   20.149 1.00 15.81  ? 65  ASP A CA  1 
ATOM   419 C C   . ASP A 1 65  ? 50.552 6.963   19.850 1.00 15.97  ? 65  ASP A C   1 
ATOM   420 O O   . ASP A 1 65  ? 49.971 7.601   20.721 1.00 16.33  ? 65  ASP A O   1 
ATOM   421 C CB  . ASP A 1 65  ? 50.157 4.539   20.568 1.00 17.71  ? 65  ASP A CB  1 
ATOM   422 C CG  . ASP A 1 65  ? 50.798 3.159   20.601 1.00 33.60  ? 65  ASP A CG  1 
ATOM   423 O OD1 . ASP A 1 65  ? 51.081 2.694   19.479 1.00 20.71  ? 65  ASP A OD1 1 
ATOM   424 O OD2 . ASP A 1 65  ? 51.076 2.575   21.698 1.00 19.29  ? 65  ASP A OD2 1 
ATOM   425 N N   . VAL A 1 66  ? 50.746 7.426   18.616 1.00 17.09  ? 66  VAL A N   1 
ATOM   426 C CA  . VAL A 1 66  ? 50.455 8.794   18.231 1.00 17.43  ? 66  VAL A CA  1 
ATOM   427 C C   . VAL A 1 66  ? 49.789 8.859   16.856 1.00 24.32  ? 66  VAL A C   1 
ATOM   428 O O   . VAL A 1 66  ? 50.339 8.372   15.865 1.00 23.98  ? 66  VAL A O   1 
ATOM   429 C CB  . VAL A 1 66  ? 51.753 9.667   18.139 1.00 17.87  ? 66  VAL A CB  1 
ATOM   430 C CG1 . VAL A 1 66  ? 51.384 11.152  18.024 1.00 19.99  ? 66  VAL A CG1 1 
ATOM   431 C CG2 . VAL A 1 66  ? 52.674 9.447   19.330 1.00 16.46  ? 66  VAL A CG2 1 
ATOM   432 N N   . GLU A 1 67  ? 48.633 9.513   16.778 1.00 27.37  ? 67  GLU A N   1 
ATOM   433 C CA  . GLU A 1 67  ? 48.113 9.876   15.484 1.00 25.43  ? 67  GLU A CA  1 
ATOM   434 C C   . GLU A 1 67  ? 48.782 11.148  15.020 1.00 23.34  ? 67  GLU A C   1 
ATOM   435 O O   . GLU A 1 67  ? 48.835 12.123  15.737 1.00 24.03  ? 67  GLU A O   1 
ATOM   436 C CB  . GLU A 1 67  ? 46.594 10.009  15.498 1.00 26.66  ? 67  GLU A CB  1 
ATOM   437 C CG  . GLU A 1 67  ? 46.061 10.415  14.146 1.00 26.18  ? 67  GLU A CG  1 
ATOM   438 C CD  . GLU A 1 67  ? 44.540 10.447  14.041 1.00 48.65  ? 67  GLU A CD  1 
ATOM   439 O OE1 . GLU A 1 67  ? 43.865 10.590  15.098 1.00 30.87  ? 67  GLU A OE1 1 
ATOM   440 O OE2 . GLU A 1 67  ? 44.035 10.345  12.881 1.00 37.76  ? 67  GLU A OE2 1 
ATOM   441 N N   . VAL A 1 68  ? 49.262 11.126  13.795 1.00 21.80  ? 68  VAL A N   1 
ATOM   442 C CA  . VAL A 1 68  ? 50.064 12.181  13.191 1.00 20.25  ? 68  VAL A CA  1 
ATOM   443 C C   . VAL A 1 68  ? 49.326 12.645  11.936 1.00 18.83  ? 68  VAL A C   1 
ATOM   444 O O   . VAL A 1 68  ? 48.756 11.830  11.197 1.00 19.42  ? 68  VAL A O   1 
ATOM   445 C CB  . VAL A 1 68  ? 51.443 11.564  12.905 1.00 21.12  ? 68  VAL A CB  1 
ATOM   446 C CG1 . VAL A 1 68  ? 51.892 11.712  11.480 1.00 20.25  ? 68  VAL A CG1 1 
ATOM   447 C CG2 . VAL A 1 68  ? 52.449 12.060  13.865 1.00 22.76  ? 68  VAL A CG2 1 
ATOM   448 N N   . GLY A 1 69  ? 49.294 13.953  11.713 1.00 19.50  ? 69  GLY A N   1 
ATOM   449 C CA  . GLY A 1 69  ? 48.498 14.552  10.618 1.00 17.61  ? 69  GLY A CA  1 
ATOM   450 C C   . GLY A 1 69  ? 49.342 15.534  9.830  1.00 16.52  ? 69  GLY A C   1 
ATOM   451 O O   . GLY A 1 69  ? 50.171 16.220  10.428 1.00 17.09  ? 69  GLY A O   1 
ATOM   452 N N   . ARG A 1 70  ? 49.126 15.609  8.504  1.00 15.88  ? 70  ARG A N   1 
ATOM   453 C CA  . ARG A 1 70  ? 49.898 16.488  7.608  1.00 15.18  ? 70  ARG A CA  1 
ATOM   454 C C   . ARG A 1 70  ? 49.429 17.963  7.733  1.00 19.48  ? 70  ARG A C   1 
ATOM   455 O O   . ARG A 1 70  ? 48.204 18.236  7.700  1.00 18.28  ? 70  ARG A O   1 
ATOM   456 C CB  . ARG A 1 70  ? 49.727 15.995  6.186  1.00 15.17  ? 70  ARG A CB  1 
ATOM   457 C CG  . ARG A 1 70  ? 50.800 16.356  5.201  1.00 14.91  ? 70  ARG A CG  1 
ATOM   458 C CD  . ARG A 1 70  ? 50.352 15.974  3.811  1.00 16.08  ? 70  ARG A CD  1 
ATOM   459 N NE  . ARG A 1 70  ? 51.415 16.082  2.818  1.00 19.26  ? 70  ARG A NE  1 
ATOM   460 C CZ  . ARG A 1 70  ? 51.242 16.062  1.486  1.00 18.44  ? 70  ARG A CZ  1 
ATOM   461 N NH1 . ARG A 1 70  ? 50.016 16.012  0.969  1.00 19.75  ? 70  ARG A NH1 1 
ATOM   462 N NH2 . ARG A 1 70  ? 52.298 16.143  0.680  1.00 19.73  ? 70  ARG A NH2 1 
ATOM   463 N N   . THR A 1 71  ? 50.371 18.893  7.901  1.00 17.04  ? 71  THR A N   1 
ATOM   464 C CA  . THR A 1 71  ? 50.039 20.306  8.010  1.00 19.72  ? 71  THR A CA  1 
ATOM   465 C C   . THR A 1 71  ? 50.256 21.039  6.683  1.00 19.58  ? 71  THR A C   1 
ATOM   466 O O   . THR A 1 71  ? 50.805 20.507  5.727  1.00 20.96  ? 71  THR A O   1 
ATOM   467 C CB  . THR A 1 71  ? 50.793 21.068  9.165  1.00 23.00  ? 71  THR A CB  1 
ATOM   468 O OG1 . THR A 1 71  ? 52.143 21.356  8.789  1.00 23.16  ? 71  THR A OG1 1 
ATOM   469 C CG2 . THR A 1 71  ? 50.725 20.338  10.533 1.00 23.75  ? 71  THR A CG2 1 
ATOM   470 N N   . THR A 1 72  ? 49.798 22.274  6.630  1.00 24.40  ? 72  THR A N   1 
ATOM   471 C CA  . THR A 1 72  ? 49.902 23.077  5.437  1.00 23.53  ? 72  THR A CA  1 
ATOM   472 C C   . THR A 1 72  ? 51.203 23.920  5.412  1.00 25.96  ? 72  THR A C   1 
ATOM   473 O O   . THR A 1 72  ? 51.521 24.534  4.387  1.00 32.70  ? 72  THR A O   1 
ATOM   474 C CB  . THR A 1 72  ? 48.586 23.940  5.236  1.00 29.85  ? 72  THR A CB  1 
ATOM   475 O OG1 . THR A 1 72  ? 48.279 24.680  6.418  1.00 32.37  ? 72  THR A OG1 1 
ATOM   476 C CG2 . THR A 1 72  ? 47.376 23.046  4.938  1.00 26.69  ? 72  THR A CG2 1 
ATOM   477 N N   . CYS A 1 73  ? 51.957 23.964  6.517  1.00 26.91  ? 73  CYS A N   1 
ATOM   478 C CA  . CYS A 1 73  ? 53.302 24.576  6.489  1.00 29.42  ? 73  CYS A CA  1 
ATOM   479 C C   . CYS A 1 73  ? 54.351 23.667  5.847  1.00 26.25  ? 73  CYS A C   1 
ATOM   480 O O   . CYS A 1 73  ? 54.276 22.444  5.967  1.00 24.79  ? 73  CYS A O   1 
ATOM   481 C CB  . CYS A 1 73  ? 53.778 24.916  7.896  1.00 35.65  ? 73  CYS A CB  1 
ATOM   482 S SG  . CYS A 1 73  ? 52.706 26.001  8.907  1.00 50.25  ? 73  CYS A SG  1 
ATOM   483 N N   . THR A 1 74  ? 55.319 24.253  5.164  1.00 46.48  ? 74  THR A N   1 
ATOM   484 C CA  . THR A 1 74  ? 56.478 23.500  4.729  1.00 46.34  ? 74  THR A CA  1 
ATOM   485 C C   . THR A 1 74  ? 57.506 23.408  5.859  1.00 48.98  ? 74  THR A C   1 
ATOM   486 O O   . THR A 1 74  ? 57.478 24.176  6.825  1.00 51.42  ? 74  THR A O   1 
ATOM   487 C CB  . THR A 1 74  ? 57.131 24.122  3.523  1.00 47.54  ? 74  THR A CB  1 
ATOM   488 O OG1 . THR A 1 74  ? 57.610 25.417  3.889  1.00 50.72  ? 74  THR A OG1 1 
ATOM   489 C CG2 . THR A 1 74  ? 56.146 24.253  2.403  1.00 45.36  ? 74  THR A CG2 1 
ATOM   490 N N   . LYS A 1 75  ? 58.415 22.446  5.734  1.00 49.16  ? 75  LYS A N   1 
ATOM   491 C CA  . LYS A 1 75  ? 59.470 22.245  6.728  1.00 52.06  ? 75  LYS A CA  1 
ATOM   492 C C   . LYS A 1 75  ? 60.389 23.480  6.855  1.00 60.91  ? 75  LYS A C   1 
ATOM   493 O O   . LYS A 1 75  ? 61.025 23.701  7.901  1.00 65.05  ? 75  LYS A O   1 
ATOM   494 C CB  . LYS A 1 75  ? 60.267 20.970  6.381  1.00 57.93  ? 75  LYS A CB  1 
ATOM   495 C CG  . LYS A 1 75  ? 59.479 19.673  6.413  1.00 48.19  ? 75  LYS A CG  1 
ATOM   496 C CD  . LYS A 1 75  ? 60.379 18.528  6.037  1.00 49.22  ? 75  LYS A CD  1 
ATOM   497 C CE  . LYS A 1 75  ? 59.627 17.226  6.122  1.00 45.85  ? 75  LYS A CE  1 
ATOM   498 N NZ  . LYS A 1 75  ? 60.298 16.101  5.405  1.00 47.00  ? 75  LYS A NZ  1 
ATOM   499 N N   . THR A 1 76  ? 60.403 24.303  5.799  1.00 69.35  ? 76  THR A N   1 
ATOM   500 C CA  . THR A 1 76  ? 61.277 25.494  5.665  1.00 71.54  ? 76  THR A CA  1 
ATOM   501 C C   . THR A 1 76  ? 60.712 26.830  6.198  1.00 63.50  ? 76  THR A C   1 
ATOM   502 O O   . THR A 1 76  ? 61.216 27.898  5.852  1.00 72.00  ? 76  THR A O   1 
ATOM   503 C CB  . THR A 1 76  ? 61.695 25.715  4.165  1.00 77.08  ? 76  THR A CB  1 
ATOM   504 O OG1 . THR A 1 76  ? 60.552 26.096  3.385  1.00 59.48  ? 76  THR A OG1 1 
ATOM   505 C CG2 . THR A 1 76  ? 62.366 24.466  3.563  1.00 63.59  ? 76  THR A CG2 1 
ATOM   506 N N   . GLN A 1 77  ? 59.685 26.785  7.044  1.00 70.81  ? 77  GLN A N   1 
ATOM   507 C CA  . GLN A 1 77  ? 59.009 28.022  7.493  1.00 68.15  ? 77  GLN A CA  1 
ATOM   508 C C   . GLN A 1 77  ? 58.740 28.078  9.011  1.00 66.77  ? 77  GLN A C   1 
ATOM   509 O O   . GLN A 1 77  ? 58.830 27.042  9.687  1.00 65.45  ? 77  GLN A O   1 
ATOM   510 C CB  . GLN A 1 77  ? 57.743 28.294  6.642  1.00 60.30  ? 77  GLN A CB  1 
ATOM   511 C CG  . GLN A 1 77  ? 56.473 27.629  7.079  1.00 57.65  ? 77  GLN A CG  1 
ATOM   512 C CD  . GLN A 1 77  ? 55.316 27.890  6.106  1.00 60.02  ? 77  GLN A CD  1 
ATOM   513 O OE1 . GLN A 1 77  ? 55.026 27.087  5.213  1.00 51.47  ? 77  GLN A OE1 1 
ATOM   514 N NE2 . GLN A 1 77  ? 54.665 29.025  6.273  1.00 65.92  ? 77  GLN A NE2 1 
ATOM   515 N N   . PRO A 1 78  ? 58.421 29.289  9.547  1.00 72.63  ? 78  PRO A N   1 
ATOM   516 C CA  . PRO A 1 78  ? 58.303 29.473  11.005 1.00 75.47  ? 78  PRO A CA  1 
ATOM   517 C C   . PRO A 1 78  ? 57.034 28.911  11.654 1.00 73.83  ? 78  PRO A C   1 
ATOM   518 O O   . PRO A 1 78  ? 56.030 28.678  10.982 1.00 70.21  ? 78  PRO A O   1 
ATOM   519 C CB  . PRO A 1 78  ? 58.344 31.002  11.177 1.00 83.30  ? 78  PRO A CB  1 
ATOM   520 C CG  . PRO A 1 78  ? 57.759 31.532  9.904  1.00 89.68  ? 78  PRO A CG  1 
ATOM   521 C CD  . PRO A 1 78  ? 58.183 30.556  8.815  1.00 72.04  ? 78  PRO A CD  1 
ATOM   522 N N   . ASN A 1 79  ? 57.125 28.683  12.964 1.00 83.13  ? 79  ASN A N   1 
ATOM   523 C CA  . ASN A 1 79  ? 55.980 28.415  13.842 1.00 84.23  ? 79  ASN A CA  1 
ATOM   524 C C   . ASN A 1 79  ? 55.119 27.212  13.472 1.00 75.29  ? 79  ASN A C   1 
ATOM   525 O O   . ASN A 1 79  ? 53.914 27.333  13.268 1.00 74.03  ? 79  ASN A O   1 
ATOM   526 C CB  . ASN A 1 79  ? 55.129 29.678  13.984 1.00 95.73  ? 79  ASN A CB  1 
ATOM   527 C CG  . ASN A 1 79  ? 54.532 29.808  15.359 1.00 114.13 ? 79  ASN A CG  1 
ATOM   528 O OD1 . ASN A 1 79  ? 53.585 29.101  15.712 1.00 119.41 ? 79  ASN A OD1 1 
ATOM   529 N ND2 . ASN A 1 79  ? 55.093 30.708  16.157 1.00 103.11 ? 79  ASN A ND2 1 
ATOM   530 N N   . LEU A 1 80  ? 55.765 26.048  13.449 1.00 70.97  ? 80  LEU A N   1 
ATOM   531 C CA  . LEU A 1 80  ? 55.237 24.809  12.887 1.00 64.86  ? 80  LEU A CA  1 
ATOM   532 C C   . LEU A 1 80  ? 54.292 23.993  13.765 1.00 65.69  ? 80  LEU A C   1 
ATOM   533 O O   . LEU A 1 80  ? 53.594 23.110  13.264 1.00 62.63  ? 80  LEU A O   1 
ATOM   534 C CB  . LEU A 1 80  ? 56.405 23.917  12.493 1.00 61.59  ? 80  LEU A CB  1 
ATOM   535 C CG  . LEU A 1 80  ? 57.283 24.382  11.341 1.00 60.37  ? 80  LEU A CG  1 
ATOM   536 C CD1 . LEU A 1 80  ? 58.504 23.482  11.183 1.00 59.35  ? 80  LEU A CD1 1 
ATOM   537 C CD2 . LEU A 1 80  ? 56.505 24.396  10.044 1.00 56.52  ? 80  LEU A CD2 1 
ATOM   538 N N   . ASP A 1 81  ? 54.270 24.278  15.059 1.00 71.25  ? 81  ASP A N   1 
ATOM   539 C CA  . ASP A 1 81  ? 53.700 23.365  16.061 1.00 72.84  ? 81  ASP A CA  1 
ATOM   540 C C   . ASP A 1 81  ? 52.238 23.625  16.399 1.00 76.88  ? 81  ASP A C   1 
ATOM   541 O O   . ASP A 1 81  ? 51.679 22.966  17.274 1.00 83.38  ? 81  ASP A O   1 
ATOM   542 C CB  . ASP A 1 81  ? 54.531 23.433  17.338 1.00 77.62  ? 81  ASP A CB  1 
ATOM   543 C CG  . ASP A 1 81  ? 54.865 24.855  17.715 1.00 103.94 ? 81  ASP A CG  1 
ATOM   544 O OD1 . ASP A 1 81  ? 55.603 25.500  16.933 1.00 104.64 ? 81  ASP A OD1 1 
ATOM   545 O OD2 . ASP A 1 81  ? 54.374 25.338  18.766 1.00 121.37 ? 81  ASP A OD2 1 
ATOM   546 N N   . ASN A 1 82  ? 51.644 24.614  15.733 1.00 81.49  ? 82  ASN A N   1 
ATOM   547 C CA  . ASN A 1 82  ? 50.196 24.834  15.752 1.00 81.87  ? 82  ASN A CA  1 
ATOM   548 C C   . ASN A 1 82  ? 49.756 25.365  14.380 1.00 78.25  ? 82  ASN A C   1 
ATOM   549 O O   . ASN A 1 82  ? 48.938 26.271  14.251 1.00 85.78  ? 82  ASN A O   1 
ATOM   550 C CB  . ASN A 1 82  ? 49.781 25.755  16.901 1.00 95.24  ? 82  ASN A CB  1 
ATOM   551 C CG  . ASN A 1 82  ? 50.558 27.038  16.918 1.00 98.97  ? 82  ASN A CG  1 
ATOM   552 O OD1 . ASN A 1 82  ? 51.364 27.299  16.024 1.00 102.72 ? 82  ASN A OD1 1 
ATOM   553 N ND2 . ASN A 1 82  ? 50.333 27.848  17.936 1.00 103.11 ? 82  ASN A ND2 1 
ATOM   554 N N   . CYS A 1 83  ? 50.346 24.771  13.360 1.00 71.00  ? 83  CYS A N   1 
ATOM   555 C CA  . CYS A 1 83  ? 50.030 25.022  11.990 1.00 67.05  ? 83  CYS A CA  1 
ATOM   556 C C   . CYS A 1 83  ? 48.846 24.111  11.599 1.00 65.68  ? 83  CYS A C   1 
ATOM   557 O O   . CYS A 1 83  ? 48.774 22.976  12.042 1.00 64.60  ? 83  CYS A O   1 
ATOM   558 C CB  . CYS A 1 83  ? 51.290 24.713  11.214 1.00 61.55  ? 83  CYS A CB  1 
ATOM   559 S SG  . CYS A 1 83  ? 51.141 24.795  9.471  1.00 70.58  ? 83  CYS A SG  1 
ATOM   560 N N   . PRO A 1 84  ? 47.884 24.633  10.811 1.00 37.98  ? 84  PRO A N   1 
ATOM   561 C CA  . PRO A 1 84  ? 46.631 23.887  10.464 1.00 31.90  ? 84  PRO A CA  1 
ATOM   562 C C   . PRO A 1 84  ? 46.838 22.667  9.556  1.00 27.91  ? 84  PRO A C   1 
ATOM   563 O O   . PRO A 1 84  ? 47.718 22.667  8.697  1.00 24.81  ? 84  PRO A O   1 
ATOM   564 C CB  . PRO A 1 84  ? 45.754 24.936  9.741  1.00 38.47  ? 84  PRO A CB  1 
ATOM   565 C CG  . PRO A 1 84  ? 46.600 26.162  9.553  1.00 44.06  ? 84  PRO A CG  1 
ATOM   566 C CD  . PRO A 1 84  ? 47.935 25.986  10.192 1.00 39.70  ? 84  PRO A CD  1 
ATOM   567 N N   . PHE A 1 85  ? 46.036 21.633  9.775  1.00 24.49  ? 85  PHE A N   1 
ATOM   568 C CA  . PHE A 1 85  ? 46.095 20.414  8.991  1.00 20.50  ? 85  PHE A CA  1 
ATOM   569 C C   . PHE A 1 85  ? 45.470 20.638  7.622  1.00 25.40  ? 85  PHE A C   1 
ATOM   570 O O   . PHE A 1 85  ? 44.539 21.452  7.473  1.00 33.20  ? 85  PHE A O   1 
ATOM   571 C CB  . PHE A 1 85  ? 45.382 19.269  9.734  1.00 21.66  ? 85  PHE A CB  1 
ATOM   572 C CG  . PHE A 1 85  ? 46.017 18.925  11.032 1.00 21.60  ? 85  PHE A CG  1 
ATOM   573 C CD1 . PHE A 1 85  ? 45.370 19.200  12.241 1.00 40.74  ? 85  PHE A CD1 1 
ATOM   574 C CD2 . PHE A 1 85  ? 47.301 18.342  11.062 1.00 19.04  ? 85  PHE A CD2 1 
ATOM   575 C CE1 . PHE A 1 85  ? 45.995 18.885  13.491 1.00 28.40  ? 85  PHE A CE1 1 
ATOM   576 C CE2 . PHE A 1 85  ? 47.925 18.045  12.274 1.00 20.71  ? 85  PHE A CE2 1 
ATOM   577 C CZ  . PHE A 1 85  ? 47.275 18.313  13.490 1.00 26.83  ? 85  PHE A CZ  1 
ATOM   578 N N   . HIS A 1 86  ? 45.987 19.940  6.611  1.00 25.05  ? 86  HIS A N   1 
ATOM   579 C CA  . HIS A 1 86  ? 45.341 19.936  5.288  1.00 25.50  ? 86  HIS A CA  1 
ATOM   580 C C   . HIS A 1 86  ? 43.928 19.427  5.489  1.00 25.77  ? 86  HIS A C   1 
ATOM   581 O O   . HIS A 1 86  ? 43.698 18.519  6.304  1.00 31.58  ? 86  HIS A O   1 
ATOM   582 C CB  . HIS A 1 86  ? 46.051 19.000  4.316  1.00 21.04  ? 86  HIS A CB  1 
ATOM   583 C CG  . HIS A 1 86  ? 47.349 19.523  3.782  1.00 21.50  ? 86  HIS A CG  1 
ATOM   584 N ND1 . HIS A 1 86  ? 47.421 20.355  2.680  1.00 31.35  ? 86  HIS A ND1 1 
ATOM   585 C CD2 . HIS A 1 86  ? 48.629 19.292  4.163  1.00 19.98  ? 86  HIS A CD2 1 
ATOM   586 C CE1 . HIS A 1 86  ? 48.688 20.616  2.407  1.00 28.13  ? 86  HIS A CE1 1 
ATOM   587 N NE2 . HIS A 1 86  ? 49.440 19.984  3.289  1.00 24.09  ? 86  HIS A NE2 1 
ATOM   588 N N   . ASP A 1 87  ? 43.006 19.991  4.735  1.00 31.12  ? 87  ASP A N   1 
ATOM   589 C CA  . ASP A 1 87  ? 41.601 19.577  4.709  1.00 37.21  ? 87  ASP A CA  1 
ATOM   590 C C   . ASP A 1 87  ? 41.099 19.160  3.322  1.00 49.33  ? 87  ASP A C   1 
ATOM   591 O O   . ASP A 1 87  ? 40.003 18.628  3.202  1.00 51.90  ? 87  ASP A O   1 
ATOM   592 C CB  . ASP A 1 87  ? 40.688 20.695  5.242  1.00 46.28  ? 87  ASP A CB  1 
ATOM   593 C CG  . ASP A 1 87  ? 40.997 22.045  4.643  1.00 48.25  ? 87  ASP A CG  1 
ATOM   594 O OD1 . ASP A 1 87  ? 41.391 22.941  5.377  1.00 88.87  ? 87  ASP A OD1 1 
ATOM   595 O OD2 . ASP A 1 87  ? 40.872 22.236  3.438  1.00 57.16  ? 87  ASP A OD2 1 
ATOM   596 N N   . GLN A 1 88  ? 41.898 19.404  2.286  1.00 39.97  ? 88  GLN A N   1 
ATOM   597 C CA  . GLN A 1 88  ? 41.546 19.077  0.914  1.00 41.76  ? 88  GLN A CA  1 
ATOM   598 C C   . GLN A 1 88  ? 41.655 17.618  0.564  1.00 43.74  ? 88  GLN A C   1 
ATOM   599 O O   . GLN A 1 88  ? 42.598 16.956  0.937  1.00 33.92  ? 88  GLN A O   1 
ATOM   600 C CB  . GLN A 1 88  ? 42.439 19.836  -0.019 1.00 43.27  ? 88  GLN A CB  1 
ATOM   601 C CG  . GLN A 1 88  ? 42.498 21.286  0.317  1.00 59.31  ? 88  GLN A CG  1 
ATOM   602 C CD  . GLN A 1 88  ? 41.341 22.047  -0.271 1.00 79.73  ? 88  GLN A CD  1 
ATOM   603 O OE1 . GLN A 1 88  ? 40.519 22.602  0.455  1.00 70.16  ? 88  GLN A OE1 1 
ATOM   604 N NE2 . GLN A 1 88  ? 41.243 22.040  -1.599 1.00 81.73  ? 88  GLN A NE2 1 
ATOM   605 N N   . PRO A 1 89  ? 40.680 17.135  -0.208 1.00 59.42  ? 89  PRO A N   1 
ATOM   606 C CA  . PRO A 1 89  ? 40.559 15.727  -0.574 1.00 61.74  ? 89  PRO A CA  1 
ATOM   607 C C   . PRO A 1 89  ? 41.868 14.969  -0.817 1.00 62.50  ? 89  PRO A C   1 
ATOM   608 O O   . PRO A 1 89  ? 42.092 13.939  -0.195 1.00 66.96  ? 89  PRO A O   1 
ATOM   609 C CB  . PRO A 1 89  ? 39.708 15.775  -1.840 1.00 60.76  ? 89  PRO A CB  1 
ATOM   610 C CG  . PRO A 1 89  ? 38.867 16.926  -1.659 1.00 66.52  ? 89  PRO A CG  1 
ATOM   611 C CD  . PRO A 1 89  ? 39.632 17.940  -0.859 1.00 59.79  ? 89  PRO A CD  1 
ATOM   612 N N   . HIS A 1 90  ? 42.748 15.402  -1.687 1.00 46.88  ? 90  HIS A N   1 
ATOM   613 C CA  . HIS A 1 90  ? 43.842 14.481  -1.896 1.00 38.24  ? 90  HIS A CA  1 
ATOM   614 C C   . HIS A 1 90  ? 45.122 15.006  -1.313 1.00 41.11  ? 90  HIS A C   1 
ATOM   615 O O   . HIS A 1 90  ? 46.195 14.628  -1.708 1.00 45.81  ? 90  HIS A O   1 
ATOM   616 C CB  . HIS A 1 90  ? 43.941 14.119  -3.367 1.00 45.49  ? 90  HIS A CB  1 
ATOM   617 C CG  . HIS A 1 90  ? 42.724 13.414  -3.880 1.00 53.01  ? 90  HIS A CG  1 
ATOM   618 N ND1 . HIS A 1 90  ? 41.674 14.075  -4.475 1.00 54.40  ? 90  HIS A ND1 1 
ATOM   619 C CD2 . HIS A 1 90  ? 42.371 12.109  -3.839 1.00 64.98  ? 90  HIS A CD2 1 
ATOM   620 C CE1 . HIS A 1 90  ? 40.737 13.207  -4.795 1.00 68.57  ? 90  HIS A CE1 1 
ATOM   621 N NE2 . HIS A 1 90  ? 41.131 12.009  -4.407 1.00 61.27  ? 90  HIS A NE2 1 
ATOM   622 N N   . LEU A 1 91  ? 44.986 15.884  -0.341 1.00 30.76  ? 91  LEU A N   1 
ATOM   623 C CA  . LEU A 1 91  ? 46.133 16.507  0.242  1.00 27.76  ? 91  LEU A CA  1 
ATOM   624 C C   . LEU A 1 91  ? 46.345 16.124  1.690  1.00 25.27  ? 91  LEU A C   1 
ATOM   625 O O   . LEU A 1 91  ? 47.454 16.063  2.150  1.00 22.44  ? 91  LEU A O   1 
ATOM   626 C CB  . LEU A 1 91  ? 46.045 18.004  0.117  1.00 29.67  ? 91  LEU A CB  1 
ATOM   627 C CG  . LEU A 1 91  ? 46.931 18.633  -0.935 1.00 35.16  ? 91  LEU A CG  1 
ATOM   628 C CD1 . LEU A 1 91  ? 46.777 17.955  -2.232 1.00 51.56  ? 91  LEU A CD1 1 
ATOM   629 C CD2 . LEU A 1 91  ? 46.532 20.032  -1.111 1.00 51.11  ? 91  LEU A CD2 1 
ATOM   630 N N   . LYS A 1 92  ? 45.262 15.873  2.393  1.00 24.22  ? 92  LYS A N   1 
ATOM   631 C CA  . LYS A 1 92  ? 45.320 15.539  3.799  1.00 24.49  ? 92  LYS A CA  1 
ATOM   632 C C   . LYS A 1 92  ? 45.859 14.120  3.973  1.00 26.01  ? 92  LYS A C   1 
ATOM   633 O O   . LYS A 1 92  ? 45.665 13.276  3.109  1.00 28.28  ? 92  LYS A O   1 
ATOM   634 C CB  . LYS A 1 92  ? 43.941 15.718  4.479  1.00 30.37  ? 92  LYS A CB  1 
ATOM   635 C CG  . LYS A 1 92  ? 42.824 14.961  3.869  1.00 30.76  ? 92  LYS A CG  1 
ATOM   636 C CD  . LYS A 1 92  ? 41.421 15.361  4.399  1.00 50.60  ? 92  LYS A CD  1 
ATOM   637 C CE  . LYS A 1 92  ? 40.342 14.645  3.531  1.00 53.87  ? 92  LYS A CE  1 
ATOM   638 N NZ  . LYS A 1 92  ? 38.995 14.466  4.145  1.00 76.16  ? 92  LYS A NZ  1 
ATOM   639 N N   . ARG A 1 93  ? 46.582 13.888  5.074  1.00 32.77  ? 93  ARG A N   1 
ATOM   640 C CA  . ARG A 1 93  ? 47.048 12.554  5.392  1.00 30.03  ? 93  ARG A CA  1 
ATOM   641 C C   . ARG A 1 93  ? 47.126 12.466  6.888  1.00 27.62  ? 93  ARG A C   1 
ATOM   642 O O   . ARG A 1 93  ? 47.476 13.439  7.557  1.00 31.47  ? 93  ARG A O   1 
ATOM   643 C CB  . ARG A 1 93  ? 48.389 12.268  4.714  1.00 29.40  ? 93  ARG A CB  1 
ATOM   644 C CG  . ARG A 1 93  ? 48.543 10.855  4.196  1.00 59.26  ? 93  ARG A CG  1 
ATOM   645 C CD  . ARG A 1 93  ? 49.496 10.856  3.003  1.00 91.47  ? 93  ARG A CD  1 
ATOM   646 N NE  . ARG A 1 93  ? 50.276 9.620   2.828  1.00 74.96  ? 93  ARG A NE  1 
ATOM   647 C CZ  . ARG A 1 93  ? 50.029 8.687   1.909  1.00 64.53  ? 93  ARG A CZ  1 
ATOM   648 N NH1 . ARG A 1 93  ? 48.995 8.804   1.089  1.00 105.76 ? 93  ARG A NH1 1 
ATOM   649 N NH2 . ARG A 1 93  ? 50.804 7.620   1.815  1.00 50.75  ? 93  ARG A NH2 1 
ATOM   650 N N   . LYS A 1 94  ? 46.756 11.304  7.414  1.00 28.70  ? 94  LYS A N   1 
ATOM   651 C CA  . LYS A 1 94  ? 46.717 11.028  8.851  1.00 25.01  ? 94  LYS A CA  1 
ATOM   652 C C   . LYS A 1 94  ? 47.248 9.602   8.970  1.00 23.27  ? 94  LYS A C   1 
ATOM   653 O O   . LYS A 1 94  ? 46.953 8.752   8.125  1.00 24.68  ? 94  LYS A O   1 
ATOM   654 C CB  . LYS A 1 94  ? 45.266 11.155  9.398  1.00 27.82  ? 94  LYS A CB  1 
ATOM   655 C CG  . LYS A 1 94  ? 44.527 12.415  8.878  1.00 50.69  ? 94  LYS A CG  1 
ATOM   656 C CD  . LYS A 1 94  ? 43.495 13.097  9.791  1.00 53.76  ? 94  LYS A CD  1 
ATOM   657 C CE  . LYS A 1 94  ? 43.185 14.521  9.235  1.00 75.89  ? 94  LYS A CE  1 
ATOM   658 N NZ  . LYS A 1 94  ? 42.127 15.297  9.976  1.00 60.28  ? 94  LYS A NZ  1 
ATOM   659 N N   . ALA A 1 95  ? 48.057 9.345   9.988  1.00 20.86  ? 95  ALA A N   1 
ATOM   660 C CA  . ALA A 1 95  ? 48.568 8.002   10.254 1.00 19.70  ? 95  ALA A CA  1 
ATOM   661 C C   . ALA A 1 95  ? 48.627 7.788   11.754 1.00 20.86  ? 95  ALA A C   1 
ATOM   662 O O   . ALA A 1 95  ? 48.850 8.739   12.527 1.00 19.04  ? 95  ALA A O   1 
ATOM   663 C CB  . ALA A 1 95  ? 49.960 7.779   9.623  1.00 18.28  ? 95  ALA A CB  1 
ATOM   664 N N   . PHE A 1 96  ? 48.434 6.542   12.162 1.00 19.20  ? 96  PHE A N   1 
ATOM   665 C CA  . PHE A 1 96  ? 48.747 6.135   13.497 1.00 18.36  ? 96  PHE A CA  1 
ATOM   666 C C   . PHE A 1 96  ? 50.153 5.519   13.523 1.00 22.26  ? 96  PHE A C   1 
ATOM   667 O O   . PHE A 1 96  ? 50.465 4.543   12.805 1.00 22.37  ? 96  PHE A O   1 
ATOM   668 C CB  . PHE A 1 96  ? 47.696 5.175   13.991 1.00 21.43  ? 96  PHE A CB  1 
ATOM   669 C CG  . PHE A 1 96  ? 46.399 5.854   14.388 1.00 28.47  ? 96  PHE A CG  1 
ATOM   670 C CD1 . PHE A 1 96  ? 45.449 6.232   13.429 1.00 26.63  ? 96  PHE A CD1 1 
ATOM   671 C CD2 . PHE A 1 96  ? 46.116 6.117   15.729 1.00 32.51  ? 96  PHE A CD2 1 
ATOM   672 C CE1 . PHE A 1 96  ? 44.253 6.877   13.809 1.00 30.07  ? 96  PHE A CE1 1 
ATOM   673 C CE2 . PHE A 1 96  ? 44.890 6.744   16.108 1.00 29.58  ? 96  PHE A CE2 1 
ATOM   674 C CZ  . PHE A 1 96  ? 43.975 7.111   15.152 1.00 31.74  ? 96  PHE A CZ  1 
ATOM   675 N N   . CYS A 1 97  ? 51.004 6.112   14.342 1.00 14.02  ? 97  CYS A N   1 
ATOM   676 C CA  . CYS A 1 97  ? 52.387 5.708   14.465 1.00 12.18  ? 97  CYS A CA  1 
ATOM   677 C C   . CYS A 1 97  ? 52.685 5.109   15.839 1.00 14.91  ? 97  CYS A C   1 
ATOM   678 O O   . CYS A 1 97  ? 52.091 5.518   16.867 1.00 12.60  ? 97  CYS A O   1 
ATOM   679 C CB  . CYS A 1 97  ? 53.233 6.938   14.274 1.00 10.93  ? 97  CYS A CB  1 
ATOM   680 S SG  . CYS A 1 97  ? 53.028 7.684   12.612 1.00 20.05  ? 97  CYS A SG  1 
ATOM   681 N N   . SER A 1 98  ? 53.619 4.155   15.866 1.00 11.38  ? 98  SER A N   1 
ATOM   682 C CA  . SER A 1 98  ? 54.189 3.671   17.101 1.00 10.98  ? 98  SER A CA  1 
ATOM   683 C C   . SER A 1 98  ? 55.637 4.034   17.099 1.00 13.44  ? 98  SER A C   1 
ATOM   684 O O   . SER A 1 98  ? 56.377 3.537   16.246 1.00 9.43   ? 98  SER A O   1 
ATOM   685 C CB  . SER A 1 98  ? 54.048 2.186   17.210 1.00 12.91  ? 98  SER A CB  1 
ATOM   686 O OG  . SER A 1 98  ? 52.712 1.892   17.074 1.00 15.31  ? 98  SER A OG  1 
ATOM   687 N N   . PHE A 1 99  ? 56.041 4.898   18.042 1.00 10.51  ? 99  PHE A N   1 
ATOM   688 C CA  . PHE A 1 99  ? 57.444 5.240   18.202 1.00 7.49   ? 99  PHE A CA  1 
ATOM   689 C C   . PHE A 1 99  ? 58.030 4.641   19.469 1.00 12.98  ? 99  PHE A C   1 
ATOM   690 O O   . PHE A 1 99  ? 57.420 4.706   20.520 1.00 11.50  ? 99  PHE A O   1 
ATOM   691 C CB  . PHE A 1 99  ? 57.593 6.751   18.294 1.00 7.85   ? 99  PHE A CB  1 
ATOM   692 C CG  . PHE A 1 99  ? 57.007 7.501   17.131 1.00 12.26  ? 99  PHE A CG  1 
ATOM   693 C CD1 . PHE A 1 99  ? 57.406 7.217   15.813 1.00 11.98  ? 99  PHE A CD1 1 
ATOM   694 C CD2 . PHE A 1 99  ? 56.053 8.518   17.345 1.00 16.69  ? 99  PHE A CD2 1 
ATOM   695 C CE1 . PHE A 1 99  ? 56.862 7.963   14.727 1.00 15.13  ? 99  PHE A CE1 1 
ATOM   696 C CE2 . PHE A 1 99  ? 55.505 9.254   16.243 1.00 9.64   ? 99  PHE A CE2 1 
ATOM   697 C CZ  . PHE A 1 99  ? 55.917 8.984   14.963 1.00 9.57   ? 99  PHE A CZ  1 
ATOM   698 N N   . GLN A 1 100 ? 59.227 4.064   19.386 1.00 10.14  ? 100 GLN A N   1 
ATOM   699 C CA  . GLN A 1 100 ? 59.913 3.636   20.609 1.00 7.83   ? 100 GLN A CA  1 
ATOM   700 C C   . GLN A 1 100 ? 61.171 4.430   20.724 1.00 8.35   ? 100 GLN A C   1 
ATOM   701 O O   . GLN A 1 100 ? 61.994 4.369   19.813 1.00 17.93  ? 100 GLN A O   1 
ATOM   702 C CB  . GLN A 1 100 ? 60.255 2.154   20.583 1.00 14.25  ? 100 GLN A CB  1 
ATOM   703 C CG  . GLN A 1 100 ? 61.077 1.791   21.788 1.00 9.55   ? 100 GLN A CG  1 
ATOM   704 C CD  . GLN A 1 100 ? 61.549 0.363   21.765 1.00 27.21  ? 100 GLN A CD  1 
ATOM   705 O OE1 . GLN A 1 100 ? 62.567 0.052   22.376 1.00 18.06  ? 100 GLN A OE1 1 
ATOM   706 N NE2 . GLN A 1 100 ? 60.799 -0.528  21.105 1.00 12.68  ? 100 GLN A NE2 1 
ATOM   707 N N   . ILE A 1 101 ? 61.318 5.191   21.814 1.00 8.76   ? 101 ILE A N   1 
ATOM   708 C CA  . ILE A 1 101 ? 62.470 6.099   22.001 1.00 8.83   ? 101 ILE A CA  1 
ATOM   709 C C   . ILE A 1 101 ? 63.324 5.591   23.175 1.00 15.76  ? 101 ILE A C   1 
ATOM   710 O O   . ILE A 1 101 ? 62.790 5.331   24.274 1.00 14.60  ? 101 ILE A O   1 
ATOM   711 C CB  . ILE A 1 101 ? 62.015 7.568   22.325 1.00 10.51  ? 101 ILE A CB  1 
ATOM   712 C CG1 . ILE A 1 101 ? 61.101 8.124   21.235 1.00 9.32   ? 101 ILE A CG1 1 
ATOM   713 C CG2 . ILE A 1 101 ? 63.220 8.483   22.549 1.00 11.69  ? 101 ILE A CG2 1 
ATOM   714 C CD1 . ILE A 1 101 ? 59.741 7.747   21.532 1.00 16.91  ? 101 ILE A CD1 1 
ATOM   715 N N   . TYR A 1 102 ? 64.636 5.460   22.964 1.00 15.44  ? 102 TYR A N   1 
ATOM   716 C CA  . TYR A 1 102 ? 65.517 4.992   24.030 1.00 11.88  ? 102 TYR A CA  1 
ATOM   717 C C   . TYR A 1 102 ? 66.308 6.182   24.476 1.00 21.13  ? 102 TYR A C   1 
ATOM   718 O O   . TYR A 1 102 ? 67.081 6.789   23.670 1.00 14.93  ? 102 TYR A O   1 
ATOM   719 C CB  . TYR A 1 102 ? 66.429 3.852   23.582 1.00 12.58  ? 102 TYR A CB  1 
ATOM   720 C CG  . TYR A 1 102 ? 67.458 3.437   24.612 1.00 14.78  ? 102 TYR A CG  1 
ATOM   721 C CD1 . TYR A 1 102 ? 67.112 2.639   25.723 1.00 14.67  ? 102 TYR A CD1 1 
ATOM   722 C CD2 . TYR A 1 102 ? 68.809 3.809   24.468 1.00 19.19  ? 102 TYR A CD2 1 
ATOM   723 C CE1 . TYR A 1 102 ? 68.081 2.254   26.671 1.00 16.71  ? 102 TYR A CE1 1 
ATOM   724 C CE2 . TYR A 1 102 ? 69.755 3.414   25.385 1.00 18.57  ? 102 TYR A CE2 1 
ATOM   725 C CZ  . TYR A 1 102 ? 69.388 2.643   26.486 1.00 18.47  ? 102 TYR A CZ  1 
ATOM   726 O OH  . TYR A 1 102 ? 70.366 2.264   27.381 1.00 20.98  ? 102 TYR A OH  1 
ATOM   727 N N   . ALA A 1 103 ? 66.089 6.540   25.747 1.00 14.87  ? 103 ALA A N   1 
ATOM   728 C CA  . ALA A 1 103 ? 66.726 7.735   26.311 1.00 20.60  ? 103 ALA A CA  1 
ATOM   729 C C   . ALA A 1 103 ? 67.754 7.305   27.341 1.00 20.01  ? 103 ALA A C   1 
ATOM   730 O O   . ALA A 1 103 ? 67.505 6.351   28.089 1.00 23.76  ? 103 ALA A O   1 
ATOM   731 C CB  . ALA A 1 103 ? 65.661 8.678   26.945 1.00 18.78  ? 103 ALA A CB  1 
ATOM   732 N N   . VAL A 1 104 ? 68.904 7.963   27.361 1.00 28.71  ? 104 VAL A N   1 
ATOM   733 C CA  . VAL A 1 104 ? 69.873 7.770   28.418 1.00 29.86  ? 104 VAL A CA  1 
ATOM   734 C C   . VAL A 1 104 ? 70.002 9.159   29.048 1.00 32.65  ? 104 VAL A C   1 
ATOM   735 O O   . VAL A 1 104 ? 70.755 9.986   28.540 1.00 40.93  ? 104 VAL A O   1 
ATOM   736 C CB  . VAL A 1 104 ? 71.224 7.300   27.820 1.00 34.32  ? 104 VAL A CB  1 
ATOM   737 C CG1 . VAL A 1 104 ? 72.279 7.054   28.894 1.00 39.75  ? 104 VAL A CG1 1 
ATOM   738 C CG2 . VAL A 1 104 ? 71.050 6.037   26.984 1.00 34.08  ? 104 VAL A CG2 1 
ATOM   739 N N   . PRO A 1 105 ? 69.242 9.450   30.132 1.00 40.91  ? 105 PRO A N   1 
ATOM   740 C CA  . PRO A 1 105 ? 69.113 10.882  30.571 1.00 41.01  ? 105 PRO A CA  1 
ATOM   741 C C   . PRO A 1 105 ? 70.342 11.596  31.158 1.00 52.67  ? 105 PRO A C   1 
ATOM   742 O O   . PRO A 1 105 ? 70.390 12.838  31.096 1.00 56.53  ? 105 PRO A O   1 
ATOM   743 C CB  . PRO A 1 105 ? 67.948 10.864  31.582 1.00 40.95  ? 105 PRO A CB  1 
ATOM   744 C CG  . PRO A 1 105 ? 67.183 9.594   31.245 1.00 46.90  ? 105 PRO A CG  1 
ATOM   745 C CD  . PRO A 1 105 ? 68.265 8.589   30.822 1.00 38.19  ? 105 PRO A CD  1 
ATOM   746 N N   . TRP A 1 106 ? 71.316 10.857  31.720 1.00 49.44  ? 106 TRP A N   1 
ATOM   747 C CA  . TRP A 1 106 ? 72.549 11.509  32.214 1.00 62.98  ? 106 TRP A CA  1 
ATOM   748 C C   . TRP A 1 106 ? 73.328 12.044  31.023 1.00 67.98  ? 106 TRP A C   1 
ATOM   749 O O   . TRP A 1 106 ? 74.045 13.058  31.138 1.00 65.81  ? 106 TRP A O   1 
ATOM   750 C CB  . TRP A 1 106 ? 73.456 10.565  33.023 1.00 72.37  ? 106 TRP A CB  1 
ATOM   751 C CG  . TRP A 1 106 ? 74.211 9.569   32.163 1.00 68.76  ? 106 TRP A CG  1 
ATOM   752 C CD1 . TRP A 1 106 ? 73.752 8.366   31.735 1.00 61.94  ? 106 TRP A CD1 1 
ATOM   753 C CD2 . TRP A 1 106 ? 75.535 9.707   31.614 1.00 98.93  ? 106 TRP A CD2 1 
ATOM   754 N NE1 . TRP A 1 106 ? 74.695 7.738   30.962 1.00 71.96  ? 106 TRP A NE1 1 
ATOM   755 C CE2 . TRP A 1 106 ? 75.803 8.536   30.871 1.00 110.02 ? 106 TRP A CE2 1 
ATOM   756 C CE3 . TRP A 1 106 ? 76.522 10.700  31.683 1.00 149.96 ? 106 TRP A CE3 1 
ATOM   757 C CZ2 . TRP A 1 106 ? 77.020 8.321   30.203 1.00 131.99 ? 106 TRP A CZ2 1 
ATOM   758 C CZ3 . TRP A 1 106 ? 77.739 10.488  31.013 1.00 169.43 ? 106 TRP A CZ3 1 
ATOM   759 C CH2 . TRP A 1 106 ? 77.971 9.306   30.283 1.00 154.24 ? 106 TRP A CH2 1 
ATOM   760 N N   . GLN A 1 107 ? 73.203 11.332  29.894 1.00 53.74  ? 107 GLN A N   1 
ATOM   761 C CA  . GLN A 1 107 ? 73.924 11.679  28.675 1.00 55.74  ? 107 GLN A CA  1 
ATOM   762 C C   . GLN A 1 107 ? 73.170 12.733  27.892 1.00 52.94  ? 107 GLN A C   1 
ATOM   763 O O   . GLN A 1 107 ? 73.784 13.446  27.081 1.00 50.55  ? 107 GLN A O   1 
ATOM   764 C CB  . GLN A 1 107 ? 74.176 10.459  27.796 1.00 54.56  ? 107 GLN A CB  1 
ATOM   765 C CG  . GLN A 1 107 ? 75.399 10.604  26.893 1.00 59.83  ? 107 GLN A CG  1 
ATOM   766 C CD  . GLN A 1 107 ? 75.794 9.288   26.242 1.00 90.50  ? 107 GLN A CD  1 
ATOM   767 O OE1 . GLN A 1 107 ? 74.931 8.474   25.857 1.00 68.91  ? 107 GLN A OE1 1 
ATOM   768 N NE2 . GLN A 1 107 ? 77.102 9.062   26.122 1.00 78.77  ? 107 GLN A NE2 1 
ATOM   769 N N   . GLY A 1 108 ? 71.857 12.829  28.147 1.00 38.23  ? 108 GLY A N   1 
ATOM   770 C CA  . GLY A 1 108 ? 70.977 13.767  27.438 1.00 41.54  ? 108 GLY A CA  1 
ATOM   771 C C   . GLY A 1 108 ? 70.712 13.352  25.996 1.00 39.57  ? 108 GLY A C   1 
ATOM   772 O O   . GLY A 1 108 ? 70.389 14.195  25.166 1.00 41.14  ? 108 GLY A O   1 
ATOM   773 N N   . THR A 1 109 ? 70.850 12.056  25.709 1.00 30.18  ? 109 THR A N   1 
ATOM   774 C CA  . THR A 1 109 ? 70.584 11.528  24.378 1.00 29.86  ? 109 THR A CA  1 
ATOM   775 C C   . THR A 1 109 ? 69.220 10.792  24.226 1.00 25.26  ? 109 THR A C   1 
ATOM   776 O O   . THR A 1 109 ? 68.610 10.342  25.217 1.00 26.91  ? 109 THR A O   1 
ATOM   777 C CB  . THR A 1 109 ? 71.710 10.575  23.923 1.00 30.67  ? 109 THR A CB  1 
ATOM   778 O OG1 . THR A 1 109 ? 71.738 9.444   24.799 1.00 26.94  ? 109 THR A OG1 1 
ATOM   779 C CG2 . THR A 1 109 ? 73.065 11.286  23.885 1.00 31.91  ? 109 THR A CG2 1 
ATOM   780 N N   . MET A 1 110 ? 68.750 10.707  22.980 1.00 21.56  ? 110 MET A N   1 
ATOM   781 C CA  . MET A 1 110 ? 67.594 9.909   22.621 1.00 18.46  ? 110 MET A CA  1 
ATOM   782 C C   . MET A 1 110 ? 67.858 9.267   21.293 1.00 17.45  ? 110 MET A C   1 
ATOM   783 O O   . MET A 1 110 ? 68.445 9.888   20.367 1.00 19.62  ? 110 MET A O   1 
ATOM   784 C CB  . MET A 1 110 ? 66.349 10.777  22.490 1.00 18.79  ? 110 MET A CB  1 
ATOM   785 C CG  . MET A 1 110 ? 65.505 10.916  23.755 1.00 21.87  ? 110 MET A CG  1 
ATOM   786 S SD  . MET A 1 110 ? 64.369 12.334  23.711 1.00 26.51  ? 110 MET A SD  1 
ATOM   787 C CE  . MET A 1 110 ? 63.688 12.227  25.403 1.00 56.11  ? 110 MET A CE  1 
ATOM   788 N N   . THR A 1 111 ? 67.393 8.033   21.154 1.00 15.50  ? 111 THR A N   1 
ATOM   789 C CA  . THR A 1 111 ? 67.449 7.349   19.863 1.00 15.42  ? 111 THR A CA  1 
ATOM   790 C C   . THR A 1 111 ? 66.085 6.806   19.545 1.00 17.67  ? 111 THR A C   1 
ATOM   791 O O   . THR A 1 111 ? 65.344 6.386   20.462 1.00 19.26  ? 111 THR A O   1 
ATOM   792 C CB  . THR A 1 111 ? 68.411 6.158   19.914 1.00 22.84  ? 111 THR A CB  1 
ATOM   793 O OG1 . THR A 1 111 ? 69.665 6.642   20.350 1.00 32.94  ? 111 THR A OG1 1 
ATOM   794 C CG2 . THR A 1 111 ? 68.608 5.516   18.498 1.00 46.48  ? 111 THR A CG2 1 
ATOM   795 N N   . LEU A 1 112 ? 65.768 6.774   18.248 1.00 19.38  ? 112 LEU A N   1 
ATOM   796 C CA  . LEU A 1 112 ? 64.504 6.198   17.783 1.00 21.98  ? 112 LEU A CA  1 
ATOM   797 C C   . LEU A 1 112 ? 64.778 4.731   17.450 1.00 23.78  ? 112 LEU A C   1 
ATOM   798 O O   . LEU A 1 112 ? 65.312 4.408   16.390 1.00 35.12  ? 112 LEU A O   1 
ATOM   799 C CB  . LEU A 1 112 ? 63.968 6.962   16.561 1.00 16.84  ? 112 LEU A CB  1 
ATOM   800 C CG  . LEU A 1 112 ? 62.595 6.604   15.974 1.00 34.16  ? 112 LEU A CG  1 
ATOM   801 C CD1 . LEU A 1 112 ? 61.479 6.902   16.947 1.00 10.98  ? 112 LEU A CD1 1 
ATOM   802 C CD2 . LEU A 1 112 ? 62.320 7.348   14.649 1.00 17.51  ? 112 LEU A CD2 1 
ATOM   803 N N   . SER A 1 113 ? 64.431 3.844   18.361 1.00 12.30  ? 113 SER A N   1 
ATOM   804 C CA  . SER A 1 113 ? 64.749 2.466   18.173 1.00 14.82  ? 113 SER A CA  1 
ATOM   805 C C   . SER A 1 113 ? 63.796 1.837   17.179 1.00 15.04  ? 113 SER A C   1 
ATOM   806 O O   . SER A 1 113 ? 64.219 0.985   16.426 1.00 18.29  ? 113 SER A O   1 
ATOM   807 C CB  . SER A 1 113 ? 64.611 1.757   19.511 1.00 15.98  ? 113 SER A CB  1 
ATOM   808 O OG  . SER A 1 113 ? 65.348 2.451   20.498 1.00 29.50  ? 113 SER A OG  1 
ATOM   809 N N   . LYS A 1 114 ? 62.495 2.218   17.244 1.00 12.62  ? 114 LYS A N   1 
ATOM   810 C CA  . LYS A 1 114 ? 61.426 1.609   16.449 1.00 13.07  ? 114 LYS A CA  1 
ATOM   811 C C   . LYS A 1 114 ? 60.471 2.678   15.970 1.00 11.14  ? 114 LYS A C   1 
ATOM   812 O O   . LYS A 1 114 ? 60.161 3.609   16.703 1.00 9.74   ? 114 LYS A O   1 
ATOM   813 C CB  . LYS A 1 114 ? 60.675 0.517   17.221 1.00 14.58  ? 114 LYS A CB  1 
ATOM   814 C CG  . LYS A 1 114 ? 61.482 -0.784  17.475 1.00 18.83  ? 114 LYS A CG  1 
ATOM   815 C CD  . LYS A 1 114 ? 61.863 -1.507  16.162 1.00 24.75  ? 114 LYS A CD  1 
ATOM   816 C CE  . LYS A 1 114 ? 63.004 -2.506  16.323 1.00 27.53  ? 114 LYS A CE  1 
ATOM   817 N NZ  . LYS A 1 114 ? 63.279 -3.116  14.987 1.00 42.68  ? 114 LYS A NZ  1 
ATOM   818 N N   . SER A 1 115 ? 60.023 2.567   14.720 1.00 15.47  ? 115 SER A N   1 
ATOM   819 C CA  . SER A 1 115 ? 59.081 3.522   14.119 1.00 11.98  ? 115 SER A CA  1 
ATOM   820 C C   . SER A 1 115 ? 58.287 2.864   12.989 1.00 14.88  ? 115 SER A C   1 
ATOM   821 O O   . SER A 1 115 ? 58.856 2.438   11.963 1.00 16.77  ? 115 SER A O   1 
ATOM   822 C CB  . SER A 1 115 ? 59.789 4.763   13.613 1.00 13.04  ? 115 SER A CB  1 
ATOM   823 O OG  . SER A 1 115 ? 58.878 5.562   12.879 1.00 16.00  ? 115 SER A OG  1 
ATOM   824 N N   . THR A 1 116 ? 56.966 2.792   13.186 1.00 13.59  ? 116 THR A N   1 
ATOM   825 C CA  . THR A 1 116 ? 56.069 2.216   12.200 1.00 15.79  ? 116 THR A CA  1 
ATOM   826 C C   . THR A 1 116 ? 54.713 2.908   12.241 1.00 16.12  ? 116 THR A C   1 
ATOM   827 O O   . THR A 1 116 ? 54.244 3.234   13.333 1.00 18.25  ? 116 THR A O   1 
ATOM   828 C CB  . THR A 1 116 ? 55.930 0.674   12.411 1.00 17.18  ? 116 THR A CB  1 
ATOM   829 O OG1 . THR A 1 116 ? 55.544 0.058   11.176 1.00 20.45  ? 116 THR A OG1 1 
ATOM   830 C CG2 . THR A 1 116 ? 54.968 0.317   13.511 1.00 16.88  ? 116 THR A CG2 1 
ATOM   831 N N   . CYS A 1 117 ? 54.088 3.102   11.074 1.00 18.76  ? 117 CYS A N   1 
ATOM   832 C CA  . CYS A 1 117 ? 52.797 3.790   10.937 1.00 20.60  ? 117 CYS A CA  1 
ATOM   833 C C   . CYS A 1 117 ? 51.826 3.050   10.014 1.00 23.54  ? 117 CYS A C   1 
ATOM   834 O O   . CYS A 1 117 ? 52.216 2.278   9.138  1.00 25.10  ? 117 CYS A O   1 
ATOM   835 C CB  . CYS A 1 117 ? 52.989 5.231   10.417 1.00 26.45  ? 117 CYS A CB  1 
ATOM   836 S SG  . CYS A 1 117 ? 54.137 6.307   11.368 1.00 31.78  ? 117 CYS A SG  1 
ATOM   837 N N   . GLN A 1 118 ? 50.547 3.270   10.228 1.00 25.29  ? 118 GLN A N   1 
ATOM   838 C CA  . GLN A 1 118 ? 49.542 2.790   9.293  1.00 28.93  ? 118 GLN A CA  1 
ATOM   839 C C   . GLN A 1 118 ? 48.627 3.930   8.996  1.00 32.48  ? 118 GLN A C   1 
ATOM   840 O O   . GLN A 1 118 ? 48.283 4.681   9.884  1.00 32.56  ? 118 GLN A O   1 
ATOM   841 C CB  . GLN A 1 118 ? 48.750 1.582   9.801  1.00 29.55  ? 118 GLN A CB  1 
ATOM   842 C CG  . GLN A 1 118 ? 48.285 1.604   11.269 1.00 46.86  ? 118 GLN A CG  1 
ATOM   843 C CD  . GLN A 1 118 ? 47.340 0.437   11.589 1.00 57.26  ? 118 GLN A CD  1 
ATOM   844 O OE1 . GLN A 1 118 ? 46.328 0.238   10.914 1.00 62.30  ? 118 GLN A OE1 1 
ATOM   845 N NE2 . GLN A 1 118 ? 47.670 -0.331  12.619 1.00 37.22  ? 118 GLN A NE2 1 
ATOM   846 N N   . ASP A 1 119 ? 48.267 4.072   7.730  1.00 36.66  ? 119 ASP A N   1 
ATOM   847 C CA  . ASP A 1 119 ? 47.409 5.151   7.286  1.00 47.34  ? 119 ASP A CA  1 
ATOM   848 C C   . ASP A 1 119 ? 46.056 5.058   7.945  1.00 43.86  ? 119 ASP A C   1 
ATOM   849 O O   . ASP A 1 119 ? 45.543 3.975   8.131  1.00 43.76  ? 119 ASP A O   1 
ATOM   850 C CB  . ASP A 1 119 ? 47.326 5.193   5.757  1.00 47.21  ? 119 ASP A CB  1 
ATOM   851 C CG  . ASP A 1 119 ? 48.392 6.123   5.158  1.00 74.37  ? 119 ASP A CG  1 
ATOM   852 O OD1 . ASP A 1 119 ? 48.731 7.167   5.783  1.00 64.47  ? 119 ASP A OD1 1 
ATOM   853 O OD2 . ASP A 1 119 ? 48.900 5.816   4.067  1.00 80.55  ? 119 ASP A OD2 1 
ATOM   854 N N   . ALA A 1 120 ? 45.525 6.202   8.363  1.00 47.35  ? 120 ALA A N   1 
ATOM   855 C CA  . ALA A 1 120 ? 44.238 6.243   9.048  1.00 52.73  ? 120 ALA A CA  1 
ATOM   856 C C   . ALA A 1 120 ? 43.211 6.772   8.101  1.00 64.72  ? 120 ALA A C   1 
ATOM   857 O O   . ALA A 1 120 ? 42.178 6.127   7.910  1.00 86.83  ? 120 ALA A O   1 
ATOM   858 C CB  . ALA A 1 120 ? 44.305 7.115   10.283 1.00 51.68  ? 120 ALA A CB  1 
ATOM   859 O OXT . ALA A 1 120 ? 43.406 7.846   7.520  1.00 75.09  ? 120 ALA A OXT 1 
HETATM 860 C C1  . PEG B 2 .   ? 95.602 -2.814  29.397 1.00 74.50  ? 121 PEG A C1  1 
HETATM 861 O O1  . PEG B 2 .   ? 94.881 -4.064  29.514 1.00 52.14  ? 121 PEG A O1  1 
HETATM 862 C C2  . PEG B 2 .   ? 96.294 -2.596  28.024 1.00 77.18  ? 121 PEG A C2  1 
HETATM 863 O O2  . PEG B 2 .   ? 95.718 -3.277  26.880 1.00 49.63  ? 121 PEG A O2  1 
HETATM 864 C C3  . PEG B 2 .   ? 95.938 -2.590  25.631 1.00 67.83  ? 121 PEG A C3  1 
HETATM 865 C C4  . PEG B 2 .   ? 94.934 -2.966  24.520 1.00 62.52  ? 121 PEG A C4  1 
HETATM 866 O O4  . PEG B 2 .   ? 94.342 -1.799  23.891 1.00 49.12  ? 121 PEG A O4  1 
HETATM 867 C C1  . PEG C 2 .   ? 93.006 2.834   27.349 1.00 58.24  ? 122 PEG A C1  1 
HETATM 868 O O1  . PEG C 2 .   ? 93.212 1.978   28.499 1.00 43.77  ? 122 PEG A O1  1 
HETATM 869 C C2  . PEG C 2 .   ? 91.535 2.886   26.920 1.00 35.54  ? 122 PEG A C2  1 
HETATM 870 O O2  . PEG C 2 .   ? 91.100 1.699   26.225 1.00 41.01  ? 122 PEG A O2  1 
HETATM 871 C C3  . PEG C 2 .   ? 91.413 1.740   24.828 1.00 28.75  ? 122 PEG A C3  1 
HETATM 872 C C4  . PEG C 2 .   ? 91.016 0.461   24.109 1.00 14.77  ? 122 PEG A C4  1 
HETATM 873 O O4  . PEG C 2 .   ? 92.220 -0.310  23.850 1.00 36.65  ? 122 PEG A O4  1 
HETATM 874 C C1  . PEG D 2 .   ? 67.586 0.017   23.036 1.00 82.02  ? 123 PEG A C1  1 
HETATM 875 O O1  . PEG D 2 .   ? 68.902 -0.483  23.300 1.00 37.59  ? 123 PEG A O1  1 
HETATM 876 C C2  . PEG D 2 .   ? 66.564 -1.099  23.193 1.00 72.09  ? 123 PEG A C2  1 
HETATM 877 O O2  . PEG D 2 .   ? 66.245 -1.676  21.926 1.00 80.85  ? 123 PEG A O2  1 
HETATM 878 C C3  . PEG D 2 .   ? 65.059 -2.476  22.014 1.00 67.04  ? 123 PEG A C3  1 
HETATM 879 C C4  . PEG D 2 .   ? 64.403 -2.617  20.640 1.00 71.27  ? 123 PEG A C4  1 
HETATM 880 O O4  . PEG D 2 .   ? 63.077 -3.109  20.878 1.00 68.51  ? 123 PEG A O4  1 
HETATM 881 C C   . ACT E 3 .   ? 88.470 -12.131 7.390  1.00 46.65  ? 124 ACT A C   1 
HETATM 882 O O   . ACT E 3 .   ? 88.569 -10.875 7.363  1.00 55.82  ? 124 ACT A O   1 
HETATM 883 O OXT . ACT E 3 .   ? 88.811 -12.703 8.471  1.00 38.31  ? 124 ACT A OXT 1 
HETATM 884 C CH3 . ACT E 3 .   ? 87.985 -12.871 6.176  1.00 38.19  ? 124 ACT A CH3 1 
HETATM 885 O O   . HOH F 4 .   ? 82.508 -16.219 -0.913 1.00 2.00   ? 125 HOH A O   1 
HETATM 886 O O   . HOH F 4 .   ? 80.749 -9.252  7.949  1.00 2.00   ? 126 HOH A O   1 
HETATM 887 O O   . HOH F 4 .   ? 90.649 -6.380  28.318 1.00 2.00   ? 127 HOH A O   1 
HETATM 888 O O   . HOH F 4 .   ? 70.267 0.221   28.823 0.50 2.00   ? 128 HOH A O   1 
HETATM 889 O O   . HOH F 4 .   ? 70.790 8.499   33.143 1.00 2.00   ? 129 HOH A O   1 
HETATM 890 O O   . HOH F 4 .   ? 82.107 -10.287 3.217  1.00 22.33  ? 130 HOH A O   1 
HETATM 891 O O   . HOH F 4 .   ? 52.181 3.013   24.149 1.00 2.21   ? 131 HOH A O   1 
HETATM 892 O O   . HOH F 4 .   ? 77.579 -13.047 -1.114 1.00 6.64   ? 132 HOH A O   1 
HETATM 893 O O   . HOH F 4 .   ? 77.264 -10.746 -3.635 1.00 16.25  ? 133 HOH A O   1 
HETATM 894 O O   . HOH F 4 .   ? 79.467 -9.419  -3.009 1.00 7.31   ? 134 HOH A O   1 
HETATM 895 O O   . HOH F 4 .   ? 49.841 3.779   17.077 1.00 2.00   ? 135 HOH A O   1 
HETATM 896 O O   . HOH F 4 .   ? 79.344 -6.715  35.528 1.00 12.10  ? 136 HOH A O   1 
HETATM 897 O O   . HOH F 4 .   ? 55.541 2.878   8.689  1.00 2.00   ? 137 HOH A O   1 
HETATM 898 O O   . HOH F 4 .   ? 51.535 1.538   13.443 1.00 7.28   ? 138 HOH A O   1 
HETATM 899 O O   . HOH F 4 .   ? 51.191 -0.975  12.457 1.00 6.08   ? 139 HOH A O   1 
HETATM 900 O O   . HOH F 4 .   ? 67.770 8.060   16.382 1.00 3.16   ? 140 HOH A O   1 
HETATM 901 O O   . HOH F 4 .   ? 53.657 7.427   7.246  1.00 9.83   ? 141 HOH A O   1 
HETATM 902 O O   . HOH F 4 .   ? 51.368 5.585   7.066  1.00 14.65  ? 142 HOH A O   1 
HETATM 903 O O   . HOH F 4 .   ? 75.840 -14.498 16.197 1.00 9.62   ? 143 HOH A O   1 
HETATM 904 O O   . HOH F 4 .   ? 70.535 12.163  21.121 1.00 16.83  ? 144 HOH A O   1 
HETATM 905 O O   . HOH F 4 .   ? 89.013 -18.996 17.666 1.00 2.00   ? 145 HOH A O   1 
HETATM 906 O O   . HOH F 4 .   ? 96.116 -7.113  24.373 1.00 2.00   ? 146 HOH A O   1 
HETATM 907 O O   . HOH F 4 .   ? 86.114 -17.174 17.228 1.00 3.53   ? 147 HOH A O   1 
HETATM 908 O O   . HOH F 4 .   ? 44.335 21.126  2.272  1.00 2.00   ? 148 HOH A O   1 
HETATM 909 O O   . HOH F 4 .   ? 80.428 -19.771 10.097 1.00 5.77   ? 149 HOH A O   1 
HETATM 910 O O   . HOH F 4 .   ? 80.780 -17.888 16.824 1.00 2.00   ? 150 HOH A O   1 
HETATM 911 O O   . HOH F 4 .   ? 80.891 -18.020 14.261 1.00 5.52   ? 151 HOH A O   1 
HETATM 912 O O   . HOH F 4 .   ? 74.829 -10.385 11.012 1.00 10.86  ? 152 HOH A O   1 
HETATM 913 O O   . HOH F 4 .   ? 73.258 -10.884 8.772  1.00 6.14   ? 153 HOH A O   1 
HETATM 914 O O   . HOH F 4 .   ? 83.063 -9.400  6.487  1.00 3.97   ? 154 HOH A O   1 
HETATM 915 O O   . HOH F 4 .   ? 46.212 16.371  6.883  1.00 3.74   ? 155 HOH A O   1 
HETATM 916 O O   . HOH F 4 .   ? 77.165 -16.456 22.311 1.00 2.00   ? 156 HOH A O   1 
HETATM 917 O O   . HOH F 4 .   ? 59.982 -3.004  21.455 1.00 7.06   ? 157 HOH A O   1 
HETATM 918 O O   . HOH F 4 .   ? 69.936 7.294   23.484 1.00 4.45   ? 158 HOH A O   1 
HETATM 919 O O   . HOH F 4 .   ? 89.202 0.757   30.477 1.00 2.00   ? 159 HOH A O   1 
HETATM 920 O O   . HOH F 4 .   ? 85.230 -14.904 6.540  1.00 5.56   ? 160 HOH A O   1 
HETATM 921 O O   . HOH F 4 .   ? 82.702 -15.359 7.156  1.00 4.47   ? 161 HOH A O   1 
HETATM 922 O O   . HOH F 4 .   ? 77.160 -17.399 12.036 1.00 4.47   ? 162 HOH A O   1 
HETATM 923 O O   . HOH F 4 .   ? 57.795 5.365   9.938  1.00 16.60  ? 163 HOH A O   1 
HETATM 924 O O   . HOH F 4 .   ? 77.689 -18.024 9.094  1.00 9.63   ? 164 HOH A O   1 
HETATM 925 O O   . HOH F 4 .   ? 52.520 -3.341  12.625 1.00 10.55  ? 165 HOH A O   1 
HETATM 926 O O   . HOH F 4 .   ? 76.264 -17.085 6.255  1.00 9.49   ? 166 HOH A O   1 
HETATM 927 O O   . HOH F 4 .   ? 79.086 -7.906  11.934 1.00 15.06  ? 167 HOH A O   1 
HETATM 928 O O   . HOH F 4 .   ? 66.261 -1.676  25.706 1.00 33.49  ? 168 HOH A O   1 
HETATM 929 O O   . HOH F 4 .   ? 51.195 8.156   5.428  1.00 19.36  ? 169 HOH A O   1 
HETATM 930 O O   . HOH F 4 .   ? 89.928 -8.994  29.138 1.00 18.69  ? 170 HOH A O   1 
HETATM 931 O O   . HOH F 4 .   ? 79.614 -1.354  34.420 1.00 11.58  ? 171 HOH A O   1 
HETATM 932 O O   . HOH F 4 .   ? 64.460 10.841  29.647 1.00 17.76  ? 172 HOH A O   1 
HETATM 933 O O   . HOH F 4 .   ? 67.730 11.983  27.737 1.00 5.56   ? 173 HOH A O   1 
HETATM 934 O O   . HOH F 4 .   ? 93.124 -9.982  26.605 1.00 8.86   ? 174 HOH A O   1 
HETATM 935 O O   . HOH F 4 .   ? 85.014 -11.603 6.500  1.00 25.94  ? 175 HOH A O   1 
HETATM 936 O O   . HOH F 4 .   ? 41.178 8.799   12.647 1.00 16.18  ? 176 HOH A O   1 
HETATM 937 O O   . HOH F 4 .   ? 43.758 22.225  11.629 1.00 10.60  ? 177 HOH A O   1 
HETATM 938 O O   . HOH F 4 .   ? 69.550 10.259  17.453 1.00 4.08   ? 178 HOH A O   1 
HETATM 939 O O   . HOH F 4 .   ? 49.574 2.197   6.031  1.00 5.54   ? 179 HOH A O   1 
HETATM 940 O O   . HOH F 4 .   ? 79.750 -7.528  9.216  1.00 3.87   ? 180 HOH A O   1 
HETATM 941 O O   . HOH F 4 .   ? 75.227 -13.476 0.802  1.00 26.95  ? 181 HOH A O   1 
HETATM 942 O O   . HOH F 4 .   ? 49.322 1.758   15.481 1.00 5.15   ? 182 HOH A O   1 
HETATM 943 O O   . HOH F 4 .   ? 57.555 0.857   9.052  1.00 17.25  ? 183 HOH A O   1 
HETATM 944 O O   . HOH F 4 .   ? 67.596 15.328  21.593 1.00 29.08  ? 184 HOH A O   1 
HETATM 945 O O   . HOH F 4 .   ? 91.538 -16.529 20.664 1.00 8.83   ? 185 HOH A O   1 
HETATM 946 O O   . HOH F 4 .   ? 89.121 -16.639 21.643 1.00 9.43   ? 186 HOH A O   1 
HETATM 947 O O   . HOH F 4 .   ? 76.925 -7.583  4.665  1.00 4.80   ? 187 HOH A O   1 
HETATM 948 O O   . HOH F 4 .   ? 79.812 -6.831  5.045  1.00 9.12   ? 188 HOH A O   1 
HETATM 949 O O   . HOH F 4 .   ? 71.240 3.402   21.385 1.00 15.25  ? 189 HOH A O   1 
HETATM 950 O O   . HOH F 4 .   ? 74.479 5.600   25.286 1.00 2.00   ? 190 HOH A O   1 
HETATM 951 O O   . HOH F 4 .   ? 46.749 25.706  15.647 1.00 2.00   ? 191 HOH A O   1 
HETATM 952 O O   . HOH F 4 .   ? 75.287 -11.989 3.084  1.00 23.85  ? 192 HOH A O   1 
HETATM 953 O O   . HOH F 4 .   ? 73.478 -12.554 4.301  1.00 14.13  ? 193 HOH A O   1 
HETATM 954 O O   . HOH F 4 .   ? 72.102 4.959   23.167 1.00 18.49  ? 194 HOH A O   1 
HETATM 955 O O   . HOH F 4 .   ? 83.711 7.809   33.934 1.00 2.00   ? 195 HOH A O   1 
HETATM 956 O O   . HOH F 4 .   ? 85.967 8.121   35.106 1.00 2.00   ? 196 HOH A O   1 
HETATM 957 O O   . HOH F 4 .   ? 36.796 22.918  0.295  1.00 2.00   ? 197 HOH A O   1 
HETATM 958 O O   . HOH F 4 .   ? 37.114 21.673  2.736  1.00 4.41   ? 198 HOH A O   1 
HETATM 959 O O   . HOH F 4 .   ? 36.490 19.428  1.130  1.00 2.00   ? 199 HOH A O   1 
HETATM 960 O O   . HOH F 4 .   ? 93.076 -14.183 22.487 1.00 12.94  ? 200 HOH A O   1 
HETATM 961 O O   . HOH F 4 .   ? 90.372 -12.158 28.354 1.00 17.98  ? 201 HOH A O   1 
HETATM 962 O O   . HOH F 4 .   ? 63.762 -5.562  21.603 1.00 37.58  ? 202 HOH A O   1 
HETATM 963 O O   . HOH F 4 .   ? 76.385 -13.206 -3.194 1.00 7.48   ? 203 HOH A O   1 
HETATM 964 O O   . HOH F 4 .   ? 79.290 9.385   34.954 0.50 31.23  ? 204 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . GLY A 12  ? 0.9651 0.7318 0.2734 0.0445  -0.0343 -0.0865 12  GLY A N   
2   C CA  . GLY A 12  ? 0.9251 0.8124 0.4017 0.0838  -0.0181 -0.0579 12  GLY A CA  
3   C C   . GLY A 12  ? 0.8155 0.8409 0.4044 0.0833  -0.0221 -0.0389 12  GLY A C   
4   O O   . GLY A 12  ? 0.7906 0.7973 0.3215 0.1074  -0.0027 -0.0325 12  GLY A O   
5   N N   . PRO A 13  ? 0.5924 0.7191 0.3026 0.0669  -0.0421 -0.0284 13  PRO A N   
6   C CA  . PRO A 13  ? 0.4387 0.6725 0.2467 0.0774  -0.0354 -0.0070 13  PRO A CA  
7   C C   . PRO A 13  ? 0.4522 0.7304 0.2173 0.0544  -0.0631 -0.0088 13  PRO A C   
8   O O   . PRO A 13  ? 0.6030 0.8689 0.3194 0.0114  -0.1016 -0.0335 13  PRO A O   
9   C CB  . PRO A 13  ? 0.3524 0.6363 0.2564 0.0706  -0.0578 -0.0020 13  PRO A CB  
10  C CG  . PRO A 13  ? 0.3826 0.5825 0.2102 0.0519  -0.0758 -0.0176 13  PRO A CG  
11  C CD  . PRO A 13  ? 0.5979 0.6976 0.3198 0.0550  -0.0620 -0.0336 13  PRO A CD  
12  N N   . MET A 14  ? 0.3910 0.7171 0.1852 0.0861  -0.0450 0.0136  14  MET A N   
13  C CA  . MET A 14  ? 0.4467 0.7953 0.1736 0.0999  -0.0776 0.0123  14  MET A CA  
14  C C   . MET A 14  ? 0.3546 0.7923 0.1676 0.1127  -0.0716 0.0375  14  MET A C   
15  O O   . MET A 14  ? 0.3854 0.8197 0.2649 0.1247  -0.0236 0.0583  14  MET A O   
16  C CB  . MET A 14  ? 0.5982 0.8272 0.1778 0.1621  -0.0348 0.0228  14  MET A CB  
17  C CG  . MET A 14  ? 0.8742 0.9867 0.2831 0.1668  -0.0719 -0.0091 14  MET A CG  
18  S SD  . MET A 14  ? 1.5883 1.4918 0.7756 0.2611  0.0203  0.0149  14  MET A SD  
19  C CE  . MET A 14  ? 1.1302 1.0559 0.3392 0.3140  0.0817  0.0601  14  MET A CE  
20  N N   . ASP A 15  ? 0.3595 0.8745 0.1779 0.1142  -0.1243 0.0309  15  ASP A N   
21  C CA  . ASP A 15  ? 0.3336 0.9231 0.2139 0.1394  -0.1157 0.0572  15  ASP A CA  
22  C C   . ASP A 15  ? 0.3543 0.8681 0.1607 0.2010  -0.0585 0.0902  15  ASP A C   
23  O O   . ASP A 15  ? 0.6960 1.1090 0.3664 0.2469  -0.0398 0.0933  15  ASP A O   
24  C CB  . ASP A 15  ? 0.5106 1.2107 0.4282 0.1464  -0.1861 0.0395  15  ASP A CB  
25  C CG  . ASP A 15  ? 0.5571 1.3379 0.5970 0.0698  -0.2122 0.0092  15  ASP A CG  
26  O OD1 . ASP A 15  ? 0.2475 1.0709 0.3819 0.0455  -0.1700 0.0268  15  ASP A OD1 
27  O OD2 . ASP A 15  ? 0.6454 1.4149 0.6642 0.0355  -0.2652 -0.0324 15  ASP A OD2 
28  N N   . ALA A 16  ? 0.2991 0.8295 0.1705 0.2041  -0.0217 0.1146  16  ALA A N   
29  C CA  . ALA A 16  ? 0.3689 0.8086 0.1878 0.2461  0.0509  0.1445  16  ALA A CA  
30  C C   . ALA A 16  ? 0.5150 0.9818 0.3422 0.2717  0.0523  0.1668  16  ALA A C   
31  O O   . ALA A 16  ? 0.4922 1.0170 0.4047 0.2406  0.0316  0.1630  16  ALA A O   
32  C CB  . ALA A 16  ? 0.3513 0.7474 0.2704 0.2083  0.1097  0.1415  16  ALA A CB  
33  N N   . SER A 17  ? 0.7479 1.1392 0.4499 0.3414  0.0845  0.1927  17  SER A N   
34  C CA  . SER A 17  ? 0.6201 1.0066 0.2987 0.3813  0.0973  0.2178  17  SER A CA  
35  C C   . SER A 17  ? 0.5790 0.9046 0.3304 0.3340  0.1521  0.2243  17  SER A C   
36  O O   . SER A 17  ? 0.5726 0.8192 0.3650 0.2966  0.2100  0.2191  17  SER A O   
37  C CB  . SER A 17  ? 0.6984 0.9610 0.1792 0.4802  0.1311  0.2455  17  SER A CB  
38  O OG  . SER A 17  ? 0.7684 0.9486 0.2002 0.5119  0.1889  0.2763  17  SER A OG  
39  N N   . VAL A 18  ? 0.4894 0.8444 0.2601 0.3408  0.1340  0.2321  18  VAL A N   
40  C CA  . VAL A 18  ? 0.4583 0.7215 0.2524 0.3084  0.1631  0.2310  18  VAL A CA  
41  C C   . VAL A 18  ? 0.7000 0.8072 0.4025 0.3333  0.2456  0.2532  18  VAL A C   
42  O O   . VAL A 18  ? 0.7014 0.7115 0.4465 0.2869  0.2733  0.2398  18  VAL A O   
43  C CB  . VAL A 18  ? 0.5314 0.8204 0.3092 0.3294  0.1365  0.2395  18  VAL A CB  
44  C CG1 . VAL A 18  ? 0.7078 0.8493 0.4402 0.3157  0.1564  0.2366  18  VAL A CG1 
45  C CG2 . VAL A 18  ? 0.3136 0.7051 0.1782 0.2892  0.0856  0.2168  18  VAL A CG2 
46  N N   . GLU A 19  ? 0.7015 0.8070 0.8293 0.4321  -0.1560 0.1738  19  GLU A N   
47  C CA  . GLU A 19  ? 0.9715 0.8091 0.9204 0.4841  -0.1989 0.2142  19  GLU A CA  
48  C C   . GLU A 19  ? 1.0061 0.7182 0.8201 0.3727  -0.1410 0.2949  19  GLU A C   
49  O O   . GLU A 19  ? 1.0689 0.5732 0.7795 0.3369  -0.1480 0.3665  19  GLU A O   
50  C CB  . GLU A 19  ? 1.2124 0.9991 1.0855 0.5931  -0.3084 0.2228  19  GLU A CB  
51  C CG  . GLU A 19  ? 1.1931 1.2541 1.2655 0.6886  -0.3687 0.1312  19  GLU A CG  
52  C CD  . GLU A 19  ? 1.4171 1.5190 1.5462 0.8423  -0.4179 0.0509  19  GLU A CD  
53  O OE1 . GLU A 19  ? 1.4140 1.7545 1.6784 0.9651  -0.4932 -0.0258 19  GLU A OE1 
54  O OE2 . GLU A 19  ? 1.4132 1.3272 1.4611 0.8596  -0.4037 0.0426  19  GLU A OE2 
55  N N   . GLU A 20  ? 0.7700 0.6222 0.6023 0.3200  -0.1041 0.2795  20  GLU A N   
56  C CA  . GLU A 20  ? 0.7661 0.6321 0.4773 0.2634  -0.0520 0.3227  20  GLU A CA  
57  C C   . GLU A 20  ? 0.7074 0.5534 0.4647 0.1722  0.0227  0.3340  20  GLU A C   
58  O O   . GLU A 20  ? 0.7053 0.5829 0.5743 0.1606  0.0378  0.2683  20  GLU A O   
59  C CB  . GLU A 20  ? 0.6820 0.6815 0.3981 0.2908  -0.0860 0.2461  20  GLU A CB  
60  C CG  . GLU A 20  ? 1.0077 1.0256 0.6506 0.3896  -0.1933 0.2179  20  GLU A CG  
61  C CD  . GLU A 20  ? 1.3968 1.4773 1.0324 0.4401  -0.2916 0.1084  20  GLU A CD  
62  O OE1 . GLU A 20  ? 1.2051 1.2833 0.8213 0.5234  -0.4211 0.0552  20  GLU A OE1 
63  O OE2 . GLU A 20  ? 0.9461 1.0520 0.5909 0.4170  -0.2747 0.0581  20  GLU A OE2 
64  N N   . GLU A 21  ? 0.8474 0.6682 0.5237 0.0984  0.0647  0.4289  21  GLU A N   
65  C CA  . GLU A 21  ? 0.9752 0.7617 0.7405 -0.0051 0.1010  0.4388  21  GLU A CA  
66  C C   . GLU A 21  ? 0.7355 0.6828 0.5989 -0.0067 0.1406  0.3259  21  GLU A C   
67  O O   . GLU A 21  ? 0.7583 0.6510 0.7103 -0.0373 0.1351  0.2780  21  GLU A O   
68  C CB  . GLU A 21  ? 1.0503 0.8602 0.7619 -0.1356 0.1418  0.5931  21  GLU A CB  
69  C CG  . GLU A 21  ? 1.3522 0.9440 1.1649 -0.2507 0.0898  0.6335  21  GLU A CG  
70  C CD  . GLU A 21  ? 1.7343 1.5080 1.6369 -0.4337 0.1539  0.7356  21  GLU A CD  
71  O OE1 . GLU A 21  ? 1.5980 1.5760 1.4130 -0.5066 0.2308  0.8894  21  GLU A OE1 
72  O OE2 . GLU A 21  ? 1.9346 1.6920 2.0005 -0.4995 0.1256  0.6614  21  GLU A OE2 
73  N N   . GLY A 22  ? 0.6810 0.7931 0.5038 0.0496  0.1485  0.2716  22  GLY A N   
74  C CA  . GLY A 22  ? 0.4097 0.6201 0.2831 0.0724  0.1457  0.1668  22  GLY A CA  
75  C C   . GLY A 22  ? 0.4367 0.5347 0.3684 0.0945  0.1032  0.1203  22  GLY A C   
76  O O   . GLY A 22  ? 0.2939 0.3910 0.2629 0.0872  0.1064  0.0718  22  GLY A O   
77  N N   . VAL A 23  ? 0.3918 0.4396 0.3315 0.1209  0.0636  0.1448  23  VAL A N   
78  C CA  . VAL A 23  ? 0.2766 0.3239 0.2964 0.1163  0.0421  0.1424  23  VAL A CA  
79  C C   . VAL A 23  ? 0.3274 0.3734 0.3829 0.1286  0.0905  0.1406  23  VAL A C   
80  O O   . VAL A 23  ? 0.3198 0.4117 0.3888 0.1295  0.1105  0.1246  23  VAL A O   
81  C CB  . VAL A 23  ? 0.3010 0.3808 0.3758 0.1279  -0.0204 0.1657  23  VAL A CB  
82  C CG1 . VAL A 23  ? 0.2653 0.4534 0.4691 0.0846  -0.0183 0.2028  23  VAL A CG1 
83  C CG2 . VAL A 23  ? 0.3683 0.4103 0.3912 0.1469  -0.1171 0.1267  23  VAL A CG2 
84  N N   . ARG A 24  ? 0.3550 0.3210 0.3929 0.1547  0.0860  0.1511  24  ARG A N   
85  C CA  . ARG A 24  ? 0.4456 0.3494 0.4955 0.2069  0.0760  0.1069  24  ARG A CA  
86  C C   . ARG A 24  ? 0.4528 0.3106 0.4991 0.1682  0.0847  0.0617  24  ARG A C   
87  O O   . ARG A 24  ? 0.5457 0.4180 0.5909 0.2347  0.0727  -0.0110 24  ARG A O   
88  C CB  . ARG A 24  ? 0.6204 0.3434 0.6321 0.2452  0.0094  0.1286  24  ARG A CB  
89  C CG  . ARG A 24  ? 1.0591 0.7174 1.0764 0.3779  -0.0589 0.0376  24  ARG A CG  
90  C CD  . ARG A 24  ? 1.7280 1.0480 1.6819 0.3773  -0.1787 0.0611  24  ARG A CD  
91  N NE  . ARG A 24  ? 1.8064 1.0128 1.7666 0.2001  -0.1612 0.1446  24  ARG A NE  
92  C CZ  . ARG A 24  ? 2.0069 1.0123 1.9190 0.0825  -0.2051 0.2806  24  ARG A CZ  
93  N NH1 . ARG A 24  ? 1.5460 0.3494 1.3545 0.1378  -0.2921 0.3491  24  ARG A NH1 
94  N NH2 . ARG A 24  ? 1.7608 0.8018 1.7290 -0.0939 -0.1627 0.3614  24  ARG A NH2 
95  N N   . ARG A 25  ? 0.4525 0.3075 0.4991 0.0798  0.1005  0.0905  25  ARG A N   
96  C CA  . ARG A 25  ? 0.4435 0.3074 0.5335 0.0420  0.0936  0.0330  25  ARG A CA  
97  C C   . ARG A 25  ? 0.3313 0.2900 0.3930 0.0990  0.1049  -0.0327 25  ARG A C   
98  O O   . ARG A 25  ? 0.3724 0.3162 0.4321 0.1399  0.0773  -0.1083 25  ARG A O   
99  C CB  . ARG A 25  ? 0.4728 0.4261 0.6106 -0.0688 0.1191  0.0825  25  ARG A CB  
100 C CG  . ARG A 25  ? 0.7701 0.5803 0.9826 -0.1806 0.0692  0.1428  25  ARG A CG  
101 C CD  . ARG A 25  ? 0.9835 0.9727 1.2482 -0.3293 0.1267  0.2662  25  ARG A CD  
102 N NE  . ARG A 25  ? 1.2350 1.4963 1.6373 -0.3873 0.1559  0.2051  25  ARG A NE  
103 C CZ  . ARG A 25  ? 1.0038 1.5787 1.3919 -0.3222 0.2222  0.1461  25  ARG A CZ  
104 N NH1 . ARG A 25  ? 0.7584 1.3722 0.9959 -0.2085 0.2519  0.1409  25  ARG A NH1 
105 N NH2 . ARG A 25  ? 0.4555 1.3024 0.9880 -0.3516 0.2280  0.0685  25  ARG A NH2 
106 N N   . ALA A 26  ? 0.2395 0.3170 0.1755 0.1851  0.0950  0.1215  26  ALA A N   
107 C CA  . ALA A 26  ? 0.1945 0.2777 0.1613 0.1507  0.0721  0.0925  26  ALA A CA  
108 C C   . ALA A 26  ? 0.2735 0.3422 0.2562 0.1330  0.0708  0.0849  26  ALA A C   
109 O O   . ALA A 26  ? 0.1974 0.2342 0.1909 0.1050  0.0701  0.0772  26  ALA A O   
110 C CB  . ALA A 26  ? 0.1932 0.3146 0.1542 0.1593  0.0463  0.0665  26  ALA A CB  
111 N N   . LEU A 27  ? 0.2008 0.3124 0.1791 0.1607  0.0710  0.0870  27  LEU A N   
112 C CA  . LEU A 27  ? 0.1901 0.3195 0.1805 0.1558  0.0717  0.0812  27  LEU A CA  
113 C C   . LEU A 27  ? 0.2555 0.2960 0.2286 0.1529  0.0928  0.0994  27  LEU A C   
114 O O   . LEU A 27  ? 0.2490 0.2763 0.2422 0.1238  0.0898  0.0890  27  LEU A O   
115 C CB  . LEU A 27  ? 0.2107 0.4423 0.1901 0.2071  0.0681  0.0778  27  LEU A CB  
116 C CG  . LEU A 27  ? 0.3180 0.5982 0.2946 0.2323  0.0728  0.0772  27  LEU A CG  
117 C CD1 . LEU A 27  ? 0.1865 0.5059 0.2117 0.1628  0.0634  0.0511  27  LEU A CD1 
118 C CD2 . LEU A 27  ? 0.2534 0.6806 0.2088 0.3079  0.0669  0.0701  27  LEU A CD2 
119 N N   . ASP A 28  ? 0.2786 0.2471 0.2030 0.1775  0.1181  0.1238  28  ASP A N   
120 C CA  . ASP A 28  ? 0.3440 0.2097 0.2367 0.1587  0.1428  0.1303  28  ASP A CA  
121 C C   . ASP A 28  ? 0.3326 0.2038 0.2708 0.0966  0.1357  0.1091  28  ASP A C   
122 O O   . ASP A 28  ? 0.3215 0.1657 0.2641 0.0756  0.1385  0.0958  28  ASP A O   
123 C CB  . ASP A 28  ? 0.4584 0.2081 0.2650 0.1760  0.1832  0.1583  28  ASP A CB  
124 C CG  . ASP A 28  ? 0.7553 0.4833 0.4814 0.2703  0.1948  0.1836  28  ASP A CG  
125 O OD1 . ASP A 28  ? 1.0254 0.6469 0.6558 0.3038  0.2316  0.2149  28  ASP A OD1 
126 O OD2 . ASP A 28  ? 0.6073 0.4351 0.3560 0.3159  0.1704  0.1723  28  ASP A OD2 
127 N N   . PHE A 29  ? 0.2562 0.1770 0.2200 0.0813  0.1247  0.1036  29  PHE A N   
128 C CA  . PHE A 29  ? 0.2570 0.2122 0.2483 0.0487  0.1169  0.0836  29  PHE A CA  
129 C C   . PHE A 29  ? 0.2381 0.2093 0.2470 0.0533  0.0955  0.0689  29  PHE A C   
130 O O   . PHE A 29  ? 0.2284 0.2050 0.2439 0.0400  0.0958  0.0547  29  PHE A O   
131 C CB  . PHE A 29  ? 0.1921 0.2040 0.1869 0.0546  0.1105  0.0832  29  PHE A CB  
132 C CG  . PHE A 29  ? 0.1659 0.2391 0.1734 0.0520  0.0968  0.0608  29  PHE A CG  
133 C CD1 . PHE A 29  ? 0.1809 0.3111 0.2019 0.0172  0.1112  0.0438  29  PHE A CD1 
134 C CD2 . PHE A 29  ? 0.2354 0.3049 0.2254 0.0857  0.0728  0.0523  29  PHE A CD2 
135 C CE1 . PHE A 29  ? 0.1586 0.3836 0.1842 0.0365  0.0957  0.0189  29  PHE A CE1 
136 C CE2 . PHE A 29  ? 0.1666 0.2769 0.1357 0.1120  0.0629  0.0358  29  PHE A CE2 
137 C CZ  . PHE A 29  ? 0.1566 0.3637 0.1478 0.0976  0.0711  0.0194  29  PHE A CZ  
138 N N   . ALA A 30  ? 0.1549 0.1355 0.1634 0.0670  0.0811  0.0695  30  ALA A N   
139 C CA  . ALA A 30  ? 0.1536 0.1229 0.1572 0.0582  0.0724  0.0592  30  ALA A CA  
140 C C   . ALA A 30  ? 0.2123 0.1769 0.2266 0.0527  0.0803  0.0609  30  ALA A C   
141 O O   . ALA A 30  ? 0.2105 0.1605 0.2158 0.0497  0.0809  0.0558  30  ALA A O   
142 C CB  . ALA A 30  ? 0.1686 0.1466 0.1638 0.0483  0.0645  0.0517  30  ALA A CB  
143 N N   . VAL A 31  ? 0.1556 0.1327 0.1744 0.0659  0.0872  0.0692  31  VAL A N   
144 C CA  . VAL A 31  ? 0.1766 0.1522 0.1928 0.0768  0.0944  0.0702  31  VAL A CA  
145 C C   . VAL A 31  ? 0.2974 0.2211 0.3024 0.0671  0.1035  0.0622  31  VAL A C   
146 O O   . VAL A 31  ? 0.2548 0.1802 0.2613 0.0665  0.1029  0.0530  31  VAL A O   
147 C CB  . VAL A 31  ? 0.3171 0.3157 0.3121 0.1206  0.1009  0.0811  31  VAL A CB  
148 C CG1 . VAL A 31  ? 0.2689 0.2474 0.2391 0.1487  0.1097  0.0819  31  VAL A CG1 
149 C CG2 . VAL A 31  ? 0.1754 0.2859 0.1939 0.1222  0.0889  0.0736  31  VAL A CG2 
150 N N   . GLY A 32  ? 0.2143 0.1074 0.2082 0.0517  0.1137  0.0606  32  GLY A N   
151 C CA  . GLY A 32  ? 0.2352 0.1174 0.2272 0.0179  0.1230  0.0375  32  GLY A CA  
152 C C   . GLY A 32  ? 0.1995 0.1514 0.2162 0.0180  0.1059  0.0181  32  GLY A C   
153 O O   . GLY A 32  ? 0.2015 0.1665 0.2176 0.0118  0.1062  -0.0040 32  GLY A O   
154 N N   . GLU A 33  ? 0.1595 0.1454 0.1798 0.0357  0.0924  0.0253  33  GLU A N   
155 C CA  . GLU A 33  ? 0.2144 0.2420 0.2208 0.0608  0.0812  0.0137  33  GLU A CA  
156 C C   . GLU A 33  ? 0.2462 0.2396 0.2346 0.0775  0.0815  0.0226  33  GLU A C   
157 O O   . GLU A 33  ? 0.2184 0.2413 0.1911 0.0998  0.0797  0.0101  33  GLU A O   
158 C CB  . GLU A 33  ? 0.1673 0.1983 0.1449 0.0892  0.0722  0.0207  33  GLU A CB  
159 C CG  . GLU A 33  ? 0.2499 0.3413 0.2437 0.0805  0.0724  0.0132  33  GLU A CG  
160 C CD  . GLU A 33  ? 0.4240 0.6286 0.4397 0.0646  0.0761  -0.0183 33  GLU A CD  
161 O OE1 . GLU A 33  ? 0.2464 0.4681 0.2904 0.0063  0.0937  -0.0293 33  GLU A OE1 
162 O OE2 . GLU A 33  ? 0.2342 0.5093 0.2262 0.1099  0.0650  -0.0351 33  GLU A OE2 
163 N N   . TYR A 34  ? 0.1786 0.1330 0.1688 0.0670  0.0857  0.0409  34  TYR A N   
164 C CA  . TYR A 34  ? 0.1846 0.1244 0.1605 0.0688  0.0927  0.0505  34  TYR A CA  
165 C C   . TYR A 34  ? 0.2406 0.2055 0.2284 0.0800  0.0946  0.0398  34  TYR A C   
166 O O   . TYR A 34  ? 0.2129 0.1835 0.1789 0.0986  0.0981  0.0400  34  TYR A O   
167 C CB  . TYR A 34  ? 0.1815 0.1294 0.1714 0.0446  0.0969  0.0607  34  TYR A CB  
168 C CG  . TYR A 34  ? 0.2452 0.2159 0.2318 0.0322  0.1090  0.0675  34  TYR A CG  
169 C CD1 . TYR A 34  ? 0.2580 0.1855 0.2018 0.0036  0.1251  0.0750  34  TYR A CD1 
170 C CD2 . TYR A 34  ? 0.1872 0.2124 0.1970 0.0498  0.1098  0.0668  34  TYR A CD2 
171 C CE1 . TYR A 34  ? 0.2839 0.2428 0.2232 -0.0204 0.1435  0.0822  34  TYR A CE1 
172 C CE2 . TYR A 34  ? 0.1915 0.2666 0.2011 0.0421  0.1216  0.0725  34  TYR A CE2 
173 C CZ  . TYR A 34  ? 0.4379 0.4907 0.4197 -0.0001 0.1396  0.0805  34  TYR A CZ  
174 O OH  . TYR A 34  ? 0.2873 0.4002 0.2670 -0.0221 0.1593  0.0873  34  TYR A OH  
175 N N   . ASN A 35  ? 0.1744 0.1365 0.1793 0.0725  0.0957  0.0304  35  ASN A N   
176 C CA  . ASN A 35  ? 0.1995 0.1553 0.1971 0.0779  0.0993  0.0108  35  ASN A CA  
177 C C   . ASN A 35  ? 0.2061 0.2025 0.2037 0.0727  0.0941  -0.0221 35  ASN A C   
178 O O   . ASN A 35  ? 0.2230 0.2362 0.2113 0.0866  0.0928  -0.0393 35  ASN A O   
179 C CB  . ASN A 35  ? 0.2465 0.1391 0.2244 0.0715  0.1110  0.0097  35  ASN A CB  
180 C CG  . ASN A 35  ? 0.2687 0.1516 0.2258 0.1110  0.1151  0.0282  35  ASN A CG  
181 O OD1 . ASN A 35  ? 0.2736 0.1826 0.2244 0.1355  0.1134  0.0253  35  ASN A OD1 
182 N ND2 . ASN A 35  ? 0.2875 0.1533 0.2294 0.1270  0.1205  0.0457  35  ASN A ND2 
183 N N   . LYS A 36  ? 0.1870 0.3486 0.2934 0.0150  0.0786  -0.0713 36  LYS A N   
184 C CA  . LYS A 36  ? 0.1876 0.4331 0.3243 0.0253  0.0718  -0.1264 36  LYS A CA  
185 C C   . LYS A 36  ? 0.2345 0.4571 0.3478 0.0861  0.0257  -0.1443 36  LYS A C   
186 O O   . LYS A 36  ? 0.2170 0.4699 0.3404 0.1037  0.0134  -0.1757 36  LYS A O   
187 C CB  . LYS A 36  ? 0.1873 0.5395 0.3515 0.0187  0.0787  -0.1754 36  LYS A CB  
188 C CG  . LYS A 36  ? 0.3773 0.8096 0.5700 -0.0406 0.1195  -0.2079 36  LYS A CG  
189 C CD  . LYS A 36  ? 0.4207 0.9573 0.6323 -0.0591 0.1325  -0.2530 36  LYS A CD  
190 C CE  . LYS A 36  ? 0.7617 1.4502 1.0231 -0.0232 0.1094  -0.3444 36  LYS A CE  
191 N NZ  . LYS A 36  ? 0.5635 1.3815 0.8511 -0.0426 0.1229  -0.4015 36  LYS A NZ  
192 N N   . ALA A 37  ? 0.2786 0.4397 0.3488 0.1179  -0.0013 -0.1272 37  ALA A N   
193 C CA  . ALA A 37  ? 0.3625 0.4562 0.3716 0.1733  -0.0488 -0.1371 37  ALA A CA  
194 C C   . ALA A 37  ? 0.4035 0.3905 0.3638 0.1597  -0.0480 -0.0937 37  ALA A C   
195 O O   . ALA A 37  ? 0.3875 0.3010 0.2792 0.1952  -0.0831 -0.1000 37  ALA A O   
196 C CB  . ALA A 37  ? 0.3301 0.3810 0.2970 0.2002  -0.0732 -0.1338 37  ALA A CB  
197 N N   . SER A 38  ? 0.2756 0.2480 0.2593 0.1105  -0.0112 -0.0533 38  SER A N   
198 C CA  . SER A 38  ? 0.2994 0.1923 0.2408 0.0966  -0.0106 -0.0237 38  SER A CA  
199 C C   . SER A 38  ? 0.3127 0.2214 0.2660 0.1000  -0.0114 -0.0383 38  SER A C   
200 O O   . SER A 38  ? 0.3305 0.3201 0.3373 0.1027  -0.0039 -0.0692 38  SER A O   
201 C CB  . SER A 38  ? 0.2723 0.1411 0.2204 0.0568  0.0168  0.0145  38  SER A CB  
202 O OG  . SER A 38  ? 0.3491 0.2574 0.3479 0.0318  0.0442  0.0222  38  SER A OG  
203 N N   . ASN A 39  ? 0.3419 0.1734 0.2378 0.0952  -0.0194 -0.0201 39  ASN A N   
204 C CA  . ASN A 39  ? 0.3490 0.1834 0.2448 0.0989  -0.0222 -0.0304 39  ASN A CA  
205 C C   . ASN A 39  ? 0.3022 0.1555 0.2419 0.0549  0.0128  -0.0071 39  ASN A C   
206 O O   . ASN A 39  ? 0.2991 0.1501 0.2384 0.0496  0.0152  -0.0098 39  ASN A O   
207 C CB  . ASN A 39  ? 0.4518 0.1748 0.2365 0.1168  -0.0530 -0.0249 39  ASN A CB  
208 C CG  . ASN A 39  ? 0.6943 0.3913 0.4234 0.1812  -0.1012 -0.0607 39  ASN A CG  
209 O OD1 . ASN A 39  ? 0.8701 0.6502 0.6492 0.2147  -0.1130 -0.1013 39  ASN A OD1 
210 N ND2 . ASN A 39  ? 0.6329 0.2132 0.2513 0.2004  -0.1318 -0.0523 39  ASN A ND2 
211 N N   . ASP A 40  ? 0.2575 0.1275 0.2288 0.0304  0.0350  0.0121  40  ASP A N   
212 C CA  . ASP A 40  ? 0.2258 0.1053 0.2250 0.0021  0.0584  0.0286  40  ASP A CA  
213 C C   . ASP A 40  ? 0.1909 0.1151 0.2446 -0.0050 0.0753  0.0203  40  ASP A C   
214 O O   . ASP A 40  ? 0.2068 0.1584 0.2802 -0.0060 0.0818  0.0119  40  ASP A O   
215 C CB  . ASP A 40  ? 0.2231 0.0957 0.2194 -0.0106 0.0672  0.0460  40  ASP A CB  
216 C CG  . ASP A 40  ? 0.3555 0.2383 0.3623 -0.0292 0.0800  0.0511  40  ASP A CG  
217 O OD1 . ASP A 40  ? 0.2319 0.1274 0.2549 -0.0331 0.0844  0.0440  40  ASP A OD1 
218 O OD2 . ASP A 40  ? 0.3253 0.2138 0.3268 -0.0371 0.0839  0.0552  40  ASP A OD2 
219 N N   . MET A 41  ? 0.1893 0.1161 0.2587 -0.0153 0.0841  0.0204  41  MET A N   
220 C CA  . MET A 41  ? 0.1743 0.1172 0.2748 -0.0274 0.0998  0.0134  41  MET A CA  
221 C C   . MET A 41  ? 0.2007 0.1161 0.2933 -0.0337 0.1087  0.0317  41  MET A C   
222 O O   . MET A 41  ? 0.2216 0.1179 0.3101 -0.0468 0.1205  0.0314  41  MET A O   
223 C CB  . MET A 41  ? 0.1720 0.1192 0.2855 -0.0303 0.1011  0.0037  41  MET A CB  
224 C CG  . MET A 41  ? 0.1713 0.1047 0.2792 -0.0299 0.0998  0.0135  41  MET A CG  
225 S SD  . MET A 41  ? 0.1681 0.1189 0.2844 -0.0309 0.0967  -0.0023 41  MET A SD  
226 C CE  . MET A 41  ? 0.1676 0.1316 0.2916 -0.0293 0.0969  -0.0067 41  MET A CE  
227 N N   . TYR A 42  ? 0.1811 0.0883 0.2605 -0.0251 0.1017  0.0439  42  TYR A N   
228 C CA  . TYR A 42  ? 0.1991 0.0849 0.2666 -0.0182 0.1026  0.0540  42  TYR A CA  
229 C C   . TYR A 42  ? 0.2052 0.0850 0.2597 -0.0202 0.1057  0.0638  42  TYR A C   
230 O O   . TYR A 42  ? 0.2006 0.1001 0.2573 -0.0197 0.1015  0.0625  42  TYR A O   
231 C CB  . TYR A 42  ? 0.1939 0.1015 0.2625 -0.0076 0.0938  0.0485  42  TYR A CB  
232 C CG  . TYR A 42  ? 0.1912 0.1154 0.2733 -0.0034 0.0907  0.0320  42  TYR A CG  
233 C CD1 . TYR A 42  ? 0.3158 0.2113 0.3909 0.0161  0.0839  0.0264  42  TYR A CD1 
234 C CD2 . TYR A 42  ? 0.1755 0.1303 0.2636 -0.0194 0.0930  0.0211  42  TYR A CD2 
235 C CE1 . TYR A 42  ? 0.2281 0.1413 0.3168 0.0259  0.0774  0.0064  42  TYR A CE1 
236 C CE2 . TYR A 42  ? 0.1744 0.1546 0.2781 -0.0173 0.0915  0.0024  42  TYR A CE2 
237 C CZ  . TYR A 42  ? 0.2164 0.1835 0.3280 0.0086  0.0827  -0.0070 42  TYR A CZ  
238 O OH  . TYR A 42  ? 0.1968 0.1914 0.3249 0.0179  0.0768  -0.0309 42  TYR A OH  
239 N N   . HIS A 43  ? 0.2452 0.0865 0.2737 -0.0210 0.1107  0.0726  43  HIS A N   
240 C CA  . HIS A 43  ? 0.2739 0.1064 0.2820 -0.0218 0.1134  0.0828  43  HIS A CA  
241 C C   . HIS A 43  ? 0.2403 0.0915 0.2512 0.0011  0.0995  0.0861  43  HIS A C   
242 O O   . HIS A 43  ? 0.2482 0.1003 0.2574 0.0203  0.0888  0.0798  43  HIS A O   
243 C CB  . HIS A 43  ? 0.3380 0.0980 0.2904 -0.0315 0.1212  0.0927  43  HIS A CB  
244 C CG  . HIS A 43  ? 0.5186 0.2588 0.4354 -0.0357 0.1255  0.1044  43  HIS A CG  
245 N ND1 . HIS A 43  ? 0.5546 0.3336 0.4816 -0.0646 0.1427  0.0979  43  HIS A ND1 
246 C CD2 . HIS A 43  ? 0.5654 0.2590 0.4356 -0.0110 0.1127  0.1168  43  HIS A CD2 
247 C CE1 . HIS A 43  ? 0.3932 0.1469 0.2810 -0.0637 0.1439  0.1100  43  HIS A CE1 
248 N NE2 . HIS A 43  ? 0.6394 0.3354 0.4889 -0.0303 0.1252  0.1237  43  HIS A NE2 
249 N N   . SER A 44  ? 0.2627 0.1378 0.2789 -0.0009 0.0990  0.0884  44  SER A N   
250 C CA  . SER A 44  ? 0.2118 0.1029 0.2248 0.0130  0.0901  0.0889  44  SER A CA  
251 C C   . SER A 44  ? 0.2816 0.1522 0.2684 0.0206  0.0913  0.0997  44  SER A C   
252 O O   . SER A 44  ? 0.3290 0.1843 0.3025 0.0039  0.1031  0.1052  44  SER A O   
253 C CB  . SER A 44  ? 0.1887 0.1004 0.2077 0.0039  0.0866  0.0842  44  SER A CB  
254 O OG  . SER A 44  ? 0.1852 0.1048 0.2044 -0.0068 0.0849  0.0744  44  SER A OG  
255 N N   . ARG A 45  ? 0.2509 0.1289 0.2276 0.0426  0.0806  0.0973  45  ARG A N   
256 C CA  . ARG A 45  ? 0.2876 0.1408 0.2291 0.0533  0.0792  0.1082  45  ARG A CA  
257 C C   . ARG A 45  ? 0.2692 0.1662 0.2231 0.0735  0.0673  0.0963  45  ARG A C   
258 O O   . ARG A 45  ? 0.2750 0.2187 0.2575 0.0758  0.0622  0.0760  45  ARG A O   
259 C CB  . ARG A 45  ? 0.3731 0.1463 0.2501 0.0672  0.0744  0.1185  45  ARG A CB  
260 C CG  . ARG A 45  ? 0.4083 0.1721 0.2677 0.1146  0.0479  0.1023  45  ARG A CG  
261 C CD  . ARG A 45  ? 0.5837 0.2329 0.3535 0.1350  0.0352  0.1119  45  ARG A CD  
262 N NE  . ARG A 45  ? 0.5618 0.2108 0.3186 0.1929  0.0015  0.0849  45  ARG A NE  
263 C CZ  . ARG A 45  ? 0.8505 0.5150 0.5852 0.2477  -0.0280 0.0640  45  ARG A CZ  
264 N NH1 . ARG A 45  ? 0.6045 0.2727 0.3215 0.2502  -0.0267 0.0740  45  ARG A NH1 
265 N NH2 . ARG A 45  ? 0.6290 0.3147 0.3608 0.3048  -0.0616 0.0260  45  ARG A NH2 
266 N N   . ALA A 46  ? 0.2895 0.1778 0.2199 0.0820  0.0658  0.1043  46  ALA A N   
267 C CA  . ALA A 46  ? 0.2724 0.2081 0.2159 0.0987  0.0561  0.0903  46  ALA A CA  
268 C C   . ALA A 46  ? 0.3263 0.2906 0.2695 0.1352  0.0372  0.0641  46  ALA A C   
269 O O   . ALA A 46  ? 0.3860 0.3011 0.2843 0.1702  0.0210  0.0645  46  ALA A O   
270 C CB  . ALA A 46  ? 0.3006 0.2158 0.2117 0.1045  0.0571  0.1041  46  ALA A CB  
271 N N   . LEU A 47  ? 0.3378 0.3801 0.3224 0.1263  0.0375  0.0346  47  LEU A N   
272 C CA  . LEU A 47  ? 0.2637 0.3717 0.2601 0.1611  0.0197  -0.0074 47  LEU A CA  
273 C C   . LEU A 47  ? 0.2848 0.4172 0.2697 0.1888  0.0078  -0.0175 47  LEU A C   
274 O O   . LEU A 47  ? 0.3932 0.5358 0.3540 0.2449  -0.0189 -0.0407 47  LEU A O   
275 C CB  . LEU A 47  ? 0.2688 0.4658 0.3114 0.1248  0.0321  -0.0455 47  LEU A CB  
276 C CG  . LEU A 47  ? 0.3612 0.5763 0.4193 0.1180  0.0337  -0.0625 47  LEU A CG  
277 C CD1 . LEU A 47  ? 0.2791 0.5451 0.3590 0.0539  0.0582  -0.0825 47  LEU A CD1 
278 C CD2 . LEU A 47  ? 0.2495 0.5253 0.3147 0.1757  0.0064  -0.1099 47  LEU A CD2 
279 N N   . GLN A 48  ? 0.3389 0.4749 0.3335 0.1566  0.0227  -0.0027 48  GLN A N   
280 C CA  . GLN A 48  ? 0.3189 0.4946 0.3127 0.1756  0.0144  -0.0177 48  GLN A CA  
281 C C   . GLN A 48  ? 0.3336 0.4755 0.3237 0.1429  0.0294  0.0123  48  GLN A C   
282 O O   . GLN A 48  ? 0.3682 0.4945 0.3701 0.1023  0.0437  0.0217  48  GLN A O   
283 C CB  . GLN A 48  ? 0.2283 0.5160 0.2667 0.1613  0.0167  -0.0730 48  GLN A CB  
284 C CG  . GLN A 48  ? 0.2983 0.6513 0.3474 0.1747  0.0102  -0.1018 48  GLN A CG  
285 C CD  . GLN A 48  ? 0.5076 0.9617 0.5964 0.1231  0.0283  -0.1534 48  GLN A CD  
286 O OE1 . GLN A 48  ? 0.4327 0.8964 0.5305 0.0715  0.0478  -0.1634 48  GLN A OE1 
287 N NE2 . GLN A 48  ? 0.5115 1.0372 0.6151 0.1299  0.0246  -0.1880 48  GLN A NE2 
288 N N   . VAL A 49  ? 0.2990 0.4266 0.2651 0.1652  0.0225  0.0239  49  VAL A N   
289 C CA  . VAL A 49  ? 0.2331 0.3529 0.2030 0.1412  0.0324  0.0388  49  VAL A CA  
290 C C   . VAL A 49  ? 0.2789 0.4646 0.2723 0.1386  0.0292  0.0075  49  VAL A C   
291 O O   . VAL A 49  ? 0.2718 0.4931 0.2593 0.1740  0.0160  -0.0093 49  VAL A O   
292 C CB  . VAL A 49  ? 0.2905 0.3659 0.2190 0.1568  0.0316  0.0651  49  VAL A CB  
293 C CG1 . VAL A 49  ? 0.2427 0.3360 0.1850 0.1384  0.0382  0.0679  49  VAL A CG1 
294 C CG2 . VAL A 49  ? 0.2993 0.3079 0.1956 0.1455  0.0406  0.0907  49  VAL A CG2 
295 N N   . VAL A 50  ? 0.2330 0.4251 0.2406 0.0968  0.0397  -0.0025 50  VAL A N   
296 C CA  . VAL A 50  ? 0.1991 0.4462 0.2191 0.0780  0.0419  -0.0374 50  VAL A CA  
297 C C   . VAL A 50  ? 0.2188 0.4635 0.2319 0.0925  0.0353  -0.0304 50  VAL A C   
298 O O   . VAL A 50  ? 0.2079 0.5120 0.2335 0.1029  0.0310  -0.0582 50  VAL A O   
299 C CB  . VAL A 50  ? 0.2304 0.4535 0.2358 0.0177  0.0564  -0.0503 50  VAL A CB  
300 C CG1 . VAL A 50  ? 0.2781 0.5388 0.2783 -0.0150 0.0629  -0.0859 50  VAL A CG1 
301 C CG2 . VAL A 50  ? 0.2172 0.4677 0.2331 -0.0032 0.0663  -0.0683 50  VAL A CG2 
302 N N   . ARG A 51  ? 0.2343 0.4230 0.2311 0.0937  0.0339  -0.0006 51  ARG A N   
303 C CA  . ARG A 51  ? 0.2007 0.3955 0.1931 0.1088  0.0272  0.0025  51  ARG A CA  
304 C C   . ARG A 51  ? 0.2212 0.3831 0.2027 0.1179  0.0276  0.0283  51  ARG A C   
305 O O   . ARG A 51  ? 0.2483 0.3753 0.2264 0.1052  0.0309  0.0385  51  ARG A O   
306 C CB  . ARG A 51  ? 0.2168 0.3997 0.1998 0.0833  0.0243  -0.0166 51  ARG A CB  
307 C CG  . ARG A 51  ? 0.2134 0.4315 0.2022 0.1043  0.0163  -0.0257 51  ARG A CG  
308 C CD  . ARG A 51  ? 0.2694 0.5096 0.2558 0.0795  0.0173  -0.0589 51  ARG A CD  
309 N NE  . ARG A 51  ? 0.2633 0.5349 0.2559 0.1017  0.0078  -0.0680 51  ARG A NE  
310 C CZ  . ARG A 51  ? 0.3081 0.5817 0.2897 0.0809  0.0055  -0.0951 51  ARG A CZ  
311 N NH1 . ARG A 51  ? 0.3604 0.5982 0.3128 0.0289  0.0152  -0.1161 51  ARG A NH1 
312 N NH2 . ARG A 51  ? 0.2489 0.5552 0.2397 0.1061  -0.0045 -0.1027 51  ARG A NH2 
313 N N   . ALA A 52  ? 0.2040 0.3869 0.1792 0.1364  0.0257  0.0326  52  ALA A N   
314 C CA  . ALA A 52  ? 0.2085 0.3864 0.1750 0.1346  0.0309  0.0436  52  ALA A CA  
315 C C   . ALA A 52  ? 0.2065 0.4228 0.1774 0.1457  0.0239  0.0293  52  ALA A C   
316 O O   . ALA A 52  ? 0.2495 0.4892 0.2118 0.1607  0.0221  0.0279  52  ALA A O   
317 C CB  . ALA A 52  ? 0.2404 0.3949 0.1731 0.1350  0.0432  0.0656  52  ALA A CB  
318 N N   . ARG A 53  ? 0.2516 0.8513 0.1794 0.2440  -0.0058 0.0040  53  ARG A N   
319 C CA  . ARG A 53  ? 0.1836 0.7208 0.1425 0.1994  -0.0035 0.0163  53  ARG A CA  
320 C C   . ARG A 53  ? 0.1854 0.6357 0.1253 0.1881  -0.0053 0.0127  53  ARG A C   
321 O O   . ARG A 53  ? 0.1970 0.6412 0.1171 0.2045  -0.0078 0.0066  53  ARG A O   
322 C CB  . ARG A 53  ? 0.1610 0.7581 0.1951 0.1619  0.0041  0.0543  53  ARG A CB  
323 C CG  . ARG A 53  ? 0.1587 0.8668 0.2362 0.1683  0.0075  0.0751  53  ARG A CG  
324 C CD  . ARG A 53  ? 0.1433 0.8880 0.3329 0.1218  0.0026  0.1175  53  ARG A CD  
325 N NE  . ARG A 53  ? 0.3625 1.1251 0.5921 0.0986  0.0142  0.1685  53  ARG A NE  
326 C CZ  . ARG A 53  ? 0.5840 1.3670 0.9337 0.0538  0.0049  0.2192  53  ARG A CZ  
327 N NH1 . ARG A 53  ? 0.6829 1.4679 1.1317 0.0279  -0.0226 0.2155  53  ARG A NH1 
328 N NH2 . ARG A 53  ? 0.1556 0.9565 0.5393 0.0369  0.0166  0.2728  53  ARG A NH2 
329 N N   . LYS A 54  ? 0.1777 0.5738 0.1264 0.1668  -0.0075 0.0125  54  LYS A N   
330 C CA  . LYS A 54  ? 0.2431 0.5701 0.1767 0.1585  -0.0078 0.0149  54  LYS A CA  
331 C C   . LYS A 54  ? 0.2586 0.5724 0.2155 0.1357  -0.0089 0.0164  54  LYS A C   
332 O O   . LYS A 54  ? 0.1655 0.5097 0.1481 0.1354  -0.0184 0.0035  54  LYS A O   
333 C CB  . LYS A 54  ? 0.3333 0.6164 0.2438 0.1825  -0.0170 0.0114  54  LYS A CB  
334 C CG  . LYS A 54  ? 0.2270 0.5154 0.1321 0.1908  -0.0163 0.0179  54  LYS A CG  
335 C CD  . LYS A 54  ? 0.5424 0.7948 0.4466 0.2103  -0.0231 0.0421  54  LYS A CD  
336 C CE  . LYS A 54  ? 0.4237 0.7163 0.3160 0.2363  -0.0212 0.0543  54  LYS A CE  
337 N NZ  . LYS A 54  ? 0.4354 0.7030 0.3492 0.2518  -0.0266 0.1022  54  LYS A NZ  
338 N N   . GLN A 55  ? 0.1633 0.4370 0.1171 0.1224  -0.0058 0.0239  55  GLN A N   
339 C CA  . GLN A 55  ? 0.1588 0.4252 0.1365 0.1089  -0.0137 0.0161  55  GLN A CA  
340 C C   . GLN A 55  ? 0.2464 0.4755 0.1996 0.1095  -0.0074 0.0254  55  GLN A C   
341 O O   . GLN A 55  ? 0.2795 0.4813 0.2269 0.0993  -0.0001 0.0388  55  GLN A O   
342 C CB  . GLN A 55  ? 0.1955 0.4747 0.2303 0.0805  -0.0188 0.0268  55  GLN A CB  
343 C CG  . GLN A 55  ? 0.1793 0.4413 0.2588 0.0691  -0.0402 0.0105  55  GLN A CG  
344 C CD  . GLN A 55  ? 0.5961 0.8620 0.7506 0.0367  -0.0466 0.0402  55  GLN A CD  
345 O OE1 . GLN A 55  ? 0.4003 0.6796 0.6453 0.0215  -0.0750 0.0372  55  GLN A OE1 
346 N NE2 . GLN A 55  ? 0.2039 0.4643 0.3353 0.0281  -0.0247 0.0726  55  GLN A NE2 
347 N N   . ILE A 56  ? 0.1701 0.4144 0.1108 0.1283  -0.0116 0.0185  56  ILE A N   
348 C CA  . ILE A 56  ? 0.1728 0.4052 0.1003 0.1300  -0.0046 0.0348  56  ILE A CA  
349 C C   . ILE A 56  ? 0.1642 0.3807 0.1148 0.1127  -0.0152 0.0154  56  ILE A C   
350 O O   . ILE A 56  ? 0.1685 0.3986 0.1524 0.1140  -0.0372 -0.0156 56  ILE A O   
351 C CB  . ILE A 56  ? 0.1912 0.4821 0.0978 0.1675  -0.0037 0.0408  56  ILE A CB  
352 C CG1 . ILE A 56  ? 0.3286 0.6345 0.2256 0.1836  0.0061  0.0749  56  ILE A CG1 
353 C CG2 . ILE A 56  ? 0.2163 0.5212 0.1164 0.1724  0.0058  0.0663  56  ILE A CG2 
354 C CD1 . ILE A 56  ? 0.4744 0.8709 0.3494 0.2321  0.0066  0.0801  56  ILE A CD1 
355 N N   . VAL A 57  ? 0.1575 0.3433 0.1038 0.0977  -0.0061 0.0326  57  VAL A N   
356 C CA  . VAL A 57  ? 0.1565 0.3243 0.1257 0.0832  -0.0167 0.0192  57  VAL A CA  
357 C C   . VAL A 57  ? 0.1800 0.3527 0.1277 0.0935  -0.0100 0.0278  57  VAL A C   
358 O O   . VAL A 57  ? 0.2841 0.4542 0.2182 0.0928  0.0062  0.0593  57  VAL A O   
359 C CB  . VAL A 57  ? 0.1408 0.2807 0.1298 0.0547  -0.0099 0.0375  57  VAL A CB  
360 C CG1 . VAL A 57  ? 0.1384 0.3020 0.1597 0.0468  -0.0139 0.0423  57  VAL A CG1 
361 C CG2 . VAL A 57  ? 0.1386 0.2612 0.0984 0.0554  0.0059  0.0554  57  VAL A CG2 
362 N N   . ALA A 58  ? 0.1668 0.3538 0.1241 0.1070  -0.0283 -0.0006 58  ALA A N   
363 C CA  . ALA A 58  ? 0.1696 0.3703 0.1097 0.1166  -0.0220 0.0078  58  ALA A CA  
364 C C   . ALA A 58  ? 0.1960 0.3505 0.1635 0.0962  -0.0366 -0.0081 58  ALA A C   
365 O O   . ALA A 58  ? 0.1726 0.3006 0.1858 0.0836  -0.0601 -0.0274 58  ALA A O   
366 C CB  . ALA A 58  ? 0.2219 0.5065 0.1412 0.1682  -0.0329 -0.0143 58  ALA A CB  
367 N N   . GLY A 59  ? 0.1622 0.3124 0.1147 0.0923  -0.0247 0.0080  59  GLY A N   
368 C CA  . GLY A 59  ? 0.1597 0.2688 0.1310 0.0739  -0.0321 0.0044  59  GLY A CA  
369 C C   . GLY A 59  ? 0.1879 0.3213 0.1362 0.0866  -0.0232 0.0112  59  GLY A C   
370 O O   . GLY A 59  ? 0.1637 0.3554 0.0913 0.1076  -0.0095 0.0296  59  GLY A O   
371 N N   . VAL A 60  ? 0.1614 0.2626 0.1214 0.0757  -0.0308 0.0052  60  VAL A N   
372 C CA  . VAL A 60  ? 0.1867 0.3143 0.1297 0.0884  -0.0255 0.0077  60  VAL A CA  
373 C C   . VAL A 60  ? 0.2019 0.2819 0.1512 0.0588  -0.0145 0.0277  60  VAL A C   
374 O O   . VAL A 60  ? 0.1528 0.1939 0.1232 0.0449  -0.0245 0.0256  60  VAL A O   
375 C CB  . VAL A 60  ? 0.1898 0.3343 0.1411 0.1210  -0.0589 -0.0395 60  VAL A CB  
376 C CG1 . VAL A 60  ? 0.1926 0.3900 0.1190 0.1425  -0.0497 -0.0348 60  VAL A CG1 
377 C CG2 . VAL A 60  ? 0.2145 0.4069 0.1687 0.1618  -0.0857 -0.0818 60  VAL A CG2 
378 N N   . ASN A 61  ? 0.1399 0.2332 0.0836 0.0519  0.0028  0.0525  61  ASN A N   
379 C CA  . ASN A 61  ? 0.1340 0.1984 0.0832 0.0369  0.0057  0.0575  61  ASN A CA  
380 C C   . ASN A 61  ? 0.2365 0.3204 0.1803 0.0486  0.0011  0.0485  61  ASN A C   
381 O O   . ASN A 61  ? 0.2013 0.3410 0.1442 0.0637  0.0064  0.0588  61  ASN A O   
382 C CB  . ASN A 61  ? 0.2464 0.3090 0.2174 0.0255  0.0118  0.0777  61  ASN A CB  
383 C CG  . ASN A 61  ? 0.1549 0.1934 0.1300 0.0211  0.0090  0.0742  61  ASN A CG  
384 O OD1 . ASN A 61  ? 0.1967 0.2249 0.1566 0.0233  0.0078  0.0626  61  ASN A OD1 
385 N ND2 . ASN A 61  ? 0.1355 0.1762 0.1395 0.0181  0.0067  0.0911  61  ASN A ND2 
386 N N   . TYR A 62  ? 0.1974 0.2512 0.1407 0.0461  -0.0075 0.0368  62  TYR A N   
387 C CA  . TYR A 62  ? 0.1492 0.2173 0.0874 0.0561  -0.0113 0.0287  62  TYR A CA  
388 C C   . TYR A 62  ? 0.1408 0.2005 0.0842 0.0439  -0.0034 0.0387  62  TYR A C   
389 O O   . TYR A 62  ? 0.1532 0.1913 0.0960 0.0384  -0.0028 0.0404  62  TYR A O   
390 C CB  . TYR A 62  ? 0.1688 0.2093 0.1149 0.0662  -0.0333 0.0091  62  TYR A CB  
391 C CG  . TYR A 62  ? 0.2036 0.2511 0.1629 0.0869  -0.0583 -0.0198 62  TYR A CG  
392 C CD1 . TYR A 62  ? 0.2976 0.3149 0.2885 0.0764  -0.0713 -0.0192 62  TYR A CD1 
393 C CD2 . TYR A 62  ? 0.3647 0.4653 0.3095 0.1251  -0.0735 -0.0526 62  TYR A CD2 
394 C CE1 . TYR A 62  ? 0.2970 0.3212 0.3138 0.1010  -0.1062 -0.0593 62  TYR A CE1 
395 C CE2 . TYR A 62  ? 0.2342 0.3550 0.1919 0.1599  -0.1074 -0.0971 62  TYR A CE2 
396 C CZ  . TYR A 62  ? 0.2578 0.3337 0.2554 0.1470  -0.1272 -0.1050 62  TYR A CZ  
397 O OH  . TYR A 62  ? 0.3838 0.4803 0.4081 0.1879  -0.1736 -0.1637 62  TYR A OH  
398 N N   . PHE A 63  ? 0.1489 0.2407 0.1036 0.0456  -0.0005 0.0442  63  PHE A N   
399 C CA  . PHE A 63  ? 0.1527 0.2397 0.1289 0.0381  -0.0040 0.0424  63  PHE A CA  
400 C C   . PHE A 63  ? 0.2465 0.3504 0.2103 0.0505  -0.0076 0.0307  63  PHE A C   
401 O O   . PHE A 63  ? 0.1396 0.2924 0.1137 0.0569  -0.0042 0.0406  63  PHE A O   
402 C CB  . PHE A 63  ? 0.1321 0.2425 0.1662 0.0234  -0.0052 0.0670  63  PHE A CB  
403 C CG  . PHE A 63  ? 0.2670 0.3605 0.3202 0.0141  -0.0055 0.0804  63  PHE A CG  
404 C CD1 . PHE A 63  ? 0.3912 0.5207 0.4450 0.0156  0.0078  0.1117  63  PHE A CD1 
405 C CD2 . PHE A 63  ? 0.3577 0.4128 0.4256 0.0134  -0.0216 0.0578  63  PHE A CD2 
406 C CE1 . PHE A 63  ? 0.1327 0.2478 0.2052 0.0088  0.0072  0.1267  63  PHE A CE1 
407 C CE2 . PHE A 63  ? 0.2181 0.2580 0.3044 0.0091  -0.0256 0.0659  63  PHE A CE2 
408 C CZ  . PHE A 63  ? 0.1853 0.2494 0.2765 0.0027  -0.0100 0.1042  63  PHE A CZ  
409 N N   . LEU A 64  ? 0.1493 0.2278 0.0932 0.0585  -0.0132 0.0164  64  LEU A N   
410 C CA  . LEU A 64  ? 0.1600 0.2435 0.0886 0.0736  -0.0193 0.0057  64  LEU A CA  
411 C C   . LEU A 64  ? 0.1627 0.2592 0.0981 0.0794  -0.0239 -0.0062 64  LEU A C   
412 O O   . LEU A 64  ? 0.2023 0.2967 0.1321 0.0880  -0.0268 -0.0120 64  LEU A O   
413 C CB  . LEU A 64  ? 0.1855 0.2376 0.1029 0.0815  -0.0261 0.0114  64  LEU A CB  
414 C CG  . LEU A 64  ? 0.2529 0.2850 0.1816 0.0791  -0.0350 0.0115  64  LEU A CG  
415 C CD1 . LEU A 64  ? 0.2074 0.2047 0.1631 0.0807  -0.0514 0.0269  64  LEU A CD1 
416 C CD2 . LEU A 64  ? 0.3211 0.3826 0.2446 0.0978  -0.0457 -0.0138 64  LEU A CD2 
417 N N   . ASP A 65  ? 0.1598 0.2859 0.1108 0.0814  -0.0271 -0.0124 65  ASP A N   
418 C CA  . ASP A 65  ? 0.1669 0.3084 0.1255 0.0928  -0.0374 -0.0317 65  ASP A CA  
419 C C   . ASP A 65  ? 0.1808 0.3238 0.1020 0.1144  -0.0383 -0.0368 65  ASP A C   
420 O O   . ASP A 65  ? 0.1824 0.3400 0.0980 0.1200  -0.0386 -0.0370 65  ASP A O   
421 C CB  . ASP A 65  ? 0.1583 0.3338 0.1809 0.0772  -0.0450 -0.0287 65  ASP A CB  
422 C CG  . ASP A 65  ? 0.3450 0.5051 0.4266 0.0581  -0.0563 -0.0241 65  ASP A CG  
423 O OD1 . ASP A 65  ? 0.1849 0.3292 0.2729 0.0724  -0.0767 -0.0589 65  ASP A OD1 
424 O OD2 . ASP A 65  ? 0.1474 0.3186 0.2669 0.0371  -0.0480 0.0119  65  ASP A OD2 
425 N N   . VAL A 66  ? 0.2042 0.3429 0.1025 0.1336  -0.0410 -0.0387 66  VAL A N   
426 C CA  . VAL A 66  ? 0.2183 0.3496 0.0945 0.1532  -0.0443 -0.0281 66  VAL A CA  
427 C C   . VAL A 66  ? 0.2986 0.4667 0.1587 0.1820  -0.0479 -0.0361 66  VAL A C   
428 O O   . VAL A 66  ? 0.2873 0.4858 0.1382 0.1989  -0.0455 -0.0342 66  VAL A O   
429 C CB  . VAL A 66  ? 0.2333 0.3325 0.1130 0.1505  -0.0425 0.0089  66  VAL A CB  
430 C CG1 . VAL A 66  ? 0.2639 0.3408 0.1548 0.1654  -0.0580 0.0251  66  VAL A CG1 
431 C CG2 . VAL A 66  ? 0.2200 0.2900 0.1154 0.1277  -0.0420 0.0098  66  VAL A CG2 
432 N N   . GLU A 67  ? 0.2580 0.5342 0.2479 0.0839  -0.0082 0.0724  67  GLU A N   
433 C CA  . GLU A 67  ? 0.2651 0.4579 0.2430 0.0818  -0.0130 0.0490  67  GLU A CA  
434 C C   . GLU A 67  ? 0.2414 0.4226 0.2226 0.0975  -0.0083 0.0080  67  GLU A C   
435 O O   . GLU A 67  ? 0.2329 0.4651 0.2148 0.0989  -0.0042 -0.0183 67  GLU A O   
436 C CB  . GLU A 67  ? 0.2613 0.4966 0.2549 0.0627  -0.0228 0.0586  67  GLU A CB  
437 C CG  . GLU A 67  ? 0.2768 0.4527 0.2654 0.0509  -0.0333 0.0502  67  GLU A CG  
438 C CD  . GLU A 67  ? 0.5267 0.7760 0.5459 0.0253  -0.0471 0.0902  67  GLU A CD  
439 O OE1 . GLU A 67  ? 0.2518 0.6141 0.3073 0.0389  -0.0352 0.1131  67  GLU A OE1 
440 O OE2 . GLU A 67  ? 0.4080 0.6141 0.4128 -0.0103 -0.0691 0.1072  67  GLU A OE2 
441 N N   . VAL A 68  ? 0.2542 0.3526 0.2214 0.1050  -0.0077 0.0030  68  VAL A N   
442 C CA  . VAL A 68  ? 0.2366 0.3220 0.2108 0.1161  -0.0070 -0.0215 68  VAL A CA  
443 C C   . VAL A 68  ? 0.2387 0.2668 0.2101 0.1109  -0.0133 -0.0386 68  VAL A C   
444 O O   . VAL A 68  ? 0.2758 0.2449 0.2169 0.0953  -0.0184 -0.0241 68  VAL A O   
445 C CB  . VAL A 68  ? 0.2544 0.3247 0.2233 0.1381  0.0060  0.0118  68  VAL A CB  
446 C CG1 . VAL A 68  ? 0.2745 0.2692 0.2256 0.1556  0.0150  0.0079  68  VAL A CG1 
447 C CG2 . VAL A 68  ? 0.2341 0.4031 0.2274 0.1308  -0.0001 0.0292  68  VAL A CG2 
448 N N   . GLY A 69  ? 0.2363 0.2756 0.2289 0.1152  -0.0152 -0.0646 69  GLY A N   
449 C CA  . GLY A 69  ? 0.2150 0.2299 0.2241 0.1120  -0.0206 -0.0676 69  GLY A CA  
450 C C   . GLY A 69  ? 0.2077 0.1942 0.2258 0.1192  -0.0233 -0.0826 69  GLY A C   
451 O O   . GLY A 69  ? 0.2120 0.2087 0.2285 0.1204  -0.0231 -0.0977 69  GLY A O   
452 N N   . ARG A 70  ? 0.2093 0.1647 0.2293 0.1122  -0.0310 -0.0729 70  ARG A N   
453 C CA  . ARG A 70  ? 0.2012 0.1401 0.2355 0.1170  -0.0355 -0.0768 70  ARG A CA  
454 C C   . ARG A 70  ? 0.2385 0.1864 0.3153 0.1243  -0.0344 -0.0880 70  ARG A C   
455 O O   . ARG A 70  ? 0.2064 0.1759 0.3124 0.1322  -0.0268 -0.0750 70  ARG A O   
456 C CB  . ARG A 70  ? 0.2227 0.1248 0.2288 0.1035  -0.0415 -0.0612 70  ARG A CB  
457 C CG  . ARG A 70  ? 0.2264 0.1134 0.2266 0.1134  -0.0394 -0.0555 70  ARG A CG  
458 C CD  . ARG A 70  ? 0.2711 0.1163 0.2234 0.0916  -0.0446 -0.0453 70  ARG A CD  
459 N NE  . ARG A 70  ? 0.3256 0.1535 0.2527 0.1087  -0.0326 -0.0365 70  ARG A NE  
460 C CZ  . ARG A 70  ? 0.3405 0.1394 0.2209 0.0891  -0.0363 -0.0287 70  ARG A CZ  
461 N NH1 . ARG A 70  ? 0.3641 0.1599 0.2264 0.0393  -0.0609 -0.0223 70  ARG A NH1 
462 N NH2 . ARG A 70  ? 0.3667 0.1603 0.2226 0.1157  -0.0166 -0.0165 70  ARG A NH2 
463 N N   . THR A 71  ? 0.2139 0.1434 0.2901 0.1213  -0.0391 -0.1018 71  THR A N   
464 C CA  . THR A 71  ? 0.2574 0.1463 0.3457 0.1279  -0.0321 -0.1164 71  THR A CA  
465 C C   . THR A 71  ? 0.2455 0.1254 0.3730 0.1243  -0.0447 -0.0947 71  THR A C   
466 O O   . THR A 71  ? 0.2506 0.1600 0.3860 0.1143  -0.0590 -0.0733 71  THR A O   
467 C CB  . THR A 71  ? 0.3349 0.1733 0.3655 0.1065  -0.0340 -0.1495 71  THR A CB  
468 O OG1 . THR A 71  ? 0.3354 0.1825 0.3620 0.0694  -0.0646 -0.1344 71  THR A OG1 
469 C CG2 . THR A 71  ? 0.3514 0.2147 0.3364 0.1017  -0.0251 -0.1667 71  THR A CG2 
470 N N   . THR A 72  ? 0.3173 0.1480 0.4619 0.1384  -0.0323 -0.0972 72  THR A N   
471 C CA  . THR A 72  ? 0.2920 0.1188 0.4833 0.1359  -0.0434 -0.0683 72  THR A CA  
472 C C   . THR A 72  ? 0.3475 0.1249 0.5141 0.1006  -0.0679 -0.0757 72  THR A C   
473 O O   . THR A 72  ? 0.4165 0.2024 0.6235 0.0907  -0.0839 -0.0453 72  THR A O   
474 C CB  . THR A 72  ? 0.3604 0.1718 0.6019 0.1789  -0.0111 -0.0427 72  THR A CB  
475 O OG1 . THR A 72  ? 0.4421 0.1550 0.6329 0.2091  0.0270  -0.0770 72  THR A OG1 
476 C CG2 . THR A 72  ? 0.2718 0.1843 0.5579 0.1922  -0.0041 -0.0030 72  THR A CG2 
477 N N   . CYS A 73  ? 0.3944 0.1338 0.4944 0.0706  -0.0768 -0.1055 73  CYS A N   
478 C CA  . CYS A 73  ? 0.4380 0.1661 0.5136 0.0139  -0.1144 -0.0925 73  CYS A CA  
479 C C   . CYS A 73  ? 0.3424 0.1972 0.4579 0.0039  -0.1361 -0.0459 73  CYS A C   
480 O O   . CYS A 73  ? 0.3027 0.2175 0.4219 0.0309  -0.1205 -0.0426 73  CYS A O   
481 C CB  . CYS A 73  ? 0.5733 0.2312 0.5499 -0.0345 -0.1245 -0.1278 73  CYS A CB  
482 S SG  . CYS A 73  ? 0.8586 0.3198 0.7309 -0.0157 -0.0802 -0.1938 73  CYS A SG  
483 N N   . THR A 74  ? 0.3996 0.4587 0.9076 -0.0394 -0.1084 -0.4920 74  THR A N   
484 C CA  . THR A 74  ? 0.3609 0.5050 0.8949 -0.0454 -0.1238 -0.4887 74  THR A CA  
485 C C   . THR A 74  ? 0.3927 0.5586 0.9096 -0.0583 -0.1489 -0.5037 74  THR A C   
486 O O   . THR A 74  ? 0.4658 0.5589 0.9288 -0.0736 -0.1621 -0.5169 74  THR A O   
487 C CB  . THR A 74  ? 0.3535 0.5323 0.9206 -0.0753 -0.1236 -0.4752 74  THR A CB  
488 O OG1 . THR A 74  ? 0.4032 0.5606 0.9635 -0.1182 -0.1441 -0.4796 74  THR A OG1 
489 C CG2 . THR A 74  ? 0.3434 0.4690 0.9111 -0.0719 -0.1109 -0.4605 74  THR A CG2 
490 N N   . LYS A 75  ? 0.3560 0.6039 0.9082 -0.0496 -0.1609 -0.4991 75  LYS A N   
491 C CA  . LYS A 75  ? 0.3834 0.6541 0.9406 -0.0677 -0.1964 -0.5051 75  LYS A CA  
492 C C   . LYS A 75  ? 0.4900 0.7564 1.0678 -0.1202 -0.2267 -0.4881 75  LYS A C   
493 O O   . LYS A 75  ? 0.5654 0.7882 1.1180 -0.1488 -0.2736 -0.4877 75  LYS A O   
494 C CB  . LYS A 75  ? 0.4067 0.7767 1.0177 -0.0413 -0.2017 -0.4986 75  LYS A CB  
495 C CG  . LYS A 75  ? 0.3012 0.6570 0.8727 0.0044  -0.2001 -0.5110 75  LYS A CG  
496 C CD  . LYS A 75  ? 0.2750 0.7125 0.8827 0.0356  -0.2125 -0.5075 75  LYS A CD  
497 C CE  . LYS A 75  ? 0.2622 0.6676 0.8122 0.0759  -0.2333 -0.5168 75  LYS A CE  
498 N NZ  . LYS A 75  ? 0.2592 0.7149 0.8119 0.1244  -0.2427 -0.5132 75  LYS A NZ  
499 N N   . THR A 76  ? 0.5773 0.8690 1.1885 -0.1386 -0.2110 -0.4693 76  THR A N   
500 C CA  . THR A 76  ? 0.5905 0.8945 1.2334 -0.1952 -0.2481 -0.4389 76  THR A CA  
501 C C   . THR A 76  ? 0.5660 0.7307 1.1159 -0.2249 -0.2817 -0.4508 76  THR A C   
502 O O   . THR A 76  ? 0.6704 0.8316 1.2338 -0.2735 -0.3196 -0.4237 76  THR A O   
503 C CB  . THR A 76  ? 0.5996 1.0073 1.3217 -0.2051 -0.2161 -0.4063 76  THR A CB  
504 O OG1 . THR A 76  ? 0.4145 0.7561 1.0892 -0.1954 -0.1865 -0.4246 76  THR A OG1 
505 C CG2 . THR A 76  ? 0.3641 0.8949 1.1573 -0.1629 -0.1766 -0.3908 76  THR A CG2 
506 N N   . GLN A 77  ? 0.7309 0.7782 1.1812 -0.1928 -0.2692 -0.4867 77  GLN A N   
507 C CA  . GLN A 77  ? 0.7821 0.6817 1.1256 -0.1996 -0.2868 -0.5021 77  GLN A CA  
508 C C   . GLN A 77  ? 0.8615 0.6099 1.0655 -0.1792 -0.3035 -0.5261 77  GLN A C   
509 O O   . GLN A 77  ? 0.8418 0.6058 1.0391 -0.1589 -0.2925 -0.5356 77  GLN A O   
510 C CB  . GLN A 77  ? 0.6822 0.5703 1.0386 -0.1718 -0.2354 -0.5141 77  GLN A CB  
511 C CG  . GLN A 77  ? 0.6699 0.5204 1.0000 -0.1121 -0.1794 -0.5323 77  GLN A CG  
512 C CD  . GLN A 77  ? 0.6846 0.5331 1.0629 -0.0955 -0.1433 -0.5261 77  GLN A CD  
513 O OE1 . GLN A 77  ? 0.5272 0.4480 0.9803 -0.0874 -0.1231 -0.5097 77  GLN A OE1 
514 N NE2 . GLN A 77  ? 0.8110 0.5572 1.1366 -0.0905 -0.1445 -0.5366 77  GLN A NE2 
515 N N   . PRO A 78  ? 1.0338 0.6185 1.1074 -0.1829 -0.3334 -0.5366 78  PRO A N   
516 C CA  . PRO A 78  ? 1.1909 0.5889 1.0876 -0.1626 -0.3546 -0.5564 78  PRO A CA  
517 C C   . PRO A 78  ? 1.2106 0.5553 1.0395 -0.0880 -0.2688 -0.5860 78  PRO A C   
518 O O   . PRO A 78  ? 1.1100 0.5356 1.0219 -0.0504 -0.1997 -0.5873 78  PRO A O   
519 C CB  . PRO A 78  ? 1.3912 0.6188 1.1551 -0.1822 -0.4166 -0.5548 78  PRO A CB  
520 C CG  . PRO A 78  ? 1.4083 0.7263 1.2730 -0.1826 -0.3856 -0.5530 78  PRO A CG  
521 C CD  . PRO A 78  ? 1.0431 0.5876 1.1064 -0.2050 -0.3558 -0.5311 78  PRO A CD  
522 N N   . ASN A 79  ? 1.4251 0.6287 1.1050 -0.0724 -0.2796 -0.6007 79  ASN A N   
523 C CA  . ASN A 79  ? 1.5090 0.6158 1.0755 -0.0003 -0.1999 -0.6220 79  ASN A CA  
524 C C   . ASN A 79  ? 1.2946 0.5673 0.9988 0.0368  -0.1191 -0.6143 79  ASN A C   
525 O O   . ASN A 79  ? 1.2640 0.5530 0.9957 0.0909  -0.0432 -0.6076 79  ASN A O   
526 C CB  . ASN A 79  ? 1.7479 0.7012 1.1881 0.0483  -0.1691 -0.6340 79  ASN A CB  
527 C CG  . ASN A 79  ? 2.1244 0.8702 1.3419 0.1133  -0.1226 -0.6537 79  ASN A CG  
528 O OD1 . ASN A 79  ? 2.1692 0.9611 1.4066 0.1714  -0.0277 -0.6514 79  ASN A OD1 
529 N ND2 . ASN A 79  ? 2.1412 0.6439 1.1326 0.1035  -0.1931 -0.6660 79  ASN A ND2 
530 N N   . LEU A 80  ? 1.1756 0.5591 0.9618 0.0071  -0.1459 -0.6090 80  LEU A N   
531 C CA  . LEU A 80  ? 0.9967 0.5455 0.9220 0.0253  -0.1056 -0.5943 80  LEU A CA  
532 C C   . LEU A 80  ? 1.0314 0.5586 0.9058 0.0711  -0.0493 -0.5914 80  LEU A C   
533 O O   . LEU A 80  ? 0.9155 0.5636 0.9004 0.0902  -0.0190 -0.5664 80  LEU A O   
534 C CB  . LEU A 80  ? 0.8853 0.5498 0.9049 -0.0196 -0.1654 -0.5906 80  LEU A CB  
535 C CG  . LEU A 80  ? 0.8044 0.5593 0.9302 -0.0589 -0.2024 -0.5759 80  LEU A CG  
536 C CD1 . LEU A 80  ? 0.7291 0.5881 0.9379 -0.0897 -0.2510 -0.5678 80  LEU A CD1 
537 C CD2 . LEU A 80  ? 0.6903 0.5386 0.9184 -0.0385 -0.1578 -0.5604 80  LEU A CD2 
538 N N   . ASP A 81  ? 1.2158 0.5778 0.9134 0.0866  -0.0407 -0.6100 81  ASP A N   
539 C CA  . ASP A 81  ? 1.2676 0.6031 0.8969 0.1147  -0.0008 -0.6073 81  ASP A CA  
540 C C   . ASP A 81  ? 1.3381 0.6461 0.9370 0.1888  0.1064  -0.5836 81  ASP A C   
541 O O   . ASP A 81  ? 1.4490 0.7338 0.9854 0.2166  0.1523  -0.5718 81  ASP A O   
542 C CB  . ASP A 81  ? 1.4556 0.6044 0.8891 0.0877  -0.0521 -0.6373 81  ASP A CB  
543 C CG  . ASP A 81  ? 1.9133 0.8567 1.1794 0.0900  -0.0745 -0.6541 81  ASP A CG  
544 O OD1 . ASP A 81  ? 1.8869 0.8645 1.2243 0.0493  -0.1361 -0.6509 81  ASP A OD1 
545 O OD2 . ASP A 81  ? 2.2721 1.0133 1.3262 0.1352  -0.0315 -0.6663 81  ASP A OD2 
546 N N   . ASN A 82  ? 1.3809 0.6897 1.0257 0.2202  0.1458  -0.5726 82  ASN A N   
547 C CA  . ASN A 82  ? 1.3629 0.6959 1.0520 0.2929  0.2493  -0.5343 82  ASN A CA  
548 C C   . ASN A 82  ? 1.2252 0.6609 1.0869 0.2899  0.2482  -0.5112 82  ASN A C   
549 O O   . ASN A 82  ? 1.3341 0.7252 1.1998 0.3395  0.3050  -0.4986 82  ASN A O   
550 C CB  . ASN A 82  ? 1.6739 0.7997 1.1449 0.3598  0.3177  -0.5517 82  ASN A CB  
551 C CG  . ASN A 82  ? 1.8292 0.7801 1.1510 0.3446  0.2594  -0.5959 82  ASN A CG  
552 O OD1 . ASN A 82  ? 1.8286 0.8378 1.2366 0.2814  0.1751  -0.6069 82  ASN A OD1 
553 N ND2 . ASN A 82  ? 2.0362 0.7609 1.1207 0.4036  0.3004  -0.6162 82  ASN A ND2 
554 N N   . CYS A 83  ? 1.0478 0.6087 1.0412 0.2320  0.1801  -0.5069 83  CYS A N   
555 C CA  . CYS A 83  ? 0.9162 0.5680 1.0635 0.2160  0.1658  -0.4832 83  CYS A CA  
556 C C   . CYS A 83  ? 0.8100 0.5778 1.1076 0.2405  0.2020  -0.4165 83  CYS A C   
557 O O   . CYS A 83  ? 0.7744 0.5980 1.0821 0.2395  0.1972  -0.3957 83  CYS A O   
558 C CB  . CYS A 83  ? 0.8157 0.5248 0.9982 0.1505  0.0825  -0.5059 83  CYS A CB  
559 S SG  . CYS A 83  ? 0.8471 0.6503 1.1842 0.1210  0.0548  -0.4804 83  CYS A SG  
560 N N   . PRO A 84  ? 0.4953 0.3271 0.6207 0.1586  -0.0609 -0.0145 84  PRO A N   
561 C CA  . PRO A 84  ? 0.3732 0.3019 0.5370 0.1977  -0.0715 0.0047  84  PRO A CA  
562 C C   . PRO A 84  ? 0.3259 0.2753 0.4594 0.1431  -0.0498 0.0645  84  PRO A C   
563 O O   . PRO A 84  ? 0.3337 0.2009 0.4080 0.0925  -0.0470 0.0953  84  PRO A O   
564 C CB  . PRO A 84  ? 0.5035 0.3086 0.6495 0.2655  -0.1458 -0.0031 84  PRO A CB  
565 C CG  . PRO A 84  ? 0.6832 0.2499 0.7412 0.2408  -0.1782 0.0025  84  PRO A CG  
566 C CD  . PRO A 84  ? 0.6161 0.2214 0.6710 0.1571  -0.1155 -0.0102 84  PRO A CD  
567 N N   . PHE A 85  ? 0.2300 0.3012 0.3992 0.1418  -0.0341 0.0688  85  PHE A N   
568 C CA  . PHE A 85  ? 0.1884 0.2596 0.3310 0.0966  -0.0248 0.1088  85  PHE A CA  
569 C C   . PHE A 85  ? 0.2628 0.3037 0.3986 0.1050  -0.0594 0.1272  85  PHE A C   
570 O O   . PHE A 85  ? 0.3472 0.4048 0.5094 0.1605  -0.0968 0.1067  85  PHE A O   
571 C CB  . PHE A 85  ? 0.1673 0.3362 0.3195 0.0639  -0.0010 0.1115  85  PHE A CB  
572 C CG  . PHE A 85  ? 0.1760 0.3534 0.2915 0.0535  0.0218  0.1118  85  PHE A CG  
573 C CD1 . PHE A 85  ? 0.3678 0.6750 0.5052 0.0518  0.0430  0.0835  85  PHE A CD1 
574 C CD2 . PHE A 85  ? 0.1940 0.2800 0.2495 0.0560  0.0150  0.1261  85  PHE A CD2 
575 C CE1 . PHE A 85  ? 0.2268 0.5478 0.3044 0.0413  0.0597  0.0906  85  PHE A CE1 
576 C CE2 . PHE A 85  ? 0.2297 0.3222 0.2349 0.0672  0.0195  0.1243  85  PHE A CE2 
577 C CZ  . PHE A 85  ? 0.2726 0.4688 0.2780 0.0548  0.0426  0.1172  85  PHE A CZ  
578 N N   . HIS A 86  ? 0.2823 0.2909 0.3788 0.0653  -0.0580 0.1530  86  HIS A N   
579 C CA  . HIS A 86  ? 0.2915 0.3047 0.3728 0.0670  -0.0899 0.1699  86  HIS A CA  
580 C C   . HIS A 86  ? 0.2298 0.3696 0.3799 0.0826  -0.0958 0.1428  86  HIS A C   
581 O O   . HIS A 86  ? 0.2734 0.4758 0.4508 0.0427  -0.0626 0.1297  86  HIS A O   
582 C CB  . HIS A 86  ? 0.2447 0.2630 0.2919 0.0198  -0.0811 0.1754  86  HIS A CB  
583 C CG  . HIS A 86  ? 0.2874 0.2622 0.2673 -0.0165 -0.0729 0.1828  86  HIS A CG  
584 N ND1 . HIS A 86  ? 0.4565 0.3827 0.3520 -0.0464 -0.0951 0.2198  86  HIS A ND1 
585 C CD2 . HIS A 86  ? 0.2623 0.2612 0.2356 -0.0400 -0.0460 0.1504  86  HIS A CD2 
586 C CE1 . HIS A 86  ? 0.4318 0.3674 0.2699 -0.1145 -0.0688 0.2118  86  HIS A CE1 
587 N NE2 . HIS A 86  ? 0.3366 0.3407 0.2378 -0.1029 -0.0391 0.1572  86  HIS A NE2 
588 N N   . ASP A 87  ? 0.2805 0.4606 0.4411 0.1313  -0.1423 0.1329  87  ASP A N   
589 C CA  . ASP A 87  ? 0.2687 0.6367 0.5086 0.1450  -0.1528 0.0811  87  ASP A CA  
590 C C   . ASP A 87  ? 0.4081 0.8287 0.6374 0.1408  -0.1853 0.0811  87  ASP A C   
591 O O   . ASP A 87  ? 0.3549 0.9616 0.6555 0.1289  -0.1870 0.0261  87  ASP A O   
592 C CB  . ASP A 87  ? 0.3356 0.7925 0.6306 0.2492  -0.1982 0.0209  87  ASP A CB  
593 C CG  . ASP A 87  ? 0.4547 0.7131 0.6657 0.3422  -0.2759 0.0506  87  ASP A CG  
594 O OD1 . ASP A 87  ? 1.0114 1.1595 1.2058 0.3839  -0.2897 0.0418  87  ASP A OD1 
595 O OD2 . ASP A 87  ? 0.6145 0.8031 0.7543 0.3653  -0.3284 0.0865  87  ASP A OD2 
596 N N   . GLN A 88  ? 0.3638 0.6534 0.5015 0.1371  -0.2071 0.1333  88  GLN A N   
597 C CA  . GLN A 88  ? 0.3775 0.7237 0.4855 0.1336  -0.2404 0.1350  88  GLN A CA  
598 C C   . GLN A 88  ? 0.3643 0.7882 0.5095 0.0509  -0.2010 0.1052  88  GLN A C   
599 O O   . GLN A 88  ? 0.2704 0.6162 0.4022 0.0000  -0.1620 0.1120  88  GLN A O   
600 C CB  . GLN A 88  ? 0.4928 0.6875 0.4636 0.1307  -0.2693 0.2029  88  GLN A CB  
601 C CG  . GLN A 88  ? 0.7789 0.8034 0.6710 0.1937  -0.3185 0.2431  88  GLN A CG  
602 C CD  . GLN A 88  ? 1.0499 1.0744 0.9052 0.3069  -0.4180 0.2374  88  GLN A CD  
603 O OE1 . GLN A 88  ? 0.8950 0.9532 0.8175 0.4088  -0.4609 0.1832  88  GLN A OE1 
604 N NE2 . GLN A 88  ? 1.1126 1.1304 0.8623 0.3016  -0.4628 0.2780  88  GLN A NE2 
605 N N   . PRO A 89  ? 0.4989 1.0731 0.6856 0.0490  -0.2250 0.0601  89  PRO A N   
606 C CA  . PRO A 89  ? 0.4943 1.1326 0.7189 -0.0338 -0.1999 0.0130  89  PRO A CA  
607 C C   . PRO A 89  ? 0.5640 1.0729 0.7376 -0.0767 -0.1789 0.0225  89  PRO A C   
608 O O   . PRO A 89  ? 0.6407 1.0759 0.8277 -0.1302 -0.1557 0.0008  89  PRO A O   
609 C CB  . PRO A 89  ? 0.4242 1.2244 0.6598 -0.0048 -0.2479 -0.0256 89  PRO A CB  
610 C CG  . PRO A 89  ? 0.4681 1.3428 0.7166 0.0933  -0.2957 -0.0260 89  PRO A CG  
611 C CD  . PRO A 89  ? 0.4657 1.1509 0.6550 0.1376  -0.2935 0.0408  89  PRO A CD  
612 N N   . HIS A 90  ? 0.3981 0.8817 0.5015 -0.0571 -0.1928 0.0453  90  HIS A N   
613 C CA  . HIS A 90  ? 0.3072 0.7485 0.3970 -0.0873 -0.1782 0.0066  90  HIS A CA  
614 C C   . HIS A 90  ? 0.3875 0.7417 0.4328 -0.0767 -0.1561 0.0359  90  HIS A C   
615 O O   . HIS A 90  ? 0.4451 0.8257 0.4697 -0.0825 -0.1521 -0.0069 90  HIS A O   
616 C CB  . HIS A 90  ? 0.3651 0.9300 0.4335 -0.0975 -0.2010 -0.0406 90  HIS A CB  
617 C CG  . HIS A 90  ? 0.4060 1.0743 0.5338 -0.1153 -0.2224 -0.0945 90  HIS A CG  
618 N ND1 . HIS A 90  ? 0.3819 1.1761 0.5090 -0.0891 -0.2518 -0.0793 90  HIS A ND1 
619 C CD2 . HIS A 90  ? 0.5432 1.1996 0.7262 -0.1602 -0.2254 -0.1711 90  HIS A CD2 
620 C CE1 . HIS A 90  ? 0.4985 1.4079 0.6988 -0.1226 -0.2617 -0.1554 90  HIS A CE1 
621 N NE2 . HIS A 90  ? 0.4292 1.2397 0.6589 -0.1799 -0.2422 -0.2072 90  HIS A NE2 
622 N N   . LEU A 91  ? 0.2816 0.5641 0.3231 -0.0584 -0.1438 0.0891  91  LEU A N   
623 C CA  . LEU A 91  ? 0.2782 0.4949 0.2816 -0.0575 -0.1221 0.1099  91  LEU A CA  
624 C C   . LEU A 91  ? 0.2599 0.4010 0.2994 -0.0433 -0.1031 0.1040  91  LEU A C   
625 O O   . LEU A 91  ? 0.2367 0.3544 0.2613 -0.0364 -0.0911 0.0847  91  LEU A O   
626 C CB  . LEU A 91  ? 0.3424 0.5061 0.2791 -0.0525 -0.1328 0.1739  91  LEU A CB  
627 C CG  . LEU A 91  ? 0.4450 0.6198 0.2709 -0.1076 -0.1323 0.1985  91  LEU A CG  
628 C CD1 . LEU A 91  ? 0.6160 0.9180 0.4249 -0.1277 -0.1462 0.1687  91  LEU A CD1 
629 C CD2 . LEU A 91  ? 0.7268 0.7671 0.4481 -0.1030 -0.1683 0.2778  91  LEU A CD2 
630 N N   . LYS A 92  ? 0.2356 0.3693 0.3153 -0.0445 -0.1016 0.1138  92  LYS A N   
631 C CA  . LYS A 92  ? 0.2585 0.3294 0.3425 -0.0490 -0.0829 0.1218  92  LYS A CA  
632 C C   . LYS A 92  ? 0.3224 0.2954 0.3706 -0.0645 -0.0981 0.0960  92  LYS A C   
633 O O   . LYS A 92  ? 0.3525 0.3207 0.4011 -0.0830 -0.1208 0.0613  92  LYS A O   
634 C CB  . LYS A 92  ? 0.2935 0.4390 0.4214 -0.0690 -0.0705 0.1282  92  LYS A CB  
635 C CG  . LYS A 92  ? 0.2597 0.4898 0.4194 -0.1192 -0.0774 0.1004  92  LYS A CG  
636 C CD  . LYS A 92  ? 0.4302 0.8360 0.6563 -0.1350 -0.0641 0.0744  92  LYS A CD  
637 C CE  . LYS A 92  ? 0.4124 0.9528 0.6818 -0.1917 -0.0734 0.0252  92  LYS A CE  
638 N NZ  . LYS A 92  ? 0.6015 1.3580 0.9343 -0.2619 -0.0466 -0.0274 92  LYS A NZ  
639 N N   . ARG A 93  ? 0.3935 0.4372 0.4142 0.0962  -0.2908 0.0877  93  ARG A N   
640 C CA  . ARG A 93  ? 0.3564 0.4191 0.3655 0.0822  -0.2630 0.0647  93  ARG A CA  
641 C C   . ARG A 93  ? 0.3114 0.3770 0.3609 0.0915  -0.2338 0.0486  93  ARG A C   
642 O O   . ARG A 93  ? 0.3684 0.4055 0.4219 0.1048  -0.2295 0.0523  93  ARG A O   
643 C CB  . ARG A 93  ? 0.3746 0.4289 0.3135 0.0674  -0.2501 0.0717  93  ARG A CB  
644 C CG  . ARG A 93  ? 0.7600 0.8285 0.6630 0.0635  -0.2481 0.0464  93  ARG A CG  
645 C CD  . ARG A 93  ? 1.1903 1.2721 1.0130 0.0651  -0.2476 0.0587  93  ARG A CD  
646 N NE  . ARG A 93  ? 0.9952 1.0841 0.7688 0.0744  -0.2323 0.0285  93  ARG A NE  
647 C CZ  . ARG A 93  ? 0.8817 0.9679 0.6024 0.0883  -0.2566 0.0007  93  ARG A CZ  
648 N NH1 . ARG A 93  ? 1.4075 1.4893 1.1214 0.0879  -0.2973 0.0019  93  ARG A NH1 
649 N NH2 . ARG A 93  ? 0.7247 0.8070 0.3967 0.1068  -0.2466 -0.0320 93  ARG A NH2 
650 N N   . LYS A 94  ? 0.3054 0.4019 0.3830 0.0842  -0.2203 0.0326  94  LYS A N   
651 C CA  . LYS A 94  ? 0.2392 0.3564 0.3547 0.0919  -0.1907 0.0226  94  LYS A CA  
652 C C   . LYS A 94  ? 0.2223 0.3385 0.3235 0.0677  -0.1788 0.0122  94  LYS A C   
653 O O   . LYS A 94  ? 0.2439 0.3580 0.3356 0.0520  -0.2027 0.0088  94  LYS A O   
654 C CB  . LYS A 94  ? 0.2294 0.4097 0.4179 0.1110  -0.1952 0.0284  94  LYS A CB  
655 C CG  . LYS A 94  ? 0.5149 0.6939 0.7173 0.1403  -0.2223 0.0366  94  LYS A CG  
656 C CD  . LYS A 94  ? 0.5161 0.7506 0.7762 0.1861  -0.2161 0.0343  94  LYS A CD  
657 C CE  . LYS A 94  ? 0.8135 1.0058 1.0642 0.2211  -0.2505 0.0363  94  LYS A CE  
658 N NZ  . LYS A 94  ? 0.5822 0.8256 0.8827 0.2828  -0.2520 0.0273  94  LYS A NZ  
659 N N   . ALA A 95  ? 0.1968 0.3047 0.2910 0.0673  -0.1492 0.0049  95  ALA A N   
660 C CA  . ALA A 95  ? 0.1878 0.2881 0.2725 0.0491  -0.1411 -0.0041 95  ALA A CA  
661 C C   . ALA A 95  ? 0.1844 0.3082 0.2999 0.0517  -0.1126 -0.0013 95  ALA A C   
662 O O   . ALA A 95  ? 0.1607 0.2877 0.2749 0.0721  -0.0946 -0.0029 95  ALA A O   
663 C CB  . ALA A 95  ? 0.2045 0.2670 0.2231 0.0480  -0.1359 -0.0151 95  ALA A CB  
664 N N   . PHE A 96  ? 0.1521 0.2868 0.2908 0.0317  -0.1146 0.0035  96  PHE A N   
665 C CA  . PHE A 96  ? 0.1304 0.2836 0.2837 0.0299  -0.0882 0.0103  96  PHE A CA  
666 C C   . PHE A 96  ? 0.2141 0.3136 0.3179 0.0253  -0.0818 -0.0051 96  PHE A C   
667 O O   . PHE A 96  ? 0.2353 0.2968 0.3179 0.0142  -0.1042 -0.0151 96  PHE A O   
668 C CB  . PHE A 96  ? 0.1312 0.3358 0.3474 0.0061  -0.0974 0.0379  96  PHE A CB  
669 C CG  . PHE A 96  ? 0.1708 0.4644 0.4466 0.0202  -0.0889 0.0596  96  PHE A CG  
670 C CD1 . PHE A 96  ? 0.1309 0.4454 0.4354 0.0211  -0.1157 0.0643  96  PHE A CD1 
671 C CD2 . PHE A 96  ? 0.1895 0.5557 0.4902 0.0395  -0.0541 0.0749  96  PHE A CD2 
672 C CE1 . PHE A 96  ? 0.1227 0.5323 0.4876 0.0430  -0.1070 0.0844  96  PHE A CE1 
673 C CE2 . PHE A 96  ? 0.1001 0.5683 0.4553 0.0659  -0.0426 0.0931  96  PHE A CE2 
674 C CZ  . PHE A 96  ? 0.1080 0.5988 0.4991 0.0679  -0.0687 0.0982  96  PHE A CZ  
675 N N   . CYS A 97  ? 0.1180 0.2137 0.2011 0.0391  -0.0560 -0.0096 97  CYS A N   
676 C CA  . CYS A 97  ? 0.1188 0.1805 0.1636 0.0388  -0.0473 -0.0199 97  CYS A CA  
677 C C   . CYS A 97  ? 0.1460 0.2183 0.2022 0.0349  -0.0302 -0.0119 97  CYS A C   
678 O O   . CYS A 97  ? 0.0963 0.2079 0.1746 0.0420  -0.0149 -0.0012 97  CYS A O   
679 C CB  . CYS A 97  ? 0.1167 0.1663 0.1322 0.0506  -0.0398 -0.0239 97  CYS A CB  
680 S SG  . CYS A 97  ? 0.2413 0.2838 0.2368 0.0520  -0.0606 -0.0214 97  CYS A SG  
681 N N   . SER A 98  ? 0.1178 0.1602 0.1543 0.0301  -0.0333 -0.0175 98  SER A N   
682 C CA  . SER A 98  ? 0.1115 0.1567 0.1489 0.0281  -0.0195 -0.0089 98  SER A CA  
683 C C   . SER A 98  ? 0.1598 0.1881 0.1627 0.0407  -0.0100 -0.0214 98  SER A C   
684 O O   . SER A 98  ? 0.1226 0.1312 0.1045 0.0475  -0.0186 -0.0333 98  SER A O   
685 C CB  . SER A 98  ? 0.1390 0.1606 0.1909 0.0114  -0.0395 0.0011  98  SER A CB  
686 O OG  . SER A 98  ? 0.1479 0.1922 0.2414 -0.0084 -0.0551 0.0207  98  SER A OG  
687 N N   . PHE A 99  ? 0.1206 0.1616 0.1169 0.0469  0.0045  -0.0190 99  PHE A N   
688 C CA  . PHE A 99  ? 0.0923 0.1247 0.0675 0.0509  0.0078  -0.0224 99  PHE A CA  
689 C C   . PHE A 99  ? 0.1625 0.1962 0.1344 0.0511  0.0142  -0.0166 99  PHE A C   
690 O O   . PHE A 99  ? 0.1383 0.1859 0.1128 0.0526  0.0212  -0.0103 99  PHE A O   
691 C CB  . PHE A 99  ? 0.1009 0.1294 0.0678 0.0535  0.0037  -0.0236 99  PHE A CB  
692 C CG  . PHE A 99  ? 0.1571 0.1821 0.1268 0.0526  -0.0065 -0.0229 99  PHE A CG  
693 C CD1 . PHE A 99  ? 0.1532 0.1864 0.1155 0.0484  -0.0097 -0.0186 99  PHE A CD1 
694 C CD2 . PHE A 99  ? 0.2143 0.2311 0.1886 0.0627  -0.0146 -0.0275 99  PHE A CD2 
695 C CE1 . PHE A 99  ? 0.1940 0.2269 0.1539 0.0466  -0.0214 -0.0128 99  PHE A CE1 
696 C CE2 . PHE A 99  ? 0.1264 0.1357 0.1044 0.0624  -0.0294 -0.0233 99  PHE A CE2 
697 C CZ  . PHE A 99  ? 0.1253 0.1422 0.0961 0.0506  -0.0329 -0.0132 99  PHE A CZ  
698 N N   . GLN A 100 ? 0.1307 0.1594 0.0952 0.0541  0.0124  -0.0169 100 GLN A N   
699 C CA  . GLN A 100 ? 0.1027 0.1323 0.0627 0.0550  0.0144  -0.0092 100 GLN A CA  
700 C C   . GLN A 100 ? 0.1077 0.1484 0.0611 0.0556  0.0116  -0.0084 100 GLN A C   
701 O O   . GLN A 100 ? 0.2214 0.2796 0.1803 0.0596  0.0111  -0.0069 100 GLN A O   
702 C CB  . GLN A 100 ? 0.1881 0.2006 0.1526 0.0595  0.0064  -0.0061 100 GLN A CB  
703 C CG  . GLN A 100 ? 0.1294 0.1446 0.0888 0.0612  0.0057  0.0053  100 GLN A CG  
704 C CD  . GLN A 100 ? 0.3609 0.3487 0.3244 0.0707  -0.0097 0.0084  100 GLN A CD  
705 O OE1 . GLN A 100 ? 0.2444 0.2365 0.2051 0.0802  -0.0136 0.0140  100 GLN A OE1 
706 N NE2 . GLN A 100 ? 0.1865 0.1385 0.1567 0.0689  -0.0262 0.0050  100 GLN A NE2 
707 N N   . ILE A 101 ? 0.1184 0.1551 0.0595 0.0530  0.0067  -0.0077 101 ILE A N   
708 C CA  . ILE A 101 ? 0.1189 0.1577 0.0588 0.0447  -0.0092 -0.0028 101 ILE A CA  
709 C C   . ILE A 101 ? 0.2076 0.2512 0.1399 0.0468  -0.0151 0.0028  101 ILE A C   
710 O O   . ILE A 101 ? 0.2038 0.2379 0.1129 0.0548  -0.0123 -0.0015 101 ILE A O   
711 C CB  . ILE A 101 ? 0.1564 0.1639 0.0792 0.0423  -0.0283 -0.0131 101 ILE A CB  
712 C CG1 . ILE A 101 ? 0.1413 0.1411 0.0718 0.0423  -0.0264 -0.0162 101 ILE A CG1 
713 C CG2 . ILE A 101 ? 0.1737 0.1701 0.1004 0.0242  -0.0595 -0.0025 101 ILE A CG2 
714 C CD1 . ILE A 101 ? 0.2385 0.2415 0.1624 0.0595  -0.0103 -0.0284 101 ILE A CD1 
715 N N   . TYR A 102 ? 0.1878 0.2584 0.1404 0.0413  -0.0230 0.0166  102 TYR A N   
716 C CA  . TYR A 102 ? 0.1410 0.2195 0.0908 0.0436  -0.0333 0.0242  102 TYR A CA  
717 C C   . TYR A 102 ? 0.2587 0.3342 0.2100 0.0246  -0.0636 0.0309  102 TYR A C   
718 O O   . TYR A 102 ? 0.1582 0.2652 0.1438 0.0064  -0.0743 0.0504  102 TYR A O   
719 C CB  . TYR A 102 ? 0.1288 0.2442 0.1048 0.0577  -0.0257 0.0350  102 TYR A CB  
720 C CG  . TYR A 102 ? 0.1505 0.2802 0.1310 0.0608  -0.0408 0.0471  102 TYR A CG  
721 C CD1 . TYR A 102 ? 0.1672 0.2679 0.1223 0.0685  -0.0435 0.0471  102 TYR A CD1 
722 C CD2 . TYR A 102 ? 0.1768 0.3603 0.1923 0.0539  -0.0544 0.0663  102 TYR A CD2 
723 C CE1 . TYR A 102 ? 0.1882 0.3019 0.1448 0.0722  -0.0612 0.0605  102 TYR A CE1 
724 C CE2 . TYR A 102 ? 0.1598 0.3615 0.1843 0.0574  -0.0719 0.0788  102 TYR A CE2 
725 C CZ  . TYR A 102 ? 0.1832 0.3442 0.1745 0.0681  -0.0762 0.0731  102 TYR A CZ  
726 O OH  . TYR A 102 ? 0.2061 0.3859 0.2050 0.0721  -0.0972 0.0880  102 TYR A OH  
727 N N   . ALA A 103 ? 0.2041 0.2444 0.1166 0.0282  -0.0814 0.0177  103 ALA A N   
728 C CA  . ALA A 103 ? 0.2897 0.3016 0.1914 0.0116  -0.1254 0.0157  103 ALA A CA  
729 C C   . ALA A 103 ? 0.2785 0.3052 0.1766 0.0096  -0.1454 0.0255  103 ALA A C   
730 O O   . ALA A 103 ? 0.3321 0.3655 0.2052 0.0293  -0.1278 0.0222  103 ALA A O   
731 C CB  . ALA A 103 ? 0.3061 0.2563 0.1511 0.0284  -0.1410 -0.0180 103 ALA A CB  
732 N N   . VAL A 104 ? 0.3520 0.3989 0.3399 0.1427  -0.2208 -0.1429 104 VAL A N   
733 C CA  . VAL A 104 ? 0.3329 0.4738 0.3277 0.1471  -0.2020 -0.1233 104 VAL A CA  
734 C C   . VAL A 104 ? 0.3762 0.5241 0.3403 0.1016  -0.2168 -0.1442 104 VAL A C   
735 O O   . VAL A 104 ? 0.4608 0.6414 0.4528 0.0763  -0.2202 -0.1527 104 VAL A O   
736 C CB  . VAL A 104 ? 0.3501 0.5456 0.4085 0.1622  -0.1769 -0.0990 104 VAL A CB  
737 C CG1 . VAL A 104 ? 0.3432 0.6530 0.5143 0.1709  -0.2321 -0.0607 104 VAL A CG1 
738 C CG2 . VAL A 104 ? 0.3838 0.4960 0.4152 0.1943  -0.1197 -0.0925 104 VAL A CG2 
739 N N   . PRO A 105 ? 0.5325 0.5971 0.4248 0.0841  -0.1859 -0.1593 105 PRO A N   
740 C CA  . PRO A 105 ? 0.5724 0.5747 0.4111 0.0303  -0.1598 -0.1939 105 PRO A CA  
741 C C   . PRO A 105 ? 0.7447 0.7701 0.4865 -0.0245 -0.2287 -0.2091 105 PRO A C   
742 O O   . PRO A 105 ? 0.8030 0.7995 0.5455 -0.0726 -0.2031 -0.2444 105 PRO A O   
743 C CB  . PRO A 105 ? 0.6543 0.4764 0.4254 0.0222  -0.0404 -0.2108 105 PRO A CB  
744 C CG  . PRO A 105 ? 0.6756 0.5140 0.5921 0.0771  -0.0127 -0.1881 105 PRO A CG  
745 C CD  . PRO A 105 ? 0.5396 0.5009 0.4104 0.1082  -0.1138 -0.1542 105 PRO A CD  
746 N N   . TRP A 106 ? 0.7023 0.7716 0.4048 -0.0204 -0.3338 -0.1801 106 TRP A N   
747 C CA  . TRP A 106 ? 0.8533 0.9649 0.5749 -0.0810 -0.4658 -0.1924 106 TRP A CA  
748 C C   . TRP A 106 ? 0.7543 1.0387 0.7898 -0.0829 -0.4346 -0.1995 106 TRP A C   
749 O O   . TRP A 106 ? 0.6851 0.9990 0.8163 -0.1482 -0.4751 -0.2356 106 TRP A O   
750 C CB  . TRP A 106 ? 0.9749 1.0973 0.6774 -0.0682 -0.6449 -0.1383 106 TRP A CB  
751 C CG  . TRP A 106 ? 0.7359 1.0698 0.8068 0.0030  -0.6505 -0.0797 106 TRP A CG  
752 C CD1 . TRP A 106 ? 0.6407 0.9825 0.7301 0.0792  -0.5618 -0.0394 106 TRP A CD1 
753 C CD2 . TRP A 106 ? 0.9089 1.4367 1.4134 -0.0020 -0.7027 -0.0623 106 TRP A CD2 
754 N NE1 . TRP A 106 ? 0.5978 1.0945 1.0419 0.1217  -0.5423 0.0013  106 TRP A NE1 
755 C CE2 . TRP A 106 ? 0.9432 1.5570 1.6801 0.0772  -0.6111 -0.0082 106 TRP A CE2 
756 C CE3 . TRP A 106 ? 1.4382 2.0564 2.2031 -0.0713 -0.7930 -0.0923 106 TRP A CE3 
757 C CZ2 . TRP A 106 ? 1.0068 1.7708 2.2374 0.0956  -0.5675 0.0223  106 TRP A CZ2 
758 C CZ3 . TRP A 106 ? 1.4370 2.2418 2.7589 -0.0531 -0.7696 -0.0617 106 TRP A CZ3 
759 C CH2 . TRP A 106 ? 1.1479 2.0124 2.7002 0.0330  -0.6381 -0.0025 106 TRP A CH2 
760 N N   . GLN A 107 ? 0.5139 0.8549 0.6729 -0.0199 -0.3452 -0.1701 107 GLN A N   
761 C CA  . GLN A 107 ? 0.4603 0.8445 0.8131 -0.0181 -0.2507 -0.1721 107 GLN A CA  
762 C C   . GLN A 107 ? 0.5149 0.7735 0.7232 -0.0339 -0.1615 -0.2003 107 GLN A C   
763 O O   . GLN A 107 ? 0.4751 0.6906 0.7549 -0.0534 -0.0680 -0.2106 107 GLN A O   
764 C CB  . GLN A 107 ? 0.4201 0.8000 0.8527 0.0425  -0.1689 -0.1335 107 GLN A CB  
765 C CG  . GLN A 107 ? 0.3983 0.7834 1.0915 0.0373  -0.0318 -0.1290 107 GLN A CG  
766 C CD  . GLN A 107 ? 0.7697 1.1107 1.5582 0.0912  0.0843  -0.0922 107 GLN A CD  
767 O OE1 . GLN A 107 ? 0.6244 0.8439 1.1500 0.1234  0.1019  -0.0879 107 GLN A OE1 
768 N NE2 . GLN A 107 ? 0.4476 0.8767 1.6685 0.0969  0.1735  -0.0680 107 GLN A NE2 
769 N N   . GLY A 108 ? 0.4102 0.5869 0.4556 -0.0227 -0.1786 -0.2051 108 GLY A N   
770 C CA  . GLY A 108 ? 0.5179 0.5715 0.4889 -0.0231 -0.1393 -0.2095 108 GLY A CA  
771 C C   . GLY A 108 ? 0.5746 0.4930 0.4361 0.0158  -0.1311 -0.1789 108 GLY A C   
772 O O   . GLY A 108 ? 0.6828 0.4450 0.4353 0.0144  -0.1223 -0.1663 108 GLY A O   
773 N N   . THR A 109 ? 0.3309 0.3982 0.4177 0.0378  -0.1477 -0.1303 109 THR A N   
774 C CA  . THR A 109 ? 0.3267 0.3912 0.4167 0.0233  -0.1102 -0.0905 109 THR A CA  
775 C C   . THR A 109 ? 0.2930 0.3408 0.3261 0.0482  -0.0829 -0.0801 109 THR A C   
776 O O   . THR A 109 ? 0.3247 0.3864 0.3113 0.0714  -0.0845 -0.0939 109 THR A O   
777 C CB  . THR A 109 ? 0.3009 0.4323 0.4321 0.0164  -0.0934 -0.0800 109 THR A CB  
778 O OG1 . THR A 109 ? 0.2563 0.4017 0.3655 0.0529  -0.1050 -0.0845 109 THR A OG1 
779 C CG2 . THR A 109 ? 0.2778 0.4542 0.4807 -0.0187 -0.1122 -0.0905 109 THR A CG2 
780 N N   . MET A 110 ? 0.2514 0.2824 0.2852 0.0331  -0.0597 -0.0535 110 MET A N   
781 C CA  . MET A 110 ? 0.2281 0.2503 0.2231 0.0504  -0.0346 -0.0416 110 MET A CA  
782 C C   . MET A 110 ? 0.2045 0.2486 0.2099 0.0325  -0.0078 -0.0191 110 MET A C   
783 O O   . MET A 110 ? 0.2200 0.2801 0.2455 -0.0065 -0.0051 -0.0047 110 MET A O   
784 C CB  . MET A 110 ? 0.2495 0.2275 0.2367 0.0573  -0.0465 -0.0521 110 MET A CB  
785 C CG  . MET A 110 ? 0.2876 0.2873 0.2559 0.0879  -0.0533 -0.0967 110 MET A CG  
786 S SD  . MET A 110 ? 0.3440 0.3043 0.3588 0.1097  -0.0905 -0.1479 110 MET A SD  
787 C CE  . MET A 110 ? 0.6934 0.7557 0.6828 0.1409  -0.0788 -0.2264 110 MET A CE  
788 N N   . THR A 111 ? 0.1819 0.2351 0.1721 0.0528  0.0090  -0.0166 111 THR A N   
789 C CA  . THR A 111 ? 0.1674 0.2502 0.1683 0.0437  0.0330  -0.0154 111 THR A CA  
790 C C   . THR A 111 ? 0.2190 0.2674 0.1852 0.0555  0.0410  -0.0046 111 THR A C   
791 O O   . THR A 111 ? 0.2539 0.2777 0.2003 0.0731  0.0323  0.0010  111 THR A O   
792 C CB  . THR A 111 ? 0.2282 0.3587 0.2810 0.0650  0.0303  -0.0429 111 THR A CB  
793 O OG1 . THR A 111 ? 0.3270 0.5007 0.4240 0.0570  0.0189  -0.0578 111 THR A OG1 
794 C CG2 . THR A 111 ? 0.4971 0.6919 0.5768 0.0588  0.0571  -0.0719 111 THR A CG2 
795 N N   . LEU A 112 ? 0.2393 0.3022 0.1950 0.0375  0.0573  -0.0007 112 LEU A N   
796 C CA  . LEU A 112 ? 0.2887 0.3261 0.2205 0.0469  0.0616  0.0050  112 LEU A CA  
797 C C   . LEU A 112 ? 0.2933 0.3556 0.2545 0.0653  0.0664  -0.0219 112 LEU A C   
798 O O   . LEU A 112 ? 0.4125 0.5325 0.3895 0.0571  0.0812  -0.0514 112 LEU A O   
799 C CB  . LEU A 112 ? 0.2351 0.2689 0.1358 0.0165  0.0616  0.0248  112 LEU A CB  
800 C CG  . LEU A 112 ? 0.4695 0.4789 0.3494 0.0233  0.0575  0.0308  112 LEU A CG  
801 C CD1 . LEU A 112 ? 0.1855 0.1555 0.0762 0.0477  0.0426  0.0314  112 LEU A CD1 
802 C CD2 . LEU A 112 ? 0.2710 0.2819 0.1125 -0.0157 0.0445  0.0589  112 LEU A CD2 
803 N N   . SER A 113 ? 0.1563 0.1822 0.1289 0.0859  0.0473  -0.0152 113 SER A N   
804 C CA  . SER A 113 ? 0.1734 0.1948 0.1950 0.1063  0.0270  -0.0394 113 SER A CA  
805 C C   . SER A 113 ? 0.1802 0.1927 0.1985 0.1049  0.0314  -0.0518 113 SER A C   
806 O O   . SER A 113 ? 0.1968 0.2334 0.2647 0.1221  0.0223  -0.1012 113 SER A O   
807 C CB  . SER A 113 ? 0.2048 0.1733 0.2292 0.1112  -0.0119 -0.0044 113 SER A CB  
808 O OG  . SER A 113 ? 0.3758 0.3575 0.3874 0.1092  -0.0177 0.0076  113 SER A OG  
809 N N   . LYS A 114 ? 0.1735 0.1597 0.1463 0.0886  0.0398  -0.0183 114 LYS A N   
810 C CA  . LYS A 114 ? 0.1837 0.1573 0.1557 0.0844  0.0366  -0.0245 114 LYS A CA  
811 C C   . LYS A 114 ? 0.1703 0.1539 0.0991 0.0689  0.0528  -0.0076 114 LYS A C   
812 O O   . LYS A 114 ? 0.1592 0.1386 0.0723 0.0660  0.0560  0.0133  114 LYS A O   
813 C CB  . LYS A 114 ? 0.2124 0.1368 0.2049 0.0787  0.0072  0.0027  114 LYS A CB  
814 C CG  . LYS A 114 ? 0.2592 0.1413 0.3149 0.0954  -0.0400 -0.0113 114 LYS A CG  
815 C CD  . LYS A 114 ? 0.3097 0.2078 0.4228 0.1223  -0.0514 -0.0860 114 LYS A CD  
816 C CE  . LYS A 114 ? 0.3208 0.1971 0.5281 0.1587  -0.1033 -0.1326 114 LYS A CE  
817 N NZ  . LYS A 114 ? 0.4752 0.4019 0.7444 0.1889  -0.1069 -0.2327 114 LYS A NZ  
818 N N   . SER A 115 ? 0.2240 0.2237 0.1401 0.0618  0.0537  -0.0242 115 SER A N   
819 C CA  . SER A 115 ? 0.1916 0.1896 0.0741 0.0477  0.0490  -0.0039 115 SER A CA  
820 C C   . SER A 115 ? 0.2271 0.2356 0.1029 0.0417  0.0384  -0.0219 115 SER A C   
821 O O   . SER A 115 ? 0.2425 0.2934 0.1013 0.0339  0.0440  -0.0551 115 SER A O   
822 C CB  . SER A 115 ? 0.2125 0.2251 0.0580 0.0259  0.0495  0.0141  115 SER A CB  
823 O OG  . SER A 115 ? 0.2653 0.2586 0.0839 0.0104  0.0225  0.0400  115 SER A OG  
824 N N   . THR A 116 ? 0.2109 0.2006 0.1051 0.0441  0.0237  -0.0101 116 THR A N   
825 C CA  . THR A 116 ? 0.2360 0.2330 0.1311 0.0379  0.0060  -0.0263 116 THR A CA  
826 C C   . THR A 116 ? 0.2355 0.2298 0.1473 0.0384  -0.0151 -0.0078 116 THR A C   
827 O O   . THR A 116 ? 0.2478 0.2480 0.1976 0.0474  -0.0084 0.0001  116 THR A O   
828 C CB  . THR A 116 ? 0.2423 0.2238 0.1864 0.0423  -0.0013 -0.0523 116 THR A CB  
829 O OG1 . THR A 116 ? 0.2799 0.2768 0.2204 0.0386  -0.0197 -0.0906 116 THR A OG1 
830 C CG2 . THR A 116 ? 0.2291 0.1962 0.2159 0.0323  -0.0060 -0.0232 116 THR A CG2 
831 N N   . CYS A 117 ? 0.2744 0.2753 0.1632 0.0292  -0.0436 -0.0092 117 CYS A N   
832 C CA  . CYS A 117 ? 0.2871 0.2869 0.2086 0.0363  -0.0803 0.0008  117 CYS A CA  
833 C C   . CYS A 117 ? 0.3153 0.3322 0.2468 0.0279  -0.1065 -0.0175 117 CYS A C   
834 O O   . CYS A 117 ? 0.3457 0.3729 0.2352 0.0135  -0.1051 -0.0379 117 CYS A O   
835 C CB  . CYS A 117 ? 0.3837 0.3527 0.2686 0.0310  -0.1206 0.0353  117 CYS A CB  
836 S SG  . CYS A 117 ? 0.4630 0.4009 0.3435 0.0356  -0.1071 0.0556  117 CYS A SG  
837 N N   . GLN A 118 ? 0.3089 0.3439 0.3081 0.0393  -0.1320 -0.0232 118 GLN A N   
838 C CA  . GLN A 118 ? 0.3438 0.3963 0.3592 0.0313  -0.1696 -0.0383 118 GLN A CA  
839 C C   . GLN A 118 ? 0.3763 0.4285 0.4291 0.0489  -0.2277 -0.0281 118 GLN A C   
840 O O   . GLN A 118 ? 0.3492 0.4151 0.4727 0.0752  -0.2295 -0.0365 118 GLN A O   
841 C CB  . GLN A 118 ? 0.3148 0.4017 0.4061 0.0210  -0.1536 -0.0633 118 GLN A CB  
842 C CG  . GLN A 118 ? 0.4920 0.6277 0.6606 0.0209  -0.1197 -0.0625 118 GLN A CG  
843 C CD  . GLN A 118 ? 0.5846 0.7667 0.8243 -0.0130 -0.1158 -0.0705 118 GLN A CD  
844 O OE1 . GLN A 118 ? 0.6229 0.8346 0.9095 -0.0183 -0.1498 -0.0891 118 GLN A OE1 
845 N NE2 . GLN A 118 ? 0.3265 0.5133 0.5742 -0.0438 -0.0829 -0.0489 118 GLN A NE2 
846 N N   . ASP A 119 ? 0.4484 0.4885 0.4562 0.0359  -0.2835 -0.0159 119 ASP A N   
847 C CA  . ASP A 119 ? 0.5775 0.5981 0.6231 0.0523  -0.3653 0.0019  119 ASP A CA  
848 C C   . ASP A 119 ? 0.4643 0.5448 0.6572 0.0856  -0.3772 -0.0455 119 ASP A C   
849 O O   . ASP A 119 ? 0.4306 0.5675 0.6646 0.0734  -0.3428 -0.0766 119 ASP A O   
850 C CB  . ASP A 119 ? 0.6143 0.6177 0.5616 0.0186  -0.4281 0.0337  119 ASP A CB  
851 C CG  . ASP A 119 ? 1.0160 0.9688 0.8408 -0.0185 -0.4538 0.1014  119 ASP A CG  
852 O OD1 . ASP A 119 ? 0.8984 0.7970 0.7541 -0.0045 -0.4722 0.1311  119 ASP A OD1 
853 O OD2 . ASP A 119 ? 1.1275 1.1061 0.8269 -0.0678 -0.4567 0.1216  119 ASP A OD2 
854 N N   . ALA A 120 ? 0.4793 0.5557 0.7640 0.1256  -0.4274 -0.0572 120 ALA A N   
855 C CA  . ALA A 120 ? 0.4612 0.6340 0.9082 0.1620  -0.4354 -0.1229 120 ALA A CA  
856 C C   . ALA A 120 ? 0.5961 0.7567 1.1062 0.1838  -0.5431 -0.1268 120 ALA A C   
857 O O   . ALA A 120 ? 0.8233 1.0648 1.4110 0.1823  -0.5501 -0.1638 120 ALA A O   
858 C CB  . ALA A 120 ? 0.4060 0.6139 0.9435 0.2042  -0.4182 -0.1664 120 ALA A CB  
859 O OXT . ALA A 120 ? 0.7667 0.8326 1.2539 0.1980  -0.6331 -0.0873 120 ALA A OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   LYS 5   5   ?   ?   ?   A . n 
A 1 6   PRO 6   6   ?   ?   ?   A . n 
A 1 7   PRO 7   7   ?   ?   ?   A . n 
A 1 8   ARG 8   8   ?   ?   ?   A . n 
A 1 9   LEU 9   9   ?   ?   ?   A . n 
A 1 10  VAL 10  10  ?   ?   ?   A . n 
A 1 11  GLY 11  11  ?   ?   ?   A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  ASP 28  28  28  ASP ASP A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  HIS 43  43  43  HIS HIS A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  ARG 51  51  51  ARG ARG A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  TYR 62  62  62  TYR TYR A . n 
A 1 63  PHE 63  63  63  PHE PHE A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  CYS 73  73  73  CYS CYS A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  ASN 82  82  82  ASN ASN A . n 
A 1 83  CYS 83  83  83  CYS CYS A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  HIS 86  86  86  HIS HIS A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  CYS 97  97  97  CYS CYS A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 TRP 106 106 106 TRP TRP A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 MET 110 110 110 MET MET A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 CYS 117 117 117 CYS CYS A . n 
A 1 118 GLN 118 118 118 GLN GLN A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7530  ? 
1 MORE         -34   ? 
1 'SSA (A^2)'  14030 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 139.8010000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     204 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-12-21 
2 'Structure model' 1 1 2013-04-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 86.6852 -5.2224  31.1056 0.2289 0.7393 0.1396 0.1488  -0.0306 0.0851  4.3944  33.4246 18.0301 
-9.6954  -4.8366  3.5258   -0.9857 -1.1616 -0.0576 2.2765  0.6186  0.3608  -0.0022 1.4923  0.3671  
'X-RAY DIFFRACTION' 2  ? refined 81.8861 -15.3875 28.8665 0.5336 0.3546 0.4504 0.1037  0.0724  0.2544  43.1899 25.1172 49.2917 
-15.4321 29.6305  4.3882   0.4711  -1.9287 -2.9628 1.8288  0.1078  -0.2013 3.3855  -0.5387 -0.5789 
'X-RAY DIFFRACTION' 3  ? refined 80.0893 -13.1461 16.0757 0.1355 0.0845 0.1509 0.0569  0.0928  0.0644  7.6345  2.8190  26.7931 
-4.7349  -4.5896  3.9151   -0.2962 -0.2096 -0.3728 0.0705  -0.0143 -0.0157 0.5526  0.1922  0.3105  
'X-RAY DIFFRACTION' 4  ? refined 86.4009 -13.9473 12.2409 0.1672 0.0937 0.1705 0.0176  0.0812  0.0911  2.5247  4.2182  14.9588 
0.4237   1.9242   8.0311   -0.2247 -0.2456 -0.2374 0.1457  0.1928  0.0050  0.2080  0.1992  0.0319  
'X-RAY DIFFRACTION' 5  ? refined 67.1625 2.4048   27.2229 0.1063 0.1579 0.0648 0.0290  0.0055  0.0600  19.4764 3.4547  5.3809  
-7.9167  6.5135   -1.6240  -0.3084 -0.4672 0.3185  0.0829  0.1699  -0.1504 -0.0788 0.0482  0.1386  
'X-RAY DIFFRACTION' 6  ? refined 49.9407 17.0617  9.0394  0.1795 0.1437 0.2212 0.1227  -0.0290 -0.0970 9.6098  8.4948  19.8134 
3.4751   -2.6297  -13.0937 -0.0248 -0.7049 0.6190  0.2703  0.0330  0.3097  -0.2002 -0.1164 -0.0082 
'X-RAY DIFFRACTION' 7  ? refined 55.9310 25.5524  10.5065 0.7836 0.5050 0.9176 -0.0271 -0.1424 -0.5697 -0.4571 16.0574 8.1252  
0.0995   7.8240   -8.6025  -0.3453 -0.2275 0.7305  2.6624  0.1970  -0.1747 -2.0512 0.4939  0.1483  
'X-RAY DIFFRACTION' 8  ? refined 44.1114 18.4418  3.3874  0.2240 0.3656 0.3247 0.0357  -0.1166 0.1616  21.3444 8.7275  36.6559 
3.2718   9.6895   15.2654  -0.4082 0.8937  0.4612  -0.8045 -0.2154 1.1378  -1.0505 -2.0078 0.6236  
'X-RAY DIFFRACTION' 9  ? refined 55.4549 6.7473   16.2705 0.0739 0.1107 0.0634 0.0527  -0.0104 -0.0255 9.7381  5.8239  10.3461 
-2.5926  6.7344   -3.4641  -0.0945 0.0397  -0.0275 -0.1507 0.0533  0.4569  -0.0842 -0.2366 0.0413  
'X-RAY DIFFRACTION' 10 ? refined 72.6646 10.2690  29.3744 0.3620 0.6846 0.4965 0.0401  -0.2951 -0.1414 13.6882 82.3060 9.8129  
5.9798   -11.3557 -2.2364  0.4008  -1.7054 -0.0401 1.7115  -0.5261 -4.0397 -0.4828 2.3063  0.1253  
'X-RAY DIFFRACTION' 11 ? refined 58.5615 4.9982   15.1253 0.1558 0.1298 0.0412 0.0525  0.0387  0.0238  21.1839 9.4436  11.8850 
5.4609   10.9306  4.9727   -0.4115 0.5957  0.0785  -0.5294 0.2228  0.3159  -0.2802 0.1393  0.1887  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 12  ? ? A 18  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 19  ? ? A 25  ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 26  ? ? A 35  ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 36  ? ? A 52  ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 53  ? ? A 66  ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 67  ? ? A 73  ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 74  ? ? A 83  ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 84  ? ? A 92  ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 93  ? ? A 103 ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 A 104 ? ? A 108 ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 A 109 ? ? A 120 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-3000 'data collection' .        ? 1 
MOLREP   phasing           .        ? 2 
REFMAC   refinement        5.5.0102 ? 3 
HKL-3000 'data reduction'  .        ? 4 
HKL-3000 'data scaling'    .        ? 5 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     82 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -145.65 
_pdbx_validate_torsion.psi             41.10 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 1  ? A SER 1  
2  1 Y 1 A SER 2  ? A SER 2  
3  1 Y 1 A PRO 3  ? A PRO 3  
4  1 Y 1 A GLY 4  ? A GLY 4  
5  1 Y 1 A LYS 5  ? A LYS 5  
6  1 Y 1 A PRO 6  ? A PRO 6  
7  1 Y 1 A PRO 7  ? A PRO 7  
8  1 Y 1 A ARG 8  ? A ARG 8  
9  1 Y 1 A LEU 9  ? A LEU 9  
10 1 Y 1 A VAL 10 ? A VAL 10 
11 1 Y 1 A GLY 11 ? A GLY 11 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'DI(HYDROXYETHYL)ETHER' PEG 
3 'ACETATE ION'           ACT 
4 water                   HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PEG 1  121 1  PEG PEG A . 
C 2 PEG 1  122 2  PEG PEG A . 
D 2 PEG 1  123 3  PEG PEG A . 
E 3 ACT 1  124 1  ACT ACT A . 
F 4 HOH 1  125 1  HOH HOH A . 
F 4 HOH 2  126 2  HOH HOH A . 
F 4 HOH 3  127 3  HOH HOH A . 
F 4 HOH 4  128 4  HOH HOH A . 
F 4 HOH 5  129 5  HOH HOH A . 
F 4 HOH 6  130 6  HOH HOH A . 
F 4 HOH 7  131 7  HOH HOH A . 
F 4 HOH 8  132 8  HOH HOH A . 
F 4 HOH 9  133 9  HOH HOH A . 
F 4 HOH 10 134 10 HOH HOH A . 
F 4 HOH 11 135 11 HOH HOH A . 
F 4 HOH 12 136 12 HOH HOH A . 
F 4 HOH 13 137 14 HOH HOH A . 
F 4 HOH 14 138 15 HOH HOH A . 
F 4 HOH 15 139 16 HOH HOH A . 
F 4 HOH 16 140 17 HOH HOH A . 
F 4 HOH 17 141 18 HOH HOH A . 
F 4 HOH 18 142 19 HOH HOH A . 
F 4 HOH 19 143 20 HOH HOH A . 
F 4 HOH 20 144 21 HOH HOH A . 
F 4 HOH 21 145 22 HOH HOH A . 
F 4 HOH 22 146 23 HOH HOH A . 
F 4 HOH 23 147 24 HOH HOH A . 
F 4 HOH 24 148 25 HOH HOH A . 
F 4 HOH 25 149 26 HOH HOH A . 
F 4 HOH 26 150 27 HOH HOH A . 
F 4 HOH 27 151 28 HOH HOH A . 
F 4 HOH 28 152 29 HOH HOH A . 
F 4 HOH 29 153 30 HOH HOH A . 
F 4 HOH 30 154 31 HOH HOH A . 
F 4 HOH 31 155 32 HOH HOH A . 
F 4 HOH 32 156 33 HOH HOH A . 
F 4 HOH 33 157 34 HOH HOH A . 
F 4 HOH 34 158 35 HOH HOH A . 
F 4 HOH 35 159 36 HOH HOH A . 
F 4 HOH 36 160 37 HOH HOH A . 
F 4 HOH 37 161 38 HOH HOH A . 
F 4 HOH 38 162 39 HOH HOH A . 
F 4 HOH 39 163 40 HOH HOH A . 
F 4 HOH 40 164 41 HOH HOH A . 
F 4 HOH 41 165 42 HOH HOH A . 
F 4 HOH 42 166 43 HOH HOH A . 
F 4 HOH 43 167 44 HOH HOH A . 
F 4 HOH 44 168 45 HOH HOH A . 
F 4 HOH 45 169 47 HOH HOH A . 
F 4 HOH 46 170 48 HOH HOH A . 
F 4 HOH 47 171 49 HOH HOH A . 
F 4 HOH 48 172 50 HOH HOH A . 
F 4 HOH 49 173 51 HOH HOH A . 
F 4 HOH 50 174 52 HOH HOH A . 
F 4 HOH 51 175 53 HOH HOH A . 
F 4 HOH 52 176 54 HOH HOH A . 
F 4 HOH 53 177 55 HOH HOH A . 
F 4 HOH 54 178 56 HOH HOH A . 
F 4 HOH 55 179 57 HOH HOH A . 
F 4 HOH 56 180 58 HOH HOH A . 
F 4 HOH 57 181 59 HOH HOH A . 
F 4 HOH 58 182 60 HOH HOH A . 
F 4 HOH 59 183 61 HOH HOH A . 
F 4 HOH 60 184 62 HOH HOH A . 
F 4 HOH 61 185 63 HOH HOH A . 
F 4 HOH 62 186 64 HOH HOH A . 
F 4 HOH 63 187 65 HOH HOH A . 
F 4 HOH 64 188 66 HOH HOH A . 
F 4 HOH 65 189 67 HOH HOH A . 
F 4 HOH 66 190 68 HOH HOH A . 
F 4 HOH 67 191 69 HOH HOH A . 
F 4 HOH 68 192 70 HOH HOH A . 
F 4 HOH 69 193 71 HOH HOH A . 
F 4 HOH 70 194 72 HOH HOH A . 
F 4 HOH 71 195 73 HOH HOH A . 
F 4 HOH 72 196 74 HOH HOH A . 
F 4 HOH 73 197 75 HOH HOH A . 
F 4 HOH 74 198 76 HOH HOH A . 
F 4 HOH 75 199 77 HOH HOH A . 
F 4 HOH 76 200 78 HOH HOH A . 
F 4 HOH 77 201 79 HOH HOH A . 
F 4 HOH 78 202 80 HOH HOH A . 
F 4 HOH 79 203 81 HOH HOH A . 
F 4 HOH 80 204 82 HOH HOH A . 
#